5D6QA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a ligand
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
192
structure length
192
Chain Sequence
b'AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Discovery of Azaindole Ureas as a Novel Class of Bacterial Gyrase B Inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
total genus 63
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5d6qA00
4U7NA 4YKZA 4YKWA 4PRVA 4O04A 3WHAA 4EEHA 3GIEA 5BODA 2YE5A 2XHTA 1KIJA 1QY8A 1EI1A 4HYPA 4DUHA 3G7BA 5IN9A 4CWOA 1Z5BA 2QG2A 2BU5A 5FNFA 2QG0A 1UYKA 2FYPA 3U2KA 1TC6A 2YKJA 5M4MA 4HXZA 4I5SA 4Q20A 2BZ5A 4I3HA 2YEGA 1BKNA 4CWPA 4V25A 3CGYA 2XABA 3HHUA 2BTZA 3EKOA 4R3AA 4XCJA 2BYHA 4YKQA 3CRKA 4URLA 3PEJA 3R91A 1OSFA 4KSGA 5M4NA 3RLQA 4P8OA 1A4HA 4LWHA 5BOCA 4LWFA 4EM7A 2AKPA 4KQVA 2XK2A 4GGLA 3VADA 3RLPA 3HYYA 3NMQA 4O0BA 1TC0A 3JZ3A 4H81A 2XD6A 4XIQA 4LWEA 4NH8A 1I5CA 4MB9A 4UROA 4ZVIA 2IORA 3B28A 3OWBA 1QYEA 3B27A 4CWSA 4MP7A 3TTZA 5CPHA 3VHDA 3QTFA 2XJGA 4AWQA 4YKRA 4DZYA 3FV5A 3K99A 4HZ0A 4BIZA 3CRLA 3O2FA 1Y4UA 5D7DA 3TZ5A 3O0IA 2XJXA 3ZXOA 2YE8A 4YKUA 3A0WA 3T2SA 4GCZA 4BIUA 4HY1A 2VCJA 1QZRA 2IWUA 2YGFA 1JM6A 5IDMA 3EHGA 3H80A 1ZWHA 1UYIA 1UYCA 4JAVA 1R62A 1YSRA 3R4MA 3C11A 3R4NA 3T0ZA 5L3JA 2BU2A 4ASBA 2E0AA 3A0YA 4HZ5A 4U93A 2K5BA 3HZ5A 4L93A 4GT8A 4LPBA 4BAEA 4FCPA 3C0EA 3ZKDA 4CWRA 1B3QA 1AMWA 1NHIA 4O05A 4B7PA 4L90A 4XKOA 2Q8HA 1GKXA 4KTNA 5CTUA 2YJXA 1TILA 2XDLA 5F3KA 2UWDA 3SL2A 2IOQA 2FWZA 1UYFA 5CF0A 1GJVA 2JKIA 1BYQA 2XDSA 1YC1A 2XDKA 2WEPA 5FNDA 3B24A 2XHXA 3B26A 4XIRA 2BU7A 2BU6A 2WI3A 4MOTA 4R1FA 2YECA 3B25A 4ASAA 2CCTA 3T1KA 1AJ6A 1US7A 4AS9A 1UY9A 4E02A 3LPSA 3CGZA 1UY7A 5IDJA 1AH8A 2YEEA 3H4LA 4EGIA 1YESA 1TH8A 2XHRA 4CE3A 5D7RA 2Q2EB 4XDMA 3FT8A 4XKAA 1MU5A 2YKBA 4XCLA 3BM9A 3EKRA 3T0HA 3CWVA 2QFOA 3GIFA 3QDDA 4CWQA 4HY6A 2JJCA 2EXLA 4JQLA 3OW6A 2YEAA 5D6QA 3K97A 1Z59A 2BSMA 2YKCA 4MPCA 2YGAA 3D0BA 4AWPA 2BT0A 5F5RA 2GFDA 1KZNA 2YKIA 4YKTA 3R4PA 3TZ2A 4MBCA 1ZXNA 3RKZA 2YEFA 4EGKA 4P7AA 4LP0A 4WUDA 2YGEA 3D2RA 4GFNA 2CGFA 3INWA 3BMYA 1Y4SA 2QF6A 5M4HA 2YK2A 1NHJA 4CWNA 2XX5A 4XC0A 4X9LA 3EHHA 2WI5A 2BU8A 2ZDYA 3PEHA 4EGHA 2WI2A 3MNRP 1Y8OA 2YE7A 1BXDA 4ASFA 2C2AA 1YT0A 4YKYA 2YEHA 2Q8GA 3U67A 4O07A 5J6AA 4XE2A 5M4KA 1UYHA 2IWSA 4QPKA 5CTWA 4L94A 2CCUA 2PNRA 3RLRA 1UY6A 4CE1A 2H8MA 1B63A 5M4EA 1Z5AA 4CWTA 2XX4A 4URMA 4LWIA 4H7QA 1NHHA 3K60A 2ESAA 2GQPA 2WI4A 4URNA 2CG9A 3A0TA 2YE6A 1U2OA 2WI6A 1S16A 2FXSA 3GIGB 2O1UA 3KE6A 4PL9A 2YE2A 2WEQA 5FWKA 3Q5JA 1YS3A 4PU9A 3EHFA 3VHCA 4B6CA 1YC3A 3EHJA 2ZKJA 4R3MA 3ZXQA 2YE9A 4PRXA 2YEIA 1S14A 2O1VA 3Q5LA 2YI5A 4AWOA 2VCIA 2O1WA 4EFTA 4O09A 3WQ9A 1H7SA 1TIDA 2YEJA 1YETA 4WUCA 4KFGA 3ZM7A 3INXA 3R4OA 4HYMA 3GIGA 3HYZA 4EFUA 4ASGA 4WUBA 4NH9A 4E01A 2XCMA 1I5BA 3Q5KA 4BXIA 2WERA 4HXWA 3OWDA 2Q8FA 4GEEA 1UYGA 4L8ZA 2BREA 1UYDA 3A0XA 4EMVA 5C93A 1I59A 1ID0A 2CH4A 1ZXMA 2HG1A 3A0RA 2YJWA 3U2DA 2IWXA 1I5AA 3DGEA 2YI7A 2YKEA 1AM1A 2HKJA 2YE3A 2ZBKB 2BRCA 5CTYA 1THNA 2YEDA 2YEBA 1EA6A 1YERA 3K98A 4JASA 1UYEA 3D36A 2Q8IA 3VHAA 1Y8PA 1PVGA 2IOPA 2YE4A 2YI6A 3OPDA 3FT5A 3IEDA 1UYMA 1UYLA 2XDXA 4MP2A 1TBWA 4L91A 2WI7A 2YI0A 3TZ4A 1UY8A 1YT1A 4QPJA 4FMTA 4XITA 2XDUA 1B62A 2ZDXA 3R92A 2VW5A 2CCSA 2BYIA 4FPPA 3TZ0A 2YK9A 5M4PA 4JAUA 5CTXA 1I58A 4CWFA 3TUHA 5D6PA 1GKZA 4FCRA 4NH7A 4K4OA 4BQJA 2VWCA 2WI1A 1U0ZA 1BGQA 3G7EA 1YT2A 4ZKIA 4MPNA 1YC4A 5GGZA 4XTJA 4KP4A 4YKXA 4XD8A 1Z5CA 4V26A 4W7TA 4CE2A 4GQTA 4XKKA 2FWYA 4H85A 1AH6A 1I5DA 3G75A 1Y8NA 3O6OA 4FCQA 3A0ZA 3OMUA 2HCHA 4BQGA 1YSZA 4MPEA 3LNUA 4U7OA 2XJJA 1ZW9A 3HEKA 3HZ1A 1L0OA 4KSHA 5D7CA 4E00A 4LWGA 5J71A 4XIPA 1H7UA 2H55A 5FNCA 3ZKBA 1MX0A 2XX2A 3T10A
chains in the Genus database with same CATH superfamily
4U7NA 4YKZA 4YKWA 4PRVA 4O04A 3WHAA 4EEHA 3GIEA 5BODA 2YE5A 2XHTA 1KIJA 1QY8A 1EI1A 4HYPA 4DUHA 3G7BA 5IN9A 4CWOA 1Z5BA 2QG2A 2BU5A 5FNFA 2QG0A 1UYKA 2FTKA 2FYPA 3U2KA 4E72A 1TC6A 2YKJA 5M4MA 4HXZA 4I5SA 4Q20A 2BZ5A 4I3HA 2YEGA 1BKNA 4CWPA 4V25A 3CGYA 2XABA 3HHUA 2BTZA 3EKOA 4R3AA 4XCJA 2BYHA 4YKQA 3CRKA 4URLA 3PEJA 3R91A 1OSFA 4KSGA 5M4NA 3RLQA 2HHIA 4P8OA 1A4HA 4LWHA 5BOCA 4LWFA 4EM7A 2AKPA 4KQVA 2XK2A 4GGLA 3VADA 3RLPA 3HYYA 3NMQA 4O0BA 1TC0A 3JZ3A 4H81A 2XD6A 4XIQA 4LWEA 4NH8A 1I5CA 4MB9A 4UROA 4ZVIA 2IORA 3B28A 3OWBA 1QYEA 3B27A 4CWSA 4MP7A 3TTZA 5CPHA 3VHDA 3QTFA 2XJGA 4AWQA 4YKRA 4DZYA 3FV5A 3K99A 4HZ0A 4BIZA 3CRLA 3O2FA 1Y4UA 5D7DA 3TZ5A 3O0IA 2XJXA 3ZXOA 2YE8A 4YKUA 3A0WA 3T2SA 2C1GA 4GCZA 4BIUA 4HY1A 2VCJA 1QZRA 2IWUA 2YGFA 1JM6A 5IDMA 3EHGA 3H80A 1ZWHA 1UYIA 1UYCA 4JAVA 1R62A 1YSRA 3R4MA 3C11A 3R4NA 3T0ZA 5L3JA 2BU2A 4ASBA 2E0AA 3A0YA 4HZ5A 4U93A 2K5BA 3HZ5A 4L93A 4GT8A 4LPBA 4BAEA 4FCPA 3C0EA 3ZKDA 4CWRA 1B3QA 1AMWA 1NHIA 4O05A 4B7PA 4L90A 4XKOA 2Q8HA 1GKXA 4KTNA 5CTUA 2YJXA 1TILA 2XDLA 5F3KA 2UWDA 3SL2A 2IOQA 2FWZA 1UYFA 5CF0A 1GJVA 2JKIA 1BYQA 2XDSA 1YC1A 2XDKA 2WEPA 5FNDA 3B24A 2XHXA 3B26A 4XIRA 2BU7A 2BU6A 2WI3A 4MOTA 4R1FA 2YECA 3B25A 4ASAA 2CCTA 3T1KA 1AJ6A 1US7A 4AS9A 1UY9A 4E02A 3LPSA 3CYGA 3CGZA 1UY7A 5IDJA 1AH8A 2YEEA 3H4LA 4EGIA 1YESA 1TH8A 2XHRA 4CE3A 5D7RA 2Q2EB 4XDMA 3FT8A 4XKAA 1MU5A 2YKBA 4XCLA 3BM9A 3EKRA 3T0HA 3CWVA 1F51A 2QFOA 3GIFA 3QDDA 4CWQA 4HY6A 2JJCA 2EXLA 4JQLA 3OW6A 2YEAA 5D6QA 3K97A 1Z59A 2BSMA 2YKCA 4MPCA 2YGAA 3D0BA 4AWPA 2BT0A 5F5RA 2GFDA 1KZNA 2YKIA 4YKTA 3R4PA 3TZ2A 4MBCA 2C1IA 1ZXNA 3RKZA 2YEFA 4EGKA 4P7AA 4LP0A 4WUDA 2YGEA 3D2RA 4GFNA 2CGFA 3INWA 3BMYA 1Y4SA 2QF6A 5M4HA 2YK2A 1NHJA 4CWNA 2XX5A 4XC0A 4X9LA 3EHHA 2WI5A 2BU8A 2ZDYA 3PEHA 4EGHA 2WI2A 3MNRP 1Y8OA 2YE7A 1BXDA 4ASFA 3S5TA 2C2AA 1YT0A 4YKYA 2YEHA 2Q8GA 3U67A 4O07A 5J6AA 4XE2A 5M4KA 1UYHA 2IWSA 4QPKA 5CTWA 4L94A 2CCUA 2PNRA 3RLRA 1UY6A 4CE1A 2H8MA 1B63A 5M4EA 1Z5AA 4CWTA 2XX4A 4URMA 4LWIA 4H7QA 1NHHA 3K60A 2ESAA 2GQPA 2WI4A 4URNA 2CG9A 3A0TA 2YE6A 1U2OA 2WI6A 1S16A 2FXSA 3GIGB 2O1UA 3KE6A 4PL9A 2YE2A 2WEQA 5FWKA 3Q5JA 1YS3A 4PU9A 5JENA 3EHFA 3VHCA 4B6CA 1YC3A 3LMMA 3EHJA 2ZKJA 4R3MA 3ZXQA 2YE9A 4PRXA 2YEIA 1S14A 2O1VA 3Q5LA 2YI5A 4AWOA 2VCIA 2O1WA 4EFTA 4O09A 3WQ9A 1H7SA 1TIDA 2YEJA 1YETA 4WUCA 4KFGA 3ZM7A 3INXA 3R4OA 4HYMA 3GIGA 3HYZA 4EFUA 4ASGA 4WUBA 4NH9A 4E01A 2XCMA 1I5BA 3Q5KA 4BXIA 2WERA 4HXWA 3OWDA 2Q8FA 4GEEA 1UYGA 4L8ZA 2BREA 1UYDA 3A0XA 4EMVA 5C93A 1I59A 1ID0A 2CH4A 1ZXMA 2HG1A 3A0RA 2YJWA 3U2DA 2IWXA 1I5AA 3DGEA 2YI7A 2YKEA 1AM1A 2HKJA 2YE3A 2ZBKB 2BRCA 5CTYA 1THNA 2YEDA 2YEBA 1EA6A 1YERA 3K98A 4JASA 1UYEA 3D36A 2Q8IA 3VHAA 1Y8PA 1PVGA 2IOPA 2YE4A 2YI6A 3OPDA 3FT5A 3IEDA 1UYMA 1UYLA 2XDXA 4MP2A 1TBWA 4L91A 2WI7A 2YI0A 3TZ4A 1UY8A 1YT1A 4QPJA 4FMTA 4XITA 2XDUA 1B62A 2ZDXA 3R92A 2VW5A 2CCSA 2BYIA 4FPPA 3TZ0A 2YK9A 5M4PA 1IXMA 4JAUA 5CTXA 1I58A 4CWFA 3TUHA 5D6PA 1GKZA 4FCRA 4NH7A 4K4OA 4BQJA 2VWCA 2WI1A 1U0ZA 1BGQA 3G7EA 1YT2A 4ZKIA 4MPNA 1YC4A 5GGZA 4XTJA 4KP4A 4YKXA 4XD8A 1Z5CA 4V26A 4W7TA 4CE2A 4GQTA 4XKKA 2FWYA 4H85A 1AH6A 1I5DA 3G75A 1Y8NA 3O6OA 4FCQA 3A0ZA 3OMUA 2HCHA 4BQGA 1YSZA 4MPEA 3LNUA 4U7OA 2XJJA 1ZW9A 3HEKA 3HZ1A 1L0OA 4KSHA 5D7CA 4E00A 4LWGA 5J71A 4XIPA 1H7UA 2H55A 5FNCA 3ZKBA 1MX0A 2XX2A 3T10A
chains in the Genus database with same CATH topology
4U7NA 4YKZA 4YKWA 4PRVA 4O04A 3WHAA 4EEHA 3GIEA 5BODA 2YE5A 2XHTA 1KIJA 1QY8A 1EI1A 4HYPA 4DUHA 3G7BA 5IN9A 4CWOA 1Z5BA 2QG2A 2BU5A 5FNFA 2QG0A 1UYKA 2FYPA 3U2KA 1TC6A 2YKJA 5M4MA 4HXZA 4I5SA 4Q20A 2BZ5A 4I3HA 2YEGA 1BKNA 4CWPA 4V25A 3CGYA 2XABA 3HHUA 2BTZA 3EKOA 4R3AA 4XCJA 2BYHA 4YKQA 3CRKA 4URLA 3PEJA 3R91A 1OSFA 4KSGA 5M4NA 3RLQA 4P8OA 1A4HA 4LWHA 5BOCA 4LWFA 4EM7A 2AKPA 4KQVA 2XK2A 4GGLA 3VADA 3RLPA 3HYYA 3NMQA 4O0BA 1TC0A 3JZ3A 4H81A 2XD6A 4XIQA 4LWEA 4NH8A 1I5CA 4MB9A 4UROA 4ZVIA 2IORA 3B28A 3OWBA 1QYEA 3B27A 4CWSA 4MP7A 3TTZA 5CPHA 3VHDA 3QTFA 2XJGA 4AWQA 4YKRA 4DZYA 3FV5A 3K99A 4HZ0A 4BIZA 3CRLA 3O2FA 1Y4UA 5D7DA 3TZ5A 3O0IA 2XJXA 3ZXOA 2YE8A 4YKUA 3A0WA 3T2SA 4GCZA 4BIUA 4HY1A 2VCJA 1QZRA 2IWUA 2YGFA 1JM6A 5IDMA 3EHGA 3H80A 1ZWHA 1UYIA 1UYCA 4JAVA 1R62A 1YSRA 3R4MA 3C11A 3R4NA 3T0ZA 5L3JA 2BU2A 4ASBA 2E0AA 3A0YA 4HZ5A 4U93A 2K5BA 3HZ5A 4L93A 4GT8A 4LPBA 4BAEA 4FCPA 3C0EA 3ZKDA 4CWRA 1B3QA 1AMWA 1NHIA 4O05A 4B7PA 4L90A 4XKOA 2Q8HA 1GKXA 4KTNA 5CTUA 2YJXA 1TILA 2XDLA 5F3KA 2UWDA 3SL2A 2IOQA 2FWZA 1UYFA 5CF0A 1GJVA 2JKIA 1BYQA 2XDSA 1YC1A 2XDKA 2WEPA 5FNDA 3B24A 2XHXA 3B26A 4XIRA 2BU7A 2BU6A 2WI3A 4MOTA 4R1FA 2YECA 3B25A 4ASAA 2CCTA 3T1KA 1AJ6A 1US7A 4AS9A 1UY9A 4E02A 3LPSA 3CGZA 1UY7A 5IDJA 1AH8A 2YEEA 3H4LA 4EGIA 1YESA 1TH8A 2XHRA 4CE3A 5D7RA 2Q2EB 4XDMA 3FT8A 4XKAA 1MU5A 2YKBA 4XCLA 3BM9A 3EKRA 3T0HA 3CWVA 2QFOA 3GIFA 3QDDA 4CWQA 4HY6A 2JJCA 2EXLA 4JQLA 3OW6A 2YEAA 5D6QA 3K97A 1Z59A 2BSMA 2YKCA 4MPCA 2YGAA 3D0BA 4AWPA 2BT0A 5F5RA 2GFDA 1KZNA 2YKIA 4YKTA 3R4PA 3TZ2A 4MBCA 1ZXNA 3RKZA 2YEFA 4EGKA 4P7AA 4LP0A 4WUDA 2YGEA 3D2RA 4GFNA 2CGFA 3INWA 3BMYA 1Y4SA 2QF6A 5M4HA 2YK2A 1NHJA 4CWNA 2XX5A 4XC0A 4X9LA 3EHHA 2WI5A 2BU8A 2ZDYA 3PEHA 4EGHA 2WI2A 3MNRP 1Y8OA 2YE7A 1BXDA 4ASFA 2C2AA 1YT0A 4YKYA 2YEHA 2Q8GA 3U67A 4O07A 5J6AA 4XE2A 5M4KA 1UYHA 2IWSA 4QPKA 5CTWA 4L94A 2CCUA 2PNRA 3RLRA 1UY6A 4CE1A 2H8MA 1B63A 5M4EA 1Z5AA 4CWTA 2XX4A 4URMA 4LWIA 4H7QA 1NHHA 3K60A 2ESAA 2GQPA 2WI4A 4URNA 2CG9A 3A0TA 2YE6A 1U2OA 2WI6A 1S16A 2FXSA 3GIGB 2O1UA 3KE6A 4PL9A 2YE2A 2WEQA 5FWKA 3Q5JA 1YS3A 4PU9A 3EHFA 3VHCA 4B6CA 1YC3A 3EHJA 2ZKJA 4R3MA 3ZXQA 2YE9A 4PRXA 2YEIA 1S14A 2O1VA 3Q5LA 2YI5A 4AWOA 2VCIA 2O1WA 4EFTA 4O09A 3WQ9A 1H7SA 1TIDA 2YEJA 1YETA 4WUCA 4KFGA 3ZM7A 3INXA 3R4OA 4HYMA 3GIGA 3HYZA 4EFUA 4ASGA 4WUBA 4NH9A 4E01A 2XCMA 1I5BA 3Q5KA 4BXIA 2WERA 4HXWA 3OWDA 2Q8FA 4GEEA 1UYGA 4L8ZA 2BREA 1UYDA 3A0XA 4EMVA 5C93A 1I59A 1ID0A 2CH4A 1ZXMA 2HG1A 3A0RA 2YJWA 3U2DA 2IWXA 1I5AA 3DGEA 2YI7A 2YKEA 1AM1A 2HKJA 2YE3A 2ZBKB 2BRCA 5CTYA 1THNA 2YEDA 2YEBA 1EA6A 1YERA 3K98A 4JASA 1UYEA 3D36A 2Q8IA 3VHAA 1Y8PA 1PVGA 2IOPA 2YE4A 2YI6A 3OPDA 3FT5A 3IEDA 1UYMA 1UYLA 2XDXA 4MP2A 1TBWA 4L91A 2WI7A 2YI0A 3TZ4A 1UY8A 1YT1A 4QPJA 4FMTA 4XITA 2XDUA 1B62A 2ZDXA 3R92A 2VW5A 2CCSA 2BYIA 4FPPA 3TZ0A 2YK9A 5M4PA 4JAUA 5CTXA 1I58A 4CWFA 3TUHA 5D6PA 1GKZA 4FCRA 4NH7A 4K4OA 4BQJA 2VWCA 2WI1A 1U0ZA 1BGQA 3G7EA 1YT2A 4ZKIA 4MPNA 1YC4A 5GGZA 4XTJA 4KP4A 4YKXA 4XD8A 1Z5CA 4V26A 4W7TA 4CE2A 4GQTA 4XKKA 2FWYA 4H85A 1AH6A 1I5DA 3G75A 1Y8NA 3O6OA 4FCQA 3A0ZA 3OMUA 2HCHA 4BQGA 1YSZA 4MPEA 3LNUA 4U7OA 2XJJA 1ZW9A 3HEKA 3HZ1A 1L0OA 4KSHA 5D7CA 4E00A 4LWGA 5J71A 4XIPA 1H7UA 2H55A 5FNCA 3ZKBA 1MX0A 2XX2A 3T10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U7N A;  4YKZ A;  4YKW A;  4PRV A;  4O04 A;  3WHA A;  4EEH A;  3GIE A;  5BOD A;  2YE5 A;  2XHT A;  1KIJ A;  1QY8 A;  1EI1 A;  4HYP A;  4DUH A;  3G7B A;  5IN9 A;  4CWO A;  1Z5B A;  2QG2 A;  2BU5 A;  5FNF A;  2QG0 A;  1UYK A;  2FYP A;  3U2K A;  1TC6 A;  2YKJ A;  5M4M A;  4HXZ A;  4I5S A;  4Q20 A;  2BZ5 A;  4I3H A;  2YEG A;  1BKN A;  4CWP A;  4V25 A;  3CGY A;  2XAB A;  3HHU A;  2BTZ A;  3EKO A;  4R3A A;  4XCJ A;  2BYH A;  4YKQ A;  3CRK A;  4URL A;  3PEJ A;  3R91 A;  1OSF A;  4KSG A;  5M4N A;  3RLQ A;  4P8O A;  1A4H A;  4LWH A;  5BOC A;  4LWF A;  4EM7 A;  2AKP A;  4KQV A;  2XK2 A;  4GGL A;  3VAD A;  3RLP A;  3HYY A;  3NMQ A;  4O0B A;  1TC0 A;  3JZ3 A;  4H81 A;  2XD6 A;  4XIQ A;  4LWE A;  4NH8 A;  1I5C A;  4MB9 A;  4URO A;  4ZVI A;  2IOR A;  3B28 A;  3OWB A;  1QYE A;  3B27 A;  4CWS A;  4MP7 A;  3TTZ A;  5CPH A;  3VHD A;  3QTF A;  2XJG A;  4AWQ A;  4YKR A;  4DZY A;  3FV5 A;  3K99 A;  4HZ0 A;  4BIZ A;  3CRL A;  3O2F A;  1Y4U A;  5D7D A;  3TZ5 A;  3O0I A;  2XJX A;  3ZXO A;  2YE8 A;  4YKU A;  3A0W A;  3T2S A;  4GCZ A;  4BIU A;  4HY1 A;  2VCJ A;  1QZR A;  2IWU A;  2YGF A;  1JM6 A;  5IDM A;  3EHG A;  3H80 A;  1ZWH A;  1UYI A;  1UYC A;  4JAV A;  1R62 A;  1YSR A;  3R4M A;  3C11 A;  3R4N A;  3T0Z A;  5L3J A;  2BU2 A;  4ASB A;  2E0A A;  3A0Y A;  4HZ5 A;  4U93 A;  2K5B A;  3HZ5 A;  4L93 A;  4GT8 A;  4LPB A;  4BAE A;  4FCP A;  3C0E A;  3ZKD A;  4CWR A;  1B3Q A;  1AMW A;  1NHI A;  4O05 A;  4B7P A;  4L90 A;  4XKO A;  2Q8H A;  1GKX A;  4KTN A;  5CTU A;  2YJX A;  1TIL A;  2XDL A;  5F3K A;  2UWD A;  3SL2 A;  2IOQ A;  2FWZ A;  1UYF A;  5CF0 A;  1GJV A;  2JKI A;  1BYQ A;  2XDS A;  1YC1 A;  2XDK A;  2WEP A;  5FND A;  3B24 A;  2XHX A;  3B26 A;  4XIR A;  2BU7 A;  2BU6 A;  2WI3 A;  4MOT A;  4R1F A;  2YEC A;  3B25 A;  4ASA A;  2CCT A;  3T1K A;  1AJ6 A;  1US7 A;  4AS9 A;  1UY9 A;  4E02 A;  3LPS A;  3CGZ A;  1UY7 A;  5IDJ A;  1AH8 A;  2YEE A;  3H4L A;  4EGI A;  1YES A;  1TH8 A;  2XHR A;  4CE3 A;  5D7R A;  2Q2E B;  4XDM A;  3FT8 A;  4XKA A;  1MU5 A;  2YKB A;  4XCL A;  3BM9 A;  3EKR A;  3T0H A;  3CWV A;  2QFO A;  3GIF A;  3QDD A;  4CWQ A;  4HY6 A;  2JJC A;  2EXL A;  4JQL A;  3OW6 A;  2YEA A;  5D6Q A;  3K97 A;  1Z59 A;  2BSM A;  2YKC A;  4MPC A;  2YGA A;  3D0B A;  4AWP A;  2BT0 A;  5F5R A;  2GFD A;  1KZN A;  2YKI A;  4YKT A;  3R4P A;  3TZ2 A;  4MBC A;  1ZXN A;  3RKZ A;  2YEF A;  4EGK A;  4P7A A;  4LP0 A;  4WUD A;  2YGE A;  3D2R A;  4GFN A;  2CGF A;  3INW A;  3BMY A;  1Y4S A;  2QF6 A;  5M4H A;  2YK2 A;  1NHJ A;  4CWN A;  2XX5 A;  4XC0 A;  4X9L A;  3EHH A;  2WI5 A;  2BU8 A;  2ZDY A;  3PEH A;  4EGH A;  2WI2 A;  3MNR P;  1Y8O A;  2YE7 A;  1BXD A;  4ASF A;  2C2A A;  1YT0 A;  4YKY A;  2YEH A;  2Q8G A;  3U67 A;  4O07 A;  5J6A A;  4XE2 A;  5M4K A;  1UYH A;  2IWS A;  4QPK A;  5CTW A;  4L94 A;  2CCU A;  2PNR A;  3RLR A;  1UY6 A;  4CE1 A;  2H8M A;  1B63 A;  5M4E A;  1Z5A A;  4CWT A;  2XX4 A;  4URM A;  4LWI A;  4H7Q A;  1NHH A;  3K60 A;  2ESA A;  2GQP A;  2WI4 A;  4URN A;  2CG9 A;  3A0T A;  2YE6 A;  1U2O A;  2WI6 A;  1S16 A;  2FXS A;  3GIG B;  2O1U A;  3KE6 A;  4PL9 A;  2YE2 A;  2WEQ A;  5FWK A;  3Q5J A;  1YS3 A;  4PU9 A;  3EHF A;  3VHC A;  4B6C A;  1YC3 A;  3EHJ A;  2ZKJ A;  4R3M A;  3ZXQ A;  2YE9 A;  4PRX A;  2YEI A;  1S14 A;  2O1V A;  3Q5L A;  2YI5 A;  4AWO A;  2VCI A;  2O1W A;  4EFT A;  4O09 A;  3WQ9 A;  1H7S A;  1TID A;  2YEJ A;  1YET A;  4WUC A;  4KFG A;  3ZM7 A;  3INX A;  3R4O A;  4HYM A;  3GIG A;  3HYZ A;  4EFU A;  4ASG A;  4WUB A;  4NH9 A;  4E01 A;  2XCM A;  1I5B A;  3Q5K A;  4BXI A;  2WER A;  4HXW A;  3OWD A;  2Q8F A;  4GEE A;  1UYG A;  4L8Z A;  2BRE A;  1UYD A;  3A0X A;  4EMV A;  5C93 A;  1I59 A;  1ID0 A;  2CH4 A;  1ZXM A;  2HG1 A;  3A0R A;  2YJW A;  3U2D A;  2IWX A;  1I5A A;  3DGE A;  2YI7 A;  2YKE A;  1AM1 A;  2HKJ A;  2YE3 A;  2ZBK B;  2BRC A;  5CTY A;  1THN A;  2YED A;  2YEB A;  1EA6 A;  1YER A;  3K98 A;  4JAS A;  1UYE A;  3D36 A;  2Q8I A;  3VHA A;  1Y8P A;  1PVG A;  2IOP A;  2YE4 A;  2YI6 A;  3OPD A;  3FT5 A;  3IED A;  1UYM A;  1UYL A;  2XDX A;  4MP2 A;  1TBW A;  4L91 A;  2WI7 A;  2YI0 A;  3TZ4 A;  1UY8 A;  1YT1 A;  4QPJ A;  4FMT A;  4XIT A;  2XDU A;  1B62 A;  2ZDX A;  3R92 A;  2VW5 A;  2CCS A;  2BYI A;  4FPP A;  3TZ0 A;  2YK9 A;  5M4P A;  4JAU A;  5CTX A;  1I58 A;  4CWF A;  3TUH A;  5D6P A;  1GKZ A;  4FCR A;  4NH7 A;  4K4O A;  4BQJ A;  2VWC A;  2WI1 A;  1U0Z A;  1BGQ A;  3G7E A;  1YT2 A;  4ZKI A;  4MPN A;  1YC4 A;  5GGZ A;  4XTJ A;  4KP4 A;  4YKX A;  4XD8 A;  1Z5C A;  4V26 A;  4W7T A;  4CE2 A;  4GQT A;  4XKK A;  2FWY A;  4H85 A;  1AH6 A;  1I5D A;  3G75 A;  1Y8N A;  3O6O A;  4FCQ A;  3A0Z A;  3OMU A;  2HCH A;  4BQG A;  1YSZ A;  4MPE A;  3LNU A;  4U7O A;  2XJJ A;  1ZW9 A;  3HEK A;  3HZ1 A;  1L0O A;  4KSH A;  5D7C A;  4E00 A;  4LWG A;  5J71 A;  4XIP A;  1H7U A;  2H55 A;  5FNC A;  3ZKB A;  1MX0 A;  2XX2 A;  3T10 A; 
#chains in the Genus database with same CATH topology
 4U7N A;  4YKZ A;  4YKW A;  4PRV A;  4O04 A;  3WHA A;  4EEH A;  3GIE A;  5BOD A;  2YE5 A;  2XHT A;  1KIJ A;  1QY8 A;  1EI1 A;  4HYP A;  4DUH A;  3G7B A;  5IN9 A;  4CWO A;  1Z5B A;  2QG2 A;  2BU5 A;  5FNF A;  2QG0 A;  1UYK A;  2FTK A;  2FYP A;  3U2K A;  4E72 A;  1TC6 A;  2YKJ A;  5M4M A;  4HXZ A;  4I5S A;  4Q20 A;  2BZ5 A;  4I3H A;  2YEG A;  1BKN A;  4CWP A;  4V25 A;  3CGY A;  2XAB A;  3HHU A;  2BTZ A;  3EKO A;  4R3A A;  4XCJ A;  2BYH A;  4YKQ A;  3CRK A;  4URL A;  3PEJ A;  3R91 A;  1OSF A;  4KSG A;  5M4N A;  3RLQ A;  2HHI A;  4P8O A;  1A4H A;  4LWH A;  5BOC A;  4LWF A;  4EM7 A;  2AKP A;  4KQV A;  2XK2 A;  4GGL A;  3VAD A;  3RLP A;  3HYY A;  3NMQ A;  4O0B A;  1TC0 A;  3JZ3 A;  4H81 A;  2XD6 A;  4XIQ A;  4LWE A;  4NH8 A;  1I5C A;  4MB9 A;  4URO A;  4ZVI A;  2IOR A;  3B28 A;  3OWB A;  1QYE A;  3B27 A;  4CWS A;  4MP7 A;  3TTZ A;  5CPH A;  3VHD A;  3QTF A;  2XJG A;  4AWQ A;  4YKR A;  4DZY A;  3FV5 A;  3K99 A;  4HZ0 A;  4BIZ A;  3CRL A;  3O2F A;  1Y4U A;  5D7D A;  3TZ5 A;  3O0I A;  2XJX A;  3ZXO A;  2YE8 A;  4YKU A;  3A0W A;  3T2S A;  2C1G A;  4GCZ A;  4BIU A;  4HY1 A;  2VCJ A;  1QZR A;  2IWU A;  2YGF A;  1JM6 A;  5IDM A;  3EHG A;  3H80 A;  1ZWH A;  1UYI A;  1UYC A;  4JAV A;  1R62 A;  1YSR A;  3R4M A;  3C11 A;  3R4N A;  3T0Z A;  5L3J A;  2BU2 A;  4ASB A;  2E0A A;  3A0Y A;  4HZ5 A;  4U93 A;  2K5B A;  3HZ5 A;  4L93 A;  4GT8 A;  4LPB A;  4BAE A;  4FCP A;  3C0E A;  3ZKD A;  4CWR A;  1B3Q A;  1AMW A;  1NHI A;  4O05 A;  4B7P A;  4L90 A;  4XKO A;  2Q8H A;  1GKX A;  4KTN A;  5CTU A;  2YJX A;  1TIL A;  2XDL A;  5F3K A;  2UWD A;  3SL2 A;  2IOQ A;  2FWZ A;  1UYF A;  5CF0 A;  1GJV A;  2JKI A;  1BYQ A;  2XDS A;  1YC1 A;  2XDK A;  2WEP A;  5FND A;  3B24 A;  2XHX A;  3B26 A;  4XIR A;  2BU7 A;  2BU6 A;  2WI3 A;  4MOT A;  4R1F A;  2YEC A;  3B25 A;  4ASA A;  2CCT A;  3T1K A;  1AJ6 A;  1US7 A;  4AS9 A;  1UY9 A;  4E02 A;  3LPS A;  3CYG A;  3CGZ A;  1UY7 A;  5IDJ A;  1AH8 A;  2YEE A;  3H4L A;  4EGI A;  1YES A;  1TH8 A;  2XHR A;  4CE3 A;  5D7R A;  2Q2E B;  4XDM A;  3FT8 A;  4XKA A;  1MU5 A;  2YKB A;  4XCL A;  3BM9 A;  3EKR A;  3T0H A;  3CWV A;  1F51 A;  2QFO A;  3GIF A;  3QDD A;  4CWQ A;  4HY6 A;  2JJC A;  2EXL A;  4JQL A;  3OW6 A;  2YEA A;  5D6Q A;  3K97 A;  1Z59 A;  2BSM A;  2YKC A;  4MPC A;  2YGA A;  3D0B A;  4AWP A;  2BT0 A;  5F5R A;  2GFD A;  1KZN A;  2YKI A;  4YKT A;  3R4P A;  3TZ2 A;  4MBC A;  2C1I A;  1ZXN A;  3RKZ A;  2YEF A;  4EGK A;  4P7A A;  4LP0 A;  4WUD A;  2YGE A;  3D2R A;  4GFN A;  2CGF A;  3INW A;  3BMY A;  1Y4S A;  2QF6 A;  5M4H A;  2YK2 A;  1NHJ A;  4CWN A;  2XX5 A;  4XC0 A;  4X9L A;  3EHH A;  2WI5 A;  2BU8 A;  2ZDY A;  3PEH A;  4EGH A;  2WI2 A;  3MNR P;  1Y8O A;  2YE7 A;  1BXD A;  4ASF A;  3S5T A;  2C2A A;  1YT0 A;  4YKY A;  2YEH A;  2Q8G A;  3U67 A;  4O07 A;  5J6A A;  4XE2 A;  5M4K A;  1UYH A;  2IWS A;  4QPK A;  5CTW A;  4L94 A;  2CCU A;  2PNR A;  3RLR A;  1UY6 A;  4CE1 A;  2H8M A;  1B63 A;  5M4E A;  1Z5A A;  4CWT A;  2XX4 A;  4URM A;  4LWI A;  4H7Q A;  1NHH A;  3K60 A;  2ESA A;  2GQP A;  2WI4 A;  4URN A;  2CG9 A;  3A0T A;  2YE6 A;  1U2O A;  2WI6 A;  1S16 A;  2FXS A;  3GIG B;  2O1U A;  3KE6 A;  4PL9 A;  2YE2 A;  2WEQ A;  5FWK A;  3Q5J A;  1YS3 A;  4PU9 A;  5JEN A;  3EHF A;  3VHC A;  4B6C A;  1YC3 A;  3LMM A;  3EHJ A;  2ZKJ A;  4R3M A;  3ZXQ A;  2YE9 A;  4PRX A;  2YEI A;  1S14 A;  2O1V A;  3Q5L A;  2YI5 A;  4AWO A;  2VCI A;  2O1W A;  4EFT A;  4O09 A;  3WQ9 A;  1H7S A;  1TID A;  2YEJ A;  1YET A;  4WUC A;  4KFG A;  3ZM7 A;  3INX A;  3R4O A;  4HYM A;  3GIG A;  3HYZ A;  4EFU A;  4ASG A;  4WUB A;  4NH9 A;  4E01 A;  2XCM A;  1I5B A;  3Q5K A;  4BXI A;  2WER A;  4HXW A;  3OWD A;  2Q8F A;  4GEE A;  1UYG A;  4L8Z A;  2BRE A;  1UYD A;  3A0X A;  4EMV A;  5C93 A;  1I59 A;  1ID0 A;  2CH4 A;  1ZXM A;  2HG1 A;  3A0R A;  2YJW A;  3U2D A;  2IWX A;  1I5A A;  3DGE A;  2YI7 A;  2YKE A;  1AM1 A;  2HKJ A;  2YE3 A;  2ZBK B;  2BRC A;  5CTY A;  1THN A;  2YED A;  2YEB A;  1EA6 A;  1YER A;  3K98 A;  4JAS A;  1UYE A;  3D36 A;  2Q8I A;  3VHA A;  1Y8P A;  1PVG A;  2IOP A;  2YE4 A;  2YI6 A;  3OPD A;  3FT5 A;  3IED A;  1UYM A;  1UYL A;  2XDX A;  4MP2 A;  1TBW A;  4L91 A;  2WI7 A;  2YI0 A;  3TZ4 A;  1UY8 A;  1YT1 A;  4QPJ A;  4FMT A;  4XIT A;  2XDU A;  1B62 A;  2ZDX A;  3R92 A;  2VW5 A;  2CCS A;  2BYI A;  4FPP A;  3TZ0 A;  2YK9 A;  5M4P A;  1IXM A;  4JAU A;  5CTX A;  1I58 A;  4CWF A;  3TUH A;  5D6P A;  1GKZ A;  4FCR A;  4NH7 A;  4K4O A;  4BQJ A;  2VWC A;  2WI1 A;  1U0Z A;  1BGQ A;  3G7E A;  1YT2 A;  4ZKI A;  4MPN A;  1YC4 A;  5GGZ A;  4XTJ A;  4KP4 A;  4YKX A;  4XD8 A;  1Z5C A;  4V26 A;  4W7T A;  4CE2 A;  4GQT A;  4XKK A;  2FWY A;  4H85 A;  1AH6 A;  1I5D A;  3G75 A;  1Y8N A;  3O6O A;  4FCQ A;  3A0Z A;  3OMU A;  2HCH A;  4BQG A;  1YSZ A;  4MPE A;  3LNU A;  4U7O A;  2XJJ A;  1ZW9 A;  3HEK A;  3HZ1 A;  1L0O A;  4KSH A;  5D7C A;  4E00 A;  4LWG A;  5J71 A;  4XIP A;  1H7U A;  2H55 A;  5FNC A;  3ZKB A;  1MX0 A;  2XX2 A;  3T10 A; 
#chains in the Genus database with same CATH homology
 4U7N A;  4YKZ A;  4YKW A;  4PRV A;  4O04 A;  3WHA A;  4EEH A;  3GIE A;  5BOD A;  2YE5 A;  2XHT A;  1KIJ A;  1QY8 A;  1EI1 A;  4HYP A;  4DUH A;  3G7B A;  5IN9 A;  4CWO A;  1Z5B A;  2QG2 A;  2BU5 A;  5FNF A;  2QG0 A;  1UYK A;  2FYP A;  3U2K A;  1TC6 A;  2YKJ A;  5M4M A;  4HXZ A;  4I5S A;  4Q20 A;  2BZ5 A;  4I3H A;  2YEG A;  1BKN A;  4CWP A;  4V25 A;  3CGY A;  2XAB A;  3HHU A;  2BTZ A;  3EKO A;  4R3A A;  4XCJ A;  2BYH A;  4YKQ A;  3CRK A;  4URL A;  3PEJ A;  3R91 A;  1OSF A;  4KSG A;  5M4N A;  3RLQ A;  4P8O A;  1A4H A;  4LWH A;  5BOC A;  4LWF A;  4EM7 A;  2AKP A;  4KQV A;  2XK2 A;  4GGL A;  3VAD A;  3RLP A;  3HYY A;  3NMQ A;  4O0B A;  1TC0 A;  3JZ3 A;  4H81 A;  2XD6 A;  4XIQ A;  4LWE A;  4NH8 A;  1I5C A;  4MB9 A;  4URO A;  4ZVI A;  2IOR A;  3B28 A;  3OWB A;  1QYE A;  3B27 A;  4CWS A;  4MP7 A;  3TTZ A;  5CPH A;  3VHD A;  3QTF A;  2XJG A;  4AWQ A;  4YKR A;  4DZY A;  3FV5 A;  3K99 A;  4HZ0 A;  4BIZ A;  3CRL A;  3O2F A;  1Y4U A;  5D7D A;  3TZ5 A;  3O0I A;  2XJX A;  3ZXO A;  2YE8 A;  4YKU A;  3A0W A;  3T2S A;  4GCZ A;  4BIU A;  4HY1 A;  2VCJ A;  1QZR A;  2IWU A;  2YGF A;  1JM6 A;  5IDM A;  3EHG A;  3H80 A;  1ZWH A;  1UYI A;  1UYC A;  4JAV A;  1R62 A;  1YSR A;  3R4M A;  3C11 A;  3R4N A;  3T0Z A;  5L3J A;  2BU2 A;  4ASB A;  2E0A A;  3A0Y A;  4HZ5 A;  4U93 A;  2K5B A;  3HZ5 A;  4L93 A;  4GT8 A;  4LPB A;  4BAE A;  4FCP A;  3C0E A;  3ZKD A;  4CWR A;  1B3Q A;  1AMW A;  1NHI A;  4O05 A;  4B7P A;  4L90 A;  4XKO A;  2Q8H A;  1GKX A;  4KTN A;  5CTU A;  2YJX A;  1TIL A;  2XDL A;  5F3K A;  2UWD A;  3SL2 A;  2IOQ A;  2FWZ A;  1UYF A;  5CF0 A;  1GJV A;  2JKI A;  1BYQ A;  2XDS A;  1YC1 A;  2XDK A;  2WEP A;  5FND A;  3B24 A;  2XHX A;  3B26 A;  4XIR A;  2BU7 A;  2BU6 A;  2WI3 A;  4MOT A;  4R1F A;  2YEC A;  3B25 A;  4ASA A;  2CCT A;  3T1K A;  1AJ6 A;  1US7 A;  4AS9 A;  1UY9 A;  4E02 A;  3LPS A;  3CGZ A;  1UY7 A;  5IDJ A;  1AH8 A;  2YEE A;  3H4L A;  4EGI A;  1YES A;  1TH8 A;  2XHR A;  4CE3 A;  5D7R A;  2Q2E B;  4XDM A;  3FT8 A;  4XKA A;  1MU5 A;  2YKB A;  4XCL A;  3BM9 A;  3EKR A;  3T0H A;  3CWV A;  2QFO A;  3GIF A;  3QDD A;  4CWQ A;  4HY6 A;  2JJC A;  2EXL A;  4JQL A;  3OW6 A;  2YEA A;  5D6Q A;  3K97 A;  1Z59 A;  2BSM A;  2YKC A;  4MPC A;  2YGA A;  3D0B A;  4AWP A;  2BT0 A;  5F5R A;  2GFD A;  1KZN A;  2YKI A;  4YKT A;  3R4P A;  3TZ2 A;  4MBC A;  1ZXN A;  3RKZ A;  2YEF A;  4EGK A;  4P7A A;  4LP0 A;  4WUD A;  2YGE A;  3D2R A;  4GFN A;  2CGF A;  3INW A;  3BMY A;  1Y4S A;  2QF6 A;  5M4H A;  2YK2 A;  1NHJ A;  4CWN A;  2XX5 A;  4XC0 A;  4X9L A;  3EHH A;  2WI5 A;  2BU8 A;  2ZDY A;  3PEH A;  4EGH A;  2WI2 A;  3MNR P;  1Y8O A;  2YE7 A;  1BXD A;  4ASF A;  2C2A A;  1YT0 A;  4YKY A;  2YEH A;  2Q8G A;  3U67 A;  4O07 A;  5J6A A;  4XE2 A;  5M4K A;  1UYH A;  2IWS A;  4QPK A;  5CTW A;  4L94 A;  2CCU A;  2PNR A;  3RLR A;  1UY6 A;  4CE1 A;  2H8M A;  1B63 A;  5M4E A;  1Z5A A;  4CWT A;  2XX4 A;  4URM A;  4LWI A;  4H7Q A;  1NHH A;  3K60 A;  2ESA A;  2GQP A;  2WI4 A;  4URN A;  2CG9 A;  3A0T A;  2YE6 A;  1U2O A;  2WI6 A;  1S16 A;  2FXS A;  3GIG B;  2O1U A;  3KE6 A;  4PL9 A;  2YE2 A;  2WEQ A;  5FWK A;  3Q5J A;  1YS3 A;  4PU9 A;  3EHF A;  3VHC A;  4B6C A;  1YC3 A;  3EHJ A;  2ZKJ A;  4R3M A;  3ZXQ A;  2YE9 A;  4PRX A;  2YEI A;  1S14 A;  2O1V A;  3Q5L A;  2YI5 A;  4AWO A;  2VCI A;  2O1W A;  4EFT A;  4O09 A;  3WQ9 A;  1H7S A;  1TID A;  2YEJ A;  1YET A;  4WUC A;  4KFG A;  3ZM7 A;  3INX A;  3R4O A;  4HYM A;  3GIG A;  3HYZ A;  4EFU A;  4ASG A;  4WUB A;  4NH9 A;  4E01 A;  2XCM A;  1I5B A;  3Q5K A;  4BXI A;  2WER A;  4HXW A;  3OWD A;  2Q8F A;  4GEE A;  1UYG A;  4L8Z A;  2BRE A;  1UYD A;  3A0X A;  4EMV A;  5C93 A;  1I59 A;  1ID0 A;  2CH4 A;  1ZXM A;  2HG1 A;  3A0R A;  2YJW A;  3U2D A;  2IWX A;  1I5A A;  3DGE A;  2YI7 A;  2YKE A;  1AM1 A;  2HKJ A;  2YE3 A;  2ZBK B;  2BRC A;  5CTY A;  1THN A;  2YED A;  2YEB A;  1EA6 A;  1YER A;  3K98 A;  4JAS A;  1UYE A;  3D36 A;  2Q8I A;  3VHA A;  1Y8P A;  1PVG A;  2IOP A;  2YE4 A;  2YI6 A;  3OPD A;  3FT5 A;  3IED A;  1UYM A;  1UYL A;  2XDX A;  4MP2 A;  1TBW A;  4L91 A;  2WI7 A;  2YI0 A;  3TZ4 A;  1UY8 A;  1YT1 A;  4QPJ A;  4FMT A;  4XIT A;  2XDU A;  1B62 A;  2ZDX A;  3R92 A;  2VW5 A;  2CCS A;  2BYI A;  4FPP A;  3TZ0 A;  2YK9 A;  5M4P A;  4JAU A;  5CTX A;  1I58 A;  4CWF A;  3TUH A;  5D6P A;  1GKZ A;  4FCR A;  4NH7 A;  4K4O A;  4BQJ A;  2VWC A;  2WI1 A;  1U0Z A;  1BGQ A;  3G7E A;  1YT2 A;  4ZKI A;  4MPN A;  1YC4 A;  5GGZ A;  4XTJ A;  4KP4 A;  4YKX A;  4XD8 A;  1Z5C A;  4V26 A;  4W7T A;  4CE2 A;  4GQT A;  4XKK A;  2FWY A;  4H85 A;  1AH6 A;  1I5D A;  3G75 A;  1Y8N A;  3O6O A;  4FCQ A;  3A0Z A;  3OMU A;  2HCH A;  4BQG A;  1YSZ A;  4MPE A;  3LNU A;  4U7O A;  2XJJ A;  1ZW9 A;  3HEK A;  3HZ1 A;  1L0O A;  4KSH A;  5D7C A;  4E00 A;  4LWG A;  5J71 A;  4XIP A;  1H7U A;  2H55 A;  5FNC A;  3ZKB A;  1MX0 A;  2XX2 A;  3T10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...