5JENA

Crystal structure of the anti-sigma factor rsiv bound to lysozyme
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
210
structure length
210
Chain Sequence
IVKAITFIEIKEEKDQSSIDVKTPALSGLSNKELENSINEKYLKESQQLYKEFIQSTSKNKKGHLSIYSDYETVTDTPDLLSIRRNIETTQASSYTQSRYITIDKKNDILLTLKSLFKDERYIKVISQNIKEQMKQQMKEDPNKIYWLTDEDAEPFKTILPDQTFYITEDHKLVISFDEYEVAPGYMGVTEFTIPTGVISNLLVGERYIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The anti-sigma factor RsiV is a receptor for lysozyme: The crystal structure of RsiV-lysozyme complex
rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Hydrolase/hydrolase receptor
molecule keywords Anti-sigma-V factor RsiV
total genus 55
structure length 210
sequence length 210
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
A PF13739 PdaC Deacetylase PdaC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 5jenA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 5jenA02
5JENA 4E72A 3CYGA 3S5TA 2HHIA
chains in the Genus database with same CATH superfamily
4PL7A 2YKIA 2YEIA 4HZ5A 3D2EB 4R3AA 1YC4A 2YJFA 2BSMA 4CZEA 3CHWA 4CBXA 3Q5JA 4HYMA 5JENA 1YETA 5EX5A 5AQRA 4RWTA 3TTZA 3G7EA 1HLUA 2P9PB 1TH8A 5AQOA 3U4LA 2E88A 4XJXA 5FNCA 2XJJA 3B25A 1UY8A 1YT0A 3A5MC 4B9QA 1UY6A 2QG2A 2YJWA 1BA0A 1ESVA 4CZIA 4YKTA 4AWPA 1KAZA 2WI2A 1NHIA 2A42A 2AKPA 3S5TA 1TC6A 3KVGA 2O1VA 2ASOA 2VYPA 2WEPA 3CIPA 1QZ6A 3D2EA 1U2VA 2QWLA 4PL9A 4GNIA 3A0TA 2Q8GA 1U0ZA 5F1XA 2YK9A 4O05A 1U2OA 1P8ZA 2P9KA 3B26A 1BGQA 5IDJA 3CYGA 3OW6A 4EMVA 2P9PA 1QZRA 3CJBA 3TPQA 1TC0A 4U93A 4H03B 4EFUA 1BUPA 4JAVA 2FWYA 4XD8A 4B1ZA 4GQTA 1UY7A 3RSEA 3FZFA 3FT8A 3G7BA 2HF3A 1UYGA 1EI1A 5BODA 3HEKA 2YE5A 1U2VB 2P9UA 2KHOA 4NH7A 3SL2A 1DEJA 5M4KA 3J8AA 5AQKA 2XHXA 3QFUA 4MPEA 2A5XA 3QB0A 1YESA 2BT0A 1HPMA 2GWKA 3LDQA 2ZWHA 2IWSA 3OPDA 4CWRA 4URMA 1ZXNA 4CWFA 1B3QA 2YJEA 1RFQA 2GQPA 4H5RA 4KTNA 3MN9A 3GIGB 3RLRA 1D4XA 3A5LC 3L6QA 3GIFA 2QWNA 1NGDA 2BU6A 4JQLA 4DUHA 5AQGA 4WUDA 4KQVA 1NWKA 1UYKA 4XIPA 1Z5AA 4A2BA 3M1FA 4L8ZA 1MDUB 2IWUA 1E4GT 4BIZA 2A40A 2QW9A 5AQNA 3H80A 1Y8OA 2YI0A 4K4OA 2QWRA 2WI1A 3D2FA 2Q8HA 3CRKA 1ATRA 4HYPA 3A0ZA 3MNRP 5CPHA 1Y64A 2ASPA 2A3ZA 3DGEA 4Q20A 5F5RA 4YKXA 4JAUA 2HG1A 4HY6A 4KFGA 1AH6A 5FNFA 3U9DA 5CTXA 5M4EA 3O2FA 2CCUA 1YT1A 1UY9A 4XKAA 4CWSA 4KP4A 4XTJA 1YXQA 5BN8A 3T0ZA 1LOTB 4MP7A 2YEFA 2YE2A 1DKGD 4FL9A 2VCJA 5AQWA 3VHAA 3QFPA 4AS9A 1QY8A 5BOCA 1KXPA 2WUSA 5CTUA 4H0XB 5JLFA 4JD2A 3TZ5A 4J8FA 2Q2EB 2BYIA 4BQGA 3EKOA 3KE6A 2YI7A 1KAYA 2XJGA 3R4PA 1AJ6A 1NGAA 1I5AA 2BYHA 2FF6A 2QWOA 5J71A 1TILA 3ATUA 3HSCA 5F3KA 5AQSA 4O04A 4EGKA 3A8YA 3L4IA 4CWOA 3WEEA 4ZVIA 4CE1A 3HZ1A 3R4NA 2BTFA 4I5SA 2YKJA 1I5BA 4H0YB 1NGHA 2A41A 3DXMA 2QFOA 4EFTA 1UYEA 4H85A 2UWDA 2HF4A 5AFUA 4B1WB 5M4PA 2YKEA 1Y4UA 4CWNA 4P8OA 1J6ZA 3K98A 2PBDA 1JCFA 3M6GA 2HHIA 3LMMA 3PEJA 1NGEA 3DXKA 5AQFA 4B1YB 4EM7A 4ASGA 1LCUA 2WI7A 5BPMA 2WI5A 1AMWA 2YEBA 5M4HA 4U7NA 1TYQA 1QZ5A 2XABA 1YC1A 4QPJA 3TZ0A 4CWQA 3ZXOA 1E4FT 3A0RA 2YGAA 4HXZA 1T44A 2VCPA 3FZKA 4AWOA 4Z94A 1YVNA 2OANA 2XDSA 3B24A 3K97A 4KBOA 4H5VA 3UKRB 3INWA 1ZW9A 1TIDA 5AQYA 4NH9A 3IEDA 4GY2B 4E01A 4CZLA 4BE7B 1Z59A 5FWKA 1UYFA 1Z5CA 3WHAA 2BZ5A 3A5NC 2YE7A 4B7PA 4H0TB 1NGIA 4YKQA 4MBCA 4BQJA 1KZNA 3DXKB 5AR0A 4CBUA 4CZKA 3O0IA 1H1VA 3GIEA 2V7YA 3ZKDA 5AQPA 4BIUA 5AFUH 3OWBA 4DZYA 3HZ5A 5AQZA 3LPSA 1OSFA 2V7ZA 4LP0A 3TZ2A 2YE8A 4EGHA 3EKUA 2P9SB 3EHFA 2ZBKB 2YKCA 1I5DA 4MOTA 5M4NA 3HBTA 3A0YA 2BTZA 1ATNA 3DWLA 1Y4SA 4B1UB 2E8AA 2YEJA 3U67A 5D7DA 2CG9A 4CZJA 4XIRA 4LWEA 4ASFA 5M4MA 4PL8A 2HMPA 3ZM7A 4A2AA 4MB9A 4CZGA 3C7NA 3UKUB 3C0EA 4XITA 2P9NB 4LWGA 3GL1A 1ID0A 3CGZA 4H5NA 1NHHA 2VWCA 3ATVA 3R92A 4IO8A 5F2RA 1L0OA 5J6AA 2HKJA 4I6MA 5CE3A 2WI4A 1WUAA 4O07A 4XIQA 2XDLA 4R1FA 4I3HA 1KAXA 4L91A 2FYPA 1I5CA 4CWPA 2BUPA 3UKRA 4YKUA 3FV5A 4FCRA 4FSVA 4ASAA 3Q5KA 5ADXH 3CQXA 3FE1A 2P9LA 2XX4A 1AM1A 2FWZA 1C0GA 1BYQA 2QWQA 5D6QA 1H7UA 4JNEA 3H4LA 2YJXA 1UYLA 2YKBA 3D2FB 3HHUA 1EA6A 3TUHA 3R4MA 4LPBA 2BU2A 4P7AA 4NH8A 3BUZB 1S16A 3QDDA 3B28A 3FZMA 2K5BA 3AY9A 5ADXA 3Q5LA 3LDPA 1Z5BA 2BU7A 5AQHA 1HX1A 3UE5A 5JLHA 3B27A 2QG0A 2Q8IA 1NGJA 2QXLA 4K41A 4H5WA 1UYHA 1QYEA 1NLVA 1QQOA 1EQYA 4E02A 4H0VB 4M63C 3LDLA 2WI6A 2CCSA 3UB5A 4HXWA 4H81A 3K99A 1YUWA 5BPNA 3IUCA 2V51B 2YEEA 1MX0A 4KSHA 4YKYA 5AQLA 4GEEA 4HY1A 2QWPA 1B62A 5FPEA 1KIJA 1Y8NA 2FXSA 4EAHD 4B1VA 2WI3A 2ZDYA 1I59A 2IOPA 4XDMA 3CI5A 5I9EB 3D0BA 3EHGA 2EXLA 3TZ4A 1JCGA 4XEIA 4PU9A 5AQUA 1IXMA 4H7QA 3RLPA 4AM6A 4L94A 1NGFA 4V25A 4H5TA 3OMUA 4U7OA 2D1KA 5BN9A 5EY4A 4XKOA 1ZWHA 4WUCA 5IN9A 5FNDA 4E72A 4LWIA 1C0FA 1GJVA 4HZ0A 3ULEA 2XDUA 3MN6A 1PVGA 1YAGA 3U8XA 2H8MA 2XJXA 1BXDA 4CZHA 1YSZA 5AQQA 1NMDA 4CBWA 2GWJA 3K60A 1MU5A 2YE4A 2Q8FA 2WEQA 3VHCA 4PRVA 2C1GA 4XE2A 1QQNA 4KSGA 3LDNA 2C2AA 5AQXA 1SQKA 1BA1A 1IJJA 4GT8A 4JN4A 3EL2A 4RTFD 2XX5A 3RKZA 2XHRA 2QWMA 5AQMA 2ZKJA 4CI6A 1H7SA 4XKKA 2ASMA 2YECA 3CRLA 3MN7A 4PKHA 4LWHA 2O1UA 3RLQA 4FCPA 1US7A 2YK2A 2WERA 2XDXA 4BAEA 2VW5A 1AH8A 1NGCA 4X9LA 4EEHA 2Q36A 4YKWA 5AQJA 5AQVA 1UYCA 1YSRA 2ZDXA 4XCJA 3A0WA 5CF0A 2CCTA 4CE3A 5FPMA 4BECA 2P9KB 4FMTA 3A5OC 4JASA 2JJCA 3U2DA 4L90A 3CWVA 2YGFA 2C1IA 2GFDA 2XX2A 3EKSA 1ZXMA 1F51A 1JCEA 1I58A 2CH4A 3JZ3A 3C11A 3C7NB 3SJHA 3UKUA 4XCLA 2BU8A 4CWTA 4I6MB 3HYYA 3WEEB 2QF6A 4JHDA 2XD6A 2XK2A 1MA9B 1RDWX 3T0HA 5EXWA 5AQIA 4AWQA 3LNUA 3EHHA 3ZXQA 4K43A 1GKZA 3DXMB 4O09A 4CZMA 3TU5A 4YKRA 4ZKIA 2P9IA 2PAVA 1YT2A 2ESAA 5CTWA 4UROA 3NMQA 5D7RA 4GFNA 4R3MA 4EFHA 3T2SA 2FXUA 3FFKB 4GCZA 2BREA 5CTYA 2PNRA 1HJOA 4AM7A 3O6OA 5F0XA 1YS3A 4PKIA 1UYDA 3GIGA 2YI6A 1THNA 1K8KB 1TBWA 1TYQB 4K42A 3BMYA 5EVZA 4MPNA 2XCMA 2YEHA 3PEHA 3U9ZA 1UYMA 2P9LB 1S3XA 2YEDA 5TKYA 1NHJA 3HYZA 1S22A 4PRXA 4V26A 5BPLA 2Q97A 4YKZA 2YGEA 5D6PA 4LWFA 3EKRA 4HWIA 3D2RA 3EHJA 1RGIA 3GDQA 2W00A 2P9IB 3R4OA 2IWXA 3VHDA 3OWDA 2YE3A 2VCIA 2FTKA 3FT5A 3ZKBA 3FZHA 3JXUA 4PKGA 2HCHA 4B1XB 2BU5A 3QTFA 2Q0UA 1BKNA 4FPPA 4MP2A 3MMVA 1XQSC 2XHTA 4BEBA 3A0XA 1ATSA 3D36A 1JM6A 4O0BA 1NGBA 2YE6A 2CGFA 4FO0A 4XC0A 1R62A 2YEGA 4CZFA 3QMLA 3LDOA 5AQTA 3I33A 5D7CA 4MPCA 2XDKA 3CJCA 4JHDB 3CGYA 4URNA 5IDMA 2E0AA 3FZLA 1B63A 1YERA 2BRCA 3WQ9A 3BM9A 4CE2A 1Y8PA 1GKXA 4WUBA 2V52B 2YE9A 5L3JA 4URLA 4JD2B 2O1WA 2P9SA 3MN5A 4B6CA 4FCQA 4QPKA 2JKIA 4WYBA 4W7TA 5E84A 4BXIA 4E00A 3W3DA 3VADA 4L93A 5FPDA 1A4HA 1K8KA 1S14A 1UYIA 2IOQA 1QQMA 1NM1A 3M3ZA 3INXA 2Q31A 1YC3A 2Q1NA 2P9NA 3T10A 5FPNA 3RSEB 4ASBA 3ULEB 3U2KA 2IORA 2YI5A 3R91A 4EGIA 2H55A 5C93A 2FF3B 3T1KA 1NGGA 2YEAA 2Q0RA 3G75A 4GGLA 3DAWA 2P9UB 5GGZA
chains in the Genus database with same CATH topology
5JENA 4E72A 3CYGA 3S5TA 2HHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEN A;  4E72 A;  3CYG A;  3S5T A;  2HHI A; 
#chains in the Genus database with same CATH topology
 4PL7 A;  2YKI A;  2YEI A;  4HZ5 A;  3D2E B;  4R3A A;  1YC4 A;  2YJF A;  2BSM A;  4CZE A;  3CHW A;  4CBX A;  3Q5J A;  4HYM A;  5JEN A;  1YET A;  5EX5 A;  5AQR A;  4RWT A;  3TTZ A;  3G7E A;  1HLU A;  2P9P B;  1TH8 A;  5AQO A;  3U4L A;  2E88 A;  4XJX A;  5FNC A;  2XJJ A;  3B25 A;  1UY8 A;  1YT0 A;  3A5M C;  4B9Q A;  1UY6 A;  2QG2 A;  2YJW A;  1BA0 A;  1ESV A;  4CZI A;  4YKT A;  4AWP A;  1KAZ A;  2WI2 A;  1NHI A;  2A42 A;  2AKP A;  3S5T A;  1TC6 A;  3KVG A;  2O1V A;  2ASO A;  2VYP A;  2WEP A;  3CIP A;  1QZ6 A;  3D2E A;  1U2V A;  2QWL A;  4PL9 A;  4GNI A;  3A0T A;  2Q8G A;  1U0Z A;  5F1X A;  2YK9 A;  4O05 A;  1U2O A;  1P8Z A;  2P9K A;  3B26 A;  1BGQ A;  5IDJ A;  3CYG A;  3OW6 A;  4EMV A;  2P9P A;  1QZR A;  3CJB A;  3TPQ A;  1TC0 A;  4U93 A;  4H03 B;  4EFU A;  1BUP A;  4JAV A;  2FWY A;  4XD8 A;  4B1Z A;  4GQT A;  1UY7 A;  3RSE A;  3FZF A;  3FT8 A;  3G7B A;  2HF3 A;  1UYG A;  1EI1 A;  5BOD A;  3HEK A;  2YE5 A;  1U2V B;  2P9U A;  2KHO A;  4NH7 A;  3SL2 A;  1DEJ A;  5M4K A;  3J8A A;  5AQK A;  2XHX A;  3QFU A;  4MPE A;  2A5X A;  3QB0 A;  1YES A;  2BT0 A;  1HPM A;  2GWK A;  3LDQ A;  2ZWH A;  2IWS A;  3OPD A;  4CWR A;  4URM A;  1ZXN A;  4CWF A;  1B3Q A;  2YJE A;  1RFQ A;  2GQP A;  4H5R A;  4KTN A;  3MN9 A;  3GIG B;  3RLR A;  1D4X A;  3A5L C;  3L6Q A;  3GIF A;  2QWN A;  1NGD A;  2BU6 A;  4JQL A;  4DUH A;  5AQG A;  4WUD A;  4KQV A;  1NWK A;  1UYK A;  4XIP A;  1Z5A A;  4A2B A;  3M1F A;  4L8Z A;  1MDU B;  2IWU A;  1E4G T;  4BIZ A;  2A40 A;  2QW9 A;  5AQN A;  3H80 A;  1Y8O A;  2YI0 A;  4K4O A;  2QWR A;  2WI1 A;  3D2F A;  2Q8H A;  3CRK A;  1ATR A;  4HYP A;  3A0Z A;  3MNR P;  5CPH A;  1Y64 A;  2ASP A;  2A3Z A;  3DGE A;  4Q20 A;  5F5R A;  4YKX A;  4JAU A;  2HG1 A;  4HY6 A;  4KFG A;  1AH6 A;  5FNF A;  3U9D A;  5CTX A;  5M4E A;  3O2F A;  2CCU A;  1YT1 A;  1UY9 A;  4XKA A;  4CWS A;  4KP4 A;  4XTJ A;  1YXQ A;  5BN8 A;  3T0Z A;  1LOT B;  4MP7 A;  2YEF A;  2YE2 A;  1DKG D;  4FL9 A;  2VCJ A;  5AQW A;  3VHA A;  3QFP A;  4AS9 A;  1QY8 A;  5BOC A;  1KXP A;  2WUS A;  5CTU A;  4H0X B;  5JLF A;  4JD2 A;  3TZ5 A;  4J8F A;  2Q2E B;  2BYI A;  4BQG A;  3EKO A;  3KE6 A;  2YI7 A;  1KAY A;  2XJG A;  3R4P A;  1AJ6 A;  1NGA A;  1I5A A;  2BYH A;  2FF6 A;  2QWO A;  5J71 A;  1TIL A;  3ATU A;  3HSC A;  5F3K A;  5AQS A;  4O04 A;  4EGK A;  3A8Y A;  3L4I A;  4CWO A;  3WEE A;  4ZVI A;  4CE1 A;  3HZ1 A;  3R4N A;  2BTF A;  4I5S A;  2YKJ A;  1I5B A;  4H0Y B;  1NGH A;  2A41 A;  3DXM A;  2QFO A;  4EFT A;  1UYE A;  4H85 A;  2UWD A;  2HF4 A;  5AFU A;  4B1W B;  5M4P A;  2YKE A;  1Y4U A;  4CWN A;  4P8O A;  1J6Z A;  3K98 A;  2PBD A;  1JCF A;  3M6G A;  2HHI A;  3LMM A;  3PEJ A;  1NGE A;  3DXK A;  5AQF A;  4B1Y B;  4EM7 A;  4ASG A;  1LCU A;  2WI7 A;  5BPM A;  2WI5 A;  1AMW A;  2YEB A;  5M4H A;  4U7N A;  1TYQ A;  1QZ5 A;  2XAB A;  1YC1 A;  4QPJ A;  3TZ0 A;  4CWQ A;  3ZXO A;  1E4F T;  3A0R A;  2YGA A;  4HXZ A;  1T44 A;  2VCP A;  3FZK A;  4AWO A;  4Z94 A;  1YVN A;  2OAN A;  2XDS A;  3B24 A;  3K97 A;  4KBO A;  4H5V A;  3UKR B;  3INW A;  1ZW9 A;  1TID A;  5AQY A;  4NH9 A;  3IED A;  4GY2 B;  4E01 A;  4CZL A;  4BE7 B;  1Z59 A;  5FWK A;  1UYF A;  1Z5C A;  3WHA A;  2BZ5 A;  3A5N C;  2YE7 A;  4B7P A;  4H0T B;  1NGI A;  4YKQ A;  4MBC A;  4BQJ A;  1KZN A;  3DXK B;  5AR0 A;  4CBU A;  4CZK A;  3O0I A;  1H1V A;  3GIE A;  2V7Y A;  3ZKD A;  5AQP A;  4BIU A;  5AFU H;  3OWB A;  4DZY A;  3HZ5 A;  5AQZ A;  3LPS A;  1OSF A;  2V7Z A;  4LP0 A;  3TZ2 A;  2YE8 A;  4EGH A;  3EKU A;  2P9S B;  3EHF A;  2ZBK B;  2YKC A;  1I5D A;  4MOT A;  5M4N A;  3HBT A;  3A0Y A;  2BTZ A;  1ATN A;  3DWL A;  1Y4S A;  4B1U B;  2E8A A;  2YEJ A;  3U67 A;  5D7D A;  2CG9 A;  4CZJ A;  4XIR A;  4LWE A;  4ASF A;  5M4M A;  4PL8 A;  2HMP A;  3ZM7 A;  4A2A A;  4MB9 A;  4CZG A;  3C7N A;  3UKU B;  3C0E A;  4XIT A;  2P9N B;  4LWG A;  3GL1 A;  1ID0 A;  3CGZ A;  4H5N A;  1NHH A;  2VWC A;  3ATV A;  3R92 A;  4IO8 A;  5F2R A;  1L0O A;  5J6A A;  2HKJ A;  4I6M A;  5CE3 A;  2WI4 A;  1WUA A;  4O07 A;  4XIQ A;  2XDL A;  4R1F A;  4I3H A;  1KAX A;  4L91 A;  2FYP A;  1I5C A;  4CWP A;  2BUP A;  3UKR A;  4YKU A;  3FV5 A;  4FCR A;  4FSV A;  4ASA A;  3Q5K A;  5ADX H;  3CQX A;  3FE1 A;  2P9L A;  2XX4 A;  1AM1 A;  2FWZ A;  1C0G A;  1BYQ A;  2QWQ A;  5D6Q A;  1H7U A;  4JNE A;  3H4L A;  2YJX A;  1UYL A;  2YKB A;  3D2F B;  3HHU A;  1EA6 A;  3TUH A;  3R4M A;  4LPB A;  2BU2 A;  4P7A A;  4NH8 A;  3BUZ B;  1S16 A;  3QDD A;  3B28 A;  3FZM A;  2K5B A;  3AY9 A;  5ADX A;  3Q5L A;  3LDP A;  1Z5B A;  2BU7 A;  5AQH A;  1HX1 A;  3UE5 A;  5JLH A;  3B27 A;  2QG0 A;  2Q8I A;  1NGJ A;  2QXL A;  4K41 A;  4H5W A;  1UYH A;  1QYE A;  1NLV A;  1QQO A;  1EQY A;  4E02 A;  4H0V B;  4M63 C;  3LDL A;  2WI6 A;  2CCS A;  3UB5 A;  4HXW A;  4H81 A;  3K99 A;  1YUW A;  5BPN A;  3IUC A;  2V51 B;  2YEE A;  1MX0 A;  4KSH A;  4YKY A;  5AQL A;  4GEE A;  4HY1 A;  2QWP A;  1B62 A;  5FPE A;  1KIJ A;  1Y8N A;  2FXS A;  4EAH D;  4B1V A;  2WI3 A;  2ZDY A;  1I59 A;  2IOP A;  4XDM A;  3CI5 A;  5I9E B;  3D0B A;  3EHG A;  2EXL A;  3TZ4 A;  1JCG A;  4XEI A;  4PU9 A;  5AQU A;  1IXM A;  4H7Q A;  3RLP A;  4AM6 A;  4L94 A;  1NGF A;  4V25 A;  4H5T A;  3OMU A;  4U7O A;  2D1K A;  5BN9 A;  5EY4 A;  4XKO A;  1ZWH A;  4WUC A;  5IN9 A;  5FND A;  4E72 A;  4LWI A;  1C0F A;  1GJV A;  4HZ0 A;  3ULE A;  2XDU A;  3MN6 A;  1PVG A;  1YAG A;  3U8X A;  2H8M A;  2XJX A;  1BXD A;  4CZH A;  1YSZ A;  5AQQ A;  1NMD A;  4CBW A;  2GWJ A;  3K60 A;  1MU5 A;  2YE4 A;  2Q8F A;  2WEQ A;  3VHC A;  4PRV A;  2C1G A;  4XE2 A;  1QQN A;  4KSG A;  3LDN A;  2C2A A;  5AQX A;  1SQK A;  1BA1 A;  1IJJ A;  4GT8 A;  4JN4 A;  3EL2 A;  4RTF D;  2XX5 A;  3RKZ A;  2XHR A;  2QWM A;  5AQM A;  2ZKJ A;  4CI6 A;  1H7S A;  4XKK A;  2ASM A;  2YEC A;  3CRL A;  3MN7 A;  4PKH A;  4LWH A;  2O1U A;  3RLQ A;  4FCP A;  1US7 A;  2YK2 A;  2WER A;  2XDX A;  4BAE A;  2VW5 A;  1AH8 A;  1NGC A;  4X9L A;  4EEH A;  2Q36 A;  4YKW A;  5AQJ A;  5AQV A;  1UYC A;  1YSR A;  2ZDX A;  4XCJ A;  3A0W A;  5CF0 A;  2CCT A;  4CE3 A;  5FPM A;  4BEC A;  2P9K B;  4FMT A;  3A5O C;  4JAS A;  2JJC A;  3U2D A;  4L90 A;  3CWV A;  2YGF A;  2C1I A;  2GFD A;  2XX2 A;  3EKS A;  1ZXM A;  1F51 A;  1JCE A;  1I58 A;  2CH4 A;  3JZ3 A;  3C11 A;  3C7N B;  3SJH A;  3UKU A;  4XCL A;  2BU8 A;  4CWT A;  4I6M B;  3HYY A;  3WEE B;  2QF6 A;  4JHD A;  2XD6 A;  2XK2 A;  1MA9 B;  1RDW X;  3T0H A;  5EXW A;  5AQI A;  4AWQ A;  3LNU A;  3EHH A;  3ZXQ A;  4K43 A;  1GKZ A;  3DXM B;  4O09 A;  4CZM A;  3TU5 A;  4YKR A;  4ZKI A;  2P9I A;  2PAV A;  1YT2 A;  2ESA A;  5CTW A;  4URO A;  3NMQ A;  5D7R A;  4GFN A;  4R3M A;  4EFH A;  3T2S A;  2FXU A;  3FFK B;  4GCZ A;  2BRE A;  5CTY A;  2PNR A;  1HJO A;  4AM7 A;  3O6O A;  5F0X A;  1YS3 A;  4PKI A;  1UYD A;  3GIG A;  2YI6 A;  1THN A;  1K8K B;  1TBW A;  1TYQ B;  4K42 A;  3BMY A;  5EVZ A;  4MPN A;  2XCM A;  2YEH A;  3PEH A;  3U9Z A;  1UYM A;  2P9L B;  1S3X A;  2YED A;  5TKY A;  1NHJ A;  3HYZ A;  1S22 A;  4PRX A;  4V26 A;  5BPL A;  2Q97 A;  4YKZ A;  2YGE A;  5D6P A;  4LWF A;  3EKR A;  4HWI A;  3D2R A;  3EHJ A;  1RGI A;  3GDQ A;  2W00 A;  2P9I B;  3R4O A;  2IWX A;  3VHD A;  3OWD A;  2YE3 A;  2VCI A;  2FTK A;  3FT5 A;  3ZKB A;  3FZH A;  3JXU A;  4PKG A;  2HCH A;  4B1X B;  2BU5 A;  3QTF A;  2Q0U A;  1BKN A;  4FPP A;  4MP2 A;  3MMV A;  1XQS C;  2XHT A;  4BEB A;  3A0X A;  1ATS A;  3D36 A;  1JM6 A;  4O0B A;  1NGB A;  2YE6 A;  2CGF A;  4FO0 A;  4XC0 A;  1R62 A;  2YEG A;  4CZF A;  3QML A;  3LDO A;  5AQT A;  3I33 A;  5D7C A;  4MPC A;  2XDK A;  3CJC A;  4JHD B;  3CGY A;  4URN A;  5IDM A;  2E0A A;  3FZL A;  1B63 A;  1YER A;  2BRC A;  3WQ9 A;  3BM9 A;  4CE2 A;  1Y8P A;  1GKX A;  4WUB A;  2V52 B;  2YE9 A;  5L3J A;  4URL A;  4JD2 B;  2O1W A;  2P9S A;  3MN5 A;  4B6C A;  4FCQ A;  4QPK A;  2JKI A;  4WYB A;  4W7T A;  5E84 A;  4BXI A;  4E00 A;  3W3D A;  3VAD A;  4L93 A;  5FPD A;  1A4H A;  1K8K A;  1S14 A;  1UYI A;  2IOQ A;  1QQM A;  1NM1 A;  3M3Z A;  3INX A;  2Q31 A;  1YC3 A;  2Q1N A;  2P9N A;  3T10 A;  5FPN A;  3RSE B;  4ASB A;  3ULE B;  3U2K A;  2IOR A;  2YI5 A;  3R91 A;  4EGI A;  2H55 A;  5C93 A;  2FF3 B;  3T1K A;  1NGG A;  2YEA A;  2Q0R A;  3G75 A;  4GGL A;  3DAW A;  2P9U B;  5GGZ A; 
#chains in the Genus database with same CATH homology
 5JEN A;  4E72 A;  3CYG A;  3S5T A;  2HHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...