3DGEA

Structure of a histidine kinase-response regulator complex reveals insights into two-component signaling and a novel cis-autophosphorylation mechanism
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
237
structure length
237
Chain Sequence
KRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/signaling protein
molecule keywords Sensor protein
publication title Structural Insight into Partner Specificity and Phosphoryl Transfer in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 69
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3dgeA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3dgeA02
3ZRXA 1JOYA 1YT0A 5CF0A 5D6QA 3FT5A 4YKQA 2ZBKB 4ASFA 3D0BA 2YI5A 3T0HA 4MP7A 1H7UA 4I3HA 1UY7A 3TTZA 4PRXA 4BXIA 2YI7A 1AH8A 4R3MA 4YKUA 4CE1A 2IWXA 1UYGA 2BYHA 1GKXA 3T2SA 1QYEA 1UYFA 1YSZA 4GT8A 4ASAA 3QTFA 5D7CA 4QPKA 4LWFA 3T0ZA 2YI6A 3EHJA 2YE8A 3P32A 1TBWA 2BSMA 2YKBA 2BTZA 4LWGA 4HZ5A 2YEDA 3JZ3A 2O1UA 4AWOA 4V26A 4XTJA 4JQLA 5CPHA 5J6AA 3OW6A 2FWZA 1UY6A 3R91A 3ZXOA 4HZ0A 1YETA 2BU6A 3VHCA 4GGLA 4Q20A 2O1WA 4KSGA 3B27A 1U0ZA 1IXMA 4UROA 1BKNA 2BYIA 4MPNA 3WQ9A 4HXWA 2IWSA 1Z5CA 2LFRA 2YEAA 3GIEA 4U93A 3OMUA 4XITA 4MT8A 1MX0A 1QZRA 4CWNA 1GKZA 4BQJA 1YC1A 4URNA 4NH7A 5BOCA 4V25A 3ZM7A 3EHHA 2BREA 4GCZA 2JJCA 1US7A 4E02A 4U7OA 5B1OA 2WEPA 2BRCA 2YI0A 3PEJA 2XX4A 3B26A 2XX2A 4ASBA 4KTNA 2H8MA 1THNA 2YGAA 4JASA 4MBCA 5IDMA 3PEHA 2HG1A 4LPBA 5D7RA 2XJGA 4NH9A 3K98A 4ZVIA 2XDSA 1YC3A 4L91A 4EEHA 4YKZA 3WHAA 2BU8A 2PNRA 4MB9A 4EGKA 3K60A 4MPCA 3T1KA 5CTWA 4L93A 1ZXMA 4CWOA 1YSRA 2K5BA 4CWFA 2QF6A 3GIGA 5BODA 3RLRA 3SL2A 2YEBA 1UYLA 2BT0A 2CCSA 3K99A 2XCMA 1UYHA 1Y4SA 3C11A 4GFNA 3H80A 2XK2A 2YE7A 4L94A 2BZ5A 1AMWA 4XDMA 5CTXA 3FT8A 3EHFA 2WI3A 1I58A 4LWIA 2BU7A 1ZW9A 4DUHA 1TC0A 3B25A 2ZDYA 1OSFA 4LWHA 1Y8OA 3Q5JA 2WWWA 2YE5A 2YGFA 5F3KA 4U7NA 1YS3A 3TK1A 3CGZA 3VHDA 4E01A 2IWUA 4HXZA 1UYDA 4YKWA 1Z5AA 4MOTA 4LP0A 5J71A 2YE9A 3NXSA 2HKJA 4GQTA 2ESAA 4O09A 1EI1A 2VCIA 1B3QA 2YKJA 3QDDA 4XCJA 2H55A 1TILA 4L8ZA 4X9LA 1S14A 1Y8NA 2XHRA 4XE2A 5M4NA 3HYZA 1JM6A 2XDKA 5FWKA 3R4PA 2YK2A 3KE6A 2WI1A 4PRVA 4H85A 5F5RA 2JKIA 2YGEA 1YESA 2XDLA 2YEEA 3O2FA 2XDXA 2WEQA 4P7AA 2YK9A 2YEJA 3TZ0A 3A0RA 4JYBA 2GFDA 1QY8A 2XJXA 2CG9A 4HYPA 4EFUA 2QFOA 3TZ4A 4I5SA 3Q5KA 1A4HA 4EFTA 4YKXA 4XD8A 2XX5A 1Z59A 4KQVA 1UYMA 4XIPA 3ZRVA 4CWSA 1AM1A 3A0WA 2CH4A 4FPPA 2IOQA 1S16A 4HYMA 3C0EA 1MU5A 3ZRWB 2YE3A 3G75A 2WI5A 5C93A 3GIFA 4P8OA 4R1FA 1NHHA 4LC1A 4MPEA 4PL9A 2C2AA 3MD0A 1YERA 2QG2A 4XIRA 2XDUA 2YEGA 3B24A 2BU2A 3G7BA 2YE6A 5CTYA 5IN9A 4CWPA 3U2KA 1I5AA 2QM7A 1TH8A 3O6OA 4BQGA 2O1VA 4AWPA 2VCJA 2YKEA 4CE2A 4BIZA 2CGFA 4HY1A 3BM9A 3D2RA 4B7PA 3H4LA 3A0XA 3LPSA 5GGZA 4CE3A 2YE2A 4H81A 1TC6A 4PU9A 2WERA 4CWTA 4XKOA 4ZKIA 5M4HA 4QPJA 3T10A 3LNUA 3RKZA 3K97A 4E00A 4XKAA 2WI6A 4EGIA 2YJWA 3CGYA 1Y8PA 3EKRA 2Q8HA 2P67A 2ZKJA 1NHJA 5CTUA 3EKOA 3A0ZA 2YE4A 3IEDA 3HZ5A 3TZ2A 5FNCA 5M4MA 3A0YA 2BU5A 3O0IA 1GJVA 1PVGA 5M4KA 2QG0A 5FNDA 1UYEA 3TUHA 4KFGA 4XC0A 4ASGA 4CWQA 5M4PA 2WI7A 4H7QA 1YT2A 4KP4A 1TIDA 4O04A 4BAEA 3DGEA 3HZ1A 1Z5BA 4FCRA 4B6CA 5M4EA 1ID0A 2FWYA 4O07A 4JYCA 4GEEA 2YECA 2YKCA 4O05A 4XIQA 5FNFA 2QM8A 1KZNA 3RLQA 3VHAA 4EMVA 4XKKA 2YJXA 3ZXQA 3U67A 2XHXA 4AS9A 4L90A 1I5BA 2WI4A 2VWCA 3A0TA 2XABA 3HYYA 3CWVA 3CRLA 3INXA 4FCPA 1UY9A 2XD6A 2ZDXA 4JAVA 3NMQA 3ZCCA 3ZKDA 1L0OA 3FV5A 2LFSA 1AJ6A 5D7DA 2EXLA 1I5DA 3ZKBA 2FTKA 3EHGA 3OWBA 4WUDA 1UYCA 3U2DA 2UWDA 4EM7A 3MNRP 5D6PA 3INWA 1BGQA 4XCLA 2Q8FA 4W7TA 1EA6A 2VW5A 2Q8IA 1UYIA 3OWDA 1KIJA 3TZ5A 4WUCA 4O0BA 1UY8A 2CCTA 3VADA 3Q5LA 1I59A 1I5CA 1UYKA 5L3JA 4URMA 4JAUA 4URLA 4EGHA 1B63A 1YC4A 1F51A 1AH6A 2FYPA 4YKTA 4DZYA 1ZWHA 2YKIA 3HEKA 3GIGB 4FCQA 1BYQA 3HHUA 2AKPA 3BMYA 4K4OA 1Y4UA 2Q8GA 2XHTA 2XJJA 4KSHA 4NH8A 4HY6A 2E0AA 4R3AA 3R4NA 2IORA 4CWRA 3B28A 2YEHA 1H7SA 4AWQA 1BXDA 2GQPA 4LWEA 4GT1A 4MTXA 4BIUA 3CRKA 1B62A 4MP2A 1U2OA 3R4OA 3R92A 2FXSA 2CCUA 3G7EA 3OPDA 1R62A 4FMTA 1YT1A 5B1NA 5IDJA 2YEFA 3ZRWA 4YKYA 4WUBA 2HCHA 2YEIA 3RLPA 4YKRA 2WI2A 3R4MA 2IOPA 2Q2EB 3D36A 1NHIA 1ZXNA
chains in the Genus database with same CATH superfamily
3ZRXA 4G2KA 1YT0A 2IH3C 4HBNA 2CTRA 2ZBKB 5TISZ 2AZ0A 4C7UA 3D8CA 3BPZA 1IBKB 3IJ4A 1UY7A 3TTZA 4PRXA 3E22B 1JCHA 2N74A 1NVPB 5JENA 4O2BB 1QHTA 3WB2A 4O4LB 4YHHB 2JDIG 4JTAB 1VQ4V 4IIJB 5CBGA 3JAKA 1RPRA 1XHXA 4FLWA 4JYAO 2HJDA 4QPKA 4CS2A 4B3MO 3SDLA 3ZJZA 3K0GA 1SKVA 1KU9A 4NTYA 1VQLV 5ITZA 3OTOB 3JALA 4G27B 3C3TA 2XHBA 1FD9A 1NVPD 1H38A 3BA8A 2O1UA 4AWOA 4YJ2A 3OW6A 2FWZA 1UY6A 2A79B 2LGWA 5HFMA 1YETA 1ZLZA 4P2ZA 4P30A 3LDCA 3VHCA 1EN4A 2FMLA 2B1IA 4LWSA 4DUZO 4I55B 1BKNA 5KHGA 4MPNA 3WQ9A 4HXWA 1QLNA 5LGUA 4U93A 3OMUA 2V7QG 4WFAV 1GKZA 4BQJA 4XDLA 3DC6A 1N36B 4FJCC 5EIBD 2NN4A 1PL4A 2UXNA 3OTFA 4J7KA 2Q73A 3CEIA 3ZM7A 1US7A 3VQWA 3K5LA 3PEJA 1BGYH 1VQ9V 4X62O 2XX4A 4DV1B 5JCOC 1P7BA 1KP2A 4MTOA 3CB2A 5LMNO 3UO3A 4LF9B 4ASBA 2FYUH 4KTNA 2YGAA 4JASA 4MBCA 4I0XA 4CS4A 3MHHC 1R6NA 3HPLC 3VQYA 3HKDA 1Q3EA 4CC5A 1A32A 2XDSA 1YC3A 3AK2A 3CCUV 4NXNO 3RYCA 4DV6B 4YKZA 2HHIA 4LFAB 1NTZH 2GBOA 2YC0A 2PNRA 3CRQA 4MB9A 3CWBH 4EGKA 3K60A 4DXWA 3T1KA 4L93A 1QQCA 5L3CA 4CWOA 2F4VO 2BSKB 3K99A 2XAFA 2XCMA 1BMFG 4X1YB 2WPDG 3TETA 1N33O 1SQVH 4BWAA 3FT8A 2QWRB 1FFXB 1XMOO 3EHFA 4BW9A 3ML0A 2LW7A 5L3BA 1XREA 1IVSA 2M7WA 1JR9A 3H01A 1Y8OA 3RYIA 3Q5JA 2YGFA 1YS3A 2CH7B 3JARA 3CGZA 3VHDA 2IU0A 4RWUA 2R9RB 4JYAB 4DW0A 4WBNB 5EC2C 4B3MB 2YE9A 1LUWA 1JQ0A 2HVKC 3OEHG 5KX5A 4WF9V 4O09A 5EBWC 3SJBC 2VCIA 5B3SB 4D7SA 1Q43A 3K08A 2OIGA 1P49A 1SZTA 2EIKC 2JVDA 4X9LA 1AI6A 4MVOA 1Y8NA 2OCCB 3E22A 5EC1C 3HYZA 2RJZA 3OGCC 1GO3F 4K8ZA 1SQXH 3E8HA 3KE6A 2WI1A 4O2BA 3C90A 4H85A 5E79Z 2YGEA 3QO5A 4DR3O 4IIJA 3CCLV 1COWG 4DUZB 3ZN0A 3O2FA 1E1QG 3W7TA 2WEQA 1XL6A 4MTFA 1PNKA 2YEJA 2E5LO 3TZ0A 4FLZA 3A0RA 1QY8A 4NXMO 2ZDIC 4HYPA 1TGOA 3OGIB 4Z2WA 1RP3B 1Z5WA 4J7ZA 2JIZG 3SYAA 3Q5KA 1N0JA 1R3IC 1IX9A 2FL4A 1XNQO 4OGQB 1VQMV 3ABKC 1FPOA 4KHPO 5LP6C 4TSFG 3RT3C 2DMXA 2ZXWB 3ABTA 1H2LA 1ROPA 1XUQA 1WB8A 4X62B 4FPPA 2D3OW 1M93A 2IOQA 5A2QN 3RBZA 1H2GA 1VQ6V 4I55A 5LMNB 3FYIB 2HKOA 2O57A 2WI5A 3JAMN 3F5TA 3GIFA 3T2MA 1Q5OA 1PP9H 3TCUA 4R1FA 3RGBA 2BTQB 4DO2A 4LFBO 4NTXA 2BU2A 2EIMC 3LNNA 5IN9A 4NXNB 5KAIZ 5K1PA 3G71V 1MMMA 4CS3A 2ZNIA 3JD1A 3BRCA 1R73A 2EZPA 2F93B 5KHKA 4NR1A 4AWPA 2VCJA 3K5MA 2CTQA 2Q5ZA 4GX5A 3DTUB 3CCQV 3JD2A 4QNHB 1ENVA 1FXKC 2F4VB 4X9QA 5CBHA 3OR7C 4H81A 4J80A 4WFFA 5IJ9B 2WERA 1N33B 3CYOA 3ZMUA 4MVRA 3BEHA 1XMOB 4DRXB 5BY1A 3OAAG 1K5QA 2YUAA 1PNLA 3CGYA 2NR5A 1JJ2U 1Y8PA 3ZHQA 1NHJA 5CTUA 1GM7A 3A0ZA 2YE4A 1SQBH 3E35A 4HYOA 5CA1B 3HZ5A 4DR1O 4CH5A 4JZ2A 3O0IA 1PVGA 4LBEC 2Q7EA 1K8AW 2YIAA 3TUHA 2HG5C 1YI2V 2ZE7A 2IM9A 4JI2O 3NR7A 3SYQA 1GKFA 1OCZB 4UCOA 4CWQA 2DWEC 3CXCU 4X1YA 1QR9A 4H7QA 4O04A 1M56C 4X1KB 1FFXA 2Z0AA 2FWYA 3CP1A 3RWRD 2AHYA 3CMEV 1VARA 4HNAB 3U10A 4H0LB 1MOFA 1NBMG 1MG1A 3BABA 4EMVA 1GH6A 1M9NA 1E79G 3DXRB 4FZ0A 2XHXA 4AS9A 1FXHA 2VQFO 1I0HA 3SJQC 4PA6A 1NZ6A 2CH7A 4LF6O 2E74B 3HYYA 3INXA 3CRLA 4DR3B 2JGUA 2XD6A 3OE7G 4LNUB 5LGNA 1DK1A 2ZDXA 4JAVA 4WBNA 3FV5A 3SR2C 2Q69A 2E5LB 1I5DA 2FTKA 2EZOA 3EHGA 3OWBA 4CH4A 1XMQO 4NXMB 3PN1A 1P4RA 1UYCA 4CH3A 3MNRP 1BGQA 2DQ3A 1EA6A 2Q8IA 3FYEB 4Q6GA 1BHAA 1VQ8V 2F95B 4UVCA 1NJIW 1XOUA 1XNQB 2YXLA 4KHPB 3CRRA 3Q5LA 4LF5O 4ZI7B 4URMA 4IGGA 2PY5A 4URLA 2HR3A 2WLHA 2XAGA 3K5OA 2UXCB 5H5NA 1G1XB 2QE7G 3ASNB 3ZHUA 1GN2A 3BMYA 3TXQA 1ZUQA 3K04A 4PA7A 5JVDB 4W4LA 4LFBB 4P9PA 2XJJA 3GVMA 5KAFZ 5DM6V 2IORA 4CWRA 3SYOA 3CCVV 1H7SA 3J81N 3CRKA 3BAAA 5B1BC 2GSMB 2CCUA 1JJOA 3VBBA 3OPDA 1W2BU 4DK0A 1YT1A 2F66C 1OJHA 2ETNA 1Z2GA 2HCHA 2YEIA 5LA6B 4PDLA 2WI2A 3ETEA 2CDYA 1NR1A 2NLJC 3D36A 1VIBA 2BTQA 2H94A 4U3FH 4YKQA 2CTWA 4ASFA 2LW1A 3D0BA 1F4MA 1GTOA 1BQZA 4MP7A 3ZMTA 3BA9A 1NR7A 2BTOA 2PUSA 2ARHA 4UVBA 1AH8A 5LHGA 1NKDA 4DR1B 4YHHO 2IWXA 3QF7A 2Q8VA 3ZHTA 4GT8A 4ASAA 4JI2B 3FKSG 4HZ3A 3ZS8C 1IBLO 2Q4PA 5IJ9A 1ZSPA 1YJWV 5JH7B 3X2QC 1TA8A 1Y74B 1F4NA 2EIKB 2YE8A 4XDKA 3P32A 2BSMA 1X4TA 4DRXA 2ZE6A 2IJJA 2AXTZ 3RW0A 2QWOB 3QO8A 4XDJA 2VWKA 2YI9A 1Q6IA 3E8BA 5CA1A 3CC7V 4JQLA 2ZCEA 5CPHA 3HB3B 1OV9A 4OXSA 3HKEB 5LMUO 5GW7A 2B9ZA 2VQFB 4HZ0A 4LF6B 2BU6A 1K4DC 4E2LA 4KSGA 2UXBO 1IXMA 2HEPA 4UROA 4JI6O 1XMQB 1UPGA 3RFRA 4PI0A 3ZMSA 3AG1C 4WCEV 2YEAA 3OUSA 3JD3A 4X1KA 4UUJC 4MT8A 1ZX3A 3STZC 4JI4O 3FD9A 4HNAA 1AJPA 1JVMA 1K5SA 3DSQA 4JI0O 5LP6B 1YXBA 3L70H 1O9HA 2DYRC 3DXRA 4URNA 3EHBB 2LO1A 4LF5B 4NH7A 4V25A 3KCYA 3JSLA 1SETA 4DV1O 2P4KA 5F2VO 4E02A 4LNUA 4W4KA 2WEPA 3SPHA 4J9YB 4BW5A 2Q7GA 1TUBA 2FB5A 2JEXA 4FM0A 1JMKC 4TUYB 3K03A 3K0DA 1THNA 1DLBA 3SPGA 1K92A 2V4DA 4UV9A 5D7RA 2XJGA 4NH9A 3CD6V 3K98A 1S3JA 2GUZA 2D2CB 4L91A 4NYKA 1EFRG 2JS3A 2X0LA 2WLKA 3WHAA 4UCUA 4B3RO 2A0LA 4ZI7A 4MPCA 4XBFA 5JCOA 1AI7A 3OMAB 3QG5A 5IWAO 3G6BA 1YSRA 3CRMA 4CWFA 1CXZB 2YS8A 3RLRA 1BHBA 2YEBA 1XDCA 5LBQA 1UYHA 2KQXA 5EK0A 4JAAA 4K0KO 1URFA 3CXHF 1FKAO 3RVYA 4L94A 2BZ5A 3O9OA 1BZKA 2WI3A 2ZM6O 4MS2A 4UXNA 4LWIA 1AILA 1M5IA 3H1HH 3ABMB 4X64O 5L3EA 4KL1A 1RFYA 1TC0A 3B25A 2IJKA 1N4CA 2W6IG 4PHZA 1KUQA 2YE5A 4DV3O 3TK1A 3E83A 5JWPA 2X6BA 2LGQA 3APQA 3QVNA 1UYDA 5LA6A 4LP0A 4CBCA 1IBLB 2Y48A 5J71A 3NXSA 2P5OA 1QLEB 1YITV 4GQTA 1M56B 1EI1A 3R65A 1B3QA 2P22C 3QDDA 4XCJA 4L8ZA 5C8YB 1VF5B 1U96A 2XHRA 4XE2A 1YF2A 4NVPA 4LFCO 4TOIA 1JM6A 5LMUB 4X66O 4TV8B 1AROP 2XDKA 3R4PA 1ZL8B 3K3WA 3W7SA 1I94O 4DR6O 5H6RA 1S77D 1MNGA 2ZQMA 1HR0O 2JKIA 1M57C 1YESA 2JK5C 2UXBB 4JI6B 1AR5A 3TJTA 3SJCC 4TQDA 4JI8O 1Y74A 3JYCA 2GFDA 1Y76B 3FX7A 4EFUA 2AW9A 4JI4B 4WFGA 1L0NH 1NT2B 2E75B 4I5SA 1J95A 1H8HG 3F7VC 3N2KB 4JI0B 2L6LA 4YKXA 2C1IA 3KZIZ 3HKEA 4I9WA 3OFNG 3M8AA 1UYMA 4IYIA 3ZRVA 4DV0O 1GMGA 4UV8A 2CH4A 2MK3A 1FJGO 1R3KC 3IAYA 2ZDIA 3C0EA 1O9GA 1TVKB 2EX3A 2LP7A 3G75A 1ZWIC 3CPWU 2DN9A 4DR7O 1NH2B 3L73H 1W0JG 4MPEA 1S0VA 1AR4A 5LHHA 4QJFB 4TT3G 2C2AA 5K1XA 2QG2A 1PKXA 2XDUA 1TUEB 3ZX6A 1SS3A 5LP6A 5CTYA 3U2KA 1SQQH 1RM1C 1I5AA 3B8MA 5B1BB 4JI1O 4WFBV 4B3RB 2HVJC 4DV5O 4BQGA 3H1IH 2O1VA 4UVAA 5IWAB 1H2MA 1NH2D 3D2RA 3ABUA 4B7PA 3A0HZ 4KFMA 2WA4A 4TUYA 1S5HC 2YE2A 1NTMH 1NTKH 4K0KB 1GAXA 4XKOA 1CPYA 4ZKIA 3J7AU 4F6RB 4QPJA 3T10A 3LNUA 2QKCA 2WLMA 3ABLC 2ZM6B 1KB9F 1JX9A 2RNBA 1IBMO 3BY6A 3EKRA 4X64B 4H37A 4F4LA 3EKOA 1SQPH 1GM9A 1HW7A 3CS5A 5D5PA 1SC5B 3GWOA 4DUYO 3A0YA 2HJFC 4DV3B 1GJVA 2Y4UA 4ZIBA 3LDDA 3B40A 4KUMA 5FNDA 1L1FA 2H8PC 3G80A 3SPJA 3X2QB 1N32O 4N21A 1FFTB 4EEQA 2VWJA 1M1KW 1ORQC 4KP4A 3FAVB 3OM3B 4BAEA 3HZ1A 4DV2O 1EZJA 2K1EA 1AVMA 2DOSA 4GEEA 4ZBMA 3ASOC 2YECA 4O05A 2ADQB 2QM8A 2ZINA 3E2EA 2GTSA 1KZNA 4LFCB 3ZXQA 1VQPV 4O4LA 4X66B 4RAIA 4RUEA 1I94B 1EN5A 1I5BA 3ETQA 5HFLA 4DR6B 2WI4A 1HR0B 1VQOV 3CWVA 1K33A 2YIDA 3NMQA 1L0OA 4X88A 2LFSA 1PPJH 2EXLA 3AG1B 3CRAA 5L3DA 3ZKBA 4JI8B 2QKAA 1IXBA 3VQVA 4WUDA 3UKMA 2HFEC 2UWDA 3G67A 4EM7A 5D6PA 2OCHA 2VW5A 5C8YA 2N04A 3P30A 2UUCO 5CMUA 2DYRB 2VQEO 3FFQA 5GTIZ 5FNVB 4TV8A 2ZNJA 1L8DA 5LYJB 1ZL8A 2Q7HA 4X89A 5IJ0B 1I59A 2AZ2A 4JTCB 1UYKA 1GN3A 4NTWA 4DV0B 2UXCO 1YHQV 1FJGB 3G6EV 2FYPA 4YKTA 2EJRA 1ZWHA 2XNDG 3BHPA 4X1IB 4J9ZB 1BYQA 1F7YA 4FCQA 4DR7B 1Y76A 2AKPA 5GONB 2UUBO 4K4OA 4PDVA 2Q8GA 2XHTA 5JJJB 1K34A 4L87A 1M90W 4NH8A 2EIJB 2ILMA 5DN6G 3N2KA 1R1BA 4I50B 5LOVB 2CTPA 4QIWF 1GK9A 4JI1B 4EFEA 1P7GA 2UU9O 4DR2O 5CB4B 3W7WA 3RVZA 4AWQA 1BXDA 1Q6UA 1YJNV 2GQPA 4ASUG 3JSNA 4DV5B 3R4OA 3CYGA 2KSDA 4DK1A 3G7EA 1KBHA 5A9GA 5IE9A 1TVKA 1WNSA 2Q0AA 3RYHB 3N27A 3R4MA 5CBFA 3CE2A 1UJWB 1NHIA 4NB5A 4GYCB 1JOYA 1DF4A 5CF0A 3FT5A 1BQ0A 2EINC 1IBMB 3LSQA 5FPRA 1H7UA 4I3HA 1J5EO 1JPXA 3CHXA 1QR8A 2BOCC 3L75H 4R3MA 4YKUA 2DQ0A 2PYJA 3N2GB 4DUYB 2BSKA 1G8MA 1UYGA 2BYHA 1GKXA 2EULA 3MDSA 1BT8A 3CJHB 4BIOA 1QYEA 1UYFA 3T2SA 2WAMA 3QTFA 5KLVH 4BR6A 1SZXA 4YJ3B 3E8FA 1N32B 1PV0A 4FLTA 2PZSA 1MSWD 4LWFA 3O65A 3F7YC 1H2NA 3EHJA 4F6RA 4DV2B 2KB1A 4AHCA 3WU2Z 2YKBA 1YIJV 5J2UB 2PI4A 4JI5O 2F23A 1DTOA 1H2KA 4GLXA 1K73W 4FFKA 4V26A 4XTJA 5KA6A 5J6AA 1M57B 1WAZA 2OT5A 2ZKOA 2WLLB 1AP5A 2GTAA 2AHZA 3ZBHA 1RPOA 4Z1VA 3B27A 2QR4A 3G4SV 2QSAA 1KMIZ 3AG2C 1PM9A 1N0NA 1Z5CA 3GIEA 4PA3A 1QZRA 2UUCB 1PNMA 4H13B 2VQEB 4GKJO 4ABMA 5AG2A 2OTJV 2HHHO 3CCJV 2XUMA 5BOCA 3F5WC 1AJQA 1ZAUA 3EHHA 2BREA 1KC8W 2P90A 3S5TA 4MW3A 4U7OA 1VF6C 2XOKG 2YI0A 2QTOA 3ZIAG 2DE0X 4LF8O 2H8MA 2UUBB 3PEHA 3THOA 4FLVA 2HG1A 4LPBA 4JV5O 3H9VA 1RM1B 1HNZO 5IY5C 3AG3C 4D6TH 2QEXV 2YEVB 4JF3A 3KCXA 5FNVA 2UU9B 4EEHA 2B1GA 4IHJB 4DR2B 1G4YB 3OW2U 5LYJA 2Y0IA 5IJ0A 2BU8A 1VQKV 2YXYA 4FZ1A 5CTWA 1SQFA 2PGGA 3M7MX 3LMMA 1ZXMA 2WA3A 3T1HO 1N8RW 3LUTB 2WLNA 5H9CA 2K5BA 4E4EA 4X1IA 1UYLA 2CCSA 4JPRA 4GZRB 3ZRSA 5GONA 1DGSA 3QO7A 3ABLB 3H80A 2XK2A 2DWDC 3OR6C 1SF9A 2YE7A 1BS3A 3K79A 1H8EG 4DW1A 4ZOLB 2R9IA 2WLJA 4BAYA 4I50A 5LOVA 1I58A 4TQFA 3L71H 3S3WA 5CB4A 4DUHA 3I5DA 2DW4A 1J5EB 2PYLA 3SYCA 5B66Z 3AK1A 1OSFA 1MZFA 2WWWA 3AG7A 1AR1B 4U7NA 3ZHRA 4E01A 2IWUA 4HXZA 1GM8A 1US6A 4FLYA 1KD1W 3RYHA 5EBMC 1Z5AA 4MOTA 1AP6A 1Q90D 4H33A 2ZE8A 4UB6Z 4PELA 2HKJA 3J80N 1MZEA 2ESAA 4YIPA 1TAEA 2N05A 2YDEA 2P4VA 5B5EZ 1WLEA 2XASA 3ASOB 1YEWA 2H55A 1TILA 4JI5B 4PJ0Z 4I4TB 1HWYA 1I7FA 4RUFA 3N2GA 5FWKA 5KHIA 2YK2A 1AI5A 2QGNA 3CJHA 3QNEA 2XDLA 2VRZA 4JI7O 5KMGB 3BCCH 4YJ3A 4I9QA 1SA0B 1S72V 1FS0G 3CCEV 4P7AA 3OUFA 1THZA 2XJXA 3ABKB 2Y69C 3TXSA 1JA8A 3TZ4A 5J2UA 4GKJB 4E72A 2EILC 3E89A 4IT5A 3VOUA 4AQYO 4XD8A 2HHHB 3ZHSA 1KKDA 1NS1A 4DV7O 1OCRC 4O4HB 4LF4O 4KQVA 2L35A 2WLLA 2DYSC 3T4DA 4KXRA 4JZGA 1AM1A 3A0WA 3UQ8A 1WB7A 3ZMZA 1BL8A 3HKCB 1MU5A 3ZRWB 2EIMB 4LF8B 5C93A 2QDOA 2R72A 4X65O 4MTGA 4LC1A 1NHHA 4PL9A 4Z1MG 2ATKC 4JV5B 3MD0A 1HNZB 1XL4A 2YEGA 1HP8A 3B24A 3G7BA 4LH6A 5CA3A 1VEWA 3CSXA 3JCUZ 3H1KH 1AI4A 5DECA 1FXKB 3APOA 3D36C 1KQSU 3SGIA 1NQTA 1OCCC 4R6ZA 5H6QA 1W0KG 2ITCC 3LDEA 3T1CA 3LSUA 2Q9LA 2YKEA 3T1HB 2CE4A 2IU3A 4GX1A 3SJAC 3A0XA 3LPSA 5JVDA 4MVSA 3L72H 2A3QA 4YIOA 2UUAO 4PU9A 4CWTA 2CAZC 4H44B 2EINB 4PV1B 5B1AC 1VP7A 5M4HA 5CA0B 1YZBA 1QVFU 3WB0A 4E00A 2YEVA 1U97A 4IHJA 2Q8HA 1IDSA 2ZKJA 4RO2A 4FM2A 4FLXA 3IEDA 5BZBA 4DYLA 4FM1A 1R6KA 2BU5A 2YIBD 5IYCO 5M4KA 1UYEA 2BE3A 4XC0A 4DV4O 3A0BZ 4OPAA 1GN4A 1KECA 3WG7C 1H2SB 2P6JA 1TIDA 2YXHA 4HAMA 5LL6Y 4ZOLA 5FPOA 2ZIMA 4I7ZB 4B6CA 5M4EA 4J10A 4J41A 1OCZC 4U3JB 1L0LH 4O07A 2YKCA 4XIQA 5FNFA 3VHAA 2YJXA 3BVOA 2A7WA 3ETGA 3JASB 4RQFA 3A0TA 2VWCA 2R9AA 2KKWA 2QJ1A 1W59A 3IC7A 5JH7A 4JI7B 5EZYB 3ZCCA 3ZKDA 4EB6B 3S3XA 3AG2B 5D7DA 5LXTB 2GV9A 1JFFB 2ZR3A 4UCTA 1RSOB 3STLC 4OPHA 1Q81W 1YSCA 3INWA 5BR8O 1GRJA 3RYFB 4XCLA 4W7TA 1V55C 3OWDA 1KIJA 2Y4TA 1R3JC 2JRIA 2UXDO 3AG4C 4I4TA 4O0BA 3P3PA 2QWQB 1PD3A 4AQYB 2CCTA 3VQXA 1S5LZ 2DJVA 3VADA 1XEQA 4DV7B 4LF4B 1K4CC 3Q4HB 4JAUA 2E3CA 4O4IB 4EGHA 3L9DA 4JI3O 5KMGA 1AH6A 1WP8A 1K7DA 1SA0A 3CC2V 4PA4A 4DZYA 3UCSC 3HEKA 3CCMV 3GIGB 4YY3O 2IJIA 4JYYA 1I5YA 4X65B 1YTFB 1D2DA 1WJZA 3SPIA 4ZHQB 4QE7A 3UT5B 1Y4UA 5IY5B 3AG3B 3CC4V 2JJ1G 4KSHA 1WPBA 5IYDO 4HY6A 4R3AA 3ASNC 2X6CA 1YCIA 2WLIB 4O4HA 4LWEA 4GT1A 4MTXA 5J2TB 1B62A 2M6YA 1S76D 1U2OA 3WB1A 2FXSA 2HLDG 1YTFD 1R62A 2QWNB 3HKCA 2Q0OC 1IZ3A 2JS5A 3ZRWA 1OZ0A 3RLPA 4A5UB 5GTHZ 3ZMVA 2UUAB 4MVQA 3P3NA 2XAJA 4LF7O 3I56V 4TWKA 1ZXNA 5D6QA 1VF7A 3D3IA 2V1DA 3QTCA 2YI5A 4WFEA 2R70A 3T0HA 5FLXN 1FXKA 1OHHG 2W0XA 5L3FA 4BXIA 2YI7A 1EM1A 4CE1A 1OCOC 4EKWA 1QVGU 4CZZA 2Q68A 2IH1C 2CK3G 4J11A 1WN7A 1YSZA 2OTLV 3A2FA 2XAHA 5KA5A 5D7CA 4B08A 4DV4B 2C1GA 4IL6Z 2YIBA 4R7CA 3T0ZA 1G6UA 2YI6A 1CP9A 2JJ2G 3JAWB 5CA0A 5JJEB 1TBWA 2K9PA 4N23A 2BTZA 3EVKA 4LWGA 4HZ5A 2YEDA 2LQTA 3JATB 3B77A 3LNMB 3JZ3A 2F43G 2CUGA 3R91A 3ZXOA 1HNXO 2EBOA 2OYQA 1P84F 1SRYA 5JJNB 3OEEG 4PI2A 1UFIA 3IGAC 4GGLA 3AK3A 4Q20A 3H1JH 2O1WA 4DR4O 2ADPA 4FFBB 1U0ZA 4OX9O 2HP8A 4YXWG 2Z3YA 2BYIA 2Y69B 2IWSA 2Y0PA 4B3TO 2LFRA 2UXXA 5KHJA 5BR8B 4XITA 1MX0A 4MVUA 2EILB 4PD4F 5CN0A 1KKCA 4U3JA 4CWNA 2UXDB 3HR0A 1OCRB 2DYSB 3H1LH 4O2AB 1QU7A 4NKGB 3JASA 1YC1A 1M4UA 1QCEA 2LJ2A 3UM7A 2GDSA 4GCZA 1Q82W 2JJCA 4JI3B 1V9PA 5B1OA 3CCSV 5EZYA 4PDRA 4F6EA 4EB6A 2BRCA 1CEZA 1LUVA 1NI8A 5EYPB 5LXTA 3EXAA 4EFBA 1JFFA 4YY3B 3B26A 1RSOA 2XX2A 3AEIA 1R6TA 5IYZB 5IDMA 2Q6AA 3RYFA 2RCVA 1AJNA 3CRCA 1MA1A 4ZVIA 4DR5O 2YSUB 2YICA 4PDMA 4O4JB 1OCCB 3B2EE 1WPXA 2XTAA 1VF6A 3Q4HA 4O4IA 3B4SA 1K3EA 1V54C 3OD4A 3K5NA 1Y6XA 1N34O 3FB6C 5LGTA 2QF6A 3GIGA 5BODA 3SL2A 5B1AB 4B3SO 2W0FC 2BT0A 4CH6A 4LF7B 2JGDB 1Y4SA 1WA8B 4ZHQA 2RQ6A 4GX2A 3UT5A 3C11A 4GFNA 2IJHA 3UO2A 4XDMA 5CTXA 1AMWA 1NU1H 2ZE5A 3B09A 4FVMA 1EZVH 2WLIA 5JQGB 3MHSC 2BU7A 1ZW9A 2RN9A 5J9PC 1VQNV 3T1YO 2W6JG 4JGSA 1S5JA 3KG2A 5J2TA 2ZDYA 4LWHA 1Y66A 3CX5F 3DC5A 2QM4A 5F3KA 2Q67A 3ABMC 4UCVA 5FL7G 4YKWA 3WG7B 1BSMA 2YKJA 1B04A 1D5AA 2A9HA 4TV9B 4D7TA 1S14A 2RMKB 1QLEC 2EJ7A 4G28B 2QKSA 3E86A 2ZT9B 3L74H 5M4NA 3B8NA 1HNXB 3K9SA 3GWKC 5IT9N 4PRVA 5F5RA 2YEEA 1K97A 4DR4B 3FAVA 3ETDA 4X8AA 2XDXA 3EFFK 4OX9B 2G38A 4J7JA 2BOBC 2Z5UA 1HNWO 2YK9A 4UCSA 1XBLA 1XHZA 3OT7A 2VS0A 1B6QA 5EIBC 4B3TB 1V55B 3JAWA 2CGOA 2CG9A 1TUBB 4LH7A 1XI1A 3AG4B 2QFOA 4LP8A 4GKKO 4MVMA 3JATA 3ZN1A 1A4HA 4WFHA 1XNRO 4EFTA 1I5XA 3CMAV 2XX5A 1Z59A 5BMVB 3E8GA 4K8XA 2GUZB 4XIPA 3JD0A 3U0ZA 3K06A 5KHHA 4CWSA 4RQEA 3ICXA 1Q6HA 4ICGA 3HKBB 2NNUA 4FFBA 3KKYA 1S16A 4LR3A 4HYMA 5H2FZ 4X20B 4AI8A 3ZHVA 2YE3A 2QA4V 1T5EA 3ZEDA 4P8OA 1Q8IA 1SESA 2KG7B 1YERA 4XIRA 5IYBO 5EBLC 4UFZA 4DR5B 5L3GA 2YE6A 4CWPA 1Y4MA 4O2AA 2XT9A 2QM7A 3LSSA 2ZR2A 2MW2B 1TH8A 3O6OA 2FKXA 4P9OA 3CCRV 3OMIB 4CE2A 4BIZA 2CGFA 4HY1A 3BM9A 4IYHA 5EYPA 2XAQA 3R66A 1N34B 3H4LA 2OIEA 4R50A 1YVWA 3D3QA 5GGZA 3JAKB 2PF4E 4B3SB 4CE3A 1TC6A 4MSWC 1R3LC 5IYZA 1Q7YW 2P7TC 1Z5VA 1FYJA 5LHIA 1BE3H 3SPCA 3RKZA 1EN6A 3K97A 5ITZB 2X7RB 3JALB 3W7XA 4XKAA 2WI6A 4EGIA 4AILC 2IBZH 2YJWA 1B06A 4O4JA 1OCOB 1AB3A 2P67A 1IBKO 1E1RG 1EBOA 1D5NA 5D5QA 3T1YB 4YJ2B 2YI8A 3IC9A 3TZ2A 2PI5A 3MAQA 4B7EA 5FNCA 5M4MA 2OWOA 2ODMA 4FIPC 2F1MA 1X59A 2PTMA 3FB7C 1BCCH 2QG0A 2JEUA 4KFGA 3WFVA 3M99B 4LWSB 3OMNB 5KUKA 1VQ5V 4J42A 4ASGA 5M4PA 3FB5C 2JGDA 2QTSA 1WA8A 2WI7A 1YT2A 3A8TA 1XQ8A 3DGEA 3K58A 1Z5BA 2H3OA 4FCRA 3OTOO 4B7KA 1FAFA 2B5UA 1ID0A 5E1AC 3SYPA 5B3SC 5JQGA 4JYCA 5DEDA 1FXVA 2X6AA 5BXZA 4MW8A 2ZD9A 3JD4A 4QE9A 4PA9A 3RLQA 4XKKA 3K59A 4R8CA 1I08A 3U67A 2OCCC 4L90A 4GX0A 1ZTEA 2XABA 4FCPA 2CGNA 1UY9A 3TGUH 1AJ6A 1MABG 1HNWB 4LCUC 1IURA 3U2DA 2P06A 2Q8FA 2IW5A 4I0XB 4TV9A 3T4ZA 3W7UA 4GKKB 3RN4A 4FLUA 1UYIA 3TZ5A 3HKDB 4WUCA 1XNRB 1VQ7V 4CC6A 2ITDC 1QBZA 1N36O 1UY8A 3RYCB 3C3SA 1LR1A 4UCRA 4L8JA 1I5CA 5L3JA 2QWPB 2BCCH 3PJSK 2WSSG 1B63A 1KP3A 1GN6A 1YC4A 1WP7A 1F51A 4GUNA 2ZIOA 2ZXWC 5KUMA 1MSDA 1LNQA 3GB7C 3FB8C 4JTDB 2YKIA 2GHYA 1YJ9V 4K3AA 3HHUA 2AGAA 4LF9O 2RDCA 1VMGA 4FK5C 3BFRA 3JCZA 4QGPA 1Q86W 3K57A 1F23A 2E0AA 4MVZA 3R4NA 1HDJA 3B28A 5BMVA 4DV6O 2YEHA 1Y67A 4LFAO 4BIUA 1V54B 4MP2A 2EIJC 1K9MW 3RYIB 4UB8Z 3R92A 4K35A 2A06H 3I55V 1YDXA 3U11A 3HKBA 3JARB 3K9AA 4FMTA 1SQGA 1XILA 5B1NA 5IDJA 2E76B 2YEFA 4X20A 4YKYA 4WUBA 1QNMA 4YKRA 2IOPA 1PL0A 1KYOF 1SERA 2Q2EB 1DF5A 2KG7A 5KX5B 4JYBA 3IFXA
chains in the Genus database with same CATH topology
3ZRXA 4G2KA 1YT0A 2IH3C 2ZBKB 1UY7A 3TTZA 4PRXA 1JCHA 1NVPB 1VQ4V 2JDIG 4JTAB 5CBGA 1RPRA 4QPKA 3ZJZA 3K0GA 1VQLV 4G27B 1NVPD 1H38A 2O1UA 4AWOA 3OW6A 2FWZA 1UY6A 2A79B 5HFMA 1YETA 4P2ZA 4P30A 3LDCA 3VHCA 2B1IA 1BKNA 4MPNA 3WQ9A 4HXWA 1QLNA 5LGUA 4U93A 3OMUA 2V7QG 4WFAV 1GKZA 4BQJA 4XDLA 4FJCC 2UXNA 3ZM7A 1US7A 3PEJA 1VQ9V 2XX4A 1P7BA 1KP2A 4MTOA 4ASBA 4KTNA 2YGAA 4JASA 4MBCA 3MHHC 1R6NA 3HPLC 2XDSA 1YC3A 3CCUV 4YKZA 2PNRA 4MB9A 4EGKA 3K60A 4DXWA 3T1KA 4L93A 5L3CA 4CWOA 3K99A 2XAFA 2XCMA 1BMFG 3TETA 2WPDG 3FT8A 3EHFA 3ML0A 5L3BA 2M7WA 3H01A 1Y8OA 3Q5JA 2YGFA 1YS3A 3CGZA 3VHDA 2IU0A 2R9RB 5EC2C 2YE9A 1JQ0A 2HVKC 3OEHG 4WF9V 4O09A 5EBWC 2VCIA 5B3SB 3K08A 1SZTA 2EIKC 4X9LA 1AI6A 4MVOA 1Y8NA 2OCCB 5EC1C 3HYZA 3OGCC 1GO3F 3E8HA 3KE6A 2WI1A 4H85A 2YGEA 3QO5A 3CCLV 1COWG 3ZN0A 3O2FA 1E1QG 3W7TA 2WEQA 1XL6A 4MTFA 1PNKA 2YEJA 3TZ0A 3A0RA 1QY8A 2ZDIC 4HYPA 2JIZG 3SYAA 3Q5KA 1R3IC 1VQMV 3ABKC 4TSFG 2ZXWB 3ABTA 1ROPA 4FPPA 2D3OW 2IOQA 3RBZA 1H2GA 1VQ6V 3FYIB 2HKOA 2WI5A 3GIFA 3T2MA 3TCUA 4R1FA 4DO2A 2BU2A 2EIMC 5IN9A 3G71V 3JD1A 1R73A 2EZPA 4AWPA 2VCJA 4GX5A 3DTUB 3CCQV 3JD2A 4QNHB 1ENVA 1FXKC 5CBHA 3OR7C 4H81A 4WFFA 2WERA 3CYOA 3ZMUA 4MVRA 3BEHA 3OAAG 1K5QA 1PNLA 3CGYA 1JJ2U 1Y8PA 1NHJA 5CTUA 1GM7A 3A0ZA 2YE4A 3E35A 4HYOA 3HZ5A 3O0IA 1PVGA 4LBEC 1K8AW 3TUHA 2HG5C 1YI2V 3SYQA 1GKFA 1OCZB 4CWQA 2DWEC 3CXCU 1QR9A 4H7QA 4O04A 1M56C 2FWYA 3CP1A 3CMEV 2AHYA 1MOFA 1NBMG 1MG1A 4EMVA 1M9NA 1E79G 2XHXA 4AS9A 1FXHA 3SJQC 4PA6A 3HYYA 3INXA 3CRLA 2XD6A 3OE7G 5LGNA 2ZDXA 4JAVA 3FV5A 2Q69A 1I5DA 2FTKA 2EZOA 3EHGA 3OWBA 1P4RA 1UYCA 3MNRP 1BGQA 2DQ3A 1EA6A 2Q8IA 3FYEB 1BHAA 1VQ8V 4UVCA 1NJIW 3Q5LA 4URMA 4URLA 2HR3A 2WLHA 2XAGA 2QE7G 3ASNB 3BMYA 3K04A 4PA7A 4P9PA 2XJJA 5DM6V 2IORA 4CWRA 3SYOA 3CCVV 1H7SA 3CRKA 5B1BC 2GSMB 2CCUA 3VBBA 3OPDA 1W2BU 1YT1A 2HCHA 2YEIA 4PDLA 2WI2A 3ETEA 1NR1A 2NLJC 3D36A 2H94A 4YKQA 4ASFA 3D0BA 1F4MA 1GTOA 4MP7A 3ZMTA 1NR7A 4UVBA 1AH8A 5LHGA 1NKDA 2IWXA 4GT8A 4ASAA 3FKSG 4HZ3A 1YJWV 3X2QC 1F4NA 2EIKB 2YE8A 4XDKA 3P32A 2BSMA 2IJJA 3RW0A 3QO8A 4XDJA 3E8BA 3CC7V 4JQLA 5CPHA 3HB3B 4OXSA 5GW7A 4HZ0A 2BU6A 1K4DC 4E2LA 4KSGA 1IXMA 4UROA 3ZMSA 3AG1C 4WCEV 2YEAA 3OUSA 3JD3A 4UUJC 4MT8A 3STZC 1AJPA 1JVMA 1K5SA 2DYRC 4URNA 3EHBB 4NH7A 4V25A 1SETA 4E02A 2WEPA 3SPHA 4J9YB 4BW5A 2JEXA 3K03A 3K0DA 1THNA 1DLBA 3SPGA 1K92A 4UV9A 5D7RA 2XJGA 4NH9A 3CD6V 3K98A 1S3JA 4L91A 1EFRG 2X0LA 2WLKA 3WHAA 2A0LA 4MPCA 4XBFA 1AI7A 3OMAB 1YSRA 4CWFA 3RLRA 1BHBA 2YEBA 5LBQA 1UYHA 5EK0A 3RVYA 4L94A 2BZ5A 2WI3A 4MS2A 4UXNA 4LWIA 3ABMB 5L3EA 1TC0A 3B25A 2IJKA 2W6IG 2YE5A 3TK1A 3E83A 2X6BA 1UYDA 4LP0A 4CBCA 5J71A 2Y48A 3NXSA 1QLEB 1YITV 4GQTA 1M56B 1EI1A 3R65A 1B3QA 3QDDA 4XCJA 4L8ZA 2XHRA 4XE2A 1JM6A 1AROP 2XDKA 3R4PA 3K3WA 3W7SA 5H6RA 1S77D 2ZQMA 2JKIA 1M57C 1YESA 2JK5C 3JYCA 2GFDA 4EFUA 4WFGA 4I5SA 1J95A 1H8HG 3F7VC 4YKXA 4I9WA 3OFNG 1UYMA 3ZRVA 1GMGA 4UV8A 2CH4A 2MK3A 1R3KC 2ZDIA 3C0EA 2LP7A 3G75A 1ZWIC 3CPWU 1NH2B 1W0JG 4MPEA 1S0VA 5LHHA 4QJFB 4TT3G 2C2AA 2QG2A 1PKXA 2XDUA 1TUEB 5CTYA 3U2KA 1RM1C 1I5AA 3B8MA 5B1BB 4WFBV 2HVJC 4BQGA 2O1VA 4UVAA 1NH2D 3D2RA 3ABUA 4B7PA 4KFMA 1S5HC 2YE2A 4XKOA 1CPYA 4ZKIA 4QPJA 3T10A 3LNUA 2WLMA 3ABLC 1JX9A 3BY6A 3EKRA 4H37A 4F4LA 3EKOA 1GM9A 3GWOA 3A0YA 2HJFC 1GJVA 3LDDA 4KUMA 5FNDA 1L1FA 2H8PC 3SPJA 3X2QB 4N21A 1FFTB 1M1KW 1ORQC 4KP4A 3OM3B 4BAEA 3HZ1A 1EZJA 2K1EA 4GEEA 2YECA 4O05A 4ZBMA 3ASOC 2QM8A 3E2EA 1KZNA 3ZXQA 1VQPV 4RAIA 4RUEA 1I5BA 5HFLA 2WI4A 1VQOV 3CWVA 1K33A 3NMQA 1L0OA 4X88A 2LFSA 2EXLA 3AG1B 5L3DA 3ZKBA 4WUDA 3UKMA 2HFEC 2UWDA 4EM7A 5D6PA 2VW5A 3P30A 5CMUA 2DYRB 4X89A 1I59A 4JTCB 1UYKA 1YHQV 3G6EV 2FYPA 4YKTA 2EJRA 1ZWHA 2XNDG 4J9ZB 1BYQA 4FCQA 2AKPA 4K4OA 4PDVA 2Q8GA 2XHTA 1K34A 4L87A 1M90W 4NH8A 2EIJB 5DN6G 4QIWF 1GK9A 3W7WA 3RVZA 4AWQA 1BXDA 1YJNV 2GQPA 4ASUG 3R4OA 3G7EA 3R4MA 5CBFA 1UJWB 1NHIA 1JOYA 1DF4A 5CF0A 3FT5A 2EINC 3LSQA 1H7UA 4I3HA 1JPXA 1QR8A 2BOCC 4R3MA 4YKUA 2DQ0A 1G8MA 1UYGA 2BYHA 1GKXA 3T2SA 1QYEA 1UYFA 2WAMA 3QTFA 3E8FA 1MSWD 4LWFA 3F7YC 3EHJA 2KB1A 2YKBA 1YIJV 2PI4A 1DTOA 1K73W 4V26A 4XTJA 5KA6A 5J6AA 1M57B 2OT5A 2WLLB 2AHZA 1RPOA 3B27A 3G4SV 3AG2C 1Z5CA 3GIEA 4PA3A 1QZRA 1PNMA 2OTJV 3CCJV 5BOCA 3F5WC 1AJQA 3EHHA 2BREA 1KC8W 2P90A 4MW3A 4U7OA 2XOKG 2YI0A 2QTOA 3ZIAG 2H8MA 3PEHA 2HG1A 4LPBA 1RM1B 5IY5C 3AG3C 2QEXV 2YEVB 4JF3A 4EEHA 2B1GA 1G4YB 3OW2U 2BU8A 1VQKV 5CTWA 1ZXMA 1N8RW 3LUTB 2WLNA 5H9CA 2K5BA 1UYLA 2CCSA 4JPRA 3ZRSA 3QO7A 3ABLB 3H80A 2XK2A 2DWDC 3OR6C 2YE7A 3K79A 1H8EG 2R9IA 2WLJA 4BAYA 1I58A 4DUHA 2DW4A 3SYCA 1OSFA 2WWWA 1AR1B 4U7NA 4E01A 2IWUA 4HXZA 1GM8A 1KD1W 5EBMC 1Z5AA 4MOTA 4H33A 4PELA 2HKJA 2ESAA 1WLEA 2XASA 3ASOB 2H55A 1TILA 1HWYA 4RUFA 5FWKA 2YK2A 1AI5A 3QNEA 2XDLA 1S72V 1FS0G 3CCEV 4P7AA 3OUFA 1THZA 2XJXA 3ABKB 2Y69C 3TZ4A 2EILC 3E89A 3VOUA 4XD8A 1KKDA 1OCRC 4KQVA 2WLLA 2DYSC 3T4DA 1AM1A 3A0WA 3ZMZA 1BL8A 1MU5A 3ZRWB 2EIMB 5C93A 4MTGA 4LC1A 1NHHA 4PL9A 4Z1MG 2ATKC 3MD0A 2YEGA 1XL4A 3B24A 3G7BA 5CA3A 1AI4A 1FXKB 1KQSU 1NQTA 1OCCC 4R6ZA 5H6QA 1W0KG 2ITCC 3LDEA 3T1CA 2YKEA 2IU3A 4GX1A 3A0XA 3LPSA 4MVSA 4PU9A 4CWTA 2EINB 5B1AC 5M4HA 1QVFU 4E00A 2YEVA 2Q8HA 2ZKJA 4RO2A 3IEDA 5BZBA 1R6KA 2BU5A 5IYCO 5M4KA 1UYEA 4XC0A 1KECA 3WG7C 2P6JA 1TIDA 4HAMA 4B6CA 5M4EA 1OCZC 4O07A 2YKCA 4XIQA 5FNFA 3VHAA 2YJXA 3ETGA 4RQFA 3A0TA 2VWCA 3IC7A 3ZCCA 3ZKDA 3AG2B 5D7DA 2ZR3A 3STLC 1Q81W 1YSCA 3INWA 4XCLA 4W7TA 1V55C 3OWDA 1KIJA 1R3JC 3AG4C 4O0BA 1PD3A 2CCTA 3VADA 1K4CC 4JAUA 4EGHA 1AH6A 1K7DA 3CC2V 4PA4A 4DZYA 3HEKA 3CCMV 3GIGB 2IJIA 1I5YA 1YTFB 3SPIA 4QE7A 1Y4UA 5IY5B 3AG3B 3CC4V 2JJ1G 4KSHA 5IYDO 4HY6A 4R3AA 3ASNC 2X6CA 2WLIB 4LWEA 4GT1A 4MTXA 1B62A 1S76D 1U2OA 2FXSA 2HLDG 1YTFD 1R62A 3ZRWA 1OZ0A 3RLPA 3ZMVA 4MVQA 2XAJA 3I56V 4TWKA 1ZXNA 5D6QA 3D3IA 2V1DA 2YI5A 4WFEA 3T0HA 1FXKA 1OHHG 5L3FA 4BXIA 2YI7A 4CE1A 1OCOC 4EKWA 1QVGU 4CZZA 2Q68A 2IH1C 2CK3G 1YSZA 2OTLV 2XAHA 5KA5A 5D7CA 4R7CA 3T0ZA 2YI6A 1CP9A 2JJ2G 1TBWA 4N23A 2BTZA 4LWGA 4HZ5A 2YEDA 3B77A 3LNMB 3JZ3A 2F43G 3R91A 3ZXOA 2EBOA 1SRYA 3OEEG 3IGAC 4GGLA 4Q20A 2O1WA 1U0ZA 4YXWG 2Z3YA 2BYIA 2Y69B 2IWSA 2LFRA 2UXXA 4XITA 1MX0A 4MVUA 2EILB 5CN0A 4CWNA 1OCRB 2DYSB 1YC1A 1QCEA 3UM7A 4GCZA 1Q82W 2JJCA 5B1OA 3CCSV 4PDRA 2BRCA 1CEZA 3B26A 2XX2A 3AEIA 5IDMA 2Q6AA 1AJNA 4ZVIA 2YSUB 4PDMA 1OCCB 1WPXA 1K3EA 1V54C 3FB6C 5LGTA 2QF6A 3GIGA 5BODA 3SL2A 5B1AB 2W0FC 2BT0A 1Y4SA 4GX2A 3C11A 4GFNA 2IJHA 4XDMA 5CTXA 1AMWA 2WLIA 3MHSC 2BU7A 1ZW9A 5J9PC 1VQNV 2W6JG 4JGSA 3KG2A 2ZDYA 4LWHA 1Y66A 5F3KA 2Q67A 3ABMC 5FL7G 4YKWA 3WG7B 2YKJA 2A9HA 1S14A 1QLEC 4G28B 2QKSA 3E86A 5M4NA 3B8NA 4PRVA 5F5RA 2YEEA 1K97A 3ETDA 4X8AA 2XDXA 3EFFK 2BOBC 2Z5UA 2YK9A 1B6QA 1V55B 2CG9A 3AG4B 2QFOA 4LP8A 4MVMA 3ZN1A 1A4HA 4WFHA 4EFTA 1I5XA 3CMAV 2XX5A 1Z59A 3E8GA 4XIPA 3JD0A 3K06A 4CWSA 4RQEA 2NNUA 1S16A 4HYMA 2YE3A 2QA4V 4P8OA 1SESA 1YERA 4XIRA 5IYBO 5EBLC 5L3GA 2YE6A 4CWPA 1Y4MA 2QM7A 3LSSA 2ZR2A 1TH8A 3O6OA 4P9OA 3CCRV 3OMIB 4CE2A 4BIZA 2CGFA 4HY1A 3BM9A 2XAQA 3H4LA 4R50A 5GGZA 4CE3A 1TC6A 4MSWC 1R3LC 1Q7YW 2P7TC 5LHIA 3SPCA 3RKZA 3K97A 2X7RB 3W7XA 4XKAA 2WI6A 4EGIA 2YJWA 1OCOB 2P67A 1E1RG 1EBOA 3TZ2A 2PI5A 5FNCA 5M4MA 4FIPC 3FB7C 2QG0A 2JEUA 4KFGA 3WFVA 3M99B 3OMNB 5KUKA 1VQ5V 4ASGA 5M4PA 3FB5C 2WI7A 1YT2A 3DGEA 4FCRA 1Z5BA 2B5UA 1ID0A 5E1AC 3SYPA 5B3SC 4JYCA 1FXVA 2X6AA 4MW8A 4PA9A 2ZD9A 3JD4A 4QE9A 3RLQA 4XKKA 4R8CA 3U67A 2OCCC 4L90A 4GX0A 2XABA 4FCPA 1UY9A 1AJ6A 1MABG 4LCUC 3U2DA 2Q8FA 2IW5A 3T4ZA 3W7UA 1UYIA 3TZ5A 4WUCA 1VQ7V 2ITDC 1QBZA 1UY8A 1I5CA 5L3JA 3PJSK 2WSSG 1B63A 1KP3A 1YC4A 1F51A 2ZXWC 5KUMA 1LNQA 3GB7C 3FB8C 4JTDB 2YKIA 2GHYA 1YJ9V 3HHUA 4FK5C 3JCZA 1Q86W 1F23A 2E0AA 4MVZA 3R4NA 3B28A 2YEHA 4BIUA 1V54B 4MP2A 2EIJC 1K9MW 3R92A 3I55V 3K9AA 4FMTA 5B1NA 5IDJA 2YEFA 4YKYA 4WUBA 4YKRA 2IOPA 1PL0A 1SERA 2Q2EB 1DF5A 4JYBA 3IFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRX A;  1JOY A;  1YT0 A;  5CF0 A;  5D6Q A;  3FT5 A;  4YKQ A;  2ZBK B;  4ASF A;  3D0B A;  2YI5 A;  3T0H A;  4MP7 A;  1H7U A;  4I3H A;  1UY7 A;  3TTZ A;  4PRX A;  4BXI A;  2YI7 A;  1AH8 A;  4R3M A;  4YKU A;  4CE1 A;  2IWX A;  1UYG A;  2BYH A;  1GKX A;  3T2S A;  1QYE A;  1UYF A;  1YSZ A;  4GT8 A;  4ASA A;  3QTF A;  5D7C A;  4QPK A;  4LWF A;  3T0Z A;  2YI6 A;  3EHJ A;  2YE8 A;  3P32 A;  1TBW A;  2BSM A;  2YKB A;  2BTZ A;  4LWG A;  4HZ5 A;  2YED A;  3JZ3 A;  2O1U A;  4AWO A;  4V26 A;  4XTJ A;  4JQL A;  5CPH A;  5J6A A;  3OW6 A;  2FWZ A;  1UY6 A;  3R91 A;  3ZXO A;  4HZ0 A;  1YET A;  2BU6 A;  3VHC A;  4GGL A;  4Q20 A;  2O1W A;  4KSG A;  3B27 A;  1U0Z A;  1IXM A;  4URO A;  1BKN A;  2BYI A;  4MPN A;  3WQ9 A;  4HXW A;  2IWS A;  1Z5C A;  2LFR A;  2YEA A;  3GIE A;  4U93 A;  3OMU A;  4XIT A;  4MT8 A;  1MX0 A;  1QZR A;  4CWN A;  1GKZ A;  4BQJ A;  1YC1 A;  4URN A;  4NH7 A;  5BOC A;  4V25 A;  3ZM7 A;  3EHH A;  2BRE A;  4GCZ A;  2JJC A;  1US7 A;  4E02 A;  4U7O A;  5B1O A;  2WEP A;  2BRC A;  2YI0 A;  3PEJ A;  2XX4 A;  3B26 A;  2XX2 A;  4ASB A;  4KTN A;  2H8M A;  1THN A;  2YGA A;  4JAS A;  4MBC A;  5IDM A;  3PEH A;  2HG1 A;  4LPB A;  5D7R A;  2XJG A;  4NH9 A;  3K98 A;  4ZVI A;  2XDS A;  1YC3 A;  4L91 A;  4EEH A;  4YKZ A;  3WHA A;  2BU8 A;  2PNR A;  4MB9 A;  4EGK A;  3K60 A;  4MPC A;  3T1K A;  5CTW A;  4L93 A;  1ZXM A;  4CWO A;  1YSR A;  2K5B A;  4CWF A;  2QF6 A;  3GIG A;  5BOD A;  3RLR A;  3SL2 A;  2YEB A;  1UYL A;  2BT0 A;  2CCS A;  3K99 A;  2XCM A;  1UYH A;  1Y4S A;  3C11 A;  4GFN A;  3H80 A;  2XK2 A;  2YE7 A;  4L94 A;  2BZ5 A;  1AMW A;  4XDM A;  5CTX A;  3FT8 A;  3EHF A;  2WI3 A;  1I58 A;  4LWI A;  2BU7 A;  1ZW9 A;  4DUH A;  1TC0 A;  3B25 A;  2ZDY A;  1OSF A;  4LWH A;  1Y8O A;  3Q5J A;  2WWW A;  2YE5 A;  2YGF A;  5F3K A;  4U7N A;  1YS3 A;  3TK1 A;  3CGZ A;  3VHD A;  4E01 A;  2IWU A;  4HXZ A;  1UYD A;  4YKW A;  1Z5A A;  4MOT A;  4LP0 A;  5J71 A;  2YE9 A;  3NXS A;  2HKJ A;  4GQT A;  2ESA A;  4O09 A;  1EI1 A;  2VCI A;  1B3Q A;  2YKJ A;  3QDD A;  4XCJ A;  2H55 A;  1TIL A;  4L8Z A;  4X9L A;  1S14 A;  1Y8N A;  2XHR A;  4XE2 A;  5M4N A;  3HYZ A;  1JM6 A;  2XDK A;  5FWK A;  3R4P A;  2YK2 A;  3KE6 A;  2WI1 A;  4PRV A;  4H85 A;  5F5R A;  2JKI A;  2YGE A;  1YES A;  2XDL A;  2YEE A;  3O2F A;  2XDX A;  2WEQ A;  4P7A A;  2YK9 A;  2YEJ A;  3TZ0 A;  3A0R A;  4JYB A;  2GFD A;  1QY8 A;  2XJX A;  2CG9 A;  4HYP A;  4EFU A;  2QFO A;  3TZ4 A;  4I5S A;  3Q5K A;  1A4H A;  4EFT A;  4YKX A;  4XD8 A;  2XX5 A;  1Z59 A;  4KQV A;  1UYM A;  4XIP A;  3ZRV A;  4CWS A;  1AM1 A;  3A0W A;  2CH4 A;  4FPP A;  2IOQ A;  1S16 A;  4HYM A;  3C0E A;  1MU5 A;  3ZRW B;  2YE3 A;  3G75 A;  2WI5 A;  5C93 A;  3GIF A;  4P8O A;  4R1F A;  1NHH A;  4LC1 A;  4MPE A;  4PL9 A;  2C2A A;  3MD0 A;  1YER A;  2QG2 A;  4XIR A;  2XDU A;  2YEG A;  3B24 A;  2BU2 A;  3G7B A;  2YE6 A;  5CTY A;  5IN9 A;  4CWP A;  3U2K A;  1I5A A;  2QM7 A;  1TH8 A;  3O6O A;  4BQG A;  2O1V A;  4AWP A;  2VCJ A;  2YKE A;  4CE2 A;  4BIZ A;  2CGF A;  4HY1 A;  3BM9 A;  3D2R A;  4B7P A;  3H4L A;  3A0X A;  3LPS A;  5GGZ A;  4CE3 A;  2YE2 A;  4H81 A;  1TC6 A;  4PU9 A;  2WER A;  4CWT A;  4XKO A;  4ZKI A;  5M4H A;  4QPJ A;  3T10 A;  3LNU A;  3RKZ A;  3K97 A;  4E00 A;  4XKA A;  2WI6 A;  4EGI A;  2YJW A;  3CGY A;  1Y8P A;  3EKR A;  2Q8H A;  2P67 A;  2ZKJ A;  1NHJ A;  5CTU A;  3EKO A;  3A0Z A;  2YE4 A;  3IED A;  3HZ5 A;  3TZ2 A;  5FNC A;  5M4M A;  3A0Y A;  2BU5 A;  3O0I A;  1GJV A;  1PVG A;  5M4K A;  2QG0 A;  5FND A;  1UYE A;  3TUH A;  4KFG A;  4XC0 A;  4ASG A;  4CWQ A;  5M4P A;  2WI7 A;  4H7Q A;  1YT2 A;  4KP4 A;  1TID A;  4O04 A;  4BAE A;  3DGE A;  3HZ1 A;  1Z5B A;  4FCR A;  4B6C A;  5M4E A;  1ID0 A;  2FWY A;  4O07 A;  4JYC A;  4GEE A;  2YEC A;  2YKC A;  4O05 A;  4XIQ A;  5FNF A;  2QM8 A;  1KZN A;  3RLQ A;  3VHA A;  4EMV A;  4XKK A;  2YJX A;  3ZXQ A;  3U67 A;  2XHX A;  4AS9 A;  4L90 A;  1I5B A;  2WI4 A;  2VWC A;  3A0T A;  2XAB A;  3HYY A;  3CWV A;  3CRL A;  3INX A;  4FCP A;  1UY9 A;  2XD6 A;  2ZDX A;  4JAV A;  3NMQ A;  3ZCC A;  3ZKD A;  1L0O A;  3FV5 A;  2LFS A;  1AJ6 A;  5D7D A;  2EXL A;  1I5D A;  3ZKB A;  2FTK A;  3EHG A;  3OWB A;  4WUD A;  1UYC A;  3U2D A;  2UWD A;  4EM7 A;  3MNR P;  5D6P A;  3INW A;  1BGQ A;  4XCL A;  2Q8F A;  4W7T A;  1EA6 A;  2VW5 A;  2Q8I A;  1UYI A;  3OWD A;  1KIJ A;  3TZ5 A;  4WUC A;  4O0B A;  1UY8 A;  2CCT A;  3VAD A;  3Q5L A;  1I59 A;  1I5C A;  1UYK A;  5L3J A;  4URM A;  4JAU A;  4URL A;  4EGH A;  1B63 A;  1YC4 A;  1F51 A;  1AH6 A;  2FYP A;  4YKT A;  4DZY A;  1ZWH A;  2YKI A;  3HEK A;  3GIG B;  4FCQ A;  1BYQ A;  3HHU A;  2AKP A;  3BMY A;  4K4O A;  1Y4U A;  2Q8G A;  2XHT A;  2XJJ A;  4KSH A;  4NH8 A;  4HY6 A;  2E0A A;  4R3A A;  3R4N A;  2IOR A;  4CWR A;  3B28 A;  2YEH A;  1H7S A;  4AWQ A;  1BXD A;  2GQP A;  4LWE A;  4GT1 A;  4MTX A;  4BIU A;  3CRK A;  1B62 A;  4MP2 A;  1U2O A;  3R4O A;  3R92 A;  2FXS A;  2CCU A;  3G7E A;  3OPD A;  1R62 A;  4FMT A;  1YT1 A;  5B1N A;  5IDJ A;  2YEF A;  3ZRW A;  4YKY A;  4WUB A;  2HCH A;  2YEI A;  3RLP A;  4YKR A;  2WI2 A;  3R4M A;  2IOP A;  2Q2E B;  3D36 A;  1NHI A;  1ZXN A; 
#chains in the Genus database with same CATH topology
 3ZRX A;  4G2K A;  1YT0 A;  2IH3 C;  4HBN A;  2CTR A;  2ZBK B;  5TIS Z;  2AZ0 A;  4C7U A;  3D8C A;  3BPZ A;  1IBK B;  3IJ4 A;  1UY7 A;  3TTZ A;  4PRX A;  3E22 B;  1JCH A;  2N74 A;  1NVP B;  5JEN A;  4O2B B;  1QHT A;  3WB2 A;  4O4L B;  4YHH B;  2JDI G;  4JTA B;  1VQ4 V;  4IIJ B;  5CBG A;  3JAK A;  1RPR A;  1XHX A;  4FLW A;  4JYA O;  2HJD A;  4QPK A;  4CS2 A;  4B3M O;  3SDL A;  3ZJZ A;  3K0G A;  1SKV A;  1KU9 A;  4NTY A;  1VQL V;  5ITZ A;  3OTO B;  3JAL A;  4G27 B;  3C3T A;  2XHB A;  1FD9 A;  1NVP D;  1H38 A;  3BA8 A;  2O1U A;  4AWO A;  4YJ2 A;  3OW6 A;  2FWZ A;  1UY6 A;  2A79 B;  2LGW A;  5HFM A;  1YET A;  1ZLZ A;  4P2Z A;  4P30 A;  3LDC A;  3VHC A;  1EN4 A;  2FML A;  2B1I A;  4LWS A;  4DUZ O;  4I55 B;  1BKN A;  5KHG A;  4MPN A;  3WQ9 A;  4HXW A;  1QLN A;  5LGU A;  4U93 A;  3OMU A;  2V7Q G;  4WFA V;  1GKZ A;  4BQJ A;  4XDL A;  3DC6 A;  1N36 B;  4FJC C;  5EIB D;  2NN4 A;  1PL4 A;  2UXN A;  3OTF A;  4J7K A;  2Q73 A;  3CEI A;  3ZM7 A;  1US7 A;  3VQW A;  3K5L A;  3PEJ A;  1BGY H;  1VQ9 V;  4X62 O;  2XX4 A;  4DV1 B;  5JCO C;  1P7B A;  1KP2 A;  4MTO A;  3CB2 A;  5LMN O;  3UO3 A;  4LF9 B;  4ASB A;  2FYU H;  4KTN A;  2YGA A;  4JAS A;  4MBC A;  4I0X A;  4CS4 A;  3MHH C;  1R6N A;  3HPL C;  3VQY A;  3HKD A;  1Q3E A;  4CC5 A;  1A32 A;  2XDS A;  1YC3 A;  3AK2 A;  3CCU V;  4NXN O;  3RYC A;  4DV6 B;  4YKZ A;  2HHI A;  4LFA B;  1NTZ H;  2GBO A;  2YC0 A;  2PNR A;  3CRQ A;  4MB9 A;  3CWB H;  4EGK A;  3K60 A;  4DXW A;  3T1K A;  4L93 A;  1QQC A;  5L3C A;  4CWO A;  2F4V O;  2BSK B;  3K99 A;  2XAF A;  2XCM A;  1BMF G;  4X1Y B;  2WPD G;  3TET A;  1N33 O;  1SQV H;  4BWA A;  3FT8 A;  2QWR B;  1FFX B;  1XMO O;  3EHF A;  4BW9 A;  3ML0 A;  2LW7 A;  5L3B A;  1XRE A;  1IVS A;  2M7W A;  1JR9 A;  3H01 A;  1Y8O A;  3RYI A;  3Q5J A;  2YGF A;  1YS3 A;  2CH7 B;  3JAR A;  3CGZ A;  3VHD A;  2IU0 A;  4RWU A;  2R9R B;  4JYA B;  4DW0 A;  4WBN B;  5EC2 C;  4B3M B;  2YE9 A;  1LUW A;  1JQ0 A;  2HVK C;  3OEH G;  5KX5 A;  4WF9 V;  4O09 A;  5EBW C;  3SJB C;  2VCI A;  5B3S B;  4D7S A;  1Q43 A;  3K08 A;  2OIG A;  1P49 A;  1SZT A;  2EIK C;  2JVD A;  4X9L A;  1AI6 A;  4MVO A;  1Y8N A;  2OCC B;  3E22 A;  5EC1 C;  3HYZ A;  2RJZ A;  3OGC C;  1GO3 F;  4K8Z A;  1SQX H;  3E8H A;  3KE6 A;  2WI1 A;  4O2B A;  3C90 A;  4H85 A;  5E79 Z;  2YGE A;  3QO5 A;  4DR3 O;  4IIJ A;  3CCL V;  1COW G;  4DUZ B;  3ZN0 A;  3O2F A;  1E1Q G;  3W7T A;  2WEQ A;  1XL6 A;  4MTF A;  1PNK A;  2YEJ A;  2E5L O;  3TZ0 A;  4FLZ A;  3A0R A;  1QY8 A;  4NXM O;  2ZDI C;  4HYP A;  1TGO A;  3OGI B;  4Z2W A;  1RP3 B;  1Z5W A;  4J7Z A;  2JIZ G;  3SYA A;  3Q5K A;  1N0J A;  1R3I C;  1IX9 A;  2FL4 A;  1XNQ O;  4OGQ B;  1VQM V;  3ABK C;  1FPO A;  4KHP O;  5LP6 C;  4TSF G;  3RT3 C;  2DMX A;  2ZXW B;  3ABT A;  1H2L A;  1ROP A;  1XUQ A;  1WB8 A;  4X62 B;  4FPP A;  2D3O W;  1M93 A;  2IOQ A;  5A2Q N;  3RBZ A;  1H2G A;  1VQ6 V;  4I55 A;  5LMN B;  3FYI B;  2HKO A;  2O57 A;  2WI5 A;  3JAM N;  3F5T A;  3GIF A;  3T2M A;  1Q5O A;  1PP9 H;  3TCU A;  4R1F A;  3RGB A;  2BTQ B;  4DO2 A;  4LFB O;  4NTX A;  2BU2 A;  2EIM C;  3LNN A;  5IN9 A;  4NXN B;  5KAI Z;  5K1P A;  3G71 V;  1MMM A;  4CS3 A;  2ZNI A;  3JD1 A;  3BRC A;  1R73 A;  2EZP A;  2F93 B;  5KHK A;  4NR1 A;  4AWP A;  2VCJ A;  3K5M A;  2CTQ A;  2Q5Z A;  4GX5 A;  3DTU B;  3CCQ V;  3JD2 A;  4QNH B;  1ENV A;  1FXK C;  2F4V B;  4X9Q A;  5CBH A;  3OR7 C;  4H81 A;  4J80 A;  4WFF A;  5IJ9 B;  2WER A;  1N33 B;  3CYO A;  3ZMU A;  4MVR A;  3BEH A;  1XMO B;  4DRX B;  5BY1 A;  3OAA G;  1K5Q A;  2YUA A;  1PNL A;  3CGY A;  2NR5 A;  1JJ2 U;  1Y8P A;  3ZHQ A;  1NHJ A;  5CTU A;  1GM7 A;  3A0Z A;  2YE4 A;  1SQB H;  3E35 A;  4HYO A;  5CA1 B;  3HZ5 A;  4DR1 O;  4CH5 A;  4JZ2 A;  3O0I A;  1PVG A;  4LBE C;  2Q7E A;  1K8A W;  2YIA A;  3TUH A;  2HG5 C;  1YI2 V;  2ZE7 A;  2IM9 A;  4JI2 O;  3NR7 A;  3SYQ A;  1GKF A;  1OCZ B;  4UCO A;  4CWQ A;  2DWE C;  3CXC U;  4X1Y A;  1QR9 A;  4H7Q A;  4O04 A;  1M56 C;  4X1K B;  1FFX A;  2Z0A A;  2FWY A;  3CP1 A;  3RWR D;  2AHY A;  3CME V;  1VAR A;  4HNA B;  3U10 A;  4H0L B;  1MOF A;  1NBM G;  1MG1 A;  3BAB A;  4EMV A;  1GH6 A;  1M9N A;  1E79 G;  3DXR B;  4FZ0 A;  2XHX A;  4AS9 A;  1FXH A;  2VQF O;  1I0H A;  3SJQ C;  4PA6 A;  1NZ6 A;  2CH7 A;  4LF6 O;  2E74 B;  3HYY A;  3INX A;  3CRL A;  4DR3 B;  2JGU A;  2XD6 A;  3OE7 G;  4LNU B;  5LGN A;  1DK1 A;  2ZDX A;  4JAV A;  4WBN A;  3FV5 A;  3SR2 C;  2Q69 A;  2E5L B;  1I5D A;  2FTK A;  2EZO A;  3EHG A;  3OWB A;  4CH4 A;  1XMQ O;  4NXM B;  3PN1 A;  1P4R A;  1UYC A;  4CH3 A;  3MNR P;  1BGQ A;  2DQ3 A;  1EA6 A;  2Q8I A;  3FYE B;  4Q6G A;  1BHA A;  1VQ8 V;  2F95 B;  4UVC A;  1NJI W;  1XOU A;  1XNQ B;  2YXL A;  4KHP B;  3CRR A;  3Q5L A;  4LF5 O;  4ZI7 B;  4URM A;  4IGG A;  2PY5 A;  4URL A;  2HR3 A;  2WLH A;  2XAG A;  3K5O A;  2UXC B;  5H5N A;  1G1X B;  2QE7 G;  3ASN B;  3ZHU A;  1GN2 A;  3BMY A;  3TXQ A;  1ZUQ A;  3K04 A;  4PA7 A;  5JVD B;  4W4L A;  4LFB B;  4P9P A;  2XJJ A;  3GVM A;  5KAF Z;  5DM6 V;  2IOR A;  4CWR A;  3SYO A;  3CCV V;  1H7S A;  3J81 N;  3CRK A;  3BAA A;  5B1B C;  2GSM B;  2CCU A;  1JJO A;  3VBB A;  3OPD A;  1W2B U;  4DK0 A;  1YT1 A;  2F66 C;  1OJH A;  2ETN A;  1Z2G A;  2HCH A;  2YEI A;  5LA6 B;  4PDL A;  2WI2 A;  3ETE A;  2CDY A;  1NR1 A;  2NLJ C;  3D36 A;  1VIB A;  2BTQ A;  2H94 A;  4U3F H;  4YKQ A;  2CTW A;  4ASF A;  2LW1 A;  3D0B A;  1F4M A;  1GTO A;  1BQZ A;  4MP7 A;  3ZMT A;  3BA9 A;  1NR7 A;  2BTO A;  2PUS A;  2ARH A;  4UVB A;  1AH8 A;  5LHG A;  1NKD A;  4DR1 B;  4YHH O;  2IWX A;  3QF7 A;  2Q8V A;  3ZHT A;  4GT8 A;  4ASA A;  4JI2 B;  3FKS G;  4HZ3 A;  3ZS8 C;  1IBL O;  2Q4P A;  5IJ9 A;  1ZSP A;  1YJW V;  5JH7 B;  3X2Q C;  1TA8 A;  1Y74 B;  1F4N A;  2EIK B;  2YE8 A;  4XDK A;  3P32 A;  2BSM A;  1X4T A;  4DRX A;  2ZE6 A;  2IJJ A;  2AXT Z;  3RW0 A;  2QWO B;  3QO8 A;  4XDJ A;  2VWK A;  2YI9 A;  1Q6I A;  3E8B A;  5CA1 A;  3CC7 V;  4JQL A;  2ZCE A;  5CPH A;  3HB3 B;  1OV9 A;  4OXS A;  3HKE B;  5LMU O;  5GW7 A;  2B9Z A;  2VQF B;  4HZ0 A;  4LF6 B;  2BU6 A;  1K4D C;  4E2L A;  4KSG A;  2UXB O;  1IXM A;  2HEP A;  4URO A;  4JI6 O;  1XMQ B;  1UPG A;  3RFR A;  4PI0 A;  3ZMS A;  3AG1 C;  4WCE V;  2YEA A;  3OUS A;  3JD3 A;  4X1K A;  4UUJ C;  4MT8 A;  1ZX3 A;  3STZ C;  4JI4 O;  3FD9 A;  4HNA A;  1AJP A;  1JVM A;  1K5S A;  3DSQ A;  4JI0 O;  5LP6 B;  1YXB A;  3L70 H;  1O9H A;  2DYR C;  3DXR A;  4URN A;  3EHB B;  2LO1 A;  4LF5 B;  4NH7 A;  4V25 A;  3KCY A;  3JSL A;  1SET A;  4DV1 O;  2P4K A;  5F2V O;  4E02 A;  4LNU A;  4W4K A;  2WEP A;  3SPH A;  4J9Y B;  4BW5 A;  2Q7G A;  1TUB A;  2FB5 A;  2JEX A;  4FM0 A;  1JMK C;  4TUY B;  3K03 A;  3K0D A;  1THN A;  1DLB A;  3SPG A;  1K92 A;  2V4D A;  4UV9 A;  5D7R A;  2XJG A;  4NH9 A;  3CD6 V;  3K98 A;  1S3J A;  2GUZ A;  2D2C B;  4L91 A;  4NYK A;  1EFR G;  2JS3 A;  2X0L A;  2WLK A;  3WHA A;  4UCU A;  4B3R O;  2A0L A;  4ZI7 A;  4MPC A;  4XBF A;  5JCO A;  1AI7 A;  3OMA B;  3QG5 A;  5IWA O;  3G6B A;  1YSR A;  3CRM A;  4CWF A;  1CXZ B;  2YS8 A;  3RLR A;  1BHB A;  2YEB A;  1XDC A;  5LBQ A;  1UYH A;  2KQX A;  5EK0 A;  4JAA A;  4K0K O;  1URF A;  3CXH F;  1FKA O;  3RVY A;  4L94 A;  2BZ5 A;  3O9O A;  1BZK A;  2WI3 A;  2ZM6 O;  4MS2 A;  4UXN A;  4LWI A;  1AIL A;  1M5I A;  3H1H H;  3ABM B;  4X64 O;  5L3E A;  4KL1 A;  1RFY A;  1TC0 A;  3B25 A;  2IJK A;  1N4C A;  2W6I G;  4PHZ A;  1KUQ A;  2YE5 A;  4DV3 O;  3TK1 A;  3E83 A;  5JWP A;  2X6B A;  2LGQ A;  3APQ A;  3QVN A;  1UYD A;  5LA6 A;  4LP0 A;  4CBC A;  1IBL B;  2Y48 A;  5J71 A;  3NXS A;  2P5O A;  1QLE B;  1YIT V;  4GQT A;  1M56 B;  1EI1 A;  3R65 A;  1B3Q A;  2P22 C;  3QDD A;  4XCJ A;  4L8Z A;  5C8Y B;  1VF5 B;  1U96 A;  2XHR A;  4XE2 A;  1YF2 A;  4NVP A;  4LFC O;  4TOI A;  1JM6 A;  5LMU B;  4X66 O;  4TV8 B;  1ARO P;  2XDK A;  3R4P A;  1ZL8 B;  3K3W A;  3W7S A;  1I94 O;  4DR6 O;  5H6R A;  1S77 D;  1MNG A;  2ZQM A;  1HR0 O;  2JKI A;  1M57 C;  1YES A;  2JK5 C;  2UXB B;  4JI6 B;  1AR5 A;  3TJT A;  3SJC C;  4TQD A;  4JI8 O;  1Y74 A;  3JYC A;  2GFD A;  1Y76 B;  3FX7 A;  4EFU A;  2AW9 A;  4JI4 B;  4WFG A;  1L0N H;  1NT2 B;  2E75 B;  4I5S A;  1J95 A;  1H8H G;  3F7V C;  3N2K B;  4JI0 B;  2L6L A;  4YKX A;  2C1I A;  3KZI Z;  3HKE A;  4I9W A;  3OFN G;  3M8A A;  1UYM A;  4IYI A;  3ZRV A;  4DV0 O;  1GMG A;  4UV8 A;  2CH4 A;  2MK3 A;  1FJG O;  1R3K C;  3IAY A;  2ZDI A;  3C0E A;  1O9G A;  1TVK B;  2EX3 A;  2LP7 A;  3G75 A;  1ZWI C;  3CPW U;  2DN9 A;  4DR7 O;  1NH2 B;  3L73 H;  1W0J G;  4MPE A;  1S0V A;  1AR4 A;  5LHH A;  4QJF B;  4TT3 G;  2C2A A;  5K1X A;  2QG2 A;  1PKX A;  2XDU A;  1TUE B;  3ZX6 A;  1SS3 A;  5LP6 A;  5CTY A;  3U2K A;  1SQQ H;  1RM1 C;  1I5A A;  3B8M A;  5B1B B;  4JI1 O;  4WFB V;  4B3R B;  2HVJ C;  4DV5 O;  4BQG A;  3H1I H;  2O1V A;  4UVA A;  5IWA B;  1H2M A;  1NH2 D;  3D2R A;  3ABU A;  4B7P A;  3A0H Z;  4KFM A;  2WA4 A;  4TUY A;  1S5H C;  2YE2 A;  1NTM H;  1NTK H;  4K0K B;  1GAX A;  4XKO A;  1CPY A;  4ZKI A;  3J7A U;  4F6R B;  4QPJ A;  3T10 A;  3LNU A;  2QKC A;  2WLM A;  3ABL C;  2ZM6 B;  1KB9 F;  1JX9 A;  2RNB A;  1IBM O;  3BY6 A;  3EKR A;  4X64 B;  4H37 A;  4F4L A;  3EKO A;  1SQP H;  1GM9 A;  1HW7 A;  3CS5 A;  5D5P A;  1SC5 B;  3GWO A;  4DUY O;  3A0Y A;  2HJF C;  4DV3 B;  1GJV A;  2Y4U A;  4ZIB A;  3LDD A;  3B40 A;  4KUM A;  5FND A;  1L1F A;  2H8P C;  3G80 A;  3SPJ A;  3X2Q B;  1N32 O;  4N21 A;  1FFT B;  4EEQ A;  2VWJ A;  1M1K W;  1ORQ C;  4KP4 A;  3FAV B;  3OM3 B;  4BAE A;  3HZ1 A;  4DV2 O;  1EZJ A;  2K1E A;  1AVM A;  2DOS A;  4GEE A;  4ZBM A;  3ASO C;  2YEC A;  4O05 A;  2ADQ B;  2QM8 A;  2ZIN A;  3E2E A;  2GTS A;  1KZN A;  4LFC B;  3ZXQ A;  1VQP V;  4O4L A;  4X66 B;  4RAI A;  4RUE A;  1I94 B;  1EN5 A;  1I5B A;  3ETQ A;  5HFL A;  4DR6 B;  2WI4 A;  1HR0 B;  1VQO V;  3CWV A;  1K33 A;  2YID A;  3NMQ A;  1L0O A;  4X88 A;  2LFS A;  1PPJ H;  2EXL A;  3AG1 B;  3CRA A;  5L3D A;  3ZKB A;  4JI8 B;  2QKA A;  1IXB A;  3VQV A;  4WUD A;  3UKM A;  2HFE C;  2UWD A;  3G67 A;  4EM7 A;  5D6P A;  2OCH A;  2VW5 A;  5C8Y A;  2N04 A;  3P30 A;  2UUC O;  5CMU A;  2DYR B;  2VQE O;  3FFQ A;  5GTI Z;  5FNV B;  4TV8 A;  2ZNJ A;  1L8D A;  5LYJ B;  1ZL8 A;  2Q7H A;  4X89 A;  5IJ0 B;  1I59 A;  2AZ2 A;  4JTC B;  1UYK A;  1GN3 A;  4NTW A;  4DV0 B;  2UXC O;  1YHQ V;  1FJG B;  3G6E V;  2FYP A;  4YKT A;  2EJR A;  1ZWH A;  2XND G;  3BHP A;  4X1I B;  4J9Z B;  1BYQ A;  1F7Y A;  4FCQ A;  4DR7 B;  1Y76 A;  2AKP A;  5GON B;  2UUB O;  4K4O A;  4PDV A;  2Q8G A;  2XHT A;  5JJJ B;  1K34 A;  4L87 A;  1M90 W;  4NH8 A;  2EIJ B;  2ILM A;  5DN6 G;  3N2K A;  1R1B A;  4I50 B;  5LOV B;  2CTP A;  4QIW F;  1GK9 A;  4JI1 B;  4EFE A;  1P7G A;  2UU9 O;  4DR2 O;  5CB4 B;  3W7W A;  3RVZ A;  4AWQ A;  1BXD A;  1Q6U A;  1YJN V;  2GQP A;  4ASU G;  3JSN A;  4DV5 B;  3R4O A;  3CYG A;  2KSD A;  4DK1 A;  3G7E A;  1KBH A;  5A9G A;  5IE9 A;  1TVK A;  1WNS A;  2Q0A A;  3RYH B;  3N27 A;  3R4M A;  5CBF A;  3CE2 A;  1UJW B;  1NHI A;  4NB5 A;  4GYC B;  1JOY A;  1DF4 A;  5CF0 A;  3FT5 A;  1BQ0 A;  2EIN C;  1IBM B;  3LSQ A;  5FPR A;  1H7U A;  4I3H A;  1J5E O;  1JPX A;  3CHX A;  1QR8 A;  2BOC C;  3L75 H;  4R3M A;  4YKU A;  2DQ0 A;  2PYJ A;  3N2G B;  4DUY B;  2BSK A;  1G8M A;  1UYG A;  2BYH A;  1GKX A;  2EUL A;  3MDS A;  1BT8 A;  3CJH B;  4BIO A;  1QYE A;  1UYF A;  3T2S A;  2WAM A;  3QTF A;  5KLV H;  4BR6 A;  1SZX A;  4YJ3 B;  3E8F A;  1N32 B;  1PV0 A;  4FLT A;  2PZS A;  1MSW D;  4LWF A;  3O65 A;  3F7Y C;  1H2N A;  3EHJ A;  4F6R A;  4DV2 B;  2KB1 A;  4AHC A;  3WU2 Z;  2YKB A;  1YIJ V;  5J2U B;  2PI4 A;  4JI5 O;  2F23 A;  1DTO A;  1H2K A;  4GLX A;  1K73 W;  4FFK A;  4V26 A;  4XTJ A;  5KA6 A;  5J6A A;  1M57 B;  1WAZ A;  2OT5 A;  2ZKO A;  2WLL B;  1AP5 A;  2GTA A;  2AHZ A;  3ZBH A;  1RPO A;  4Z1V A;  3B27 A;  2QR4 A;  3G4S V;  2QSA A;  1KMI Z;  3AG2 C;  1PM9 A;  1N0N A;  1Z5C A;  3GIE A;  4PA3 A;  1QZR A;  2UUC B;  1PNM A;  4H13 B;  2VQE B;  4GKJ O;  4ABM A;  5AG2 A;  2OTJ V;  2HHH O;  3CCJ V;  2XUM A;  5BOC A;  3F5W C;  1AJQ A;  1ZAU A;  3EHH A;  2BRE A;  1KC8 W;  2P90 A;  3S5T A;  4MW3 A;  4U7O A;  1VF6 C;  2XOK G;  2YI0 A;  2QTO A;  3ZIA G;  2DE0 X;  4LF8 O;  2H8M A;  2UUB B;  3PEH A;  3THO A;  4FLV A;  2HG1 A;  4LPB A;  4JV5 O;  3H9V A;  1RM1 B;  1HNZ O;  5IY5 C;  3AG3 C;  4D6T H;  2QEX V;  2YEV B;  4JF3 A;  3KCX A;  5FNV A;  2UU9 B;  4EEH A;  2B1G A;  4IHJ B;  4DR2 B;  1G4Y B;  3OW2 U;  5LYJ A;  2Y0I A;  5IJ0 A;  2BU8 A;  1VQK V;  2YXY A;  4FZ1 A;  5CTW A;  1SQF A;  2PGG A;  3M7M X;  3LMM A;  1ZXM A;  2WA3 A;  3T1H O;  1N8R W;  3LUT B;  2WLN A;  5H9C A;  2K5B A;  4E4E A;  4X1I A;  1UYL A;  2CCS A;  4JPR A;  4GZR B;  3ZRS A;  5GON A;  1DGS A;  3QO7 A;  3ABL B;  3H80 A;  2XK2 A;  2DWD C;  3OR6 C;  1SF9 A;  2YE7 A;  1BS3 A;  3K79 A;  1H8E G;  4DW1 A;  4ZOL B;  2R9I A;  2WLJ A;  4BAY A;  4I50 A;  5LOV A;  1I58 A;  4TQF A;  3L71 H;  3S3W A;  5CB4 A;  4DUH A;  3I5D A;  2DW4 A;  1J5E B;  2PYL A;  3SYC A;  5B66 Z;  3AK1 A;  1OSF A;  1MZF A;  2WWW A;  3AG7 A;  1AR1 B;  4U7N A;  3ZHR A;  4E01 A;  2IWU A;  4HXZ A;  1GM8 A;  1US6 A;  4FLY A;  1KD1 W;  3RYH A;  5EBM C;  1Z5A A;  4MOT A;  1AP6 A;  1Q90 D;  4H33 A;  2ZE8 A;  4UB6 Z;  4PEL A;  2HKJ A;  3J80 N;  1MZE A;  2ESA A;  4YIP A;  1TAE A;  2N05 A;  2YDE A;  2P4V A;  5B5E Z;  1WLE A;  2XAS A;  3ASO B;  1YEW A;  2H55 A;  1TIL A;  4JI5 B;  4PJ0 Z;  4I4T B;  1HWY A;  1I7F A;  4RUF A;  3N2G A;  5FWK A;  5KHI A;  2YK2 A;  1AI5 A;  2QGN A;  3CJH A;  3QNE A;  2XDL A;  2VRZ A;  4JI7 O;  5KMG B;  3BCC H;  4YJ3 A;  4I9Q A;  1SA0 B;  1S72 V;  1FS0 G;  3CCE V;  4P7A A;  3OUF A;  1THZ A;  2XJX A;  3ABK B;  2Y69 C;  3TXS A;  1JA8 A;  3TZ4 A;  5J2U A;  4GKJ B;  4E72 A;  2EIL C;  3E89 A;  4IT5 A;  3VOU A;  4AQY O;  4XD8 A;  2HHH B;  3ZHS A;  1KKD A;  1NS1 A;  4DV7 O;  1OCR C;  4O4H B;  4LF4 O;  4KQV A;  2L35 A;  2WLL A;  2DYS C;  3T4D A;  4KXR A;  4JZG A;  1AM1 A;  3A0W A;  3UQ8 A;  1WB7 A;  3ZMZ A;  1BL8 A;  3HKC B;  1MU5 A;  3ZRW B;  2EIM B;  4LF8 B;  5C93 A;  2QDO A;  2R72 A;  4X65 O;  4MTG A;  4LC1 A;  1NHH A;  4PL9 A;  4Z1M G;  2ATK C;  4JV5 B;  3MD0 A;  1HNZ B;  1XL4 A;  2YEG A;  1HP8 A;  3B24 A;  3G7B A;  4LH6 A;  5CA3 A;  1VEW A;  3CSX A;  3JCU Z;  3H1K H;  1AI4 A;  5DEC A;  1FXK B;  3APO A;  3D36 C;  1KQS U;  3SGI A;  1NQT A;  1OCC C;  4R6Z A;  5H6Q A;  1W0K G;  2ITC C;  3LDE A;  3T1C A;  3LSU A;  2Q9L A;  2YKE A;  3T1H B;  2CE4 A;  2IU3 A;  4GX1 A;  3SJA C;  3A0X A;  3LPS A;  5JVD A;  4MVS A;  3L72 H;  2A3Q A;  4YIO A;  2UUA O;  4PU9 A;  4CWT A;  2CAZ C;  4H44 B;  2EIN B;  4PV1 B;  5B1A C;  1VP7 A;  5M4H A;  5CA0 B;  1YZB A;  1QVF U;  3WB0 A;  4E00 A;  2YEV A;  1U97 A;  4IHJ A;  2Q8H A;  1IDS A;  2ZKJ A;  4RO2 A;  4FM2 A;  4FLX A;  3IED A;  5BZB A;  4DYL A;  4FM1 A;  1R6K A;  2BU5 A;  2YIB D;  5IYC O;  5M4K A;  1UYE A;  2BE3 A;  4XC0 A;  4DV4 O;  3A0B Z;  4OPA A;  1GN4 A;  1KEC A;  3WG7 C;  1H2S B;  2P6J A;  1TID A;  2YXH A;  4HAM A;  5LL6 Y;  4ZOL A;  5FPO A;  2ZIM A;  4I7Z B;  4B6C A;  5M4E A;  4J10 A;  4J41 A;  1OCZ C;  4U3J B;  1L0L H;  4O07 A;  2YKC A;  4XIQ A;  5FNF A;  3VHA A;  2YJX A;  3BVO A;  2A7W A;  3ETG A;  3JAS B;  4RQF A;  3A0T A;  2VWC A;  2R9A A;  2KKW A;  2QJ1 A;  1W59 A;  3IC7 A;  5JH7 A;  4JI7 B;  5EZY B;  3ZCC A;  3ZKD A;  4EB6 B;  3S3X A;  3AG2 B;  5D7D A;  5LXT B;  2GV9 A;  1JFF B;  2ZR3 A;  4UCT A;  1RSO B;  3STL C;  4OPH A;  1Q81 W;  1YSC A;  3INW A;  5BR8 O;  1GRJ A;  3RYF B;  4XCL A;  4W7T A;  1V55 C;  3OWD A;  1KIJ A;  2Y4T A;  1R3J C;  2JRI A;  2UXD O;  3AG4 C;  4I4T A;  4O0B A;  3P3P A;  2QWQ B;  1PD3 A;  4AQY B;  2CCT A;  3VQX A;  1S5L Z;  2DJV A;  3VAD A;  1XEQ A;  4DV7 B;  4LF4 B;  1K4C C;  3Q4H B;  4JAU A;  2E3C A;  4O4I B;  4EGH A;  3L9D A;  4JI3 O;  5KMG A;  1AH6 A;  1WP8 A;  1K7D A;  1SA0 A;  3CC2 V;  4PA4 A;  4DZY A;  3UCS C;  3HEK A;  3CCM V;  3GIG B;  4YY3 O;  2IJI A;  4JYY A;  1I5Y A;  4X65 B;  1YTF B;  1D2D A;  1WJZ A;  3SPI A;  4ZHQ B;  4QE7 A;  3UT5 B;  1Y4U A;  5IY5 B;  3AG3 B;  3CC4 V;  2JJ1 G;  4KSH A;  1WPB A;  5IYD O;  4HY6 A;  4R3A A;  3ASN C;  2X6C A;  1YCI A;  2WLI B;  4O4H A;  4LWE A;  4GT1 A;  4MTX A;  5J2T B;  1B62 A;  2M6Y A;  1S76 D;  1U2O A;  3WB1 A;  2FXS A;  2HLD G;  1YTF D;  1R62 A;  2QWN B;  3HKC A;  2Q0O C;  1IZ3 A;  2JS5 A;  3ZRW A;  1OZ0 A;  3RLP A;  4A5U B;  5GTH Z;  3ZMV A;  2UUA B;  4MVQ A;  3P3N A;  2XAJ A;  4LF7 O;  3I56 V;  4TWK A;  1ZXN A;  5D6Q A;  1VF7 A;  3D3I A;  2V1D A;  3QTC A;  2YI5 A;  4WFE A;  2R70 A;  3T0H A;  5FLX N;  1FXK A;  1OHH G;  2W0X A;  5L3F A;  4BXI A;  2YI7 A;  1EM1 A;  4CE1 A;  1OCO C;  4EKW A;  1QVG U;  4CZZ A;  2Q68 A;  2IH1 C;  2CK3 G;  4J11 A;  1WN7 A;  1YSZ A;  2OTL V;  3A2F A;  2XAH A;  5KA5 A;  5D7C A;  4B08 A;  4DV4 B;  2C1G A;  4IL6 Z;  2YIB A;  4R7C A;  3T0Z A;  1G6U A;  2YI6 A;  1CP9 A;  2JJ2 G;  3JAW B;  5CA0 A;  5JJE B;  1TBW A;  2K9P A;  4N23 A;  2BTZ A;  3EVK A;  4LWG A;  4HZ5 A;  2YED A;  2LQT A;  3JAT B;  3B77 A;  3LNM B;  3JZ3 A;  2F43 G;  2CUG A;  3R91 A;  3ZXO A;  1HNX O;  2EBO A;  2OYQ A;  1P84 F;  1SRY A;  5JJN B;  3OEE G;  4PI2 A;  1UFI A;  3IGA C;  4GGL A;  3AK3 A;  4Q20 A;  3H1J H;  2O1W A;  4DR4 O;  2ADP A;  4FFB B;  1U0Z A;  4OX9 O;  2HP8 A;  4YXW G;  2Z3Y A;  2BYI A;  2Y69 B;  2IWS A;  2Y0P A;  4B3T O;  2LFR A;  2UXX A;  5KHJ A;  5BR8 B;  4XIT A;  1MX0 A;  4MVU A;  2EIL B;  4PD4 F;  5CN0 A;  1KKC A;  4U3J A;  4CWN A;  2UXD B;  3HR0 A;  1OCR B;  2DYS B;  3H1L H;  4O2A B;  1QU7 A;  4NKG B;  3JAS A;  1YC1 A;  1M4U A;  1QCE A;  2LJ2 A;  3UM7 A;  2GDS A;  4GCZ A;  1Q82 W;  2JJC A;  4JI3 B;  1V9P A;  5B1O A;  3CCS V;  5EZY A;  4PDR A;  4F6E A;  4EB6 A;  2BRC A;  1CEZ A;  1LUV A;  1NI8 A;  5EYP B;  5LXT A;  3EXA A;  4EFB A;  1JFF A;  4YY3 B;  3B26 A;  1RSO A;  2XX2 A;  3AEI A;  1R6T A;  5IYZ B;  5IDM A;  2Q6A A;  3RYF A;  2RCV A;  1AJN A;  3CRC A;  1MA1 A;  4ZVI A;  4DR5 O;  2YSU B;  2YIC A;  4PDM A;  4O4J B;  1OCC B;  3B2E E;  1WPX A;  2XTA A;  1VF6 A;  3Q4H A;  4O4I A;  3B4S A;  1K3E A;  1V54 C;  3OD4 A;  3K5N A;  1Y6X A;  1N34 O;  3FB6 C;  5LGT A;  2QF6 A;  3GIG A;  5BOD A;  3SL2 A;  5B1A B;  4B3S O;  2W0F C;  2BT0 A;  4CH6 A;  4LF7 B;  2JGD B;  1Y4S A;  1WA8 B;  4ZHQ A;  2RQ6 A;  4GX2 A;  3UT5 A;  3C11 A;  4GFN A;  2IJH A;  3UO2 A;  4XDM A;  5CTX A;  1AMW A;  1NU1 H;  2ZE5 A;  3B09 A;  4FVM A;  1EZV H;  2WLI A;  5JQG B;  3MHS C;  2BU7 A;  1ZW9 A;  2RN9 A;  5J9P C;  1VQN V;  3T1Y O;  2W6J G;  4JGS A;  1S5J A;  3KG2 A;  5J2T A;  2ZDY A;  4LWH A;  1Y66 A;  3CX5 F;  3DC5 A;  2QM4 A;  5F3K A;  2Q67 A;  3ABM C;  4UCV A;  5FL7 G;  4YKW A;  3WG7 B;  1BSM A;  2YKJ A;  1B04 A;  1D5A A;  2A9H A;  4TV9 B;  4D7T A;  1S14 A;  2RMK B;  1QLE C;  2EJ7 A;  4G28 B;  2QKS A;  3E86 A;  2ZT9 B;  3L74 H;  5M4N A;  3B8N A;  1HNX B;  3K9S A;  3GWK C;  5IT9 N;  4PRV A;  5F5R A;  2YEE A;  1K97 A;  4DR4 B;  3FAV A;  3ETD A;  4X8A A;  2XDX A;  3EFF K;  4OX9 B;  2G38 A;  4J7J A;  2BOB C;  2Z5U A;  1HNW O;  2YK9 A;  4UCS A;  1XBL A;  1XHZ A;  3OT7 A;  2VS0 A;  1B6Q A;  5EIB C;  4B3T B;  1V55 B;  3JAW A;  2CGO A;  2CG9 A;  1TUB B;  4LH7 A;  1XI1 A;  3AG4 B;  2QFO A;  4LP8 A;  4GKK O;  4MVM A;  3JAT A;  3ZN1 A;  1A4H A;  4WFH A;  1XNR O;  4EFT A;  1I5X A;  3CMA V;  2XX5 A;  1Z59 A;  5BMV B;  3E8G A;  4K8X A;  2GUZ B;  4XIP A;  3JD0 A;  3U0Z A;  3K06 A;  5KHH A;  4CWS A;  4RQE A;  3ICX A;  1Q6H A;  4ICG A;  3HKB B;  2NNU A;  4FFB A;  3KKY A;  1S16 A;  4LR3 A;  4HYM A;  5H2F Z;  4X20 B;  4AI8 A;  3ZHV A;  2YE3 A;  2QA4 V;  1T5E A;  3ZED A;  4P8O A;  1Q8I A;  1SES A;  2KG7 B;  1YER A;  4XIR A;  5IYB O;  5EBL C;  4UFZ A;  4DR5 B;  5L3G A;  2YE6 A;  4CWP A;  1Y4M A;  4O2A A;  2XT9 A;  2QM7 A;  3LSS A;  2ZR2 A;  2MW2 B;  1TH8 A;  3O6O A;  2FKX A;  4P9O A;  3CCR V;  3OMI B;  4CE2 A;  4BIZ A;  2CGF A;  4HY1 A;  3BM9 A;  4IYH A;  5EYP A;  2XAQ A;  3R66 A;  1N34 B;  3H4L A;  2OIE A;  4R50 A;  1YVW A;  3D3Q A;  5GGZ A;  3JAK B;  2PF4 E;  4B3S B;  4CE3 A;  1TC6 A;  4MSW C;  1R3L C;  5IYZ A;  1Q7Y W;  2P7T C;  1Z5V A;  1FYJ A;  5LHI A;  1BE3 H;  3SPC A;  3RKZ A;  1EN6 A;  3K97 A;  5ITZ B;  2X7R B;  3JAL B;  3W7X A;  4XKA A;  2WI6 A;  4EGI A;  4AIL C;  2IBZ H;  2YJW A;  1B06 A;  4O4J A;  1OCO B;  1AB3 A;  2P67 A;  1IBK O;  1E1R G;  1EBO A;  1D5N A;  5D5Q A;  3T1Y B;  4YJ2 B;  2YI8 A;  3IC9 A;  3TZ2 A;  2PI5 A;  3MAQ A;  4B7E A;  5FNC A;  5M4M A;  2OWO A;  2ODM A;  4FIP C;  2F1M A;  1X59 A;  2PTM A;  3FB7 C;  1BCC H;  2QG0 A;  2JEU A;  4KFG A;  3WFV A;  3M99 B;  4LWS B;  3OMN B;  5KUK A;  1VQ5 V;  4J42 A;  4ASG A;  5M4P A;  3FB5 C;  2JGD A;  2QTS A;  1WA8 A;  2WI7 A;  1YT2 A;  3A8T A;  1XQ8 A;  3DGE A;  3K58 A;  1Z5B A;  2H3O A;  4FCR A;  3OTO O;  4B7K A;  1FAF A;  2B5U A;  1ID0 A;  5E1A C;  3SYP A;  5B3S C;  5JQG A;  4JYC A;  5DED A;  1FXV A;  2X6A A;  5BXZ A;  4MW8 A;  2ZD9 A;  3JD4 A;  4QE9 A;  4PA9 A;  3RLQ A;  4XKK A;  3K59 A;  4R8C A;  1I08 A;  3U67 A;  2OCC C;  4L90 A;  4GX0 A;  1ZTE A;  2XAB A;  4FCP A;  2CGN A;  1UY9 A;  3TGU H;  1AJ6 A;  1MAB G;  1HNW B;  4LCU C;  1IUR A;  3U2D A;  2P06 A;  2Q8F A;  2IW5 A;  4I0X B;  4TV9 A;  3T4Z A;  3W7U A;  4GKK B;  3RN4 A;  4FLU A;  1UYI A;  3TZ5 A;  3HKD B;  4WUC A;  1XNR B;  1VQ7 V;  4CC6 A;  2ITD C;  1QBZ A;  1N36 O;  1UY8 A;  3RYC B;  3C3S A;  1LR1 A;  4UCR A;  4L8J A;  1I5C A;  5L3J A;  2QWP B;  2BCC H;  3PJS K;  2WSS G;  1B63 A;  1KP3 A;  1GN6 A;  1YC4 A;  1WP7 A;  1F51 A;  4GUN A;  2ZIO A;  2ZXW C;  5KUM A;  1MSD A;  1LNQ A;  3GB7 C;  3FB8 C;  4JTD B;  2YKI A;  2GHY A;  1YJ9 V;  4K3A A;  3HHU A;  2AGA A;  4LF9 O;  2RDC A;  1VMG A;  4FK5 C;  3BFR A;  3JCZ A;  4QGP A;  1Q86 W;  3K57 A;  1F23 A;  2E0A A;  4MVZ A;  3R4N A;  1HDJ A;  3B28 A;  5BMV A;  4DV6 O;  2YEH A;  1Y67 A;  4LFA O;  4BIU A;  1V54 B;  4MP2 A;  2EIJ C;  1K9M W;  3RYI B;  4UB8 Z;  3R92 A;  4K35 A;  2A06 H;  3I55 V;  1YDX A;  3U11 A;  3HKB A;  3JAR B;  3K9A A;  4FMT A;  1SQG A;  1XIL A;  5B1N A;  5IDJ A;  2E76 B;  2YEF A;  4X20 A;  4YKY A;  4WUB A;  1QNM A;  4YKR A;  2IOP A;  1PL0 A;  1KYO F;  1SER A;  2Q2E B;  1DF5 A;  2KG7 A;  5KX5 B;  4JYB A;  3IFX A; 
#chains in the Genus database with same CATH homology
 3ZRX A;  4G2K A;  1YT0 A;  2IH3 C;  2ZBK B;  1UY7 A;  3TTZ A;  4PRX A;  1JCH A;  1NVP B;  1VQ4 V;  2JDI G;  4JTA B;  5CBG A;  1RPR A;  4QPK A;  3ZJZ A;  3K0G A;  1VQL V;  4G27 B;  1NVP D;  1H38 A;  2O1U A;  4AWO A;  3OW6 A;  2FWZ A;  1UY6 A;  2A79 B;  5HFM A;  1YET A;  4P2Z A;  4P30 A;  3LDC A;  3VHC A;  2B1I A;  1BKN A;  4MPN A;  3WQ9 A;  4HXW A;  1QLN A;  5LGU A;  4U93 A;  3OMU A;  2V7Q G;  4WFA V;  1GKZ A;  4BQJ A;  4XDL A;  4FJC C;  2UXN A;  3ZM7 A;  1US7 A;  3PEJ A;  1VQ9 V;  2XX4 A;  1P7B A;  1KP2 A;  4MTO A;  4ASB A;  4KTN A;  2YGA A;  4JAS A;  4MBC A;  3MHH C;  1R6N A;  3HPL C;  2XDS A;  1YC3 A;  3CCU V;  4YKZ A;  2PNR A;  4MB9 A;  4EGK A;  3K60 A;  4DXW A;  3T1K A;  4L93 A;  5L3C A;  4CWO A;  3K99 A;  2XAF A;  2XCM A;  1BMF G;  3TET A;  2WPD G;  3FT8 A;  3EHF A;  3ML0 A;  5L3B A;  2M7W A;  3H01 A;  1Y8O A;  3Q5J A;  2YGF A;  1YS3 A;  3CGZ A;  3VHD A;  2IU0 A;  2R9R B;  5EC2 C;  2YE9 A;  1JQ0 A;  2HVK C;  3OEH G;  4WF9 V;  4O09 A;  5EBW C;  2VCI A;  5B3S B;  3K08 A;  1SZT A;  2EIK C;  4X9L A;  1AI6 A;  4MVO A;  1Y8N A;  2OCC B;  5EC1 C;  3HYZ A;  3OGC C;  1GO3 F;  3E8H A;  3KE6 A;  2WI1 A;  4H85 A;  2YGE A;  3QO5 A;  3CCL V;  1COW G;  3ZN0 A;  3O2F A;  1E1Q G;  3W7T A;  2WEQ A;  1XL6 A;  4MTF A;  1PNK A;  2YEJ A;  3TZ0 A;  3A0R A;  1QY8 A;  2ZDI C;  4HYP A;  2JIZ G;  3SYA A;  3Q5K A;  1R3I C;  1VQM V;  3ABK C;  4TSF G;  2ZXW B;  3ABT A;  1ROP A;  4FPP A;  2D3O W;  2IOQ A;  3RBZ A;  1H2G A;  1VQ6 V;  3FYI B;  2HKO A;  2WI5 A;  3GIF A;  3T2M A;  3TCU A;  4R1F A;  4DO2 A;  2BU2 A;  2EIM C;  5IN9 A;  3G71 V;  3JD1 A;  1R73 A;  2EZP A;  4AWP A;  2VCJ A;  4GX5 A;  3DTU B;  3CCQ V;  3JD2 A;  4QNH B;  1ENV A;  1FXK C;  5CBH A;  3OR7 C;  4H81 A;  4WFF A;  2WER A;  3CYO A;  3ZMU A;  4MVR A;  3BEH A;  3OAA G;  1K5Q A;  1PNL A;  3CGY A;  1JJ2 U;  1Y8P A;  1NHJ A;  5CTU A;  1GM7 A;  3A0Z A;  2YE4 A;  3E35 A;  4HYO A;  3HZ5 A;  3O0I A;  1PVG A;  4LBE C;  1K8A W;  3TUH A;  2HG5 C;  1YI2 V;  3SYQ A;  1GKF A;  1OCZ B;  4CWQ A;  2DWE C;  3CXC U;  1QR9 A;  4H7Q A;  4O04 A;  1M56 C;  2FWY A;  3CP1 A;  3CME V;  2AHY A;  1MOF A;  1NBM G;  1MG1 A;  4EMV A;  1M9N A;  1E79 G;  2XHX A;  4AS9 A;  1FXH A;  3SJQ C;  4PA6 A;  3HYY A;  3INX A;  3CRL A;  2XD6 A;  3OE7 G;  5LGN A;  2ZDX A;  4JAV A;  3FV5 A;  2Q69 A;  1I5D A;  2FTK A;  2EZO A;  3EHG A;  3OWB A;  1P4R A;  1UYC A;  3MNR P;  1BGQ A;  2DQ3 A;  1EA6 A;  2Q8I A;  3FYE B;  1BHA A;  1VQ8 V;  4UVC A;  1NJI W;  3Q5L A;  4URM A;  4URL A;  2HR3 A;  2WLH A;  2XAG A;  2QE7 G;  3ASN B;  3BMY A;  3K04 A;  4PA7 A;  4P9P A;  2XJJ A;  5DM6 V;  2IOR A;  4CWR A;  3SYO A;  3CCV V;  1H7S A;  3CRK A;  5B1B C;  2GSM B;  2CCU A;  3VBB A;  3OPD A;  1W2B U;  1YT1 A;  2HCH A;  2YEI A;  4PDL A;  2WI2 A;  3ETE A;  1NR1 A;  2NLJ C;  3D36 A;  2H94 A;  4YKQ A;  4ASF A;  3D0B A;  1F4M A;  1GTO A;  4MP7 A;  3ZMT A;  1NR7 A;  4UVB A;  1AH8 A;  5LHG A;  1NKD A;  2IWX A;  4GT8 A;  4ASA A;  3FKS G;  4HZ3 A;  1YJW V;  3X2Q C;  1F4N A;  2EIK B;  2YE8 A;  4XDK A;  3P32 A;  2BSM A;  2IJJ A;  3RW0 A;  3QO8 A;  4XDJ A;  3E8B A;  3CC7 V;  4JQL A;  5CPH A;  3HB3 B;  4OXS A;  5GW7 A;  4HZ0 A;  2BU6 A;  1K4D C;  4E2L A;  4KSG A;  1IXM A;  4URO A;  3ZMS A;  3AG1 C;  4WCE V;  2YEA A;  3OUS A;  3JD3 A;  4UUJ C;  4MT8 A;  3STZ C;  1AJP A;  1JVM A;  1K5S A;  2DYR C;  4URN A;  3EHB B;  4NH7 A;  4V25 A;  1SET A;  4E02 A;  2WEP A;  3SPH A;  4J9Y B;  4BW5 A;  2JEX A;  3K03 A;  3K0D A;  1THN A;  1DLB A;  3SPG A;  1K92 A;  4UV9 A;  5D7R A;  2XJG A;  4NH9 A;  3CD6 V;  3K98 A;  1S3J A;  4L91 A;  1EFR G;  2X0L A;  2WLK A;  3WHA A;  2A0L A;  4MPC A;  4XBF A;  1AI7 A;  3OMA B;  1YSR A;  4CWF A;  3RLR A;  1BHB A;  2YEB A;  5LBQ A;  1UYH A;  5EK0 A;  3RVY A;  4L94 A;  2BZ5 A;  2WI3 A;  4MS2 A;  4UXN A;  4LWI A;  3ABM B;  5L3E A;  1TC0 A;  3B25 A;  2IJK A;  2W6I G;  2YE5 A;  3TK1 A;  3E83 A;  2X6B A;  1UYD A;  4LP0 A;  4CBC A;  5J71 A;  2Y48 A;  3NXS A;  1QLE B;  1YIT V;  4GQT A;  1M56 B;  1EI1 A;  3R65 A;  1B3Q A;  3QDD A;  4XCJ A;  4L8Z A;  2XHR A;  4XE2 A;  1JM6 A;  1ARO P;  2XDK A;  3R4P A;  3K3W A;  3W7S A;  5H6R A;  1S77 D;  2ZQM A;  2JKI A;  1M57 C;  1YES A;  2JK5 C;  3JYC A;  2GFD A;  4EFU A;  4WFG A;  4I5S A;  1J95 A;  1H8H G;  3F7V C;  4YKX A;  4I9W A;  3OFN G;  1UYM A;  3ZRV A;  1GMG A;  4UV8 A;  2CH4 A;  2MK3 A;  1R3K C;  2ZDI A;  3C0E A;  2LP7 A;  3G75 A;  1ZWI C;  3CPW U;  1NH2 B;  1W0J G;  4MPE A;  1S0V A;  5LHH A;  4QJF B;  4TT3 G;  2C2A A;  2QG2 A;  1PKX A;  2XDU A;  1TUE B;  5CTY A;  3U2K A;  1RM1 C;  1I5A A;  3B8M A;  5B1B B;  4WFB V;  2HVJ C;  4BQG A;  2O1V A;  4UVA A;  1NH2 D;  3D2R A;  3ABU A;  4B7P A;  4KFM A;  1S5H C;  2YE2 A;  4XKO A;  1CPY A;  4ZKI A;  4QPJ A;  3T10 A;  3LNU A;  2WLM A;  3ABL C;  1JX9 A;  3BY6 A;  3EKR A;  4H37 A;  4F4L A;  3EKO A;  1GM9 A;  3GWO A;  3A0Y A;  2HJF C;  1GJV A;  3LDD A;  4KUM A;  5FND A;  1L1F A;  2H8P C;  3SPJ A;  3X2Q B;  4N21 A;  1FFT B;  1M1K W;  1ORQ C;  4KP4 A;  3OM3 B;  4BAE A;  3HZ1 A;  1EZJ A;  2K1E A;  4GEE A;  2YEC A;  4O05 A;  4ZBM A;  3ASO C;  2QM8 A;  3E2E A;  1KZN A;  3ZXQ A;  1VQP V;  4RAI A;  4RUE A;  1I5B A;  5HFL A;  2WI4 A;  1VQO V;  3CWV A;  1K33 A;  3NMQ A;  1L0O A;  4X88 A;  2LFS A;  2EXL A;  3AG1 B;  5L3D A;  3ZKB A;  4WUD A;  3UKM A;  2HFE C;  2UWD A;  4EM7 A;  5D6P A;  2VW5 A;  3P30 A;  5CMU A;  2DYR B;  4X89 A;  1I59 A;  4JTC B;  1UYK A;  1YHQ V;  3G6E V;  2FYP A;  4YKT A;  2EJR A;  1ZWH A;  2XND G;  4J9Z B;  1BYQ A;  4FCQ A;  2AKP A;  4K4O A;  4PDV A;  2Q8G A;  2XHT A;  1K34 A;  4L87 A;  1M90 W;  4NH8 A;  2EIJ B;  5DN6 G;  4QIW F;  1GK9 A;  3W7W A;  3RVZ A;  4AWQ A;  1BXD A;  1YJN V;  2GQP A;  4ASU G;  3R4O A;  3G7E A;  3R4M A;  5CBF A;  1UJW B;  1NHI A;  1JOY A;  1DF4 A;  5CF0 A;  3FT5 A;  2EIN C;  3LSQ A;  1H7U A;  4I3H A;  1JPX A;  1QR8 A;  2BOC C;  4R3M A;  4YKU A;  2DQ0 A;  1G8M A;  1UYG A;  2BYH A;  1GKX A;  3T2S A;  1QYE A;  1UYF A;  2WAM A;  3QTF A;  3E8F A;  1MSW D;  4LWF A;  3F7Y C;  3EHJ A;  2KB1 A;  2YKB A;  1YIJ V;  2PI4 A;  1DTO A;  1K73 W;  4V26 A;  4XTJ A;  5KA6 A;  5J6A A;  1M57 B;  2OT5 A;  2WLL B;  2AHZ A;  1RPO A;  3B27 A;  3G4S V;  3AG2 C;  1Z5C A;  3GIE A;  4PA3 A;  1QZR A;  1PNM A;  2OTJ V;  3CCJ V;  5BOC A;  3F5W C;  1AJQ A;  3EHH A;  2BRE A;  1KC8 W;  2P90 A;  4MW3 A;  4U7O A;  2XOK G;  2YI0 A;  2QTO A;  3ZIA G;  2H8M A;  3PEH A;  2HG1 A;  4LPB A;  1RM1 B;  5IY5 C;  3AG3 C;  2QEX V;  2YEV B;  4JF3 A;  4EEH A;  2B1G A;  1G4Y B;  3OW2 U;  2BU8 A;  1VQK V;  5CTW A;  1ZXM A;  1N8R W;  3LUT B;  2WLN A;  5H9C A;  2K5B A;  1UYL A;  2CCS A;  4JPR A;  3ZRS A;  3QO7 A;  3ABL B;  3H80 A;  2XK2 A;  2DWD C;  3OR6 C;  2YE7 A;  3K79 A;  1H8E G;  2R9I A;  2WLJ A;  4BAY A;  1I58 A;  4DUH A;  2DW4 A;  3SYC A;  1OSF A;  2WWW A;  1AR1 B;  4U7N A;  4E01 A;  2IWU A;  4HXZ A;  1GM8 A;  1KD1 W;  5EBM C;  1Z5A A;  4MOT A;  4H33 A;  4PEL A;  2HKJ A;  2ESA A;  1WLE A;  2XAS A;  3ASO B;  2H55 A;  1TIL A;  1HWY A;  4RUF A;  5FWK A;  2YK2 A;  1AI5 A;  3QNE A;  2XDL A;  1S72 V;  1FS0 G;  3CCE V;  4P7A A;  3OUF A;  1THZ A;  2XJX A;  3ABK B;  2Y69 C;  3TZ4 A;  2EIL C;  3E89 A;  3VOU A;  4XD8 A;  1KKD A;  1OCR C;  4KQV A;  2WLL A;  2DYS C;  3T4D A;  1AM1 A;  3A0W A;  3ZMZ A;  1BL8 A;  1MU5 A;  3ZRW B;  2EIM B;  5C93 A;  4MTG A;  4LC1 A;  1NHH A;  4PL9 A;  4Z1M G;  2ATK C;  3MD0 A;  2YEG A;  1XL4 A;  3B24 A;  3G7B A;  5CA3 A;  1AI4 A;  1FXK B;  1KQS U;  1NQT A;  1OCC C;  4R6Z A;  5H6Q A;  1W0K G;  2ITC C;  3LDE A;  3T1C A;  2YKE A;  2IU3 A;  4GX1 A;  3A0X A;  3LPS A;  4MVS A;  4PU9 A;  4CWT A;  2EIN B;  5B1A C;  5M4H A;  1QVF U;  4E00 A;  2YEV A;  2Q8H A;  2ZKJ A;  4RO2 A;  3IED A;  5BZB A;  1R6K A;  2BU5 A;  5IYC O;  5M4K A;  1UYE A;  4XC0 A;  1KEC A;  3WG7 C;  2P6J A;  1TID A;  4HAM A;  4B6C A;  5M4E A;  1OCZ C;  4O07 A;  2YKC A;  4XIQ A;  5FNF A;  3VHA A;  2YJX A;  3ETG A;  4RQF A;  3A0T A;  2VWC A;  3IC7 A;  3ZCC A;  3ZKD A;  3AG2 B;  5D7D A;  2ZR3 A;  3STL C;  1Q81 W;  1YSC A;  3INW A;  4XCL A;  4W7T A;  1V55 C;  3OWD A;  1KIJ A;  1R3J C;  3AG4 C;  4O0B A;  1PD3 A;  2CCT A;  3VAD A;  1K4C C;  4JAU A;  4EGH A;  1AH6 A;  1K7D A;  3CC2 V;  4PA4 A;  4DZY A;  3HEK A;  3CCM V;  3GIG B;  2IJI A;  1I5Y A;  1YTF B;  3SPI A;  4QE7 A;  1Y4U A;  5IY5 B;  3AG3 B;  3CC4 V;  2JJ1 G;  4KSH A;  5IYD O;  4HY6 A;  4R3A A;  3ASN C;  2X6C A;  2WLI B;  4LWE A;  4GT1 A;  4MTX A;  1B62 A;  1S76 D;  1U2O A;  2FXS A;  2HLD G;  1YTF D;  1R62 A;  3ZRW A;  1OZ0 A;  3RLP A;  3ZMV A;  4MVQ A;  2XAJ A;  3I56 V;  4TWK A;  1ZXN A;  5D6Q A;  3D3I A;  2V1D A;  2YI5 A;  4WFE A;  3T0H A;  1FXK A;  1OHH G;  5L3F A;  4BXI A;  2YI7 A;  4CE1 A;  1OCO C;  4EKW A;  1QVG U;  4CZZ A;  2Q68 A;  2IH1 C;  2CK3 G;  1YSZ A;  2OTL V;  2XAH A;  5KA5 A;  5D7C A;  4R7C A;  3T0Z A;  2YI6 A;  1CP9 A;  2JJ2 G;  1TBW A;  4N23 A;  2BTZ A;  4LWG A;  4HZ5 A;  2YED A;  3B77 A;  3LNM B;  3JZ3 A;  2F43 G;  3R91 A;  3ZXO A;  2EBO A;  1SRY A;  3OEE G;  3IGA C;  4GGL A;  4Q20 A;  2O1W A;  1U0Z A;  4YXW G;  2Z3Y A;  2BYI A;  2Y69 B;  2IWS A;  2LFR A;  2UXX A;  4XIT A;  1MX0 A;  4MVU A;  2EIL B;  5CN0 A;  4CWN A;  1OCR B;  2DYS B;  1YC1 A;  1QCE A;  3UM7 A;  4GCZ A;  1Q82 W;  2JJC A;  5B1O A;  3CCS V;  4PDR A;  2BRC A;  1CEZ A;  3B26 A;  2XX2 A;  3AEI A;  5IDM A;  2Q6A A;  1AJN A;  4ZVI A;  2YSU B;  4PDM A;  1OCC B;  1WPX A;  1K3E A;  1V54 C;  3FB6 C;  5LGT A;  2QF6 A;  3GIG A;  5BOD A;  3SL2 A;  5B1A B;  2W0F C;  2BT0 A;  1Y4S A;  4GX2 A;  3C11 A;  4GFN A;  2IJH A;  4XDM A;  5CTX A;  1AMW A;  2WLI A;  3MHS C;  2BU7 A;  1ZW9 A;  5J9P C;  1VQN V;  2W6J G;  4JGS A;  3KG2 A;  2ZDY A;  4LWH A;  1Y66 A;  5F3K A;  2Q67 A;  3ABM C;  5FL7 G;  4YKW A;  3WG7 B;  2YKJ A;  2A9H A;  1S14 A;  1QLE C;  4G28 B;  2QKS A;  3E86 A;  5M4N A;  3B8N A;  4PRV A;  5F5R A;  2YEE A;  1K97 A;  3ETD A;  4X8A A;  2XDX A;  3EFF K;  2BOB C;  2Z5U A;  2YK9 A;  1B6Q A;  1V55 B;  2CG9 A;  3AG4 B;  2QFO A;  4LP8 A;  4MVM A;  3ZN1 A;  1A4H A;  4WFH A;  4EFT A;  1I5X A;  3CMA V;  2XX5 A;  1Z59 A;  3E8G A;  4XIP A;  3JD0 A;  3K06 A;  4CWS A;  4RQE A;  2NNU A;  1S16 A;  4HYM A;  2YE3 A;  2QA4 V;  4P8O A;  1SES A;  1YER A;  4XIR A;  5IYB O;  5EBL C;  5L3G A;  2YE6 A;  4CWP A;  1Y4M A;  2QM7 A;  3LSS A;  2ZR2 A;  1TH8 A;  3O6O A;  4P9O A;  3CCR V;  3OMI B;  4CE2 A;  4BIZ A;  2CGF A;  4HY1 A;  3BM9 A;  2XAQ A;  3H4L A;  4R50 A;  5GGZ A;  4CE3 A;  1TC6 A;  4MSW C;  1R3L C;  1Q7Y W;  2P7T C;  5LHI A;  3SPC A;  3RKZ A;  3K97 A;  2X7R B;  3W7X A;  4XKA A;  2WI6 A;  4EGI A;  2YJW A;  1OCO B;  2P67 A;  1E1R G;  1EBO A;  3TZ2 A;  2PI5 A;  5FNC A;  5M4M A;  4FIP C;  3FB7 C;  2QG0 A;  2JEU A;  4KFG A;  3WFV A;  3M99 B;  3OMN B;  5KUK A;  1VQ5 V;  4ASG A;  5M4P A;  3FB5 C;  2WI7 A;  1YT2 A;  3DGE A;  4FCR A;  1Z5B A;  2B5U A;  1ID0 A;  5E1A C;  3SYP A;  5B3S C;  4JYC A;  1FXV A;  2X6A A;  4MW8 A;  4PA9 A;  2ZD9 A;  3JD4 A;  4QE9 A;  3RLQ A;  4XKK A;  4R8C A;  3U67 A;  2OCC C;  4L90 A;  4GX0 A;  2XAB A;  4FCP A;  1UY9 A;  1AJ6 A;  1MAB G;  4LCU C;  3U2D A;  2Q8F A;  2IW5 A;  3T4Z A;  3W7U A;  1UYI A;  3TZ5 A;  4WUC A;  1VQ7 V;  2ITD C;  1QBZ A;  1UY8 A;  1I5C A;  5L3J A;  3PJS K;  2WSS G;  1B63 A;  1KP3 A;  1YC4 A;  1F51 A;  2ZXW C;  5KUM A;  1LNQ A;  3GB7 C;  3FB8 C;  4JTD B;  2YKI A;  2GHY A;  1YJ9 V;  3HHU A;  4FK5 C;  3JCZ A;  1Q86 W;  1F23 A;  2E0A A;  4MVZ A;  3R4N A;  3B28 A;  2YEH A;  4BIU A;  1V54 B;  4MP2 A;  2EIJ C;  1K9M W;  3R92 A;  3I55 V;  3K9A A;  4FMT A;  5B1N A;  5IDJ A;  2YEF A;  4YKY A;  4WUB A;  4YKR A;  2IOP A;  1PL0 A;  1SER A;  2Q2E B;  1DF5 A;  4JYB A;  3IFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...