3DGEA

Structure of a histidine kinase-response regulator complex reveals insights into two-component signaling and a novel cis-autophosphorylation mechanism
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
237
structure length
237
Chain Sequence
b'KRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein
molecule tags Transferase/signaling protein
source organism Thermotoga maritima
publication title Structural Insight into Partner Specificity and Phosphoryl Transfer in Two-Component Signal Transduction.
pubmed doi rcsb
total genus 69
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3dgeA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3dgeA02
5M4HA 3OMUA 1YT1A 5J71A 3C0EA 1UYLA 3R4OA 2YEFA 3RKZA 4AWPA 1QYEA 3WQ9A 4MT8A 3HZ5A 3TUHA 4X9LA 2CCTA 4KP4A 4QPKA 2LFRA 3VHDA 1TC6A 4FCPA 5FWKA 2YI6A 4I5SA 1ZXMA 4L94A 3ZM7A 2YE4A 4JAVA 4XCLA 4Q20A 5M4EA 2ZDXA 1YETA 3INWA 2YEJA 1NHHA 5D6PA 3ZRVA 5M4NA 2WI7A 1S16A 3R4NA 2HCHA 1BKNA 4PL9A 4YKXA 2GQPA 3LNUA 3PEHA 1JOYA 1MU5A 2FWZA 2GFDA 4EGIA 5GGZA 3ZRXA 4LWGA 3BM9A 2YE9A 4KTNA 4XKAA 4YKRA 3R4MA 4WUBA 1TBWA 4LWFA 1Y8NA 2IORA 4ASAA 4YKTA 4XE2A 3RLPA 3FV5A 2BU6A 3TZ0A 1I58A 2LFSA 1TILA 2UWDA 1PVGA 1GJVA 3B26A 4XIQA 3FT5A 1BYQA 4NH7A 3TK1A 1GKZA 5BODA 2QG0A 4CE3A 4FMTA 1TH8A 4E00A 1I5CA 2BREA 2WWWA 2WI6A 2H55A 3H4LA 2QG2A 1TIDA 4MB9A 1JM6A 1KIJA 1AH8A 4W7TA 4CE1A 2BU7A 5CTUA 4XKOA 3R4PA 4HZ5A 3A0ZA 4CWOA 2VCIA 1I5AA 3OWBA 4HY6A 3K60A 5CTWA 3GIFA 3GIGB 1A4HA 3EHFA 2ZBKB 4U7NA 4BIZA 5D6QA 4H85A 2YE2A 4MTXA 2VWCA 2FYPA 4EGHA 4DUHA 4LWEA 1THNA 5L3JA 5CPHA 1GKXA 3K99A 2O1UA 2E0AA 3G7EA 3ZKBA 1H7SA 3TZ2A 3VHAA 2XJGA 3HYYA 4JASA 2VW5A 4KFGA 4JYBA 3CGYA 3HYZA 2WI3A 5FNFA 4CWQA 3H80A 1H7UA 3A0RA 1Z5BA 2YKBA 4XDMA 2QM7A 3D2RA 5CTXA 3GIGA 4WUDA 4XIPA 2XCMA 3BMYA 4PU9A 3ZKDA 1YESA 2XDLA 4L90A 5M4MA 2XHXA 3EHGA 2BZ5A 1ZW9A 5FNCA 2QM8A 2YI0A 4XIRA 4MP7A 3TZ4A 2HKJA 2YE8A 3Q5LA 4DZYA 4GEEA 4CWPA 3INXA 3O2FA 1YSZA 2WI1A 1AJ6A 2YEGA 1AM1A 1AH6A 4FPPA 2YKEA 4YKQA 2WI2A 3MD0A 4XITA 2YEBA 1EA6A 1IXMA 1ZXNA 2YEIA 1YT2A 5CTYA 4CWSA 3VHCA 4XTJA 1US7A 4FCRA 4GT8A 2K5BA 4FCQA 4XD8A 4UROA 2XHTA 4LC1A 4LWIA 2Q2EB 1Y4UA 5BOCA 4HXZA 1Y4SA 4JQLA 3T0ZA 5M4PA 2FTKA 4YKWA 5IDMA 4L8ZA 1YT0A 4O07A 4E01A 3CRLA 3R91A 2YKJA 3KE6A 4YKUA 2BTZA 3T1KA 5IDJA 4LPBA 1Y8OA 1YC1A 2VCJA 2YKIA 3R92A 4V25A 4MPEA 5F3KA 3ZXOA 3FT8A 4GFNA 3ZXQA 3A0WA 4ASFA 3K98A 3QDDA 3ZRWB 2JKIA 4HYPA 4AWQA 4URNA 4CWFA 4XC0A 4PRXA 4KSGA 3O0IA 4YKZA 2YGEA 4GT1A 4URMA 3EKRA 2XJJA 5CF0A 3A0TA 3EKOA 3JZ3A 1UYCA 2HG1A 2BU5A 3HEKA 2XDKA 2BU8A 2YJWA 3VADA 4BQGA 1Y8PA 2XX2A 2YK9A 4YKYA 1Z5CA 3G7BA 1OSFA 4HYMA 4B7PA 4O05A 3T10A 4B6CA 1B63A 2YEHA 2WEPA 4O0BA 2IWSA 1UYKA 1I5BA 1L0OA 4PRVA 1UY8A 3NMQA 3A0YA 4CWNA 1S14A 2EXLA 2YK2A 1TC0A 3HHUA 1F51A 3P32A 3O6OA 4BQJA 2FXSA 5IN9A 2YE7A 3LPSA 3QTFA 3OW6A 5J6AA 4NH8A 2YEEA 5B1NA 1UY9A 4LWHA 1UY7A 4WUCA 3B24A 4NH9A 3DGEA 1I59A 1Z5AA 3B28A 2Q8FA 4L93A 4URLA 1UYIA 4R1FA 5D7RA 2YGFA 2XDSA 2Q8IA 2YKCA 4U93A 2XDXA 1NHJA 4MP2A 4O09A 2QFOA 2Q8HA 2YE3A 3TTZA 5D7CA 1I5DA 2XX4A 3ZRWA 2O1VA 3EHHA 2XHRA 3SL2A 2XD6A 4H81A 2BSMA 3K97A 4XCJA 4H7QA 5M4KA 1MX0A 2WI4A 2YJXA 1YC3A 4I3HA 3U67A 2P67A 2XJXA 5B1OA 4HZ0A 2XX5A 2JJCA 4MBCA 2C2AA 4CWTA 2CCUA 2WEQA 3OWDA 4GCZA 3NXSA 4EFTA 1NHIA 2BRCA 4K4OA 1Z59A 4KQVA 1YC4A 2IWUA 4L91A 4HY1A 3T0HA 1YERA 4JYCA 2ESAA 3TZ5A 4EFUA 2CGFA 3MNRP 2CCSA 4MOTA 3D36A 1ID0A 2ZDYA 4O04A 3IEDA 1UYEA 1UY6A 1BGQA 3B25A 1UYFA 2YEDA 2PNRA 4EMVA 5FNDA 4BIUA 4R3AA 4ASBA 3HZ1A 2WERA 4MPCA 4HXWA 3A0XA 1UYDA 2XDUA 2BU2A 1UYGA 2YGAA 2YI5A 3Q5KA 1AMWA 3T2SA 2AKPA 2BT0A 4MPNA 2YE5A 1UYMA 3WHAA 1KZNA 2IOQA 2H8MA 1YS3A 4LP0A 3U2KA 5D7DA 4AS9A 4V26A 4XKKA 2BYIA 1QY8A 2IOPA 4ZKIA 2XABA 3PEJA 1U2OA 3RLRA 4EGKA 4R3MA 4JAUA 4EEHA 2BYHA 2QF6A 4E02A 1UYHA 3Q5JA 4GGLA 3CGZA 4ZVIA 3ZCCA 2XK2A 4BAEA 3C11A 1ZWHA 1QZRA 2O1WA 2YEAA 4P7AA 2YECA 3D0BA 5C93A 2YE6A 4EM7A 3G75A 2Q8GA 4CE2A 1U0ZA 3CRKA 3B27A 4KSHA 3U2DA 4QPJA 1B62A 1R62A 3EHJA 4ASGA 3OPDA 4GQTA 2WI5A 2YI7A 1B3QA 4AWOA 4U7OA 3GIEA 2CG9A 2IWXA 4P8OA 3CWVA 2CH4A 4BXIA 2FWYA 3RLQA 1EI1A 2ZKJA 5F5RA 1YSRA 1BXDA 4CWRA
chains in the Genus database with same CATH superfamily
3K0GA 1IBMB 4J7KA 2VQFO 4LFCO 1YT1A 2QWQB 2YXYA 3W7TA 2AW9A 4IYHA 4ZI7B 1UYLA 1EN5A 5GONA 3RKZA 1Q90D 2K9PA 4UVCA 3WQ9A 1VQNV 4DR4O 4JTCB 3HZ5A 1X59A 1D2DA 4NTYA 2CCTA 2X6BA 1DF4A 1Q6UA 3B09A 4KP4A 4QPKA 2ADPA 4DV2O 2IU3A 2LFRA 3L73H 1R3JC 2YI6A 4DR3B 1PPJH 3UO3A 1XMOO 2QDOA 1G8MA 4Q20A 3SPJA 2JDIG 1JFFB 3INWA 2QEXV 4FJCC 2CTWA 3JARA 1VQ4V 3SYPA 3ZRVA 4PA3A 2WI7A 3JASB 2ZIMA 3R4NA 1B6QA 2DWDC 2PZSA 4YKXA 2GQPA 3CCSV 2EIMB 3RVYA 1K4DC 4CH6A 4X1KB 3G6BA 1V55C 4UCVA 1RFYA 3C90A 2GFDA 1MU5A 3AK1A 5GGZA 1MA1A 3ZRXA 2PI4A 2HHHB 3AG7A 3G67A 1TBWA 4ICGA 4QE9A 2LJ2A 1H2NA 3CS5A 2L35A 1SA0B 4YKTA 4ZHQB 3K59A 4DO2A 5KX5B 1F4MA 5EBMC 4WBNB 3B26A 3K9AA 1BYQA 3B8NA 2HHHO 4FFBB 2OT5A 1AI7A 3B4SA 3QVNA 4I9WA 1I5CA 2X7RB 2WWWA 1M90W 5EZYB 3K57A 2H55A 3H4LA 3JD2A 2NN4A 1NTMH 1TIDA 3JAWA 4MB9A 5IJ9A 1YJWV 1AI5A 1R6KA 3R4PA 1FYJA 1TUEB 2F4VO 1GH6A 4MS2A 4DW0A 2HVJC 1I5AA 1YDXA 1GK9A 3K60A 1WJZA 3L72H 4PHZA 4F4LA 4BW9A 3CX5F 4ZOLA 4PJ0Z 2ZR2A 4DV3B 1K73W 5D6QA 4LF5B 5BY1A 2YE2A 2OTJV 3E22A 2H3OA 4U3JB 4DUHA 4LWEA 1YXBA 1BT8A 3CCQV 4J42A 4L8JA 1ZL8B 4GUNA 1S0VA 3G7EA 4JI4O 1Q43A 3BVOA 1H7SA 1AJNA 3QG5A 4XDJA 1FD9A 1G4YB 3E8GA 4JYBA 1GO3F 4H44B 3HYZA 2OWOA 5EIBD 4ZOLB 4FM2A 4CWQA 1H7UA 4NVPA 2YKBA 3A2FA 3KZIZ 4JI8B 5LMNB 1M5IA 3B8MA 3GIGA 1NTZH 4XIPA 5CA0A 5LYJA 3B40A 5CB4B 4WFFA 4DV6O 1K5QA 2YICA 3MAQA 2QE7G 4P2ZA 1NKDA 3ZKDA 4L90A 5M4MA 4J9ZB 4OX9O 3HKDB 4ZIBA 2BZ5A 1ZW9A 5IJ9B 1XBLA 2YI0A 4O2AB 3TZ4A 5E1AC 2JEUA 2A7WA 3RGBA 3Q5LA 4LWSA 1YSZA 4DV5B 5LA6B 1Y76A 1OCOB 4YKQA 4CH5A 1WN7A 4CZZA 2WI2A 1KD1W 3M99B 1BL8A 1KP3A 3ZJZA 3OTFA 1SQXH 4MVMA 4GT8A 2GUZB 5A2QN 4UROA 5GTHZ 4NTXA 3CEIA 4DR6B 2Y0PA 2YS8A 2GSMB 4HNAB 3AG4C 2WLJA 1FFTB 2F1MA 1PNLA 1Y4SA 3HKBB 5IDMA 3CCMV 2DJVA 4L8ZA 1QVGU 5BZBA 2EIMC 5IYBO 1KYOF 3O9OA 3CYOA 4JI6B 3QO8A 3HR0A 4O4JA 2QWRB 1OHHG 4E72A 5D5QA 2YIDA 3F5TA 4X1YA 2L6LA 3APOA 3T1HB 2BTOA 3D8CA 1Y4MA 4MVRA 1SQPH 2ZE8A 3T1CA 4GZRB 3FT8A 1LUWA 1XQ8A 3ZMTA 3DTUB 4JI6O 3K98A 3FB5C 3ZRWB 3ABLB 1K4CC 4PI2A 4FLVA 4URNA 4XC0A 4IIJA 3O0IA 3UCSC 2Q69A 2MW2B 2WA3A 4AQYO 4YKZA 2E5LB 2Q0AA 3ETQA 3RYIA 3EKOA 4JV5B 4I9QA 2Q6AA 2XX2A 5LGTA 5B1BC 1SQFA 1FS0G 3ZMUA 4HYMA 1IURA 2P4KA 2M6YA 4X20A 2YEHA 2IU0A 1UYKA 4R6ZA 1EZJA 2XOKG 4J10A 2IJIA 2EXLA 3CRRA 3P3PA 5LGNA 4LF7O 2AHYA 3P32A 1SERA 3O6OA 4BQJA 3OTOO 2FXSA 4X62O 3LPSA 2FKXA 1MMMA 1S76D 1UY9A 4E4EA 5JH7A 2JVDA 2R9RB 3B24A 5FPOA 1NS1A 3LMMA 1UYIA 2W0XA 2HLDG 5KHJA 4DV1B 2EILC 2JRIA 3E2EA 3TTZA 2XDXA 5FNVB 4O09A 2QFOA 3ZIAG 2YE3A 2KKWA 1JVMA 5D7CA 1ZUQA 4NXMB 1RM1C 4FK5C 3EHHA 2B9ZA 3ZN0A 1LR1A 5IJ0B 4K0KO 3H1KH 1IBLB 3JAMN 1WB7A 3JCZA 4H7QA 5M4KA 2YJXA 3JD4A 1URFA 1N0NA 1P7GA 1R6TA 4O2BB 4TV8B 1NH2B 1Q82W 2P67A 1V9PA 3JYCA 1EBOA 3LNNA 4JI0O 5EIBC 3D3IA 1L8DA 1R73A 4LH6A 2OCCC 1N36B 2F23A 4U3JA 4NXMO 5GONB 4EFTA 3J81N 4JYYA 1ZX3A 1VF6C 4UB6Z 1XUQA 4K4OA 3OGCC 3IAYA 1YC4A 1VF7A 2IWUA 3LDDA 4X20B 5EC2C 1M1KW 1SRYA 3M7MX 1LUVA 2KB1A 5LMUO 4O2BA 4TV8A 3TZ5A 1QU7A 3SYCA 1R3IC 3MNRP 2EJRA 2LW7A 4MOTA 1I7FA 2DYSC 5KLVH 5B3SC 1S77D 1VF5B 4PA9A 4FLZA 3HB3B 4X88A 1SQGA 1MABG 1UY6A 4WFEA 1UYFA 2YEDA 3WG7B 4BIUA 3CMEV 4NTWA 3OFNG 1VQ5V 3A0XA 1UYDA 1HW7A 2B1GA 3T2SA 1H8HG 2AKPA 3HPLC 4MPNA 1BS3A 3ZRSA 2YE5A 4UCUA 3JAKA 3JD0A 4J11A 1KZNA 2Y48A 3U2KA 4AS9A 3LSSA 1QY8A 3DC6A 4ZKIA 4DR7O 4DR2O 3RLRA 2IJHA 4EGKA 2EINB 1Q81W 2BYHA 5L3EA 1MSDA 3QO5A 2YIBD 1UYHA 3CGZA 3ZCCA 2JS5A 4MW8A 4DK1A 4B7KA 1YSCA 3LSUA 1QZRA 4TV9A 1RSOB 3IGAC 2XAFA 4CC6A 3OR6C 4OPHA 3SGIA 3OUFA 2YE6A 4EM7A 1L0NH 2CTRA 2ZINA 3STZC 1Q5OA 4ASUG 4UV8A 2WLIB 2DN9A 2XAJA 4K0KB 2UXDB 3B27A 3FKSG 5B3SB 1O9GA 3U2DA 3FB7C 4W4LA 4FIPC 1V54B 1BHAA 3OPDA 2B1IA 1KECA 2YI7A 4JF3A 3GIEA 1XHZA 3JATB 3EHBB 2FWYA 5IWAO 1EI1A 2ZKJA 5F5RA 1YSRA 2F95B 5J2TA 4PI0A 1VQKV 5M4HA 2GV9A 5LHIA 3OMUA 4DXWA 1JJ2U 5J71A 2IH1C 4LF4B 3LDEA 4OX9B 1CP9A 5K1XA 4AWPA 1PL4A 1MG1A 1S5LZ 2OCCB 2VWKA 5KA6A 4YJ2B 3W7UA 3TUHA 2UXXA 2AZ2A 2ZM6O 2E74B 5JVDB 5AG2A 2N04A 4CC5A 4L94A 1NR1A 2XNDG 5B5EZ 2N05A 1AI6A 1NHHA 3LDCA 1KQSU 5L3CA 1DK1A 1FFXB 2HCHA 2YEVB 3ZHQA 4PL9A 3PEHA 2HVKC 4E2LA 3CRAA 3CSXA 2FWZA 4JI1O 5JVDA 3A0BZ 4LWGA 3BM9A 1Q86W 2R70A 4KTNA 1ZL8A 3H1LH 3OM3B 5H6QA 3SJAC 3VQVA 1Y74B 3X2QC 2P06A 3QTCA 4YKRA 4WUBA 1AJQA 2ARHA 5BMVA 2IORA 5ITZA 4PA7A 1COWG 2EJ7A 1DGSA 3BRCA 4JI1B 1TILA 1PVGA 5EBLC 4XIQA 1XNQO 2KG7B 1GKZA 2C1IA 5JJEB 2QG0A 2R9IA 3VOUA 4DR4B 2BREA 2JGDB 3ICXA 3CXHF 4J41A 5IYCO 3K3WA 2Y4UA 3EXAA 1JM6A 4R50A 5CTUA 2C1GA 1I94O 1XEQA 1YCIA 4WF9V 4RO2A 4QNHB 5J2UA 2E5LO 3ASOC 4HZ5A 3OR7C 4CWOA 2CDYA 3GIFA 4OPAA 4CS2A 3H01A 3EHFA 4DV5O 4U7NA 4QIWF 4WFHA 1S72V 4BIZA 1K5SA 4NR1A 3SJQC 5J2TB 4MVSA 4H85A 3ABLC 2DQ0A 2VWCA 4UXNA 1XMQO 5IY5C 1P84F 4C7UA 4DUZO 1KU9A 1VIBA 4X66O 3G71V 2A3QA 3QO7A 3K99A 1JQ0A 1PP9H 2QWPB 4GKKB 2YXLA 2QKSA 4DR6O 3HYYA 4KXRA 4JASA 2VW5A 4KFGA 4EKWA 3CGYA 4YY3B 2WI3A 2YUAA 1N32O 2VRZA 1IZ3A 3J80N 5DECA 5FNFA 3E8BA 3H80A 1Z5BA 2QM7A 3DXRA 3JARB 4X66B 2XCMA 1H2SB 4J7JA 2GBOA 2UU9O 2D3OW 4DUYO 4EEQA 2YIAA 4X9QA 3T1HO 2XHXA 3EHGA 2HFEC 1K3EA 5FNCA 1N32B 1YTFB 4MP7A 4IT5A 4R8CA 3RN4A 4I0XB 2HKJA 1RP3B 1N33B 2ZNJA 3O2FA 1AVMA 4DR3O 2YKEA 2G38A 1AJPA 3BY6A 2GTAA 1J95A 1XOUA 2WA4A 4CS3A 1ZXNA 2YEIA 1YT2A 5CTYA 4CWSA 1US7A 4FCRA 3B2EE 2WSSG 4LFAO 3SYAA 1HNZO 5KUKA 2XHTA 2PGGA 4LC1A 1WNSA 3MDSA 2OYQA 4YJ2A 5KHIA 4X1KA 4HXZA 4JQLA 3BCCH 4RUEA 4DR1O 5LGUA 1K33A 5LHHA 1YJ9V 3T1KA 3VQXA 1Y76B 5LA6A 2YKIA 2ETNA 2W0FC 2IM9A 1QR9A 1MZEA 2FL4A 5J9PC 3K9SA 3A0WA 4GKKO 1DTOA 3S3XA 1WB8A 4LR3A 1HR0B 3ABUA 5A9GA 4HYPA 5IJ0A 1D5NA 4FM1A 4B3MB 3DC5A 4DV1O 4DK0A 4WFBV 4I4TB 3L9DA 3RYCA 3RYIB 1Y67A 2GDSA 2W6IG 3A0TA 1TAEA 4WFGA 3BA9A 2BTQB 4DV4B 3OT7A 2XDKA 2YJWA 3VADA 1IBLO 1P4RA 3BAAA 2UU9B 2YK9A 3D3QA 3GWOA 4HAMA 2GUZA 3CC7V 4JI2B 4XDKA 3J7AU 4YKYA 2F93B 3ZHSA 1FKAO 1OSFA 4W4KA 1W0JG 1RPRA 2JS3A 3E86A 3K08A 1W59A 3T10A 4B6CA 1B63A 3E22B 2XHBA 4LF9O 3ZEDA 4FM0A 1IVSA 1PL0A 3NMQA 4CWNA 3S5TA 3TJTA 1NZ6A 5B66Z 1F51A 4DV0B 1VP7A 2XTAA 2QA4V 2YE7A 3QTFA 1BZKA 3FD9A 5J6AA 1AI4A 2LP7A 2YEEA 1KMIZ 2Q7HA 1PKXA 5JJNB 1YITV 3L71H 2UUAB 3PN1A 2F43G 4FLTA 4DV6B 1TUBB 1BE3H 4X64B 4LFAB 4DYLA 3B28A 2UUCB 3FYEB 1Z5VA 2MK3A 1SQQH 4Z1VA 2Q8IA 2CAZC 4H33A 1QNMA 3AG1C 3E83A 4LF6B 4JV5O 1M57B 2XHRA 2XD6A 2QTOA 3K97A 3B77A 2P90A 2WI4A 1CXZB 1YC3A 3TXSA 4I3HA 1NVPD 1SZTA 5EYPA 4HZ0A 3OEEG 1ZTEA 3CJHA 4FLUA 4JI3O 1FXHA 2CCUA 2WEQA 3OWDA 4LF6O 2WLIA 1XDCA 2OTLV 2IW5A 2ZR3A 3NXSA 1AB3A 1Y66A 5CB4A 3UQ8A 5EK0A 4YJ3B 2E75B 5DEDA 2QWOB 4LF7B 4J7ZA 1Z59A 4KQVA 4L91A 1Q6IA 3T0HA 4JAAA 3VBBA 2ESAA 3O65A 4LFBB 1S5JA 1XMOB 1PNKA 1JX9A 3D36A 1Q7YW 4O04A 3IEDA 4LF8O 4TQFA 3IFXA 4KHPB 5CA0B 4B3RO 1UYEA 1YJNV 3ABKC 2EIJC 3CHXA 5C8YB 4ASBA 3MHSC 1VQLV 1R3KC 3HZ1A 5KX5A 4MPCA 2WLLA 4HXWA 5CN0A 3C3SA 3UT5A 3BHPA 2BU2A 2YGAA 3CRCA 3APQA 3ML0A 1AMWA 1AR5A 4NXNO 4I0XA 2BT0A 4LF8B 4DV0O 2Q5ZA 4LP0A 1GM8A 2QSAA 4V26A 4XKKA 1O9HA 2XABA 1FJGO 3PEJA 2RMKB 3G6EV 4JAUA 5JCOA 4B3TO 1ZWIC 2P5OA 1OCZB 1HWYA 4GGLA 2VQEB 1N34O 4BAEA 2DWEC 3JASA 5KHHA 4DUZB 2D2CB 1NT2B 2O1WA 4P7AA 2YECA 2CUGA 3K5OA 4FFKA 2M7WA 4CE2A 1R3LC 1QBZA 1S3JA 4LNUB 4X89A 4KFMA 1F23A 2OIEA 4O4LA 5J2UB 1Y74A 4QPJA 3OW2U 5IYZB 1SC5B 3ZMSA 2WI5A 4X62B 4AWOA 4U7OA 2PYLA 2CG9A 2IWXA 4FFBA 1GN2A 2ATKC 2V1DA 2CH4A 4BXIA 1QVFU 4BW5A 2QJ1A 3ZN1A 5LP6B 5IE9A 1YF2A 4CWRA 2DOSA 1QLNA 3Q4HA 5DN6G 3R4OA 3KG2A 2E3CA 2ZNIA 2XAHA 4F6RA 2P4VA 4B3SO 2ZDIC 3BABA 1MNGA 3L70H 1XI1A 4X9LA 1L0LH 1TC6A 4UCSA 3K5LA 4FCPA 5FWKA 2K1EA 2UXCB 2WLKA 2A79B 3D36C 2ILMA 1EM1A 3ZM7A 3U10A 1SQVH 3AG3C 1YETA 3OGIB 5B1AC 4TOIA 1GTOA 1OCRC 1WLEA 5D6PA 2XAGA 1FXKA 4DV7O 1S16A 4I50A 1N36O 4JZGA 2Z3YA 3CJHB 3CMAV 4HBNA 1JOYA 1WA8B 4FLWA 2UXDO 4EFEA 3U0ZA 2EBOA 5JJJB 2YE9A 4EFBA 2AXTZ 4DR1B 3ETEA 5FPRA 4XKAA 4YXWG 1Q3EA 2JJ1G 3CWBH 1EZVH 4X1YB 4X8AA 1NH2D 3FV5A 2BU6A 3CCVV 5H5NA 3ZHRA 1I58A 1XNRB 2UWDA 1ZSPA 3Q4HB 1GJVA 1J5EB 4UCOA 3H9VA 4NYKA 3UKMA 4CE3A 2EULA 1TH8A 2WI6A 3ZHUA 4TSFG 3I55V 3WU2Z 5IT9N 1VEWA 1AH8A 1K7DA 3C3TA 3F7YC 3ETGA 3QF7A 3E8FA 2DYRB 5KA5A 3A0ZA 3H1HH 3K58A 3FX7A 4HY6A 4DR7B 5CTWA 4OGQB 2H8PC 1GMGA 2Q4PA 2ZBKB 2W6JG 2YEVA 2FB5A 4DRXB 4EB6B 3RBZA 3JALB 2BCCH 4IHJB 2FYPA 4EGHA 2A06H 1KC8W 5L3JA 4JI8O 1QCEA 2E0AA 2Q8VA 1P7BA 2PTMA 5KHGA 1QHTA 3ZKBA 1P49A 3TZ2A 3SPCA 2AGAA 4IGGA 3E35A 4PA4A 1YHQV 1ENVA 4H0LB 5L3GA 2UXNA 4ABMA 5LHGA 3ZX6A 5JQGA 4X65O 1XL6A 4X1IA 1JA8A 3A0RA 4XDMA 1N8RW 1FXKB 1VQMV 2NR5A 4U3FH 2DYRC 3SR2C 3W7WA 1KKDA 3EFFK 4PU9A 4PA6A 3T1YB 5FL7G 2LGWA 4G28B 1AR4A 4PDRA 1OCCB 3KCYA 3AK3A 4LNUA 5CA3A 4XIRA 4X65B 2YXHA 3I56V 4B08A 3AG2B 2UUBO 4GX5A 3U11A 2ZM6B 4DZYA 5K1PA 4CWPA 3N2KA 3INXA 3DXRB 1AJ6A 2YI9A 1TVKB 1AM1A 4AI8A 4B3MO 4FPPA 1GN6A 3FB6C 1XNRO 2V7QG 3K5MA 2WLHA 3OTOB 2ZT9B 4QE7A 1OJHA 4XITA 1J5EO 2YEBA 5LL6Y 4FZ1A 4XTJA 1QQCA 2K5BA 4XD8A 1BCCH 3SPHA 3SPIA 3R66A 4P30A 3BEHA 1VMGA 4LWIA 2Q2EB 5BOCA 2FTKA 1WA8A 2ZE5A 1FXKC 1T5EA 1YT0A 4O07A 4E01A 1HNWB 4JGSA 3CRLA 3R91A 3OMAB 2YKJA 1M56B 3KE6A 4X1IB 2BTZA 3ABMC 3CCLV 5B1AB 1NR7A 3CP1A 1Q6HA 3JATA 4DV3O 2VCJA 3R92A 4LF5O 4V25A 2GHYA 5F3KA 1H2GA 4PDMA 4GFNA 2Q0OC 3GB7C 1H2KA 4ASFA 3QDDA 2JKIA 2P22C 4CWFA 1CEZA 4KSGA 1D5AA 3CRQA 4HYOA 3AEIA 4YIPA 2YGEA 2DQ3A 4GT1A 2XJJA 4WCEV 5TISZ 3L75H 2AZ0A 5CF0A 5LP6C 2VWJA 3JZ3A 4DW1A 2YC0A 1KUQA 2BU5A 4LCUC 2HJFC 3HEKA 3QNEA 1ZAUA 1A32A 1ORQC 4BQGA 4BWAA 4GX0A 4D6TH 1NU1H 5HFMA 3G7BA 4YHHB 2ZKOA 3ZHVA 4AQYB 4O05A 1YEWA 2BSKA 2HKOA 4O0BA 1GKFA 3UM7A 2IWSA 4ZI7A 3WB0A 1R6NA 1I5BA 1L0OA 1JR9A 3JSLA 4O4HA 5JQGB 5LXTA 1SQBH 1RSOA 1UY8A 3P30A 3A0YA 1TC0A 4UVAA 4B7EA 1TVKA 3RFRA 2RCVA 2OIGA 5IN9A 4TUYA 4Z1MG 2JEXA 4NH8A 2FMLA 5B1NA 4LWHA 1OZ0A 5BXZA 1GM7A 3RVZA 4WUCA 4LFCB 2VQFB 1SS3A 1Z5AA 1NQTA 4L93A 2YGFA 3ETDA 4EB6A 2XT9A 2XDSA 1YI2V 2JGUA 5IYDO 1HDJA 1Y6XA 2CH7A 5HFLA 4JI5O 3RYFA 4MVQA 3ZRWA 2O1VA 3AG3B 2HR3A 3ABKB 4H81A 1PNMA 2BSMA 4K35A 4WFAV 3PJSK 3T4ZA 4D7SA 3U67A 3W7SA 2XJXA 5B1OA 2XX5A 2JJCA 4MBCA 2BTQA 2RJZA 1M9NA 4JYAO 4JI5B 1QLEC 4I55B 1Z2GA 1UPGA 4J9YB 4Z2WA 5KUMA 3BFRA 4FZ0A 2CH7B 4HY1A 4JYCA 5ITZB 4PD4F 5BMVB 1H8EG 3JD1A 2ZE6A 3ZMVA 2P6JA 2CGFA 1TGOA 4JPRA 1W2BU 5EBWC 5IYZA 1NJIW 5BR8O 3BPZA 1ID0A 2EIKC 4UCRA 2ZDYA 5F2VO 3K03A 1MZFA 1BGQA 3AK2A 3RYHA 3B25A 3OMIB 3CCJV 4FLXA 1B06A 4L87A 5JCOC 2PY5A 1VQ6V 1PV0A 4RUFA 4R3AA 3T2MA 5KAIZ 1VF6A 1SKVA 3AG1B 2XDUA 1N4CA 2YI5A 3Q5KA 1CPYA 2ZXWC 4RQFA 4O4HB 1KB9F 3ASNC 5LXTB 2EILB 1I0HA 3CD6V 4RAIA 4RQEA 3WHAA 2IOQA 1X4TA 4PDLA 3K04A 1YS3A 2P7TC 5D7DA 5DM6V 2HHIA 4FVMA 2BYIA 2IOPA 3N27A 5LBQA 4DV2B 1M93A 3RT3C 2ODMA 3ASNB 3BA8A 2ZXWB 2QF6A 4E02A 1JPXA 2H94A 3ZMZA 1U97A 1BQ0A 3Q5JA 1XNQB 3JD3A 2YEAA 5LP6A 3D0BA 5C8YA 1L1FA 4IIJB 5H6RA 1K97A 2EIJB 4OXSA 2JIZG 1F4NA 4DR2B 1E1QG 1H2LA 1U0ZA 1FXVA 2QWNB 4LFBO 1EFRG 4LF4O 4O2AA 4KSHA 2EIKB 4MTGA 1W0KG 4KHPO 4ASGA 4GQTA 1B3QA 4K8ZA 4N23A 1R1BA 3CWVA 2WLMA 4BR6A 3RW0A 4JI0B 1KKCA 5EZYA 5L3DA 2Q68A 2A0LA 1WPXA 3E8HA 2CE4A 2ZE7A 3L74H 3C0EA 3CB2A 2YEFA 1S5HC 1QLEB 1MSWD 4KUMA 1QYEA 4PELA 4O4IA 2HG5C 4MT8A 4HNAA 2UUBB 5LMUB 5IWAB 3VHDA 4D7TA 1NTKH 4DR5O 4I5SA 1E79G 1IXBA 1ZXMA 2F66C 2YE4A 4JAVA 4XCLA 3S3WA 3JAKB 5M4EA 2ZDXA 1M57C 4GKJO 2F4VB 1GAXA 1N34B 2E76B 2YEJA 3MHHC 3SJBC 5M4NA 2YSUB 3E89A 4J80A 4K3AA 1FFXA 3T4DA 1BKNA 3VQYA 4MW3A 4JI3B 5CBHA 3LNUA 1DF5A 2NNUA 5FNVA 2WLNA 4I55A 4EGIA 1GRJA 1NI8A 1SETA 3HKBA 3ABTA 3K5NA 2PF4E 2ZDIA 3AG4B 3G4SV 1UFIA 3OMNB 4GKJB 4O4IB 5E79Z 1YZBA 3R4MA 4LWFA 2WPDG 4G2KA 4JI4B 1Y8NA 4ASAA 3RLPA 4XE2A 3CCEV 1GN4A 2QR4A 1AROP 3TZ0A 2HJDA 3HKEB 2LFSA 1I94B 2Q67A 5L3FA 4B3RB 4WBNA 3FT5A 3OEHG 3UT5B 1DLBA 2Q7GA 4NH7A 1OCOC 5LOVB 2Q9LA 3TK1A 5BODA 5JWPA 4FMTA 4E00A 2X6CA 4B3SB 5EYPB 2YI8A 2XAQA 1N0JA 3RWRD 1HNZB 2QG2A 3T1YO 1KIJA 4W7TA 4CE1A 2BU7A 3DSQA 1XMQB 1K8AW 4XKOA 3CC4V 3ZHTA 2EZPA 1IBKO 3SJCC 3LNMB 2VCIA 1K92A 3FB8C 2EX3A 3OWBA 3GIGB 1A4HA 3A8TA 2RQ6A 3FAVB 3RYCB 4JI7B 1YTFD 4Q6GA 4DRXA 5H2FZ 1GN3A 3OE7G 1TA8A 1UJWB 2DW4A 1K34A 3HKCB 4MTXA 2XUMA 2PYJA 1THNA 3RYHB 5CPHA 1GKXA 2O1UA 3H1JH 4DUYB 3IC7A 1HR0O 3VHAA 2XJGA 1FPOA 4LH7A 1XREA 3CE2A 3RYFB 2CGNA 4XDLA 2Q7EA 2HEPA 3ABMB 2O57A 4RWUA 3CXCU 1M56C 2OCHA 3D2RA 3CCUV 5CTXA 1EN4A 4DV4O 4WUDA 1SZXA 2BOBC 3N2GA 3OUSA 3BMYA 1AILA 4F6EA 5H9CA 4H13B 1HNXO 3K79A 1YESA 5CMUA 3SPGA 2XDLA 4MSWC 4TQDA 3GWKC 1WP8A 4CS4A 1RPOA 1SESA 2Z5UA 3HKDA 1THZA 2QM8A 4UB8Z 1IX9A 3A0HZ 4BIOA 3GVMA 2NLJC 5GW7A 2YE8A 5JENA 3SYOA 4GEEA 2R72A 2IJJA 2WI1A 2RDCA 3FFQA 2YEGA 1PM9A 2UXCO 1AH6A 3N2GB 1HP8A 3FAVA 4MVUA 4PDVA 4G27B 3SDLA 5CA1B 3MD0A 2RNBA 2B5UA 3TETA 2N74A 1JFFA 3AG2C 1YIJV 1EA6A 1IXMA 1VQ8V 4DV7B 3VHCA 2X6AA 3WFVA 4A5UB 1GM9A 4FCQA 4R7CA 2DE0X 1OCCC 3I5DA 2ITDC 4IYIA 1Y4UA 4KL1A 5M4PA 3T0ZA 4YKWA 1V55B 1YVWA 4TUYB 3WB2A 5CA1A 5KMGA 2RN9A 2KQXA 5LMNO 4O4JB 5EC1C 4YKUA 1G1XB 5IDJA 4LPBA 1Y8OA 2Z0AA 5BR8B 1I5XA 1YC1A 2QGNA 2Y0IA 2Y4TA 1VQOV 4K8XA 2YDEA 4MPEA 2BSKB 2CTQA 3CRMA 4IL6Z 3ZXOA 1K9MW 1G6UA 1MOFA 1US6A 2CK3G 3ZXQA 4AHCA 5IY5B 4O4LB 4MTFA 3JCUZ 4AWQA 4CBCA 4PRXA 2DMXA 1FAFA 4YY3O 2ITCC 2ZIOA 5CBGA 4URMA 3EKRA 1IDSA 1BQZA 2FYUH 4BAYA 2BOCC 3HKEA 1UYCA 3THOA 3ASOB 2HG1A 2CGOA 4LBEC 1KBHA 2EZOA 3KKYA 2BU8A 1Y8PA 2ZD9A 3R65A 2YIBA 1HNXB 1Z5WA 2IJKA 1ROPA 1V54C 1Z5CA 1KP2A 1JCHA 4TT3G 1M4UA 1NVPB 4B7PA 2QTSA 4I7ZB 3JAWB 4N21A 4H37A 1ZLZA 1EN6A 3HKCA 4IHJA 2JJ2G 2WEPA 1HNWO 4P9OA 3STLC 4JYAB 3JSNA 4NB5A 1SF9A 1N33O 4TV9B 4PRVA 3EVKA 2UUCO 4GYCB 1S14A 3G80A 3N2KB 3UO2A 2YK2A 3HHUA 3LSQA 1XILA 4JI2O 1B04A 4PV1B 3F5WC 4MTOA 4MVOA 2EINC 3OW6A 2XASA 2LQTA 2HP8A 3X2QB 4CH3A 1LNQA 1UY7A 1F7YA 3WB1A 4B3TB 4NH9A 1AP6A 3DGEA 4LF9B 1I59A 3P3NA 2Q8FA 4URLA 4ZBMA 4R1FA 4GX2A 4GLXA 5D7RA 1VARA 2YKCA 4U93A 2WLLB 3KCXA 4HZ3A 4UVBA 1NHJA 4MP2A 2Q8HA 3CC2V 2Y69C 1I5DA 1OCRB 4ZHQA 1OV9A 2UUAO 1BSMA 2LGQA 2LO1A 4CH4A 2XX4A 1WAZA 1WPBA 3K06A 3SL2A 1BHBA 4UV9A 4DR5B 4P9PA 4XCJA 1MX0A 4NKGB 4AILC 2VS0A 3TXQA 2A9HA 5D5PA 5JH7B 2C2AA 4QGPA 3ZBHA 4CWTA 2GTSA 3JALA 2PI5A 2ZQMA 4GCZA 2BE3A 2KG7A 1IBMO 2CTPA 3TCUA 1I5YA 1NHIA 2KSDA 4YJ3A 2BRCA 3NR7A 1XHXA 4YIOA 2IBZH 3K0DA 4JZ2A 1BMFG 4GX1A 1YERA 1SA0A 1NBMG 4EFUA 1WP7A 3IJ4A 2CCSA 4UFZA 3VQWA 2R9AA 1BGYH 2ADQB 2X0LA 2IH3C 1JMKC 3SYQA 1TUBA 1E1RG 3OAAG 3CCRV 1H2MA 4F6RB 2PNRA 2JGDA 3W7XA 4EMVA 5FNDA 1VQPV 1FJGB 4TWKA 1H38A 2QM4A 4LP8A 1RM1B 3TGUH 2WERA 4I4TA 1XL4A 2Y69B 1UYGA 3M8AA 3IC9A 1OCZC 4QJFB 2V4DA 5KMGB 4FLYA 2VQEO 2JK5C 2QKAA 1UYMA 3ZS8C 3LUTB 4JTDB 1IBKB 2H8MA 1QR8A 3F7VC 1VQ9V 1JJOA 3CYGA 5GTIZ 2LW1A 1U2OA 4JI7O 3CPWU 4R3MA 1VQ7V 4X64O 4EEHA 4XBFA 2ZCEA 4NXNB 5LOVA 2UXBB 4ZVIA 4I50B 4YHHO 3OD4A 2XK2A 3C11A 1ZWHA 1I08A 1PD3A 4LWSB 1AR1B 5C93A 3H1IH 3WG7C 3G75A 2AHZA 5FLXN 2Q8GA 1U96A 3CRKA 5L3BA 4MVZA 2DYSB 4UCTA 2QKCA 1B62A 1R62A 3EHJA 5B1BB 2UXBO 2Q73A 2PUSA 3FYIB 4P8OA 5KAFZ 5LYJB 5KHKA 3RLQA 1AP5A 4JTAB 4UUJC 2WAMA 5CBFA 1BXDA 1Q8IA
chains in the Genus database with same CATH topology
5M4HA 3K0GA 1WPXA 3E8HA 5LHIA 4DXWA 3OMUA 1YT1A 1QLNA 1JJ2U 5J71A 5DN6G 2IH1C 3W7TA 3C0EA 1UYLA 3KG2A 3LDEA 3R4OA 1CP9A 2YEFA 3RKZA 1S5HC 1QLEB 1MSWD 4KUMA 4AWPA 1MG1A 2OCCB 2XAHA 4UVCA 5KA6A 1QYEA 3WQ9A 4PELA 1VQNV 2HG5C 4MT8A 2ZDIC 4JTCB 3W7UA 3HZ5A 3TUHA 2UXXA 4X9LA 2CCTA 2X6BA 1DF4A 4KP4A 4QPKA 2IU3A 2LFRA 1TC6A 3VHDA 4FCPA 5FWKA 1R3JC 2K1EA 2YI6A 4I5SA 2WLKA 1E79G 2A79B 1ZXMA 4L94A 3ZM7A 2YE4A 4JAVA 4XCLA 1NR1A 1G8MA 2XNDG 4Q20A 3SPJA 2JDIG 2ZDXA 5M4EA 1M57C 3AG3C 1YETA 3INWA 2QEXV 1AI6A 4FJCC 5B1AC 2YEJA 1VQ4V 3LDCA 3SYPA 3MHHC 1GTOA 1OCRC 1WLEA 3ZRVA 2XAGA 1KQSU 1FXKA 5D6PA 4PA3A 5L3CA 2WI7A 2YSUB 3E89A 1S16A 3R4NA 1B6QA 3T4DA 2YEVB 2DWDC 1BKNA 2HCHA 4MW3A 4PL9A 4YKXA 2GQPA 5CBHA 3CCSV 2EIMB 2Z3YA 3LNUA 3RVYA 1K4DC 3CMAV 2HVKC 4E2LA 3PEHA 1DF5A 1V55C 2NNUA 2WLNA 1JOYA 1MU5A 2FWZA 2GFDA 4EGIA 5GGZA 1SETA 3ZRXA 3ABTA 4LWGA 2PI4A 3BM9A 2EBOA 2YE9A 2ZDIA 3AG4B 1Q86W 3G4SV 3OMNB 4KTNA 3ETEA 3OM3B 5H6QA 4XKAA 3X2QC 4YKRA 4YXWG 2JJ1G 3R4MA 4WUBA 1AJQA 1TBWA 4LWFA 2WPDG 4G2KA 4QE9A 4X8AA 1Y8NA 1NH2D 2IORA 4YKTA 4XE2A 3RLPA 3FV5A 3CCEV 4ASAA 2BU6A 4PA7A 1COWG 3CCVV 1AROP 3TZ0A 4DO2A 1I58A 2LFSA 1TILA 2UWDA 1PVGA 5EBLC 1F4MA 2Q67A 5EBMC 5L3FA 1GJVA 3B26A 4XIQA 3FT5A 3OEHG 1DLBA 3K9AA 1BYQA 1OCOC 4NH7A 3B8NA 3TK1A 1GKZA 2OT5A 1AI7A 3UKMA 2QG0A 4CE3A 5BODA 2R9IA 4FMTA 4I9WA 2X6CA 1TH8A 1I5CA 4E00A 2X7RB 3VOUA 2WWWA 2BREA 4CWRA 1M90W 2WI6A 2H55A 2XAQA 3JD2A 4TSFG 3H4LA 3I55V 2QG2A 1TIDA 4MB9A 5IYCO 3K3WA 1JM6A 2Q8HA 4R50A 1YJWV 1KIJA 1AH8A 1K7DA 1AI5A 2BU7A 4W7TA 3F7YC 4CE1A 5CTUA 3ETGA 1K8AW 4XKOA 1R6KA 3CC4V 3R4PA 2EZPA 4WF9V 3E8FA 1TUEB 4RO2A 4QNHB 2DYRB 4MS2A 3ASOC 5KA5A 4HZ5A 2HVJC 3OR7C 3A0ZA 3LNMB 4CWOA 2VCIA 1I5AA 1K92A 3FB8C 3OWBA 1GK9A 4HY6A 3K60A 5CTWA 3GIFA 3GIGB 2H8PC 1A4HA 3H01A 3EHFA 1GMGA 2ZBKB 4U7NA 4QIWF 4WFHA 1S72V 2W6JG 4BIZA 1YTFD 2YEVA 4F4LA 1K5SA 3OE7G 3RBZA 2ZR2A 4MVSA 3SJQC 1K73W 5D6QA 1UJWB 2DW4A 4H85A 3ABLC 1K34A 2YE2A 2DQ0A 4MTXA 4UXNA 2OTJV 5IY5C 2VWCA 2FYPA 4EGHA 4DUHA 4LWEA 1KC8W 1THNA 5L3JA 3G71V 3CCQV 5CPHA 1QCEA 1GKXA 3K99A 3QO7A 1S0VA 1JQ0A 2O1UA 2E0AA 1P7BA 1NHHA 3G7EA 2QKSA 3ZKBA 3IC7A 1H7SA 3TZ2A 3VHAA 3SPCA 2XJGA 3HYYA 1AJNA 4JASA 2VW5A 4XDJA 4KFGA 1G4YB 3E35A 3E8GA 1GO3F 4JYBA 4PA4A 1YHQV 1ENVA 4EKWA 3CGYA 5L3GA 3HYZA 4XDLA 2UXNA 2WI3A 5LHGA 3ABMB 3CXCU 5FNFA 1XL6A 1M56C 3E8BA 3H80A 1H7UA 4CWQA 3A0RA 1Z5BA 2YKBA 4XDMA 2QM7A 3D2RA 3CCUV 5CTXA 3B8MA 3GIGA 4WUDA 4XIPA 2BOBC 1N8RW 1FXKB 2XCMA 3OUSA 1VQMV 3BMYA 4WFFA 1K5QA 5H9CA 2D3OW 2DYRC 3W7WA 2QE7G 4P2ZA 1NKDA 3EFFK 1KKDA 3K79A 4PU9A 1YESA 5CMUA 3ZKDA 3SPGA 2XDLA 4MSWC 4PA6A 4L90A 5M4MA 5FL7G 4J9ZB 2XHXA 4G28B 3EHGA 4PDRA 1OCCB 1RPOA 1SESA 2Z5UA 1THZA 2HFEC 1K3EA 1ZW9A 2BZ5A 5FNCA 2QM8A 2YI0A 5CA3A 1YTFB 4MP7A 4XIRA 4R8CA 2NLJC 5GW7A 3TZ4A 3I56V 2HKJA 5E1AC 2JEUA 2YE8A 3AG2B 3Q5LA 4GX5A 3SYOA 4DZYA 4GEEA 4CWPA 3INXA 3O2FA 2IJJA 1YSZA 1AJ6A 2WI1A 2YEGA 1AM1A 1AH6A 1OCOB 4FPPA 4MVUA 2YKEA 4PDVA 4YKQA 1AJPA 4G27B 3FB6C 4CZZA 2V7QG 2WI2A 2WLHA 1KD1W 3M99B 3BY6A 3MD0A 4QE7A 1BL8A 4XITA 2B5UA 2YEBA 1J95A 3TETA 3AG2C 1YIJV 1EA6A 1KP3A 1IXMA 1VQ8V 1ZXNA 1YT2A 3ZJZA 2YEIA 5CTYA 4CWSA 3VHCA 4XTJA 2X6AA 4MVMA 3WFVA 1US7A 4FCRA 4GT8A 2K5BA 1GM9A 2WSSG 4FCQA 4R7CA 3SYAA 4XD8A 4UROA 3SPHA 1OCCC 5KUKA 2XHTA 4LC1A 3SPIA 2ITDC 4P30A 3BEHA 2GSMB 4LWIA 3AG4C 2WLJA 2Q2EB 1Y4UA 1FFTB 1PNLA 4HXZA 1Y4SA 4JQLA 5BOCA 3T0ZA 2FTKA 4YKWA 5IDMA 4RUEA 3CCMV 4L8ZA 1FXKC 1V55B 1YT0A 5LGUA 4O07A 4E01A 1QVGU 5BZBA 2EIMC 5M4PA 4JGSA 5IYBO 3CRLA 3R91A 3CYOA 3OMAB 2YKJA 1M56B 3QO8A 3KE6A 1K33A 5LHHA 5EC1C 1OHHG 3ABMC 2BTZA 4YKUA 1YJ9V 3T1KA 3CCLV 5IDJA 4LPBA 1Y8OA 3TTZA 1YC1A 1I5XA 5B1AB 1NR7A 3CP1A 2VCJA 2YKIA 3R92A 1VQOV 4V25A 2W0FC 2GHYA 1Y4MA 4MPEA 5F3KA 1H2GA 1QR9A 4MVRA 4PDMA 3T1CA 3ZXOA 3FT8A 1K9MW 1MOFA 4GFNA 3ZMTA 2CK3G 5J9PC 3GB7C 3ZXQA 3DTUB 3A0WA 4ASFA 3K98A 3QDDA 1DTOA 5IY5B 3FB5C 3ZRWB 4MTFA 3ABLB 2JKIA 1K4CC 3ABUA 4HYPA 4AWQA 4URNA 4CBCA 4CWFA 4XC0A 1CEZA 4PRXA 4KSGA 3O0IA 2Q69A 4HYOA 4WFBV 2ITCC 3AEIA 5CBGA 4YKZA 2YGEA 2DQ3A 5M4NA 4GT1A 4URMA 2W6IG 3EKRA 2XJJA 4WCEV 5CF0A 3A0TA 4BAYA 3EKOA 2BOCC 3JZ3A 4WFGA 1UYCA 3ASOB 2BU5A 4LCUC 2HJFC 2HG1A 3HEKA 2Q6AA 3QNEA 4LBEC 2EZOA 1ORQC 2BU8A 2XDKA 2YJWA 3VADA 4BQGA 1P4RA 1Y8PA 2ZD9A 2XX2A 4GX0A 3R65A 5LGTA 3GWOA 5B1BC 4HAMA 3CC7V 2YK9A 4YKYA 2IJKA 4XDKA 1ROPA 1FS0G 1V54C 3ZMUA 5HFMA 1Z5CA 3G7BA 1OSFA 4HYMA 1KP2A 1JCHA 4TT3G 1NVPB 4B7PA 1W0JG 1RPRA 4O05A 3E86A 3K08A 4N21A 3T10A 2HKOA 4B6CA 4H37A 1B63A 2JJ2G 2WEPA 2YEHA 4O0BA 1GKFA 2IU0A 3UM7A 1UYKA 2IWSA 4R6ZA 1R6NA 4P9OA 3STLC 1EZJA 1I5BA 1L0OA 2XOKG 4PRVA 1PL0A 2IJIA 1UY8A 3NMQA 3P30A 3A0YA 4CWNA 1S14A 2EXLA 2YK2A 1TC0A 4UVAA 5LGNA 3HHUA 3LSQA 1F51A 2AHYA 3P32A 1SERA 3O6OA 4BQJA 2FXSA 3F5WC 4MTOA 4MVOA 5IN9A 2QA4V 2YE7A 3LPSA 3QTFA 4Z1MG 2EINC 1AI4A 2JEXA 2LP7A 2XASA 2YEEA 3OW6A 5B1NA 1S76D 4NH8A 1PKXA 1YITV 1UY9A 3X2QB 4LWHA 1OZ0A 2F43G 1GM7A 1LNQA 2R9RB 3RVZA 1UY7A 4WUCA 3B24A 4NH9A 3DGEA 1I59A 1Z5AA 3B28A 1NQTA 2Q8FA 4L93A 4URLA 4ZBMA 3FYEB 1UYIA 4R1FA 4GX2A 5D7RA 2YGFA 2MK3A 3ETDA 2HLDG 2EILC 2XDSA 2Q8IA 1YI2V 3SL2A 3E2EA 2YKCA 4U93A 2WLLB 4HZ3A 1NHJA 4H33A 4UVBA 5IYDO 3ZIAG 3CC2V 2QFOA 2XDXA 2YE3A 4O09A 2Y69C 3AG1C 1JVMA 5D7CA 1I5DA 5HFLA 3E83A 1OCRB 4MP2A 1RM1C 4MVQA 2XX4A 4FK5C 3ZRWA 2O1VA 3EHHA 1M57B 3AG3B 3K06A 1BHBA 2HR3A 3ABKB 3ZN0A 2XD6A 2QTOA 2XHRA 4UV9A 4H81A 1PNMA 2BSMA 4P9PA 3K97A 4XCJA 3B77A 3JCZA 2P90A 4H7QA 1MX0A 5M4KA 2WI4A 2YJXA 4WFAV 3PJSK 3T2SA 3JD4A 1YC3A 3T4ZA 1NH2B 4I3HA 3U67A 1Q82W 2P67A 1SZTA 1NVPD 3JYCA 3W7SA 2XJXA 2A9HA 1EBOA 5B1OA 4HZ0A 2XX5A 2JJCA 4MBCA 3OEEG 2C2AA 3D3IA 4CWTA 1FXHA 1M9NA 1R73A 2OCCC 2CCUA 2PI5A 2ZQMA 2WEQA 4GCZA 1QLEC 3OWDA 2WLIA 2OTLV 2IW5A 2ZR3A 3NXSA 3TCUA 4EFTA 1I5YA 1NHIA 1Y66A 2BRCA 5EK0A 4K4OA 4J9YB 3OGCC 1Z59A 5KUMA 4KQVA 3K0DA 1YC4A 2IWUA 4L91A 3LDDA 5EC2C 4HY1A 1M1KW 1BMFG 4GX1A 1YERA 1SRYA 4JYCA 3T0HA 1NBMG 3VBBA 2KB1A 1H8EG 2ESAA 3TZ5A 3JD1A 3ZMVA 3SYCA 2P6JA 1R3IC 4EFUA 2CGFA 4JPRA 1W2BU 2CCSA 2EJRA 5EBWC 3MNRP 4MOTA 2X0LA 1NJIW 1PNKA 1JX9A 2DYSC 2IH3C 3D36A 1Q7YW 2EIKC 1ID0A 3SYQA 5B3SC 2ZDYA 3IEDA 4O04A 1S77D 3IFXA 4PA9A 1E1RG 3OAAG 3K03A 1UYEA 3HB3B 4X88A 1YJNV 1MABG 1BGQA 1UY6A 3CCRV 3OMIB 3B25A 4WFEA 3CCJV 1UYFA 2YEDA 2PNRA 4L87A 3WG7B 3ABKC 3W7XA 4EMVA 1VQ6V 2EIJC 5FNDA 4BIUA 4RUFA 1VQPV 4R3AA 3CMEV 4ASBA 3MHSC 4TWKA 1R3KC 3OFNG 4LP8A 1VQLV 1RM1B 1H38A 2WERA 2WLLA 3T2MA 3HZ1A 4HXWA 4MPCA 5CN0A 1VQ5V 1XL4A 3AG1B 1UYDA 2Y69B 2XDUA 2BU2A 3A0XA 1UYGA 2YGAA 2B1GA 1OCZC 2YI5A 4QJFB 3ML0A 1CPYA 1AMWA 3Q5KA 1H8HG 2ZXWC 4RQFA 2AKPA 3ASNC 2BT0A 2EILB 3HPLC 4MPNA 2JK5C 3ZRSA 3CD6V 4RAIA 1UYMA 4RQEA 2YE5A 3JD0A 3LUTB 3WHAA 4JTDB 1KZNA 2IOQA 2H8MA 1QR8A 3F7VC 4PDLA 2Y48A 3K04A 1VQ9V 1YS3A 2P7TC 4LP0A 1GM8A 5DM6V 5D7DA 4V26A 3LSSA 4XKKA 3U2KA 2BYIA 1QY8A 2IOPA 4AS9A 4ZKIA 2XABA 5LBQA 3PEJA 1U2OA 3RLRA 3CPWU 2IJHA 3G6EV 4EGKA 4R3MA 2EINB 4JAUA 1VQ7V 4EEHA 1ZWIC 3ASNB 1Q81W 2BYHA 2ZXWB 4XBFA 3QO5A 5L3EA 1JPXA 2QF6A 4E02A 2H94A 3ZMZA 1OCZB 1UYHA 1HWYA 3Q5JA 4GGLA 3CGZA 4ZVIA 5J6AA 3ZCCA 4MW8A 2DWEC 2XK2A 4BAEA 3JD3A 3C11A 1YSCA 1ZWHA 1QZRA 2O1WA 2YEAA 3IGAC 2XAFA 4P7AA 3OR6C 1PD3A 2YECA 3D0BA 3OUFA 5H6RA 1L1FA 5C93A 1K97A 2EIJB 1AR1B 2YE6A 4EM7A 3WG7C 4OXSA 3G75A 2AHZA 2JIZG 3STZC 1F4NA 4ASUG 4UV8A 1E1QG 2M7WA 1R3LC 2WLIB 2Q8GA 1QBZA 1S3JA 4CE2A 1U0ZA 1FXVA 3CRKA 2XAJA 1EFRG 4X89A 3B27A 3FKSG 5B3SB 4KSHA 2EIKB 1F23A 4KFMA 4MVZA 2DYSB 5L3BA 3U2DA 4QPJA 3OW2U 3FB7C 1B62A 4FIPC 4MTGA 1V54B 1W0KG 1BHAA 1R62A 3EHJA 4ASGA 3OPDA 2B1IA 4GQTA 5B1BB 1KECA 3ZMSA 1B3QA 2WI5A 2YI7A 4JF3A 4U7OA 4AWOA 3GIEA 2CG9A 3FYIB 4N23A 2IWXA 4P8OA 3CWVA 2ATKC 2V1DA 2CH4A 2WLMA 4BXIA 1QVFU 3EHBB 3RW0A 4BW5A 2FWYA 4JTAB 3RLQA 4UUJC 2WAMA 5CBFA 1EI1A 2ZKJA 3ZN1A 1YSRA 5F5RA 5L3DA 1BXDA 2Q68A 2A0LA 1VQKV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M4H A;  3OMU A;  1YT1 A;  5J71 A;  3C0E A;  1UYL A;  3R4O A;  2YEF A;  3RKZ A;  4AWP A;  1QYE A;  3WQ9 A;  4MT8 A;  3HZ5 A;  3TUH A;  4X9L A;  2CCT A;  4KP4 A;  4QPK A;  2LFR A;  3VHD A;  1TC6 A;  4FCP A;  5FWK A;  2YI6 A;  4I5S A;  1ZXM A;  4L94 A;  3ZM7 A;  2YE4 A;  4JAV A;  4XCL A;  4Q20 A;  5M4E A;  2ZDX A;  1YET A;  3INW A;  2YEJ A;  1NHH A;  5D6P A;  3ZRV A;  5M4N A;  2WI7 A;  1S16 A;  3R4N A;  2HCH A;  1BKN A;  4PL9 A;  4YKX A;  2GQP A;  3LNU A;  3PEH A;  1JOY A;  1MU5 A;  2FWZ A;  2GFD A;  4EGI A;  5GGZ A;  3ZRX A;  4LWG A;  3BM9 A;  2YE9 A;  4KTN A;  4XKA A;  4YKR A;  3R4M A;  4WUB A;  1TBW A;  4LWF A;  1Y8N A;  2IOR A;  4ASA A;  4YKT A;  4XE2 A;  3RLP A;  3FV5 A;  2BU6 A;  3TZ0 A;  1I58 A;  2LFS A;  1TIL A;  2UWD A;  1PVG A;  1GJV A;  3B26 A;  4XIQ A;  3FT5 A;  1BYQ A;  4NH7 A;  3TK1 A;  1GKZ A;  5BOD A;  2QG0 A;  4CE3 A;  4FMT A;  1TH8 A;  4E00 A;  1I5C A;  2BRE A;  2WWW A;  2WI6 A;  2H55 A;  3H4L A;  2QG2 A;  1TID A;  4MB9 A;  1JM6 A;  1KIJ A;  1AH8 A;  4W7T A;  4CE1 A;  2BU7 A;  5CTU A;  4XKO A;  3R4P A;  4HZ5 A;  3A0Z A;  4CWO A;  2VCI A;  1I5A A;  3OWB A;  4HY6 A;  3K60 A;  5CTW A;  3GIF A;  3GIG B;  1A4H A;  3EHF A;  2ZBK B;  4U7N A;  4BIZ A;  5D6Q A;  4H85 A;  2YE2 A;  4MTX A;  2VWC A;  2FYP A;  4EGH A;  4DUH A;  4LWE A;  1THN A;  5L3J A;  5CPH A;  1GKX A;  3K99 A;  2O1U A;  2E0A A;  3G7E A;  3ZKB A;  1H7S A;  3TZ2 A;  3VHA A;  2XJG A;  3HYY A;  4JAS A;  2VW5 A;  4KFG A;  4JYB A;  3CGY A;  3HYZ A;  2WI3 A;  5FNF A;  4CWQ A;  3H80 A;  1H7U A;  3A0R A;  1Z5B A;  2YKB A;  4XDM A;  2QM7 A;  3D2R A;  5CTX A;  3GIG A;  4WUD A;  4XIP A;  2XCM A;  3BMY A;  4PU9 A;  3ZKD A;  1YES A;  2XDL A;  4L90 A;  5M4M A;  2XHX A;  3EHG A;  2BZ5 A;  1ZW9 A;  5FNC A;  2QM8 A;  2YI0 A;  4XIR A;  4MP7 A;  3TZ4 A;  2HKJ A;  2YE8 A;  3Q5L A;  4DZY A;  4GEE A;  4CWP A;  3INX A;  3O2F A;  1YSZ A;  2WI1 A;  1AJ6 A;  2YEG A;  1AM1 A;  1AH6 A;  4FPP A;  2YKE A;  4YKQ A;  2WI2 A;  3MD0 A;  4XIT A;  2YEB A;  1EA6 A;  1IXM A;  1ZXN A;  2YEI A;  1YT2 A;  5CTY A;  4CWS A;  3VHC A;  4XTJ A;  1US7 A;  4FCR A;  4GT8 A;  2K5B A;  4FCQ A;  4XD8 A;  4URO A;  2XHT A;  4LC1 A;  4LWI A;  2Q2E B;  1Y4U A;  5BOC A;  4HXZ A;  1Y4S A;  4JQL A;  3T0Z A;  5M4P A;  2FTK A;  4YKW A;  5IDM A;  4L8Z A;  1YT0 A;  4O07 A;  4E01 A;  3CRL A;  3R91 A;  2YKJ A;  3KE6 A;  4YKU A;  2BTZ A;  3T1K A;  5IDJ A;  4LPB A;  1Y8O A;  1YC1 A;  2VCJ A;  2YKI A;  3R92 A;  4V25 A;  4MPE A;  5F3K A;  3ZXO A;  3FT8 A;  4GFN A;  3ZXQ A;  3A0W A;  4ASF A;  3K98 A;  3QDD A;  3ZRW B;  2JKI A;  4HYP A;  4AWQ A;  4URN A;  4CWF A;  4XC0 A;  4PRX A;  4KSG A;  3O0I A;  4YKZ A;  2YGE A;  4GT1 A;  4URM A;  3EKR A;  2XJJ A;  5CF0 A;  3A0T A;  3EKO A;  3JZ3 A;  1UYC A;  2HG1 A;  2BU5 A;  3HEK A;  2XDK A;  2BU8 A;  2YJW A;  3VAD A;  4BQG A;  1Y8P A;  2XX2 A;  2YK9 A;  4YKY A;  1Z5C A;  3G7B A;  1OSF A;  4HYM A;  4B7P A;  4O05 A;  3T10 A;  4B6C A;  1B63 A;  2YEH A;  2WEP A;  4O0B A;  2IWS A;  1UYK A;  1I5B A;  1L0O A;  4PRV A;  1UY8 A;  3NMQ A;  3A0Y A;  4CWN A;  1S14 A;  2EXL A;  2YK2 A;  1TC0 A;  3HHU A;  1F51 A;  3P32 A;  3O6O A;  4BQJ A;  2FXS A;  5IN9 A;  2YE7 A;  3LPS A;  3QTF A;  3OW6 A;  5J6A A;  4NH8 A;  2YEE A;  5B1N A;  1UY9 A;  4LWH A;  1UY7 A;  4WUC A;  3B24 A;  4NH9 A;  3DGE A;  1I59 A;  1Z5A A;  3B28 A;  2Q8F A;  4L93 A;  4URL A;  1UYI A;  4R1F A;  5D7R A;  2YGF A;  2XDS A;  2Q8I A;  2YKC A;  4U93 A;  2XDX A;  1NHJ A;  4MP2 A;  4O09 A;  2QFO A;  2Q8H A;  2YE3 A;  3TTZ A;  5D7C A;  1I5D A;  2XX4 A;  3ZRW A;  2O1V A;  3EHH A;  2XHR A;  3SL2 A;  2XD6 A;  4H81 A;  2BSM A;  3K97 A;  4XCJ A;  4H7Q A;  5M4K A;  1MX0 A;  2WI4 A;  2YJX A;  1YC3 A;  4I3H A;  3U67 A;  2P67 A;  2XJX A;  5B1O A;  4HZ0 A;  2XX5 A;  2JJC A;  4MBC A;  2C2A A;  4CWT A;  2CCU A;  2WEQ A;  3OWD A;  4GCZ A;  3NXS A;  4EFT A;  1NHI A;  2BRC A;  4K4O A;  1Z59 A;  4KQV A;  1YC4 A;  2IWU A;  4L91 A;  4HY1 A;  3T0H A;  1YER A;  4JYC A;  2ESA A;  3TZ5 A;  4EFU A;  2CGF A;  3MNR P;  2CCS A;  4MOT A;  3D36 A;  1ID0 A;  2ZDY A;  4O04 A;  3IED A;  1UYE A;  1UY6 A;  1BGQ A;  3B25 A;  1UYF A;  2YED A;  2PNR A;  4EMV A;  5FND A;  4BIU A;  4R3A A;  4ASB A;  3HZ1 A;  2WER A;  4MPC A;  4HXW A;  3A0X A;  1UYD A;  2XDU A;  2BU2 A;  1UYG A;  2YGA A;  2YI5 A;  3Q5K A;  1AMW A;  3T2S A;  2AKP A;  2BT0 A;  4MPN A;  2YE5 A;  1UYM A;  3WHA A;  1KZN A;  2IOQ A;  2H8M A;  1YS3 A;  4LP0 A;  3U2K A;  5D7D A;  4AS9 A;  4V26 A;  4XKK A;  2BYI A;  1QY8 A;  2IOP A;  4ZKI A;  2XAB A;  3PEJ A;  1U2O A;  3RLR A;  4EGK A;  4R3M A;  4JAU A;  4EEH A;  2BYH A;  2QF6 A;  4E02 A;  1UYH A;  3Q5J A;  4GGL A;  3CGZ A;  4ZVI A;  3ZCC A;  2XK2 A;  4BAE A;  3C11 A;  1ZWH A;  1QZR A;  2O1W A;  2YEA A;  4P7A A;  2YEC A;  3D0B A;  5C93 A;  2YE6 A;  4EM7 A;  3G75 A;  2Q8G A;  4CE2 A;  1U0Z A;  3CRK A;  3B27 A;  4KSH A;  3U2D A;  4QPJ A;  1B62 A;  1R62 A;  3EHJ A;  4ASG A;  3OPD A;  4GQT A;  2WI5 A;  2YI7 A;  1B3Q A;  4AWO A;  4U7O A;  3GIE A;  2CG9 A;  2IWX A;  4P8O A;  3CWV A;  2CH4 A;  4BXI A;  2FWY A;  3RLQ A;  1EI1 A;  2ZKJ A;  5F5R A;  1YSR A;  1BXD A;  4CWR A; 
#chains in the Genus database with same CATH topology
 3K0G A;  1IBM B;  4J7K A;  2VQF O;  4LFC O;  1YT1 A;  2QWQ B;  2YXY A;  3W7T A;  2AW9 A;  4IYH A;  4ZI7 B;  1UYL A;  1EN5 A;  5GON A;  3RKZ A;  1Q90 D;  2K9P A;  4UVC A;  3WQ9 A;  1VQN V;  4DR4 O;  4JTC B;  3HZ5 A;  1X59 A;  1D2D A;  4NTY A;  2CCT A;  2X6B A;  1DF4 A;  1Q6U A;  3B09 A;  4KP4 A;  4QPK A;  2ADP A;  4DV2 O;  2IU3 A;  2LFR A;  3L73 H;  1R3J C;  2YI6 A;  4DR3 B;  1PPJ H;  3UO3 A;  1XMO O;  2QDO A;  1G8M A;  4Q20 A;  3SPJ A;  2JDI G;  1JFF B;  3INW A;  2QEX V;  4FJC C;  2CTW A;  3JAR A;  1VQ4 V;  3SYP A;  3ZRV A;  4PA3 A;  2WI7 A;  3JAS B;  2ZIM A;  3R4N A;  1B6Q A;  2DWD C;  2PZS A;  4YKX A;  2GQP A;  3CCS V;  2EIM B;  3RVY A;  1K4D C;  4CH6 A;  4X1K B;  3G6B A;  1V55 C;  4UCV A;  1RFY A;  3C90 A;  2GFD A;  1MU5 A;  3AK1 A;  5GGZ A;  1MA1 A;  3ZRX A;  2PI4 A;  2HHH B;  3AG7 A;  3G67 A;  1TBW A;  4ICG A;  4QE9 A;  2LJ2 A;  1H2N A;  3CS5 A;  2L35 A;  1SA0 B;  4YKT A;  4ZHQ B;  3K59 A;  4DO2 A;  5KX5 B;  1F4M A;  5EBM C;  4WBN B;  3B26 A;  3K9A A;  1BYQ A;  3B8N A;  2HHH O;  4FFB B;  2OT5 A;  1AI7 A;  3B4S A;  3QVN A;  4I9W A;  1I5C A;  2X7R B;  2WWW A;  1M90 W;  5EZY B;  3K57 A;  2H55 A;  3H4L A;  3JD2 A;  2NN4 A;  1NTM H;  1TID A;  3JAW A;  4MB9 A;  5IJ9 A;  1YJW V;  1AI5 A;  1R6K A;  3R4P A;  1FYJ A;  1TUE B;  2F4V O;  1GH6 A;  4MS2 A;  4DW0 A;  2HVJ C;  1I5A A;  1YDX A;  1GK9 A;  3K60 A;  1WJZ A;  3L72 H;  4PHZ A;  4F4L A;  4BW9 A;  3CX5 F;  4ZOL A;  4PJ0 Z;  2ZR2 A;  4DV3 B;  1K73 W;  5D6Q A;  4LF5 B;  5BY1 A;  2YE2 A;  2OTJ V;  3E22 A;  2H3O A;  4U3J B;  4DUH A;  4LWE A;  1YXB A;  1BT8 A;  3CCQ V;  4J42 A;  4L8J A;  1ZL8 B;  4GUN A;  1S0V A;  3G7E A;  4JI4 O;  1Q43 A;  3BVO A;  1H7S A;  1AJN A;  3QG5 A;  4XDJ A;  1FD9 A;  1G4Y B;  3E8G A;  4JYB A;  1GO3 F;  4H44 B;  3HYZ A;  2OWO A;  5EIB D;  4ZOL B;  4FM2 A;  4CWQ A;  1H7U A;  4NVP A;  2YKB A;  3A2F A;  3KZI Z;  4JI8 B;  5LMN B;  1M5I A;  3B8M A;  3GIG A;  1NTZ H;  4XIP A;  5CA0 A;  5LYJ A;  3B40 A;  5CB4 B;  4WFF A;  4DV6 O;  1K5Q A;  2YIC A;  3MAQ A;  2QE7 G;  4P2Z A;  1NKD A;  3ZKD A;  4L90 A;  5M4M A;  4J9Z B;  4OX9 O;  3HKD B;  4ZIB A;  2BZ5 A;  1ZW9 A;  5IJ9 B;  1XBL A;  2YI0 A;  4O2A B;  3TZ4 A;  5E1A C;  2JEU A;  2A7W A;  3RGB A;  3Q5L A;  4LWS A;  1YSZ A;  4DV5 B;  5LA6 B;  1Y76 A;  1OCO B;  4YKQ A;  4CH5 A;  1WN7 A;  4CZZ A;  2WI2 A;  1KD1 W;  3M99 B;  1BL8 A;  1KP3 A;  3ZJZ A;  3OTF A;  1SQX H;  4MVM A;  4GT8 A;  2GUZ B;  5A2Q N;  4URO A;  5GTH Z;  4NTX A;  3CEI A;  4DR6 B;  2Y0P A;  2YS8 A;  2GSM B;  4HNA B;  3AG4 C;  2WLJ A;  1FFT B;  2F1M A;  1PNL A;  1Y4S A;  3HKB B;  5IDM A;  3CCM V;  2DJV A;  4L8Z A;  1QVG U;  5BZB A;  2EIM C;  5IYB O;  1KYO F;  3O9O A;  3CYO A;  4JI6 B;  3QO8 A;  3HR0 A;  4O4J A;  2QWR B;  1OHH G;  4E72 A;  5D5Q A;  2YID A;  3F5T A;  4X1Y A;  2L6L A;  3APO A;  3T1H B;  2BTO A;  3D8C A;  1Y4M A;  4MVR A;  1SQP H;  2ZE8 A;  3T1C A;  4GZR B;  3FT8 A;  1LUW A;  1XQ8 A;  3ZMT A;  3DTU B;  4JI6 O;  3K98 A;  3FB5 C;  3ZRW B;  3ABL B;  1K4C C;  4PI2 A;  4FLV A;  4URN A;  4XC0 A;  4IIJ A;  3O0I A;  3UCS C;  2Q69 A;  2MW2 B;  2WA3 A;  4AQY O;  4YKZ A;  2E5L B;  2Q0A A;  3ETQ A;  3RYI A;  3EKO A;  4JV5 B;  4I9Q A;  2Q6A A;  2XX2 A;  5LGT A;  5B1B C;  1SQF A;  1FS0 G;  3ZMU A;  4HYM A;  1IUR A;  2P4K A;  2M6Y A;  4X20 A;  2YEH A;  2IU0 A;  1UYK A;  4R6Z A;  1EZJ A;  2XOK G;  4J10 A;  2IJI A;  2EXL A;  3CRR A;  3P3P A;  5LGN A;  4LF7 O;  2AHY A;  3P32 A;  1SER A;  3O6O A;  4BQJ A;  3OTO O;  2FXS A;  4X62 O;  3LPS A;  2FKX A;  1MMM A;  1S76 D;  1UY9 A;  4E4E A;  5JH7 A;  2JVD A;  2R9R B;  3B24 A;  5FPO A;  1NS1 A;  3LMM A;  1UYI A;  2W0X A;  2HLD G;  5KHJ A;  4DV1 B;  2EIL C;  2JRI A;  3E2E A;  3TTZ A;  2XDX A;  5FNV B;  4O09 A;  2QFO A;  3ZIA G;  2YE3 A;  2KKW A;  1JVM A;  5D7C A;  1ZUQ A;  4NXM B;  1RM1 C;  4FK5 C;  3EHH A;  2B9Z A;  3ZN0 A;  1LR1 A;  5IJ0 B;  4K0K O;  3H1K H;  1IBL B;  3JAM N;  1WB7 A;  3JCZ A;  4H7Q A;  5M4K A;  2YJX A;  3JD4 A;  1URF A;  1N0N A;  1P7G A;  1R6T A;  4O2B B;  4TV8 B;  1NH2 B;  1Q82 W;  2P67 A;  1V9P A;  3JYC A;  1EBO A;  3LNN A;  4JI0 O;  5EIB C;  3D3I A;  1L8D A;  1R73 A;  4LH6 A;  2OCC C;  1N36 B;  2F23 A;  4U3J A;  4NXM O;  5GON B;  4EFT A;  3J81 N;  4JYY A;  1ZX3 A;  1VF6 C;  4UB6 Z;  1XUQ A;  4K4O A;  3OGC C;  3IAY A;  1YC4 A;  1VF7 A;  2IWU A;  3LDD A;  4X20 B;  5EC2 C;  1M1K W;  1SRY A;  3M7M X;  1LUV A;  2KB1 A;  5LMU O;  4O2B A;  4TV8 A;  3TZ5 A;  1QU7 A;  3SYC A;  1R3I C;  3MNR P;  2EJR A;  2LW7 A;  4MOT A;  1I7F A;  2DYS C;  5KLV H;  5B3S C;  1S77 D;  1VF5 B;  4PA9 A;  4FLZ A;  3HB3 B;  4X88 A;  1SQG A;  1MAB G;  1UY6 A;  4WFE A;  1UYF A;  2YED A;  3WG7 B;  4BIU A;  3CME V;  4NTW A;  3OFN G;  1VQ5 V;  3A0X A;  1UYD A;  1HW7 A;  2B1G A;  3T2S A;  1H8H G;  2AKP A;  3HPL C;  4MPN A;  1BS3 A;  3ZRS A;  2YE5 A;  4UCU A;  3JAK A;  3JD0 A;  4J11 A;  1KZN A;  2Y48 A;  3U2K A;  4AS9 A;  3LSS A;  1QY8 A;  3DC6 A;  4ZKI A;  4DR7 O;  4DR2 O;  3RLR A;  2IJH A;  4EGK A;  2EIN B;  1Q81 W;  2BYH A;  5L3E A;  1MSD A;  3QO5 A;  2YIB D;  1UYH A;  3CGZ A;  3ZCC A;  2JS5 A;  4MW8 A;  4DK1 A;  4B7K A;  1YSC A;  3LSU A;  1QZR A;  4TV9 A;  1RSO B;  3IGA C;  2XAF A;  4CC6 A;  3OR6 C;  4OPH A;  3SGI A;  3OUF A;  2YE6 A;  4EM7 A;  1L0N H;  2CTR A;  2ZIN A;  3STZ C;  1Q5O A;  4ASU G;  4UV8 A;  2WLI B;  2DN9 A;  2XAJ A;  4K0K B;  2UXD B;  3B27 A;  3FKS G;  5B3S B;  1O9G A;  3U2D A;  3FB7 C;  4W4L A;  4FIP C;  1V54 B;  1BHA A;  3OPD A;  2B1I A;  1KEC A;  2YI7 A;  4JF3 A;  3GIE A;  1XHZ A;  3JAT B;  3EHB B;  2FWY A;  5IWA O;  1EI1 A;  2ZKJ A;  5F5R A;  1YSR A;  2F95 B;  5J2T A;  4PI0 A;  1VQK V;  5M4H A;  2GV9 A;  5LHI A;  3OMU A;  4DXW A;  1JJ2 U;  5J71 A;  2IH1 C;  4LF4 B;  3LDE A;  4OX9 B;  1CP9 A;  5K1X A;  4AWP A;  1PL4 A;  1MG1 A;  1S5L Z;  2OCC B;  2VWK A;  5KA6 A;  4YJ2 B;  3W7U A;  3TUH A;  2UXX A;  2AZ2 A;  2ZM6 O;  2E74 B;  5JVD B;  5AG2 A;  2N04 A;  4CC5 A;  4L94 A;  1NR1 A;  2XND G;  5B5E Z;  2N05 A;  1AI6 A;  1NHH A;  3LDC A;  1KQS U;  5L3C A;  1DK1 A;  1FFX B;  2HCH A;  2YEV B;  3ZHQ A;  4PL9 A;  3PEH A;  2HVK C;  4E2L A;  3CRA A;  3CSX A;  2FWZ A;  4JI1 O;  5JVD A;  3A0B Z;  4LWG A;  3BM9 A;  1Q86 W;  2R70 A;  4KTN A;  1ZL8 A;  3H1L H;  3OM3 B;  5H6Q A;  3SJA C;  3VQV A;  1Y74 B;  3X2Q C;  2P06 A;  3QTC A;  4YKR A;  4WUB A;  1AJQ A;  2ARH A;  5BMV A;  2IOR A;  5ITZ A;  4PA7 A;  1COW G;  2EJ7 A;  1DGS A;  3BRC A;  4JI1 B;  1TIL A;  1PVG A;  5EBL C;  4XIQ A;  1XNQ O;  2KG7 B;  1GKZ A;  2C1I A;  5JJE B;  2QG0 A;  2R9I A;  3VOU A;  4DR4 B;  2BRE A;  2JGD B;  3ICX A;  3CXH F;  4J41 A;  5IYC O;  3K3W A;  2Y4U A;  3EXA A;  1JM6 A;  4R50 A;  5CTU A;  2C1G A;  1I94 O;  1XEQ A;  1YCI A;  4WF9 V;  4RO2 A;  4QNH B;  5J2U A;  2E5L O;  3ASO C;  4HZ5 A;  3OR7 C;  4CWO A;  2CDY A;  3GIF A;  4OPA A;  4CS2 A;  3H01 A;  3EHF A;  4DV5 O;  4U7N A;  4QIW F;  4WFH A;  1S72 V;  4BIZ A;  1K5S A;  4NR1 A;  3SJQ C;  5J2T B;  4MVS A;  4H85 A;  3ABL C;  2DQ0 A;  2VWC A;  4UXN A;  1XMQ O;  5IY5 C;  1P84 F;  4C7U A;  4DUZ O;  1KU9 A;  1VIB A;  4X66 O;  3G71 V;  2A3Q A;  3QO7 A;  3K99 A;  1JQ0 A;  1PP9 H;  2QWP B;  4GKK B;  2YXL A;  2QKS A;  4DR6 O;  3HYY A;  4KXR A;  4JAS A;  2VW5 A;  4KFG A;  4EKW A;  3CGY A;  4YY3 B;  2WI3 A;  2YUA A;  1N32 O;  2VRZ A;  1IZ3 A;  3J80 N;  5DEC A;  5FNF A;  3E8B A;  3H80 A;  1Z5B A;  2QM7 A;  3DXR A;  3JAR B;  4X66 B;  2XCM A;  1H2S B;  4J7J A;  2GBO A;  2UU9 O;  2D3O W;  4DUY O;  4EEQ A;  2YIA A;  4X9Q A;  3T1H O;  2XHX A;  3EHG A;  2HFE C;  1K3E A;  5FNC A;  1N32 B;  1YTF B;  4MP7 A;  4IT5 A;  4R8C A;  3RN4 A;  4I0X B;  2HKJ A;  1RP3 B;  1N33 B;  2ZNJ A;  3O2F A;  1AVM A;  4DR3 O;  2YKE A;  2G38 A;  1AJP A;  3BY6 A;  2GTA A;  1J95 A;  1XOU A;  2WA4 A;  4CS3 A;  1ZXN A;  2YEI A;  1YT2 A;  5CTY A;  4CWS A;  1US7 A;  4FCR A;  3B2E E;  2WSS G;  4LFA O;  3SYA A;  1HNZ O;  5KUK A;  2XHT A;  2PGG A;  4LC1 A;  1WNS A;  3MDS A;  2OYQ A;  4YJ2 A;  5KHI A;  4X1K A;  4HXZ A;  4JQL A;  3BCC H;  4RUE A;  4DR1 O;  5LGU A;  1K33 A;  5LHH A;  1YJ9 V;  3T1K A;  3VQX A;  1Y76 B;  5LA6 A;  2YKI A;  2ETN A;  2W0F C;  2IM9 A;  1QR9 A;  1MZE A;  2FL4 A;  5J9P C;  3K9S A;  3A0W A;  4GKK O;  1DTO A;  3S3X A;  1WB8 A;  4LR3 A;  1HR0 B;  3ABU A;  5A9G A;  4HYP A;  5IJ0 A;  1D5N A;  4FM1 A;  4B3M B;  3DC5 A;  4DV1 O;  4DK0 A;  4WFB V;  4I4T B;  3L9D A;  3RYC A;  3RYI B;  1Y67 A;  2GDS A;  2W6I G;  3A0T A;  1TAE A;  4WFG A;  3BA9 A;  2BTQ B;  4DV4 B;  3OT7 A;  2XDK A;  2YJW A;  3VAD A;  1IBL O;  1P4R A;  3BAA A;  2UU9 B;  2YK9 A;  3D3Q A;  3GWO A;  4HAM A;  2GUZ A;  3CC7 V;  4JI2 B;  4XDK A;  3J7A U;  4YKY A;  2F93 B;  3ZHS A;  1FKA O;  1OSF A;  4W4K A;  1W0J G;  1RPR A;  2JS3 A;  3E86 A;  3K08 A;  1W59 A;  3T10 A;  4B6C A;  1B63 A;  3E22 B;  2XHB A;  4LF9 O;  3ZED A;  4FM0 A;  1IVS A;  1PL0 A;  3NMQ A;  4CWN A;  3S5T A;  3TJT A;  1NZ6 A;  5B66 Z;  1F51 A;  4DV0 B;  1VP7 A;  2XTA A;  2QA4 V;  2YE7 A;  3QTF A;  1BZK A;  3FD9 A;  5J6A A;  1AI4 A;  2LP7 A;  2YEE A;  1KMI Z;  2Q7H A;  1PKX A;  5JJN B;  1YIT V;  3L71 H;  2UUA B;  3PN1 A;  2F43 G;  4FLT A;  4DV6 B;  1TUB B;  1BE3 H;  4X64 B;  4LFA B;  4DYL A;  3B28 A;  2UUC B;  3FYE B;  1Z5V A;  2MK3 A;  1SQQ H;  4Z1V A;  2Q8I A;  2CAZ C;  4H33 A;  1QNM A;  3AG1 C;  3E83 A;  4LF6 B;  4JV5 O;  1M57 B;  2XHR A;  2XD6 A;  2QTO A;  3K97 A;  3B77 A;  2P90 A;  2WI4 A;  1CXZ B;  1YC3 A;  3TXS A;  4I3H A;  1NVP D;  1SZT A;  5EYP A;  4HZ0 A;  3OEE G;  1ZTE A;  3CJH A;  4FLU A;  4JI3 O;  1FXH A;  2CCU A;  2WEQ A;  3OWD A;  4LF6 O;  2WLI A;  1XDC A;  2OTL V;  2IW5 A;  2ZR3 A;  3NXS A;  1AB3 A;  1Y66 A;  5CB4 A;  3UQ8 A;  5EK0 A;  4YJ3 B;  2E75 B;  5DED A;  2QWO B;  4LF7 B;  4J7Z A;  1Z59 A;  4KQV A;  4L91 A;  1Q6I A;  3T0H A;  4JAA A;  3VBB A;  2ESA A;  3O65 A;  4LFB B;  1S5J A;  1XMO B;  1PNK A;  1JX9 A;  3D36 A;  1Q7Y W;  4O04 A;  3IED A;  4LF8 O;  4TQF A;  3IFX A;  4KHP B;  5CA0 B;  4B3R O;  1UYE A;  1YJN V;  3ABK C;  2EIJ C;  3CHX A;  5C8Y B;  4ASB A;  3MHS C;  1VQL V;  1R3K C;  3HZ1 A;  5KX5 A;  4MPC A;  2WLL A;  4HXW A;  5CN0 A;  3C3S A;  3UT5 A;  3BHP A;  2BU2 A;  2YGA A;  3CRC A;  3APQ A;  3ML0 A;  1AMW A;  1AR5 A;  4NXN O;  4I0X A;  2BT0 A;  4LF8 B;  4DV0 O;  2Q5Z A;  4LP0 A;  1GM8 A;  2QSA A;  4V26 A;  4XKK A;  1O9H A;  2XAB A;  1FJG O;  3PEJ A;  2RMK B;  3G6E V;  4JAU A;  5JCO A;  4B3T O;  1ZWI C;  2P5O A;  1OCZ B;  1HWY A;  4GGL A;  2VQE B;  1N34 O;  4BAE A;  2DWE C;  3JAS A;  5KHH A;  4DUZ B;  2D2C B;  1NT2 B;  2O1W A;  4P7A A;  2YEC A;  2CUG A;  3K5O A;  4FFK A;  2M7W A;  4CE2 A;  1R3L C;  1QBZ A;  1S3J A;  4LNU B;  4X89 A;  4KFM A;  1F23 A;  2OIE A;  4O4L A;  5J2U B;  1Y74 A;  4QPJ A;  3OW2 U;  5IYZ B;  1SC5 B;  3ZMS A;  2WI5 A;  4X62 B;  4AWO A;  4U7O A;  2PYL A;  2CG9 A;  2IWX A;  4FFB A;  1GN2 A;  2ATK C;  2V1D A;  2CH4 A;  4BXI A;  1QVF U;  4BW5 A;  2QJ1 A;  3ZN1 A;  5LP6 B;  5IE9 A;  1YF2 A;  4CWR A;  2DOS A;  1QLN A;  3Q4H A;  5DN6 G;  3R4O A;  3KG2 A;  2E3C A;  2ZNI A;  2XAH A;  4F6R A;  2P4V A;  4B3S O;  2ZDI C;  3BAB A;  1MNG A;  3L70 H;  1XI1 A;  4X9L A;  1L0L H;  1TC6 A;  4UCS A;  3K5L A;  4FCP A;  5FWK A;  2K1E A;  2UXC B;  2WLK A;  2A79 B;  3D36 C;  2ILM A;  1EM1 A;  3ZM7 A;  3U10 A;  1SQV H;  3AG3 C;  1YET A;  3OGI B;  5B1A C;  4TOI A;  1GTO A;  1OCR C;  1WLE A;  5D6P A;  2XAG A;  1FXK A;  4DV7 O;  1S16 A;  4I50 A;  1N36 O;  4JZG A;  2Z3Y A;  3CJH B;  3CMA V;  4HBN A;  1JOY A;  1WA8 B;  4FLW A;  2UXD O;  4EFE A;  3U0Z A;  2EBO A;  5JJJ B;  2YE9 A;  4EFB A;  2AXT Z;  4DR1 B;  3ETE A;  5FPR A;  4XKA A;  4YXW G;  1Q3E A;  2JJ1 G;  3CWB H;  1EZV H;  4X1Y B;  4X8A A;  1NH2 D;  3FV5 A;  2BU6 A;  3CCV V;  5H5N A;  3ZHR A;  1I58 A;  1XNR B;  2UWD A;  1ZSP A;  3Q4H B;  1GJV A;  1J5E B;  4UCO A;  3H9V A;  4NYK A;  3UKM A;  4CE3 A;  2EUL A;  1TH8 A;  2WI6 A;  3ZHU A;  4TSF G;  3I55 V;  3WU2 Z;  5IT9 N;  1VEW A;  1AH8 A;  1K7D A;  3C3T A;  3F7Y C;  3ETG A;  3QF7 A;  3E8F A;  2DYR B;  5KA5 A;  3A0Z A;  3H1H H;  3K58 A;  3FX7 A;  4HY6 A;  4DR7 B;  5CTW A;  4OGQ B;  2H8P C;  1GMG A;  2Q4P A;  2ZBK B;  2W6J G;  2YEV A;  2FB5 A;  4DRX B;  4EB6 B;  3RBZ A;  3JAL B;  2BCC H;  4IHJ B;  2FYP A;  4EGH A;  2A06 H;  1KC8 W;  5L3J A;  4JI8 O;  1QCE A;  2E0A A;  2Q8V A;  1P7B A;  2PTM A;  5KHG A;  1QHT A;  3ZKB A;  1P49 A;  3TZ2 A;  3SPC A;  2AGA A;  4IGG A;  3E35 A;  4PA4 A;  1YHQ V;  1ENV A;  4H0L B;  5L3G A;  2UXN A;  4ABM A;  5LHG A;  3ZX6 A;  5JQG A;  4X65 O;  1XL6 A;  4X1I A;  1JA8 A;  3A0R A;  4XDM A;  1N8R W;  1FXK B;  1VQM V;  2NR5 A;  4U3F H;  2DYR C;  3SR2 C;  3W7W A;  1KKD A;  3EFF K;  4PU9 A;  4PA6 A;  3T1Y B;  5FL7 G;  2LGW A;  4G28 B;  1AR4 A;  4PDR A;  1OCC B;  3KCY A;  3AK3 A;  4LNU A;  5CA3 A;  4XIR A;  4X65 B;  2YXH A;  3I56 V;  4B08 A;  3AG2 B;  2UUB O;  4GX5 A;  3U11 A;  2ZM6 B;  4DZY A;  5K1P A;  4CWP A;  3N2K A;  3INX A;  3DXR B;  1AJ6 A;  2YI9 A;  1TVK B;  1AM1 A;  4AI8 A;  4B3M O;  4FPP A;  1GN6 A;  3FB6 C;  1XNR O;  2V7Q G;  3K5M A;  2WLH A;  3OTO B;  2ZT9 B;  4QE7 A;  1OJH A;  4XIT A;  1J5E O;  2YEB A;  5LL6 Y;  4FZ1 A;  4XTJ A;  1QQC A;  2K5B A;  4XD8 A;  1BCC H;  3SPH A;  3SPI A;  3R66 A;  4P30 A;  3BEH A;  1VMG A;  4LWI A;  2Q2E B;  5BOC A;  2FTK A;  1WA8 A;  2ZE5 A;  1FXK C;  1T5E A;  1YT0 A;  4O07 A;  4E01 A;  1HNW B;  4JGS A;  3CRL A;  3R91 A;  3OMA B;  2YKJ A;  1M56 B;  3KE6 A;  4X1I B;  2BTZ A;  3ABM C;  3CCL V;  5B1A B;  1NR7 A;  3CP1 A;  1Q6H A;  3JAT A;  4DV3 O;  2VCJ A;  3R92 A;  4LF5 O;  4V25 A;  2GHY A;  5F3K A;  1H2G A;  4PDM A;  4GFN A;  2Q0O C;  3GB7 C;  1H2K A;  4ASF A;  3QDD A;  2JKI A;  2P22 C;  4CWF A;  1CEZ A;  4KSG A;  1D5A A;  3CRQ A;  4HYO A;  3AEI A;  4YIP A;  2YGE A;  2DQ3 A;  4GT1 A;  2XJJ A;  4WCE V;  5TIS Z;  3L75 H;  2AZ0 A;  5CF0 A;  5LP6 C;  2VWJ A;  3JZ3 A;  4DW1 A;  2YC0 A;  1KUQ A;  2BU5 A;  4LCU C;  2HJF C;  3HEK A;  3QNE A;  1ZAU A;  1A32 A;  1ORQ C;  4BQG A;  4BWA A;  4GX0 A;  4D6T H;  1NU1 H;  5HFM A;  3G7B A;  4YHH B;  2ZKO A;  3ZHV A;  4AQY B;  4O05 A;  1YEW A;  2BSK A;  2HKO A;  4O0B A;  1GKF A;  3UM7 A;  2IWS A;  4ZI7 A;  3WB0 A;  1R6N A;  1I5B A;  1L0O A;  1JR9 A;  3JSL A;  4O4H A;  5JQG B;  5LXT A;  1SQB H;  1RSO A;  1UY8 A;  3P30 A;  3A0Y A;  1TC0 A;  4UVA A;  4B7E A;  1TVK A;  3RFR A;  2RCV A;  2OIG A;  5IN9 A;  4TUY A;  4Z1M G;  2JEX A;  4NH8 A;  2FML A;  5B1N A;  4LWH A;  1OZ0 A;  5BXZ A;  1GM7 A;  3RVZ A;  4WUC A;  4LFC B;  2VQF B;  1SS3 A;  1Z5A A;  1NQT A;  4L93 A;  2YGF A;  3ETD A;  4EB6 A;  2XT9 A;  2XDS A;  1YI2 V;  2JGU A;  5IYD O;  1HDJ A;  1Y6X A;  2CH7 A;  5HFL A;  4JI5 O;  3RYF A;  4MVQ A;  3ZRW A;  2O1V A;  3AG3 B;  2HR3 A;  3ABK B;  4H81 A;  1PNM A;  2BSM A;  4K35 A;  4WFA V;  3PJS K;  3T4Z A;  4D7S A;  3U67 A;  3W7S A;  2XJX A;  5B1O A;  2XX5 A;  2JJC A;  4MBC A;  2BTQ A;  2RJZ A;  1M9N A;  4JYA O;  4JI5 B;  1QLE C;  4I55 B;  1Z2G A;  1UPG A;  4J9Y B;  4Z2W A;  5KUM A;  3BFR A;  4FZ0 A;  2CH7 B;  4HY1 A;  4JYC A;  5ITZ B;  4PD4 F;  5BMV B;  1H8E G;  3JD1 A;  2ZE6 A;  3ZMV A;  2P6J A;  2CGF A;  1TGO A;  4JPR A;  1W2B U;  5EBW C;  5IYZ A;  1NJI W;  5BR8 O;  3BPZ A;  1ID0 A;  2EIK C;  4UCR A;  2ZDY A;  5F2V O;  3K03 A;  1MZF A;  1BGQ A;  3AK2 A;  3RYH A;  3B25 A;  3OMI B;  3CCJ V;  4FLX A;  1B06 A;  4L87 A;  5JCO C;  2PY5 A;  1VQ6 V;  1PV0 A;  4RUF A;  4R3A A;  3T2M A;  5KAI Z;  1VF6 A;  1SKV A;  3AG1 B;  2XDU A;  1N4C A;  2YI5 A;  3Q5K A;  1CPY A;  2ZXW C;  4RQF A;  4O4H B;  1KB9 F;  3ASN C;  5LXT B;  2EIL B;  1I0H A;  3CD6 V;  4RAI A;  4RQE A;  3WHA A;  2IOQ A;  1X4T A;  4PDL A;  3K04 A;  1YS3 A;  2P7T C;  5D7D A;  5DM6 V;  2HHI A;  4FVM A;  2BYI A;  2IOP A;  3N27 A;  5LBQ A;  4DV2 B;  1M93 A;  3RT3 C;  2ODM A;  3ASN B;  3BA8 A;  2ZXW B;  2QF6 A;  4E02 A;  1JPX A;  2H94 A;  3ZMZ A;  1U97 A;  1BQ0 A;  3Q5J A;  1XNQ B;  3JD3 A;  2YEA A;  5LP6 A;  3D0B A;  5C8Y A;  1L1F A;  4IIJ B;  5H6R A;  1K97 A;  2EIJ B;  4OXS A;  2JIZ G;  1F4N A;  4DR2 B;  1E1Q G;  1H2L A;  1U0Z A;  1FXV A;  2QWN B;  4LFB O;  1EFR G;  4LF4 O;  4O2A A;  4KSH A;  2EIK B;  4MTG A;  1W0K G;  4KHP O;  4ASG A;  4GQT A;  1B3Q A;  4K8Z A;  4N23 A;  1R1B A;  3CWV A;  2WLM A;  4BR6 A;  3RW0 A;  4JI0 B;  1KKC A;  5EZY A;  5L3D A;  2Q68 A;  2A0L A;  1WPX A;  3E8H A;  2CE4 A;  2ZE7 A;  3L74 H;  3C0E A;  3CB2 A;  2YEF A;  1S5H C;  1QLE B;  1MSW D;  4KUM A;  1QYE A;  4PEL A;  4O4I A;  2HG5 C;  4MT8 A;  4HNA A;  2UUB B;  5LMU B;  5IWA B;  3VHD A;  4D7T A;  1NTK H;  4DR5 O;  4I5S A;  1E79 G;  1IXB A;  1ZXM A;  2F66 C;  2YE4 A;  4JAV A;  4XCL A;  3S3W A;  3JAK B;  5M4E A;  2ZDX A;  1M57 C;  4GKJ O;  2F4V B;  1GAX A;  1N34 B;  2E76 B;  2YEJ A;  3MHH C;  3SJB C;  5M4N A;  2YSU B;  3E89 A;  4J80 A;  4K3A A;  1FFX A;  3T4D A;  1BKN A;  3VQY A;  4MW3 A;  4JI3 B;  5CBH A;  3LNU A;  1DF5 A;  2NNU A;  5FNV A;  2WLN A;  4I55 A;  4EGI A;  1GRJ A;  1NI8 A;  1SET A;  3HKB A;  3ABT A;  3K5N A;  2PF4 E;  2ZDI A;  3AG4 B;  3G4S V;  1UFI A;  3OMN B;  4GKJ B;  4O4I B;  5E79 Z;  1YZB A;  3R4M A;  4LWF A;  2WPD G;  4G2K A;  4JI4 B;  1Y8N A;  4ASA A;  3RLP A;  4XE2 A;  3CCE V;  1GN4 A;  2QR4 A;  1ARO P;  3TZ0 A;  2HJD A;  3HKE B;  2LFS A;  1I94 B;  2Q67 A;  5L3F A;  4B3R B;  4WBN A;  3FT5 A;  3OEH G;  3UT5 B;  1DLB A;  2Q7G A;  4NH7 A;  1OCO C;  5LOV B;  2Q9L A;  3TK1 A;  5BOD A;  5JWP A;  4FMT A;  4E00 A;  2X6C A;  4B3S B;  5EYP B;  2YI8 A;  2XAQ A;  1N0J A;  3RWR D;  1HNZ B;  2QG2 A;  3T1Y O;  1KIJ A;  4W7T A;  4CE1 A;  2BU7 A;  3DSQ A;  1XMQ B;  1K8A W;  4XKO A;  3CC4 V;  3ZHT A;  2EZP A;  1IBK O;  3SJC C;  3LNM B;  2VCI A;  1K92 A;  3FB8 C;  2EX3 A;  3OWB A;  3GIG B;  1A4H A;  3A8T A;  2RQ6 A;  3FAV B;  3RYC B;  4JI7 B;  1YTF D;  4Q6G A;  4DRX A;  5H2F Z;  1GN3 A;  3OE7 G;  1TA8 A;  1UJW B;  2DW4 A;  1K34 A;  3HKC B;  4MTX A;  2XUM A;  2PYJ A;  1THN A;  3RYH B;  5CPH A;  1GKX A;  2O1U A;  3H1J H;  4DUY B;  3IC7 A;  1HR0 O;  3VHA A;  2XJG A;  1FPO A;  4LH7 A;  1XRE A;  3CE2 A;  3RYF B;  2CGN A;  4XDL A;  2Q7E A;  2HEP A;  3ABM B;  2O57 A;  4RWU A;  3CXC U;  1M56 C;  2OCH A;  3D2R A;  3CCU V;  5CTX A;  1EN4 A;  4DV4 O;  4WUD A;  1SZX A;  2BOB C;  3N2G A;  3OUS A;  3BMY A;  1AIL A;  4F6E A;  5H9C A;  4H13 B;  1HNX O;  3K79 A;  1YES A;  5CMU A;  3SPG A;  2XDL A;  4MSW C;  4TQD A;  3GWK C;  1WP8 A;  4CS4 A;  1RPO A;  1SES A;  2Z5U A;  3HKD A;  1THZ A;  2QM8 A;  4UB8 Z;  1IX9 A;  3A0H Z;  4BIO A;  3GVM A;  2NLJ C;  5GW7 A;  2YE8 A;  5JEN A;  3SYO A;  4GEE A;  2R72 A;  2IJJ A;  2WI1 A;  2RDC A;  3FFQ A;  2YEG A;  1PM9 A;  2UXC O;  1AH6 A;  3N2G B;  1HP8 A;  3FAV A;  4MVU A;  4PDV A;  4G27 B;  3SDL A;  5CA1 B;  3MD0 A;  2RNB A;  2B5U A;  3TET A;  2N74 A;  1JFF A;  3AG2 C;  1YIJ V;  1EA6 A;  1IXM A;  1VQ8 V;  4DV7 B;  3VHC A;  2X6A A;  3WFV A;  4A5U B;  1GM9 A;  4FCQ A;  4R7C A;  2DE0 X;  1OCC C;  3I5D A;  2ITD C;  4IYI A;  1Y4U A;  4KL1 A;  5M4P A;  3T0Z A;  4YKW A;  1V55 B;  1YVW A;  4TUY B;  3WB2 A;  5CA1 A;  5KMG A;  2RN9 A;  2KQX A;  5LMN O;  4O4J B;  5EC1 C;  4YKU A;  1G1X B;  5IDJ A;  4LPB A;  1Y8O A;  2Z0A A;  5BR8 B;  1I5X A;  1YC1 A;  2QGN A;  2Y0I A;  2Y4T A;  1VQO V;  4K8X A;  2YDE A;  4MPE A;  2BSK B;  2CTQ A;  3CRM A;  4IL6 Z;  3ZXO A;  1K9M W;  1G6U A;  1MOF A;  1US6 A;  2CK3 G;  3ZXQ A;  4AHC A;  5IY5 B;  4O4L B;  4MTF A;  3JCU Z;  4AWQ A;  4CBC A;  4PRX A;  2DMX A;  1FAF A;  4YY3 O;  2ITC C;  2ZIO A;  5CBG A;  4URM A;  3EKR A;  1IDS A;  1BQZ A;  2FYU H;  4BAY A;  2BOC C;  3HKE A;  1UYC A;  3THO A;  3ASO B;  2HG1 A;  2CGO A;  4LBE C;  1KBH A;  2EZO A;  3KKY A;  2BU8 A;  1Y8P A;  2ZD9 A;  3R65 A;  2YIB A;  1HNX B;  1Z5W A;  2IJK A;  1ROP A;  1V54 C;  1Z5C A;  1KP2 A;  1JCH A;  4TT3 G;  1M4U A;  1NVP B;  4B7P A;  2QTS A;  4I7Z B;  3JAW B;  4N21 A;  4H37 A;  1ZLZ A;  1EN6 A;  3HKC A;  4IHJ A;  2JJ2 G;  2WEP A;  1HNW O;  4P9O A;  3STL C;  4JYA B;  3JSN A;  4NB5 A;  1SF9 A;  1N33 O;  4TV9 B;  4PRV A;  3EVK A;  2UUC O;  4GYC B;  1S14 A;  3G80 A;  3N2K B;  3UO2 A;  2YK2 A;  3HHU A;  3LSQ A;  1XIL A;  4JI2 O;  1B04 A;  4PV1 B;  3F5W C;  4MTO A;  4MVO A;  2EIN C;  3OW6 A;  2XAS A;  2LQT A;  2HP8 A;  3X2Q B;  4CH3 A;  1LNQ A;  1UY7 A;  1F7Y A;  3WB1 A;  4B3T B;  4NH9 A;  1AP6 A;  3DGE A;  4LF9 B;  1I59 A;  3P3N A;  2Q8F A;  4URL A;  4ZBM A;  4R1F A;  4GX2 A;  4GLX A;  5D7R A;  1VAR A;  2YKC A;  4U93 A;  2WLL B;  3KCX A;  4HZ3 A;  4UVB A;  1NHJ A;  4MP2 A;  2Q8H A;  3CC2 V;  2Y69 C;  1I5D A;  1OCR B;  4ZHQ A;  1OV9 A;  2UUA O;  1BSM A;  2LGQ A;  2LO1 A;  4CH4 A;  2XX4 A;  1WAZ A;  1WPB A;  3K06 A;  3SL2 A;  1BHB A;  4UV9 A;  4DR5 B;  4P9P A;  4XCJ A;  1MX0 A;  4NKG B;  4AIL C;  2VS0 A;  3TXQ A;  2A9H A;  5D5P A;  5JH7 B;  2C2A A;  4QGP A;  3ZBH A;  4CWT A;  2GTS A;  3JAL A;  2PI5 A;  2ZQM A;  4GCZ A;  2BE3 A;  2KG7 A;  1IBM O;  2CTP A;  3TCU A;  1I5Y A;  1NHI A;  2KSD A;  4YJ3 A;  2BRC A;  3NR7 A;  1XHX A;  4YIO A;  2IBZ H;  3K0D A;  4JZ2 A;  1BMF G;  4GX1 A;  1YER A;  1SA0 A;  1NBM G;  4EFU A;  1WP7 A;  3IJ4 A;  2CCS A;  4UFZ A;  3VQW A;  2R9A A;  1BGY H;  2ADQ B;  2X0L A;  2IH3 C;  1JMK C;  3SYQ A;  1TUB A;  1E1R G;  3OAA G;  3CCR V;  1H2M A;  4F6R B;  2PNR A;  2JGD A;  3W7X A;  4EMV A;  5FND A;  1VQP V;  1FJG B;  4TWK A;  1H38 A;  2QM4 A;  4LP8 A;  1RM1 B;  3TGU H;  2WER A;  4I4T A;  1XL4 A;  2Y69 B;  1UYG A;  3M8A A;  3IC9 A;  1OCZ C;  4QJF B;  2V4D A;  5KMG B;  4FLY A;  2VQE O;  2JK5 C;  2QKA A;  1UYM A;  3ZS8 C;  3LUT B;  4JTD B;  1IBK B;  2H8M A;  1QR8 A;  3F7V C;  1VQ9 V;  1JJO A;  3CYG A;  5GTI Z;  2LW1 A;  1U2O A;  4JI7 O;  3CPW U;  4R3M A;  1VQ7 V;  4X64 O;  4EEH A;  4XBF A;  2ZCE A;  4NXN B;  5LOV A;  2UXB B;  4ZVI A;  4I50 B;  4YHH O;  3OD4 A;  2XK2 A;  3C11 A;  1ZWH A;  1I08 A;  1PD3 A;  4LWS B;  1AR1 B;  5C93 A;  3H1I H;  3WG7 C;  3G75 A;  2AHZ A;  5FLX N;  2Q8G A;  1U96 A;  3CRK A;  5L3B A;  4MVZ A;  2DYS B;  4UCT A;  2QKC A;  1B62 A;  1R62 A;  3EHJ A;  5B1B B;  2UXB O;  2Q73 A;  2PUS A;  3FYI B;  4P8O A;  5KAF Z;  5LYJ B;  5KHK A;  3RLQ A;  1AP5 A;  4JTA B;  4UUJ C;  2WAM A;  5CBF A;  1BXD A;  1Q8I A; 
#chains in the Genus database with same CATH homology
 5M4H A;  3K0G A;  1WPX A;  3E8H A;  5LHI A;  4DXW A;  3OMU A;  1YT1 A;  1QLN A;  1JJ2 U;  5J71 A;  5DN6 G;  2IH1 C;  3W7T A;  3C0E A;  1UYL A;  3KG2 A;  3LDE A;  3R4O A;  1CP9 A;  2YEF A;  3RKZ A;  1S5H C;  1QLE B;  1MSW D;  4KUM A;  4AWP A;  1MG1 A;  2OCC B;  2XAH A;  4UVC A;  5KA6 A;  1QYE A;  3WQ9 A;  4PEL A;  1VQN V;  2HG5 C;  4MT8 A;  2ZDI C;  4JTC B;  3W7U A;  3HZ5 A;  3TUH A;  2UXX A;  4X9L A;  2CCT A;  2X6B A;  1DF4 A;  4KP4 A;  4QPK A;  2IU3 A;  2LFR A;  1TC6 A;  3VHD A;  4FCP A;  5FWK A;  1R3J C;  2K1E A;  2YI6 A;  4I5S A;  2WLK A;  1E79 G;  2A79 B;  1ZXM A;  4L94 A;  3ZM7 A;  2YE4 A;  4JAV A;  4XCL A;  1NR1 A;  1G8M A;  2XND G;  4Q20 A;  3SPJ A;  2JDI G;  2ZDX A;  5M4E A;  1M57 C;  3AG3 C;  1YET A;  3INW A;  2QEX V;  1AI6 A;  4FJC C;  5B1A C;  2YEJ A;  1VQ4 V;  3LDC A;  3SYP A;  3MHH C;  1GTO A;  1OCR C;  1WLE A;  3ZRV A;  2XAG A;  1KQS U;  1FXK A;  5D6P A;  4PA3 A;  5L3C A;  2WI7 A;  2YSU B;  3E89 A;  1S16 A;  3R4N A;  1B6Q A;  3T4D A;  2YEV B;  2DWD C;  1BKN A;  2HCH A;  4MW3 A;  4PL9 A;  4YKX A;  2GQP A;  5CBH A;  3CCS V;  2EIM B;  2Z3Y A;  3LNU A;  3RVY A;  1K4D C;  3CMA V;  2HVK C;  4E2L A;  3PEH A;  1DF5 A;  1V55 C;  2NNU A;  2WLN A;  1JOY A;  1MU5 A;  2FWZ A;  2GFD A;  4EGI A;  5GGZ A;  1SET A;  3ZRX A;  3ABT A;  4LWG A;  2PI4 A;  3BM9 A;  2EBO A;  2YE9 A;  2ZDI A;  3AG4 B;  1Q86 W;  3G4S V;  3OMN B;  4KTN A;  3ETE A;  3OM3 B;  5H6Q A;  4XKA A;  3X2Q C;  4YKR A;  4YXW G;  2JJ1 G;  3R4M A;  4WUB A;  1AJQ A;  1TBW A;  4LWF A;  2WPD G;  4G2K A;  4QE9 A;  4X8A A;  1Y8N A;  1NH2 D;  2IOR A;  4YKT A;  4XE2 A;  3RLP A;  3FV5 A;  3CCE V;  4ASA A;  2BU6 A;  4PA7 A;  1COW G;  3CCV V;  1ARO P;  3TZ0 A;  4DO2 A;  1I58 A;  2LFS A;  1TIL A;  2UWD A;  1PVG A;  5EBL C;  1F4M A;  2Q67 A;  5EBM C;  5L3F A;  1GJV A;  3B26 A;  4XIQ A;  3FT5 A;  3OEH G;  1DLB A;  3K9A A;  1BYQ A;  1OCO C;  4NH7 A;  3B8N A;  3TK1 A;  1GKZ A;  2OT5 A;  1AI7 A;  3UKM A;  2QG0 A;  4CE3 A;  5BOD A;  2R9I A;  4FMT A;  4I9W A;  2X6C A;  1TH8 A;  1I5C A;  4E00 A;  2X7R B;  3VOU A;  2WWW A;  2BRE A;  4CWR A;  1M90 W;  2WI6 A;  2H55 A;  2XAQ A;  3JD2 A;  4TSF G;  3H4L A;  3I55 V;  2QG2 A;  1TID A;  4MB9 A;  5IYC O;  3K3W A;  1JM6 A;  2Q8H A;  4R50 A;  1YJW V;  1KIJ A;  1AH8 A;  1K7D A;  1AI5 A;  2BU7 A;  4W7T A;  3F7Y C;  4CE1 A;  5CTU A;  3ETG A;  1K8A W;  4XKO A;  1R6K A;  3CC4 V;  3R4P A;  2EZP A;  4WF9 V;  3E8F A;  1TUE B;  4RO2 A;  4QNH B;  2DYR B;  4MS2 A;  3ASO C;  5KA5 A;  4HZ5 A;  2HVJ C;  3OR7 C;  3A0Z A;  3LNM B;  4CWO A;  2VCI A;  1I5A A;  1K92 A;  3FB8 C;  3OWB A;  1GK9 A;  4HY6 A;  3K60 A;  5CTW A;  3GIF A;  3GIG B;  2H8P C;  1A4H A;  3H01 A;  3EHF A;  1GMG A;  2ZBK B;  4U7N A;  4QIW F;  4WFH A;  1S72 V;  2W6J G;  4BIZ A;  1YTF D;  2YEV A;  4F4L A;  1K5S A;  3OE7 G;  3RBZ A;  2ZR2 A;  4MVS A;  3SJQ C;  1K73 W;  5D6Q A;  1UJW B;  2DW4 A;  4H85 A;  3ABL C;  1K34 A;  2YE2 A;  2DQ0 A;  4MTX A;  4UXN A;  2OTJ V;  5IY5 C;  2VWC A;  2FYP A;  4EGH A;  4DUH A;  4LWE A;  1KC8 W;  1THN A;  5L3J A;  3G71 V;  3CCQ V;  5CPH A;  1QCE A;  1GKX A;  3K99 A;  3QO7 A;  1S0V A;  1JQ0 A;  2O1U A;  2E0A A;  1P7B A;  1NHH A;  3G7E A;  2QKS A;  3ZKB A;  3IC7 A;  1H7S A;  3TZ2 A;  3VHA A;  3SPC A;  2XJG A;  3HYY A;  1AJN A;  4JAS A;  2VW5 A;  4XDJ A;  4KFG A;  1G4Y B;  3E35 A;  3E8G A;  1GO3 F;  4JYB A;  4PA4 A;  1YHQ V;  1ENV A;  4EKW A;  3CGY A;  5L3G A;  3HYZ A;  4XDL A;  2UXN A;  2WI3 A;  5LHG A;  3ABM B;  3CXC U;  5FNF A;  1XL6 A;  1M56 C;  3E8B A;  3H80 A;  1H7U A;  4CWQ A;  3A0R A;  1Z5B A;  2YKB A;  4XDM A;  2QM7 A;  3D2R A;  3CCU V;  5CTX A;  3B8M A;  3GIG A;  4WUD A;  4XIP A;  2BOB C;  1N8R W;  1FXK B;  2XCM A;  3OUS A;  1VQM V;  3BMY A;  4WFF A;  1K5Q A;  5H9C A;  2D3O W;  2DYR C;  3W7W A;  2QE7 G;  4P2Z A;  1NKD A;  3EFF K;  1KKD A;  3K79 A;  4PU9 A;  1YES A;  5CMU A;  3ZKD A;  3SPG A;  2XDL A;  4MSW C;  4PA6 A;  4L90 A;  5M4M A;  5FL7 G;  4J9Z B;  2XHX A;  4G28 B;  3EHG A;  4PDR A;  1OCC B;  1RPO A;  1SES A;  2Z5U A;  1THZ A;  2HFE C;  1K3E A;  1ZW9 A;  2BZ5 A;  5FNC A;  2QM8 A;  2YI0 A;  5CA3 A;  1YTF B;  4MP7 A;  4XIR A;  4R8C A;  2NLJ C;  5GW7 A;  3TZ4 A;  3I56 V;  2HKJ A;  5E1A C;  2JEU A;  2YE8 A;  3AG2 B;  3Q5L A;  4GX5 A;  3SYO A;  4DZY A;  4GEE A;  4CWP A;  3INX A;  3O2F A;  2IJJ A;  1YSZ A;  1AJ6 A;  2WI1 A;  2YEG A;  1AM1 A;  1AH6 A;  1OCO B;  4FPP A;  4MVU A;  2YKE A;  4PDV A;  4YKQ A;  1AJP A;  4G27 B;  3FB6 C;  4CZZ A;  2V7Q G;  2WI2 A;  2WLH A;  1KD1 W;  3M99 B;  3BY6 A;  3MD0 A;  4QE7 A;  1BL8 A;  4XIT A;  2B5U A;  2YEB A;  1J95 A;  3TET A;  3AG2 C;  1YIJ V;  1EA6 A;  1KP3 A;  1IXM A;  1VQ8 V;  1ZXN A;  1YT2 A;  3ZJZ A;  2YEI A;  5CTY A;  4CWS A;  3VHC A;  4XTJ A;  2X6A A;  4MVM A;  3WFV A;  1US7 A;  4FCR A;  4GT8 A;  2K5B A;  1GM9 A;  2WSS G;  4FCQ A;  4R7C A;  3SYA A;  4XD8 A;  4URO A;  3SPH A;  1OCC C;  5KUK A;  2XHT A;  4LC1 A;  3SPI A;  2ITD C;  4P30 A;  3BEH A;  2GSM B;  4LWI A;  3AG4 C;  2WLJ A;  2Q2E B;  1Y4U A;  1FFT B;  1PNL A;  4HXZ A;  1Y4S A;  4JQL A;  5BOC A;  3T0Z A;  2FTK A;  4YKW A;  5IDM A;  4RUE A;  3CCM V;  4L8Z A;  1FXK C;  1V55 B;  1YT0 A;  5LGU A;  4O07 A;  4E01 A;  1QVG U;  5BZB A;  2EIM C;  5M4P A;  4JGS A;  5IYB O;  3CRL A;  3R91 A;  3CYO A;  3OMA B;  2YKJ A;  1M56 B;  3QO8 A;  3KE6 A;  1K33 A;  5LHH A;  5EC1 C;  1OHH G;  3ABM C;  2BTZ A;  4YKU A;  1YJ9 V;  3T1K A;  3CCL V;  5IDJ A;  4LPB A;  1Y8O A;  3TTZ A;  1YC1 A;  1I5X A;  5B1A B;  1NR7 A;  3CP1 A;  2VCJ A;  2YKI A;  3R92 A;  1VQO V;  4V25 A;  2W0F C;  2GHY A;  1Y4M A;  4MPE A;  5F3K A;  1H2G A;  1QR9 A;  4MVR A;  4PDM A;  3T1C A;  3ZXO A;  3FT8 A;  1K9M W;  1MOF A;  4GFN A;  3ZMT A;  2CK3 G;  5J9P C;  3GB7 C;  3ZXQ A;  3DTU B;  3A0W A;  4ASF A;  3K98 A;  3QDD A;  1DTO A;  5IY5 B;  3FB5 C;  3ZRW B;  4MTF A;  3ABL B;  2JKI A;  1K4C C;  3ABU A;  4HYP A;  4AWQ A;  4URN A;  4CBC A;  4CWF A;  4XC0 A;  1CEZ A;  4PRX A;  4KSG A;  3O0I A;  2Q69 A;  4HYO A;  4WFB V;  2ITC C;  3AEI A;  5CBG A;  4YKZ A;  2YGE A;  2DQ3 A;  5M4N A;  4GT1 A;  4URM A;  2W6I G;  3EKR A;  2XJJ A;  4WCE V;  5CF0 A;  3A0T A;  4BAY A;  3EKO A;  2BOC C;  3JZ3 A;  4WFG A;  1UYC A;  3ASO B;  2BU5 A;  4LCU C;  2HJF C;  2HG1 A;  3HEK A;  2Q6A A;  3QNE A;  4LBE C;  2EZO A;  1ORQ C;  2BU8 A;  2XDK A;  2YJW A;  3VAD A;  4BQG A;  1P4R A;  1Y8P A;  2ZD9 A;  2XX2 A;  4GX0 A;  3R65 A;  5LGT A;  3GWO A;  5B1B C;  4HAM A;  3CC7 V;  2YK9 A;  4YKY A;  2IJK A;  4XDK A;  1ROP A;  1FS0 G;  1V54 C;  3ZMU A;  5HFM A;  1Z5C A;  3G7B A;  1OSF A;  4HYM A;  1KP2 A;  1JCH A;  4TT3 G;  1NVP B;  4B7P A;  1W0J G;  1RPR A;  4O05 A;  3E86 A;  3K08 A;  4N21 A;  3T10 A;  2HKO A;  4B6C A;  4H37 A;  1B63 A;  2JJ2 G;  2WEP A;  2YEH A;  4O0B A;  1GKF A;  2IU0 A;  3UM7 A;  1UYK A;  2IWS A;  4R6Z A;  1R6N A;  4P9O A;  3STL C;  1EZJ A;  1I5B A;  1L0O A;  2XOK G;  4PRV A;  1PL0 A;  2IJI A;  1UY8 A;  3NMQ A;  3P30 A;  3A0Y A;  4CWN A;  1S14 A;  2EXL A;  2YK2 A;  1TC0 A;  4UVA A;  5LGN A;  3HHU A;  3LSQ A;  1F51 A;  2AHY A;  3P32 A;  1SER A;  3O6O A;  4BQJ A;  2FXS A;  3F5W C;  4MTO A;  4MVO A;  5IN9 A;  2QA4 V;  2YE7 A;  3LPS A;  3QTF A;  4Z1M G;  2EIN C;  1AI4 A;  2JEX A;  2LP7 A;  2XAS A;  2YEE A;  3OW6 A;  5B1N A;  1S76 D;  4NH8 A;  1PKX A;  1YIT V;  1UY9 A;  3X2Q B;  4LWH A;  1OZ0 A;  2F43 G;  1GM7 A;  1LNQ A;  2R9R B;  3RVZ A;  1UY7 A;  4WUC A;  3B24 A;  4NH9 A;  3DGE A;  1I59 A;  1Z5A A;  3B28 A;  1NQT A;  2Q8F A;  4L93 A;  4URL A;  4ZBM A;  3FYE B;  1UYI A;  4R1F A;  4GX2 A;  5D7R A;  2YGF A;  2MK3 A;  3ETD A;  2HLD G;  2EIL C;  2XDS A;  2Q8I A;  1YI2 V;  3SL2 A;  3E2E A;  2YKC A;  4U93 A;  2WLL B;  4HZ3 A;  1NHJ A;  4H33 A;  4UVB A;  5IYD O;  3ZIA G;  3CC2 V;  2QFO A;  2XDX A;  2YE3 A;  4O09 A;  2Y69 C;  3AG1 C;  1JVM A;  5D7C A;  1I5D A;  5HFL A;  3E83 A;  1OCR B;  4MP2 A;  1RM1 C;  4MVQ A;  2XX4 A;  4FK5 C;  3ZRW A;  2O1V A;  3EHH A;  1M57 B;  3AG3 B;  3K06 A;  1BHB A;  2HR3 A;  3ABK B;  3ZN0 A;  2XD6 A;  2QTO A;  2XHR A;  4UV9 A;  4H81 A;  1PNM A;  2BSM A;  4P9P A;  3K97 A;  4XCJ A;  3B77 A;  3JCZ A;  2P90 A;  4H7Q A;  1MX0 A;  5M4K A;  2WI4 A;  2YJX A;  4WFA V;  3PJS K;  3T2S A;  3JD4 A;  1YC3 A;  3T4Z A;  1NH2 B;  4I3H A;  3U67 A;  1Q82 W;  2P67 A;  1SZT A;  1NVP D;  3JYC A;  3W7S A;  2XJX A;  2A9H A;  1EBO A;  5B1O A;  4HZ0 A;  2XX5 A;  2JJC A;  4MBC A;  3OEE G;  2C2A A;  3D3I A;  4CWT A;  1FXH A;  1M9N A;  1R73 A;  2OCC C;  2CCU A;  2PI5 A;  2ZQM A;  2WEQ A;  4GCZ A;  1QLE C;  3OWD A;  2WLI A;  2OTL V;  2IW5 A;  2ZR3 A;  3NXS A;  3TCU A;  4EFT A;  1I5Y A;  1NHI A;  1Y66 A;  2BRC A;  5EK0 A;  4K4O A;  4J9Y B;  3OGC C;  1Z59 A;  5KUM A;  4KQV A;  3K0D A;  1YC4 A;  2IWU A;  4L91 A;  3LDD A;  5EC2 C;  4HY1 A;  1M1K W;  1BMF G;  4GX1 A;  1YER A;  1SRY A;  4JYC A;  3T0H A;  1NBM G;  3VBB A;  2KB1 A;  1H8E G;  2ESA A;  3TZ5 A;  3JD1 A;  3ZMV A;  3SYC A;  2P6J A;  1R3I C;  4EFU A;  2CGF A;  4JPR A;  1W2B U;  2CCS A;  2EJR A;  5EBW C;  3MNR P;  4MOT A;  2X0L A;  1NJI W;  1PNK A;  1JX9 A;  2DYS C;  2IH3 C;  3D36 A;  1Q7Y W;  2EIK C;  1ID0 A;  3SYQ A;  5B3S C;  2ZDY A;  3IED A;  4O04 A;  1S77 D;  3IFX A;  4PA9 A;  1E1R G;  3OAA G;  3K03 A;  1UYE A;  3HB3 B;  4X88 A;  1YJN V;  1MAB G;  1BGQ A;  1UY6 A;  3CCR V;  3OMI B;  3B25 A;  4WFE A;  3CCJ V;  1UYF A;  2YED A;  2PNR A;  4L87 A;  3WG7 B;  3ABK C;  3W7X A;  4EMV A;  1VQ6 V;  2EIJ C;  5FND A;  4BIU A;  4RUF A;  1VQP V;  4R3A A;  3CME V;  4ASB A;  3MHS C;  4TWK A;  1R3K C;  3OFN G;  4LP8 A;  1VQL V;  1RM1 B;  1H38 A;  2WER A;  2WLL A;  3T2M A;  3HZ1 A;  4HXW A;  4MPC A;  5CN0 A;  1VQ5 V;  1XL4 A;  3AG1 B;  1UYD A;  2Y69 B;  2XDU A;  2BU2 A;  3A0X A;  1UYG A;  2YGA A;  2B1G A;  1OCZ C;  2YI5 A;  4QJF B;  3ML0 A;  1CPY A;  1AMW A;  3Q5K A;  1H8H G;  2ZXW C;  4RQF A;  2AKP A;  3ASN C;  2BT0 A;  2EIL B;  3HPL C;  4MPN A;  2JK5 C;  3ZRS A;  3CD6 V;  4RAI A;  1UYM A;  4RQE A;  2YE5 A;  3JD0 A;  3LUT B;  3WHA A;  4JTD B;  1KZN A;  2IOQ A;  2H8M A;  1QR8 A;  3F7V C;  4PDL A;  2Y48 A;  3K04 A;  1VQ9 V;  1YS3 A;  2P7T C;  4LP0 A;  1GM8 A;  5DM6 V;  5D7D A;  4V26 A;  3LSS A;  4XKK A;  3U2K A;  2BYI A;  1QY8 A;  2IOP A;  4AS9 A;  4ZKI A;  2XAB A;  5LBQ A;  3PEJ A;  1U2O A;  3RLR A;  3CPW U;  2IJH A;  3G6E V;  4EGK A;  4R3M A;  2EIN B;  4JAU A;  1VQ7 V;  4EEH A;  1ZWI C;  3ASN B;  1Q81 W;  2BYH A;  2ZXW B;  4XBF A;  3QO5 A;  5L3E A;  1JPX A;  2QF6 A;  4E02 A;  2H94 A;  3ZMZ A;  1OCZ B;  1UYH A;  1HWY A;  3Q5J A;  4GGL A;  3CGZ A;  4ZVI A;  5J6A A;  3ZCC A;  4MW8 A;  2DWE C;  2XK2 A;  4BAE A;  3JD3 A;  3C11 A;  1YSC A;  1ZWH A;  1QZR A;  2O1W A;  2YEA A;  3IGA C;  2XAF A;  4P7A A;  3OR6 C;  1PD3 A;  2YEC A;  3D0B A;  3OUF A;  5H6R A;  1L1F A;  5C93 A;  1K97 A;  2EIJ B;  1AR1 B;  2YE6 A;  4EM7 A;  3WG7 C;  4OXS A;  3G75 A;  2AHZ A;  2JIZ G;  3STZ C;  1F4N A;  4ASU G;  4UV8 A;  1E1Q G;  2M7W A;  1R3L C;  2WLI B;  2Q8G A;  1QBZ A;  1S3J A;  4CE2 A;  1U0Z A;  1FXV A;  3CRK A;  2XAJ A;  1EFR G;  4X89 A;  3B27 A;  3FKS G;  5B3S B;  4KSH A;  2EIK B;  1F23 A;  4KFM A;  4MVZ A;  2DYS B;  5L3B A;  3U2D A;  4QPJ A;  3OW2 U;  3FB7 C;  1B62 A;  4FIP C;  4MTG A;  1V54 B;  1W0K G;  1BHA A;  1R62 A;  3EHJ A;  4ASG A;  3OPD A;  2B1I A;  4GQT A;  5B1B B;  1KEC A;  3ZMS A;  1B3Q A;  2WI5 A;  2YI7 A;  4JF3 A;  4U7O A;  4AWO A;  3GIE A;  2CG9 A;  3FYI B;  4N23 A;  2IWX A;  4P8O A;  3CWV A;  2ATK C;  2V1D A;  2CH4 A;  2WLM A;  4BXI A;  1QVF U;  3EHB B;  3RW0 A;  4BW5 A;  2FWY A;  4JTA B;  3RLQ A;  4UUJ C;  2WAM A;  5CBF A;  1EI1 A;  2ZKJ A;  3ZN1 A;  1YSR A;  5F5R A;  5L3D A;  1BXD A;  2Q68 A;  2A0L A;  1VQK V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...