2IWSA

Radicicol analogues bound to the atp site of hsp90
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
213
structure length
210
Chain Sequence
MASETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETEPDLFIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTILRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPIQLVVTKEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of Hsp90 with Synthetic Macrolactones: Synthesis and Structural and Biological Evaluation of Ring and Conformational Analogs of Radicicol.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
total genus 60
structure length 210
sequence length 213
ec nomenclature
pdb deposition date 2006-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2iwsA00
4YKTA 4CWFA 5FNCA 2YE2A 4FCQA 4E01A 3ZXOA 4QPKA 1YC3A 2WEQA 4CWPA 1L0OA 3INXA 3WHAA 1TILA 4CWSA 1BYQA 2FXSA 4BXIA 1AH8A 1TC0A 3A0ZA 3RLPA 1TH8A 4WUBA 4KFGA 3O0IA 4XKAA 4EMVA 4XIQA 3LNUA 3CGZA 1AH6A 3TUHA 2WI2A 2XCMA 2WI1A 2YEJA 1GKZA 3OPDA 1B3QA 1AMWA 5D7CA 3B25A 4QPJA 1QY8A 3T0ZA 2C2AA 3ZM7A 4MP2A 2EXLA 4YKRA 2YEEA 3T2SA 1YS3A 5FWKA 3PEHA 2O1WA 4P8OA 1OSFA 2YK2A 2XX2A 3K60A 3GIFA 4ASGA 5F3KA 4PL9A 2CCSA 5IDJA 3MNRP 5F5RA 5D6QA 5CTWA 3CWVA 2IOPA 3EHGA 3OWDA 4HY6A 2YE4A 4HZ0A 4EGHA 3DGEA 3ZKBA 4L94A 2H8MA 2IWXA 3HYYA 4I3HA 4LWEA 3H80A 3T10A 1YSRA 2HCHA 4URLA 2XX4A 3G75A 5M4MA 3TTZA 2YECA 4CWTA 4PU9A 3B27A 3TZ0A 4XDMA 2GFDA 4LP0A 3HHUA 4CE1A 2YEBA 1YC1A 2XHXA 1UY9A 3JZ3A 4B6CA 4LPBA 2YKEA 4E02A 1UYFA 5BOCA 4MP7A 5CTYA 3HZ1A 1U0ZA 1ZXMA 3Q5LA 5IN9A 3O2FA 4EFUA 1GKXA 1YC4A 4AS9A 5C93A 1NHJA 2CCTA 1H7UA 4LWHA 2YEIA 1YESA 5FNFA 2YEGA 4ZVIA 1YT0A 2YK9A 4I5SA 1I5BA 4JASA 1BXDA 4XTJA 2BU7A 4FMTA 4CWQA 1UYDA 3K98A 3TZ5A 2FWYA 4KQVA 1UYGA 1S16A 2PNRA 4BQGA 2XHTA 2IWUA 1EA6A 3TZ2A 1Z59A 1Y4SA 3VHCA 1UYCA 3VADA 2BTZA 3EHJA 3ZXQA 2YKIA 4XKKA 1GJVA 1US7A 2XD6A 1S14A 3KE6A 2Q8HA 4L8ZA 2WEPA 1UY6A 4GT8A 5CTUA 4GEEA 4AWOA 2GQPA 2WI3A 3K99A 3GIGA 2YE3A 3FT5A 4KSGA 1AJ6A 1MX0A 4MOTA 3U2KA 1THNA 1UYLA 3VHAA 3C11A 4X9LA 4WUCA 3SL2A 3OMUA 1UY7A 4LWFA 2YI7A 3CGYA 3R4OA 4R3MA 2YE9A 2HKJA 1KIJA 2K5BA 4BAEA 2BREA 1YETA 1Z5BA 2HG1A 2ZDXA 5D7DA 3D36A 2Q8GA 1YERA 4XKOA 4XIPA 3RKZA 3C0EA 2XDLA 2YE7A 2YGFA 2YJWA 3QTFA 2E0AA 2JKIA 1UYIA 4MBCA 3FV5A 4O04A 2VW5A 3R4MA 4JAVA 4K4OA 4XCJA 4MPEA 1Z5CA 3BM9A 3CRLA 3Q5JA 2H55A 5J71A 4KSHA 4XCLA 5M4NA 3G7EA 1UYKA 4H7QA 3B26A 2YE6A 4H85A 2Q8FA 4YKYA 4O0BA 5IDMA 2YI6A 4BQJA 2BU8A 2BT0A 4ASBA 4XE2A 4JAUA 2XABA 3U2DA 1I5AA 3CRKA 2ZKJA 4XC0A 3EKOA 3HZ5A 4LWGA 2BYIA 3VHDA 4CE2A 2UWDA 1YT2A 2VWCA 4DUHA 5GGZA 1YSZA 4KP4A 2BU2A 4GFNA 2JJCA 4GQTA 3R92A 3A0WA 2YE8A 2CH4A 4PRXA 5CPHA 1Y8PA 3T1KA 1NHIA 5M4KA 2CG9A 2O1VA 4MB9A 4HY1A 4P7AA 2AKPA 4LWIA 5CTXA 1H7SA 2XDKA 3HYZA 4EEHA 2YI0A 4YKXA 3O6OA 4HYMA 4O07A 2YI5A 4EGIA 5M4EA 4DZYA 1Y4UA 1I59A 1UY8A 2Q2EB 3K97A 1BKNA 2BSMA 4O05A 1PVGA 5D7RA 4EGKA 3LPSA 1NHHA 4L93A 3Q5KA 2XJGA 4FPPA 4NH7A 3BMYA 1I58A 4PRVA 1ZW9A 2XDSA 1A4HA 2ZDYA 1TIDA 3FT8A 3ZKDA 2YEHA 4XITA 4BIZA 3R4PA 3RLQA 1U2OA 4ASAA 1YT1A 2IORA 4V25A 1TC6A 1I5CA 2QG0A 2YKCA 3R91A 3WQ9A 4W7TA 4U7OA 2YEAA 1MU5A 3HEKA 4CWRA 4B7PA 2ZBKB 2CCUA 4Q20A 3EKRA 4CWNA 4GGLA 4AWQA 3A0TA 3T0HA 3OWBA 1BGQA 2QFOA 2Q8IA 2BYHA 5L3JA 2FWZA 1R62A 3D2RA 2YEDA 3PEJA 4FCPA 3B24A 4YKUA 1KZNA 2WI7A 2QG2A 2WI5A 3H4LA 4MPNA 4U93A 3B28A 2QF6A 4FCRA 4ASFA 4NH8A 1B63A 5CF0A 2YGEA 2VCIA 1Y8OA 4E00A 3OW6A 4HXWA 3R4NA 4L91A 3RLRA 4R1FA 4HZ5A 5FNDA 4EFTA 1UYHA 4UROA 5J6AA 4HYPA 1B62A 4URMA 2YE5A 1QZRA 1EI1A 3TZ4A 2BRCA 3G7BA 2XDXA 1JM6A 4GCZA 4EM7A 4V26A 4MPCA 1Z5AA 2IWSA 4XD8A 2FYPA 2WI4A 1AM1A 1ZWHA 2BZ5A 4YKZA 2XK2A 1UYEA 2XJXA 3U67A 3NMQA 4HXZA 4XIRA 2YKBA 3QDDA 4BIUA 5M4PA 2CGFA 3GIEA 2YKJA 4NH9A 2ESAA 2YGAA 4URNA 4CE3A 4AWPA 1UYMA 4R3AA 2XDUA 3EHHA 2YEFA 2XHRA 4L90A 2YJXA 2WERA 5D6PA 2XJJA 1Y8NA 1TBWA 3GIGB 4CWOA 2IOQA 4H81A 1I5DA 2O1UA 4YKWA 1QYEA 2XX5A 3IEDA 3INWA 5BODA 1ZXNA 2WI6A 4YKQA 3A0XA 4JQLA 4KTNA 2BU5A 4U7NA 2BU6A 4WUDA 3D0BA 4O09A 3A0YA 2VCJA 5M4HA 1ID0A 4ZKIA 3A0RA 3EHFA
chains in the Genus database with same CATH superfamily
4YKTA 4CWFA 5FNCA 2YE2A 4FCQA 4E01A 3ZXOA 4QPKA 1YC3A 2WEQA 4CWPA 1L0OA 3INXA 3WHAA 1TILA 4CWSA 1BYQA 2FXSA 4BXIA 1AH8A 1TC0A 3A0ZA 3LMMA 3RLPA 1TH8A 4WUBA 4KFGA 3O0IA 4XKAA 4EMVA 4XIQA 3LNUA 3CGZA 1AH6A 3TUHA 2WI2A 2XCMA 2WI1A 2YEJA 1GKZA 3OPDA 1B3QA 1AMWA 5D7CA 3B25A 4QPJA 1QY8A 3T0ZA 2C2AA 3ZM7A 4MP2A 2EXLA 4YKRA 2YEEA 3T2SA 1YS3A 5FWKA 3PEHA 2O1WA 4P8OA 1OSFA 2YK2A 2XX2A 3K60A 3GIFA 4ASGA 5F3KA 4PL9A 2CCSA 5IDJA 3MNRP 5F5RA 5D6QA 5CTWA 3CWVA 2IOPA 3EHGA 3OWDA 4HY6A 2YE4A 4HZ0A 4EGHA 1IXMA 3DGEA 3ZKBA 4L94A 2H8MA 2IWXA 3HYYA 4I3HA 4LWEA 3H80A 3T10A 1YSRA 2HCHA 4URLA 2XX4A 3G75A 5M4MA 3TTZA 2YECA 4CWTA 4PU9A 3B27A 3TZ0A 4XDMA 2GFDA 4LP0A 3HHUA 4CE1A 2YEBA 1YC1A 2XHXA 1UY9A 3JZ3A 4B6CA 4LPBA 5JENA 2YKEA 4E02A 1UYFA 5BOCA 4MP7A 5CTYA 3HZ1A 1U0ZA 1ZXMA 3Q5LA 5IN9A 3O2FA 4EFUA 1GKXA 1YC4A 4AS9A 5C93A 1NHJA 2CCTA 1H7UA 4LWHA 2YEIA 1YESA 5FNFA 2YEGA 4ZVIA 1YT0A 2YK9A 4I5SA 1I5BA 4JASA 1BXDA 4XTJA 2BU7A 4FMTA 4CWQA 1UYDA 3K98A 3TZ5A 2FWYA 4KQVA 1UYGA 1S16A 2PNRA 4BQGA 2XHTA 2IWUA 1EA6A 3TZ2A 1Z59A 1Y4SA 3VHCA 1UYCA 3VADA 2BTZA 3EHJA 3ZXQA 2YKIA 4XKKA 1GJVA 1US7A 2XD6A 1S14A 3KE6A 2Q8HA 4L8ZA 2WEPA 1UY6A 4GT8A 5CTUA 4GEEA 4AWOA 2GQPA 2WI3A 3K99A 3GIGA 2YE3A 3FT5A 4KSGA 1AJ6A 1MX0A 4MOTA 3U2KA 1THNA 1UYLA 3VHAA 3C11A 4X9LA 4WUCA 3SL2A 3OMUA 1UY7A 2YI7A 3CGYA 4LWFA 3R4OA 4R3MA 2YE9A 2HKJA 1KIJA 2K5BA 4BAEA 2BREA 1YETA 1Z5BA 2HG1A 2ZDXA 1F51A 5D7DA 3D36A 2C1GA 2Q8GA 1YERA 4XKOA 4XIPA 3RKZA 3C0EA 2XDLA 2YE7A 2YGFA 2YJWA 3QTFA 2E0AA 2JKIA 1UYIA 4MBCA 3FV5A 4O04A 2VW5A 3R4MA 3S5TA 4JAVA 4K4OA 4XCJA 4MPEA 1Z5CA 3BM9A 3CRLA 3Q5JA 2H55A 5J71A 4KSHA 4XCLA 5M4NA 3G7EA 1UYKA 4H7QA 3B26A 2YE6A 4H85A 2Q8FA 4YKYA 4O0BA 5IDMA 2YI6A 4BQJA 2BU8A 2BT0A 4ASBA 4XE2A 4JAUA 2XABA 3U2DA 1I5AA 3CRKA 2ZKJA 4XC0A 3EKOA 3HZ5A 4LWGA 2BYIA 3VHDA 4CE2A 2UWDA 1YT2A 2VWCA 4DUHA 5GGZA 1YSZA 4KP4A 2BU2A 4GFNA 2JJCA 4GQTA 3R92A 3A0WA 2YE8A 2CH4A 4PRXA 5CPHA 1Y8PA 3T1KA 1NHIA 5M4KA 2CG9A 4E72A 2O1VA 4MB9A 4HY1A 4P7AA 2AKPA 4LWIA 5CTXA 1H7SA 2XDKA 3HYZA 4EEHA 2YI0A 4YKXA 3O6OA 4HYMA 4O07A 2YI5A 4EGIA 5M4EA 4DZYA 1Y4UA 1I59A 1UY8A 2Q2EB 3K97A 1BKNA 2BSMA 4O05A 1PVGA 5D7RA 4EGKA 3LPSA 1NHHA 4L93A 3Q5KA 2XJGA 2HHIA 4FPPA 4NH7A 3BMYA 1I58A 4PRVA 1ZW9A 2XDSA 1A4HA 2ZDYA 1TIDA 3FT8A 3ZKDA 2YEHA 4XITA 4BIZA 3R4PA 3RLQA 1U2OA 4ASAA 1YT1A 2IORA 4V25A 1TC6A 1I5CA 2QG0A 2YKCA 3R91A 3WQ9A 4W7TA 4U7OA 2FTKA 2YEAA 1MU5A 3HEKA 4CWRA 4B7PA 2ZBKB 2CCUA 4Q20A 3EKRA 4CWNA 4GGLA 4AWQA 3A0TA 3T0HA 3OWBA 1BGQA 2QFOA 2Q8IA 2BYHA 5L3JA 2FWZA 3CYGA 1R62A 3D2RA 2YEDA 3PEJA 4FCPA 3B24A 4YKUA 1KZNA 2WI7A 2QG2A 2WI5A 3H4LA 4MPNA 4U93A 3B28A 2QF6A 4FCRA 4ASFA 4NH8A 1B63A 5CF0A 2YGEA 2VCIA 1Y8OA 4E00A 3OW6A 4HXWA 3R4NA 4L91A 3RLRA 4R1FA 4HZ5A 5FNDA 4EFTA 1UYHA 4UROA 5J6AA 4HYPA 1B62A 4URMA 2YE5A 1QZRA 1EI1A 3TZ4A 2BRCA 3G7BA 2XDXA 1JM6A 4GCZA 4EM7A 4V26A 4MPCA 1Z5AA 2IWSA 4XD8A 2FYPA 2C1IA 2WI4A 1AM1A 1ZWHA 2BZ5A 4YKZA 2XK2A 1UYEA 2XJXA 3U67A 3NMQA 4HXZA 4XIRA 2YKBA 3QDDA 4BIUA 5M4PA 2CGFA 3GIEA 2YKJA 4NH9A 2ESAA 2YGAA 4URNA 4CE3A 4AWPA 1UYMA 4R3AA 2XDUA 3EHHA 2YEFA 2XHRA 4L90A 2YJXA 2WERA 5D6PA 2XJJA 1Y8NA 1TBWA 3GIGB 4CWOA 2IOQA 4H81A 1I5DA 2O1UA 4YKWA 1QYEA 2XX5A 3IEDA 3INWA 5BODA 1ZXNA 2WI6A 4YKQA 3A0XA 4JQLA 4KTNA 2BU5A 4U7NA 2BU6A 4WUDA 3D0BA 4O09A 3A0YA 2VCJA 5M4HA 1ID0A 4ZKIA 3A0RA 3EHFA
chains in the Genus database with same CATH topology
4YKTA 4CWFA 5FNCA 2YE2A 4FCQA 4E01A 3ZXOA 4QPKA 1YC3A 2WEQA 4CWPA 1L0OA 3INXA 3WHAA 1TILA 4CWSA 1BYQA 2FXSA 4BXIA 1AH8A 1TC0A 3A0ZA 3RLPA 1TH8A 4WUBA 4KFGA 3O0IA 4XKAA 4EMVA 4XIQA 3LNUA 3CGZA 1AH6A 3TUHA 2WI2A 2XCMA 2WI1A 2YEJA 1GKZA 3OPDA 1B3QA 1AMWA 5D7CA 3B25A 4QPJA 1QY8A 3T0ZA 2C2AA 3ZM7A 4MP2A 2EXLA 4YKRA 2YEEA 3T2SA 1YS3A 5FWKA 3PEHA 2O1WA 4P8OA 1OSFA 2YK2A 2XX2A 3K60A 3GIFA 4ASGA 5F3KA 4PL9A 2CCSA 5IDJA 3MNRP 5F5RA 5D6QA 5CTWA 3CWVA 2IOPA 3EHGA 3OWDA 4HY6A 2YE4A 4HZ0A 4EGHA 3DGEA 3ZKBA 4L94A 2H8MA 2IWXA 3HYYA 4I3HA 4LWEA 3H80A 3T10A 1YSRA 2HCHA 4URLA 2XX4A 3G75A 5M4MA 3TTZA 2YECA 4CWTA 4PU9A 3B27A 3TZ0A 4XDMA 2GFDA 4LP0A 3HHUA 4CE1A 2YEBA 1YC1A 2XHXA 1UY9A 3JZ3A 4B6CA 4LPBA 2YKEA 4E02A 1UYFA 5BOCA 4MP7A 5CTYA 3HZ1A 1U0ZA 1ZXMA 3Q5LA 5IN9A 3O2FA 4EFUA 1GKXA 1YC4A 4AS9A 5C93A 1NHJA 2CCTA 1H7UA 4LWHA 2YEIA 1YESA 5FNFA 2YEGA 4ZVIA 1YT0A 2YK9A 4I5SA 1I5BA 4JASA 1BXDA 4XTJA 2BU7A 4FMTA 4CWQA 1UYDA 3K98A 3TZ5A 2FWYA 4KQVA 1UYGA 1S16A 2PNRA 4BQGA 2XHTA 2IWUA 1EA6A 3TZ2A 1Z59A 1Y4SA 3VHCA 1UYCA 3VADA 2BTZA 3EHJA 3ZXQA 2YKIA 4XKKA 1GJVA 1US7A 2XD6A 1S14A 3KE6A 2Q8HA 4L8ZA 2WEPA 1UY6A 4GT8A 5CTUA 4GEEA 4AWOA 2GQPA 2WI3A 3K99A 3GIGA 2YE3A 3FT5A 4KSGA 1AJ6A 1MX0A 4MOTA 3U2KA 1THNA 1UYLA 3VHAA 3C11A 4X9LA 4WUCA 3SL2A 3OMUA 1UY7A 4LWFA 2YI7A 3CGYA 3R4OA 4R3MA 2YE9A 2HKJA 1KIJA 2K5BA 4BAEA 2BREA 1YETA 1Z5BA 2HG1A 2ZDXA 5D7DA 3D36A 2Q8GA 1YERA 4XKOA 4XIPA 3RKZA 3C0EA 2XDLA 2YE7A 2YGFA 2YJWA 3QTFA 2E0AA 2JKIA 1UYIA 4MBCA 3FV5A 4O04A 2VW5A 3R4MA 4JAVA 4K4OA 4XCJA 4MPEA 1Z5CA 3BM9A 3CRLA 3Q5JA 2H55A 5J71A 4KSHA 4XCLA 5M4NA 3G7EA 1UYKA 4H7QA 3B26A 2YE6A 4H85A 2Q8FA 4YKYA 4O0BA 5IDMA 2YI6A 4BQJA 2BU8A 2BT0A 4ASBA 4XE2A 4JAUA 2XABA 3U2DA 1I5AA 3CRKA 2ZKJA 4XC0A 3EKOA 3HZ5A 4LWGA 2BYIA 3VHDA 4CE2A 2UWDA 1YT2A 2VWCA 4DUHA 5GGZA 1YSZA 4KP4A 2BU2A 4GFNA 2JJCA 4GQTA 3R92A 3A0WA 2YE8A 2CH4A 4PRXA 5CPHA 1Y8PA 3T1KA 1NHIA 5M4KA 2CG9A 2O1VA 4MB9A 4HY1A 4P7AA 2AKPA 4LWIA 5CTXA 1H7SA 2XDKA 3HYZA 4EEHA 2YI0A 4YKXA 3O6OA 4HYMA 4O07A 2YI5A 4EGIA 5M4EA 4DZYA 1Y4UA 1I59A 1UY8A 2Q2EB 3K97A 1BKNA 2BSMA 4O05A 1PVGA 5D7RA 4EGKA 3LPSA 1NHHA 4L93A 3Q5KA 2XJGA 4FPPA 4NH7A 3BMYA 1I58A 4PRVA 1ZW9A 2XDSA 1A4HA 2ZDYA 1TIDA 3FT8A 3ZKDA 2YEHA 4XITA 4BIZA 3R4PA 3RLQA 1U2OA 4ASAA 1YT1A 2IORA 4V25A 1TC6A 1I5CA 2QG0A 2YKCA 3R91A 3WQ9A 4W7TA 4U7OA 2YEAA 1MU5A 3HEKA 4CWRA 4B7PA 2ZBKB 2CCUA 4Q20A 3EKRA 4CWNA 4GGLA 4AWQA 3A0TA 3T0HA 3OWBA 1BGQA 2QFOA 2Q8IA 2BYHA 5L3JA 2FWZA 1R62A 3D2RA 2YEDA 3PEJA 4FCPA 3B24A 4YKUA 1KZNA 2WI7A 2QG2A 2WI5A 3H4LA 4MPNA 4U93A 3B28A 2QF6A 4FCRA 4ASFA 4NH8A 1B63A 5CF0A 2YGEA 2VCIA 1Y8OA 4E00A 3OW6A 4HXWA 3R4NA 4L91A 3RLRA 4R1FA 4HZ5A 5FNDA 4EFTA 1UYHA 4UROA 5J6AA 4HYPA 1B62A 4URMA 2YE5A 1QZRA 1EI1A 3TZ4A 2BRCA 3G7BA 2XDXA 1JM6A 4GCZA 4EM7A 4V26A 4MPCA 1Z5AA 2IWSA 4XD8A 2FYPA 2WI4A 1AM1A 1ZWHA 2BZ5A 4YKZA 2XK2A 1UYEA 2XJXA 3U67A 3NMQA 4HXZA 4XIRA 2YKBA 3QDDA 4BIUA 5M4PA 2CGFA 3GIEA 2YKJA 4NH9A 2ESAA 2YGAA 4URNA 4CE3A 4AWPA 1UYMA 4R3AA 2XDUA 3EHHA 2YEFA 2XHRA 4L90A 2YJXA 2WERA 5D6PA 2XJJA 1Y8NA 1TBWA 3GIGB 4CWOA 2IOQA 4H81A 1I5DA 2O1UA 4YKWA 1QYEA 2XX5A 3IEDA 3INWA 5BODA 1ZXNA 2WI6A 4YKQA 3A0XA 4JQLA 4KTNA 2BU5A 4U7NA 2BU6A 4WUDA 3D0BA 4O09A 3A0YA 2VCJA 5M4HA 1ID0A 4ZKIA 3A0RA 3EHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YKT A;  4CWF A;  5FNC A;  2YE2 A;  4FCQ A;  4E01 A;  3ZXO A;  4QPK A;  1YC3 A;  2WEQ A;  4CWP A;  1L0O A;  3INX A;  3WHA A;  1TIL A;  4CWS A;  1BYQ A;  2FXS A;  4BXI A;  1AH8 A;  1TC0 A;  3A0Z A;  3RLP A;  1TH8 A;  4WUB A;  4KFG A;  3O0I A;  4XKA A;  4EMV A;  4XIQ A;  3LNU A;  3CGZ A;  1AH6 A;  3TUH A;  2WI2 A;  2XCM A;  2WI1 A;  2YEJ A;  1GKZ A;  3OPD A;  1B3Q A;  1AMW A;  5D7C A;  3B25 A;  4QPJ A;  1QY8 A;  3T0Z A;  2C2A A;  3ZM7 A;  4MP2 A;  2EXL A;  4YKR A;  2YEE A;  3T2S A;  1YS3 A;  5FWK A;  3PEH A;  2O1W A;  4P8O A;  1OSF A;  2YK2 A;  2XX2 A;  3K60 A;  3GIF A;  4ASG A;  5F3K A;  4PL9 A;  2CCS A;  5IDJ A;  3MNR P;  5F5R A;  5D6Q A;  5CTW A;  3CWV A;  2IOP A;  3EHG A;  3OWD A;  4HY6 A;  2YE4 A;  4HZ0 A;  4EGH A;  3DGE A;  3ZKB A;  4L94 A;  2H8M A;  2IWX A;  3HYY A;  4I3H A;  4LWE A;  3H80 A;  3T10 A;  1YSR A;  2HCH A;  4URL A;  2XX4 A;  3G75 A;  5M4M A;  3TTZ A;  2YEC A;  4CWT A;  4PU9 A;  3B27 A;  3TZ0 A;  4XDM A;  2GFD A;  4LP0 A;  3HHU A;  4CE1 A;  2YEB A;  1YC1 A;  2XHX A;  1UY9 A;  3JZ3 A;  4B6C A;  4LPB A;  2YKE A;  4E02 A;  1UYF A;  5BOC A;  4MP7 A;  5CTY A;  3HZ1 A;  1U0Z A;  1ZXM A;  3Q5L A;  5IN9 A;  3O2F A;  4EFU A;  1GKX A;  1YC4 A;  4AS9 A;  5C93 A;  1NHJ A;  2CCT A;  1H7U A;  4LWH A;  2YEI A;  1YES A;  5FNF A;  2YEG A;  4ZVI A;  1YT0 A;  2YK9 A;  4I5S A;  1I5B A;  4JAS A;  1BXD A;  4XTJ A;  2BU7 A;  4FMT A;  4CWQ A;  1UYD A;  3K98 A;  3TZ5 A;  2FWY A;  4KQV A;  1UYG A;  1S16 A;  2PNR A;  4BQG A;  2XHT A;  2IWU A;  1EA6 A;  3TZ2 A;  1Z59 A;  1Y4S A;  3VHC A;  1UYC A;  3VAD A;  2BTZ A;  3EHJ A;  3ZXQ A;  2YKI A;  4XKK A;  1GJV A;  1US7 A;  2XD6 A;  1S14 A;  3KE6 A;  2Q8H A;  4L8Z A;  2WEP A;  1UY6 A;  4GT8 A;  5CTU A;  4GEE A;  4AWO A;  2GQP A;  2WI3 A;  3K99 A;  3GIG A;  2YE3 A;  3FT5 A;  4KSG A;  1AJ6 A;  1MX0 A;  4MOT A;  3U2K A;  1THN A;  1UYL A;  3VHA A;  3C11 A;  4X9L A;  4WUC A;  3SL2 A;  3OMU A;  1UY7 A;  4LWF A;  2YI7 A;  3CGY A;  3R4O A;  4R3M A;  2YE9 A;  2HKJ A;  1KIJ A;  2K5B A;  4BAE A;  2BRE A;  1YET A;  1Z5B A;  2HG1 A;  2ZDX A;  5D7D A;  3D36 A;  2Q8G A;  1YER A;  4XKO A;  4XIP A;  3RKZ A;  3C0E A;  2XDL A;  2YE7 A;  2YGF A;  2YJW A;  3QTF A;  2E0A A;  2JKI A;  1UYI A;  4MBC A;  3FV5 A;  4O04 A;  2VW5 A;  3R4M A;  4JAV A;  4K4O A;  4XCJ A;  4MPE A;  1Z5C A;  3BM9 A;  3CRL A;  3Q5J A;  2H55 A;  5J71 A;  4KSH A;  4XCL A;  5M4N A;  3G7E A;  1UYK A;  4H7Q A;  3B26 A;  2YE6 A;  4H85 A;  2Q8F A;  4YKY A;  4O0B A;  5IDM A;  2YI6 A;  4BQJ A;  2BU8 A;  2BT0 A;  4ASB A;  4XE2 A;  4JAU A;  2XAB A;  3U2D A;  1I5A A;  3CRK A;  2ZKJ A;  4XC0 A;  3EKO A;  3HZ5 A;  4LWG A;  2BYI A;  3VHD A;  4CE2 A;  2UWD A;  1YT2 A;  2VWC A;  4DUH A;  5GGZ A;  1YSZ A;  4KP4 A;  2BU2 A;  4GFN A;  2JJC A;  4GQT A;  3R92 A;  3A0W A;  2YE8 A;  2CH4 A;  4PRX A;  5CPH A;  1Y8P A;  3T1K A;  1NHI A;  5M4K A;  2CG9 A;  2O1V A;  4MB9 A;  4HY1 A;  4P7A A;  2AKP A;  4LWI A;  5CTX A;  1H7S A;  2XDK A;  3HYZ A;  4EEH A;  2YI0 A;  4YKX A;  3O6O A;  4HYM A;  4O07 A;  2YI5 A;  4EGI A;  5M4E A;  4DZY A;  1Y4U A;  1I59 A;  1UY8 A;  2Q2E B;  3K97 A;  1BKN A;  2BSM A;  4O05 A;  1PVG A;  5D7R A;  4EGK A;  3LPS A;  1NHH A;  4L93 A;  3Q5K A;  2XJG A;  4FPP A;  4NH7 A;  3BMY A;  1I58 A;  4PRV A;  1ZW9 A;  2XDS A;  1A4H A;  2ZDY A;  1TID A;  3FT8 A;  3ZKD A;  2YEH A;  4XIT A;  4BIZ A;  3R4P A;  3RLQ A;  1U2O A;  4ASA A;  1YT1 A;  2IOR A;  4V25 A;  1TC6 A;  1I5C A;  2QG0 A;  2YKC A;  3R91 A;  3WQ9 A;  4W7T A;  4U7O A;  2YEA A;  1MU5 A;  3HEK A;  4CWR A;  4B7P A;  2ZBK B;  2CCU A;  4Q20 A;  3EKR A;  4CWN A;  4GGL A;  4AWQ A;  3A0T A;  3T0H A;  3OWB A;  1BGQ A;  2QFO A;  2Q8I A;  2BYH A;  5L3J A;  2FWZ A;  1R62 A;  3D2R A;  2YED A;  3PEJ A;  4FCP A;  3B24 A;  4YKU A;  1KZN A;  2WI7 A;  2QG2 A;  2WI5 A;  3H4L A;  4MPN A;  4U93 A;  3B28 A;  2QF6 A;  4FCR A;  4ASF A;  4NH8 A;  1B63 A;  5CF0 A;  2YGE A;  2VCI A;  1Y8O A;  4E00 A;  3OW6 A;  4HXW A;  3R4N A;  4L91 A;  3RLR A;  4R1F A;  4HZ5 A;  5FND A;  4EFT A;  1UYH A;  4URO A;  5J6A A;  4HYP A;  1B62 A;  4URM A;  2YE5 A;  1QZR A;  1EI1 A;  3TZ4 A;  2BRC A;  3G7B A;  2XDX A;  1JM6 A;  4GCZ A;  4EM7 A;  4V26 A;  4MPC A;  1Z5A A;  2IWS A;  4XD8 A;  2FYP A;  2WI4 A;  1AM1 A;  1ZWH A;  2BZ5 A;  4YKZ A;  2XK2 A;  1UYE A;  2XJX A;  3U67 A;  3NMQ A;  4HXZ A;  4XIR A;  2YKB A;  3QDD A;  4BIU A;  5M4P A;  2CGF A;  3GIE A;  2YKJ A;  4NH9 A;  2ESA A;  2YGA A;  4URN A;  4CE3 A;  4AWP A;  1UYM A;  4R3A A;  2XDU A;  3EHH A;  2YEF A;  2XHR A;  4L90 A;  2YJX A;  2WER A;  5D6P A;  2XJJ A;  1Y8N A;  1TBW A;  3GIG B;  4CWO A;  2IOQ A;  4H81 A;  1I5D A;  2O1U A;  4YKW A;  1QYE A;  2XX5 A;  3IED A;  3INW A;  5BOD A;  1ZXN A;  2WI6 A;  4YKQ A;  3A0X A;  4JQL A;  4KTN A;  2BU5 A;  4U7N A;  2BU6 A;  4WUD A;  3D0B A;  4O09 A;  3A0Y A;  2VCJ A;  5M4H A;  1ID0 A;  4ZKI A;  3A0R A;  3EHF A; 
#chains in the Genus database with same CATH topology
 4YKT A;  4CWF A;  5FNC A;  2YE2 A;  4FCQ A;  4E01 A;  3ZXO A;  4QPK A;  1YC3 A;  2WEQ A;  4CWP A;  1L0O A;  3INX A;  3WHA A;  1TIL A;  4CWS A;  1BYQ A;  2FXS A;  4BXI A;  1AH8 A;  1TC0 A;  3A0Z A;  3LMM A;  3RLP A;  1TH8 A;  4WUB A;  4KFG A;  3O0I A;  4XKA A;  4EMV A;  4XIQ A;  3LNU A;  3CGZ A;  1AH6 A;  3TUH A;  2WI2 A;  2XCM A;  2WI1 A;  2YEJ A;  1GKZ A;  3OPD A;  1B3Q A;  1AMW A;  5D7C A;  3B25 A;  4QPJ A;  1QY8 A;  3T0Z A;  2C2A A;  3ZM7 A;  4MP2 A;  2EXL A;  4YKR A;  2YEE A;  3T2S A;  1YS3 A;  5FWK A;  3PEH A;  2O1W A;  4P8O A;  1OSF A;  2YK2 A;  2XX2 A;  3K60 A;  3GIF A;  4ASG A;  5F3K A;  4PL9 A;  2CCS A;  5IDJ A;  3MNR P;  5F5R A;  5D6Q A;  5CTW A;  3CWV A;  2IOP A;  3EHG A;  3OWD A;  4HY6 A;  2YE4 A;  4HZ0 A;  4EGH A;  1IXM A;  3DGE A;  3ZKB A;  4L94 A;  2H8M A;  2IWX A;  3HYY A;  4I3H A;  4LWE A;  3H80 A;  3T10 A;  1YSR A;  2HCH A;  4URL A;  2XX4 A;  3G75 A;  5M4M A;  3TTZ A;  2YEC A;  4CWT A;  4PU9 A;  3B27 A;  3TZ0 A;  4XDM A;  2GFD A;  4LP0 A;  3HHU A;  4CE1 A;  2YEB A;  1YC1 A;  2XHX A;  1UY9 A;  3JZ3 A;  4B6C A;  4LPB A;  5JEN A;  2YKE A;  4E02 A;  1UYF A;  5BOC A;  4MP7 A;  5CTY A;  3HZ1 A;  1U0Z A;  1ZXM A;  3Q5L A;  5IN9 A;  3O2F A;  4EFU A;  1GKX A;  1YC4 A;  4AS9 A;  5C93 A;  1NHJ A;  2CCT A;  1H7U A;  4LWH A;  2YEI A;  1YES A;  5FNF A;  2YEG A;  4ZVI A;  1YT0 A;  2YK9 A;  4I5S A;  1I5B A;  4JAS A;  1BXD A;  4XTJ A;  2BU7 A;  4FMT A;  4CWQ A;  1UYD A;  3K98 A;  3TZ5 A;  2FWY A;  4KQV A;  1UYG A;  1S16 A;  2PNR A;  4BQG A;  2XHT A;  2IWU A;  1EA6 A;  3TZ2 A;  1Z59 A;  1Y4S A;  3VHC A;  1UYC A;  3VAD A;  2BTZ A;  3EHJ A;  3ZXQ A;  2YKI A;  4XKK A;  1GJV A;  1US7 A;  2XD6 A;  1S14 A;  3KE6 A;  2Q8H A;  4L8Z A;  2WEP A;  1UY6 A;  4GT8 A;  5CTU A;  4GEE A;  4AWO A;  2GQP A;  2WI3 A;  3K99 A;  3GIG A;  2YE3 A;  3FT5 A;  4KSG A;  1AJ6 A;  1MX0 A;  4MOT A;  3U2K A;  1THN A;  1UYL A;  3VHA A;  3C11 A;  4X9L A;  4WUC A;  3SL2 A;  3OMU A;  1UY7 A;  2YI7 A;  3CGY A;  4LWF A;  3R4O A;  4R3M A;  2YE9 A;  2HKJ A;  1KIJ A;  2K5B A;  4BAE A;  2BRE A;  1YET A;  1Z5B A;  2HG1 A;  2ZDX A;  1F51 A;  5D7D A;  3D36 A;  2C1G A;  2Q8G A;  1YER A;  4XKO A;  4XIP A;  3RKZ A;  3C0E A;  2XDL A;  2YE7 A;  2YGF A;  2YJW A;  3QTF A;  2E0A A;  2JKI A;  1UYI A;  4MBC A;  3FV5 A;  4O04 A;  2VW5 A;  3R4M A;  3S5T A;  4JAV A;  4K4O A;  4XCJ A;  4MPE A;  1Z5C A;  3BM9 A;  3CRL A;  3Q5J A;  2H55 A;  5J71 A;  4KSH A;  4XCL A;  5M4N A;  3G7E A;  1UYK A;  4H7Q A;  3B26 A;  2YE6 A;  4H85 A;  2Q8F A;  4YKY A;  4O0B A;  5IDM A;  2YI6 A;  4BQJ A;  2BU8 A;  2BT0 A;  4ASB A;  4XE2 A;  4JAU A;  2XAB A;  3U2D A;  1I5A A;  3CRK A;  2ZKJ A;  4XC0 A;  3EKO A;  3HZ5 A;  4LWG A;  2BYI A;  3VHD A;  4CE2 A;  2UWD A;  1YT2 A;  2VWC A;  4DUH A;  5GGZ A;  1YSZ A;  4KP4 A;  2BU2 A;  4GFN A;  2JJC A;  4GQT A;  3R92 A;  3A0W A;  2YE8 A;  2CH4 A;  4PRX A;  5CPH A;  1Y8P A;  3T1K A;  1NHI A;  5M4K A;  2CG9 A;  4E72 A;  2O1V A;  4MB9 A;  4HY1 A;  4P7A A;  2AKP A;  4LWI A;  5CTX A;  1H7S A;  2XDK A;  3HYZ A;  4EEH A;  2YI0 A;  4YKX A;  3O6O A;  4HYM A;  4O07 A;  2YI5 A;  4EGI A;  5M4E A;  4DZY A;  1Y4U A;  1I59 A;  1UY8 A;  2Q2E B;  3K97 A;  1BKN A;  2BSM A;  4O05 A;  1PVG A;  5D7R A;  4EGK A;  3LPS A;  1NHH A;  4L93 A;  3Q5K A;  2XJG A;  2HHI A;  4FPP A;  4NH7 A;  3BMY A;  1I58 A;  4PRV A;  1ZW9 A;  2XDS A;  1A4H A;  2ZDY A;  1TID A;  3FT8 A;  3ZKD A;  2YEH A;  4XIT A;  4BIZ A;  3R4P A;  3RLQ A;  1U2O A;  4ASA A;  1YT1 A;  2IOR A;  4V25 A;  1TC6 A;  1I5C A;  2QG0 A;  2YKC A;  3R91 A;  3WQ9 A;  4W7T A;  4U7O A;  2FTK A;  2YEA A;  1MU5 A;  3HEK A;  4CWR A;  4B7P A;  2ZBK B;  2CCU A;  4Q20 A;  3EKR A;  4CWN A;  4GGL A;  4AWQ A;  3A0T A;  3T0H A;  3OWB A;  1BGQ A;  2QFO A;  2Q8I A;  2BYH A;  5L3J A;  2FWZ A;  3CYG A;  1R62 A;  3D2R A;  2YED A;  3PEJ A;  4FCP A;  3B24 A;  4YKU A;  1KZN A;  2WI7 A;  2QG2 A;  2WI5 A;  3H4L A;  4MPN A;  4U93 A;  3B28 A;  2QF6 A;  4FCR A;  4ASF A;  4NH8 A;  1B63 A;  5CF0 A;  2YGE A;  2VCI A;  1Y8O A;  4E00 A;  3OW6 A;  4HXW A;  3R4N A;  4L91 A;  3RLR A;  4R1F A;  4HZ5 A;  5FND A;  4EFT A;  1UYH A;  4URO A;  5J6A A;  4HYP A;  1B62 A;  4URM A;  2YE5 A;  1QZR A;  1EI1 A;  3TZ4 A;  2BRC A;  3G7B A;  2XDX A;  1JM6 A;  4GCZ A;  4EM7 A;  4V26 A;  4MPC A;  1Z5A A;  2IWS A;  4XD8 A;  2FYP A;  2C1I A;  2WI4 A;  1AM1 A;  1ZWH A;  2BZ5 A;  4YKZ A;  2XK2 A;  1UYE A;  2XJX A;  3U67 A;  3NMQ A;  4HXZ A;  4XIR A;  2YKB A;  3QDD A;  4BIU A;  5M4P A;  2CGF A;  3GIE A;  2YKJ A;  4NH9 A;  2ESA A;  2YGA A;  4URN A;  4CE3 A;  4AWP A;  1UYM A;  4R3A A;  2XDU A;  3EHH A;  2YEF A;  2XHR A;  4L90 A;  2YJX A;  2WER A;  5D6P A;  2XJJ A;  1Y8N A;  1TBW A;  3GIG B;  4CWO A;  2IOQ A;  4H81 A;  1I5D A;  2O1U A;  4YKW A;  1QYE A;  2XX5 A;  3IED A;  3INW A;  5BOD A;  1ZXN A;  2WI6 A;  4YKQ A;  3A0X A;  4JQL A;  4KTN A;  2BU5 A;  4U7N A;  2BU6 A;  4WUD A;  3D0B A;  4O09 A;  3A0Y A;  2VCJ A;  5M4H A;  1ID0 A;  4ZKI A;  3A0R A;  3EHF A; 
#chains in the Genus database with same CATH homology
 4YKT A;  4CWF A;  5FNC A;  2YE2 A;  4FCQ A;  4E01 A;  3ZXO A;  4QPK A;  1YC3 A;  2WEQ A;  4CWP A;  1L0O A;  3INX A;  3WHA A;  1TIL A;  4CWS A;  1BYQ A;  2FXS A;  4BXI A;  1AH8 A;  1TC0 A;  3A0Z A;  3RLP A;  1TH8 A;  4WUB A;  4KFG A;  3O0I A;  4XKA A;  4EMV A;  4XIQ A;  3LNU A;  3CGZ A;  1AH6 A;  3TUH A;  2WI2 A;  2XCM A;  2WI1 A;  2YEJ A;  1GKZ A;  3OPD A;  1B3Q A;  1AMW A;  5D7C A;  3B25 A;  4QPJ A;  1QY8 A;  3T0Z A;  2C2A A;  3ZM7 A;  4MP2 A;  2EXL A;  4YKR A;  2YEE A;  3T2S A;  1YS3 A;  5FWK A;  3PEH A;  2O1W A;  4P8O A;  1OSF A;  2YK2 A;  2XX2 A;  3K60 A;  3GIF A;  4ASG A;  5F3K A;  4PL9 A;  2CCS A;  5IDJ A;  3MNR P;  5F5R A;  5D6Q A;  5CTW A;  3CWV A;  2IOP A;  3EHG A;  3OWD A;  4HY6 A;  2YE4 A;  4HZ0 A;  4EGH A;  3DGE A;  3ZKB A;  4L94 A;  2H8M A;  2IWX A;  3HYY A;  4I3H A;  4LWE A;  3H80 A;  3T10 A;  1YSR A;  2HCH A;  4URL A;  2XX4 A;  3G75 A;  5M4M A;  3TTZ A;  2YEC A;  4CWT A;  4PU9 A;  3B27 A;  3TZ0 A;  4XDM A;  2GFD A;  4LP0 A;  3HHU A;  4CE1 A;  2YEB A;  1YC1 A;  2XHX A;  1UY9 A;  3JZ3 A;  4B6C A;  4LPB A;  2YKE A;  4E02 A;  1UYF A;  5BOC A;  4MP7 A;  5CTY A;  3HZ1 A;  1U0Z A;  1ZXM A;  3Q5L A;  5IN9 A;  3O2F A;  4EFU A;  1GKX A;  1YC4 A;  4AS9 A;  5C93 A;  1NHJ A;  2CCT A;  1H7U A;  4LWH A;  2YEI A;  1YES A;  5FNF A;  2YEG A;  4ZVI A;  1YT0 A;  2YK9 A;  4I5S A;  1I5B A;  4JAS A;  1BXD A;  4XTJ A;  2BU7 A;  4FMT A;  4CWQ A;  1UYD A;  3K98 A;  3TZ5 A;  2FWY A;  4KQV A;  1UYG A;  1S16 A;  2PNR A;  4BQG A;  2XHT A;  2IWU A;  1EA6 A;  3TZ2 A;  1Z59 A;  1Y4S A;  3VHC A;  1UYC A;  3VAD A;  2BTZ A;  3EHJ A;  3ZXQ A;  2YKI A;  4XKK A;  1GJV A;  1US7 A;  2XD6 A;  1S14 A;  3KE6 A;  2Q8H A;  4L8Z A;  2WEP A;  1UY6 A;  4GT8 A;  5CTU A;  4GEE A;  4AWO A;  2GQP A;  2WI3 A;  3K99 A;  3GIG A;  2YE3 A;  3FT5 A;  4KSG A;  1AJ6 A;  1MX0 A;  4MOT A;  3U2K A;  1THN A;  1UYL A;  3VHA A;  3C11 A;  4X9L A;  4WUC A;  3SL2 A;  3OMU A;  1UY7 A;  4LWF A;  2YI7 A;  3CGY A;  3R4O A;  4R3M A;  2YE9 A;  2HKJ A;  1KIJ A;  2K5B A;  4BAE A;  2BRE A;  1YET A;  1Z5B A;  2HG1 A;  2ZDX A;  5D7D A;  3D36 A;  2Q8G A;  1YER A;  4XKO A;  4XIP A;  3RKZ A;  3C0E A;  2XDL A;  2YE7 A;  2YGF A;  2YJW A;  3QTF A;  2E0A A;  2JKI A;  1UYI A;  4MBC A;  3FV5 A;  4O04 A;  2VW5 A;  3R4M A;  4JAV A;  4K4O A;  4XCJ A;  4MPE A;  1Z5C A;  3BM9 A;  3CRL A;  3Q5J A;  2H55 A;  5J71 A;  4KSH A;  4XCL A;  5M4N A;  3G7E A;  1UYK A;  4H7Q A;  3B26 A;  2YE6 A;  4H85 A;  2Q8F A;  4YKY A;  4O0B A;  5IDM A;  2YI6 A;  4BQJ A;  2BU8 A;  2BT0 A;  4ASB A;  4XE2 A;  4JAU A;  2XAB A;  3U2D A;  1I5A A;  3CRK A;  2ZKJ A;  4XC0 A;  3EKO A;  3HZ5 A;  4LWG A;  2BYI A;  3VHD A;  4CE2 A;  2UWD A;  1YT2 A;  2VWC A;  4DUH A;  5GGZ A;  1YSZ A;  4KP4 A;  2BU2 A;  4GFN A;  2JJC A;  4GQT A;  3R92 A;  3A0W A;  2YE8 A;  2CH4 A;  4PRX A;  5CPH A;  1Y8P A;  3T1K A;  1NHI A;  5M4K A;  2CG9 A;  2O1V A;  4MB9 A;  4HY1 A;  4P7A A;  2AKP A;  4LWI A;  5CTX A;  1H7S A;  2XDK A;  3HYZ A;  4EEH A;  2YI0 A;  4YKX A;  3O6O A;  4HYM A;  4O07 A;  2YI5 A;  4EGI A;  5M4E A;  4DZY A;  1Y4U A;  1I59 A;  1UY8 A;  2Q2E B;  3K97 A;  1BKN A;  2BSM A;  4O05 A;  1PVG A;  5D7R A;  4EGK A;  3LPS A;  1NHH A;  4L93 A;  3Q5K A;  2XJG A;  4FPP A;  4NH7 A;  3BMY A;  1I58 A;  4PRV A;  1ZW9 A;  2XDS A;  1A4H A;  2ZDY A;  1TID A;  3FT8 A;  3ZKD A;  2YEH A;  4XIT A;  4BIZ A;  3R4P A;  3RLQ A;  1U2O A;  4ASA A;  1YT1 A;  2IOR A;  4V25 A;  1TC6 A;  1I5C A;  2QG0 A;  2YKC A;  3R91 A;  3WQ9 A;  4W7T A;  4U7O A;  2YEA A;  1MU5 A;  3HEK A;  4CWR A;  4B7P A;  2ZBK B;  2CCU A;  4Q20 A;  3EKR A;  4CWN A;  4GGL A;  4AWQ A;  3A0T A;  3T0H A;  3OWB A;  1BGQ A;  2QFO A;  2Q8I A;  2BYH A;  5L3J A;  2FWZ A;  1R62 A;  3D2R A;  2YED A;  3PEJ A;  4FCP A;  3B24 A;  4YKU A;  1KZN A;  2WI7 A;  2QG2 A;  2WI5 A;  3H4L A;  4MPN A;  4U93 A;  3B28 A;  2QF6 A;  4FCR A;  4ASF A;  4NH8 A;  1B63 A;  5CF0 A;  2YGE A;  2VCI A;  1Y8O A;  4E00 A;  3OW6 A;  4HXW A;  3R4N A;  4L91 A;  3RLR A;  4R1F A;  4HZ5 A;  5FND A;  4EFT A;  1UYH A;  4URO A;  5J6A A;  4HYP A;  1B62 A;  4URM A;  2YE5 A;  1QZR A;  1EI1 A;  3TZ4 A;  2BRC A;  3G7B A;  2XDX A;  1JM6 A;  4GCZ A;  4EM7 A;  4V26 A;  4MPC A;  1Z5A A;  2IWS A;  4XD8 A;  2FYP A;  2WI4 A;  1AM1 A;  1ZWH A;  2BZ5 A;  4YKZ A;  2XK2 A;  1UYE A;  2XJX A;  3U67 A;  3NMQ A;  4HXZ A;  4XIR A;  2YKB A;  3QDD A;  4BIU A;  5M4P A;  2CGF A;  3GIE A;  2YKJ A;  4NH9 A;  2ESA A;  2YGA A;  4URN A;  4CE3 A;  4AWP A;  1UYM A;  4R3A A;  2XDU A;  3EHH A;  2YEF A;  2XHR A;  4L90 A;  2YJX A;  2WER A;  5D6P A;  2XJJ A;  1Y8N A;  1TBW A;  3GIG B;  4CWO A;  2IOQ A;  4H81 A;  1I5D A;  2O1U A;  4YKW A;  1QYE A;  2XX5 A;  3IED A;  3INW A;  5BOD A;  1ZXN A;  2WI6 A;  4YKQ A;  3A0X A;  4JQL A;  4KTN A;  2BU5 A;  4U7N A;  2BU6 A;  4WUD A;  3D0B A;  4O09 A;  3A0Y A;  2VCJ A;  5M4H A;  1ID0 A;  4ZKI A;  3A0R A;  3EHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...