5JENA

Crystal structure of the anti-sigma factor rsiv bound to lysozyme
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
210
structure length
210
Chain Sequence
IVKAITFIEIKEEKDQSSIDVKTPALSGLSNKELENSINEKYLKESQQLYKEFIQSTSKNKKGHLSIYSDYETVTDTPDLLSIRRNIETTQASSYTQSRYITIDKKNDILLTLKSLFKDERYIKVISQNIKEQMKQQMKEDPNKIYWLTDEDAEPFKTILPDQTFYITEDHKLVISFDEYEVAPGYMGVTEFTIPTGVISNLLVGERYIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-sigma-V factor RsiV
publication title The anti-sigma factor RsiV is a receptor for lysozyme: The crystal structure of RsiV-lysozyme complex
rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Hydrolase/hydrolase receptor
total genus 55
structure length 210
sequence length 210
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
A PF13739 PdaC Deacetylase PdaC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 5jenA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 5jenA02
2HHIA 3CYGA 4E72A 5JENA 3S5TA
chains in the Genus database with same CATH superfamily
3ULEB 3EKOA 1I5AA 2QWMA 4H5VA 3FE1A 4PL7A 3G7BA 3ZM7A 3A5LC 3UB5A 2BT0A 4Q20A 2FF6A 5AQVA 4NH8A 5F0XA 2FXSA 4WUDA 4I6MB 5BOCA 3FT8A 1TYQA 1HPMA 1ID0A 2P9PB 5L3JA 2XHRA 3BM9A 4Z94A 2WI2A 4YKQA 4CE1A 1Y8NA 2QXLA 3LMMA 4ASFA 1US7A 4QPKA 2VCIA 2YE3A 4PRXA 3RKZA 2ASOA 4B1VA 2YJWA 4L94A 1YSRA 4AM6A 3HYZA 1UYFA 4H85A 1UYIA 4FCQA 4A2AA 1B63A 4BQJA 4H03B 1S3XA 1AH8A 5CTWA 2YJEA 3VHDA 2YI6A 3PEJA 3A0XA 3INWA 2H55A 4JHDB 4CWRA 4XIQA 1HLUA 1YT2A 5GGZA 1B62A 1UY7A 1C0FA 1NGHA 1TIDA 2P9LB 3CGZA 5I9EB 2H8MA 4JN4A 3TZ0A 3LDNA 5E84A 4MPCA 1R62A 3M3ZA 5TKYA 1NGJA 1NGIA 4EGKA 4HWIA 5AQSA 3GIFA 3G7EA 3EHJA 4I5SA 2IWSA 4YKRA 3GL1A 3A5OC 2P9UA 3A5MC 1SQKA 4L91A 3RLQA 4CWSA 5AQNA 3ATVA 4CZMA 1UYLA 3T2SA 2UWDA 1U2OA 2ZWHA 3A0RA 3VHAA 2CGFA 1DEJA 3AY9A 2XX5A 3QTFA 3B24A 4KQVA 4CWFA 4V26A 3FZHA 4CZLA 5CTXA 5D7RA 1ZWHA 3RSEA 2AKPA 5FPEA 3L6QA 4GY2B 1UY9A 4L90A 2GWJA 3WHAA 2O1WA 2WI5A 4CE2A 2OANA 3LDPA 4XKAA 1L0OA 2XJJA 2D1KA 1TH8A 2XDLA 4CBXA 2A42A 2P9NB 2QWLA 2O1VA 2GQPA 3R92A 2VCPA 3MN5A 1UYHA 3DXKA 1YESA 2Q1NA 3B25A 1Y4UA 2YKJA 3A0ZA 3A8YA 5AFUH 3K60A 3CRKA 3Q5LA 2BSMA 3LDQA 1QZ5A 5M4KA 2YEFA 2WEPA 4YKTA 2IOPA 1BXDA 1QY8A 3MN6A 5CTUA 4EGIA 2Q8IA 1NGGA 3DAWA 4XJXA 5BN9A 4URLA 1MA9B 2V51B 4DZYA 3HHUA 4AWQA 4BQGA 5J6AA 2XDKA 5BODA 3DXMA 4FO0A 1IXMA 5CPHA 3QMLA 4B7PA 5AQUA 1YC4A 2XX4A 5AQOA 1E4GT 2HMPA 2HF4A 3B26A 4P8OA 2FXUA 5M4NA 2BUPA 3CI5A 4HY6A 3U9ZA 3FT5A 1PVGA 5AQXA 2CH4A 1NMDA 2QG2A 4LPBA 5JLHA 1YC1A 2XDUA 4L8ZA 4PL9A 1ESVA 2P9UB 1UY8A 4HXZA 3FV5A 4EFUA 2QWNA 2WI1A 3OMUA 3QB0A 5AQYA 3KE6A 4GQTA 1KZNA 1U2VA 4HYMA 4YKUA 1YUWA 5AQPA 3UKRA 1ZXMA 3W3DA 2HCHA 4BEBA 4B1UB 3D0BA 3IEDA 1DKGD 2JKIA 3WQ9A 1LOTB 4NH7A 3TPQA 4YKWA 5AQZA 4H5TA 3C11A 2YEJA 4HYPA 5EXWA 1NHIA 2FYPA 4FPPA 2V52B 1HX1A 2QWQA 3LDLA 2XDXA 3RSEB 1H7UA 2Q8GA 4AWPA 4KBOA 4X9LA 3CHWA 4ASBA 1I5BA 2P9IB 5AQRA 4XCLA 2P9SA 4E01A 4XC0A 1KAXA 4UROA 3EKSA 4AS9A 2VCJA 1Y4SA 4BE7B 2IORA 2E88A 3DGEA 3D2EB 3FFKB 4HXWA 2PNRA 4GFNA 1GKZA 2Q8FA 2P9KA 3DXKB 4EMVA 3LDOA 3EKUA 1J6ZA 3S5TA 1D4XA 1MDUB 3TU5A 3EHFA 1MU5A 3FZFA 5ADXA 5C93A 1BKNA 3O2FA 2YKIA 5D6QA 4XTJA 2Q97A 1GKXA 3U4LA 1NGEA 2PBDA 2FTKA 3A0YA 3CGYA 4E00A 5M4EA 4BIZA 4LP0A 3DXMB 4JNEA 4K43A 2YGFA 3ZKDA 1UYEA 2BRCA 2YJXA 2YGAA 5FNFA 4JAVA 5IDJA 4JAUA 1BYQA 2YKEA 1U0ZA 5AQKA 5M4MA 4JQLA 2A3ZA 5EX5A 4XITA 1RFQA 4W7TA 5AQGA 2YGEA 3TTZA 1QZ6A 1K8KA 3D2FA 1WUAA 3MN7A 3K99A 4V25A 5AQQA 1U2VB 1I58A 3ATUA 3UKRB 4URNA 2YE7A 5AQTA 2BTZA 4U93A 4EFHA 3H4LA 4E02A 4CWTA 3EHGA 2QW9A 3GIEA 3T1KA 2IOQA 4KFGA 4MBCA 4PU9A 4GT8A 1NHHA 2XD6A 4KTNA 4EM7A 4O04A 5CTYA 4HZ0A 4K4OA 3LNUA 4QPJA 4R3AA 3FZMA 4O0BA 2YJFA 4CZFA 1NGFA 1Z5BA 1AMWA 3CYGA 2C1GA 4CWQA 2ASPA 4A2BA 3GIGA 4O07A 1AH6A 2GWKA 2A5XA 1TYQB 2YI0A 1EQYA 1B3QA 2ZDYA 4CZJA 3T10A 5D7CA 1ZXNA 2YE9A 4LWEA 3PEHA 1BGQA 2XX2A 2Q0RA 5F2RA 1UYDA 3K98A 2XHXA 4ZKIA 3U9DA 4KSHA 4L93A 4MPNA 5JLFA 1QYEA 1QQNA 4FCPA 2QWOA 4LWHA 3WEEA 4B1XB 4CZKA 1A4HA 4EFTA 5CE3A 4H0XB 3CIPA 1YERA 4H5NA 2QG0A 4EEHA 4CZGA 4CWOA 5BN8A 5ADXH 2FWYA 1GJVA 2EXLA 2WI7A 5FWKA 2K5BA 1NGBA 1UYMA 3ULEA 2BREA 4BECA 4P7AA 4FCRA 4YKXA 3TUHA 4PL8A 2IWXA 3CWVA 1H1VA 1THNA 3CQXA 3D2FB 1K8KB 4I6MA 3RLRA 3IUCA 3LPSA 4U7NA 3HYYA 3H80A 4WUCA 2P9PA 4U7OA 3R4NA 1NHJA 3T0ZA 2XCMA 3BMYA 4XIRA 2HG1A 4LWIA 3FZKA 3OWDA 1Z5AA 4XD8A 3A5NC 3MMVA 4DUHA 3CRLA 4MPEA 4LWFA 3HZ1A 3VHCA 3TZ4A 2CCTA 2YE5A 4GGLA 4JD2A 1EA6A 5F5RA 1YS3A 3DWLA 4CWPA 2YE4A 5AQLA 4YKYA 3B28A 1Z59A 3GIGB 2FWZA 4JHDA 1RDWX 3JXUA 2ZDXA 4I3HA 1RGIA 2GFDA 3HZ5A 2W00A 2YEDA 2WEQA 4GEEA 2P9LA 5EY4A 1YAGA 1ZW9A 1P8ZA 3HSCA 2BU2A 5FNCA 4CZIA 4EAHD 5IDMA 5AQHA 1LCUA 3A0TA 5AQMA 5F1XA 3Q5JA 2CG9A 1KAZA 3WEEB 1YT0A 2HHIA 3MNRP 2WI4A 5D7DA 2ZBKB 2WUSA 5BPLA 4MP2A 2VWCA 1NLVA 4MP7A 2V7YA 4ZVIA 4B1YB 4O05A 1JCEA 4XKKA 2JJCA 4K42A 1NM1A 1I59A 5F3KA 4GNIA 2Q2EB 1T44A 1UY6A 4PRVA 3UKUA 2ASMA 3M6GA 3ZXOA 1KAYA 4R1FA 2QFOA 3BUZB 4CE3A 1Z5CA 3G75A 4JASA 3NMQA 1BA0A 3QFUA 4H5WA 1NGCA 3J8AA 3QFPA 4NH9A 2XJXA 1JCGA 4H81A 4FMTA 5FPMA 5AFUA 4CI6A 1UYGA 4XE2A 1ATNA 1JM6A 2YEIA 5M4PA 2KHOA 4B9QA 2YE8A 2BU7A 2QWRA 5CF0A 5IN9A 2P9NA 2QWPA 4JD2B 1YVNA 2YEAA 1TC0A 4EGHA 3ZXQA 4FSVA 2YK2A 2YK9A 3R4OA 3HBTA 1KIJA 4IO8A 2IWUA 4MB9A 3EHHA 1C0GA 2BYIA 4WYBA 3D2RA 5M4HA 1TC6A 1YXQA 1S16A 3VADA 5J71A 2E0AA 3KVGA 5EVZA 2BTFA 4URMA 2YEGA 1NGAA 1UYKA 3JZ3A 2P9SB 1EI1A 1UYCA 2YEBA 4K41A 5FPNA 1ATRA 4XKOA 2YE2A 5BPNA 2WI3A 3TZ2A 4CZHA 1TBWA 3A0WA 2A40A 3R4PA 2QF6A 3EKRA 2HF3A 2P9KB 5AQFA 4M63C 4HZ5A 2YI5A 1IJJA 1I5CA 3K97A 3CJBA 2BU5A 2YKBA 5D6PA 1MX0A 3SJHA 3GDQA 2XK2A 4CZEA 4H7QA 4HY1A 5FNDA 3FZLA 4WUBA 3HEKA 3C7NA 4BAEA 4XEIA 3UKUB 2XDSA 4B1WB 3O0IA 2O1UA 2PAVA 1TILA 4CWNA 3TZ5A 1F51A 4GCZA 4H5RA 4R3MA 5BPMA 3O6OA 3U2DA 1S22A 4AWOA 1H7SA 1QQMA 1E4FT 2BZ5A 3I33A 4PKHA 2YECA 3C0EA 2Q8HA 2P9IA 4BXIA 4KSGA 2VYPA 4RTFD 2HKJA 3L4IA 5AQJA 4B6CA 1OSFA 3QDDA 3U8XA 2FF3B 1BUPA 5FPDA 1YETA 1XQSC 3D2EA 2YEHA 4FL9A 2E8AA 3CJCA 2CCUA 2WERA 1QZRA 1I5DA 4KP4A 2C1IA 4E72A 4H0VB 2XJGA 2YI7A 3OWBA 3Q5KA 4RWTA 2YE6A 2XABA 1YSZA 2YEEA 4MOTA 4XIPA 1QQOA 1AJ6A 3R4MA 3MN9A 4H0TB 4H0YB 2YKCA 1JCFA 2BU6A 5AQWA 3SL2A 1Y8PA 3ZKBA 5AR0A 3OW6A 4B1ZA 1KXPA 1YC3A 2Q36A 3UE5A 1AM1A 4CBUA 5JENA 3B27A 1BA1A 4YKZA 1NWKA 3T0HA 4CBWA 1YT1A 1S14A 3R91A 2A41A 2BU8A 3M1FA 2ZKJA 2V7ZA 4ASAA 1NGDA 2CCSA 5AQIA 3D36A 2Q0UA 1HJOA 4ASGA 4PKIA 3C7NB 1ATSA 2C2AA 3U2KA 1Y64A 4XDMA 3RLPA 2ESAA 2WI6A 4AM7A 1Y8OA 2VW5A 3OPDA 2Q31A 2BYHA 4PKGA 4J8FA 4XCJA 3EL2A 3U67A 4BIUA 2XHTA 4LWGA 3INXA 4O09A
chains in the Genus database with same CATH topology
2HHIA 3CYGA 4E72A 5JENA 3S5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHI A;  3CYG A;  4E72 A;  5JEN A;  3S5T A; 
#chains in the Genus database with same CATH topology
 3ULE B;  3EKO A;  1I5A A;  2QWM A;  4H5V A;  3FE1 A;  4PL7 A;  3G7B A;  3ZM7 A;  3A5L C;  3UB5 A;  2BT0 A;  4Q20 A;  2FF6 A;  5AQV A;  4NH8 A;  5F0X A;  2FXS A;  4WUD A;  4I6M B;  5BOC A;  3FT8 A;  1TYQ A;  1HPM A;  1ID0 A;  2P9P B;  5L3J A;  2XHR A;  3BM9 A;  4Z94 A;  2WI2 A;  4YKQ A;  4CE1 A;  1Y8N A;  2QXL A;  3LMM A;  4ASF A;  1US7 A;  4QPK A;  2VCI A;  2YE3 A;  4PRX A;  3RKZ A;  2ASO A;  4B1V A;  2YJW A;  4L94 A;  1YSR A;  4AM6 A;  3HYZ A;  1UYF A;  4H85 A;  1UYI A;  4FCQ A;  4A2A A;  1B63 A;  4BQJ A;  4H03 B;  1S3X A;  1AH8 A;  5CTW A;  2YJE A;  3VHD A;  2YI6 A;  3PEJ A;  3A0X A;  3INW A;  2H55 A;  4JHD B;  4CWR A;  4XIQ A;  1HLU A;  1YT2 A;  5GGZ A;  1B62 A;  1UY7 A;  1C0F A;  1NGH A;  1TID A;  2P9L B;  3CGZ A;  5I9E B;  2H8M A;  4JN4 A;  3TZ0 A;  3LDN A;  5E84 A;  4MPC A;  1R62 A;  3M3Z A;  5TKY A;  1NGJ A;  1NGI A;  4EGK A;  4HWI A;  5AQS A;  3GIF A;  3G7E A;  3EHJ A;  4I5S A;  2IWS A;  4YKR A;  3GL1 A;  3A5O C;  2P9U A;  3A5M C;  1SQK A;  4L91 A;  3RLQ A;  4CWS A;  5AQN A;  3ATV A;  4CZM A;  1UYL A;  3T2S A;  2UWD A;  1U2O A;  2ZWH A;  3A0R A;  3VHA A;  2CGF A;  1DEJ A;  3AY9 A;  2XX5 A;  3QTF A;  3B24 A;  4KQV A;  4CWF A;  4V26 A;  3FZH A;  4CZL A;  5CTX A;  5D7R A;  1ZWH A;  3RSE A;  2AKP A;  5FPE A;  3L6Q A;  4GY2 B;  1UY9 A;  4L90 A;  2GWJ A;  3WHA A;  2O1W A;  2WI5 A;  4CE2 A;  2OAN A;  3LDP A;  4XKA A;  1L0O A;  2XJJ A;  2D1K A;  1TH8 A;  2XDL A;  4CBX A;  2A42 A;  2P9N B;  2QWL A;  2O1V A;  2GQP A;  3R92 A;  2VCP A;  3MN5 A;  1UYH A;  3DXK A;  1YES A;  2Q1N A;  3B25 A;  1Y4U A;  2YKJ A;  3A0Z A;  3A8Y A;  5AFU H;  3K60 A;  3CRK A;  3Q5L A;  2BSM A;  3LDQ A;  1QZ5 A;  5M4K A;  2YEF A;  2WEP A;  4YKT A;  2IOP A;  1BXD A;  1QY8 A;  3MN6 A;  5CTU A;  4EGI A;  2Q8I A;  1NGG A;  3DAW A;  4XJX A;  5BN9 A;  4URL A;  1MA9 B;  2V51 B;  4DZY A;  3HHU A;  4AWQ A;  4BQG A;  5J6A A;  2XDK A;  5BOD A;  3DXM A;  4FO0 A;  1IXM A;  5CPH A;  3QML A;  4B7P A;  5AQU A;  1YC4 A;  2XX4 A;  5AQO A;  1E4G T;  2HMP A;  2HF4 A;  3B26 A;  4P8O A;  2FXU A;  5M4N A;  2BUP A;  3CI5 A;  4HY6 A;  3U9Z A;  3FT5 A;  1PVG A;  5AQX A;  2CH4 A;  1NMD A;  2QG2 A;  4LPB A;  5JLH A;  1YC1 A;  2XDU A;  4L8Z A;  4PL9 A;  1ESV A;  2P9U B;  1UY8 A;  4HXZ A;  3FV5 A;  4EFU A;  2QWN A;  2WI1 A;  3OMU A;  3QB0 A;  5AQY A;  3KE6 A;  4GQT A;  1KZN A;  1U2V A;  4HYM A;  4YKU A;  1YUW A;  5AQP A;  3UKR A;  1ZXM A;  3W3D A;  2HCH A;  4BEB A;  4B1U B;  3D0B A;  3IED A;  1DKG D;  2JKI A;  3WQ9 A;  1LOT B;  4NH7 A;  3TPQ A;  4YKW A;  5AQZ A;  4H5T A;  3C11 A;  2YEJ A;  4HYP A;  5EXW A;  1NHI A;  2FYP A;  4FPP A;  2V52 B;  1HX1 A;  2QWQ A;  3LDL A;  2XDX A;  3RSE B;  1H7U A;  2Q8G A;  4AWP A;  4KBO A;  4X9L A;  3CHW A;  4ASB A;  1I5B A;  2P9I B;  5AQR A;  4XCL A;  2P9S A;  4E01 A;  4XC0 A;  1KAX A;  4URO A;  3EKS A;  4AS9 A;  2VCJ A;  1Y4S A;  4BE7 B;  2IOR A;  2E88 A;  3DGE A;  3D2E B;  3FFK B;  4HXW A;  2PNR A;  4GFN A;  1GKZ A;  2Q8F A;  2P9K A;  3DXK B;  4EMV A;  3LDO A;  3EKU A;  1J6Z A;  3S5T A;  1D4X A;  1MDU B;  3TU5 A;  3EHF A;  1MU5 A;  3FZF A;  5ADX A;  5C93 A;  1BKN A;  3O2F A;  2YKI A;  5D6Q A;  4XTJ A;  2Q97 A;  1GKX A;  3U4L A;  1NGE A;  2PBD A;  2FTK A;  3A0Y A;  3CGY A;  4E00 A;  5M4E A;  4BIZ A;  4LP0 A;  3DXM B;  4JNE A;  4K43 A;  2YGF A;  3ZKD A;  1UYE A;  2BRC A;  2YJX A;  2YGA A;  5FNF A;  4JAV A;  5IDJ A;  4JAU A;  1BYQ A;  2YKE A;  1U0Z A;  5AQK A;  5M4M A;  4JQL A;  2A3Z A;  5EX5 A;  4XIT A;  1RFQ A;  4W7T A;  5AQG A;  2YGE A;  3TTZ A;  1QZ6 A;  1K8K A;  3D2F A;  1WUA A;  3MN7 A;  3K99 A;  4V25 A;  5AQQ A;  1U2V B;  1I58 A;  3ATU A;  3UKR B;  4URN A;  2YE7 A;  5AQT A;  2BTZ A;  4U93 A;  4EFH A;  3H4L A;  4E02 A;  4CWT A;  3EHG A;  2QW9 A;  3GIE A;  3T1K A;  2IOQ A;  4KFG A;  4MBC A;  4PU9 A;  4GT8 A;  1NHH A;  2XD6 A;  4KTN A;  4EM7 A;  4O04 A;  5CTY A;  4HZ0 A;  4K4O A;  3LNU A;  4QPJ A;  4R3A A;  3FZM A;  4O0B A;  2YJF A;  4CZF A;  1NGF A;  1Z5B A;  1AMW A;  3CYG A;  2C1G A;  4CWQ A;  2ASP A;  4A2B A;  3GIG A;  4O07 A;  1AH6 A;  2GWK A;  2A5X A;  1TYQ B;  2YI0 A;  1EQY A;  1B3Q A;  2ZDY A;  4CZJ A;  3T10 A;  5D7C A;  1ZXN A;  2YE9 A;  4LWE A;  3PEH A;  1BGQ A;  2XX2 A;  2Q0R A;  5F2R A;  1UYD A;  3K98 A;  2XHX A;  4ZKI A;  3U9D A;  4KSH A;  4L93 A;  4MPN A;  5JLF A;  1QYE A;  1QQN A;  4FCP A;  2QWO A;  4LWH A;  3WEE A;  4B1X B;  4CZK A;  1A4H A;  4EFT A;  5CE3 A;  4H0X B;  3CIP A;  1YER A;  4H5N A;  2QG0 A;  4EEH A;  4CZG A;  4CWO A;  5BN8 A;  5ADX H;  2FWY A;  1GJV A;  2EXL A;  2WI7 A;  5FWK A;  2K5B A;  1NGB A;  1UYM A;  3ULE A;  2BRE A;  4BEC A;  4P7A A;  4FCR A;  4YKX A;  3TUH A;  4PL8 A;  2IWX A;  3CWV A;  1H1V A;  1THN A;  3CQX A;  3D2F B;  1K8K B;  4I6M A;  3RLR A;  3IUC A;  3LPS A;  4U7N A;  3HYY A;  3H80 A;  4WUC A;  2P9P A;  4U7O A;  3R4N A;  1NHJ A;  3T0Z A;  2XCM A;  3BMY A;  4XIR A;  2HG1 A;  4LWI A;  3FZK A;  3OWD A;  1Z5A A;  4XD8 A;  3A5N C;  3MMV A;  4DUH A;  3CRL A;  4MPE A;  4LWF A;  3HZ1 A;  3VHC A;  3TZ4 A;  2CCT A;  2YE5 A;  4GGL A;  4JD2 A;  1EA6 A;  5F5R A;  1YS3 A;  3DWL A;  4CWP A;  2YE4 A;  5AQL A;  4YKY A;  3B28 A;  1Z59 A;  3GIG B;  2FWZ A;  4JHD A;  1RDW X;  3JXU A;  2ZDX A;  4I3H A;  1RGI A;  2GFD A;  3HZ5 A;  2W00 A;  2YED A;  2WEQ A;  4GEE A;  2P9L A;  5EY4 A;  1YAG A;  1ZW9 A;  1P8Z A;  3HSC A;  2BU2 A;  5FNC A;  4CZI A;  4EAH D;  5IDM A;  5AQH A;  1LCU A;  3A0T A;  5AQM A;  5F1X A;  3Q5J A;  2CG9 A;  1KAZ A;  3WEE B;  1YT0 A;  2HHI A;  3MNR P;  2WI4 A;  5D7D A;  2ZBK B;  2WUS A;  5BPL A;  4MP2 A;  2VWC A;  1NLV A;  4MP7 A;  2V7Y A;  4ZVI A;  4B1Y B;  4O05 A;  1JCE A;  4XKK A;  2JJC A;  4K42 A;  1NM1 A;  1I59 A;  5F3K A;  4GNI A;  2Q2E B;  1T44 A;  1UY6 A;  4PRV A;  3UKU A;  2ASM A;  3M6G A;  3ZXO A;  1KAY A;  4R1F A;  2QFO A;  3BUZ B;  4CE3 A;  1Z5C A;  3G75 A;  4JAS A;  3NMQ A;  1BA0 A;  3QFU A;  4H5W A;  1NGC A;  3J8A A;  3QFP A;  4NH9 A;  2XJX A;  1JCG A;  4H81 A;  4FMT A;  5FPM A;  5AFU A;  4CI6 A;  1UYG A;  4XE2 A;  1ATN A;  1JM6 A;  2YEI A;  5M4P A;  2KHO A;  4B9Q A;  2YE8 A;  2BU7 A;  2QWR A;  5CF0 A;  5IN9 A;  2P9N A;  2QWP A;  4JD2 B;  1YVN A;  2YEA A;  1TC0 A;  4EGH A;  3ZXQ A;  4FSV A;  2YK2 A;  2YK9 A;  3R4O A;  3HBT A;  1KIJ A;  4IO8 A;  2IWU A;  4MB9 A;  3EHH A;  1C0G A;  2BYI A;  4WYB A;  3D2R A;  5M4H A;  1TC6 A;  1YXQ A;  1S16 A;  3VAD A;  5J71 A;  2E0A A;  3KVG A;  5EVZ A;  2BTF A;  4URM A;  2YEG A;  1NGA A;  1UYK A;  3JZ3 A;  2P9S B;  1EI1 A;  1UYC A;  2YEB A;  4K41 A;  5FPN A;  1ATR A;  4XKO A;  2YE2 A;  5BPN A;  2WI3 A;  3TZ2 A;  4CZH A;  1TBW A;  3A0W A;  2A40 A;  3R4P A;  2QF6 A;  3EKR A;  2HF3 A;  2P9K B;  5AQF A;  4M63 C;  4HZ5 A;  2YI5 A;  1IJJ A;  1I5C A;  3K97 A;  3CJB A;  2BU5 A;  2YKB A;  5D6P A;  1MX0 A;  3SJH A;  3GDQ A;  2XK2 A;  4CZE A;  4H7Q A;  4HY1 A;  5FND A;  3FZL A;  4WUB A;  3HEK A;  3C7N A;  4BAE A;  4XEI A;  3UKU B;  2XDS A;  4B1W B;  3O0I A;  2O1U A;  2PAV A;  1TIL A;  4CWN A;  3TZ5 A;  1F51 A;  4GCZ A;  4H5R A;  4R3M A;  5BPM A;  3O6O A;  3U2D A;  1S22 A;  4AWO A;  1H7S A;  1QQM A;  1E4F T;  2BZ5 A;  3I33 A;  4PKH A;  2YEC A;  3C0E A;  2Q8H A;  2P9I A;  4BXI A;  4KSG A;  2VYP A;  4RTF D;  2HKJ A;  3L4I A;  5AQJ A;  4B6C A;  1OSF A;  3QDD A;  3U8X A;  2FF3 B;  1BUP A;  5FPD A;  1YET A;  1XQS C;  3D2E A;  2YEH A;  4FL9 A;  2E8A A;  3CJC A;  2CCU A;  2WER A;  1QZR A;  1I5D A;  4KP4 A;  2C1I A;  4E72 A;  4H0V B;  2XJG A;  2YI7 A;  3OWB A;  3Q5K A;  4RWT A;  2YE6 A;  2XAB A;  1YSZ A;  2YEE A;  4MOT A;  4XIP A;  1QQO A;  1AJ6 A;  3R4M A;  3MN9 A;  4H0T B;  4H0Y B;  2YKC A;  1JCF A;  2BU6 A;  5AQW A;  3SL2 A;  1Y8P A;  3ZKB A;  5AR0 A;  3OW6 A;  4B1Z A;  1KXP A;  1YC3 A;  2Q36 A;  3UE5 A;  1AM1 A;  4CBU A;  5JEN A;  3B27 A;  1BA1 A;  4YKZ A;  1NWK A;  3T0H A;  4CBW A;  1YT1 A;  1S14 A;  3R91 A;  2A41 A;  2BU8 A;  3M1F A;  2ZKJ A;  2V7Z A;  4ASA A;  1NGD A;  2CCS A;  5AQI A;  3D36 A;  2Q0U A;  1HJO A;  4ASG A;  4PKI A;  3C7N B;  1ATS A;  2C2A A;  3U2K A;  1Y64 A;  4XDM A;  3RLP A;  2ESA A;  2WI6 A;  4AM7 A;  1Y8O A;  2VW5 A;  3OPD A;  2Q31 A;  2BYH A;  4PKG A;  4J8F A;  4XCJ A;  3EL2 A;  3U67 A;  4BIU A;  2XHT A;  4LWG A;  3INX A;  4O09 A; 
#chains in the Genus database with same CATH homology
 2HHI A;  3CYG A;  4E72 A;  5JEN A;  3S5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...