2IWSA

Radicicol analogues bound to the atp site of hsp90
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
213
structure length
210
Chain Sequence
MASETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETEPDLFIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTILRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPIQLVVTKEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of Hsp90 with Synthetic Macrolactones: Synthesis and Structural and Biological Evaluation of Ring and Conformational Analogs of Radicicol.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
total genus 60
structure length 210
sequence length 213
ec nomenclature
pdb deposition date 2006-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2iwsA00
2CG9A 3T2SA 2QFOA 2BYIA 3Q5KA 4DZYA 2XDLA 2YGEA 5M4EA 4ASFA 3FT8A 1EI1A 5CTXA 2GQPA 4XIPA 3HEKA 4PL9A 4XKAA 3HYYA 4JAUA 3R4OA 4YKYA 2WI2A 2YEEA 3Q5JA 1BKNA 1JM6A 2Q8IA 2YE3A 3T1KA 3KE6A 2YK2A 3LPSA 4XKOA 1AH8A 1Y8PA 4XIRA 4CE3A 5CTWA 2WI4A 4HXWA 1YETA 2VCJA 4BQGA 1GKZA 4LWEA 3RKZA 2XCMA 4PRVA 4MP2A 4BQJA 3B26A 2Q8FA 3ZXQA 4CWSA 2BU2A 2XABA 4CWOA 5M4KA 4H85A 2VW5A 4MBCA 3K60A 2FXSA 1AH6A 1EA6A 2ZBKB 1I5BA 4LP0A 4O09A 4E01A 4LWGA 3O2FA 4I3HA 3EKOA 4E00A 1UYEA 3G7BA 4QPJA 2YKCA 4FMTA 2QG2A 2IWUA 4XCJA 2XX5A 4BIUA 1S14A 5D7DA 4BXIA 2YI6A 1U0ZA 2XHXA 4YKUA 3RLPA 1QYEA 2WEQA 3INWA 4AWOA 4BIZA 3ZKBA 4KQVA 4CWNA 4L91A 4QPKA 3R92A 2XJXA 4W7TA 2YE7A 4YKWA 5CPHA 2WI7A 4O0BA 1R62A 3OWBA 1NHIA 5IN9A 2XX4A 2Q2EB 2BU6A 5J71A 4XKKA 2EXLA 1UY7A 3T0HA 4ASBA 4MP7A 2O1UA 3A0TA 4LPBA 3D2RA 4ZKIA 4PU9A 2BYHA 2WI6A 3EHFA 4EGKA 3GIFA 3TTZA 2YEGA 2YEJA 3EHHA 1Y8NA 4URLA 2BZ5A 4CWRA 1NHJA 3K99A 3BMYA 4JASA 4L93A 2YEHA 5BODA 1Z5CA 2YJXA 3MNRP 2BTZA 4HZ0A 3VHDA 4P8OA 2ZKJA 1TC6A 1THNA 4AS9A 3BM9A 4KTNA 4CE2A 1Z5AA 2XDSA 5CTUA 1A4HA 3WHAA 1I59A 2XDUA 2FWZA 1Z59A 1TIDA 3DGEA 5M4MA 2XX2A 4YKZA 1H7SA 1UYKA 3ZM7A 3C11A 2Q8HA 4ZVIA 2YI5A 4MPEA 4LWHA 3HZ5A 1YSZA 2YEDA 3LNUA 4AWQA 3K97A 4JQLA 4K4OA 1Z5BA 3A0ZA 3RLRA 2YE9A 4XCLA 1YS3A 4DUHA 4GEEA 4EFUA 4GFNA 2HG1A 4ASAA 2YEIA 2K5BA 2VCIA 3R91A 4EM7A 4LWIA 3VADA 1B63A 3OPDA 2WI1A 2HCHA 1UYIA 1PVGA 5D6PA 4FCQA 3K98A 2XJJA 2IOQA 1TBWA 2GFDA 4PRXA 4URNA 1YSRA 3Q5LA 4CWQA 4HYMA 4MB9A 2CH4A 1UYGA 2IWSA 2YEFA 2WERA 3CGZA 3EKRA 3T10A 3CGYA 5J6AA 5GGZA 4EGHA 1ZW9A 3A0YA 3INXA 4YKRA 4WUDA 5FNDA 4WUCA 3R4MA 1UYHA 3H80A 3GIEA 4YKQA 5IDJA 2XK2A 4E02A 3G75A 2XJGA 3D36A 2ESAA 4HY6A 2C2AA 4LWFA 4V25A 4U93A 2WI3A 1Y4SA 2QG0A 2IWXA 4B7PA 3RLQA 2BSMA 3TUHA 4UROA 1UYCA 4O04A 3TZ2A 2BT0A 4H81A 3R4NA 5FNCA 1NHHA 2JKIA 4GCZA 2YE6A 2ZDYA 2YGAA 3SL2A 4O05A 1YT0A 4NH7A 1I5AA 4YKXA 5M4HA 4V26A 2YJWA 3TZ5A 2YKEA 5CTYA 2CCTA 5L3JA 5CF0A 4P7AA 3U67A 2YKBA 3OMUA 5M4NA 1BXDA 5BOCA 4HXZA 4EEHA 4MPCA 4GGLA 4B6CA 5IDMA 3QTFA 4AWPA 3A0RA 3IEDA 1US7A 1GKXA 2YGFA 3A0WA 3HZ1A 1S16A 4NH9A 1QZRA 4ASGA 1ZXMA 1TC0A 2IOPA 1YERA 3GIGA 1B62A 1YC1A 1BYQA 2HKJA 4WUBA 4YKTA 2FYPA 4U7NA 3NMQA 4L8ZA 2BRCA 4GT8A 3U2DA 4CWFA 1GJVA 4CE1A 1Y8OA 4XIQA 2CGFA 1MX0A 1KZNA 2E0AA 3EHJA 3H4LA 2YEAA 4H7QA 3G7EA 2JJCA 1AJ6A 3PEHA 3B28A 3D0BA 2XHTA 1UY8A 4URMA 5D7RA 2O1VA 3CRLA 4FCPA 1KIJA 3B24A 2WEPA 1YC3A 4MPNA 4HZ5A 4L94A 2WI5A 3TZ0A 2UWDA 3U2KA 5D7CA 1YT2A 1YT1A 4L90A 2QF6A 4CWPA 4FPPA 3TZ4A 2YE5A 3JZ3A 3ZXOA 2VWCA 3O0IA 5M4PA 4KFGA 4EMVA 3GIGB 2BU5A 4FCRA 4X9LA 3WQ9A 5C93A 5FNFA 1B3QA 1YC4A 2YE4A 2ZDXA 1YESA 4XTJA 3VHCA 2O1WA 2CCUA 5F3KA 4MOTA 4R3MA 2XD6A 4O07A 1H7UA 2YKIA 2H55A 4KSHA 4R1FA 1TH8A 3O6OA 2XDKA 2IORA 1Y4UA 4EGIA 1UY9A 4I5SA 3PEJA 1L0OA 2BU7A 4JAVA 2BREA 2YEBA 4XC0A 1BGQA 2XHRA 1UYLA 1OSFA 1MU5A 4NH8A 4U7OA 4KSGA 1TILA 5FWKA 3CWVA 2CCSA 2Q8GA 1I58A 1UY6A 1UYMA 3ZKDA 2YI7A 2XDXA 4EFTA 2YE2A 3R4PA 1UYDA 1QY8A 1ID0A 2YI0A 1I5DA 5F5RA 4Q20A 1ZWHA 3OW6A 4XDMA 2H8MA 4XE2A 1ZXNA 2YE8A 1AMWA 2YKJA 3T0ZA 4HYPA 3B25A 2AKPA 4HY1A 2YK9A 3A0XA 4CWTA 3FT5A 2YECA 2BU8A 3FV5A 2PNRA 1UYFA 3VHAA 5D6QA 3QDDA 4BAEA 1I5CA 3EHGA 3OWDA 4R3AA 1AM1A 3HYZA 4GQTA 3B27A 4KP4A 1U2OA 4XD8A 4XITA 3HHUA 2FWYA 3CRKA 3C0EA
chains in the Genus database with same CATH superfamily
2CG9A 3T2SA 2QFOA 2BYIA 3Q5KA 4DZYA 2XDLA 2YGEA 5M4EA 4ASFA 3FT8A 1EI1A 5CTXA 2GQPA 4XIPA 3HEKA 4PL9A 4XKAA 3HYYA 4JAUA 3R4OA 4YKYA 2WI2A 2YEEA 3Q5JA 1BKNA 1JM6A 2Q8IA 2YE3A 3T1KA 3KE6A 2YK2A 3LPSA 4XKOA 1AH8A 1Y8PA 4XIRA 4CE3A 5CTWA 2WI4A 4HXWA 1YETA 2VCJA 4BQGA 1GKZA 4LWEA 3RKZA 2XCMA 4PRVA 4MP2A 4BQJA 3B26A 2Q8FA 3ZXQA 4CWSA 2BU2A 2XABA 4CWOA 5M4KA 4H85A 2VW5A 4MBCA 3K60A 2FXSA 1AH6A 1EA6A 2ZBKB 1I5BA 4LP0A 4O09A 4E01A 4LWGA 1IXMA 3O2FA 4I3HA 3EKOA 4E00A 1UYEA 3G7BA 4QPJA 2YKCA 4FMTA 2QG2A 2IWUA 4XCJA 2XX5A 4BIUA 1S14A 5D7DA 4BXIA 2YI6A 1U0ZA 2XHXA 4YKUA 3RLPA 1QYEA 2WEQA 3INWA 4AWOA 4BIZA 4E72A 3ZKBA 4KQVA 4CWNA 4L91A 4QPKA 3R92A 2XJXA 4W7TA 2YE7A 4YKWA 5CPHA 2WI7A 4O0BA 1R62A 3OWBA 1NHIA 5IN9A 2XX4A 2Q2EB 2BU6A 5J71A 4XKKA 2EXLA 1UY7A 3T0HA 4ASBA 4MP7A 2O1UA 3A0TA 4LPBA 3D2RA 4ZKIA 4PU9A 2BYHA 2WI6A 3LMMA 3EHFA 4EGKA 3GIFA 3TTZA 2YEGA 2YEJA 3EHHA 1Y8NA 4URLA 2BZ5A 4CWRA 1NHJA 2C1IA 3K99A 3BMYA 4JASA 4L93A 2YEHA 5BODA 1Z5CA 2YJXA 3MNRP 2BTZA 4HZ0A 3VHDA 4P8OA 2ZKJA 1TC6A 1THNA 4AS9A 3BM9A 4KTNA 4CE2A 1Z5AA 2XDSA 5CTUA 1A4HA 3WHAA 1I59A 2XDUA 2FWZA 1Z59A 1TIDA 3DGEA 5M4MA 2XX2A 4YKZA 1H7SA 1UYKA 3ZM7A 3C11A 2Q8HA 4ZVIA 2YI5A 4MPEA 4LWHA 3HZ5A 1YSZA 2YEDA 3LNUA 4AWQA 3K97A 4JQLA 4K4OA 1Z5BA 3A0ZA 3RLRA 2YE9A 4XCLA 1YS3A 4DUHA 4GEEA 4EFUA 4GFNA 2HG1A 4ASAA 2YEIA 2K5BA 2VCIA 3R91A 4EM7A 4LWIA 3VADA 1B63A 3OPDA 2WI1A 2HCHA 1UYIA 1PVGA 5D6PA 4FCQA 3K98A 2XJJA 2IOQA 1TBWA 2GFDA 4PRXA 4URNA 1YSRA 3Q5LA 4CWQA 4HYMA 3CYGA 4MB9A 2CH4A 1UYGA 2IWSA 2YEFA 2WERA 3CGZA 3EKRA 3T10A 2C1GA 3CGYA 5J6AA 5GGZA 4EGHA 1ZW9A 3A0YA 3INXA 4YKRA 4WUDA 5FNDA 4WUCA 3R4MA 1UYHA 3H80A 3GIEA 4YKQA 5IDJA 2XK2A 4E02A 3G75A 2XJGA 3D36A 2ESAA 4HY6A 2C2AA 4LWFA 4V25A 4U93A 2WI3A 1Y4SA 2QG0A 2IWXA 4B7PA 3RLQA 2BSMA 3TUHA 4UROA 1UYCA 4O04A 3TZ2A 2BT0A 4H81A 3R4NA 5FNCA 1NHHA 2JKIA 4GCZA 2YE6A 2ZDYA 2YGAA 3SL2A 4O05A 1YT0A 4NH7A 1I5AA 4YKXA 5M4HA 4V26A 2YJWA 3TZ5A 2YKEA 5CTYA 2CCTA 5L3JA 5CF0A 4P7AA 3U67A 2YKBA 3OMUA 5M4NA 1BXDA 5BOCA 4HXZA 4EEHA 4MPCA 4GGLA 4B6CA 5IDMA 3QTFA 4AWPA 3A0RA 3IEDA 1US7A 1GKXA 2YGFA 3A0WA 3HZ1A 1S16A 4NH9A 1QZRA 4ASGA 1ZXMA 1TC0A 2IOPA 1YERA 3GIGA 1B62A 1YC1A 1BYQA 2HKJA 4WUBA 4YKTA 2FYPA 4U7NA 3NMQA 4L8ZA 2BRCA 4GT8A 3U2DA 4CWFA 1GJVA 4CE1A 1Y8OA 4XIQA 2CGFA 1MX0A 1KZNA 2E0AA 3EHJA 3H4LA 2YEAA 4H7QA 3G7EA 2JJCA 1AJ6A 3PEHA 3B28A 3D0BA 2XHTA 1UY8A 4URMA 5D7RA 2O1VA 3CRLA 4FCPA 1KIJA 3B24A 2WEPA 1YC3A 4MPNA 4HZ5A 4L94A 2WI5A 3TZ0A 2UWDA 3U2KA 5D7CA 1YT2A 1YT1A 4L90A 2QF6A 4CWPA 4FPPA 3TZ4A 2YE5A 3JZ3A 3ZXOA 2VWCA 3O0IA 3S5TA 5M4PA 4KFGA 4EMVA 3GIGB 2BU5A 4FCRA 4X9LA 3WQ9A 5C93A 5FNFA 1B3QA 1YC4A 2YE4A 2ZDXA 1YESA 4XTJA 2HHIA 3VHCA 2O1WA 2CCUA 5F3KA 4MOTA 4R3MA 2XD6A 4O07A 1H7UA 2YKIA 5JENA 2H55A 4KSHA 4R1FA 1TH8A 3O6OA 2XDKA 2IORA 1Y4UA 4EGIA 1UY9A 4I5SA 3PEJA 1L0OA 2BU7A 4JAVA 2BREA 2YEBA 4XC0A 1BGQA 2XHRA 1OSFA 1UYLA 1MU5A 4NH8A 4U7OA 4KSGA 1TILA 5FWKA 3CWVA 2CCSA 2Q8GA 1I58A 1UY6A 1UYMA 3ZKDA 2YI7A 2XDXA 4EFTA 2YE2A 3R4PA 1UYDA 1QY8A 1ID0A 2YI0A 1I5DA 5F5RA 1F51A 4Q20A 1ZWHA 3OW6A 4XDMA 2H8MA 4XE2A 1ZXNA 2YE8A 2FTKA 1AMWA 2YKJA 3T0ZA 4HYPA 3B25A 2AKPA 4HY1A 2YK9A 3A0XA 4CWTA 3FT5A 2YECA 2BU8A 3FV5A 2PNRA 1UYFA 3VHAA 5D6QA 3QDDA 4BAEA 1I5CA 3EHGA 3OWDA 4R3AA 1AM1A 3HYZA 4GQTA 3B27A 4KP4A 1U2OA 4XD8A 4XITA 3HHUA 2FWYA 3CRKA 3C0EA
chains in the Genus database with same CATH topology
2CG9A 3T2SA 2QFOA 2BYIA 3Q5KA 4DZYA 2XDLA 2YGEA 5M4EA 4ASFA 3FT8A 1EI1A 5CTXA 2GQPA 4XIPA 3HEKA 4PL9A 4XKAA 3HYYA 4JAUA 3R4OA 4YKYA 2WI2A 2YEEA 3Q5JA 1BKNA 1JM6A 2Q8IA 2YE3A 3T1KA 3KE6A 2YK2A 3LPSA 4XKOA 1AH8A 1Y8PA 4XIRA 4CE3A 5CTWA 2WI4A 4HXWA 1YETA 2VCJA 4BQGA 1GKZA 4LWEA 3RKZA 2XCMA 4PRVA 4MP2A 4BQJA 3B26A 2Q8FA 3ZXQA 4CWSA 2BU2A 2XABA 4CWOA 5M4KA 4H85A 2VW5A 4MBCA 3K60A 2FXSA 1AH6A 1EA6A 2ZBKB 1I5BA 4LP0A 4O09A 4E01A 4LWGA 3O2FA 4I3HA 3EKOA 4E00A 1UYEA 3G7BA 4QPJA 2YKCA 4FMTA 2QG2A 2IWUA 4XCJA 2XX5A 4BIUA 1S14A 5D7DA 4BXIA 2YI6A 1U0ZA 2XHXA 4YKUA 3RLPA 1QYEA 2WEQA 3INWA 4AWOA 4BIZA 3ZKBA 4KQVA 4CWNA 4L91A 4QPKA 3R92A 2XJXA 4W7TA 2YE7A 4YKWA 5CPHA 2WI7A 4O0BA 1R62A 3OWBA 1NHIA 5IN9A 2XX4A 2Q2EB 2BU6A 5J71A 4XKKA 2EXLA 1UY7A 3T0HA 4ASBA 4MP7A 2O1UA 3A0TA 4LPBA 3D2RA 4ZKIA 4PU9A 2BYHA 2WI6A 3EHFA 4EGKA 3GIFA 3TTZA 2YEGA 2YEJA 3EHHA 1Y8NA 4URLA 2BZ5A 4CWRA 1NHJA 3K99A 3BMYA 4JASA 4L93A 2YEHA 5BODA 1Z5CA 2YJXA 3MNRP 2BTZA 4HZ0A 3VHDA 4P8OA 2ZKJA 1TC6A 1THNA 4AS9A 3BM9A 4KTNA 4CE2A 1Z5AA 2XDSA 5CTUA 1A4HA 3WHAA 1I59A 2XDUA 2FWZA 1Z59A 1TIDA 3DGEA 5M4MA 2XX2A 4YKZA 1H7SA 1UYKA 3ZM7A 3C11A 2Q8HA 4ZVIA 2YI5A 4MPEA 4LWHA 3HZ5A 1YSZA 2YEDA 3LNUA 4AWQA 3K97A 4JQLA 4K4OA 1Z5BA 3A0ZA 3RLRA 2YE9A 4XCLA 1YS3A 4DUHA 4GEEA 4EFUA 4GFNA 2HG1A 4ASAA 2YEIA 2K5BA 2VCIA 3R91A 4EM7A 4LWIA 3VADA 1B63A 3OPDA 2WI1A 2HCHA 1UYIA 1PVGA 5D6PA 4FCQA 3K98A 2XJJA 2IOQA 1TBWA 2GFDA 4PRXA 4URNA 1YSRA 3Q5LA 4CWQA 4HYMA 4MB9A 2CH4A 1UYGA 2IWSA 2YEFA 2WERA 3CGZA 3EKRA 3T10A 3CGYA 5J6AA 5GGZA 4EGHA 1ZW9A 3A0YA 3INXA 4YKRA 4WUDA 5FNDA 4WUCA 3R4MA 1UYHA 3H80A 3GIEA 4YKQA 5IDJA 2XK2A 4E02A 3G75A 2XJGA 3D36A 2ESAA 4HY6A 2C2AA 4LWFA 4V25A 4U93A 2WI3A 1Y4SA 2QG0A 2IWXA 4B7PA 3RLQA 2BSMA 3TUHA 4UROA 1UYCA 4O04A 3TZ2A 2BT0A 4H81A 3R4NA 5FNCA 1NHHA 2JKIA 4GCZA 2YE6A 2ZDYA 2YGAA 3SL2A 4O05A 1YT0A 4NH7A 1I5AA 4YKXA 5M4HA 4V26A 2YJWA 3TZ5A 2YKEA 5CTYA 2CCTA 5L3JA 5CF0A 4P7AA 3U67A 2YKBA 3OMUA 5M4NA 1BXDA 5BOCA 4HXZA 4EEHA 4MPCA 4GGLA 4B6CA 5IDMA 3QTFA 4AWPA 3A0RA 3IEDA 1US7A 1GKXA 2YGFA 3A0WA 3HZ1A 1S16A 4NH9A 1QZRA 4ASGA 1ZXMA 1TC0A 2IOPA 1YERA 3GIGA 1B62A 1YC1A 1BYQA 2HKJA 4WUBA 4YKTA 2FYPA 4U7NA 3NMQA 4L8ZA 2BRCA 4GT8A 3U2DA 4CWFA 1GJVA 4CE1A 1Y8OA 4XIQA 2CGFA 1MX0A 1KZNA 2E0AA 3EHJA 3H4LA 2YEAA 4H7QA 3G7EA 2JJCA 1AJ6A 3PEHA 3B28A 3D0BA 2XHTA 1UY8A 4URMA 5D7RA 2O1VA 3CRLA 4FCPA 1KIJA 3B24A 2WEPA 1YC3A 4MPNA 4HZ5A 4L94A 2WI5A 3TZ0A 2UWDA 3U2KA 5D7CA 1YT2A 1YT1A 4L90A 2QF6A 4CWPA 4FPPA 3TZ4A 2YE5A 3JZ3A 3ZXOA 2VWCA 3O0IA 5M4PA 4KFGA 4EMVA 3GIGB 2BU5A 4FCRA 4X9LA 3WQ9A 5C93A 5FNFA 1B3QA 1YC4A 2YE4A 2ZDXA 1YESA 4XTJA 3VHCA 2O1WA 2CCUA 5F3KA 4MOTA 4R3MA 2XD6A 4O07A 1H7UA 2YKIA 2H55A 4KSHA 4R1FA 1TH8A 3O6OA 2XDKA 2IORA 1Y4UA 4EGIA 1UY9A 4I5SA 3PEJA 1L0OA 2BU7A 4JAVA 2BREA 2YEBA 4XC0A 1BGQA 2XHRA 1UYLA 1OSFA 1MU5A 4NH8A 4U7OA 4KSGA 1TILA 5FWKA 3CWVA 2CCSA 2Q8GA 1I58A 1UY6A 1UYMA 3ZKDA 2YI7A 2XDXA 4EFTA 2YE2A 3R4PA 1UYDA 1QY8A 1ID0A 2YI0A 1I5DA 5F5RA 4Q20A 1ZWHA 3OW6A 4XDMA 2H8MA 4XE2A 1ZXNA 2YE8A 1AMWA 2YKJA 3T0ZA 4HYPA 3B25A 2AKPA 4HY1A 2YK9A 3A0XA 4CWTA 3FT5A 2YECA 2BU8A 3FV5A 2PNRA 1UYFA 3VHAA 5D6QA 3QDDA 4BAEA 1I5CA 3EHGA 3OWDA 4R3AA 1AM1A 3HYZA 4GQTA 3B27A 4KP4A 1U2OA 4XD8A 4XITA 3HHUA 2FWYA 3CRKA 3C0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CG9 A;  3T2S A;  2QFO A;  2BYI A;  3Q5K A;  4DZY A;  2XDL A;  2YGE A;  5M4E A;  4ASF A;  3FT8 A;  1EI1 A;  5CTX A;  2GQP A;  4XIP A;  3HEK A;  4PL9 A;  4XKA A;  3HYY A;  4JAU A;  3R4O A;  4YKY A;  2WI2 A;  2YEE A;  3Q5J A;  1BKN A;  1JM6 A;  2Q8I A;  2YE3 A;  3T1K A;  3KE6 A;  2YK2 A;  3LPS A;  4XKO A;  1AH8 A;  1Y8P A;  4XIR A;  4CE3 A;  5CTW A;  2WI4 A;  4HXW A;  1YET A;  2VCJ A;  4BQG A;  1GKZ A;  4LWE A;  3RKZ A;  2XCM A;  4PRV A;  4MP2 A;  4BQJ A;  3B26 A;  2Q8F A;  3ZXQ A;  4CWS A;  2BU2 A;  2XAB A;  4CWO A;  5M4K A;  4H85 A;  2VW5 A;  4MBC A;  3K60 A;  2FXS A;  1AH6 A;  1EA6 A;  2ZBK B;  1I5B A;  4LP0 A;  4O09 A;  4E01 A;  4LWG A;  3O2F A;  4I3H A;  3EKO A;  4E00 A;  1UYE A;  3G7B A;  4QPJ A;  2YKC A;  4FMT A;  2QG2 A;  2IWU A;  4XCJ A;  2XX5 A;  4BIU A;  1S14 A;  5D7D A;  4BXI A;  2YI6 A;  1U0Z A;  2XHX A;  4YKU A;  3RLP A;  1QYE A;  2WEQ A;  3INW A;  4AWO A;  4BIZ A;  3ZKB A;  4KQV A;  4CWN A;  4L91 A;  4QPK A;  3R92 A;  2XJX A;  4W7T A;  2YE7 A;  4YKW A;  5CPH A;  2WI7 A;  4O0B A;  1R62 A;  3OWB A;  1NHI A;  5IN9 A;  2XX4 A;  2Q2E B;  2BU6 A;  5J71 A;  4XKK A;  2EXL A;  1UY7 A;  3T0H A;  4ASB A;  4MP7 A;  2O1U A;  3A0T A;  4LPB A;  3D2R A;  4ZKI A;  4PU9 A;  2BYH A;  2WI6 A;  3EHF A;  4EGK A;  3GIF A;  3TTZ A;  2YEG A;  2YEJ A;  3EHH A;  1Y8N A;  4URL A;  2BZ5 A;  4CWR A;  1NHJ A;  3K99 A;  3BMY A;  4JAS A;  4L93 A;  2YEH A;  5BOD A;  1Z5C A;  2YJX A;  3MNR P;  2BTZ A;  4HZ0 A;  3VHD A;  4P8O A;  2ZKJ A;  1TC6 A;  1THN A;  4AS9 A;  3BM9 A;  4KTN A;  4CE2 A;  1Z5A A;  2XDS A;  5CTU A;  1A4H A;  3WHA A;  1I59 A;  2XDU A;  2FWZ A;  1Z59 A;  1TID A;  3DGE A;  5M4M A;  2XX2 A;  4YKZ A;  1H7S A;  1UYK A;  3ZM7 A;  3C11 A;  2Q8H A;  4ZVI A;  2YI5 A;  4MPE A;  4LWH A;  3HZ5 A;  1YSZ A;  2YED A;  3LNU A;  4AWQ A;  3K97 A;  4JQL A;  4K4O A;  1Z5B A;  3A0Z A;  3RLR A;  2YE9 A;  4XCL A;  1YS3 A;  4DUH A;  4GEE A;  4EFU A;  4GFN A;  2HG1 A;  4ASA A;  2YEI A;  2K5B A;  2VCI A;  3R91 A;  4EM7 A;  4LWI A;  3VAD A;  1B63 A;  3OPD A;  2WI1 A;  2HCH A;  1UYI A;  1PVG A;  5D6P A;  4FCQ A;  3K98 A;  2XJJ A;  2IOQ A;  1TBW A;  2GFD A;  4PRX A;  4URN A;  1YSR A;  3Q5L A;  4CWQ A;  4HYM A;  4MB9 A;  2CH4 A;  1UYG A;  2IWS A;  2YEF A;  2WER A;  3CGZ A;  3EKR A;  3T10 A;  3CGY A;  5J6A A;  5GGZ A;  4EGH A;  1ZW9 A;  3A0Y A;  3INX A;  4YKR A;  4WUD A;  5FND A;  4WUC A;  3R4M A;  1UYH A;  3H80 A;  3GIE A;  4YKQ A;  5IDJ A;  2XK2 A;  4E02 A;  3G75 A;  2XJG A;  3D36 A;  2ESA A;  4HY6 A;  2C2A A;  4LWF A;  4V25 A;  4U93 A;  2WI3 A;  1Y4S A;  2QG0 A;  2IWX A;  4B7P A;  3RLQ A;  2BSM A;  3TUH A;  4URO A;  1UYC A;  4O04 A;  3TZ2 A;  2BT0 A;  4H81 A;  3R4N A;  5FNC A;  1NHH A;  2JKI A;  4GCZ A;  2YE6 A;  2ZDY A;  2YGA A;  3SL2 A;  4O05 A;  1YT0 A;  4NH7 A;  1I5A A;  4YKX A;  5M4H A;  4V26 A;  2YJW A;  3TZ5 A;  2YKE A;  5CTY A;  2CCT A;  5L3J A;  5CF0 A;  4P7A A;  3U67 A;  2YKB A;  3OMU A;  5M4N A;  1BXD A;  5BOC A;  4HXZ A;  4EEH A;  4MPC A;  4GGL A;  4B6C A;  5IDM A;  3QTF A;  4AWP A;  3A0R A;  3IED A;  1US7 A;  1GKX A;  2YGF A;  3A0W A;  3HZ1 A;  1S16 A;  4NH9 A;  1QZR A;  4ASG A;  1ZXM A;  1TC0 A;  2IOP A;  1YER A;  3GIG A;  1B62 A;  1YC1 A;  1BYQ A;  2HKJ A;  4WUB A;  4YKT A;  2FYP A;  4U7N A;  3NMQ A;  4L8Z A;  2BRC A;  4GT8 A;  3U2D A;  4CWF A;  1GJV A;  4CE1 A;  1Y8O A;  4XIQ A;  2CGF A;  1MX0 A;  1KZN A;  2E0A A;  3EHJ A;  3H4L A;  2YEA A;  4H7Q A;  3G7E A;  2JJC A;  1AJ6 A;  3PEH A;  3B28 A;  3D0B A;  2XHT A;  1UY8 A;  4URM A;  5D7R A;  2O1V A;  3CRL A;  4FCP A;  1KIJ A;  3B24 A;  2WEP A;  1YC3 A;  4MPN A;  4HZ5 A;  4L94 A;  2WI5 A;  3TZ0 A;  2UWD A;  3U2K A;  5D7C A;  1YT2 A;  1YT1 A;  4L90 A;  2QF6 A;  4CWP A;  4FPP A;  3TZ4 A;  2YE5 A;  3JZ3 A;  3ZXO A;  2VWC A;  3O0I A;  5M4P A;  4KFG A;  4EMV A;  3GIG B;  2BU5 A;  4FCR A;  4X9L A;  3WQ9 A;  5C93 A;  5FNF A;  1B3Q A;  1YC4 A;  2YE4 A;  2ZDX A;  1YES A;  4XTJ A;  3VHC A;  2O1W A;  2CCU A;  5F3K A;  4MOT A;  4R3M A;  2XD6 A;  4O07 A;  1H7U A;  2YKI A;  2H55 A;  4KSH A;  4R1F A;  1TH8 A;  3O6O A;  2XDK A;  2IOR A;  1Y4U A;  4EGI A;  1UY9 A;  4I5S A;  3PEJ A;  1L0O A;  2BU7 A;  4JAV A;  2BRE A;  2YEB A;  4XC0 A;  1BGQ A;  2XHR A;  1UYL A;  1OSF A;  1MU5 A;  4NH8 A;  4U7O A;  4KSG A;  1TIL A;  5FWK A;  3CWV A;  2CCS A;  2Q8G A;  1I58 A;  1UY6 A;  1UYM A;  3ZKD A;  2YI7 A;  2XDX A;  4EFT A;  2YE2 A;  3R4P A;  1UYD A;  1QY8 A;  1ID0 A;  2YI0 A;  1I5D A;  5F5R A;  4Q20 A;  1ZWH A;  3OW6 A;  4XDM A;  2H8M A;  4XE2 A;  1ZXN A;  2YE8 A;  1AMW A;  2YKJ A;  3T0Z A;  4HYP A;  3B25 A;  2AKP A;  4HY1 A;  2YK9 A;  3A0X A;  4CWT A;  3FT5 A;  2YEC A;  2BU8 A;  3FV5 A;  2PNR A;  1UYF A;  3VHA A;  5D6Q A;  3QDD A;  4BAE A;  1I5C A;  3EHG A;  3OWD A;  4R3A A;  1AM1 A;  3HYZ A;  4GQT A;  3B27 A;  4KP4 A;  1U2O A;  4XD8 A;  4XIT A;  3HHU A;  2FWY A;  3CRK A;  3C0E A; 
#chains in the Genus database with same CATH topology
 2CG9 A;  3T2S A;  2QFO A;  2BYI A;  3Q5K A;  4DZY A;  2XDL A;  2YGE A;  5M4E A;  4ASF A;  3FT8 A;  1EI1 A;  5CTX A;  2GQP A;  4XIP A;  3HEK A;  4PL9 A;  4XKA A;  3HYY A;  4JAU A;  3R4O A;  4YKY A;  2WI2 A;  2YEE A;  3Q5J A;  1BKN A;  1JM6 A;  2Q8I A;  2YE3 A;  3T1K A;  3KE6 A;  2YK2 A;  3LPS A;  4XKO A;  1AH8 A;  1Y8P A;  4XIR A;  4CE3 A;  5CTW A;  2WI4 A;  4HXW A;  1YET A;  2VCJ A;  4BQG A;  1GKZ A;  4LWE A;  3RKZ A;  2XCM A;  4PRV A;  4MP2 A;  4BQJ A;  3B26 A;  2Q8F A;  3ZXQ A;  4CWS A;  2BU2 A;  2XAB A;  4CWO A;  5M4K A;  4H85 A;  2VW5 A;  4MBC A;  3K60 A;  2FXS A;  1AH6 A;  1EA6 A;  2ZBK B;  1I5B A;  4LP0 A;  4O09 A;  4E01 A;  4LWG A;  1IXM A;  3O2F A;  4I3H A;  3EKO A;  4E00 A;  1UYE A;  3G7B A;  4QPJ A;  2YKC A;  4FMT A;  2QG2 A;  2IWU A;  4XCJ A;  2XX5 A;  4BIU A;  1S14 A;  5D7D A;  4BXI A;  2YI6 A;  1U0Z A;  2XHX A;  4YKU A;  3RLP A;  1QYE A;  2WEQ A;  3INW A;  4AWO A;  4BIZ A;  4E72 A;  3ZKB A;  4KQV A;  4CWN A;  4L91 A;  4QPK A;  3R92 A;  2XJX A;  4W7T A;  2YE7 A;  4YKW A;  5CPH A;  2WI7 A;  4O0B A;  1R62 A;  3OWB A;  1NHI A;  5IN9 A;  2XX4 A;  2Q2E B;  2BU6 A;  5J71 A;  4XKK A;  2EXL A;  1UY7 A;  3T0H A;  4ASB A;  4MP7 A;  2O1U A;  3A0T A;  4LPB A;  3D2R A;  4ZKI A;  4PU9 A;  2BYH A;  2WI6 A;  3LMM A;  3EHF A;  4EGK A;  3GIF A;  3TTZ A;  2YEG A;  2YEJ A;  3EHH A;  1Y8N A;  4URL A;  2BZ5 A;  4CWR A;  1NHJ A;  2C1I A;  3K99 A;  3BMY A;  4JAS A;  4L93 A;  2YEH A;  5BOD A;  1Z5C A;  2YJX A;  3MNR P;  2BTZ A;  4HZ0 A;  3VHD A;  4P8O A;  2ZKJ A;  1TC6 A;  1THN A;  4AS9 A;  3BM9 A;  4KTN A;  4CE2 A;  1Z5A A;  2XDS A;  5CTU A;  1A4H A;  3WHA A;  1I59 A;  2XDU A;  2FWZ A;  1Z59 A;  1TID A;  3DGE A;  5M4M A;  2XX2 A;  4YKZ A;  1H7S A;  1UYK A;  3ZM7 A;  3C11 A;  2Q8H A;  4ZVI A;  2YI5 A;  4MPE A;  4LWH A;  3HZ5 A;  1YSZ A;  2YED A;  3LNU A;  4AWQ A;  3K97 A;  4JQL A;  4K4O A;  1Z5B A;  3A0Z A;  3RLR A;  2YE9 A;  4XCL A;  1YS3 A;  4DUH A;  4GEE A;  4EFU A;  4GFN A;  2HG1 A;  4ASA A;  2YEI A;  2K5B A;  2VCI A;  3R91 A;  4EM7 A;  4LWI A;  3VAD A;  1B63 A;  3OPD A;  2WI1 A;  2HCH A;  1UYI A;  1PVG A;  5D6P A;  4FCQ A;  3K98 A;  2XJJ A;  2IOQ A;  1TBW A;  2GFD A;  4PRX A;  4URN A;  1YSR A;  3Q5L A;  4CWQ A;  4HYM A;  3CYG A;  4MB9 A;  2CH4 A;  1UYG A;  2IWS A;  2YEF A;  2WER A;  3CGZ A;  3EKR A;  3T10 A;  2C1G A;  3CGY A;  5J6A A;  5GGZ A;  4EGH A;  1ZW9 A;  3A0Y A;  3INX A;  4YKR A;  4WUD A;  5FND A;  4WUC A;  3R4M A;  1UYH A;  3H80 A;  3GIE A;  4YKQ A;  5IDJ A;  2XK2 A;  4E02 A;  3G75 A;  2XJG A;  3D36 A;  2ESA A;  4HY6 A;  2C2A A;  4LWF A;  4V25 A;  4U93 A;  2WI3 A;  1Y4S A;  2QG0 A;  2IWX A;  4B7P A;  3RLQ A;  2BSM A;  3TUH A;  4URO A;  1UYC A;  4O04 A;  3TZ2 A;  2BT0 A;  4H81 A;  3R4N A;  5FNC A;  1NHH A;  2JKI A;  4GCZ A;  2YE6 A;  2ZDY A;  2YGA A;  3SL2 A;  4O05 A;  1YT0 A;  4NH7 A;  1I5A A;  4YKX A;  5M4H A;  4V26 A;  2YJW A;  3TZ5 A;  2YKE A;  5CTY A;  2CCT A;  5L3J A;  5CF0 A;  4P7A A;  3U67 A;  2YKB A;  3OMU A;  5M4N A;  1BXD A;  5BOC A;  4HXZ A;  4EEH A;  4MPC A;  4GGL A;  4B6C A;  5IDM A;  3QTF A;  4AWP A;  3A0R A;  3IED A;  1US7 A;  1GKX A;  2YGF A;  3A0W A;  3HZ1 A;  1S16 A;  4NH9 A;  1QZR A;  4ASG A;  1ZXM A;  1TC0 A;  2IOP A;  1YER A;  3GIG A;  1B62 A;  1YC1 A;  1BYQ A;  2HKJ A;  4WUB A;  4YKT A;  2FYP A;  4U7N A;  3NMQ A;  4L8Z A;  2BRC A;  4GT8 A;  3U2D A;  4CWF A;  1GJV A;  4CE1 A;  1Y8O A;  4XIQ A;  2CGF A;  1MX0 A;  1KZN A;  2E0A A;  3EHJ A;  3H4L A;  2YEA A;  4H7Q A;  3G7E A;  2JJC A;  1AJ6 A;  3PEH A;  3B28 A;  3D0B A;  2XHT A;  1UY8 A;  4URM A;  5D7R A;  2O1V A;  3CRL A;  4FCP A;  1KIJ A;  3B24 A;  2WEP A;  1YC3 A;  4MPN A;  4HZ5 A;  4L94 A;  2WI5 A;  3TZ0 A;  2UWD A;  3U2K A;  5D7C A;  1YT2 A;  1YT1 A;  4L90 A;  2QF6 A;  4CWP A;  4FPP A;  3TZ4 A;  2YE5 A;  3JZ3 A;  3ZXO A;  2VWC A;  3O0I A;  3S5T A;  5M4P A;  4KFG A;  4EMV A;  3GIG B;  2BU5 A;  4FCR A;  4X9L A;  3WQ9 A;  5C93 A;  5FNF A;  1B3Q A;  1YC4 A;  2YE4 A;  2ZDX A;  1YES A;  4XTJ A;  2HHI A;  3VHC A;  2O1W A;  2CCU A;  5F3K A;  4MOT A;  4R3M A;  2XD6 A;  4O07 A;  1H7U A;  2YKI A;  5JEN A;  2H55 A;  4KSH A;  4R1F A;  1TH8 A;  3O6O A;  2XDK A;  2IOR A;  1Y4U A;  4EGI A;  1UY9 A;  4I5S A;  3PEJ A;  1L0O A;  2BU7 A;  4JAV A;  2BRE A;  2YEB A;  4XC0 A;  1BGQ A;  2XHR A;  1OSF A;  1UYL A;  1MU5 A;  4NH8 A;  4U7O A;  4KSG A;  1TIL A;  5FWK A;  3CWV A;  2CCS A;  2Q8G A;  1I58 A;  1UY6 A;  1UYM A;  3ZKD A;  2YI7 A;  2XDX A;  4EFT A;  2YE2 A;  3R4P A;  1UYD A;  1QY8 A;  1ID0 A;  2YI0 A;  1I5D A;  5F5R A;  1F51 A;  4Q20 A;  1ZWH A;  3OW6 A;  4XDM A;  2H8M A;  4XE2 A;  1ZXN A;  2YE8 A;  2FTK A;  1AMW A;  2YKJ A;  3T0Z A;  4HYP A;  3B25 A;  2AKP A;  4HY1 A;  2YK9 A;  3A0X A;  4CWT A;  3FT5 A;  2YEC A;  2BU8 A;  3FV5 A;  2PNR A;  1UYF A;  3VHA A;  5D6Q A;  3QDD A;  4BAE A;  1I5C A;  3EHG A;  3OWD A;  4R3A A;  1AM1 A;  3HYZ A;  4GQT A;  3B27 A;  4KP4 A;  1U2O A;  4XD8 A;  4XIT A;  3HHU A;  2FWY A;  3CRK A;  3C0E A; 
#chains in the Genus database with same CATH homology
 2CG9 A;  3T2S A;  2QFO A;  2BYI A;  3Q5K A;  4DZY A;  2XDL A;  2YGE A;  5M4E A;  4ASF A;  3FT8 A;  1EI1 A;  5CTX A;  2GQP A;  4XIP A;  3HEK A;  4PL9 A;  4XKA A;  3HYY A;  4JAU A;  3R4O A;  4YKY A;  2WI2 A;  2YEE A;  3Q5J A;  1BKN A;  1JM6 A;  2Q8I A;  2YE3 A;  3T1K A;  3KE6 A;  2YK2 A;  3LPS A;  4XKO A;  1AH8 A;  1Y8P A;  4XIR A;  4CE3 A;  5CTW A;  2WI4 A;  4HXW A;  1YET A;  2VCJ A;  4BQG A;  1GKZ A;  4LWE A;  3RKZ A;  2XCM A;  4PRV A;  4MP2 A;  4BQJ A;  3B26 A;  2Q8F A;  3ZXQ A;  4CWS A;  2BU2 A;  2XAB A;  4CWO A;  5M4K A;  4H85 A;  2VW5 A;  4MBC A;  3K60 A;  2FXS A;  1AH6 A;  1EA6 A;  2ZBK B;  1I5B A;  4LP0 A;  4O09 A;  4E01 A;  4LWG A;  3O2F A;  4I3H A;  3EKO A;  4E00 A;  1UYE A;  3G7B A;  4QPJ A;  2YKC A;  4FMT A;  2QG2 A;  2IWU A;  4XCJ A;  2XX5 A;  4BIU A;  1S14 A;  5D7D A;  4BXI A;  2YI6 A;  1U0Z A;  2XHX A;  4YKU A;  3RLP A;  1QYE A;  2WEQ A;  3INW A;  4AWO A;  4BIZ A;  3ZKB A;  4KQV A;  4CWN A;  4L91 A;  4QPK A;  3R92 A;  2XJX A;  4W7T A;  2YE7 A;  4YKW A;  5CPH A;  2WI7 A;  4O0B A;  1R62 A;  3OWB A;  1NHI A;  5IN9 A;  2XX4 A;  2Q2E B;  2BU6 A;  5J71 A;  4XKK A;  2EXL A;  1UY7 A;  3T0H A;  4ASB A;  4MP7 A;  2O1U A;  3A0T A;  4LPB A;  3D2R A;  4ZKI A;  4PU9 A;  2BYH A;  2WI6 A;  3EHF A;  4EGK A;  3GIF A;  3TTZ A;  2YEG A;  2YEJ A;  3EHH A;  1Y8N A;  4URL A;  2BZ5 A;  4CWR A;  1NHJ A;  3K99 A;  3BMY A;  4JAS A;  4L93 A;  2YEH A;  5BOD A;  1Z5C A;  2YJX A;  3MNR P;  2BTZ A;  4HZ0 A;  3VHD A;  4P8O A;  2ZKJ A;  1TC6 A;  1THN A;  4AS9 A;  3BM9 A;  4KTN A;  4CE2 A;  1Z5A A;  2XDS A;  5CTU A;  1A4H A;  3WHA A;  1I59 A;  2XDU A;  2FWZ A;  1Z59 A;  1TID A;  3DGE A;  5M4M A;  2XX2 A;  4YKZ A;  1H7S A;  1UYK A;  3ZM7 A;  3C11 A;  2Q8H A;  4ZVI A;  2YI5 A;  4MPE A;  4LWH A;  3HZ5 A;  1YSZ A;  2YED A;  3LNU A;  4AWQ A;  3K97 A;  4JQL A;  4K4O A;  1Z5B A;  3A0Z A;  3RLR A;  2YE9 A;  4XCL A;  1YS3 A;  4DUH A;  4GEE A;  4EFU A;  4GFN A;  2HG1 A;  4ASA A;  2YEI A;  2K5B A;  2VCI A;  3R91 A;  4EM7 A;  4LWI A;  3VAD A;  1B63 A;  3OPD A;  2WI1 A;  2HCH A;  1UYI A;  1PVG A;  5D6P A;  4FCQ A;  3K98 A;  2XJJ A;  2IOQ A;  1TBW A;  2GFD A;  4PRX A;  4URN A;  1YSR A;  3Q5L A;  4CWQ A;  4HYM A;  4MB9 A;  2CH4 A;  1UYG A;  2IWS A;  2YEF A;  2WER A;  3CGZ A;  3EKR A;  3T10 A;  3CGY A;  5J6A A;  5GGZ A;  4EGH A;  1ZW9 A;  3A0Y A;  3INX A;  4YKR A;  4WUD A;  5FND A;  4WUC A;  3R4M A;  1UYH A;  3H80 A;  3GIE A;  4YKQ A;  5IDJ A;  2XK2 A;  4E02 A;  3G75 A;  2XJG A;  3D36 A;  2ESA A;  4HY6 A;  2C2A A;  4LWF A;  4V25 A;  4U93 A;  2WI3 A;  1Y4S A;  2QG0 A;  2IWX A;  4B7P A;  3RLQ A;  2BSM A;  3TUH A;  4URO A;  1UYC A;  4O04 A;  3TZ2 A;  2BT0 A;  4H81 A;  3R4N A;  5FNC A;  1NHH A;  2JKI A;  4GCZ A;  2YE6 A;  2ZDY A;  2YGA A;  3SL2 A;  4O05 A;  1YT0 A;  4NH7 A;  1I5A A;  4YKX A;  5M4H A;  4V26 A;  2YJW A;  3TZ5 A;  2YKE A;  5CTY A;  2CCT A;  5L3J A;  5CF0 A;  4P7A A;  3U67 A;  2YKB A;  3OMU A;  5M4N A;  1BXD A;  5BOC A;  4HXZ A;  4EEH A;  4MPC A;  4GGL A;  4B6C A;  5IDM A;  3QTF A;  4AWP A;  3A0R A;  3IED A;  1US7 A;  1GKX A;  2YGF A;  3A0W A;  3HZ1 A;  1S16 A;  4NH9 A;  1QZR A;  4ASG A;  1ZXM A;  1TC0 A;  2IOP A;  1YER A;  3GIG A;  1B62 A;  1YC1 A;  1BYQ A;  2HKJ A;  4WUB A;  4YKT A;  2FYP A;  4U7N A;  3NMQ A;  4L8Z A;  2BRC A;  4GT8 A;  3U2D A;  4CWF A;  1GJV A;  4CE1 A;  1Y8O A;  4XIQ A;  2CGF A;  1MX0 A;  1KZN A;  2E0A A;  3EHJ A;  3H4L A;  2YEA A;  4H7Q A;  3G7E A;  2JJC A;  1AJ6 A;  3PEH A;  3B28 A;  3D0B A;  2XHT A;  1UY8 A;  4URM A;  5D7R A;  2O1V A;  3CRL A;  4FCP A;  1KIJ A;  3B24 A;  2WEP A;  1YC3 A;  4MPN A;  4HZ5 A;  4L94 A;  2WI5 A;  3TZ0 A;  2UWD A;  3U2K A;  5D7C A;  1YT2 A;  1YT1 A;  4L90 A;  2QF6 A;  4CWP A;  4FPP A;  3TZ4 A;  2YE5 A;  3JZ3 A;  3ZXO A;  2VWC A;  3O0I A;  5M4P A;  4KFG A;  4EMV A;  3GIG B;  2BU5 A;  4FCR A;  4X9L A;  3WQ9 A;  5C93 A;  5FNF A;  1B3Q A;  1YC4 A;  2YE4 A;  2ZDX A;  1YES A;  4XTJ A;  3VHC A;  2O1W A;  2CCU A;  5F3K A;  4MOT A;  4R3M A;  2XD6 A;  4O07 A;  1H7U A;  2YKI A;  2H55 A;  4KSH A;  4R1F A;  1TH8 A;  3O6O A;  2XDK A;  2IOR A;  1Y4U A;  4EGI A;  1UY9 A;  4I5S A;  3PEJ A;  1L0O A;  2BU7 A;  4JAV A;  2BRE A;  2YEB A;  4XC0 A;  1BGQ A;  2XHR A;  1UYL A;  1OSF A;  1MU5 A;  4NH8 A;  4U7O A;  4KSG A;  1TIL A;  5FWK A;  3CWV A;  2CCS A;  2Q8G A;  1I58 A;  1UY6 A;  1UYM A;  3ZKD A;  2YI7 A;  2XDX A;  4EFT A;  2YE2 A;  3R4P A;  1UYD A;  1QY8 A;  1ID0 A;  2YI0 A;  1I5D A;  5F5R A;  4Q20 A;  1ZWH A;  3OW6 A;  4XDM A;  2H8M A;  4XE2 A;  1ZXN A;  2YE8 A;  1AMW A;  2YKJ A;  3T0Z A;  4HYP A;  3B25 A;  2AKP A;  4HY1 A;  2YK9 A;  3A0X A;  4CWT A;  3FT5 A;  2YEC A;  2BU8 A;  3FV5 A;  2PNR A;  1UYF A;  3VHA A;  5D6Q A;  3QDD A;  4BAE A;  1I5C A;  3EHG A;  3OWD A;  4R3A A;  1AM1 A;  3HYZ A;  4GQT A;  3B27 A;  4KP4 A;  1U2O A;  4XD8 A;  4XIT A;  3HHU A;  2FWY A;  3CRK A;  3C0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...