2IWSA

Radicicol analogues bound to the atp site of hsp90
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
213
structure length
210
Chain Sequence
b'MASETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETEPDLFIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTILRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPIQLVVTKEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
publication title Inhibition of Hsp90 with Synthetic Macrolactones: Synthesis and Structural and Biological Evaluation of Ring and Conformational Analogs of Radicicol.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 60
structure length 210
sequence length 213
ec nomenclature
pdb deposition date 2006-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2iwsA00
2YKIA 2WERA 2CCTA 1AMWA 4KP4A 2XX2A 4CWPA 1TC6A 2EXLA 4O0BA 4AWPA 3VADA 3A0ZA 4DUHA 1YT1A 2C2AA 3T10A 2AKPA 1YSZA 4ZVIA 3ZXQA 4EGKA 4MBCA 2PNRA 3KE6A 3R4NA 1JM6A 3EHFA 4YKYA 2YE7A 2Q8IA 4BQGA 2YEIA 5CTYA 2XDLA 4XIQA 4MP2A 4K4OA 3ZM7A 4XE2A 2XHXA 2YEGA 3O0IA 3CGYA 4EGHA 1UYMA 4HY6A 2Q8FA 3R4OA 5L3JA 2YI6A 1BGQA 4KQVA 5D7CA 4EMVA 3B26A 4KFGA 4BAEA 4NH7A 4GFNA 3HYYA 2YK9A 4CWQA 3DGEA 2HKJA 1Y4SA 4CE3A 4BIZA 1UYHA 4GEEA 4BIUA 3GIGA 4JQLA 1TC0A 4O05A 4MOTA 4CWSA 4CWRA 1ZWHA 4R3MA 4L91A 1UY7A 1Z5BA 2WI7A 1GJVA 3EHHA 1UYLA 1YC4A 2JKIA 3SL2A 1L0OA 5FNDA 4V26A 4DZYA 4NH8A 2CH4A 4EFUA 4EFTA 4LWIA 4R1FA 4BXIA 3K98A 3INWA 2E0AA 4XCJA 4WUCA 3GIGB 2WI5A 1ID0A 1U2OA 2YJXA 5IDJA 2XDUA 3TZ4A 4PU9A 2IOPA 3O2FA 4AS9A 3EKRA 3BMYA 4FCQA 2H55A 1KIJA 4NH9A 3LPSA 2CGFA 2FWYA 3EHGA 3D0BA 5CPHA 5D6QA 1UYIA 4LWHA 4P7AA 3OPDA 2O1VA 4U7NA 4XKAA 1TBWA 3T2SA 5FNFA 4QPKA 4LWFA 3VHCA 1B62A 2YEHA 2HCHA 5FWKA 1R62A 4L93A 1YC1A 2O1WA 3O6OA 3RLQA 2YGEA 2YJWA 3D36A 2XDXA 4PRVA 5D7DA 4EM7A 1I5CA 2XDKA 2VWCA 4HZ5A 2WI1A 5D7RA 1Y8NA 4EEHA 5GGZA 4EGIA 3K60A 4H85A 2FXSA 4CWFA 2YECA 4XITA 2YGFA 4XDMA 1US7A 1MX0A 4Q20A 4B6CA 2Q8HA 1ZXNA 1NHIA 4W7TA 4GCZA 4HY1A 2YE8A 3A0XA 2FWZA 4WUDA 4ASGA 3Q5LA 2Q8GA 1ZW9A 4PRXA 4I5SA 4XD8A 2ZDXA 4E01A 4E00A 1UY8A 4XIPA 3B25A 1Z5AA 4HYPA 2VCIA 2ESAA 2YI0A 3OMUA 4YKTA 3CRLA 5J71A 2CCUA 1NHHA 2YKCA 2IOQA 3G7BA 4R3AA 4L90A 2Q2EB 4MPCA 4MB9A 2XK2A 2QG2A 4O09A 2GFDA 2YEFA 4O07A 1PVGA 4XKOA 1YT2A 4GGLA 2ZKJA 2XD6A 3A0TA 1AH6A 2BU2A 5M4KA 3QTFA 4H81A 2CCSA 2BSMA 2BREA 4X9LA 2XHTA 3G75A 2YKBA 3ZKDA 2WI6A 3CWVA 1I5DA 1S16A 1I58A 1H7UA 2ZDYA 4ASFA 2H8MA 2GQPA 3R4PA 4MP7A 4U93A 2XDSA 3D2RA 2YEJA 1BXDA 3HHUA 5CTWA 5M4HA 4JAUA 2XABA 2HG1A 4CWNA 2YKJA 3VHAA 1I5BA 1UYCA 3VHDA 4LWGA 4E02A 2BU6A 1UY9A 1YC3A 2BYHA 3OWBA 4KSGA 2YI5A 4ASBA 3OWDA 4U7OA 4AWQA 4URLA 5M4PA 4YKUA 2ZBKB 3RLRA 3FV5A 2YEAA 2YE2A 3EKOA 4XC0A 5F5RA 2XCMA 3MNRP 4FPPA 4YKZA 5CTUA 2YI7A 5D6PA 4MPEA 1QY8A 3HEKA 3INXA 3HZ1A 1AJ6A 2K5BA 3QDDA 4XIRA 4MPNA 1TH8A 1YS3A 3NMQA 2IWSA 3T0ZA 1BKNA 1Z59A 3TZ0A 4QPJA 1UYEA 4CWOA 3FT8A 1THNA 4FMTA 4HYMA 3ZXOA 1YERA 2WI3A 4YKWA 3PEJA 3A0WA 4I3HA 4CWTA 1I59A 1UY6A 1ZXMA 4B7PA 1KZNA 4LPBA 4O04A 3PEHA 2IORA 4ZKIA 4URMA 1AM1A 3TZ2A 4HXWA 2WEQA 4XKKA 2JJCA 1Y8PA 3LNUA 1I5AA 1YSRA 3EHJA 4CE1A 3K97A 3JZ3A 3U67A 3HYZA 4YKQA 2XX5A 2QG0A 2YGAA 2VW5A 2BU5A 3B28A 5M4EA 3RKZA 4AWOA 2IWXA 3GIEA 2WI4A 2O1UA 3G7EA 3K99A 3Q5JA 3CGZA 3H4LA 2BU7A 1Z5CA 5FNCA 3TTZA 1Y8OA 1U0ZA 3U2KA 4V25A 3WQ9A 1BYQA 5BOCA 1GKZA 3TUHA 1UYDA 4FCRA 1YT0A 3R91A 3ZKBA 1TILA 4HXZA 2XX4A 5J6AA 1UYKA 3GIFA 4KTNA 1YESA 2VCJA 1QZRA 3A0YA 5CF0A 4GT8A 4WUBA 1B63A 2QF6A 1Y4UA 5IDMA 1GKXA 2XJGA 2FYPA 2CG9A 2BRCA 4HZ0A 2YE5A 2YE4A 4UROA 2BT0A 5C93A 5IN9A 1EA6A 4JAVA 3OW6A 3R4MA 1NHJA 2WEPA 2BZ5A 1S14A 4LWEA 4GQTA 3TZ5A 5M4MA 3HZ5A 4XTJA 3WHAA 1TIDA 2YEBA 5F3KA 5CTXA 4BQJA 1YETA 1UYGA 1EI1A 2BYIA 3Q5KA 1H7SA 2IWUA 1B3QA 2YE3A 3BM9A 2QFOA 3A0RA 3RLPA 3B27A 3C11A 5BODA 1A4HA 3T1KA 4KSHA 3CRKA 2BTZA 2XJJA 3IEDA 4YKRA 4PL9A 2YEDA 2YEEA 1AH8A 3B24A 4P8OA 2BU8A 3U2DA 3C0EA 2XJXA 4LP0A 2YE9A 1QYEA 4JASA 4YKXA 3T0HA 4H7QA 4XCLA 2YKEA 5M4NA 1UYFA 4L8ZA 3H80A 4ASAA 3R92A 2YK2A 2XHRA 4CE2A 2WI2A 1OSFA 2UWDA 3FT5A 2YE6A 4URNA 4L94A 1MU5A 4FCPA
chains in the Genus database with same CATH superfamily
2YKIA 2WERA 2CCTA 1AMWA 4KP4A 2XX2A 4CWPA 1TC6A 2EXLA 4O0BA 4AWPA 3VADA 3A0ZA 4DUHA 1YT1A 2C2AA 3T10A 2AKPA 1YSZA 4ZVIA 3ZXQA 4EGKA 4MBCA 2PNRA 3KE6A 3R4NA 1JM6A 3EHFA 4YKYA 2YE7A 2Q8IA 4BQGA 2YEIA 5CTYA 2XDLA 4XIQA 4MP2A 4K4OA 3ZM7A 4XE2A 2XHXA 2YEGA 3O0IA 3CGYA 4EGHA 1UYMA 4HY6A 2Q8FA 3R4OA 5L3JA 2YI6A 1BGQA 4KQVA 5D7CA 4EMVA 3B26A 4KFGA 4BAEA 4NH7A 4GFNA 3HYYA 2YK9A 4CWQA 3DGEA 2HKJA 1Y4SA 4CE3A 4BIZA 1UYHA 4GEEA 4BIUA 3GIGA 4JQLA 1TC0A 4O05A 4MOTA 3S5TA 4CWSA 4CWRA 1ZWHA 4R3MA 4L91A 1UY7A 1Z5BA 2WI7A 1GJVA 3EHHA 1UYLA 1YC4A 2JKIA 3SL2A 1L0OA 5FNDA 4V26A 4DZYA 4NH8A 2CH4A 2FTKA 4EFUA 4EFTA 4LWIA 4R1FA 4BXIA 3K98A 3INWA 2E0AA 4XCJA 4WUCA 3GIGB 2WI5A 1ID0A 1U2OA 2YJXA 5IDJA 2XDUA 3TZ4A 4PU9A 2IOPA 3O2FA 4AS9A 3EKRA 3BMYA 4FCQA 2H55A 1KIJA 4NH9A 3LPSA 2CGFA 2C1GA 2FWYA 3EHGA 3D0BA 5CPHA 5D6QA 1UYIA 4LWHA 4P7AA 3OPDA 2O1VA 4U7NA 4XKAA 1TBWA 3T2SA 5FNFA 4QPKA 4LWFA 3VHCA 1B62A 2YEHA 2HCHA 5FWKA 1R62A 4L93A 1YC1A 2O1WA 3O6OA 3RLQA 2YGEA 2YJWA 3D36A 2XDXA 4PRVA 5D7DA 4EM7A 1I5CA 2XDKA 2VWCA 4HZ5A 2WI1A 5D7RA 1Y8NA 4EEHA 5GGZA 4EGIA 3K60A 4H85A 2FXSA 4CWFA 2YECA 4XITA 2YGFA 4XDMA 1US7A 1MX0A 4Q20A 4B6CA 2Q8HA 1IXMA 1ZXNA 1NHIA 4W7TA 3CYGA 4GCZA 4HY1A 2YE8A 3A0XA 2FWZA 4WUDA 4ASGA 3Q5LA 2Q8GA 1ZW9A 4PRXA 4I5SA 4XD8A 2ZDXA 4E01A 4E00A 1UY8A 4XIPA 3B25A 1Z5AA 4HYPA 2VCIA 2ESAA 2YI0A 3OMUA 4YKTA 3CRLA 1F51A 5J71A 2CCUA 1NHHA 2YKCA 2IOQA 3G7BA 4R3AA 4L90A 2Q2EB 4MPCA 4MB9A 2XK2A 2QG2A 4O09A 2GFDA 2YEFA 4O07A 1PVGA 4XKOA 1YT2A 4GGLA 2ZKJA 2XD6A 3A0TA 1AH6A 2BU2A 2HHIA 5M4KA 3QTFA 5JENA 4H81A 2CCSA 2BSMA 2BREA 4X9LA 2XHTA 3G75A 2YKBA 3ZKDA 2WI6A 3CWVA 1I5DA 1S16A 1I58A 1H7UA 2ZDYA 4ASFA 2H8MA 2GQPA 3R4PA 4MP7A 4U93A 2XDSA 3D2RA 2YEJA 1BXDA 3HHUA 5CTWA 5M4HA 4JAUA 2XABA 2HG1A 4CWNA 2YKJA 3VHAA 1I5BA 1UYCA 3VHDA 4LWGA 4E02A 2BU6A 1YC3A 1UY9A 2BYHA 3OWBA 4KSGA 2YI5A 4ASBA 3OWDA 4U7OA 4AWQA 4URLA 5M4PA 4YKUA 2ZBKB 3RLRA 3FV5A 2YEAA 2YE2A 3EKOA 4XC0A 5F5RA 2XCMA 3MNRP 4FPPA 4YKZA 5CTUA 2YI7A 5D6PA 4MPEA 1QY8A 3HEKA 3INXA 3HZ1A 1AJ6A 2K5BA 3QDDA 4XIRA 4MPNA 1TH8A 1YS3A 3NMQA 2IWSA 3T0ZA 1BKNA 1Z59A 3TZ0A 4QPJA 1UYEA 4CWOA 3FT8A 1THNA 4FMTA 4HYMA 3ZXOA 1YERA 2WI3A 4YKWA 3PEJA 3A0WA 2C1IA 4I3HA 4CWTA 1I59A 1UY6A 1ZXMA 4B7PA 1KZNA 4LPBA 4O04A 3PEHA 2IORA 4ZKIA 4URMA 1AM1A 3TZ2A 4HXWA 2WEQA 4XKKA 2JJCA 1Y8PA 3LNUA 1I5AA 1YSRA 3EHJA 4CE1A 3K97A 3JZ3A 3U67A 3HYZA 4YKQA 2XX5A 2QG0A 2YGAA 2VW5A 2BU5A 3B28A 5M4EA 3RKZA 4AWOA 2IWXA 3GIEA 2WI4A 2O1UA 3G7EA 3K99A 3Q5JA 3CGZA 3H4LA 2BU7A 1Z5CA 5FNCA 3TTZA 1Y8OA 1U0ZA 3U2KA 4V25A 3WQ9A 1BYQA 5BOCA 1GKZA 3TUHA 1UYDA 4FCRA 1YT0A 3R91A 3ZKBA 1TILA 3LMMA 4HXZA 2XX4A 5J6AA 1UYKA 3GIFA 4KTNA 1YESA 2VCJA 1QZRA 3A0YA 5CF0A 4GT8A 4WUBA 1B63A 2QF6A 1Y4UA 5IDMA 1GKXA 2XJGA 2FYPA 2CG9A 2BRCA 4HZ0A 2YE5A 2YE4A 4UROA 2BT0A 5C93A 5IN9A 1EA6A 4JAVA 3OW6A 3R4MA 1NHJA 2WEPA 2BZ5A 1S14A 4LWEA 4GQTA 3TZ5A 5M4MA 3HZ5A 4XTJA 3WHAA 1TIDA 2YEBA 5F3KA 5CTXA 4BQJA 1YETA 1UYGA 1EI1A 2BYIA 3Q5KA 1H7SA 2IWUA 1B3QA 2YE3A 3BM9A 2QFOA 3A0RA 3RLPA 3B27A 3C11A 5BODA 1A4HA 3T1KA 4KSHA 3CRKA 2BTZA 2XJJA 3IEDA 4YKRA 4PL9A 2YEDA 2YEEA 1AH8A 3B24A 4P8OA 2BU8A 3U2DA 3C0EA 2XJXA 4LP0A 2YE9A 1QYEA 4JASA 4YKXA 3T0HA 4H7QA 4XCLA 2YKEA 5M4NA 1UYFA 4L8ZA 3H80A 4ASAA 3R92A 4E72A 2YK2A 2XHRA 4CE2A 2WI2A 1OSFA 2UWDA 3FT5A 2YE6A 4URNA 4L94A 1MU5A 4FCPA
chains in the Genus database with same CATH topology
2YKIA 2WERA 2CCTA 1AMWA 4KP4A 2XX2A 4CWPA 1TC6A 2EXLA 4O0BA 4AWPA 3VADA 3A0ZA 4DUHA 1YT1A 2C2AA 3T10A 2AKPA 1YSZA 4ZVIA 3ZXQA 4EGKA 4MBCA 2PNRA 3KE6A 3R4NA 1JM6A 3EHFA 4YKYA 2YE7A 2Q8IA 4BQGA 2YEIA 5CTYA 2XDLA 4XIQA 4MP2A 4K4OA 3ZM7A 4XE2A 2XHXA 2YEGA 3O0IA 3CGYA 4EGHA 1UYMA 4HY6A 2Q8FA 3R4OA 5L3JA 2YI6A 1BGQA 4KQVA 5D7CA 4EMVA 3B26A 4KFGA 4BAEA 4NH7A 4GFNA 3HYYA 2YK9A 4CWQA 3DGEA 2HKJA 1Y4SA 4CE3A 4BIZA 1UYHA 4GEEA 4BIUA 3GIGA 4JQLA 1TC0A 4O05A 4MOTA 4CWSA 4CWRA 1ZWHA 4R3MA 4L91A 1UY7A 1Z5BA 2WI7A 1GJVA 3EHHA 1UYLA 1YC4A 2JKIA 3SL2A 1L0OA 5FNDA 4V26A 4DZYA 4NH8A 2CH4A 4EFUA 4EFTA 4LWIA 4R1FA 4BXIA 3K98A 3INWA 2E0AA 4XCJA 4WUCA 3GIGB 2WI5A 1ID0A 1U2OA 2YJXA 5IDJA 2XDUA 3TZ4A 4PU9A 2IOPA 3O2FA 4AS9A 3EKRA 3BMYA 4FCQA 2H55A 1KIJA 4NH9A 3LPSA 2CGFA 2FWYA 3EHGA 3D0BA 5CPHA 5D6QA 1UYIA 4LWHA 4P7AA 3OPDA 2O1VA 4U7NA 4XKAA 1TBWA 3T2SA 5FNFA 4QPKA 4LWFA 3VHCA 1B62A 2YEHA 2HCHA 5FWKA 1R62A 4L93A 1YC1A 2O1WA 3O6OA 3RLQA 2YGEA 2YJWA 3D36A 2XDXA 4PRVA 5D7DA 4EM7A 1I5CA 2XDKA 2VWCA 4HZ5A 2WI1A 5D7RA 1Y8NA 4EEHA 5GGZA 4EGIA 3K60A 4H85A 2FXSA 4CWFA 2YECA 4XITA 2YGFA 4XDMA 1US7A 1MX0A 4Q20A 4B6CA 2Q8HA 1ZXNA 1NHIA 4W7TA 4GCZA 4HY1A 2YE8A 3A0XA 2FWZA 4WUDA 4ASGA 3Q5LA 2Q8GA 1ZW9A 4PRXA 4I5SA 4XD8A 2ZDXA 4E01A 4E00A 1UY8A 4XIPA 3B25A 1Z5AA 4HYPA 2VCIA 2ESAA 2YI0A 3OMUA 4YKTA 3CRLA 5J71A 2CCUA 1NHHA 2YKCA 2IOQA 3G7BA 4R3AA 4L90A 2Q2EB 4MPCA 4MB9A 2XK2A 2QG2A 4O09A 2GFDA 2YEFA 4O07A 1PVGA 4XKOA 1YT2A 4GGLA 2ZKJA 2XD6A 3A0TA 1AH6A 2BU2A 5M4KA 3QTFA 4H81A 2CCSA 2BSMA 2BREA 4X9LA 2XHTA 3G75A 2YKBA 3ZKDA 2WI6A 3CWVA 1I5DA 1S16A 1I58A 1H7UA 2ZDYA 4ASFA 2H8MA 2GQPA 3R4PA 4MP7A 4U93A 2XDSA 3D2RA 2YEJA 1BXDA 3HHUA 5CTWA 5M4HA 4JAUA 2XABA 2HG1A 4CWNA 2YKJA 3VHAA 1I5BA 1UYCA 3VHDA 4LWGA 4E02A 2BU6A 1UY9A 1YC3A 2BYHA 3OWBA 4KSGA 2YI5A 4ASBA 3OWDA 4U7OA 4AWQA 4URLA 5M4PA 4YKUA 2ZBKB 3RLRA 3FV5A 2YEAA 2YE2A 3EKOA 4XC0A 5F5RA 2XCMA 3MNRP 4FPPA 4YKZA 5CTUA 2YI7A 5D6PA 4MPEA 1QY8A 3HEKA 3INXA 3HZ1A 1AJ6A 2K5BA 3QDDA 4XIRA 4MPNA 1TH8A 1YS3A 3NMQA 2IWSA 3T0ZA 1BKNA 1Z59A 3TZ0A 4QPJA 1UYEA 4CWOA 3FT8A 1THNA 4FMTA 4HYMA 3ZXOA 1YERA 2WI3A 4YKWA 3PEJA 3A0WA 4I3HA 4CWTA 1I59A 1UY6A 1ZXMA 4B7PA 1KZNA 4LPBA 4O04A 3PEHA 2IORA 4ZKIA 4URMA 1AM1A 3TZ2A 4HXWA 2WEQA 4XKKA 2JJCA 1Y8PA 3LNUA 1I5AA 1YSRA 3EHJA 4CE1A 3K97A 3JZ3A 3U67A 3HYZA 4YKQA 2XX5A 2QG0A 2YGAA 2VW5A 2BU5A 3B28A 5M4EA 3RKZA 4AWOA 2IWXA 3GIEA 2WI4A 2O1UA 3G7EA 3K99A 3Q5JA 3CGZA 3H4LA 2BU7A 1Z5CA 5FNCA 3TTZA 1Y8OA 1U0ZA 3U2KA 4V25A 3WQ9A 1BYQA 5BOCA 1GKZA 3TUHA 1UYDA 4FCRA 1YT0A 3R91A 3ZKBA 1TILA 4HXZA 2XX4A 5J6AA 1UYKA 3GIFA 4KTNA 1YESA 2VCJA 1QZRA 3A0YA 5CF0A 4GT8A 4WUBA 1B63A 2QF6A 1Y4UA 5IDMA 1GKXA 2XJGA 2FYPA 2CG9A 2BRCA 4HZ0A 2YE5A 2YE4A 4UROA 2BT0A 5C93A 5IN9A 1EA6A 4JAVA 3OW6A 3R4MA 1NHJA 2WEPA 2BZ5A 1S14A 4LWEA 4GQTA 3TZ5A 5M4MA 3HZ5A 4XTJA 3WHAA 1TIDA 2YEBA 5F3KA 5CTXA 4BQJA 1YETA 1UYGA 1EI1A 2BYIA 3Q5KA 1H7SA 2IWUA 1B3QA 2YE3A 3BM9A 2QFOA 3A0RA 3RLPA 3B27A 3C11A 5BODA 1A4HA 3T1KA 4KSHA 3CRKA 2BTZA 2XJJA 3IEDA 4YKRA 4PL9A 2YEDA 2YEEA 1AH8A 3B24A 4P8OA 2BU8A 3U2DA 3C0EA 2XJXA 4LP0A 2YE9A 1QYEA 4JASA 4YKXA 3T0HA 4H7QA 4XCLA 2YKEA 5M4NA 1UYFA 4L8ZA 3H80A 4ASAA 3R92A 2YK2A 2XHRA 4CE2A 2WI2A 1OSFA 2UWDA 3FT5A 2YE6A 4URNA 4L94A 1MU5A 4FCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKI A;  2WER A;  2CCT A;  1AMW A;  4KP4 A;  2XX2 A;  4CWP A;  1TC6 A;  2EXL A;  4O0B A;  4AWP A;  3VAD A;  3A0Z A;  4DUH A;  1YT1 A;  2C2A A;  3T10 A;  2AKP A;  1YSZ A;  4ZVI A;  3ZXQ A;  4EGK A;  4MBC A;  2PNR A;  3KE6 A;  3R4N A;  1JM6 A;  3EHF A;  4YKY A;  2YE7 A;  2Q8I A;  4BQG A;  2YEI A;  5CTY A;  2XDL A;  4XIQ A;  4MP2 A;  4K4O A;  3ZM7 A;  4XE2 A;  2XHX A;  2YEG A;  3O0I A;  3CGY A;  4EGH A;  1UYM A;  4HY6 A;  2Q8F A;  3R4O A;  5L3J A;  2YI6 A;  1BGQ A;  4KQV A;  5D7C A;  4EMV A;  3B26 A;  4KFG A;  4BAE A;  4NH7 A;  4GFN A;  3HYY A;  2YK9 A;  4CWQ A;  3DGE A;  2HKJ A;  1Y4S A;  4CE3 A;  4BIZ A;  1UYH A;  4GEE A;  4BIU A;  3GIG A;  4JQL A;  1TC0 A;  4O05 A;  4MOT A;  4CWS A;  4CWR A;  1ZWH A;  4R3M A;  4L91 A;  1UY7 A;  1Z5B A;  2WI7 A;  1GJV A;  3EHH A;  1UYL A;  1YC4 A;  2JKI A;  3SL2 A;  1L0O A;  5FND A;  4V26 A;  4DZY A;  4NH8 A;  2CH4 A;  4EFU A;  4EFT A;  4LWI A;  4R1F A;  4BXI A;  3K98 A;  3INW A;  2E0A A;  4XCJ A;  4WUC A;  3GIG B;  2WI5 A;  1ID0 A;  1U2O A;  2YJX A;  5IDJ A;  2XDU A;  3TZ4 A;  4PU9 A;  2IOP A;  3O2F A;  4AS9 A;  3EKR A;  3BMY A;  4FCQ A;  2H55 A;  1KIJ A;  4NH9 A;  3LPS A;  2CGF A;  2FWY A;  3EHG A;  3D0B A;  5CPH A;  5D6Q A;  1UYI A;  4LWH A;  4P7A A;  3OPD A;  2O1V A;  4U7N A;  4XKA A;  1TBW A;  3T2S A;  5FNF A;  4QPK A;  4LWF A;  3VHC A;  1B62 A;  2YEH A;  2HCH A;  5FWK A;  1R62 A;  4L93 A;  1YC1 A;  2O1W A;  3O6O A;  3RLQ A;  2YGE A;  2YJW A;  3D36 A;  2XDX A;  4PRV A;  5D7D A;  4EM7 A;  1I5C A;  2XDK A;  2VWC A;  4HZ5 A;  2WI1 A;  5D7R A;  1Y8N A;  4EEH A;  5GGZ A;  4EGI A;  3K60 A;  4H85 A;  2FXS A;  4CWF A;  2YEC A;  4XIT A;  2YGF A;  4XDM A;  1US7 A;  1MX0 A;  4Q20 A;  4B6C A;  2Q8H A;  1ZXN A;  1NHI A;  4W7T A;  4GCZ A;  4HY1 A;  2YE8 A;  3A0X A;  2FWZ A;  4WUD A;  4ASG A;  3Q5L A;  2Q8G A;  1ZW9 A;  4PRX A;  4I5S A;  4XD8 A;  2ZDX A;  4E01 A;  4E00 A;  1UY8 A;  4XIP A;  3B25 A;  1Z5A A;  4HYP A;  2VCI A;  2ESA A;  2YI0 A;  3OMU A;  4YKT A;  3CRL A;  5J71 A;  2CCU A;  1NHH A;  2YKC A;  2IOQ A;  3G7B A;  4R3A A;  4L90 A;  2Q2E B;  4MPC A;  4MB9 A;  2XK2 A;  2QG2 A;  4O09 A;  2GFD A;  2YEF A;  4O07 A;  1PVG A;  4XKO A;  1YT2 A;  4GGL A;  2ZKJ A;  2XD6 A;  3A0T A;  1AH6 A;  2BU2 A;  5M4K A;  3QTF A;  4H81 A;  2CCS A;  2BSM A;  2BRE A;  4X9L A;  2XHT A;  3G75 A;  2YKB A;  3ZKD A;  2WI6 A;  3CWV A;  1I5D A;  1S16 A;  1I58 A;  1H7U A;  2ZDY A;  4ASF A;  2H8M A;  2GQP A;  3R4P A;  4MP7 A;  4U93 A;  2XDS A;  3D2R A;  2YEJ A;  1BXD A;  3HHU A;  5CTW A;  5M4H A;  4JAU A;  2XAB A;  2HG1 A;  4CWN A;  2YKJ A;  3VHA A;  1I5B A;  1UYC A;  3VHD A;  4LWG A;  4E02 A;  2BU6 A;  1UY9 A;  1YC3 A;  2BYH A;  3OWB A;  4KSG A;  2YI5 A;  4ASB A;  3OWD A;  4U7O A;  4AWQ A;  4URL A;  5M4P A;  4YKU A;  2ZBK B;  3RLR A;  3FV5 A;  2YEA A;  2YE2 A;  3EKO A;  4XC0 A;  5F5R A;  2XCM A;  3MNR P;  4FPP A;  4YKZ A;  5CTU A;  2YI7 A;  5D6P A;  4MPE A;  1QY8 A;  3HEK A;  3INX A;  3HZ1 A;  1AJ6 A;  2K5B A;  3QDD A;  4XIR A;  4MPN A;  1TH8 A;  1YS3 A;  3NMQ A;  2IWS A;  3T0Z A;  1BKN A;  1Z59 A;  3TZ0 A;  4QPJ A;  1UYE A;  4CWO A;  3FT8 A;  1THN A;  4FMT A;  4HYM A;  3ZXO A;  1YER A;  2WI3 A;  4YKW A;  3PEJ A;  3A0W A;  4I3H A;  4CWT A;  1I59 A;  1UY6 A;  1ZXM A;  4B7P A;  1KZN A;  4LPB A;  4O04 A;  3PEH A;  2IOR A;  4ZKI A;  4URM A;  1AM1 A;  3TZ2 A;  4HXW A;  2WEQ A;  4XKK A;  2JJC A;  1Y8P A;  3LNU A;  1I5A A;  1YSR A;  3EHJ A;  4CE1 A;  3K97 A;  3JZ3 A;  3U67 A;  3HYZ A;  4YKQ A;  2XX5 A;  2QG0 A;  2YGA A;  2VW5 A;  2BU5 A;  3B28 A;  5M4E A;  3RKZ A;  4AWO A;  2IWX A;  3GIE A;  2WI4 A;  2O1U A;  3G7E A;  3K99 A;  3Q5J A;  3CGZ A;  3H4L A;  2BU7 A;  1Z5C A;  5FNC A;  3TTZ A;  1Y8O A;  1U0Z A;  3U2K A;  4V25 A;  3WQ9 A;  1BYQ A;  5BOC A;  1GKZ A;  3TUH A;  1UYD A;  4FCR A;  1YT0 A;  3R91 A;  3ZKB A;  1TIL A;  4HXZ A;  2XX4 A;  5J6A A;  1UYK A;  3GIF A;  4KTN A;  1YES A;  2VCJ A;  1QZR A;  3A0Y A;  5CF0 A;  4GT8 A;  4WUB A;  1B63 A;  2QF6 A;  1Y4U A;  5IDM A;  1GKX A;  2XJG A;  2FYP A;  2CG9 A;  2BRC A;  4HZ0 A;  2YE5 A;  2YE4 A;  4URO A;  2BT0 A;  5C93 A;  5IN9 A;  1EA6 A;  4JAV A;  3OW6 A;  3R4M A;  1NHJ A;  2WEP A;  2BZ5 A;  1S14 A;  4LWE A;  4GQT A;  3TZ5 A;  5M4M A;  3HZ5 A;  4XTJ A;  3WHA A;  1TID A;  2YEB A;  5F3K A;  5CTX A;  4BQJ A;  1YET A;  1UYG A;  1EI1 A;  2BYI A;  3Q5K A;  1H7S A;  2IWU A;  1B3Q A;  2YE3 A;  3BM9 A;  2QFO A;  3A0R A;  3RLP A;  3B27 A;  3C11 A;  5BOD A;  1A4H A;  3T1K A;  4KSH A;  3CRK A;  2BTZ A;  2XJJ A;  3IED A;  4YKR A;  4PL9 A;  2YED A;  2YEE A;  1AH8 A;  3B24 A;  4P8O A;  2BU8 A;  3U2D A;  3C0E A;  2XJX A;  4LP0 A;  2YE9 A;  1QYE A;  4JAS A;  4YKX A;  3T0H A;  4H7Q A;  4XCL A;  2YKE A;  5M4N A;  1UYF A;  4L8Z A;  3H80 A;  4ASA A;  3R92 A;  2YK2 A;  2XHR A;  4CE2 A;  2WI2 A;  1OSF A;  2UWD A;  3FT5 A;  2YE6 A;  4URN A;  4L94 A;  1MU5 A;  4FCP A; 
#chains in the Genus database with same CATH topology
 2YKI A;  2WER A;  2CCT A;  1AMW A;  4KP4 A;  2XX2 A;  4CWP A;  1TC6 A;  2EXL A;  4O0B A;  4AWP A;  3VAD A;  3A0Z A;  4DUH A;  1YT1 A;  2C2A A;  3T10 A;  2AKP A;  1YSZ A;  4ZVI A;  3ZXQ A;  4EGK A;  4MBC A;  2PNR A;  3KE6 A;  3R4N A;  1JM6 A;  3EHF A;  4YKY A;  2YE7 A;  2Q8I A;  4BQG A;  2YEI A;  5CTY A;  2XDL A;  4XIQ A;  4MP2 A;  4K4O A;  3ZM7 A;  4XE2 A;  2XHX A;  2YEG A;  3O0I A;  3CGY A;  4EGH A;  1UYM A;  4HY6 A;  2Q8F A;  3R4O A;  5L3J A;  2YI6 A;  1BGQ A;  4KQV A;  5D7C A;  4EMV A;  3B26 A;  4KFG A;  4BAE A;  4NH7 A;  4GFN A;  3HYY A;  2YK9 A;  4CWQ A;  3DGE A;  2HKJ A;  1Y4S A;  4CE3 A;  4BIZ A;  1UYH A;  4GEE A;  4BIU A;  3GIG A;  4JQL A;  1TC0 A;  4O05 A;  4MOT A;  3S5T A;  4CWS A;  4CWR A;  1ZWH A;  4R3M A;  4L91 A;  1UY7 A;  1Z5B A;  2WI7 A;  1GJV A;  3EHH A;  1UYL A;  1YC4 A;  2JKI A;  3SL2 A;  1L0O A;  5FND A;  4V26 A;  4DZY A;  4NH8 A;  2CH4 A;  2FTK A;  4EFU A;  4EFT A;  4LWI A;  4R1F A;  4BXI A;  3K98 A;  3INW A;  2E0A A;  4XCJ A;  4WUC A;  3GIG B;  2WI5 A;  1ID0 A;  1U2O A;  2YJX A;  5IDJ A;  2XDU A;  3TZ4 A;  4PU9 A;  2IOP A;  3O2F A;  4AS9 A;  3EKR A;  3BMY A;  4FCQ A;  2H55 A;  1KIJ A;  4NH9 A;  3LPS A;  2CGF A;  2C1G A;  2FWY A;  3EHG A;  3D0B A;  5CPH A;  5D6Q A;  1UYI A;  4LWH A;  4P7A A;  3OPD A;  2O1V A;  4U7N A;  4XKA A;  1TBW A;  3T2S A;  5FNF A;  4QPK A;  4LWF A;  3VHC A;  1B62 A;  2YEH A;  2HCH A;  5FWK A;  1R62 A;  4L93 A;  1YC1 A;  2O1W A;  3O6O A;  3RLQ A;  2YGE A;  2YJW A;  3D36 A;  2XDX A;  4PRV A;  5D7D A;  4EM7 A;  1I5C A;  2XDK A;  2VWC A;  4HZ5 A;  2WI1 A;  5D7R A;  1Y8N A;  4EEH A;  5GGZ A;  4EGI A;  3K60 A;  4H85 A;  2FXS A;  4CWF A;  2YEC A;  4XIT A;  2YGF A;  4XDM A;  1US7 A;  1MX0 A;  4Q20 A;  4B6C A;  2Q8H A;  1IXM A;  1ZXN A;  1NHI A;  4W7T A;  3CYG A;  4GCZ A;  4HY1 A;  2YE8 A;  3A0X A;  2FWZ A;  4WUD A;  4ASG A;  3Q5L A;  2Q8G A;  1ZW9 A;  4PRX A;  4I5S A;  4XD8 A;  2ZDX A;  4E01 A;  4E00 A;  1UY8 A;  4XIP A;  3B25 A;  1Z5A A;  4HYP A;  2VCI A;  2ESA A;  2YI0 A;  3OMU A;  4YKT A;  3CRL A;  1F51 A;  5J71 A;  2CCU A;  1NHH A;  2YKC A;  2IOQ A;  3G7B A;  4R3A A;  4L90 A;  2Q2E B;  4MPC A;  4MB9 A;  2XK2 A;  2QG2 A;  4O09 A;  2GFD A;  2YEF A;  4O07 A;  1PVG A;  4XKO A;  1YT2 A;  4GGL A;  2ZKJ A;  2XD6 A;  3A0T A;  1AH6 A;  2BU2 A;  2HHI A;  5M4K A;  3QTF A;  5JEN A;  4H81 A;  2CCS A;  2BSM A;  2BRE A;  4X9L A;  2XHT A;  3G75 A;  2YKB A;  3ZKD A;  2WI6 A;  3CWV A;  1I5D A;  1S16 A;  1I58 A;  1H7U A;  2ZDY A;  4ASF A;  2H8M A;  2GQP A;  3R4P A;  4MP7 A;  4U93 A;  2XDS A;  3D2R A;  2YEJ A;  1BXD A;  3HHU A;  5CTW A;  5M4H A;  4JAU A;  2XAB A;  2HG1 A;  4CWN A;  2YKJ A;  3VHA A;  1I5B A;  1UYC A;  3VHD A;  4LWG A;  4E02 A;  2BU6 A;  1YC3 A;  1UY9 A;  2BYH A;  3OWB A;  4KSG A;  2YI5 A;  4ASB A;  3OWD A;  4U7O A;  4AWQ A;  4URL A;  5M4P A;  4YKU A;  2ZBK B;  3RLR A;  3FV5 A;  2YEA A;  2YE2 A;  3EKO A;  4XC0 A;  5F5R A;  2XCM A;  3MNR P;  4FPP A;  4YKZ A;  5CTU A;  2YI7 A;  5D6P A;  4MPE A;  1QY8 A;  3HEK A;  3INX A;  3HZ1 A;  1AJ6 A;  2K5B A;  3QDD A;  4XIR A;  4MPN A;  1TH8 A;  1YS3 A;  3NMQ A;  2IWS A;  3T0Z A;  1BKN A;  1Z59 A;  3TZ0 A;  4QPJ A;  1UYE A;  4CWO A;  3FT8 A;  1THN A;  4FMT A;  4HYM A;  3ZXO A;  1YER A;  2WI3 A;  4YKW A;  3PEJ A;  3A0W A;  2C1I A;  4I3H A;  4CWT A;  1I59 A;  1UY6 A;  1ZXM A;  4B7P A;  1KZN A;  4LPB A;  4O04 A;  3PEH A;  2IOR A;  4ZKI A;  4URM A;  1AM1 A;  3TZ2 A;  4HXW A;  2WEQ A;  4XKK A;  2JJC A;  1Y8P A;  3LNU A;  1I5A A;  1YSR A;  3EHJ A;  4CE1 A;  3K97 A;  3JZ3 A;  3U67 A;  3HYZ A;  4YKQ A;  2XX5 A;  2QG0 A;  2YGA A;  2VW5 A;  2BU5 A;  3B28 A;  5M4E A;  3RKZ A;  4AWO A;  2IWX A;  3GIE A;  2WI4 A;  2O1U A;  3G7E A;  3K99 A;  3Q5J A;  3CGZ A;  3H4L A;  2BU7 A;  1Z5C A;  5FNC A;  3TTZ A;  1Y8O A;  1U0Z A;  3U2K A;  4V25 A;  3WQ9 A;  1BYQ A;  5BOC A;  1GKZ A;  3TUH A;  1UYD A;  4FCR A;  1YT0 A;  3R91 A;  3ZKB A;  1TIL A;  3LMM A;  4HXZ A;  2XX4 A;  5J6A A;  1UYK A;  3GIF A;  4KTN A;  1YES A;  2VCJ A;  1QZR A;  3A0Y A;  5CF0 A;  4GT8 A;  4WUB A;  1B63 A;  2QF6 A;  1Y4U A;  5IDM A;  1GKX A;  2XJG A;  2FYP A;  2CG9 A;  2BRC A;  4HZ0 A;  2YE5 A;  2YE4 A;  4URO A;  2BT0 A;  5C93 A;  5IN9 A;  1EA6 A;  4JAV A;  3OW6 A;  3R4M A;  1NHJ A;  2WEP A;  2BZ5 A;  1S14 A;  4LWE A;  4GQT A;  3TZ5 A;  5M4M A;  3HZ5 A;  4XTJ A;  3WHA A;  1TID A;  2YEB A;  5F3K A;  5CTX A;  4BQJ A;  1YET A;  1UYG A;  1EI1 A;  2BYI A;  3Q5K A;  1H7S A;  2IWU A;  1B3Q A;  2YE3 A;  3BM9 A;  2QFO A;  3A0R A;  3RLP A;  3B27 A;  3C11 A;  5BOD A;  1A4H A;  3T1K A;  4KSH A;  3CRK A;  2BTZ A;  2XJJ A;  3IED A;  4YKR A;  4PL9 A;  2YED A;  2YEE A;  1AH8 A;  3B24 A;  4P8O A;  2BU8 A;  3U2D A;  3C0E A;  2XJX A;  4LP0 A;  2YE9 A;  1QYE A;  4JAS A;  4YKX A;  3T0H A;  4H7Q A;  4XCL A;  2YKE A;  5M4N A;  1UYF A;  4L8Z A;  3H80 A;  4ASA A;  3R92 A;  4E72 A;  2YK2 A;  2XHR A;  4CE2 A;  2WI2 A;  1OSF A;  2UWD A;  3FT5 A;  2YE6 A;  4URN A;  4L94 A;  1MU5 A;  4FCP A; 
#chains in the Genus database with same CATH homology
 2YKI A;  2WER A;  2CCT A;  1AMW A;  4KP4 A;  2XX2 A;  4CWP A;  1TC6 A;  2EXL A;  4O0B A;  4AWP A;  3VAD A;  3A0Z A;  4DUH A;  1YT1 A;  2C2A A;  3T10 A;  2AKP A;  1YSZ A;  4ZVI A;  3ZXQ A;  4EGK A;  4MBC A;  2PNR A;  3KE6 A;  3R4N A;  1JM6 A;  3EHF A;  4YKY A;  2YE7 A;  2Q8I A;  4BQG A;  2YEI A;  5CTY A;  2XDL A;  4XIQ A;  4MP2 A;  4K4O A;  3ZM7 A;  4XE2 A;  2XHX A;  2YEG A;  3O0I A;  3CGY A;  4EGH A;  1UYM A;  4HY6 A;  2Q8F A;  3R4O A;  5L3J A;  2YI6 A;  1BGQ A;  4KQV A;  5D7C A;  4EMV A;  3B26 A;  4KFG A;  4BAE A;  4NH7 A;  4GFN A;  3HYY A;  2YK9 A;  4CWQ A;  3DGE A;  2HKJ A;  1Y4S A;  4CE3 A;  4BIZ A;  1UYH A;  4GEE A;  4BIU A;  3GIG A;  4JQL A;  1TC0 A;  4O05 A;  4MOT A;  4CWS A;  4CWR A;  1ZWH A;  4R3M A;  4L91 A;  1UY7 A;  1Z5B A;  2WI7 A;  1GJV A;  3EHH A;  1UYL A;  1YC4 A;  2JKI A;  3SL2 A;  1L0O A;  5FND A;  4V26 A;  4DZY A;  4NH8 A;  2CH4 A;  4EFU A;  4EFT A;  4LWI A;  4R1F A;  4BXI A;  3K98 A;  3INW A;  2E0A A;  4XCJ A;  4WUC A;  3GIG B;  2WI5 A;  1ID0 A;  1U2O A;  2YJX A;  5IDJ A;  2XDU A;  3TZ4 A;  4PU9 A;  2IOP A;  3O2F A;  4AS9 A;  3EKR A;  3BMY A;  4FCQ A;  2H55 A;  1KIJ A;  4NH9 A;  3LPS A;  2CGF A;  2FWY A;  3EHG A;  3D0B A;  5CPH A;  5D6Q A;  1UYI A;  4LWH A;  4P7A A;  3OPD A;  2O1V A;  4U7N A;  4XKA A;  1TBW A;  3T2S A;  5FNF A;  4QPK A;  4LWF A;  3VHC A;  1B62 A;  2YEH A;  2HCH A;  5FWK A;  1R62 A;  4L93 A;  1YC1 A;  2O1W A;  3O6O A;  3RLQ A;  2YGE A;  2YJW A;  3D36 A;  2XDX A;  4PRV A;  5D7D A;  4EM7 A;  1I5C A;  2XDK A;  2VWC A;  4HZ5 A;  2WI1 A;  5D7R A;  1Y8N A;  4EEH A;  5GGZ A;  4EGI A;  3K60 A;  4H85 A;  2FXS A;  4CWF A;  2YEC A;  4XIT A;  2YGF A;  4XDM A;  1US7 A;  1MX0 A;  4Q20 A;  4B6C A;  2Q8H A;  1ZXN A;  1NHI A;  4W7T A;  4GCZ A;  4HY1 A;  2YE8 A;  3A0X A;  2FWZ A;  4WUD A;  4ASG A;  3Q5L A;  2Q8G A;  1ZW9 A;  4PRX A;  4I5S A;  4XD8 A;  2ZDX A;  4E01 A;  4E00 A;  1UY8 A;  4XIP A;  3B25 A;  1Z5A A;  4HYP A;  2VCI A;  2ESA A;  2YI0 A;  3OMU A;  4YKT A;  3CRL A;  5J71 A;  2CCU A;  1NHH A;  2YKC A;  2IOQ A;  3G7B A;  4R3A A;  4L90 A;  2Q2E B;  4MPC A;  4MB9 A;  2XK2 A;  2QG2 A;  4O09 A;  2GFD A;  2YEF A;  4O07 A;  1PVG A;  4XKO A;  1YT2 A;  4GGL A;  2ZKJ A;  2XD6 A;  3A0T A;  1AH6 A;  2BU2 A;  5M4K A;  3QTF A;  4H81 A;  2CCS A;  2BSM A;  2BRE A;  4X9L A;  2XHT A;  3G75 A;  2YKB A;  3ZKD A;  2WI6 A;  3CWV A;  1I5D A;  1S16 A;  1I58 A;  1H7U A;  2ZDY A;  4ASF A;  2H8M A;  2GQP A;  3R4P A;  4MP7 A;  4U93 A;  2XDS A;  3D2R A;  2YEJ A;  1BXD A;  3HHU A;  5CTW A;  5M4H A;  4JAU A;  2XAB A;  2HG1 A;  4CWN A;  2YKJ A;  3VHA A;  1I5B A;  1UYC A;  3VHD A;  4LWG A;  4E02 A;  2BU6 A;  1UY9 A;  1YC3 A;  2BYH A;  3OWB A;  4KSG A;  2YI5 A;  4ASB A;  3OWD A;  4U7O A;  4AWQ A;  4URL A;  5M4P A;  4YKU A;  2ZBK B;  3RLR A;  3FV5 A;  2YEA A;  2YE2 A;  3EKO A;  4XC0 A;  5F5R A;  2XCM A;  3MNR P;  4FPP A;  4YKZ A;  5CTU A;  2YI7 A;  5D6P A;  4MPE A;  1QY8 A;  3HEK A;  3INX A;  3HZ1 A;  1AJ6 A;  2K5B A;  3QDD A;  4XIR A;  4MPN A;  1TH8 A;  1YS3 A;  3NMQ A;  2IWS A;  3T0Z A;  1BKN A;  1Z59 A;  3TZ0 A;  4QPJ A;  1UYE A;  4CWO A;  3FT8 A;  1THN A;  4FMT A;  4HYM A;  3ZXO A;  1YER A;  2WI3 A;  4YKW A;  3PEJ A;  3A0W A;  4I3H A;  4CWT A;  1I59 A;  1UY6 A;  1ZXM A;  4B7P A;  1KZN A;  4LPB A;  4O04 A;  3PEH A;  2IOR A;  4ZKI A;  4URM A;  1AM1 A;  3TZ2 A;  4HXW A;  2WEQ A;  4XKK A;  2JJC A;  1Y8P A;  3LNU A;  1I5A A;  1YSR A;  3EHJ A;  4CE1 A;  3K97 A;  3JZ3 A;  3U67 A;  3HYZ A;  4YKQ A;  2XX5 A;  2QG0 A;  2YGA A;  2VW5 A;  2BU5 A;  3B28 A;  5M4E A;  3RKZ A;  4AWO A;  2IWX A;  3GIE A;  2WI4 A;  2O1U A;  3G7E A;  3K99 A;  3Q5J A;  3CGZ A;  3H4L A;  2BU7 A;  1Z5C A;  5FNC A;  3TTZ A;  1Y8O A;  1U0Z A;  3U2K A;  4V25 A;  3WQ9 A;  1BYQ A;  5BOC A;  1GKZ A;  3TUH A;  1UYD A;  4FCR A;  1YT0 A;  3R91 A;  3ZKB A;  1TIL A;  4HXZ A;  2XX4 A;  5J6A A;  1UYK A;  3GIF A;  4KTN A;  1YES A;  2VCJ A;  1QZR A;  3A0Y A;  5CF0 A;  4GT8 A;  4WUB A;  1B63 A;  2QF6 A;  1Y4U A;  5IDM A;  1GKX A;  2XJG A;  2FYP A;  2CG9 A;  2BRC A;  4HZ0 A;  2YE5 A;  2YE4 A;  4URO A;  2BT0 A;  5C93 A;  5IN9 A;  1EA6 A;  4JAV A;  3OW6 A;  3R4M A;  1NHJ A;  2WEP A;  2BZ5 A;  1S14 A;  4LWE A;  4GQT A;  3TZ5 A;  5M4M A;  3HZ5 A;  4XTJ A;  3WHA A;  1TID A;  2YEB A;  5F3K A;  5CTX A;  4BQJ A;  1YET A;  1UYG A;  1EI1 A;  2BYI A;  3Q5K A;  1H7S A;  2IWU A;  1B3Q A;  2YE3 A;  3BM9 A;  2QFO A;  3A0R A;  3RLP A;  3B27 A;  3C11 A;  5BOD A;  1A4H A;  3T1K A;  4KSH A;  3CRK A;  2BTZ A;  2XJJ A;  3IED A;  4YKR A;  4PL9 A;  2YED A;  2YEE A;  1AH8 A;  3B24 A;  4P8O A;  2BU8 A;  3U2D A;  3C0E A;  2XJX A;  4LP0 A;  2YE9 A;  1QYE A;  4JAS A;  4YKX A;  3T0H A;  4H7Q A;  4XCL A;  2YKE A;  5M4N A;  1UYF A;  4L8Z A;  3H80 A;  4ASA A;  3R92 A;  2YK2 A;  2XHR A;  4CE2 A;  2WI2 A;  1OSF A;  2UWD A;  3FT5 A;  2YE6 A;  4URN A;  4L94 A;  1MU5 A;  4FCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...