4KSHA

Dna gyrase atp binding domain of enterococcus faecalis in complex with a small molecule inhibitor (7-({4-[(3r)-3-aminopyrrolidin-1-yl]-5-chloro-6-ethyl-7h-pyrrolo[2,3-d]pyrimidin-2-yl}sulfanyl)-1,5-naphthyridin-1(4h)-ol)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
193
Chain Sequence
GLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLHGVGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAVVDDLKVIEETDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new class of type iia topoisomerase inhibitors with broad-spectrum antibacterial activity
rcsb
source organism Enterococcus faecalis
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 59
structure length 193
sequence length 210
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4kshA00
4AS9A 5CTUA 4AWOA 1BGQA 3R4NA 3GIGA 4XCJA 4KFGA 4FCPA 2YI6A 4HZ5A 1YERA 1PVGA 1ZWHA 3PEHA 3B27A 4CWTA 4XIPA 3T1KA 1YC1A 2JJCA 4KP4A 1H7UA 2BT0A 3QDDA 2IOPA 1MU5A 4WUBA 2YE9A 4MB9A 2WEQA 3ZKBA 3RLQA 1UYFA 4LWIA 3OPDA 3R4PA 3CGZA 2C2AA 4U7NA 4LWGA 4EGKA 2WI3A 3VHAA 1US7A 2WI4A 2YKIA 3A0YA 4XD8A 1Z5AA 2QF6A 2YKJA 5GGZA 5CF0A 2GQPA 5M4NA 2BRCA 1QYEA 1U0ZA 4GQTA 5D7DA 4KQVA 1TBWA 3FV5A 3VHCA 5IDMA 2IOQA 3B24A 2XX5A 2HG1A 1OSFA 3VHDA 2XJXA 1Y4SA 4LWHA 3FT5A 1B62A 4DUHA 1UY6A 3HZ1A 4YKWA 3D36A 2HKJA 2WI6A 3HYZA 5M4HA 1U2OA 4O07A 4URNA 4KTNA 1YS3A 3ZXQA 1AH6A 2Q8FA 3K60A 4MBCA 3T0HA 4EGHA 2XDKA 3BM9A 2JKIA 2QG2A 4H7QA 3WHAA 3T0ZA 2AKPA 5CPHA 2O1WA 2Q8GA 1BXDA 1TC0A 3U67A 5FNDA 4XKOA 1UYDA 2XABA 4XITA 3LNUA 3H4LA 3G7EA 2BU5A 3BMYA 2YEFA 3HHUA 3O6OA 2XDSA 2VWCA 4BQGA 2ZBKB 4LPBA 1BKNA 4H81A 1UYHA 3GIGB 4GGLA 4LP0A 2XHTA 1Y8PA 2YKEA 4I3HA 1UYEA 4GT8A 2CGFA 4XCLA 4I5SA 4AWQA 1I5BA 4R1FA 2WI5A 3O0IA 1EI1A 4HY1A 5C93A 5F3KA 4E01A 2BU8A 5FNFA 4PRVA 2YEEA 1H7SA 3SL2A 5M4KA 1AM1A 2WI1A 4BXIA 2XCMA 1I5CA 2QG0A 2YEBA 2YI7A 2YI0A 4DZYA 5F5RA 1Y8NA 3QTFA 3D0BA 4FCRA 4EGIA 1AJ6A 4YKXA 1YT0A 2YE5A 1TC6A 4U93A 2O1VA 5D7CA 4HY6A 3B26A 1I5AA 5IDJA 2XJJA 1ZXNA 2XK2A 3A0ZA 2YGEA 1ID0A 2XHRA 1YC4A 4WUDA 2YK2A 3A0TA 1YC3A 4YKYA 2YJXA 1ZW9A 3TZ2A 2YEIA 4MP7A 4QPJA 3NMQA 4CWRA 2BU2A 2YECA 4BIUA 4LWEA 1KIJA 1NHIA 5J6AA 2GFDA 4BIZA 3LPSA 2VCIA 3K99A 3CRLA 1Z5BA 3B25A 4NH8A 2YKBA 4MPCA 3WQ9A 2IORA 4ASBA 3ZXOA 3HYYA 2BSMA 1QZRA 1KZNA 4L90A 1I5DA 4PL9A 3TZ0A 4B6CA 3U2KA 2BTZA 2E0AA 2YE7A 4BQJA 4V25A 4BAEA 2IWXA 1GJVA 5BODA 4FPPA 2YEDA 4HYMA 3RKZA 4JAVA 1I59A 1Z59A 2WERA 3B28A 1Y8OA 3H80A 4WUCA 4L94A 4ZVIA 2BYHA 3K98A 2YE2A 4NH9A 3TUHA 3O2FA 3G7BA 4K4OA 3DGEA 3R92A 3HZ5A 3Q5JA 4EEHA 5M4PA 3C11A 2YEJA 4XIRA 3TTZA 3HEKA 4LWFA 4R3AA 4CWQA 2Q8IA 3EHJA 2YJWA 4O0BA 3VADA 1UYCA 2ZDXA 4V26A 2ESAA 4HZ0A 2XX2A 4CWNA 1YESA 3PEJA 2WEPA 4XTJA 2IWUA 2XDXA 4X9LA 4UROA 3FT8A 4XE2A 3A0WA 4HXWA 4GEEA 2YKCA 4O04A 2PNRA 4URMA 4R3MA 3EHHA 4JQLA 5D6PA 4KSHA 3G75A 2XDUA 3TZ5A 2HCHA 1TILA 1NHJA 1THNA 2FXSA 2VCJA 2Q2EB 4E00A 4CWPA 1YSRA 2YEGA 5M4MA 3RLPA 3D2RA 1MX0A 3KE6A 2XX4A 3Q5LA 4L93A 4P7AA 2YEAA 2O1UA 1UY8A 4MPNA 4AWPA 2QFOA 3R91A 1B63A 3CWVA 4ASFA 3EHGA 4O09A 4ASGA 1L0OA 1A4HA 1S14A 4MP2A 1I58A 3EKOA 4PRXA 5J71A 4GFNA 5M4EA 2YE3A 3OW6A 4KSGA 3INXA 2Q8HA 1QY8A 3U2DA 4JAUA 4NH7A 4FMTA 5CTXA 1UY9A 4L8ZA 3A0XA 4CE3A 4YKQA 5L3JA 2FYPA 1B3QA 2WI2A 3RLRA 5D6QA 4CWSA 4PU9A 2YI5A 4U7OA 2BZ5A 3JZ3A 1TIDA 4EM7A 4YKZA 2H8MA 4EFUA 2CCUA 2YE8A 1UYIA 4XKKA 1YETA 4CWFA 1Y4UA 4MPEA 3ZKDA 2BYIA 4CE1A 2IWSA 5CTYA 4YKUA 2CG9A 1AH8A 2YGFA 4ASAA 2VW5A 4YKRA 2BU7A 4QPKA 2ZDYA 4HXZA 4CWOA 5FNCA 2YGAA 1EA6A 1UY7A 2CCSA 2H55A 3R4MA 4XC0A 3Q5KA 4CE2A 3EHFA 1GKXA 1NHHA 4L91A 3OWBA 4W7TA 4P8OA 1YSZA 1YT1A 2YEHA 3GIFA 4EFTA 4EMVA 1UYGA 3T10A 3GIEA 4GCZA 3OMUA 2K5BA 1AMWA 3K97A 5IN9A 2YE6A 3A0RA 3OWDA 3R4OA 4Q20A 1YT2A 2UWDA 1Z5CA 2YK9A 3ZM7A 4E02A 2BREA 2WI7A 2XDLA 3CRKA 2YE4A 4O05A 2XHXA 5BOCA 2FWYA 3CGYA 1BYQA 3IEDA 4FCQA 5FWKA 4XKAA 1R62A 3C0EA 1TH8A 3MNRP 4URLA 3T2SA 3EKRA 3TZ4A 4B7PA 2EXLA 5D7RA 1UYLA 5CTWA 1UYMA 3INWA 1S16A 2FWZA 1ZXMA 2CCTA 4ZKIA 2CH4A 2XJGA 1UYKA 4HYPA 4XDMA 2ZKJA 4MOTA 1JM6A 4YKTA 4H85A 1GKZA 4JASA 4XIQA 2BU6A 2XD6A
chains in the Genus database with same CATH superfamily
4AS9A 5CTUA 4AWOA 1BGQA 3R4NA 3GIGA 4XCJA 4KFGA 4FCPA 2YI6A 4HZ5A 1YERA 1PVGA 1ZWHA 3PEHA 3B27A 4CWTA 4XIPA 3T1KA 1YC1A 2JJCA 4KP4A 1H7UA 2BT0A 3QDDA 2IOPA 1MU5A 4WUBA 2YE9A 4MB9A 2WEQA 3ZKBA 3RLQA 1UYFA 4LWIA 3OPDA 3R4PA 3CGZA 2C2AA 4U7NA 4LWGA 4EGKA 2WI3A 3VHAA 1US7A 2WI4A 2YKIA 3A0YA 4XD8A 1Z5AA 2QF6A 2YKJA 5GGZA 5CF0A 2GQPA 5M4NA 2BRCA 1QYEA 1U0ZA 4GQTA 5D7DA 4KQVA 1TBWA 3FV5A 3VHCA 5IDMA 2IOQA 3B24A 2XX5A 2HG1A 1OSFA 3VHDA 2XJXA 1Y4SA 4LWHA 3FT5A 1B62A 4DUHA 1UY6A 3HZ1A 4YKWA 3D36A 2HKJA 2WI6A 3HYZA 5M4HA 1U2OA 5JENA 4O07A 4URNA 4KTNA 1YS3A 3ZXQA 1AH6A 2Q8FA 3K60A 4MBCA 3T0HA 4EGHA 2XDKA 3BM9A 2JKIA 2QG2A 4H7QA 2FTKA 3WHAA 3T0ZA 2AKPA 5CPHA 2O1WA 2Q8GA 1BXDA 1TC0A 3U67A 5FNDA 4XKOA 1UYDA 2XABA 4XITA 3LNUA 3H4LA 3G7EA 2BU5A 3BMYA 2YEFA 3HHUA 3O6OA 2XDSA 2VWCA 4BQGA 2ZBKB 4LPBA 1BKNA 4H81A 1UYHA 3GIGB 4GGLA 4LP0A 2XHTA 1Y8PA 2YKEA 4I3HA 1UYEA 4GT8A 2CGFA 4XCLA 4I5SA 4AWQA 1I5BA 4R1FA 2WI5A 3O0IA 1EI1A 4HY1A 5C93A 5F3KA 4E01A 2BU8A 5FNFA 4PRVA 2YEEA 1H7SA 3SL2A 5M4KA 1AM1A 2WI1A 4BXIA 2XCMA 1I5CA 2QG0A 2YEBA 2YI7A 2YI0A 4DZYA 5F5RA 1Y8NA 3QTFA 3D0BA 4FCRA 4EGIA 1AJ6A 4YKXA 1YT0A 2YE5A 1TC6A 4U93A 2O1VA 5D7CA 4HY6A 3B26A 1I5AA 5IDJA 2XJJA 1ZXNA 2XK2A 3A0ZA 2YGEA 1ID0A 2HHIA 2XHRA 1YC4A 4WUDA 2YK2A 3A0TA 1YC3A 4YKYA 2YJXA 1ZW9A 3TZ2A 2YEIA 4MP7A 4QPJA 3NMQA 4CWRA 2BU2A 2YECA 4BIUA 4LWEA 1KIJA 1NHIA 5J6AA 2GFDA 4BIZA 3LPSA 2VCIA 3K99A 3CRLA 1Z5BA 3B25A 4NH8A 2YKBA 4MPCA 3WQ9A 2IORA 4ASBA 3ZXOA 3HYYA 2BSMA 1QZRA 1KZNA 4L90A 1I5DA 4PL9A 3TZ0A 4B6CA 3U2KA 2BTZA 2E0AA 2YE7A 4BQJA 4V25A 4BAEA 2IWXA 1GJVA 5BODA 4FPPA 2YEDA 4HYMA 3RKZA 3LMMA 4JAVA 1I59A 1Z59A 2WERA 3B28A 1Y8OA 3H80A 4WUCA 4L94A 4ZVIA 2BYHA 3K98A 2YE2A 4NH9A 3TUHA 3O2FA 3G7BA 4K4OA 3DGEA 3R92A 3HZ5A 3Q5JA 4EEHA 5M4PA 3C11A 2YEJA 4XIRA 3TTZA 3HEKA 4LWFA 4R3AA 4CWQA 2Q8IA 3EHJA 2YJWA 4O0BA 3VADA 1UYCA 2ZDXA 4V26A 2ESAA 4HZ0A 2XX2A 4CWNA 1YESA 4E72A 3PEJA 2WEPA 4XTJA 2IWUA 2XDXA 3S5TA 4X9LA 4UROA 3FT8A 4XE2A 3A0WA 1IXMA 4HXWA 4GEEA 2YKCA 4O04A 2PNRA 4URMA 4R3MA 3EHHA 4JQLA 5D6PA 4KSHA 3G75A 2XDUA 3TZ5A 2HCHA 1TILA 1NHJA 1THNA 2FXSA 2VCJA 2Q2EB 4E00A 4CWPA 1YSRA 2YEGA 5M4MA 3RLPA 3D2RA 1MX0A 3KE6A 2XX4A 3Q5LA 4L93A 4P7AA 2YEAA 2O1UA 1UY8A 4MPNA 4AWPA 2QFOA 2C1IA 3R91A 1B63A 3CWVA 4ASFA 3EHGA 4O09A 4ASGA 1L0OA 1A4HA 1S14A 4MP2A 1I58A 3EKOA 4PRXA 5J71A 4GFNA 5M4EA 2YE3A 3OW6A 4KSGA 3INXA 2Q8HA 1QY8A 3U2DA 4JAUA 4NH7A 4FMTA 5CTXA 1UY9A 4L8ZA 3A0XA 4CE3A 4YKQA 5L3JA 2FYPA 1B3QA 2WI2A 3RLRA 5D6QA 4CWSA 4PU9A 2YI5A 4U7OA 2BZ5A 3JZ3A 1TIDA 4EM7A 4YKZA 2H8MA 4EFUA 2CCUA 2YE8A 1UYIA 4XKKA 1YETA 4CWFA 1Y4UA 2C1GA 4MPEA 3ZKDA 2BYIA 4CE1A 2IWSA 5CTYA 4YKUA 2CG9A 1AH8A 2YGFA 4ASAA 2VW5A 4YKRA 2BU7A 4QPKA 2ZDYA 4HXZA 4CWOA 5FNCA 2YGAA 1EA6A 1UY7A 2CCSA 2H55A 3R4MA 4XC0A 3Q5KA 4CE2A 3EHFA 1GKXA 1NHHA 4L91A 3OWBA 4W7TA 4P8OA 1YSZA 1YT1A 2YEHA 3GIFA 4EFTA 4EMVA 1UYGA 3T10A 3GIEA 4GCZA 3OMUA 2K5BA 1AMWA 3K97A 5IN9A 2YE6A 3A0RA 3OWDA 3R4OA 4Q20A 1YT2A 2UWDA 1Z5CA 2YK9A 3ZM7A 4E02A 2BREA 2WI7A 2XDLA 3CRKA 2YE4A 4O05A 2XHXA 5BOCA 2FWYA 1F51A 3CGYA 1BYQA 3IEDA 4FCQA 5FWKA 4XKAA 1R62A 3C0EA 1TH8A 3MNRP 4URLA 3T2SA 3EKRA 3TZ4A 4B7PA 2EXLA 5D7RA 1UYLA 5CTWA 1UYMA 3INWA 3CYGA 1S16A 2FWZA 1ZXMA 2CCTA 4ZKIA 2CH4A 2XJGA 1UYKA 4HYPA 4XDMA 2ZKJA 4MOTA 1JM6A 4YKTA 4H85A 1GKZA 4JASA 4XIQA 2BU6A 2XD6A
chains in the Genus database with same CATH topology
4AS9A 5CTUA 4AWOA 1BGQA 3R4NA 3GIGA 4XCJA 4KFGA 4FCPA 2YI6A 4HZ5A 1YERA 1PVGA 1ZWHA 3PEHA 3B27A 4CWTA 4XIPA 3T1KA 1YC1A 2JJCA 4KP4A 1H7UA 2BT0A 3QDDA 2IOPA 1MU5A 4WUBA 2YE9A 4MB9A 2WEQA 3ZKBA 3RLQA 1UYFA 4LWIA 3OPDA 3R4PA 3CGZA 2C2AA 4U7NA 4LWGA 4EGKA 2WI3A 3VHAA 1US7A 2WI4A 2YKIA 3A0YA 4XD8A 1Z5AA 2QF6A 2YKJA 5GGZA 5CF0A 2GQPA 5M4NA 2BRCA 1QYEA 1U0ZA 4GQTA 5D7DA 4KQVA 1TBWA 3FV5A 3VHCA 5IDMA 2IOQA 3B24A 2XX5A 2HG1A 1OSFA 3VHDA 2XJXA 1Y4SA 4LWHA 3FT5A 1B62A 4DUHA 1UY6A 3HZ1A 4YKWA 3D36A 2HKJA 2WI6A 3HYZA 5M4HA 1U2OA 4O07A 4URNA 4KTNA 1YS3A 3ZXQA 1AH6A 2Q8FA 3K60A 4MBCA 3T0HA 4EGHA 2XDKA 3BM9A 2JKIA 2QG2A 4H7QA 3WHAA 3T0ZA 2AKPA 5CPHA 2O1WA 2Q8GA 1BXDA 1TC0A 3U67A 5FNDA 4XKOA 1UYDA 2XABA 4XITA 3LNUA 3H4LA 3G7EA 2BU5A 3BMYA 2YEFA 3HHUA 3O6OA 2XDSA 2VWCA 4BQGA 2ZBKB 4LPBA 1BKNA 4H81A 1UYHA 3GIGB 4GGLA 4LP0A 2XHTA 1Y8PA 2YKEA 4I3HA 1UYEA 4GT8A 2CGFA 4XCLA 4I5SA 4AWQA 1I5BA 4R1FA 2WI5A 3O0IA 1EI1A 4HY1A 5C93A 5F3KA 4E01A 2BU8A 5FNFA 4PRVA 2YEEA 1H7SA 3SL2A 5M4KA 1AM1A 2WI1A 4BXIA 2XCMA 1I5CA 2QG0A 2YEBA 2YI7A 2YI0A 4DZYA 5F5RA 1Y8NA 3QTFA 3D0BA 4FCRA 4EGIA 1AJ6A 4YKXA 1YT0A 2YE5A 1TC6A 4U93A 2O1VA 5D7CA 4HY6A 3B26A 1I5AA 5IDJA 2XJJA 1ZXNA 2XK2A 3A0ZA 2YGEA 1ID0A 2XHRA 1YC4A 4WUDA 2YK2A 3A0TA 1YC3A 4YKYA 2YJXA 1ZW9A 3TZ2A 2YEIA 4MP7A 4QPJA 3NMQA 4CWRA 2BU2A 2YECA 4BIUA 4LWEA 1KIJA 1NHIA 5J6AA 2GFDA 4BIZA 3LPSA 2VCIA 3K99A 3CRLA 1Z5BA 3B25A 4NH8A 2YKBA 4MPCA 3WQ9A 2IORA 4ASBA 3ZXOA 3HYYA 2BSMA 1QZRA 1KZNA 4L90A 1I5DA 4PL9A 3TZ0A 4B6CA 3U2KA 2BTZA 2E0AA 2YE7A 4BQJA 4V25A 4BAEA 2IWXA 1GJVA 5BODA 4FPPA 2YEDA 4HYMA 3RKZA 4JAVA 1I59A 1Z59A 2WERA 3B28A 1Y8OA 3H80A 4WUCA 4L94A 4ZVIA 2BYHA 3K98A 2YE2A 4NH9A 3TUHA 3O2FA 3G7BA 4K4OA 3DGEA 3R92A 3HZ5A 3Q5JA 4EEHA 5M4PA 3C11A 2YEJA 4XIRA 3TTZA 3HEKA 4LWFA 4R3AA 4CWQA 2Q8IA 3EHJA 2YJWA 4O0BA 3VADA 1UYCA 2ZDXA 4V26A 2ESAA 4HZ0A 2XX2A 4CWNA 1YESA 3PEJA 2WEPA 4XTJA 2IWUA 2XDXA 4X9LA 4UROA 3FT8A 4XE2A 3A0WA 4HXWA 4GEEA 2YKCA 4O04A 2PNRA 4URMA 4R3MA 3EHHA 4JQLA 5D6PA 4KSHA 3G75A 2XDUA 3TZ5A 2HCHA 1TILA 1NHJA 1THNA 2FXSA 2VCJA 2Q2EB 4E00A 4CWPA 1YSRA 2YEGA 5M4MA 3RLPA 3D2RA 1MX0A 3KE6A 2XX4A 3Q5LA 4L93A 4P7AA 2YEAA 2O1UA 1UY8A 4MPNA 4AWPA 2QFOA 3R91A 1B63A 3CWVA 4ASFA 3EHGA 4O09A 4ASGA 1L0OA 1A4HA 1S14A 4MP2A 1I58A 3EKOA 4PRXA 5J71A 4GFNA 5M4EA 2YE3A 3OW6A 4KSGA 3INXA 2Q8HA 1QY8A 3U2DA 4JAUA 4NH7A 4FMTA 5CTXA 1UY9A 4L8ZA 3A0XA 4CE3A 4YKQA 5L3JA 2FYPA 1B3QA 2WI2A 3RLRA 5D6QA 4CWSA 4PU9A 2YI5A 4U7OA 2BZ5A 3JZ3A 1TIDA 4EM7A 4YKZA 2H8MA 4EFUA 2CCUA 2YE8A 1UYIA 4XKKA 1YETA 4CWFA 1Y4UA 4MPEA 3ZKDA 2BYIA 4CE1A 2IWSA 5CTYA 4YKUA 2CG9A 1AH8A 2YGFA 4ASAA 2VW5A 4YKRA 2BU7A 4QPKA 2ZDYA 4HXZA 4CWOA 5FNCA 2YGAA 1EA6A 1UY7A 2CCSA 2H55A 3R4MA 4XC0A 3Q5KA 4CE2A 3EHFA 1GKXA 1NHHA 4L91A 3OWBA 4W7TA 4P8OA 1YSZA 1YT1A 2YEHA 3GIFA 4EFTA 4EMVA 1UYGA 3T10A 3GIEA 4GCZA 3OMUA 2K5BA 1AMWA 3K97A 5IN9A 2YE6A 3A0RA 3OWDA 3R4OA 4Q20A 1YT2A 2UWDA 1Z5CA 2YK9A 3ZM7A 4E02A 2BREA 2WI7A 2XDLA 3CRKA 2YE4A 4O05A 2XHXA 5BOCA 2FWYA 3CGYA 1BYQA 3IEDA 4FCQA 5FWKA 4XKAA 1R62A 3C0EA 1TH8A 3MNRP 4URLA 3T2SA 3EKRA 3TZ4A 4B7PA 2EXLA 5D7RA 1UYLA 5CTWA 1UYMA 3INWA 1S16A 2FWZA 1ZXMA 2CCTA 4ZKIA 2CH4A 2XJGA 1UYKA 4HYPA 4XDMA 2ZKJA 4MOTA 1JM6A 4YKTA 4H85A 1GKZA 4JASA 4XIQA 2BU6A 2XD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AS9 A;  5CTU A;  4AWO A;  1BGQ A;  3R4N A;  3GIG A;  4XCJ A;  4KFG A;  4FCP A;  2YI6 A;  4HZ5 A;  1YER A;  1PVG A;  1ZWH A;  3PEH A;  3B27 A;  4CWT A;  4XIP A;  3T1K A;  1YC1 A;  2JJC A;  4KP4 A;  1H7U A;  2BT0 A;  3QDD A;  2IOP A;  1MU5 A;  4WUB A;  2YE9 A;  4MB9 A;  2WEQ A;  3ZKB A;  3RLQ A;  1UYF A;  4LWI A;  3OPD A;  3R4P A;  3CGZ A;  2C2A A;  4U7N A;  4LWG A;  4EGK A;  2WI3 A;  3VHA A;  1US7 A;  2WI4 A;  2YKI A;  3A0Y A;  4XD8 A;  1Z5A A;  2QF6 A;  2YKJ A;  5GGZ A;  5CF0 A;  2GQP A;  5M4N A;  2BRC A;  1QYE A;  1U0Z A;  4GQT A;  5D7D A;  4KQV A;  1TBW A;  3FV5 A;  3VHC A;  5IDM A;  2IOQ A;  3B24 A;  2XX5 A;  2HG1 A;  1OSF A;  3VHD A;  2XJX A;  1Y4S A;  4LWH A;  3FT5 A;  1B62 A;  4DUH A;  1UY6 A;  3HZ1 A;  4YKW A;  3D36 A;  2HKJ A;  2WI6 A;  3HYZ A;  5M4H A;  1U2O A;  4O07 A;  4URN A;  4KTN A;  1YS3 A;  3ZXQ A;  1AH6 A;  2Q8F A;  3K60 A;  4MBC A;  3T0H A;  4EGH A;  2XDK A;  3BM9 A;  2JKI A;  2QG2 A;  4H7Q A;  3WHA A;  3T0Z A;  2AKP A;  5CPH A;  2O1W A;  2Q8G A;  1BXD A;  1TC0 A;  3U67 A;  5FND A;  4XKO A;  1UYD A;  2XAB A;  4XIT A;  3LNU A;  3H4L A;  3G7E A;  2BU5 A;  3BMY A;  2YEF A;  3HHU A;  3O6O A;  2XDS A;  2VWC A;  4BQG A;  2ZBK B;  4LPB A;  1BKN A;  4H81 A;  1UYH A;  3GIG B;  4GGL A;  4LP0 A;  2XHT A;  1Y8P A;  2YKE A;  4I3H A;  1UYE A;  4GT8 A;  2CGF A;  4XCL A;  4I5S A;  4AWQ A;  1I5B A;  4R1F A;  2WI5 A;  3O0I A;  1EI1 A;  4HY1 A;  5C93 A;  5F3K A;  4E01 A;  2BU8 A;  5FNF A;  4PRV A;  2YEE A;  1H7S A;  3SL2 A;  5M4K A;  1AM1 A;  2WI1 A;  4BXI A;  2XCM A;  1I5C A;  2QG0 A;  2YEB A;  2YI7 A;  2YI0 A;  4DZY A;  5F5R A;  1Y8N A;  3QTF A;  3D0B A;  4FCR A;  4EGI A;  1AJ6 A;  4YKX A;  1YT0 A;  2YE5 A;  1TC6 A;  4U93 A;  2O1V A;  5D7C A;  4HY6 A;  3B26 A;  1I5A A;  5IDJ A;  2XJJ A;  1ZXN A;  2XK2 A;  3A0Z A;  2YGE A;  1ID0 A;  2XHR A;  1YC4 A;  4WUD A;  2YK2 A;  3A0T A;  1YC3 A;  4YKY A;  2YJX A;  1ZW9 A;  3TZ2 A;  2YEI A;  4MP7 A;  4QPJ A;  3NMQ A;  4CWR A;  2BU2 A;  2YEC A;  4BIU A;  4LWE A;  1KIJ A;  1NHI A;  5J6A A;  2GFD A;  4BIZ A;  3LPS A;  2VCI A;  3K99 A;  3CRL A;  1Z5B A;  3B25 A;  4NH8 A;  2YKB A;  4MPC A;  3WQ9 A;  2IOR A;  4ASB A;  3ZXO A;  3HYY A;  2BSM A;  1QZR A;  1KZN A;  4L90 A;  1I5D A;  4PL9 A;  3TZ0 A;  4B6C A;  3U2K A;  2BTZ A;  2E0A A;  2YE7 A;  4BQJ A;  4V25 A;  4BAE A;  2IWX A;  1GJV A;  5BOD A;  4FPP A;  2YED A;  4HYM A;  3RKZ A;  4JAV A;  1I59 A;  1Z59 A;  2WER A;  3B28 A;  1Y8O A;  3H80 A;  4WUC A;  4L94 A;  4ZVI A;  2BYH A;  3K98 A;  2YE2 A;  4NH9 A;  3TUH A;  3O2F A;  3G7B A;  4K4O A;  3DGE A;  3R92 A;  3HZ5 A;  3Q5J A;  4EEH A;  5M4P A;  3C11 A;  2YEJ A;  4XIR A;  3TTZ A;  3HEK A;  4LWF A;  4R3A A;  4CWQ A;  2Q8I A;  3EHJ A;  2YJW A;  4O0B A;  3VAD A;  1UYC A;  2ZDX A;  4V26 A;  2ESA A;  4HZ0 A;  2XX2 A;  4CWN A;  1YES A;  3PEJ A;  2WEP A;  4XTJ A;  2IWU A;  2XDX A;  4X9L A;  4URO A;  3FT8 A;  4XE2 A;  3A0W A;  4HXW A;  4GEE A;  2YKC A;  4O04 A;  2PNR A;  4URM A;  4R3M A;  3EHH A;  4JQL A;  5D6P A;  4KSH A;  3G75 A;  2XDU A;  3TZ5 A;  2HCH A;  1TIL A;  1NHJ A;  1THN A;  2FXS A;  2VCJ A;  2Q2E B;  4E00 A;  4CWP A;  1YSR A;  2YEG A;  5M4M A;  3RLP A;  3D2R A;  1MX0 A;  3KE6 A;  2XX4 A;  3Q5L A;  4L93 A;  4P7A A;  2YEA A;  2O1U A;  1UY8 A;  4MPN A;  4AWP A;  2QFO A;  3R91 A;  1B63 A;  3CWV A;  4ASF A;  3EHG A;  4O09 A;  4ASG A;  1L0O A;  1A4H A;  1S14 A;  4MP2 A;  1I58 A;  3EKO A;  4PRX A;  5J71 A;  4GFN A;  5M4E A;  2YE3 A;  3OW6 A;  4KSG A;  3INX A;  2Q8H A;  1QY8 A;  3U2D A;  4JAU A;  4NH7 A;  4FMT A;  5CTX A;  1UY9 A;  4L8Z A;  3A0X A;  4CE3 A;  4YKQ A;  5L3J A;  2FYP A;  1B3Q A;  2WI2 A;  3RLR A;  5D6Q A;  4CWS A;  4PU9 A;  2YI5 A;  4U7O A;  2BZ5 A;  3JZ3 A;  1TID A;  4EM7 A;  4YKZ A;  2H8M A;  4EFU A;  2CCU A;  2YE8 A;  1UYI A;  4XKK A;  1YET A;  4CWF A;  1Y4U A;  4MPE A;  3ZKD A;  2BYI A;  4CE1 A;  2IWS A;  5CTY A;  4YKU A;  2CG9 A;  1AH8 A;  2YGF A;  4ASA A;  2VW5 A;  4YKR A;  2BU7 A;  4QPK A;  2ZDY A;  4HXZ A;  4CWO A;  5FNC A;  2YGA A;  1EA6 A;  1UY7 A;  2CCS A;  2H55 A;  3R4M A;  4XC0 A;  3Q5K A;  4CE2 A;  3EHF A;  1GKX A;  1NHH A;  4L91 A;  3OWB A;  4W7T A;  4P8O A;  1YSZ A;  1YT1 A;  2YEH A;  3GIF A;  4EFT A;  4EMV A;  1UYG A;  3T10 A;  3GIE A;  4GCZ A;  3OMU A;  2K5B A;  1AMW A;  3K97 A;  5IN9 A;  2YE6 A;  3A0R A;  3OWD A;  3R4O A;  4Q20 A;  1YT2 A;  2UWD A;  1Z5C A;  2YK9 A;  3ZM7 A;  4E02 A;  2BRE A;  2WI7 A;  2XDL A;  3CRK A;  2YE4 A;  4O05 A;  2XHX A;  5BOC A;  2FWY A;  3CGY A;  1BYQ A;  3IED A;  4FCQ A;  5FWK A;  4XKA A;  1R62 A;  3C0E A;  1TH8 A;  3MNR P;  4URL A;  3T2S A;  3EKR A;  3TZ4 A;  4B7P A;  2EXL A;  5D7R A;  1UYL A;  5CTW A;  1UYM A;  3INW A;  1S16 A;  2FWZ A;  1ZXM A;  2CCT A;  4ZKI A;  2CH4 A;  2XJG A;  1UYK A;  4HYP A;  4XDM A;  2ZKJ A;  4MOT A;  1JM6 A;  4YKT A;  4H85 A;  1GKZ A;  4JAS A;  4XIQ A;  2BU6 A;  2XD6 A; 
#chains in the Genus database with same CATH topology
 4AS9 A;  5CTU A;  4AWO A;  1BGQ A;  3R4N A;  3GIG A;  4XCJ A;  4KFG A;  4FCP A;  2YI6 A;  4HZ5 A;  1YER A;  1PVG A;  1ZWH A;  3PEH A;  3B27 A;  4CWT A;  4XIP A;  3T1K A;  1YC1 A;  2JJC A;  4KP4 A;  1H7U A;  2BT0 A;  3QDD A;  2IOP A;  1MU5 A;  4WUB A;  2YE9 A;  4MB9 A;  2WEQ A;  3ZKB A;  3RLQ A;  1UYF A;  4LWI A;  3OPD A;  3R4P A;  3CGZ A;  2C2A A;  4U7N A;  4LWG A;  4EGK A;  2WI3 A;  3VHA A;  1US7 A;  2WI4 A;  2YKI A;  3A0Y A;  4XD8 A;  1Z5A A;  2QF6 A;  2YKJ A;  5GGZ A;  5CF0 A;  2GQP A;  5M4N A;  2BRC A;  1QYE A;  1U0Z A;  4GQT A;  5D7D A;  4KQV A;  1TBW A;  3FV5 A;  3VHC A;  5IDM A;  2IOQ A;  3B24 A;  2XX5 A;  2HG1 A;  1OSF A;  3VHD A;  2XJX A;  1Y4S A;  4LWH A;  3FT5 A;  1B62 A;  4DUH A;  1UY6 A;  3HZ1 A;  4YKW A;  3D36 A;  2HKJ A;  2WI6 A;  3HYZ A;  5M4H A;  1U2O A;  5JEN A;  4O07 A;  4URN A;  4KTN A;  1YS3 A;  3ZXQ A;  1AH6 A;  2Q8F A;  3K60 A;  4MBC A;  3T0H A;  4EGH A;  2XDK A;  3BM9 A;  2JKI A;  2QG2 A;  4H7Q A;  2FTK A;  3WHA A;  3T0Z A;  2AKP A;  5CPH A;  2O1W A;  2Q8G A;  1BXD A;  1TC0 A;  3U67 A;  5FND A;  4XKO A;  1UYD A;  2XAB A;  4XIT A;  3LNU A;  3H4L A;  3G7E A;  2BU5 A;  3BMY A;  2YEF A;  3HHU A;  3O6O A;  2XDS A;  2VWC A;  4BQG A;  2ZBK B;  4LPB A;  1BKN A;  4H81 A;  1UYH A;  3GIG B;  4GGL A;  4LP0 A;  2XHT A;  1Y8P A;  2YKE A;  4I3H A;  1UYE A;  4GT8 A;  2CGF A;  4XCL A;  4I5S A;  4AWQ A;  1I5B A;  4R1F A;  2WI5 A;  3O0I A;  1EI1 A;  4HY1 A;  5C93 A;  5F3K A;  4E01 A;  2BU8 A;  5FNF A;  4PRV A;  2YEE A;  1H7S A;  3SL2 A;  5M4K A;  1AM1 A;  2WI1 A;  4BXI A;  2XCM A;  1I5C A;  2QG0 A;  2YEB A;  2YI7 A;  2YI0 A;  4DZY A;  5F5R A;  1Y8N A;  3QTF A;  3D0B A;  4FCR A;  4EGI A;  1AJ6 A;  4YKX A;  1YT0 A;  2YE5 A;  1TC6 A;  4U93 A;  2O1V A;  5D7C A;  4HY6 A;  3B26 A;  1I5A A;  5IDJ A;  2XJJ A;  1ZXN A;  2XK2 A;  3A0Z A;  2YGE A;  1ID0 A;  2HHI A;  2XHR A;  1YC4 A;  4WUD A;  2YK2 A;  3A0T A;  1YC3 A;  4YKY A;  2YJX A;  1ZW9 A;  3TZ2 A;  2YEI A;  4MP7 A;  4QPJ A;  3NMQ A;  4CWR A;  2BU2 A;  2YEC A;  4BIU A;  4LWE A;  1KIJ A;  1NHI A;  5J6A A;  2GFD A;  4BIZ A;  3LPS A;  2VCI A;  3K99 A;  3CRL A;  1Z5B A;  3B25 A;  4NH8 A;  2YKB A;  4MPC A;  3WQ9 A;  2IOR A;  4ASB A;  3ZXO A;  3HYY A;  2BSM A;  1QZR A;  1KZN A;  4L90 A;  1I5D A;  4PL9 A;  3TZ0 A;  4B6C A;  3U2K A;  2BTZ A;  2E0A A;  2YE7 A;  4BQJ A;  4V25 A;  4BAE A;  2IWX A;  1GJV A;  5BOD A;  4FPP A;  2YED A;  4HYM A;  3RKZ A;  3LMM A;  4JAV A;  1I59 A;  1Z59 A;  2WER A;  3B28 A;  1Y8O A;  3H80 A;  4WUC A;  4L94 A;  4ZVI A;  2BYH A;  3K98 A;  2YE2 A;  4NH9 A;  3TUH A;  3O2F A;  3G7B A;  4K4O A;  3DGE A;  3R92 A;  3HZ5 A;  3Q5J A;  4EEH A;  5M4P A;  3C11 A;  2YEJ A;  4XIR A;  3TTZ A;  3HEK A;  4LWF A;  4R3A A;  4CWQ A;  2Q8I A;  3EHJ A;  2YJW A;  4O0B A;  3VAD A;  1UYC A;  2ZDX A;  4V26 A;  2ESA A;  4HZ0 A;  2XX2 A;  4CWN A;  1YES A;  4E72 A;  3PEJ A;  2WEP A;  4XTJ A;  2IWU A;  2XDX A;  3S5T A;  4X9L A;  4URO A;  3FT8 A;  4XE2 A;  3A0W A;  1IXM A;  4HXW A;  4GEE A;  2YKC A;  4O04 A;  2PNR A;  4URM A;  4R3M A;  3EHH A;  4JQL A;  5D6P A;  4KSH A;  3G75 A;  2XDU A;  3TZ5 A;  2HCH A;  1TIL A;  1NHJ A;  1THN A;  2FXS A;  2VCJ A;  2Q2E B;  4E00 A;  4CWP A;  1YSR A;  2YEG A;  5M4M A;  3RLP A;  3D2R A;  1MX0 A;  3KE6 A;  2XX4 A;  3Q5L A;  4L93 A;  4P7A A;  2YEA A;  2O1U A;  1UY8 A;  4MPN A;  4AWP A;  2QFO A;  2C1I A;  3R91 A;  1B63 A;  3CWV A;  4ASF A;  3EHG A;  4O09 A;  4ASG A;  1L0O A;  1A4H A;  1S14 A;  4MP2 A;  1I58 A;  3EKO A;  4PRX A;  5J71 A;  4GFN A;  5M4E A;  2YE3 A;  3OW6 A;  4KSG A;  3INX A;  2Q8H A;  1QY8 A;  3U2D A;  4JAU A;  4NH7 A;  4FMT A;  5CTX A;  1UY9 A;  4L8Z A;  3A0X A;  4CE3 A;  4YKQ A;  5L3J A;  2FYP A;  1B3Q A;  2WI2 A;  3RLR A;  5D6Q A;  4CWS A;  4PU9 A;  2YI5 A;  4U7O A;  2BZ5 A;  3JZ3 A;  1TID A;  4EM7 A;  4YKZ A;  2H8M A;  4EFU A;  2CCU A;  2YE8 A;  1UYI A;  4XKK A;  1YET A;  4CWF A;  1Y4U A;  2C1G A;  4MPE A;  3ZKD A;  2BYI A;  4CE1 A;  2IWS A;  5CTY A;  4YKU A;  2CG9 A;  1AH8 A;  2YGF A;  4ASA A;  2VW5 A;  4YKR A;  2BU7 A;  4QPK A;  2ZDY A;  4HXZ A;  4CWO A;  5FNC A;  2YGA A;  1EA6 A;  1UY7 A;  2CCS A;  2H55 A;  3R4M A;  4XC0 A;  3Q5K A;  4CE2 A;  3EHF A;  1GKX A;  1NHH A;  4L91 A;  3OWB A;  4W7T A;  4P8O A;  1YSZ A;  1YT1 A;  2YEH A;  3GIF A;  4EFT A;  4EMV A;  1UYG A;  3T10 A;  3GIE A;  4GCZ A;  3OMU A;  2K5B A;  1AMW A;  3K97 A;  5IN9 A;  2YE6 A;  3A0R A;  3OWD A;  3R4O A;  4Q20 A;  1YT2 A;  2UWD A;  1Z5C A;  2YK9 A;  3ZM7 A;  4E02 A;  2BRE A;  2WI7 A;  2XDL A;  3CRK A;  2YE4 A;  4O05 A;  2XHX A;  5BOC A;  2FWY A;  1F51 A;  3CGY A;  1BYQ A;  3IED A;  4FCQ A;  5FWK A;  4XKA A;  1R62 A;  3C0E A;  1TH8 A;  3MNR P;  4URL A;  3T2S A;  3EKR A;  3TZ4 A;  4B7P A;  2EXL A;  5D7R A;  1UYL A;  5CTW A;  1UYM A;  3INW A;  3CYG A;  1S16 A;  2FWZ A;  1ZXM A;  2CCT A;  4ZKI A;  2CH4 A;  2XJG A;  1UYK A;  4HYP A;  4XDM A;  2ZKJ A;  4MOT A;  1JM6 A;  4YKT A;  4H85 A;  1GKZ A;  4JAS A;  4XIQ A;  2BU6 A;  2XD6 A; 
#chains in the Genus database with same CATH homology
 4AS9 A;  5CTU A;  4AWO A;  1BGQ A;  3R4N A;  3GIG A;  4XCJ A;  4KFG A;  4FCP A;  2YI6 A;  4HZ5 A;  1YER A;  1PVG A;  1ZWH A;  3PEH A;  3B27 A;  4CWT A;  4XIP A;  3T1K A;  1YC1 A;  2JJC A;  4KP4 A;  1H7U A;  2BT0 A;  3QDD A;  2IOP A;  1MU5 A;  4WUB A;  2YE9 A;  4MB9 A;  2WEQ A;  3ZKB A;  3RLQ A;  1UYF A;  4LWI A;  3OPD A;  3R4P A;  3CGZ A;  2C2A A;  4U7N A;  4LWG A;  4EGK A;  2WI3 A;  3VHA A;  1US7 A;  2WI4 A;  2YKI A;  3A0Y A;  4XD8 A;  1Z5A A;  2QF6 A;  2YKJ A;  5GGZ A;  5CF0 A;  2GQP A;  5M4N A;  2BRC A;  1QYE A;  1U0Z A;  4GQT A;  5D7D A;  4KQV A;  1TBW A;  3FV5 A;  3VHC A;  5IDM A;  2IOQ A;  3B24 A;  2XX5 A;  2HG1 A;  1OSF A;  3VHD A;  2XJX A;  1Y4S A;  4LWH A;  3FT5 A;  1B62 A;  4DUH A;  1UY6 A;  3HZ1 A;  4YKW A;  3D36 A;  2HKJ A;  2WI6 A;  3HYZ A;  5M4H A;  1U2O A;  4O07 A;  4URN A;  4KTN A;  1YS3 A;  3ZXQ A;  1AH6 A;  2Q8F A;  3K60 A;  4MBC A;  3T0H A;  4EGH A;  2XDK A;  3BM9 A;  2JKI A;  2QG2 A;  4H7Q A;  3WHA A;  3T0Z A;  2AKP A;  5CPH A;  2O1W A;  2Q8G A;  1BXD A;  1TC0 A;  3U67 A;  5FND A;  4XKO A;  1UYD A;  2XAB A;  4XIT A;  3LNU A;  3H4L A;  3G7E A;  2BU5 A;  3BMY A;  2YEF A;  3HHU A;  3O6O A;  2XDS A;  2VWC A;  4BQG A;  2ZBK B;  4LPB A;  1BKN A;  4H81 A;  1UYH A;  3GIG B;  4GGL A;  4LP0 A;  2XHT A;  1Y8P A;  2YKE A;  4I3H A;  1UYE A;  4GT8 A;  2CGF A;  4XCL A;  4I5S A;  4AWQ A;  1I5B A;  4R1F A;  2WI5 A;  3O0I A;  1EI1 A;  4HY1 A;  5C93 A;  5F3K A;  4E01 A;  2BU8 A;  5FNF A;  4PRV A;  2YEE A;  1H7S A;  3SL2 A;  5M4K A;  1AM1 A;  2WI1 A;  4BXI A;  2XCM A;  1I5C A;  2QG0 A;  2YEB A;  2YI7 A;  2YI0 A;  4DZY A;  5F5R A;  1Y8N A;  3QTF A;  3D0B A;  4FCR A;  4EGI A;  1AJ6 A;  4YKX A;  1YT0 A;  2YE5 A;  1TC6 A;  4U93 A;  2O1V A;  5D7C A;  4HY6 A;  3B26 A;  1I5A A;  5IDJ A;  2XJJ A;  1ZXN A;  2XK2 A;  3A0Z A;  2YGE A;  1ID0 A;  2XHR A;  1YC4 A;  4WUD A;  2YK2 A;  3A0T A;  1YC3 A;  4YKY A;  2YJX A;  1ZW9 A;  3TZ2 A;  2YEI A;  4MP7 A;  4QPJ A;  3NMQ A;  4CWR A;  2BU2 A;  2YEC A;  4BIU A;  4LWE A;  1KIJ A;  1NHI A;  5J6A A;  2GFD A;  4BIZ A;  3LPS A;  2VCI A;  3K99 A;  3CRL A;  1Z5B A;  3B25 A;  4NH8 A;  2YKB A;  4MPC A;  3WQ9 A;  2IOR A;  4ASB A;  3ZXO A;  3HYY A;  2BSM A;  1QZR A;  1KZN A;  4L90 A;  1I5D A;  4PL9 A;  3TZ0 A;  4B6C A;  3U2K A;  2BTZ A;  2E0A A;  2YE7 A;  4BQJ A;  4V25 A;  4BAE A;  2IWX A;  1GJV A;  5BOD A;  4FPP A;  2YED A;  4HYM A;  3RKZ A;  4JAV A;  1I59 A;  1Z59 A;  2WER A;  3B28 A;  1Y8O A;  3H80 A;  4WUC A;  4L94 A;  4ZVI A;  2BYH A;  3K98 A;  2YE2 A;  4NH9 A;  3TUH A;  3O2F A;  3G7B A;  4K4O A;  3DGE A;  3R92 A;  3HZ5 A;  3Q5J A;  4EEH A;  5M4P A;  3C11 A;  2YEJ A;  4XIR A;  3TTZ A;  3HEK A;  4LWF A;  4R3A A;  4CWQ A;  2Q8I A;  3EHJ A;  2YJW A;  4O0B A;  3VAD A;  1UYC A;  2ZDX A;  4V26 A;  2ESA A;  4HZ0 A;  2XX2 A;  4CWN A;  1YES A;  3PEJ A;  2WEP A;  4XTJ A;  2IWU A;  2XDX A;  4X9L A;  4URO A;  3FT8 A;  4XE2 A;  3A0W A;  4HXW A;  4GEE A;  2YKC A;  4O04 A;  2PNR A;  4URM A;  4R3M A;  3EHH A;  4JQL A;  5D6P A;  4KSH A;  3G75 A;  2XDU A;  3TZ5 A;  2HCH A;  1TIL A;  1NHJ A;  1THN A;  2FXS A;  2VCJ A;  2Q2E B;  4E00 A;  4CWP A;  1YSR A;  2YEG A;  5M4M A;  3RLP A;  3D2R A;  1MX0 A;  3KE6 A;  2XX4 A;  3Q5L A;  4L93 A;  4P7A A;  2YEA A;  2O1U A;  1UY8 A;  4MPN A;  4AWP A;  2QFO A;  3R91 A;  1B63 A;  3CWV A;  4ASF A;  3EHG A;  4O09 A;  4ASG A;  1L0O A;  1A4H A;  1S14 A;  4MP2 A;  1I58 A;  3EKO A;  4PRX A;  5J71 A;  4GFN A;  5M4E A;  2YE3 A;  3OW6 A;  4KSG A;  3INX A;  2Q8H A;  1QY8 A;  3U2D A;  4JAU A;  4NH7 A;  4FMT A;  5CTX A;  1UY9 A;  4L8Z A;  3A0X A;  4CE3 A;  4YKQ A;  5L3J A;  2FYP A;  1B3Q A;  2WI2 A;  3RLR A;  5D6Q A;  4CWS A;  4PU9 A;  2YI5 A;  4U7O A;  2BZ5 A;  3JZ3 A;  1TID A;  4EM7 A;  4YKZ A;  2H8M A;  4EFU A;  2CCU A;  2YE8 A;  1UYI A;  4XKK A;  1YET A;  4CWF A;  1Y4U A;  4MPE A;  3ZKD A;  2BYI A;  4CE1 A;  2IWS A;  5CTY A;  4YKU A;  2CG9 A;  1AH8 A;  2YGF A;  4ASA A;  2VW5 A;  4YKR A;  2BU7 A;  4QPK A;  2ZDY A;  4HXZ A;  4CWO A;  5FNC A;  2YGA A;  1EA6 A;  1UY7 A;  2CCS A;  2H55 A;  3R4M A;  4XC0 A;  3Q5K A;  4CE2 A;  3EHF A;  1GKX A;  1NHH A;  4L91 A;  3OWB A;  4W7T A;  4P8O A;  1YSZ A;  1YT1 A;  2YEH A;  3GIF A;  4EFT A;  4EMV A;  1UYG A;  3T10 A;  3GIE A;  4GCZ A;  3OMU A;  2K5B A;  1AMW A;  3K97 A;  5IN9 A;  2YE6 A;  3A0R A;  3OWD A;  3R4O A;  4Q20 A;  1YT2 A;  2UWD A;  1Z5C A;  2YK9 A;  3ZM7 A;  4E02 A;  2BRE A;  2WI7 A;  2XDL A;  3CRK A;  2YE4 A;  4O05 A;  2XHX A;  5BOC A;  2FWY A;  3CGY A;  1BYQ A;  3IED A;  4FCQ A;  5FWK A;  4XKA A;  1R62 A;  3C0E A;  1TH8 A;  3MNR P;  4URL A;  3T2S A;  3EKR A;  3TZ4 A;  4B7P A;  2EXL A;  5D7R A;  1UYL A;  5CTW A;  1UYM A;  3INW A;  1S16 A;  2FWZ A;  1ZXM A;  2CCT A;  4ZKI A;  2CH4 A;  2XJG A;  1UYK A;  4HYP A;  4XDM A;  2ZKJ A;  4MOT A;  1JM6 A;  4YKT A;  4H85 A;  1GKZ A;  4JAS A;  4XIQ A;  2BU6 A;  2XD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...