5JENA

Crystal structure of the anti-sigma factor rsiv bound to lysozyme
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
210
structure length
210
Chain Sequence
IVKAITFIEIKEEKDQSSIDVKTPALSGLSNKELENSINEKYLKESQQLYKEFIQSTSKNKKGHLSIYSDYETVTDTPDLLSIRRNIETTQASSYTQSRYITIDKKNDILLTLKSLFKDERYIKVISQNIKEQMKQQMKEDPNKIYWLTDEDAEPFKTILPDQTFYITEDHKLVISFDEYEVAPGYMGVTEFTIPTGVISNLLVGERYIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase receptor
molecule keywords Anti-sigma-V factor RsiV
publication title The anti-sigma factor RsiV is a receptor for lysozyme: The crystal structure of RsiV-lysozyme complex
rcsb
source organism Bacillus subtilis (strain 168)
total genus 55
structure length 210
sequence length 210
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
A PF13739 PdaC Deacetylase PdaC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 5jenA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 5jenA02
3CYGA 3S5TA 4E72A 5JENA 2HHIA
chains in the Genus database with same CATH superfamily
4R3MA 1YUWA 5D7RA 3T10A 4BECA 2XX4A 5ADXH 2XDUA 3C0EA 2P9LA 4XJXA 5ADXA 1YC3A 2YEBA 2Q0RA 2BU6A 2GQPA 3SJHA 3KVGA 4CBUA 4H81A 2P9UA 4LWIA 1HLUA 2QWRA 3FZHA 2UWDA 4QPKA 3K98A 2PNRA 2Q1NA 3HBTA 4CZLA 4FL9A 4YKYA 1ATNA 3DXMA 4PL7A 1IJJA 1JCEA 5BN9A 5AQFA 2XX5A 4JHDA 5JLFA 3CYGA 4CE3A 1UY8A 3TZ0A 3R92A 4EEHA 3R91A 3IEDA 5BPLA 2XDLA 4BE7B 4BXIA 1ESVA 4CWFA 3CI5A 4CZHA 2YEIA 2QWOA 3WHAA 1ZW9A 4FSVA 5CTYA 1UYKA 3G7BA 4HXZA 1RFQA 4H5TA 1EA6A 3ATUA 1H7SA 4K41A 3FE1A 2IWSA 1BA0A 2VCJA 4EM7A 5CTUA 1KAZA 1SQKA 3ZKBA 4AWQA 2XX2A 4BIZA 4EMVA 1QQOA 4CZKA 1TYQA 2ZWHA 4JD2B 4XIRA 5D7DA 4CWSA 2XJJA 2WI1A 3U2DA 2AKPA 5AQGA 4CZEA 5AQNA 3OW6A 3FZMA 4PL8A 2XJGA 2YE2A 1QY8A 4H5NA 1EI1A 3LNUA 2P9SA 3LPSA 4H7QA 1DKGD 4CBXA 4WYBA 2Q8FA 1C0GA 4O04A 4CBWA 1YXQA 2VCIA 3A0XA 2YEEA 2HG1A 1MA9B 2HMPA 3QB0A 2BTFA 4ASBA 2Q8HA 1ATSA 3C7NB 1MDUB 3EKOA 2VWCA 4K42A 3TZ5A 4GY2B 2YKCA 4EAHD 2ASOA 3G7EA 3W3DA 2YE7A 2YE6A 4XKOA 4HZ5A 1QYEA 1THNA 4GEEA 4R3AA 4UROA 4E72A 5FNFA 3QMLA 4CZIA 4CWNA 4QPJA 4BAEA 2XDSA 4CZMA 1AJ6A 3TUHA 3K97A 1K8KB 3U67A 4Q20A 3CQXA 3NMQA 3O6OA 4GQTA 4U93A 4I6MA 3R4OA 1KAXA 4AS9A 3JZ3A 4EGIA 4L94A 3TZ2A 1U0ZA 2YE5A 4URNA 3L6QA 1I58A 3G75A 4PRXA 1U2VB 4M63C 4FMTA 2CCTA 1QQNA 5GGZA 1ATRA 4YKUA 2BT0A 2YGEA 5CTWA 3A0RA 4A2AA 1UY7A 2YEGA 2H55A 4B7PA 4CWRA 3GDQA 2WERA 4H5VA 4CZFA 3EHGA 3TU5A 1UYDA 2CG9A 3R4MA 1NM1A 3LDOA 2WI7A 5L3JA 5CTXA 2BSMA 2XHTA 5IDJA 4XTJA 2FTKA 3O0IA 4MOTA 3U9ZA 2CH4A 2ASMA 2GFDA 4YKXA 3A5LC 3BUZB 4EFUA 2FWYA 2P9PB 4JQLA 3K60A 1TC6A 4NH7A 1BA1A 5AQUA 3SL2A 4LWGA 4U7NA 4CE2A 4CWOA 1UYFA 3D0BA 2QFOA 1P8ZA 3CIPA 4P7AA 4H5WA 1PVGA 4CZJA 1C0FA 2XDKA 2YKBA 2YJXA 2YEFA 2Q8GA 3UKUA 2WUSA 3A0TA 3B26A 2YEDA 3T0HA 1S14A 3QTFA 3U2KA 5M4NA 4DUHA 5IDMA 1T44A 4GNIA 5AQRA 1DEJA 2HF4A 3HSCA 5CE3A 4O0BA 2KHOA 2YKEA 3BMYA 5FPNA 3T2SA 2IOQA 2YJEA 5FPMA 1L0OA 1I5BA 3T1KA 2YGAA 3ATVA 2CGFA 2YKIA 2IWUA 1J6ZA 4YKQA 4O07A 3UB5A 2P9KA 4BQGA 1UYEA 1NGIA 2VYPA 4AWPA 2ASPA 1KIJA 1YERA 2YI7A 1U2OA 3ZKDA 1YC1A 1IXMA 4K4OA 3EHJA 2WI4A 4MPCA 4DZYA 5AQJA 3UE5A 5J6AA 3CJCA 4E01A 3B25A 4PKHA 4FPPA 3EKUA 1I5DA 2WI2A 4V25A 4KTNA 1YC4A 4R1FA 2H8MA 1TH8A 2WI6A 4I5SA 2A42A 3UKRA 3A0YA 3RLPA 4B1VA 5BPNA 1NWKA 4XDMA 5E84A 2ZBKB 1NGEA 1D4XA 2C1GA 2Q2EB 2BU2A 4L8ZA 4EFTA 1JM6A 3U4LA 2YEJA 3CRKA 3DXKB 3GIGB 2IWXA 3OPDA 2ESAA 5AQKA 3VHDA 3QDDA 3MN9A 4IO8A 3FT8A 2YEHA 2P9NB 1I59A 3M6GA 3HYYA 2GWJA 2V52B 4ASFA 1GKXA 3VHCA 3D36A 3D2FB 3HZ1A 3TPQA 4E00A 1S3XA 2ZDXA 3D2RA 4FCQA 2XJXA 3FT5A 1Z5AA 1HJOA 2WI3A 1NGHA 4XD8A 3EKSA 3KE6A 3GL1A 4YKTA 4PU9A 3D2EB 4NH9A 5FPEA 1KXPA 1NGCA 2E0AA 1BXDA 2JKIA 4H0TB 3PEJA 4URMA 5M4EA 1NGBA 4FCPA 4AWOA 3J8AA 2A5XA 4HWIA 4LPBA 4JAVA 2HKJA 2OANA 2VW5A 3H4LA 4XC0A 5JLHA 1ZXMA 4HY6A 5F5RA 1TIDA 3BM9A 1YT1A 4EGKA 4AM6A 5JENA 3CHWA 5IN9A 4JNEA 5AQOA 5F0XA 1BUPA 1AM1A 5D7CA 3GIFA 1UYCA 3ULEB 4PRVA 4PKGA 4GFNA 4YKRA 4XKAA 4XITA 3ZM7A 4B6CA 2QG0A 2XCMA 1NHHA 5AQSA 2YKJA 1JCFA 1Y4UA 4XE2A 4XIPA 4ASGA 5AQTA 3VADA 2XDXA 3O2FA 2W00A 3FFKB 5M4HA 4MPNA 4NH8A 2P9IB 4LWFA 2A41A 4JD2A 4B1WB 3WEEB 5AQYA 2BU7A 3A5OC 5AQHA 3HZ5A 1ZWHA 5AQQA 3IUCA 2GWKA 3MN5A 1LCUA 4X9LA 2PBDA 2P9LB 5M4KA 2Q97A 2YJWA 4HXWA 1AH8A 1S22A 3S5TA 3CGZA 2P9UB 2XABA 3FV5A 4BQJA 5AFUH 2QWQA 1Y4SA 4YKZA 4CI6A 5AFUA 4H0YB 3HEKA 3DXMB 2YE3A 4KSGA 3PEHA 3QFUA 4MBCA 4MP2A 2XHXA 1YETA 2WEPA 1HPMA 3C11A 3FZFA 3MN7A 2E8AA 2WI5A 3LDPA 2BZ5A 4JHDB 2FWZA 5EXWA 1UYGA 2V51B 1YSZA 3C7NA 4KQVA 4L90A 4CWPA 3I33A 4JN4A 2FF3B 4B9QA 1H1VA 5FNDA 1QQMA 4I3HA 4KFGA 2HCHA 1UYHA 4Z94A 4FCRA 3B28A 3A0WA 3CGYA 4GCZA 2BRCA 1ID0A 4V26A 4BIUA 4EGHA 5M4MA 3RSEA 2HF3A 3TZ4A 5EY4A 2V7YA 4AM7A 4CWTA 1TC0A 1ZXNA 3QFPA 1K8KA 1QZ6A 3INXA 1YT0A 3ZXOA 4XIQA 5TKYA 3A5MC 2EXLA 3CRLA 1UY9A 1WUAA 4J8FA 4BEBA 3GIEA 3R4NA 3OWBA 1NHIA 2QXLA 1I5AA 1TYQB 2VCPA 5CF0A 3OWDA 1U2VA 4O05A 2FXSA 4B1UB 1S16A 1NGDA 4RWTA 2QF6A 3VHAA 1Y8NA 1LOTB 4XKKA 1MU5A 4YKWA 4MPEA 5CPHA 5AQZA 2QG2A 1US7A 3EHFA 2BYIA 4LWEA 5FWKA 2C2AA 3EL2A 5AQLA 2P9SB 2Q31A 5I9EB 1UYLA 2QW9A 4B1XB 2D1KA 2YI5A 2FF6A 4CE1A 3RLRA 4P8OA 5FPDA 2FYPA 4H85A 4O09A 2P9PA 1TILA 4XEIA 4URLA 2XD6A 4H03B 4KP4A 4H0VB 4KBOA 3H80A 1B62A 1UY6A 4L91A 5J71A 2FXUA 4U7OA 2YE4A 3TTZA 5BPMA 5D6QA 3EKRA 1UYIA 4EFHA 1E4FT 1NGAA 1QZ5A 5AQVA 1Z5CA 1YAGA 2P9KB 1E4GT 1EQYA 1GKZA 4FO0A 5FNCA 4PKIA 4B1ZA 3A8YA 1UYMA 2YE9A 3DGEA 1BGQA 3WQ9A 3HHUA 5M4PA 3L4IA 1I5CA 1JCGA 1OSFA 4GGLA 5EX5A 2XK2A 4E02A 5BOCA 5AQPA 2YJFA 3B27A 5BN8A 3MMVA 1XQSC 4I6MB 3M3ZA 4RTFD 3FZKA 1Y64A 3RKZA 5AQWA 4ZVIA 2CCSA 2IORA 4HYMA 5AQIA 2YECA 4CZGA 4ZKIA 2QWMA 5AQXA 3R4PA 1HX1A 2A40A 2Q0UA 4HZ0A 4H5RA 2JJCA 1NGGA 2YGFA 1B63A 3K99A 5EVZA 3Q5KA 3A0ZA 3CJBA 1Y8OA 1NGJA 4XCJA 4PL9A 3T0ZA 4JAUA 1NMDA 4WUBA 1YVNA 3LDNA 2YEAA 2Q36A 1YESA 3RLQA 3A5NC 3U9DA 4JASA 4GT8A 4A2BA 2C1IA 3ZXQA 3DWLA 3B24A 2BU8A 1BKNA 3FZLA 3DXKA 2WEQA 1BYQA 3Q5LA 3GIGA 5BODA 3UKUB 1GJVA 3HYZA 2P9NA 1NLVA 2V7ZA 1H7UA 1YSRA 4WUCA 3M1FA 4XCLA 5AQMA 1KZNA 3RSEB 1AH6A 3D2FA 4H0XB 5F3KA 4KSHA 1RGIA 1QZRA 2YK9A 2BREA 2CCUA 3AY9A 4MP7A 3MNRP 3OMUA 3DAWA 5F1XA 3CWVA 2O1WA 1TBWA 3D2EA 4CWQA 1MX0A 2HHIA 1Z5BA 4K43A 2XHRA 1F51A 2YE8A 3U8XA 2YI6A 2ZKJA 1YS3A 1RDWX 2O1UA 2PAVA 1Y8PA 4HYPA 2E88A 3INWA 3LDLA 1Z59A 2BYHA 1B3QA 2K5BA 1KAYA 2QWLA 1YT2A 2YK2A 3ULEA 2O1VA 3EHHA 4LP0A 3LDQA 2BTZA 2ZDYA 4LWHA 2BU5A 4MB9A 3LMMA 5D6PA 3UKRB 3Q5JA 2YI0A 5F2RA 3MN6A 1R62A 4HY1A 1NHJA 1A4HA 2QWPA 2BUPA 3JXUA 4ASAA 4L93A 2IOPA 2Q8IA 1NGFA 2A3ZA 2P9IA 1AMWA 4W7TA 4B1YB 2QWNA 5AR0A 3WEEA 5C93A 4WUDA
chains in the Genus database with same CATH topology
3CYGA 3S5TA 4E72A 5JENA 2HHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYG A;  3S5T A;  4E72 A;  5JEN A;  2HHI A; 
#chains in the Genus database with same CATH topology
 4R3M A;  1YUW A;  5D7R A;  3T10 A;  4BEC A;  2XX4 A;  5ADX H;  2XDU A;  3C0E A;  2P9L A;  4XJX A;  5ADX A;  1YC3 A;  2YEB A;  2Q0R A;  2BU6 A;  2GQP A;  3SJH A;  3KVG A;  4CBU A;  4H81 A;  2P9U A;  4LWI A;  1HLU A;  2QWR A;  3FZH A;  2UWD A;  4QPK A;  3K98 A;  2PNR A;  2Q1N A;  3HBT A;  4CZL A;  4FL9 A;  4YKY A;  1ATN A;  3DXM A;  4PL7 A;  1IJJ A;  1JCE A;  5BN9 A;  5AQF A;  2XX5 A;  4JHD A;  5JLF A;  3CYG A;  4CE3 A;  1UY8 A;  3TZ0 A;  3R92 A;  4EEH A;  3R91 A;  3IED A;  5BPL A;  2XDL A;  4BE7 B;  4BXI A;  1ESV A;  4CWF A;  3CI5 A;  4CZH A;  2YEI A;  2QWO A;  3WHA A;  1ZW9 A;  4FSV A;  5CTY A;  1UYK A;  3G7B A;  4HXZ A;  1RFQ A;  4H5T A;  1EA6 A;  3ATU A;  1H7S A;  4K41 A;  3FE1 A;  2IWS A;  1BA0 A;  2VCJ A;  4EM7 A;  5CTU A;  1KAZ A;  1SQK A;  3ZKB A;  4AWQ A;  2XX2 A;  4BIZ A;  4EMV A;  1QQO A;  4CZK A;  1TYQ A;  2ZWH A;  4JD2 B;  4XIR A;  5D7D A;  4CWS A;  2XJJ A;  2WI1 A;  3U2D A;  2AKP A;  5AQG A;  4CZE A;  5AQN A;  3OW6 A;  3FZM A;  4PL8 A;  2XJG A;  2YE2 A;  1QY8 A;  4H5N A;  1EI1 A;  3LNU A;  2P9S A;  3LPS A;  4H7Q A;  1DKG D;  4CBX A;  4WYB A;  2Q8F A;  1C0G A;  4O04 A;  4CBW A;  1YXQ A;  2VCI A;  3A0X A;  2YEE A;  2HG1 A;  1MA9 B;  2HMP A;  3QB0 A;  2BTF A;  4ASB A;  2Q8H A;  1ATS A;  3C7N B;  1MDU B;  3EKO A;  2VWC A;  4K42 A;  3TZ5 A;  4GY2 B;  2YKC A;  4EAH D;  2ASO A;  3G7E A;  3W3D A;  2YE7 A;  2YE6 A;  4XKO A;  4HZ5 A;  1QYE A;  1THN A;  4GEE A;  4R3A A;  4URO A;  4E72 A;  5FNF A;  3QML A;  4CZI A;  4CWN A;  4QPJ A;  4BAE A;  2XDS A;  4CZM A;  1AJ6 A;  3TUH A;  3K97 A;  1K8K B;  3U67 A;  4Q20 A;  3CQX A;  3NMQ A;  3O6O A;  4GQT A;  4U93 A;  4I6M A;  3R4O A;  1KAX A;  4AS9 A;  3JZ3 A;  4EGI A;  4L94 A;  3TZ2 A;  1U0Z A;  2YE5 A;  4URN A;  3L6Q A;  1I58 A;  3G75 A;  4PRX A;  1U2V B;  4M63 C;  4FMT A;  2CCT A;  1QQN A;  5GGZ A;  1ATR A;  4YKU A;  2BT0 A;  2YGE A;  5CTW A;  3A0R A;  4A2A A;  1UY7 A;  2YEG A;  2H55 A;  4B7P A;  4CWR A;  3GDQ A;  2WER A;  4H5V A;  4CZF A;  3EHG A;  3TU5 A;  1UYD A;  2CG9 A;  3R4M A;  1NM1 A;  3LDO A;  2WI7 A;  5L3J A;  5CTX A;  2BSM A;  2XHT A;  5IDJ A;  4XTJ A;  2FTK A;  3O0I A;  4MOT A;  3U9Z A;  2CH4 A;  2ASM A;  2GFD A;  4YKX A;  3A5L C;  3BUZ B;  4EFU A;  2FWY A;  2P9P B;  4JQL A;  3K60 A;  1TC6 A;  4NH7 A;  1BA1 A;  5AQU A;  3SL2 A;  4LWG A;  4U7N A;  4CE2 A;  4CWO A;  1UYF A;  3D0B A;  2QFO A;  1P8Z A;  3CIP A;  4P7A A;  4H5W A;  1PVG A;  4CZJ A;  1C0F A;  2XDK A;  2YKB A;  2YJX A;  2YEF A;  2Q8G A;  3UKU A;  2WUS A;  3A0T A;  3B26 A;  2YED A;  3T0H A;  1S14 A;  3QTF A;  3U2K A;  5M4N A;  4DUH A;  5IDM A;  1T44 A;  4GNI A;  5AQR A;  1DEJ A;  2HF4 A;  3HSC A;  5CE3 A;  4O0B A;  2KHO A;  2YKE A;  3BMY A;  5FPN A;  3T2S A;  2IOQ A;  2YJE A;  5FPM A;  1L0O A;  1I5B A;  3T1K A;  2YGA A;  3ATV A;  2CGF A;  2YKI A;  2IWU A;  1J6Z A;  4YKQ A;  4O07 A;  3UB5 A;  2P9K A;  4BQG A;  1UYE A;  1NGI A;  2VYP A;  4AWP A;  2ASP A;  1KIJ A;  1YER A;  2YI7 A;  1U2O A;  3ZKD A;  1YC1 A;  1IXM A;  4K4O A;  3EHJ A;  2WI4 A;  4MPC A;  4DZY A;  5AQJ A;  3UE5 A;  5J6A A;  3CJC A;  4E01 A;  3B25 A;  4PKH A;  4FPP A;  3EKU A;  1I5D A;  2WI2 A;  4V25 A;  4KTN A;  1YC4 A;  4R1F A;  2H8M A;  1TH8 A;  2WI6 A;  4I5S A;  2A42 A;  3UKR A;  3A0Y A;  3RLP A;  4B1V A;  5BPN A;  1NWK A;  4XDM A;  5E84 A;  2ZBK B;  1NGE A;  1D4X A;  2C1G A;  2Q2E B;  2BU2 A;  4L8Z A;  4EFT A;  1JM6 A;  3U4L A;  2YEJ A;  3CRK A;  3DXK B;  3GIG B;  2IWX A;  3OPD A;  2ESA A;  5AQK A;  3VHD A;  3QDD A;  3MN9 A;  4IO8 A;  3FT8 A;  2YEH A;  2P9N B;  1I59 A;  3M6G A;  3HYY A;  2GWJ A;  2V52 B;  4ASF A;  1GKX A;  3VHC A;  3D36 A;  3D2F B;  3HZ1 A;  3TPQ A;  4E00 A;  1S3X A;  2ZDX A;  3D2R A;  4FCQ A;  2XJX A;  3FT5 A;  1Z5A A;  1HJO A;  2WI3 A;  1NGH A;  4XD8 A;  3EKS A;  3KE6 A;  3GL1 A;  4YKT A;  4PU9 A;  3D2E B;  4NH9 A;  5FPE A;  1KXP A;  1NGC A;  2E0A A;  1BXD A;  2JKI A;  4H0T B;  3PEJ A;  4URM A;  5M4E A;  1NGB A;  4FCP A;  4AWO A;  3J8A A;  2A5X A;  4HWI A;  4LPB A;  4JAV A;  2HKJ A;  2OAN A;  2VW5 A;  3H4L A;  4XC0 A;  5JLH A;  1ZXM A;  4HY6 A;  5F5R A;  1TID A;  3BM9 A;  1YT1 A;  4EGK A;  4AM6 A;  5JEN A;  3CHW A;  5IN9 A;  4JNE A;  5AQO A;  5F0X A;  1BUP A;  1AM1 A;  5D7C A;  3GIF A;  1UYC A;  3ULE B;  4PRV A;  4PKG A;  4GFN A;  4YKR A;  4XKA A;  4XIT A;  3ZM7 A;  4B6C A;  2QG0 A;  2XCM A;  1NHH A;  5AQS A;  2YKJ A;  1JCF A;  1Y4U A;  4XE2 A;  4XIP A;  4ASG A;  5AQT A;  3VAD A;  2XDX A;  3O2F A;  2W00 A;  3FFK B;  5M4H A;  4MPN A;  4NH8 A;  2P9I B;  4LWF A;  2A41 A;  4JD2 A;  4B1W B;  3WEE B;  5AQY A;  2BU7 A;  3A5O C;  5AQH A;  3HZ5 A;  1ZWH A;  5AQQ A;  3IUC A;  2GWK A;  3MN5 A;  1LCU A;  4X9L A;  2PBD A;  2P9L B;  5M4K A;  2Q97 A;  2YJW A;  4HXW A;  1AH8 A;  1S22 A;  3S5T A;  3CGZ A;  2P9U B;  2XAB A;  3FV5 A;  4BQJ A;  5AFU H;  2QWQ A;  1Y4S A;  4YKZ A;  4CI6 A;  5AFU A;  4H0Y B;  3HEK A;  3DXM B;  2YE3 A;  4KSG A;  3PEH A;  3QFU A;  4MBC A;  4MP2 A;  2XHX A;  1YET A;  2WEP A;  1HPM A;  3C11 A;  3FZF A;  3MN7 A;  2E8A A;  2WI5 A;  3LDP A;  2BZ5 A;  4JHD B;  2FWZ A;  5EXW A;  1UYG A;  2V51 B;  1YSZ A;  3C7N A;  4KQV A;  4L90 A;  4CWP A;  3I33 A;  4JN4 A;  2FF3 B;  4B9Q A;  1H1V A;  5FND A;  1QQM A;  4I3H A;  4KFG A;  2HCH A;  1UYH A;  4Z94 A;  4FCR A;  3B28 A;  3A0W A;  3CGY A;  4GCZ A;  2BRC A;  1ID0 A;  4V26 A;  4BIU A;  4EGH A;  5M4M A;  3RSE A;  2HF3 A;  3TZ4 A;  5EY4 A;  2V7Y A;  4AM7 A;  4CWT A;  1TC0 A;  1ZXN A;  3QFP A;  1K8K A;  1QZ6 A;  3INX A;  1YT0 A;  3ZXO A;  4XIQ A;  5TKY A;  3A5M C;  2EXL A;  3CRL A;  1UY9 A;  1WUA A;  4J8F A;  4BEB A;  3GIE A;  3R4N A;  3OWB A;  1NHI A;  2QXL A;  1I5A A;  1TYQ B;  2VCP A;  5CF0 A;  3OWD A;  1U2V A;  4O05 A;  2FXS A;  4B1U B;  1S16 A;  1NGD A;  4RWT A;  2QF6 A;  3VHA A;  1Y8N A;  1LOT B;  4XKK A;  1MU5 A;  4YKW A;  4MPE A;  5CPH A;  5AQZ A;  2QG2 A;  1US7 A;  3EHF A;  2BYI A;  4LWE A;  5FWK A;  2C2A A;  3EL2 A;  5AQL A;  2P9S B;  2Q31 A;  5I9E B;  1UYL A;  2QW9 A;  4B1X B;  2D1K A;  2YI5 A;  2FF6 A;  4CE1 A;  3RLR A;  4P8O A;  5FPD A;  2FYP A;  4H85 A;  4O09 A;  2P9P A;  1TIL A;  4XEI A;  4URL A;  2XD6 A;  4H03 B;  4KP4 A;  4H0V B;  4KBO A;  3H80 A;  1B62 A;  1UY6 A;  4L91 A;  5J71 A;  2FXU A;  4U7O A;  2YE4 A;  3TTZ A;  5BPM A;  5D6Q A;  3EKR A;  1UYI A;  4EFH A;  1E4F T;  1NGA A;  1QZ5 A;  5AQV A;  1Z5C A;  1YAG A;  2P9K B;  1E4G T;  1EQY A;  1GKZ A;  4FO0 A;  5FNC A;  4PKI A;  4B1Z A;  3A8Y A;  1UYM A;  2YE9 A;  3DGE A;  1BGQ A;  3WQ9 A;  3HHU A;  5M4P A;  3L4I A;  1I5C A;  1JCG A;  1OSF A;  4GGL A;  5EX5 A;  2XK2 A;  4E02 A;  5BOC A;  5AQP A;  2YJF A;  3B27 A;  5BN8 A;  3MMV A;  1XQS C;  4I6M B;  3M3Z A;  4RTF D;  3FZK A;  1Y64 A;  3RKZ A;  5AQW A;  4ZVI A;  2CCS A;  2IOR A;  4HYM A;  5AQI A;  2YEC A;  4CZG A;  4ZKI A;  2QWM A;  5AQX A;  3R4P A;  1HX1 A;  2A40 A;  2Q0U A;  4HZ0 A;  4H5R A;  2JJC A;  1NGG A;  2YGF A;  1B63 A;  3K99 A;  5EVZ A;  3Q5K A;  3A0Z A;  3CJB A;  1Y8O A;  1NGJ A;  4XCJ A;  4PL9 A;  3T0Z A;  4JAU A;  1NMD A;  4WUB A;  1YVN A;  3LDN A;  2YEA A;  2Q36 A;  1YES A;  3RLQ A;  3A5N C;  3U9D A;  4JAS A;  4GT8 A;  4A2B A;  2C1I A;  3ZXQ A;  3DWL A;  3B24 A;  2BU8 A;  1BKN A;  3FZL A;  3DXK A;  2WEQ A;  1BYQ A;  3Q5L A;  3GIG A;  5BOD A;  3UKU B;  1GJV A;  3HYZ A;  2P9N A;  1NLV A;  2V7Z A;  1H7U A;  1YSR A;  4WUC A;  3M1F A;  4XCL A;  5AQM A;  1KZN A;  3RSE B;  1AH6 A;  3D2F A;  4H0X B;  5F3K A;  4KSH A;  1RGI A;  1QZR A;  2YK9 A;  2BRE A;  2CCU A;  3AY9 A;  4MP7 A;  3MNR P;  3OMU A;  3DAW A;  5F1X A;  3CWV A;  2O1W A;  1TBW A;  3D2E A;  4CWQ A;  1MX0 A;  2HHI A;  1Z5B A;  4K43 A;  2XHR A;  1F51 A;  2YE8 A;  3U8X A;  2YI6 A;  2ZKJ A;  1YS3 A;  1RDW X;  2O1U A;  2PAV A;  1Y8P A;  4HYP A;  2E88 A;  3INW A;  3LDL A;  1Z59 A;  2BYH A;  1B3Q A;  2K5B A;  1KAY A;  2QWL A;  1YT2 A;  2YK2 A;  3ULE A;  2O1V A;  3EHH A;  4LP0 A;  3LDQ A;  2BTZ A;  2ZDY A;  4LWH A;  2BU5 A;  4MB9 A;  3LMM A;  5D6P A;  3UKR B;  3Q5J A;  2YI0 A;  5F2R A;  3MN6 A;  1R62 A;  4HY1 A;  1NHJ A;  1A4H A;  2QWP A;  2BUP A;  3JXU A;  4ASA A;  4L93 A;  2IOP A;  2Q8I A;  1NGF A;  2A3Z A;  2P9I A;  1AMW A;  4W7T A;  4B1Y B;  2QWN A;  5AR0 A;  3WEE A;  5C93 A;  4WUD A; 
#chains in the Genus database with same CATH homology
 3CYG A;  3S5T A;  4E72 A;  5JEN A;  2HHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...