5D6QA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a ligand
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
192
structure length
192
Chain Sequence
AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Discovery of Azaindole Ureas as a Novel Class of Bacterial Gyrase B Inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
total genus 63
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5d6qA00
2VWCA 2YJXA 3RKZA 5M4PA 4WUCA 2BU2A 3JZ3A 4ZVIA 2QFOA 3K98A 1I5DA 2XK2A 3G75A 1YSRA 4U93A 2XDUA 3OMUA 2VCJA 2BU6A 3EKOA 3HYZA 3LNUA 4GEEA 2YE5A 2BYHA 2HG1A 3IEDA 4CE2A 2UWDA 2YEIA 4WUBA 2K5BA 3BMYA 4ASAA 2YKEA 4K4OA 3A0WA 2Q8IA 1UYHA 1Y4UA 1TBWA 4GFNA 4CWOA 3BM9A 3K99A 4QPKA 4URMA 3D2RA 4U7NA 2GQPA 4HY1A 4BXIA 4H81A 2YKJA 1YSZA 2CCSA 1Z5AA 3B28A 3A0XA 1KZNA 4BQJA 2YGEA 1YT2A 4GT8A 3PEJA 3G7BA 1KIJA 4LWGA 2BRCA 4AWPA 2O1WA 1BGQA 2YI5A 2AKPA 1TIDA 3LPSA 2HKJA 3A0YA 2IWUA 2YE3A 4CWNA 2YEDA 2VW5A 3HYYA 4ASFA 2ZBKB 4L8ZA 4Q20A 3A0RA 2BSMA 4R3AA 3EHFA 2IWXA 1UYGA 2YE7A 1YERA 3TUHA 4QPJA 2CH4A 2Q8GA 4CWRA 1S14A 4NH8A 4HXWA 2CG9A 2XCMA 4WUDA 4EGIA 4PRVA 4H85A 3RLPA 4JQLA 5FNCA 2CCTA 4V26A 1ZW9A 2YEFA 2O1UA 2QG0A 5F5RA 4I3HA 1L0OA 3OPDA 2XHRA 4L91A 2YI0A 4FCQA 3VHCA 3R4MA 1YC3A 5M4HA 1A4HA 3C0EA 1YT1A 2BYIA 4URNA 4EEHA 1EA6A 2BTZA 3ZKDA 3B24A 3O0IA 4ASBA 1THNA 4EGHA 3D0BA 2Q2EB 4R3MA 4P8OA 3HEKA 3O6OA 1TC6A 2ZDXA 1I5BA 2YEEA 1NHIA 3B25A 1JM6A 2H8MA 5CTYA 2WEQA 3EHHA 4LWEA 4MP7A 3B27A 5IDMA 2ZKJA 2YJWA 1YESA 2HCHA 4KSGA 4XC0A 3CRKA 4CE1A 2FWYA 3R4PA 5FNFA 4XE2A 4URLA 4HYMA 2FYPA 1Y8PA 3K97A 2YK2A 2IOQA 4PRXA 2IWSA 3MNRP 3QDDA 1UY7A 1UYDA 1YETA 4I5SA 1Z5BA 4X9LA 1ZWHA 3C11A 4CE3A 3HZ5A 2WI1A 5C93A 2CGFA 4E01A 2XJGA 5IDJA 5M4KA 4GCZA 1UYLA 4B7PA 1Y8NA 4KTNA 4XCJA 5CPHA 2BT0A 1Z5CA 2BREA 2XJJA 2XDSA 4L93A 3T10A 3K60A 1U0ZA 1UYEA 4O0BA 2XHTA 4EGKA 2PNRA 4BIZA 2XDKA 1YT0A 1PVGA 4KP4A 3R91A 1TC0A 3SL2A 4XIRA 3VADA 2BZ5A 4YKUA 4XIQA 4LWHA 1TH8A 4BQGA 2YI6A 2YEBA 3EHJA 4XTJA 4XKOA 3CRLA 5L3JA 2YEHA 2FWZA 3CGYA 1UYMA 2IORA 1NHJA 2XABA 4XITA 4BIUA 4LWFA 1UY6A 2XDXA 4L90A 4UROA 3DGEA 4HZ5A 2XHXA 3CGZA 1UY8A 4MPNA 2WI6A 3U67A 4PU9A 1UYCA 4DZYA 4EM7A 1I5AA 3HHUA 4LWIA 4MBCA 4E02A 5GGZA 1NHHA 2BU5A 4EFUA 3EHGA 2YI7A 1QYEA 4HY6A 4JASA 3U2DA 5M4MA 2QG2A 2XD6A 1MX0A 4NH7A 5J6AA 1BYQA 3RLQA 5D7DA 2CCUA 2YKBA 3TZ2A 3INWA 4ASGA 5IN9A 1B3QA 3FT8A 3A0ZA 1UYKA 1EI1A 2XX2A 2YE8A 3EKRA 4O07A 3H80A 4R1FA 3GIFA 2ESAA 3NMQA 1UYFA 3GIGA 4B6CA 2E0AA 3OWDA 3ZKBA 1YC1A 4PL9A 4JAVA 4MPEA 4YKWA 1AH6A 5CTXA 1R62A 2Q8FA 3WQ9A 4FCPA 5D7RA 4XCLA 3A0TA 5F3KA 2XX5A 5M4EA 2YECA 2ZDYA 3TTZA 3Q5JA 3HZ1A 4XKAA 3WHAA 3R4OA 3O2FA 4YKXA 1QY8A 2VCIA 3OWBA 1BXDA 3D36A 1Z59A 4KQVA 4MB9A 4E00A 4O09A 5FWKA 4YKRA 2YGFA 2C2AA 4CWSA 3FT5A 4V25A 1AM1A 4XKKA 4AWQA 4CWPA 2XDLA 5BOCA 2YE6A 2YE4A 4LP0A 4BAEA 1H7UA 3G7EA 5D7CA 2WEPA 1B63A 4NH9A 3VHAA 4GGLA 4W7TA 4JAUA 1U2OA 1Y4SA 4P7AA 4FPPA 3U2KA 2BU8A 1YS3A 4DUHA 1Y8OA 2YE2A 2WI3A 1B62A 4FCRA 2YEAA 4CWFA 3GIGB 3R92A 3Q5LA 4HYPA 5CTUA 4YKYA 2YKIA 2Q8HA 1ZXMA 4O04A 2BU7A 4FMTA 2XX4A 2XJXA 2GFDA 4MP2A 4EFTA 2WI7A 3H4LA 1ID0A 3PEHA 3T1KA 4O05A 2WI4A 3B26A 4ZKIA 1TILA 3OW6A 5CTWA 3ZXQA 2IOPA 2WI5A 3QTFA 3RLRA 4YKZA 2YEJA 4CWTA 2QF6A 5D6QA 4CWQA 4YKQA 3Q5KA 2FXSA 4KSHA 3ZXOA 1I59A 2YKCA 1AJ6A 1H7SA 2O1VA 3INXA 1YC4A 5FNDA 1UY9A 4XIPA 5D6PA 4AS9A 3CWVA 4U7OA 3TZ0A 3T0ZA 4H7QA 1GKXA 1GJVA 4KFGA 2JJCA 3R4NA 5M4NA 2WI2A 1QZRA 4MPCA 4L94A 2YGAA 1US7A 4LPBA 3TZ4A 4AWOA 4HZ0A 1UYIA 5CF0A 2YEGA 2YE9A 4EMVA 2H55A 1BKNA 2EXLA 4YKTA 5BODA 3GIEA 3ZM7A 3T0HA 1ZXNA 3FV5A 4HXZA 4XDMA 1GKZA 5J71A 1MU5A 4XD8A 1I58A 3KE6A 1AMWA 2YK9A 2JKIA 4MOTA 1OSFA 3T2SA 3VHDA 1I5CA 1AH8A 4GQTA 1S16A 3TZ5A 2WERA
chains in the Genus database with same CATH superfamily
2VWCA 2YJXA 3RKZA 5M4PA 4WUCA 2BU2A 3JZ3A 4ZVIA 2QFOA 3K98A 1I5DA 2XK2A 3S5TA 3G75A 1YSRA 4U93A 2XDUA 3OMUA 2VCJA 2BU6A 3EKOA 3HYZA 3LNUA 4GEEA 2YE5A 2BYHA 2HG1A 3IEDA 4CE2A 2UWDA 2YEIA 4WUBA 2K5BA 3BMYA 4ASAA 2YKEA 4K4OA 3A0WA 2Q8IA 1UYHA 1Y4UA 1TBWA 4GFNA 4CWOA 3BM9A 3K99A 4QPKA 4URMA 3D2RA 4U7NA 2GQPA 4HY1A 4BXIA 1F51A 4H81A 2YKJA 1YSZA 2CCSA 1Z5AA 3B28A 3A0XA 1KZNA 4BQJA 2YGEA 1YT2A 4GT8A 3PEJA 3G7BA 1KIJA 4LWGA 2BRCA 4AWPA 2O1WA 1BGQA 2YI5A 2AKPA 1TIDA 3LPSA 2HKJA 3A0YA 2IWUA 2YE3A 4CWNA 2YEDA 2VW5A 3HYYA 4ASFA 2ZBKB 4L8ZA 3CYGA 4Q20A 3A0RA 2BSMA 4R3AA 3EHFA 2IWXA 1UYGA 2YE7A 1YERA 3TUHA 4QPJA 2CH4A 2Q8GA 4CWRA 1S14A 4E72A 4NH8A 4HXWA 2CG9A 2XCMA 4WUDA 4EGIA 4PRVA 4H85A 3RLPA 4JQLA 5FNCA 2CCTA 4V26A 1ZW9A 2YEFA 2O1UA 2QG0A 5F5RA 4I3HA 1L0OA 3OPDA 2XHRA 4L91A 2YI0A 4FCQA 3VHCA 3R4MA 1YC3A 5M4HA 1A4HA 3C0EA 1YT1A 2BYIA 4URNA 4EEHA 1EA6A 2BTZA 3ZKDA 3B24A 3O0IA 4ASBA 1THNA 4EGHA 3D0BA 2Q2EB 4R3MA 4P8OA 3HEKA 3O6OA 1TC6A 2ZDXA 1I5BA 2YEEA 1NHIA 3B25A 1JM6A 2H8MA 5CTYA 2WEQA 3EHHA 4LWEA 4MP7A 3B27A 5IDMA 2ZKJA 2YJWA 1YESA 2HCHA 4KSGA 4XC0A 3CRKA 4CE1A 2FWYA 3R4PA 5FNFA 4XE2A 4URLA 4HYMA 2FYPA 1Y8PA 3K97A 2YK2A 2IOQA 4PRXA 2IWSA 3MNRP 3QDDA 1UY7A 1UYDA 1YETA 4I5SA 1Z5BA 4X9LA 1ZWHA 3C11A 4CE3A 3HZ5A 2WI1A 5C93A 2CGFA 4E01A 2XJGA 5IDJA 5M4KA 4GCZA 1UYLA 4B7PA 1Y8NA 4KTNA 4XCJA 5CPHA 2BT0A 1Z5CA 2BREA 2XJJA 2XDSA 4L93A 3T10A 3K60A 1U0ZA 1UYEA 4O0BA 2XHTA 4EGKA 2PNRA 4BIZA 2XDKA 1YT0A 1PVGA 4KP4A 3R91A 1TC0A 3SL2A 4XIRA 3VADA 2BZ5A 4YKUA 4XIQA 4LWHA 1TH8A 4BQGA 2YI6A 2YEBA 3EHJA 4XTJA 4XKOA 3CRLA 5L3JA 2YEHA 2FWZA 3CGYA 1UYMA 2IORA 1NHJA 2XABA 4XITA 2HHIA 4BIUA 4LWFA 1UY6A 2XDXA 4L90A 4UROA 3DGEA 4HZ5A 2XHXA 3CGZA 1UY8A 4MPNA 2WI6A 3U67A 4PU9A 1UYCA 4DZYA 4EM7A 1I5AA 3HHUA 4LWIA 4MBCA 4E02A 5GGZA 1NHHA 2BU5A 4EFUA 3EHGA 2YI7A 1QYEA 4HY6A 4JASA 3U2DA 5M4MA 2QG2A 2XD6A 1MX0A 4NH7A 5J6AA 1BYQA 3RLQA 5D7DA 2CCUA 2YKBA 3TZ2A 3INWA 4ASGA 5IN9A 1B3QA 3FT8A 3A0ZA 1UYKA 1EI1A 2XX2A 2YE8A 3EKRA 4O07A 3H80A 4R1FA 3GIFA 2ESAA 3NMQA 1UYFA 3GIGA 4B6CA 2E0AA 3OWDA 3ZKBA 1YC1A 4PL9A 4JAVA 4MPEA 4YKWA 1AH6A 5CTXA 1R62A 2Q8FA 3WQ9A 4FCPA 5D7RA 4XCLA 3A0TA 5F3KA 2XX5A 5M4EA 2YECA 2ZDYA 3TTZA 3Q5JA 3HZ1A 4XKAA 3WHAA 3R4OA 3O2FA 4YKXA 1QY8A 2VCIA 3OWBA 1BXDA 3D36A 1Z59A 4KQVA 4MB9A 4E00A 4O09A 5FWKA 4YKRA 2YGFA 2C2AA 4CWSA 3FT5A 4V25A 1AM1A 3LMMA 4XKKA 4AWQA 4CWPA 2XDLA 5BOCA 2YE6A 2YE4A 4LP0A 4BAEA 1H7UA 3G7EA 5D7CA 2WEPA 1B63A 4NH9A 3VHAA 4GGLA 4W7TA 4JAUA 2C1IA 1U2OA 1Y4SA 4P7AA 4FPPA 3U2KA 2BU8A 1YS3A 4DUHA 1Y8OA 2YE2A 2WI3A 1B62A 4FCRA 2YEAA 4CWFA 3GIGB 3R92A 3Q5LA 2FTKA 4HYPA 5CTUA 4YKYA 2YKIA 2Q8HA 1ZXMA 4O04A 2BU7A 4FMTA 2XX4A 2XJXA 2GFDA 4MP2A 4EFTA 2WI7A 3H4LA 1ID0A 3PEHA 3T1KA 4O05A 2WI4A 3B26A 4ZKIA 1TILA 3OW6A 5CTWA 3ZXQA 2IOPA 2WI5A 3QTFA 3RLRA 4YKZA 2YEJA 4CWTA 2QF6A 5D6QA 4CWQA 4YKQA 3Q5KA 2FXSA 4KSHA 3ZXOA 1I59A 2YKCA 1AJ6A 1H7SA 2O1VA 3INXA 1YC4A 5FNDA 1UY9A 2C1GA 4XIPA 5D6PA 4AS9A 3CWVA 4U7OA 3TZ0A 3T0ZA 4H7QA 1GKXA 1GJVA 4KFGA 2JJCA 3R4NA 5M4NA 2WI2A 1QZRA 4MPCA 4L94A 2YGAA 1US7A 4LPBA 3TZ4A 4AWOA 4HZ0A 1UYIA 5CF0A 1IXMA 5JENA 2YEGA 2YE9A 4EMVA 2H55A 1BKNA 2EXLA 4YKTA 5BODA 3GIEA 3ZM7A 3T0HA 1ZXNA 3FV5A 4HXZA 4XDMA 1GKZA 5J71A 1MU5A 4XD8A 1I58A 3KE6A 1AMWA 2YK9A 2JKIA 4MOTA 1OSFA 3T2SA 3VHDA 1I5CA 1AH8A 4GQTA 1S16A 3TZ5A 2WERA
chains in the Genus database with same CATH topology
2VWCA 2YJXA 3RKZA 5M4PA 4WUCA 2BU2A 3JZ3A 4ZVIA 2QFOA 3K98A 1I5DA 2XK2A 3G75A 1YSRA 4U93A 2XDUA 3OMUA 2VCJA 2BU6A 3EKOA 3HYZA 3LNUA 4GEEA 2YE5A 2BYHA 2HG1A 3IEDA 4CE2A 2UWDA 2YEIA 4WUBA 2K5BA 3BMYA 4ASAA 2YKEA 4K4OA 3A0WA 2Q8IA 1UYHA 1Y4UA 1TBWA 4GFNA 4CWOA 3BM9A 3K99A 4QPKA 4URMA 3D2RA 4U7NA 2GQPA 4HY1A 4BXIA 4H81A 2YKJA 1YSZA 2CCSA 1Z5AA 3B28A 3A0XA 1KZNA 4BQJA 2YGEA 1YT2A 4GT8A 3PEJA 3G7BA 1KIJA 4LWGA 2BRCA 4AWPA 2O1WA 1BGQA 2YI5A 2AKPA 1TIDA 3LPSA 2HKJA 3A0YA 2IWUA 2YE3A 4CWNA 2YEDA 2VW5A 3HYYA 4ASFA 2ZBKB 4L8ZA 4Q20A 3A0RA 2BSMA 4R3AA 3EHFA 2IWXA 1UYGA 2YE7A 1YERA 3TUHA 4QPJA 2CH4A 2Q8GA 4CWRA 1S14A 4NH8A 4HXWA 2CG9A 2XCMA 4WUDA 4EGIA 4PRVA 4H85A 3RLPA 4JQLA 5FNCA 2CCTA 4V26A 1ZW9A 2YEFA 2O1UA 2QG0A 5F5RA 4I3HA 1L0OA 3OPDA 2XHRA 4L91A 2YI0A 4FCQA 3VHCA 3R4MA 1YC3A 5M4HA 1A4HA 3C0EA 1YT1A 2BYIA 4URNA 4EEHA 1EA6A 2BTZA 3ZKDA 3B24A 3O0IA 4ASBA 1THNA 4EGHA 3D0BA 2Q2EB 4R3MA 4P8OA 3HEKA 3O6OA 1TC6A 2ZDXA 1I5BA 2YEEA 1NHIA 3B25A 1JM6A 2H8MA 5CTYA 2WEQA 3EHHA 4LWEA 4MP7A 3B27A 5IDMA 2ZKJA 2YJWA 1YESA 2HCHA 4KSGA 4XC0A 3CRKA 4CE1A 2FWYA 3R4PA 5FNFA 4XE2A 4URLA 4HYMA 2FYPA 1Y8PA 3K97A 2YK2A 2IOQA 4PRXA 2IWSA 3MNRP 3QDDA 1UY7A 1UYDA 1YETA 4I5SA 1Z5BA 4X9LA 1ZWHA 3C11A 4CE3A 3HZ5A 2WI1A 5C93A 2CGFA 4E01A 2XJGA 5IDJA 5M4KA 4GCZA 1UYLA 4B7PA 1Y8NA 4KTNA 4XCJA 5CPHA 2BT0A 1Z5CA 2BREA 2XJJA 2XDSA 4L93A 3T10A 3K60A 1U0ZA 1UYEA 4O0BA 2XHTA 4EGKA 2PNRA 4BIZA 2XDKA 1YT0A 1PVGA 4KP4A 3R91A 1TC0A 3SL2A 4XIRA 3VADA 2BZ5A 4YKUA 4XIQA 4LWHA 1TH8A 4BQGA 2YI6A 2YEBA 3EHJA 4XTJA 4XKOA 3CRLA 5L3JA 2YEHA 2FWZA 3CGYA 1UYMA 2IORA 1NHJA 2XABA 4XITA 4BIUA 4LWFA 1UY6A 2XDXA 4L90A 4UROA 3DGEA 4HZ5A 2XHXA 3CGZA 1UY8A 4MPNA 2WI6A 3U67A 4PU9A 1UYCA 4DZYA 4EM7A 1I5AA 3HHUA 4LWIA 4MBCA 4E02A 5GGZA 1NHHA 2BU5A 4EFUA 3EHGA 2YI7A 1QYEA 4HY6A 4JASA 3U2DA 5M4MA 2QG2A 2XD6A 1MX0A 4NH7A 5J6AA 1BYQA 3RLQA 5D7DA 2CCUA 2YKBA 3TZ2A 3INWA 4ASGA 5IN9A 1B3QA 3FT8A 3A0ZA 1UYKA 1EI1A 2XX2A 2YE8A 3EKRA 4O07A 3H80A 4R1FA 3GIFA 2ESAA 3NMQA 1UYFA 3GIGA 4B6CA 2E0AA 3OWDA 3ZKBA 1YC1A 4PL9A 4JAVA 4MPEA 4YKWA 1AH6A 5CTXA 1R62A 2Q8FA 3WQ9A 4FCPA 5D7RA 4XCLA 3A0TA 5F3KA 2XX5A 5M4EA 2YECA 2ZDYA 3TTZA 3Q5JA 3HZ1A 4XKAA 3WHAA 3R4OA 3O2FA 4YKXA 1QY8A 2VCIA 3OWBA 1BXDA 3D36A 1Z59A 4KQVA 4MB9A 4E00A 4O09A 5FWKA 4YKRA 2YGFA 2C2AA 4CWSA 3FT5A 4V25A 1AM1A 4XKKA 4AWQA 4CWPA 2XDLA 5BOCA 2YE6A 2YE4A 4LP0A 4BAEA 1H7UA 3G7EA 5D7CA 2WEPA 1B63A 4NH9A 3VHAA 4GGLA 4W7TA 4JAUA 1U2OA 1Y4SA 4P7AA 4FPPA 3U2KA 2BU8A 1YS3A 4DUHA 1Y8OA 2YE2A 2WI3A 1B62A 4FCRA 2YEAA 4CWFA 3GIGB 3R92A 3Q5LA 4HYPA 5CTUA 4YKYA 2YKIA 2Q8HA 1ZXMA 4O04A 2BU7A 4FMTA 2XX4A 2XJXA 2GFDA 4MP2A 4EFTA 2WI7A 3H4LA 1ID0A 3PEHA 3T1KA 4O05A 2WI4A 3B26A 4ZKIA 1TILA 3OW6A 5CTWA 3ZXQA 2IOPA 2WI5A 3QTFA 3RLRA 4YKZA 2YEJA 4CWTA 2QF6A 5D6QA 4CWQA 4YKQA 3Q5KA 2FXSA 4KSHA 3ZXOA 1I59A 2YKCA 1AJ6A 1H7SA 2O1VA 3INXA 1YC4A 5FNDA 1UY9A 4XIPA 5D6PA 4AS9A 3CWVA 4U7OA 3TZ0A 3T0ZA 4H7QA 1GKXA 1GJVA 4KFGA 2JJCA 3R4NA 5M4NA 2WI2A 1QZRA 4MPCA 4L94A 2YGAA 1US7A 4LPBA 3TZ4A 4AWOA 4HZ0A 1UYIA 5CF0A 2YEGA 2YE9A 4EMVA 2H55A 1BKNA 2EXLA 4YKTA 5BODA 3GIEA 3ZM7A 3T0HA 1ZXNA 3FV5A 4HXZA 4XDMA 1GKZA 5J71A 1MU5A 4XD8A 1I58A 3KE6A 1AMWA 2YK9A 2JKIA 4MOTA 1OSFA 3T2SA 3VHDA 1I5CA 1AH8A 4GQTA 1S16A 3TZ5A 2WERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VWC A;  2YJX A;  3RKZ A;  5M4P A;  4WUC A;  2BU2 A;  3JZ3 A;  4ZVI A;  2QFO A;  3K98 A;  1I5D A;  2XK2 A;  3G75 A;  1YSR A;  4U93 A;  2XDU A;  3OMU A;  2VCJ A;  2BU6 A;  3EKO A;  3HYZ A;  3LNU A;  4GEE A;  2YE5 A;  2BYH A;  2HG1 A;  3IED A;  4CE2 A;  2UWD A;  2YEI A;  4WUB A;  2K5B A;  3BMY A;  4ASA A;  2YKE A;  4K4O A;  3A0W A;  2Q8I A;  1UYH A;  1Y4U A;  1TBW A;  4GFN A;  4CWO A;  3BM9 A;  3K99 A;  4QPK A;  4URM A;  3D2R A;  4U7N A;  2GQP A;  4HY1 A;  4BXI A;  4H81 A;  2YKJ A;  1YSZ A;  2CCS A;  1Z5A A;  3B28 A;  3A0X A;  1KZN A;  4BQJ A;  2YGE A;  1YT2 A;  4GT8 A;  3PEJ A;  3G7B A;  1KIJ A;  4LWG A;  2BRC A;  4AWP A;  2O1W A;  1BGQ A;  2YI5 A;  2AKP A;  1TID A;  3LPS A;  2HKJ A;  3A0Y A;  2IWU A;  2YE3 A;  4CWN A;  2YED A;  2VW5 A;  3HYY A;  4ASF A;  2ZBK B;  4L8Z A;  4Q20 A;  3A0R A;  2BSM A;  4R3A A;  3EHF A;  2IWX A;  1UYG A;  2YE7 A;  1YER A;  3TUH A;  4QPJ A;  2CH4 A;  2Q8G A;  4CWR A;  1S14 A;  4NH8 A;  4HXW A;  2CG9 A;  2XCM A;  4WUD A;  4EGI A;  4PRV A;  4H85 A;  3RLP A;  4JQL A;  5FNC A;  2CCT A;  4V26 A;  1ZW9 A;  2YEF A;  2O1U A;  2QG0 A;  5F5R A;  4I3H A;  1L0O A;  3OPD A;  2XHR A;  4L91 A;  2YI0 A;  4FCQ A;  3VHC A;  3R4M A;  1YC3 A;  5M4H A;  1A4H A;  3C0E A;  1YT1 A;  2BYI A;  4URN A;  4EEH A;  1EA6 A;  2BTZ A;  3ZKD A;  3B24 A;  3O0I A;  4ASB A;  1THN A;  4EGH A;  3D0B A;  2Q2E B;  4R3M A;  4P8O A;  3HEK A;  3O6O A;  1TC6 A;  2ZDX A;  1I5B A;  2YEE A;  1NHI A;  3B25 A;  1JM6 A;  2H8M A;  5CTY A;  2WEQ A;  3EHH A;  4LWE A;  4MP7 A;  3B27 A;  5IDM A;  2ZKJ A;  2YJW A;  1YES A;  2HCH A;  4KSG A;  4XC0 A;  3CRK A;  4CE1 A;  2FWY A;  3R4P A;  5FNF A;  4XE2 A;  4URL A;  4HYM A;  2FYP A;  1Y8P A;  3K97 A;  2YK2 A;  2IOQ A;  4PRX A;  2IWS A;  3MNR P;  3QDD A;  1UY7 A;  1UYD A;  1YET A;  4I5S A;  1Z5B A;  4X9L A;  1ZWH A;  3C11 A;  4CE3 A;  3HZ5 A;  2WI1 A;  5C93 A;  2CGF A;  4E01 A;  2XJG A;  5IDJ A;  5M4K A;  4GCZ A;  1UYL A;  4B7P A;  1Y8N A;  4KTN A;  4XCJ A;  5CPH A;  2BT0 A;  1Z5C A;  2BRE A;  2XJJ A;  2XDS A;  4L93 A;  3T10 A;  3K60 A;  1U0Z A;  1UYE A;  4O0B A;  2XHT A;  4EGK A;  2PNR A;  4BIZ A;  2XDK A;  1YT0 A;  1PVG A;  4KP4 A;  3R91 A;  1TC0 A;  3SL2 A;  4XIR A;  3VAD A;  2BZ5 A;  4YKU A;  4XIQ A;  4LWH A;  1TH8 A;  4BQG A;  2YI6 A;  2YEB A;  3EHJ A;  4XTJ A;  4XKO A;  3CRL A;  5L3J A;  2YEH A;  2FWZ A;  3CGY A;  1UYM A;  2IOR A;  1NHJ A;  2XAB A;  4XIT A;  4BIU A;  4LWF A;  1UY6 A;  2XDX A;  4L90 A;  4URO A;  3DGE A;  4HZ5 A;  2XHX A;  3CGZ A;  1UY8 A;  4MPN A;  2WI6 A;  3U67 A;  4PU9 A;  1UYC A;  4DZY A;  4EM7 A;  1I5A A;  3HHU A;  4LWI A;  4MBC A;  4E02 A;  5GGZ A;  1NHH A;  2BU5 A;  4EFU A;  3EHG A;  2YI7 A;  1QYE A;  4HY6 A;  4JAS A;  3U2D A;  5M4M A;  2QG2 A;  2XD6 A;  1MX0 A;  4NH7 A;  5J6A A;  1BYQ A;  3RLQ A;  5D7D A;  2CCU A;  2YKB A;  3TZ2 A;  3INW A;  4ASG A;  5IN9 A;  1B3Q A;  3FT8 A;  3A0Z A;  1UYK A;  1EI1 A;  2XX2 A;  2YE8 A;  3EKR A;  4O07 A;  3H80 A;  4R1F A;  3GIF A;  2ESA A;  3NMQ A;  1UYF A;  3GIG A;  4B6C A;  2E0A A;  3OWD A;  3ZKB A;  1YC1 A;  4PL9 A;  4JAV A;  4MPE A;  4YKW A;  1AH6 A;  5CTX A;  1R62 A;  2Q8F A;  3WQ9 A;  4FCP A;  5D7R A;  4XCL A;  3A0T A;  5F3K A;  2XX5 A;  5M4E A;  2YEC A;  2ZDY A;  3TTZ A;  3Q5J A;  3HZ1 A;  4XKA A;  3WHA A;  3R4O A;  3O2F A;  4YKX A;  1QY8 A;  2VCI A;  3OWB A;  1BXD A;  3D36 A;  1Z59 A;  4KQV A;  4MB9 A;  4E00 A;  4O09 A;  5FWK A;  4YKR A;  2YGF A;  2C2A A;  4CWS A;  3FT5 A;  4V25 A;  1AM1 A;  4XKK A;  4AWQ A;  4CWP A;  2XDL A;  5BOC A;  2YE6 A;  2YE4 A;  4LP0 A;  4BAE A;  1H7U A;  3G7E A;  5D7C A;  2WEP A;  1B63 A;  4NH9 A;  3VHA A;  4GGL A;  4W7T A;  4JAU A;  1U2O A;  1Y4S A;  4P7A A;  4FPP A;  3U2K A;  2BU8 A;  1YS3 A;  4DUH A;  1Y8O A;  2YE2 A;  2WI3 A;  1B62 A;  4FCR A;  2YEA A;  4CWF A;  3GIG B;  3R92 A;  3Q5L A;  4HYP A;  5CTU A;  4YKY A;  2YKI A;  2Q8H A;  1ZXM A;  4O04 A;  2BU7 A;  4FMT A;  2XX4 A;  2XJX A;  2GFD A;  4MP2 A;  4EFT A;  2WI7 A;  3H4L A;  1ID0 A;  3PEH A;  3T1K A;  4O05 A;  2WI4 A;  3B26 A;  4ZKI A;  1TIL A;  3OW6 A;  5CTW A;  3ZXQ A;  2IOP A;  2WI5 A;  3QTF A;  3RLR A;  4YKZ A;  2YEJ A;  4CWT A;  2QF6 A;  5D6Q A;  4CWQ A;  4YKQ A;  3Q5K A;  2FXS A;  4KSH A;  3ZXO A;  1I59 A;  2YKC A;  1AJ6 A;  1H7S A;  2O1V A;  3INX A;  1YC4 A;  5FND A;  1UY9 A;  4XIP A;  5D6P A;  4AS9 A;  3CWV A;  4U7O A;  3TZ0 A;  3T0Z A;  4H7Q A;  1GKX A;  1GJV A;  4KFG A;  2JJC A;  3R4N A;  5M4N A;  2WI2 A;  1QZR A;  4MPC A;  4L94 A;  2YGA A;  1US7 A;  4LPB A;  3TZ4 A;  4AWO A;  4HZ0 A;  1UYI A;  5CF0 A;  2YEG A;  2YE9 A;  4EMV A;  2H55 A;  1BKN A;  2EXL A;  4YKT A;  5BOD A;  3GIE A;  3ZM7 A;  3T0H A;  1ZXN A;  3FV5 A;  4HXZ A;  4XDM A;  1GKZ A;  5J71 A;  1MU5 A;  4XD8 A;  1I58 A;  3KE6 A;  1AMW A;  2YK9 A;  2JKI A;  4MOT A;  1OSF A;  3T2S A;  3VHD A;  1I5C A;  1AH8 A;  4GQT A;  1S16 A;  3TZ5 A;  2WER A; 
#chains in the Genus database with same CATH topology
 2VWC A;  2YJX A;  3RKZ A;  5M4P A;  4WUC A;  2BU2 A;  3JZ3 A;  4ZVI A;  2QFO A;  3K98 A;  1I5D A;  2XK2 A;  3S5T A;  3G75 A;  1YSR A;  4U93 A;  2XDU A;  3OMU A;  2VCJ A;  2BU6 A;  3EKO A;  3HYZ A;  3LNU A;  4GEE A;  2YE5 A;  2BYH A;  2HG1 A;  3IED A;  4CE2 A;  2UWD A;  2YEI A;  4WUB A;  2K5B A;  3BMY A;  4ASA A;  2YKE A;  4K4O A;  3A0W A;  2Q8I A;  1UYH A;  1Y4U A;  1TBW A;  4GFN A;  4CWO A;  3BM9 A;  3K99 A;  4QPK A;  4URM A;  3D2R A;  4U7N A;  2GQP A;  4HY1 A;  4BXI A;  1F51 A;  4H81 A;  2YKJ A;  1YSZ A;  2CCS A;  1Z5A A;  3B28 A;  3A0X A;  1KZN A;  4BQJ A;  2YGE A;  1YT2 A;  4GT8 A;  3PEJ A;  3G7B A;  1KIJ A;  4LWG A;  2BRC A;  4AWP A;  2O1W A;  1BGQ A;  2YI5 A;  2AKP A;  1TID A;  3LPS A;  2HKJ A;  3A0Y A;  2IWU A;  2YE3 A;  4CWN A;  2YED A;  2VW5 A;  3HYY A;  4ASF A;  2ZBK B;  4L8Z A;  3CYG A;  4Q20 A;  3A0R A;  2BSM A;  4R3A A;  3EHF A;  2IWX A;  1UYG A;  2YE7 A;  1YER A;  3TUH A;  4QPJ A;  2CH4 A;  2Q8G A;  4CWR A;  1S14 A;  4E72 A;  4NH8 A;  4HXW A;  2CG9 A;  2XCM A;  4WUD A;  4EGI A;  4PRV A;  4H85 A;  3RLP A;  4JQL A;  5FNC A;  2CCT A;  4V26 A;  1ZW9 A;  2YEF A;  2O1U A;  2QG0 A;  5F5R A;  4I3H A;  1L0O A;  3OPD A;  2XHR A;  4L91 A;  2YI0 A;  4FCQ A;  3VHC A;  3R4M A;  1YC3 A;  5M4H A;  1A4H A;  3C0E A;  1YT1 A;  2BYI A;  4URN A;  4EEH A;  1EA6 A;  2BTZ A;  3ZKD A;  3B24 A;  3O0I A;  4ASB A;  1THN A;  4EGH A;  3D0B A;  2Q2E B;  4R3M A;  4P8O A;  3HEK A;  3O6O A;  1TC6 A;  2ZDX A;  1I5B A;  2YEE A;  1NHI A;  3B25 A;  1JM6 A;  2H8M A;  5CTY A;  2WEQ A;  3EHH A;  4LWE A;  4MP7 A;  3B27 A;  5IDM A;  2ZKJ A;  2YJW A;  1YES A;  2HCH A;  4KSG A;  4XC0 A;  3CRK A;  4CE1 A;  2FWY A;  3R4P A;  5FNF A;  4XE2 A;  4URL A;  4HYM A;  2FYP A;  1Y8P A;  3K97 A;  2YK2 A;  2IOQ A;  4PRX A;  2IWS A;  3MNR P;  3QDD A;  1UY7 A;  1UYD A;  1YET A;  4I5S A;  1Z5B A;  4X9L A;  1ZWH A;  3C11 A;  4CE3 A;  3HZ5 A;  2WI1 A;  5C93 A;  2CGF A;  4E01 A;  2XJG A;  5IDJ A;  5M4K A;  4GCZ A;  1UYL A;  4B7P A;  1Y8N A;  4KTN A;  4XCJ A;  5CPH A;  2BT0 A;  1Z5C A;  2BRE A;  2XJJ A;  2XDS A;  4L93 A;  3T10 A;  3K60 A;  1U0Z A;  1UYE A;  4O0B A;  2XHT A;  4EGK A;  2PNR A;  4BIZ A;  2XDK A;  1YT0 A;  1PVG A;  4KP4 A;  3R91 A;  1TC0 A;  3SL2 A;  4XIR A;  3VAD A;  2BZ5 A;  4YKU A;  4XIQ A;  4LWH A;  1TH8 A;  4BQG A;  2YI6 A;  2YEB A;  3EHJ A;  4XTJ A;  4XKO A;  3CRL A;  5L3J A;  2YEH A;  2FWZ A;  3CGY A;  1UYM A;  2IOR A;  1NHJ A;  2XAB A;  4XIT A;  2HHI A;  4BIU A;  4LWF A;  1UY6 A;  2XDX A;  4L90 A;  4URO A;  3DGE A;  4HZ5 A;  2XHX A;  3CGZ A;  1UY8 A;  4MPN A;  2WI6 A;  3U67 A;  4PU9 A;  1UYC A;  4DZY A;  4EM7 A;  1I5A A;  3HHU A;  4LWI A;  4MBC A;  4E02 A;  5GGZ A;  1NHH A;  2BU5 A;  4EFU A;  3EHG A;  2YI7 A;  1QYE A;  4HY6 A;  4JAS A;  3U2D A;  5M4M A;  2QG2 A;  2XD6 A;  1MX0 A;  4NH7 A;  5J6A A;  1BYQ A;  3RLQ A;  5D7D A;  2CCU A;  2YKB A;  3TZ2 A;  3INW A;  4ASG A;  5IN9 A;  1B3Q A;  3FT8 A;  3A0Z A;  1UYK A;  1EI1 A;  2XX2 A;  2YE8 A;  3EKR A;  4O07 A;  3H80 A;  4R1F A;  3GIF A;  2ESA A;  3NMQ A;  1UYF A;  3GIG A;  4B6C A;  2E0A A;  3OWD A;  3ZKB A;  1YC1 A;  4PL9 A;  4JAV A;  4MPE A;  4YKW A;  1AH6 A;  5CTX A;  1R62 A;  2Q8F A;  3WQ9 A;  4FCP A;  5D7R A;  4XCL A;  3A0T A;  5F3K A;  2XX5 A;  5M4E A;  2YEC A;  2ZDY A;  3TTZ A;  3Q5J A;  3HZ1 A;  4XKA A;  3WHA A;  3R4O A;  3O2F A;  4YKX A;  1QY8 A;  2VCI A;  3OWB A;  1BXD A;  3D36 A;  1Z59 A;  4KQV A;  4MB9 A;  4E00 A;  4O09 A;  5FWK A;  4YKR A;  2YGF A;  2C2A A;  4CWS A;  3FT5 A;  4V25 A;  1AM1 A;  3LMM A;  4XKK A;  4AWQ A;  4CWP A;  2XDL A;  5BOC A;  2YE6 A;  2YE4 A;  4LP0 A;  4BAE A;  1H7U A;  3G7E A;  5D7C A;  2WEP A;  1B63 A;  4NH9 A;  3VHA A;  4GGL A;  4W7T A;  4JAU A;  2C1I A;  1U2O A;  1Y4S A;  4P7A A;  4FPP A;  3U2K A;  2BU8 A;  1YS3 A;  4DUH A;  1Y8O A;  2YE2 A;  2WI3 A;  1B62 A;  4FCR A;  2YEA A;  4CWF A;  3GIG B;  3R92 A;  3Q5L A;  2FTK A;  4HYP A;  5CTU A;  4YKY A;  2YKI A;  2Q8H A;  1ZXM A;  4O04 A;  2BU7 A;  4FMT A;  2XX4 A;  2XJX A;  2GFD A;  4MP2 A;  4EFT A;  2WI7 A;  3H4L A;  1ID0 A;  3PEH A;  3T1K A;  4O05 A;  2WI4 A;  3B26 A;  4ZKI A;  1TIL A;  3OW6 A;  5CTW A;  3ZXQ A;  2IOP A;  2WI5 A;  3QTF A;  3RLR A;  4YKZ A;  2YEJ A;  4CWT A;  2QF6 A;  5D6Q A;  4CWQ A;  4YKQ A;  3Q5K A;  2FXS A;  4KSH A;  3ZXO A;  1I59 A;  2YKC A;  1AJ6 A;  1H7S A;  2O1V A;  3INX A;  1YC4 A;  5FND A;  1UY9 A;  2C1G A;  4XIP A;  5D6P A;  4AS9 A;  3CWV A;  4U7O A;  3TZ0 A;  3T0Z A;  4H7Q A;  1GKX A;  1GJV A;  4KFG A;  2JJC A;  3R4N A;  5M4N A;  2WI2 A;  1QZR A;  4MPC A;  4L94 A;  2YGA A;  1US7 A;  4LPB A;  3TZ4 A;  4AWO A;  4HZ0 A;  1UYI A;  5CF0 A;  1IXM A;  5JEN A;  2YEG A;  2YE9 A;  4EMV A;  2H55 A;  1BKN A;  2EXL A;  4YKT A;  5BOD A;  3GIE A;  3ZM7 A;  3T0H A;  1ZXN A;  3FV5 A;  4HXZ A;  4XDM A;  1GKZ A;  5J71 A;  1MU5 A;  4XD8 A;  1I58 A;  3KE6 A;  1AMW A;  2YK9 A;  2JKI A;  4MOT A;  1OSF A;  3T2S A;  3VHD A;  1I5C A;  1AH8 A;  4GQT A;  1S16 A;  3TZ5 A;  2WER A; 
#chains in the Genus database with same CATH homology
 2VWC A;  2YJX A;  3RKZ A;  5M4P A;  4WUC A;  2BU2 A;  3JZ3 A;  4ZVI A;  2QFO A;  3K98 A;  1I5D A;  2XK2 A;  3G75 A;  1YSR A;  4U93 A;  2XDU A;  3OMU A;  2VCJ A;  2BU6 A;  3EKO A;  3HYZ A;  3LNU A;  4GEE A;  2YE5 A;  2BYH A;  2HG1 A;  3IED A;  4CE2 A;  2UWD A;  2YEI A;  4WUB A;  2K5B A;  3BMY A;  4ASA A;  2YKE A;  4K4O A;  3A0W A;  2Q8I A;  1UYH A;  1Y4U A;  1TBW A;  4GFN A;  4CWO A;  3BM9 A;  3K99 A;  4QPK A;  4URM A;  3D2R A;  4U7N A;  2GQP A;  4HY1 A;  4BXI A;  4H81 A;  2YKJ A;  1YSZ A;  2CCS A;  1Z5A A;  3B28 A;  3A0X A;  1KZN A;  4BQJ A;  2YGE A;  1YT2 A;  4GT8 A;  3PEJ A;  3G7B A;  1KIJ A;  4LWG A;  2BRC A;  4AWP A;  2O1W A;  1BGQ A;  2YI5 A;  2AKP A;  1TID A;  3LPS A;  2HKJ A;  3A0Y A;  2IWU A;  2YE3 A;  4CWN A;  2YED A;  2VW5 A;  3HYY A;  4ASF A;  2ZBK B;  4L8Z A;  4Q20 A;  3A0R A;  2BSM A;  4R3A A;  3EHF A;  2IWX A;  1UYG A;  2YE7 A;  1YER A;  3TUH A;  4QPJ A;  2CH4 A;  2Q8G A;  4CWR A;  1S14 A;  4NH8 A;  4HXW A;  2CG9 A;  2XCM A;  4WUD A;  4EGI A;  4PRV A;  4H85 A;  3RLP A;  4JQL A;  5FNC A;  2CCT A;  4V26 A;  1ZW9 A;  2YEF A;  2O1U A;  2QG0 A;  5F5R A;  4I3H A;  1L0O A;  3OPD A;  2XHR A;  4L91 A;  2YI0 A;  4FCQ A;  3VHC A;  3R4M A;  1YC3 A;  5M4H A;  1A4H A;  3C0E A;  1YT1 A;  2BYI A;  4URN A;  4EEH A;  1EA6 A;  2BTZ A;  3ZKD A;  3B24 A;  3O0I A;  4ASB A;  1THN A;  4EGH A;  3D0B A;  2Q2E B;  4R3M A;  4P8O A;  3HEK A;  3O6O A;  1TC6 A;  2ZDX A;  1I5B A;  2YEE A;  1NHI A;  3B25 A;  1JM6 A;  2H8M A;  5CTY A;  2WEQ A;  3EHH A;  4LWE A;  4MP7 A;  3B27 A;  5IDM A;  2ZKJ A;  2YJW A;  1YES A;  2HCH A;  4KSG A;  4XC0 A;  3CRK A;  4CE1 A;  2FWY A;  3R4P A;  5FNF A;  4XE2 A;  4URL A;  4HYM A;  2FYP A;  1Y8P A;  3K97 A;  2YK2 A;  2IOQ A;  4PRX A;  2IWS A;  3MNR P;  3QDD A;  1UY7 A;  1UYD A;  1YET A;  4I5S A;  1Z5B A;  4X9L A;  1ZWH A;  3C11 A;  4CE3 A;  3HZ5 A;  2WI1 A;  5C93 A;  2CGF A;  4E01 A;  2XJG A;  5IDJ A;  5M4K A;  4GCZ A;  1UYL A;  4B7P A;  1Y8N A;  4KTN A;  4XCJ A;  5CPH A;  2BT0 A;  1Z5C A;  2BRE A;  2XJJ A;  2XDS A;  4L93 A;  3T10 A;  3K60 A;  1U0Z A;  1UYE A;  4O0B A;  2XHT A;  4EGK A;  2PNR A;  4BIZ A;  2XDK A;  1YT0 A;  1PVG A;  4KP4 A;  3R91 A;  1TC0 A;  3SL2 A;  4XIR A;  3VAD A;  2BZ5 A;  4YKU A;  4XIQ A;  4LWH A;  1TH8 A;  4BQG A;  2YI6 A;  2YEB A;  3EHJ A;  4XTJ A;  4XKO A;  3CRL A;  5L3J A;  2YEH A;  2FWZ A;  3CGY A;  1UYM A;  2IOR A;  1NHJ A;  2XAB A;  4XIT A;  4BIU A;  4LWF A;  1UY6 A;  2XDX A;  4L90 A;  4URO A;  3DGE A;  4HZ5 A;  2XHX A;  3CGZ A;  1UY8 A;  4MPN A;  2WI6 A;  3U67 A;  4PU9 A;  1UYC A;  4DZY A;  4EM7 A;  1I5A A;  3HHU A;  4LWI A;  4MBC A;  4E02 A;  5GGZ A;  1NHH A;  2BU5 A;  4EFU A;  3EHG A;  2YI7 A;  1QYE A;  4HY6 A;  4JAS A;  3U2D A;  5M4M A;  2QG2 A;  2XD6 A;  1MX0 A;  4NH7 A;  5J6A A;  1BYQ A;  3RLQ A;  5D7D A;  2CCU A;  2YKB A;  3TZ2 A;  3INW A;  4ASG A;  5IN9 A;  1B3Q A;  3FT8 A;  3A0Z A;  1UYK A;  1EI1 A;  2XX2 A;  2YE8 A;  3EKR A;  4O07 A;  3H80 A;  4R1F A;  3GIF A;  2ESA A;  3NMQ A;  1UYF A;  3GIG A;  4B6C A;  2E0A A;  3OWD A;  3ZKB A;  1YC1 A;  4PL9 A;  4JAV A;  4MPE A;  4YKW A;  1AH6 A;  5CTX A;  1R62 A;  2Q8F A;  3WQ9 A;  4FCP A;  5D7R A;  4XCL A;  3A0T A;  5F3K A;  2XX5 A;  5M4E A;  2YEC A;  2ZDY A;  3TTZ A;  3Q5J A;  3HZ1 A;  4XKA A;  3WHA A;  3R4O A;  3O2F A;  4YKX A;  1QY8 A;  2VCI A;  3OWB A;  1BXD A;  3D36 A;  1Z59 A;  4KQV A;  4MB9 A;  4E00 A;  4O09 A;  5FWK A;  4YKR A;  2YGF A;  2C2A A;  4CWS A;  3FT5 A;  4V25 A;  1AM1 A;  4XKK A;  4AWQ A;  4CWP A;  2XDL A;  5BOC A;  2YE6 A;  2YE4 A;  4LP0 A;  4BAE A;  1H7U A;  3G7E A;  5D7C A;  2WEP A;  1B63 A;  4NH9 A;  3VHA A;  4GGL A;  4W7T A;  4JAU A;  1U2O A;  1Y4S A;  4P7A A;  4FPP A;  3U2K A;  2BU8 A;  1YS3 A;  4DUH A;  1Y8O A;  2YE2 A;  2WI3 A;  1B62 A;  4FCR A;  2YEA A;  4CWF A;  3GIG B;  3R92 A;  3Q5L A;  4HYP A;  5CTU A;  4YKY A;  2YKI A;  2Q8H A;  1ZXM A;  4O04 A;  2BU7 A;  4FMT A;  2XX4 A;  2XJX A;  2GFD A;  4MP2 A;  4EFT A;  2WI7 A;  3H4L A;  1ID0 A;  3PEH A;  3T1K A;  4O05 A;  2WI4 A;  3B26 A;  4ZKI A;  1TIL A;  3OW6 A;  5CTW A;  3ZXQ A;  2IOP A;  2WI5 A;  3QTF A;  3RLR A;  4YKZ A;  2YEJ A;  4CWT A;  2QF6 A;  5D6Q A;  4CWQ A;  4YKQ A;  3Q5K A;  2FXS A;  4KSH A;  3ZXO A;  1I59 A;  2YKC A;  1AJ6 A;  1H7S A;  2O1V A;  3INX A;  1YC4 A;  5FND A;  1UY9 A;  4XIP A;  5D6P A;  4AS9 A;  3CWV A;  4U7O A;  3TZ0 A;  3T0Z A;  4H7Q A;  1GKX A;  1GJV A;  4KFG A;  2JJC A;  3R4N A;  5M4N A;  2WI2 A;  1QZR A;  4MPC A;  4L94 A;  2YGA A;  1US7 A;  4LPB A;  3TZ4 A;  4AWO A;  4HZ0 A;  1UYI A;  5CF0 A;  2YEG A;  2YE9 A;  4EMV A;  2H55 A;  1BKN A;  2EXL A;  4YKT A;  5BOD A;  3GIE A;  3ZM7 A;  3T0H A;  1ZXN A;  3FV5 A;  4HXZ A;  4XDM A;  1GKZ A;  5J71 A;  1MU5 A;  4XD8 A;  1I58 A;  3KE6 A;  1AMW A;  2YK9 A;  2JKI A;  4MOT A;  1OSF A;  3T2S A;  3VHD A;  1I5C A;  1AH8 A;  4GQT A;  1S16 A;  3TZ5 A;  2WER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...