4KSHA

Dna gyrase atp binding domain of enterococcus faecalis in complex with a small molecule inhibitor (7-({4-[(3r)-3-aminopyrrolidin-1-yl]-5-chloro-6-ethyl-7h-pyrrolo[2,3-d]pyrimidin-2-yl}sulfanyl)-1,5-naphthyridin-1(4h)-ol)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
193
Chain Sequence
b'GLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLHGVGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAVVDDLKVIEETDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title A new class of type iia topoisomerase inhibitors with broad-spectrum antibacterial activity
rcsb
source organism Enterococcus faecalis
molecule tags Isomerase/isomerase inhibitor
total genus 59
structure length 193
sequence length 210
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4kshA00
1AH6A 3T0ZA 3TZ4A 4EM7A 4XIRA 3LNUA 3VHCA 4H7QA 1NHJA 1Z5CA 2AKPA 4HY1A 4U7OA 2YEDA 5FWKA 2BU8A 4YKUA 2O1VA 4PU9A 3TUHA 1TILA 3ZM7A 4NH9A 2BSMA 5D7CA 2XDKA 2BRCA 1B3QA 2HKJA 2WI2A 3GIGA 4PL9A 3H4LA 3K97A 3R92A 4EGKA 3U67A 5FNDA 4CWPA 3G7BA 2VWCA 2QG2A 4CWSA 2VW5A 2WERA 4XKKA 1Z5BA 2JJCA 4AWPA 4URLA 1I5DA 4HZ5A 3R4MA 3O2FA 3A0YA 1YERA 2UWDA 4NH8A 4XTJA 3A0TA 2ZDYA 4XCLA 5CPHA 3WQ9A 5J71A 4BIUA 4KSHA 1MX0A 1BXDA 2Q8HA 4KFGA 5D6QA 4L8ZA 4EMVA 4WUCA 1YT0A 5IDMA 4EGIA 2HG1A 2YE9A 4MPNA 5D6PA 3ZXQA 4JAVA 4ZKIA 2BU7A 3ZXOA 2PNRA 2YECA 2WEQA 2BU2A 4B6CA 4PRXA 4O05A 4YKXA 1S14A 1BKNA 4YKZA 4EFTA 4L93A 1AH8A 3G7EA 5CTUA 4KTNA 4DUHA 5IDJA 4O07A 2YK2A 5M4MA 2BREA 5CF0A 2CG9A 3GIGB 1YSZA 3WHAA 2O1WA 3OWBA 3A0RA 5D7DA 2YJXA 4CWTA 1PVGA 3ZKDA 2ESAA 1S16A 4HYMA 4ASGA 3U2DA 1TIDA 3FT8A 2ZBKB 1QZRA 2BYIA 3R4OA 4B7PA 4L90A 3CGZA 2JKIA 2YJWA 3EKOA 3R4NA 3VHDA 2CH4A 5F5RA 2YE7A 2YKIA 4WUDA 1ID0A 1UY8A 4HYPA 4HY6A 2Q8GA 5BODA 2XK2A 3CWVA 3CGYA 2XHRA 3EHJA 2XDUA 1I5CA 2XJJA 2YE6A 4WUBA 4AS9A 2WI3A 1UYIA 1UYEA 3HZ1A 3PEJA 4KP4A 3GIEA 5CTXA 4MP2A 3TTZA 1UYCA 3OW6A 3INXA 3RLPA 3Q5LA 2WI4A 1EA6A 4FCPA 1UYLA 1GJVA 1AM1A 2YE2A 4R1FA 3NMQA 5M4KA 4YKTA 4BAEA 4XDMA 3Q5JA 1YT1A 3T10A 3KE6A 2H8MA 4GCZA 4AWQA 1TC0A 1YSRA 2YE8A 4LP0A 3A0WA 3D0BA 1NHHA 4BXIA 5C93A 4QPKA 2YEHA 4MP7A 1UYHA 5M4PA 4O0BA 2FWYA 3EHHA 4UROA 3A0ZA 2YI5A 4MOTA 4E02A 5M4EA 2QG0A 3PEHA 4GEEA 4LWGA 4GGLA 5D7RA 1Y4UA 2YKCA 4EGHA 4JQLA 1QY8A 2YGFA 2YEAA 2XDSA 4URNA 2YGAA 2IOQA 4BQJA 4MPEA 1KIJA 4ASFA 1US7A 2EXLA 4YKQA 4H81A 2YEIA 1H7SA 2CCUA 4HXZA 1Y8OA 4GFNA 1BGQA 2WI7A 4I3HA 3TZ0A 2BZ5A 1Z5AA 2CCSA 2VCJA 4V25A 3EHGA 1TC6A 4V26A 2ZDXA 2IWXA 2C2AA 2XHTA 2IOPA 3C11A 3CRLA 2BTZA 1BYQA 2ZKJA 4BQGA 1UYMA 5BOCA 5FNFA 3A0XA 4XIQA 5CTYA 4E01A 3RLRA 4FCQA 4XC0A 3BMYA 3FV5A 3DGEA 3K98A 4EFUA 1UY9A 4XIPA 3JZ3A 1UYKA 2FYPA 3K99A 3VHAA 3T1KA 4CE3A 5J6AA 2Q2EB 1AJ6A 3QTFA 2BU5A 3B27A 3FT5A 2QF6A 3ZKBA 4CWRA 2YE4A 2E0AA 4HXWA 4LWFA 1A4HA 2YI7A 1THNA 3B24A 2FWZA 1I5AA 4URMA 3Q5KA 3OWDA 4O04A 1I59A 4YKWA 4U93A 4CWOA 2CCTA 2HCHA 2K5BA 2XX5A 3QDDA 4Q20A 4CWNA 4EEHA 2WEPA 2YE3A 4ZVIA 5M4HA 1NHIA 3INWA 1TBWA 1UYGA 5FNCA 3HYZA 2BU6A 4CWQA 4W7TA 4I5SA 2XJXA 2YI6A 3B28A 4YKRA 1UYDA 4MPCA 4QPJA 2XJGA 1YETA 2XX4A 5M4NA 2YK9A 1ZXMA 2XX2A 4BIZA 1TH8A 2YE5A 3D36A 2YEFA 2Q8IA 2YI0A 2YEGA 2YEBA 4X9LA 1KZNA 4CWFA 3LPSA 3K60A 3T0HA 2XDLA 1U2OA 5L3JA 4JAUA 1UYFA 2IWSA 4LWEA 4KSGA 4LWHA 1L0OA 2VCIA 1YC3A 1GKXA 4YKYA 1R62A 4CE1A 1H7UA 2IWUA 4LWIA 1YS3A 5IN9A 4XKAA 1MU5A 2XDXA 3HHUA 2XCMA 3EHFA 5F3KA 2WI6A 3HYYA 1OSFA 3CRKA 4JASA 1ZWHA 1ZXNA 3R91A 4XE2A 1U0ZA 4L91A 2QFOA 3EKRA 3TZ2A 4XCJA 4LPBA 2GFDA 2IORA 3HZ5A 4L94A 4R3AA 1Y8NA 1AMWA 4HZ0A 4R3MA 1B63A 3O0IA 3OMUA 3D2RA 5CTWA 4E00A 1YC1A 2FXSA 3U2KA 3C0EA 3O6OA 3H80A 4GT8A 1B62A 2H55A 4PRVA 2GQPA 1YESA 4MB9A 2YEEA 1I58A 4ASAA 1I5BA 3BM9A 1Y4SA 4NH7A 4AWOA 3TZ5A 1EI1A 1Y8PA 2BT0A 4KQVA 2YEJA 3RKZA 4P8OA 1YT2A 4O09A 2YKBA 1ZW9A 4XD8A 1YC4A 4XKOA 2WI1A 3MNRP 4FMTA 2O1UA 3IEDA 3R4PA 5GGZA 1UY7A 2YGEA 2BYHA 3OPDA 3VADA 1Z59A 4CE2A 4FPPA 2XD6A 4H85A 3RLQA 3B25A 2WI5A 4ASBA 4XITA 3B26A 4GQTA 3G75A 4DZYA 2YKEA 4MBCA 3T2SA 1UY6A 4P7AA 1GKZA 1JM6A 1QYEA 2Q8FA 4FCRA 4K4OA 2XABA 3GIFA 2CGFA 3HEKA 4U7NA 3SL2A 2YKJA 2XHXA
chains in the Genus database with same CATH superfamily
1AH6A 3T0ZA 3TZ4A 4EM7A 4XIRA 3LNUA 3VHCA 4H7QA 1NHJA 1Z5CA 2AKPA 4HY1A 4U7OA 2YEDA 5FWKA 2BU8A 4YKUA 2O1VA 4PU9A 3TUHA 1TILA 3ZM7A 4NH9A 2BSMA 5D7CA 2XDKA 2BRCA 1B3QA 2HKJA 2WI2A 3GIGA 4PL9A 3H4LA 3K97A 3R92A 4EGKA 3U67A 5FNDA 4CWPA 3G7BA 2VWCA 2QG2A 4CWSA 2VW5A 2WERA 4XKKA 1Z5BA 2JJCA 4AWPA 4URLA 1I5DA 4HZ5A 3R4MA 3O2FA 3A0YA 1YERA 2UWDA 4NH8A 4XTJA 3A0TA 2ZDYA 4XCLA 5CPHA 3WQ9A 5J71A 4BIUA 4KSHA 1MX0A 1BXDA 2Q8HA 4KFGA 5D6QA 4L8ZA 4EMVA 4WUCA 1YT0A 5IDMA 4EGIA 2HG1A 2YE9A 4MPNA 5D6PA 3ZXQA 4JAVA 4ZKIA 2BU7A 3ZXOA 2PNRA 2YECA 2WEQA 2BU2A 4B6CA 4PRXA 4O05A 4YKXA 1S14A 1BKNA 4YKZA 4EFTA 4L93A 1AH8A 3G7EA 5CTUA 4KTNA 4DUHA 5IDJA 4O07A 2YK2A 5M4MA 2BREA 5CF0A 2CG9A 3GIGB 1YSZA 3WHAA 2O1WA 3OWBA 3A0RA 5D7DA 2YJXA 4CWTA 1PVGA 3ZKDA 2ESAA 1S16A 4HYMA 4ASGA 3U2DA 1TIDA 3FT8A 2ZBKB 1QZRA 2BYIA 3R4OA 4B7PA 4L90A 3CGZA 2JKIA 2YJWA 3EKOA 3R4NA 3VHDA 2CH4A 5F5RA 2YE7A 2YKIA 4WUDA 1ID0A 1UY8A 4HYPA 4HY6A 2Q8GA 5BODA 2XK2A 3CWVA 3CGYA 2XHRA 3EHJA 2XDUA 1I5CA 2XJJA 2YE6A 4WUBA 4AS9A 2WI3A 1UYIA 1UYEA 3HZ1A 3PEJA 4KP4A 3GIEA 5CTXA 4MP2A 3TTZA 1UYCA 3OW6A 3INXA 3RLPA 3Q5LA 2WI4A 1EA6A 4FCPA 1UYLA 1GJVA 1AM1A 2YE2A 4R1FA 3NMQA 5M4KA 4YKTA 4BAEA 4XDMA 3Q5JA 1YT1A 3T10A 3KE6A 2H8MA 4GCZA 4AWQA 1TC0A 1YSRA 2YE8A 4LP0A 3A0WA 3D0BA 1NHHA 4BXIA 5C93A 4QPKA 2YEHA 4MP7A 1UYHA 5M4PA 4O0BA 2FWYA 3EHHA 4UROA 3A0ZA 2YI5A 4MOTA 4E02A 5M4EA 2QG0A 3PEHA 4GEEA 4LWGA 4GGLA 5D7RA 1Y4UA 2YKCA 4EGHA 4JQLA 1QY8A 2YGFA 2YEAA 2XDSA 4URNA 2YGAA 2IOQA 4BQJA 4MPEA 1KIJA 4ASFA 1US7A 2EXLA 4YKQA 4H81A 2YEIA 1H7SA 2CCUA 4HXZA 1Y8OA 4GFNA 1BGQA 2WI7A 4I3HA 3TZ0A 2BZ5A 1Z5AA 2CCSA 2VCJA 4V25A 3EHGA 1TC6A 4V26A 2ZDXA 2IWXA 4E72A 2C2AA 2XHTA 2IOPA 3C11A 3CRLA 2BTZA 1BYQA 2ZKJA 4BQGA 1IXMA 1UYMA 5BOCA 5FNFA 3A0XA 4XIQA 5CTYA 4E01A 3RLRA 4FCQA 4XC0A 3BMYA 3FV5A 3DGEA 3K98A 1F51A 4EFUA 1UY9A 4XIPA 3JZ3A 1UYKA 2FYPA 3K99A 3VHAA 3T1KA 4CE3A 5J6AA 2Q2EB 1AJ6A 3QTFA 2BU5A 3B27A 3FT5A 2QF6A 3ZKBA 4CWRA 2YE4A 2E0AA 4HXWA 4LWFA 1A4HA 2YI7A 1THNA 3B24A 2FWZA 1I5AA 4URMA 3Q5KA 3OWDA 4O04A 5JENA 1I59A 4YKWA 4U93A 2C1IA 4CWOA 2CCTA 2HCHA 2K5BA 2XX5A 3QDDA 4Q20A 4CWNA 4EEHA 2WEPA 2YE3A 4ZVIA 5M4HA 1NHIA 3INWA 1TBWA 1UYGA 5FNCA 3HYZA 2BU6A 4CWQA 4W7TA 4I5SA 2XJXA 2YI6A 3B28A 4YKRA 1UYDA 4MPCA 4QPJA 2XJGA 1YETA 2XX4A 5M4NA 2YK9A 1ZXMA 2XX2A 4BIZA 1TH8A 2YE5A 3D36A 2YEFA 2Q8IA 2YI0A 2YEGA 2YEBA 3S5TA 4X9LA 1KZNA 4CWFA 3LPSA 3K60A 3T0HA 2XDLA 1U2OA 5L3JA 4JAUA 1UYFA 2IWSA 4LWEA 4KSGA 4LWHA 1L0OA 2VCIA 1YC3A 1GKXA 4YKYA 1R62A 4CE1A 1H7UA 2IWUA 4LWIA 1YS3A 5IN9A 4XKAA 1MU5A 2XDXA 3HHUA 2XCMA 3EHFA 5F3KA 2WI6A 3HYYA 1OSFA 3CRKA 4JASA 1ZWHA 1ZXNA 3R91A 4XE2A 1U0ZA 4L91A 3LMMA 2QFOA 3EKRA 3TZ2A 4XCJA 4LPBA 2GFDA 2IORA 3HZ5A 4L94A 4R3AA 1Y8NA 1AMWA 4HZ0A 4R3MA 1B63A 3O0IA 3OMUA 3D2RA 5CTWA 4E00A 2C1GA 1YC1A 2FXSA 3U2KA 3C0EA 3O6OA 3H80A 4GT8A 1B62A 2H55A 4PRVA 2FTKA 2GQPA 1YESA 4MB9A 2YEEA 1I58A 2HHIA 4ASAA 1I5BA 3BM9A 1Y4SA 4NH7A 4AWOA 3TZ5A 1EI1A 1Y8PA 2BT0A 4KQVA 2YEJA 3RKZA 4P8OA 1YT2A 4O09A 2YKBA 1ZW9A 4XD8A 1YC4A 4XKOA 2WI1A 3MNRP 4FMTA 2O1UA 3IEDA 3R4PA 5GGZA 1UY7A 2YGEA 2BYHA 3OPDA 3VADA 1Z59A 4CE2A 4FPPA 2XD6A 3CYGA 4H85A 3RLQA 3B25A 2WI5A 4ASBA 4XITA 3B26A 4GQTA 3G75A 4DZYA 2YKEA 4MBCA 3T2SA 1UY6A 4P7AA 1GKZA 1JM6A 1QYEA 2Q8FA 4FCRA 4K4OA 2XABA 3GIFA 2CGFA 3HEKA 4U7NA 3SL2A 2YKJA 2XHXA
chains in the Genus database with same CATH topology
1AH6A 3T0ZA 3TZ4A 4EM7A 4XIRA 3LNUA 3VHCA 4H7QA 1NHJA 1Z5CA 2AKPA 4HY1A 4U7OA 2YEDA 5FWKA 2BU8A 4YKUA 2O1VA 4PU9A 3TUHA 1TILA 3ZM7A 4NH9A 2BSMA 5D7CA 2XDKA 2BRCA 1B3QA 2HKJA 2WI2A 3GIGA 4PL9A 3H4LA 3K97A 3R92A 4EGKA 3U67A 5FNDA 4CWPA 3G7BA 2VWCA 2QG2A 4CWSA 2VW5A 2WERA 4XKKA 1Z5BA 2JJCA 4AWPA 4URLA 1I5DA 4HZ5A 3R4MA 3O2FA 3A0YA 1YERA 2UWDA 4NH8A 4XTJA 3A0TA 2ZDYA 4XCLA 5CPHA 3WQ9A 5J71A 4BIUA 4KSHA 1MX0A 1BXDA 2Q8HA 4KFGA 5D6QA 4L8ZA 4EMVA 4WUCA 1YT0A 5IDMA 4EGIA 2HG1A 2YE9A 4MPNA 5D6PA 3ZXQA 4JAVA 4ZKIA 2BU7A 3ZXOA 2PNRA 2YECA 2WEQA 2BU2A 4B6CA 4PRXA 4O05A 4YKXA 1S14A 1BKNA 4YKZA 4EFTA 4L93A 1AH8A 3G7EA 5CTUA 4KTNA 4DUHA 5IDJA 4O07A 2YK2A 5M4MA 2BREA 5CF0A 2CG9A 3GIGB 1YSZA 3WHAA 2O1WA 3OWBA 3A0RA 5D7DA 2YJXA 4CWTA 1PVGA 3ZKDA 2ESAA 1S16A 4HYMA 4ASGA 3U2DA 1TIDA 3FT8A 2ZBKB 1QZRA 2BYIA 3R4OA 4B7PA 4L90A 3CGZA 2JKIA 2YJWA 3EKOA 3R4NA 3VHDA 2CH4A 5F5RA 2YE7A 2YKIA 4WUDA 1ID0A 1UY8A 4HYPA 4HY6A 2Q8GA 5BODA 2XK2A 3CWVA 3CGYA 2XHRA 3EHJA 2XDUA 1I5CA 2XJJA 2YE6A 4WUBA 4AS9A 2WI3A 1UYIA 1UYEA 3HZ1A 3PEJA 4KP4A 3GIEA 5CTXA 4MP2A 3TTZA 1UYCA 3OW6A 3INXA 3RLPA 3Q5LA 2WI4A 1EA6A 4FCPA 1UYLA 1GJVA 1AM1A 2YE2A 4R1FA 3NMQA 5M4KA 4YKTA 4BAEA 4XDMA 3Q5JA 1YT1A 3T10A 3KE6A 2H8MA 4GCZA 4AWQA 1TC0A 1YSRA 2YE8A 4LP0A 3A0WA 3D0BA 1NHHA 4BXIA 5C93A 4QPKA 2YEHA 4MP7A 1UYHA 5M4PA 4O0BA 2FWYA 3EHHA 4UROA 3A0ZA 2YI5A 4MOTA 4E02A 5M4EA 2QG0A 3PEHA 4GEEA 4LWGA 4GGLA 5D7RA 1Y4UA 2YKCA 4EGHA 4JQLA 1QY8A 2YGFA 2YEAA 2XDSA 4URNA 2YGAA 2IOQA 4BQJA 4MPEA 1KIJA 4ASFA 1US7A 2EXLA 4YKQA 4H81A 2YEIA 1H7SA 2CCUA 4HXZA 1Y8OA 4GFNA 1BGQA 2WI7A 4I3HA 3TZ0A 2BZ5A 1Z5AA 2CCSA 2VCJA 4V25A 3EHGA 1TC6A 4V26A 2ZDXA 2IWXA 2C2AA 2XHTA 2IOPA 3C11A 3CRLA 2BTZA 1BYQA 2ZKJA 4BQGA 1UYMA 5BOCA 5FNFA 3A0XA 4XIQA 5CTYA 4E01A 3RLRA 4FCQA 4XC0A 3BMYA 3FV5A 3DGEA 3K98A 4EFUA 1UY9A 4XIPA 3JZ3A 1UYKA 2FYPA 3K99A 3VHAA 3T1KA 4CE3A 5J6AA 2Q2EB 1AJ6A 3QTFA 2BU5A 3B27A 3FT5A 2QF6A 3ZKBA 4CWRA 2YE4A 2E0AA 4HXWA 4LWFA 1A4HA 2YI7A 1THNA 3B24A 2FWZA 1I5AA 4URMA 3Q5KA 3OWDA 4O04A 1I59A 4YKWA 4U93A 4CWOA 2CCTA 2HCHA 2K5BA 2XX5A 3QDDA 4Q20A 4CWNA 4EEHA 2WEPA 2YE3A 4ZVIA 5M4HA 1NHIA 3INWA 1TBWA 1UYGA 5FNCA 3HYZA 2BU6A 4CWQA 4W7TA 4I5SA 2XJXA 2YI6A 3B28A 4YKRA 1UYDA 4MPCA 4QPJA 2XJGA 1YETA 2XX4A 5M4NA 2YK9A 1ZXMA 2XX2A 4BIZA 1TH8A 2YE5A 3D36A 2YEFA 2Q8IA 2YI0A 2YEGA 2YEBA 4X9LA 1KZNA 4CWFA 3LPSA 3K60A 3T0HA 2XDLA 1U2OA 5L3JA 4JAUA 1UYFA 2IWSA 4LWEA 4KSGA 4LWHA 1L0OA 2VCIA 1YC3A 1GKXA 4YKYA 1R62A 4CE1A 1H7UA 2IWUA 4LWIA 1YS3A 5IN9A 4XKAA 1MU5A 2XDXA 3HHUA 2XCMA 3EHFA 5F3KA 2WI6A 3HYYA 1OSFA 3CRKA 4JASA 1ZWHA 1ZXNA 3R91A 4XE2A 1U0ZA 4L91A 2QFOA 3EKRA 3TZ2A 4XCJA 4LPBA 2GFDA 2IORA 3HZ5A 4L94A 4R3AA 1Y8NA 1AMWA 4HZ0A 4R3MA 1B63A 3O0IA 3OMUA 3D2RA 5CTWA 4E00A 1YC1A 2FXSA 3U2KA 3C0EA 3O6OA 3H80A 4GT8A 1B62A 2H55A 4PRVA 2GQPA 1YESA 4MB9A 2YEEA 1I58A 4ASAA 1I5BA 3BM9A 1Y4SA 4NH7A 4AWOA 3TZ5A 1EI1A 1Y8PA 2BT0A 4KQVA 2YEJA 3RKZA 4P8OA 1YT2A 4O09A 2YKBA 1ZW9A 4XD8A 1YC4A 4XKOA 2WI1A 3MNRP 4FMTA 2O1UA 3IEDA 3R4PA 5GGZA 1UY7A 2YGEA 2BYHA 3OPDA 3VADA 1Z59A 4CE2A 4FPPA 2XD6A 4H85A 3RLQA 3B25A 2WI5A 4ASBA 4XITA 3B26A 4GQTA 3G75A 4DZYA 2YKEA 4MBCA 3T2SA 1UY6A 4P7AA 1GKZA 1JM6A 1QYEA 2Q8FA 4FCRA 4K4OA 2XABA 3GIFA 2CGFA 3HEKA 4U7NA 3SL2A 2YKJA 2XHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AH6 A;  3T0Z A;  3TZ4 A;  4EM7 A;  4XIR A;  3LNU A;  3VHC A;  4H7Q A;  1NHJ A;  1Z5C A;  2AKP A;  4HY1 A;  4U7O A;  2YED A;  5FWK A;  2BU8 A;  4YKU A;  2O1V A;  4PU9 A;  3TUH A;  1TIL A;  3ZM7 A;  4NH9 A;  2BSM A;  5D7C A;  2XDK A;  2BRC A;  1B3Q A;  2HKJ A;  2WI2 A;  3GIG A;  4PL9 A;  3H4L A;  3K97 A;  3R92 A;  4EGK A;  3U67 A;  5FND A;  4CWP A;  3G7B A;  2VWC A;  2QG2 A;  4CWS A;  2VW5 A;  2WER A;  4XKK A;  1Z5B A;  2JJC A;  4AWP A;  4URL A;  1I5D A;  4HZ5 A;  3R4M A;  3O2F A;  3A0Y A;  1YER A;  2UWD A;  4NH8 A;  4XTJ A;  3A0T A;  2ZDY A;  4XCL A;  5CPH A;  3WQ9 A;  5J71 A;  4BIU A;  4KSH A;  1MX0 A;  1BXD A;  2Q8H A;  4KFG A;  5D6Q A;  4L8Z A;  4EMV A;  4WUC A;  1YT0 A;  5IDM A;  4EGI A;  2HG1 A;  2YE9 A;  4MPN A;  5D6P A;  3ZXQ A;  4JAV A;  4ZKI A;  2BU7 A;  3ZXO A;  2PNR A;  2YEC A;  2WEQ A;  2BU2 A;  4B6C A;  4PRX A;  4O05 A;  4YKX A;  1S14 A;  1BKN A;  4YKZ A;  4EFT A;  4L93 A;  1AH8 A;  3G7E A;  5CTU A;  4KTN A;  4DUH A;  5IDJ A;  4O07 A;  2YK2 A;  5M4M A;  2BRE A;  5CF0 A;  2CG9 A;  3GIG B;  1YSZ A;  3WHA A;  2O1W A;  3OWB A;  3A0R A;  5D7D A;  2YJX A;  4CWT A;  1PVG A;  3ZKD A;  2ESA A;  1S16 A;  4HYM A;  4ASG A;  3U2D A;  1TID A;  3FT8 A;  2ZBK B;  1QZR A;  2BYI A;  3R4O A;  4B7P A;  4L90 A;  3CGZ A;  2JKI A;  2YJW A;  3EKO A;  3R4N A;  3VHD A;  2CH4 A;  5F5R A;  2YE7 A;  2YKI A;  4WUD A;  1ID0 A;  1UY8 A;  4HYP A;  4HY6 A;  2Q8G A;  5BOD A;  2XK2 A;  3CWV A;  3CGY A;  2XHR A;  3EHJ A;  2XDU A;  1I5C A;  2XJJ A;  2YE6 A;  4WUB A;  4AS9 A;  2WI3 A;  1UYI A;  1UYE A;  3HZ1 A;  3PEJ A;  4KP4 A;  3GIE A;  5CTX A;  4MP2 A;  3TTZ A;  1UYC A;  3OW6 A;  3INX A;  3RLP A;  3Q5L A;  2WI4 A;  1EA6 A;  4FCP A;  1UYL A;  1GJV A;  1AM1 A;  2YE2 A;  4R1F A;  3NMQ A;  5M4K A;  4YKT A;  4BAE A;  4XDM A;  3Q5J A;  1YT1 A;  3T10 A;  3KE6 A;  2H8M A;  4GCZ A;  4AWQ A;  1TC0 A;  1YSR A;  2YE8 A;  4LP0 A;  3A0W A;  3D0B A;  1NHH A;  4BXI A;  5C93 A;  4QPK A;  2YEH A;  4MP7 A;  1UYH A;  5M4P A;  4O0B A;  2FWY A;  3EHH A;  4URO A;  3A0Z A;  2YI5 A;  4MOT A;  4E02 A;  5M4E A;  2QG0 A;  3PEH A;  4GEE A;  4LWG A;  4GGL A;  5D7R A;  1Y4U A;  2YKC A;  4EGH A;  4JQL A;  1QY8 A;  2YGF A;  2YEA A;  2XDS A;  4URN A;  2YGA A;  2IOQ A;  4BQJ A;  4MPE A;  1KIJ A;  4ASF A;  1US7 A;  2EXL A;  4YKQ A;  4H81 A;  2YEI A;  1H7S A;  2CCU A;  4HXZ A;  1Y8O A;  4GFN A;  1BGQ A;  2WI7 A;  4I3H A;  3TZ0 A;  2BZ5 A;  1Z5A A;  2CCS A;  2VCJ A;  4V25 A;  3EHG A;  1TC6 A;  4V26 A;  2ZDX A;  2IWX A;  2C2A A;  2XHT A;  2IOP A;  3C11 A;  3CRL A;  2BTZ A;  1BYQ A;  2ZKJ A;  4BQG A;  1UYM A;  5BOC A;  5FNF A;  3A0X A;  4XIQ A;  5CTY A;  4E01 A;  3RLR A;  4FCQ A;  4XC0 A;  3BMY A;  3FV5 A;  3DGE A;  3K98 A;  4EFU A;  1UY9 A;  4XIP A;  3JZ3 A;  1UYK A;  2FYP A;  3K99 A;  3VHA A;  3T1K A;  4CE3 A;  5J6A A;  2Q2E B;  1AJ6 A;  3QTF A;  2BU5 A;  3B27 A;  3FT5 A;  2QF6 A;  3ZKB A;  4CWR A;  2YE4 A;  2E0A A;  4HXW A;  4LWF A;  1A4H A;  2YI7 A;  1THN A;  3B24 A;  2FWZ A;  1I5A A;  4URM A;  3Q5K A;  3OWD A;  4O04 A;  1I59 A;  4YKW A;  4U93 A;  4CWO A;  2CCT A;  2HCH A;  2K5B A;  2XX5 A;  3QDD A;  4Q20 A;  4CWN A;  4EEH A;  2WEP A;  2YE3 A;  4ZVI A;  5M4H A;  1NHI A;  3INW A;  1TBW A;  1UYG A;  5FNC A;  3HYZ A;  2BU6 A;  4CWQ A;  4W7T A;  4I5S A;  2XJX A;  2YI6 A;  3B28 A;  4YKR A;  1UYD A;  4MPC A;  4QPJ A;  2XJG A;  1YET A;  2XX4 A;  5M4N A;  2YK9 A;  1ZXM A;  2XX2 A;  4BIZ A;  1TH8 A;  2YE5 A;  3D36 A;  2YEF A;  2Q8I A;  2YI0 A;  2YEG A;  2YEB A;  4X9L A;  1KZN A;  4CWF A;  3LPS A;  3K60 A;  3T0H A;  2XDL A;  1U2O A;  5L3J A;  4JAU A;  1UYF A;  2IWS A;  4LWE A;  4KSG A;  4LWH A;  1L0O A;  2VCI A;  1YC3 A;  1GKX A;  4YKY A;  1R62 A;  4CE1 A;  1H7U A;  2IWU A;  4LWI A;  1YS3 A;  5IN9 A;  4XKA A;  1MU5 A;  2XDX A;  3HHU A;  2XCM A;  3EHF A;  5F3K A;  2WI6 A;  3HYY A;  1OSF A;  3CRK A;  4JAS A;  1ZWH A;  1ZXN A;  3R91 A;  4XE2 A;  1U0Z A;  4L91 A;  2QFO A;  3EKR A;  3TZ2 A;  4XCJ A;  4LPB A;  2GFD A;  2IOR A;  3HZ5 A;  4L94 A;  4R3A A;  1Y8N A;  1AMW A;  4HZ0 A;  4R3M A;  1B63 A;  3O0I A;  3OMU A;  3D2R A;  5CTW A;  4E00 A;  1YC1 A;  2FXS A;  3U2K A;  3C0E A;  3O6O A;  3H80 A;  4GT8 A;  1B62 A;  2H55 A;  4PRV A;  2GQP A;  1YES A;  4MB9 A;  2YEE A;  1I58 A;  4ASA A;  1I5B A;  3BM9 A;  1Y4S A;  4NH7 A;  4AWO A;  3TZ5 A;  1EI1 A;  1Y8P A;  2BT0 A;  4KQV A;  2YEJ A;  3RKZ A;  4P8O A;  1YT2 A;  4O09 A;  2YKB A;  1ZW9 A;  4XD8 A;  1YC4 A;  4XKO A;  2WI1 A;  3MNR P;  4FMT A;  2O1U A;  3IED A;  3R4P A;  5GGZ A;  1UY7 A;  2YGE A;  2BYH A;  3OPD A;  3VAD A;  1Z59 A;  4CE2 A;  4FPP A;  2XD6 A;  4H85 A;  3RLQ A;  3B25 A;  2WI5 A;  4ASB A;  4XIT A;  3B26 A;  4GQT A;  3G75 A;  4DZY A;  2YKE A;  4MBC A;  3T2S A;  1UY6 A;  4P7A A;  1GKZ A;  1JM6 A;  1QYE A;  2Q8F A;  4FCR A;  4K4O A;  2XAB A;  3GIF A;  2CGF A;  3HEK A;  4U7N A;  3SL2 A;  2YKJ A;  2XHX A; 
#chains in the Genus database with same CATH topology
 1AH6 A;  3T0Z A;  3TZ4 A;  4EM7 A;  4XIR A;  3LNU A;  3VHC A;  4H7Q A;  1NHJ A;  1Z5C A;  2AKP A;  4HY1 A;  4U7O A;  2YED A;  5FWK A;  2BU8 A;  4YKU A;  2O1V A;  4PU9 A;  3TUH A;  1TIL A;  3ZM7 A;  4NH9 A;  2BSM A;  5D7C A;  2XDK A;  2BRC A;  1B3Q A;  2HKJ A;  2WI2 A;  3GIG A;  4PL9 A;  3H4L A;  3K97 A;  3R92 A;  4EGK A;  3U67 A;  5FND A;  4CWP A;  3G7B A;  2VWC A;  2QG2 A;  4CWS A;  2VW5 A;  2WER A;  4XKK A;  1Z5B A;  2JJC A;  4AWP A;  4URL A;  1I5D A;  4HZ5 A;  3R4M A;  3O2F A;  3A0Y A;  1YER A;  2UWD A;  4NH8 A;  4XTJ A;  3A0T A;  2ZDY A;  4XCL A;  5CPH A;  3WQ9 A;  5J71 A;  4BIU A;  4KSH A;  1MX0 A;  1BXD A;  2Q8H A;  4KFG A;  5D6Q A;  4L8Z A;  4EMV A;  4WUC A;  1YT0 A;  5IDM A;  4EGI A;  2HG1 A;  2YE9 A;  4MPN A;  5D6P A;  3ZXQ A;  4JAV A;  4ZKI A;  2BU7 A;  3ZXO A;  2PNR A;  2YEC A;  2WEQ A;  2BU2 A;  4B6C A;  4PRX A;  4O05 A;  4YKX A;  1S14 A;  1BKN A;  4YKZ A;  4EFT A;  4L93 A;  1AH8 A;  3G7E A;  5CTU A;  4KTN A;  4DUH A;  5IDJ A;  4O07 A;  2YK2 A;  5M4M A;  2BRE A;  5CF0 A;  2CG9 A;  3GIG B;  1YSZ A;  3WHA A;  2O1W A;  3OWB A;  3A0R A;  5D7D A;  2YJX A;  4CWT A;  1PVG A;  3ZKD A;  2ESA A;  1S16 A;  4HYM A;  4ASG A;  3U2D A;  1TID A;  3FT8 A;  2ZBK B;  1QZR A;  2BYI A;  3R4O A;  4B7P A;  4L90 A;  3CGZ A;  2JKI A;  2YJW A;  3EKO A;  3R4N A;  3VHD A;  2CH4 A;  5F5R A;  2YE7 A;  2YKI A;  4WUD A;  1ID0 A;  1UY8 A;  4HYP A;  4HY6 A;  2Q8G A;  5BOD A;  2XK2 A;  3CWV A;  3CGY A;  2XHR A;  3EHJ A;  2XDU A;  1I5C A;  2XJJ A;  2YE6 A;  4WUB A;  4AS9 A;  2WI3 A;  1UYI A;  1UYE A;  3HZ1 A;  3PEJ A;  4KP4 A;  3GIE A;  5CTX A;  4MP2 A;  3TTZ A;  1UYC A;  3OW6 A;  3INX A;  3RLP A;  3Q5L A;  2WI4 A;  1EA6 A;  4FCP A;  1UYL A;  1GJV A;  1AM1 A;  2YE2 A;  4R1F A;  3NMQ A;  5M4K A;  4YKT A;  4BAE A;  4XDM A;  3Q5J A;  1YT1 A;  3T10 A;  3KE6 A;  2H8M A;  4GCZ A;  4AWQ A;  1TC0 A;  1YSR A;  2YE8 A;  4LP0 A;  3A0W A;  3D0B A;  1NHH A;  4BXI A;  5C93 A;  4QPK A;  2YEH A;  4MP7 A;  1UYH A;  5M4P A;  4O0B A;  2FWY A;  3EHH A;  4URO A;  3A0Z A;  2YI5 A;  4MOT A;  4E02 A;  5M4E A;  2QG0 A;  3PEH A;  4GEE A;  4LWG A;  4GGL A;  5D7R A;  1Y4U A;  2YKC A;  4EGH A;  4JQL A;  1QY8 A;  2YGF A;  2YEA A;  2XDS A;  4URN A;  2YGA A;  2IOQ A;  4BQJ A;  4MPE A;  1KIJ A;  4ASF A;  1US7 A;  2EXL A;  4YKQ A;  4H81 A;  2YEI A;  1H7S A;  2CCU A;  4HXZ A;  1Y8O A;  4GFN A;  1BGQ A;  2WI7 A;  4I3H A;  3TZ0 A;  2BZ5 A;  1Z5A A;  2CCS A;  2VCJ A;  4V25 A;  3EHG A;  1TC6 A;  4V26 A;  2ZDX A;  2IWX A;  4E72 A;  2C2A A;  2XHT A;  2IOP A;  3C11 A;  3CRL A;  2BTZ A;  1BYQ A;  2ZKJ A;  4BQG A;  1IXM A;  1UYM A;  5BOC A;  5FNF A;  3A0X A;  4XIQ A;  5CTY A;  4E01 A;  3RLR A;  4FCQ A;  4XC0 A;  3BMY A;  3FV5 A;  3DGE A;  3K98 A;  1F51 A;  4EFU A;  1UY9 A;  4XIP A;  3JZ3 A;  1UYK A;  2FYP A;  3K99 A;  3VHA A;  3T1K A;  4CE3 A;  5J6A A;  2Q2E B;  1AJ6 A;  3QTF A;  2BU5 A;  3B27 A;  3FT5 A;  2QF6 A;  3ZKB A;  4CWR A;  2YE4 A;  2E0A A;  4HXW A;  4LWF A;  1A4H A;  2YI7 A;  1THN A;  3B24 A;  2FWZ A;  1I5A A;  4URM A;  3Q5K A;  3OWD A;  4O04 A;  5JEN A;  1I59 A;  4YKW A;  4U93 A;  2C1I A;  4CWO A;  2CCT A;  2HCH A;  2K5B A;  2XX5 A;  3QDD A;  4Q20 A;  4CWN A;  4EEH A;  2WEP A;  2YE3 A;  4ZVI A;  5M4H A;  1NHI A;  3INW A;  1TBW A;  1UYG A;  5FNC A;  3HYZ A;  2BU6 A;  4CWQ A;  4W7T A;  4I5S A;  2XJX A;  2YI6 A;  3B28 A;  4YKR A;  1UYD A;  4MPC A;  4QPJ A;  2XJG A;  1YET A;  2XX4 A;  5M4N A;  2YK9 A;  1ZXM A;  2XX2 A;  4BIZ A;  1TH8 A;  2YE5 A;  3D36 A;  2YEF A;  2Q8I A;  2YI0 A;  2YEG A;  2YEB A;  3S5T A;  4X9L A;  1KZN A;  4CWF A;  3LPS A;  3K60 A;  3T0H A;  2XDL A;  1U2O A;  5L3J A;  4JAU A;  1UYF A;  2IWS A;  4LWE A;  4KSG A;  4LWH A;  1L0O A;  2VCI A;  1YC3 A;  1GKX A;  4YKY A;  1R62 A;  4CE1 A;  1H7U A;  2IWU A;  4LWI A;  1YS3 A;  5IN9 A;  4XKA A;  1MU5 A;  2XDX A;  3HHU A;  2XCM A;  3EHF A;  5F3K A;  2WI6 A;  3HYY A;  1OSF A;  3CRK A;  4JAS A;  1ZWH A;  1ZXN A;  3R91 A;  4XE2 A;  1U0Z A;  4L91 A;  3LMM A;  2QFO A;  3EKR A;  3TZ2 A;  4XCJ A;  4LPB A;  2GFD A;  2IOR A;  3HZ5 A;  4L94 A;  4R3A A;  1Y8N A;  1AMW A;  4HZ0 A;  4R3M A;  1B63 A;  3O0I A;  3OMU A;  3D2R A;  5CTW A;  4E00 A;  2C1G A;  1YC1 A;  2FXS A;  3U2K A;  3C0E A;  3O6O A;  3H80 A;  4GT8 A;  1B62 A;  2H55 A;  4PRV A;  2FTK A;  2GQP A;  1YES A;  4MB9 A;  2YEE A;  1I58 A;  2HHI A;  4ASA A;  1I5B A;  3BM9 A;  1Y4S A;  4NH7 A;  4AWO A;  3TZ5 A;  1EI1 A;  1Y8P A;  2BT0 A;  4KQV A;  2YEJ A;  3RKZ A;  4P8O A;  1YT2 A;  4O09 A;  2YKB A;  1ZW9 A;  4XD8 A;  1YC4 A;  4XKO A;  2WI1 A;  3MNR P;  4FMT A;  2O1U A;  3IED A;  3R4P A;  5GGZ A;  1UY7 A;  2YGE A;  2BYH A;  3OPD A;  3VAD A;  1Z59 A;  4CE2 A;  4FPP A;  2XD6 A;  3CYG A;  4H85 A;  3RLQ A;  3B25 A;  2WI5 A;  4ASB A;  4XIT A;  3B26 A;  4GQT A;  3G75 A;  4DZY A;  2YKE A;  4MBC A;  3T2S A;  1UY6 A;  4P7A A;  1GKZ A;  1JM6 A;  1QYE A;  2Q8F A;  4FCR A;  4K4O A;  2XAB A;  3GIF A;  2CGF A;  3HEK A;  4U7N A;  3SL2 A;  2YKJ A;  2XHX A; 
#chains in the Genus database with same CATH homology
 1AH6 A;  3T0Z A;  3TZ4 A;  4EM7 A;  4XIR A;  3LNU A;  3VHC A;  4H7Q A;  1NHJ A;  1Z5C A;  2AKP A;  4HY1 A;  4U7O A;  2YED A;  5FWK A;  2BU8 A;  4YKU A;  2O1V A;  4PU9 A;  3TUH A;  1TIL A;  3ZM7 A;  4NH9 A;  2BSM A;  5D7C A;  2XDK A;  2BRC A;  1B3Q A;  2HKJ A;  2WI2 A;  3GIG A;  4PL9 A;  3H4L A;  3K97 A;  3R92 A;  4EGK A;  3U67 A;  5FND A;  4CWP A;  3G7B A;  2VWC A;  2QG2 A;  4CWS A;  2VW5 A;  2WER A;  4XKK A;  1Z5B A;  2JJC A;  4AWP A;  4URL A;  1I5D A;  4HZ5 A;  3R4M A;  3O2F A;  3A0Y A;  1YER A;  2UWD A;  4NH8 A;  4XTJ A;  3A0T A;  2ZDY A;  4XCL A;  5CPH A;  3WQ9 A;  5J71 A;  4BIU A;  4KSH A;  1MX0 A;  1BXD A;  2Q8H A;  4KFG A;  5D6Q A;  4L8Z A;  4EMV A;  4WUC A;  1YT0 A;  5IDM A;  4EGI A;  2HG1 A;  2YE9 A;  4MPN A;  5D6P A;  3ZXQ A;  4JAV A;  4ZKI A;  2BU7 A;  3ZXO A;  2PNR A;  2YEC A;  2WEQ A;  2BU2 A;  4B6C A;  4PRX A;  4O05 A;  4YKX A;  1S14 A;  1BKN A;  4YKZ A;  4EFT A;  4L93 A;  1AH8 A;  3G7E A;  5CTU A;  4KTN A;  4DUH A;  5IDJ A;  4O07 A;  2YK2 A;  5M4M A;  2BRE A;  5CF0 A;  2CG9 A;  3GIG B;  1YSZ A;  3WHA A;  2O1W A;  3OWB A;  3A0R A;  5D7D A;  2YJX A;  4CWT A;  1PVG A;  3ZKD A;  2ESA A;  1S16 A;  4HYM A;  4ASG A;  3U2D A;  1TID A;  3FT8 A;  2ZBK B;  1QZR A;  2BYI A;  3R4O A;  4B7P A;  4L90 A;  3CGZ A;  2JKI A;  2YJW A;  3EKO A;  3R4N A;  3VHD A;  2CH4 A;  5F5R A;  2YE7 A;  2YKI A;  4WUD A;  1ID0 A;  1UY8 A;  4HYP A;  4HY6 A;  2Q8G A;  5BOD A;  2XK2 A;  3CWV A;  3CGY A;  2XHR A;  3EHJ A;  2XDU A;  1I5C A;  2XJJ A;  2YE6 A;  4WUB A;  4AS9 A;  2WI3 A;  1UYI A;  1UYE A;  3HZ1 A;  3PEJ A;  4KP4 A;  3GIE A;  5CTX A;  4MP2 A;  3TTZ A;  1UYC A;  3OW6 A;  3INX A;  3RLP A;  3Q5L A;  2WI4 A;  1EA6 A;  4FCP A;  1UYL A;  1GJV A;  1AM1 A;  2YE2 A;  4R1F A;  3NMQ A;  5M4K A;  4YKT A;  4BAE A;  4XDM A;  3Q5J A;  1YT1 A;  3T10 A;  3KE6 A;  2H8M A;  4GCZ A;  4AWQ A;  1TC0 A;  1YSR A;  2YE8 A;  4LP0 A;  3A0W A;  3D0B A;  1NHH A;  4BXI A;  5C93 A;  4QPK A;  2YEH A;  4MP7 A;  1UYH A;  5M4P A;  4O0B A;  2FWY A;  3EHH A;  4URO A;  3A0Z A;  2YI5 A;  4MOT A;  4E02 A;  5M4E A;  2QG0 A;  3PEH A;  4GEE A;  4LWG A;  4GGL A;  5D7R A;  1Y4U A;  2YKC A;  4EGH A;  4JQL A;  1QY8 A;  2YGF A;  2YEA A;  2XDS A;  4URN A;  2YGA A;  2IOQ A;  4BQJ A;  4MPE A;  1KIJ A;  4ASF A;  1US7 A;  2EXL A;  4YKQ A;  4H81 A;  2YEI A;  1H7S A;  2CCU A;  4HXZ A;  1Y8O A;  4GFN A;  1BGQ A;  2WI7 A;  4I3H A;  3TZ0 A;  2BZ5 A;  1Z5A A;  2CCS A;  2VCJ A;  4V25 A;  3EHG A;  1TC6 A;  4V26 A;  2ZDX A;  2IWX A;  2C2A A;  2XHT A;  2IOP A;  3C11 A;  3CRL A;  2BTZ A;  1BYQ A;  2ZKJ A;  4BQG A;  1UYM A;  5BOC A;  5FNF A;  3A0X A;  4XIQ A;  5CTY A;  4E01 A;  3RLR A;  4FCQ A;  4XC0 A;  3BMY A;  3FV5 A;  3DGE A;  3K98 A;  4EFU A;  1UY9 A;  4XIP A;  3JZ3 A;  1UYK A;  2FYP A;  3K99 A;  3VHA A;  3T1K A;  4CE3 A;  5J6A A;  2Q2E B;  1AJ6 A;  3QTF A;  2BU5 A;  3B27 A;  3FT5 A;  2QF6 A;  3ZKB A;  4CWR A;  2YE4 A;  2E0A A;  4HXW A;  4LWF A;  1A4H A;  2YI7 A;  1THN A;  3B24 A;  2FWZ A;  1I5A A;  4URM A;  3Q5K A;  3OWD A;  4O04 A;  1I59 A;  4YKW A;  4U93 A;  4CWO A;  2CCT A;  2HCH A;  2K5B A;  2XX5 A;  3QDD A;  4Q20 A;  4CWN A;  4EEH A;  2WEP A;  2YE3 A;  4ZVI A;  5M4H A;  1NHI A;  3INW A;  1TBW A;  1UYG A;  5FNC A;  3HYZ A;  2BU6 A;  4CWQ A;  4W7T A;  4I5S A;  2XJX A;  2YI6 A;  3B28 A;  4YKR A;  1UYD A;  4MPC A;  4QPJ A;  2XJG A;  1YET A;  2XX4 A;  5M4N A;  2YK9 A;  1ZXM A;  2XX2 A;  4BIZ A;  1TH8 A;  2YE5 A;  3D36 A;  2YEF A;  2Q8I A;  2YI0 A;  2YEG A;  2YEB A;  4X9L A;  1KZN A;  4CWF A;  3LPS A;  3K60 A;  3T0H A;  2XDL A;  1U2O A;  5L3J A;  4JAU A;  1UYF A;  2IWS A;  4LWE A;  4KSG A;  4LWH A;  1L0O A;  2VCI A;  1YC3 A;  1GKX A;  4YKY A;  1R62 A;  4CE1 A;  1H7U A;  2IWU A;  4LWI A;  1YS3 A;  5IN9 A;  4XKA A;  1MU5 A;  2XDX A;  3HHU A;  2XCM A;  3EHF A;  5F3K A;  2WI6 A;  3HYY A;  1OSF A;  3CRK A;  4JAS A;  1ZWH A;  1ZXN A;  3R91 A;  4XE2 A;  1U0Z A;  4L91 A;  2QFO A;  3EKR A;  3TZ2 A;  4XCJ A;  4LPB A;  2GFD A;  2IOR A;  3HZ5 A;  4L94 A;  4R3A A;  1Y8N A;  1AMW A;  4HZ0 A;  4R3M A;  1B63 A;  3O0I A;  3OMU A;  3D2R A;  5CTW A;  4E00 A;  1YC1 A;  2FXS A;  3U2K A;  3C0E A;  3O6O A;  3H80 A;  4GT8 A;  1B62 A;  2H55 A;  4PRV A;  2GQP A;  1YES A;  4MB9 A;  2YEE A;  1I58 A;  4ASA A;  1I5B A;  3BM9 A;  1Y4S A;  4NH7 A;  4AWO A;  3TZ5 A;  1EI1 A;  1Y8P A;  2BT0 A;  4KQV A;  2YEJ A;  3RKZ A;  4P8O A;  1YT2 A;  4O09 A;  2YKB A;  1ZW9 A;  4XD8 A;  1YC4 A;  4XKO A;  2WI1 A;  3MNR P;  4FMT A;  2O1U A;  3IED A;  3R4P A;  5GGZ A;  1UY7 A;  2YGE A;  2BYH A;  3OPD A;  3VAD A;  1Z59 A;  4CE2 A;  4FPP A;  2XD6 A;  4H85 A;  3RLQ A;  3B25 A;  2WI5 A;  4ASB A;  4XIT A;  3B26 A;  4GQT A;  3G75 A;  4DZY A;  2YKE A;  4MBC A;  3T2S A;  1UY6 A;  4P7A A;  1GKZ A;  1JM6 A;  1QYE A;  2Q8F A;  4FCR A;  4K4O A;  2XAB A;  3GIF A;  2CGF A;  3HEK A;  4U7N A;  3SL2 A;  2YKJ A;  2XHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...