5D6QA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a ligand
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
192
structure length
192
Chain Sequence
AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Azaindole Ureas as a Novel Class of Bacterial Gyrase B Inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 63
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5d6qA00
2YE5A 1THNA 3G7BA 1Y4UA 2BRCA 3KE6A 2IWSA 2BU8A 5F5RA 3T2SA 2CCSA 2YEFA 3U2KA 2IOQA 4XE2A 4U7NA 4YKRA 1Y8PA 5IDJA 2XDUA 4WUDA 3Q5JA 2XDLA 5J6AA 5FWKA 4ZVIA 1GKZA 3EKRA 2YE3A 4JAVA 1I5DA 2YEGA 4KTNA 4FCPA 2BYIA 4NH7A 1H7UA 2C2AA 3EHGA 3T10A 2IORA 3ZXOA 4CWTA 3QTFA 4YKZA 2K5BA 4EMVA 3HZ5A 4YKYA 5GGZA 2YEAA 4H7QA 3EHJA 4FMTA 4PU9A 1ID0A 2YI7A 3LNUA 2XHTA 4HY1A 3K97A 4KQVA 3RLQA 4LP0A 1I58A 3K60A 4CE1A 1TIDA 3G7EA 3H80A 1GJVA 1YC4A 1I5AA 5CTYA 2E0AA 3R91A 3T0ZA 3A0XA 1UYDA 2ZDXA 1UYHA 3EHFA 3R4MA 3ZM7A 1YT0A 1L0OA 4EFTA 4DUHA 1TC6A 1JM6A 1ZWHA 4ASGA 2QF6A 2UWDA 2YJXA 2Q8HA 1BGQA 4JASA 2QG0A 1BYQA 1ZW9A 1UY9A 2YEJA 4BQJA 4X9LA 2XK2A 3DGEA 4W7TA 1UYKA 4XIQA 1QY8A 3CWVA 1YERA 2YEHA 4MBCA 3INXA 2WEQA 2YGFA 5M4HA 4HZ0A 4XCJA 2EXLA 2WEPA 4KP4A 2BZ5A 3TTZA 1AM1A 2BTZA 1TILA 4GGLA 4L94A 2WI2A 1I59A 2YEEA 2YE7A 3GIEA 2JKIA 1MX0A 2YE8A 3OW6A 3R4OA 3O6OA 4EGKA 2BYHA 4PRXA 1GKXA 4L93A 2AKPA 2YK9A 1NHJA 1YS3A 5M4EA 2YEIA 4GT8A 4MP7A 3RKZA 1B3QA 3HEKA 3A0ZA 3K99A 4V26A 2YE2A 4CWQA 3CGZA 1B62A 2XCMA 1UYGA 1B63A 4HZ5A 4E02A 3R4NA 2ESAA 1UY8A 4FCQA 4ASBA 1I5BA 4XKAA 4LWHA 3INWA 2YE4A 1Z5AA 4BXIA 3VADA 1YSRA 4MPEA 2H8MA 1NHIA 2FWZA 4O07A 2GFDA 4E01A 4HYMA 5L3JA 4H85A 4CWOA 2H55A 4EEHA 2XDXA 2WERA 4U93A 4BQGA 4EGIA 3B25A 3HZ1A 2VWCA 2FYPA 2CGFA 2YECA 2BREA 2YKBA 4L91A 2YEDA 2XD6A 2ZDYA 1NHHA 2XJGA 1S16A 1Z5CA 4QPKA 2BU7A 3EHHA 2YKIA 4NH9A 2GQPA 4CWSA 4E00A 3RLRA 1AJ6A 1YETA 2YI0A 4MPCA 2YE9A 1Y8OA 3IEDA 2YI6A 2CH4A 4MPNA 2XDKA 5CTWA 4EM7A 4U7OA 4EGHA 4BAEA 5J71A 5D7CA 4K4OA 2FXSA 2YK2A 4O09A 4LWFA 4XDMA 3VHDA 2QFOA 2Q8FA 3WHAA 4XKKA 3CRKA 3A0TA 1YC1A 2YKCA 2XHXA 2HG1A 4YKWA 3B26A 4I3HA 2ZBKB 3B28A 5D6QA 3CRLA 2XJXA 2VCIA 4URLA 1UY6A 2XJJA 3BMYA 5IDMA 3A0RA 1YSZA 3FT8A 4O04A 1UYFA 2O1WA 1UYIA 2BT0A 4HXZA 2WI1A 4L8ZA 2XX4A 4XIRA 3R4PA 3H4LA 5FNFA 5BOCA 3TZ4A 5CPHA 1H7SA 4AS9A 4YKXA 3A0YA 4XITA 4MB9A 4R1FA 3PEHA 1QYEA 4UROA 4FCRA 1U2OA 3D36A 3C11A 4CWNA 4AWOA 1UYEA 1EA6A 5F3KA 4B7PA 2YE6A 4JQLA 3HHUA 4PL9A 2XX2A 3O2FA 4B6CA 2CCTA 2YGEA 1YESA 2WI4A 4BIZA 2FWYA 3GIFA 5CF0A 4Q20A 2BU5A 5M4NA 2Q8GA 1PVGA 1OSFA 4LWGA 1R62A 1KIJA 3O0IA 2O1VA 5CTUA 4URMA 1UY7A 1UYCA 1TC0A 3TZ5A 1QZRA 4R3MA 5D6PA 1S14A 5CTXA 3RLPA 3WQ9A 4CE2A 1MU5A 4XC0A 4MOTA 3GIGB 3G75A 4LWEA 4P8OA 2YKEA 2CG9A 3B27A 3R92A 2O1UA 4GQTA 3TZ2A 5C93A 3FV5A 1YT1A 2YKJA 1A4HA 5BODA 5M4KA 1Z5BA 4ZKIA 5FNCA 1ZXNA 1Y8NA 2QG2A 5IN9A 1UYLA 3Q5LA 4XKOA 2YEBA 3OMUA 3BM9A 3CGYA 4DZYA 4QPJA 4CE3A 3U2DA 4CWFA 4O05A 4GCZA 3D2RA 2WI6A 1YT2A 3QDDA 4HY6A 4KSHA 4P7AA 3T0HA 3EKOA 5D7RA 2XABA 3TZ0A 4AWQA 3TUHA 4HXWA 2YGAA 1BKNA 3VHAA 2BU6A 2HKJA 3ZKDA 3HYYA 5FNDA 3VHCA 3ZXQA 3OWDA 4GEEA 2XHRA 4MP2A 4V25A 3U67A 1AMWA 3SL2A 4L90A 1BXDA 2XDSA 4XD8A 1I5CA 1KZNA 2Q2EB 4I5SA 3HYZA 3LPSA 4PRVA 4LWIA 3B24A 3Q5KA 4NH8A 3GIGA 1TBWA 4XIPA 2PNRA 2WI3A 4O0BA 1YC3A 1EI1A 2CCUA 3ZKBA 1U0ZA 4WUBA 4HYPA 2XX5A 4YKQA 3T1KA 3OWBA 5D7DA 2VW5A 1Y4SA 4LPBA 2JJCA 2WI5A 2IWUA 4YKUA 4CWPA 5M4PA 4R3AA 4CWRA 4KFGA 1US7A 2Q8IA 5M4MA 2YI5A 2VCJA 3PEJA 4XCLA 2IWXA 4WUCA 4AWPA 4BIUA 4XTJA 4ASAA 4ASFA 2BSMA 3OPDA 2IOPA 2WI7A 1AH6A 4H81A 4EFUA 4YKTA 2BU2A 4FPPA 3MNRP 3NMQA 4GFNA 2YJWA 1TH8A 2HCHA 3A0WA 3D0BA 1AH8A 1ZXMA 3FT5A 2ZKJA 4JAUA 4URNA 3C0EA 3JZ3A 1UYMA 3K98A 4KSGA 1Z59A
chains in the Genus database with same CATH superfamily
2YE5A 1THNA 3G7BA 1Y4UA 2BRCA 3LMMA 3KE6A 2IWSA 2BU8A 5F5RA 3T2SA 2CCSA 2YEFA 3U2KA 2IOQA 4XE2A 4U7NA 4YKRA 1Y8PA 5IDJA 2XDUA 4WUDA 3Q5JA 2XDLA 3CYGA 5J6AA 5FWKA 4ZVIA 1GKZA 3EKRA 2YE3A 4JAVA 1I5DA 2YEGA 4KTNA 4FCPA 2BYIA 4NH7A 1H7UA 2C2AA 3EHGA 3T10A 2IORA 3ZXOA 4CWTA 3QTFA 4YKZA 2K5BA 4EMVA 3HZ5A 4YKYA 5GGZA 2YEAA 4H7QA 4FMTA 3EHJA 4PU9A 1ID0A 2YI7A 3LNUA 2XHTA 4HY1A 3K97A 4KQVA 3RLQA 4LP0A 1I58A 3K60A 4CE1A 1TIDA 3G7EA 3H80A 1GJVA 1YC4A 1I5AA 5CTYA 2E0AA 3R91A 3T0ZA 3A0XA 1UYDA 2ZDXA 1UYHA 3EHFA 3R4MA 3ZM7A 1YT0A 1L0OA 4EFTA 4DUHA 2HHIA 1TC6A 1JM6A 1ZWHA 4ASGA 2QF6A 2UWDA 2YJXA 2Q8HA 1BGQA 4JASA 2QG0A 1BYQA 1ZW9A 1UY9A 2YEJA 1IXMA 4BQJA 4X9LA 2XK2A 3DGEA 1F51A 4W7TA 1UYKA 4XIQA 1QY8A 3CWVA 1YERA 2YEHA 4MBCA 3INXA 2WEQA 2YGFA 5M4HA 4HZ0A 4XCJA 2EXLA 2WEPA 4KP4A 2BZ5A 3TTZA 1AM1A 2BTZA 1TILA 4GGLA 4L94A 2WI2A 1I59A 2YEEA 2YE7A 3GIEA 2JKIA 1MX0A 2YE8A 3OW6A 3R4OA 3O6OA 4EGKA 2BYHA 4PRXA 1GKXA 4L93A 2AKPA 2YK9A 1NHJA 1YS3A 5M4EA 2YEIA 4GT8A 4MP7A 3RKZA 1B3QA 3HEKA 3A0ZA 3K99A 4V26A 2YE2A 4CWQA 3CGZA 1B62A 2XCMA 1UYGA 1B63A 4HZ5A 4E02A 3R4NA 2ESAA 1UY8A 4FCQA 4ASBA 1I5BA 4XKAA 4LWHA 3INWA 2YE4A 1Z5AA 4BXIA 3VADA 1YSRA 4MPEA 2H8MA 1NHIA 2FWZA 4O07A 2GFDA 4E01A 4HYMA 5L3JA 4H85A 4CWOA 2H55A 4EEHA 2XDXA 2WERA 4U93A 4BQGA 4EGIA 3B25A 3HZ1A 2VWCA 2FYPA 2CGFA 2YECA 2BREA 2YKBA 4L91A 2YEDA 2XD6A 2ZDYA 1NHHA 2XJGA 1S16A 1Z5CA 4QPKA 2BU7A 3EHHA 2YKIA 4NH9A 2GQPA 4CWSA 4E00A 3RLRA 1AJ6A 1YETA 2YI0A 4MPCA 2YE9A 1Y8OA 3IEDA 2YI6A 2CH4A 4MPNA 2XDKA 5CTWA 4EM7A 4U7OA 4EGHA 4BAEA 5J71A 5D7CA 4K4OA 2FXSA 2YK2A 4O09A 4LWFA 4XDMA 3VHDA 2QFOA 2Q8FA 3WHAA 4XKKA 3CRKA 3A0TA 1YC1A 2YKCA 2XHXA 2HG1A 2FTKA 4YKWA 3B26A 4I3HA 2ZBKB 3B28A 5D6QA 3CRLA 2XJXA 2VCIA 4URLA 2C1IA 1UY6A 2XJJA 3BMYA 5IDMA 3A0RA 1YSZA 3FT8A 4O04A 1UYFA 2O1WA 1UYIA 2BT0A 4HXZA 2WI1A 4L8ZA 2XX4A 4XIRA 3R4PA 3H4LA 5FNFA 5BOCA 3TZ4A 5CPHA 1H7SA 4AS9A 4YKXA 3A0YA 4XITA 4MB9A 4R1FA 3PEHA 1QYEA 4UROA 4FCRA 1U2OA 3D36A 3C11A 4CWNA 4AWOA 1UYEA 1EA6A 5F3KA 4B7PA 2YE6A 4JQLA 3HHUA 4PL9A 2XX2A 3O2FA 4B6CA 2CCTA 2YGEA 3S5TA 1YESA 2WI4A 4BIZA 2FWYA 3GIFA 5CF0A 4Q20A 2BU5A 5M4NA 2Q8GA 1PVGA 1OSFA 4LWGA 1R62A 1KIJA 3O0IA 2O1VA 5CTUA 4URMA 1UY7A 1UYCA 1TC0A 5JENA 3TZ5A 1QZRA 4R3MA 5D6PA 1S14A 5CTXA 3RLPA 3WQ9A 4CE2A 1MU5A 4XC0A 4MOTA 3GIGB 3G75A 4LWEA 4P8OA 2YKEA 2CG9A 3B27A 3R92A 2O1UA 4GQTA 3TZ2A 5C93A 3FV5A 1YT1A 2YKJA 1A4HA 5BODA 5M4KA 1Z5BA 4ZKIA 5FNCA 1ZXNA 1Y8NA 2QG2A 5IN9A 1UYLA 3Q5LA 4XKOA 2YEBA 3OMUA 3BM9A 3CGYA 4DZYA 4QPJA 4CE3A 3U2DA 4CWFA 4O05A 4GCZA 3D2RA 2WI6A 1YT2A 3QDDA 4HY6A 4KSHA 4P7AA 3T0HA 3EKOA 5D7RA 2XABA 3TZ0A 4AWQA 3TUHA 4HXWA 2YGAA 1BKNA 3VHAA 2BU6A 2HKJA 3ZKDA 3HYYA 5FNDA 3VHCA 3ZXQA 3OWDA 4GEEA 2XHRA 4MP2A 4V25A 3U67A 1AMWA 3SL2A 4L90A 1BXDA 2XDSA 4XD8A 1I5CA 1KZNA 4E72A 2Q2EB 4I5SA 3HYZA 3LPSA 4PRVA 2C1GA 4LWIA 3B24A 3Q5KA 4NH8A 3GIGA 1TBWA 4XIPA 2PNRA 2WI3A 4O0BA 1YC3A 1EI1A 2CCUA 3ZKBA 1U0ZA 4WUBA 4HYPA 2XX5A 4YKQA 3T1KA 3OWBA 5D7DA 2VW5A 1Y4SA 4LPBA 2JJCA 2WI5A 2IWUA 4YKUA 4CWPA 5M4PA 4R3AA 4CWRA 4KFGA 1US7A 2Q8IA 5M4MA 2YI5A 2VCJA 3PEJA 4XCLA 2IWXA 4WUCA 4AWPA 4BIUA 4XTJA 4ASAA 4ASFA 2BSMA 3OPDA 2IOPA 2WI7A 1AH6A 4H81A 4EFUA 4YKTA 2BU2A 4FPPA 3MNRP 3NMQA 4GFNA 2YJWA 1TH8A 2HCHA 3A0WA 3D0BA 1AH8A 1ZXMA 3FT5A 2ZKJA 4JAUA 4URNA 3C0EA 3JZ3A 1UYMA 3K98A 4KSGA 1Z59A
chains in the Genus database with same CATH topology
2YE5A 1THNA 3G7BA 1Y4UA 2BRCA 3KE6A 2IWSA 2BU8A 5F5RA 3T2SA 2CCSA 2YEFA 3U2KA 2IOQA 4XE2A 4U7NA 4YKRA 1Y8PA 5IDJA 2XDUA 4WUDA 3Q5JA 2XDLA 5J6AA 5FWKA 4ZVIA 1GKZA 3EKRA 2YE3A 4JAVA 1I5DA 2YEGA 4KTNA 4FCPA 2BYIA 4NH7A 1H7UA 2C2AA 3EHGA 3T10A 2IORA 3ZXOA 4CWTA 3QTFA 4YKZA 2K5BA 4EMVA 3HZ5A 4YKYA 5GGZA 2YEAA 4H7QA 3EHJA 4FMTA 4PU9A 1ID0A 2YI7A 3LNUA 2XHTA 4HY1A 3K97A 4KQVA 3RLQA 4LP0A 1I58A 3K60A 4CE1A 1TIDA 3G7EA 3H80A 1GJVA 1YC4A 1I5AA 5CTYA 2E0AA 3R91A 3T0ZA 3A0XA 1UYDA 2ZDXA 1UYHA 3EHFA 3R4MA 3ZM7A 1YT0A 1L0OA 4EFTA 4DUHA 1TC6A 1JM6A 1ZWHA 4ASGA 2QF6A 2UWDA 2YJXA 2Q8HA 1BGQA 4JASA 2QG0A 1BYQA 1ZW9A 1UY9A 2YEJA 4BQJA 4X9LA 2XK2A 3DGEA 4W7TA 1UYKA 4XIQA 1QY8A 3CWVA 1YERA 2YEHA 4MBCA 3INXA 2WEQA 2YGFA 5M4HA 4HZ0A 4XCJA 2EXLA 2WEPA 4KP4A 2BZ5A 3TTZA 1AM1A 2BTZA 1TILA 4GGLA 4L94A 2WI2A 1I59A 2YEEA 2YE7A 3GIEA 2JKIA 1MX0A 2YE8A 3OW6A 3R4OA 3O6OA 4EGKA 2BYHA 4PRXA 1GKXA 4L93A 2AKPA 2YK9A 1NHJA 1YS3A 5M4EA 2YEIA 4GT8A 4MP7A 3RKZA 1B3QA 3HEKA 3A0ZA 3K99A 4V26A 2YE2A 4CWQA 3CGZA 1B62A 2XCMA 1UYGA 1B63A 4HZ5A 4E02A 3R4NA 2ESAA 1UY8A 4FCQA 4ASBA 1I5BA 4XKAA 4LWHA 3INWA 2YE4A 1Z5AA 4BXIA 3VADA 1YSRA 4MPEA 2H8MA 1NHIA 2FWZA 4O07A 2GFDA 4E01A 4HYMA 5L3JA 4H85A 4CWOA 2H55A 4EEHA 2XDXA 2WERA 4U93A 4BQGA 4EGIA 3B25A 3HZ1A 2VWCA 2FYPA 2CGFA 2YECA 2BREA 2YKBA 4L91A 2YEDA 2XD6A 2ZDYA 1NHHA 2XJGA 1S16A 1Z5CA 4QPKA 2BU7A 3EHHA 2YKIA 4NH9A 2GQPA 4CWSA 4E00A 3RLRA 1AJ6A 1YETA 2YI0A 4MPCA 2YE9A 1Y8OA 3IEDA 2YI6A 2CH4A 4MPNA 2XDKA 5CTWA 4EM7A 4U7OA 4EGHA 4BAEA 5J71A 5D7CA 4K4OA 2FXSA 2YK2A 4O09A 4LWFA 4XDMA 3VHDA 2QFOA 2Q8FA 3WHAA 4XKKA 3CRKA 3A0TA 1YC1A 2YKCA 2XHXA 2HG1A 4YKWA 3B26A 4I3HA 2ZBKB 3B28A 5D6QA 3CRLA 2XJXA 2VCIA 4URLA 1UY6A 2XJJA 3BMYA 5IDMA 3A0RA 1YSZA 3FT8A 4O04A 1UYFA 2O1WA 1UYIA 2BT0A 4HXZA 2WI1A 4L8ZA 2XX4A 4XIRA 3R4PA 3H4LA 5FNFA 5BOCA 3TZ4A 5CPHA 1H7SA 4AS9A 4YKXA 3A0YA 4XITA 4MB9A 4R1FA 3PEHA 1QYEA 4UROA 4FCRA 1U2OA 3D36A 3C11A 4CWNA 4AWOA 1UYEA 1EA6A 5F3KA 4B7PA 2YE6A 4JQLA 3HHUA 4PL9A 2XX2A 3O2FA 4B6CA 2CCTA 2YGEA 1YESA 2WI4A 4BIZA 2FWYA 3GIFA 5CF0A 4Q20A 2BU5A 5M4NA 2Q8GA 1PVGA 1OSFA 4LWGA 1R62A 1KIJA 3O0IA 2O1VA 5CTUA 4URMA 1UY7A 1UYCA 1TC0A 3TZ5A 1QZRA 4R3MA 5D6PA 1S14A 5CTXA 3RLPA 3WQ9A 4CE2A 1MU5A 4XC0A 4MOTA 3GIGB 3G75A 4LWEA 4P8OA 2YKEA 2CG9A 3B27A 3R92A 2O1UA 4GQTA 3TZ2A 5C93A 3FV5A 1YT1A 2YKJA 1A4HA 5BODA 5M4KA 1Z5BA 4ZKIA 5FNCA 1ZXNA 1Y8NA 2QG2A 5IN9A 1UYLA 3Q5LA 4XKOA 2YEBA 3OMUA 3BM9A 3CGYA 4DZYA 4QPJA 4CE3A 3U2DA 4CWFA 4O05A 4GCZA 3D2RA 2WI6A 1YT2A 3QDDA 4HY6A 4KSHA 4P7AA 3T0HA 3EKOA 5D7RA 2XABA 3TZ0A 4AWQA 3TUHA 4HXWA 2YGAA 1BKNA 3VHAA 2BU6A 2HKJA 3ZKDA 3HYYA 5FNDA 3VHCA 3ZXQA 3OWDA 4GEEA 2XHRA 4MP2A 4V25A 3U67A 1AMWA 3SL2A 4L90A 1BXDA 2XDSA 4XD8A 1I5CA 1KZNA 2Q2EB 4I5SA 3HYZA 3LPSA 4PRVA 4LWIA 3B24A 3Q5KA 4NH8A 3GIGA 1TBWA 4XIPA 2PNRA 2WI3A 4O0BA 1YC3A 1EI1A 2CCUA 3ZKBA 1U0ZA 4WUBA 4HYPA 2XX5A 4YKQA 3T1KA 3OWBA 5D7DA 2VW5A 1Y4SA 4LPBA 2JJCA 2WI5A 2IWUA 4YKUA 4CWPA 5M4PA 4R3AA 4CWRA 4KFGA 1US7A 2Q8IA 5M4MA 2YI5A 2VCJA 3PEJA 4XCLA 2IWXA 4WUCA 4AWPA 4BIUA 4XTJA 4ASAA 4ASFA 2BSMA 3OPDA 2IOPA 2WI7A 1AH6A 4H81A 4EFUA 4YKTA 2BU2A 4FPPA 3MNRP 3NMQA 4GFNA 2YJWA 1TH8A 2HCHA 3A0WA 3D0BA 1AH8A 1ZXMA 3FT5A 2ZKJA 4JAUA 4URNA 3C0EA 3JZ3A 1UYMA 3K98A 4KSGA 1Z59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YE5 A;  1THN A;  3G7B A;  1Y4U A;  2BRC A;  3KE6 A;  2IWS A;  2BU8 A;  5F5R A;  3T2S A;  2CCS A;  2YEF A;  3U2K A;  2IOQ A;  4XE2 A;  4U7N A;  4YKR A;  1Y8P A;  5IDJ A;  2XDU A;  4WUD A;  3Q5J A;  2XDL A;  5J6A A;  5FWK A;  4ZVI A;  1GKZ A;  3EKR A;  2YE3 A;  4JAV A;  1I5D A;  2YEG A;  4KTN A;  4FCP A;  2BYI A;  4NH7 A;  1H7U A;  2C2A A;  3EHG A;  3T10 A;  2IOR A;  3ZXO A;  4CWT A;  3QTF A;  4YKZ A;  2K5B A;  4EMV A;  3HZ5 A;  4YKY A;  5GGZ A;  2YEA A;  4H7Q A;  3EHJ A;  4FMT A;  4PU9 A;  1ID0 A;  2YI7 A;  3LNU A;  2XHT A;  4HY1 A;  3K97 A;  4KQV A;  3RLQ A;  4LP0 A;  1I58 A;  3K60 A;  4CE1 A;  1TID A;  3G7E A;  3H80 A;  1GJV A;  1YC4 A;  1I5A A;  5CTY A;  2E0A A;  3R91 A;  3T0Z A;  3A0X A;  1UYD A;  2ZDX A;  1UYH A;  3EHF A;  3R4M A;  3ZM7 A;  1YT0 A;  1L0O A;  4EFT A;  4DUH A;  1TC6 A;  1JM6 A;  1ZWH A;  4ASG A;  2QF6 A;  2UWD A;  2YJX A;  2Q8H A;  1BGQ A;  4JAS A;  2QG0 A;  1BYQ A;  1ZW9 A;  1UY9 A;  2YEJ A;  4BQJ A;  4X9L A;  2XK2 A;  3DGE A;  4W7T A;  1UYK A;  4XIQ A;  1QY8 A;  3CWV A;  1YER A;  2YEH A;  4MBC A;  3INX A;  2WEQ A;  2YGF A;  5M4H A;  4HZ0 A;  4XCJ A;  2EXL A;  2WEP A;  4KP4 A;  2BZ5 A;  3TTZ A;  1AM1 A;  2BTZ A;  1TIL A;  4GGL A;  4L94 A;  2WI2 A;  1I59 A;  2YEE A;  2YE7 A;  3GIE A;  2JKI A;  1MX0 A;  2YE8 A;  3OW6 A;  3R4O A;  3O6O A;  4EGK A;  2BYH A;  4PRX A;  1GKX A;  4L93 A;  2AKP A;  2YK9 A;  1NHJ A;  1YS3 A;  5M4E A;  2YEI A;  4GT8 A;  4MP7 A;  3RKZ A;  1B3Q A;  3HEK A;  3A0Z A;  3K99 A;  4V26 A;  2YE2 A;  4CWQ A;  3CGZ A;  1B62 A;  2XCM A;  1UYG A;  1B63 A;  4HZ5 A;  4E02 A;  3R4N A;  2ESA A;  1UY8 A;  4FCQ A;  4ASB A;  1I5B A;  4XKA A;  4LWH A;  3INW A;  2YE4 A;  1Z5A A;  4BXI A;  3VAD A;  1YSR A;  4MPE A;  2H8M A;  1NHI A;  2FWZ A;  4O07 A;  2GFD A;  4E01 A;  4HYM A;  5L3J A;  4H85 A;  4CWO A;  2H55 A;  4EEH A;  2XDX A;  2WER A;  4U93 A;  4BQG A;  4EGI A;  3B25 A;  3HZ1 A;  2VWC A;  2FYP A;  2CGF A;  2YEC A;  2BRE A;  2YKB A;  4L91 A;  2YED A;  2XD6 A;  2ZDY A;  1NHH A;  2XJG A;  1S16 A;  1Z5C A;  4QPK A;  2BU7 A;  3EHH A;  2YKI A;  4NH9 A;  2GQP A;  4CWS A;  4E00 A;  3RLR A;  1AJ6 A;  1YET A;  2YI0 A;  4MPC A;  2YE9 A;  1Y8O A;  3IED A;  2YI6 A;  2CH4 A;  4MPN A;  2XDK A;  5CTW A;  4EM7 A;  4U7O A;  4EGH A;  4BAE A;  5J71 A;  5D7C A;  4K4O A;  2FXS A;  2YK2 A;  4O09 A;  4LWF A;  4XDM A;  3VHD A;  2QFO A;  2Q8F A;  3WHA A;  4XKK A;  3CRK A;  3A0T A;  1YC1 A;  2YKC A;  2XHX A;  2HG1 A;  4YKW A;  3B26 A;  4I3H A;  2ZBK B;  3B28 A;  5D6Q A;  3CRL A;  2XJX A;  2VCI A;  4URL A;  1UY6 A;  2XJJ A;  3BMY A;  5IDM A;  3A0R A;  1YSZ A;  3FT8 A;  4O04 A;  1UYF A;  2O1W A;  1UYI A;  2BT0 A;  4HXZ A;  2WI1 A;  4L8Z A;  2XX4 A;  4XIR A;  3R4P A;  3H4L A;  5FNF A;  5BOC A;  3TZ4 A;  5CPH A;  1H7S A;  4AS9 A;  4YKX A;  3A0Y A;  4XIT A;  4MB9 A;  4R1F A;  3PEH A;  1QYE A;  4URO A;  4FCR A;  1U2O A;  3D36 A;  3C11 A;  4CWN A;  4AWO A;  1UYE A;  1EA6 A;  5F3K A;  4B7P A;  2YE6 A;  4JQL A;  3HHU A;  4PL9 A;  2XX2 A;  3O2F A;  4B6C A;  2CCT A;  2YGE A;  1YES A;  2WI4 A;  4BIZ A;  2FWY A;  3GIF A;  5CF0 A;  4Q20 A;  2BU5 A;  5M4N A;  2Q8G A;  1PVG A;  1OSF A;  4LWG A;  1R62 A;  1KIJ A;  3O0I A;  2O1V A;  5CTU A;  4URM A;  1UY7 A;  1UYC A;  1TC0 A;  3TZ5 A;  1QZR A;  4R3M A;  5D6P A;  1S14 A;  5CTX A;  3RLP A;  3WQ9 A;  4CE2 A;  1MU5 A;  4XC0 A;  4MOT A;  3GIG B;  3G75 A;  4LWE A;  4P8O A;  2YKE A;  2CG9 A;  3B27 A;  3R92 A;  2O1U A;  4GQT A;  3TZ2 A;  5C93 A;  3FV5 A;  1YT1 A;  2YKJ A;  1A4H A;  5BOD A;  5M4K A;  1Z5B A;  4ZKI A;  5FNC A;  1ZXN A;  1Y8N A;  2QG2 A;  5IN9 A;  1UYL A;  3Q5L A;  4XKO A;  2YEB A;  3OMU A;  3BM9 A;  3CGY A;  4DZY A;  4QPJ A;  4CE3 A;  3U2D A;  4CWF A;  4O05 A;  4GCZ A;  3D2R A;  2WI6 A;  1YT2 A;  3QDD A;  4HY6 A;  4KSH A;  4P7A A;  3T0H A;  3EKO A;  5D7R A;  2XAB A;  3TZ0 A;  4AWQ A;  3TUH A;  4HXW A;  2YGA A;  1BKN A;  3VHA A;  2BU6 A;  2HKJ A;  3ZKD A;  3HYY A;  5FND A;  3VHC A;  3ZXQ A;  3OWD A;  4GEE A;  2XHR A;  4MP2 A;  4V25 A;  3U67 A;  1AMW A;  3SL2 A;  4L90 A;  1BXD A;  2XDS A;  4XD8 A;  1I5C A;  1KZN A;  2Q2E B;  4I5S A;  3HYZ A;  3LPS A;  4PRV A;  4LWI A;  3B24 A;  3Q5K A;  4NH8 A;  3GIG A;  1TBW A;  4XIP A;  2PNR A;  2WI3 A;  4O0B A;  1YC3 A;  1EI1 A;  2CCU A;  3ZKB A;  1U0Z A;  4WUB A;  4HYP A;  2XX5 A;  4YKQ A;  3T1K A;  3OWB A;  5D7D A;  2VW5 A;  1Y4S A;  4LPB A;  2JJC A;  2WI5 A;  2IWU A;  4YKU A;  4CWP A;  5M4P A;  4R3A A;  4CWR A;  4KFG A;  1US7 A;  2Q8I A;  5M4M A;  2YI5 A;  2VCJ A;  3PEJ A;  4XCL A;  2IWX A;  4WUC A;  4AWP A;  4BIU A;  4XTJ A;  4ASA A;  4ASF A;  2BSM A;  3OPD A;  2IOP A;  2WI7 A;  1AH6 A;  4H81 A;  4EFU A;  4YKT A;  2BU2 A;  4FPP A;  3MNR P;  3NMQ A;  4GFN A;  2YJW A;  1TH8 A;  2HCH A;  3A0W A;  3D0B A;  1AH8 A;  1ZXM A;  3FT5 A;  2ZKJ A;  4JAU A;  4URN A;  3C0E A;  3JZ3 A;  1UYM A;  3K98 A;  4KSG A;  1Z59 A; 
#chains in the Genus database with same CATH topology
 2YE5 A;  1THN A;  3G7B A;  1Y4U A;  2BRC A;  3LMM A;  3KE6 A;  2IWS A;  2BU8 A;  5F5R A;  3T2S A;  2CCS A;  2YEF A;  3U2K A;  2IOQ A;  4XE2 A;  4U7N A;  4YKR A;  1Y8P A;  5IDJ A;  2XDU A;  4WUD A;  3Q5J A;  2XDL A;  3CYG A;  5J6A A;  5FWK A;  4ZVI A;  1GKZ A;  3EKR A;  2YE3 A;  4JAV A;  1I5D A;  2YEG A;  4KTN A;  4FCP A;  2BYI A;  4NH7 A;  1H7U A;  2C2A A;  3EHG A;  3T10 A;  2IOR A;  3ZXO A;  4CWT A;  3QTF A;  4YKZ A;  2K5B A;  4EMV A;  3HZ5 A;  4YKY A;  5GGZ A;  2YEA A;  4H7Q A;  4FMT A;  3EHJ A;  4PU9 A;  1ID0 A;  2YI7 A;  3LNU A;  2XHT A;  4HY1 A;  3K97 A;  4KQV A;  3RLQ A;  4LP0 A;  1I58 A;  3K60 A;  4CE1 A;  1TID A;  3G7E A;  3H80 A;  1GJV A;  1YC4 A;  1I5A A;  5CTY A;  2E0A A;  3R91 A;  3T0Z A;  3A0X A;  1UYD A;  2ZDX A;  1UYH A;  3EHF A;  3R4M A;  3ZM7 A;  1YT0 A;  1L0O A;  4EFT A;  4DUH A;  2HHI A;  1TC6 A;  1JM6 A;  1ZWH A;  4ASG A;  2QF6 A;  2UWD A;  2YJX A;  2Q8H A;  1BGQ A;  4JAS A;  2QG0 A;  1BYQ A;  1ZW9 A;  1UY9 A;  2YEJ A;  1IXM A;  4BQJ A;  4X9L A;  2XK2 A;  3DGE A;  1F51 A;  4W7T A;  1UYK A;  4XIQ A;  1QY8 A;  3CWV A;  1YER A;  2YEH A;  4MBC A;  3INX A;  2WEQ A;  2YGF A;  5M4H A;  4HZ0 A;  4XCJ A;  2EXL A;  2WEP A;  4KP4 A;  2BZ5 A;  3TTZ A;  1AM1 A;  2BTZ A;  1TIL A;  4GGL A;  4L94 A;  2WI2 A;  1I59 A;  2YEE A;  2YE7 A;  3GIE A;  2JKI A;  1MX0 A;  2YE8 A;  3OW6 A;  3R4O A;  3O6O A;  4EGK A;  2BYH A;  4PRX A;  1GKX A;  4L93 A;  2AKP A;  2YK9 A;  1NHJ A;  1YS3 A;  5M4E A;  2YEI A;  4GT8 A;  4MP7 A;  3RKZ A;  1B3Q A;  3HEK A;  3A0Z A;  3K99 A;  4V26 A;  2YE2 A;  4CWQ A;  3CGZ A;  1B62 A;  2XCM A;  1UYG A;  1B63 A;  4HZ5 A;  4E02 A;  3R4N A;  2ESA A;  1UY8 A;  4FCQ A;  4ASB A;  1I5B A;  4XKA A;  4LWH A;  3INW A;  2YE4 A;  1Z5A A;  4BXI A;  3VAD A;  1YSR A;  4MPE A;  2H8M A;  1NHI A;  2FWZ A;  4O07 A;  2GFD A;  4E01 A;  4HYM A;  5L3J A;  4H85 A;  4CWO A;  2H55 A;  4EEH A;  2XDX A;  2WER A;  4U93 A;  4BQG A;  4EGI A;  3B25 A;  3HZ1 A;  2VWC A;  2FYP A;  2CGF A;  2YEC A;  2BRE A;  2YKB A;  4L91 A;  2YED A;  2XD6 A;  2ZDY A;  1NHH A;  2XJG A;  1S16 A;  1Z5C A;  4QPK A;  2BU7 A;  3EHH A;  2YKI A;  4NH9 A;  2GQP A;  4CWS A;  4E00 A;  3RLR A;  1AJ6 A;  1YET A;  2YI0 A;  4MPC A;  2YE9 A;  1Y8O A;  3IED A;  2YI6 A;  2CH4 A;  4MPN A;  2XDK A;  5CTW A;  4EM7 A;  4U7O A;  4EGH A;  4BAE A;  5J71 A;  5D7C A;  4K4O A;  2FXS A;  2YK2 A;  4O09 A;  4LWF A;  4XDM A;  3VHD A;  2QFO A;  2Q8F A;  3WHA A;  4XKK A;  3CRK A;  3A0T A;  1YC1 A;  2YKC A;  2XHX A;  2HG1 A;  2FTK A;  4YKW A;  3B26 A;  4I3H A;  2ZBK B;  3B28 A;  5D6Q A;  3CRL A;  2XJX A;  2VCI A;  4URL A;  2C1I A;  1UY6 A;  2XJJ A;  3BMY A;  5IDM A;  3A0R A;  1YSZ A;  3FT8 A;  4O04 A;  1UYF A;  2O1W A;  1UYI A;  2BT0 A;  4HXZ A;  2WI1 A;  4L8Z A;  2XX4 A;  4XIR A;  3R4P A;  3H4L A;  5FNF A;  5BOC A;  3TZ4 A;  5CPH A;  1H7S A;  4AS9 A;  4YKX A;  3A0Y A;  4XIT A;  4MB9 A;  4R1F A;  3PEH A;  1QYE A;  4URO A;  4FCR A;  1U2O A;  3D36 A;  3C11 A;  4CWN A;  4AWO A;  1UYE A;  1EA6 A;  5F3K A;  4B7P A;  2YE6 A;  4JQL A;  3HHU A;  4PL9 A;  2XX2 A;  3O2F A;  4B6C A;  2CCT A;  2YGE A;  3S5T A;  1YES A;  2WI4 A;  4BIZ A;  2FWY A;  3GIF A;  5CF0 A;  4Q20 A;  2BU5 A;  5M4N A;  2Q8G A;  1PVG A;  1OSF A;  4LWG A;  1R62 A;  1KIJ A;  3O0I A;  2O1V A;  5CTU A;  4URM A;  1UY7 A;  1UYC A;  1TC0 A;  5JEN A;  3TZ5 A;  1QZR A;  4R3M A;  5D6P A;  1S14 A;  5CTX A;  3RLP A;  3WQ9 A;  4CE2 A;  1MU5 A;  4XC0 A;  4MOT A;  3GIG B;  3G75 A;  4LWE A;  4P8O A;  2YKE A;  2CG9 A;  3B27 A;  3R92 A;  2O1U A;  4GQT A;  3TZ2 A;  5C93 A;  3FV5 A;  1YT1 A;  2YKJ A;  1A4H A;  5BOD A;  5M4K A;  1Z5B A;  4ZKI A;  5FNC A;  1ZXN A;  1Y8N A;  2QG2 A;  5IN9 A;  1UYL A;  3Q5L A;  4XKO A;  2YEB A;  3OMU A;  3BM9 A;  3CGY A;  4DZY A;  4QPJ A;  4CE3 A;  3U2D A;  4CWF A;  4O05 A;  4GCZ A;  3D2R A;  2WI6 A;  1YT2 A;  3QDD A;  4HY6 A;  4KSH A;  4P7A A;  3T0H A;  3EKO A;  5D7R A;  2XAB A;  3TZ0 A;  4AWQ A;  3TUH A;  4HXW A;  2YGA A;  1BKN A;  3VHA A;  2BU6 A;  2HKJ A;  3ZKD A;  3HYY A;  5FND A;  3VHC A;  3ZXQ A;  3OWD A;  4GEE A;  2XHR A;  4MP2 A;  4V25 A;  3U67 A;  1AMW A;  3SL2 A;  4L90 A;  1BXD A;  2XDS A;  4XD8 A;  1I5C A;  1KZN A;  4E72 A;  2Q2E B;  4I5S A;  3HYZ A;  3LPS A;  4PRV A;  2C1G A;  4LWI A;  3B24 A;  3Q5K A;  4NH8 A;  3GIG A;  1TBW A;  4XIP A;  2PNR A;  2WI3 A;  4O0B A;  1YC3 A;  1EI1 A;  2CCU A;  3ZKB A;  1U0Z A;  4WUB A;  4HYP A;  2XX5 A;  4YKQ A;  3T1K A;  3OWB A;  5D7D A;  2VW5 A;  1Y4S A;  4LPB A;  2JJC A;  2WI5 A;  2IWU A;  4YKU A;  4CWP A;  5M4P A;  4R3A A;  4CWR A;  4KFG A;  1US7 A;  2Q8I A;  5M4M A;  2YI5 A;  2VCJ A;  3PEJ A;  4XCL A;  2IWX A;  4WUC A;  4AWP A;  4BIU A;  4XTJ A;  4ASA A;  4ASF A;  2BSM A;  3OPD A;  2IOP A;  2WI7 A;  1AH6 A;  4H81 A;  4EFU A;  4YKT A;  2BU2 A;  4FPP A;  3MNR P;  3NMQ A;  4GFN A;  2YJW A;  1TH8 A;  2HCH A;  3A0W A;  3D0B A;  1AH8 A;  1ZXM A;  3FT5 A;  2ZKJ A;  4JAU A;  4URN A;  3C0E A;  3JZ3 A;  1UYM A;  3K98 A;  4KSG A;  1Z59 A; 
#chains in the Genus database with same CATH homology
 2YE5 A;  1THN A;  3G7B A;  1Y4U A;  2BRC A;  3KE6 A;  2IWS A;  2BU8 A;  5F5R A;  3T2S A;  2CCS A;  2YEF A;  3U2K A;  2IOQ A;  4XE2 A;  4U7N A;  4YKR A;  1Y8P A;  5IDJ A;  2XDU A;  4WUD A;  3Q5J A;  2XDL A;  5J6A A;  5FWK A;  4ZVI A;  1GKZ A;  3EKR A;  2YE3 A;  4JAV A;  1I5D A;  2YEG A;  4KTN A;  4FCP A;  2BYI A;  4NH7 A;  1H7U A;  2C2A A;  3EHG A;  3T10 A;  2IOR A;  3ZXO A;  4CWT A;  3QTF A;  4YKZ A;  2K5B A;  4EMV A;  3HZ5 A;  4YKY A;  5GGZ A;  2YEA A;  4H7Q A;  3EHJ A;  4FMT A;  4PU9 A;  1ID0 A;  2YI7 A;  3LNU A;  2XHT A;  4HY1 A;  3K97 A;  4KQV A;  3RLQ A;  4LP0 A;  1I58 A;  3K60 A;  4CE1 A;  1TID A;  3G7E A;  3H80 A;  1GJV A;  1YC4 A;  1I5A A;  5CTY A;  2E0A A;  3R91 A;  3T0Z A;  3A0X A;  1UYD A;  2ZDX A;  1UYH A;  3EHF A;  3R4M A;  3ZM7 A;  1YT0 A;  1L0O A;  4EFT A;  4DUH A;  1TC6 A;  1JM6 A;  1ZWH A;  4ASG A;  2QF6 A;  2UWD A;  2YJX A;  2Q8H A;  1BGQ A;  4JAS A;  2QG0 A;  1BYQ A;  1ZW9 A;  1UY9 A;  2YEJ A;  4BQJ A;  4X9L A;  2XK2 A;  3DGE A;  4W7T A;  1UYK A;  4XIQ A;  1QY8 A;  3CWV A;  1YER A;  2YEH A;  4MBC A;  3INX A;  2WEQ A;  2YGF A;  5M4H A;  4HZ0 A;  4XCJ A;  2EXL A;  2WEP A;  4KP4 A;  2BZ5 A;  3TTZ A;  1AM1 A;  2BTZ A;  1TIL A;  4GGL A;  4L94 A;  2WI2 A;  1I59 A;  2YEE A;  2YE7 A;  3GIE A;  2JKI A;  1MX0 A;  2YE8 A;  3OW6 A;  3R4O A;  3O6O A;  4EGK A;  2BYH A;  4PRX A;  1GKX A;  4L93 A;  2AKP A;  2YK9 A;  1NHJ A;  1YS3 A;  5M4E A;  2YEI A;  4GT8 A;  4MP7 A;  3RKZ A;  1B3Q A;  3HEK A;  3A0Z A;  3K99 A;  4V26 A;  2YE2 A;  4CWQ A;  3CGZ A;  1B62 A;  2XCM A;  1UYG A;  1B63 A;  4HZ5 A;  4E02 A;  3R4N A;  2ESA A;  1UY8 A;  4FCQ A;  4ASB A;  1I5B A;  4XKA A;  4LWH A;  3INW A;  2YE4 A;  1Z5A A;  4BXI A;  3VAD A;  1YSR A;  4MPE A;  2H8M A;  1NHI A;  2FWZ A;  4O07 A;  2GFD A;  4E01 A;  4HYM A;  5L3J A;  4H85 A;  4CWO A;  2H55 A;  4EEH A;  2XDX A;  2WER A;  4U93 A;  4BQG A;  4EGI A;  3B25 A;  3HZ1 A;  2VWC A;  2FYP A;  2CGF A;  2YEC A;  2BRE A;  2YKB A;  4L91 A;  2YED A;  2XD6 A;  2ZDY A;  1NHH A;  2XJG A;  1S16 A;  1Z5C A;  4QPK A;  2BU7 A;  3EHH A;  2YKI A;  4NH9 A;  2GQP A;  4CWS A;  4E00 A;  3RLR A;  1AJ6 A;  1YET A;  2YI0 A;  4MPC A;  2YE9 A;  1Y8O A;  3IED A;  2YI6 A;  2CH4 A;  4MPN A;  2XDK A;  5CTW A;  4EM7 A;  4U7O A;  4EGH A;  4BAE A;  5J71 A;  5D7C A;  4K4O A;  2FXS A;  2YK2 A;  4O09 A;  4LWF A;  4XDM A;  3VHD A;  2QFO A;  2Q8F A;  3WHA A;  4XKK A;  3CRK A;  3A0T A;  1YC1 A;  2YKC A;  2XHX A;  2HG1 A;  4YKW A;  3B26 A;  4I3H A;  2ZBK B;  3B28 A;  5D6Q A;  3CRL A;  2XJX A;  2VCI A;  4URL A;  1UY6 A;  2XJJ A;  3BMY A;  5IDM A;  3A0R A;  1YSZ A;  3FT8 A;  4O04 A;  1UYF A;  2O1W A;  1UYI A;  2BT0 A;  4HXZ A;  2WI1 A;  4L8Z A;  2XX4 A;  4XIR A;  3R4P A;  3H4L A;  5FNF A;  5BOC A;  3TZ4 A;  5CPH A;  1H7S A;  4AS9 A;  4YKX A;  3A0Y A;  4XIT A;  4MB9 A;  4R1F A;  3PEH A;  1QYE A;  4URO A;  4FCR A;  1U2O A;  3D36 A;  3C11 A;  4CWN A;  4AWO A;  1UYE A;  1EA6 A;  5F3K A;  4B7P A;  2YE6 A;  4JQL A;  3HHU A;  4PL9 A;  2XX2 A;  3O2F A;  4B6C A;  2CCT A;  2YGE A;  1YES A;  2WI4 A;  4BIZ A;  2FWY A;  3GIF A;  5CF0 A;  4Q20 A;  2BU5 A;  5M4N A;  2Q8G A;  1PVG A;  1OSF A;  4LWG A;  1R62 A;  1KIJ A;  3O0I A;  2O1V A;  5CTU A;  4URM A;  1UY7 A;  1UYC A;  1TC0 A;  3TZ5 A;  1QZR A;  4R3M A;  5D6P A;  1S14 A;  5CTX A;  3RLP A;  3WQ9 A;  4CE2 A;  1MU5 A;  4XC0 A;  4MOT A;  3GIG B;  3G75 A;  4LWE A;  4P8O A;  2YKE A;  2CG9 A;  3B27 A;  3R92 A;  2O1U A;  4GQT A;  3TZ2 A;  5C93 A;  3FV5 A;  1YT1 A;  2YKJ A;  1A4H A;  5BOD A;  5M4K A;  1Z5B A;  4ZKI A;  5FNC A;  1ZXN A;  1Y8N A;  2QG2 A;  5IN9 A;  1UYL A;  3Q5L A;  4XKO A;  2YEB A;  3OMU A;  3BM9 A;  3CGY A;  4DZY A;  4QPJ A;  4CE3 A;  3U2D A;  4CWF A;  4O05 A;  4GCZ A;  3D2R A;  2WI6 A;  1YT2 A;  3QDD A;  4HY6 A;  4KSH A;  4P7A A;  3T0H A;  3EKO A;  5D7R A;  2XAB A;  3TZ0 A;  4AWQ A;  3TUH A;  4HXW A;  2YGA A;  1BKN A;  3VHA A;  2BU6 A;  2HKJ A;  3ZKD A;  3HYY A;  5FND A;  3VHC A;  3ZXQ A;  3OWD A;  4GEE A;  2XHR A;  4MP2 A;  4V25 A;  3U67 A;  1AMW A;  3SL2 A;  4L90 A;  1BXD A;  2XDS A;  4XD8 A;  1I5C A;  1KZN A;  2Q2E B;  4I5S A;  3HYZ A;  3LPS A;  4PRV A;  4LWI A;  3B24 A;  3Q5K A;  4NH8 A;  3GIG A;  1TBW A;  4XIP A;  2PNR A;  2WI3 A;  4O0B A;  1YC3 A;  1EI1 A;  2CCU A;  3ZKB A;  1U0Z A;  4WUB A;  4HYP A;  2XX5 A;  4YKQ A;  3T1K A;  3OWB A;  5D7D A;  2VW5 A;  1Y4S A;  4LPB A;  2JJC A;  2WI5 A;  2IWU A;  4YKU A;  4CWP A;  5M4P A;  4R3A A;  4CWR A;  4KFG A;  1US7 A;  2Q8I A;  5M4M A;  2YI5 A;  2VCJ A;  3PEJ A;  4XCL A;  2IWX A;  4WUC A;  4AWP A;  4BIU A;  4XTJ A;  4ASA A;  4ASF A;  2BSM A;  3OPD A;  2IOP A;  2WI7 A;  1AH6 A;  4H81 A;  4EFU A;  4YKT A;  2BU2 A;  4FPP A;  3MNR P;  3NMQ A;  4GFN A;  2YJW A;  1TH8 A;  2HCH A;  3A0W A;  3D0B A;  1AH8 A;  1ZXM A;  3FT5 A;  2ZKJ A;  4JAU A;  4URN A;  3C0E A;  3JZ3 A;  1UYM A;  3K98 A;  4KSG A;  1Z59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...