3DGEA

Structure of a histidine kinase-response regulator complex reveals insights into two-component signaling and a novel cis-autophosphorylation mechanism
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
237
structure length
237
Chain Sequence
KRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein
publication title Structural Insight into Partner Specificity and Phosphoryl Transfer in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
total genus 69
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3dgeA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3dgeA02
1GJVA 4EGKA 3HYZA 3WHAA 2P67A 1H7SA 4O0BA 5F5RA 4O07A 4FMTA 2GQPA 4MTXA 4XTJA 1UY7A 2YEEA 3EKOA 2QM8A 3OWDA 4GT8A 4ZVIA 1AMWA 4HY6A 3C0EA 3NMQA 2Q8HA 5D7DA 1U0ZA 3D0BA 4HXZA 4XCJA 3K97A 4PL9A 3GIGB 2YE4A 3GIFA 2YKIA 3EHJA 1UYGA 4MT8A 3ZRVA 4HZ0A 4HZ5A 1KIJA 4YKYA 3GIEA 2PNRA 1YSRA 3R92A 1I59A 2QFOA 2XCMA 3BM9A 2YK9A 1TIDA 2BU2A 4FCQA 1OSFA 5CPHA 2XABA 3O2FA 1NHJA 4WUBA 2Q2EB 1TC0A 4XITA 2FXSA 2XK2A 3EHFA 4QPKA 5M4NA 1YT2A 4Q20A 1I5BA 2BYIA 4P8OA 2BZ5A 1UYIA 1UY8A 4CE1A 4ASFA 3TZ0A 1AJ6A 1YC3A 3BMYA 4MPEA 4O09A 3U2DA 3H80A 4YKTA 3VHCA 2QF6A 4JASA 3T2SA 4CE3A 3EKRA 2YGEA 4XC0A 1TBWA 4ASGA 2O1UA 4WUCA 3A0TA 2JJCA 3QTFA 1YSZA 4R3MA 1YERA 4BQGA 2QG2A 3HYYA 1TC6A 5CTXA 4BQJA 4MP7A 3KE6A 3U67A 2YE5A 1UYKA 1TH8A 4CWSA 2CGFA 2YEHA 2EXLA 3B24A 3FT8A 2WI5A 1KZNA 1UYFA 1UYCA 1UYLA 1YT0A 4ASBA 2HG1A 2CH4A 2LFRA 4B7PA 1UY9A 2WERA 3LNUA 4LWEA 4XD8A 5L3JA 1QZRA 3PEJA 3G75A 3ZCCA 5M4HA 5M4KA 3Q5LA 4JQLA 1QYEA 4AS9A 3HZ1A 4XCLA 4LC1A 1YS3A 4PRVA 4LWFA 5D6QA 3Q5JA 4XKOA 1GKZA 1JM6A 2YECA 4L94A 1Z5BA 4EGIA 2C2AA 4YKQA 1ID0A 1NHIA 5FWKA 2XX4A 3G7BA 2BREA 3GIGA 4DUHA 2QG0A 2YKEA 2YKCA 3Q5KA 4GGLA 2CCUA 3OW6A 3SL2A 2YEDA 2WI7A 1BKNA 5D7CA 3T0ZA 5FNFA 5D7RA 3TTZA 4MPCA 3T0HA 2WEQA 1AH8A 2YI0A 1YETA 2YE9A 1L0OA 2Q8IA 4BAEA 4KQVA 4FCPA 3OPDA 1ZXMA 2WI4A 1B3QA 2YEBA 1Y8PA 4LWHA 1MU5A 2IWSA 5M4PA 2E0AA 2XX5A 2YI7A 4EFUA 3B28A 4XE2A 3MNRP 2BRCA 2BU6A 3RLQA 3P32A 3WQ9A 5IDMA 2IWUA 4HY1A 4GT1A 3G7EA 2BYHA 5J6AA 3TK1A 1Y4SA 1S14A 2YE8A 4JAVA 4V25A 4BIZA 2LFSA 2YGAA 2XDXA 1Y8NA 3MD0A 4AWPA 1UYDA 4DZYA 3R4OA 1GKXA 1MX0A 2IORA 4E00A 1YC1A 3CRKA 4R1FA 1Y8OA 2XX2A 2BU5A 1Z59A 2QM7A 4JYBA 3HHUA 2WI3A 3CWVA 5IN9A 2FWYA 2BT0A 4HXWA 2YEFA 3OWBA 2YI5A 5CTUA 2XJJA 5CF0A 5C93A 3ZRWB 4LPBA 4MBCA 5CTWA 4CWFA 4KTNA 4PU9A 1TILA 4LWIA 4U7NA 4NH7A 2XDKA 4XIQA 3RKZA 4YKWA 1US7A 3A0ZA 5FNCA 4B6CA 4L90A 4U7OA 1H7UA 2XD6A 2XJXA 2IOQA 2XHTA 4EEHA 1ZXNA 3ZM7A 2K5BA 1Z5CA 4GQTA 5D6PA 4GFNA 1EA6A 2O1VA 4U93A 4JAUA 2WEPA 4WUDA 3D36A 4L91A 3TZ4A 4MB9A 5GGZA 1I5DA 3RLPA 4CWOA 2WI6A 4ZKIA 3K99A 4NH8A 4W7TA 4XIRA 5CTYA 3A0RA 2XDSA 1BXDA 2VW5A 3LPSA 1YESA 1YC4A 4CWTA 3B27A 4NH9A 4O04A 2BTZA 2H55A 4CWRA 3NXSA 3CGYA 2YEIA 1EI1A 2HKJA 1B62A 5BODA 1THNA 2YEAA 3ZXOA 2H8MA 2XHXA 3A0WA 1UYEA 1Z5AA 3R4NA 4L93A 4H81A 2ZBKB 2YE7A 4AWQA 2YEGA 1I58A 2IWXA 1PVGA 1I5AA 5J71A 4YKXA 4CWNA 1YT1A 4BXIA 4H85A 2YKJA 4QPJA 4O05A 4L8ZA 4HYPA 2Q8FA 3HZ5A 4LP0A 3D2RA 4CWQA 1ZWHA 3PEHA 2JKIA 2IOPA 2ZDYA 3ZKDA 4LWGA 4CE2A 4K4OA 4FPPA 5F3KA 1AH6A 4HYMA 2WWWA 3O0IA 1I5CA 3R4MA 2XHRA 2YJXA 1A4HA 3FV5A 3IEDA 4KP4A 2ZKJA 2VWCA 2O1WA 4KSGA 2YGFA 4YKRA 2ZDXA 3ZRXA 2XDLA 5M4MA 4H7QA 5IDJA 2YI6A 3A0YA 1QY8A 4YKUA 4YKZA 1S16A 4E01A 4MP2A 1AM1A 2FTKA 3R4PA 4MOTA 5B1NA 2BU7A 3ZRWA 1B63A 2GFDA 4ASAA 1NHHA 2WI1A 2YE6A 3TZ2A 3INWA 2HCHA 2CCTA 4EM7A 4XIPA 2Q8GA 1BGQA 1JOYA 3U2KA 4EGHA 4XKKA 2FWZA 2CG9A 3HEKA 5FNDA 4E02A 4XDMA 4URMA 1U2OA 3INXA 4EFTA 1ZW9A 3FT5A 3VHAA 1F51A 2YE3A 4KFGA 5M4EA 3T10A 3DGEA 2YKBA 3TZ5A 3VHDA 2AKPA 2YEJA 4PRXA 4GEEA 3ZXQA 4AWOA 4X9LA 2BSMA 3JZ3A 4GCZA 3CGZA 3B25A 1R62A 3ZKBA 2YE2A 2UWDA 4I5SA 4XKAA 2WI2A 4I3HA 2YK2A 3RLRA 4BIUA 4R3AA 4FCRA 1IXMA 4UROA 3K98A 1UYMA 1Y4UA 3B26A 3EHHA 3VADA 3T1KA 2VCIA 3OMUA 2XJGA 3A0XA 4URLA 4KSHA 3QDDA 4P7AA 2CCSA 4MPNA 5B1OA 3C11A 4V26A 3R91A 2VCJA 4JYCA 1BYQA 1UYHA 3H4LA 2FYPA 3K60A 4EMVA 3EHGA 3TUHA 4URNA 3O6OA 2YJWA 5BOCA 3CRLA 2BU8A 2XDUA 2ESAA 1UY6A 4CWPA
chains in the Genus database with same CATH superfamily
2ITCC 1JCHA 2JVDA 3B09A 3BHPA 1H7SA 4O0BA 4DUYO 4AHCA 4O07A 3FD9A 3D36C 5KUKA 3ML0A 4XTJA 3UT5A 2LO1A 1BMFG 5IYDO 4ZVIA 1AR5A 2WLIA 1Q7YW 3CCRV 4JI5B 1U97A 4JYAO 1AI7A 2RN9A 1N33O 4MTFA 3NMQA 1FXKB 4GZRB 1H2LA 2FKXA 4HXZA 2QWQB 2A3QA 3L75H 4X66O 1QLEC 2M7WA 4WCEV 1MABG 3CS5A 4P30A 5B3SB 1SF9A 3ZN0A 2YE4A 3EHJA 4FZ1A 3FB7C 2IM9A 1Q43A 4X65O 1ENVA 2DWEC 3GIEA 4RUEA 2PNRA 1JPXA 2F95B 1K4DC 4DW1A 2JIZG 3B2EE 3BM9A 4O2BB 4FCQA 1OSFA 5CPHA 3O9OA 4I55A 1HNXO 2XABA 3LDCA 2VRZA 4HYOA 3JCUZ 1QHTA 2ZDIA 2N04A 4XITA 4U3JB 4AQYO 5GW7A 5EIBD 2WLNA 1NJIW 2IJJA 1VQLV 2ZM6B 3JALA 5ITZA 1HNWB 5KHJA 1N36B 3HKCB 1XOUA 4CE1A 4ASFA 3RYCB 5A2QN 1WA8B 1FJGB 2ZE5A 3BMYA 5IJ0B 4O09A 2HJDA 1AR4A 2YXHA 5DM6V 3IFXA 4JASA 2ZXWB 1OCCB 1Q3EA 2B1IA 5L3CA 3L9DA 3TGUH 2O1UA 3LSUA 3RVZA 2AW9A 2JS5A 3SJCC 4R3MA 1OJHA 2L6LA 2CTQA 3BRCA 2ZNIA 4BW5A 4MP7A 5DN6G 3U67A 3T4ZA 2WSSG 5BY1A 3L74H 1NR7A 4C7UA 2CGFA 1P84F 2EXLA 3B24A 4WF9V 2F43G 3T1HO 1YT0A 3ABTA 3CSXA 1NU1H 2YXLA 4NTYA 3OAAG 1UY9A 5L3JA 3NR7A 5EK0A 3G75A 2F1MA 3OT7A 4JQLA 2DQ0A 3OUSA 1F7YA 4LF9O 2RDCA 1H2KA 4CH6A 3ZMVA 4DYLA 5CA0B 3JASB 3AK2A 4LWFA 1V55C 2QWPB 5IWAO 2A06H 1M1KW 2QEXV 4PRVA 2GDSA 4YJ2A 5GTIZ 2JS3A 2NNUA 2XNDG 4WFBV 3N27A 1Z5BA 4UV9A 1FXKA 4BAYA 4I0XB 1Y74B 1RFYA 1ID0A 2V1DA 2BREA 5L3GA 1XBLA 4DUHA 4JV5O 4FFBB 1B6QA 3B8MA 4TUYB 1XL4A 2Q73A 1N32B 5GONA 2QTOA 5D7CA 2AZ2A 5FNFA 3H9VA 4O2BA 4UB8Z 1E79G 5JVDB 4MPCA 3FX7A 5EBMC 1X4TA 1VF6A 1YZBA 3KCXA 5LMNB 2YE9A 4U3JA 4MVQA 1ZXMA 2HJFC 2WI4A 1ZAUA 1D2DA 2UXBO 1G4YB 4CS2A 1US6A 4X88A 2HG5C 4EFUA 3B28A 4XE2A 3HKCA 1TGOA 3F7VC 3LSSA 1K4CC 2VQFO 3RLQA 3WQ9A 3RYCA 4GT1A 4DR4O 1YEWA 1WA8A 2BYHA 1GN6A 4B3RB 1Y4SA 4LWSB 3HR0A 1EM1A 2YGAA 1Y66A 3MD0A 4DR3O 1NVPB 4DZYA 3K58A 1U96A 3JATB 2DWDC 4DV6B 3K5NA 5D5QA 4ZHQB 2IORA 5LMUB 3R65A 3STLC 4LF7O 1EN4A 1VQ6V 5IT9N 4R1FA 2P4VA 4W4KA 3W7TA 2QM7A 4JYBA 5KHGA 4E2LA 3VQXA 3ASOC 1AR1B 3ABLC 4EFEA 3AK3A 1ROPA 5HFMA 2YEFA 5CTUA 1YTFD 5CF0A 2GTSA 3ZRWB 1YHQV 1P4RA 2CTRA 1YVWA 4ZBMA 1TILA 4HZ3A 4WFHA 3JARB 1BSMA 3JSNA 1W0JG 2FB5A 1RSOB 2AGAA 5LP6C 2EIJC 2OCCC 3JD4A 3A0ZA 5FNCA 1H2SB 3H1JH 4EEQA 1Y76A 5CA0A 4YIPA 3JASA 1M93A 2XJXA 1QU7A 1VEWA 2UXDB 2LGWA 3ZEDA 4EEHA 3LUTB 1ZXNA 3ZM7A 3T1YB 3QTCA 5D6PA 3SR2C 1H8EG 1Y74A 4JAUA 4WUDA 3D36A 5GGZA 1PL0A 4FM1A 4ZKIA 1B06A 1V55B 4W7TA 4FFBA 1IURA 3HPLC 4TUYA 2VWKA 2XDSA 1S5LZ 3LPSA 3H1LH 1YC4A 4ABMA 3M7MX 4MS2A 3B27A 4O04A 3CGYA 2YEIA 1EI1A 1SQPH 4YXWG 2RCVA 1THNA 1ZUQA 2H8MA 2XHXA 3A0WA 2PTMA 4JI4O 2V7QG 3ABMC 4H81A 2ZBKB 3N2GB 3G6EV 4WFAV 4AWQA 1TUBB 1KP2A 1MA1A 3CCQV 2PYLA 1BQZA 2GTAA 1VQPV 4BXIA 4CWNA 3ICXA 4H85A 1Z2GA 3CCLV 4QPJA 3JD2A 4FIPC 1XREA 4HYPA 3HZ5A 4LP0A 1MOFA 3IGAC 1F4MA 4YY3B 4DV2O 1Q8IA 1FFXB 4LWSA 4CE2A 1XDCA 1S72V 2KG7B 2XTAA 3CRQA 5LBQA 4LFBO 3SYPA 3SPCA 1I5CA 2XHRA 4KP4A 3JATA 4ZHQA 1G6UA 1K9MW 2EJRA 4NXNB 3A8TA 4G27B 3QO8A 5IDJA 1QY8A 4DV0O 2V4DA 3DC6A 2C1GA 1THZA 1YIJV 2DE0X 4K0KB 4HNAB 3R4PA 4ZOLB 2H8PC 5B1NA 1S3JA 2IJHA 3ZRWA 3BA9A 3ZMZA 5BZBA 2OTLV 2GFDA 1PPJH 3U11A 2B1GA 2WI1A 4JI7B 3JARA 2YE6A 3INWA 3BABA 2Q9LA 3ABLB 1RSOA 1GKFA 1RPRA 3U2KA 2CTWA 2HFEC 2WLLB 4JF3A 4UFZA 3ZMTA 3ZJZA 2XT9A 3H1KH 3OEEG 2CG9A 1IBKO 2P6JA 4E02A 3VQWA 4XDMA 3CMAV 4LF4O 1U2OA 4Z1VA 2R9RB 1ZLZA 1IBLB 2YE3A 1SZXA 5LP6B 4MVZA 2ZE7A 2BSKB 2EIJB 2Q7EA 3ZIAG 2YEJA 4PRXA 4GEEA 2E3CA 3K9AA 4NTWA 4X9LA 3ZXQA 1R6NA 2YIDA 1VQMV 1MSWD 2BSMA 4GCZA 5EIBC 5J2UB 3CGZA 1XQ8A 3B25A 5BXZA 4CS4A 1R62A 1EN5A 1MMMA 4JI1O 1DF5A 1JQ0A 5KX5B 2UWDA 2WI2A 4I3HA 2YK2A 3EVKA 2F4VB 4R3AA 3K57A 2O57A 4UROA 4ICGA 1UYMA 3CCJV 4CH3A 1R3JC 4LF6O 1NH2D 1NKDA 3OMUA 1M5IA 3N2GA 3IC9A 4URLA 4TSFG 1TUBA 2Z3YA 4CH4A 1WP7A 4OXSA 5JJEB 2Q8VA 1DK1A 2OYQA 4LF5B 3QDDA 4P7AA 1R3LC 2QSAA 3C11A 3LSQA 4H13B 4V26A 1UYHA 3J80N 5K1PA 4FK5C 3LMMA 3EHGA 4EMVA 1ZL8B 2YUAA 2HHHB 3ABMB 1YI2V 1IBMO 1AB3A 3O6OA 4E4EA 3BVOA 4PA3A 1FFXA 3CX5F 3OFNG 2KG7A 4CWPA 4YJ3B 1P49A 3F5WC 4RUFA 1GJVA 2C1IA 3LNNA 4EGKA 3HYZA 3CPWU 2P67A 1SZTA 4FLXA 3ZS8C 1YJWV 4J7KA 2YEEA 2EJ7A 4DV5O 1GN3A 2QM8A 2Y4TA 5D6QA 3CRRA 1PP9H 2R9IA 4DK0A 4LFAB 3C0EA 4J7ZA 2DN9A 2WLKA 2XAGA 3E83A 4AILC 3OE7G 4ZOLA 2GUZB 2IBZH 3D0BA 1FXKC 4L8JA 4XCJA 3D3QA 4BR6A 1SKVA 1GO3F 2R9AA 2Y4UA 4GKKB 2AZ0A 3RBZA 1UYGA 1WB7A 3ZRVA 4HZ0A 2LP7A 5F2VO 1QVFU 1KIJA 5KMGB 2WLIB 5B1AB 2UUBB 2WLLA 4UVAA 4UXNA 5H6QA 1I59A 2QFOA 3ZHVA 2XCMA 4RQEA 1K92A 3KG2A 2KSDA 1VQ9V 3OEHG 4JI5O 4JI2B 1W59A 1WNSA 3U0ZA 3O2FA 2PZSA 3WB0A 1BE3H 1TC0A 4QE9A 5LP6A 1XUQA 3EHFA 2BSKA 5M4NA 3FKSG 5J2TA 4CBCA 2YDEA 1I5BA 3KKYA 2CGOA 5J2UA 4I55B 2BZ5A 4X1YB 3I56V 5KX5A 3UCSC 3TZ0A 1CPYA 4DR6B 4DUZB 5IJ9B 3H80A 4YKTA 3H01A 1N8RW 1VQNV 1AJNA 4MTOA 1T5EA 5CBFA 3EKRA 1JVMA 1R73A 3JD0A 4FM2A 4XC0A 1S5JA 2ZXWC 2YSUB 2QWRB 2L35A 2JJCA 1J5EB 2ZM6O 4B3TB 4JTAB 1YERA 1HNWO 3HYYA 1N0JA 4DR5B 1R3KC 1N36O 1TC6A 2ZKOA 1ZL8A 5B5EZ 2D3OW 1FJGO 4IYHA 4TQDA 4CC6A 2WI5A 4PI0A 1SQVH 1UYCA 1H2NA 3ABKC 5EBLC 4YJ3A 1H2GA 3IAYA 2HG1A 2CH4A 2LFRA 3LNUA 1QZRA 5M4KA 5M4HA 3Q5LA 4TT3G 2Q67A 1IZ3A 4AS9A 4H44B 4XCLA 4AI8A 1HDJA 1GM7A 2EINB 2OWOA 4XKOA 1JM6A 1M57C 1EZJA 2LW1A 3CP1A 1LNQA 2C2AA 2GUZA 1K97A 4GX2A 4YKQA 3H1HH 3SDLA 4JI0B 4R7CA 2E5LB 3RWRD 3G7BA 5IYZB 5H5NA 2P7TC 2QG0A 3J81N 2XAFA 5KMGA 3Q5KA 4YJ2B 4F6EA 3SL2A 2YEDA 4FLZA 3OR7C 2YXYA 1PNMA 5D7RA 4D7TA 1UJWB 3TTZA 1XNRB 5H9CA 1XMQB 2WEQA 5LYJB 2YI0A 4G28B 1SQBH 2PUSA 4BAEA 4U3FH 4JGSA 5GONB 3SYQA 3D3IA 1B3QA 2UXXA 4UCUA 1N32O 5M4PA 4XDJA 4LBEC 2JJ1G 3T4DA 1HNZB 2YI7A 2YC0A 2M6YA 3MNRP 3OTOB 2BRCA 3P32A 4X1YA 4HY1A 5IYCO 5IE9A 3JAWB 2DYRC 3VOUA 2EIMB 2YE8A 5KAIZ 4J42A 2LFSA 5IJ9A 2XDXA 1NT2B 1VIBA 5DECA 5LA6A 5LMNO 2EZOA 3K5OA 3QO7A 3RVYA 1Y8NA 1UYDA 3R4OA 1GKXA 1IX9A 4N21A 2IU3A 3T2MA 1H38A 2BE3A 2Q7HA 1YC1A 4EKWA 1BT8A 2OIEA 3THOA 3OM3B 3CRKA 2XX2A 4MVRA 5IN9A 4B3RO 2NLJC 1Q82W 4X1IA 3OWBA 5C93A 5CTWA 3OGCC 2A0LA 1Y6XA 4KTNA 4DV6O 3AG1C 4X64B 5LMUO 2H94A 1PNKA 4B3SB 2JEUA 2EILC 3BAAA 3CXHF 4PELA 2XDKA 4XIQA 3RKZA 3TJTA 4L90A 1PV0A 2E74B 3ABKB 3OMNB 3E89A 4F4LA 1H7UA 1XEQA 4CC5A 2XHTA 1D5AA 1GN4A 2A9HA 1Z5CA 3X2QC 1YTFB 1D5NA 3RW0A 1GAXA 1EA6A 2O1VA 4U93A 3MHHC 2WEPA 1BZKA 2DOSA 4L91A 4TQFA 3CCEV 3TZ4A 2QKCA 5IYZA 3KZIZ 4NH8A 1Y76B 3A0RA 1M57B 1YESA 2K9PA 3SPIA 1JX9A 2GHYA 4NH9A 4CWRA 5LL6Y 3NXSA 3CCVV 4D6TH 1B04A 1ORQC 2JRIA 5JH7B 2UXDO 3ZXOA 3T1YO 2PYJA 3CJHB 5LYJA 1SETA 1Z5AA 4O4LB 5EYPB 3BEHA 4H33A 2YE7A 3JSLA 5CBGA 4OX9B 4UUJC 1PVGA 3QNEA 3LNMB 4NTXA 1VQ8V 4O05A 4ASUG 4L8ZA 1R6TA 2Q8FA 4PA7A 3ETQA 3D2RA 5IY5C 4KHPB 2E75B 3K59A 4CWQA 1ZWHA 3JAWA 4KUMA 2DQ3A 3W7SA 4J80A 3FYIB 2Q5ZA 4K4OA 4LF8B 5F3KA 2CK3G 5FPRA 3O0IA 2YJXA 1A4HA 3IEDA 1WP8A 2X6BA 2O1WA 4DW0A 3AG2C 2YGFA 2RMKB 2N74A 1JJ2U 4EB6B 3TETA 2DYRB 2Y48A 4DV1B 5M4MA 4JZGA 4UCOA 3SYAA 4LR3A 4YKUA 1NTKH 1S16A 2OTJV 1M9NA 4YY3O 4CH5A 2FTKA 2W0XA 3ZHUA 1NBMG 2EZPA 2BU7A 4GX0A 1B63A 2ZE8A 4I50B 3P30A 1EFRG 1NS1A 1YXBA 4N23A 3ZN1A 5BMVB 3K3WA 2K1EA 2CCTA 4XIPA 2ODMA 4DXWA 1BGQA 4NXNO 4KL1A 4NB5A 1R1BA 1KP3A 1VQ5V 3BY6A 1N34B 1AP5A 3HEKA 5B1BB 5FNDA 2QKSA 1GM9A 3AG1B 4K0KO 1ZW9A 2QE7G 3VHAA 3WB2A 4OPHA 4PHZA 2XAQA 1VQKV 4QE7A 2EILB 3G80A 4DR7B 3TZ5A 3VHDA 2A79B 4JI7O 2H3OA 1YJ9V 3BPZA 4R6ZA 4JZ2A 4AWOA 3ZRSA 2YI9A 5LXTB 4XDLA 3X2QB 1GM8A 4UVCA 1PKXA 4FLWA 4I5SA 2IH3C 3SGIA 3OMIB 5JH7A 3C90A 5L3DA 5JENA 4BW9A 2PF4E 3CJHA 1IBLO 1AI5A 1OCZC 1SQGA 4JI3B 2YEVB 4O4LA 5EYPA 3S3XA 3MAQA 3EHHA 2DMXA 2XASA 3F7YC 2P90A 3K08A 4O4HA 3BFRA 2YI8A 5B1OA 3L73H 4TV8A 1AI4A 2VCJA 4JYCA 2OIGA 2VQEB 4H37A 1M56B 2F4VO 4URNA 2YJWA 1AJQA 4JPRA 4E72A 1JMKC 1MZFA 2BU8A 4FLYA 2XUMA 2XDUA 3CD6V 1NH2B 1UY6A 4RQFA 2D2CB 3TCUA 4UB6Z 2IU0A 2QWNB 2ZIOA 3FB8C 4DO2A 1KD1W 4LF5O 1SA0B 2JEXA 4X1KA 5IY5B 4EB6A 4FMTA 5AG2A 5F5RA 2GQPA 1R6KA 1UY7A 2Y69C 3C3SA 4GT8A 1N0NA 2BOCC 1GTOA 4HY6A 2HHHO 1FPOA 5LHIA 1Z5VA 3CCUV 3AG2B 4DR2B 1XILA 5D7DA 1U0ZA 3FB5C 1NR1A 2QJ1A 4J11A 4I50A 4QJFB 1COWG 4I9QA 4PL9A 3GIFA 4MT8A 5FPOA 5BMVA 2X6AA 4HZ5A 3VBBA 2ZT9B 4YKYA 4DV4B 2Q0OC 1YSRA 1Y4MA 3KCYA 2IJKA 5B1AC 1KQSU 3CE2A 3BCCH 3CC2V 1Q5OA 4QIWF 4LFAO 2YK9A 5B66Z 1TIDA 3CCSV 2BU2A 1E1RG 3SJQC 3L71H 4LNUB 3QO5A 2DJVA 1NHJA 4WUBA 1I5XA 3E8BA 2Q2EB 4X62B 2FXSA 3P3NA 5K1XA 2XK2A 1K73W 2BTOA 4GKKO 4K8ZA 5KHIA 1QCEA 4Q20A 2UUBO 4JI8B 1YF2A 1BS3A 5LXTA 4IIJB 2BYIA 3UO2A 1UYIA 1UY8A 3AG3C 4JI2O 2ATKC 1KECA 3E2EA 4GKJB 2UUAB 1JA8A 2QF6A 2YEVA 5J2TB 4CE3A 3WB1A 1VP7A 2IW5A 3HKDB 1TBWA 3GWOA 2LQTA 4MVMA 3W7UA 1FFTB 1SQQH 3AG7A 1QLNA 5CTXA 1OCZB 3WFVA 2X6CA 3KE6A 1CXZB 2GSMB 2RQ6A 3CRAA 3E8GA 3G71V 5H2FZ 4DR6O 1TH8A 4DUZO 3RN4A 1YITV 1PM9A 1KZNA 3H1IH 4LFCB 1IXBA 3JCZA 3APOA 2Y0IA 4LP8A 4ASBA 2RJZA 3CXCU 5JJJB 1OCOC 2WERA 4LWEA 4XD8A 1AILA 2E76B 3PEJA 3ZCCA 1J5EO 1SA0A 4NXMB 4B3TO 2LJ2A 4DR5O 1CP9A 1HWYA 2XHBA 2YIAA 3OW2U 2PI5A 2YIBD 1M4UA 3Q5JA 1YJNV 1GKZA 2EINC 2YECA 4L94A 4NVPA 2P4KA 3G67A 3RYFB 4EGIA 2ZR3A 4DV3B 4WFGA 4R50A 5FWKA 2X0LA 1FXHA 3CYOA 2Y69B 3G4SV 5KLVH 5TISZ 2YKCA 4HBNA 5E1AC 3R66A 4I7ZB 3LDEA 2F93B 4FLUA 2WI7A 4JI6B 2DYSC 1WPBA 3WU2Z 3ZMUA 4FZ0A 3N2KB 1AH8A 1BL8A 4LNUA 4MVUA 1WN7A 1YETA 2Q8IA 4JI0O 2GBOA 2E5LO 4KQVA 3OPDA 1V9PA 4W4LA 4EFBA 1Y8PA 3SJBC 4LWHA 3AG4C 2HKOA 1FKAO 2FYUH 5KUMA 1EZVH 2FMLA 2W0FC 4IIJA 4JYYA 4RAIA 3JAMN 1TAEA 2BU6A 4JAAA 2IWUA 3FFQA 1XNRO 3G7EA 5J6AA 3TK1A 5JCOC 1XMQO 1A32A 5EZYB 1S14A 2KQXA 3DC5A 4JAVA 3SYCA 4BIZA 1XHZA 2EIMC 3K79A 5LGUA 4X9QA 3MHSC 2QM4A 4PDRA 4P2ZA 2IJIA 3HKDA 2P22C 2FL4A 1DTOA 5EC1C 3AG3B 2UXCB 1N4CA 1K5SA 4UCTA 1HNZO 3OTOO 4CS3A 5LA6B 2WI3A 3CWVA 2WLJA 4TV9B 1H2MA 5JJNB 4HXWA 4X20B 1DGSA 1QNMA 4LPBA 4MBCA 4CWFA 3K0DA 3E8HA 4NH7A 1LUVA 3OD4A 2VWJA 4QGPA 1AVMA 1UPGA 4CZZA 1K5QA 2ZE6A 4B6CA 4X1IB 1DLBA 4U7OA 1OCOB 1KU9A 3T1CA 4GQTA 3RYFA 2P06A 1G8MA 1WB8A 4WBNB 3J7AU 4MB9A 4X64O 1G1XB 3K99A 4B3SO 1KUQA 2Z5UA 4XIRA 5CTYA 3K5LA 2WLMA 4QNHB 2VW5A 2QWOB 5BR8B 3M8AA 4CWTA 2QA4V 4J10A 2JGDB 4B3MB 2H55A 3VQYA 4UCRA 5J9PC 2HKJA 2BCCH 2IH1C 2ZIMA 3O65A 5IYBO 3FYEB 3N2KA 1OV9A 1UYEA 1S0VA 3R4NA 2UUCB 1P7BA 3RYHB 5JWPA 4MVSA 3SPGA 1FYJA 1VF7A 2YEGA 1VMGA 2DYSB 1I94B 1Q6HA 3K04A 1OHHG 2YKJA 3I5DA 3CYGA 4NR1A 4DRXB 1S76D 1KMIZ 3PEHA 1I7FA 2JKIA 2KKWA 2ZDYA 5EZYA 4YHHB 4Z2WA 1AH6A 3AG4B 2EULA 2WWWA 3B4SA 3FV5A 4FVMA 4KSGA 3ZMSA 4OX9O 3UQ8A 1SC5B 2OCHA 1MZEA 4H7QA 2YI6A 1HR0B 3A0YA 1TVKB 4YKZA 1VQOV 4DR1B 4KHPO 1TUEB 1EN6A 4E01A 1WAZA 5KA5A 1AM1A 4TV9A 2P5OA 4NYKA 1L0NH 3ETDA 2Q69A 4X20A 3TXQA 4FLTA 4LF8O 2B9ZA 3CC4V 5EBWC 4MSWC 4WFFA 3TZ2A 2F23A 2HCHA 4BIOA 2ETNA 3OUFA 1JOYA 4DV1O 2BTQB 3JAKB 2CUGA 4EGHA 2FWZA 2JDIG 3RGBA 5CA3A 2UU9B 3ZHSA 5B1BC 4EFTA 2G38A 3IC7A 1F51A 3JD3A 3T10A 1K8AW 2YKBA 3C3TA 4NKGB 4WBNA 5HFLA 4PA6A 3E35A 5KHHA 3FB6C 3JZ3A 1AP6A 4RO2A 3E8FA 3HKBB 2JGDA 4I9WA 3ZKBA 1N34O 1XMOB 2YE2A 4XKAA 1ZSPA 3B8NA 3RLRA 4BIUA 3QF7A 4FCRA 1OCRC 1IXMA 1JFFA 1V54B 3K98A 1Y4UA 1GK9A 3B26A 2QTSA 1E1QG 4G2KA 3VADA 3T1KA 2EBOA 4DR7O 3RYHA 3A0XA 5E79Z 4DUYB 2CCSA 4MPNA 5CA1B 4IYIA 4O4IB 3LDDA 4J9YB 5CB4B 2FYPA 3RYIB 4DRXA 2EIKC 1NTMH 4K3AA 1M56C 3OTFA 4O4JB 1OZ0A 4JYAB 3ABUA 4GX5A 5L3BA 4IGGA 1N33B 3S3WA 4JI3O 2ZQMA 1HW7A 4O4HB 1X59A 4Z1MG 1AI6A 1EBOA 1PL4A 4X66B 4TV8B 3WHAA 3OMAB 3A0HZ 2PGGA 2QDOA 4X65B 4MTXA 2CH7B 5JCOA 3W7WA 3EKOA 4R8CA 2VQEO 3OWDA 3D8CA 1TVKA 4MW3A 1FAFA 1AMWA 3TXSA 5FL7G 3ASNC 3ZBHA 2Q8HA 3CB2A 1HNXB 2WA3A 1QLEB 1MSDA 5A9GA 3UKMA 4X1KB 2CAZC 4IT5A 4AQYB 3K97A 3GIGB 2YKIA 1BCCH 2RNBA 2Y0PA 3ZX6A 1XI1A 4ZI7B 3R92A 2BTQA 3JAKA 4F6RB 4B7KA 3K5MA 3PN1A 4RWUA 2ZCEA 2WLHA 4DR2O 3BA8A 2CTPA 5IJ0A 5JQGB 4QPKA 3A0BZ 4IHJB 1YT2A 1ZX3A 4TWKA 4DV4O 1QR8A 4PDVA 2JJ2G 1WJZA 1KBHA 3HKBA 4P8OA 1FS0G 2QKAA 1Z5WA 3CMEV 1AJ6A 1SESA 1RPOA 3VQVA 1YC3A 4MPEA 3U2DA 1VQ4V 3VHCA 3CRCA 3JD1A 3T1HB 4X62O 3T2SA 1GRJA 2YGEA 4DK1A 4ASGA 4WUCA 3A0TA 1NZ6A 3HB3B 1K34A 3QTFA 1YSZA 4LF9B 4JI8O 3G6BA 3E86A 1OCRB 5CA1A 2QG2A 4O4IA 4BQGA 1YCIA 3UO3A 5CB4A 4BQJA 2HLDG 1FD9A 3RYIA 5IWAB 1L0LH 2ADPA 4GYCB 2YE5A 1UYKA 1AROP 4CWSA 4HAMA 4GKJO 2YEHA 4O4JA 2XAJA 2LGQA 4PV1B 5LGNA 2UUAO 3FT8A 1L1FA 4O2AB 1UYFA 1UYLA 1GMGA 1W0KG 1KKDA 4B7PA 4I0XA 4JV5B 1L8DA 2EIKB 3ETGA 4B08A 4ZIBA 1QYEA 2CH7A 4Q6GA 3HZ1A 4LC1A 1YS3A 4MVOA 2KB1A 3CWBH 1QVGU 4FFKA 4PDMA 3GVMA 1I08A 3OGIB 1MNGA 2MW2B 4FLVA 2EX3A 4UVBA 4LFCO 5JVDA 5LOVB 1NHIA 2XX4A 3CHXA 3M99B 2HHIA 3GIGA 1Q86W 3K06A 1NTZH 4PD4F 2YKEA 1S5HC 4NXMO 4B7EA 3ASNB 1ZWIC 2UXBB 4J7JA 1JJOA 3ZHRA 2CCUA 3OW6A 4GGLA 4ZI7A 3OR6C 2W6IG 2ITDC 1BKNA 4F6RA 3T0ZA 3ZHTA 2VQFB 2WPDG 5D5PA 4DR4B 3FAVB 3T0HA 3K0GA 3Q4HB 1K33A 4UCVA 4UV8A 1CEZA 2ZINA 4DV3O 1K7DA 4DR3B 1L0OA 1ZTEA 1QQCA 1NVPD 2X7RB 4FCPA 4GUNA 4X89A 2WA4A 5C8YB 5JQGA 2YEBA 2CGNA 2UXNA 4IHJA 4LCUC 1MU5A 2IWSA 2E0AA 4LF7B 2XX5A 4JI6O 1GN2A 3SPHA 5IDMA 3APQA 4TOIA 2R70A 4K8XA 3RFRA 1S77D 1KYOF 1VF5B 2JGUA 4V25A 2Q0AA 3EFFK 1SRYA 3WG7C 3RT3C 4IL6Z 2B5UA 4AWPA 4WFEA 1NI8A 3F5TA 3GWKC 1LUWA 1MX0A 4L87A 5CBHA 4E00A 2W6JG 1IDSA 1HP8A 1M90W 3QG5A 5H6RA 1Y8OA 2N05A 5GTHZ 2BU5A 2Q4PA 3SPJA 3ASOB 1Z59A 3HHUA 3AEIA 1F4NA 2FWYA 3DXRB 2YS8A 4K35A 2BT0A 1DF4A 2YI5A 2XOKG 4KFMA 2XJJA 4O2AA 1IVSA 4PU9A 2ZD9A 1PNLA 2WAMA 4OGQB 4LWIA 5LGTA 2UXCO 4U7NA 1BHAA 1WPXA 2ZDIC 1QR9A 2R72A 1RM1C 2OCCB 1I0HA 4D7SA 4YKWA 1US7A 4YIOA 3B77A 1SQXH 2OT5A 2XD6A 3E22B 2IOQA 4PDLA 1XL6A 2K5BA 2HVJC 1BHBA 4GFNA 1QBZA 4P9PA 1JR9A 1LR1A 5DEDA 4JI4B 3K9SA 4MW8A 1BQ0A 5LOVA 1I5DA 3RLPA 4CWOA 2WI6A 1RP3B 2BOBC 3ETEA 5FNVB 1BGYH 2Q7GA 1BXDA 5CMUA 2F66C 4JTDB 1O9HA 2Q6AA 3CCMV 4XBFA 2BTZA 2YIBA 4I4TB 4J41A 3CRMA 1B62A 5BODA 3FAVA 3Q4HA 4DV2B 2YEAA 4PA4A 1TA8A 3L72H 4DV7O 4LFBB 4L93A 1SQFA 3HKEB 3EHBB 1PD3A 5C8YA 3W7XA 1I58A 2IWXA 3SYOA 1I5AA 5J71A 4YKXA 2QR4A 1KC8W 5BR8O 1YT1A 1XHXA 2JK5C 1SERA 1NQTA 4DV0B 4B3MO 2A7WA 4PA9A 2HR3A 1MG1A 1O9GA 4JTCB 4GX1A 3S5TA 2AXTZ 1Q81W 4FJCC 2IOPA 2MK3A 5CN0A 3PJSK 3ZKDA 3AK1A 3IJ4A 4LWGA 4FPPA 4OPAA 4HYMA 2UUCO 3R4MA 1URFA 1XNQO 1YSCA 2ZR2A 4HNAA 2XAHA 2LW7A 2ZKJA 4LH7A 2VWCA 2HEPA 4YKRA 2CDYA 1I94O 2ARHA 3JYCA 5LHGA 2ZDXA 3ZRXA 2ZNJA 3UT5B 2XDLA 5B3SC 2PY5A 3EXAA 5KHKA 4PI2A 3WG7B 4GLXA 4FM0A 1VQ7V 1IBKB 1Q6UA 4MP2A 3SJAC 3DXRA 4LF4B 4YHHO 1UFIA 3QVNA 4MOTA 3DTUB 1WLEA 1KKCA 3A2FA 5EC2C 3UM7A 4ASAA 1I5YA 1NHHA 2Z0AA 1VF6C 4EM7A 2PI4A 2Q8GA 3U10A 1FXVA 1HR0O 4XKKA 1H8HG 5FLXN 4DR1O 1AJPA 4JI1B 3B40A 3DSQA 3GB7C 3E22A 4URMA 3INXA 2AHYA 2QGNA 3FT5A 3CEIA 3ZHQA 4KFGA 5M4EA 4LF6B 2HP8A 1RM1B 2YICA 3DGEA 4XDKA 1P7GA 2HVKC 3K03A 2AKPA 4A5UB 2GV9A 1R3IC 1W2BU 4KXRA 4PJ0Z 5FNVA 3JALB 1Y67A 5ITZB 3P3PA 1OCCC 4X8AA 4P9OA 1VARA 1YDXA 1SS3A 5KAFZ 3CC7V 4I4TA 3STZC 2UU9O 4DV7B 1IBMB 4LH6A 2NR5A 4MTGA 4BWAA 1Q90D 1V54C 2CE4A 5L3EA 2VCIA 3MDSA 3HKEA 1K3EA 2XJGA 1F23A 2VS0A 4UCSA 5LHHA 4KSHA 5KA6A 2ILMA 3L70H 4H0LB 1J95A 3R91A 1BYQA 4DV5B 3H4LA 3K60A 1JFFB 2AHZA 1XMOO 2ADQB 3TUHA 2Q68A 1Q6IA 5L3FA 5BOCA 1GH6A 3I55V 3CRLA 2NN4A 1XNQB 2DW4A 4J9ZB 2ESAA 1KB9F
chains in the Genus database with same CATH topology
2ITCC 1JCHA 1H7SA 4O0BA 4O07A 5KUKA 3ML0A 4XTJA 1BMFG 5IYDO 4ZVIA 2WLIA 1Q7YW 3CCRV 1AI7A 3NMQA 4MTFA 1FXKB 4HXZA 1QLEC 2M7WA 4WCEV 1MABG 4P30A 5B3SB 3ZN0A 2YE4A 3EHJA 3FB7C 1ENVA 2DWEC 3GIEA 4RUEA 2PNRA 1JPXA 1K4DC 2JIZG 3BM9A 4FCQA 1OSFA 5CPHA 2XABA 3LDCA 4HYOA 2ZDIA 4XITA 5GW7A 2WLNA 1NJIW 2IJJA 1VQLV 4CE1A 4ASFA 3BMYA 4O09A 5DM6V 3IFXA 4JASA 2ZXWB 1OCCB 2B1IA 5L3CA 2O1UA 3RVZA 4R3MA 4BW5A 4MP7A 5DN6G 3U67A 3T4ZA 2WSSG 1NR7A 2CGFA 2EXLA 3B24A 4WF9V 2F43G 1YT0A 3ABTA 3OAAG 1UY9A 5L3JA 5EK0A 3G75A 4JQLA 2DQ0A 3OUSA 3ZMVA 4PRVA 4LWFA 5D6QA 1V55C 1M1KW 2QEXV 2NNUA 2XNDG 4WFBV 1Z5BA 4UV9A 1FXKA 4BAYA 1ID0A 2V1DA 2BREA 5L3GA 4DUHA 1B6QA 3B8MA 1XL4A 2QTOA 5D7CA 5FNFA 1E79G 4MPCA 5EBMC 2YE9A 4MVQA 1ZXMA 2HJFC 2WI4A 1G4YB 4X88A 2HG5C 4EFUA 3B28A 4XE2A 3F7VC 3LSSA 1K4CC 3RLQA 3WQ9A 4GT1A 2BYHA 1Y4SA 2YGAA 1Y66A 3MD0A 1NVPB 4DZYA 2DWDC 2IORA 3R65A 3STLC 1VQ6V 4R1FA 3W7TA 2QM7A 4JYBA 4E2LA 3ASOC 1AR1B 3ABLC 1ROPA 5HFMA 2YEFA 5CTUA 1YTFD 5CF0A 3ZRWB 1YHQV 1P4RA 4ZBMA 1TILA 4HZ3A 4WFHA 1W0JG 2EIJC 2OCCC 3JD4A 3A0ZA 5FNCA 2XJXA 4EEHA 3ZM7A 3LUTB 1ZXNA 5D6PA 1H8EG 4JAUA 4WUDA 3D36A 5GGZA 1PL0A 4ZKIA 1V55B 4W7TA 3HPLC 2XDSA 3LPSA 1YC4A 4MS2A 3B27A 4O04A 3CGYA 2YEIA 1EI1A 4YXWG 1THNA 2H8MA 2XHXA 3A0WA 2V7QG 3ABMC 4H81A 2ZBKB 3G6EV 4WFAV 4AWQA 1KP2A 3CCQV 1VQPV 4BXIA 4CWNA 4H85A 3CCLV 4QPJA 3JD2A 4FIPC 4HYPA 3HZ5A 4LP0A 1MOFA 3IGAC 1F4MA 4CE2A 1S72V 5LBQA 3SYPA 3SPCA 1I5CA 2XHRA 4KP4A 1K9MW 2EJRA 5IDJA 4G27B 3QO8A 1QY8A 1THZA 1YIJV 3R4PA 2H8PC 5B1NA 1S3JA 2IJHA 3ZRWA 3ZMZA 5BZBA 2OTLV 2GFDA 2B1GA 2WI1A 2YE6A 3INWA 3ABLB 1GKFA 1RPRA 3U2KA 2HFEC 2WLLB 4JF3A 3ZMTA 3ZJZA 3OEEG 2CG9A 2P6JA 4E02A 4XDMA 3CMAV 1U2OA 2R9RB 2YE3A 4MVZA 2EIJB 3ZIAG 2YEJA 4PRXA 4GEEA 3K9AA 3ZXQA 4X9LA 1R6NA 1VQMV 1MSWD 2BSMA 4GCZA 3CGZA 3B25A 1R62A 2UWDA 1DF5A 1JQ0A 2WI2A 4I3HA 2YK2A 4R3AA 4UROA 1UYMA 3CCJV 1R3JC 1NH2D 1NKDA 3OMUA 4URLA 4TSFG 2Z3YA 4OXSA 3QDDA 4P7AA 1R3LC 3C11A 4V26A 3LSQA 1UYHA 4FK5C 4EMVA 3EHGA 3ABMB 1YI2V 3O6OA 4PA3A 3OFNG 4CWPA 3F5WC 4RUFA 1GJVA 4EGKA 3HYZA 3CPWU 2P67A 1SZTA 1YJWV 2YEEA 2QM8A 2R9IA 3C0EA 2WLKA 2XAGA 3E83A 3OE7G 3D0BA 1FXKC 4XCJA 1GO3F 3RBZA 1UYGA 3ZRVA 4HZ0A 2LP7A 1QVFU 1KIJA 2WLIB 5B1AB 2WLLA 4UVAA 4UXNA 5H6QA 1I59A 2QFOA 2XCMA 4RQEA 1K92A 3KG2A 1VQ9V 3OEHG 3O2FA 1TC0A 4QE9A 3EHFA 5M4NA 3FKSG 4CBCA 1I5BA 2BZ5A 3I56V 3TZ0A 1CPYA 3H80A 4YKTA 3H01A 1N8RW 1VQNV 1AJNA 4MTOA 5CBFA 3EKRA 1JVMA 1R73A 3JD0A 4XC0A 2ZXWC 2YSUB 2JJCA 4JTAB 1YERA 3HYYA 1TC6A 1R3KC 2D3OW 2WI5A 1UYCA 5EBLC 3ABKC 1H2GA 2HG1A 2CH4A 2LFRA 3LNUA 1QZRA 5M4KA 5M4HA 3Q5LA 4TT3G 2Q67A 4AS9A 4XCLA 1GM7A 2EINB 4XKOA 1JM6A 1M57C 1EZJA 3CP1A 1LNQA 2C2AA 4GX2A 1K97A 4YKQA 4R7CA 3G7BA 2P7TC 2QG0A 2XAFA 3Q5KA 3SL2A 2YEDA 3OR7C 1PNMA 5D7RA 1UJWB 3TTZA 5H9CA 2WEQA 2YI0A 4G28B 4BAEA 4JGSA 3SYQA 3D3IA 1B3QA 2UXXA 5M4PA 4XDJA 4LBEC 2JJ1G 3T4DA 2YI7A 3MNRP 2BRCA 3P32A 4HY1A 5IYCO 2DYRC 3VOUA 2EIMB 2YE8A 2LFSA 2XDXA 1Y8NA 2EZOA 3QO7A 3RVYA 1UYDA 3R4OA 1GKXA 4N21A 2IU3A 3T2MA 1H38A 1YC1A 4EKWA 3OM3B 3CRKA 2XX2A 4MVRA 5IN9A 2NLJC 1Q82W 3OWBA 5C93A 5CTWA 3OGCC 2A0LA 4KTNA 3AG1C 2H94A 1PNKA 2JEUA 2EILC 4PELA 2XDKA 4XIQA 3RKZA 4L90A 3ABKB 3OMNB 3E89A 4F4LA 1H7UA 2XHTA 2A9HA 1Z5CA 3X2QC 1YTFB 3RW0A 1EA6A 2O1VA 4U93A 3MHHC 2WEPA 4L91A 3CCEV 3TZ4A 4NH8A 3A0RA 1M57B 1YESA 3SPIA 1JX9A 2GHYA 4CWRA 4NH9A 3NXSA 3CCVV 1ORQC 3ZXOA 1SETA 1Z5AA 3BEHA 4H33A 2YE7A 5CBGA 4UUJC 1PVGA 3QNEA 3LNMB 1VQ8V 4O05A 4ASUG 4L8ZA 2Q8FA 4PA7A 3D2RA 5IY5C 4CWQA 1ZWHA 4KUMA 2DQ3A 3W7SA 3FYIB 4K4OA 5F3KA 2CK3G 3O0IA 2YJXA 1A4HA 3IEDA 2X6BA 2O1WA 3AG2C 2YGFA 1JJ2U 3TETA 2DYRB 2Y48A 5M4MA 3SYAA 4YKUA 1S16A 2OTJV 1M9NA 2FTKA 1NBMG 2EZPA 2BU7A 4GX0A 1B63A 3P30A 1EFRG 4N23A 3ZN1A 3K3WA 2K1EA 2CCTA 4XIPA 4DXWA 1BGQA 1KP3A 1VQ5V 3BY6A 3HEKA 5B1BB 5FNDA 2QKSA 1GM9A 3AG1B 1ZW9A 2QE7G 3VHAA 2XAQA 1VQKV 4QE7A 2EILB 3TZ5A 3VHDA 2A79B 1YJ9V 4R6ZA 4AWOA 3ZRSA 4XDLA 3X2QB 1GM8A 4UVCA 1PKXA 4I5SA 2IH3C 3OMIB 5L3DA 1AI5A 1OCZC 2YEVB 3EHHA 2XASA 3F7YC 2P90A 3K08A 5B1OA 1AI4A 2VCJA 4JYCA 4H37A 1M56B 4URNA 2YJWA 1AJQA 4JPRA 2BU8A 2XDUA 1UY6A 3CD6V 1NH2B 4RQFA 3TCUA 2IU0A 3FB8C 4DO2A 1KD1W 2JEXA 5IY5B 5F5RA 4FMTA 2GQPA 1R6KA 1UY7A 2Y69C 4GT8A 2BOCC 1GTOA 4HY6A 5LHIA 3CCUV 3AG2B 5D7DA 1U0ZA 3FB5C 1NR1A 4QJFB 1COWG 4PL9A 3GIFA 4MT8A 2X6AA 4HZ5A 3VBBA 4YKYA 1YSRA 1Y4MA 2IJKA 5B1AC 1KQSU 3CC2V 4QIWF 2YK9A 1TIDA 3CCSV 2BU2A 1E1RG 3SJQC 3QO5A 1NHJA 4WUBA 1I5XA 3E8BA 2Q2EB 2FXSA 2XK2A 1K73W 1QCEA 4Q20A 2BYIA 1UYIA 1UY8A 3AG3C 2ATKC 1KECA 3E2EA 2QF6A 2YEVA 4CE3A 2IW5A 1TBWA 3GWOA 4MVMA 3W7UA 1FFTB 1QLNA 5CTXA 1OCZB 3WFVA 2X6CA 3KE6A 2GSMB 3E8GA 3G71V 1TH8A 1YITV 1KZNA 3JCZA 4LP8A 4ASBA 3CXCU 1OCOC 2WERA 4LWEA 4XD8A 3PEJA 3ZCCA 1CP9A 1HWYA 3OW2U 2PI5A 3Q5JA 1YJNV 1GKZA 2EINC 2YECA 4L94A 4EGIA 2ZR3A 4WFGA 4R50A 5FWKA 2X0LA 1FXHA 3CYOA 2Y69B 3G4SV 2YKCA 5E1AC 3LDEA 2WI7A 2DYSC 3ZMUA 1AH8A 1BL8A 4MVUA 1YETA 2Q8IA 4KQVA 3OPDA 1Y8PA 4LWHA 3AG4C 2HKOA 5KUMA 2W0FC 4RAIA 2BU6A 2IWUA 3G7EA 5J6AA 3TK1A 1S14A 3SYCA 4JAVA 4BIZA 2EIMC 3K79A 5LGUA 3MHSC 4PDRA 4P2ZA 2IJIA 1DTOA 5EC1C 3AG3B 1K5SA 2WI3A 3CWVA 2WLJA 4HXWA 4LPBA 4MBCA 4CWFA 3K0DA 3E8HA 4NH7A 4CZZA 1K5QA 4B6CA 1DLBA 4U7OA 1OCOB 3T1CA 4GQTA 1G8MA 4MB9A 3K99A 2Z5UA 4XIRA 5CTYA 2WLMA 4QNHB 2VW5A 4CWTA 2QA4V 2H55A 5J9PC 2HKJA 2IH1C 5IYBO 3FYEB 1UYEA 1S0VA 3R4NA 1P7BA 4MVSA 3SPGA 2YEGA 2DYSB 3K04A 1OHHG 2YKJA 1S76D 3PEHA 2JKIA 2ZDYA 1AH6A 3AG4B 2WWWA 3FV5A 4KSGA 3ZMSA 4H7QA 2YI6A 3A0YA 4YKZA 1VQOV 1TUEB 4E01A 5KA5A 1AM1A 3ETDA 2Q69A 3CC4V 5EBWC 4MSWC 4WFFA 3TZ2A 2HCHA 3OUFA 1JOYA 4EGHA 2FWZA 2JDIG 5CA3A 5B1BC 4EFTA 3IC7A 1F51A 3JD3A 3T10A 1K8AW 2YKBA 5HFLA 4PA6A 3E35A 3FB6C 3JZ3A 4RO2A 3E8FA 4I9WA 3ZKBA 2YE2A 4XKAA 3B8NA 3RLRA 4BIUA 4FCRA 1OCRC 1IXMA 1V54B 3K98A 1Y4UA 1GK9A 3B26A 1E1QG 4G2KA 3VADA 3T1KA 2EBOA 3A0XA 2CCSA 4MPNA 3LDDA 4J9YB 2FYPA 2EIKC 1M56C 1OZ0A 3ABUA 4GX5A 5L3BA 2ZQMA 4Z1MG 1AI6A 1EBOA 3WHAA 3OMAB 4MTXA 3W7WA 3EKOA 4R8CA 3OWDA 4MW3A 1AMWA 5FL7G 3ASNC 2Q8HA 1QLEB 3UKMA 3K97A 3GIGB 2YKIA 3R92A 2WLHA 4QPKA 1YT2A 4TWKA 1QR8A 4PDVA 2JJ2G 4P8OA 1FS0G 3CMEV 1AJ6A 1SESA 1RPOA 1YC3A 4MPEA 3U2DA 1VQ4V 3VHCA 3JD1A 3T2SA 2YGEA 4ASGA 4WUCA 3A0TA 3HB3B 1K34A 3QTFA 1YSZA 3E86A 1OCRB 4BQGA 2QG2A 4BQJA 2HLDG 2YE5A 1UYKA 1AROP 4CWSA 4HAMA 2YEHA 5LGNA 2XAJA 3FT8A 1L1FA 1UYFA 1UYLA 1GMGA 1W0KG 1KKDA 4B7PA 2EIKB 3ETGA 1QYEA 3HZ1A 4LC1A 1YS3A 4MVOA 2KB1A 1QVGU 4PDMA 4UVBA 1NHIA 2XX4A 3M99B 3GIGA 1Q86W 3K06A 2YKEA 1S5HC 3ASNB 1ZWIC 4GGLA 2CCUA 3OW6A 3OR6C 2W6IG 2ITDC 1BKNA 3T0ZA 2WPDG 3T0HA 3K0GA 1K33A 4UV8A 1CEZA 1K7DA 1L0OA 1NVPD 2X7RB 4FCPA 4X89A 2YEBA 2UXNA 4LCUC 1MU5A 2IWSA 2E0AA 2XX5A 3SPHA 5IDMA 1S77D 4V25A 3EFFK 1SRYA 3WG7C 4AWPA 2B5UA 4WFEA 1MX0A 4L87A 5CBHA 4E00A 2W6JG 1M90W 5H6RA 1Y8OA 2BU5A 3SPJA 3ASOB 1Z59A 3HHUA 3AEIA 1F4NA 2FWYA 2BT0A 1DF4A 2YI5A 2XOKG 4KFMA 2XJJA 4PU9A 2ZD9A 1PNLA 2WAMA 4LWIA 5LGTA 4U7NA 1BHAA 1WPXA 2ZDIC 1QR9A 1RM1C 2OCCB 4YKWA 1US7A 3B77A 2OT5A 2XD6A 2IOQA 4PDLA 1XL6A 2K5BA 2HVJC 1BHBA 4GFNA 1QBZA 4P9PA 4MW8A 1I5DA 3RLPA 4CWOA 2WI6A 2BOBC 3ETEA 1BXDA 5CMUA 4JTDB 2Q6AA 3CCMV 4XBFA 2BTZA 1B62A 5BODA 2YEAA 4PA4A 4L93A 3EHBB 1PD3A 3W7XA 1I58A 2IWXA 3SYOA 1I5AA 5J71A 4YKXA 1KC8W 1YT1A 2JK5C 1SERA 1NQTA 4PA9A 2HR3A 1MG1A 4JTCB 4GX1A 1Q81W 4FJCC 2IOPA 2MK3A 5CN0A 3PJSK 3ZKDA 4LWGA 4FPPA 4HYMA 3R4MA 1YSCA 2ZR2A 2XAHA 2ZKJA 2VWCA 4YKRA 3JYCA 5LHGA 2ZDXA 3ZRXA 2XDLA 5B3SC 3WG7B 1VQ7V 4MP2A 4MOTA 3DTUB 1WLEA 5EC2C 3UM7A 4ASAA 1I5YA 1NHHA 4EM7A 2PI4A 2Q8GA 1FXVA 4XKKA 1H8HG 1AJPA 3GB7C 4URMA 3INXA 2AHYA 3FT5A 4KFGA 5M4EA 1RM1B 3DGEA 4XDKA 2HVKC 3K03A 2AKPA 1R3IC 1W2BU 1OCCC 4X8AA 4P9OA 3CC7V 3STZC 4MTGA 1V54C 5L3EA 2VCIA 1K3EA 2XJGA 1F23A 5LHHA 4KSHA 5KA6A 1J95A 3R91A 1BYQA 3H4LA 3K60A 2AHZA 3TUHA 2Q68A 5L3FA 5BOCA 3I55V 3CRLA 2DW4A 4J9ZB 2ESAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJV A;  4EGK A;  3HYZ A;  3WHA A;  2P67 A;  1H7S A;  4O0B A;  5F5R A;  4O07 A;  4FMT A;  2GQP A;  4MTX A;  4XTJ A;  1UY7 A;  2YEE A;  3EKO A;  2QM8 A;  3OWD A;  4GT8 A;  4ZVI A;  1AMW A;  4HY6 A;  3C0E A;  3NMQ A;  2Q8H A;  5D7D A;  1U0Z A;  3D0B A;  4HXZ A;  4XCJ A;  3K97 A;  4PL9 A;  3GIG B;  2YE4 A;  3GIF A;  2YKI A;  3EHJ A;  1UYG A;  4MT8 A;  3ZRV A;  4HZ0 A;  4HZ5 A;  1KIJ A;  4YKY A;  3GIE A;  2PNR A;  1YSR A;  3R92 A;  1I59 A;  2QFO A;  2XCM A;  3BM9 A;  2YK9 A;  1TID A;  2BU2 A;  4FCQ A;  1OSF A;  5CPH A;  2XAB A;  3O2F A;  1NHJ A;  4WUB A;  2Q2E B;  1TC0 A;  4XIT A;  2FXS A;  2XK2 A;  3EHF A;  4QPK A;  5M4N A;  1YT2 A;  4Q20 A;  1I5B A;  2BYI A;  4P8O A;  2BZ5 A;  1UYI A;  1UY8 A;  4CE1 A;  4ASF A;  3TZ0 A;  1AJ6 A;  1YC3 A;  3BMY A;  4MPE A;  4O09 A;  3U2D A;  3H80 A;  4YKT A;  3VHC A;  2QF6 A;  4JAS A;  3T2S A;  4CE3 A;  3EKR A;  2YGE A;  4XC0 A;  1TBW A;  4ASG A;  2O1U A;  4WUC A;  3A0T A;  2JJC A;  3QTF A;  1YSZ A;  4R3M A;  1YER A;  4BQG A;  2QG2 A;  3HYY A;  1TC6 A;  5CTX A;  4BQJ A;  4MP7 A;  3KE6 A;  3U67 A;  2YE5 A;  1UYK A;  1TH8 A;  4CWS A;  2CGF A;  2YEH A;  2EXL A;  3B24 A;  3FT8 A;  2WI5 A;  1KZN A;  1UYF A;  1UYC A;  1UYL A;  1YT0 A;  4ASB A;  2HG1 A;  2CH4 A;  2LFR A;  4B7P A;  1UY9 A;  2WER A;  3LNU A;  4LWE A;  4XD8 A;  5L3J A;  1QZR A;  3PEJ A;  3G75 A;  3ZCC A;  5M4H A;  5M4K A;  3Q5L A;  4JQL A;  1QYE A;  4AS9 A;  3HZ1 A;  4XCL A;  4LC1 A;  1YS3 A;  4PRV A;  4LWF A;  5D6Q A;  3Q5J A;  4XKO A;  1GKZ A;  1JM6 A;  2YEC A;  4L94 A;  1Z5B A;  4EGI A;  2C2A A;  4YKQ A;  1ID0 A;  1NHI A;  5FWK A;  2XX4 A;  3G7B A;  2BRE A;  3GIG A;  4DUH A;  2QG0 A;  2YKE A;  2YKC A;  3Q5K A;  4GGL A;  2CCU A;  3OW6 A;  3SL2 A;  2YED A;  2WI7 A;  1BKN A;  5D7C A;  3T0Z A;  5FNF A;  5D7R A;  3TTZ A;  4MPC A;  3T0H A;  2WEQ A;  1AH8 A;  2YI0 A;  1YET A;  2YE9 A;  1L0O A;  2Q8I A;  4BAE A;  4KQV A;  4FCP A;  3OPD A;  1ZXM A;  2WI4 A;  1B3Q A;  2YEB A;  1Y8P A;  4LWH A;  1MU5 A;  2IWS A;  5M4P A;  2E0A A;  2XX5 A;  2YI7 A;  4EFU A;  3B28 A;  4XE2 A;  3MNR P;  2BRC A;  2BU6 A;  3RLQ A;  3P32 A;  3WQ9 A;  5IDM A;  2IWU A;  4HY1 A;  4GT1 A;  3G7E A;  2BYH A;  5J6A A;  3TK1 A;  1Y4S A;  1S14 A;  2YE8 A;  4JAV A;  4V25 A;  4BIZ A;  2LFS A;  2YGA A;  2XDX A;  1Y8N A;  3MD0 A;  4AWP A;  1UYD A;  4DZY A;  3R4O A;  1GKX A;  1MX0 A;  2IOR A;  4E00 A;  1YC1 A;  3CRK A;  4R1F A;  1Y8O A;  2XX2 A;  2BU5 A;  1Z59 A;  2QM7 A;  4JYB A;  3HHU A;  2WI3 A;  3CWV A;  5IN9 A;  2FWY A;  2BT0 A;  4HXW A;  2YEF A;  3OWB A;  2YI5 A;  5CTU A;  2XJJ A;  5CF0 A;  5C93 A;  3ZRW B;  4LPB A;  4MBC A;  5CTW A;  4CWF A;  4KTN A;  4PU9 A;  1TIL A;  4LWI A;  4U7N A;  4NH7 A;  2XDK A;  4XIQ A;  3RKZ A;  4YKW A;  1US7 A;  3A0Z A;  5FNC A;  4B6C A;  4L90 A;  4U7O A;  1H7U A;  2XD6 A;  2XJX A;  2IOQ A;  2XHT A;  4EEH A;  1ZXN A;  3ZM7 A;  2K5B A;  1Z5C A;  4GQT A;  5D6P A;  4GFN A;  1EA6 A;  2O1V A;  4U93 A;  4JAU A;  2WEP A;  4WUD A;  3D36 A;  4L91 A;  3TZ4 A;  4MB9 A;  5GGZ A;  1I5D A;  3RLP A;  4CWO A;  2WI6 A;  4ZKI A;  3K99 A;  4NH8 A;  4W7T A;  4XIR A;  5CTY A;  3A0R A;  2XDS A;  1BXD A;  2VW5 A;  3LPS A;  1YES A;  1YC4 A;  4CWT A;  3B27 A;  4NH9 A;  4O04 A;  2BTZ A;  2H55 A;  4CWR A;  3NXS A;  3CGY A;  2YEI A;  1EI1 A;  2HKJ A;  1B62 A;  5BOD A;  1THN A;  2YEA A;  3ZXO A;  2H8M A;  2XHX A;  3A0W A;  1UYE A;  1Z5A A;  3R4N A;  4L93 A;  4H81 A;  2ZBK B;  2YE7 A;  4AWQ A;  2YEG A;  1I58 A;  2IWX A;  1PVG A;  1I5A A;  5J71 A;  4YKX A;  4CWN A;  1YT1 A;  4BXI A;  4H85 A;  2YKJ A;  4QPJ A;  4O05 A;  4L8Z A;  4HYP A;  2Q8F A;  3HZ5 A;  4LP0 A;  3D2R A;  4CWQ A;  1ZWH A;  3PEH A;  2JKI A;  2IOP A;  2ZDY A;  3ZKD A;  4LWG A;  4CE2 A;  4K4O A;  4FPP A;  5F3K A;  1AH6 A;  4HYM A;  2WWW A;  3O0I A;  1I5C A;  3R4M A;  2XHR A;  2YJX A;  1A4H A;  3FV5 A;  3IED A;  4KP4 A;  2ZKJ A;  2VWC A;  2O1W A;  4KSG A;  2YGF A;  4YKR A;  2ZDX A;  3ZRX A;  2XDL A;  5M4M A;  4H7Q A;  5IDJ A;  2YI6 A;  3A0Y A;  1QY8 A;  4YKU A;  4YKZ A;  1S16 A;  4E01 A;  4MP2 A;  1AM1 A;  2FTK A;  3R4P A;  4MOT A;  5B1N A;  2BU7 A;  3ZRW A;  1B63 A;  2GFD A;  4ASA A;  1NHH A;  2WI1 A;  2YE6 A;  3TZ2 A;  3INW A;  2HCH A;  2CCT A;  4EM7 A;  4XIP A;  2Q8G A;  1BGQ A;  1JOY A;  3U2K A;  4EGH A;  4XKK A;  2FWZ A;  2CG9 A;  3HEK A;  5FND A;  4E02 A;  4XDM A;  4URM A;  1U2O A;  3INX A;  4EFT A;  1ZW9 A;  3FT5 A;  3VHA A;  1F51 A;  2YE3 A;  4KFG A;  5M4E A;  3T10 A;  3DGE A;  2YKB A;  3TZ5 A;  3VHD A;  2AKP A;  2YEJ A;  4PRX A;  4GEE A;  3ZXQ A;  4AWO A;  4X9L A;  2BSM A;  3JZ3 A;  4GCZ A;  3CGZ A;  3B25 A;  1R62 A;  3ZKB A;  2YE2 A;  2UWD A;  4I5S A;  4XKA A;  2WI2 A;  4I3H A;  2YK2 A;  3RLR A;  4BIU A;  4R3A A;  4FCR A;  1IXM A;  4URO A;  3K98 A;  1UYM A;  1Y4U A;  3B26 A;  3EHH A;  3VAD A;  3T1K A;  2VCI A;  3OMU A;  2XJG A;  3A0X A;  4URL A;  4KSH A;  3QDD A;  4P7A A;  2CCS A;  4MPN A;  5B1O A;  3C11 A;  4V26 A;  3R91 A;  2VCJ A;  4JYC A;  1BYQ A;  1UYH A;  3H4L A;  2FYP A;  3K60 A;  4EMV A;  3EHG A;  3TUH A;  4URN A;  3O6O A;  2YJW A;  5BOC A;  3CRL A;  2BU8 A;  2XDU A;  2ESA A;  1UY6 A;  4CWP A; 
#chains in the Genus database with same CATH topology
 2ITC C;  1JCH A;  2JVD A;  3B09 A;  3BHP A;  1H7S A;  4O0B A;  4DUY O;  4AHC A;  4O07 A;  3FD9 A;  3D36 C;  5KUK A;  3ML0 A;  4XTJ A;  3UT5 A;  2LO1 A;  1BMF G;  5IYD O;  4ZVI A;  1AR5 A;  2WLI A;  1Q7Y W;  3CCR V;  4JI5 B;  1U97 A;  4JYA O;  1AI7 A;  2RN9 A;  1N33 O;  4MTF A;  3NMQ A;  1FXK B;  4GZR B;  1H2L A;  2FKX A;  4HXZ A;  2QWQ B;  2A3Q A;  3L75 H;  4X66 O;  1QLE C;  2M7W A;  4WCE V;  1MAB G;  3CS5 A;  4P30 A;  5B3S B;  1SF9 A;  3ZN0 A;  2YE4 A;  3EHJ A;  4FZ1 A;  3FB7 C;  2IM9 A;  1Q43 A;  4X65 O;  1ENV A;  2DWE C;  3GIE A;  4RUE A;  2PNR A;  1JPX A;  2F95 B;  1K4D C;  4DW1 A;  2JIZ G;  3B2E E;  3BM9 A;  4O2B B;  4FCQ A;  1OSF A;  5CPH A;  3O9O A;  4I55 A;  1HNX O;  2XAB A;  3LDC A;  2VRZ A;  4HYO A;  3JCU Z;  1QHT A;  2ZDI A;  2N04 A;  4XIT A;  4U3J B;  4AQY O;  5GW7 A;  5EIB D;  2WLN A;  1NJI W;  2IJJ A;  1VQL V;  2ZM6 B;  3JAL A;  5ITZ A;  1HNW B;  5KHJ A;  1N36 B;  3HKC B;  1XOU A;  4CE1 A;  4ASF A;  3RYC B;  5A2Q N;  1WA8 B;  1FJG B;  2ZE5 A;  3BMY A;  5IJ0 B;  4O09 A;  2HJD A;  1AR4 A;  2YXH A;  5DM6 V;  3IFX A;  4JAS A;  2ZXW B;  1OCC B;  1Q3E A;  2B1I A;  5L3C A;  3L9D A;  3TGU H;  2O1U A;  3LSU A;  3RVZ A;  2AW9 A;  2JS5 A;  3SJC C;  4R3M A;  1OJH A;  2L6L A;  2CTQ A;  3BRC A;  2ZNI A;  4BW5 A;  4MP7 A;  5DN6 G;  3U67 A;  3T4Z A;  2WSS G;  5BY1 A;  3L74 H;  1NR7 A;  4C7U A;  2CGF A;  1P84 F;  2EXL A;  3B24 A;  4WF9 V;  2F43 G;  3T1H O;  1YT0 A;  3ABT A;  3CSX A;  1NU1 H;  2YXL A;  4NTY A;  3OAA G;  1UY9 A;  5L3J A;  3NR7 A;  5EK0 A;  3G75 A;  2F1M A;  3OT7 A;  4JQL A;  2DQ0 A;  3OUS A;  1F7Y A;  4LF9 O;  2RDC A;  1H2K A;  4CH6 A;  3ZMV A;  4DYL A;  5CA0 B;  3JAS B;  3AK2 A;  4LWF A;  1V55 C;  2QWP B;  5IWA O;  2A06 H;  1M1K W;  2QEX V;  4PRV A;  2GDS A;  4YJ2 A;  5GTI Z;  2JS3 A;  2NNU A;  2XND G;  4WFB V;  3N27 A;  1Z5B A;  4UV9 A;  1FXK A;  4BAY A;  4I0X B;  1Y74 B;  1RFY A;  1ID0 A;  2V1D A;  2BRE A;  5L3G A;  1XBL A;  4DUH A;  4JV5 O;  4FFB B;  1B6Q A;  3B8M A;  4TUY B;  1XL4 A;  2Q73 A;  1N32 B;  5GON A;  2QTO A;  5D7C A;  2AZ2 A;  5FNF A;  3H9V A;  4O2B A;  4UB8 Z;  1E79 G;  5JVD B;  4MPC A;  3FX7 A;  5EBM C;  1X4T A;  1VF6 A;  1YZB A;  3KCX A;  5LMN B;  2YE9 A;  4U3J A;  4MVQ A;  1ZXM A;  2HJF C;  2WI4 A;  1ZAU A;  1D2D A;  2UXB O;  1G4Y B;  4CS2 A;  1US6 A;  4X88 A;  2HG5 C;  4EFU A;  3B28 A;  4XE2 A;  3HKC A;  1TGO A;  3F7V C;  3LSS A;  1K4C C;  2VQF O;  3RLQ A;  3WQ9 A;  3RYC A;  4GT1 A;  4DR4 O;  1YEW A;  1WA8 A;  2BYH A;  1GN6 A;  4B3R B;  1Y4S A;  4LWS B;  3HR0 A;  1EM1 A;  2YGA A;  1Y66 A;  3MD0 A;  4DR3 O;  1NVP B;  4DZY A;  3K58 A;  1U96 A;  3JAT B;  2DWD C;  4DV6 B;  3K5N A;  5D5Q A;  4ZHQ B;  2IOR A;  5LMU B;  3R65 A;  3STL C;  4LF7 O;  1EN4 A;  1VQ6 V;  5IT9 N;  4R1F A;  2P4V A;  4W4K A;  3W7T A;  2QM7 A;  4JYB A;  5KHG A;  4E2L A;  3VQX A;  3ASO C;  1AR1 B;  3ABL C;  4EFE A;  3AK3 A;  1ROP A;  5HFM A;  2YEF A;  5CTU A;  1YTF D;  5CF0 A;  2GTS A;  3ZRW B;  1YHQ V;  1P4R A;  2CTR A;  1YVW A;  4ZBM A;  1TIL A;  4HZ3 A;  4WFH A;  3JAR B;  1BSM A;  3JSN A;  1W0J G;  2FB5 A;  1RSO B;  2AGA A;  5LP6 C;  2EIJ C;  2OCC C;  3JD4 A;  3A0Z A;  5FNC A;  1H2S B;  3H1J H;  4EEQ A;  1Y76 A;  5CA0 A;  4YIP A;  3JAS A;  1M93 A;  2XJX A;  1QU7 A;  1VEW A;  2UXD B;  2LGW A;  3ZED A;  4EEH A;  3LUT B;  1ZXN A;  3ZM7 A;  3T1Y B;  3QTC A;  5D6P A;  3SR2 C;  1H8E G;  1Y74 A;  4JAU A;  4WUD A;  3D36 A;  5GGZ A;  1PL0 A;  4FM1 A;  4ZKI A;  1B06 A;  1V55 B;  4W7T A;  4FFB A;  1IUR A;  3HPL C;  4TUY A;  2VWK A;  2XDS A;  1S5L Z;  3LPS A;  3H1L H;  1YC4 A;  4ABM A;  3M7M X;  4MS2 A;  3B27 A;  4O04 A;  3CGY A;  2YEI A;  1EI1 A;  1SQP H;  4YXW G;  2RCV A;  1THN A;  1ZUQ A;  2H8M A;  2XHX A;  3A0W A;  2PTM A;  4JI4 O;  2V7Q G;  3ABM C;  4H81 A;  2ZBK B;  3N2G B;  3G6E V;  4WFA V;  4AWQ A;  1TUB B;  1KP2 A;  1MA1 A;  3CCQ V;  2PYL A;  1BQZ A;  2GTA A;  1VQP V;  4BXI A;  4CWN A;  3ICX A;  4H85 A;  1Z2G A;  3CCL V;  4QPJ A;  3JD2 A;  4FIP C;  1XRE A;  4HYP A;  3HZ5 A;  4LP0 A;  1MOF A;  3IGA C;  1F4M A;  4YY3 B;  4DV2 O;  1Q8I A;  1FFX B;  4LWS A;  4CE2 A;  1XDC A;  1S72 V;  2KG7 B;  2XTA A;  3CRQ A;  5LBQ A;  4LFB O;  3SYP A;  3SPC A;  1I5C A;  2XHR A;  4KP4 A;  3JAT A;  4ZHQ A;  1G6U A;  1K9M W;  2EJR A;  4NXN B;  3A8T A;  4G27 B;  3QO8 A;  5IDJ A;  1QY8 A;  4DV0 O;  2V4D A;  3DC6 A;  2C1G A;  1THZ A;  1YIJ V;  2DE0 X;  4K0K B;  4HNA B;  3R4P A;  4ZOL B;  2H8P C;  5B1N A;  1S3J A;  2IJH A;  3ZRW A;  3BA9 A;  3ZMZ A;  5BZB A;  2OTL V;  2GFD A;  1PPJ H;  3U11 A;  2B1G A;  2WI1 A;  4JI7 B;  3JAR A;  2YE6 A;  3INW A;  3BAB A;  2Q9L A;  3ABL B;  1RSO A;  1GKF A;  1RPR A;  3U2K A;  2CTW A;  2HFE C;  2WLL B;  4JF3 A;  4UFZ A;  3ZMT A;  3ZJZ A;  2XT9 A;  3H1K H;  3OEE G;  2CG9 A;  1IBK O;  2P6J A;  4E02 A;  3VQW A;  4XDM A;  3CMA V;  4LF4 O;  1U2O A;  4Z1V A;  2R9R B;  1ZLZ A;  1IBL B;  2YE3 A;  1SZX A;  5LP6 B;  4MVZ A;  2ZE7 A;  2BSK B;  2EIJ B;  2Q7E A;  3ZIA G;  2YEJ A;  4PRX A;  4GEE A;  2E3C A;  3K9A A;  4NTW A;  4X9L A;  3ZXQ A;  1R6N A;  2YID A;  1VQM V;  1MSW D;  2BSM A;  4GCZ A;  5EIB C;  5J2U B;  3CGZ A;  1XQ8 A;  3B25 A;  5BXZ A;  4CS4 A;  1R62 A;  1EN5 A;  1MMM A;  4JI1 O;  1DF5 A;  1JQ0 A;  5KX5 B;  2UWD A;  2WI2 A;  4I3H A;  2YK2 A;  3EVK A;  2F4V B;  4R3A A;  3K57 A;  2O57 A;  4URO A;  4ICG A;  1UYM A;  3CCJ V;  4CH3 A;  1R3J C;  4LF6 O;  1NH2 D;  1NKD A;  3OMU A;  1M5I A;  3N2G A;  3IC9 A;  4URL A;  4TSF G;  1TUB A;  2Z3Y A;  4CH4 A;  1WP7 A;  4OXS A;  5JJE B;  2Q8V A;  1DK1 A;  2OYQ A;  4LF5 B;  3QDD A;  4P7A A;  1R3L C;  2QSA A;  3C11 A;  3LSQ A;  4H13 B;  4V26 A;  1UYH A;  3J80 N;  5K1P A;  4FK5 C;  3LMM A;  3EHG A;  4EMV A;  1ZL8 B;  2YUA A;  2HHH B;  3ABM B;  1YI2 V;  1IBM O;  1AB3 A;  3O6O A;  4E4E A;  3BVO A;  4PA3 A;  1FFX A;  3CX5 F;  3OFN G;  2KG7 A;  4CWP A;  4YJ3 B;  1P49 A;  3F5W C;  4RUF A;  1GJV A;  2C1I A;  3LNN A;  4EGK A;  3HYZ A;  3CPW U;  2P67 A;  1SZT A;  4FLX A;  3ZS8 C;  1YJW V;  4J7K A;  2YEE A;  2EJ7 A;  4DV5 O;  1GN3 A;  2QM8 A;  2Y4T A;  5D6Q A;  3CRR A;  1PP9 H;  2R9I A;  4DK0 A;  4LFA B;  3C0E A;  4J7Z A;  2DN9 A;  2WLK A;  2XAG A;  3E83 A;  4AIL C;  3OE7 G;  4ZOL A;  2GUZ B;  2IBZ H;  3D0B A;  1FXK C;  4L8J A;  4XCJ A;  3D3Q A;  4BR6 A;  1SKV A;  1GO3 F;  2R9A A;  2Y4U A;  4GKK B;  2AZ0 A;  3RBZ A;  1UYG A;  1WB7 A;  3ZRV A;  4HZ0 A;  2LP7 A;  5F2V O;  1QVF U;  1KIJ A;  5KMG B;  2WLI B;  5B1A B;  2UUB B;  2WLL A;  4UVA A;  4UXN A;  5H6Q A;  1I59 A;  2QFO A;  3ZHV A;  2XCM A;  4RQE A;  1K92 A;  3KG2 A;  2KSD A;  1VQ9 V;  3OEH G;  4JI5 O;  4JI2 B;  1W59 A;  1WNS A;  3U0Z A;  3O2F A;  2PZS A;  3WB0 A;  1BE3 H;  1TC0 A;  4QE9 A;  5LP6 A;  1XUQ A;  3EHF A;  2BSK A;  5M4N A;  3FKS G;  5J2T A;  4CBC A;  2YDE A;  1I5B A;  3KKY A;  2CGO A;  5J2U A;  4I55 B;  2BZ5 A;  4X1Y B;  3I56 V;  5KX5 A;  3UCS C;  3TZ0 A;  1CPY A;  4DR6 B;  4DUZ B;  5IJ9 B;  3H80 A;  4YKT A;  3H01 A;  1N8R W;  1VQN V;  1AJN A;  4MTO A;  1T5E A;  5CBF A;  3EKR A;  1JVM A;  1R73 A;  3JD0 A;  4FM2 A;  4XC0 A;  1S5J A;  2ZXW C;  2YSU B;  2QWR B;  2L35 A;  2JJC A;  1J5E B;  2ZM6 O;  4B3T B;  4JTA B;  1YER A;  1HNW O;  3HYY A;  1N0J A;  4DR5 B;  1R3K C;  1N36 O;  1TC6 A;  2ZKO A;  1ZL8 A;  5B5E Z;  2D3O W;  1FJG O;  4IYH A;  4TQD A;  4CC6 A;  2WI5 A;  4PI0 A;  1SQV H;  1UYC A;  1H2N A;  3ABK C;  5EBL C;  4YJ3 A;  1H2G A;  3IAY A;  2HG1 A;  2CH4 A;  2LFR A;  3LNU A;  1QZR A;  5M4K A;  5M4H A;  3Q5L A;  4TT3 G;  2Q67 A;  1IZ3 A;  4AS9 A;  4H44 B;  4XCL A;  4AI8 A;  1HDJ A;  1GM7 A;  2EIN B;  2OWO A;  4XKO A;  1JM6 A;  1M57 C;  1EZJ A;  2LW1 A;  3CP1 A;  1LNQ A;  2C2A A;  2GUZ A;  1K97 A;  4GX2 A;  4YKQ A;  3H1H H;  3SDL A;  4JI0 B;  4R7C A;  2E5L B;  3RWR D;  3G7B A;  5IYZ B;  5H5N A;  2P7T C;  2QG0 A;  3J81 N;  2XAF A;  5KMG A;  3Q5K A;  4YJ2 B;  4F6E A;  3SL2 A;  2YED A;  4FLZ A;  3OR7 C;  2YXY A;  1PNM A;  5D7R A;  4D7T A;  1UJW B;  3TTZ A;  1XNR B;  5H9C A;  1XMQ B;  2WEQ A;  5LYJ B;  2YI0 A;  4G28 B;  1SQB H;  2PUS A;  4BAE A;  4U3F H;  4JGS A;  5GON B;  3SYQ A;  3D3I A;  1B3Q A;  2UXX A;  4UCU A;  1N32 O;  5M4P A;  4XDJ A;  4LBE C;  2JJ1 G;  3T4D A;  1HNZ B;  2YI7 A;  2YC0 A;  2M6Y A;  3MNR P;  3OTO B;  2BRC A;  3P32 A;  4X1Y A;  4HY1 A;  5IYC O;  5IE9 A;  3JAW B;  2DYR C;  3VOU A;  2EIM B;  2YE8 A;  5KAI Z;  4J42 A;  2LFS A;  5IJ9 A;  2XDX A;  1NT2 B;  1VIB A;  5DEC A;  5LA6 A;  5LMN O;  2EZO A;  3K5O A;  3QO7 A;  3RVY A;  1Y8N A;  1UYD A;  3R4O A;  1GKX A;  1IX9 A;  4N21 A;  2IU3 A;  3T2M A;  1H38 A;  2BE3 A;  2Q7H A;  1YC1 A;  4EKW A;  1BT8 A;  2OIE A;  3THO A;  3OM3 B;  3CRK A;  2XX2 A;  4MVR A;  5IN9 A;  4B3R O;  2NLJ C;  1Q82 W;  4X1I A;  3OWB A;  5C93 A;  5CTW A;  3OGC C;  2A0L A;  1Y6X A;  4KTN A;  4DV6 O;  3AG1 C;  4X64 B;  5LMU O;  2H94 A;  1PNK A;  4B3S B;  2JEU A;  2EIL C;  3BAA A;  3CXH F;  4PEL A;  2XDK A;  4XIQ A;  3RKZ A;  3TJT A;  4L90 A;  1PV0 A;  2E74 B;  3ABK B;  3OMN B;  3E89 A;  4F4L A;  1H7U A;  1XEQ A;  4CC5 A;  2XHT A;  1D5A A;  1GN4 A;  2A9H A;  1Z5C A;  3X2Q C;  1YTF B;  1D5N A;  3RW0 A;  1GAX A;  1EA6 A;  2O1V A;  4U93 A;  3MHH C;  2WEP A;  1BZK A;  2DOS A;  4L91 A;  4TQF A;  3CCE V;  3TZ4 A;  2QKC A;  5IYZ A;  3KZI Z;  4NH8 A;  1Y76 B;  3A0R A;  1M57 B;  1YES A;  2K9P A;  3SPI A;  1JX9 A;  2GHY A;  4NH9 A;  4CWR A;  5LL6 Y;  3NXS A;  3CCV V;  4D6T H;  1B04 A;  1ORQ C;  2JRI A;  5JH7 B;  2UXD O;  3ZXO A;  3T1Y O;  2PYJ A;  3CJH B;  5LYJ A;  1SET A;  1Z5A A;  4O4L B;  5EYP B;  3BEH A;  4H33 A;  2YE7 A;  3JSL A;  5CBG A;  4OX9 B;  4UUJ C;  1PVG A;  3QNE A;  3LNM B;  4NTX A;  1VQ8 V;  4O05 A;  4ASU G;  4L8Z A;  1R6T A;  2Q8F A;  4PA7 A;  3ETQ A;  3D2R A;  5IY5 C;  4KHP B;  2E75 B;  3K59 A;  4CWQ A;  1ZWH A;  3JAW A;  4KUM A;  2DQ3 A;  3W7S A;  4J80 A;  3FYI B;  2Q5Z A;  4K4O A;  4LF8 B;  5F3K A;  2CK3 G;  5FPR A;  3O0I A;  2YJX A;  1A4H A;  3IED A;  1WP8 A;  2X6B A;  2O1W A;  4DW0 A;  3AG2 C;  2YGF A;  2RMK B;  2N74 A;  1JJ2 U;  4EB6 B;  3TET A;  2DYR B;  2Y48 A;  4DV1 B;  5M4M A;  4JZG A;  4UCO A;  3SYA A;  4LR3 A;  4YKU A;  1NTK H;  1S16 A;  2OTJ V;  1M9N A;  4YY3 O;  4CH5 A;  2FTK A;  2W0X A;  3ZHU A;  1NBM G;  2EZP A;  2BU7 A;  4GX0 A;  1B63 A;  2ZE8 A;  4I50 B;  3P30 A;  1EFR G;  1NS1 A;  1YXB A;  4N23 A;  3ZN1 A;  5BMV B;  3K3W A;  2K1E A;  2CCT A;  4XIP A;  2ODM A;  4DXW A;  1BGQ A;  4NXN O;  4KL1 A;  4NB5 A;  1R1B A;  1KP3 A;  1VQ5 V;  3BY6 A;  1N34 B;  1AP5 A;  3HEK A;  5B1B B;  5FND A;  2QKS A;  1GM9 A;  3AG1 B;  4K0K O;  1ZW9 A;  2QE7 G;  3VHA A;  3WB2 A;  4OPH A;  4PHZ A;  2XAQ A;  1VQK V;  4QE7 A;  2EIL B;  3G80 A;  4DR7 B;  3TZ5 A;  3VHD A;  2A79 B;  4JI7 O;  2H3O A;  1YJ9 V;  3BPZ A;  4R6Z A;  4JZ2 A;  4AWO A;  3ZRS A;  2YI9 A;  5LXT B;  4XDL A;  3X2Q B;  1GM8 A;  4UVC A;  1PKX A;  4FLW A;  4I5S A;  2IH3 C;  3SGI A;  3OMI B;  5JH7 A;  3C90 A;  5L3D A;  5JEN A;  4BW9 A;  2PF4 E;  3CJH A;  1IBL O;  1AI5 A;  1OCZ C;  1SQG A;  4JI3 B;  2YEV B;  4O4L A;  5EYP A;  3S3X A;  3MAQ A;  3EHH A;  2DMX A;  2XAS A;  3F7Y C;  2P90 A;  3K08 A;  4O4H A;  3BFR A;  2YI8 A;  5B1O A;  3L73 H;  4TV8 A;  1AI4 A;  2VCJ A;  4JYC A;  2OIG A;  2VQE B;  4H37 A;  1M56 B;  2F4V O;  4URN A;  2YJW A;  1AJQ A;  4JPR A;  4E72 A;  1JMK C;  1MZF A;  2BU8 A;  4FLY A;  2XUM A;  2XDU A;  3CD6 V;  1NH2 B;  1UY6 A;  4RQF A;  2D2C B;  3TCU A;  4UB6 Z;  2IU0 A;  2QWN B;  2ZIO A;  3FB8 C;  4DO2 A;  1KD1 W;  4LF5 O;  1SA0 B;  2JEX A;  4X1K A;  5IY5 B;  4EB6 A;  4FMT A;  5AG2 A;  5F5R A;  2GQP A;  1R6K A;  1UY7 A;  2Y69 C;  3C3S A;  4GT8 A;  1N0N A;  2BOC C;  1GTO A;  4HY6 A;  2HHH O;  1FPO A;  5LHI A;  1Z5V A;  3CCU V;  3AG2 B;  4DR2 B;  1XIL A;  5D7D A;  1U0Z A;  3FB5 C;  1NR1 A;  2QJ1 A;  4J11 A;  4I50 A;  4QJF B;  1COW G;  4I9Q A;  4PL9 A;  3GIF A;  4MT8 A;  5FPO A;  5BMV A;  2X6A A;  4HZ5 A;  3VBB A;  2ZT9 B;  4YKY A;  4DV4 B;  2Q0O C;  1YSR A;  1Y4M A;  3KCY A;  2IJK A;  5B1A C;  1KQS U;  3CE2 A;  3BCC H;  3CC2 V;  1Q5O A;  4QIW F;  4LFA O;  2YK9 A;  5B66 Z;  1TID A;  3CCS V;  2BU2 A;  1E1R G;  3SJQ C;  3L71 H;  4LNU B;  3QO5 A;  2DJV A;  1NHJ A;  4WUB A;  1I5X A;  3E8B A;  2Q2E B;  4X62 B;  2FXS A;  3P3N A;  5K1X A;  2XK2 A;  1K73 W;  2BTO A;  4GKK O;  4K8Z A;  5KHI A;  1QCE A;  4Q20 A;  2UUB O;  4JI8 B;  1YF2 A;  1BS3 A;  5LXT A;  4IIJ B;  2BYI A;  3UO2 A;  1UYI A;  1UY8 A;  3AG3 C;  4JI2 O;  2ATK C;  1KEC A;  3E2E A;  4GKJ B;  2UUA B;  1JA8 A;  2QF6 A;  2YEV A;  5J2T B;  4CE3 A;  3WB1 A;  1VP7 A;  2IW5 A;  3HKD B;  1TBW A;  3GWO A;  2LQT A;  4MVM A;  3W7U A;  1FFT B;  1SQQ H;  3AG7 A;  1QLN A;  5CTX A;  1OCZ B;  3WFV A;  2X6C A;  3KE6 A;  1CXZ B;  2GSM B;  2RQ6 A;  3CRA A;  3E8G A;  3G71 V;  5H2F Z;  4DR6 O;  1TH8 A;  4DUZ O;  3RN4 A;  1YIT V;  1PM9 A;  1KZN A;  3H1I H;  4LFC B;  1IXB A;  3JCZ A;  3APO A;  2Y0I A;  4LP8 A;  4ASB A;  2RJZ A;  3CXC U;  5JJJ B;  1OCO C;  2WER A;  4LWE A;  4XD8 A;  1AIL A;  2E76 B;  3PEJ A;  3ZCC A;  1J5E O;  1SA0 A;  4NXM B;  4B3T O;  2LJ2 A;  4DR5 O;  1CP9 A;  1HWY A;  2XHB A;  2YIA A;  3OW2 U;  2PI5 A;  2YIB D;  1M4U A;  3Q5J A;  1YJN V;  1GKZ A;  2EIN C;  2YEC A;  4L94 A;  4NVP A;  2P4K A;  3G67 A;  3RYF B;  4EGI A;  2ZR3 A;  4DV3 B;  4WFG A;  4R50 A;  5FWK A;  2X0L A;  1FXH A;  3CYO A;  2Y69 B;  3G4S V;  5KLV H;  5TIS Z;  2YKC A;  4HBN A;  5E1A C;  3R66 A;  4I7Z B;  3LDE A;  2F93 B;  4FLU A;  2WI7 A;  4JI6 B;  2DYS C;  1WPB A;  3WU2 Z;  3ZMU A;  4FZ0 A;  3N2K B;  1AH8 A;  1BL8 A;  4LNU A;  4MVU A;  1WN7 A;  1YET A;  2Q8I A;  4JI0 O;  2GBO A;  2E5L O;  4KQV A;  3OPD A;  1V9P A;  4W4L A;  4EFB A;  1Y8P A;  3SJB C;  4LWH A;  3AG4 C;  2HKO A;  1FKA O;  2FYU H;  5KUM A;  1EZV H;  2FML A;  2W0F C;  4IIJ A;  4JYY A;  4RAI A;  3JAM N;  1TAE A;  2BU6 A;  4JAA A;  2IWU A;  3FFQ A;  1XNR O;  3G7E A;  5J6A A;  3TK1 A;  5JCO C;  1XMQ O;  1A32 A;  5EZY B;  1S14 A;  2KQX A;  3DC5 A;  4JAV A;  3SYC A;  4BIZ A;  1XHZ A;  2EIM C;  3K79 A;  5LGU A;  4X9Q A;  3MHS C;  2QM4 A;  4PDR A;  4P2Z A;  2IJI A;  3HKD A;  2P22 C;  2FL4 A;  1DTO A;  5EC1 C;  3AG3 B;  2UXC B;  1N4C A;  1K5S A;  4UCT A;  1HNZ O;  3OTO O;  4CS3 A;  5LA6 B;  2WI3 A;  3CWV A;  2WLJ A;  4TV9 B;  1H2M A;  5JJN B;  4HXW A;  4X20 B;  1DGS A;  1QNM A;  4LPB A;  4MBC A;  4CWF A;  3K0D A;  3E8H A;  4NH7 A;  1LUV A;  3OD4 A;  2VWJ A;  4QGP A;  1AVM A;  1UPG A;  4CZZ A;  1K5Q A;  2ZE6 A;  4B6C A;  4X1I B;  1DLB A;  4U7O A;  1OCO B;  1KU9 A;  3T1C A;  4GQT A;  3RYF A;  2P06 A;  1G8M A;  1WB8 A;  4WBN B;  3J7A U;  4MB9 A;  4X64 O;  1G1X B;  3K99 A;  4B3S O;  1KUQ A;  2Z5U A;  4XIR A;  5CTY A;  3K5L A;  2WLM A;  4QNH B;  2VW5 A;  2QWO B;  5BR8 B;  3M8A A;  4CWT A;  2QA4 V;  4J10 A;  2JGD B;  4B3M B;  2H55 A;  3VQY A;  4UCR A;  5J9P C;  2HKJ A;  2BCC H;  2IH1 C;  2ZIM A;  3O65 A;  5IYB O;  3FYE B;  3N2K A;  1OV9 A;  1UYE A;  1S0V A;  3R4N A;  2UUC B;  1P7B A;  3RYH B;  5JWP A;  4MVS A;  3SPG A;  1FYJ A;  1VF7 A;  2YEG A;  1VMG A;  2DYS B;  1I94 B;  1Q6H A;  3K04 A;  1OHH G;  2YKJ A;  3I5D A;  3CYG A;  4NR1 A;  4DRX B;  1S76 D;  1KMI Z;  3PEH A;  1I7F A;  2JKI A;  2KKW A;  2ZDY A;  5EZY A;  4YHH B;  4Z2W A;  1AH6 A;  3AG4 B;  2EUL A;  2WWW A;  3B4S A;  3FV5 A;  4FVM A;  4KSG A;  3ZMS A;  4OX9 O;  3UQ8 A;  1SC5 B;  2OCH A;  1MZE A;  4H7Q A;  2YI6 A;  1HR0 B;  3A0Y A;  1TVK B;  4YKZ A;  1VQO V;  4DR1 B;  4KHP O;  1TUE B;  1EN6 A;  4E01 A;  1WAZ A;  5KA5 A;  1AM1 A;  4TV9 A;  2P5O A;  4NYK A;  1L0N H;  3ETD A;  2Q69 A;  4X20 A;  3TXQ A;  4FLT A;  4LF8 O;  2B9Z A;  3CC4 V;  5EBW C;  4MSW C;  4WFF A;  3TZ2 A;  2F23 A;  2HCH A;  4BIO A;  2ETN A;  3OUF A;  1JOY A;  4DV1 O;  2BTQ B;  3JAK B;  2CUG A;  4EGH A;  2FWZ A;  2JDI G;  3RGB A;  5CA3 A;  2UU9 B;  3ZHS A;  5B1B C;  4EFT A;  2G38 A;  3IC7 A;  1F51 A;  3JD3 A;  3T10 A;  1K8A W;  2YKB A;  3C3T A;  4NKG B;  4WBN A;  5HFL A;  4PA6 A;  3E35 A;  5KHH A;  3FB6 C;  3JZ3 A;  1AP6 A;  4RO2 A;  3E8F A;  3HKB B;  2JGD A;  4I9W A;  3ZKB A;  1N34 O;  1XMO B;  2YE2 A;  4XKA A;  1ZSP A;  3B8N A;  3RLR A;  4BIU A;  3QF7 A;  4FCR A;  1OCR C;  1IXM A;  1JFF A;  1V54 B;  3K98 A;  1Y4U A;  1GK9 A;  3B26 A;  2QTS A;  1E1Q G;  4G2K A;  3VAD A;  3T1K A;  2EBO A;  4DR7 O;  3RYH A;  3A0X A;  5E79 Z;  4DUY B;  2CCS A;  4MPN A;  5CA1 B;  4IYI A;  4O4I B;  3LDD A;  4J9Y B;  5CB4 B;  2FYP A;  3RYI B;  4DRX A;  2EIK C;  1NTM H;  4K3A A;  1M56 C;  3OTF A;  4O4J B;  1OZ0 A;  4JYA B;  3ABU A;  4GX5 A;  5L3B A;  4IGG A;  1N33 B;  3S3W A;  4JI3 O;  2ZQM A;  1HW7 A;  4O4H B;  1X59 A;  4Z1M G;  1AI6 A;  1EBO A;  1PL4 A;  4X66 B;  4TV8 B;  3WHA A;  3OMA B;  3A0H Z;  2PGG A;  2QDO A;  4X65 B;  4MTX A;  2CH7 B;  5JCO A;  3W7W A;  3EKO A;  4R8C A;  2VQE O;  3OWD A;  3D8C A;  1TVK A;  4MW3 A;  1FAF A;  1AMW A;  3TXS A;  5FL7 G;  3ASN C;  3ZBH A;  2Q8H A;  3CB2 A;  1HNX B;  2WA3 A;  1QLE B;  1MSD A;  5A9G A;  3UKM A;  4X1K B;  2CAZ C;  4IT5 A;  4AQY B;  3K97 A;  3GIG B;  2YKI A;  1BCC H;  2RNB A;  2Y0P A;  3ZX6 A;  1XI1 A;  4ZI7 B;  3R92 A;  2BTQ A;  3JAK A;  4F6R B;  4B7K A;  3K5M A;  3PN1 A;  4RWU A;  2ZCE A;  2WLH A;  4DR2 O;  3BA8 A;  2CTP A;  5IJ0 A;  5JQG B;  4QPK A;  3A0B Z;  4IHJ B;  1YT2 A;  1ZX3 A;  4TWK A;  4DV4 O;  1QR8 A;  4PDV A;  2JJ2 G;  1WJZ A;  1KBH A;  3HKB A;  4P8O A;  1FS0 G;  2QKA A;  1Z5W A;  3CME V;  1AJ6 A;  1SES A;  1RPO A;  3VQV A;  1YC3 A;  4MPE A;  3U2D A;  1VQ4 V;  3VHC A;  3CRC A;  3JD1 A;  3T1H B;  4X62 O;  3T2S A;  1GRJ A;  2YGE A;  4DK1 A;  4ASG A;  4WUC A;  3A0T A;  1NZ6 A;  3HB3 B;  1K34 A;  3QTF A;  1YSZ A;  4LF9 B;  4JI8 O;  3G6B A;  3E86 A;  1OCR B;  5CA1 A;  2QG2 A;  4O4I A;  4BQG A;  1YCI A;  3UO3 A;  5CB4 A;  4BQJ A;  2HLD G;  1FD9 A;  3RYI A;  5IWA B;  1L0L H;  2ADP A;  4GYC B;  2YE5 A;  1UYK A;  1ARO P;  4CWS A;  4HAM A;  4GKJ O;  2YEH A;  4O4J A;  2XAJ A;  2LGQ A;  4PV1 B;  5LGN A;  2UUA O;  3FT8 A;  1L1F A;  4O2A B;  1UYF A;  1UYL A;  1GMG A;  1W0K G;  1KKD A;  4B7P A;  4I0X A;  4JV5 B;  1L8D A;  2EIK B;  3ETG A;  4B08 A;  4ZIB A;  1QYE A;  2CH7 A;  4Q6G A;  3HZ1 A;  4LC1 A;  1YS3 A;  4MVO A;  2KB1 A;  3CWB H;  1QVG U;  4FFK A;  4PDM A;  3GVM A;  1I08 A;  3OGI B;  1MNG A;  2MW2 B;  4FLV A;  2EX3 A;  4UVB A;  4LFC O;  5JVD A;  5LOV B;  1NHI A;  2XX4 A;  3CHX A;  3M99 B;  2HHI A;  3GIG A;  1Q86 W;  3K06 A;  1NTZ H;  4PD4 F;  2YKE A;  1S5H C;  4NXM O;  4B7E A;  3ASN B;  1ZWI C;  2UXB B;  4J7J A;  1JJO A;  3ZHR A;  2CCU A;  3OW6 A;  4GGL A;  4ZI7 A;  3OR6 C;  2W6I G;  2ITD C;  1BKN A;  4F6R A;  3T0Z A;  3ZHT A;  2VQF B;  2WPD G;  5D5P A;  4DR4 B;  3FAV B;  3T0H A;  3K0G A;  3Q4H B;  1K33 A;  4UCV A;  4UV8 A;  1CEZ A;  2ZIN A;  4DV3 O;  1K7D A;  4DR3 B;  1L0O A;  1ZTE A;  1QQC A;  1NVP D;  2X7R B;  4FCP A;  4GUN A;  4X89 A;  2WA4 A;  5C8Y B;  5JQG A;  2YEB A;  2CGN A;  2UXN A;  4IHJ A;  4LCU C;  1MU5 A;  2IWS A;  2E0A A;  4LF7 B;  2XX5 A;  4JI6 O;  1GN2 A;  3SPH A;  5IDM A;  3APQ A;  4TOI A;  2R70 A;  4K8X A;  3RFR A;  1S77 D;  1KYO F;  1VF5 B;  2JGU A;  4V25 A;  2Q0A A;  3EFF K;  1SRY A;  3WG7 C;  3RT3 C;  4IL6 Z;  2B5U A;  4AWP A;  4WFE A;  1NI8 A;  3F5T A;  3GWK C;  1LUW A;  1MX0 A;  4L87 A;  5CBH A;  4E00 A;  2W6J G;  1IDS A;  1HP8 A;  1M90 W;  3QG5 A;  5H6R A;  1Y8O A;  2N05 A;  5GTH Z;  2BU5 A;  2Q4P A;  3SPJ A;  3ASO B;  1Z59 A;  3HHU A;  3AEI A;  1F4N A;  2FWY A;  3DXR B;  2YS8 A;  4K35 A;  2BT0 A;  1DF4 A;  2YI5 A;  2XOK G;  4KFM A;  2XJJ A;  4O2A A;  1IVS A;  4PU9 A;  2ZD9 A;  1PNL A;  2WAM A;  4OGQ B;  4LWI A;  5LGT A;  2UXC O;  4U7N A;  1BHA A;  1WPX A;  2ZDI C;  1QR9 A;  2R72 A;  1RM1 C;  2OCC B;  1I0H A;  4D7S A;  4YKW A;  1US7 A;  4YIO A;  3B77 A;  1SQX H;  2OT5 A;  2XD6 A;  3E22 B;  2IOQ A;  4PDL A;  1XL6 A;  2K5B A;  2HVJ C;  1BHB A;  4GFN A;  1QBZ A;  4P9P A;  1JR9 A;  1LR1 A;  5DED A;  4JI4 B;  3K9S A;  4MW8 A;  1BQ0 A;  5LOV A;  1I5D A;  3RLP A;  4CWO A;  2WI6 A;  1RP3 B;  2BOB C;  3ETE A;  5FNV B;  1BGY H;  2Q7G A;  1BXD A;  5CMU A;  2F66 C;  4JTD B;  1O9H A;  2Q6A A;  3CCM V;  4XBF A;  2BTZ A;  2YIB A;  4I4T B;  4J41 A;  3CRM A;  1B62 A;  5BOD A;  3FAV A;  3Q4H A;  4DV2 B;  2YEA A;  4PA4 A;  1TA8 A;  3L72 H;  4DV7 O;  4LFB B;  4L93 A;  1SQF A;  3HKE B;  3EHB B;  1PD3 A;  5C8Y A;  3W7X A;  1I58 A;  2IWX A;  3SYO A;  1I5A A;  5J71 A;  4YKX A;  2QR4 A;  1KC8 W;  5BR8 O;  1YT1 A;  1XHX A;  2JK5 C;  1SER A;  1NQT A;  4DV0 B;  4B3M O;  2A7W A;  4PA9 A;  2HR3 A;  1MG1 A;  1O9G A;  4JTC B;  4GX1 A;  3S5T A;  2AXT Z;  1Q81 W;  4FJC C;  2IOP A;  2MK3 A;  5CN0 A;  3PJS K;  3ZKD A;  3AK1 A;  3IJ4 A;  4LWG A;  4FPP A;  4OPA A;  4HYM A;  2UUC O;  3R4M A;  1URF A;  1XNQ O;  1YSC A;  2ZR2 A;  4HNA A;  2XAH A;  2LW7 A;  2ZKJ A;  4LH7 A;  2VWC A;  2HEP A;  4YKR A;  2CDY A;  1I94 O;  2ARH A;  3JYC A;  5LHG A;  2ZDX A;  3ZRX A;  2ZNJ A;  3UT5 B;  2XDL A;  5B3S C;  2PY5 A;  3EXA A;  5KHK A;  4PI2 A;  3WG7 B;  4GLX A;  4FM0 A;  1VQ7 V;  1IBK B;  1Q6U A;  4MP2 A;  3SJA C;  3DXR A;  4LF4 B;  4YHH O;  1UFI A;  3QVN A;  4MOT A;  3DTU B;  1WLE A;  1KKC A;  3A2F A;  5EC2 C;  3UM7 A;  4ASA A;  1I5Y A;  1NHH A;  2Z0A A;  1VF6 C;  4EM7 A;  2PI4 A;  2Q8G A;  3U10 A;  1FXV A;  1HR0 O;  4XKK A;  1H8H G;  5FLX N;  4DR1 O;  1AJP A;  4JI1 B;  3B40 A;  3DSQ A;  3GB7 C;  3E22 A;  4URM A;  3INX A;  2AHY A;  2QGN A;  3FT5 A;  3CEI A;  3ZHQ A;  4KFG A;  5M4E A;  4LF6 B;  2HP8 A;  1RM1 B;  2YIC A;  3DGE A;  4XDK A;  1P7G A;  2HVK C;  3K03 A;  2AKP A;  4A5U B;  2GV9 A;  1R3I C;  1W2B U;  4KXR A;  4PJ0 Z;  5FNV A;  3JAL B;  1Y67 A;  5ITZ B;  3P3P A;  1OCC C;  4X8A A;  4P9O A;  1VAR A;  1YDX A;  1SS3 A;  5KAF Z;  3CC7 V;  4I4T A;  3STZ C;  2UU9 O;  4DV7 B;  1IBM B;  4LH6 A;  2NR5 A;  4MTG A;  4BWA A;  1Q90 D;  1V54 C;  2CE4 A;  5L3E A;  2VCI A;  3MDS A;  3HKE A;  1K3E A;  2XJG A;  1F23 A;  2VS0 A;  4UCS A;  5LHH A;  4KSH A;  5KA6 A;  2ILM A;  3L70 H;  4H0L B;  1J95 A;  3R91 A;  1BYQ A;  4DV5 B;  3H4L A;  3K60 A;  1JFF B;  2AHZ A;  1XMO O;  2ADQ B;  3TUH A;  2Q68 A;  1Q6I A;  5L3F A;  5BOC A;  1GH6 A;  3I55 V;  3CRL A;  2NN4 A;  1XNQ B;  2DW4 A;  4J9Z B;  2ESA A;  1KB9 F; 
#chains in the Genus database with same CATH homology
 2ITC C;  1JCH A;  1H7S A;  4O0B A;  4O07 A;  5KUK A;  3ML0 A;  4XTJ A;  1BMF G;  5IYD O;  4ZVI A;  2WLI A;  1Q7Y W;  3CCR V;  1AI7 A;  3NMQ A;  4MTF A;  1FXK B;  4HXZ A;  1QLE C;  2M7W A;  4WCE V;  1MAB G;  4P30 A;  5B3S B;  3ZN0 A;  2YE4 A;  3EHJ A;  3FB7 C;  1ENV A;  2DWE C;  3GIE A;  4RUE A;  2PNR A;  1JPX A;  1K4D C;  2JIZ G;  3BM9 A;  4FCQ A;  1OSF A;  5CPH A;  2XAB A;  3LDC A;  4HYO A;  2ZDI A;  4XIT A;  5GW7 A;  2WLN A;  1NJI W;  2IJJ A;  1VQL V;  4CE1 A;  4ASF A;  3BMY A;  4O09 A;  5DM6 V;  3IFX A;  4JAS A;  2ZXW B;  1OCC B;  2B1I A;  5L3C A;  2O1U A;  3RVZ A;  4R3M A;  4BW5 A;  4MP7 A;  5DN6 G;  3U67 A;  3T4Z A;  2WSS G;  1NR7 A;  2CGF A;  2EXL A;  3B24 A;  4WF9 V;  2F43 G;  1YT0 A;  3ABT A;  3OAA G;  1UY9 A;  5L3J A;  5EK0 A;  3G75 A;  4JQL A;  2DQ0 A;  3OUS A;  3ZMV A;  4PRV A;  4LWF A;  5D6Q A;  1V55 C;  1M1K W;  2QEX V;  2NNU A;  2XND G;  4WFB V;  1Z5B A;  4UV9 A;  1FXK A;  4BAY A;  1ID0 A;  2V1D A;  2BRE A;  5L3G A;  4DUH A;  1B6Q A;  3B8M A;  1XL4 A;  2QTO A;  5D7C A;  5FNF A;  1E79 G;  4MPC A;  5EBM C;  2YE9 A;  4MVQ A;  1ZXM A;  2HJF C;  2WI4 A;  1G4Y B;  4X88 A;  2HG5 C;  4EFU A;  3B28 A;  4XE2 A;  3F7V C;  3LSS A;  1K4C C;  3RLQ A;  3WQ9 A;  4GT1 A;  2BYH A;  1Y4S A;  2YGA A;  1Y66 A;  3MD0 A;  1NVP B;  4DZY A;  2DWD C;  2IOR A;  3R65 A;  3STL C;  1VQ6 V;  4R1F A;  3W7T A;  2QM7 A;  4JYB A;  4E2L A;  3ASO C;  1AR1 B;  3ABL C;  1ROP A;  5HFM A;  2YEF A;  5CTU A;  1YTF D;  5CF0 A;  3ZRW B;  1YHQ V;  1P4R A;  4ZBM A;  1TIL A;  4HZ3 A;  4WFH A;  1W0J G;  2EIJ C;  2OCC C;  3JD4 A;  3A0Z A;  5FNC A;  2XJX A;  4EEH A;  3ZM7 A;  3LUT B;  1ZXN A;  5D6P A;  1H8E G;  4JAU A;  4WUD A;  3D36 A;  5GGZ A;  1PL0 A;  4ZKI A;  1V55 B;  4W7T A;  3HPL C;  2XDS A;  3LPS A;  1YC4 A;  4MS2 A;  3B27 A;  4O04 A;  3CGY A;  2YEI A;  1EI1 A;  4YXW G;  1THN A;  2H8M A;  2XHX A;  3A0W A;  2V7Q G;  3ABM C;  4H81 A;  2ZBK B;  3G6E V;  4WFA V;  4AWQ A;  1KP2 A;  3CCQ V;  1VQP V;  4BXI A;  4CWN A;  4H85 A;  3CCL V;  4QPJ A;  3JD2 A;  4FIP C;  4HYP A;  3HZ5 A;  4LP0 A;  1MOF A;  3IGA C;  1F4M A;  4CE2 A;  1S72 V;  5LBQ A;  3SYP A;  3SPC A;  1I5C A;  2XHR A;  4KP4 A;  1K9M W;  2EJR A;  5IDJ A;  4G27 B;  3QO8 A;  1QY8 A;  1THZ A;  1YIJ V;  3R4P A;  2H8P C;  5B1N A;  1S3J A;  2IJH A;  3ZRW A;  3ZMZ A;  5BZB A;  2OTL V;  2GFD A;  2B1G A;  2WI1 A;  2YE6 A;  3INW A;  3ABL B;  1GKF A;  1RPR A;  3U2K A;  2HFE C;  2WLL B;  4JF3 A;  3ZMT A;  3ZJZ A;  3OEE G;  2CG9 A;  2P6J A;  4E02 A;  4XDM A;  3CMA V;  1U2O A;  2R9R B;  2YE3 A;  4MVZ A;  2EIJ B;  3ZIA G;  2YEJ A;  4PRX A;  4GEE A;  3K9A A;  3ZXQ A;  4X9L A;  1R6N A;  1VQM V;  1MSW D;  2BSM A;  4GCZ A;  3CGZ A;  3B25 A;  1R62 A;  2UWD A;  1DF5 A;  1JQ0 A;  2WI2 A;  4I3H A;  2YK2 A;  4R3A A;  4URO A;  1UYM A;  3CCJ V;  1R3J C;  1NH2 D;  1NKD A;  3OMU A;  4URL A;  4TSF G;  2Z3Y A;  4OXS A;  3QDD A;  4P7A A;  1R3L C;  3C11 A;  4V26 A;  3LSQ A;  1UYH A;  4FK5 C;  4EMV A;  3EHG A;  3ABM B;  1YI2 V;  3O6O A;  4PA3 A;  3OFN G;  4CWP A;  3F5W C;  4RUF A;  1GJV A;  4EGK A;  3HYZ A;  3CPW U;  2P67 A;  1SZT A;  1YJW V;  2YEE A;  2QM8 A;  2R9I A;  3C0E A;  2WLK A;  2XAG A;  3E83 A;  3OE7 G;  3D0B A;  1FXK C;  4XCJ A;  1GO3 F;  3RBZ A;  1UYG A;  3ZRV A;  4HZ0 A;  2LP7 A;  1QVF U;  1KIJ A;  2WLI B;  5B1A B;  2WLL A;  4UVA A;  4UXN A;  5H6Q A;  1I59 A;  2QFO A;  2XCM A;  4RQE A;  1K92 A;  3KG2 A;  1VQ9 V;  3OEH G;  3O2F A;  1TC0 A;  4QE9 A;  3EHF A;  5M4N A;  3FKS G;  4CBC A;  1I5B A;  2BZ5 A;  3I56 V;  3TZ0 A;  1CPY A;  3H80 A;  4YKT A;  3H01 A;  1N8R W;  1VQN V;  1AJN A;  4MTO A;  5CBF A;  3EKR A;  1JVM A;  1R73 A;  3JD0 A;  4XC0 A;  2ZXW C;  2YSU B;  2JJC A;  4JTA B;  1YER A;  3HYY A;  1TC6 A;  1R3K C;  2D3O W;  2WI5 A;  1UYC A;  5EBL C;  3ABK C;  1H2G A;  2HG1 A;  2CH4 A;  2LFR A;  3LNU A;  1QZR A;  5M4K A;  5M4H A;  3Q5L A;  4TT3 G;  2Q67 A;  4AS9 A;  4XCL A;  1GM7 A;  2EIN B;  4XKO A;  1JM6 A;  1M57 C;  1EZJ A;  3CP1 A;  1LNQ A;  2C2A A;  4GX2 A;  1K97 A;  4YKQ A;  4R7C A;  3G7B A;  2P7T C;  2QG0 A;  2XAF A;  3Q5K A;  3SL2 A;  2YED A;  3OR7 C;  1PNM A;  5D7R A;  1UJW B;  3TTZ A;  5H9C A;  2WEQ A;  2YI0 A;  4G28 B;  4BAE A;  4JGS A;  3SYQ A;  3D3I A;  1B3Q A;  2UXX A;  5M4P A;  4XDJ A;  4LBE C;  2JJ1 G;  3T4D A;  2YI7 A;  3MNR P;  2BRC A;  3P32 A;  4HY1 A;  5IYC O;  2DYR C;  3VOU A;  2EIM B;  2YE8 A;  2LFS A;  2XDX A;  1Y8N A;  2EZO A;  3QO7 A;  3RVY A;  1UYD A;  3R4O A;  1GKX A;  4N21 A;  2IU3 A;  3T2M A;  1H38 A;  1YC1 A;  4EKW A;  3OM3 B;  3CRK A;  2XX2 A;  4MVR A;  5IN9 A;  2NLJ C;  1Q82 W;  3OWB A;  5C93 A;  5CTW A;  3OGC C;  2A0L A;  4KTN A;  3AG1 C;  2H94 A;  1PNK A;  2JEU A;  2EIL C;  4PEL A;  2XDK A;  4XIQ A;  3RKZ A;  4L90 A;  3ABK B;  3OMN B;  3E89 A;  4F4L A;  1H7U A;  2XHT A;  2A9H A;  1Z5C A;  3X2Q C;  1YTF B;  3RW0 A;  1EA6 A;  2O1V A;  4U93 A;  3MHH C;  2WEP A;  4L91 A;  3CCE V;  3TZ4 A;  4NH8 A;  3A0R A;  1M57 B;  1YES A;  3SPI A;  1JX9 A;  2GHY A;  4CWR A;  4NH9 A;  3NXS A;  3CCV V;  1ORQ C;  3ZXO A;  1SET A;  1Z5A A;  3BEH A;  4H33 A;  2YE7 A;  5CBG A;  4UUJ C;  1PVG A;  3QNE A;  3LNM B;  1VQ8 V;  4O05 A;  4ASU G;  4L8Z A;  2Q8F A;  4PA7 A;  3D2R A;  5IY5 C;  4CWQ A;  1ZWH A;  4KUM A;  2DQ3 A;  3W7S A;  3FYI B;  4K4O A;  5F3K A;  2CK3 G;  3O0I A;  2YJX A;  1A4H A;  3IED A;  2X6B A;  2O1W A;  3AG2 C;  2YGF A;  1JJ2 U;  3TET A;  2DYR B;  2Y48 A;  5M4M A;  3SYA A;  4YKU A;  1S16 A;  2OTJ V;  1M9N A;  2FTK A;  1NBM G;  2EZP A;  2BU7 A;  4GX0 A;  1B63 A;  3P30 A;  1EFR G;  4N23 A;  3ZN1 A;  3K3W A;  2K1E A;  2CCT A;  4XIP A;  4DXW A;  1BGQ A;  1KP3 A;  1VQ5 V;  3BY6 A;  3HEK A;  5B1B B;  5FND A;  2QKS A;  1GM9 A;  3AG1 B;  1ZW9 A;  2QE7 G;  3VHA A;  2XAQ A;  1VQK V;  4QE7 A;  2EIL B;  3TZ5 A;  3VHD A;  2A79 B;  1YJ9 V;  4R6Z A;  4AWO A;  3ZRS A;  4XDL A;  3X2Q B;  1GM8 A;  4UVC A;  1PKX A;  4I5S A;  2IH3 C;  3OMI B;  5L3D A;  1AI5 A;  1OCZ C;  2YEV B;  3EHH A;  2XAS A;  3F7Y C;  2P90 A;  3K08 A;  5B1O A;  1AI4 A;  2VCJ A;  4JYC A;  4H37 A;  1M56 B;  4URN A;  2YJW A;  1AJQ A;  4JPR A;  2BU8 A;  2XDU A;  1UY6 A;  3CD6 V;  1NH2 B;  4RQF A;  3TCU A;  2IU0 A;  3FB8 C;  4DO2 A;  1KD1 W;  2JEX A;  5IY5 B;  5F5R A;  4FMT A;  2GQP A;  1R6K A;  1UY7 A;  2Y69 C;  4GT8 A;  2BOC C;  1GTO A;  4HY6 A;  5LHI A;  3CCU V;  3AG2 B;  5D7D A;  1U0Z A;  3FB5 C;  1NR1 A;  4QJF B;  1COW G;  4PL9 A;  3GIF A;  4MT8 A;  2X6A A;  4HZ5 A;  3VBB A;  4YKY A;  1YSR A;  1Y4M A;  2IJK A;  5B1A C;  1KQS U;  3CC2 V;  4QIW F;  2YK9 A;  1TID A;  3CCS V;  2BU2 A;  1E1R G;  3SJQ C;  3QO5 A;  1NHJ A;  4WUB A;  1I5X A;  3E8B A;  2Q2E B;  2FXS A;  2XK2 A;  1K73 W;  1QCE A;  4Q20 A;  2BYI A;  1UYI A;  1UY8 A;  3AG3 C;  2ATK C;  1KEC A;  3E2E A;  2QF6 A;  2YEV A;  4CE3 A;  2IW5 A;  1TBW A;  3GWO A;  4MVM A;  3W7U A;  1FFT B;  1QLN A;  5CTX A;  1OCZ B;  3WFV A;  2X6C A;  3KE6 A;  2GSM B;  3E8G A;  3G71 V;  1TH8 A;  1YIT V;  1KZN A;  3JCZ A;  4LP8 A;  4ASB A;  3CXC U;  1OCO C;  2WER A;  4LWE A;  4XD8 A;  3PEJ A;  3ZCC A;  1CP9 A;  1HWY A;  3OW2 U;  2PI5 A;  3Q5J A;  1YJN V;  1GKZ A;  2EIN C;  2YEC A;  4L94 A;  4EGI A;  2ZR3 A;  4WFG A;  4R50 A;  5FWK A;  2X0L A;  1FXH A;  3CYO A;  2Y69 B;  3G4S V;  2YKC A;  5E1A C;  3LDE A;  2WI7 A;  2DYS C;  3ZMU A;  1AH8 A;  1BL8 A;  4MVU A;  1YET A;  2Q8I A;  4KQV A;  3OPD A;  1Y8P A;  4LWH A;  3AG4 C;  2HKO A;  5KUM A;  2W0F C;  4RAI A;  2BU6 A;  2IWU A;  3G7E A;  5J6A A;  3TK1 A;  1S14 A;  3SYC A;  4JAV A;  4BIZ A;  2EIM C;  3K79 A;  5LGU A;  3MHS C;  4PDR A;  4P2Z A;  2IJI A;  1DTO A;  5EC1 C;  3AG3 B;  1K5S A;  2WI3 A;  3CWV A;  2WLJ A;  4HXW A;  4LPB A;  4MBC A;  4CWF A;  3K0D A;  3E8H A;  4NH7 A;  4CZZ A;  1K5Q A;  4B6C A;  1DLB A;  4U7O A;  1OCO B;  3T1C A;  4GQT A;  1G8M A;  4MB9 A;  3K99 A;  2Z5U A;  4XIR A;  5CTY A;  2WLM A;  4QNH B;  2VW5 A;  4CWT A;  2QA4 V;  2H55 A;  5J9P C;  2HKJ A;  2IH1 C;  5IYB O;  3FYE B;  1UYE A;  1S0V A;  3R4N A;  1P7B A;  4MVS A;  3SPG A;  2YEG A;  2DYS B;  3K04 A;  1OHH G;  2YKJ A;  1S76 D;  3PEH A;  2JKI A;  2ZDY A;  1AH6 A;  3AG4 B;  2WWW A;  3FV5 A;  4KSG A;  3ZMS A;  4H7Q A;  2YI6 A;  3A0Y A;  4YKZ A;  1VQO V;  1TUE B;  4E01 A;  5KA5 A;  1AM1 A;  3ETD A;  2Q69 A;  3CC4 V;  5EBW C;  4MSW C;  4WFF A;  3TZ2 A;  2HCH A;  3OUF A;  1JOY A;  4EGH A;  2FWZ A;  2JDI G;  5CA3 A;  5B1B C;  4EFT A;  3IC7 A;  1F51 A;  3JD3 A;  3T10 A;  1K8A W;  2YKB A;  5HFL A;  4PA6 A;  3E35 A;  3FB6 C;  3JZ3 A;  4RO2 A;  3E8F A;  4I9W A;  3ZKB A;  2YE2 A;  4XKA A;  3B8N A;  3RLR A;  4BIU A;  4FCR A;  1OCR C;  1IXM A;  1V54 B;  3K98 A;  1Y4U A;  1GK9 A;  3B26 A;  1E1Q G;  4G2K A;  3VAD A;  3T1K A;  2EBO A;  3A0X A;  2CCS A;  4MPN A;  3LDD A;  4J9Y B;  2FYP A;  2EIK C;  1M56 C;  1OZ0 A;  3ABU A;  4GX5 A;  5L3B A;  2ZQM A;  4Z1M G;  1AI6 A;  1EBO A;  3WHA A;  3OMA B;  4MTX A;  3W7W A;  3EKO A;  4R8C A;  3OWD A;  4MW3 A;  1AMW A;  5FL7 G;  3ASN C;  2Q8H A;  1QLE B;  3UKM A;  3K97 A;  3GIG B;  2YKI A;  3R92 A;  2WLH A;  4QPK A;  1YT2 A;  4TWK A;  1QR8 A;  4PDV A;  2JJ2 G;  4P8O A;  1FS0 G;  3CME V;  1AJ6 A;  1SES A;  1RPO A;  1YC3 A;  4MPE A;  3U2D A;  1VQ4 V;  3VHC A;  3JD1 A;  3T2S A;  2YGE A;  4ASG A;  4WUC A;  3A0T A;  3HB3 B;  1K34 A;  3QTF A;  1YSZ A;  3E86 A;  1OCR B;  4BQG A;  2QG2 A;  4BQJ A;  2HLD G;  2YE5 A;  1UYK A;  1ARO P;  4CWS A;  4HAM A;  2YEH A;  5LGN A;  2XAJ A;  3FT8 A;  1L1F A;  1UYF A;  1UYL A;  1GMG A;  1W0K G;  1KKD A;  4B7P A;  2EIK B;  3ETG A;  1QYE A;  3HZ1 A;  4LC1 A;  1YS3 A;  4MVO A;  2KB1 A;  1QVG U;  4PDM A;  4UVB A;  1NHI A;  2XX4 A;  3M99 B;  3GIG A;  1Q86 W;  3K06 A;  2YKE A;  1S5H C;  3ASN B;  1ZWI C;  4GGL A;  2CCU A;  3OW6 A;  3OR6 C;  2W6I G;  2ITD C;  1BKN A;  3T0Z A;  2WPD G;  3T0H A;  3K0G A;  1K33 A;  4UV8 A;  1CEZ A;  1K7D A;  1L0O A;  1NVP D;  2X7R B;  4FCP A;  4X89 A;  2YEB A;  2UXN A;  4LCU C;  1MU5 A;  2IWS A;  2E0A A;  2XX5 A;  3SPH A;  5IDM A;  1S77 D;  4V25 A;  3EFF K;  1SRY A;  3WG7 C;  4AWP A;  2B5U A;  4WFE A;  1MX0 A;  4L87 A;  5CBH A;  4E00 A;  2W6J G;  1M90 W;  5H6R A;  1Y8O A;  2BU5 A;  3SPJ A;  3ASO B;  1Z59 A;  3HHU A;  3AEI A;  1F4N A;  2FWY A;  2BT0 A;  1DF4 A;  2YI5 A;  2XOK G;  4KFM A;  2XJJ A;  4PU9 A;  2ZD9 A;  1PNL A;  2WAM A;  4LWI A;  5LGT A;  4U7N A;  1BHA A;  1WPX A;  2ZDI C;  1QR9 A;  1RM1 C;  2OCC B;  4YKW A;  1US7 A;  3B77 A;  2OT5 A;  2XD6 A;  2IOQ A;  4PDL A;  1XL6 A;  2K5B A;  2HVJ C;  1BHB A;  4GFN A;  1QBZ A;  4P9P A;  4MW8 A;  1I5D A;  3RLP A;  4CWO A;  2WI6 A;  2BOB C;  3ETE A;  1BXD A;  5CMU A;  4JTD B;  2Q6A A;  3CCM V;  4XBF A;  2BTZ A;  1B62 A;  5BOD A;  2YEA A;  4PA4 A;  4L93 A;  3EHB B;  1PD3 A;  3W7X A;  1I58 A;  2IWX A;  3SYO A;  1I5A A;  5J71 A;  4YKX A;  1KC8 W;  1YT1 A;  2JK5 C;  1SER A;  1NQT A;  4PA9 A;  2HR3 A;  1MG1 A;  4JTC B;  4GX1 A;  1Q81 W;  4FJC C;  2IOP A;  2MK3 A;  5CN0 A;  3PJS K;  3ZKD A;  4LWG A;  4FPP A;  4HYM A;  3R4M A;  1YSC A;  2ZR2 A;  2XAH A;  2ZKJ A;  2VWC A;  4YKR A;  3JYC A;  5LHG A;  2ZDX A;  3ZRX A;  2XDL A;  5B3S C;  3WG7 B;  1VQ7 V;  4MP2 A;  4MOT A;  3DTU B;  1WLE A;  5EC2 C;  3UM7 A;  4ASA A;  1I5Y A;  1NHH A;  4EM7 A;  2PI4 A;  2Q8G A;  1FXV A;  4XKK A;  1H8H G;  1AJP A;  3GB7 C;  4URM A;  3INX A;  2AHY A;  3FT5 A;  4KFG A;  5M4E A;  1RM1 B;  3DGE A;  4XDK A;  2HVK C;  3K03 A;  2AKP A;  1R3I C;  1W2B U;  1OCC C;  4X8A A;  4P9O A;  3CC7 V;  3STZ C;  4MTG A;  1V54 C;  5L3E A;  2VCI A;  1K3E A;  2XJG A;  1F23 A;  5LHH A;  4KSH A;  5KA6 A;  1J95 A;  3R91 A;  1BYQ A;  3H4L A;  3K60 A;  2AHZ A;  3TUH A;  2Q68 A;  5L3F A;  5BOC A;  3I55 V;  3CRL A;  2DW4 A;  4J9Z B;  2ESA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...