5D6QA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a ligand
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
192
structure length
192
Chain Sequence
AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Azaindole Ureas as a Novel Class of Bacterial Gyrase B Inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 63
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5d6qA00
2ZKJA 1UYCA 2CCUA 2YKBA 3TUHA 1UY8A 4MB9A 3OPDA 2CH4A 4GQTA 4JAUA 3OWDA 3U2DA 4P8OA 3O0IA 1A4HA 1QYEA 3GIGB 3CGYA 2YEEA 2WEPA 2YE9A 2CCSA 2VW5A 5FNFA 2YE4A 1BKNA 2O1WA 4BQGA 2BU6A 1UYLA 5FNDA 2GFDA 5J71A 1TH8A 2ZDXA 4UROA 1S16A 5IDMA 2BYIA 2GQPA 4U93A 5FWKA 2XHRA 3H80A 2BRCA 2WEQA 2YK2A 3C0EA 1UY9A 4AWQA 3D0BA 2O1VA 2ZDYA 3QDDA 4FCPA 3T2SA 4URMA 1TIDA 5GGZA 4MPCA 4PRVA 3BMYA 4LWFA 2IWSA 1EA6A 2YKJA 2YJXA 3A0TA 2IOPA 1ZXNA 4CWTA 1U2OA 3OMUA 4CE2A 3EHGA 4URNA 3EHJA 4KFGA 1UYKA 2QG0A 1YT1A 1Z5CA 1H7UA 1UYGA 3RLQA 2FWZA 3G7EA 2YI0A 4YKQA 4LWEA 2IWXA 4BAEA 3WHAA 3LPSA 2YE6A 4JQLA 4LP0A 4LWIA 3OW6A 3EKOA 1YS3A 3CWVA 4DUHA 1U0ZA 2CCTA 2XHTA 4DZYA 4R1FA 1UYHA 3LNUA 5F5RA 3TZ0A 1Y8OA 1UY7A 1QY8A 4XKKA 5IDJA 4CWNA 3D36A 1UYMA 2YECA 2UWDA 3K60A 1S14A 2Q8FA 3VHDA 4CE3A 4HYPA 5C93A 4PU9A 4XIQA 3TZ2A 4EM7A 2HG1A 3FV5A 3T1KA 5D7CA 3HEKA 1I5CA 1I59A 2WI5A 3O6OA 5CTWA 4WUDA 3TTZA 1Y4UA 2CG9A 2XJGA 4EMVA 4LWGA 3A0ZA 3MNRP 1B63A 1YC4A 4L93A 4PRXA 4YKXA 3EKRA 1I5BA 1R62A 2WI1A 1UYFA 4GFNA 3R4PA 3RLPA 4URLA 5M4NA 4YKRA 3O2FA 5CTXA 4NH7A 3IEDA 1GJVA 4H81A 4GEEA 1GKZA 4O0BA 2Q8GA 4ASFA 2XJJA 4KSGA 2IOQA 3KE6A 1BGQA 4R3MA 3BM9A 4HY1A 4HXZA 4E00A 5CF0A 3G7BA 3HYYA 2BSMA 2FWYA 4ZKIA 4EFTA 4XKAA 4B7PA 4L8ZA 2C2AA 4XD8A 4AS9A 2PNRA 2QFOA 3INXA 3T0ZA 4U7NA 3B27A 3D2RA 3PEJA 2BU2A 3EHHA 1I5DA 2EXLA 1UYEA 2YEIA 4NH9A 4O07A 3K98A 1TC6A 4XKOA 3K97A 3R92A 2BU5A 4V26A 2WERA 1YC1A 4MPEA 4EGIA 4HZ5A 4HYMA 2YGAA 1MU5A 2WI2A 4FCRA 4HZ0A 2HCHA 2CGFA 1QZRA 2BTZA 2BU8A 1US7A 3H4LA 4ASBA 2Q8IA 3U2KA 5CTYA 4XIRA 2VWCA 4O09A 1AH6A 4WUCA 4R3AA 2YGEA 4O04A 2XDKA 4CWFA 4XE2A 2XX5A 4EGKA 1YERA 2YE2A 3GIEA 2HKJA 3R4MA 3QTFA 1ZXMA 4XIPA 3TZ5A 5M4PA 2FXSA 2YEBA 4K4OA 4MP2A 3C11A 3A0WA 1AJ6A 3VHAA 4XDMA 4X9LA 3DGEA 4ASGA 4EGHA 4FMTA 2VCIA 2XDSA 2IORA 3ZXOA 1NHIA 4PL9A 1Z5BA 2XHXA 4QPKA 2BT0A 1Y4SA 3ZKDA 2YEFA 5M4HA 1AMWA 3HZ5A 2QF6A 4H85A 1ID0A 2H55A 5IN9A 3VADA 3T10A 5D7DA 2YKIA 2Q8HA 1NHJA 2XX4A 1I58A 4YKTA 4LPBA 5L3JA 4HXWA 1YESA 4FPPA 2XK2A 4KTNA 2XCMA 2XDXA 5CPHA 1I5AA 1L0OA 1YT2A 2YI7A 3B25A 4CWOA 2VCJA 1Y8PA 4WUBA 4KP4A 4XCLA 3T0HA 4GGLA 2BREA 3GIFA 2YKCA 5F3KA 2YE3A 5BODA 1BYQA 5M4KA 3EHFA 4NH8A 3TZ4A 4XTJA 4CWPA 3PEHA 4W7TA 4B6CA 3FT5A 2WI7A 4EFUA 4JAVA 3OWBA 3RKZA 2XDLA 1UYDA 3U67A 2XABA 3A0XA 3R91A 2WI3A 1THNA 1GKXA 1AH8A 3WQ9A 1Z59A 2WI4A 3R4NA 2WI6A 4Q20A 5BOCA 2YE8A 1KIJA 3ZM7A 4GT8A 1NHHA 1YT0A 4V25A 3HZ1A 4AWPA 4ASAA 2YE5A 3Q5KA 1UYIA 4CWRA 4I3HA 2ESAA 1JM6A 2YEGA 4L91A 3A0RA 4XCJA 2AKPA 5D6QA 2XD6A 4MPNA 1BXDA 2H8MA 2YEDA 5M4MA 2XJXA 2FYPA 3K99A 5FNCA 5CTUA 1KZNA 3HHUA 4E02A 1B3QA 4CWSA 4FCQA 3SL2A 4BIZA 2JKIA 2YKEA 2IWUA 2BU7A 4U7OA 1PVGA 1B62A 1TILA 4I5SA 2BZ5A 4L90A 2QG2A 2YI5A 4P7AA 4BIUA 3ZXQA 2BYHA 4GCZA 3NMQA 4HY6A 3G75A 3VHCA 4JASA 4LWHA 2YGFA 4MBCA 2XDUA 4QPJA 3A0YA 1YSZA 1Y8NA 3R4OA 5D7RA 1ZWHA 1YSRA 3GIGA 5D6PA 3CRKA 4XC0A 4ZVIA 2YI6A 4AWOA 3B26A 3ZKBA 4BXIA 4CWQA 1Z5AA 3Q5LA 4E01A 4O05A 2O1UA 3B24A 2YK9A 4CE1A 1YETA 2Q2EB 1AM1A 4XITA 1YC3A 3HYZA 4YKUA 2YEAA 3B28A 4MOTA 4MP7A 1EI1A 3CGZA 1UY6A 5M4EA 3JZ3A 1MX0A 4H7QA 1H7SA 4L94A 4BQJA 3CRLA 2XX2A 2JJCA 2K5BA 3RLRA 2YE7A 4YKWA 5J6AA 2ZBKB 2YJWA 3FT8A 2YEJA 4YKYA 1TBWA 3Q5JA 4KSHA 4EEHA 1TC0A 4YKZA 2YEHA 1OSFA 1ZW9A 2E0AA 4KQVA 3INWA
chains in the Genus database with same CATH superfamily
2ZKJA 1UYCA 2CCUA 2YKBA 3TUHA 1UY8A 4MB9A 3OPDA 2CH4A 4GQTA 4JAUA 3OWDA 3U2DA 4P8OA 3O0IA 1A4HA 1QYEA 3GIGB 3CGYA 2YEEA 2WEPA 2YE9A 2CCSA 2VW5A 5FNFA 2YE4A 1BKNA 2O1WA 4BQGA 2BU6A 1UYLA 5FNDA 2GFDA 5J71A 1TH8A 2ZDXA 4UROA 1S16A 5IDMA 2BYIA 3LMMA 2GQPA 4U93A 5FWKA 2XHRA 3H80A 2BRCA 2WEQA 2YK2A 3C0EA 1UY9A 4AWQA 3D0BA 2O1VA 2ZDYA 3QDDA 4FCPA 3T2SA 4URMA 1TIDA 5GGZA 4MPCA 4PRVA 3BMYA 4LWFA 2IWSA 1EA6A 2YKJA 2YJXA 3A0TA 2IOPA 1ZXNA 4CWTA 1U2OA 3OMUA 4CE2A 3EHGA 2FTKA 4URNA 3EHJA 4KFGA 1UYKA 2QG0A 1YT1A 1Z5CA 1H7UA 1UYGA 3RLQA 2FWZA 3G7EA 2YI0A 4YKQA 4LWEA 2IWXA 4BAEA 3WHAA 3LPSA 2YE6A 4JQLA 4LP0A 4LWIA 3OW6A 4E72A 3EKOA 1YS3A 3CWVA 4DUHA 1U0ZA 2CCTA 2XHTA 4DZYA 4R1FA 1UYHA 3LNUA 5F5RA 3TZ0A 1Y8OA 1UY7A 1QY8A 4XKKA 5IDJA 4CWNA 3D36A 1UYMA 2YECA 2UWDA 3K60A 1S14A 2Q8FA 3VHDA 4CE3A 4HYPA 5C93A 4PU9A 4XIQA 3TZ2A 4EM7A 2HG1A 3FV5A 3T1KA 5D7CA 3HEKA 1I5CA 1I59A 2WI5A 3O6OA 5CTWA 4WUDA 3TTZA 1Y4UA 2CG9A 2XJGA 4EMVA 4LWGA 3A0ZA 3MNRP 1B63A 1YC4A 4L93A 4PRXA 4YKXA 3EKRA 1I5BA 1R62A 2WI1A 1UYFA 1IXMA 4GFNA 3R4PA 3RLPA 4URLA 5M4NA 4YKRA 3O2FA 5CTXA 4NH7A 3IEDA 1GJVA 4H81A 4GEEA 1GKZA 4O0BA 2Q8GA 4ASFA 2XJJA 4KSGA 2IOQA 3KE6A 1BGQA 4R3MA 3BM9A 4HY1A 4HXZA 4E00A 5CF0A 5JENA 3G7BA 3HYYA 2BSMA 2FWYA 3S5TA 4ZKIA 4EFTA 4XKAA 4B7PA 4L8ZA 2C2AA 4XD8A 4AS9A 2PNRA 2QFOA 3INXA 3T0ZA 4U7NA 3B27A 3D2RA 3PEJA 2BU2A 3EHHA 1I5DA 2EXLA 1UYEA 2YEIA 4NH9A 4O07A 3K98A 1TC6A 4XKOA 3K97A 3R92A 2BU5A 4V26A 2WERA 1YC1A 4MPEA 4EGIA 4HZ5A 4HYMA 2YGAA 1MU5A 2WI2A 4FCRA 4HZ0A 2HCHA 2CGFA 1QZRA 2BTZA 2BU8A 2C1GA 1US7A 3H4LA 4ASBA 2Q8IA 3U2KA 5CTYA 4XIRA 2VWCA 4O09A 1AH6A 4WUCA 4R3AA 2YGEA 4O04A 2XDKA 4CWFA 4XE2A 2XX5A 4EGKA 1YERA 2YE2A 3GIEA 2HKJA 3R4MA 3QTFA 1ZXMA 4XIPA 3TZ5A 5M4PA 2FXSA 2YEBA 4K4OA 4MP2A 3C11A 3A0WA 1AJ6A 3VHAA 4XDMA 4X9LA 3DGEA 4ASGA 4EGHA 4FMTA 2VCIA 2XDSA 2IORA 3ZXOA 1NHIA 4PL9A 1Z5BA 2XHXA 4QPKA 2BT0A 1Y4SA 3ZKDA 2YEFA 5M4HA 1AMWA 3HZ5A 2QF6A 4H85A 1ID0A 2H55A 5IN9A 3VADA 3T10A 5D7DA 2YKIA 2Q8HA 1NHJA 2XX4A 1I58A 4YKTA 4LPBA 5L3JA 4HXWA 1YESA 4FPPA 2XK2A 4KTNA 2XCMA 2XDXA 5CPHA 1I5AA 1L0OA 1YT2A 2YI7A 3B25A 4CWOA 2VCJA 1Y8PA 4WUBA 4KP4A 3CYGA 4XCLA 3T0HA 4GGLA 2BREA 3GIFA 2YKCA 5F3KA 2YE3A 5BODA 1BYQA 5M4KA 3EHFA 4NH8A 3TZ4A 4XTJA 4CWPA 3PEHA 4W7TA 4B6CA 3FT5A 2WI7A 4EFUA 4JAVA 3OWBA 3RKZA 2XDLA 1UYDA 3U67A 2XABA 3A0XA 3R91A 2WI3A 1THNA 1GKXA 1AH8A 3WQ9A 1Z59A 2WI4A 3R4NA 2WI6A 4Q20A 5BOCA 2YE8A 1KIJA 3ZM7A 4GT8A 1NHHA 1YT0A 4V25A 3HZ1A 4AWPA 4ASAA 2YE5A 2HHIA 3Q5KA 1UYIA 4CWRA 4I3HA 2ESAA 1JM6A 2YEGA 4L91A 3A0RA 4XCJA 2AKPA 5D6QA 2XD6A 4MPNA 1BXDA 2H8MA 2YEDA 5M4MA 2XJXA 2FYPA 3K99A 5FNCA 5CTUA 1KZNA 3HHUA 4E02A 1B3QA 4CWSA 4FCQA 3SL2A 4BIZA 2JKIA 2YKEA 2IWUA 2BU7A 4U7OA 1PVGA 1B62A 1TILA 4I5SA 2BZ5A 4L90A 2QG2A 2YI5A 4P7AA 4BIUA 3ZXQA 2BYHA 4GCZA 3NMQA 4HY6A 3G75A 3VHCA 4JASA 4LWHA 2YGFA 4MBCA 2XDUA 4QPJA 3A0YA 1YSZA 1Y8NA 3R4OA 5D7RA 1ZWHA 1YSRA 3GIGA 5D6PA 3CRKA 4XC0A 4ZVIA 2YI6A 4AWOA 3B26A 3ZKBA 4BXIA 4CWQA 1Z5AA 3Q5LA 4E01A 4O05A 2O1UA 3B24A 2YK9A 4CE1A 1YETA 2Q2EB 1AM1A 4XITA 1YC3A 3HYZA 4YKUA 2YEAA 3B28A 4MOTA 4MP7A 1EI1A 3CGZA 1UY6A 5M4EA 3JZ3A 1MX0A 4H7QA 1H7SA 4L94A 4BQJA 3CRLA 2XX2A 2JJCA 2K5BA 3RLRA 2YE7A 4YKWA 5J6AA 2ZBKB 2YJWA 3FT8A 2YEJA 4YKYA 1TBWA 1F51A 3Q5JA 4KSHA 4EEHA 2C1IA 1TC0A 4YKZA 2YEHA 1OSFA 1ZW9A 2E0AA 4KQVA 3INWA
chains in the Genus database with same CATH topology
2ZKJA 1UYCA 2CCUA 2YKBA 3TUHA 1UY8A 4MB9A 3OPDA 2CH4A 4GQTA 4JAUA 3OWDA 3U2DA 4P8OA 3O0IA 1A4HA 1QYEA 3GIGB 3CGYA 2YEEA 2WEPA 2YE9A 2CCSA 2VW5A 5FNFA 2YE4A 1BKNA 2O1WA 4BQGA 2BU6A 1UYLA 5FNDA 2GFDA 5J71A 1TH8A 2ZDXA 4UROA 1S16A 5IDMA 2BYIA 2GQPA 4U93A 5FWKA 2XHRA 3H80A 2BRCA 2WEQA 2YK2A 3C0EA 1UY9A 4AWQA 3D0BA 2O1VA 2ZDYA 3QDDA 4FCPA 3T2SA 4URMA 1TIDA 5GGZA 4MPCA 4PRVA 3BMYA 4LWFA 2IWSA 1EA6A 2YKJA 2YJXA 3A0TA 2IOPA 1ZXNA 4CWTA 1U2OA 3OMUA 4CE2A 3EHGA 4URNA 3EHJA 4KFGA 1UYKA 2QG0A 1YT1A 1Z5CA 1H7UA 1UYGA 3RLQA 2FWZA 3G7EA 2YI0A 4YKQA 4LWEA 2IWXA 4BAEA 3WHAA 3LPSA 2YE6A 4JQLA 4LP0A 4LWIA 3OW6A 3EKOA 1YS3A 3CWVA 4DUHA 1U0ZA 2CCTA 2XHTA 4DZYA 4R1FA 1UYHA 3LNUA 5F5RA 3TZ0A 1Y8OA 1UY7A 1QY8A 4XKKA 5IDJA 4CWNA 3D36A 1UYMA 2YECA 2UWDA 3K60A 1S14A 2Q8FA 3VHDA 4CE3A 4HYPA 5C93A 4PU9A 4XIQA 3TZ2A 4EM7A 2HG1A 3FV5A 3T1KA 5D7CA 3HEKA 1I5CA 1I59A 2WI5A 3O6OA 5CTWA 4WUDA 3TTZA 1Y4UA 2CG9A 2XJGA 4EMVA 4LWGA 3A0ZA 3MNRP 1B63A 1YC4A 4L93A 4PRXA 4YKXA 3EKRA 1I5BA 1R62A 2WI1A 1UYFA 4GFNA 3R4PA 3RLPA 4URLA 5M4NA 4YKRA 3O2FA 5CTXA 4NH7A 3IEDA 1GJVA 4H81A 4GEEA 1GKZA 4O0BA 2Q8GA 4ASFA 2XJJA 4KSGA 2IOQA 3KE6A 1BGQA 4R3MA 3BM9A 4HY1A 4HXZA 4E00A 5CF0A 3G7BA 3HYYA 2BSMA 2FWYA 4ZKIA 4EFTA 4XKAA 4B7PA 4L8ZA 2C2AA 4XD8A 4AS9A 2PNRA 2QFOA 3INXA 3T0ZA 4U7NA 3B27A 3D2RA 3PEJA 2BU2A 3EHHA 1I5DA 2EXLA 1UYEA 2YEIA 4NH9A 4O07A 3K98A 1TC6A 4XKOA 3K97A 3R92A 2BU5A 4V26A 2WERA 1YC1A 4MPEA 4EGIA 4HZ5A 4HYMA 2YGAA 1MU5A 2WI2A 4FCRA 4HZ0A 2HCHA 2CGFA 1QZRA 2BTZA 2BU8A 1US7A 3H4LA 4ASBA 2Q8IA 3U2KA 5CTYA 4XIRA 2VWCA 4O09A 1AH6A 4WUCA 4R3AA 2YGEA 4O04A 2XDKA 4CWFA 4XE2A 2XX5A 4EGKA 1YERA 2YE2A 3GIEA 2HKJA 3R4MA 3QTFA 1ZXMA 4XIPA 3TZ5A 5M4PA 2FXSA 2YEBA 4K4OA 4MP2A 3C11A 3A0WA 1AJ6A 3VHAA 4XDMA 4X9LA 3DGEA 4ASGA 4EGHA 4FMTA 2VCIA 2XDSA 2IORA 3ZXOA 1NHIA 4PL9A 1Z5BA 2XHXA 4QPKA 2BT0A 1Y4SA 3ZKDA 2YEFA 5M4HA 1AMWA 3HZ5A 2QF6A 4H85A 1ID0A 2H55A 5IN9A 3VADA 3T10A 5D7DA 2YKIA 2Q8HA 1NHJA 2XX4A 1I58A 4YKTA 4LPBA 5L3JA 4HXWA 1YESA 4FPPA 2XK2A 4KTNA 2XCMA 2XDXA 5CPHA 1I5AA 1L0OA 1YT2A 2YI7A 3B25A 4CWOA 2VCJA 1Y8PA 4WUBA 4KP4A 4XCLA 3T0HA 4GGLA 2BREA 3GIFA 2YKCA 5F3KA 2YE3A 5BODA 1BYQA 5M4KA 3EHFA 4NH8A 3TZ4A 4XTJA 4CWPA 3PEHA 4W7TA 4B6CA 3FT5A 2WI7A 4EFUA 4JAVA 3OWBA 3RKZA 2XDLA 1UYDA 3U67A 2XABA 3A0XA 3R91A 2WI3A 1THNA 1GKXA 1AH8A 3WQ9A 1Z59A 2WI4A 3R4NA 2WI6A 4Q20A 5BOCA 2YE8A 1KIJA 3ZM7A 4GT8A 1NHHA 1YT0A 4V25A 3HZ1A 4AWPA 4ASAA 2YE5A 3Q5KA 1UYIA 4CWRA 4I3HA 2ESAA 1JM6A 2YEGA 4L91A 3A0RA 4XCJA 2AKPA 5D6QA 2XD6A 4MPNA 1BXDA 2H8MA 2YEDA 5M4MA 2XJXA 2FYPA 3K99A 5FNCA 5CTUA 1KZNA 3HHUA 4E02A 1B3QA 4CWSA 4FCQA 3SL2A 4BIZA 2JKIA 2YKEA 2IWUA 2BU7A 4U7OA 1PVGA 1B62A 1TILA 4I5SA 2BZ5A 4L90A 2QG2A 2YI5A 4P7AA 4BIUA 3ZXQA 2BYHA 4GCZA 3NMQA 4HY6A 3G75A 3VHCA 4JASA 4LWHA 2YGFA 4MBCA 2XDUA 4QPJA 3A0YA 1YSZA 1Y8NA 3R4OA 5D7RA 1ZWHA 1YSRA 3GIGA 5D6PA 3CRKA 4XC0A 4ZVIA 2YI6A 4AWOA 3B26A 3ZKBA 4BXIA 4CWQA 1Z5AA 3Q5LA 4E01A 4O05A 2O1UA 3B24A 2YK9A 4CE1A 1YETA 2Q2EB 1AM1A 4XITA 1YC3A 3HYZA 4YKUA 2YEAA 3B28A 4MOTA 4MP7A 1EI1A 3CGZA 1UY6A 5M4EA 3JZ3A 1MX0A 4H7QA 1H7SA 4L94A 4BQJA 3CRLA 2XX2A 2JJCA 2K5BA 3RLRA 2YE7A 4YKWA 5J6AA 2ZBKB 2YJWA 3FT8A 2YEJA 4YKYA 1TBWA 3Q5JA 4KSHA 4EEHA 1TC0A 4YKZA 2YEHA 1OSFA 1ZW9A 2E0AA 4KQVA 3INWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZKJ A;  1UYC A;  2CCU A;  2YKB A;  3TUH A;  1UY8 A;  4MB9 A;  3OPD A;  2CH4 A;  4GQT A;  4JAU A;  3OWD A;  3U2D A;  4P8O A;  3O0I A;  1A4H A;  1QYE A;  3GIG B;  3CGY A;  2YEE A;  2WEP A;  2YE9 A;  2CCS A;  2VW5 A;  5FNF A;  2YE4 A;  1BKN A;  2O1W A;  4BQG A;  2BU6 A;  1UYL A;  5FND A;  2GFD A;  5J71 A;  1TH8 A;  2ZDX A;  4URO A;  1S16 A;  5IDM A;  2BYI A;  2GQP A;  4U93 A;  5FWK A;  2XHR A;  3H80 A;  2BRC A;  2WEQ A;  2YK2 A;  3C0E A;  1UY9 A;  4AWQ A;  3D0B A;  2O1V A;  2ZDY A;  3QDD A;  4FCP A;  3T2S A;  4URM A;  1TID A;  5GGZ A;  4MPC A;  4PRV A;  3BMY A;  4LWF A;  2IWS A;  1EA6 A;  2YKJ A;  2YJX A;  3A0T A;  2IOP A;  1ZXN A;  4CWT A;  1U2O A;  3OMU A;  4CE2 A;  3EHG A;  4URN A;  3EHJ A;  4KFG A;  1UYK A;  2QG0 A;  1YT1 A;  1Z5C A;  1H7U A;  1UYG A;  3RLQ A;  2FWZ A;  3G7E A;  2YI0 A;  4YKQ A;  4LWE A;  2IWX A;  4BAE A;  3WHA A;  3LPS A;  2YE6 A;  4JQL A;  4LP0 A;  4LWI A;  3OW6 A;  3EKO A;  1YS3 A;  3CWV A;  4DUH A;  1U0Z A;  2CCT A;  2XHT A;  4DZY A;  4R1F A;  1UYH A;  3LNU A;  5F5R A;  3TZ0 A;  1Y8O A;  1UY7 A;  1QY8 A;  4XKK A;  5IDJ A;  4CWN A;  3D36 A;  1UYM A;  2YEC A;  2UWD A;  3K60 A;  1S14 A;  2Q8F A;  3VHD A;  4CE3 A;  4HYP A;  5C93 A;  4PU9 A;  4XIQ A;  3TZ2 A;  4EM7 A;  2HG1 A;  3FV5 A;  3T1K A;  5D7C A;  3HEK A;  1I5C A;  1I59 A;  2WI5 A;  3O6O A;  5CTW A;  4WUD A;  3TTZ A;  1Y4U A;  2CG9 A;  2XJG A;  4EMV A;  4LWG A;  3A0Z A;  3MNR P;  1B63 A;  1YC4 A;  4L93 A;  4PRX A;  4YKX A;  3EKR A;  1I5B A;  1R62 A;  2WI1 A;  1UYF A;  4GFN A;  3R4P A;  3RLP A;  4URL A;  5M4N A;  4YKR A;  3O2F A;  5CTX A;  4NH7 A;  3IED A;  1GJV A;  4H81 A;  4GEE A;  1GKZ A;  4O0B A;  2Q8G A;  4ASF A;  2XJJ A;  4KSG A;  2IOQ A;  3KE6 A;  1BGQ A;  4R3M A;  3BM9 A;  4HY1 A;  4HXZ A;  4E00 A;  5CF0 A;  3G7B A;  3HYY A;  2BSM A;  2FWY A;  4ZKI A;  4EFT A;  4XKA A;  4B7P A;  4L8Z A;  2C2A A;  4XD8 A;  4AS9 A;  2PNR A;  2QFO A;  3INX A;  3T0Z A;  4U7N A;  3B27 A;  3D2R A;  3PEJ A;  2BU2 A;  3EHH A;  1I5D A;  2EXL A;  1UYE A;  2YEI A;  4NH9 A;  4O07 A;  3K98 A;  1TC6 A;  4XKO A;  3K97 A;  3R92 A;  2BU5 A;  4V26 A;  2WER A;  1YC1 A;  4MPE A;  4EGI A;  4HZ5 A;  4HYM A;  2YGA A;  1MU5 A;  2WI2 A;  4FCR A;  4HZ0 A;  2HCH A;  2CGF A;  1QZR A;  2BTZ A;  2BU8 A;  1US7 A;  3H4L A;  4ASB A;  2Q8I A;  3U2K A;  5CTY A;  4XIR A;  2VWC A;  4O09 A;  1AH6 A;  4WUC A;  4R3A A;  2YGE A;  4O04 A;  2XDK A;  4CWF A;  4XE2 A;  2XX5 A;  4EGK A;  1YER A;  2YE2 A;  3GIE A;  2HKJ A;  3R4M A;  3QTF A;  1ZXM A;  4XIP A;  3TZ5 A;  5M4P A;  2FXS A;  2YEB A;  4K4O A;  4MP2 A;  3C11 A;  3A0W A;  1AJ6 A;  3VHA A;  4XDM A;  4X9L A;  3DGE A;  4ASG A;  4EGH A;  4FMT A;  2VCI A;  2XDS A;  2IOR A;  3ZXO A;  1NHI A;  4PL9 A;  1Z5B A;  2XHX A;  4QPK A;  2BT0 A;  1Y4S A;  3ZKD A;  2YEF A;  5M4H A;  1AMW A;  3HZ5 A;  2QF6 A;  4H85 A;  1ID0 A;  2H55 A;  5IN9 A;  3VAD A;  3T10 A;  5D7D A;  2YKI A;  2Q8H A;  1NHJ A;  2XX4 A;  1I58 A;  4YKT A;  4LPB A;  5L3J A;  4HXW A;  1YES A;  4FPP A;  2XK2 A;  4KTN A;  2XCM A;  2XDX A;  5CPH A;  1I5A A;  1L0O A;  1YT2 A;  2YI7 A;  3B25 A;  4CWO A;  2VCJ A;  1Y8P A;  4WUB A;  4KP4 A;  4XCL A;  3T0H A;  4GGL A;  2BRE A;  3GIF A;  2YKC A;  5F3K A;  2YE3 A;  5BOD A;  1BYQ A;  5M4K A;  3EHF A;  4NH8 A;  3TZ4 A;  4XTJ A;  4CWP A;  3PEH A;  4W7T A;  4B6C A;  3FT5 A;  2WI7 A;  4EFU A;  4JAV A;  3OWB A;  3RKZ A;  2XDL A;  1UYD A;  3U67 A;  2XAB A;  3A0X A;  3R91 A;  2WI3 A;  1THN A;  1GKX A;  1AH8 A;  3WQ9 A;  1Z59 A;  2WI4 A;  3R4N A;  2WI6 A;  4Q20 A;  5BOC A;  2YE8 A;  1KIJ A;  3ZM7 A;  4GT8 A;  1NHH A;  1YT0 A;  4V25 A;  3HZ1 A;  4AWP A;  4ASA A;  2YE5 A;  3Q5K A;  1UYI A;  4CWR A;  4I3H A;  2ESA A;  1JM6 A;  2YEG A;  4L91 A;  3A0R A;  4XCJ A;  2AKP A;  5D6Q A;  2XD6 A;  4MPN A;  1BXD A;  2H8M A;  2YED A;  5M4M A;  2XJX A;  2FYP A;  3K99 A;  5FNC A;  5CTU A;  1KZN A;  3HHU A;  4E02 A;  1B3Q A;  4CWS A;  4FCQ A;  3SL2 A;  4BIZ A;  2JKI A;  2YKE A;  2IWU A;  2BU7 A;  4U7O A;  1PVG A;  1B62 A;  1TIL A;  4I5S A;  2BZ5 A;  4L90 A;  2QG2 A;  2YI5 A;  4P7A A;  4BIU A;  3ZXQ A;  2BYH A;  4GCZ A;  3NMQ A;  4HY6 A;  3G75 A;  3VHC A;  4JAS A;  4LWH A;  2YGF A;  4MBC A;  2XDU A;  4QPJ A;  3A0Y A;  1YSZ A;  1Y8N A;  3R4O A;  5D7R A;  1ZWH A;  1YSR A;  3GIG A;  5D6P A;  3CRK A;  4XC0 A;  4ZVI A;  2YI6 A;  4AWO A;  3B26 A;  3ZKB A;  4BXI A;  4CWQ A;  1Z5A A;  3Q5L A;  4E01 A;  4O05 A;  2O1U A;  3B24 A;  2YK9 A;  4CE1 A;  1YET A;  2Q2E B;  1AM1 A;  4XIT A;  1YC3 A;  3HYZ A;  4YKU A;  2YEA A;  3B28 A;  4MOT A;  4MP7 A;  1EI1 A;  3CGZ A;  1UY6 A;  5M4E A;  3JZ3 A;  1MX0 A;  4H7Q A;  1H7S A;  4L94 A;  4BQJ A;  3CRL A;  2XX2 A;  2JJC A;  2K5B A;  3RLR A;  2YE7 A;  4YKW A;  5J6A A;  2ZBK B;  2YJW A;  3FT8 A;  2YEJ A;  4YKY A;  1TBW A;  3Q5J A;  4KSH A;  4EEH A;  1TC0 A;  4YKZ A;  2YEH A;  1OSF A;  1ZW9 A;  2E0A A;  4KQV A;  3INW A; 
#chains in the Genus database with same CATH topology
 2ZKJ A;  1UYC A;  2CCU A;  2YKB A;  3TUH A;  1UY8 A;  4MB9 A;  3OPD A;  2CH4 A;  4GQT A;  4JAU A;  3OWD A;  3U2D A;  4P8O A;  3O0I A;  1A4H A;  1QYE A;  3GIG B;  3CGY A;  2YEE A;  2WEP A;  2YE9 A;  2CCS A;  2VW5 A;  5FNF A;  2YE4 A;  1BKN A;  2O1W A;  4BQG A;  2BU6 A;  1UYL A;  5FND A;  2GFD A;  5J71 A;  1TH8 A;  2ZDX A;  4URO A;  1S16 A;  5IDM A;  2BYI A;  3LMM A;  2GQP A;  4U93 A;  5FWK A;  2XHR A;  3H80 A;  2BRC A;  2WEQ A;  2YK2 A;  3C0E A;  1UY9 A;  4AWQ A;  3D0B A;  2O1V A;  2ZDY A;  3QDD A;  4FCP A;  3T2S A;  4URM A;  1TID A;  5GGZ A;  4MPC A;  4PRV A;  3BMY A;  4LWF A;  2IWS A;  1EA6 A;  2YKJ A;  2YJX A;  3A0T A;  2IOP A;  1ZXN A;  4CWT A;  1U2O A;  3OMU A;  4CE2 A;  3EHG A;  2FTK A;  4URN A;  3EHJ A;  4KFG A;  1UYK A;  2QG0 A;  1YT1 A;  1Z5C A;  1H7U A;  1UYG A;  3RLQ A;  2FWZ A;  3G7E A;  2YI0 A;  4YKQ A;  4LWE A;  2IWX A;  4BAE A;  3WHA A;  3LPS A;  2YE6 A;  4JQL A;  4LP0 A;  4LWI A;  3OW6 A;  4E72 A;  3EKO A;  1YS3 A;  3CWV A;  4DUH A;  1U0Z A;  2CCT A;  2XHT A;  4DZY A;  4R1F A;  1UYH A;  3LNU A;  5F5R A;  3TZ0 A;  1Y8O A;  1UY7 A;  1QY8 A;  4XKK A;  5IDJ A;  4CWN A;  3D36 A;  1UYM A;  2YEC A;  2UWD A;  3K60 A;  1S14 A;  2Q8F A;  3VHD A;  4CE3 A;  4HYP A;  5C93 A;  4PU9 A;  4XIQ A;  3TZ2 A;  4EM7 A;  2HG1 A;  3FV5 A;  3T1K A;  5D7C A;  3HEK A;  1I5C A;  1I59 A;  2WI5 A;  3O6O A;  5CTW A;  4WUD A;  3TTZ A;  1Y4U A;  2CG9 A;  2XJG A;  4EMV A;  4LWG A;  3A0Z A;  3MNR P;  1B63 A;  1YC4 A;  4L93 A;  4PRX A;  4YKX A;  3EKR A;  1I5B A;  1R62 A;  2WI1 A;  1UYF A;  1IXM A;  4GFN A;  3R4P A;  3RLP A;  4URL A;  5M4N A;  4YKR A;  3O2F A;  5CTX A;  4NH7 A;  3IED A;  1GJV A;  4H81 A;  4GEE A;  1GKZ A;  4O0B A;  2Q8G A;  4ASF A;  2XJJ A;  4KSG A;  2IOQ A;  3KE6 A;  1BGQ A;  4R3M A;  3BM9 A;  4HY1 A;  4HXZ A;  4E00 A;  5CF0 A;  5JEN A;  3G7B A;  3HYY A;  2BSM A;  2FWY A;  3S5T A;  4ZKI A;  4EFT A;  4XKA A;  4B7P A;  4L8Z A;  2C2A A;  4XD8 A;  4AS9 A;  2PNR A;  2QFO A;  3INX A;  3T0Z A;  4U7N A;  3B27 A;  3D2R A;  3PEJ A;  2BU2 A;  3EHH A;  1I5D A;  2EXL A;  1UYE A;  2YEI A;  4NH9 A;  4O07 A;  3K98 A;  1TC6 A;  4XKO A;  3K97 A;  3R92 A;  2BU5 A;  4V26 A;  2WER A;  1YC1 A;  4MPE A;  4EGI A;  4HZ5 A;  4HYM A;  2YGA A;  1MU5 A;  2WI2 A;  4FCR A;  4HZ0 A;  2HCH A;  2CGF A;  1QZR A;  2BTZ A;  2BU8 A;  2C1G A;  1US7 A;  3H4L A;  4ASB A;  2Q8I A;  3U2K A;  5CTY A;  4XIR A;  2VWC A;  4O09 A;  1AH6 A;  4WUC A;  4R3A A;  2YGE A;  4O04 A;  2XDK A;  4CWF A;  4XE2 A;  2XX5 A;  4EGK A;  1YER A;  2YE2 A;  3GIE A;  2HKJ A;  3R4M A;  3QTF A;  1ZXM A;  4XIP A;  3TZ5 A;  5M4P A;  2FXS A;  2YEB A;  4K4O A;  4MP2 A;  3C11 A;  3A0W A;  1AJ6 A;  3VHA A;  4XDM A;  4X9L A;  3DGE A;  4ASG A;  4EGH A;  4FMT A;  2VCI A;  2XDS A;  2IOR A;  3ZXO A;  1NHI A;  4PL9 A;  1Z5B A;  2XHX A;  4QPK A;  2BT0 A;  1Y4S A;  3ZKD A;  2YEF A;  5M4H A;  1AMW A;  3HZ5 A;  2QF6 A;  4H85 A;  1ID0 A;  2H55 A;  5IN9 A;  3VAD A;  3T10 A;  5D7D A;  2YKI A;  2Q8H A;  1NHJ A;  2XX4 A;  1I58 A;  4YKT A;  4LPB A;  5L3J A;  4HXW A;  1YES A;  4FPP A;  2XK2 A;  4KTN A;  2XCM A;  2XDX A;  5CPH A;  1I5A A;  1L0O A;  1YT2 A;  2YI7 A;  3B25 A;  4CWO A;  2VCJ A;  1Y8P A;  4WUB A;  4KP4 A;  3CYG A;  4XCL A;  3T0H A;  4GGL A;  2BRE A;  3GIF A;  2YKC A;  5F3K A;  2YE3 A;  5BOD A;  1BYQ A;  5M4K A;  3EHF A;  4NH8 A;  3TZ4 A;  4XTJ A;  4CWP A;  3PEH A;  4W7T A;  4B6C A;  3FT5 A;  2WI7 A;  4EFU A;  4JAV A;  3OWB A;  3RKZ A;  2XDL A;  1UYD A;  3U67 A;  2XAB A;  3A0X A;  3R91 A;  2WI3 A;  1THN A;  1GKX A;  1AH8 A;  3WQ9 A;  1Z59 A;  2WI4 A;  3R4N A;  2WI6 A;  4Q20 A;  5BOC A;  2YE8 A;  1KIJ A;  3ZM7 A;  4GT8 A;  1NHH A;  1YT0 A;  4V25 A;  3HZ1 A;  4AWP A;  4ASA A;  2YE5 A;  2HHI A;  3Q5K A;  1UYI A;  4CWR A;  4I3H A;  2ESA A;  1JM6 A;  2YEG A;  4L91 A;  3A0R A;  4XCJ A;  2AKP A;  5D6Q A;  2XD6 A;  4MPN A;  1BXD A;  2H8M A;  2YED A;  5M4M A;  2XJX A;  2FYP A;  3K99 A;  5FNC A;  5CTU A;  1KZN A;  3HHU A;  4E02 A;  1B3Q A;  4CWS A;  4FCQ A;  3SL2 A;  4BIZ A;  2JKI A;  2YKE A;  2IWU A;  2BU7 A;  4U7O A;  1PVG A;  1B62 A;  1TIL A;  4I5S A;  2BZ5 A;  4L90 A;  2QG2 A;  2YI5 A;  4P7A A;  4BIU A;  3ZXQ A;  2BYH A;  4GCZ A;  3NMQ A;  4HY6 A;  3G75 A;  3VHC A;  4JAS A;  4LWH A;  2YGF A;  4MBC A;  2XDU A;  4QPJ A;  3A0Y A;  1YSZ A;  1Y8N A;  3R4O A;  5D7R A;  1ZWH A;  1YSR A;  3GIG A;  5D6P A;  3CRK A;  4XC0 A;  4ZVI A;  2YI6 A;  4AWO A;  3B26 A;  3ZKB A;  4BXI A;  4CWQ A;  1Z5A A;  3Q5L A;  4E01 A;  4O05 A;  2O1U A;  3B24 A;  2YK9 A;  4CE1 A;  1YET A;  2Q2E B;  1AM1 A;  4XIT A;  1YC3 A;  3HYZ A;  4YKU A;  2YEA A;  3B28 A;  4MOT A;  4MP7 A;  1EI1 A;  3CGZ A;  1UY6 A;  5M4E A;  3JZ3 A;  1MX0 A;  4H7Q A;  1H7S A;  4L94 A;  4BQJ A;  3CRL A;  2XX2 A;  2JJC A;  2K5B A;  3RLR A;  2YE7 A;  4YKW A;  5J6A A;  2ZBK B;  2YJW A;  3FT8 A;  2YEJ A;  4YKY A;  1TBW A;  1F51 A;  3Q5J A;  4KSH A;  4EEH A;  2C1I A;  1TC0 A;  4YKZ A;  2YEH A;  1OSF A;  1ZW9 A;  2E0A A;  4KQV A;  3INW A; 
#chains in the Genus database with same CATH homology
 2ZKJ A;  1UYC A;  2CCU A;  2YKB A;  3TUH A;  1UY8 A;  4MB9 A;  3OPD A;  2CH4 A;  4GQT A;  4JAU A;  3OWD A;  3U2D A;  4P8O A;  3O0I A;  1A4H A;  1QYE A;  3GIG B;  3CGY A;  2YEE A;  2WEP A;  2YE9 A;  2CCS A;  2VW5 A;  5FNF A;  2YE4 A;  1BKN A;  2O1W A;  4BQG A;  2BU6 A;  1UYL A;  5FND A;  2GFD A;  5J71 A;  1TH8 A;  2ZDX A;  4URO A;  1S16 A;  5IDM A;  2BYI A;  2GQP A;  4U93 A;  5FWK A;  2XHR A;  3H80 A;  2BRC A;  2WEQ A;  2YK2 A;  3C0E A;  1UY9 A;  4AWQ A;  3D0B A;  2O1V A;  2ZDY A;  3QDD A;  4FCP A;  3T2S A;  4URM A;  1TID A;  5GGZ A;  4MPC A;  4PRV A;  3BMY A;  4LWF A;  2IWS A;  1EA6 A;  2YKJ A;  2YJX A;  3A0T A;  2IOP A;  1ZXN A;  4CWT A;  1U2O A;  3OMU A;  4CE2 A;  3EHG A;  4URN A;  3EHJ A;  4KFG A;  1UYK A;  2QG0 A;  1YT1 A;  1Z5C A;  1H7U A;  1UYG A;  3RLQ A;  2FWZ A;  3G7E A;  2YI0 A;  4YKQ A;  4LWE A;  2IWX A;  4BAE A;  3WHA A;  3LPS A;  2YE6 A;  4JQL A;  4LP0 A;  4LWI A;  3OW6 A;  3EKO A;  1YS3 A;  3CWV A;  4DUH A;  1U0Z A;  2CCT A;  2XHT A;  4DZY A;  4R1F A;  1UYH A;  3LNU A;  5F5R A;  3TZ0 A;  1Y8O A;  1UY7 A;  1QY8 A;  4XKK A;  5IDJ A;  4CWN A;  3D36 A;  1UYM A;  2YEC A;  2UWD A;  3K60 A;  1S14 A;  2Q8F A;  3VHD A;  4CE3 A;  4HYP A;  5C93 A;  4PU9 A;  4XIQ A;  3TZ2 A;  4EM7 A;  2HG1 A;  3FV5 A;  3T1K A;  5D7C A;  3HEK A;  1I5C A;  1I59 A;  2WI5 A;  3O6O A;  5CTW A;  4WUD A;  3TTZ A;  1Y4U A;  2CG9 A;  2XJG A;  4EMV A;  4LWG A;  3A0Z A;  3MNR P;  1B63 A;  1YC4 A;  4L93 A;  4PRX A;  4YKX A;  3EKR A;  1I5B A;  1R62 A;  2WI1 A;  1UYF A;  4GFN A;  3R4P A;  3RLP A;  4URL A;  5M4N A;  4YKR A;  3O2F A;  5CTX A;  4NH7 A;  3IED A;  1GJV A;  4H81 A;  4GEE A;  1GKZ A;  4O0B A;  2Q8G A;  4ASF A;  2XJJ A;  4KSG A;  2IOQ A;  3KE6 A;  1BGQ A;  4R3M A;  3BM9 A;  4HY1 A;  4HXZ A;  4E00 A;  5CF0 A;  3G7B A;  3HYY A;  2BSM A;  2FWY A;  4ZKI A;  4EFT A;  4XKA A;  4B7P A;  4L8Z A;  2C2A A;  4XD8 A;  4AS9 A;  2PNR A;  2QFO A;  3INX A;  3T0Z A;  4U7N A;  3B27 A;  3D2R A;  3PEJ A;  2BU2 A;  3EHH A;  1I5D A;  2EXL A;  1UYE A;  2YEI A;  4NH9 A;  4O07 A;  3K98 A;  1TC6 A;  4XKO A;  3K97 A;  3R92 A;  2BU5 A;  4V26 A;  2WER A;  1YC1 A;  4MPE A;  4EGI A;  4HZ5 A;  4HYM A;  2YGA A;  1MU5 A;  2WI2 A;  4FCR A;  4HZ0 A;  2HCH A;  2CGF A;  1QZR A;  2BTZ A;  2BU8 A;  1US7 A;  3H4L A;  4ASB A;  2Q8I A;  3U2K A;  5CTY A;  4XIR A;  2VWC A;  4O09 A;  1AH6 A;  4WUC A;  4R3A A;  2YGE A;  4O04 A;  2XDK A;  4CWF A;  4XE2 A;  2XX5 A;  4EGK A;  1YER A;  2YE2 A;  3GIE A;  2HKJ A;  3R4M A;  3QTF A;  1ZXM A;  4XIP A;  3TZ5 A;  5M4P A;  2FXS A;  2YEB A;  4K4O A;  4MP2 A;  3C11 A;  3A0W A;  1AJ6 A;  3VHA A;  4XDM A;  4X9L A;  3DGE A;  4ASG A;  4EGH A;  4FMT A;  2VCI A;  2XDS A;  2IOR A;  3ZXO A;  1NHI A;  4PL9 A;  1Z5B A;  2XHX A;  4QPK A;  2BT0 A;  1Y4S A;  3ZKD A;  2YEF A;  5M4H A;  1AMW A;  3HZ5 A;  2QF6 A;  4H85 A;  1ID0 A;  2H55 A;  5IN9 A;  3VAD A;  3T10 A;  5D7D A;  2YKI A;  2Q8H A;  1NHJ A;  2XX4 A;  1I58 A;  4YKT A;  4LPB A;  5L3J A;  4HXW A;  1YES A;  4FPP A;  2XK2 A;  4KTN A;  2XCM A;  2XDX A;  5CPH A;  1I5A A;  1L0O A;  1YT2 A;  2YI7 A;  3B25 A;  4CWO A;  2VCJ A;  1Y8P A;  4WUB A;  4KP4 A;  4XCL A;  3T0H A;  4GGL A;  2BRE A;  3GIF A;  2YKC A;  5F3K A;  2YE3 A;  5BOD A;  1BYQ A;  5M4K A;  3EHF A;  4NH8 A;  3TZ4 A;  4XTJ A;  4CWP A;  3PEH A;  4W7T A;  4B6C A;  3FT5 A;  2WI7 A;  4EFU A;  4JAV A;  3OWB A;  3RKZ A;  2XDL A;  1UYD A;  3U67 A;  2XAB A;  3A0X A;  3R91 A;  2WI3 A;  1THN A;  1GKX A;  1AH8 A;  3WQ9 A;  1Z59 A;  2WI4 A;  3R4N A;  2WI6 A;  4Q20 A;  5BOC A;  2YE8 A;  1KIJ A;  3ZM7 A;  4GT8 A;  1NHH A;  1YT0 A;  4V25 A;  3HZ1 A;  4AWP A;  4ASA A;  2YE5 A;  3Q5K A;  1UYI A;  4CWR A;  4I3H A;  2ESA A;  1JM6 A;  2YEG A;  4L91 A;  3A0R A;  4XCJ A;  2AKP A;  5D6Q A;  2XD6 A;  4MPN A;  1BXD A;  2H8M A;  2YED A;  5M4M A;  2XJX A;  2FYP A;  3K99 A;  5FNC A;  5CTU A;  1KZN A;  3HHU A;  4E02 A;  1B3Q A;  4CWS A;  4FCQ A;  3SL2 A;  4BIZ A;  2JKI A;  2YKE A;  2IWU A;  2BU7 A;  4U7O A;  1PVG A;  1B62 A;  1TIL A;  4I5S A;  2BZ5 A;  4L90 A;  2QG2 A;  2YI5 A;  4P7A A;  4BIU A;  3ZXQ A;  2BYH A;  4GCZ A;  3NMQ A;  4HY6 A;  3G75 A;  3VHC A;  4JAS A;  4LWH A;  2YGF A;  4MBC A;  2XDU A;  4QPJ A;  3A0Y A;  1YSZ A;  1Y8N A;  3R4O A;  5D7R A;  1ZWH A;  1YSR A;  3GIG A;  5D6P A;  3CRK A;  4XC0 A;  4ZVI A;  2YI6 A;  4AWO A;  3B26 A;  3ZKB A;  4BXI A;  4CWQ A;  1Z5A A;  3Q5L A;  4E01 A;  4O05 A;  2O1U A;  3B24 A;  2YK9 A;  4CE1 A;  1YET A;  2Q2E B;  1AM1 A;  4XIT A;  1YC3 A;  3HYZ A;  4YKU A;  2YEA A;  3B28 A;  4MOT A;  4MP7 A;  1EI1 A;  3CGZ A;  1UY6 A;  5M4E A;  3JZ3 A;  1MX0 A;  4H7Q A;  1H7S A;  4L94 A;  4BQJ A;  3CRL A;  2XX2 A;  2JJC A;  2K5B A;  3RLR A;  2YE7 A;  4YKW A;  5J6A A;  2ZBK B;  2YJW A;  3FT8 A;  2YEJ A;  4YKY A;  1TBW A;  3Q5J A;  4KSH A;  4EEH A;  1TC0 A;  4YKZ A;  2YEH A;  1OSF A;  1ZW9 A;  2E0A A;  4KQV A;  3INW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...