5JENA

Crystal structure of the anti-sigma factor rsiv bound to lysozyme
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
210
structure length
210
Chain Sequence
IVKAITFIEIKEEKDQSSIDVKTPALSGLSNKELENSINEKYLKESQQLYKEFIQSTSKNKKGHLSIYSDYETVTDTPDLLSIRRNIETTQASSYTQSRYITIDKKNDILLTLKSLFKDERYIKVISQNIKEQMKQQMKEDPNKIYWLTDEDAEPFKTILPDQTFYITEDHKLVISFDEYEVAPGYMGVTEFTIPTGVISNLLVGERYIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The anti-sigma factor RsiV is a receptor for lysozyme: The crystal structure of RsiV-lysozyme complex
rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Hydrolase/hydrolase receptor
molecule keywords Anti-sigma-V factor RsiV
total genus 55
structure length 210
sequence length 210
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
A PF13739 PdaC Deacetylase PdaC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 5jenA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 5jenA02
4E72A 5JENA 3S5TA 2HHIA 3CYGA
chains in the Genus database with same CATH superfamily
1U2OA 3MN9A 3DGEA 4ASFA 3RLRA 4R3MA 4XKAA 2GFDA 2WI3A 1QZRA 2UWDA 4LP0A 5D7CA 2YEIA 4CWOA 1AH8A 5F0XA 4FPPA 2CG9A 4JQLA 1K8KB 5AR0A 5CTXA 5IDMA 4CBWA 3IEDA 1UYMA 1KAXA 1EI1A 5AQXA 4O07A 2FWZA 1KIJA 3EKOA 1BA0A 1D4XA 2YEHA 3VHAA 2E8AA 2BYIA 2WI5A 3A5NC 2VCJA 2FXSA 5AFUA 4AM6A 4V25A 1RDWX 2O1UA 4K43A 3CGYA 4FO0A 2QWMA 2YJXA 2CCUA 1S3XA 4YKQA 1KAZA 1NGAA 4RWTA 3ZKBA 3CYGA 5BPMA 2XJJA 2XX4A 2IOQA 2HMPA 4H0XB 3CHWA 4CZEA 2ZDXA 4ASBA 3PEJA 3FZLA 3OWDA 1UY7A 1YSRA 4KP4A 1LCUA 2ZDYA 2IWUA 4H5RA 2WERA 2ZKJA 2Q8FA 3FV5A 3VHDA 5AQPA 4XCJA 4EGHA 4B1ZA 1NHJA 2HF3A 3D2EA 1QYEA 5M4HA 1UYLA 2P9IB 3B26A 3QFUA 4MPNA 4QPJA 2XHTA 5I9EB 2Q0RA 4BQJA 1NGBA 4AWQA 2YKJA 1E4GT 1UY6A 2WUSA 1GKZA 3D2EB 2P9UA 5FNFA 3ZM7A 4URNA 1YSZA 1NMDA 3QMLA 4MP7A 2XHXA 2P9KA 5FPMA 1I58A 2IWSA 3SJHA 4CWFA 2YE3A 3HSCA 2A41A 3OMUA 4CWPA 3DXMB 4GEEA 4AWOA 3G7EA 1JCEA 1YT2A 3LDNA 4Q20A 2XJXA 4R1FA 1KZNA 2BRCA 4UROA 4PL8A 4U7OA 3A0ZA 3JZ3A 2VCIA 2XX5A 1NGHA 5AQWA 5J6AA 2QW9A 2YEFA 5BODA 4KFGA 5AQLA 1A4HA 4H7QA 2VW5A 3G7BA 4NH7A 5CPHA 3FT5A 2QWOA 1DKGD 1TILA 3UKRA 2IWXA 1I59A 3QTFA 2AKPA 1B62A 4GCZA 1HJOA 3AY9A 1ZWHA 2P9KB 5FNDA 3TZ0A 4URLA 1TBWA 3U2KA 5CF0A 5L3JA 4WUBA 4WUDA 4HYPA 2H55A 4JD2A 1GKXA 4B6CA 2BU2A 4P7AA 3LDPA 2YJFA 4JN4A 4PL7A 1YT0A 3B24A 2FXUA 2IORA 3R4PA 5CTUA 2WEPA 5F3KA 2XK2A 1GJVA 1QQMA 3LPSA 1YXQA 2JKIA 4CWQA 3D2RA 3ATVA 3LNUA 2YEJA 4L94A 3J8AA 4CZIA 4AS9A 2QWQA 2CH4A 4PKIA 2CCTA 5D6QA 3UKRB 4W7TA 5AQRA 1AJ6A 2YI7A 3BM9A 4CWRA 4ZVIA 3WQ9A 2ASMA 2HHIA 3U9ZA 4EMVA 5AQFA 4FSVA 2YEBA 4MOTA 3M6GA 3RSEA 4WYBA 1KAYA 5AQZA 4Z94A 5CTWA 5IN9A 2P9UB 2V51B 4O04A 4H5VA 4PRXA 1KXPA 1I5DA 3T0HA 2YI6A 1SQKA 4B1YB 3EHFA 3WHAA 4B7PA 5AQQA 3H80A 2ASPA 4E02A 3RLQA 1PVGA 4DUHA 2QG0A 4H5NA 2Q8HA 4CWSA 2YKIA 5J71A 1B3QA 4XEIA 5AQOA 2C2AA 3ZXQA 2ZBKB 4CE3A 2V7ZA 5AQSA 3Q5KA 1NGCA 5ADXA 2XHRA 4CI6A 1IXMA 3PEHA 4GY2B 2FF3B 5TKYA 4GGLA 2ESAA 4PRVA 3GIGA 2XDUA 4URMA 5BPNA 3A0XA 3CRKA 3INWA 3CJBA 2A3ZA 1QY8A 4KSHA 2P9PB 2IOPA 1TC0A 3DXKB 4H0VB 1ATNA 5AQIA 1YT1A 2P9SA 2YJWA 1BA1A 4NH8A 1LOTB 4CBUA 4P8OA 3UKUB 3LDOA 4FL9A 1H7SA 2E0AA 2O1VA 3A0WA 4EAHD 4GNIA 4KSGA 2YEDA 2YE2A 2P9SB 2Q31A 4NH9A 4YKXA 2YKCA 1THNA 3VHCA 2VCPA 4HXZA 4LWFA 3D2FB 1EQYA 4XJXA 2JJCA 4K4OA 2YGAA 4FMTA 4GT8A 3CJCA 2Q8GA 2QFOA 4L91A 3R4NA 2H8MA 1YC1A 1YVNA 4CZHA 1NGGA 2YGEA 3CI5A 2YKEA 2V52B 5AQTA 4KTNA 4LWEA 4BQGA 4MP2A 1NGJA 3TU5A 4HZ0A 4BEBA 3DXKA 4BECA 3FZKA 3U2DA 1H7UA 1UYKA 3S5TA 4AM7A 2K5BA 3Q5JA 2YE9A 4E01A 1ID0A 4XC0A 1NGFA 3ZXOA 4JAUA 1JCFA 4M63C 1TIDA 5AQNA 1C0FA 2WI6A 3MN7A 1NGIA 1ATRA 4A2AA 4ASGA 2V7YA 3U4LA 3TPQA 2QWRA 2YK9A 5CTYA 2E88A 3HBTA 4B1WB 4L93A 1US7A 3GL1A 1JM6A 2ZWHA 1I5BA 3EKRA 4XIRA 4PU9A 2YGFA 2QG2A 2XCMA 1UYEA 1NWKA 1T44A 2BREA 4AWPA 1AH6A 2HG1A 3MMVA 3A5MC 3HYYA 5JENA 3RKZA 3R4MA 4EFUA 5GGZA 1YAGA 3A5LC 1Z59A 2W00A 4CZJA 5FNCA 3D2FA 1Z5BA 1NLVA 3TZ5A 4HYMA 5BN9A 4I6MB 5BPLA 1R62A 2C1GA 2Q8IA 2BU5A 1NHIA 1I5CA 4L8ZA 3EKSA 2FF6A 2BU7A 5JLFA 4JAVA 1HLUA 4K42A 2P9LB 3CRLA 1UYGA 1H1VA 1MA9B 4LPBA 2GWKA 3GIGB 3R92A 2ASOA 1Y4SA 4YKWA 4GQTA 4LWHA 1F51A 1ZXNA 4U93A 4JASA 5M4MA 4XKKA 3FZHA 3R4OA 3GDQA 3EHJA 2PAVA 5AQKA 3TZ4A 4XKOA 4CBXA 3G75A 4QPKA 2WI1A 2BUPA 1Y8NA 4CE2A 4GFNA 4B1XB 4FCPA 5BOCA 1OSFA 3IUCA 4E00A 4E72A 2YK2A 3FE1A 4MB9A 4O05A 4JD2B 3CQXA 2BU6A 1NGEA 5FPNA 1UYIA 4H81A 3T0ZA 1WUAA 2XABA 2WEQA 2A40A 2YEGA 2YE6A 4PKHA 3VADA 2KHOA 1TH8A 1S14A 1UYFA 5M4KA 4XIQA 1UYHA 4CWNA 3U67A 3GIFA 4EM7A 2BU8A 2P9LA 3H4LA 4EEHA 1U2VA 3MNRP 2A42A 2YI0A 4MPEA 5AQJA 4K41A 2Q1NA 4PKGA 3LDLA 3TUHA 2P9PA 1Y8PA 4EGKA 2CCSA 1L0OA 2XDXA 1ATSA 4B1VA 2YE5A 4MBCA 2QWPA 5F2RA 2P9NA 4YKRA 4IO8A 3UE5A 3D36A 2BZ5A 3HHUA 1ESVA 4HY6A 3ZKDA 4CWTA 2QWLA 5D7RA 1UY9A 4JNEA 4HWIA 4H0TB 5AQYA 4WUCA 3RLPA 2QXLA 4HY1A 5AFUH 4BXIA 2XDSA 3UB5A 1TC6A 1Z5AA 3DXMA 4X9LA 4R3AA 2BTFA 4CE1A 1AMWA 4LWIA 3ATUA 4B1UB 4I6MA 5EX5A 3A5OC 3L6QA 2FWYA 1HX1A 5BN8A 2Q2EB 2XDKA 2XX2A 4BIUA 2YJEA 2YECA 1UY8A 3TZ2A 1XQSC 1BKNA 3M1FA 3K99A 3HYZA 1HPMA 1U2VB 3FZMA 2XD6A 1QQOA 2GWJA 3EKUA 1UYCA 2BTZA 2P9IA 1ZW9A 4H5TA 1Y8OA 2HCHA 3OW6A 1BYQA 5FWKA 3MN6A 4KBOA 3L4IA 4ZKIA 2Q97A 3SL2A 3EHHA 1BGQA 3TTZA 1ZXMA 5AQUA 4JHDB 2P9NB 2YEAA 2YE8A 3U8XA 2BSMA 2EXLA 3C7NA 1BUPA 3ULEA 5JLHA 5C93A 2YE7A 4ASAA 2YI5A 1EA6A 4EGIA 2WI7A 2Q36A 4A2BA 3B28A 5FPEA 5F1XA 3A8YA 3K97A 1NGDA 2FYPA 1J6ZA 3FFKB 3A0YA 3KE6A 3BUZB 4CZMA 5AQHA 5D7DA 2D1KA 3DAWA 4KQVA 2YE4A 3C0EA 1DEJA 2FTKA 4MPCA 2O1WA 2WI2A 5EY4A 2WI4A 2VWCA 4H03B 3CWVA 3QB0A 3LDQA 4FCQA 1B63A 1Z5CA 4BIZA 3M3ZA 3JXUA 4CZFA 2QWNA 4H5WA 1YC3A 3O6OA 4O09A 4BAEA 3UKUA 4FCRA 3T2SA 3T1KA 3WEEB 2VYPA 1NHHA 3C7NB 3I33A 3ULEB 4XE2A 3K60A 5IDJA 1QZ6A 1Y4UA 2Q0UA 5F5RA 3C11A 2XDLA 1RFQA 5M4NA 1JCGA 4YKZA 1NM1A 4EFHA 1BXDA 3NMQA 2BT0A 4XTJA 3LMMA 3DWLA 3D0BA 1TYQB 2YEEA 1U0ZA 5CE3A 5D6PA 4JHDA 3B27A 3CGZA 1YETA 3BMYA 4HXWA 4HZ5A 5AQVA 4CZLA 5ADXH 1MDUB 4J8FA 3QDDA 5EXWA 4PL9A 1QZ5A 5AQMA 1TYQA 1YS3A 2CGFA 3EHGA 4H85A 3A0RA 3OWBA 3INXA 3A0TA 1S22A 3HZ1A 4BE7B 3HZ5A 2XJGA 3K98A 5EVZA 4H0YB 1Y64A 2C1IA 3T10A 3OPDA 3FZFA 3HEKA 3Q5LA 4B9QA 3B25A 4V26A 1RGIA 1YUWA 4LWGA 1MU5A 5E84A 3W3DA 3QFPA 3RSEB 2A5XA 1MX0A 4XDMA 4YKUA 2HKJA 4L90A 2HF4A 2PBDA 4XCLA 1YC4A 2BYHA 3EL2A 5AQGA 4I3HA 1P8ZA 3FT8A 3CIPA 1I5AA 2PNRA 1YERA 1IJJA 4YKTA 4YKYA 1K8KA 4CZKA 4EFTA 2OANA 4XD8A 5M4EA 4U7NA 5M4PA 3WEEA 2YKBA 1E4FT 4RTFD 1QQNA 3O2FA 3MN5A 2QF6A 2GQPA 3U9DA 4DZYA 5FPDA 1AM1A 4XIPA 1UYDA 1YESA 3KVGA 3O0IA 4XITA 1C0GA 3R91A 4O0BA 4I5SA 3GIEA 1S16A 4CZGA
chains in the Genus database with same CATH topology
4E72A 5JENA 3S5TA 2HHIA 3CYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E72 A;  5JEN A;  3S5T A;  2HHI A;  3CYG A; 
#chains in the Genus database with same CATH topology
 1U2O A;  3MN9 A;  3DGE A;  4ASF A;  3RLR A;  4R3M A;  4XKA A;  2GFD A;  2WI3 A;  1QZR A;  2UWD A;  4LP0 A;  5D7C A;  2YEI A;  4CWO A;  1AH8 A;  5F0X A;  4FPP A;  2CG9 A;  4JQL A;  1K8K B;  5AR0 A;  5CTX A;  5IDM A;  4CBW A;  3IED A;  1UYM A;  1KAX A;  1EI1 A;  5AQX A;  4O07 A;  2FWZ A;  1KIJ A;  3EKO A;  1BA0 A;  1D4X A;  2YEH A;  3VHA A;  2E8A A;  2BYI A;  2WI5 A;  3A5N C;  2VCJ A;  2FXS A;  5AFU A;  4AM6 A;  4V25 A;  1RDW X;  2O1U A;  4K43 A;  3CGY A;  4FO0 A;  2QWM A;  2YJX A;  2CCU A;  1S3X A;  4YKQ A;  1KAZ A;  1NGA A;  4RWT A;  3ZKB A;  3CYG A;  5BPM A;  2XJJ A;  2XX4 A;  2IOQ A;  2HMP A;  4H0X B;  3CHW A;  4CZE A;  2ZDX A;  4ASB A;  3PEJ A;  3FZL A;  3OWD A;  1UY7 A;  1YSR A;  4KP4 A;  1LCU A;  2ZDY A;  2IWU A;  4H5R A;  2WER A;  2ZKJ A;  2Q8F A;  3FV5 A;  3VHD A;  5AQP A;  4XCJ A;  4EGH A;  4B1Z A;  1NHJ A;  2HF3 A;  3D2E A;  1QYE A;  5M4H A;  1UYL A;  2P9I B;  3B26 A;  3QFU A;  4MPN A;  4QPJ A;  2XHT A;  5I9E B;  2Q0R A;  4BQJ A;  1NGB A;  4AWQ A;  2YKJ A;  1E4G T;  1UY6 A;  2WUS A;  1GKZ A;  3D2E B;  2P9U A;  5FNF A;  3ZM7 A;  4URN A;  1YSZ A;  1NMD A;  3QML A;  4MP7 A;  2XHX A;  2P9K A;  5FPM A;  1I58 A;  2IWS A;  3SJH A;  4CWF A;  2YE3 A;  3HSC A;  2A41 A;  3OMU A;  4CWP A;  3DXM B;  4GEE A;  4AWO A;  3G7E A;  1JCE A;  1YT2 A;  3LDN A;  4Q20 A;  2XJX A;  4R1F A;  1KZN A;  2BRC A;  4URO A;  4PL8 A;  4U7O A;  3A0Z A;  3JZ3 A;  2VCI A;  2XX5 A;  1NGH A;  5AQW A;  5J6A A;  2QW9 A;  2YEF A;  5BOD A;  4KFG A;  5AQL A;  1A4H A;  4H7Q A;  2VW5 A;  3G7B A;  4NH7 A;  5CPH A;  3FT5 A;  2QWO A;  1DKG D;  1TIL A;  3UKR A;  2IWX A;  1I59 A;  3QTF A;  2AKP A;  1B62 A;  4GCZ A;  1HJO A;  3AY9 A;  1ZWH A;  2P9K B;  5FND A;  3TZ0 A;  4URL A;  1TBW A;  3U2K A;  5CF0 A;  5L3J A;  4WUB A;  4WUD A;  4HYP A;  2H55 A;  4JD2 A;  1GKX A;  4B6C A;  2BU2 A;  4P7A A;  3LDP A;  2YJF A;  4JN4 A;  4PL7 A;  1YT0 A;  3B24 A;  2FXU A;  2IOR A;  3R4P A;  5CTU A;  2WEP A;  5F3K A;  2XK2 A;  1GJV A;  1QQM A;  3LPS A;  1YXQ A;  2JKI A;  4CWQ A;  3D2R A;  3ATV A;  3LNU A;  2YEJ A;  4L94 A;  3J8A A;  4CZI A;  4AS9 A;  2QWQ A;  2CH4 A;  4PKI A;  2CCT A;  5D6Q A;  3UKR B;  4W7T A;  5AQR A;  1AJ6 A;  2YI7 A;  3BM9 A;  4CWR A;  4ZVI A;  3WQ9 A;  2ASM A;  2HHI A;  3U9Z A;  4EMV A;  5AQF A;  4FSV A;  2YEB A;  4MOT A;  3M6G A;  3RSE A;  4WYB A;  1KAY A;  5AQZ A;  4Z94 A;  5CTW A;  5IN9 A;  2P9U B;  2V51 B;  4O04 A;  4H5V A;  4PRX A;  1KXP A;  1I5D A;  3T0H A;  2YI6 A;  1SQK A;  4B1Y B;  3EHF A;  3WHA A;  4B7P A;  5AQQ A;  3H80 A;  2ASP A;  4E02 A;  3RLQ A;  1PVG A;  4DUH A;  2QG0 A;  4H5N A;  2Q8H A;  4CWS A;  2YKI A;  5J71 A;  1B3Q A;  4XEI A;  5AQO A;  2C2A A;  3ZXQ A;  2ZBK B;  4CE3 A;  2V7Z A;  5AQS A;  3Q5K A;  1NGC A;  5ADX A;  2XHR A;  4CI6 A;  1IXM A;  3PEH A;  4GY2 B;  2FF3 B;  5TKY A;  4GGL A;  2ESA A;  4PRV A;  3GIG A;  2XDU A;  4URM A;  5BPN A;  3A0X A;  3CRK A;  3INW A;  3CJB A;  2A3Z A;  1QY8 A;  4KSH A;  2P9P B;  2IOP A;  1TC0 A;  3DXK B;  4H0V B;  1ATN A;  5AQI A;  1YT1 A;  2P9S A;  2YJW A;  1BA1 A;  4NH8 A;  1LOT B;  4CBU A;  4P8O A;  3UKU B;  3LDO A;  4FL9 A;  1H7S A;  2E0A A;  2O1V A;  3A0W A;  4EAH D;  4GNI A;  4KSG A;  2YED A;  2YE2 A;  2P9S B;  2Q31 A;  4NH9 A;  4YKX A;  2YKC A;  1THN A;  3VHC A;  2VCP A;  4HXZ A;  4LWF A;  3D2F B;  1EQY A;  4XJX A;  2JJC A;  4K4O A;  2YGA A;  4FMT A;  4GT8 A;  3CJC A;  2Q8G A;  2QFO A;  4L91 A;  3R4N A;  2H8M A;  1YC1 A;  1YVN A;  4CZH A;  1NGG A;  2YGE A;  3CI5 A;  2YKE A;  2V52 B;  5AQT A;  4KTN A;  4LWE A;  4BQG A;  4MP2 A;  1NGJ A;  3TU5 A;  4HZ0 A;  4BEB A;  3DXK A;  4BEC A;  3FZK A;  3U2D A;  1H7U A;  1UYK A;  3S5T A;  4AM7 A;  2K5B A;  3Q5J A;  2YE9 A;  4E01 A;  1ID0 A;  4XC0 A;  1NGF A;  3ZXO A;  4JAU A;  1JCF A;  4M63 C;  1TID A;  5AQN A;  1C0F A;  2WI6 A;  3MN7 A;  1NGI A;  1ATR A;  4A2A A;  4ASG A;  2V7Y A;  3U4L A;  3TPQ A;  2QWR A;  2YK9 A;  5CTY A;  2E88 A;  3HBT A;  4B1W B;  4L93 A;  1US7 A;  3GL1 A;  1JM6 A;  2ZWH A;  1I5B A;  3EKR A;  4XIR A;  4PU9 A;  2YGF A;  2QG2 A;  2XCM A;  1UYE A;  1NWK A;  1T44 A;  2BRE A;  4AWP A;  1AH6 A;  2HG1 A;  3MMV A;  3A5M C;  3HYY A;  5JEN A;  3RKZ A;  3R4M A;  4EFU A;  5GGZ A;  1YAG A;  3A5L C;  1Z59 A;  2W00 A;  4CZJ A;  5FNC A;  3D2F A;  1Z5B A;  1NLV A;  3TZ5 A;  4HYM A;  5BN9 A;  4I6M B;  5BPL A;  1R62 A;  2C1G A;  2Q8I A;  2BU5 A;  1NHI A;  1I5C A;  4L8Z A;  3EKS A;  2FF6 A;  2BU7 A;  5JLF A;  4JAV A;  1HLU A;  4K42 A;  2P9L B;  3CRL A;  1UYG A;  1H1V A;  1MA9 B;  4LPB A;  2GWK A;  3GIG B;  3R92 A;  2ASO A;  1Y4S A;  4YKW A;  4GQT A;  4LWH A;  1F51 A;  1ZXN A;  4U93 A;  4JAS A;  5M4M A;  4XKK A;  3FZH A;  3R4O A;  3GDQ A;  3EHJ A;  2PAV A;  5AQK A;  3TZ4 A;  4XKO A;  4CBX A;  3G75 A;  4QPK A;  2WI1 A;  2BUP A;  1Y8N A;  4CE2 A;  4GFN A;  4B1X B;  4FCP A;  5BOC A;  1OSF A;  3IUC A;  4E00 A;  4E72 A;  2YK2 A;  3FE1 A;  4MB9 A;  4O05 A;  4JD2 B;  3CQX A;  2BU6 A;  1NGE A;  5FPN A;  1UYI A;  4H81 A;  3T0Z A;  1WUA A;  2XAB A;  2WEQ A;  2A40 A;  2YEG A;  2YE6 A;  4PKH A;  3VAD A;  2KHO A;  1TH8 A;  1S14 A;  1UYF A;  5M4K A;  4XIQ A;  1UYH A;  4CWN A;  3U67 A;  3GIF A;  4EM7 A;  2BU8 A;  2P9L A;  3H4L A;  4EEH A;  1U2V A;  3MNR P;  2A42 A;  2YI0 A;  4MPE A;  5AQJ A;  4K41 A;  2Q1N A;  4PKG A;  3LDL A;  3TUH A;  2P9P A;  1Y8P A;  4EGK A;  2CCS A;  1L0O A;  2XDX A;  1ATS A;  4B1V A;  2YE5 A;  4MBC A;  2QWP A;  5F2R A;  2P9N A;  4YKR A;  4IO8 A;  3UE5 A;  3D36 A;  2BZ5 A;  3HHU A;  1ESV A;  4HY6 A;  3ZKD A;  4CWT A;  2QWL A;  5D7R A;  1UY9 A;  4JNE A;  4HWI A;  4H0T B;  5AQY A;  4WUC A;  3RLP A;  2QXL A;  4HY1 A;  5AFU H;  4BXI A;  2XDS A;  3UB5 A;  1TC6 A;  1Z5A A;  3DXM A;  4X9L A;  4R3A A;  2BTF A;  4CE1 A;  1AMW A;  4LWI A;  3ATU A;  4B1U B;  4I6M A;  5EX5 A;  3A5O C;  3L6Q A;  2FWY A;  1HX1 A;  5BN8 A;  2Q2E B;  2XDK A;  2XX2 A;  4BIU A;  2YJE A;  2YEC A;  1UY8 A;  3TZ2 A;  1XQS C;  1BKN A;  3M1F A;  3K99 A;  3HYZ A;  1HPM A;  1U2V B;  3FZM A;  2XD6 A;  1QQO A;  2GWJ A;  3EKU A;  1UYC A;  2BTZ A;  2P9I A;  1ZW9 A;  4H5T A;  1Y8O A;  2HCH A;  3OW6 A;  1BYQ A;  5FWK A;  3MN6 A;  4KBO A;  3L4I A;  4ZKI A;  2Q97 A;  3SL2 A;  3EHH A;  1BGQ A;  3TTZ A;  1ZXM A;  5AQU A;  4JHD B;  2P9N B;  2YEA A;  2YE8 A;  3U8X A;  2BSM A;  2EXL A;  3C7N A;  1BUP A;  3ULE A;  5JLH A;  5C93 A;  2YE7 A;  4ASA A;  2YI5 A;  1EA6 A;  4EGI A;  2WI7 A;  2Q36 A;  4A2B A;  3B28 A;  5FPE A;  5F1X A;  3A8Y A;  3K97 A;  1NGD A;  2FYP A;  1J6Z A;  3FFK B;  3A0Y A;  3KE6 A;  3BUZ B;  4CZM A;  5AQH A;  5D7D A;  2D1K A;  3DAW A;  4KQV A;  2YE4 A;  3C0E A;  1DEJ A;  2FTK A;  4MPC A;  2O1W A;  2WI2 A;  5EY4 A;  2WI4 A;  2VWC A;  4H03 B;  3CWV A;  3QB0 A;  3LDQ A;  4FCQ A;  1B63 A;  1Z5C A;  4BIZ A;  3M3Z A;  3JXU A;  4CZF A;  2QWN A;  4H5W A;  1YC3 A;  3O6O A;  4O09 A;  4BAE A;  3UKU A;  4FCR A;  3T2S A;  3T1K A;  3WEE B;  2VYP A;  1NHH A;  3C7N B;  3I33 A;  3ULE B;  4XE2 A;  3K60 A;  5IDJ A;  1QZ6 A;  1Y4U A;  2Q0U A;  5F5R A;  3C11 A;  2XDL A;  1RFQ A;  5M4N A;  1JCG A;  4YKZ A;  1NM1 A;  4EFH A;  1BXD A;  3NMQ A;  2BT0 A;  4XTJ A;  3LMM A;  3DWL A;  3D0B A;  1TYQ B;  2YEE A;  1U0Z A;  5CE3 A;  5D6P A;  4JHD A;  3B27 A;  3CGZ A;  1YET A;  3BMY A;  4HXW A;  4HZ5 A;  5AQV A;  4CZL A;  5ADX H;  1MDU B;  4J8F A;  3QDD A;  5EXW A;  4PL9 A;  1QZ5 A;  5AQM A;  1TYQ A;  1YS3 A;  2CGF A;  3EHG A;  4H85 A;  3A0R A;  3OWB A;  3INX A;  3A0T A;  1S22 A;  3HZ1 A;  4BE7 B;  3HZ5 A;  2XJG A;  3K98 A;  5EVZ A;  4H0Y B;  1Y64 A;  2C1I A;  3T10 A;  3OPD A;  3FZF A;  3HEK A;  3Q5L A;  4B9Q A;  3B25 A;  4V26 A;  1RGI A;  1YUW A;  4LWG A;  1MU5 A;  5E84 A;  3W3D A;  3QFP A;  3RSE B;  2A5X A;  1MX0 A;  4XDM A;  4YKU A;  2HKJ A;  4L90 A;  2HF4 A;  2PBD A;  4XCL A;  1YC4 A;  2BYH A;  3EL2 A;  5AQG A;  4I3H A;  1P8Z A;  3FT8 A;  3CIP A;  1I5A A;  2PNR A;  1YER A;  1IJJ A;  4YKT A;  4YKY A;  1K8K A;  4CZK A;  4EFT A;  2OAN A;  4XD8 A;  5M4E A;  4U7N A;  5M4P A;  3WEE A;  2YKB A;  1E4F T;  4RTF D;  1QQN A;  3O2F A;  3MN5 A;  2QF6 A;  2GQP A;  3U9D A;  4DZY A;  5FPD A;  1AM1 A;  4XIP A;  1UYD A;  1YES A;  3KVG A;  3O0I A;  4XIT A;  1C0G A;  3R91 A;  4O0B A;  4I5S A;  3GIE A;  1S16 A;  4CZG A; 
#chains in the Genus database with same CATH homology
 4E72 A;  5JEN A;  3S5T A;  2HHI A;  3CYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...