4KSHA

Dna gyrase atp binding domain of enterococcus faecalis in complex with a small molecule inhibitor (7-({4-[(3r)-3-aminopyrrolidin-1-yl]-5-chloro-6-ethyl-7h-pyrrolo[2,3-d]pyrimidin-2-yl}sulfanyl)-1,5-naphthyridin-1(4h)-ol)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
193
Chain Sequence
GLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLHGVGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAVVDDLKVIEETDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
publication title A new class of type iia topoisomerase inhibitors with broad-spectrum antibacterial activity
rcsb
source organism Enterococcus faecalis
total genus 59
structure length 193
sequence length 210
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4kshA00
1MX0A 4EGIA 4MPNA 3T0HA 2IOQA 1H7SA 4I3HA 2VCJA 1EA6A 5M4EA 4E01A 2Q2EB 5D6QA 4KSHA 4URNA 3D0BA 4HY6A 4FCRA 1GKZA 3PEHA 4XKAA 4JASA 1UY7A 2XX5A 1EI1A 2YEDA 2YE9A 4U7NA 1BXDA 4E00A 3INWA 3B25A 5IN9A 4XCLA 4HXZA 2YE3A 2WEQA 2ZDYA 4JAUA 2YE6A 5M4NA 4KTNA 2BYIA 4GCZA 4CWFA 3EKOA 4XKOA 2YEBA 4GGLA 3PEJA 4QPKA 1I5CA 2C2AA 2BU2A 2FWYA 4PRXA 2BYHA 3U2DA 1Y8OA 3CRKA 4QPJA 5M4KA 4U7OA 4EM7A 5FWKA 4FCPA 1YSZA 4V26A 4L93A 3HYYA 5J71A 4MBCA 5C93A 4BQGA 4LWIA 3K98A 4H81A 4MP2A 4NH7A 1Z5BA 2YE4A 2ZKJA 4P8OA 2YEFA 2QFOA 2XDLA 1OSFA 2EXLA 3EHGA 1YC3A 1YC1A 2O1UA 3B28A 3CGYA 1BYQA 3VADA 4YKXA 4UROA 4LPBA 1KIJA 1Y8NA 2BT0A 4R3MA 1JM6A 1ZW9A 5M4PA 4HZ0A 1UYDA 4URLA 2K5BA 3CGZA 3OWBA 3CRLA 4CE1A 5L3JA 3INXA 3HZ1A 2YE2A 1UY8A 2XHRA 1AH8A 1UYCA 2XX2A 1B63A 2ZDXA 3GIFA 1I59A 1QY8A 2BSMA 4GT8A 4BXIA 1YC4A 3R91A 4I5SA 3H80A 2BU7A 4FCQA 3MNRP 1MU5A 4XC0A 4FPPA 1I5DA 2HG1A 4EMVA 3JZ3A 1GJVA 2XDXA 2WI4A 1UYEA 2GQPA 2FXSA 2YKJA 4P7AA 3HHUA 4R1FA 1US7A 2YE7A 4O09A 4HXWA 2XX4A 1BKNA 3EHHA 1NHJA 2YI6A 2YEAA 5BOCA 1TILA 3OPDA 4E02A 3RLRA 2E0AA 5FNFA 3BM9A 3R4MA 4V25A 1AJ6A 1YSRA 4LWGA 2ESAA 1TC6A 2CCSA 4U93A 1UYFA 4MP7A 2Q8HA 2VW5A 4HY1A 4K4OA 2XHTA 5D6PA 1QZRA 1I5AA 2XDSA 4LWHA 3RLPA 3TZ2A 4WUCA 2Q8IA 3NMQA 3G7BA 4XITA 4O0BA 5F3KA 1QYEA 1S14A 2YK2A 3CWVA 2GFDA 1ZXMA 2O1VA 3U2KA 4EFUA 2YKCA 4Q20A 4ASBA 4AWOA 2WI3A 3LNUA 4CWTA 4KFGA 2VCIA 4XE2A 1U0ZA 3K99A 4YKRA 2XDUA 1AH6A 3OWDA 5BODA 1ID0A 4MPCA 5M4HA 4XTJA 3HEKA 2CCTA 3TZ0A 3G7EA 3T1KA 2YJXA 3FV5A 3T2SA 4KQVA 1KZNA 3HZ5A 3Q5LA 2BTZA 3WQ9A 4XKKA 2VWCA 2YK9A 4ZVIA 5J6AA 3R92A 1I58A 4GFNA 1YT0A 4JAVA 2YEIA 3TTZA 3ZM7A 2QG2A 2XK2A 4URMA 1YT2A 4HYMA 4LP0A 2IWUA 4XIPA 3QTFA 4BAEA 2YJWA 3EHFA 4XIRA 2YI0A 2CGFA 3IEDA 5GGZA 2YKBA 3T10A 2XDKA 1YESA 3C0EA 1PVGA 2FYPA 1I5BA 2HCHA 2YKIA 3WHAA 5D7RA 4BIUA 1Y4SA 2QF6A 4XIQA 4JQLA 3VHCA 1TIDA 2UWDA 3KE6A 3T0ZA 3EKRA 4CWRA 4CWOA 5D7DA 5D7CA 1UY6A 1A4HA 1H7UA 3B27A 3Q5JA 5CTXA 1TC0A 1UYLA 2YEGA 2BU6A 2WI5A 4O05A 4PL9A 2XD6A 4EGKA 5IDMA 4MOTA 1UY9A 2HKJA 4MB9A 4DZYA 4XD8A 2YGEA 4LWEA 2WI1A 3A0RA 1UYIA 3GIEA 3ZKDA 3ZKBA 2BRCA 2XJJA 2YE8A 1B3QA 2AKPA 2YI7A 2BU5A 1YERA 1U2OA 4CWNA 2YE5A 4O07A 3GIGA 3ZXQA 2QG0A 5CTYA 1R62A 4L91A 4YKZA 2XCMA 4YKWA 3GIGB 4ASGA 3SL2A 4NH9A 3BMYA 5IDJA 2WERA 1BGQA 3C11A 4KP4A 5FNDA 3VHAA 3DGEA 5CTWA 4LWFA 3TZ4A 4CE3A 4L94A 3A0XA 3D2RA 4W7TA 1THNA 3FT5A 1YT1A 4PRVA 1YS3A 4H7QA 3K60A 4NH8A 4AS9A 2XABA 2WI6A 4YKTA 3O2FA 4XCJA 2Q8FA 2CG9A 4DUHA 1Y4UA 2IWXA 2PNRA 2CCUA 4YKYA 4ASAA 5FNCA 2YGFA 3G75A 4L8ZA 1TBWA 3HYZA 3ZXOA 2ZBKB 3OMUA 2XJGA 1NHIA 5CTUA 4CWPA 4L90A 2H8MA 2O1WA 5M4MA 5CF0A 3U67A 1AMWA 4EFTA 1B62A 1NHHA 2BU8A 1GKXA 3RLQA 3LPSA 3R4OA 2XHXA 2YGAA 4B6CA 4EGHA 3QDDA 2FWZA 4YKUA 4HYPA 4KSGA 3FT8A 4PU9A 2Q8GA 3R4PA 1ZXNA 4ZKIA 2YEEA 3O0IA 2YECA 1Z59A 2CH4A 4GQTA 4CWQA 1UYKA 1UYHA 1Y8PA 3Q5KA 1YETA 2YEHA 3A0WA 2IOPA 2WI7A 2IORA 2YKEA 3A0ZA 1S16A 3EHJA 5F5RA 4CWSA 2IWSA 4AWQA 1Z5AA 4XDMA 4GEEA 4WUBA 2JJCA 2YEJA 4HZ5A 5CPHA 4BIZA 2YI5A 3B24A 4CE2A 1UYMA 3H4LA 4YKQA 3TUHA 2WI2A 3A0TA 3D36A 3K97A 3R4NA 1Z5CA 4B7PA 1UYGA 2XJXA 4EEHA 3OW6A 2BREA 4MPEA 3O6OA 4WUDA 4H85A 3VHDA 4O04A 4BQJA 2H55A 2WEPA 3A0YA 4ASFA 4AWPA 4FMTA 3TZ5A 2JKIA 4X9LA 4R3AA 1L0OA 3B26A 1TH8A 3RKZA 1AM1A 1ZWHA 2BZ5A
chains in the Genus database with same CATH superfamily
1MX0A 4EGIA 4MPNA 3T0HA 2IOQA 1IXMA 1H7SA 4I3HA 2VCJA 1EA6A 5M4EA 4E01A 2Q2EB 5D6QA 4KSHA 4URNA 3D0BA 4HY6A 4FCRA 1GKZA 3PEHA 1F51A 4XKAA 4JASA 1UY7A 2XX5A 1EI1A 2YEDA 2YE9A 4U7NA 1BXDA 4E00A 3INWA 3B25A 5IN9A 4XCLA 4HXZA 2YE3A 2WEQA 2ZDYA 4JAUA 2YE6A 5M4NA 4KTNA 2BYIA 4GCZA 4CWFA 3EKOA 4XKOA 2YEBA 4GGLA 3PEJA 4QPKA 1I5CA 2C2AA 2BU2A 2FWYA 4PRXA 2BYHA 2C1GA 3U2DA 1Y8OA 3CRKA 4QPJA 5M4KA 4U7OA 4EM7A 5FWKA 4FCPA 1YSZA 4V26A 4L93A 3HYYA 5J71A 4MBCA 5C93A 4BQGA 4LWIA 3K98A 4H81A 4MP2A 4NH7A 1Z5BA 2YE4A 2ZKJA 4P8OA 2YEFA 2QFOA 2XDLA 1OSFA 2EXLA 3EHGA 1YC3A 1YC1A 2O1UA 3B28A 3CGYA 1BYQA 3VADA 4YKXA 4UROA 4LPBA 1KIJA 2HHIA 1Y8NA 2BT0A 4R3MA 3S5TA 1JM6A 1ZW9A 5M4PA 4HZ0A 1UYDA 4URLA 2K5BA 3CGZA 3OWBA 3CRLA 4CE1A 5L3JA 3INXA 3HZ1A 2YE2A 1UY8A 2XHRA 1AH8A 1UYCA 2XX2A 1B63A 2ZDXA 3GIFA 1I59A 1QY8A 2BSMA 4GT8A 4BXIA 1YC4A 3R91A 4I5SA 3H80A 2BU7A 4FCQA 3MNRP 1MU5A 4XC0A 4FPPA 1I5DA 2HG1A 4EMVA 3JZ3A 1GJVA 2XDXA 2WI4A 1UYEA 2GQPA 2FXSA 2YKJA 4P7AA 3HHUA 4R1FA 1US7A 2YE7A 4O09A 4HXWA 2XX4A 1BKNA 3EHHA 1NHJA 2YI6A 2YEAA 5BOCA 1TILA 3CYGA 3OPDA 4E02A 3RLRA 2E0AA 5FNFA 3BM9A 3R4MA 4V25A 1AJ6A 1YSRA 4LWGA 2ESAA 1TC6A 2CCSA 4U93A 1UYFA 4MP7A 2Q8HA 2VW5A 4HY1A 4K4OA 2XHTA 5D6PA 1QZRA 1I5AA 2XDSA 4LWHA 3RLPA 3TZ2A 4WUCA 2Q8IA 3NMQA 3G7BA 4XITA 4O0BA 5F3KA 1QYEA 1S14A 2YK2A 3CWVA 2GFDA 1ZXMA 2O1VA 3U2KA 4EFUA 2YKCA 4Q20A 4ASBA 4AWOA 2WI3A 3LNUA 4CWTA 5JENA 4KFGA 2VCIA 4XE2A 1U0ZA 3K99A 4YKRA 2XDUA 1AH6A 3OWDA 5BODA 1ID0A 4MPCA 5M4HA 4XTJA 3HEKA 2CCTA 3TZ0A 3G7EA 3T1KA 2YJXA 3FV5A 3T2SA 4KQVA 1KZNA 3HZ5A 3Q5LA 2BTZA 3WQ9A 4XKKA 2VWCA 2YK9A 4ZVIA 5J6AA 3R92A 1I58A 4GFNA 1YT0A 4JAVA 2YEIA 3TTZA 3ZM7A 2QG2A 2XK2A 4URMA 2FTKA 1YT2A 4HYMA 4LP0A 2IWUA 4XIPA 3QTFA 4BAEA 2YJWA 3EHFA 4XIRA 2YI0A 2CGFA 3IEDA 5GGZA 2YKBA 3T10A 2XDKA 1YESA 3C0EA 1PVGA 2FYPA 1I5BA 2HCHA 2YKIA 3WHAA 5D7RA 4BIUA 1Y4SA 2QF6A 4XIQA 4JQLA 3VHCA 1TIDA 2UWDA 3KE6A 3T0ZA 3EKRA 4CWRA 4CWOA 5D7DA 5D7CA 1UY6A 1A4HA 1H7UA 3B27A 3Q5JA 5CTXA 1TC0A 1UYLA 2YEGA 2BU6A 2WI5A 4O05A 4PL9A 2XD6A 4EGKA 5IDMA 4MOTA 1UY9A 2HKJA 4MB9A 4DZYA 4XD8A 2YGEA 4LWEA 2WI1A 3A0RA 1UYIA 3GIEA 2C1IA 3ZKDA 3ZKBA 2BRCA 2XJJA 2YE8A 1B3QA 2AKPA 2YI7A 2BU5A 1YERA 1U2OA 4CWNA 2YE5A 4O07A 3GIGA 3ZXQA 2QG0A 5CTYA 1R62A 4L91A 4YKZA 2XCMA 4YKWA 3GIGB 4ASGA 3SL2A 4NH9A 3BMYA 5IDJA 2WERA 1BGQA 3C11A 4KP4A 5FNDA 3VHAA 3DGEA 5CTWA 4LWFA 3TZ4A 4CE3A 3LMMA 4L94A 3A0XA 3D2RA 4W7TA 1THNA 3FT5A 1YT1A 4PRVA 1YS3A 4H7QA 3K60A 4NH8A 4AS9A 2XABA 2WI6A 4YKTA 3O2FA 4XCJA 2Q8FA 2CG9A 4DUHA 1Y4UA 2IWXA 2PNRA 2CCUA 4YKYA 4ASAA 5FNCA 2YGFA 3G75A 4L8ZA 1TBWA 3HYZA 3ZXOA 2ZBKB 3OMUA 2XJGA 1NHIA 5CTUA 4CWPA 4L90A 2H8MA 2O1WA 5M4MA 5CF0A 3U67A 1AMWA 4EFTA 1B62A 1NHHA 2BU8A 1GKXA 3RLQA 3LPSA 3R4OA 2XHXA 2YGAA 4B6CA 4EGHA 3QDDA 2FWZA 4YKUA 4HYPA 4KSGA 3FT8A 4PU9A 2Q8GA 3R4PA 1ZXNA 4ZKIA 2YEEA 3O0IA 2YECA 1Z59A 2CH4A 4GQTA 4CWQA 1UYKA 1UYHA 1Y8PA 3Q5KA 4E72A 1YETA 2YEHA 3A0WA 2IOPA 2WI7A 2IORA 2YKEA 3A0ZA 1S16A 3EHJA 5F5RA 4CWSA 2IWSA 4AWQA 1Z5AA 4XDMA 4GEEA 4WUBA 2JJCA 2YEJA 4HZ5A 5CPHA 4BIZA 2YI5A 3B24A 4CE2A 1UYMA 3H4LA 4YKQA 3TUHA 2WI2A 3A0TA 3D36A 3K97A 3R4NA 1Z5CA 4B7PA 1UYGA 2XJXA 4EEHA 3OW6A 2BREA 4MPEA 3O6OA 4WUDA 4H85A 3VHDA 4O04A 4BQJA 2H55A 2WEPA 3A0YA 4ASFA 4AWPA 4FMTA 3TZ5A 2JKIA 4X9LA 4R3AA 1L0OA 3B26A 1TH8A 3RKZA 1AM1A 1ZWHA 2BZ5A
chains in the Genus database with same CATH topology
1MX0A 4EGIA 4MPNA 3T0HA 2IOQA 1H7SA 4I3HA 2VCJA 1EA6A 5M4EA 4E01A 2Q2EB 5D6QA 4KSHA 4URNA 3D0BA 4HY6A 4FCRA 1GKZA 3PEHA 4XKAA 4JASA 1UY7A 2XX5A 1EI1A 2YEDA 2YE9A 4U7NA 1BXDA 4E00A 3INWA 3B25A 5IN9A 4XCLA 4HXZA 2YE3A 2WEQA 2ZDYA 4JAUA 2YE6A 5M4NA 4KTNA 2BYIA 4GCZA 4CWFA 3EKOA 4XKOA 2YEBA 4GGLA 3PEJA 4QPKA 1I5CA 2C2AA 2BU2A 2FWYA 4PRXA 2BYHA 3U2DA 1Y8OA 3CRKA 4QPJA 5M4KA 4U7OA 4EM7A 5FWKA 4FCPA 1YSZA 4V26A 4L93A 3HYYA 5J71A 4MBCA 5C93A 4BQGA 4LWIA 3K98A 4H81A 4MP2A 4NH7A 1Z5BA 2YE4A 2ZKJA 4P8OA 2YEFA 2QFOA 2XDLA 1OSFA 2EXLA 3EHGA 1YC3A 1YC1A 2O1UA 3B28A 3CGYA 1BYQA 3VADA 4YKXA 4UROA 4LPBA 1KIJA 1Y8NA 2BT0A 4R3MA 1JM6A 1ZW9A 5M4PA 4HZ0A 1UYDA 4URLA 2K5BA 3CGZA 3OWBA 3CRLA 4CE1A 5L3JA 3INXA 3HZ1A 2YE2A 1UY8A 2XHRA 1AH8A 1UYCA 2XX2A 1B63A 2ZDXA 3GIFA 1I59A 1QY8A 2BSMA 4GT8A 4BXIA 1YC4A 3R91A 4I5SA 3H80A 2BU7A 4FCQA 3MNRP 1MU5A 4XC0A 4FPPA 1I5DA 2HG1A 4EMVA 3JZ3A 1GJVA 2XDXA 2WI4A 1UYEA 2GQPA 2FXSA 2YKJA 4P7AA 3HHUA 4R1FA 1US7A 2YE7A 4O09A 4HXWA 2XX4A 1BKNA 3EHHA 1NHJA 2YI6A 2YEAA 5BOCA 1TILA 3OPDA 4E02A 3RLRA 2E0AA 5FNFA 3BM9A 3R4MA 4V25A 1AJ6A 1YSRA 4LWGA 2ESAA 1TC6A 2CCSA 4U93A 1UYFA 4MP7A 2Q8HA 2VW5A 4HY1A 4K4OA 2XHTA 5D6PA 1QZRA 1I5AA 2XDSA 4LWHA 3RLPA 3TZ2A 4WUCA 2Q8IA 3NMQA 3G7BA 4XITA 4O0BA 5F3KA 1QYEA 1S14A 2YK2A 3CWVA 2GFDA 1ZXMA 2O1VA 3U2KA 4EFUA 2YKCA 4Q20A 4ASBA 4AWOA 2WI3A 3LNUA 4CWTA 4KFGA 2VCIA 4XE2A 1U0ZA 3K99A 4YKRA 2XDUA 1AH6A 3OWDA 5BODA 1ID0A 4MPCA 5M4HA 4XTJA 3HEKA 2CCTA 3TZ0A 3G7EA 3T1KA 2YJXA 3FV5A 3T2SA 4KQVA 1KZNA 3HZ5A 3Q5LA 2BTZA 3WQ9A 4XKKA 2VWCA 2YK9A 4ZVIA 5J6AA 3R92A 1I58A 4GFNA 1YT0A 4JAVA 2YEIA 3TTZA 3ZM7A 2QG2A 2XK2A 4URMA 1YT2A 4HYMA 4LP0A 2IWUA 4XIPA 3QTFA 4BAEA 2YJWA 3EHFA 4XIRA 2YI0A 2CGFA 3IEDA 5GGZA 2YKBA 3T10A 2XDKA 1YESA 3C0EA 1PVGA 2FYPA 1I5BA 2HCHA 2YKIA 3WHAA 5D7RA 4BIUA 1Y4SA 2QF6A 4XIQA 4JQLA 3VHCA 1TIDA 2UWDA 3KE6A 3T0ZA 3EKRA 4CWRA 4CWOA 5D7DA 5D7CA 1UY6A 1A4HA 1H7UA 3B27A 3Q5JA 5CTXA 1TC0A 1UYLA 2YEGA 2BU6A 2WI5A 4O05A 4PL9A 2XD6A 4EGKA 5IDMA 4MOTA 1UY9A 2HKJA 4MB9A 4DZYA 4XD8A 2YGEA 4LWEA 2WI1A 3A0RA 1UYIA 3GIEA 3ZKDA 3ZKBA 2BRCA 2XJJA 2YE8A 1B3QA 2AKPA 2YI7A 2BU5A 1YERA 1U2OA 4CWNA 2YE5A 4O07A 3GIGA 3ZXQA 2QG0A 5CTYA 1R62A 4L91A 4YKZA 2XCMA 4YKWA 3GIGB 4ASGA 3SL2A 4NH9A 3BMYA 5IDJA 2WERA 1BGQA 3C11A 4KP4A 5FNDA 3VHAA 3DGEA 5CTWA 4LWFA 3TZ4A 4CE3A 4L94A 3A0XA 3D2RA 4W7TA 1THNA 3FT5A 1YT1A 4PRVA 1YS3A 4H7QA 3K60A 4NH8A 4AS9A 2XABA 2WI6A 4YKTA 3O2FA 4XCJA 2Q8FA 2CG9A 4DUHA 1Y4UA 2IWXA 2PNRA 2CCUA 4YKYA 4ASAA 5FNCA 2YGFA 3G75A 4L8ZA 1TBWA 3HYZA 3ZXOA 2ZBKB 3OMUA 2XJGA 1NHIA 5CTUA 4CWPA 4L90A 2H8MA 2O1WA 5M4MA 5CF0A 3U67A 1AMWA 4EFTA 1B62A 1NHHA 2BU8A 1GKXA 3RLQA 3LPSA 3R4OA 2XHXA 2YGAA 4B6CA 4EGHA 3QDDA 2FWZA 4YKUA 4HYPA 4KSGA 3FT8A 4PU9A 2Q8GA 3R4PA 1ZXNA 4ZKIA 2YEEA 3O0IA 2YECA 1Z59A 2CH4A 4GQTA 4CWQA 1UYKA 1UYHA 1Y8PA 3Q5KA 1YETA 2YEHA 3A0WA 2IOPA 2WI7A 2IORA 2YKEA 3A0ZA 1S16A 3EHJA 5F5RA 4CWSA 2IWSA 4AWQA 1Z5AA 4XDMA 4GEEA 4WUBA 2JJCA 2YEJA 4HZ5A 5CPHA 4BIZA 2YI5A 3B24A 4CE2A 1UYMA 3H4LA 4YKQA 3TUHA 2WI2A 3A0TA 3D36A 3K97A 3R4NA 1Z5CA 4B7PA 1UYGA 2XJXA 4EEHA 3OW6A 2BREA 4MPEA 3O6OA 4WUDA 4H85A 3VHDA 4O04A 4BQJA 2H55A 2WEPA 3A0YA 4ASFA 4AWPA 4FMTA 3TZ5A 2JKIA 4X9LA 4R3AA 1L0OA 3B26A 1TH8A 3RKZA 1AM1A 1ZWHA 2BZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MX0 A;  4EGI A;  4MPN A;  3T0H A;  2IOQ A;  1H7S A;  4I3H A;  2VCJ A;  1EA6 A;  5M4E A;  4E01 A;  2Q2E B;  5D6Q A;  4KSH A;  4URN A;  3D0B A;  4HY6 A;  4FCR A;  1GKZ A;  3PEH A;  4XKA A;  4JAS A;  1UY7 A;  2XX5 A;  1EI1 A;  2YED A;  2YE9 A;  4U7N A;  1BXD A;  4E00 A;  3INW A;  3B25 A;  5IN9 A;  4XCL A;  4HXZ A;  2YE3 A;  2WEQ A;  2ZDY A;  4JAU A;  2YE6 A;  5M4N A;  4KTN A;  2BYI A;  4GCZ A;  4CWF A;  3EKO A;  4XKO A;  2YEB A;  4GGL A;  3PEJ A;  4QPK A;  1I5C A;  2C2A A;  2BU2 A;  2FWY A;  4PRX A;  2BYH A;  3U2D A;  1Y8O A;  3CRK A;  4QPJ A;  5M4K A;  4U7O A;  4EM7 A;  5FWK A;  4FCP A;  1YSZ A;  4V26 A;  4L93 A;  3HYY A;  5J71 A;  4MBC A;  5C93 A;  4BQG A;  4LWI A;  3K98 A;  4H81 A;  4MP2 A;  4NH7 A;  1Z5B A;  2YE4 A;  2ZKJ A;  4P8O A;  2YEF A;  2QFO A;  2XDL A;  1OSF A;  2EXL A;  3EHG A;  1YC3 A;  1YC1 A;  2O1U A;  3B28 A;  3CGY A;  1BYQ A;  3VAD A;  4YKX A;  4URO A;  4LPB A;  1KIJ A;  1Y8N A;  2BT0 A;  4R3M A;  1JM6 A;  1ZW9 A;  5M4P A;  4HZ0 A;  1UYD A;  4URL A;  2K5B A;  3CGZ A;  3OWB A;  3CRL A;  4CE1 A;  5L3J A;  3INX A;  3HZ1 A;  2YE2 A;  1UY8 A;  2XHR A;  1AH8 A;  1UYC A;  2XX2 A;  1B63 A;  2ZDX A;  3GIF A;  1I59 A;  1QY8 A;  2BSM A;  4GT8 A;  4BXI A;  1YC4 A;  3R91 A;  4I5S A;  3H80 A;  2BU7 A;  4FCQ A;  3MNR P;  1MU5 A;  4XC0 A;  4FPP A;  1I5D A;  2HG1 A;  4EMV A;  3JZ3 A;  1GJV A;  2XDX A;  2WI4 A;  1UYE A;  2GQP A;  2FXS A;  2YKJ A;  4P7A A;  3HHU A;  4R1F A;  1US7 A;  2YE7 A;  4O09 A;  4HXW A;  2XX4 A;  1BKN A;  3EHH A;  1NHJ A;  2YI6 A;  2YEA A;  5BOC A;  1TIL A;  3OPD A;  4E02 A;  3RLR A;  2E0A A;  5FNF A;  3BM9 A;  3R4M A;  4V25 A;  1AJ6 A;  1YSR A;  4LWG A;  2ESA A;  1TC6 A;  2CCS A;  4U93 A;  1UYF A;  4MP7 A;  2Q8H A;  2VW5 A;  4HY1 A;  4K4O A;  2XHT A;  5D6P A;  1QZR A;  1I5A A;  2XDS A;  4LWH A;  3RLP A;  3TZ2 A;  4WUC A;  2Q8I A;  3NMQ A;  3G7B A;  4XIT A;  4O0B A;  5F3K A;  1QYE A;  1S14 A;  2YK2 A;  3CWV A;  2GFD A;  1ZXM A;  2O1V A;  3U2K A;  4EFU A;  2YKC A;  4Q20 A;  4ASB A;  4AWO A;  2WI3 A;  3LNU A;  4CWT A;  4KFG A;  2VCI A;  4XE2 A;  1U0Z A;  3K99 A;  4YKR A;  2XDU A;  1AH6 A;  3OWD A;  5BOD A;  1ID0 A;  4MPC A;  5M4H A;  4XTJ A;  3HEK A;  2CCT A;  3TZ0 A;  3G7E A;  3T1K A;  2YJX A;  3FV5 A;  3T2S A;  4KQV A;  1KZN A;  3HZ5 A;  3Q5L A;  2BTZ A;  3WQ9 A;  4XKK A;  2VWC A;  2YK9 A;  4ZVI A;  5J6A A;  3R92 A;  1I58 A;  4GFN A;  1YT0 A;  4JAV A;  2YEI A;  3TTZ A;  3ZM7 A;  2QG2 A;  2XK2 A;  4URM A;  1YT2 A;  4HYM A;  4LP0 A;  2IWU A;  4XIP A;  3QTF A;  4BAE A;  2YJW A;  3EHF A;  4XIR A;  2YI0 A;  2CGF A;  3IED A;  5GGZ A;  2YKB A;  3T10 A;  2XDK A;  1YES A;  3C0E A;  1PVG A;  2FYP A;  1I5B A;  2HCH A;  2YKI A;  3WHA A;  5D7R A;  4BIU A;  1Y4S A;  2QF6 A;  4XIQ A;  4JQL A;  3VHC A;  1TID A;  2UWD A;  3KE6 A;  3T0Z A;  3EKR A;  4CWR A;  4CWO A;  5D7D A;  5D7C A;  1UY6 A;  1A4H A;  1H7U A;  3B27 A;  3Q5J A;  5CTX A;  1TC0 A;  1UYL A;  2YEG A;  2BU6 A;  2WI5 A;  4O05 A;  4PL9 A;  2XD6 A;  4EGK A;  5IDM A;  4MOT A;  1UY9 A;  2HKJ A;  4MB9 A;  4DZY A;  4XD8 A;  2YGE A;  4LWE A;  2WI1 A;  3A0R A;  1UYI A;  3GIE A;  3ZKD A;  3ZKB A;  2BRC A;  2XJJ A;  2YE8 A;  1B3Q A;  2AKP A;  2YI7 A;  2BU5 A;  1YER A;  1U2O A;  4CWN A;  2YE5 A;  4O07 A;  3GIG A;  3ZXQ A;  2QG0 A;  5CTY A;  1R62 A;  4L91 A;  4YKZ A;  2XCM A;  4YKW A;  3GIG B;  4ASG A;  3SL2 A;  4NH9 A;  3BMY A;  5IDJ A;  2WER A;  1BGQ A;  3C11 A;  4KP4 A;  5FND A;  3VHA A;  3DGE A;  5CTW A;  4LWF A;  3TZ4 A;  4CE3 A;  4L94 A;  3A0X A;  3D2R A;  4W7T A;  1THN A;  3FT5 A;  1YT1 A;  4PRV A;  1YS3 A;  4H7Q A;  3K60 A;  4NH8 A;  4AS9 A;  2XAB A;  2WI6 A;  4YKT A;  3O2F A;  4XCJ A;  2Q8F A;  2CG9 A;  4DUH A;  1Y4U A;  2IWX A;  2PNR A;  2CCU A;  4YKY A;  4ASA A;  5FNC A;  2YGF A;  3G75 A;  4L8Z A;  1TBW A;  3HYZ A;  3ZXO A;  2ZBK B;  3OMU A;  2XJG A;  1NHI A;  5CTU A;  4CWP A;  4L90 A;  2H8M A;  2O1W A;  5M4M A;  5CF0 A;  3U67 A;  1AMW A;  4EFT A;  1B62 A;  1NHH A;  2BU8 A;  1GKX A;  3RLQ A;  3LPS A;  3R4O A;  2XHX A;  2YGA A;  4B6C A;  4EGH A;  3QDD A;  2FWZ A;  4YKU A;  4HYP A;  4KSG A;  3FT8 A;  4PU9 A;  2Q8G A;  3R4P A;  1ZXN A;  4ZKI A;  2YEE A;  3O0I A;  2YEC A;  1Z59 A;  2CH4 A;  4GQT A;  4CWQ A;  1UYK A;  1UYH A;  1Y8P A;  3Q5K A;  1YET A;  2YEH A;  3A0W A;  2IOP A;  2WI7 A;  2IOR A;  2YKE A;  3A0Z A;  1S16 A;  3EHJ A;  5F5R A;  4CWS A;  2IWS A;  4AWQ A;  1Z5A A;  4XDM A;  4GEE A;  4WUB A;  2JJC A;  2YEJ A;  4HZ5 A;  5CPH A;  4BIZ A;  2YI5 A;  3B24 A;  4CE2 A;  1UYM A;  3H4L A;  4YKQ A;  3TUH A;  2WI2 A;  3A0T A;  3D36 A;  3K97 A;  3R4N A;  1Z5C A;  4B7P A;  1UYG A;  2XJX A;  4EEH A;  3OW6 A;  2BRE A;  4MPE A;  3O6O A;  4WUD A;  4H85 A;  3VHD A;  4O04 A;  4BQJ A;  2H55 A;  2WEP A;  3A0Y A;  4ASF A;  4AWP A;  4FMT A;  3TZ5 A;  2JKI A;  4X9L A;  4R3A A;  1L0O A;  3B26 A;  1TH8 A;  3RKZ A;  1AM1 A;  1ZWH A;  2BZ5 A; 
#chains in the Genus database with same CATH topology
 1MX0 A;  4EGI A;  4MPN A;  3T0H A;  2IOQ A;  1IXM A;  1H7S A;  4I3H A;  2VCJ A;  1EA6 A;  5M4E A;  4E01 A;  2Q2E B;  5D6Q A;  4KSH A;  4URN A;  3D0B A;  4HY6 A;  4FCR A;  1GKZ A;  3PEH A;  1F51 A;  4XKA A;  4JAS A;  1UY7 A;  2XX5 A;  1EI1 A;  2YED A;  2YE9 A;  4U7N A;  1BXD A;  4E00 A;  3INW A;  3B25 A;  5IN9 A;  4XCL A;  4HXZ A;  2YE3 A;  2WEQ A;  2ZDY A;  4JAU A;  2YE6 A;  5M4N A;  4KTN A;  2BYI A;  4GCZ A;  4CWF A;  3EKO A;  4XKO A;  2YEB A;  4GGL A;  3PEJ A;  4QPK A;  1I5C A;  2C2A A;  2BU2 A;  2FWY A;  4PRX A;  2BYH A;  2C1G A;  3U2D A;  1Y8O A;  3CRK A;  4QPJ A;  5M4K A;  4U7O A;  4EM7 A;  5FWK A;  4FCP A;  1YSZ A;  4V26 A;  4L93 A;  3HYY A;  5J71 A;  4MBC A;  5C93 A;  4BQG A;  4LWI A;  3K98 A;  4H81 A;  4MP2 A;  4NH7 A;  1Z5B A;  2YE4 A;  2ZKJ A;  4P8O A;  2YEF A;  2QFO A;  2XDL A;  1OSF A;  2EXL A;  3EHG A;  1YC3 A;  1YC1 A;  2O1U A;  3B28 A;  3CGY A;  1BYQ A;  3VAD A;  4YKX A;  4URO A;  4LPB A;  1KIJ A;  2HHI A;  1Y8N A;  2BT0 A;  4R3M A;  3S5T A;  1JM6 A;  1ZW9 A;  5M4P A;  4HZ0 A;  1UYD A;  4URL A;  2K5B A;  3CGZ A;  3OWB A;  3CRL A;  4CE1 A;  5L3J A;  3INX A;  3HZ1 A;  2YE2 A;  1UY8 A;  2XHR A;  1AH8 A;  1UYC A;  2XX2 A;  1B63 A;  2ZDX A;  3GIF A;  1I59 A;  1QY8 A;  2BSM A;  4GT8 A;  4BXI A;  1YC4 A;  3R91 A;  4I5S A;  3H80 A;  2BU7 A;  4FCQ A;  3MNR P;  1MU5 A;  4XC0 A;  4FPP A;  1I5D A;  2HG1 A;  4EMV A;  3JZ3 A;  1GJV A;  2XDX A;  2WI4 A;  1UYE A;  2GQP A;  2FXS A;  2YKJ A;  4P7A A;  3HHU A;  4R1F A;  1US7 A;  2YE7 A;  4O09 A;  4HXW A;  2XX4 A;  1BKN A;  3EHH A;  1NHJ A;  2YI6 A;  2YEA A;  5BOC A;  1TIL A;  3CYG A;  3OPD A;  4E02 A;  3RLR A;  2E0A A;  5FNF A;  3BM9 A;  3R4M A;  4V25 A;  1AJ6 A;  1YSR A;  4LWG A;  2ESA A;  1TC6 A;  2CCS A;  4U93 A;  1UYF A;  4MP7 A;  2Q8H A;  2VW5 A;  4HY1 A;  4K4O A;  2XHT A;  5D6P A;  1QZR A;  1I5A A;  2XDS A;  4LWH A;  3RLP A;  3TZ2 A;  4WUC A;  2Q8I A;  3NMQ A;  3G7B A;  4XIT A;  4O0B A;  5F3K A;  1QYE A;  1S14 A;  2YK2 A;  3CWV A;  2GFD A;  1ZXM A;  2O1V A;  3U2K A;  4EFU A;  2YKC A;  4Q20 A;  4ASB A;  4AWO A;  2WI3 A;  3LNU A;  4CWT A;  5JEN A;  4KFG A;  2VCI A;  4XE2 A;  1U0Z A;  3K99 A;  4YKR A;  2XDU A;  1AH6 A;  3OWD A;  5BOD A;  1ID0 A;  4MPC A;  5M4H A;  4XTJ A;  3HEK A;  2CCT A;  3TZ0 A;  3G7E A;  3T1K A;  2YJX A;  3FV5 A;  3T2S A;  4KQV A;  1KZN A;  3HZ5 A;  3Q5L A;  2BTZ A;  3WQ9 A;  4XKK A;  2VWC A;  2YK9 A;  4ZVI A;  5J6A A;  3R92 A;  1I58 A;  4GFN A;  1YT0 A;  4JAV A;  2YEI A;  3TTZ A;  3ZM7 A;  2QG2 A;  2XK2 A;  4URM A;  2FTK A;  1YT2 A;  4HYM A;  4LP0 A;  2IWU A;  4XIP A;  3QTF A;  4BAE A;  2YJW A;  3EHF A;  4XIR A;  2YI0 A;  2CGF A;  3IED A;  5GGZ A;  2YKB A;  3T10 A;  2XDK A;  1YES A;  3C0E A;  1PVG A;  2FYP A;  1I5B A;  2HCH A;  2YKI A;  3WHA A;  5D7R A;  4BIU A;  1Y4S A;  2QF6 A;  4XIQ A;  4JQL A;  3VHC A;  1TID A;  2UWD A;  3KE6 A;  3T0Z A;  3EKR A;  4CWR A;  4CWO A;  5D7D A;  5D7C A;  1UY6 A;  1A4H A;  1H7U A;  3B27 A;  3Q5J A;  5CTX A;  1TC0 A;  1UYL A;  2YEG A;  2BU6 A;  2WI5 A;  4O05 A;  4PL9 A;  2XD6 A;  4EGK A;  5IDM A;  4MOT A;  1UY9 A;  2HKJ A;  4MB9 A;  4DZY A;  4XD8 A;  2YGE A;  4LWE A;  2WI1 A;  3A0R A;  1UYI A;  3GIE A;  2C1I A;  3ZKD A;  3ZKB A;  2BRC A;  2XJJ A;  2YE8 A;  1B3Q A;  2AKP A;  2YI7 A;  2BU5 A;  1YER A;  1U2O A;  4CWN A;  2YE5 A;  4O07 A;  3GIG A;  3ZXQ A;  2QG0 A;  5CTY A;  1R62 A;  4L91 A;  4YKZ A;  2XCM A;  4YKW A;  3GIG B;  4ASG A;  3SL2 A;  4NH9 A;  3BMY A;  5IDJ A;  2WER A;  1BGQ A;  3C11 A;  4KP4 A;  5FND A;  3VHA A;  3DGE A;  5CTW A;  4LWF A;  3TZ4 A;  4CE3 A;  3LMM A;  4L94 A;  3A0X A;  3D2R A;  4W7T A;  1THN A;  3FT5 A;  1YT1 A;  4PRV A;  1YS3 A;  4H7Q A;  3K60 A;  4NH8 A;  4AS9 A;  2XAB A;  2WI6 A;  4YKT A;  3O2F A;  4XCJ A;  2Q8F A;  2CG9 A;  4DUH A;  1Y4U A;  2IWX A;  2PNR A;  2CCU A;  4YKY A;  4ASA A;  5FNC A;  2YGF A;  3G75 A;  4L8Z A;  1TBW A;  3HYZ A;  3ZXO A;  2ZBK B;  3OMU A;  2XJG A;  1NHI A;  5CTU A;  4CWP A;  4L90 A;  2H8M A;  2O1W A;  5M4M A;  5CF0 A;  3U67 A;  1AMW A;  4EFT A;  1B62 A;  1NHH A;  2BU8 A;  1GKX A;  3RLQ A;  3LPS A;  3R4O A;  2XHX A;  2YGA A;  4B6C A;  4EGH A;  3QDD A;  2FWZ A;  4YKU A;  4HYP A;  4KSG A;  3FT8 A;  4PU9 A;  2Q8G A;  3R4P A;  1ZXN A;  4ZKI A;  2YEE A;  3O0I A;  2YEC A;  1Z59 A;  2CH4 A;  4GQT A;  4CWQ A;  1UYK A;  1UYH A;  1Y8P A;  3Q5K A;  4E72 A;  1YET A;  2YEH A;  3A0W A;  2IOP A;  2WI7 A;  2IOR A;  2YKE A;  3A0Z A;  1S16 A;  3EHJ A;  5F5R A;  4CWS A;  2IWS A;  4AWQ A;  1Z5A A;  4XDM A;  4GEE A;  4WUB A;  2JJC A;  2YEJ A;  4HZ5 A;  5CPH A;  4BIZ A;  2YI5 A;  3B24 A;  4CE2 A;  1UYM A;  3H4L A;  4YKQ A;  3TUH A;  2WI2 A;  3A0T A;  3D36 A;  3K97 A;  3R4N A;  1Z5C A;  4B7P A;  1UYG A;  2XJX A;  4EEH A;  3OW6 A;  2BRE A;  4MPE A;  3O6O A;  4WUD A;  4H85 A;  3VHD A;  4O04 A;  4BQJ A;  2H55 A;  2WEP A;  3A0Y A;  4ASF A;  4AWP A;  4FMT A;  3TZ5 A;  2JKI A;  4X9L A;  4R3A A;  1L0O A;  3B26 A;  1TH8 A;  3RKZ A;  1AM1 A;  1ZWH A;  2BZ5 A; 
#chains in the Genus database with same CATH homology
 1MX0 A;  4EGI A;  4MPN A;  3T0H A;  2IOQ A;  1H7S A;  4I3H A;  2VCJ A;  1EA6 A;  5M4E A;  4E01 A;  2Q2E B;  5D6Q A;  4KSH A;  4URN A;  3D0B A;  4HY6 A;  4FCR A;  1GKZ A;  3PEH A;  4XKA A;  4JAS A;  1UY7 A;  2XX5 A;  1EI1 A;  2YED A;  2YE9 A;  4U7N A;  1BXD A;  4E00 A;  3INW A;  3B25 A;  5IN9 A;  4XCL A;  4HXZ A;  2YE3 A;  2WEQ A;  2ZDY A;  4JAU A;  2YE6 A;  5M4N A;  4KTN A;  2BYI A;  4GCZ A;  4CWF A;  3EKO A;  4XKO A;  2YEB A;  4GGL A;  3PEJ A;  4QPK A;  1I5C A;  2C2A A;  2BU2 A;  2FWY A;  4PRX A;  2BYH A;  3U2D A;  1Y8O A;  3CRK A;  4QPJ A;  5M4K A;  4U7O A;  4EM7 A;  5FWK A;  4FCP A;  1YSZ A;  4V26 A;  4L93 A;  3HYY A;  5J71 A;  4MBC A;  5C93 A;  4BQG A;  4LWI A;  3K98 A;  4H81 A;  4MP2 A;  4NH7 A;  1Z5B A;  2YE4 A;  2ZKJ A;  4P8O A;  2YEF A;  2QFO A;  2XDL A;  1OSF A;  2EXL A;  3EHG A;  1YC3 A;  1YC1 A;  2O1U A;  3B28 A;  3CGY A;  1BYQ A;  3VAD A;  4YKX A;  4URO A;  4LPB A;  1KIJ A;  1Y8N A;  2BT0 A;  4R3M A;  1JM6 A;  1ZW9 A;  5M4P A;  4HZ0 A;  1UYD A;  4URL A;  2K5B A;  3CGZ A;  3OWB A;  3CRL A;  4CE1 A;  5L3J A;  3INX A;  3HZ1 A;  2YE2 A;  1UY8 A;  2XHR A;  1AH8 A;  1UYC A;  2XX2 A;  1B63 A;  2ZDX A;  3GIF A;  1I59 A;  1QY8 A;  2BSM A;  4GT8 A;  4BXI A;  1YC4 A;  3R91 A;  4I5S A;  3H80 A;  2BU7 A;  4FCQ A;  3MNR P;  1MU5 A;  4XC0 A;  4FPP A;  1I5D A;  2HG1 A;  4EMV A;  3JZ3 A;  1GJV A;  2XDX A;  2WI4 A;  1UYE A;  2GQP A;  2FXS A;  2YKJ A;  4P7A A;  3HHU A;  4R1F A;  1US7 A;  2YE7 A;  4O09 A;  4HXW A;  2XX4 A;  1BKN A;  3EHH A;  1NHJ A;  2YI6 A;  2YEA A;  5BOC A;  1TIL A;  3OPD A;  4E02 A;  3RLR A;  2E0A A;  5FNF A;  3BM9 A;  3R4M A;  4V25 A;  1AJ6 A;  1YSR A;  4LWG A;  2ESA A;  1TC6 A;  2CCS A;  4U93 A;  1UYF A;  4MP7 A;  2Q8H A;  2VW5 A;  4HY1 A;  4K4O A;  2XHT A;  5D6P A;  1QZR A;  1I5A A;  2XDS A;  4LWH A;  3RLP A;  3TZ2 A;  4WUC A;  2Q8I A;  3NMQ A;  3G7B A;  4XIT A;  4O0B A;  5F3K A;  1QYE A;  1S14 A;  2YK2 A;  3CWV A;  2GFD A;  1ZXM A;  2O1V A;  3U2K A;  4EFU A;  2YKC A;  4Q20 A;  4ASB A;  4AWO A;  2WI3 A;  3LNU A;  4CWT A;  4KFG A;  2VCI A;  4XE2 A;  1U0Z A;  3K99 A;  4YKR A;  2XDU A;  1AH6 A;  3OWD A;  5BOD A;  1ID0 A;  4MPC A;  5M4H A;  4XTJ A;  3HEK A;  2CCT A;  3TZ0 A;  3G7E A;  3T1K A;  2YJX A;  3FV5 A;  3T2S A;  4KQV A;  1KZN A;  3HZ5 A;  3Q5L A;  2BTZ A;  3WQ9 A;  4XKK A;  2VWC A;  2YK9 A;  4ZVI A;  5J6A A;  3R92 A;  1I58 A;  4GFN A;  1YT0 A;  4JAV A;  2YEI A;  3TTZ A;  3ZM7 A;  2QG2 A;  2XK2 A;  4URM A;  1YT2 A;  4HYM A;  4LP0 A;  2IWU A;  4XIP A;  3QTF A;  4BAE A;  2YJW A;  3EHF A;  4XIR A;  2YI0 A;  2CGF A;  3IED A;  5GGZ A;  2YKB A;  3T10 A;  2XDK A;  1YES A;  3C0E A;  1PVG A;  2FYP A;  1I5B A;  2HCH A;  2YKI A;  3WHA A;  5D7R A;  4BIU A;  1Y4S A;  2QF6 A;  4XIQ A;  4JQL A;  3VHC A;  1TID A;  2UWD A;  3KE6 A;  3T0Z A;  3EKR A;  4CWR A;  4CWO A;  5D7D A;  5D7C A;  1UY6 A;  1A4H A;  1H7U A;  3B27 A;  3Q5J A;  5CTX A;  1TC0 A;  1UYL A;  2YEG A;  2BU6 A;  2WI5 A;  4O05 A;  4PL9 A;  2XD6 A;  4EGK A;  5IDM A;  4MOT A;  1UY9 A;  2HKJ A;  4MB9 A;  4DZY A;  4XD8 A;  2YGE A;  4LWE A;  2WI1 A;  3A0R A;  1UYI A;  3GIE A;  3ZKD A;  3ZKB A;  2BRC A;  2XJJ A;  2YE8 A;  1B3Q A;  2AKP A;  2YI7 A;  2BU5 A;  1YER A;  1U2O A;  4CWN A;  2YE5 A;  4O07 A;  3GIG A;  3ZXQ A;  2QG0 A;  5CTY A;  1R62 A;  4L91 A;  4YKZ A;  2XCM A;  4YKW A;  3GIG B;  4ASG A;  3SL2 A;  4NH9 A;  3BMY A;  5IDJ A;  2WER A;  1BGQ A;  3C11 A;  4KP4 A;  5FND A;  3VHA A;  3DGE A;  5CTW A;  4LWF A;  3TZ4 A;  4CE3 A;  4L94 A;  3A0X A;  3D2R A;  4W7T A;  1THN A;  3FT5 A;  1YT1 A;  4PRV A;  1YS3 A;  4H7Q A;  3K60 A;  4NH8 A;  4AS9 A;  2XAB A;  2WI6 A;  4YKT A;  3O2F A;  4XCJ A;  2Q8F A;  2CG9 A;  4DUH A;  1Y4U A;  2IWX A;  2PNR A;  2CCU A;  4YKY A;  4ASA A;  5FNC A;  2YGF A;  3G75 A;  4L8Z A;  1TBW A;  3HYZ A;  3ZXO A;  2ZBK B;  3OMU A;  2XJG A;  1NHI A;  5CTU A;  4CWP A;  4L90 A;  2H8M A;  2O1W A;  5M4M A;  5CF0 A;  3U67 A;  1AMW A;  4EFT A;  1B62 A;  1NHH A;  2BU8 A;  1GKX A;  3RLQ A;  3LPS A;  3R4O A;  2XHX A;  2YGA A;  4B6C A;  4EGH A;  3QDD A;  2FWZ A;  4YKU A;  4HYP A;  4KSG A;  3FT8 A;  4PU9 A;  2Q8G A;  3R4P A;  1ZXN A;  4ZKI A;  2YEE A;  3O0I A;  2YEC A;  1Z59 A;  2CH4 A;  4GQT A;  4CWQ A;  1UYK A;  1UYH A;  1Y8P A;  3Q5K A;  1YET A;  2YEH A;  3A0W A;  2IOP A;  2WI7 A;  2IOR A;  2YKE A;  3A0Z A;  1S16 A;  3EHJ A;  5F5R A;  4CWS A;  2IWS A;  4AWQ A;  1Z5A A;  4XDM A;  4GEE A;  4WUB A;  2JJC A;  2YEJ A;  4HZ5 A;  5CPH A;  4BIZ A;  2YI5 A;  3B24 A;  4CE2 A;  1UYM A;  3H4L A;  4YKQ A;  3TUH A;  2WI2 A;  3A0T A;  3D36 A;  3K97 A;  3R4N A;  1Z5C A;  4B7P A;  1UYG A;  2XJX A;  4EEH A;  3OW6 A;  2BRE A;  4MPE A;  3O6O A;  4WUD A;  4H85 A;  3VHD A;  4O04 A;  4BQJ A;  2H55 A;  2WEP A;  3A0Y A;  4ASF A;  4AWP A;  4FMT A;  3TZ5 A;  2JKI A;  4X9L A;  4R3A A;  1L0O A;  3B26 A;  1TH8 A;  3RKZ A;  1AM1 A;  1ZWH A;  2BZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...