5JENA

Crystal structure of the anti-sigma factor rsiv bound to lysozyme
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
210
structure length
210
Chain Sequence
b'IVKAITFIEIKEEKDQSSIDVKTPALSGLSNKELENSINEKYLKESQQLYKEFIQSTSKNKKGHLSIYSDYETVTDTPDLLSIRRNIETTQASSYTQSRYITIDKKNDILLTLKSLFKDERYIKVISQNIKEQMKQQMKEDPNKIYWLTDEDAEPFKTILPDQTFYITEDHKLVISFDEYEVAPGYMGVTEFTIPTGVISNLLVGERYIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-sigma-V factor RsiV
publication title The anti-sigma factor RsiV is a receptor for lysozyme: The crystal structure of RsiV-lysozyme complex
rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Hydrolase/hydrolase receptor
total genus 55
structure length 210
sequence length 210
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
A PF13739 PdaC Deacetylase PdaC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 5jenA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 5jenA02
3CYGA 5JENA 2HHIA 4E72A 3S5TA
chains in the Genus database with same CATH superfamily
3BM9A 4HZ0A 4JQLA 5D7RA 3OW6A 5IDMA 2XDXA 1XQSC 1ATNA 3CQXA 2WERA 5F2RA 3HHUA 3MN5A 2WI7A 4QPJA 4ZVIA 1QQNA 4AWOA 1T44A 1EA6A 1R62A 5AQUA 3A0RA 4A2BA 5CE3A 2YEHA 2FXUA 2XDKA 3R91A 4XC0A 1AH6A 2BU7A 4PRVA 1S16A 1F51A 4RWTA 1D4XA 3Q5KA 2P9SA 2WI2A 1SQKA 3AY9A 2YEIA 4E01A 4H5NA 5AQGA 5M4MA 4JN4A 3EHFA 5JENA 4BAEA 3UKUA 2P9IB 2YEJA 4B1XB 4W7TA 5CTXA 4KTNA 3RLPA 2P9PB 3ZKBA 3HZ1A 4CZKA 4XIRA 4EGIA 1DKGD 2V52B 1TYQB 2VCIA 4MPCA 1S14A 5D7DA 1BA1A 3DWLA 3EKUA 2E8AA 4CE2A 4LWFA 5F5RA 4XCJA 3GL1A 1YC3A 3BMYA 3VHCA 4NH9A 4MPEA 4FCRA 5D7CA 4GCZA 4E00A 1DEJA 2GWKA 2FTKA 1YERA 2ZWHA 2XDUA 5AQFA 4MOTA 2Q0RA 3U9DA 4U93A 4H5RA 2P9UA 5M4NA 1YAGA 3A5MC 1QYEA 2BT0A 2O1UA 2HG1A 4GNIA 1YSZA 1ZXNA 4BECA 2QWOA 4PU9A 5C93A 2QW9A 4XTJA 2XJGA 4CZMA 1LCUA 4QPKA 4L93A 4U7OA 1NHJA 4CBXA 3EKRA 3QTFA 2CCTA 3HZ5A 4CWSA 3QDDA 4DZYA 4EGHA 5BPNA 2YK9A 2XDLA 3OPDA 1ATRA 1BUPA 4YKWA 3RSEA 1NGFA 3O6OA 3VADA 1YSRA 1YT1A 3GIEA 2PAVA 3LDLA 4GY2B 2PBDA 1I5DA 1H7SA 3UKUB 2O1WA 2O1VA 3B27A 1BYQA 3C11A 4M63C 3T10A 1YVNA 4O04A 2GWJA 2YEBA 4URMA 4HY6A 4L8ZA 3U8XA 1TILA 3RKZA 1NGAA 3G75A 2P9KB 5AQMA 5AQSA 3K98A 4PL9A 1HX1A 2WI5A 2BYHA 4YKZA 3L6QA 5AQLA 1HPMA 1NGCA 1A4HA 2Q8HA 1NGEA 3D2FA 5AQNA 4FMTA 2JJCA 4BXIA 2XHTA 3MNRP 4JAUA 2YJFA 3UB5A 4CWNA 1EI1A 3T0ZA 3EHHA 2P9UB 3PEHA 3CI5A 4CBUA 2Q8IA 1MA9B 3LPSA 5BPLA 1Z5AA 3NMQA 3LDNA 3MMVA 1YXQA 4H0XB 2WI1A 1IJJA 2FF3B 2YI0A 3DXMA 2CCSA 3LDOA 3OWBA 1TC0A 2XJJA 5M4HA 2FWYA 2YE4A 1Z5BA 1KAXA 1QZ6A 2K5BA 5FWKA 2QG0A 2BU5A 4KQVA 2YKIA 1KZNA 3OMUA 5CTUA 5BN9A 1QY8A 2Q0UA 3FT8A 1ESVA 2YEEA 1RFQA 4PKIA 2QWNA 4IO8A 5EX5A 5FPNA 2P9IA 3U9ZA 3G7EA 4R1FA 3A5LC 2XABA 1TC6A 2XX2A 2YGFA 3B28A 4CWPA 2P9PA 2HF3A 4JAVA 1NGHA 1TYQA 2QWRA 4H0VB 1KAZA 4AM6A 4GFNA 2V51B 1NGBA 1YC1A 1HLUA 4EFUA 1Z59A 4ASFA 3MN6A 4HWIA 5AFUA 1AMWA 5FPMA 5AQHA 5AQKA 2BSMA 1NM1A 4CWFA 1HJOA 3IEDA 2P9NB 5AFUH 2KHOA 2BRCA 2YI5A 3RLRA 1QQMA 5M4EA 4MP2A 3TU5A 1BA0A 1NHHA 2IOPA 5AQVA 4CZJA 4LPBA 4K41A 3D0BA 3K60A 4JHDA 4Z94A 3DXMB 4GT8A 1YESA 1QQOA 1I5CA 1UYEA 3MN7A 2QXLA 1ZXMA 4HYMA 5CPHA 3TZ0A 3TZ4A 1RGIA 1YUWA 3S5TA 1TIDA 1LOTB 2A3ZA 4CWQA 1UYCA 3HYYA 3DGEA 1GKXA 1BXDA 2YE9A 4B6CA 2C2AA 4AM7A 1Y8NA 5M4PA 3L4IA 5IDJA 4FCQA 2Q31A 4XE2A 2YJEA 2HHIA 2YEAA 1B63A 3M1FA 3GIGB 2P9KA 4XD8A 4O07A 3UE5A 4XJXA 4NH7A 3M6GA 2XDSA 1UYFA 4O0BA 4X9LA 2EXLA 2CG9A 1BGQA 2BU6A 2ZKJA 2YI7A 5D6QA 3ZXOA 2YJXA 4O05A 1JM6A 1P8ZA 3INWA 4I3HA 4ASAA 5M4KA 4RTFD 1UY6A 2XHXA 2BREA 4H03B 1ZW9A 2FF6A 3B26A 3HYZA 2FWZA 3FV5A 4Q20A 1WUAA 3DXKB 2WI6A 2YKEA 3KVGA 1YS3A 2VYPA 4JHDB 2YGAA 2ESAA 1THNA 4HYPA 2BU2A 1NGIA 2YECA 3CWVA 3MN9A 5AQXA 4R3AA 3WEEB 4MPNA 4B1UB 2XK2A 2E88A 2YGEA 3CYGA 2IWSA 1B3QA 1KXPA 2E0AA 1H1VA 2QWPA 1Y8OA 1UYDA 4KP4A 5GGZA 1U2VA 4B9QA 5IN9A 3EL2A 3ZM7A 3CRLA 1JCEA 4EM7A 3I33A 5JLFA 2D1KA 3B24A 3O0IA 2YEFA 2PNRA 1Z5CA 1AM1A 4GGLA 3INXA 2HF4A 1YETA 3G7BA 3TPQA 4LWIA 5AQIA 3K97A 5EY4A 2IOQA 5TKYA 3R92A 1NLVA 4H0TB 4CE3A 1UY9A 2HKJA 2XD6A 4BE7B 4CZLA 3SJHA 4AWQA 3EKSA 2QFOA 2JKIA 1YC4A 2BTFA 3CHWA 3FZHA 3R4PA 3RLQA 5AQZA 4CE1A 1K8KB 3TZ5A 3LDQA 5AQWA 4UROA 3K99A 1S3XA 4BIZA 4WYBA 4XKAA 2FYPA 1L0OA 4WUBA 4YKUA 3SL2A 2P9NA 4H85A 4HXWA 1UYGA 3FZKA 4MP7A 4KSHA 4MB9A 3CRKA 2ASPA 2Q36A 1NWKA 2XJXA 2GFDA 1RDWX 1QZ5A 4H81A 3FE1A 4NH8A 3ULEA 2HMPA 1UY7A 2Q2EB 2YK2A 1U2VB 4CI6A 4B7PA 5BODA 4BQJA 4E72A 4KSGA 2YEGA 2ZBKB 4DUHA 1PVGA 1Y64A 4YKTA 2IWUA 5CF0A 1J6ZA 1AJ6A 3D36A 3IUCA 1B62A 4KFGA 4FPPA 1NGGA 4CBWA 2FXSA 4U7NA 2A5XA 5FPEA 3GIGA 4XKOA 3Q5JA 5FNFA 5FNDA 1JCFA 5AR0A 1ATSA 3ZXQA 4AWPA 2Q1NA 2YE7A 3TZ2A 5AQTA 2YKJA 3FZFA 2CCUA 2P9LA 4XKKA 2W00A 4FL9A 4FCPA 4WUCA 4ZKIA 5AQOA 4H0YB 2BZ5A 4URLA 1MX0A 1QZRA 4EAHD 3GDQA 3J8AA 4K42A 3CJCA 2YJWA 1I5AA 4YKXA 4WUDA 4YKRA 3OWDA 4B1VA 3DXKA 1UYLA 2XX4A 1IXMA 4BIUA 3CJBA 1TBWA 3FZLA 5J71A 5E84A 4XIQA 4JD2B 3WEEA 3ULEB 3B25A 4H5WA 3ZKDA 4FO0A 4XITA 3CGYA 5AQQA 4XDMA 3DAWA 4CWRA 3HBTA 1Y8PA 2ASMA 4H7QA 4H5TA 4V26A 3D2EB 4V25A 5BN8A 3U2DA 5AQJA 1U2OA 1I58A 4HXZA 3FFKB 2YE2A 1MDUB 4LWGA 3U4LA 3VHAA 5AQYA 5AQRA 2IWXA 2A42A 5I9EB 1AH8A 2QWQA 1NGDA 1NHIA 4R3MA 3A0WA 1ID0A 2GQPA 3A0TA 2P9LB 3WQ9A 1YT2A 2YE5A 3CGZA 4PRXA 1K8KA 2QG2A 3T0HA 3A0XA 4ASBA 3W3DA 5EXWA 4O09A 1UYHA 2YKCA 2A41A 3UKRB 4CWOA 5J6AA 3ATUA 4XEIA 5BPMA 4P8OA 4EMVA 4CZGA 4LWHA 2ASOA 2XX5A 2CH4A 3C7NB 4CZIA 2VWCA 3A0ZA 3A8YA 3GIFA 1NGJA 2VCPA 4GQTA 4A2AA 4XIPA 4KBOA 1UYMA 3QFPA 2YI6A 2IORA 4I6MB 1OSFA 4GEEA 4LWEA 2C1IA 4ASGA 2BU8A 2Q8GA 1UY8A 4EGKA 2YE8A 3TUHA 2VCJA 4PL7A 4CZEA 4HY1A 2BYIA 3HEKA 1UYIA 1MU5A 5L3JA 2WI3A 1E4GT 4L90A 2BUPA 3VHDA 1Y4SA 1YT0A 2V7YA 4EFTA 4L94A 1ZWHA 4PKGA 2WEPA 3LDPA 4H5VA 3T2SA 4P7AA 3FT5A 5BOCA 4L91A 2C1GA 2YEDA 3LMMA 2P9SB 2CGFA 1C0FA 5FNCA 4JASA 3CIPA 2XCMA 1NMDA 4B1ZA 2H55A 2V7ZA 5CTWA 3QB0A 4EFHA 4AS9A 4EEHA 3A5NC 3HSCA 4CWTA 3LNUA 3QMLA 3D2RA 5EVZA 5ADXA 3ATVA 2YE3A 4B1YB 4YKYA 5F0XA 5CTYA 3JZ3A 3U2KA 5FPDA 4JD2A 5ADXH 2BTZA 2QWMA 3KE6A 3Q5LA 3EHGA 1TH8A 1GKZA 2WUSA 3FZMA 3JXUA 4BEBA 3QFUA 3D2EA 4CZHA 1GJVA 4E02A 2ZDXA 1Y4UA 1U0ZA 2VW5A 2WEQA 4JNEA 1KAYA 4YKQA 4BQGA 4B1WB 4I5SA 3TTZA 3EKOA 3RSEB 2AKPA 1I59A 5JLHA 3PEJA 2OANA 3M3ZA 4PL8A 2ZDYA 3BUZB 4HZ5A 1H7UA 3R4OA 1US7A 1EQYA 3R4NA 2UWDA 2YE6A 5D6PA 2QF6A 4CZFA 3H4LA 1C0GA 5F3KA 2H8MA 1JCGA 2YKBA 4MBCA 5F1XA 3R4MA 3T1KA 3UKRA 3U67A 1S22A 1I5BA 2A40A 3C0EA 2HCHA 3H80A 4URNA 4XCLA 2QWLA 3C7NA 1E4FT 2Q8FA 3D2FB 3EHJA 4PKHA 5AQPA 4I6MA 4K43A 2WI4A 3O2FA 2XHRA 4K4OA 3A5OC 4LP0A 2Q97A 1BKNA 3WHAA 4FSVA 3A0YA 1KIJA 4J8FA 1UYKA
chains in the Genus database with same CATH topology
3CYGA 5JENA 2HHIA 4E72A 3S5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYG A;  5JEN A;  2HHI A;  4E72 A;  3S5T A; 
#chains in the Genus database with same CATH topology
 3BM9 A;  4HZ0 A;  4JQL A;  5D7R A;  3OW6 A;  5IDM A;  2XDX A;  1XQS C;  1ATN A;  3CQX A;  2WER A;  5F2R A;  3HHU A;  3MN5 A;  2WI7 A;  4QPJ A;  4ZVI A;  1QQN A;  4AWO A;  1T44 A;  1EA6 A;  1R62 A;  5AQU A;  3A0R A;  4A2B A;  5CE3 A;  2YEH A;  2FXU A;  2XDK A;  3R91 A;  4XC0 A;  1AH6 A;  2BU7 A;  4PRV A;  1S16 A;  1F51 A;  4RWT A;  1D4X A;  3Q5K A;  2P9S A;  2WI2 A;  1SQK A;  3AY9 A;  2YEI A;  4E01 A;  4H5N A;  5AQG A;  5M4M A;  4JN4 A;  3EHF A;  5JEN A;  4BAE A;  3UKU A;  2P9I B;  2YEJ A;  4B1X B;  4W7T A;  5CTX A;  4KTN A;  3RLP A;  2P9P B;  3ZKB A;  3HZ1 A;  4CZK A;  4XIR A;  4EGI A;  1DKG D;  2V52 B;  1TYQ B;  2VCI A;  4MPC A;  1S14 A;  5D7D A;  1BA1 A;  3DWL A;  3EKU A;  2E8A A;  4CE2 A;  4LWF A;  5F5R A;  4XCJ A;  3GL1 A;  1YC3 A;  3BMY A;  3VHC A;  4NH9 A;  4MPE A;  4FCR A;  5D7C A;  4GCZ A;  4E00 A;  1DEJ A;  2GWK A;  2FTK A;  1YER A;  2ZWH A;  2XDU A;  5AQF A;  4MOT A;  2Q0R A;  3U9D A;  4U93 A;  4H5R A;  2P9U A;  5M4N A;  1YAG A;  3A5M C;  1QYE A;  2BT0 A;  2O1U A;  2HG1 A;  4GNI A;  1YSZ A;  1ZXN A;  4BEC A;  2QWO A;  4PU9 A;  5C93 A;  2QW9 A;  4XTJ A;  2XJG A;  4CZM A;  1LCU A;  4QPK A;  4L93 A;  4U7O A;  1NHJ A;  4CBX A;  3EKR A;  3QTF A;  2CCT A;  3HZ5 A;  4CWS A;  3QDD A;  4DZY A;  4EGH A;  5BPN A;  2YK9 A;  2XDL A;  3OPD A;  1ATR A;  1BUP A;  4YKW A;  3RSE A;  1NGF A;  3O6O A;  3VAD A;  1YSR A;  1YT1 A;  3GIE A;  2PAV A;  3LDL A;  4GY2 B;  2PBD A;  1I5D A;  1H7S A;  3UKU B;  2O1W A;  2O1V A;  3B27 A;  1BYQ A;  3C11 A;  4M63 C;  3T10 A;  1YVN A;  4O04 A;  2GWJ A;  2YEB A;  4URM A;  4HY6 A;  4L8Z A;  3U8X A;  1TIL A;  3RKZ A;  1NGA A;  3G75 A;  2P9K B;  5AQM A;  5AQS A;  3K98 A;  4PL9 A;  1HX1 A;  2WI5 A;  2BYH A;  4YKZ A;  3L6Q A;  5AQL A;  1HPM A;  1NGC A;  1A4H A;  2Q8H A;  1NGE A;  3D2F A;  5AQN A;  4FMT A;  2JJC A;  4BXI A;  2XHT A;  3MNR P;  4JAU A;  2YJF A;  3UB5 A;  4CWN A;  1EI1 A;  3T0Z A;  3EHH A;  2P9U B;  3PEH A;  3CI5 A;  4CBU A;  2Q8I A;  1MA9 B;  3LPS A;  5BPL A;  1Z5A A;  3NMQ A;  3LDN A;  3MMV A;  1YXQ A;  4H0X B;  2WI1 A;  1IJJ A;  2FF3 B;  2YI0 A;  3DXM A;  2CCS A;  3LDO A;  3OWB A;  1TC0 A;  2XJJ A;  5M4H A;  2FWY A;  2YE4 A;  1Z5B A;  1KAX A;  1QZ6 A;  2K5B A;  5FWK A;  2QG0 A;  2BU5 A;  4KQV A;  2YKI A;  1KZN A;  3OMU A;  5CTU A;  5BN9 A;  1QY8 A;  2Q0U A;  3FT8 A;  1ESV A;  2YEE A;  1RFQ A;  4PKI A;  2QWN A;  4IO8 A;  5EX5 A;  5FPN A;  2P9I A;  3U9Z A;  3G7E A;  4R1F A;  3A5L C;  2XAB A;  1TC6 A;  2XX2 A;  2YGF A;  3B28 A;  4CWP A;  2P9P A;  2HF3 A;  4JAV A;  1NGH A;  1TYQ A;  2QWR A;  4H0V B;  1KAZ A;  4AM6 A;  4GFN A;  2V51 B;  1NGB A;  1YC1 A;  1HLU A;  4EFU A;  1Z59 A;  4ASF A;  3MN6 A;  4HWI A;  5AFU A;  1AMW A;  5FPM A;  5AQH A;  5AQK A;  2BSM A;  1NM1 A;  4CWF A;  1HJO A;  3IED A;  2P9N B;  5AFU H;  2KHO A;  2BRC A;  2YI5 A;  3RLR A;  1QQM A;  5M4E A;  4MP2 A;  3TU5 A;  1BA0 A;  1NHH A;  2IOP A;  5AQV A;  4CZJ A;  4LPB A;  4K41 A;  3D0B A;  3K60 A;  4JHD A;  4Z94 A;  3DXM B;  4GT8 A;  1YES A;  1QQO A;  1I5C A;  1UYE A;  3MN7 A;  2QXL A;  1ZXM A;  4HYM A;  5CPH A;  3TZ0 A;  3TZ4 A;  1RGI A;  1YUW A;  3S5T A;  1TID A;  1LOT B;  2A3Z A;  4CWQ A;  1UYC A;  3HYY A;  3DGE A;  1GKX A;  1BXD A;  2YE9 A;  4B6C A;  2C2A A;  4AM7 A;  1Y8N A;  5M4P A;  3L4I A;  5IDJ A;  4FCQ A;  2Q31 A;  4XE2 A;  2YJE A;  2HHI A;  2YEA A;  1B63 A;  3M1F A;  3GIG B;  2P9K A;  4XD8 A;  4O07 A;  3UE5 A;  4XJX A;  4NH7 A;  3M6G A;  2XDS A;  1UYF A;  4O0B A;  4X9L A;  2EXL A;  2CG9 A;  1BGQ A;  2BU6 A;  2ZKJ A;  2YI7 A;  5D6Q A;  3ZXO A;  2YJX A;  4O05 A;  1JM6 A;  1P8Z A;  3INW A;  4I3H A;  4ASA A;  5M4K A;  4RTF D;  1UY6 A;  2XHX A;  2BRE A;  4H03 B;  1ZW9 A;  2FF6 A;  3B26 A;  3HYZ A;  2FWZ A;  3FV5 A;  4Q20 A;  1WUA A;  3DXK B;  2WI6 A;  2YKE A;  3KVG A;  1YS3 A;  2VYP A;  4JHD B;  2YGA A;  2ESA A;  1THN A;  4HYP A;  2BU2 A;  1NGI A;  2YEC A;  3CWV A;  3MN9 A;  5AQX A;  4R3A A;  3WEE B;  4MPN A;  4B1U B;  2XK2 A;  2E88 A;  2YGE A;  3CYG A;  2IWS A;  1B3Q A;  1KXP A;  2E0A A;  1H1V A;  2QWP A;  1Y8O A;  1UYD A;  4KP4 A;  5GGZ A;  1U2V A;  4B9Q A;  5IN9 A;  3EL2 A;  3ZM7 A;  3CRL A;  1JCE A;  4EM7 A;  3I33 A;  5JLF A;  2D1K A;  3B24 A;  3O0I A;  2YEF A;  2PNR A;  1Z5C A;  1AM1 A;  4GGL A;  3INX A;  2HF4 A;  1YET A;  3G7B A;  3TPQ A;  4LWI A;  5AQI A;  3K97 A;  5EY4 A;  2IOQ A;  5TKY A;  3R92 A;  1NLV A;  4H0T B;  4CE3 A;  1UY9 A;  2HKJ A;  2XD6 A;  4BE7 B;  4CZL A;  3SJH A;  4AWQ A;  3EKS A;  2QFO A;  2JKI A;  1YC4 A;  2BTF A;  3CHW A;  3FZH A;  3R4P A;  3RLQ A;  5AQZ A;  4CE1 A;  1K8K B;  3TZ5 A;  3LDQ A;  5AQW A;  4URO A;  3K99 A;  1S3X A;  4BIZ A;  4WYB A;  4XKA A;  2FYP A;  1L0O A;  4WUB A;  4YKU A;  3SL2 A;  2P9N A;  4H85 A;  4HXW A;  1UYG A;  3FZK A;  4MP7 A;  4KSH A;  4MB9 A;  3CRK A;  2ASP A;  2Q36 A;  1NWK A;  2XJX A;  2GFD A;  1RDW X;  1QZ5 A;  4H81 A;  3FE1 A;  4NH8 A;  3ULE A;  2HMP A;  1UY7 A;  2Q2E B;  2YK2 A;  1U2V B;  4CI6 A;  4B7P A;  5BOD A;  4BQJ A;  4E72 A;  4KSG A;  2YEG A;  2ZBK B;  4DUH A;  1PVG A;  1Y64 A;  4YKT A;  2IWU A;  5CF0 A;  1J6Z A;  1AJ6 A;  3D36 A;  3IUC A;  1B62 A;  4KFG A;  4FPP A;  1NGG A;  4CBW A;  2FXS A;  4U7N A;  2A5X A;  5FPE A;  3GIG A;  4XKO A;  3Q5J A;  5FNF A;  5FND A;  1JCF A;  5AR0 A;  1ATS A;  3ZXQ A;  4AWP A;  2Q1N A;  2YE7 A;  3TZ2 A;  5AQT A;  2YKJ A;  3FZF A;  2CCU A;  2P9L A;  4XKK A;  2W00 A;  4FL9 A;  4FCP A;  4WUC A;  4ZKI A;  5AQO A;  4H0Y B;  2BZ5 A;  4URL A;  1MX0 A;  1QZR A;  4EAH D;  3GDQ A;  3J8A A;  4K42 A;  3CJC A;  2YJW A;  1I5A A;  4YKX A;  4WUD A;  4YKR A;  3OWD A;  4B1V A;  3DXK A;  1UYL A;  2XX4 A;  1IXM A;  4BIU A;  3CJB A;  1TBW A;  3FZL A;  5J71 A;  5E84 A;  4XIQ A;  4JD2 B;  3WEE A;  3ULE B;  3B25 A;  4H5W A;  3ZKD A;  4FO0 A;  4XIT A;  3CGY A;  5AQQ A;  4XDM A;  3DAW A;  4CWR A;  3HBT A;  1Y8P A;  2ASM A;  4H7Q A;  4H5T A;  4V26 A;  3D2E B;  4V25 A;  5BN8 A;  3U2D A;  5AQJ A;  1U2O A;  1I58 A;  4HXZ A;  3FFK B;  2YE2 A;  1MDU B;  4LWG A;  3U4L A;  3VHA A;  5AQY A;  5AQR A;  2IWX A;  2A42 A;  5I9E B;  1AH8 A;  2QWQ A;  1NGD A;  1NHI A;  4R3M A;  3A0W A;  1ID0 A;  2GQP A;  3A0T A;  2P9L B;  3WQ9 A;  1YT2 A;  2YE5 A;  3CGZ A;  4PRX A;  1K8K A;  2QG2 A;  3T0H A;  3A0X A;  4ASB A;  3W3D A;  5EXW A;  4O09 A;  1UYH A;  2YKC A;  2A41 A;  3UKR B;  4CWO A;  5J6A A;  3ATU A;  4XEI A;  5BPM A;  4P8O A;  4EMV A;  4CZG A;  4LWH A;  2ASO A;  2XX5 A;  2CH4 A;  3C7N B;  4CZI A;  2VWC A;  3A0Z A;  3A8Y A;  3GIF A;  1NGJ A;  2VCP A;  4GQT A;  4A2A A;  4XIP A;  4KBO A;  1UYM A;  3QFP A;  2YI6 A;  2IOR A;  4I6M B;  1OSF A;  4GEE A;  4LWE A;  2C1I A;  4ASG A;  2BU8 A;  2Q8G A;  1UY8 A;  4EGK A;  2YE8 A;  3TUH A;  2VCJ A;  4PL7 A;  4CZE A;  4HY1 A;  2BYI A;  3HEK A;  1UYI A;  1MU5 A;  5L3J A;  2WI3 A;  1E4G T;  4L90 A;  2BUP A;  3VHD A;  1Y4S A;  1YT0 A;  2V7Y A;  4EFT A;  4L94 A;  1ZWH A;  4PKG A;  2WEP A;  3LDP A;  4H5V A;  3T2S A;  4P7A A;  3FT5 A;  5BOC A;  4L91 A;  2C1G A;  2YED A;  3LMM A;  2P9S B;  2CGF A;  1C0F A;  5FNC A;  4JAS A;  3CIP A;  2XCM A;  1NMD A;  4B1Z A;  2H55 A;  2V7Z A;  5CTW A;  3QB0 A;  4EFH A;  4AS9 A;  4EEH A;  3A5N C;  3HSC A;  4CWT A;  3LNU A;  3QML A;  3D2R A;  5EVZ A;  5ADX A;  3ATV A;  2YE3 A;  4B1Y B;  4YKY A;  5F0X A;  5CTY A;  3JZ3 A;  3U2K A;  5FPD A;  4JD2 A;  5ADX H;  2BTZ A;  2QWM A;  3KE6 A;  3Q5L A;  3EHG A;  1TH8 A;  1GKZ A;  2WUS A;  3FZM A;  3JXU A;  4BEB A;  3QFU A;  3D2E A;  4CZH A;  1GJV A;  4E02 A;  2ZDX A;  1Y4U A;  1U0Z A;  2VW5 A;  2WEQ A;  4JNE A;  1KAY A;  4YKQ A;  4BQG A;  4B1W B;  4I5S A;  3TTZ A;  3EKO A;  3RSE B;  2AKP A;  1I59 A;  5JLH A;  3PEJ A;  2OAN A;  3M3Z A;  4PL8 A;  2ZDY A;  3BUZ B;  4HZ5 A;  1H7U A;  3R4O A;  1US7 A;  1EQY A;  3R4N A;  2UWD A;  2YE6 A;  5D6P A;  2QF6 A;  4CZF A;  3H4L A;  1C0G A;  5F3K A;  2H8M A;  1JCG A;  2YKB A;  4MBC A;  5F1X A;  3R4M A;  3T1K A;  3UKR A;  3U67 A;  1S22 A;  1I5B A;  2A40 A;  3C0E A;  2HCH A;  3H80 A;  4URN A;  4XCL A;  2QWL A;  3C7N A;  1E4F T;  2Q8F A;  3D2F B;  3EHJ A;  4PKH A;  5AQP A;  4I6M A;  4K43 A;  2WI4 A;  3O2F A;  2XHR A;  4K4O A;  3A5O C;  4LP0 A;  2Q97 A;  1BKN A;  3WHA A;  4FSV A;  3A0Y A;  1KIJ A;  4J8F A;  1UYK A; 
#chains in the Genus database with same CATH homology
 3CYG A;  5JEN A;  2HHI A;  4E72 A;  3S5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...