4KSHA

Dna gyrase atp binding domain of enterococcus faecalis in complex with a small molecule inhibitor (7-({4-[(3r)-3-aminopyrrolidin-1-yl]-5-chloro-6-ethyl-7h-pyrrolo[2,3-d]pyrimidin-2-yl}sulfanyl)-1,5-naphthyridin-1(4h)-ol)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
193
Chain Sequence
GLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLHGVGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAVVDDLKVIEETDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new class of type iia topoisomerase inhibitors with broad-spectrum antibacterial activity
rcsb
source organism Enterococcus faecalis
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 59
structure length 193
sequence length 210
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4kshA00
3R4NA 2XHRA 5FNFA 3RLQA 4L90A 4CE3A 3TZ2A 3H4LA 1TH8A 3TZ0A 2YECA 2ZKJA 4CWNA 4LWFA 2IORA 4YKWA 4LWHA 4CWPA 1ZWHA 4HXZA 4QPKA 4BQJA 3EHJA 4MPNA 4ZKIA 2XHXA 1GJVA 2YE4A 1ZXMA 1ZXNA 4AWOA 4XIQA 5D7DA 3TTZA 1U2OA 4XC0A 4EEHA 1AJ6A 2XJJA 3T0HA 2VW5A 4FCRA 3TZ5A 1GKXA 4AWPA 1ZW9A 1ID0A 1YT0A 5M4NA 2YJXA 3B25A 3LPSA 4EFTA 4XCLA 2BZ5A 3FV5A 5J71A 2WI6A 4XE2A 5M4HA 3T2SA 2O1UA 5GGZA 2PNRA 3G7EA 2WI1A 2XX5A 3U67A 2YE7A 1YC4A 2YI7A 4WUBA 2QG0A 1R62A 4CWSA 4E02A 3VADA 1A4HA 3T10A 2BYHA 2YEIA 4KQVA 2JJCA 3B28A 4AS9A 1UY8A 2HCHA 5M4MA 4MOTA 2VCJA 2WI5A 1YESA 4HXWA 3H80A 3R4MA 3SL2A 2YEBA 4L91A 3Q5LA 5L3JA 4HYPA 5D7CA 3TUHA 2IWUA 2WEPA 5D6PA 3ZXOA 1I58A 1THNA 3U2KA 4AWQA 1S14A 2O1WA 4PL9A 1YSZA 5C93A 2YI6A 1UY9A 3RKZA 1MU5A 3EHFA 2WI4A 3CGYA 2YI5A 3FT5A 3WHAA 1KIJA 1UYFA 2YEEA 4LWEA 1YC1A 4H81A 4EMVA 1I5DA 4X9LA 4B6CA 2XJGA 4WUCA 4I3HA 3OW6A 4CE2A 2IOPA 4PRVA 2Q8GA 4LWGA 1MX0A 2YEFA 4XDMA 3HZ1A 3A0RA 2H8MA 1YSRA 2CCSA 5FWKA 4URLA 5FNDA 3ZKBA 3VHDA 3VHCA 1BGQA 2XX2A 4I5SA 3R92A 5CTXA 2ZDYA 2EXLA 3D36A 1U0ZA 4U93A 4LP0A 4XKKA 4O05A 2QFOA 5D7RA 4EFUA 2YKIA 1NHHA 4U7NA 1AM1A 3Q5KA 3B26A 4O07A 4EGIA 3R4PA 2YE2A 3CRKA 4BIUA 4NH9A 4EM7A 3ZXQA 5F3KA 4CE1A 1UYIA 4YKXA 3D2RA 1AH8A 4CWQA 1QZRA 3PEJA 1UYEA 2BU6A 2JKIA 2YEJA 4NH8A 4MBCA 1BXDA 4P7AA 2AKPA 4LWIA 2CGFA 3C0EA 2XD6A 4JASA 4BAEA 3Q5JA 4MPCA 4O0BA 4R3MA 5CTUA 4LPBA 1UYLA 1Y8PA 3KE6A 2BU5A 2Q8IA 2BYIA 2XX4A 4O09A 3R91A 3NMQA 4L8ZA 3WQ9A 3HYZA 4DUHA 3OWBA 1Y4UA 5F5RA 4BQGA 5BOCA 3HYYA 1YT2A 2FWZA 1Z5AA 1I5CA 2UWDA 2XABA 1EA6A 4R3AA 1L0OA 3OWDA 2YKJA 3PEHA 4YKQA 2YE5A 1QY8A 2YE9A 4URMA 2XDLA 4JAUA 2BU7A 2BU8A 3O0IA 2WI7A 2FYPA 1NHJA 1Y8NA 3INXA 1YT1A 3B24A 5M4KA 4HY6A 1AH6A 1UYCA 1TC0A 5FNCA 1US7A 2XCMA 3EHGA 2WI2A 4JQLA 4HY1A 1I5BA 4BXIA 4DZYA 4GEEA 1YS3A 2VWCA 2Q2EB 1KZNA 1I59A 1H7SA 2XDKA 2BSMA 1S16A 3A0WA 4YKRA 1B63A 4XKOA 4ASGA 4MP7A 2YKBA 1GKZA 2C2AA 4H7QA 2FWYA 2FXSA 3VHAA 4PU9A 2Q8FA 3BM9A 5IN9A 2HKJA 2YEHA 4GCZA 3EKOA 3EKRA 4ASFA 5BODA 2YEGA 4ZVIA 2O1VA 2CH4A 4V26A 2QF6A 1TILA 1UYDA 2BT0A 2YE8A 5CTWA 2XJXA 2CCUA 4XKAA 4URNA 3A0YA 1BYQA 4P8OA 1UYGA 4KSGA 2XDUA 3A0XA 2CCTA 3ZM7A 2YEAA 4JAVA 3A0TA 2K5BA 1UYMA 4R1FA 2YGFA 3O2FA 4WUDA 5IDMA 4ASBA 1TIDA 4CWFA 1YERA 1TC6A 3K98A 4L94A 3B27A 2YK9A 4YKYA 2XHTA 3D0BA 4GT8A 2XDSA 4YKZA 5CPHA 5CTYA 1NHIA 2GQPA 4FCQA 3OMUA 1QYEA 3GIGA 4XIRA 4EGKA 3QDDA 2ZDXA 3HEKA 2YKEA 2BTZA 3BMYA 1B3QA 3K60A 4CWTA 4HZ5A 4B7PA 4BIZA 3G75A 4FPPA 2YE3A 3DGEA 4XD8A 1AMWA 5J6AA 2Q8HA 4L93A 2YEDA 2XK2A 4MB9A 2IWXA 3U2DA 2QG2A 3QTFA 2YGAA 4ASAA 2VCIA 2YE6A 1UY7A 1UYHA 4GGLA 3ZKDA 1EI1A 4KTNA 4NH7A 4H85A 4XIPA 1YC3A 2YK2A 3T0ZA 1TBWA 3GIEA 3O6OA 4V25A 3HHUA 4HZ0A 3FT8A 5D6QA 3CGZA 1Z5CA 4UROA 4YKUA 1UY6A 5CF0A 2GFDA 4CWRA 4U7OA 1Z59A 3K99A 2XDXA 2E0AA 2ESAA 3A0ZA 4GFNA 2CG9A 1Y8OA 5IDJA 3G7BA 2WERA 3RLPA 2H55A 2ZBKB 3K97A 3CRLA 2BU2A 1B62A 1OSFA 3T1KA 5M4EA 1I5AA 4XTJA 4KSHA 2WI3A 3R4OA 2IWSA 4EGHA 3HZ5A 4E00A 2YKCA 3TZ4A 4FMTA 5M4PA 4MP2A 4XCJA 4MPEA 4KFGA 1H7UA 1Y4SA 1YETA 2YI0A 4HYMA 2WEQA 3OPDA 3CWVA 3MNRP 1BKNA 3IEDA 3RLRA 2HG1A 4KP4A 4Q20A 2BRCA 4CWOA 1PVGA 2BREA 1Z5BA 2YGEA 2YJWA 4W7TA 4FCPA 4XITA 1JM6A 3C11A 3EHHA 4GQTA 4QPJA 4YKTA 4E01A 3INWA 1UYKA 3JZ3A 2IOQA 4O04A 4K4OA 3GIGB 4PRXA 3GIFA 3LNUA
chains in the Genus database with same CATH superfamily
3R4NA 2XHRA 5FNFA 3RLQA 4L90A 4CE3A 3TZ2A 3H4LA 1TH8A 3TZ0A 2YECA 2ZKJA 4CWNA 4LWFA 2IORA 4YKWA 4LWHA 4CWPA 1ZWHA 4HXZA 4QPKA 4BQJA 3EHJA 4MPNA 4ZKIA 2XHXA 1GJVA 2YE4A 1ZXMA 1ZXNA 4AWOA 4XIQA 5D7DA 3TTZA 1U2OA 4XC0A 4EEHA 1AJ6A 2XJJA 3T0HA 2VW5A 4FCRA 3TZ5A 1GKXA 4AWPA 1ZW9A 1ID0A 1YT0A 5M4NA 2YJXA 3B25A 3LPSA 4EFTA 4XCLA 2BZ5A 3FV5A 5J71A 2WI6A 4XE2A 5M4HA 3T2SA 2O1UA 5GGZA 2PNRA 3G7EA 2WI1A 2XX5A 3U67A 2YE7A 1YC4A 2YI7A 4WUBA 2QG0A 1R62A 4CWSA 4E02A 3VADA 1A4HA 3T10A 2BYHA 2YEIA 3CYGA 2JJCA 3B28A 4KQVA 4AS9A 1UY8A 2HCHA 5M4MA 4MOTA 2VCJA 2WI5A 1YESA 4HXWA 2C1GA 3H80A 3R4MA 3SL2A 2YEBA 4L91A 3Q5LA 5L3JA 4HYPA 5D7CA 3TUHA 2IWUA 2WEPA 5D6PA 3ZXOA 1I58A 1THNA 3U2KA 4AWQA 1S14A 2O1WA 4PL9A 1YSZA 5C93A 2YI6A 1UY9A 3RKZA 1MU5A 3EHFA 2WI4A 3CGYA 2YI5A 3FT5A 3WHAA 1KIJA 1UYFA 2YEEA 4LWEA 1YC1A 3S5TA 4H81A 4EMVA 1I5DA 4X9LA 4B6CA 2XJGA 4WUCA 4I3HA 3OW6A 4CE2A 2IOPA 4PRVA 2Q8GA 4LWGA 1MX0A 2YEFA 4XDMA 3HZ1A 3A0RA 2H8MA 1YSRA 2CCSA 5FWKA 4URLA 1F51A 5FNDA 3ZKBA 3VHDA 3VHCA 1BGQA 2XX2A 4I5SA 3R92A 5CTXA 2ZDYA 2EXLA 3D36A 1U0ZA 4U93A 4LP0A 4XKKA 4O05A 2QFOA 5D7RA 4EFUA 2YKIA 1NHHA 4U7NA 1AM1A 3Q5KA 3B26A 4O07A 4EGIA 3R4PA 2YE2A 3CRKA 4BIUA 4NH9A 4EM7A 3ZXQA 5F3KA 4CE1A 1UYIA 4YKXA 3D2RA 1AH8A 4CWQA 1QZRA 3PEJA 1UYEA 2BU6A 2JKIA 2YEJA 4NH8A 4MBCA 1BXDA 4P7AA 2AKPA 4LWIA 2CGFA 3C0EA 2XD6A 4JASA 4BAEA 3Q5JA 4MPCA 4O0BA 4R3MA 5CTUA 4LPBA 1UYLA 1Y8PA 3KE6A 2BU5A 2Q8IA 2BYIA 2XX4A 4O09A 3R91A 3NMQA 4L8ZA 3WQ9A 3HYZA 4DUHA 3OWBA 1Y4UA 5F5RA 4BQGA 5BOCA 3HYYA 1YT2A 2FWZA 1Z5AA 1I5CA 2UWDA 2XABA 1EA6A 4R3AA 1L0OA 3OWDA 2YKJA 3PEHA 4YKQA 2YE5A 1QY8A 2YE9A 4URMA 2XDLA 4JAUA 2BU7A 2BU8A 3O0IA 2WI7A 2FYPA 1NHJA 1Y8NA 3INXA 1YT1A 3B24A 5M4KA 4HY6A 1AH6A 1UYCA 1TC0A 5FNCA 1US7A 2XCMA 3EHGA 2WI2A 4JQLA 4HY1A 1I5BA 4BXIA 4DZYA 4GEEA 1YS3A 2VWCA 2Q2EB 1KZNA 1I59A 1H7SA 2XDKA 2BSMA 1S16A 3A0WA 4YKRA 1B63A 4XKOA 4ASGA 4MP7A 2YKBA 1GKZA 2FTKA 2C2AA 4H7QA 2FWYA 2FXSA 3VHAA 4PU9A 2Q8FA 3BM9A 5IN9A 2HKJA 2YEHA 4GCZA 3EKOA 3EKRA 4ASFA 5BODA 2YEGA 4ZVIA 2O1VA 2CH4A 4V26A 2QF6A 1TILA 1UYDA 2BT0A 2YE8A 5CTWA 2XJXA 2CCUA 4XKAA 4URNA 3A0YA 1BYQA 4P8OA 1UYGA 4KSGA 2XDUA 3A0XA 2CCTA 3ZM7A 2YEAA 4JAVA 3A0TA 2K5BA 1UYMA 4R1FA 2YGFA 3O2FA 4WUDA 5IDMA 4ASBA 1TIDA 4CWFA 1YERA 1TC6A 3K98A 4L94A 3B27A 2YK9A 4YKYA 2XHTA 3D0BA 4GT8A 2XDSA 4YKZA 5CPHA 5CTYA 1NHIA 2GQPA 4FCQA 3OMUA 1QYEA 3GIGA 4XIRA 4EGKA 3QDDA 2ZDXA 3HEKA 2YKEA 2BTZA 3BMYA 1B3QA 3K60A 4CWTA 4HZ5A 4B7PA 4BIZA 3G75A 4FPPA 2YE3A 3DGEA 4XD8A 1AMWA 5J6AA 2Q8HA 4L93A 2YEDA 2XK2A 4MB9A 2IWXA 3U2DA 2QG2A 3QTFA 2YGAA 4ASAA 2VCIA 2YE6A 1UY7A 1UYHA 4GGLA 3ZKDA 1EI1A 4KTNA 4NH7A 4H85A 4XIPA 1YC3A 2YK2A 3T0ZA 1TBWA 3GIEA 2HHIA 3O6OA 4V25A 3HHUA 3LMMA 4HZ0A 3FT8A 1IXMA 5D6QA 3CGZA 1Z5CA 4UROA 4YKUA 4E72A 1UY6A 5CF0A 2GFDA 4CWRA 4U7OA 1Z59A 3K99A 2XDXA 2C1IA 2E0AA 2ESAA 3A0ZA 4GFNA 2CG9A 1Y8OA 5IDJA 3G7BA 2WERA 3RLPA 2H55A 2ZBKB 3K97A 3CRLA 2BU2A 1B62A 1OSFA 3T1KA 5M4EA 1I5AA 4XTJA 4KSHA 2WI3A 3R4OA 2IWSA 4EGHA 3HZ5A 4E00A 2YKCA 3TZ4A 4FMTA 5M4PA 4MP2A 4XCJA 4MPEA 4KFGA 1H7UA 1Y4SA 1YETA 2YI0A 4HYMA 2WEQA 3OPDA 3CWVA 5JENA 3MNRP 1BKNA 3IEDA 3RLRA 2HG1A 4KP4A 4Q20A 2BRCA 4CWOA 1PVGA 2BREA 1Z5BA 2YGEA 2YJWA 4W7TA 4FCPA 4XITA 1JM6A 3C11A 3EHHA 4GQTA 4QPJA 4YKTA 4E01A 3INWA 1UYKA 3JZ3A 2IOQA 4O04A 4K4OA 3GIGB 4PRXA 3GIFA 3LNUA
chains in the Genus database with same CATH topology
3R4NA 2XHRA 5FNFA 3RLQA 4L90A 4CE3A 3TZ2A 3H4LA 1TH8A 3TZ0A 2YECA 2ZKJA 4CWNA 4LWFA 2IORA 4YKWA 4LWHA 4CWPA 1ZWHA 4HXZA 4QPKA 4BQJA 3EHJA 4MPNA 4ZKIA 2XHXA 1GJVA 2YE4A 1ZXMA 1ZXNA 4AWOA 4XIQA 5D7DA 3TTZA 1U2OA 4XC0A 4EEHA 1AJ6A 2XJJA 3T0HA 2VW5A 4FCRA 3TZ5A 1GKXA 4AWPA 1ZW9A 1ID0A 1YT0A 5M4NA 2YJXA 3B25A 3LPSA 4EFTA 4XCLA 2BZ5A 3FV5A 5J71A 2WI6A 4XE2A 5M4HA 3T2SA 2O1UA 5GGZA 2PNRA 3G7EA 2WI1A 2XX5A 3U67A 2YE7A 1YC4A 2YI7A 4WUBA 2QG0A 1R62A 4CWSA 4E02A 3VADA 1A4HA 3T10A 2BYHA 2YEIA 4KQVA 2JJCA 3B28A 4AS9A 1UY8A 2HCHA 5M4MA 4MOTA 2VCJA 2WI5A 1YESA 4HXWA 3H80A 3R4MA 3SL2A 2YEBA 4L91A 3Q5LA 5L3JA 4HYPA 5D7CA 3TUHA 2IWUA 2WEPA 5D6PA 3ZXOA 1I58A 1THNA 3U2KA 4AWQA 1S14A 2O1WA 4PL9A 1YSZA 5C93A 2YI6A 1UY9A 3RKZA 1MU5A 3EHFA 2WI4A 3CGYA 2YI5A 3FT5A 3WHAA 1KIJA 1UYFA 2YEEA 4LWEA 1YC1A 4H81A 4EMVA 1I5DA 4X9LA 4B6CA 2XJGA 4WUCA 4I3HA 3OW6A 4CE2A 2IOPA 4PRVA 2Q8GA 4LWGA 1MX0A 2YEFA 4XDMA 3HZ1A 3A0RA 2H8MA 1YSRA 2CCSA 5FWKA 4URLA 5FNDA 3ZKBA 3VHDA 3VHCA 1BGQA 2XX2A 4I5SA 3R92A 5CTXA 2ZDYA 2EXLA 3D36A 1U0ZA 4U93A 4LP0A 4XKKA 4O05A 2QFOA 5D7RA 4EFUA 2YKIA 1NHHA 4U7NA 1AM1A 3Q5KA 3B26A 4O07A 4EGIA 3R4PA 2YE2A 3CRKA 4BIUA 4NH9A 4EM7A 3ZXQA 5F3KA 4CE1A 1UYIA 4YKXA 3D2RA 1AH8A 4CWQA 1QZRA 3PEJA 1UYEA 2BU6A 2JKIA 2YEJA 4NH8A 4MBCA 1BXDA 4P7AA 2AKPA 4LWIA 2CGFA 3C0EA 2XD6A 4JASA 4BAEA 3Q5JA 4MPCA 4O0BA 4R3MA 5CTUA 4LPBA 1UYLA 1Y8PA 3KE6A 2BU5A 2Q8IA 2BYIA 2XX4A 4O09A 3R91A 3NMQA 4L8ZA 3WQ9A 3HYZA 4DUHA 3OWBA 1Y4UA 5F5RA 4BQGA 5BOCA 3HYYA 1YT2A 2FWZA 1Z5AA 1I5CA 2UWDA 2XABA 1EA6A 4R3AA 1L0OA 3OWDA 2YKJA 3PEHA 4YKQA 2YE5A 1QY8A 2YE9A 4URMA 2XDLA 4JAUA 2BU7A 2BU8A 3O0IA 2WI7A 2FYPA 1NHJA 1Y8NA 3INXA 1YT1A 3B24A 5M4KA 4HY6A 1AH6A 1UYCA 1TC0A 5FNCA 1US7A 2XCMA 3EHGA 2WI2A 4JQLA 4HY1A 1I5BA 4BXIA 4DZYA 4GEEA 1YS3A 2VWCA 2Q2EB 1KZNA 1I59A 1H7SA 2XDKA 2BSMA 1S16A 3A0WA 4YKRA 1B63A 4XKOA 4ASGA 4MP7A 2YKBA 1GKZA 2C2AA 4H7QA 2FWYA 2FXSA 3VHAA 4PU9A 2Q8FA 3BM9A 5IN9A 2HKJA 2YEHA 4GCZA 3EKOA 3EKRA 4ASFA 5BODA 2YEGA 4ZVIA 2O1VA 2CH4A 4V26A 2QF6A 1TILA 1UYDA 2BT0A 2YE8A 5CTWA 2XJXA 2CCUA 4XKAA 4URNA 3A0YA 1BYQA 4P8OA 1UYGA 4KSGA 2XDUA 3A0XA 2CCTA 3ZM7A 2YEAA 4JAVA 3A0TA 2K5BA 1UYMA 4R1FA 2YGFA 3O2FA 4WUDA 5IDMA 4ASBA 1TIDA 4CWFA 1YERA 1TC6A 3K98A 4L94A 3B27A 2YK9A 4YKYA 2XHTA 3D0BA 4GT8A 2XDSA 4YKZA 5CPHA 5CTYA 1NHIA 2GQPA 4FCQA 3OMUA 1QYEA 3GIGA 4XIRA 4EGKA 3QDDA 2ZDXA 3HEKA 2YKEA 2BTZA 3BMYA 1B3QA 3K60A 4CWTA 4HZ5A 4B7PA 4BIZA 3G75A 4FPPA 2YE3A 3DGEA 4XD8A 1AMWA 5J6AA 2Q8HA 4L93A 2YEDA 2XK2A 4MB9A 2IWXA 3U2DA 2QG2A 3QTFA 2YGAA 4ASAA 2VCIA 2YE6A 1UY7A 1UYHA 4GGLA 3ZKDA 1EI1A 4KTNA 4NH7A 4H85A 4XIPA 1YC3A 2YK2A 3T0ZA 1TBWA 3GIEA 3O6OA 4V25A 3HHUA 4HZ0A 3FT8A 5D6QA 3CGZA 1Z5CA 4UROA 4YKUA 1UY6A 5CF0A 2GFDA 4CWRA 4U7OA 1Z59A 3K99A 2XDXA 2E0AA 2ESAA 3A0ZA 4GFNA 2CG9A 1Y8OA 5IDJA 3G7BA 2WERA 3RLPA 2H55A 2ZBKB 3K97A 3CRLA 2BU2A 1B62A 1OSFA 3T1KA 5M4EA 1I5AA 4XTJA 4KSHA 2WI3A 3R4OA 2IWSA 4EGHA 3HZ5A 4E00A 2YKCA 3TZ4A 4FMTA 5M4PA 4MP2A 4XCJA 4MPEA 4KFGA 1H7UA 1Y4SA 1YETA 2YI0A 4HYMA 2WEQA 3OPDA 3CWVA 3MNRP 1BKNA 3IEDA 3RLRA 2HG1A 4KP4A 4Q20A 2BRCA 4CWOA 1PVGA 2BREA 1Z5BA 2YGEA 2YJWA 4W7TA 4FCPA 4XITA 1JM6A 3C11A 3EHHA 4GQTA 4QPJA 4YKTA 4E01A 3INWA 1UYKA 3JZ3A 2IOQA 4O04A 4K4OA 3GIGB 4PRXA 3GIFA 3LNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R4N A;  2XHR A;  5FNF A;  3RLQ A;  4L90 A;  4CE3 A;  3TZ2 A;  3H4L A;  1TH8 A;  3TZ0 A;  2YEC A;  2ZKJ A;  4CWN A;  4LWF A;  2IOR A;  4YKW A;  4LWH A;  4CWP A;  1ZWH A;  4HXZ A;  4QPK A;  4BQJ A;  3EHJ A;  4MPN A;  4ZKI A;  2XHX A;  1GJV A;  2YE4 A;  1ZXM A;  1ZXN A;  4AWO A;  4XIQ A;  5D7D A;  3TTZ A;  1U2O A;  4XC0 A;  4EEH A;  1AJ6 A;  2XJJ A;  3T0H A;  2VW5 A;  4FCR A;  3TZ5 A;  1GKX A;  4AWP A;  1ZW9 A;  1ID0 A;  1YT0 A;  5M4N A;  2YJX A;  3B25 A;  3LPS A;  4EFT A;  4XCL A;  2BZ5 A;  3FV5 A;  5J71 A;  2WI6 A;  4XE2 A;  5M4H A;  3T2S A;  2O1U A;  5GGZ A;  2PNR A;  3G7E A;  2WI1 A;  2XX5 A;  3U67 A;  2YE7 A;  1YC4 A;  2YI7 A;  4WUB A;  2QG0 A;  1R62 A;  4CWS A;  4E02 A;  3VAD A;  1A4H A;  3T10 A;  2BYH A;  2YEI A;  4KQV A;  2JJC A;  3B28 A;  4AS9 A;  1UY8 A;  2HCH A;  5M4M A;  4MOT A;  2VCJ A;  2WI5 A;  1YES A;  4HXW A;  3H80 A;  3R4M A;  3SL2 A;  2YEB A;  4L91 A;  3Q5L A;  5L3J A;  4HYP A;  5D7C A;  3TUH A;  2IWU A;  2WEP A;  5D6P A;  3ZXO A;  1I58 A;  1THN A;  3U2K A;  4AWQ A;  1S14 A;  2O1W A;  4PL9 A;  1YSZ A;  5C93 A;  2YI6 A;  1UY9 A;  3RKZ A;  1MU5 A;  3EHF A;  2WI4 A;  3CGY A;  2YI5 A;  3FT5 A;  3WHA A;  1KIJ A;  1UYF A;  2YEE A;  4LWE A;  1YC1 A;  4H81 A;  4EMV A;  1I5D A;  4X9L A;  4B6C A;  2XJG A;  4WUC A;  4I3H A;  3OW6 A;  4CE2 A;  2IOP A;  4PRV A;  2Q8G A;  4LWG A;  1MX0 A;  2YEF A;  4XDM A;  3HZ1 A;  3A0R A;  2H8M A;  1YSR A;  2CCS A;  5FWK A;  4URL A;  5FND A;  3ZKB A;  3VHD A;  3VHC A;  1BGQ A;  2XX2 A;  4I5S A;  3R92 A;  5CTX A;  2ZDY A;  2EXL A;  3D36 A;  1U0Z A;  4U93 A;  4LP0 A;  4XKK A;  4O05 A;  2QFO A;  5D7R A;  4EFU A;  2YKI A;  1NHH A;  4U7N A;  1AM1 A;  3Q5K A;  3B26 A;  4O07 A;  4EGI A;  3R4P A;  2YE2 A;  3CRK A;  4BIU A;  4NH9 A;  4EM7 A;  3ZXQ A;  5F3K A;  4CE1 A;  1UYI A;  4YKX A;  3D2R A;  1AH8 A;  4CWQ A;  1QZR A;  3PEJ A;  1UYE A;  2BU6 A;  2JKI A;  2YEJ A;  4NH8 A;  4MBC A;  1BXD A;  4P7A A;  2AKP A;  4LWI A;  2CGF A;  3C0E A;  2XD6 A;  4JAS A;  4BAE A;  3Q5J A;  4MPC A;  4O0B A;  4R3M A;  5CTU A;  4LPB A;  1UYL A;  1Y8P A;  3KE6 A;  2BU5 A;  2Q8I A;  2BYI A;  2XX4 A;  4O09 A;  3R91 A;  3NMQ A;  4L8Z A;  3WQ9 A;  3HYZ A;  4DUH A;  3OWB A;  1Y4U A;  5F5R A;  4BQG A;  5BOC A;  3HYY A;  1YT2 A;  2FWZ A;  1Z5A A;  1I5C A;  2UWD A;  2XAB A;  1EA6 A;  4R3A A;  1L0O A;  3OWD A;  2YKJ A;  3PEH A;  4YKQ A;  2YE5 A;  1QY8 A;  2YE9 A;  4URM A;  2XDL A;  4JAU A;  2BU7 A;  2BU8 A;  3O0I A;  2WI7 A;  2FYP A;  1NHJ A;  1Y8N A;  3INX A;  1YT1 A;  3B24 A;  5M4K A;  4HY6 A;  1AH6 A;  1UYC A;  1TC0 A;  5FNC A;  1US7 A;  2XCM A;  3EHG A;  2WI2 A;  4JQL A;  4HY1 A;  1I5B A;  4BXI A;  4DZY A;  4GEE A;  1YS3 A;  2VWC A;  2Q2E B;  1KZN A;  1I59 A;  1H7S A;  2XDK A;  2BSM A;  1S16 A;  3A0W A;  4YKR A;  1B63 A;  4XKO A;  4ASG A;  4MP7 A;  2YKB A;  1GKZ A;  2C2A A;  4H7Q A;  2FWY A;  2FXS A;  3VHA A;  4PU9 A;  2Q8F A;  3BM9 A;  5IN9 A;  2HKJ A;  2YEH A;  4GCZ A;  3EKO A;  3EKR A;  4ASF A;  5BOD A;  2YEG A;  4ZVI A;  2O1V A;  2CH4 A;  4V26 A;  2QF6 A;  1TIL A;  1UYD A;  2BT0 A;  2YE8 A;  5CTW A;  2XJX A;  2CCU A;  4XKA A;  4URN A;  3A0Y A;  1BYQ A;  4P8O A;  1UYG A;  4KSG A;  2XDU A;  3A0X A;  2CCT A;  3ZM7 A;  2YEA A;  4JAV A;  3A0T A;  2K5B A;  1UYM A;  4R1F A;  2YGF A;  3O2F A;  4WUD A;  5IDM A;  4ASB A;  1TID A;  4CWF A;  1YER A;  1TC6 A;  3K98 A;  4L94 A;  3B27 A;  2YK9 A;  4YKY A;  2XHT A;  3D0B A;  4GT8 A;  2XDS A;  4YKZ A;  5CPH A;  5CTY A;  1NHI A;  2GQP A;  4FCQ A;  3OMU A;  1QYE A;  3GIG A;  4XIR A;  4EGK A;  3QDD A;  2ZDX A;  3HEK A;  2YKE A;  2BTZ A;  3BMY A;  1B3Q A;  3K60 A;  4CWT A;  4HZ5 A;  4B7P A;  4BIZ A;  3G75 A;  4FPP A;  2YE3 A;  3DGE A;  4XD8 A;  1AMW A;  5J6A A;  2Q8H A;  4L93 A;  2YED A;  2XK2 A;  4MB9 A;  2IWX A;  3U2D A;  2QG2 A;  3QTF A;  2YGA A;  4ASA A;  2VCI A;  2YE6 A;  1UY7 A;  1UYH A;  4GGL A;  3ZKD A;  1EI1 A;  4KTN A;  4NH7 A;  4H85 A;  4XIP A;  1YC3 A;  2YK2 A;  3T0Z A;  1TBW A;  3GIE A;  3O6O A;  4V25 A;  3HHU A;  4HZ0 A;  3FT8 A;  5D6Q A;  3CGZ A;  1Z5C A;  4URO A;  4YKU A;  1UY6 A;  5CF0 A;  2GFD A;  4CWR A;  4U7O A;  1Z59 A;  3K99 A;  2XDX A;  2E0A A;  2ESA A;  3A0Z A;  4GFN A;  2CG9 A;  1Y8O A;  5IDJ A;  3G7B A;  2WER A;  3RLP A;  2H55 A;  2ZBK B;  3K97 A;  3CRL A;  2BU2 A;  1B62 A;  1OSF A;  3T1K A;  5M4E A;  1I5A A;  4XTJ A;  4KSH A;  2WI3 A;  3R4O A;  2IWS A;  4EGH A;  3HZ5 A;  4E00 A;  2YKC A;  3TZ4 A;  4FMT A;  5M4P A;  4MP2 A;  4XCJ A;  4MPE A;  4KFG A;  1H7U A;  1Y4S A;  1YET A;  2YI0 A;  4HYM A;  2WEQ A;  3OPD A;  3CWV A;  3MNR P;  1BKN A;  3IED A;  3RLR A;  2HG1 A;  4KP4 A;  4Q20 A;  2BRC A;  4CWO A;  1PVG A;  2BRE A;  1Z5B A;  2YGE A;  2YJW A;  4W7T A;  4FCP A;  4XIT A;  1JM6 A;  3C11 A;  3EHH A;  4GQT A;  4QPJ A;  4YKT A;  4E01 A;  3INW A;  1UYK A;  3JZ3 A;  2IOQ A;  4O04 A;  4K4O A;  3GIG B;  4PRX A;  3GIF A;  3LNU A; 
#chains in the Genus database with same CATH topology
 3R4N A;  2XHR A;  5FNF A;  3RLQ A;  4L90 A;  4CE3 A;  3TZ2 A;  3H4L A;  1TH8 A;  3TZ0 A;  2YEC A;  2ZKJ A;  4CWN A;  4LWF A;  2IOR A;  4YKW A;  4LWH A;  4CWP A;  1ZWH A;  4HXZ A;  4QPK A;  4BQJ A;  3EHJ A;  4MPN A;  4ZKI A;  2XHX A;  1GJV A;  2YE4 A;  1ZXM A;  1ZXN A;  4AWO A;  4XIQ A;  5D7D A;  3TTZ A;  1U2O A;  4XC0 A;  4EEH A;  1AJ6 A;  2XJJ A;  3T0H A;  2VW5 A;  4FCR A;  3TZ5 A;  1GKX A;  4AWP A;  1ZW9 A;  1ID0 A;  1YT0 A;  5M4N A;  2YJX A;  3B25 A;  3LPS A;  4EFT A;  4XCL A;  2BZ5 A;  3FV5 A;  5J71 A;  2WI6 A;  4XE2 A;  5M4H A;  3T2S A;  2O1U A;  5GGZ A;  2PNR A;  3G7E A;  2WI1 A;  2XX5 A;  3U67 A;  2YE7 A;  1YC4 A;  2YI7 A;  4WUB A;  2QG0 A;  1R62 A;  4CWS A;  4E02 A;  3VAD A;  1A4H A;  3T10 A;  2BYH A;  2YEI A;  3CYG A;  2JJC A;  3B28 A;  4KQV A;  4AS9 A;  1UY8 A;  2HCH A;  5M4M A;  4MOT A;  2VCJ A;  2WI5 A;  1YES A;  4HXW A;  2C1G A;  3H80 A;  3R4M A;  3SL2 A;  2YEB A;  4L91 A;  3Q5L A;  5L3J A;  4HYP A;  5D7C A;  3TUH A;  2IWU A;  2WEP A;  5D6P A;  3ZXO A;  1I58 A;  1THN A;  3U2K A;  4AWQ A;  1S14 A;  2O1W A;  4PL9 A;  1YSZ A;  5C93 A;  2YI6 A;  1UY9 A;  3RKZ A;  1MU5 A;  3EHF A;  2WI4 A;  3CGY A;  2YI5 A;  3FT5 A;  3WHA A;  1KIJ A;  1UYF A;  2YEE A;  4LWE A;  1YC1 A;  3S5T A;  4H81 A;  4EMV A;  1I5D A;  4X9L A;  4B6C A;  2XJG A;  4WUC A;  4I3H A;  3OW6 A;  4CE2 A;  2IOP A;  4PRV A;  2Q8G A;  4LWG A;  1MX0 A;  2YEF A;  4XDM A;  3HZ1 A;  3A0R A;  2H8M A;  1YSR A;  2CCS A;  5FWK A;  4URL A;  1F51 A;  5FND A;  3ZKB A;  3VHD A;  3VHC A;  1BGQ A;  2XX2 A;  4I5S A;  3R92 A;  5CTX A;  2ZDY A;  2EXL A;  3D36 A;  1U0Z A;  4U93 A;  4LP0 A;  4XKK A;  4O05 A;  2QFO A;  5D7R A;  4EFU A;  2YKI A;  1NHH A;  4U7N A;  1AM1 A;  3Q5K A;  3B26 A;  4O07 A;  4EGI A;  3R4P A;  2YE2 A;  3CRK A;  4BIU A;  4NH9 A;  4EM7 A;  3ZXQ A;  5F3K A;  4CE1 A;  1UYI A;  4YKX A;  3D2R A;  1AH8 A;  4CWQ A;  1QZR A;  3PEJ A;  1UYE A;  2BU6 A;  2JKI A;  2YEJ A;  4NH8 A;  4MBC A;  1BXD A;  4P7A A;  2AKP A;  4LWI A;  2CGF A;  3C0E A;  2XD6 A;  4JAS A;  4BAE A;  3Q5J A;  4MPC A;  4O0B A;  4R3M A;  5CTU A;  4LPB A;  1UYL A;  1Y8P A;  3KE6 A;  2BU5 A;  2Q8I A;  2BYI A;  2XX4 A;  4O09 A;  3R91 A;  3NMQ A;  4L8Z A;  3WQ9 A;  3HYZ A;  4DUH A;  3OWB A;  1Y4U A;  5F5R A;  4BQG A;  5BOC A;  3HYY A;  1YT2 A;  2FWZ A;  1Z5A A;  1I5C A;  2UWD A;  2XAB A;  1EA6 A;  4R3A A;  1L0O A;  3OWD A;  2YKJ A;  3PEH A;  4YKQ A;  2YE5 A;  1QY8 A;  2YE9 A;  4URM A;  2XDL A;  4JAU A;  2BU7 A;  2BU8 A;  3O0I A;  2WI7 A;  2FYP A;  1NHJ A;  1Y8N A;  3INX A;  1YT1 A;  3B24 A;  5M4K A;  4HY6 A;  1AH6 A;  1UYC A;  1TC0 A;  5FNC A;  1US7 A;  2XCM A;  3EHG A;  2WI2 A;  4JQL A;  4HY1 A;  1I5B A;  4BXI A;  4DZY A;  4GEE A;  1YS3 A;  2VWC A;  2Q2E B;  1KZN A;  1I59 A;  1H7S A;  2XDK A;  2BSM A;  1S16 A;  3A0W A;  4YKR A;  1B63 A;  4XKO A;  4ASG A;  4MP7 A;  2YKB A;  1GKZ A;  2FTK A;  2C2A A;  4H7Q A;  2FWY A;  2FXS A;  3VHA A;  4PU9 A;  2Q8F A;  3BM9 A;  5IN9 A;  2HKJ A;  2YEH A;  4GCZ A;  3EKO A;  3EKR A;  4ASF A;  5BOD A;  2YEG A;  4ZVI A;  2O1V A;  2CH4 A;  4V26 A;  2QF6 A;  1TIL A;  1UYD A;  2BT0 A;  2YE8 A;  5CTW A;  2XJX A;  2CCU A;  4XKA A;  4URN A;  3A0Y A;  1BYQ A;  4P8O A;  1UYG A;  4KSG A;  2XDU A;  3A0X A;  2CCT A;  3ZM7 A;  2YEA A;  4JAV A;  3A0T A;  2K5B A;  1UYM A;  4R1F A;  2YGF A;  3O2F A;  4WUD A;  5IDM A;  4ASB A;  1TID A;  4CWF A;  1YER A;  1TC6 A;  3K98 A;  4L94 A;  3B27 A;  2YK9 A;  4YKY A;  2XHT A;  3D0B A;  4GT8 A;  2XDS A;  4YKZ A;  5CPH A;  5CTY A;  1NHI A;  2GQP A;  4FCQ A;  3OMU A;  1QYE A;  3GIG A;  4XIR A;  4EGK A;  3QDD A;  2ZDX A;  3HEK A;  2YKE A;  2BTZ A;  3BMY A;  1B3Q A;  3K60 A;  4CWT A;  4HZ5 A;  4B7P A;  4BIZ A;  3G75 A;  4FPP A;  2YE3 A;  3DGE A;  4XD8 A;  1AMW A;  5J6A A;  2Q8H A;  4L93 A;  2YED A;  2XK2 A;  4MB9 A;  2IWX A;  3U2D A;  2QG2 A;  3QTF A;  2YGA A;  4ASA A;  2VCI A;  2YE6 A;  1UY7 A;  1UYH A;  4GGL A;  3ZKD A;  1EI1 A;  4KTN A;  4NH7 A;  4H85 A;  4XIP A;  1YC3 A;  2YK2 A;  3T0Z A;  1TBW A;  3GIE A;  2HHI A;  3O6O A;  4V25 A;  3HHU A;  3LMM A;  4HZ0 A;  3FT8 A;  1IXM A;  5D6Q A;  3CGZ A;  1Z5C A;  4URO A;  4YKU A;  4E72 A;  1UY6 A;  5CF0 A;  2GFD A;  4CWR A;  4U7O A;  1Z59 A;  3K99 A;  2XDX A;  2C1I A;  2E0A A;  2ESA A;  3A0Z A;  4GFN A;  2CG9 A;  1Y8O A;  5IDJ A;  3G7B A;  2WER A;  3RLP A;  2H55 A;  2ZBK B;  3K97 A;  3CRL A;  2BU2 A;  1B62 A;  1OSF A;  3T1K A;  5M4E A;  1I5A A;  4XTJ A;  4KSH A;  2WI3 A;  3R4O A;  2IWS A;  4EGH A;  3HZ5 A;  4E00 A;  2YKC A;  3TZ4 A;  4FMT A;  5M4P A;  4MP2 A;  4XCJ A;  4MPE A;  4KFG A;  1H7U A;  1Y4S A;  1YET A;  2YI0 A;  4HYM A;  2WEQ A;  3OPD A;  3CWV A;  5JEN A;  3MNR P;  1BKN A;  3IED A;  3RLR A;  2HG1 A;  4KP4 A;  4Q20 A;  2BRC A;  4CWO A;  1PVG A;  2BRE A;  1Z5B A;  2YGE A;  2YJW A;  4W7T A;  4FCP A;  4XIT A;  1JM6 A;  3C11 A;  3EHH A;  4GQT A;  4QPJ A;  4YKT A;  4E01 A;  3INW A;  1UYK A;  3JZ3 A;  2IOQ A;  4O04 A;  4K4O A;  3GIG B;  4PRX A;  3GIF A;  3LNU A; 
#chains in the Genus database with same CATH homology
 3R4N A;  2XHR A;  5FNF A;  3RLQ A;  4L90 A;  4CE3 A;  3TZ2 A;  3H4L A;  1TH8 A;  3TZ0 A;  2YEC A;  2ZKJ A;  4CWN A;  4LWF A;  2IOR A;  4YKW A;  4LWH A;  4CWP A;  1ZWH A;  4HXZ A;  4QPK A;  4BQJ A;  3EHJ A;  4MPN A;  4ZKI A;  2XHX A;  1GJV A;  2YE4 A;  1ZXM A;  1ZXN A;  4AWO A;  4XIQ A;  5D7D A;  3TTZ A;  1U2O A;  4XC0 A;  4EEH A;  1AJ6 A;  2XJJ A;  3T0H A;  2VW5 A;  4FCR A;  3TZ5 A;  1GKX A;  4AWP A;  1ZW9 A;  1ID0 A;  1YT0 A;  5M4N A;  2YJX A;  3B25 A;  3LPS A;  4EFT A;  4XCL A;  2BZ5 A;  3FV5 A;  5J71 A;  2WI6 A;  4XE2 A;  5M4H A;  3T2S A;  2O1U A;  5GGZ A;  2PNR A;  3G7E A;  2WI1 A;  2XX5 A;  3U67 A;  2YE7 A;  1YC4 A;  2YI7 A;  4WUB A;  2QG0 A;  1R62 A;  4CWS A;  4E02 A;  3VAD A;  1A4H A;  3T10 A;  2BYH A;  2YEI A;  4KQV A;  2JJC A;  3B28 A;  4AS9 A;  1UY8 A;  2HCH A;  5M4M A;  4MOT A;  2VCJ A;  2WI5 A;  1YES A;  4HXW A;  3H80 A;  3R4M A;  3SL2 A;  2YEB A;  4L91 A;  3Q5L A;  5L3J A;  4HYP A;  5D7C A;  3TUH A;  2IWU A;  2WEP A;  5D6P A;  3ZXO A;  1I58 A;  1THN A;  3U2K A;  4AWQ A;  1S14 A;  2O1W A;  4PL9 A;  1YSZ A;  5C93 A;  2YI6 A;  1UY9 A;  3RKZ A;  1MU5 A;  3EHF A;  2WI4 A;  3CGY A;  2YI5 A;  3FT5 A;  3WHA A;  1KIJ A;  1UYF A;  2YEE A;  4LWE A;  1YC1 A;  4H81 A;  4EMV A;  1I5D A;  4X9L A;  4B6C A;  2XJG A;  4WUC A;  4I3H A;  3OW6 A;  4CE2 A;  2IOP A;  4PRV A;  2Q8G A;  4LWG A;  1MX0 A;  2YEF A;  4XDM A;  3HZ1 A;  3A0R A;  2H8M A;  1YSR A;  2CCS A;  5FWK A;  4URL A;  5FND A;  3ZKB A;  3VHD A;  3VHC A;  1BGQ A;  2XX2 A;  4I5S A;  3R92 A;  5CTX A;  2ZDY A;  2EXL A;  3D36 A;  1U0Z A;  4U93 A;  4LP0 A;  4XKK A;  4O05 A;  2QFO A;  5D7R A;  4EFU A;  2YKI A;  1NHH A;  4U7N A;  1AM1 A;  3Q5K A;  3B26 A;  4O07 A;  4EGI A;  3R4P A;  2YE2 A;  3CRK A;  4BIU A;  4NH9 A;  4EM7 A;  3ZXQ A;  5F3K A;  4CE1 A;  1UYI A;  4YKX A;  3D2R A;  1AH8 A;  4CWQ A;  1QZR A;  3PEJ A;  1UYE A;  2BU6 A;  2JKI A;  2YEJ A;  4NH8 A;  4MBC A;  1BXD A;  4P7A A;  2AKP A;  4LWI A;  2CGF A;  3C0E A;  2XD6 A;  4JAS A;  4BAE A;  3Q5J A;  4MPC A;  4O0B A;  4R3M A;  5CTU A;  4LPB A;  1UYL A;  1Y8P A;  3KE6 A;  2BU5 A;  2Q8I A;  2BYI A;  2XX4 A;  4O09 A;  3R91 A;  3NMQ A;  4L8Z A;  3WQ9 A;  3HYZ A;  4DUH A;  3OWB A;  1Y4U A;  5F5R A;  4BQG A;  5BOC A;  3HYY A;  1YT2 A;  2FWZ A;  1Z5A A;  1I5C A;  2UWD A;  2XAB A;  1EA6 A;  4R3A A;  1L0O A;  3OWD A;  2YKJ A;  3PEH A;  4YKQ A;  2YE5 A;  1QY8 A;  2YE9 A;  4URM A;  2XDL A;  4JAU A;  2BU7 A;  2BU8 A;  3O0I A;  2WI7 A;  2FYP A;  1NHJ A;  1Y8N A;  3INX A;  1YT1 A;  3B24 A;  5M4K A;  4HY6 A;  1AH6 A;  1UYC A;  1TC0 A;  5FNC A;  1US7 A;  2XCM A;  3EHG A;  2WI2 A;  4JQL A;  4HY1 A;  1I5B A;  4BXI A;  4DZY A;  4GEE A;  1YS3 A;  2VWC A;  2Q2E B;  1KZN A;  1I59 A;  1H7S A;  2XDK A;  2BSM A;  1S16 A;  3A0W A;  4YKR A;  1B63 A;  4XKO A;  4ASG A;  4MP7 A;  2YKB A;  1GKZ A;  2C2A A;  4H7Q A;  2FWY A;  2FXS A;  3VHA A;  4PU9 A;  2Q8F A;  3BM9 A;  5IN9 A;  2HKJ A;  2YEH A;  4GCZ A;  3EKO A;  3EKR A;  4ASF A;  5BOD A;  2YEG A;  4ZVI A;  2O1V A;  2CH4 A;  4V26 A;  2QF6 A;  1TIL A;  1UYD A;  2BT0 A;  2YE8 A;  5CTW A;  2XJX A;  2CCU A;  4XKA A;  4URN A;  3A0Y A;  1BYQ A;  4P8O A;  1UYG A;  4KSG A;  2XDU A;  3A0X A;  2CCT A;  3ZM7 A;  2YEA A;  4JAV A;  3A0T A;  2K5B A;  1UYM A;  4R1F A;  2YGF A;  3O2F A;  4WUD A;  5IDM A;  4ASB A;  1TID A;  4CWF A;  1YER A;  1TC6 A;  3K98 A;  4L94 A;  3B27 A;  2YK9 A;  4YKY A;  2XHT A;  3D0B A;  4GT8 A;  2XDS A;  4YKZ A;  5CPH A;  5CTY A;  1NHI A;  2GQP A;  4FCQ A;  3OMU A;  1QYE A;  3GIG A;  4XIR A;  4EGK A;  3QDD A;  2ZDX A;  3HEK A;  2YKE A;  2BTZ A;  3BMY A;  1B3Q A;  3K60 A;  4CWT A;  4HZ5 A;  4B7P A;  4BIZ A;  3G75 A;  4FPP A;  2YE3 A;  3DGE A;  4XD8 A;  1AMW A;  5J6A A;  2Q8H A;  4L93 A;  2YED A;  2XK2 A;  4MB9 A;  2IWX A;  3U2D A;  2QG2 A;  3QTF A;  2YGA A;  4ASA A;  2VCI A;  2YE6 A;  1UY7 A;  1UYH A;  4GGL A;  3ZKD A;  1EI1 A;  4KTN A;  4NH7 A;  4H85 A;  4XIP A;  1YC3 A;  2YK2 A;  3T0Z A;  1TBW A;  3GIE A;  3O6O A;  4V25 A;  3HHU A;  4HZ0 A;  3FT8 A;  5D6Q A;  3CGZ A;  1Z5C A;  4URO A;  4YKU A;  1UY6 A;  5CF0 A;  2GFD A;  4CWR A;  4U7O A;  1Z59 A;  3K99 A;  2XDX A;  2E0A A;  2ESA A;  3A0Z A;  4GFN A;  2CG9 A;  1Y8O A;  5IDJ A;  3G7B A;  2WER A;  3RLP A;  2H55 A;  2ZBK B;  3K97 A;  3CRL A;  2BU2 A;  1B62 A;  1OSF A;  3T1K A;  5M4E A;  1I5A A;  4XTJ A;  4KSH A;  2WI3 A;  3R4O A;  2IWS A;  4EGH A;  3HZ5 A;  4E00 A;  2YKC A;  3TZ4 A;  4FMT A;  5M4P A;  4MP2 A;  4XCJ A;  4MPE A;  4KFG A;  1H7U A;  1Y4S A;  1YET A;  2YI0 A;  4HYM A;  2WEQ A;  3OPD A;  3CWV A;  3MNR P;  1BKN A;  3IED A;  3RLR A;  2HG1 A;  4KP4 A;  4Q20 A;  2BRC A;  4CWO A;  1PVG A;  2BRE A;  1Z5B A;  2YGE A;  2YJW A;  4W7T A;  4FCP A;  4XIT A;  1JM6 A;  3C11 A;  3EHH A;  4GQT A;  4QPJ A;  4YKT A;  4E01 A;  3INW A;  1UYK A;  3JZ3 A;  2IOQ A;  4O04 A;  4K4O A;  3GIG B;  4PRX A;  3GIF A;  3LNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...