3DGEA

Structure of a histidine kinase-response regulator complex reveals insights into two-component signaling and a novel cis-autophosphorylation mechanism
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
237
structure length
237
Chain Sequence
KRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insight into Partner Specificity and Phosphoryl Transfer in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
molecule keywords Sensor protein
total genus 69
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3dgeA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3dgeA02
4ZKIA 4PU9A 1YSRA 1U0ZA 3ZRVA 3BMYA 3B24A 4JASA 2BU6A 3MNRP 2XHRA 3RLRA 5F5RA 2YI0A 3H80A 2JJCA 2EXLA 2WWWA 4B6CA 3EHHA 3A0WA 3SL2A 1Z5AA 3G7BA 3CRLA 3PEJA 2BREA 4HYPA 4FCRA 1UYCA 1UY7A 1KIJA 1H7SA 4CE2A 4R1FA 5CTWA 3FV5A 2IOPA 3HZ1A 4KQVA 2QG2A 4CWRA 4U7OA 3KE6A 4MOTA 1I5AA 2YEFA 4MP2A 4FCQA 3K97A 4UROA 2YE9A 2BU8A 1Z5BA 3A0XA 4QPJA 4HY1A 3R4OA 2XK2A 4HZ0A 5M4KA 5CTUA 4U7NA 3CGYA 3OMUA 3K99A 2XCMA 2QF6A 1Y8PA 2Q2EB 4DUHA 1PVGA 3Q5LA 3RLQA 2YKBA 2YEJA 4EMVA 1B63A 4CE3A 4JAVA 4KSHA 1THNA 2YE8A 4E01A 3K98A 1GJVA 4GFNA 3OW6A 5FNDA 1YC3A 5B1NA 2WI5A 3DGEA 1ZXMA 1I59A 4H7QA 2O1VA 4E02A 4MTXA 4FMTA 2YKJA 3GIFA 4X9LA 1Z59A 2C2AA 3ZKDA 3B26A 1Y8OA 1UYGA 2YK9A 5F3KA 1Y4UA 2XJGA 1TH8A 2XX2A 3O2FA 5M4HA 2BT0A 3R4MA 3MD0A 4BIUA 1TC0A 3T1KA 4EGKA 4V25A 2BYIA 4MBCA 1AH8A 3ZM7A 4L91A 1YERA 2IWSA 1U2OA 1NHHA 2YE2A 2YKCA 4ZVIA 1YSZA 2QFOA 2YJXA 4YKUA 5CPHA 1H7UA 3Q5KA 4CWQA 3U2KA 3INXA 3A0YA 3EHGA 1AH6A 1UY6A 4GQTA 2XJJA 2YE3A 2BZ5A 4YKYA 1UY9A 1L0OA 4NH8A 4B7PA 4MP7A 3C0EA 5D7RA 4JYBA 3VHCA 3ZXOA 3CWVA 1R62A 1YT2A 4AS9A 2VCIA 4H81A 3D36A 3ZRWB 4FCPA 5CTXA 4LWGA 2GFDA 4YKZA 4GCZA 1NHJA 2YE4A 1GKXA 2XD6A 2YE7A 4O09A 2LFSA 4XITA 4XTJA 3T2SA 1US7A 2WI4A 4PL9A 2YE6A 4XKAA 5FNFA 4MB9A 3P32A 2HCHA 3EKRA 2WI3A 3VHAA 1YT0A 4HYMA 4EGHA 1TILA 5M4NA 1ZW9A 5IDMA 2WI7A 1I58A 4LWIA 1EI1A 3G7EA 1UYKA 2YGFA 1QY8A 1F51A 3NXSA 2P67A 4KTNA 2CGFA 3IEDA 4HY6A 2YE5A 3H4LA 1IXMA 3QDDA 4CWPA 3EKOA 1EA6A 3GIGB 1BKNA 2XHXA 3B28A 2ZBKB 5B1OA 3TZ0A 3ZRWA 4O0BA 3A0RA 4URLA 4NH9A 3FT8A 5FNCA 4CE1A 2QM7A 4BIZA 4WUDA 1YC1A 4PRVA 4ASBA 2O1UA 3CGZA 2YI5A 4URNA 4BQGA 1UY8A 3GIGA 3HEKA 4WUBA 2UWDA 4KP4A 1NHIA 1ID0A 2CG9A 2YEBA 2XX4A 4NH7A 1MU5A 5M4PA 1S16A 2YGEA 2O1WA 4AWQA 3T0ZA 4XKOA 2XHTA 4R3MA 5BOCA 3VHDA 1BGQA 4LP0A 1MX0A 1B62A 3HZ5A 1AM1A 4ASAA 2ZDXA 4XC0A 1KZNA 3QTFA 4L90A 1ZXNA 5D6QA 2IWXA 2Q8GA 4DZYA 4HZ5A 4P8OA 4CWFA 3OWBA 2VCJA 3TK1A 5M4EA 4EEHA 2Q8IA 1GKZA 4MPNA 1QZRA 2Q8HA 2FXSA 5GGZA 3R92A 4I3HA 1TBWA 4CWNA 2YI6A 2BSMA 5M4MA 4GT8A 2YJWA 4PRXA 4R3AA 3Q5JA 4XD8A 1I5CA 1QYEA 3ZRXA 4MPEA 2XDLA 3FT5A 1AJ6A 1Z5CA 3EHJA 1Y8NA 1BXDA 3NMQA 3WHAA 2WI2A 3B25A 1AMWA 3A0TA 4XIRA 4U93A 2QM8A 4CWSA 1UYFA 2XJXA 4O07A 4O05A 3VADA 3EHFA 2ZDYA 3RKZA 2K5BA 3T10A 5CF0A 4JQLA 2WI6A 4KSGA 4MT8A 2BU5A 2CH4A 1A4HA 3TZ4A 3BM9A 2WI1A 1YESA 4YKWA 4XIPA 2XDUA 3D0BA 4CWOA 4ASFA 3TZ2A 4XCLA 2YECA 4EFUA 4I5SA 4URMA 2YGAA 4AWPA 4EFTA 1UYMA 3RLPA 4XE2A 2CCUA 2ZKJA 2H55A 3LPSA 4BXIA 3HYZA 4EGIA 1UYIA 2CCTA 1I5BA 3O0IA 2BYHA 3K60A 2BTZA 4E00A 4GGLA 4O04A 5L3JA 3TZ5A 2FYPA 2QG0A 2XDKA 4HXWA 3OPDA 2E0AA 2YKIA 2HG1A 2YEDA 4L8ZA 2WEQA 4W7TA 4AWOA 1I5DA 2YEIA 4FPPA 1JM6A 4XDMA 2BRCA 4LPBA 3WQ9A 3ZXQA 4MPCA 2XX5A 2FWYA 4V26A 2IORA 4KFGA 1S14A 3D2RA 2LFRA 5J6AA 5FWKA 1Y4SA 4H85A 3U67A 4XKKA 3CRKA 4QPKA 2ESAA 2PNRA 3INWA 2Q8FA 3ZKBA 3U2DA 2XDSA 2YKEA 1UYLA 3PEHA 1YC4A 2VWCA 3B27A 2YI7A 2WERA 1YETA 1BYQA 2YEEA 4WUCA 2YEAA 4HXZA 4CWTA 4YKRA 3ZCCA 1B3QA 3A0ZA 2WEPA 3R4PA 3T0HA 2IWUA 2VW5A 3GIEA 4ASGA 3G75A 5J71A 4L94A 3OWDA 1ZWHA 3C11A 5D7DA 4JYCA 4LWEA 2H8MA 5IDJA 2GQPA 5D7CA 4EM7A 2CCSA 4Q20A 4YKQA 4GT1A 4XIQA 4BAEA 4L93A 2JKIA 3O6OA 1TIDA 2XABA 5CTYA 4YKTA 4YKXA 1YT1A 3HHUA 1OSFA 3LNUA 1JOYA 2YEHA 1TC6A 3R91A 2XDXA 4XCJA 1UYEA 3HYYA 5BODA 3TUHA 2FWZA 1YS3A 5C93A 2HKJA 4P7AA 2AKPA 5IN9A 2YK2A 4K4OA 4LWHA 3R4NA 5D6PA 4LC1A 4LWFA 2YEGA 2FTKA 4JAUA 4BQJA 1UYHA 2IOQA 4GEEA 3TTZA 2BU2A 1UYDA 2BU7A 3JZ3A
chains in the Genus database with same CATH superfamily
4TV9B 4PU9A 5DEDA 1OCZB 2CDYA 1K4DC 4JASA 2KG7B 2QM4A 2YI0A 4CZZA 2A0LA 4CC5A 4DR2B 1XHXA 3ETQA 1Z5AA 1H2MA 3E8GA 5JJNB 5A9GA 3RYHA 1OCOB 2EIJB 5H9CA 1KKDA 3HKDA 3HZ1A 2P7TC 4KQVA 1BE3H 4X64B 4UCOA 3OMNB 4MTOA 4JI4B 2VS0A 2Y69B 4MOTA 3FX7A 1I5AA 4MP2A 4WFAV 2HJFC 1VIBA 2YE9A 3LDEA 2IU0A 1P49A 2F95B 1V9PA 4QPJA 5H6QA 4MTGA 3FYEB 5BXZA 4CS3A 4DR1O 1KU9A 1YJNV 4WCEV 4EEQA 2P22C 5CTUA 3OMUA 4B3MO 4JYAB 4LNUA 1Y8PA 5EBMC 4DUHA 1G4YB 3K04A 2KG7A 5CA0A 5CA1B 2DJVA 4Z1VA 3U10A 2QSAA 3SYPA 2CTPA 2YUAA 4D7TA 3HB3B 1EN6A 2XUMA 1GJVA 2CGOA 2ZE6A 3OW6A 2Q73A 3CC2V 2L6LA 2WI5A 2E75B 1OV9A 2LGQA 1DK1A 3JARA 1F7YA 4MTXA 1G8MA 2XOKG 4FMTA 3GIFA 4DRXB 1GKFA 4CH5A 1K5SA 3QG5A 1MA1A 2C2AA 2Q68A 1FJGB 1HR0B 4J80A 4PJ0Z 2VQFO 3L74H 2W0XA 2XJGA 2ZINA 2LO1A 3R4MA 1TC0A 3T1KA 4EGKA 1GN3A 2G38A 3FYIB 1S77D 2BYIA 4V25A 3E8BA 3ABUA 4BIOA 4J9ZB 1U2OA 2IWSA 1IX9A 1DF5A 4DV7B 2YE2A 1G6UA 2OIEA 1YEWA 3ZMSA 1M57B 5KAIZ 1Y6XA 2QFOA 5LP6C 1E1QG 1BQZA 2UUAB 3Q5KA 3DTUB 1WLEA 3EHGA 2ZIOA 3AG2C 3N2KA 5GW7A 3SJBC 3ZHSA 3KG2A 2N05A 4FFBB 2X0LA 5D5PA 3JD4A 4HZ3A 2CAZC 3SPGA 4TWKA 3ASOB 3CCQV 1I08A 4LF4B 3ABKB 4WFGA 4DXWA 4TV8B 5D7RA 2EJ7A 2ZNJA 4GZRB 3UO3A 3CWVA 1R62A 2Q69A 3D36A 4FCPA 3E83A 3QTCA 5KHKA 4GCZA 1WP8A 2HVJC 2WA3A 2XD6A 3OTOB 1SQGA 4O09A 1AR4A 2XAHA 4XITA 4ICGA 4A5UB 1X4TA 4YJ3A 2Q7EA 4BR6A 5FNFA 5EC2C 2HCHA 4LCUC 2RJZA 1MZFA 2YDEA 4HYMA 2VWKA 1MZEA 3RW0A 1NI8A 5M4NA 5IWAO 4UXNA 1ZW9A 1KP3A 4H13B 1EI1A 4NVPA 3SPCA 3OW2U 4DV0O 5IYCO 1QY8A 1F51A 4DK1A 4FLVA 1OCCC 3K08A 1XILA 5KHHA 4UUJC 1F23A 1AB3A 2UXNA 4ZOLA 2YE5A 1BQ0A 3ZN0A 1US6A 5H6RA 4CWPA 4RO2A 1K92A 3GIGB 3G71V 1SZTA 3CCMV 4AI8A 4URLA 4NH9A 4CE1A 4JZ2A 5L3EA 1YC1A 4PRVA 4ASBA 3OUFA 3CGZA 5LGNA 1PM9A 4URNA 3CCVV 1R73A 1HNZO 4B3SB 5FL7G 3BABA 4DR3B 2B9ZA 1S5LZ 5TISZ 2E5LO 3VQXA 2YEBA 4NH7A 2XAFA 2IJKA 1MU5A 1TAEA 3EHBB 3KZIZ 2M6YA 5EIBC 1QR8A 4XKOA 2XHTA 5BOCA 1VQLV 2ZD9A 4PI2A 4IYIA 1BT8A 1B6QA 4ASAA 1SKVA 3OTFA 4O2AB 1KZNA 2NNUA 1ZXNA 2Q8GA 3TXQA 2H8PC 4GLXA 1ZLZA 4CWFA 4TQDA 3TK1A 4EEHA 4X89A 2Q8IA 3W7WA 2IH1C 3KKYA 3WB0A 2C1IA 2N74A 4I3HA 4GT8A 2YJWA 4R3AA 3Q5JA 2VWJA 4DR2O 4FJCC 2AHYA 5GTHZ 3ZRXA 4UVCA 3TGUH 2JIZG 3H1JH 3BA8A 1BGYH 3K06A 1HDJA 3VQVA 3L72H 3JARB 1Y8NA 3RVZA 3WHAA 1FAFA 3A0TA 4XIRA 3ETGA 1P7BA 1R3IC 1DF4A 3THOA 3K0GA 1XI1A 2R9RB 4JI1B 2WAMA 4KHPB 1BS3A 4O05A 3TXSA 3VADA 1IBLB 1H2KA 2VRZA 4NB5A 2ZDYA 4TSFG 1XNQO 3CC4V 3T10A 1TUEB 2Z0AA 5CF0A 3CX5F 4JQLA 3ML0A 3E89A 4LH7A 3JAWB 1A4HA 1VMGA 3BM9A 4JV5O 1GK9A 2EIMC 3AG1B 4Z1MG 4XDKA 2XDUA 3D0BA 2FKXA 4JI0B 3QF7A 4NXMB 1HP8A 5IE9A 4RQFA 1YSCA 2WLJA 1UYMA 1N34O 4XE2A 2F1MA 2H55A 5A2QN 4BXIA 3B2EE 5B1AB 1YJWV 1I5BA 3W7TA 3CYGA 4MVZA 5FNVA 4PELA 1OCZC 5L3JA 3JD1A 2BE3A 2F43G 1FFTB 1Z5VA 2YIAA 2QA4V 3T1YB 2QG0A 1NBMG 4NTYA 1FXKB 3EXAA 1VF5B 1Y76B 3F7YC 1P7GA 3M99B 4AWOA 1I5DA 5LYJB 1Q81W 5CB4A 4O2BA 3ZRSA 4FPPA 2A79B 4HAMA 3JAKA 4LPBA 4B7KA 4YY3O 2R70A 3RN4A 2FWYA 1M93A 1KQSU 3T4DA 4NXMO 2Z5UA 4KFGA 4O4JA 3D2RA 2LFRA 5IYBO 3U67A 4LR3A 1D5NA 4H85A 4QPKA 5KA6A 3RYIB 2L35A 2Q7GA 1KB9F 2ADQB 3C3TA 1UYLA 2Y0IA 1YC4A 4GKJO 1YETA 1RP3B 1D5AA 4OX9O 2YEAA 2KB1A 1UFIA 4HXZA 2HHHB 2YC0A 4YKRA 3OFNG 2YI9A 4F6RA 1B3QA 3OD4A 2WEPA 4WBNA 2JDIG 2IWUA 2X7RB 3TCUA 3OWDA 1Y76A 1HNWO 3SJAC 1R6NA 5D7DA 3JATA 2UXBB 1H2LA 5IDJA 4JI6B 2HHHO 2H3OA 4L93A 2FB5A 3O6OA 4FLYA 1KD1W 2R72A 4YIOA 5CTYA 4UFZA 2GUZB 2YEHA 5C8YB 1TC6A 4OGQB 2ZDIA 2JS5A 1J95A 4DUYB 1DGSA 3LUTB 4R50A 3UT5A 1K97A 1ZWIC 4O2AA 4UCSA 3EVKA 3W7SA 4DV5B 3L70H 2AKPA 4PA6A 1K4CC 5JENA 4K4OA 1I5YA 4LC1A 4X1YA 3Q4HA 4UB6Z 4B3TO 3WU2Z 1UYHA 4LFCB 4ZHQB 3B09A 2UUAO 3C90A 4I55B 1UYDA 1SERA 2HHIA 3B24A 2W6JG 2BU6A 2XHRA 1S76D 1OCCB 3CMAV 4K8XA 2JJCA 2EXLA 2WWWA 1SF9A 3A0WA 4B3SO 3FB6C 5KHJA 4G2KA 2AZ2A 1TA8A 3F7VC 1UYCA 2D3OW 4GX5A 3BVOA 4DV5O 1AR1B 4I0XA 3LSQA 1H38A 4PA4A 2EIJC 5BR8O 1D2DA 3FB5C 2QWOB 2IOPA 3FD9A 4J42A 4CBCA 2QR4A 4MW8A 4D7SA 4IHJB 4DV2O 2YEFA 3SPJA 4FCQA 4CH6A 3B8NA 4QE9A 4ZIBA 4I9WA 5CA0B 1Z5BA 2BTQA 3JASB 3A0XA 1IVSA 4ZHQA 1K3EA 4DR6B 3BAAA 5M4KA 4U7NA 1PD3A 1XNRO 2XCMA 3WG7C 3S3WA 4LWSB 3E8HA 4X88A 3AEIA 5B3SC 2YKBA 3H01A 4EMVA 4JAVA 4DRXA 1ENVA 4BWAA 2OTJV 2YE8A 3K98A 5CN0A 4DR3O 4LNUB 5FNDA 1W2BU 4P9PA 1XDCA 2GDSA 3DGEA 3QO8A 1EM1A 5L3CA 1M5IA 4JI3B 3ZHUA 1S0VA 1IURA 2YKJA 3R65A 1QVGU 4X9LA 3CE2A 3NR7A 5IYZA 4MVRA 3S5TA 3JSNA 1GH6A 1UYGA 2YK9A 1YXBA 4YXWG 1BZKA 5M4HA 1XBLA 2BT0A 3MD0A 1OHHG 2Y0PA 5CA3A 4PD4F 3CCEV 2ITCC 3K57A 2CTRA 1KP2A 4KHPO 4MBCA 1AH8A 3ASNC 2LJ2A 3ICXA 5J9PC 2PF4E 2EILC 1ZTEA 2D2CB 4FM1A 1NHHA 3G6BA 5LOVB 1YSZA 3GWOA 1XMOO 2YJXA 4YKUA 1TVKA 4IT5A 1FXHA 5K1PA 5FPOA 4GQTA 3HKBA 2XJJA 2YE3A 2JRIA 1VQ6V 2BZ5A 4UVBA 2F23A 4UCUA 5KMGA 3SJCC 5JQGB 4JZGA 2V1DA 4I50A 5IY5C 2OWOA 1Q43A 1MSDA 1SQFA 4WF9V 4B7PA 2ZDIC 4GKKO 3C0EA 3X2QB 2QKCA 1GM8A 4PA3A 2PY5A 1S3JA 4MSWC 3ZXOA 4J7ZA 3W7UA 3CCRV 2H94A 1YJ9V 4LF9B 2DQ3A 2VCIA 4H81A 1NTMH 5E1AC 4YJ3B 5CTXA 4LFAO 2GFDA 1SQQH 2QWQB 5H5NA 2EJRA 1NHJA 1LR1A 2OYQA 2LFSA 3T2SA 2A9HA 4PL9A 3IFXA 4MVOA 2XASA 4DV3O 4XKAA 4FK5C 3APOA 2E3CA 2WLMA 2WI3A 2PTMA 1JR9A 3A0HZ 1YT0A 3IJ4A 4KFMA 3E22B 4JI7B 4X64O 2Q9LA 2VQEB 2WI7A 4DR7O 4ZI7A 3T4ZA 5LMUB 4DK0A 1UYKA 4JI1O 3OMIB 1BMFG 5JQGA 4LBEC 3I5DA 2PUSA 3LMMA 4I50B 3G80A 2CGFA 3IEDA 5EK0A 4LFAB 1SRYA 5LHIA 1EA6A 1BKNA 4FLUA 1NKDA 4R8CA 4WFBV 2QM7A 2QEXV 3CJHB 3CS5A 3PJSK 3OE7G 2O1UA 1N36B 1F4NA 1M1KW 2YI5A 4BQGA 3QO7A 2ZXWC 3GIGA 1PKXA 1IBMB 4KP4A 4LF4O 1ID0A 4NTWA 4H0LB 2CG9A 2Y4UA 3P3NA 1FS0G 4AWQA 1PL4A 1QNMA 5LYJA 2YIBA 1ZSPA 2XNDG 1IXBA 2K1EA 2QKSA 4ZI7B 3HZ5A 1RSOA 1JJ2U 5D6QA 1L0NH 1NU1H 3LDCA 3QVNA 1ZL8B 3RT3C 4GUNA 3UKMA 1V55B 1M57C 2PYJA 4DR6O 3TJTA 2EILB 2FXSA 5GGZA 3R92A 3GB7C 4DV1O 3M7MX 1VQOV 1TBWA 1R6TA 2HEPA 2P4VA 3X2QC 4B3TB 4PRXA 3FB8C 3KCXA 3HKEB 4O4IA 3SJQC 1YHQV 1I5CA 1VQMV 1YF2A 5LBQA 4J10A 4PDRA 2XDLA 1PP9H 1H8HG 4LF5O 5LGUA 1AJ6A 3ABTA 2QWRB 1FYJA 5IYZB 3CB2A 2LQTA 3SYCA 1NS1A 4CWSA 1GRJA 1UYFA 4IIJB 4X1IA 3EHFA 1VQ8V 1HNZB 2HJDA 1QLEC 3CEIA 3FFQA 1B04A 3CRQA 3RYFA 3CYOA 2YEVA 2CK3G 4KSGA 3MHSC 1AP5A 4O4HB 2DMXA 1XMQB 5LOVA 1YESA 2YXHA 4LF7B 1NJIW 3OMAB 4CWOA 3AK3A 2WSSG 4X1YB 2YECA 4URMA 1Q6IA 4EFTA 4J7JA 2CCUA 1PL0A 3P30A 4EGIA 1LNQA 5CBFA 1SC5B 4DV6B 4JI6O 1NH2D 4IYHA 2Y48A 4FLZA 3OR7C 3IC7A 2EULA 1I5XA 2B1GA 2XDKA 2PI4A 2AW9A 2JJ1G 2JJ2G 4QJFB 4Z2WA 4L8ZA 2Q0OC 2WEQA 3ABMC 1WA8A 2E76B 4W7TA 5KA5A 2YEIA 3ZBHA 1PNLA 3OUSA 3FKSG 4XDMA 3RYIA 4E4EA 2BRCA 3ZXQA 5DN6G 3ZMTA 2UUBO 3DC5A 2WPDG 2ZE8A 3STZC 1VQKV 1BHAA 5J6AA 4LFCO 5FWKA 2ZE5A 3S3XA 1OCRB 5CB4B 2KSDA 2IJIA 2NR5A 2QE7G 3UM7A 1R3LC 4DV3B 1WB8A 3INWA 2Q8FA 1WB7A 2BTQB 3UO2A 4X65O 3U2DA 2B5UA 1Q6UA 3VOUA 4LFBO 4EKWA 4X66B 3K5MA 4QIWF 1BYQA 2QKAA 4R6ZA 2YEEA 5LHHA 5LA6B 3MAQA 5CBGA 4XBFA 2GHYA 4CWTA 1SQXH 2Q4PA 2OCCB 1QLNA 2CUGA 3N2GA 3A2FA 3A0ZA 3R4PA 1JQ0A 1R3JC 3T0HA 2VW5A 2Q6AA 1XNQB 5J71A 1K8AW 3OEEG 1CXZB 3C11A 1DLBA 4DV1B 2JEUA 4LWEA 2Q5ZA 4W4KA 5D7CA 2HVKC 3TETA 4EM7A 2JS3A 4YKQA 4O4LA 4XIQA 1FKAO 3ZMVA 4BAEA 5LP6B 4H33A 1COWG 1M56B 3N27A 4YKTA 4WFEA 5GONA 4DV4O 2F93B 1YT1A 4P30A 1UYEA 3HYYA 3QO5A 1QVFU 4P7AA 5EYPB 1AILA 4FFKA 4LWHA 3R4NA 3ABMB 3BPZA 3VQWA 2QTSA 5LHGA 2YEGA 2FTKA 4JAUA 1DTOA 3N2GB 2YIBD 1CEZA 1SA0B 2Z3YA 4GEEA 1CPYA 3U11A 4ZKIA 1YTFD 2KKWA 1XMQO 4UV9A 1GN6A 3CRRA 1PNKA 3D3IA 3RYCB 4RQEA 5F5RA 1K7DA 5B5EZ 3WG7B 3ZEDA 2WLIB 4AQYB 1O9HA 4B6CA 2FMLA 3BHPA 4F6EA 2UU9B 3EHHA 3SL2A 2YI8A 4I55A 3PEJA 2DE0X 3ZHTA 1FFXA 2BREA 2BOBC 1HW7A 3OGCC 4YHHB 4FCRA 2HP8A 3LDDA 1SS3A 2ZR2A 1YZBA 1LUWA 2UXXA 5IY5B 4MVSA 5CTWA 1W59A 2M7WA 5KLVH 2X6AA 2HLDG 2ZIMA 1GM9A 4CWRA 3CXCU 4U7OA 1GTOA 4O4JB 2PZSA 1IBMO 3BY6A 2YXLA 2UUCB 3K97A 4L8JA 4UROA 4GKKB 3CCSV 1JVMA 4JI8O 2XK2A 3FAVB 4HZ0A 4X66O 3CCJV 3K99A 5KUKA 4IHJA 3E22A 3J80N 2WLHA 4IL6Z 2Q2EB 1V54C 4I9QA 2IJHA 3ASNB 1BCCH 3RLQA 1BHBA 4DV0B 1I94O 2UUCO 2YEJA 4TQFA 1QU7A 1YITV 4KSHA 1BSMA 3O9OA 2FL4A 3AG4C 5JVDB 4E01A 3OM3B 5LL6Y 3SYOA 4PDLA 4X20B 4GFNA 4MW3A 5H2FZ 4LWSA 1H2GA 2WLNA 5B1NA 1YC3A 1ZAUA 1W0KG 4KL1A 1VEWA 4BAYA 1ZXMA 1EN5A 1NR7A 3OTOO 2O1VA 4PA9A 2ETNA 4E72A 1Z59A 4DR4O 3B26A 2EIKB 3RBZA 3CD6V 1Q6HA 3ASOC 2DYRC 2GSMB 4KUMA 1TH8A 3SR2C 2ARHA 4JI7O 2XX2A 5IWAB 3OT7A 3SYQA 4JI3O 1XL6A 4LF9O 1KC8W 1N0NA 3HKBB 2UXDB 1YERA 4L91A 1LUVA 3JYCA 1QQCA 1FD9A 1K73W 3H1IH 1Y66A 5CA1A 3AG3B 2ZXWB 5BMVB 5CPHA 1H7UA 1PPJH 4G27B 5KAFZ 3U2KA 2RDCA 3INXA 1HNXO 2ATKC 4HNAB 1UY6A 4MVMA 2EZPA 2YSUB 3R66A 4CS4A 3WFVA 1NVPB 4YKYA 1UY9A 3D36C 4JI4O 1TVKB 2ADPA 3HKEA 3JCZA 1XOUA 1R6KA 4MP7A 4YHHO 1GMGA 4FVMA 2XAJA 4JYBA 3VHCA 4AILC 1WP7A 3K9AA 2JVDA 4GX1A 4JI8B 1YT2A 4J9YB 5KMGB 1FXKA 3ZRWB 1S5HC 3ZJZA 4LWGA 3E86A 5LP6A 1JFFB 2YE4A 1AI7A 1KKCA 5JCOC 3RWRD 5BY1A 4NTXA 4WFHA 2Y69C 1R1BA 1WJZA 4XTJA 2CTQA 1US7A 4W4LA 3JSLA 2YE6A 5K1XA 5L3BA 1XQ8A 1MABG 5EZYB 4MB9A 4FLTA 1N0JA 3RYFB 4UB8Z 4PI0A 1H8EG 4UCRA 1TILA 1E79G 4FLXA 1PNMA 5IDMA 3BEHA 3F5TA 4P2ZA 2YGFA 3P3PA 1H2NA 5E79Z 5JJEB 2P67A 5IJ0B 2ZM6O 4KTNA 2JEXA 1ZX3A 4UVAA 2CTWA 3MHHC 2YICA 3QDDA 2WLIA 4QE7A 3SDLA 4WBNB 3AG7A 2ZBKB 4KXRA 3ZX6A 3ZRWA 4DR7B 4O0BA 3STLC 1AJQA 3FT8A 4BIZA 4WUDA 2F4VO 5BR8B 2P06A 3JATB 4GX2A 3I56V 2ZKOA 4C7UA 1UY8A 3PN1A 1VQ7V 1S5JA 2ZR3A 4DV2B 1VP7A 4PDVA 4F4LA 4YIPA 2VQFB 4FZ1A 4H44B 3K3WA 5M4PA 1S16A 2YGEA 4X1KA 2XT9A 1J5EO 4GX0A 3VHDA 1WPBA 4YJ2B 5C8YA 4LP0A 2UXDO 1B62A 2OIGA 3K5OA 3KCYA 2ZDXA 1S72V 3QTFA 4L90A 1K5QA 3CRAA 5DM6V 2P6JA 5IJ0A 3OGIB 1QHTA 3OWBA 4ZOLB 2V4DA 1OCRC 4DR1B 1GKZA 1QZRA 4U3JB 3DXRB 4H37A 1JCHA 4JI5B 2YI6A 1U97A 1NR1A 4B7EA 2BSMA 3AG3C 4JTDB 3UCSC 3AG1C 5LA6A 4RUFA 1GO3F 5JVDA 4K8ZA 2Q8VA 2Q0AA 1WAZA 3CCUV 2LGWA 1N33O 5LMNB 2CGNA 4TUYA 1Z5CA 1FXVA 1BXDA 3NMQA 3RGBA 5F2VO 5KUMA 1NZ6A 2XTAA 4YY3B 1AMWA 5FNVB 1MOFA 4U93A 5J2TA 4DW0A 2QM8A 1TGOA 2XJXA 4O07A 3ABLB 1QBZA 3H1HH 1PV0A 3U0ZA 2UXCO 1V55C 1AJNA 1M56C 5GONB 2WI6A 2BSKA 2RN9A 3SPHA 4MT8A 3JAMN 2BU5A 4DUYO 1NT2B 3ZHQA 3HKCB 5ITZA 1VF6A 2UXBO 4UCTA 2HKOA 4GYCB 3CSXA 4D6TH 3D3QA 2QWNB 4RUEA 2CH7A 3JALA 3JCUZ 1WPXA 4JGSA 4EFEA 1Y67A 4QGPA 4I5SA 1Y74B 5IJ9A 5JJJB 1Q86W 3RLPA 1L0LH 2DN9A 2ZKJA 3ZMUA 4LH6A 3BCCH 2BYHA 4IGGA 2OT5A 4JAAA 4X65B 3I55V 4E00A 2AHZA 1WNSA 2F66C 3TZ5A 2FYPA 1FJGO 3SYAA 1OCOC 2QGNA 2HG1A 3ETDA 1NH2B 1JFFA 2PI5A 2X6BA 3MDSA 4HYOA 1NVPD 3G6EV 1AR5A 1MMMA 3WQ9A 2JGDB 4X9QA 3CC7V 2Y4TA 2IH3C 5EZYA 4FM0A 1Y4SA 1SETA 4XKKA 1ZL8A 4B08A 2IBZH 4J41A 3J81N 3IAYA 1Y74A 5IJ9B 1VQ4V 2AZ0A 4MS2A 1OJHA 4N21A 2YIDA 2XDSA 1V54B 4N23A 4B3MB 2VWCA 1QLEB 3B27A 4X8AA 3T1CA 2YI7A 4WUCA 4EB6A 5LXTA 2IU3A 3ZMZA 3JD2A 2DQ0A 1NTKH 1URFA 2HFEC 3GIEA 1Q3EA 4AHCA 4ASGA 1TUBA 4L94A 4B3RO 3D8CA 1SESA 4RAIA 4HBNA 5JCOA 4LP8A 1JA8A 4JYCA 2GQPA 4IIJA 4JTCB 2CCSA 4Q20A 5EBLC 2GV9A 2F4VB 4JI0O 3M8AA 5KX5B 1M90W 1U96A 5BZBA 1TIDA 3OR6C 4R7CA 3LNUA 3SPIA 1JOYA 3VBBA 4I0XB 5IT9N 3L71H 3CPWU 4L87A 4O4LB 3R91A 4JYAO 2XDXA 4XCJA 3TUHA 5C93A 5JH7A 5HFLA 3L73H 2YK2A 3IGAC 1SQPH 1Q8IA 1RM1B 1AI4A 4FLWA 3WB2A 4U3JA 1N34B 2HR3A 1IBKB 4XD8A 3LNNA 3JZ3A 1XREA 1YSRA 1U0ZA 4HNAA 3ZRVA 3BMYA 2NN4A 1RPOA 4JI2O 2OCHA 3MNRP 3RLRA 2GTSA 2RNBA 3H80A 1SA0A 5B1AC 3HKDB 3G7BA 3CRLA 1JMKC 2RMKB 3K5NA 4HYPA 4DW1A 1Y4MA 1UY7A 1KIJA 3LSSA 1MNGA 2XAQA 4BW9A 1H7SA 3K0DA 4CE2A 2JK5C 4R1FA 3RFRA 1HNWB 2EX3A 3FV5A 3W7XA 2QG2A 2VQEO 4FZ0A 1FFXB 3KE6A 1AROP 2MW2B 2RCVA 2QJ1A 2BSKB 3T2MA 5EIBD 4ASUG 2BU8A 1Z2GA 3ZS8C 4HY1A 3O65A 1YVWA 1N8RW 2LW1A 1GAXA 3R4OA 5EC1C 1YDXA 4DR5O 3CGYA 1VQPV 4J7KA 2QF6A 5J2UB 4E2LA 4K0KB 4X20A 1G1XB 2BCCH 4JV5B 1PVGA 3Q5LA 5KHGA 1I0HA 2P90A 3CCLV 1B63A 2O57A 1EN4A 4CE3A 2EINB 3UQ8A 1THNA 2W6IG 4O4IB 3OAAG 3CXHF 5B1BC 1FPOA 2DWEC 2P5OA 4K35A 4P9OA 1IBKO 1BL8A 1I59A 4H7QA 4NYKA 4E02A 4OPHA 4DUZB 4NXNB 3ZKDA 1Y8OA 4OPAA 1XMOB 5F3KA 1Y4UA 3JASA 1P84F 3O2FA 1YI2V 4BIUA 5BMVA 2LP7A 1KBHA 1IDSA 3J7AU 3AG2B 2YEVB 4LF8B 3L75H 3LSUA 2GTAA 3ZM7A 1N36O 2BTOA 2YKCA 4ZVIA 2RQ6A 2OCCC 5GTIZ 4CWQA 4I7ZB 3A0YA 5LMNO 1AH6A 4MVQA 3K79A 3B40A 4LF7O 2GBOA 2EZOA 3K59A 4F6RB 2C1GA 4JF3A 2ZQMA 2R9IA 1L0OA 4NH8A 1L1FA 3QNEA 2E74B 5B66Z 2PYLA 4XDLA 1N33B 3ZHRA 3CP1A 3EFFK 4AS9A 3BA9A 1M4UA 3A0BZ 4EFBA 4MVUA 4YKZA 3RVYA 3JD0A 1WA8B 4TT3G 1GKXA 2YE7A 4TV8A 1YCIA 2ZCEA 5LMUO 2X6CA 3T1HB 4DUZO 5CMUA 1QR9A 2WI4A 3H9VA 1HNXB 2DYRB 2ZM6B 4LF5B 3FAVA 3P32A 2P4KA 3EKRA 4LFBB 1IZ3A 5IYDO 3VHAA 4EGHA 3CMEV 5ITZB 4OXSA 4U3FH 2XHBA 1I58A 3CHXA 4LWIA 3G7EA 2HG5C 5AG2A 1J5EB 1SZXA 3AK1A 2MK3A 4QNHB 1NQTA 3ABLC 3NXSA 4PDMA 2QDOA 4JPRA 2Q67A 4DR4B 1ORQC 4HY6A 1JX9A 3H4LA 4PA7A 2EIMB 2QTOA 4BW5A 1IXMA 4UV8A 3EKOA 2ILMA 3B28A 2XHXA 1AJPA 1VQNV 5B1OA 5JWPA 3TZ0A 1KUQA 3A0RA 1O9GA 1WN7A 5FNCA 2Q7HA 2JGUA 3E2EA 1SQBH 3T1YO 4RWUA 4FM2A 1GN4A 2BOCC 2DYSC 2UU9O 1EBOA 3HEKA 4WUBA 3H1KH 3H1LH 4MTFA 1NHIA 2UWDA 3ETEA 2XX4A 4DV6O 3CRMA 4DYLA 4FIPC 2O1WA 1MSWD 3T0ZA 4R3MA 1FXKC 4LF6B 4DR5B 1BGQA 1K33A 1THZA 4GKJB 3JAKB 1MX0A 3HPLC 4X1IB 1AM1A 4UCVA 1A32A 1Q5OA 4XC0A 2YS8A 3CRCA 2IWXA 4DZYA 2OTLV 4HZ5A 2PGGA 4P8OA 1RM1C 2ITDC 1H2SB 4NKGB 5KHIA 5LGTA 5J2UA 2VCJA 5M4EA 3E35A 3N2KB 2WLKA 1ZUQA 4O4HA 4MPNA 4FFBA 4LF8O 2AGAA 4LF6O 2ZNIA 2Q8HA 4CWNA 1F4MA 2ZT9B 4JYYA 3VQYA 5M4MA 1L8DA 2EBOA 4TV9A 1XEQA 1Q7YW 3C3SA 2UUBB 3ABKC 3A8TA 2E5LB 3CJHA 1QYEA 3RYCA 4MPEA 3FT5A 1XUQA 4NXNO 3AK2A 1MG1A 3EHJA 2EIKC 2WI2A 3B25A 2R9AA 1HWYA 4AQYO 3RYHB 4OX9B 3K9SA 3BFRA 1Q82W 1KMIZ 3HKCA 5FPRA 2NLJC 1K9MW 4TUYB 1RSOB 1XL4A 1T5EA 2WLLB 3RKZA 2K5BA 1HR0O 3AG4B 5J2TB 4B3RB 2CE4A 2CH4A 3IC9A 3TZ4A 3DSQA 1VF7A 2WI1A 5L3FA 4YKWA 2AXTZ 4XIPA 3GWKC 4X62O 1ROPA 4ASFA 3DC6A 3TZ2A 1EZVH 4DV7O 4XCLA 5B3SB 1NTZH 4I4TA 4TOIA 4EFUA 3JAWA 1SQVH 3OEHG 5EBWC 2DOSA 2YGAA 4AWPA 1VQ9V 1Q90D 3LNMB 3WB1A 1RFYA 3L9DA 3LPSA 3HYZA 3K58A 1UYIA 2FYUH 2CCTA 3O0IA 3K60A 5B1BB 2BTZA 1N32B 1I94B 4GGLA 4O04A 2EINC 4O2BB 1UPGA 2A7WA 1K34A 4HXWA 1GM7A 1EFRG 3FB7C 2UXCB 2E0AA 2YKIA 3OPDA 2A06H 2YEDA 1UJWB 1EZJA 1VARA 2WLLA 4K3AA 4CH4A 5DECA 3ZN1A 4X1KB 3B4SA 3G4SV 3ZHVA 4CC6A 1Z5WA 4YJ2A 1JM6A 4JI2B 1E1RG 2DYSB 4DO2A 1VQ5V 2XX5A 4MPCA 5L3GA 1AI5A 4V26A 1QCEA 1VF6C 4CH3A 2IORA 1S14A 4EB6B 3CWBH 5LXTB 2ODMA 3CRKA 5HFMA 4I4TB 2ESAA 1IBLO 2PNRA 4PHZA 2JGDA 3ZKBA 4J11A 1N32O 3DXRA 4DV4B 1CP9A 3B77A 2YKEA 2A3QA 3PEHA 1JPXA 1B06A 3K5LA 1TUBB 2IW5A 4NR1A 2WERA 1GN2A 4WFFA 1JJOA 3E8FA 5EYPA 4JI5O 5FLXN 3APQA 2DWDC 3ZCCA 3ZIAG 2IJJA 4XDJA 1KECA 3G67A 3G75A 3BRCA 2W0FC 1M9NA 1ZWHA 4JTAB 1W0JG 2QWPB 2KQXA 2WA4A 2DW4A 1XNRB 2H8MA 2B1IA 4Q6GA 2V7QG 4PV1B 3SGIA 1XHZA 4GT1A 3UT5B 2K9PA 4X62B 1YIJV 2JKIA 5D5QA 1R3KC 1X59A 2XABA 2YXYA 3JD3A 5JH7B 3F5WC 4YKXA 2N04A 3HHUA 1OSFA 3Q4HB 1AI6A 2ZE7A 4CS2A 1OZ0A 4G28B 4K0KO 5BODA 1P4RA 3HR0A 3GVMA 2FWZA 1KYOF 1AP6A 1RPRA 3B8MA 5KX5A 3T1HO 1YTFB 1YS3A 2HKJA 2CH7B 3JALB 5IN9A 1N4CA 5D6PA 4LWFA 2GUZA 5L3DA 4ABMA 3K03A 2IM9A 2XAGA 2LW7A 4BQJA 5CBHA 1I7FA 4ZBMA 2IOQA 3TTZA 1AVMA 2BU2A 2BU7A
chains in the Genus database with same CATH topology
4ZKIA 1YTFD 1SERA 1YSRA 4PU9A 1U0ZA 3ZRVA 3BMYA 1OCZB 3B24A 1K4DC 1RPOA 2W6JG 4JASA 4UV9A 2BU6A 2XHRA 3MNRP 3RLRA 1S76D 1PNKA 3D3IA 1OCCB 4RQEA 3CMAV 1K7DA 2YI0A 5F5RA 3WG7B 3H80A 2JJCA 2WLIB 5B1AC 4CZZA 2WWWA 2A0LA 2EXLA 4B6CA 3EHHA 3A0WA 3SL2A 1Z5AA 3FB6C 3G7BA 3CRLA 3PEJA 4G2KA 3F7VC 2BREA 2BOBC 3E8GA 4HYPA 3OGCC 1Y4MA 4FCRA 1UYCA 1UY7A 2D3OW 4GX5A 1KIJA 3LDDA 3LSSA 1OCOB 2XAQA 2ZR2A 1H7SA 3K0DA 1AR1B 1H38A 3LSQA 3ZXOA 4CE2A 2JK5C 2EIJB 2EIJC 2UXXA 4PA4A 5IY5B 4MVSA 5H9CA 4R1FA 5CTWA 1KKDA 2M7WA 3FV5A 3FB5C 2IOPA 3HZ1A 2X6AA 3W7XA 2P7TC 2HLDG 4KQVA 2QG2A 1GM9A 4CBCA 3OMNB 3CXCU 4MTOA 4U7OA 3KE6A 4CWRA 1AROP 2Y69B 1GTOA 4MOTA 4MW8A 1I5AA 2YEFA 4MP2A 3SPJA 3BY6A 4FCQA 4WFAV 3B8NA 4QE9A 3K97A 4UROA 2HJFC 3T2MA 4I9WA 2YE9A 3LDEA 4ASUG 2IU0A 2BU8A 1Z5BA 3A0XA 4QPJA 3CCSV 1JVMA 5H6QA 1K3EA 3FYEB 4MTGA 1N8RW 2XK2A 3R4OA 4HY1A 1YJNV 4HZ0A 5EC1C 4WCEV 5M4KA 5CTUA 4U7NA 3CGYA 1VQPV 1PD3A 3CCJV 5KUKA 2XCMA 3K99A 3OMUA 2QF6A 2WLHA 4E2LA 3WG7C 1Y8PA 2Q2EB 5EBMC 1V54C 4DUHA 1G4YB 3E8HA 3K04A 2IJHA 3ASNB 4X88A 1PVGA 3Q5LA 3RLQA 3AEIA 5B3SC 1BHBA 2YKBA 2YEJA 3H01A 4EMVA 2P90A 3CCLV 1B63A 1YITV 3SYPA 4CE3A 2EINB 4JAVA 4KSHA 1ENVA 1THNA 3AG4C 3HB3B 2OTJV 2W6IG 2YE8A 3OM3B 5CN0A 3OAAG 3K98A 3SYOA 4PDLA 1GJVA 4GFNA 5B1BC 4MW3A 3CC2V 2DWEC 1YC3A 1H2GA 2WLNA 5B1NA 2WI5A 1W2BU 5FNDA 1W0KG 4P9PA 4P9OA 3DGEA 3QO8A 4BAYA 1BL8A 5L3CA 1NR7A 1I59A 1ZXMA 4H7QA 2O1VA 1S0VA 4E02A 4MTXA 1G8MA 2XOKG 4FMTA 2YKJA 3R65A 3GIFA 1GKFA 4PA9A 1QVGU 4X9LA 1K5SA 4MVRA 1Z59A 2C2AA 3ZKDA 2Q68A 3B26A 2EIKB 1Y8OA 3RBZA 3CD6V 1UYGA 2YK9A 5F3KA 3ASOC 2DYRC 2GSMB 1Y4UA 4KUMA 2XJGA 4YXWG 1TH8A 2XX2A 3O2FA 5M4HA 1YI2V 2BT0A 3MD0A 3R4MA 1OHHG 4BIUA 1TC0A 5CA3A 3CCEV 3SYQA 3T1KA 4EGKA 2ITCC 2LP7A 3FYIB 1S77D 2BYIA 1KP2A 1XL6A 3AG2B 2YEVB 3E8BA 3ABUA 3ASNC 1AH8A 4MBCA 1KC8W 4J9ZB 3ZM7A 4L91A 1YERA 1U2OA 2IWSA 3JYCA 5J9PC 1K73W 1DF5A 2EILC 1Y66A 1NHHA 2YE2A 2YKCA 4ZVIA 3ZMSA 2OCCC 1M57B 1YSZA 3AG3B 3GWOA 2ZXWB 2QFOA 2YJXA 4YKUA 5CPHA 1E1QG 1H7UA 4G27B 1FXHA 3Q5KA 3U2KA 4CWQA 3INXA 3DTUB 1WLEA 3A0YA 2ATKC 3EHGA 1AH6A 1UY6A 4GQTA 4MVQA 3K79A 4MVMA 2XJJA 2EZPA 2YSUB 2YE3A 3AG2C 5GW7A 3WFVA 2EZOA 3KG2A 1VQ6V 1NVPB 2BZ5A 4UVBA 2X0LA 4YKYA 4JF3A 3JD4A 2ZQMA 4HZ3A 1UY9A 2R9IA 3SPGA 1L0OA 4NH8A 4TWKA 1L1FA 3ASOB 3CCQV 2V1DA 5IY5C 3QNEA 4WF9V 3JCZA 3ABKB 4B7PA 2ZDIC 1R6KA 4MP7A 3C0EA 4WFGA 3X2QB 4DXWA 1GMGA 4XDLA 5D7RA 1GM8A 2XAJA 4JYBA 4PA3A 3VHCA 1S3JA 3CP1A 4MSWC 3CWVA 3EFFK 3K9AA 3W7UA 3CCRV 4GX1A 1R62A 1YT2A 2Q69A 2H94A 4J9YB 1YJ9V 2DQ3A 1FXKA 2VCIA 4H81A 3D36A 4MVUA 5E1AC 1S5HC 3ZJZA 3ZRWB 4FCPA 5CTXA 4LWGA 2GFDA 3E83A 3E86A 3RVYA 3JD0A 4YKZA 2EJRA 4GCZA 4TT3G 1NHJA 2YE4A 2HVJC 1AI7A 1GKXA 2XD6A 2YE7A 4O09A 4WFHA 2XAHA 2Y69C 2X6CA 2LFSA 4XITA 4XTJA 3T2SA 5CMUA 2A9HA 1QR9A 1US7A 2WI4A 4PL9A 2YE6A 3IFXA 2DYRB 4MVOA 5L3BA 2XASA 1MABG 4XKAA 4FK5C 5FNFA 5EC2C 3P32A 2WLMA 2HCHA 3EKRA 4MB9A 4AS9A 4LCUC 2WI3A 5IYDO 3VHAA 1YT0A 4KFMA 4HYMA 1H8EG 4EGHA 3CMEV 3RW0A 1TILA 5M4NA 4OXSA 4UXNA 1ZW9A 1E79G 1KP3A 1PNMA 1I58A 2WI7A 5IDMA 4LWIA 3T4ZA 3BEHA 1EI1A 3G7EA 2HG5C 4P2ZA 3SPCA 1UYKA 2YGFA 3OW2U 3OMIB 5IYCO 1BMFG 1QY8A 1F51A 2MK3A 4QNHB 1NQTA 4LBEC 3ABLC 1OCCC 3NXSA 3K08A 4UUJC 2P67A 4JPRA 4PDMA 2Q67A 4KTNA 1F23A 2JEXA 2CGFA 3IEDA 2UXNA 1ORQC 5EK0A 4HY6A 1JX9A 2YE5A 4UVAA 4PA7A 3ZN0A 3H4LA 2EIMB 2QTOA 5H6RA 4BW5A 1IXMA 3MHHC 3QDDA 4UV8A 4CWPA 4RO2A 3EKOA 1SRYA 5LHIA 1EA6A 1K92A 2WLIA 4QE7A 3GIGB 1BKNA 2XHXA 3G71V 3B28A 1SZTA 1AJPA 1VQNV 3CCMV 2ZBKB 5B1OA 3TZ0A 3ZRWA 4O0BA 1NKDA 4R8CA 3A0RA 4URLA 3STLC 4WFBV 1AJQA 3FT8A 4NH9A 2QM7A 4BIZA 5L3EA 4WUDA 2QEXV 1YC1A 5FNCA 4PRVA 3PJSK 3E2EA 3OE7G 3OUFA 4GX2A 3I56V 1F4NA 1M1KW 2O1UA 2YI5A 5LGNA 3CGZA 4URNA 4BQGA 2BOCC 1R73A 2DYSC 3CCVV 1UY8A 1EBOA 3QO7A 2ZXWC 1VQ7V 3GIGA 5FL7G 3HEKA 1PKXA 2ZR3A 4WUBA 2UWDA 4KP4A 4MTFA 1NHIA 4PDVA 4E01A 1ID0A 3ETEA 4F4LA 2CG9A 2YEBA 2XX4A 4NH7A 2XAFA 2IJKA 1MU5A 3EHBB 3K3WA 5M4PA 1FS0G 4FIPC 1S16A 2O1WA 2YGEA 1MSWD 4AWQA 1QR8A 4XKOA 2XHTA 1FXKC 4GX0A 4R3MA 5BOCA 1VQLV 3T0ZA 2ZD9A 3VHDA 1BGQA 2XNDG 1K33A 1THZA 4LP0A 2K1EA 1MX0A 2QKSA 3HPLC 1B62A 3HZ5A 1AM1A 1B6QA 4ASAA 2ZDXA 1JJ2U 4XC0A 1S72V 1KZNA 3QTFA 2NNUA 4L90A 1K5QA 1ZXNA 5D6QA 2IWXA 2Q8GA 4DZYA 5DM6V 2H8PC 2OTLV 4HZ5A 2P6JA 4P8OA 1RM1C 2ITDC 3LDCA 4CWFA 5LGTA 3OWBA 2VCJA 3TK1A 3UKMA 4EEHA 4X89A 3E35A 5M4EA 1OCRC 2WLKA 1V55B 1M57C 2IH1C 3W7WA 2Q8IA 4V25A 1GKZA 4MPNA 1QZRA 2Q8HA 2EILB 4H37A 2FXSA 5GGZA 3GB7C 3R92A 1JCHA 4I3HA 1VQOV 1TBWA 4CWNA 2YI6A 1F4MA 1NR1A 3X2QC 2BSMA 3AG3C 2YJWA 3FB8C 2EBOA 4JTDB 3Q5JA 3AG1C 1Q7YW 4GT8A 4PRXA 3ABKC 4R3AA 4RUFA 4XD8A 1GO3F 3SJQC 4FJCC 1YHQV 1I5CA 2AHYA 1QYEA 1VQMV 3ZRXA 4UVCA 5LBQA 2JIZG 4PDRA 4MPEA 2XDLA 3FT5A 3CCUV 1H8HG 3K06A 5LGUA 1MG1A 1FXVA 1AJ6A 1Z5CA 3EHJA 1Y8NA 2EIKC 3RVZA 3NMQA 2WI2A 3WHAA 1BXDA 3ABTA 5KUMA 3B25A 1AMWA 1HWYA 3A0TA 4XIRA 1MOFA 3ETGA 4U93A 1P7BA 3SYCA 2QM8A 1R3IC 4CWSA 1Q82W 1DF4A 1UYFA 3K0GA 2R9RB 2XJXA 2WAMA 2NLJC 1K9MW 4O07A 3ABLB 4O05A 1QBZA 3VADA 1XL4A 3EHFA 1VQ8V 2WLLB 2ZDYA 3RKZA 2K5BA 1QLEC 4TSFG 3AG4B 3CC4V 3T10A 1TUEB 1V55C 3CYOA 1AJNA 1M56C 2YEVA 4JQLA 2CK3G 2WI6A 5CF0A 4KSGA 3SPHA 3MHSC 4MT8A 3ML0A 3E89A 2BU5A 2CH4A 1A4HA 3TZ4A 3BM9A 2HKOA 2WI1A 1GK9A 2EIMC 1YESA 5L3FA 4YKWA 4RUEA 1NJIW 4XIPA 3AG1B 3OMAB 4Z1MG 4XDKA 2XDUA 3D0BA 4CWOA 2WSSG 1ROPA 1WPXA 4ASFA 3TZ2A 4XCLA 5B3SB 4JGSA 2YECA 3OW6A 4EFUA 3OEHG 5EBWC 4I5SA 4URMA 4RQFA 2YGAA 4AWPA 1YSCA 2WLJA 1VQ9V 1Q86W 1UYMA 3RLPA 4EFTA 3LNMB 4XE2A 2CCUA 2ZKJA 3ZMUA 1PL0A 2H55A 3LPSA 3P30A 4BXIA 3HYZA 4EGIA 1LNQA 5B1AB 5CBFA 1UYIA 2CCTA 1YJWV 1I5BA 3W7TA 3O0IA 4MVZA 1NH2D 2BYHA 2Y48A 5B1BB 3K60A 2BTZA 2OT5A 3I55V 3OR7C 4E00A 4PELA 4GGLA 1OCZC 4O04A 5L3JA 2EINC 3JD1A 2F43G 2AHZA 3IC7A 1I5XA 3TZ5A 1FFTB 4ASBA 2QA4V 1K34A 2B1GA 2FYPA 2QG0A 2XDKA 4HXWA 1GM7A 1NBMG 3SYAA 1EFRG 3FB7C 2PI4A 1FXKB 2E0AA 2JJ1G 2YKIA 3OPDA 1OCOC 2HG1A 2JJ2G 4QJFB 2YEDA 3ETDA 4L8ZA 1UJWB 1EZJA 2WLLA 3F7YC 1NH2B 2WEQA 3ABMC 3M99B 4W7TA 2PI5A 2X6BA 5KA5A 1I5DA 2YEIA 3ZN1A 1Q81W 4AWOA 1PNLA 4HYOA 3OUSA 3G4SV 3ZRSA 1NVPD 3G6EV 4FPPA 3FKSG 1JM6A 2A79B 4XDMA 4HAMA 1E1RG 2DYSB 2BRCA 4LPBA 4DO2A 5DN6G 1VQ5V 2XX5A 4MPCA 3ZMTA 3WQ9A 5L3GA 3CC7V 3ZXQA 1AI5A 2FWYA 2IH3C 4V26A 1KQSU 1QCEA 3T4DA 2IORA 2Z5UA 4KFGA 1VQKV 2WPDG 3STZC 1BHAA 1S14A 3D2RA 2LFRA 5IYBO 5J6AA 5FWKA 1Y4SA 4H85A 3U67A 1SETA 4XKKA 3CRKA 4QPKA 1OCRB 5HFMA 5KA6A 2ESAA 2IJIA 2QE7G 3UM7A 1R3LC 2PNRA 1VQ4V 3INWA 2Q8FA 3ZKBA 4MS2A 3U2DA 4N21A 2B5UA 1CP9A 1V54B 3B77A 3VOUA 1UYLA 2XDSA 4EKWA 2YKEA 1JPXA 4N23A 1YC4A 2VWCA 3PEHA 1QLEB 2IW5A 4X8AA 3T1CA 4QIWF 2YI7A 3B27A 2WERA 1YETA 4WFFA 4R6ZA 3E8FA 1BYQA 2YEEA 5LHHA 4WUCA 2YEAA 2KB1A 4HXZA 5CBGA 4XBFA 2GHYA 2IU3A 4CWTA 5M4MA 4YKRA 3ZMZA 3OFNG 2DWDC 2OCCB 3JD2A 3ZCCA 2IJJA 2DQ0A 4XDJA 3ZIAG 1QLNA 1B3QA 2HFEC 3A0ZA 2WEPA 1KECA 3R4PA 2JDIG 1JQ0A 1R3JC 3T0HA 2IWUA 2VW5A 3GIEA 4ASGA 2X7RB 2Q6AA 3G75A 3TCUA 5J71A 2W0FC 1K8AW 4L94A 3OEEG 3OWDA 1M9NA 1ZWHA 4JTAB 1W0JG 3C11A 1DLBA 1SESA 1R6NA 4RAIA 2JEUA 5D7DA 4LP8A 4JYCA 2DW4A 4LWEA 2H8MA 2B1IA 5IDJA 2GQPA 2V7QG 5D7CA 2HVKC 4JTCB 3TETA 4EM7A 2CCSA 4Q20A 4YKQA 5EBLC 4GT1A 4XIQA 3ZMVA 4BAEA 4L93A 1YIJV 2JKIA 3O6OA 1R3KC 1KD1W 4H33A 1M90W 5BZBA 3JD3A 1COWG 1M56B 1TIDA 2XABA 5CTYA 3F5WC 4YKTA 4WFEA 4YKXA 3OR6C 1YT1A 3HHUA 4R7CA 1OSFA 3LNUA 3SPIA 4P30A 1JOYA 3VBBA 1AI6A 2YEHA 1TC6A 3CPWU 4L87A 2ZDIA 1J95A 1OZ0A 3R91A 4G28B 2XDXA 3LUTB 4XCJA 4R50A 1P4RA 1UYEA 3HYYA 1K97A 1ZWIC 4CE1A 5BODA 3TUHA 2FWZA 3W7SA 1RPRA 3B8MA 3QO5A 5C93A 1YTFB 1YS3A 1QVFU 2HKJA 2AKPA 4P7AA 5IN9A 4PA6A 1K4CC 5HFLA 2YK2A 1I5YA 3IGAC 3R4NA 4K4OA 4LC1A 4LWHA 5D6PA 3ABMB 4LWFA 5L3DA 5LHGA 2YEGA 2FTKA 1AI4A 1RM1B 4JAUA 1DTOA 3K03A 2XAGA 1CEZA 4BQJA 5CBHA 1UYHA 4ZBMA 2IOQA 2Z3YA 4GEEA 1CPYA 2HR3A 2BU2A 3TTZA 1UYDA 2BU7A 3JZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKI A;  4PU9 A;  1YSR A;  1U0Z A;  3ZRV A;  3BMY A;  3B24 A;  4JAS A;  2BU6 A;  3MNR P;  2XHR A;  3RLR A;  5F5R A;  2YI0 A;  3H80 A;  2JJC A;  2EXL A;  2WWW A;  4B6C A;  3EHH A;  3A0W A;  3SL2 A;  1Z5A A;  3G7B A;  3CRL A;  3PEJ A;  2BRE A;  4HYP A;  4FCR A;  1UYC A;  1UY7 A;  1KIJ A;  1H7S A;  4CE2 A;  4R1F A;  5CTW A;  3FV5 A;  2IOP A;  3HZ1 A;  4KQV A;  2QG2 A;  4CWR A;  4U7O A;  3KE6 A;  4MOT A;  1I5A A;  2YEF A;  4MP2 A;  4FCQ A;  3K97 A;  4URO A;  2YE9 A;  2BU8 A;  1Z5B A;  3A0X A;  4QPJ A;  4HY1 A;  3R4O A;  2XK2 A;  4HZ0 A;  5M4K A;  5CTU A;  4U7N A;  3CGY A;  3OMU A;  3K99 A;  2XCM A;  2QF6 A;  1Y8P A;  2Q2E B;  4DUH A;  1PVG A;  3Q5L A;  3RLQ A;  2YKB A;  2YEJ A;  4EMV A;  1B63 A;  4CE3 A;  4JAV A;  4KSH A;  1THN A;  2YE8 A;  4E01 A;  3K98 A;  1GJV A;  4GFN A;  3OW6 A;  5FND A;  1YC3 A;  5B1N A;  2WI5 A;  3DGE A;  1ZXM A;  1I59 A;  4H7Q A;  2O1V A;  4E02 A;  4MTX A;  4FMT A;  2YKJ A;  3GIF A;  4X9L A;  1Z59 A;  2C2A A;  3ZKD A;  3B26 A;  1Y8O A;  1UYG A;  2YK9 A;  5F3K A;  1Y4U A;  2XJG A;  1TH8 A;  2XX2 A;  3O2F A;  5M4H A;  2BT0 A;  3R4M A;  3MD0 A;  4BIU A;  1TC0 A;  3T1K A;  4EGK A;  4V25 A;  2BYI A;  4MBC A;  1AH8 A;  3ZM7 A;  4L91 A;  1YER A;  2IWS A;  1U2O A;  1NHH A;  2YE2 A;  2YKC A;  4ZVI A;  1YSZ A;  2QFO A;  2YJX A;  4YKU A;  5CPH A;  1H7U A;  3Q5K A;  4CWQ A;  3U2K A;  3INX A;  3A0Y A;  3EHG A;  1AH6 A;  1UY6 A;  4GQT A;  2XJJ A;  2YE3 A;  2BZ5 A;  4YKY A;  1UY9 A;  1L0O A;  4NH8 A;  4B7P A;  4MP7 A;  3C0E A;  5D7R A;  4JYB A;  3VHC A;  3ZXO A;  3CWV A;  1R62 A;  1YT2 A;  4AS9 A;  2VCI A;  4H81 A;  3D36 A;  3ZRW B;  4FCP A;  5CTX A;  4LWG A;  2GFD A;  4YKZ A;  4GCZ A;  1NHJ A;  2YE4 A;  1GKX A;  2XD6 A;  2YE7 A;  4O09 A;  2LFS A;  4XIT A;  4XTJ A;  3T2S A;  1US7 A;  2WI4 A;  4PL9 A;  2YE6 A;  4XKA A;  5FNF A;  4MB9 A;  3P32 A;  2HCH A;  3EKR A;  2WI3 A;  3VHA A;  1YT0 A;  4HYM A;  4EGH A;  1TIL A;  5M4N A;  1ZW9 A;  5IDM A;  2WI7 A;  1I58 A;  4LWI A;  1EI1 A;  3G7E A;  1UYK A;  2YGF A;  1QY8 A;  1F51 A;  3NXS A;  2P67 A;  4KTN A;  2CGF A;  3IED A;  4HY6 A;  2YE5 A;  3H4L A;  1IXM A;  3QDD A;  4CWP A;  3EKO A;  1EA6 A;  3GIG B;  1BKN A;  2XHX A;  3B28 A;  2ZBK B;  5B1O A;  3TZ0 A;  3ZRW A;  4O0B A;  3A0R A;  4URL A;  4NH9 A;  3FT8 A;  5FNC A;  4CE1 A;  2QM7 A;  4BIZ A;  4WUD A;  1YC1 A;  4PRV A;  4ASB A;  2O1U A;  3CGZ A;  2YI5 A;  4URN A;  4BQG A;  1UY8 A;  3GIG A;  3HEK A;  4WUB A;  2UWD A;  4KP4 A;  1NHI A;  1ID0 A;  2CG9 A;  2YEB A;  2XX4 A;  4NH7 A;  1MU5 A;  5M4P A;  1S16 A;  2YGE A;  2O1W A;  4AWQ A;  3T0Z A;  4XKO A;  2XHT A;  4R3M A;  5BOC A;  3VHD A;  1BGQ A;  4LP0 A;  1MX0 A;  1B62 A;  3HZ5 A;  1AM1 A;  4ASA A;  2ZDX A;  4XC0 A;  1KZN A;  3QTF A;  4L90 A;  1ZXN A;  5D6Q A;  2IWX A;  2Q8G A;  4DZY A;  4HZ5 A;  4P8O A;  4CWF A;  3OWB A;  2VCJ A;  3TK1 A;  5M4E A;  4EEH A;  2Q8I A;  1GKZ A;  4MPN A;  1QZR A;  2Q8H A;  2FXS A;  5GGZ A;  3R92 A;  4I3H A;  1TBW A;  4CWN A;  2YI6 A;  2BSM A;  5M4M A;  4GT8 A;  2YJW A;  4PRX A;  4R3A A;  3Q5J A;  4XD8 A;  1I5C A;  1QYE A;  3ZRX A;  4MPE A;  2XDL A;  3FT5 A;  1AJ6 A;  1Z5C A;  3EHJ A;  1Y8N A;  1BXD A;  3NMQ A;  3WHA A;  2WI2 A;  3B25 A;  1AMW A;  3A0T A;  4XIR A;  4U93 A;  2QM8 A;  4CWS A;  1UYF A;  2XJX A;  4O07 A;  4O05 A;  3VAD A;  3EHF A;  2ZDY A;  3RKZ A;  2K5B A;  3T10 A;  5CF0 A;  4JQL A;  2WI6 A;  4KSG A;  4MT8 A;  2BU5 A;  2CH4 A;  1A4H A;  3TZ4 A;  3BM9 A;  2WI1 A;  1YES A;  4YKW A;  4XIP A;  2XDU A;  3D0B A;  4CWO A;  4ASF A;  3TZ2 A;  4XCL A;  2YEC A;  4EFU A;  4I5S A;  4URM A;  2YGA A;  4AWP A;  4EFT A;  1UYM A;  3RLP A;  4XE2 A;  2CCU A;  2ZKJ A;  2H55 A;  3LPS A;  4BXI A;  3HYZ A;  4EGI A;  1UYI A;  2CCT A;  1I5B A;  3O0I A;  2BYH A;  3K60 A;  2BTZ A;  4E00 A;  4GGL A;  4O04 A;  5L3J A;  3TZ5 A;  2FYP A;  2QG0 A;  2XDK A;  4HXW A;  3OPD A;  2E0A A;  2YKI A;  2HG1 A;  2YED A;  4L8Z A;  2WEQ A;  4W7T A;  4AWO A;  1I5D A;  2YEI A;  4FPP A;  1JM6 A;  4XDM A;  2BRC A;  4LPB A;  3WQ9 A;  3ZXQ A;  4MPC A;  2XX5 A;  2FWY A;  4V26 A;  2IOR A;  4KFG A;  1S14 A;  3D2R A;  2LFR A;  5J6A A;  5FWK A;  1Y4S A;  4H85 A;  3U67 A;  4XKK A;  3CRK A;  4QPK A;  2ESA A;  2PNR A;  3INW A;  2Q8F A;  3ZKB A;  3U2D A;  2XDS A;  2YKE A;  1UYL A;  3PEH A;  1YC4 A;  2VWC A;  3B27 A;  2YI7 A;  2WER A;  1YET A;  1BYQ A;  2YEE A;  4WUC A;  2YEA A;  4HXZ A;  4CWT A;  4YKR A;  3ZCC A;  1B3Q A;  3A0Z A;  2WEP A;  3R4P A;  3T0H A;  2IWU A;  2VW5 A;  3GIE A;  4ASG A;  3G75 A;  5J71 A;  4L94 A;  3OWD A;  1ZWH A;  3C11 A;  5D7D A;  4JYC A;  4LWE A;  2H8M A;  5IDJ A;  2GQP A;  5D7C A;  4EM7 A;  2CCS A;  4Q20 A;  4YKQ A;  4GT1 A;  4XIQ A;  4BAE A;  4L93 A;  2JKI A;  3O6O A;  1TID A;  2XAB A;  5CTY A;  4YKT A;  4YKX A;  1YT1 A;  3HHU A;  1OSF A;  3LNU A;  1JOY A;  2YEH A;  1TC6 A;  3R91 A;  2XDX A;  4XCJ A;  1UYE A;  3HYY A;  5BOD A;  3TUH A;  2FWZ A;  1YS3 A;  5C93 A;  2HKJ A;  4P7A A;  2AKP A;  5IN9 A;  2YK2 A;  4K4O A;  4LWH A;  3R4N A;  5D6P A;  4LC1 A;  4LWF A;  2YEG A;  2FTK A;  4JAU A;  4BQJ A;  1UYH A;  2IOQ A;  4GEE A;  3TTZ A;  2BU2 A;  1UYD A;  2BU7 A;  3JZ3 A; 
#chains in the Genus database with same CATH topology
 4TV9 B;  4PU9 A;  5DED A;  1OCZ B;  2CDY A;  1K4D C;  4JAS A;  2KG7 B;  2QM4 A;  2YI0 A;  4CZZ A;  2A0L A;  4CC5 A;  4DR2 B;  1XHX A;  3ETQ A;  1Z5A A;  1H2M A;  3E8G A;  5JJN B;  5A9G A;  3RYH A;  1OCO B;  2EIJ B;  5H9C A;  1KKD A;  3HKD A;  3HZ1 A;  2P7T C;  4KQV A;  1BE3 H;  4X64 B;  4UCO A;  3OMN B;  4MTO A;  4JI4 B;  2VS0 A;  2Y69 B;  4MOT A;  3FX7 A;  1I5A A;  4MP2 A;  4WFA V;  2HJF C;  1VIB A;  2YE9 A;  3LDE A;  2IU0 A;  1P49 A;  2F95 B;  1V9P A;  4QPJ A;  5H6Q A;  4MTG A;  3FYE B;  5BXZ A;  4CS3 A;  4DR1 O;  1KU9 A;  1YJN V;  4WCE V;  4EEQ A;  2P22 C;  5CTU A;  3OMU A;  4B3M O;  4JYA B;  4LNU A;  1Y8P A;  5EBM C;  4DUH A;  1G4Y B;  3K04 A;  2KG7 A;  5CA0 A;  5CA1 B;  2DJV A;  4Z1V A;  3U10 A;  2QSA A;  3SYP A;  2CTP A;  2YUA A;  4D7T A;  3HB3 B;  1EN6 A;  2XUM A;  1GJV A;  2CGO A;  2ZE6 A;  3OW6 A;  2Q73 A;  3CC2 V;  2L6L A;  2WI5 A;  2E75 B;  1OV9 A;  2LGQ A;  1DK1 A;  3JAR A;  1F7Y A;  4MTX A;  1G8M A;  2XOK G;  4FMT A;  3GIF A;  4DRX B;  1GKF A;  4CH5 A;  1K5S A;  3QG5 A;  1MA1 A;  2C2A A;  2Q68 A;  1FJG B;  1HR0 B;  4J80 A;  4PJ0 Z;  2VQF O;  3L74 H;  2W0X A;  2XJG A;  2ZIN A;  2LO1 A;  3R4M A;  1TC0 A;  3T1K A;  4EGK A;  1GN3 A;  2G38 A;  3FYI B;  1S77 D;  2BYI A;  4V25 A;  3E8B A;  3ABU A;  4BIO A;  4J9Z B;  1U2O A;  2IWS A;  1IX9 A;  1DF5 A;  4DV7 B;  2YE2 A;  1G6U A;  2OIE A;  1YEW A;  3ZMS A;  1M57 B;  5KAI Z;  1Y6X A;  2QFO A;  5LP6 C;  1E1Q G;  1BQZ A;  2UUA B;  3Q5K A;  3DTU B;  1WLE A;  3EHG A;  2ZIO A;  3AG2 C;  3N2K A;  5GW7 A;  3SJB C;  3ZHS A;  3KG2 A;  2N05 A;  4FFB B;  2X0L A;  5D5P A;  3JD4 A;  4HZ3 A;  2CAZ C;  3SPG A;  4TWK A;  3ASO B;  3CCQ V;  1I08 A;  4LF4 B;  3ABK B;  4WFG A;  4DXW A;  4TV8 B;  5D7R A;  2EJ7 A;  2ZNJ A;  4GZR B;  3UO3 A;  3CWV A;  1R62 A;  2Q69 A;  3D36 A;  4FCP A;  3E83 A;  3QTC A;  5KHK A;  4GCZ A;  1WP8 A;  2HVJ C;  2WA3 A;  2XD6 A;  3OTO B;  1SQG A;  4O09 A;  1AR4 A;  2XAH A;  4XIT A;  4ICG A;  4A5U B;  1X4T A;  4YJ3 A;  2Q7E A;  4BR6 A;  5FNF A;  5EC2 C;  2HCH A;  4LCU C;  2RJZ A;  1MZF A;  2YDE A;  4HYM A;  2VWK A;  1MZE A;  3RW0 A;  1NI8 A;  5M4N A;  5IWA O;  4UXN A;  1ZW9 A;  1KP3 A;  4H13 B;  1EI1 A;  4NVP A;  3SPC A;  3OW2 U;  4DV0 O;  5IYC O;  1QY8 A;  1F51 A;  4DK1 A;  4FLV A;  1OCC C;  3K08 A;  1XIL A;  5KHH A;  4UUJ C;  1F23 A;  1AB3 A;  2UXN A;  4ZOL A;  2YE5 A;  1BQ0 A;  3ZN0 A;  1US6 A;  5H6R A;  4CWP A;  4RO2 A;  1K92 A;  3GIG B;  3G71 V;  1SZT A;  3CCM V;  4AI8 A;  4URL A;  4NH9 A;  4CE1 A;  4JZ2 A;  5L3E A;  1YC1 A;  4PRV A;  4ASB A;  3OUF A;  3CGZ A;  5LGN A;  1PM9 A;  4URN A;  3CCV V;  1R73 A;  1HNZ O;  4B3S B;  5FL7 G;  3BAB A;  4DR3 B;  2B9Z A;  1S5L Z;  5TIS Z;  2E5L O;  3VQX A;  2YEB A;  4NH7 A;  2XAF A;  2IJK A;  1MU5 A;  1TAE A;  3EHB B;  3KZI Z;  2M6Y A;  5EIB C;  1QR8 A;  4XKO A;  2XHT A;  5BOC A;  1VQL V;  2ZD9 A;  4PI2 A;  4IYI A;  1BT8 A;  1B6Q A;  4ASA A;  1SKV A;  3OTF A;  4O2A B;  1KZN A;  2NNU A;  1ZXN A;  2Q8G A;  3TXQ A;  2H8P C;  4GLX A;  1ZLZ A;  4CWF A;  4TQD A;  3TK1 A;  4EEH A;  4X89 A;  2Q8I A;  3W7W A;  2IH1 C;  3KKY A;  3WB0 A;  2C1I A;  2N74 A;  4I3H A;  4GT8 A;  2YJW A;  4R3A A;  3Q5J A;  2VWJ A;  4DR2 O;  4FJC C;  2AHY A;  5GTH Z;  3ZRX A;  4UVC A;  3TGU H;  2JIZ G;  3H1J H;  3BA8 A;  1BGY H;  3K06 A;  1HDJ A;  3VQV A;  3L72 H;  3JAR B;  1Y8N A;  3RVZ A;  3WHA A;  1FAF A;  3A0T A;  4XIR A;  3ETG A;  1P7B A;  1R3I C;  1DF4 A;  3THO A;  3K0G A;  1XI1 A;  2R9R B;  4JI1 B;  2WAM A;  4KHP B;  1BS3 A;  4O05 A;  3TXS A;  3VAD A;  1IBL B;  1H2K A;  2VRZ A;  4NB5 A;  2ZDY A;  4TSF G;  1XNQ O;  3CC4 V;  3T10 A;  1TUE B;  2Z0A A;  5CF0 A;  3CX5 F;  4JQL A;  3ML0 A;  3E89 A;  4LH7 A;  3JAW B;  1A4H A;  1VMG A;  3BM9 A;  4JV5 O;  1GK9 A;  2EIM C;  3AG1 B;  4Z1M G;  4XDK A;  2XDU A;  3D0B A;  2FKX A;  4JI0 B;  3QF7 A;  4NXM B;  1HP8 A;  5IE9 A;  4RQF A;  1YSC A;  2WLJ A;  1UYM A;  1N34 O;  4XE2 A;  2F1M A;  2H55 A;  5A2Q N;  4BXI A;  3B2E E;  5B1A B;  1YJW V;  1I5B A;  3W7T A;  3CYG A;  4MVZ A;  5FNV A;  4PEL A;  1OCZ C;  5L3J A;  3JD1 A;  2BE3 A;  2F43 G;  1FFT B;  1Z5V A;  2YIA A;  2QA4 V;  3T1Y B;  2QG0 A;  1NBM G;  4NTY A;  1FXK B;  3EXA A;  1VF5 B;  1Y76 B;  3F7Y C;  1P7G A;  3M99 B;  4AWO A;  1I5D A;  5LYJ B;  1Q81 W;  5CB4 A;  4O2B A;  3ZRS A;  4FPP A;  2A79 B;  4HAM A;  3JAK A;  4LPB A;  4B7K A;  4YY3 O;  2R70 A;  3RN4 A;  2FWY A;  1M93 A;  1KQS U;  3T4D A;  4NXM O;  2Z5U A;  4KFG A;  4O4J A;  3D2R A;  2LFR A;  5IYB O;  3U67 A;  4LR3 A;  1D5N A;  4H85 A;  4QPK A;  5KA6 A;  3RYI B;  2L35 A;  2Q7G A;  1KB9 F;  2ADQ B;  3C3T A;  1UYL A;  2Y0I A;  1YC4 A;  4GKJ O;  1YET A;  1RP3 B;  1D5A A;  4OX9 O;  2YEA A;  2KB1 A;  1UFI A;  4HXZ A;  2HHH B;  2YC0 A;  4YKR A;  3OFN G;  2YI9 A;  4F6R A;  1B3Q A;  3OD4 A;  2WEP A;  4WBN A;  2JDI G;  2IWU A;  2X7R B;  3TCU A;  3OWD A;  1Y76 A;  1HNW O;  3SJA C;  1R6N A;  5D7D A;  3JAT A;  2UXB B;  1H2L A;  5IDJ A;  4JI6 B;  2HHH O;  2H3O A;  4L93 A;  2FB5 A;  3O6O A;  4FLY A;  1KD1 W;  2R72 A;  4YIO A;  5CTY A;  4UFZ A;  2GUZ B;  2YEH A;  5C8Y B;  1TC6 A;  4OGQ B;  2ZDI A;  2JS5 A;  1J95 A;  4DUY B;  1DGS A;  3LUT B;  4R50 A;  3UT5 A;  1K97 A;  1ZWI C;  4O2A A;  4UCS A;  3EVK A;  3W7S A;  4DV5 B;  3L70 H;  2AKP A;  4PA6 A;  1K4C C;  5JEN A;  4K4O A;  1I5Y A;  4LC1 A;  4X1Y A;  3Q4H A;  4UB6 Z;  4B3T O;  3WU2 Z;  1UYH A;  4LFC B;  4ZHQ B;  3B09 A;  2UUA O;  3C90 A;  4I55 B;  1UYD A;  1SER A;  2HHI A;  3B24 A;  2W6J G;  2BU6 A;  2XHR A;  1S76 D;  1OCC B;  3CMA V;  4K8X A;  2JJC A;  2EXL A;  2WWW A;  1SF9 A;  3A0W A;  4B3S O;  3FB6 C;  5KHJ A;  4G2K A;  2AZ2 A;  1TA8 A;  3F7V C;  1UYC A;  2D3O W;  4GX5 A;  3BVO A;  4DV5 O;  1AR1 B;  4I0X A;  3LSQ A;  1H38 A;  4PA4 A;  2EIJ C;  5BR8 O;  1D2D A;  3FB5 C;  2QWO B;  2IOP A;  3FD9 A;  4J42 A;  4CBC A;  2QR4 A;  4MW8 A;  4D7S A;  4IHJ B;  4DV2 O;  2YEF A;  3SPJ A;  4FCQ A;  4CH6 A;  3B8N A;  4QE9 A;  4ZIB A;  4I9W A;  5CA0 B;  1Z5B A;  2BTQ A;  3JAS B;  3A0X A;  1IVS A;  4ZHQ A;  1K3E A;  4DR6 B;  3BAA A;  5M4K A;  4U7N A;  1PD3 A;  1XNR O;  2XCM A;  3WG7 C;  3S3W A;  4LWS B;  3E8H A;  4X88 A;  3AEI A;  5B3S C;  2YKB A;  3H01 A;  4EMV A;  4JAV A;  4DRX A;  1ENV A;  4BWA A;  2OTJ V;  2YE8 A;  3K98 A;  5CN0 A;  4DR3 O;  4LNU B;  5FND A;  1W2B U;  4P9P A;  1XDC A;  2GDS A;  3DGE A;  3QO8 A;  1EM1 A;  5L3C A;  1M5I A;  4JI3 B;  3ZHU A;  1S0V A;  1IUR A;  2YKJ A;  3R65 A;  1QVG U;  4X9L A;  3CE2 A;  3NR7 A;  5IYZ A;  4MVR A;  3S5T A;  3JSN A;  1GH6 A;  1UYG A;  2YK9 A;  1YXB A;  4YXW G;  1BZK A;  5M4H A;  1XBL A;  2BT0 A;  3MD0 A;  1OHH G;  2Y0P A;  5CA3 A;  4PD4 F;  3CCE V;  2ITC C;  3K57 A;  2CTR A;  1KP2 A;  4KHP O;  4MBC A;  1AH8 A;  3ASN C;  2LJ2 A;  3ICX A;  5J9P C;  2PF4 E;  2EIL C;  1ZTE A;  2D2C B;  4FM1 A;  1NHH A;  3G6B A;  5LOV B;  1YSZ A;  3GWO A;  1XMO O;  2YJX A;  4YKU A;  1TVK A;  4IT5 A;  1FXH A;  5K1P A;  5FPO A;  4GQT A;  3HKB A;  2XJJ A;  2YE3 A;  2JRI A;  1VQ6 V;  2BZ5 A;  4UVB A;  2F23 A;  4UCU A;  5KMG A;  3SJC C;  5JQG B;  4JZG A;  2V1D A;  4I50 A;  5IY5 C;  2OWO A;  1Q43 A;  1MSD A;  1SQF A;  4WF9 V;  4B7P A;  2ZDI C;  4GKK O;  3C0E A;  3X2Q B;  2QKC A;  1GM8 A;  4PA3 A;  2PY5 A;  1S3J A;  4MSW C;  3ZXO A;  4J7Z A;  3W7U A;  3CCR V;  2H94 A;  1YJ9 V;  4LF9 B;  2DQ3 A;  2VCI A;  4H81 A;  1NTM H;  5E1A C;  4YJ3 B;  5CTX A;  4LFA O;  2GFD A;  1SQQ H;  2QWQ B;  5H5N A;  2EJR A;  1NHJ A;  1LR1 A;  2OYQ A;  2LFS A;  3T2S A;  2A9H A;  4PL9 A;  3IFX A;  4MVO A;  2XAS A;  4DV3 O;  4XKA A;  4FK5 C;  3APO A;  2E3C A;  2WLM A;  2WI3 A;  2PTM A;  1JR9 A;  3A0H Z;  1YT0 A;  3IJ4 A;  4KFM A;  3E22 B;  4JI7 B;  4X64 O;  2Q9L A;  2VQE B;  2WI7 A;  4DR7 O;  4ZI7 A;  3T4Z A;  5LMU B;  4DK0 A;  1UYK A;  4JI1 O;  3OMI B;  1BMF G;  5JQG A;  4LBE C;  3I5D A;  2PUS A;  3LMM A;  4I50 B;  3G80 A;  2CGF A;  3IED A;  5EK0 A;  4LFA B;  1SRY A;  5LHI A;  1EA6 A;  1BKN A;  4FLU A;  1NKD A;  4R8C A;  4WFB V;  2QM7 A;  2QEX V;  3CJH B;  3CS5 A;  3PJS K;  3OE7 G;  2O1U A;  1N36 B;  1F4N A;  1M1K W;  2YI5 A;  4BQG A;  3QO7 A;  2ZXW C;  3GIG A;  1PKX A;  1IBM B;  4KP4 A;  4LF4 O;  1ID0 A;  4NTW A;  4H0L B;  2CG9 A;  2Y4U A;  3P3N A;  1FS0 G;  4AWQ A;  1PL4 A;  1QNM A;  5LYJ A;  2YIB A;  1ZSP A;  2XND G;  1IXB A;  2K1E A;  2QKS A;  4ZI7 B;  3HZ5 A;  1RSO A;  1JJ2 U;  5D6Q A;  1L0N H;  1NU1 H;  3LDC A;  3QVN A;  1ZL8 B;  3RT3 C;  4GUN A;  3UKM A;  1V55 B;  1M57 C;  2PYJ A;  4DR6 O;  3TJT A;  2EIL B;  2FXS A;  5GGZ A;  3R92 A;  3GB7 C;  4DV1 O;  3M7M X;  1VQO V;  1TBW A;  1R6T A;  2HEP A;  2P4V A;  3X2Q C;  4B3T B;  4PRX A;  3FB8 C;  3KCX A;  3HKE B;  4O4I A;  3SJQ C;  1YHQ V;  1I5C A;  1VQM V;  1YF2 A;  5LBQ A;  4J10 A;  4PDR A;  2XDL A;  1PP9 H;  1H8H G;  4LF5 O;  5LGU A;  1AJ6 A;  3ABT A;  2QWR B;  1FYJ A;  5IYZ B;  3CB2 A;  2LQT A;  3SYC A;  1NS1 A;  4CWS A;  1GRJ A;  1UYF A;  4IIJ B;  4X1I A;  3EHF A;  1VQ8 V;  1HNZ B;  2HJD A;  1QLE C;  3CEI A;  3FFQ A;  1B04 A;  3CRQ A;  3RYF A;  3CYO A;  2YEV A;  2CK3 G;  4KSG A;  3MHS C;  1AP5 A;  4O4H B;  2DMX A;  1XMQ B;  5LOV A;  1YES A;  2YXH A;  4LF7 B;  1NJI W;  3OMA B;  4CWO A;  3AK3 A;  2WSS G;  4X1Y B;  2YEC A;  4URM A;  1Q6I A;  4EFT A;  4J7J A;  2CCU A;  1PL0 A;  3P30 A;  4EGI A;  1LNQ A;  5CBF A;  1SC5 B;  4DV6 B;  4JI6 O;  1NH2 D;  4IYH A;  2Y48 A;  4FLZ A;  3OR7 C;  3IC7 A;  2EUL A;  1I5X A;  2B1G A;  2XDK A;  2PI4 A;  2AW9 A;  2JJ1 G;  2JJ2 G;  4QJF B;  4Z2W A;  4L8Z A;  2Q0O C;  2WEQ A;  3ABM C;  1WA8 A;  2E76 B;  4W7T A;  5KA5 A;  2YEI A;  3ZBH A;  1PNL A;  3OUS A;  3FKS G;  4XDM A;  3RYI A;  4E4E A;  2BRC A;  3ZXQ A;  5DN6 G;  3ZMT A;  2UUB O;  3DC5 A;  2WPD G;  2ZE8 A;  3STZ C;  1VQK V;  1BHA A;  5J6A A;  4LFC O;  5FWK A;  2ZE5 A;  3S3X A;  1OCR B;  5CB4 B;  2KSD A;  2IJI A;  2NR5 A;  2QE7 G;  3UM7 A;  1R3L C;  4DV3 B;  1WB8 A;  3INW A;  2Q8F A;  1WB7 A;  2BTQ B;  3UO2 A;  4X65 O;  3U2D A;  2B5U A;  1Q6U A;  3VOU A;  4LFB O;  4EKW A;  4X66 B;  3K5M A;  4QIW F;  1BYQ A;  2QKA A;  4R6Z A;  2YEE A;  5LHH A;  5LA6 B;  3MAQ A;  5CBG A;  4XBF A;  2GHY A;  4CWT A;  1SQX H;  2Q4P A;  2OCC B;  1QLN A;  2CUG A;  3N2G A;  3A2F A;  3A0Z A;  3R4P A;  1JQ0 A;  1R3J C;  3T0H A;  2VW5 A;  2Q6A A;  1XNQ B;  5J71 A;  1K8A W;  3OEE G;  1CXZ B;  3C11 A;  1DLB A;  4DV1 B;  2JEU A;  4LWE A;  2Q5Z A;  4W4K A;  5D7C A;  2HVK C;  3TET A;  4EM7 A;  2JS3 A;  4YKQ A;  4O4L A;  4XIQ A;  1FKA O;  3ZMV A;  4BAE A;  5LP6 B;  4H33 A;  1COW G;  1M56 B;  3N27 A;  4YKT A;  4WFE A;  5GON A;  4DV4 O;  2F93 B;  1YT1 A;  4P30 A;  1UYE A;  3HYY A;  3QO5 A;  1QVF U;  4P7A A;  5EYP B;  1AIL A;  4FFK A;  4LWH A;  3R4N A;  3ABM B;  3BPZ A;  3VQW A;  2QTS A;  5LHG A;  2YEG A;  2FTK A;  4JAU A;  1DTO A;  3N2G B;  2YIB D;  1CEZ A;  1SA0 B;  2Z3Y A;  4GEE A;  1CPY A;  3U11 A;  4ZKI A;  1YTF D;  2KKW A;  1XMQ O;  4UV9 A;  1GN6 A;  3CRR A;  1PNK A;  3D3I A;  3RYC B;  4RQE A;  5F5R A;  1K7D A;  5B5E Z;  3WG7 B;  3ZED A;  2WLI B;  4AQY B;  1O9H A;  4B6C A;  2FML A;  3BHP A;  4F6E A;  2UU9 B;  3EHH A;  3SL2 A;  2YI8 A;  4I55 A;  3PEJ A;  2DE0 X;  3ZHT A;  1FFX A;  2BRE A;  2BOB C;  1HW7 A;  3OGC C;  4YHH B;  4FCR A;  2HP8 A;  3LDD A;  1SS3 A;  2ZR2 A;  1YZB A;  1LUW A;  2UXX A;  5IY5 B;  4MVS A;  5CTW A;  1W59 A;  2M7W A;  5KLV H;  2X6A A;  2HLD G;  2ZIM A;  1GM9 A;  4CWR A;  3CXC U;  4U7O A;  1GTO A;  4O4J B;  2PZS A;  1IBM O;  3BY6 A;  2YXL A;  2UUC B;  3K97 A;  4L8J A;  4URO A;  4GKK B;  3CCS V;  1JVM A;  4JI8 O;  2XK2 A;  3FAV B;  4HZ0 A;  4X66 O;  3CCJ V;  3K99 A;  5KUK A;  4IHJ A;  3E22 A;  3J80 N;  2WLH A;  4IL6 Z;  2Q2E B;  1V54 C;  4I9Q A;  2IJH A;  3ASN B;  1BCC H;  3RLQ A;  1BHB A;  4DV0 B;  1I94 O;  2UUC O;  2YEJ A;  4TQF A;  1QU7 A;  1YIT V;  4KSH A;  1BSM A;  3O9O A;  2FL4 A;  3AG4 C;  5JVD B;  4E01 A;  3OM3 B;  5LL6 Y;  3SYO A;  4PDL A;  4X20 B;  4GFN A;  4MW3 A;  5H2F Z;  4LWS A;  1H2G A;  2WLN A;  5B1N A;  1YC3 A;  1ZAU A;  1W0K G;  4KL1 A;  1VEW A;  4BAY A;  1ZXM A;  1EN5 A;  1NR7 A;  3OTO O;  2O1V A;  4PA9 A;  2ETN A;  4E72 A;  1Z59 A;  4DR4 O;  3B26 A;  2EIK B;  3RBZ A;  3CD6 V;  1Q6H A;  3ASO C;  2DYR C;  2GSM B;  4KUM A;  1TH8 A;  3SR2 C;  2ARH A;  4JI7 O;  2XX2 A;  5IWA B;  3OT7 A;  3SYQ A;  4JI3 O;  1XL6 A;  4LF9 O;  1KC8 W;  1N0N A;  3HKB B;  2UXD B;  1YER A;  4L91 A;  1LUV A;  3JYC A;  1QQC A;  1FD9 A;  1K73 W;  3H1I H;  1Y66 A;  5CA1 A;  3AG3 B;  2ZXW B;  5BMV B;  5CPH A;  1H7U A;  1PPJ H;  4G27 B;  5KAF Z;  3U2K A;  2RDC A;  3INX A;  1HNX O;  2ATK C;  4HNA B;  1UY6 A;  4MVM A;  2EZP A;  2YSU B;  3R66 A;  4CS4 A;  3WFV A;  1NVP B;  4YKY A;  1UY9 A;  3D36 C;  4JI4 O;  1TVK B;  2ADP A;  3HKE A;  3JCZ A;  1XOU A;  1R6K A;  4MP7 A;  4YHH O;  1GMG A;  4FVM A;  2XAJ A;  4JYB A;  3VHC A;  4AIL C;  1WP7 A;  3K9A A;  2JVD A;  4GX1 A;  4JI8 B;  1YT2 A;  4J9Y B;  5KMG B;  1FXK A;  3ZRW B;  1S5H C;  3ZJZ A;  4LWG A;  3E86 A;  5LP6 A;  1JFF B;  2YE4 A;  1AI7 A;  1KKC A;  5JCO C;  3RWR D;  5BY1 A;  4NTX A;  4WFH A;  2Y69 C;  1R1B A;  1WJZ A;  4XTJ A;  2CTQ A;  1US7 A;  4W4L A;  3JSL A;  2YE6 A;  5K1X A;  5L3B A;  1XQ8 A;  1MAB G;  5EZY B;  4MB9 A;  4FLT A;  1N0J A;  3RYF B;  4UB8 Z;  4PI0 A;  1H8E G;  4UCR A;  1TIL A;  1E79 G;  4FLX A;  1PNM A;  5IDM A;  3BEH A;  3F5T A;  4P2Z A;  2YGF A;  3P3P A;  1H2N A;  5E79 Z;  5JJE B;  2P67 A;  5IJ0 B;  2ZM6 O;  4KTN A;  2JEX A;  1ZX3 A;  4UVA A;  2CTW A;  3MHH C;  2YIC A;  3QDD A;  2WLI A;  4QE7 A;  3SDL A;  4WBN B;  3AG7 A;  2ZBK B;  4KXR A;  3ZX6 A;  3ZRW A;  4DR7 B;  4O0B A;  3STL C;  1AJQ A;  3FT8 A;  4BIZ A;  4WUD A;  2F4V O;  5BR8 B;  2P06 A;  3JAT B;  4GX2 A;  3I56 V;  2ZKO A;  4C7U A;  1UY8 A;  3PN1 A;  1VQ7 V;  1S5J A;  2ZR3 A;  4DV2 B;  1VP7 A;  4PDV A;  4F4L A;  4YIP A;  2VQF B;  4FZ1 A;  4H44 B;  3K3W A;  5M4P A;  1S16 A;  2YGE A;  4X1K A;  2XT9 A;  1J5E O;  4GX0 A;  3VHD A;  1WPB A;  4YJ2 B;  5C8Y A;  4LP0 A;  2UXD O;  1B62 A;  2OIG A;  3K5O A;  3KCY A;  2ZDX A;  1S72 V;  3QTF A;  4L90 A;  1K5Q A;  3CRA A;  5DM6 V;  2P6J A;  5IJ0 A;  3OGI B;  1QHT A;  3OWB A;  4ZOL B;  2V4D A;  1OCR C;  4DR1 B;  1GKZ A;  1QZR A;  4U3J B;  3DXR B;  4H37 A;  1JCH A;  4JI5 B;  2YI6 A;  1U97 A;  1NR1 A;  4B7E A;  2BSM A;  3AG3 C;  4JTD B;  3UCS C;  3AG1 C;  5LA6 A;  4RUF A;  1GO3 F;  5JVD A;  4K8Z A;  2Q8V A;  2Q0A A;  1WAZ A;  3CCU V;  2LGW A;  1N33 O;  5LMN B;  2CGN A;  4TUY A;  1Z5C A;  1FXV A;  1BXD A;  3NMQ A;  3RGB A;  5F2V O;  5KUM A;  1NZ6 A;  2XTA A;  4YY3 B;  1AMW A;  5FNV B;  1MOF A;  4U93 A;  5J2T A;  4DW0 A;  2QM8 A;  1TGO A;  2XJX A;  4O07 A;  3ABL B;  1QBZ A;  3H1H H;  1PV0 A;  3U0Z A;  2UXC O;  1V55 C;  1AJN A;  1M56 C;  5GON B;  2WI6 A;  2BSK A;  2RN9 A;  3SPH A;  4MT8 A;  3JAM N;  2BU5 A;  4DUY O;  1NT2 B;  3ZHQ A;  3HKC B;  5ITZ A;  1VF6 A;  2UXB O;  4UCT A;  2HKO A;  4GYC B;  3CSX A;  4D6T H;  3D3Q A;  2QWN B;  4RUE A;  2CH7 A;  3JAL A;  3JCU Z;  1WPX A;  4JGS A;  4EFE A;  1Y67 A;  4QGP A;  4I5S A;  1Y74 B;  5IJ9 A;  5JJJ B;  1Q86 W;  3RLP A;  1L0L H;  2DN9 A;  2ZKJ A;  3ZMU A;  4LH6 A;  3BCC H;  2BYH A;  4IGG A;  2OT5 A;  4JAA A;  4X65 B;  3I55 V;  4E00 A;  2AHZ A;  1WNS A;  2F66 C;  3TZ5 A;  2FYP A;  1FJG O;  3SYA A;  1OCO C;  2QGN A;  2HG1 A;  3ETD A;  1NH2 B;  1JFF A;  2PI5 A;  2X6B A;  3MDS A;  4HYO A;  1NVP D;  3G6E V;  1AR5 A;  1MMM A;  3WQ9 A;  2JGD B;  4X9Q A;  3CC7 V;  2Y4T A;  2IH3 C;  5EZY A;  4FM0 A;  1Y4S A;  1SET A;  4XKK A;  1ZL8 A;  4B08 A;  2IBZ H;  4J41 A;  3J81 N;  3IAY A;  1Y74 A;  5IJ9 B;  1VQ4 V;  2AZ0 A;  4MS2 A;  1OJH A;  4N21 A;  2YID A;  2XDS A;  1V54 B;  4N23 A;  4B3M B;  2VWC A;  1QLE B;  3B27 A;  4X8A A;  3T1C A;  2YI7 A;  4WUC A;  4EB6 A;  5LXT A;  2IU3 A;  3ZMZ A;  3JD2 A;  2DQ0 A;  1NTK H;  1URF A;  2HFE C;  3GIE A;  1Q3E A;  4AHC A;  4ASG A;  1TUB A;  4L94 A;  4B3R O;  3D8C A;  1SES A;  4RAI A;  4HBN A;  5JCO A;  4LP8 A;  1JA8 A;  4JYC A;  2GQP A;  4IIJ A;  4JTC B;  2CCS A;  4Q20 A;  5EBL C;  2GV9 A;  2F4V B;  4JI0 O;  3M8A A;  5KX5 B;  1M90 W;  1U96 A;  5BZB A;  1TID A;  3OR6 C;  4R7C A;  3LNU A;  3SPI A;  1JOY A;  3VBB A;  4I0X B;  5IT9 N;  3L71 H;  3CPW U;  4L87 A;  4O4L B;  3R91 A;  4JYA O;  2XDX A;  4XCJ A;  3TUH A;  5C93 A;  5JH7 A;  5HFL A;  3L73 H;  2YK2 A;  3IGA C;  1SQP H;  1Q8I A;  1RM1 B;  1AI4 A;  4FLW A;  3WB2 A;  4U3J A;  1N34 B;  2HR3 A;  1IBK B;  4XD8 A;  3LNN A;  3JZ3 A;  1XRE A;  1YSR A;  1U0Z A;  4HNA A;  3ZRV A;  3BMY A;  2NN4 A;  1RPO A;  4JI2 O;  2OCH A;  3MNR P;  3RLR A;  2GTS A;  2RNB A;  3H80 A;  1SA0 A;  5B1A C;  3HKD B;  3G7B A;  3CRL A;  1JMK C;  2RMK B;  3K5N A;  4HYP A;  4DW1 A;  1Y4M A;  1UY7 A;  1KIJ A;  3LSS A;  1MNG A;  2XAQ A;  4BW9 A;  1H7S A;  3K0D A;  4CE2 A;  2JK5 C;  4R1F A;  3RFR A;  1HNW B;  2EX3 A;  3FV5 A;  3W7X A;  2QG2 A;  2VQE O;  4FZ0 A;  1FFX B;  3KE6 A;  1ARO P;  2MW2 B;  2RCV A;  2QJ1 A;  2BSK B;  3T2M A;  5EIB D;  4ASU G;  2BU8 A;  1Z2G A;  3ZS8 C;  4HY1 A;  3O65 A;  1YVW A;  1N8R W;  2LW1 A;  1GAX A;  3R4O A;  5EC1 C;  1YDX A;  4DR5 O;  3CGY A;  1VQP V;  4J7K A;  2QF6 A;  5J2U B;  4E2L A;  4K0K B;  4X20 A;  1G1X B;  2BCC H;  4JV5 B;  1PVG A;  3Q5L A;  5KHG A;  1I0H A;  2P90 A;  3CCL V;  1B63 A;  2O57 A;  1EN4 A;  4CE3 A;  2EIN B;  3UQ8 A;  1THN A;  2W6I G;  4O4I B;  3OAA G;  3CXH F;  5B1B C;  1FPO A;  2DWE C;  2P5O A;  4K35 A;  4P9O A;  1IBK O;  1BL8 A;  1I59 A;  4H7Q A;  4NYK A;  4E02 A;  4OPH A;  4DUZ B;  4NXN B;  3ZKD A;  1Y8O A;  4OPA A;  1XMO B;  5F3K A;  1Y4U A;  3JAS A;  1P84 F;  3O2F A;  1YI2 V;  4BIU A;  5BMV A;  2LP7 A;  1KBH A;  1IDS A;  3J7A U;  3AG2 B;  2YEV B;  4LF8 B;  3L75 H;  3LSU A;  2GTA A;  3ZM7 A;  1N36 O;  2BTO A;  2YKC A;  4ZVI A;  2RQ6 A;  2OCC C;  5GTI Z;  4CWQ A;  4I7Z B;  3A0Y A;  5LMN O;  1AH6 A;  4MVQ A;  3K79 A;  3B40 A;  4LF7 O;  2GBO A;  2EZO A;  3K59 A;  4F6R B;  2C1G A;  4JF3 A;  2ZQM A;  2R9I A;  1L0O A;  4NH8 A;  1L1F A;  3QNE A;  2E74 B;  5B66 Z;  2PYL A;  4XDL A;  1N33 B;  3ZHR A;  3CP1 A;  3EFF K;  4AS9 A;  3BA9 A;  1M4U A;  3A0B Z;  4EFB A;  4MVU A;  4YKZ A;  3RVY A;  3JD0 A;  1WA8 B;  4TT3 G;  1GKX A;  2YE7 A;  4TV8 A;  1YCI A;  2ZCE A;  5LMU O;  2X6C A;  3T1H B;  4DUZ O;  5CMU A;  1QR9 A;  2WI4 A;  3H9V A;  1HNX B;  2DYR B;  2ZM6 B;  4LF5 B;  3FAV A;  3P32 A;  2P4K A;  3EKR A;  4LFB B;  1IZ3 A;  5IYD O;  3VHA A;  4EGH A;  3CME V;  5ITZ B;  4OXS A;  4U3F H;  2XHB A;  1I58 A;  3CHX A;  4LWI A;  3G7E A;  2HG5 C;  5AG2 A;  1J5E B;  1SZX A;  3AK1 A;  2MK3 A;  4QNH B;  1NQT A;  3ABL C;  3NXS A;  4PDM A;  2QDO A;  4JPR A;  2Q67 A;  4DR4 B;  1ORQ C;  4HY6 A;  1JX9 A;  3H4L A;  4PA7 A;  2EIM B;  2QTO A;  4BW5 A;  1IXM A;  4UV8 A;  3EKO A;  2ILM A;  3B28 A;  2XHX A;  1AJP A;  1VQN V;  5B1O A;  5JWP A;  3TZ0 A;  1KUQ A;  3A0R A;  1O9G A;  1WN7 A;  5FNC A;  2Q7H A;  2JGU A;  3E2E A;  1SQB H;  3T1Y O;  4RWU A;  4FM2 A;  1GN4 A;  2BOC C;  2DYS C;  2UU9 O;  1EBO A;  3HEK A;  4WUB A;  3H1K H;  3H1L H;  4MTF A;  1NHI A;  2UWD A;  3ETE A;  2XX4 A;  4DV6 O;  3CRM A;  4DYL A;  4FIP C;  2O1W A;  1MSW D;  3T0Z A;  4R3M A;  1FXK C;  4LF6 B;  4DR5 B;  1BGQ A;  1K33 A;  1THZ A;  4GKJ B;  3JAK B;  1MX0 A;  3HPL C;  4X1I B;  1AM1 A;  4UCV A;  1A32 A;  1Q5O A;  4XC0 A;  2YS8 A;  3CRC A;  2IWX A;  4DZY A;  2OTL V;  4HZ5 A;  2PGG A;  4P8O A;  1RM1 C;  2ITD C;  1H2S B;  4NKG B;  5KHI A;  5LGT A;  5J2U A;  2VCJ A;  5M4E A;  3E35 A;  3N2K B;  2WLK A;  1ZUQ A;  4O4H A;  4MPN A;  4FFB A;  4LF8 O;  2AGA A;  4LF6 O;  2ZNI A;  2Q8H A;  4CWN A;  1F4M A;  2ZT9 B;  4JYY A;  3VQY A;  5M4M A;  1L8D A;  2EBO A;  4TV9 A;  1XEQ A;  1Q7Y W;  3C3S A;  2UUB B;  3ABK C;  3A8T A;  2E5L B;  3CJH A;  1QYE A;  3RYC A;  4MPE A;  3FT5 A;  1XUQ A;  4NXN O;  3AK2 A;  1MG1 A;  3EHJ A;  2EIK C;  2WI2 A;  3B25 A;  2R9A A;  1HWY A;  4AQY O;  3RYH B;  4OX9 B;  3K9S A;  3BFR A;  1Q82 W;  1KMI Z;  3HKC A;  5FPR A;  2NLJ C;  1K9M W;  4TUY B;  1RSO B;  1XL4 A;  1T5E A;  2WLL B;  3RKZ A;  2K5B A;  1HR0 O;  3AG4 B;  5J2T B;  4B3R B;  2CE4 A;  2CH4 A;  3IC9 A;  3TZ4 A;  3DSQ A;  1VF7 A;  2WI1 A;  5L3F A;  4YKW A;  2AXT Z;  4XIP A;  3GWK C;  4X62 O;  1ROP A;  4ASF A;  3DC6 A;  3TZ2 A;  1EZV H;  4DV7 O;  4XCL A;  5B3S B;  1NTZ H;  4I4T A;  4TOI A;  4EFU A;  3JAW A;  1SQV H;  3OEH G;  5EBW C;  2DOS A;  2YGA A;  4AWP A;  1VQ9 V;  1Q90 D;  3LNM B;  3WB1 A;  1RFY A;  3L9D A;  3LPS A;  3HYZ A;  3K58 A;  1UYI A;  2FYU H;  2CCT A;  3O0I A;  3K60 A;  5B1B B;  2BTZ A;  1N32 B;  1I94 B;  4GGL A;  4O04 A;  2EIN C;  4O2B B;  1UPG A;  2A7W A;  1K34 A;  4HXW A;  1GM7 A;  1EFR G;  3FB7 C;  2UXC B;  2E0A A;  2YKI A;  3OPD A;  2A06 H;  2YED A;  1UJW B;  1EZJ A;  1VAR A;  2WLL A;  4K3A A;  4CH4 A;  5DEC A;  3ZN1 A;  4X1K B;  3B4S A;  3G4S V;  3ZHV A;  4CC6 A;  1Z5W A;  4YJ2 A;  1JM6 A;  4JI2 B;  1E1R G;  2DYS B;  4DO2 A;  1VQ5 V;  2XX5 A;  4MPC A;  5L3G A;  1AI5 A;  4V26 A;  1QCE A;  1VF6 C;  4CH3 A;  2IOR A;  1S14 A;  4EB6 B;  3CWB H;  5LXT B;  2ODM A;  3CRK A;  5HFM A;  4I4T B;  2ESA A;  1IBL O;  2PNR A;  4PHZ A;  2JGD A;  3ZKB A;  4J11 A;  1N32 O;  3DXR A;  4DV4 B;  1CP9 A;  3B77 A;  2YKE A;  2A3Q A;  3PEH A;  1JPX A;  1B06 A;  3K5L A;  1TUB B;  2IW5 A;  4NR1 A;  2WER A;  1GN2 A;  4WFF A;  1JJO A;  3E8F A;  5EYP A;  4JI5 O;  5FLX N;  3APQ A;  2DWD C;  3ZCC A;  3ZIA G;  2IJJ A;  4XDJ A;  1KEC A;  3G67 A;  3G75 A;  3BRC A;  2W0F C;  1M9N A;  1ZWH A;  4JTA B;  1W0J G;  2QWP B;  2KQX A;  2WA4 A;  2DW4 A;  1XNR B;  2H8M A;  2B1I A;  4Q6G A;  2V7Q G;  4PV1 B;  3SGI A;  1XHZ A;  4GT1 A;  3UT5 B;  2K9P A;  4X62 B;  1YIJ V;  2JKI A;  5D5Q A;  1R3K C;  1X59 A;  2XAB A;  2YXY A;  3JD3 A;  5JH7 B;  3F5W C;  4YKX A;  2N04 A;  3HHU A;  1OSF A;  3Q4H B;  1AI6 A;  2ZE7 A;  4CS2 A;  1OZ0 A;  4G28 B;  4K0K O;  5BOD A;  1P4R A;  3HR0 A;  3GVM A;  2FWZ A;  1KYO F;  1AP6 A;  1RPR A;  3B8M A;  5KX5 A;  3T1H O;  1YTF B;  1YS3 A;  2HKJ A;  2CH7 B;  3JAL B;  5IN9 A;  1N4C A;  5D6P A;  4LWF A;  2GUZ A;  5L3D A;  4ABM A;  3K03 A;  2IM9 A;  2XAG A;  2LW7 A;  4BQJ A;  5CBH A;  1I7F A;  4ZBM A;  2IOQ A;  3TTZ A;  1AVM A;  2BU2 A;  2BU7 A; 
#chains in the Genus database with same CATH homology
 4ZKI A;  1YTF D;  1SER A;  1YSR A;  4PU9 A;  1U0Z A;  3ZRV A;  3BMY A;  1OCZ B;  3B24 A;  1K4D C;  1RPO A;  2W6J G;  4JAS A;  4UV9 A;  2BU6 A;  2XHR A;  3MNR P;  3RLR A;  1S76 D;  1PNK A;  3D3I A;  1OCC B;  4RQE A;  3CMA V;  1K7D A;  2YI0 A;  5F5R A;  3WG7 B;  3H80 A;  2JJC A;  2WLI B;  5B1A C;  4CZZ A;  2WWW A;  2A0L A;  2EXL A;  4B6C A;  3EHH A;  3A0W A;  3SL2 A;  1Z5A A;  3FB6 C;  3G7B A;  3CRL A;  3PEJ A;  4G2K A;  3F7V C;  2BRE A;  2BOB C;  3E8G A;  4HYP A;  3OGC C;  1Y4M A;  4FCR A;  1UYC A;  1UY7 A;  2D3O W;  4GX5 A;  1KIJ A;  3LDD A;  3LSS A;  1OCO B;  2XAQ A;  2ZR2 A;  1H7S A;  3K0D A;  1AR1 B;  1H38 A;  3LSQ A;  3ZXO A;  4CE2 A;  2JK5 C;  2EIJ B;  2EIJ C;  2UXX A;  4PA4 A;  5IY5 B;  4MVS A;  5H9C A;  4R1F A;  5CTW A;  1KKD A;  2M7W A;  3FV5 A;  3FB5 C;  2IOP A;  3HZ1 A;  2X6A A;  3W7X A;  2P7T C;  2HLD G;  4KQV A;  2QG2 A;  1GM9 A;  4CBC A;  3OMN B;  3CXC U;  4MTO A;  4U7O A;  3KE6 A;  4CWR A;  1ARO P;  2Y69 B;  1GTO A;  4MOT A;  4MW8 A;  1I5A A;  2YEF A;  4MP2 A;  3SPJ A;  3BY6 A;  4FCQ A;  4WFA V;  3B8N A;  4QE9 A;  3K97 A;  4URO A;  2HJF C;  3T2M A;  4I9W A;  2YE9 A;  3LDE A;  4ASU G;  2IU0 A;  2BU8 A;  1Z5B A;  3A0X A;  4QPJ A;  3CCS V;  1JVM A;  5H6Q A;  1K3E A;  3FYE B;  4MTG A;  1N8R W;  2XK2 A;  3R4O A;  4HY1 A;  1YJN V;  4HZ0 A;  5EC1 C;  4WCE V;  5M4K A;  5CTU A;  4U7N A;  3CGY A;  1VQP V;  1PD3 A;  3CCJ V;  5KUK A;  2XCM A;  3K99 A;  3OMU A;  2QF6 A;  2WLH A;  4E2L A;  3WG7 C;  1Y8P A;  2Q2E B;  5EBM C;  1V54 C;  4DUH A;  1G4Y B;  3E8H A;  3K04 A;  2IJH A;  3ASN B;  4X88 A;  1PVG A;  3Q5L A;  3RLQ A;  3AEI A;  5B3S C;  1BHB A;  2YKB A;  2YEJ A;  3H01 A;  4EMV A;  2P90 A;  3CCL V;  1B63 A;  1YIT V;  3SYP A;  4CE3 A;  2EIN B;  4JAV A;  4KSH A;  1ENV A;  1THN A;  3AG4 C;  3HB3 B;  2OTJ V;  2W6I G;  2YE8 A;  3OM3 B;  5CN0 A;  3OAA G;  3K98 A;  3SYO A;  4PDL A;  1GJV A;  4GFN A;  5B1B C;  4MW3 A;  3CC2 V;  2DWE C;  1YC3 A;  1H2G A;  2WLN A;  5B1N A;  2WI5 A;  1W2B U;  5FND A;  1W0K G;  4P9P A;  4P9O A;  3DGE A;  3QO8 A;  4BAY A;  1BL8 A;  5L3C A;  1NR7 A;  1I59 A;  1ZXM A;  4H7Q A;  2O1V A;  1S0V A;  4E02 A;  4MTX A;  1G8M A;  2XOK G;  4FMT A;  2YKJ A;  3R65 A;  3GIF A;  1GKF A;  4PA9 A;  1QVG U;  4X9L A;  1K5S A;  4MVR A;  1Z59 A;  2C2A A;  3ZKD A;  2Q68 A;  3B26 A;  2EIK B;  1Y8O A;  3RBZ A;  3CD6 V;  1UYG A;  2YK9 A;  5F3K A;  3ASO C;  2DYR C;  2GSM B;  1Y4U A;  4KUM A;  2XJG A;  4YXW G;  1TH8 A;  2XX2 A;  3O2F A;  5M4H A;  1YI2 V;  2BT0 A;  3MD0 A;  3R4M A;  1OHH G;  4BIU A;  1TC0 A;  5CA3 A;  3CCE V;  3SYQ A;  3T1K A;  4EGK A;  2ITC C;  2LP7 A;  3FYI B;  1S77 D;  2BYI A;  1KP2 A;  1XL6 A;  3AG2 B;  2YEV B;  3E8B A;  3ABU A;  3ASN C;  1AH8 A;  4MBC A;  1KC8 W;  4J9Z B;  3ZM7 A;  4L91 A;  1YER A;  1U2O A;  2IWS A;  3JYC A;  5J9P C;  1K73 W;  1DF5 A;  2EIL C;  1Y66 A;  1NHH A;  2YE2 A;  2YKC A;  4ZVI A;  3ZMS A;  2OCC C;  1M57 B;  1YSZ A;  3AG3 B;  3GWO A;  2ZXW B;  2QFO A;  2YJX A;  4YKU A;  5CPH A;  1E1Q G;  1H7U A;  4G27 B;  1FXH A;  3Q5K A;  3U2K A;  4CWQ A;  3INX A;  3DTU B;  1WLE A;  3A0Y A;  2ATK C;  3EHG A;  1AH6 A;  1UY6 A;  4GQT A;  4MVQ A;  3K79 A;  4MVM A;  2XJJ A;  2EZP A;  2YSU B;  2YE3 A;  3AG2 C;  5GW7 A;  3WFV A;  2EZO A;  3KG2 A;  1VQ6 V;  1NVP B;  2BZ5 A;  4UVB A;  2X0L A;  4YKY A;  4JF3 A;  3JD4 A;  2ZQM A;  4HZ3 A;  1UY9 A;  2R9I A;  3SPG A;  1L0O A;  4NH8 A;  4TWK A;  1L1F A;  3ASO B;  3CCQ V;  2V1D A;  5IY5 C;  3QNE A;  4WF9 V;  3JCZ A;  3ABK B;  4B7P A;  2ZDI C;  1R6K A;  4MP7 A;  3C0E A;  4WFG A;  3X2Q B;  4DXW A;  1GMG A;  4XDL A;  5D7R A;  1GM8 A;  2XAJ A;  4JYB A;  4PA3 A;  3VHC A;  1S3J A;  3CP1 A;  4MSW C;  3CWV A;  3EFF K;  3K9A A;  3W7U A;  3CCR V;  4GX1 A;  1R62 A;  1YT2 A;  2Q69 A;  2H94 A;  4J9Y B;  1YJ9 V;  2DQ3 A;  1FXK A;  2VCI A;  4H81 A;  3D36 A;  4MVU A;  5E1A C;  1S5H C;  3ZJZ A;  3ZRW B;  4FCP A;  5CTX A;  4LWG A;  2GFD A;  3E83 A;  3E86 A;  3RVY A;  3JD0 A;  4YKZ A;  2EJR A;  4GCZ A;  4TT3 G;  1NHJ A;  2YE4 A;  2HVJ C;  1AI7 A;  1GKX A;  2XD6 A;  2YE7 A;  4O09 A;  4WFH A;  2XAH A;  2Y69 C;  2X6C A;  2LFS A;  4XIT A;  4XTJ A;  3T2S A;  5CMU A;  2A9H A;  1QR9 A;  1US7 A;  2WI4 A;  4PL9 A;  2YE6 A;  3IFX A;  2DYR B;  4MVO A;  5L3B A;  2XAS A;  1MAB G;  4XKA A;  4FK5 C;  5FNF A;  5EC2 C;  3P32 A;  2WLM A;  2HCH A;  3EKR A;  4MB9 A;  4AS9 A;  4LCU C;  2WI3 A;  5IYD O;  3VHA A;  1YT0 A;  4KFM A;  4HYM A;  1H8E G;  4EGH A;  3CME V;  3RW0 A;  1TIL A;  5M4N A;  4OXS A;  4UXN A;  1ZW9 A;  1E79 G;  1KP3 A;  1PNM A;  1I58 A;  2WI7 A;  5IDM A;  4LWI A;  3T4Z A;  3BEH A;  1EI1 A;  3G7E A;  2HG5 C;  4P2Z A;  3SPC A;  1UYK A;  2YGF A;  3OW2 U;  3OMI B;  5IYC O;  1BMF G;  1QY8 A;  1F51 A;  2MK3 A;  4QNH B;  1NQT A;  4LBE C;  3ABL C;  1OCC C;  3NXS A;  3K08 A;  4UUJ C;  2P67 A;  4JPR A;  4PDM A;  2Q67 A;  4KTN A;  1F23 A;  2JEX A;  2CGF A;  3IED A;  2UXN A;  1ORQ C;  5EK0 A;  4HY6 A;  1JX9 A;  2YE5 A;  4UVA A;  4PA7 A;  3ZN0 A;  3H4L A;  2EIM B;  2QTO A;  5H6R A;  4BW5 A;  1IXM A;  3MHH C;  3QDD A;  4UV8 A;  4CWP A;  4RO2 A;  3EKO A;  1SRY A;  5LHI A;  1EA6 A;  1K92 A;  2WLI A;  4QE7 A;  3GIG B;  1BKN A;  2XHX A;  3G71 V;  3B28 A;  1SZT A;  1AJP A;  1VQN V;  3CCM V;  2ZBK B;  5B1O A;  3TZ0 A;  3ZRW A;  4O0B A;  1NKD A;  4R8C A;  3A0R A;  4URL A;  3STL C;  4WFB V;  1AJQ A;  3FT8 A;  4NH9 A;  2QM7 A;  4BIZ A;  5L3E A;  4WUD A;  2QEX V;  1YC1 A;  5FNC A;  4PRV A;  3PJS K;  3E2E A;  3OE7 G;  3OUF A;  4GX2 A;  3I56 V;  1F4N A;  1M1K W;  2O1U A;  2YI5 A;  5LGN A;  3CGZ A;  4URN A;  4BQG A;  2BOC C;  1R73 A;  2DYS C;  3CCV V;  1UY8 A;  1EBO A;  3QO7 A;  2ZXW C;  1VQ7 V;  3GIG A;  5FL7 G;  3HEK A;  1PKX A;  2ZR3 A;  4WUB A;  2UWD A;  4KP4 A;  4MTF A;  1NHI A;  4PDV A;  4E01 A;  1ID0 A;  3ETE A;  4F4L A;  2CG9 A;  2YEB A;  2XX4 A;  4NH7 A;  2XAF A;  2IJK A;  1MU5 A;  3EHB B;  3K3W A;  5M4P A;  1FS0 G;  4FIP C;  1S16 A;  2O1W A;  2YGE A;  1MSW D;  4AWQ A;  1QR8 A;  4XKO A;  2XHT A;  1FXK C;  4GX0 A;  4R3M A;  5BOC A;  1VQL V;  3T0Z A;  2ZD9 A;  3VHD A;  1BGQ A;  2XND G;  1K33 A;  1THZ A;  4LP0 A;  2K1E A;  1MX0 A;  2QKS A;  3HPL C;  1B62 A;  3HZ5 A;  1AM1 A;  1B6Q A;  4ASA A;  2ZDX A;  1JJ2 U;  4XC0 A;  1S72 V;  1KZN A;  3QTF A;  2NNU A;  4L90 A;  1K5Q A;  1ZXN A;  5D6Q A;  2IWX A;  2Q8G A;  4DZY A;  5DM6 V;  2H8P C;  2OTL V;  4HZ5 A;  2P6J A;  4P8O A;  1RM1 C;  2ITD C;  3LDC A;  4CWF A;  5LGT A;  3OWB A;  2VCJ A;  3TK1 A;  3UKM A;  4EEH A;  4X89 A;  3E35 A;  5M4E A;  1OCR C;  2WLK A;  1V55 B;  1M57 C;  2IH1 C;  3W7W A;  2Q8I A;  4V25 A;  1GKZ A;  4MPN A;  1QZR A;  2Q8H A;  2EIL B;  4H37 A;  2FXS A;  5GGZ A;  3GB7 C;  3R92 A;  1JCH A;  4I3H A;  1VQO V;  1TBW A;  4CWN A;  2YI6 A;  1F4M A;  1NR1 A;  3X2Q C;  2BSM A;  3AG3 C;  2YJW A;  3FB8 C;  2EBO A;  4JTD B;  3Q5J A;  3AG1 C;  1Q7Y W;  4GT8 A;  4PRX A;  3ABK C;  4R3A A;  4RUF A;  4XD8 A;  1GO3 F;  3SJQ C;  4FJC C;  1YHQ V;  1I5C A;  2AHY A;  1QYE A;  1VQM V;  3ZRX A;  4UVC A;  5LBQ A;  2JIZ G;  4PDR A;  4MPE A;  2XDL A;  3FT5 A;  3CCU V;  1H8H G;  3K06 A;  5LGU A;  1MG1 A;  1FXV A;  1AJ6 A;  1Z5C A;  3EHJ A;  1Y8N A;  2EIK C;  3RVZ A;  3NMQ A;  2WI2 A;  3WHA A;  1BXD A;  3ABT A;  5KUM A;  3B25 A;  1AMW A;  1HWY A;  3A0T A;  4XIR A;  1MOF A;  3ETG A;  4U93 A;  1P7B A;  3SYC A;  2QM8 A;  1R3I C;  4CWS A;  1Q82 W;  1DF4 A;  1UYF A;  3K0G A;  2R9R B;  2XJX A;  2WAM A;  2NLJ C;  1K9M W;  4O07 A;  3ABL B;  4O05 A;  1QBZ A;  3VAD A;  1XL4 A;  3EHF A;  1VQ8 V;  2WLL B;  2ZDY A;  3RKZ A;  2K5B A;  1QLE C;  4TSF G;  3AG4 B;  3CC4 V;  3T10 A;  1TUE B;  1V55 C;  3CYO A;  1AJN A;  1M56 C;  2YEV A;  4JQL A;  2CK3 G;  2WI6 A;  5CF0 A;  4KSG A;  3SPH A;  3MHS C;  4MT8 A;  3ML0 A;  3E89 A;  2BU5 A;  2CH4 A;  1A4H A;  3TZ4 A;  3BM9 A;  2HKO A;  2WI1 A;  1GK9 A;  2EIM C;  1YES A;  5L3F A;  4YKW A;  4RUE A;  1NJI W;  4XIP A;  3AG1 B;  3OMA B;  4Z1M G;  4XDK A;  2XDU A;  3D0B A;  4CWO A;  2WSS G;  1ROP A;  1WPX A;  4ASF A;  3TZ2 A;  4XCL A;  5B3S B;  4JGS A;  2YEC A;  3OW6 A;  4EFU A;  3OEH G;  5EBW C;  4I5S A;  4URM A;  4RQF A;  2YGA A;  4AWP A;  1YSC A;  2WLJ A;  1VQ9 V;  1Q86 W;  1UYM A;  3RLP A;  4EFT A;  3LNM B;  4XE2 A;  2CCU A;  2ZKJ A;  3ZMU A;  1PL0 A;  2H55 A;  3LPS A;  3P30 A;  4BXI A;  3HYZ A;  4EGI A;  1LNQ A;  5B1A B;  5CBF A;  1UYI A;  2CCT A;  1YJW V;  1I5B A;  3W7T A;  3O0I A;  4MVZ A;  1NH2 D;  2BYH A;  2Y48 A;  5B1B B;  3K60 A;  2BTZ A;  2OT5 A;  3I55 V;  3OR7 C;  4E00 A;  4PEL A;  4GGL A;  1OCZ C;  4O04 A;  5L3J A;  2EIN C;  3JD1 A;  2F43 G;  2AHZ A;  3IC7 A;  1I5X A;  3TZ5 A;  1FFT B;  4ASB A;  2QA4 V;  1K34 A;  2B1G A;  2FYP A;  2QG0 A;  2XDK A;  4HXW A;  1GM7 A;  1NBM G;  3SYA A;  1EFR G;  3FB7 C;  2PI4 A;  1FXK B;  2E0A A;  2JJ1 G;  2YKI A;  3OPD A;  1OCO C;  2HG1 A;  2JJ2 G;  4QJF B;  2YED A;  3ETD A;  4L8Z A;  1UJW B;  1EZJ A;  2WLL A;  3F7Y C;  1NH2 B;  2WEQ A;  3ABM C;  3M99 B;  4W7T A;  2PI5 A;  2X6B A;  5KA5 A;  1I5D A;  2YEI A;  3ZN1 A;  1Q81 W;  4AWO A;  1PNL A;  4HYO A;  3OUS A;  3G4S V;  3ZRS A;  1NVP D;  3G6E V;  4FPP A;  3FKS G;  1JM6 A;  2A79 B;  4XDM A;  4HAM A;  1E1R G;  2DYS B;  2BRC A;  4LPB A;  4DO2 A;  5DN6 G;  1VQ5 V;  2XX5 A;  4MPC A;  3ZMT A;  3WQ9 A;  5L3G A;  3CC7 V;  3ZXQ A;  1AI5 A;  2FWY A;  2IH3 C;  4V26 A;  1KQS U;  1QCE A;  3T4D A;  2IOR A;  2Z5U A;  4KFG A;  1VQK V;  2WPD G;  3STZ C;  1BHA A;  1S14 A;  3D2R A;  2LFR A;  5IYB O;  5J6A A;  5FWK A;  1Y4S A;  4H85 A;  3U67 A;  1SET A;  4XKK A;  3CRK A;  4QPK A;  1OCR B;  5HFM A;  5KA6 A;  2ESA A;  2IJI A;  2QE7 G;  3UM7 A;  1R3L C;  2PNR A;  1VQ4 V;  3INW A;  2Q8F A;  3ZKB A;  4MS2 A;  3U2D A;  4N21 A;  2B5U A;  1CP9 A;  1V54 B;  3B77 A;  3VOU A;  1UYL A;  2XDS A;  4EKW A;  2YKE A;  1JPX A;  4N23 A;  1YC4 A;  2VWC A;  3PEH A;  1QLE B;  2IW5 A;  4X8A A;  3T1C A;  4QIW F;  2YI7 A;  3B27 A;  2WER A;  1YET A;  4WFF A;  4R6Z A;  3E8F A;  1BYQ A;  2YEE A;  5LHH A;  4WUC A;  2YEA A;  2KB1 A;  4HXZ A;  5CBG A;  4XBF A;  2GHY A;  2IU3 A;  4CWT A;  5M4M A;  4YKR A;  3ZMZ A;  3OFN G;  2DWD C;  2OCC B;  3JD2 A;  3ZCC A;  2IJJ A;  2DQ0 A;  4XDJ A;  3ZIA G;  1QLN A;  1B3Q A;  2HFE C;  3A0Z A;  2WEP A;  1KEC A;  3R4P A;  2JDI G;  1JQ0 A;  1R3J C;  3T0H A;  2IWU A;  2VW5 A;  3GIE A;  4ASG A;  2X7R B;  2Q6A A;  3G75 A;  3TCU A;  5J71 A;  2W0F C;  1K8A W;  4L94 A;  3OEE G;  3OWD A;  1M9N A;  1ZWH A;  4JTA B;  1W0J G;  3C11 A;  1DLB A;  1SES A;  1R6N A;  4RAI A;  2JEU A;  5D7D A;  4LP8 A;  4JYC A;  2DW4 A;  4LWE A;  2H8M A;  2B1I A;  5IDJ A;  2GQP A;  2V7Q G;  5D7C A;  2HVK C;  4JTC B;  3TET A;  4EM7 A;  2CCS A;  4Q20 A;  4YKQ A;  5EBL C;  4GT1 A;  4XIQ A;  3ZMV A;  4BAE A;  4L93 A;  1YIJ V;  2JKI A;  3O6O A;  1R3K C;  1KD1 W;  4H33 A;  1M90 W;  5BZB A;  3JD3 A;  1COW G;  1M56 B;  1TID A;  2XAB A;  5CTY A;  3F5W C;  4YKT A;  4WFE A;  4YKX A;  3OR6 C;  1YT1 A;  3HHU A;  4R7C A;  1OSF A;  3LNU A;  3SPI A;  4P30 A;  1JOY A;  3VBB A;  1AI6 A;  2YEH A;  1TC6 A;  3CPW U;  4L87 A;  2ZDI A;  1J95 A;  1OZ0 A;  3R91 A;  4G28 B;  2XDX A;  3LUT B;  4XCJ A;  4R50 A;  1P4R A;  1UYE A;  3HYY A;  1K97 A;  1ZWI C;  4CE1 A;  5BOD A;  3TUH A;  2FWZ A;  3W7S A;  1RPR A;  3B8M A;  3QO5 A;  5C93 A;  1YTF B;  1YS3 A;  1QVF U;  2HKJ A;  2AKP A;  4P7A A;  5IN9 A;  4PA6 A;  1K4C C;  5HFL A;  2YK2 A;  1I5Y A;  3IGA C;  3R4N A;  4K4O A;  4LC1 A;  4LWH A;  5D6P A;  3ABM B;  4LWF A;  5L3D A;  5LHG A;  2YEG A;  2FTK A;  1AI4 A;  1RM1 B;  4JAU A;  1DTO A;  3K03 A;  2XAG A;  1CEZ A;  4BQJ A;  5CBH A;  1UYH A;  4ZBM A;  2IOQ A;  2Z3Y A;  4GEE A;  1CPY A;  2HR3 A;  2BU2 A;  3TTZ A;  1UYD A;  2BU7 A;  3JZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...