3DGEA

Structure of a histidine kinase-response regulator complex reveals insights into two-component signaling and a novel cis-autophosphorylation mechanism
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
237
structure length
237
Chain Sequence
KRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insight into Partner Specificity and Phosphoryl Transfer in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
molecule keywords Sensor protein
total genus 69
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3dgeA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3dgeA02
1QYEA 4MTXA 4XKKA 3R4OA 2WI1A 4YKRA 3A0RA 4KSHA 3WHAA 3CWVA 5L3JA 4MBCA 4CWTA 1YS3A 1JM6A 5D6PA 3H4LA 2AKPA 3A0ZA 2EXLA 3VADA 4CE3A 1NHHA 4DZYA 5BODA 1I5BA 1TH8A 4U7NA 4QPKA 4ZKIA 4GT1A 4CWSA 2YK9A 4EEHA 2VWCA 5CTXA 4HYMA 4XCJA 1AJ6A 4GEEA 3DGEA 1MX0A 4PRXA 1AM1A 4KFGA 4YKYA 3ZXQA 1EI1A 2LFRA 1UYHA 2C2AA 3INXA 2FWYA 3OW6A 3R91A 4BAEA 4LC1A 4LWGA 3CGYA 3WQ9A 3VHAA 5M4EA 5M4PA 3EKRA 1H7UA 2P67A 3GIEA 3B25A 3ZRWA 3HHUA 2BRCA 2XABA 3INWA 2IOPA 2H8MA 4MOTA 4P8OA 1GKXA 1NHJA 2YGFA 3FT5A 4BQGA 1YSZA 2O1UA 1U2OA 3TK1A 4LWFA 3T2SA 1YESA 4YKTA 2HKJA 1EA6A 5CTUA 2YE6A 4CE1A 3D2RA 4WUCA 2XJXA 2K5BA 3HEKA 3B24A 4XITA 4MP2A 2CGFA 2YEJA 1L0OA 1TC6A 4MPEA 4I3HA 3ZM7A 1ID0A 2FYPA 2YE4A 4XC0A 2QFOA 4XIPA 4NH7A 1I58A 2YEBA 4YKXA 2O1WA 2HCHA 2Q8HA 2GFDA 2YJXA 4KTNA 3EHJA 4JYCA 4E00A 4H7QA 4PL9A 3B27A 4L90A 1UYCA 2BYHA 1TIDA 2BU6A 3RLRA 3A0YA 1UYFA 2Q2EB 4H81A 4HZ5A 1YC3A 2BU5A 3T10A 2FXSA 3R4NA 2QG2A 1S16A 2BSMA 1TC0A 1Z5BA 4XIQA 4R3MA 2CG9A 2YEFA 4WUBA 3TZ5A 3ZXOA 1OSFA 4ASBA 4YKQA 1ZW9A 4EMVA 2XK2A 4HXZA 3BMYA 4FCPA 4XD8A 3O0IA 3Q5KA 2YE3A 4HZ0A 3LNUA 3HZ5A 2BU8A 4ZVIA 3IEDA 1YETA 3NMQA 3KE6A 2CCSA 1AH6A 1YERA 4E02A 1I5CA 2ZDXA 5B1NA 3K60A 2O1VA 4YKZA 1I59A 2WWWA 4CWOA 4JYBA 2YKIA 2CH4A 2GQPA 2WI2A 2XX2A 2YI7A 4JAVA 2YI0A 3CRKA 4ASFA 5M4HA 3VHCA 2ZBKB 3QTFA 4AWOA 2XDXA 4EGHA 3QDDA 5D6QA 5CPHA 2YE9A 1BGQA 3GIGB 4DUHA 2WI7A 2XJGA 3T0HA 1NHIA 2JKIA 1ZXNA 2YI6A 3O6OA 4XKOA 3TZ0A 4L94A 5FNFA 3MD0A 5B1OA 2VCJA 4URLA 3K99A 2XX5A 5FNCA 4L91A 4URNA 2WEPA 2QM7A 2YKBA 2XHTA 4XE2A 4LWEA 4B6CA 5M4KA 4H85A 3EHHA 4EGKA 1Y4UA 5IDMA 1I5DA 2PNRA 4O07A 5F5RA 2BREA 1H7SA 2CCUA 1GKZA 3OWDA 2XCMA 3RLQA 1ZXMA 1B63A 3FV5A 5D7DA 2YECA 4JAUA 3TZ2A 4PRVA 1R62A 2XHRA 4L8ZA 2YK2A 3VHDA 2IWXA 4HYPA 2WI3A 5CTWA 2VCIA 3GIGA 1IXMA 4L93A 1QY8A 5M4NA 1PVGA 4MB9A 2YI5A 2Q8GA 3U67A 3HYZA 3D0BA 1TILA 4XCLA 3MNRP 2XX4A 1UYMA 4XTJA 4V26A 4NH8A 4O05A 4HY6A 4WUDA 4JASA 3T1KA 1TBWA 1BKNA 3OWBA 1QZRA 4EFUA 1AMWA 2FWZA 3C11A 1B3QA 2YKEA 1Z59A 3R4PA 2HG1A 4YKUA 4CWFA 3G7EA 3TZ4A 1UYIA 2JJCA 4LWIA 3ZKBA 3C0EA 4GGLA 2YE2A 5BOCA 4UROA 5GGZA 4AS9A 2ZDYA 1MU5A 4JQLA 3PEJA 2QM8A 5F3KA 2H55A 4U93A 1THNA 4R1FA 3ZKDA 1Z5AA 1U0ZA 3G75A 4P7AA 5CTYA 4LPBA 4AWQA 4AWPA 4V25A 3PEHA 3B26A 4W7TA 4XDMA 4X9LA 2YGAA 4BIZA 3EKOA 2QG0A 1Y4SA 3Q5JA 4LWHA 3A0TA 4KQVA 1AH8A 2IWUA 3HZ1A 1UY7A 4HY1A 1UY9A 3RLPA 2IORA 3R4MA 4BIUA 2YE7A 1BXDA 4EFTA 2Q8IA 3U2KA 2XD6A 3LPSA 4Q20A 4EM7A 4YKWA 1A4HA 4GFNA 2YEIA 4K4OA 2XDSA 5IDJA 1YT1A 3G7BA 1S14A 1UYGA 4GQTA 3Q5LA 4MP7A 3O2FA 2YE8A 1UY6A 3ZRXA 4FCRA 4HXWA 2FTKA 2IOQA 1Y8OA 2QF6A 3FT8A 4FPPA 3T0ZA 5M4MA 2BTZA 2BT0A 3OMUA 1GJVA 5J6AA 4XKAA 1B62A 5IN9A 1US7A 3K97A 3B28A 4E01A 4FCQA 2CCTA 4BQJA 2XJJA 3U2DA 4CWNA 4GCZA 4R3AA 2YJWA 4ASGA 1UYDA 3EHGA 3ZCCA 3SL2A 1Z5CA 2YKJA 1UYEA 1YT2A 4U7OA 2WI4A 3JZ3A 2BU7A 4BXIA 5C93A 3K98A 3RKZA 1Y8NA 1UYKA 2YKCA 2UWDA 2VW5A 1Y8PA 4MT8A 1ZWHA 3R92A 4CE2A 3TTZA 1JOYA 2WI6A 2XDKA 4XIRA 2ESAA 4O04A 4ASAA 2Q8FA 5CF0A 2WEQA 3GIFA 3NXSA 4NH9A 4B7PA 5D7RA 4KP4A 5J71A 2YEEA 2ZKJA 1YT0A 3HYYA 2YEGA 3EHFA 3CGZA 3P32A 2YE5A 4KSGA 2YEDA 2E0AA 5FNDA 2BZ5A 2IWSA 3BM9A 1UYLA 5D7CA 4O09A 4URMA 4MPNA 1YC1A 3A0WA 2BU2A 5FWKA 1F51A 1UY8A 3CRLA 4LP0A 2YEAA 4O0BA 2WERA 1KZNA 3ZRWB 3A0XA 4EGIA 4QPJA 1YSRA 2XDUA 3ZRVA 4CWRA 4CWQA 4CWPA 2XDLA 3OPDA 2LFSA 2YEHA 4I5SA 2XHXA 3H80A 1KIJA 4MPCA 1YC4A 4FMTA 2WI5A 4PU9A 2YGEA 3TUHA 1BYQA 4GT8A 3D36A 1I5AA 2BYIA
chains in the Genus database with same CATH superfamily
4YJ2B 4MS2A 1KKCA 1F23A 3A0RA 4X9QA 4KSHA 4JI1O 4LFCB 1EN6A 3TGUH 1N34B 3CWVA 1EN5A 4AQYB 1YJNV 2F66C 1ROPA 1GKFA 4XDLA 2AKPA 3SDLA 4NKGB 1FD9A 1VF6C 2R70A 1HNWO 4CE3A 1YZBA 2Y4UA 1I5BA 1TH8A 4U7NA 4QPKA 5BODA 1LUVA 4DYLA 4NXMO 4JI6B 3LSQA 3P3NA 2Q7EA 4ZI7B 3QG5A 3CC2V 3DGEA 4MVQA 1AM1A 4X8AA 3K5LA 3RYHA 2C2AA 3INXA 2FWYA 1URFA 3IFXA 4LH6A 4LWGA 3JASB 2VRZA 3WQ9A 3H1LH 5M4EA 3EVKA 3THOA 3BA8A 2ZR3A 1XNRB 1H7UA 5KHHA 2YICA 4W4KA 3B25A 3GIEA 3HHUA 1KQSU 2XABA 1OZ0A 2Q67A 3CMEV 2H8MA 2IOPA 2WLIA 2LW7A 2EIJB 2JGUA 4BQGA 1YSZA 1U2OA 1JA8A 4YKTA 3R66A 4O4LB 1R3KC 4E2LA 4WUCA 2XJXA 1EN4A 2K5BA 4XITA 4WFAV 4MP2A 3CB2A 2N05A 4X89A 4IGGA 1LNQA 1KP2A 3ABMC 2FYPA 1V54B 4DRXA 2QFOA 1WPXA 2GTSA 4NH7A 4MTFA 4QIWF 5JH7B 3E22A 2RJZA 5CA3A 1HR0B 3DXRA 4JGSA 4JYCA 4E00A 4GLXA 4H7QA 4PL9A 4L90A 4XDKA 1EZJA 2JGDB 5H5NA 4H81A 1TVKA 3JCZA 4HZ5A 1IBMO 2RCVA 1SA0A 1YC3A 2BU5A 3L9DA 2FXSA 1T5EA 5J2UB 4DR4B 2QG2A 2VQEO 3R4NA 1FXKB 2E74B 1BE3H 3H1KH 1KC8W 2BSMA 5B66Z 1TC0A 1SKVA 4XIQA 1TGOA 3IC7A 4YKQA 4CZZA 5LXTB 4JV5B 4EMVA 4R50A 4LF7B 2CGNA 2YE3A 2DQ3A 4UB6Z 2AW9A 3L73H 3A2FA 4DV7O 4ZVIA 4PDLA 2ADPA 5ITZA 2UXNA 1AI5A 3ZS8C 4DV0O 1I94O 2UXBO 2P6JA 2LGQA 1I5CA 3ZMVA 2ZDXA 3JSNA 4J9ZB 4GZRB 4HAMA 4DR7O 4GKKO 4YKZA 1L8DA 1I59A 2XAHA 2WWWA 4G27B 4X62O 1V55C 4JI5O 2CH4A 2XX2A 2YI0A 1YEWA 3CRKA 3ZIAG 3ZMZA 3HKDA 1VQ7V 1Y74A 5A2QN 4QGPA 5LXTA 1SA0B 4DR7B 4AWOA 1MABG 1QVFU 3FYIB 3ABLB 1YXBA 4DUHA 2BOBC 2B9ZA 2XJGA 3T0HA 2JKIA 1ZXNA 4H0LB 4XKOA 4QJFB 1S0VA 4J7ZA 4BIOA 3TZ0A 2RMKB 1E1QG 1VQMV 2YDEA 2VCJA 5KLVH 1YF2A 3K99A 2KKWA 4L91A 4URNA 3JALB 1CPYA 2DE0X 1DLBA 4FZ0A 1D2DA 2DQ0A 5LHGA 4FLZA 2RQ6A 5H6QA 2XHTA 4DV1O 1JVMA 4B6CA 3W7SA 3UT5B 2F23A 2ZR2A 3EHHA 2UXCO 2QA4V 3DXRB 4DRXB 4ASUG 1B04A 2HHHO 1AI6A 1H7SA 2WPDG 1B63A 3FV5A 3KCYA 2YECA 2A7WA 3TZ2A 1H2SB 5B1AB 2A79B 2IWXA 3ZHQA 3AK2A 5CTWA 3GIGA 2V1DA 2QM4A 4IIJB 2WLLB 1I08A 2E76B 3CCEV 5BR8B 3CSXA 2P4VA 3NR7A 3OMIB 3R65A 1PVGA 2YI5A 2Q8GA 3I5DA 2Q9LA 3VQYA 3LDEA 4R8CA 1BZKA 1THZA 2E75B 3K9SA 4JI3O 3FB6C 3HYZA 3ZN0A 1DTOA 3SYAA 2DYSB 1IBKO 1VQLV 1DF5A 2YIBA 3ICXA 3OAAG 1K9MW 2QEXV 4JASA 1ZX3A 2P06A 3JASA 3T1KA 4YIPA 2PY5A 2BTOA 1BKNA 1XQ8A 5KHKA 1QZRA 1AMWA 2FWZA 2Z5UA 1B3QA 2YKEA 2JGDA 5IWAB 3DTUB 2N74A 3C0EA 4GGLA 3WG7B 1J5EO 4DV0B 4FM2A 4JI3B 3PEJA 2H55A 2FMLA 3KCXA 4LR3A 4J41A 3H9VA 1Q81W 4DV4B 2JS3A 1HNZB 5CTYA 3TXQA 4X62B 1XMQB 4V25A 3PEHA 3ASNB 2CGOA 2YGAA 1RFYA 5JENA 4J11A 2IH1C 5H2FZ 2GUZA 1UY7A 2EIMC 4HY1A 4X1KA 2P7TC 3RLPA 2P5OA 2W0XA 3R4MA 1TAEA 3JALA 3U2KA 4I7ZB 2XD6A 1H2LA 4Q20A 2OIGA 3N2KB 3ETDA 4WF9V 1XMQO 3ZJZA 2Y0IA 2Q0AA 1I0HA 3RYHB 4OPAA 3LMMA 4N21A 4TUYA 3GB7C 4PA9A 4X65O 2CH7A 3G7BA 4GQTA 4FFBB 3STZC 2K9PA 5AG2A 3P30A 5BXZA 2EZPA 3ABUA 1YSCA 2FKXA 1Y76A 2CE4A 4AQYO 1XBLA 4QE9A 4CS4A 5L3FA 1N36B 1S76D 2QF6A 2IJJA 1KBHA 1WP7A 1Q6IA 3ABMB 3CRRA 3CYGA 3T0ZA 1YITV 2XAGA 2BT0A 3OMUA 2Q4PA 1NTZH 4E01A 2CCTA 2WLLA 4CH5A 3UKMA 2EIMB 2JVDA 2XJJA 3BY6A 1NU1H 3CCRV 3OM3B 4GCZA 1GH6A 1JMKC 4JTAB 1KB9F 1Z5CA 4UFZA 4DV7B 2ETNA 3JZ3A 4PI2A 2BU7A 2YXYA 4UVBA 1MA1A 4Z1VA 5CBFA 1RPOA 1QBZA 1XL6A 2IW5A 4JI0O 2UWDA 3H1JH 1KD1W 4CE2A 1PP9H 2Q7HA 1W0KG 5JQGA 2CUGA 2Q7GA 1HP8A 4IT5A 5IY5C 2WI6A 2L35A 3I55V 4PD4F 4JI5B 4HZ3A 5CF0A 1SRYA 2F1MA 1GN6A 5D7RA 5EBLC 2YI9A 4I55B 4I0XA 1S3JA 4MW8A 1VP7A 2L6LA 3FB7C 4K35A 3SPCA 5KHJA 3CHXA 2HG5C 4KSGA 1Q6UA 2WA3A 4EEQA 2UXDO 5EYPA 3ABKC 4O09A 1JFFA 4PJ0Z 1UFIA 3CYOA 4OXSA 3A0WA 2CK3G 1Y4MA 2DMXA 2PGGA 4R6ZA 4IHJA 1X59A 2C1IA 3A0XA 5GW7A 3DC6A 1OHHG 4ZOLB 3LNNA 2XDUA 4P9PA 4CWQA 4HYOA 4LWSB 4JI2B 4X64O 5IT9N 4I4TB 5KAFZ 3CD6V 2QWPB 1EZVH 3ZHSA 4ABMA 1XNQO 4PU9A 2YGEA 1FXKC 3K58A 5C8YA 1QQCA 2QSAA 5H9CA 4PA6A 2ZIMA 3D36A 1QNMA 3ETGA 4MTXA 5LGTA 3OT7A 4YKRA 4FLXA 4LF8B 2ZNJA 4DO2A 1PNLA 5J9PC 3LNMB 4MBCA 3VQVA 4IYIA 5JWPA 1VQ8V 4CWTA 5D6PA 2F93B 3KKYA 1SQGA 2UU9B 3JATB 4D7TA 3J7AU 1NHHA 3K5MA 4FLYA 2IJKA 5L3EA 4WFGA 1XL4A 3L70H 1WB7A 1K4CC 4IYHA 5LOVB 4GKKB 2YK9A 1BQZA 1Y74B 4MW3A 2V7QG 4LBEC 2VWCA 5CTXA 3AEIA 1SQFA 2PUSA 2IU0A 5FPOA 4B3SO 4GEEA 1GM7A 4EFBA 4PRXA 4YKYA 3ZXQA 2LFRA 1WP8A 3HKDB 1UYHA 1WLEA 1QLEB 2AXTZ 3QTCA 1E1RG 4DK0A 3OW6A 4BAEA 5IYCO 3F5TA 4JI1B 4YJ3B 1COWG 5M4PA 2EX3A 2QJ1A 3VQWA 5LHIA 4JI0B 3ZRWA 3AG1B 5LHHA 1NH2B 1KKDA 4MOTA 1GK9A 1M57B 3T4DA 2EJ7A 2VQEB 2O1UA 4LWFA 3UT5A 3T2SA 1WPBA 2WA4A 5CTUA 5CB4A 3HKEA 1L0LH 2HR3A 1YI2V 3CCUV 3RYFB 1JFFB 3SYPA 1LR1A 1TC6A 3T1HB 4PELA 3ZHTA 4O4HB 3BCCH 1ID0A 4XC0A 1NTKH 4FFBA 2YUAA 4FFKA 3JAMN 2YEBA 2O1WA 2BOCC 3AG4B 4UB8Z 2Q8HA 1I5YA 2GFDA 2YIAA 2YJXA 5LYJB 3E8FA 2JEUA 3EXAA 1WB8A 3CRMA 1TIDA 2BU6A 2Y48A 1HDJA 1UYFA 2HFEC 2Q2EB 5GONA 1P84F 4LH7A 5L3DA 2E3CA 4D6TH 4JI2O 4A5UB 1M56C 2GHYA 2OIEA 3OEHG 5IJ0A 2GTAA 1Z5BA 2CG9A 4WUBA 1GTOA 3TZ5A 3ZXOA 1OSFA 4ASBA 1ZW9A 1AR5A 3JCUZ 1U96A 4HXZA 3BMYA 4TQFA 1Q7YW 4FCPA 4XD8A 3Q5KA 1DGSA 2ZE8A 5B3SC 4JZ2A 5LYJA 3NMQA 3ZX6A 1M57C 4E02A 4KHPB 3MHSC 1Q6HA 1YIJV 4LF6B 4TUYB 5B1NA 2C1GA 1P49A 1MMMA 5BMVA 1WAZA 4CWOA 5EC2C 1NT2B 4JYBA 3IGAC 2YKIA 3P3PA 4JAVA 1YVWA 1IBLB 2ARHA 1B6QA 5M4HA 5EIBC 3SYOA 1ZSPA 3N2KA 4EGHA 2FB5A 3O9OA 3H01A 4LP8A 1BGQA 2PYLA 4CS2A 4LFBB 3GIGB 3OTOO 3PN1A 3AG2B 5JVDB 3O6OA 2WLNA 3ML0A 1Q86W 4L94A 3MD0A 4AILC 2HHIA 3JD4A 4LF6O 5FNCA 1N36O 2WEPA 4L87A 5EYPB 2GSMB 4G2KA 2XUMA 4K0KB 4XE2A 1ZL8A 3QVNA 3WB0A 5M4KA 4EGKA 1Y4UA 5IDMA 1I5DA 4JV5O 2HP8A 1MZEA 3E83A 2Y0PA 3E89A 4DW1A 1K3EA 3HB3B 3JD3A 1F7YA 5CB4B 5IE9A 1SQBH 4YXWG 3OWDA 2IM9A 4DUZB 1ZXMA 2UU9O 4JAUA 4PRVA 1R62A 1VQKV 1WA8A 2YK2A 4X20A 4B3RO 4AHCA 3A0BZ 1Y6XA 2WI3A 4HYPA 3E8HA 5IJ0B 2ZXWC 1H2KA 1IXMA 4J80A 5M4NA 4ZBMA 2N04A 2JDIG 4D7SA 4J7KA 4FK5C 1R3IC 1SQVH 4B3MB 3IJ4A 5IJ9B 4DR6B 2H3OA 3JD0A 5ITZB 2XX4A 3E8BA 2BTQB 4XTJA 2W6JG 4V26A 4NH8A 3MDSA 1BS3A 4HY6A 3BPZA 4MTGA 5L3GA 3OWBA 4EFUA 1QVGU 2V4DA 3M8AA 3C11A 2WSSG 4CWFA 3OD4A 3G7EA 3ETQA 1HW7A 5BY1A 5KHIA 1UYIA 4TWKA 2YE2A 3CRCA 1N4CA 5GGZA 1S5LZ 4AS9A 3HKCB 2ITCC 1MU5A 5F3KA 1KYOF 4U93A 4R1FA 3VQXA 1Z5VA 2EIJC 3T2MA 2CTWA 5LP6C 3GVMA 1FXVA 1Q8IA 2QE7G 3K3WA 3B26A 4XDMA 1YTFB 4X64B 4UVAA 1BGYH 3UM7A 4BIZA 2GDSA 3J80N 4LWHA 1GO3F 3X2QB 4DR2B 4KQVA 3CXHF 1HNXO 4ZI7A 1R6TA 4DV2B 4TV9A 1UY9A 4J9YB 2EIKB 2W0FC 4EFTA 4KL1A 2Q8IA 1VQ6V 4EM7A 2UUBO 1KECA 1K92A 2ZM6B 2OWOA 2CTPA 2XTAA 2B5UA 4TSFG 2R9IA 1OCCC 2XDSA 1YT1A 3QF7A 1UYGA 3SJQC 1FFXA 1W0JG 2HHHB 2P90A 2F4VO 2YE8A 4LWSA 3ZMUA 1W59A 3ZRXA 4FCRA 3JAKA 3FT8A 5D5QA 2LP7A 1FJGB 1O9GA 2JK5C 1J95A 2BTZA 1VF6A 4JYYA 1WA8B 4LF5B 3C90A 5E1AC 4XKAA 5LOVA 4FCQA 4BQJA 5EZYA 1GN2A 3BEHA 2CH7B 3U2DA 1XHXA 2YC0A 2UXBB 1AJNA 1NQTA 1PM9A 1N33O 4CWNA 4LF4O 1R1BA 4DXWA 1UYDA 3ZCCA 2HJFC 3S3XA 1QU7A 2JRIA 4U7OA 4BXIA 5C93A 5B3SB 4OX9B 3W7WA 4B3RB 4KHPO 3WB1A 1Y8NA 2OT5A 4X1KB 2YKCA 3FD9A 2Q73A 5KMGA 2EINB 4ICGA 4I9QA 4I4TA 1AR1B 1AR4A 2VW5A 1SESA 1AJPA 1WNSA 2OTLV 1FJGO 1NBMG 4JI7O 3TTZA 3JYCA 4MVZA 1G1XB 1K4DC 5C8YB 2RNBA 3NXSA 4NH9A 4LFAO 1QR8A 1S5JA 3ZN1A 2YEEA 3I56V 1YT0A 1QR9A 1V9PA 4JI4O 3HYYA 2DN9A 4DR4O 5JJNB 3CGZA 2XOKG 2WLJA 2ADQB 1GN4A 4OGQB 3C3SA 2EILB 2NNUA 3CPWU 1K7DA 3RT3C 2YEDA 3BM9A 4PV1B 2IWSA 1UYLA 4ZIBA 1R3JC 5D7CA 1NZ6A 4URMA 1YC1A 4PDVA 2BU2A 5FWKA 3AG4C 1F51A 4LF7O 1UY8A 3CRLA 3RN4A 4F4LA 1QLNA 2UXCB 2KQXA 4EGIA 1YSRA 4DR3O 1M1KW 4CWPA 3RYFA 4X20B 1P4RA 5LMNO 3BA9A 4IIJA 2ITDC 2XHXA 2VS0A 4CH6A 2QWOB 5DEDA 1I5XA 1OCOC 2XAFA 1KIJA 2X6BA 4FMTA 4DR3B 3AK1A 4HBNA 4F6EA 3JAKB 5JJEB 3CS5A 3JAWA 4FM1A 4GT8A 1WJZA 5LGNA 4LCUC 2QKSA 3L71H 1QYEA 1K33A 3SJBC 2WI1A 2EJRA 3E86A 3WHAA 3HKBA 2A9HA 2B1IA 1WN7A 5L3JA 5JH7A 3LDCA 4WFFA 2OCCC 4NTXA 5L3CA 1OJHA 2XHBA 3TETA 5EIBD 4CBCA 1YDXA 5J2TA 3A0ZA 3VADA 3RVZA 4WBNB 3CJHA 4GT1A 4CWSA 3D3QA 5GTHZ 3SJCC 4NXNB 4H33A 4JYAO 2NR5A 3G6BA 4I9WA 4YHHB 2UUAO 4HYMA 3SJAC 4XCJA 3L74H 1OV9A 1AJ6A 5KMGB 3B2EE 4XDJA 4KFGA 1EI1A 4PHZA 1TVKB 4I50B 2KG7B 1HNZO 3R91A 2AHZA 2Q0OC 4OX9O 3EKRA 1ZTEA 3CMAV 1N0NA 5E79Z 2BRCA 5LMUB 3K57A 5CA1B 2X7RB 4EKWA 3CX5F 4P8OA 1GKXA 1NHJA 4LF4B 1GRJA 4NTYA 3TK1A 3AG1C 1YESA 2DYRC 1EM1A 4FZ1A 5LA6A 2YE6A 4CS3A 4CE1A 1FFXB 1EFRG 3ZEDA 1KMIZ 2YEJA 1L0OA 4MPEA 4Z2WA 1P7BA 4I3HA 3ZM7A 4O4JA 2YE4A 5HFMA 2PZSA 5IYZA 3N27A 3N2GA 1S77D 2YIDA 2EZOA 4XIPA 2FL4A 3KZIZ 1I58A 4YKXA 3O65A 4JI8B 4RAIA 3CCLV 5K1XA 5LMUO 5CA1A 3JARA 1AJQA 3EHJA 2H94A 3B27A 1TA8A 1MSDA 1M9NA 4QNHB 1IBLO 3A0YA 5B1AC 1NR7A 4DUYO 3STLC 3L72H 1N32O 4P2ZA 3FB5C 1QCEA 4GKJB 3HKCA 3CEIA 5EBWC 4RWUA 4UV9A 2VWJA 2QTOA 3OMAB 4JI6O 1O9HA 1GAXA 3K79A 4R3MA 4KUMA 4O2BA 2HJDA 1K8AW 2MW2B 1P7GA 3RVYA 2YS8A 2ZE7A 3X2QC 1PL0A 1SZXA 2D2CB 1BMFG 3ASNC 3OUSA 3IEDA 3HKEB 1YETA 4XBFA 1AI7A 1YERA 2RN9A 1XEQA 1F4NA 3OW2U 3RYCA 1G4YB 3K60A 2O1VA 1H2GA 1N32B 3MHHC 1XHZA 4RO2A 3RYIA 4ASFA 3SPIA 3B40A 4FLWA 4HNAB 5KAIZ 4IL6Z 2YSUB 2LGWA 5BMVB 2XDXA 3CRQA 3QDDA 2QWRB 1V54C 2M6YA 5CPHA 5D6QA 1Q82W 1AP5A 1K5SA 4NTWA 1AVMA 4LF9B 2WI7A 5K1PA 3AG7A 1NHIA 2CTRA 5FLXN 2YI6A 2F4VB 1TUBA 3E22B 3SGIA 1SQPH 3OE7G 3OR6C 1K5QA 5BZBA 5KHGA 1R6NA 2GUZB 3IC9A 2BSKB 4B08A 4P30A 1OCRC 3H1IH 4UCRA 1IBMB 2ZNIA 1V55B 3JARB 1Q3EA 5IYZB 4H13B 3UO3A 2PNRA 3RGBA 4WBNA 3HKBB 5F5RA 2QGNA 2CCUA 2Q5ZA 1GKZA 2XCMA 3RLQA 4ZHQB 1VQNV 2CAZC 1L0NH 4JYAB 5D5PA 3VHDA 3OFNG 1QHTA 2YIBD 4JI8O 3F7VC 2GV9A 4DR2O 4L93A 1QY8A 2VQFB 2E5LB 4PI0A 2DJVA 2OCCB 2QDOA 2XAQA 1IURA 3BAAA 1JR9A 4X88A 3D0BA 2EINC 3MNRP 1UYMA 1FXHA 4O05A 2ZT9B 3QO7A 3G4SV 1FXKA 1I7FA 5CBHA 5EBMC 1JJOA 5IY5B 1K34A 4LWIA 2YEVB 5F2VO 4L8JA 1FYJA 3S3WA 5BOCA 5LGUA 5KX5B 1FFTB 5FL7G 1NI8A 4B3MO 1XDCA 2ZDYA 4JQLA 2QM8A 3T1HO 3ZKDA 3AG3B 1Y67A 4CC6A 1Z5AA 3RYIB 1PL4A 2VQFO 2E5LO 4BR6A 3D3IA 1U0ZA 4P7AA 4B3TO 4AWQA 4AWPA 2UUCO 2ZE6A 2KSDA 2QG0A 1Y4SA 5DN6G 3A0TA 3U11A 1AH8A 3FFQA 3FX7A 4UCOA 4K0KO 1JPXA 4W4LA 1IVSA 3QO5A 4DR5O 1NVPB 4GX5A 2IH3C 2IORA 3WFVA 4BIUA 2A0LA 2QKAA 2Y4TA 4X65B 1MSWD 1BXDA 5BR8O 1AB3A 4MSWC 4K8ZA 3TJTA 2O57A 3VBBA 1VF5B 2LQTA 2UUCB 1H8HG 4YKWA 1A4HA 3TXSA 5B5EZ 3K0GA 2YEVA 1MNGA 2EULA 5IDJA 1RSOA 3H1HH 4DV5O 3WG7C 4MP7A 3O2FA 4DR5B 3CRAA 3SPHA 1OCZC 1ORQC 1VMGA 2W6IG 3EHBB 5L3BA 4HXWA 4UXNA 2FTKA 4UCVA 1KU9A 5CA0A 4FIPC 1BL8A 5M4MA 2IBZH 4TV8A 1PNMA 1B62A 4WFBV 4Q6GA 1US7A 3OR7C 4FLVA 1G8MA 4YJ3A 1XUQA 4R3AA 1OCRB 2YJWA 4MVMA 3SL2A 4O4JB 3ZMTA 2YKJA 1K97A 3W7TA 2WI4A 1DK1A 1M93A 3K98A 3RKZA 3QO8A 1CP9A 4JTCB 2M7WA 5LMNB 3LSUA 1RP3B 3R92A 5KX5A 2B1GA 4BW5A 4I55A 3C3TA 1JOYA 2XDKA 5A9GA 2ESAA 3BHPA 1H2NA 2WLMA 1IXBA 3T1YB 2Q8FA 3OGIB 4YIOA 2ZXWB 4NXMB 4O4HA 2WEQA 3B4SA 2Z3YA 4B7PA 5J71A 2ZKJA 1MG1A 4UCTA 3EHFA 3DC5A 3MAQA 3FKSG 3CWBH 3T4ZA 1JJ2U 1MOFA 2IJIA 3P32A 3PJSK 4O2AA 1US6A 1NVPD 2E0AA 3E35A 5GTIZ 1HNXB 1ENVA 2A3QA 2X6AA 4RQEA 2XAJA 4LP0A 2YEAA 4OPHA 4RQFA 1BHBA 4O0BA 2WERA 4AI8A 1KZNA 2K1EA 3ZRWB 4PDMA 4UCSA 1S72V 3B8NA 4QPJA 3HR0A 2PTMA 3ZRVA 1Q90D 3GWKC 4CH3A 2XDLA 3OGCC 1MZFA 3FAVB 3OPDA 2LFSA 1NKDA 1A32A 1PKXA 2GBOA 1BHAA 4GX1A 3W7UA 4O2BB 1BSMA 4B3TB 1XNQB 4ZOLA 1YC4A 2ZDIA 3TUHA 3FB8C 1BYQA 3Q4HB 1LUWA 3A8TA 3K59A 1N8RW 1I5AA 3ZHRA 4XKKA 3R4OA 1KUQA 2WLKA 2Q8VA 3JATA 5J2UA 2ZE5A 4NR1A 4FVMA 1TUEB 4BAYA 5EZYB 1D5NA 4YY3B 3RBZA 1FPOA 1YS3A 1PV0A 1JM6A 3WB2A 2PI5A 2MK3A 3BVOA 3H4LA 4X1IA 5KA5A 2EXLA 1TUBB 3ZRSA 2ZINA 4DZYA 1ZL8B 4DR1O 4ZKIA 4RUEA 4EEHA 4JZGA 4WFHA 4DV5B 5EK0A 1FS0G 3LDDA 2JIZG 1MX0A 1YJ9V 1SZTA 1BCCH 5KA6A 4HNAA 4EFEA 2EIKC 4DUYB 3IAYA 4IHJB 5JVDA 4FM0A 4LC1A 1M90W 3CGYA 4U3JA 4JI7B 3VHAA 2BCCH 4QE7A 2DYRB 3ABLC 1AILA 3JD1A 2P67A 2LJ2A 1XREA 1UPGA 3G80A 4O4LA 3OTFA 3INWA 3S5TA 3G67A 1RM1B 2YGFA 2EBOA 3UCSC 4TOIA 3K03A 4DV6O 3FT5A 4GKJO 1SS3A 2HKJA 2LO1A 1EA6A 4O2AB 2ZDIC 3ASOB 3SYQA 4UCUA 3D2RA 5FPRA 3UQ8A 2JEXA 4DV4O 1J5EB 3HEKA 3B24A 1AP6A 3RFRA 2QR4A 2CGFA 3JD2A 1HNWB 4DR6O 2HLDG 1XILA 3F7YC 1U97A 2EILC 2AZ2A 3K5NA 3K0DA 3RW0A 1IX9A 3K04A 4I0XB 3WU2Z 4JTDB 1M4UA 4DV6B 1N34O 1N33B 4X1YB 3CCMV 2NN4A 3CJHB 2HCHA 2AGAA 1BT8A 2DW4A 4C7UA 1G6UA 4MVOA 2Z0AA 4KTNA 3N2GB 2ZIOA 4F6RB 5LP6A 5B1BC 3CC4V 1UYCA 2BYHA 3J81N 4UVCA 3RLRA 5IYDO 2UXDB 1VEWA 4E72A 4X66O 4TQDA 1Y66A 3K5OA 3T10A 2PI4A 1S16A 1XOUA 1AROP 4LNUB 3CC7V 4NYKA 4O4IB 2YEFA 2AZ0A 2XASA 2JJ2G 1PPJH 2HKOA 2XK2A 2ODMA 2X0LA 1FAFA 4UV8A 1XNRO 3O0IA 4HZ0A 3LNUA 4KFMA 3HZ5A 1PD3A 2BU8A 5CN0A 2G38A 5LA6B 3KE6A 2CCSA 1AH6A 1B06A 5FNVA 1D5AA 2D3OW 1YJWV 1KP3A 2ZQMA 1ZLZA 2P22C 2WLHA 4H37A 4CC5A 1VARA 2Q69A 5B1BB 1NH2D 2YXLA 1SC5B 3GWOA 2GQPA 2WI2A 2YI7A 4LNUA 3SYCA 4DK1A 5IWAO 1IBKB 3VHCA 1DF4A 2ZBKB 3LUTB 4J42A 4DW0A 3QTFA 2NLJC 1XMOB 1IZ3A 1ZUQA 1RM1C 2YE9A 4LFBO 4NVPA 1Z2GA 3RYCB 2QTSA 3DSQA 3APQA 2HVKC 5H6RA 1XMOO 1YTFD 3K08A 3ABKB 2ZD9A 5FNFA 5B1OA 1R3LC 4URLA 3F5WC 5CMUA 2OYQA 2XX5A 1NR1A 1VF7A 5GONB 2QM7A 3D36C 1VQOV 2YKBA 4B7EA 5EC1C 4MTOA 2F95B 2CDYA 4TV8B 4LWEA 1SERA 1IDSA 4B7KA 4DUZO 2IU3A 5CA0B 4H85A 4YJ2A 4LFAB 2YXHA 2WLIB 2YI8A 4O07A 4FLUA 2HVJC 5JJJB 1H2MA 4B3SB 2BREA 4GX2A 1X4TA 1SQQH 3OEEG 5D7DA 4EB6B 1FKAO 1JQ0A 1AI4A 2R9RB 2XHRA 4UUJC 4K3AA 4L8ZA 2IJHA 3ETEA 4PDRA 4DR1B 5IYBO 2VCIA 2XNDG 2DYSC 4KXRA 5LBQA 3BABA 5CBGA 1R73A 4U3FH 1GMGA 2Y69C 2P4KA 5TISZ 2UUAB 4MB9A 3U67A 3B77A 1K73W 1ZWIC 1Q43A 3T1YO 2Q68A 1TILA 4XCLA 3UO2A 4ZHQA 4WUDA 2OCHA 1TBWA 4WCEV 3M99B 3A0HZ 1Z59A 3R4PA 2HG1A 4YKUA 2A06H 3ZHVA 3QNEA 4BWAA 3TZ4A 2JJCA 4LF9O 3ZKBA 3FYEB 2ZKOA 4UROA 1L1FA 2UXXA 2R72A 1BQ0A 4NB5A 4WFEA 4TV9B 3JAWB 1F4MA 2VWKA 1THNA 1GN3A 5JCOC 1UJWB 3CXCU 2DWDC 5LL6Y 1RPRA 4DV3B 4JPRA 5DM6V 3G75A 4LPBA 3CP1A 1EBOA 3TCUA 4W7TA 4X1YA 4X9LA 3EKOA 3Q5JA 2R9AA 3ZHUA 2QWQB 3ASOC 3OMNB 1NJIW 2IWUA 3HZ1A 5JCOA 4N23A 3JSLA 1JX9A 2ILMA 3Q4HA 3ZMSA 5KUMA 2YE7A 2OTJV 3LPSA 1SETA 2AHYA 4R7CA 4X66B 3SR2C 4GX0A 2ZM6O 2DWEC 3E8GA 1SF9A 4GFNA 2YEIA 3APOA 2PYJA 1OCZB 2DOSA 4K4OA 3W7XA 2BTQA 1Q5OA 3CCQV 4JI4B 1S14A 3U10A 2BE3A 4JF3A 3Q5LA 4DV1B 5IJ9A 4PA7A 3FAVA 1UY6A 4P9OA 1CEZA 2KB1A 1Y8OA 3SPGA 2IOQA 4FPPA 3K06A 1YCIA 2H8PC 4K8XA 2PF4E 4LF8O 4F6RA 2QWNB 5LP6B 5DECA 1GJVA 5J6AA 5IN9A 2HEPA 4LF5O 3U0ZA 3K97A 3B28A 4PA4A 3EFFK 1Z5WA 3OTOB 1RSOB 4GUNA 3BFRA 5FNVB 4ASGA 3EHGA 1UYEA 3K9AA 1YT2A 4E4EA 3B8MA 1NTMH 1YHQV 1HWYA 3B09A 5JQGB 3G71V 1CXZB 4G28B 3AK3A 5J2TB 1UYKA 2XT9A 1S5HC 2JS5A 1Y8PA 4MT8A 2WAMA 1ZWHA 3AG2C 3HPLC 4XIRA 3LSSA 1OCOB 4YHHO 1I94B 4O04A 3G6EV 4ASAA 2UUBB 3VOUA 1W2BU 1R6KA 3GIFA 1SQXH 4KP4A 4DV2O 4FLTA 3CCSV 2YEGA 1PNKA 4U3JB 3RWRD 3CE2A 4MVUA 2BSKA 3M7MX 2X6CA 1E79G 3CCJV 4Z1MG 4NXNO 3E2EA 2YE5A 3AG3C 3CCVV 1GM8A 4YY3O 5FNDA 3BRCA 3KG2A 2BZ5A 5HFLA 4BW9A 1OCCB 2QKCA 4MPNA 3SPJA 2Q6AA 3ABTA 1ZAUA 2JJ1G 1VIBA 1VQ5V 1VQ9V 3ZBHA 3OUFA 4JAAA 2ATKC 2KG7A 4I50A 1HR0O 1H38A 4FJCC 4DV3O 1VQPV 4CWRA 4X1IB 4J7JA 1Y76B 1NS1A 4RUFA 4GYCB 2YEHA 1N0JA 2ZCEA 2F43G 4H44B 4I5SA 1H8EG 4EB6A 4CH4A 1JCHA 3H80A 2CTQA 2FYUH 2Y69B 1XI1A 1VQ4V 4MPCA 2RDCA 5KUKA 3T1CA 4LFCO 2WI5A 4PA3A 4TT3G 4MVSA 1QLEC 1M56B 4J10A 4MVRA 3D8CA 3L75H 2LW1A 1GM9A 4O4IA 2BYIA 1M5IA
chains in the Genus database with same CATH topology
1QYEA 4MTXA 4XKKA 5LGTA 1K33A 4MS2A 3R4OA 2WI1A 4YKRA 2EJRA 1F23A 2WLKA 3A0RA 3E86A 4KSHA 4DO2A 3WHAA 1PNLA 2A9HA 1TUEB 4BAYA 2B1IA 5J9PC 3CWVA 3LNMB 4MBCA 5L3JA 3RBZA 1YJNV 1VQ8V 3LDCA 1YS3A 4WFFA 2OCCC 4CWTA 1JM6A 5D6PA 5L3CA 1ROPA 2PI5A 1GKFA 2MK3A 4XDLA 2AKPA 3H4LA 3TETA 4CBCA 5KA5A 3A0ZA 2EXLA 3VADA 4CE3A 3RVZA 3ZRSA 1NHHA 4DZYA 2IJKA 5L3EA 4WFGA 1I5BA 1TH8A 4U7NA 1XL4A 4QPKA 4GT1A 4ZKIA 4CWSA 5BODA 1K4CC 4RUEA 4H33A 2YK9A 4EEHA 4MW3A 4WFHA 3LSQA 2V7QG 4LBEC 2VWCA 5EK0A 4I9WA 5CTXA 1N8RW 4HYMA 1FS0G 4XCJA 3AEIA 3LDDA 3CC2V 2IU0A 1AJ6A 4GEEA 2JIZG 1GM7A 3DGEA 4MVQA 1YJ9V 1MX0A 4PRXA 1SZTA 4XDJA 1AM1A 4KFGA 4YKYA 5KA6A 2LFRA 1EI1A 3ZXQA 4X8AA 1UYHA 2EIKC 2C2AA 3INXA 1QLEB 1WLEA 2FWYA 3OW6A 1E1RG 3IFXA 2AHZA 4LC1A 3R91A 5IYCO 4BAEA 1M90W 4LWGA 3CGYA 3WQ9A 3VHAA 1COWG 5M4EA 5M4PA 4QE7A 3EKRA 2DYRB 2ZR3A 3ABLC 3CMAV 1H7UA 2YE5A 3JD1A 2P67A 5LHIA 3GIEA 3B25A 3ZRWA 3HHUA 3AG1B 5LHHA 1NH2B 1KQSU 1KKDA 2BRCA 2XABA 3INWA 1OZ0A 2Q67A 3CMEV 1RM1B 2X7RB 4EKWA 2H8MA 2IOPA 1GK9A 1GKXA 1NHJA 2WLIA 1M57B 3T4DA 2YGFA 2EBOA 4P8OA 3K03A 2EIJB 3FT5A 4BQGA 1YSZA 2O1UA 1U2OA 3TK1A 4LWFA 3T2SA 3AG1C 1YESA 2DYRC 4YKTA 2HKJA 1EA6A 5CTUA 2ZDIC 2HR3A 3ASOB 2YE6A 4CE1A 3SYQA 1R3KC 4E2LA 3D2RA 4WUCA 2XJXA 1YI2V 2K5BA 2JEXA 3CCUV 3HEKA 1EFRG 3SYPA 3B24A 4XITA 4WFAV 4HXWA 4MP2A 2CGFA 2YEJA 3JD2A 2HLDG 4X89A 1L0OA 1TC6A 3F7YC 4MPEA 1P7BA 2EILC 4PELA 1LNQA 4I3HA 1KP2A 3ZM7A 3ABMC 1ID0A 2FYPA 1V54B 5HFMA 3K0DA 3RW0A 2YE4A 4XC0A 1S77D 2QFOA 1WPXA 2EZOA 3K04A 4XIPA 4NH7A 4JTDB 1I58A 2YEBA 4MTFA 4YKXA 2O1WA 2BOCC 3AG4B 3CCMV 4QIWF 2HCHA 4RAIA 2Q8HA 1I5YA 2DW4A 3CCLV 2GFDA 2YJXA 5CA3A 4MVOA 4KTNA 1AJQA 3E8FA 4JGSA 2JEUA 4JYCA 3EHJA 2H94A 4E00A 4H7QA 4PL9A 3B27A 4L90A 5B1BC 3CC4V 1M9NA 4XDKA 1UYCA 2BYHA 1EZJA 4UVCA 4QNHB 1TIDA 2Y48A 2BU6A 3A0YA 3RLRA 5B1AC 1NR7A 5IYDO 1UYFA 2HFEC 3STLC 2Q2EB 4H81A 3JCZA 4HZ5A 4P2ZA 5L3DA 1Y66A 1YC3A 2BU5A 3T10A 3FB5C 1QCEA 2FXSA 3R4NA 2QG2A 5EBWC 1FXKB 1M56C 2PI4A 2GHYA 4UV9A 1S16A 1AROP 1KC8W 3CC7V 2QTOA 2BSMA 3OMAB 3OEHG 1TC0A 1Z5BA 4XIQA 3K79A 2CG9A 4R3MA 2YEFA 1GTOA 3IC7A 2XASA 2JJ2G 4KUMA 1K8AW 1OSFA 4CZZA 1ZW9A 4YKQA 3ZXOA 4ASBA 2HKOA 4EMVA 2XK2A 4HXZA 2X0LA 4R50A 4UV8A 3RVYA 1Q7YW 3BMYA 3O0IA 4FCPA 4XD8A 3X2QC 5FWKA 3Q5KA 2YE3A 2DQ3A 3LNUA 4KFMA 4HZ0A 3HZ5A 1PD3A 1PL0A 2BU8A 4ZVIA 1BMFG 3ASNC 4PDLA 3OUSA 5B3SC 3IEDA 5CN0A 2UXNA 1AI5A 1YETA 3NMQA 3KE6A 2CCSA 1AH6A 4XBFA 1AI7A 1M57C 1YERA 4E02A 2P6JA 3MHSC 2D3OW 1YJWV 1F4NA 1KP3A 3OW2U 1YIJV 1I5CA 2ZQMA 2WLHA 3ZMVA 2ZDXA 4H37A 5B1NA 1G4YB 3K60A 2Q69A 4J9ZB 2O1VA 1H2GA 4HAMA 4YKZA 5B1BB 1NH2D 1I59A 2XAHA 3MHHC 2WWWA 4G27B 3GWOA 1V55C 4CWOA 5EC2C 4JYBA 3IGAC 2YKIA 2CH4A 2GQPA 2WI2A 2XX2A 2YI7A 4JAVA 2YI0A 3CRKA 1B6QA 4RO2A 3SYCA 4ASFA 3ZIAG 3VHCA 5M4HA 3SPIA 3ZMZA 1DF4A 2ZBKB 3LUTB 3SYOA 1VQ7V 3QTFA 2YSUB 2NLJC 4AWOA 2XDXA 4EGHA 1MABG 1QVFU 3FYIB 3QDDA 1RM1C 3H01A 1V54C 5D6QA 5CPHA 1Q82W 3ABLB 4LP8A 1BGQA 2YE9A 1K5SA 3GIGB 4DUHA 2BOBC 2WI7A 2XJGA 3AG2B 3T0HA 1NHIA 2HVKC 5H6RA 2JKIA 1ZXNA 2YI6A 4QJFB 3O6OA 2WLNA 1YTFD 3K08A 1S0VA 4XKOA 3TZ0A 3ML0A 1E1QG 3ABKB 1Q86W 2ZD9A 1VQMV 4L94A 5FNFA 3MD0A 5B1OA 1R3LC 2VCJA 4URLA 4MOTA 3F5WC 3JD4A 5CMUA 3K99A 2XX5A 5FNCA 4L91A 4URNA 1NR1A 1CPYA 2WEPA 1DLBA 3OE7G 3OR6C 4L87A 2GSMB 2DQ0A 4G2KA 5LHGA 2QM7A 1K5QA 1VQOV 2YKBA 5BZBA 5H6QA 2XHTA 5EC1C 4MTOA 4XE2A 1R6NA 4LWEA 1JVMA 1SERA 3W7SA 3TZ5A 4B6CA 4P30A 1OCRC 5M4KA 2IU3A 2ZR2A 4H85A 3EHHA 4EGKA 1Y4UA 5IDMA 2WLIB 1I5DA 2QA4V 1V55B 4ASUG 3E83A 3E89A 2PNRA 4O07A 5F5RA 2HVJC 2BREA 1K3EA 1AI6A 3HB3B 3JD3A 1H7SA 4GX2A 4YXWG 1GKZA 2CCUA 2WPDG 3OWDA 2XCMA 3RLQA 3OEEG 1ZXMA 1B63A 3FV5A 5D7DA 1VQNV 2YECA 1JQ0A 4JAUA 3TZ2A 4PRVA 5B1AB 1AI4A 2A79B 2R9RB 1VQKV 4UUJC 1R62A 2XHRA 2YK2A 4L8ZA 2IWXA 2IJHA 3VHDA 3ETEA 3OFNG 4PDRA 4HYPA 2WI3A 5CTWA 5IYBO 2V1DA 2XNDG 2DYSC 5LBQA 2VCIA 3GIGA 3E8HA 3RLPA 2ZXWC 3F7VC 2WLLB 1IXMA 4L93A 1QY8A 5M4NA 4ZBMA 3CCEV 5CBGA 1R73A 1GMGA 2JDIG 2Y69C 3OMIB 3R65A 1PVGA 2YI5A 4MB9A 2Q8GA 3U67A 2OCCB 3B77A 1K73W 4R8CA 1ZWIC 3LDEA 1R3IC 1THZA 4FK5C 2XAQA 2Q68A 3FB6C 4X88A 3HYZA 3D0BA 3ZN0A 1TILA 4XCLA 2EINC 3MNRP 1DTOA 3JD0A 3SYAA 2DYSB 3E8BA 1VQLV 2XX4A 1DF5A 1FXHA 3OAAG 1K9MW 2W6JG 1UYMA 4XTJA 4V26A 4NH8A 2QEXV 4O05A 4HY6A 4WUDA 4JASA 3QO7A 3T1KA 4MTGA 5L3GA 1BKNA 1TBWA 1QZRA 3OWBA 4EFUA 1QVGU 4WCEV 1AMWA 2FWZA 2WSSG 3G4SV 3M99B 2Z5UA 3C11A 1B3QA 2YKEA 1Z59A 1FXKA 2HG1A 3R4PA 4YKUA 3G7EA 4CWFA 3QNEA 5CBHA 5EBMC 3DTUB 5IY5B 3TZ4A 1UYIA 2JJCA 1K34A 4LWIA 2YEVB 4TWKA 3C0EA 2YE2A 4GGLA 3FYEB 5BOCA 3ZKBA 5LGUA 4UROA 1L1FA 5GGZA 3WG7B 1FFTB 5FL7G 4AS9A 2UXXA 2ZDYA 2ITCC 1MU5A 4JQLA 4WFEA 3PEJA 2QM8A 5F3KA 1F4MA 2H55A 4U93A 1THNA 3AG3B 4R1FA 3ZKDA 1UJWB 3CXCU 1Z5AA 1Q81W 2DWDC 3D3IA 1U0ZA 1RPRA 2EIJC 4JPRA 3T2MA 5DM6V 3G75A 4P7AA 5CTYA 1FXVA 4LPBA 4AWQA 3CP1A 4AWPA 4V25A 2QE7G 1EBOA 3K3WA 3TCUA 3B26A 3PEHA 1YTFB 4W7TA 4XDMA 3ASNB 4UVAA 4X9LA 2YGAA 3UM7A 4BIZA 3EKOA 2QG0A 1Y4SA 3Q5JA 4LWHA 5DN6G 3A0TA 1GO3F 2IH1C 3X2QB 4KQVA 1AH8A 1NJIW 3ASOC 3OMNB 2IWUA 3HZ1A 1UY7A 1JPXA 2EIMC 4HY1A 4N23A 3QO5A 2P7TC 1JX9A 4J9YB 2EIKB 1NVPB 3ZMSA 1UY9A 4GX5A 2IH3C 2W0FC 3WFVA 2IORA 5KUMA 3R4MA 4BIUA 2A0LA 2YE7A 1MSWD 1BXDA 4EFTA 2OTJV 2Q8IA 4MSWC 3U2KA 2XD6A 3LPSA 1SETA 2AHYA 4Q20A 4R7CA 3VBBA 1VQ6V 3ETDA 4GX0A 4EM7A 4WF9V 2DWEC 3E8GA 1H8HG 1KECA 4YKWA 1A4HA 1K92A 3ZJZA 4GFNA 2YEIA 3K0GA 2YEVA 2B5UA 4TSFG 1OCZB 4K4OA 4N21A 2R9IA 3GB7C 1OCCC 4PA9A 5IDJA 3W7XA 1YT1A 2XDSA 3CCQV 3G7BA 1S14A 3SJQC 3STZC 1UYGA 4JF3A 4GQTA 3WG7C 3P30A 3Q5LA 2EZPA 3ABUA 1W0JG 4MP7A 2P90A 3O2FA 1YSCA 4PA7A 3SPHA 2YE8A 1OCZC 1ORQC 2W6IG 3EHBB 3ZMUA 3ZRXA 5L3BA 4P9OA 1UY6A 4UXNA 4FCRA 2FTKA 4QE9A 1CEZA 5L3FA 2KB1A 1S76D 3SPGA 1Y8OA 2IOQA 2QF6A 2IJJA 4FPPA 3FT8A 3K06A 4FIPC 1BL8A 2H8PC 2LP7A 3ABMB 3T0ZA 2JK5C 5M4MA 1J95A 2BTZA 1YITV 2XAGA 2BT0A 3OMUA 1GJVA 1PNMA 4XKAA 5E1AC 1B62A 5IN9A 5J6AA 4WFBV 1US7A 3K97A 3B28A 4E01A 4FCQA 4PA4A 3EFFK 2CCTA 4BQJA 2WLLA 3BEHA 3UKMA 3OR7C 2EIMB 1G8MA 2XJJA 3U2DA 3BY6A 4CWNA 1AJNA 1NQTA 3CCRV 3OM3B 4GCZA 1OCRB 4R3AA 2YJWA 4MVMA 4DXWA 4ASGA 1UYDA 3EHGA 3ZCCA 3SL2A 4JTAB 1Z5CA 3ZMTA 2YKJA 1UYEA 1K97A 3K9AA 2HJFC 3W7TA 1YT2A 3B8MA 4U7OA 1YHQV 1HWYA 2WI4A 3JZ3A 3G71V 2BU7A 4BXIA 5C93A 3K98A 5B3SB 3RKZA 4UVBA 3QO8A 4G28B 3W7WA 1CP9A 5CBFA 1Y8NA 1RPOA 4WUBA 4JTCB 2M7WA 1QBZA 1XL6A 2OT5A 1UYKA 2IW5A 2YKCA 2EINB 1S5HC 2UWDA 1AR1B 2VW5A 1Y8PA 4MT8A 2WAMA 1KD1W 1ZWHA 1SESA 1AJPA 3R92A 2B1GA 3AG2C 4BW5A 4CE2A 1W0KG 2OTLV 3TTZA 1NBMG 3HPLC 1JOYA 2WI6A 2XDKA 3LSSA 5IY5C 4XIRA 3JYCA 1OCOB 3I55V 2ESAA 4O04A 3G6EV 4ASAA 2WLMA 4MVZA 2Q8FA 4HZ3A 1K4DC 3VOUA 5CF0A 1SRYA 2ZXWB 1W2BU 1R6KA 2WEQA 3NXSA 3GIFA 4NH9A 2Z3YA 4B7PA 5D7RA 4KP4A 1QR8A 5EBLC 5J71A 3ZN1A 2YEEA 3CCSV 2ZKJA 3I56V 1YT0A 1QR9A 1MG1A 1S3JA 4MW8A 2YEGA 3EHFA 3HYYA 1PNKA 3FKSG 3FB7C 3CGZA 2XOKG 4MVUA 3SPCA 3T4ZA 2WLJA 1JJ2U 1MOFA 2IJIA 3P32A 3PJSK 2X6CA 1E79G 3CCJV 2EILB 2NNUA 4Z1MG 1K7DA 2HG5C 3AG3C 3CPWU 3CCVV 3E2EA 1NVPD 2YEDA 1GM8A 2E0AA 4KSGA 3E35A 5FNDA 3KG2A 2BZ5A 2IWSA 5HFLA 1UYLA 3BM9A 3ABKC 1OCCB 1ENVA 1R3JC 5D7CA 4O09A 2X6AA 4URMA 4MPNA 1YC1A 3CYOA 4PDVA 4OXSA 3A0WA 2BU2A 3SPJA 2Q6AA 4RQEA 3ABTA 2CK3G 1F51A 2JJ1G 2XAJA 3AG4C 1VQ5V 1VQ9V 1Y4MA 1UY8A 3CRLA 2YEAA 4LP0A 4RQFA 4R6ZA 3OUFA 1BHBA 2WERA 4F4LA 2ATKC 1QLNA 2K1EA 3ZRWB 1KZNA 4O0BA 1H38A 4FJCC 3A0XA 4PDMA 5GW7A 1VQPV 1S72V 1OHHG 3B8NA 4QPJA 4EGIA 1YSRA 2XDUA 3ZRVA 4CWRA 4P9PA 1M1KW 4CWQA 4CWPA 2XDLA 3OGCC 1P4RA 4HYOA 3OPDA 2LFSA 4RUFA 1NKDA 1PKXA 1BHAA 2YEHA 2F43G 2ITDC 4GX1A 3W7UA 4I5SA 3CD6V 1H8EG 2XHXA 1JCHA 3H80A 2Y69B 1VQ4V 1I5XA 1OCOC 2XAFA 1KIJA 4MPCA 2X6BA 1YC4A 2ZDIA 4FMTA 3T1CA 5KUKA 2WI5A 4PU9A 4PA3A 4TT3G 2YGEA 4MVSA 1QLEC 3TUHA 1FXKC 1M56B 3FB8C 1BYQA 5H9CA 4GT8A 5LGNA 4MVRA 4PA6A 3D36A 4LCUC 1GM9A 1I5AA 2BYIA 2QKSA 3ETGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QYE A;  4MTX A;  4XKK A;  3R4O A;  2WI1 A;  4YKR A;  3A0R A;  4KSH A;  3WHA A;  3CWV A;  5L3J A;  4MBC A;  4CWT A;  1YS3 A;  1JM6 A;  5D6P A;  3H4L A;  2AKP A;  3A0Z A;  2EXL A;  3VAD A;  4CE3 A;  1NHH A;  4DZY A;  5BOD A;  1I5B A;  1TH8 A;  4U7N A;  4QPK A;  4ZKI A;  4GT1 A;  4CWS A;  2YK9 A;  4EEH A;  2VWC A;  5CTX A;  4HYM A;  4XCJ A;  1AJ6 A;  4GEE A;  3DGE A;  1MX0 A;  4PRX A;  1AM1 A;  4KFG A;  4YKY A;  3ZXQ A;  1EI1 A;  2LFR A;  1UYH A;  2C2A A;  3INX A;  2FWY A;  3OW6 A;  3R91 A;  4BAE A;  4LC1 A;  4LWG A;  3CGY A;  3WQ9 A;  3VHA A;  5M4E A;  5M4P A;  3EKR A;  1H7U A;  2P67 A;  3GIE A;  3B25 A;  3ZRW A;  3HHU A;  2BRC A;  2XAB A;  3INW A;  2IOP A;  2H8M A;  4MOT A;  4P8O A;  1GKX A;  1NHJ A;  2YGF A;  3FT5 A;  4BQG A;  1YSZ A;  2O1U A;  1U2O A;  3TK1 A;  4LWF A;  3T2S A;  1YES A;  4YKT A;  2HKJ A;  1EA6 A;  5CTU A;  2YE6 A;  4CE1 A;  3D2R A;  4WUC A;  2XJX A;  2K5B A;  3HEK A;  3B24 A;  4XIT A;  4MP2 A;  2CGF A;  2YEJ A;  1L0O A;  1TC6 A;  4MPE A;  4I3H A;  3ZM7 A;  1ID0 A;  2FYP A;  2YE4 A;  4XC0 A;  2QFO A;  4XIP A;  4NH7 A;  1I58 A;  2YEB A;  4YKX A;  2O1W A;  2HCH A;  2Q8H A;  2GFD A;  2YJX A;  4KTN A;  3EHJ A;  4JYC A;  4E00 A;  4H7Q A;  4PL9 A;  3B27 A;  4L90 A;  1UYC A;  2BYH A;  1TID A;  2BU6 A;  3RLR A;  3A0Y A;  1UYF A;  2Q2E B;  4H81 A;  4HZ5 A;  1YC3 A;  2BU5 A;  3T10 A;  2FXS A;  3R4N A;  2QG2 A;  1S16 A;  2BSM A;  1TC0 A;  1Z5B A;  4XIQ A;  4R3M A;  2CG9 A;  2YEF A;  4WUB A;  3TZ5 A;  3ZXO A;  1OSF A;  4ASB A;  4YKQ A;  1ZW9 A;  4EMV A;  2XK2 A;  4HXZ A;  3BMY A;  4FCP A;  4XD8 A;  3O0I A;  3Q5K A;  2YE3 A;  4HZ0 A;  3LNU A;  3HZ5 A;  2BU8 A;  4ZVI A;  3IED A;  1YET A;  3NMQ A;  3KE6 A;  2CCS A;  1AH6 A;  1YER A;  4E02 A;  1I5C A;  2ZDX A;  5B1N A;  3K60 A;  2O1V A;  4YKZ A;  1I59 A;  2WWW A;  4CWO A;  4JYB A;  2YKI A;  2CH4 A;  2GQP A;  2WI2 A;  2XX2 A;  2YI7 A;  4JAV A;  2YI0 A;  3CRK A;  4ASF A;  5M4H A;  3VHC A;  2ZBK B;  3QTF A;  4AWO A;  2XDX A;  4EGH A;  3QDD A;  5D6Q A;  5CPH A;  2YE9 A;  1BGQ A;  3GIG B;  4DUH A;  2WI7 A;  2XJG A;  3T0H A;  1NHI A;  2JKI A;  1ZXN A;  2YI6 A;  3O6O A;  4XKO A;  3TZ0 A;  4L94 A;  5FNF A;  3MD0 A;  5B1O A;  2VCJ A;  4URL A;  3K99 A;  2XX5 A;  5FNC A;  4L91 A;  4URN A;  2WEP A;  2QM7 A;  2YKB A;  2XHT A;  4XE2 A;  4LWE A;  4B6C A;  5M4K A;  4H85 A;  3EHH A;  4EGK A;  1Y4U A;  5IDM A;  1I5D A;  2PNR A;  4O07 A;  5F5R A;  2BRE A;  1H7S A;  2CCU A;  1GKZ A;  3OWD A;  2XCM A;  3RLQ A;  1ZXM A;  1B63 A;  3FV5 A;  5D7D A;  2YEC A;  4JAU A;  3TZ2 A;  4PRV A;  1R62 A;  2XHR A;  4L8Z A;  2YK2 A;  3VHD A;  2IWX A;  4HYP A;  2WI3 A;  5CTW A;  2VCI A;  3GIG A;  1IXM A;  4L93 A;  1QY8 A;  5M4N A;  1PVG A;  4MB9 A;  2YI5 A;  2Q8G A;  3U67 A;  3HYZ A;  3D0B A;  1TIL A;  4XCL A;  3MNR P;  2XX4 A;  1UYM A;  4XTJ A;  4V26 A;  4NH8 A;  4O05 A;  4HY6 A;  4WUD A;  4JAS A;  3T1K A;  1TBW A;  1BKN A;  3OWB A;  1QZR A;  4EFU A;  1AMW A;  2FWZ A;  3C11 A;  1B3Q A;  2YKE A;  1Z59 A;  3R4P A;  2HG1 A;  4YKU A;  4CWF A;  3G7E A;  3TZ4 A;  1UYI A;  2JJC A;  4LWI A;  3ZKB A;  3C0E A;  4GGL A;  2YE2 A;  5BOC A;  4URO A;  5GGZ A;  4AS9 A;  2ZDY A;  1MU5 A;  4JQL A;  3PEJ A;  2QM8 A;  5F3K A;  2H55 A;  4U93 A;  1THN A;  4R1F A;  3ZKD A;  1Z5A A;  1U0Z A;  3G75 A;  4P7A A;  5CTY A;  4LPB A;  4AWQ A;  4AWP A;  4V25 A;  3PEH A;  3B26 A;  4W7T A;  4XDM A;  4X9L A;  2YGA A;  4BIZ A;  3EKO A;  2QG0 A;  1Y4S A;  3Q5J A;  4LWH A;  3A0T A;  4KQV A;  1AH8 A;  2IWU A;  3HZ1 A;  1UY7 A;  4HY1 A;  1UY9 A;  3RLP A;  2IOR A;  3R4M A;  4BIU A;  2YE7 A;  1BXD A;  4EFT A;  2Q8I A;  3U2K A;  2XD6 A;  3LPS A;  4Q20 A;  4EM7 A;  4YKW A;  1A4H A;  4GFN A;  2YEI A;  4K4O A;  2XDS A;  5IDJ A;  1YT1 A;  3G7B A;  1S14 A;  1UYG A;  4GQT A;  3Q5L A;  4MP7 A;  3O2F A;  2YE8 A;  1UY6 A;  3ZRX A;  4FCR A;  4HXW A;  2FTK A;  2IOQ A;  1Y8O A;  2QF6 A;  3FT8 A;  4FPP A;  3T0Z A;  5M4M A;  2BTZ A;  2BT0 A;  3OMU A;  1GJV A;  5J6A A;  4XKA A;  1B62 A;  5IN9 A;  1US7 A;  3K97 A;  3B28 A;  4E01 A;  4FCQ A;  2CCT A;  4BQJ A;  2XJJ A;  3U2D A;  4CWN A;  4GCZ A;  4R3A A;  2YJW A;  4ASG A;  1UYD A;  3EHG A;  3ZCC A;  3SL2 A;  1Z5C A;  2YKJ A;  1UYE A;  1YT2 A;  4U7O A;  2WI4 A;  3JZ3 A;  2BU7 A;  4BXI A;  5C93 A;  3K98 A;  3RKZ A;  1Y8N A;  1UYK A;  2YKC A;  2UWD A;  2VW5 A;  1Y8P A;  4MT8 A;  1ZWH A;  3R92 A;  4CE2 A;  3TTZ A;  1JOY A;  2WI6 A;  2XDK A;  4XIR A;  2ESA A;  4O04 A;  4ASA A;  2Q8F A;  5CF0 A;  2WEQ A;  3GIF A;  3NXS A;  4NH9 A;  4B7P A;  5D7R A;  4KP4 A;  5J71 A;  2YEE A;  2ZKJ A;  1YT0 A;  3HYY A;  2YEG A;  3EHF A;  3CGZ A;  3P32 A;  2YE5 A;  4KSG A;  2YED A;  2E0A A;  5FND A;  2BZ5 A;  2IWS A;  3BM9 A;  1UYL A;  5D7C A;  4O09 A;  4URM A;  4MPN A;  1YC1 A;  3A0W A;  2BU2 A;  5FWK A;  1F51 A;  1UY8 A;  3CRL A;  4LP0 A;  2YEA A;  4O0B A;  2WER A;  1KZN A;  3ZRW B;  3A0X A;  4EGI A;  4QPJ A;  1YSR A;  2XDU A;  3ZRV A;  4CWR A;  4CWQ A;  4CWP A;  2XDL A;  3OPD A;  2LFS A;  2YEH A;  4I5S A;  2XHX A;  3H80 A;  1KIJ A;  4MPC A;  1YC4 A;  4FMT A;  2WI5 A;  4PU9 A;  2YGE A;  3TUH A;  1BYQ A;  4GT8 A;  3D36 A;  1I5A A;  2BYI A; 
#chains in the Genus database with same CATH topology
 4YJ2 B;  4MS2 A;  1KKC A;  1F23 A;  3A0R A;  4X9Q A;  4KSH A;  4JI1 O;  4LFC B;  1EN6 A;  3TGU H;  1N34 B;  3CWV A;  1EN5 A;  4AQY B;  1YJN V;  2F66 C;  1ROP A;  1GKF A;  4XDL A;  2AKP A;  3SDL A;  4NKG B;  1FD9 A;  1VF6 C;  2R70 A;  1HNW O;  4CE3 A;  1YZB A;  2Y4U A;  1I5B A;  1TH8 A;  4U7N A;  4QPK A;  5BOD A;  1LUV A;  4DYL A;  4NXM O;  4JI6 B;  3LSQ A;  3P3N A;  2Q7E A;  4ZI7 B;  3QG5 A;  3CC2 V;  3DGE A;  4MVQ A;  1AM1 A;  4X8A A;  3K5L A;  3RYH A;  2C2A A;  3INX A;  2FWY A;  1URF A;  3IFX A;  4LH6 A;  4LWG A;  3JAS B;  2VRZ A;  3WQ9 A;  3H1L H;  5M4E A;  3EVK A;  3THO A;  3BA8 A;  2ZR3 A;  1XNR B;  1H7U A;  5KHH A;  2YIC A;  4W4K A;  3B25 A;  3GIE A;  3HHU A;  1KQS U;  2XAB A;  1OZ0 A;  2Q67 A;  3CME V;  2H8M A;  2IOP A;  2WLI A;  2LW7 A;  2EIJ B;  2JGU A;  4BQG A;  1YSZ A;  1U2O A;  1JA8 A;  4YKT A;  3R66 A;  4O4L B;  1R3K C;  4E2L A;  4WUC A;  2XJX A;  1EN4 A;  2K5B A;  4XIT A;  4WFA V;  4MP2 A;  3CB2 A;  2N05 A;  4X89 A;  4IGG A;  1LNQ A;  1KP2 A;  3ABM C;  2FYP A;  1V54 B;  4DRX A;  2QFO A;  1WPX A;  2GTS A;  4NH7 A;  4MTF A;  4QIW F;  5JH7 B;  3E22 A;  2RJZ A;  5CA3 A;  1HR0 B;  3DXR A;  4JGS A;  4JYC A;  4E00 A;  4GLX A;  4H7Q A;  4PL9 A;  4L90 A;  4XDK A;  1EZJ A;  2JGD B;  5H5N A;  4H81 A;  1TVK A;  3JCZ A;  4HZ5 A;  1IBM O;  2RCV A;  1SA0 A;  1YC3 A;  2BU5 A;  3L9D A;  2FXS A;  1T5E A;  5J2U B;  4DR4 B;  2QG2 A;  2VQE O;  3R4N A;  1FXK B;  2E74 B;  1BE3 H;  3H1K H;  1KC8 W;  2BSM A;  5B66 Z;  1TC0 A;  1SKV A;  4XIQ A;  1TGO A;  3IC7 A;  4YKQ A;  4CZZ A;  5LXT B;  4JV5 B;  4EMV A;  4R50 A;  4LF7 B;  2CGN A;  2YE3 A;  2DQ3 A;  4UB6 Z;  2AW9 A;  3L73 H;  3A2F A;  4DV7 O;  4ZVI A;  4PDL A;  2ADP A;  5ITZ A;  2UXN A;  1AI5 A;  3ZS8 C;  4DV0 O;  1I94 O;  2UXB O;  2P6J A;  2LGQ A;  1I5C A;  3ZMV A;  2ZDX A;  3JSN A;  4J9Z B;  4GZR B;  4HAM A;  4DR7 O;  4GKK O;  4YKZ A;  1L8D A;  1I59 A;  2XAH A;  2WWW A;  4G27 B;  4X62 O;  1V55 C;  4JI5 O;  2CH4 A;  2XX2 A;  2YI0 A;  1YEW A;  3CRK A;  3ZIA G;  3ZMZ A;  3HKD A;  1VQ7 V;  1Y74 A;  5A2Q N;  4QGP A;  5LXT A;  1SA0 B;  4DR7 B;  4AWO A;  1MAB G;  1QVF U;  3FYI B;  3ABL B;  1YXB A;  4DUH A;  2BOB C;  2B9Z A;  2XJG A;  3T0H A;  2JKI A;  1ZXN A;  4H0L B;  4XKO A;  4QJF B;  1S0V A;  4J7Z A;  4BIO A;  3TZ0 A;  2RMK B;  1E1Q G;  1VQM V;  2YDE A;  2VCJ A;  5KLV H;  1YF2 A;  3K99 A;  2KKW A;  4L91 A;  4URN A;  3JAL B;  1CPY A;  2DE0 X;  1DLB A;  4FZ0 A;  1D2D A;  2DQ0 A;  5LHG A;  4FLZ A;  2RQ6 A;  5H6Q A;  2XHT A;  4DV1 O;  1JVM A;  4B6C A;  3W7S A;  3UT5 B;  2F23 A;  2ZR2 A;  3EHH A;  2UXC O;  2QA4 V;  3DXR B;  4DRX B;  4ASU G;  1B04 A;  2HHH O;  1AI6 A;  1H7S A;  2WPD G;  1B63 A;  3FV5 A;  3KCY A;  2YEC A;  2A7W A;  3TZ2 A;  1H2S B;  5B1A B;  2A79 B;  2IWX A;  3ZHQ A;  3AK2 A;  5CTW A;  3GIG A;  2V1D A;  2QM4 A;  4IIJ B;  2WLL B;  1I08 A;  2E76 B;  3CCE V;  5BR8 B;  3CSX A;  2P4V A;  3NR7 A;  3OMI B;  3R65 A;  1PVG A;  2YI5 A;  2Q8G A;  3I5D A;  2Q9L A;  3VQY A;  3LDE A;  4R8C A;  1BZK A;  1THZ A;  2E75 B;  3K9S A;  4JI3 O;  3FB6 C;  3HYZ A;  3ZN0 A;  1DTO A;  3SYA A;  2DYS B;  1IBK O;  1VQL V;  1DF5 A;  2YIB A;  3ICX A;  3OAA G;  1K9M W;  2QEX V;  4JAS A;  1ZX3 A;  2P06 A;  3JAS A;  3T1K A;  4YIP A;  2PY5 A;  2BTO A;  1BKN A;  1XQ8 A;  5KHK A;  1QZR A;  1AMW A;  2FWZ A;  2Z5U A;  1B3Q A;  2YKE A;  2JGD A;  5IWA B;  3DTU B;  2N74 A;  3C0E A;  4GGL A;  3WG7 B;  1J5E O;  4DV0 B;  4FM2 A;  4JI3 B;  3PEJ A;  2H55 A;  2FML A;  3KCX A;  4LR3 A;  4J41 A;  3H9V A;  1Q81 W;  4DV4 B;  2JS3 A;  1HNZ B;  5CTY A;  3TXQ A;  4X62 B;  1XMQ B;  4V25 A;  3PEH A;  3ASN B;  2CGO A;  2YGA A;  1RFY A;  5JEN A;  4J11 A;  2IH1 C;  5H2F Z;  2GUZ A;  1UY7 A;  2EIM C;  4HY1 A;  4X1K A;  2P7T C;  3RLP A;  2P5O A;  2W0X A;  3R4M A;  1TAE A;  3JAL A;  3U2K A;  4I7Z B;  2XD6 A;  1H2L A;  4Q20 A;  2OIG A;  3N2K B;  3ETD A;  4WF9 V;  1XMQ O;  3ZJZ A;  2Y0I A;  2Q0A A;  1I0H A;  3RYH B;  4OPA A;  3LMM A;  4N21 A;  4TUY A;  3GB7 C;  4PA9 A;  4X65 O;  2CH7 A;  3G7B A;  4GQT A;  4FFB B;  3STZ C;  2K9P A;  5AG2 A;  3P30 A;  5BXZ A;  2EZP A;  3ABU A;  1YSC A;  2FKX A;  1Y76 A;  2CE4 A;  4AQY O;  1XBL A;  4QE9 A;  4CS4 A;  5L3F A;  1N36 B;  1S76 D;  2QF6 A;  2IJJ A;  1KBH A;  1WP7 A;  1Q6I A;  3ABM B;  3CRR A;  3CYG A;  3T0Z A;  1YIT V;  2XAG A;  2BT0 A;  3OMU A;  2Q4P A;  1NTZ H;  4E01 A;  2CCT A;  2WLL A;  4CH5 A;  3UKM A;  2EIM B;  2JVD A;  2XJJ A;  3BY6 A;  1NU1 H;  3CCR V;  3OM3 B;  4GCZ A;  1GH6 A;  1JMK C;  4JTA B;  1KB9 F;  1Z5C A;  4UFZ A;  4DV7 B;  2ETN A;  3JZ3 A;  4PI2 A;  2BU7 A;  2YXY A;  4UVB A;  1MA1 A;  4Z1V A;  5CBF A;  1RPO A;  1QBZ A;  1XL6 A;  2IW5 A;  4JI0 O;  2UWD A;  3H1J H;  1KD1 W;  4CE2 A;  1PP9 H;  2Q7H A;  1W0K G;  5JQG A;  2CUG A;  2Q7G A;  1HP8 A;  4IT5 A;  5IY5 C;  2WI6 A;  2L35 A;  3I55 V;  4PD4 F;  4JI5 B;  4HZ3 A;  5CF0 A;  1SRY A;  2F1M A;  1GN6 A;  5D7R A;  5EBL C;  2YI9 A;  4I55 B;  4I0X A;  1S3J A;  4MW8 A;  1VP7 A;  2L6L A;  3FB7 C;  4K35 A;  3SPC A;  5KHJ A;  3CHX A;  2HG5 C;  4KSG A;  1Q6U A;  2WA3 A;  4EEQ A;  2UXD O;  5EYP A;  3ABK C;  4O09 A;  1JFF A;  4PJ0 Z;  1UFI A;  3CYO A;  4OXS A;  3A0W A;  2CK3 G;  1Y4M A;  2DMX A;  2PGG A;  4R6Z A;  4IHJ A;  1X59 A;  2C1I A;  3A0X A;  5GW7 A;  3DC6 A;  1OHH G;  4ZOL B;  3LNN A;  2XDU A;  4P9P A;  4CWQ A;  4HYO A;  4LWS B;  4JI2 B;  4X64 O;  5IT9 N;  4I4T B;  5KAF Z;  3CD6 V;  2QWP B;  1EZV H;  3ZHS A;  4ABM A;  1XNQ O;  4PU9 A;  2YGE A;  1FXK C;  3K58 A;  5C8Y A;  1QQC A;  2QSA A;  5H9C A;  4PA6 A;  2ZIM A;  3D36 A;  1QNM A;  3ETG A;  4MTX A;  5LGT A;  3OT7 A;  4YKR A;  4FLX A;  4LF8 B;  2ZNJ A;  4DO2 A;  1PNL A;  5J9P C;  3LNM B;  4MBC A;  3VQV A;  4IYI A;  5JWP A;  1VQ8 V;  4CWT A;  5D6P A;  2F93 B;  3KKY A;  1SQG A;  2UU9 B;  3JAT B;  4D7T A;  3J7A U;  1NHH A;  3K5M A;  4FLY A;  2IJK A;  5L3E A;  4WFG A;  1XL4 A;  3L70 H;  1WB7 A;  1K4C C;  4IYH A;  5LOV B;  4GKK B;  2YK9 A;  1BQZ A;  1Y74 B;  4MW3 A;  2V7Q G;  4LBE C;  2VWC A;  5CTX A;  3AEI A;  1SQF A;  2PUS A;  2IU0 A;  5FPO A;  4B3S O;  4GEE A;  1GM7 A;  4EFB A;  4PRX A;  4YKY A;  3ZXQ A;  2LFR A;  1WP8 A;  3HKD B;  1UYH A;  1WLE A;  1QLE B;  2AXT Z;  3QTC A;  1E1R G;  4DK0 A;  3OW6 A;  4BAE A;  5IYC O;  3F5T A;  4JI1 B;  4YJ3 B;  1COW G;  5M4P A;  2EX3 A;  2QJ1 A;  3VQW A;  5LHI A;  4JI0 B;  3ZRW A;  3AG1 B;  5LHH A;  1NH2 B;  1KKD A;  4MOT A;  1GK9 A;  1M57 B;  3T4D A;  2EJ7 A;  2VQE B;  2O1U A;  4LWF A;  3UT5 A;  3T2S A;  1WPB A;  2WA4 A;  5CTU A;  5CB4 A;  3HKE A;  1L0L H;  2HR3 A;  1YI2 V;  3CCU V;  3RYF B;  1JFF B;  3SYP A;  1LR1 A;  1TC6 A;  3T1H B;  4PEL A;  3ZHT A;  4O4H B;  3BCC H;  1ID0 A;  4XC0 A;  1NTK H;  4FFB A;  2YUA A;  4FFK A;  3JAM N;  2YEB A;  2O1W A;  2BOC C;  3AG4 B;  4UB8 Z;  2Q8H A;  1I5Y A;  2GFD A;  2YIA A;  2YJX A;  5LYJ B;  3E8F A;  2JEU A;  3EXA A;  1WB8 A;  3CRM A;  1TID A;  2BU6 A;  2Y48 A;  1HDJ A;  1UYF A;  2HFE C;  2Q2E B;  5GON A;  1P84 F;  4LH7 A;  5L3D A;  2E3C A;  4D6T H;  4JI2 O;  4A5U B;  1M56 C;  2GHY A;  2OIE A;  3OEH G;  5IJ0 A;  2GTA A;  1Z5B A;  2CG9 A;  4WUB A;  1GTO A;  3TZ5 A;  3ZXO A;  1OSF A;  4ASB A;  1ZW9 A;  1AR5 A;  3JCU Z;  1U96 A;  4HXZ A;  3BMY A;  4TQF A;  1Q7Y W;  4FCP A;  4XD8 A;  3Q5K A;  1DGS A;  2ZE8 A;  5B3S C;  4JZ2 A;  5LYJ A;  3NMQ A;  3ZX6 A;  1M57 C;  4E02 A;  4KHP B;  3MHS C;  1Q6H A;  1YIJ V;  4LF6 B;  4TUY B;  5B1N A;  2C1G A;  1P49 A;  1MMM A;  5BMV A;  1WAZ A;  4CWO A;  5EC2 C;  1NT2 B;  4JYB A;  3IGA C;  2YKI A;  3P3P A;  4JAV A;  1YVW A;  1IBL B;  2ARH A;  1B6Q A;  5M4H A;  5EIB C;  3SYO A;  1ZSP A;  3N2K A;  4EGH A;  2FB5 A;  3O9O A;  3H01 A;  4LP8 A;  1BGQ A;  2PYL A;  4CS2 A;  4LFB B;  3GIG B;  3OTO O;  3PN1 A;  3AG2 B;  5JVD B;  3O6O A;  2WLN A;  3ML0 A;  1Q86 W;  4L94 A;  3MD0 A;  4AIL C;  2HHI A;  3JD4 A;  4LF6 O;  5FNC A;  1N36 O;  2WEP A;  4L87 A;  5EYP B;  2GSM B;  4G2K A;  2XUM A;  4K0K B;  4XE2 A;  1ZL8 A;  3QVN A;  3WB0 A;  5M4K A;  4EGK A;  1Y4U A;  5IDM A;  1I5D A;  4JV5 O;  2HP8 A;  1MZE A;  3E83 A;  2Y0P A;  3E89 A;  4DW1 A;  1K3E A;  3HB3 B;  3JD3 A;  1F7Y A;  5CB4 B;  5IE9 A;  1SQB H;  4YXW G;  3OWD A;  2IM9 A;  4DUZ B;  1ZXM A;  2UU9 O;  4JAU A;  4PRV A;  1R62 A;  1VQK V;  1WA8 A;  2YK2 A;  4X20 A;  4B3R O;  4AHC A;  3A0B Z;  1Y6X A;  2WI3 A;  4HYP A;  3E8H A;  5IJ0 B;  2ZXW C;  1H2K A;  1IXM A;  4J80 A;  5M4N A;  4ZBM A;  2N04 A;  2JDI G;  4D7S A;  4J7K A;  4FK5 C;  1R3I C;  1SQV H;  4B3M B;  3IJ4 A;  5IJ9 B;  4DR6 B;  2H3O A;  3JD0 A;  5ITZ B;  2XX4 A;  3E8B A;  2BTQ B;  4XTJ A;  2W6J G;  4V26 A;  4NH8 A;  3MDS A;  1BS3 A;  4HY6 A;  3BPZ A;  4MTG A;  5L3G A;  3OWB A;  4EFU A;  1QVG U;  2V4D A;  3M8A A;  3C11 A;  2WSS G;  4CWF A;  3OD4 A;  3G7E A;  3ETQ A;  1HW7 A;  5BY1 A;  5KHI A;  1UYI A;  4TWK A;  2YE2 A;  3CRC A;  1N4C A;  5GGZ A;  1S5L Z;  4AS9 A;  3HKC B;  2ITC C;  1MU5 A;  5F3K A;  1KYO F;  4U93 A;  4R1F A;  3VQX A;  1Z5V A;  2EIJ C;  3T2M A;  2CTW A;  5LP6 C;  3GVM A;  1FXV A;  1Q8I A;  2QE7 G;  3K3W A;  3B26 A;  4XDM A;  1YTF B;  4X64 B;  4UVA A;  1BGY H;  3UM7 A;  4BIZ A;  2GDS A;  3J80 N;  4LWH A;  1GO3 F;  3X2Q B;  4DR2 B;  4KQV A;  3CXH F;  1HNX O;  4ZI7 A;  1R6T A;  4DV2 B;  4TV9 A;  1UY9 A;  4J9Y B;  2EIK B;  2W0F C;  4EFT A;  4KL1 A;  2Q8I A;  1VQ6 V;  4EM7 A;  2UUB O;  1KEC A;  1K92 A;  2ZM6 B;  2OWO A;  2CTP A;  2XTA A;  2B5U A;  4TSF G;  2R9I A;  1OCC C;  2XDS A;  1YT1 A;  3QF7 A;  1UYG A;  3SJQ C;  1FFX A;  1W0J G;  2HHH B;  2P90 A;  2F4V O;  2YE8 A;  4LWS A;  3ZMU A;  1W59 A;  3ZRX A;  4FCR A;  3JAK A;  3FT8 A;  5D5Q A;  2LP7 A;  1FJG B;  1O9G A;  2JK5 C;  1J95 A;  2BTZ A;  1VF6 A;  4JYY A;  1WA8 B;  4LF5 B;  3C90 A;  5E1A C;  4XKA A;  5LOV A;  4FCQ A;  4BQJ A;  5EZY A;  1GN2 A;  3BEH A;  2CH7 B;  3U2D A;  1XHX A;  2YC0 A;  2UXB B;  1AJN A;  1NQT A;  1PM9 A;  1N33 O;  4CWN A;  4LF4 O;  1R1B A;  4DXW A;  1UYD A;  3ZCC A;  2HJF C;  3S3X A;  1QU7 A;  2JRI A;  4U7O A;  4BXI A;  5C93 A;  5B3S B;  4OX9 B;  3W7W A;  4B3R B;  4KHP O;  3WB1 A;  1Y8N A;  2OT5 A;  4X1K B;  2YKC A;  3FD9 A;  2Q73 A;  5KMG A;  2EIN B;  4ICG A;  4I9Q A;  4I4T A;  1AR1 B;  1AR4 A;  2VW5 A;  1SES A;  1AJP A;  1WNS A;  2OTL V;  1FJG O;  1NBM G;  4JI7 O;  3TTZ A;  3JYC A;  4MVZ A;  1G1X B;  1K4D C;  5C8Y B;  2RNB A;  3NXS A;  4NH9 A;  4LFA O;  1QR8 A;  1S5J A;  3ZN1 A;  2YEE A;  3I56 V;  1YT0 A;  1QR9 A;  1V9P A;  4JI4 O;  3HYY A;  2DN9 A;  4DR4 O;  5JJN B;  3CGZ A;  2XOK G;  2WLJ A;  2ADQ B;  1GN4 A;  4OGQ B;  3C3S A;  2EIL B;  2NNU A;  3CPW U;  1K7D A;  3RT3 C;  2YED A;  3BM9 A;  4PV1 B;  2IWS A;  1UYL A;  4ZIB A;  1R3J C;  5D7C A;  1NZ6 A;  4URM A;  1YC1 A;  4PDV A;  2BU2 A;  5FWK A;  3AG4 C;  1F51 A;  4LF7 O;  1UY8 A;  3CRL A;  3RN4 A;  4F4L A;  1QLN A;  2UXC B;  2KQX A;  4EGI A;  1YSR A;  4DR3 O;  1M1K W;  4CWP A;  3RYF A;  4X20 B;  1P4R A;  5LMN O;  3BA9 A;  4IIJ A;  2ITD C;  2XHX A;  2VS0 A;  4CH6 A;  2QWO B;  5DED A;  1I5X A;  1OCO C;  2XAF A;  1KIJ A;  2X6B A;  4FMT A;  4DR3 B;  3AK1 A;  4HBN A;  4F6E A;  3JAK B;  5JJE B;  3CS5 A;  3JAW A;  4FM1 A;  4GT8 A;  1WJZ A;  5LGN A;  4LCU C;  2QKS A;  3L71 H;  1QYE A;  1K33 A;  3SJB C;  2WI1 A;  2EJR A;  3E86 A;  3WHA A;  3HKB A;  2A9H A;  2B1I A;  1WN7 A;  5L3J A;  5JH7 A;  3LDC A;  4WFF A;  2OCC C;  4NTX A;  5L3C A;  1OJH A;  2XHB A;  3TET A;  5EIB D;  4CBC A;  1YDX A;  5J2T A;  3A0Z A;  3VAD A;  3RVZ A;  4WBN B;  3CJH A;  4GT1 A;  4CWS A;  3D3Q A;  5GTH Z;  3SJC C;  4NXN B;  4H33 A;  4JYA O;  2NR5 A;  3G6B A;  4I9W A;  4YHH B;  2UUA O;  4HYM A;  3SJA C;  4XCJ A;  3L74 H;  1OV9 A;  1AJ6 A;  5KMG B;  3B2E E;  4XDJ A;  4KFG A;  1EI1 A;  4PHZ A;  1TVK B;  4I50 B;  2KG7 B;  1HNZ O;  3R91 A;  2AHZ A;  2Q0O C;  4OX9 O;  3EKR A;  1ZTE A;  3CMA V;  1N0N A;  5E79 Z;  2BRC A;  5LMU B;  3K57 A;  5CA1 B;  2X7R B;  4EKW A;  3CX5 F;  4P8O A;  1GKX A;  1NHJ A;  4LF4 B;  1GRJ A;  4NTY A;  3TK1 A;  3AG1 C;  1YES A;  2DYR C;  1EM1 A;  4FZ1 A;  5LA6 A;  2YE6 A;  4CS3 A;  4CE1 A;  1FFX B;  1EFR G;  3ZED A;  1KMI Z;  2YEJ A;  1L0O A;  4MPE A;  4Z2W A;  1P7B A;  4I3H A;  3ZM7 A;  4O4J A;  2YE4 A;  5HFM A;  2PZS A;  5IYZ A;  3N27 A;  3N2G A;  1S77 D;  2YID A;  2EZO A;  4XIP A;  2FL4 A;  3KZI Z;  1I58 A;  4YKX A;  3O65 A;  4JI8 B;  4RAI A;  3CCL V;  5K1X A;  5LMU O;  5CA1 A;  3JAR A;  1AJQ A;  3EHJ A;  2H94 A;  3B27 A;  1TA8 A;  1MSD A;  1M9N A;  4QNH B;  1IBL O;  3A0Y A;  5B1A C;  1NR7 A;  4DUY O;  3STL C;  3L72 H;  1N32 O;  4P2Z A;  3FB5 C;  1QCE A;  4GKJ B;  3HKC A;  3CEI A;  5EBW C;  4RWU A;  4UV9 A;  2VWJ A;  2QTO A;  3OMA B;  4JI6 O;  1O9H A;  1GAX A;  3K79 A;  4R3M A;  4KUM A;  4O2B A;  2HJD A;  1K8A W;  2MW2 B;  1P7G A;  3RVY A;  2YS8 A;  2ZE7 A;  3X2Q C;  1PL0 A;  1SZX A;  2D2C B;  1BMF G;  3ASN C;  3OUS A;  3IED A;  3HKE B;  1YET A;  4XBF A;  1AI7 A;  1YER A;  2RN9 A;  1XEQ A;  1F4N A;  3OW2 U;  3RYC A;  1G4Y B;  3K60 A;  2O1V A;  1H2G A;  1N32 B;  3MHH C;  1XHZ A;  4RO2 A;  3RYI A;  4ASF A;  3SPI A;  3B40 A;  4FLW A;  4HNA B;  5KAI Z;  4IL6 Z;  2YSU B;  2LGW A;  5BMV B;  2XDX A;  3CRQ A;  3QDD A;  2QWR B;  1V54 C;  2M6Y A;  5CPH A;  5D6Q A;  1Q82 W;  1AP5 A;  1K5S A;  4NTW A;  1AVM A;  4LF9 B;  2WI7 A;  5K1P A;  3AG7 A;  1NHI A;  2CTR A;  5FLX N;  2YI6 A;  2F4V B;  1TUB A;  3E22 B;  3SGI A;  1SQP H;  3OE7 G;  3OR6 C;  1K5Q A;  5BZB A;  5KHG A;  1R6N A;  2GUZ B;  3IC9 A;  2BSK B;  4B08 A;  4P30 A;  1OCR C;  3H1I H;  4UCR A;  1IBM B;  2ZNI A;  1V55 B;  3JAR B;  1Q3E A;  5IYZ B;  4H13 B;  3UO3 A;  2PNR A;  3RGB A;  4WBN A;  3HKB B;  5F5R A;  2QGN A;  2CCU A;  2Q5Z A;  1GKZ A;  2XCM A;  3RLQ A;  4ZHQ B;  1VQN V;  2CAZ C;  1L0N H;  4JYA B;  5D5P A;  3VHD A;  3OFN G;  1QHT A;  2YIB D;  4JI8 O;  3F7V C;  2GV9 A;  4DR2 O;  4L93 A;  1QY8 A;  2VQF B;  2E5L B;  4PI0 A;  2DJV A;  2OCC B;  2QDO A;  2XAQ A;  1IUR A;  3BAA A;  1JR9 A;  4X88 A;  3D0B A;  2EIN C;  3MNR P;  1UYM A;  1FXH A;  4O05 A;  2ZT9 B;  3QO7 A;  3G4S V;  1FXK A;  1I7F A;  5CBH A;  5EBM C;  1JJO A;  5IY5 B;  1K34 A;  4LWI A;  2YEV B;  5F2V O;  4L8J A;  1FYJ A;  3S3W A;  5BOC A;  5LGU A;  5KX5 B;  1FFT B;  5FL7 G;  1NI8 A;  4B3M O;  1XDC A;  2ZDY A;  4JQL A;  2QM8 A;  3T1H O;  3ZKD A;  3AG3 B;  1Y67 A;  4CC6 A;  1Z5A A;  3RYI B;  1PL4 A;  2VQF O;  2E5L O;  4BR6 A;  3D3I A;  1U0Z A;  4P7A A;  4B3T O;  4AWQ A;  4AWP A;  2UUC O;  2ZE6 A;  2KSD A;  2QG0 A;  1Y4S A;  5DN6 G;  3A0T A;  3U11 A;  1AH8 A;  3FFQ A;  3FX7 A;  4UCO A;  4K0K O;  1JPX A;  4W4L A;  1IVS A;  3QO5 A;  4DR5 O;  1NVP B;  4GX5 A;  2IH3 C;  2IOR A;  3WFV A;  4BIU A;  2A0L A;  2QKA A;  2Y4T A;  4X65 B;  1MSW D;  1BXD A;  5BR8 O;  1AB3 A;  4MSW C;  4K8Z A;  3TJT A;  2O57 A;  3VBB A;  1VF5 B;  2LQT A;  2UUC B;  1H8H G;  4YKW A;  1A4H A;  3TXS A;  5B5E Z;  3K0G A;  2YEV A;  1MNG A;  2EUL A;  5IDJ A;  1RSO A;  3H1H H;  4DV5 O;  3WG7 C;  4MP7 A;  3O2F A;  4DR5 B;  3CRA A;  3SPH A;  1OCZ C;  1ORQ C;  1VMG A;  2W6I G;  3EHB B;  5L3B A;  4HXW A;  4UXN A;  2FTK A;  4UCV A;  1KU9 A;  5CA0 A;  4FIP C;  1BL8 A;  5M4M A;  2IBZ H;  4TV8 A;  1PNM A;  1B62 A;  4WFB V;  4Q6G A;  1US7 A;  3OR7 C;  4FLV A;  1G8M A;  4YJ3 A;  1XUQ A;  4R3A A;  1OCR B;  2YJW A;  4MVM A;  3SL2 A;  4O4J B;  3ZMT A;  2YKJ A;  1K97 A;  3W7T A;  2WI4 A;  1DK1 A;  1M93 A;  3K98 A;  3RKZ A;  3QO8 A;  1CP9 A;  4JTC B;  2M7W A;  5LMN B;  3LSU A;  1RP3 B;  3R92 A;  5KX5 A;  2B1G A;  4BW5 A;  4I55 A;  3C3T A;  1JOY A;  2XDK A;  5A9G A;  2ESA A;  3BHP A;  1H2N A;  2WLM A;  1IXB A;  3T1Y B;  2Q8F A;  3OGI B;  4YIO A;  2ZXW B;  4NXM B;  4O4H A;  2WEQ A;  3B4S A;  2Z3Y A;  4B7P A;  5J71 A;  2ZKJ A;  1MG1 A;  4UCT A;  3EHF A;  3DC5 A;  3MAQ A;  3FKS G;  3CWB H;  3T4Z A;  1JJ2 U;  1MOF A;  2IJI A;  3P32 A;  3PJS K;  4O2A A;  1US6 A;  1NVP D;  2E0A A;  3E35 A;  5GTI Z;  1HNX B;  1ENV A;  2A3Q A;  2X6A A;  4RQE A;  2XAJ A;  4LP0 A;  2YEA A;  4OPH A;  4RQF A;  1BHB A;  4O0B A;  2WER A;  4AI8 A;  1KZN A;  2K1E A;  3ZRW B;  4PDM A;  4UCS A;  1S72 V;  3B8N A;  4QPJ A;  3HR0 A;  2PTM A;  3ZRV A;  1Q90 D;  3GWK C;  4CH3 A;  2XDL A;  3OGC C;  1MZF A;  3FAV B;  3OPD A;  2LFS A;  1NKD A;  1A32 A;  1PKX A;  2GBO A;  1BHA A;  4GX1 A;  3W7U A;  4O2B B;  1BSM A;  4B3T B;  1XNQ B;  4ZOL A;  1YC4 A;  2ZDI A;  3TUH A;  3FB8 C;  1BYQ A;  3Q4H B;  1LUW A;  3A8T A;  3K59 A;  1N8R W;  1I5A A;  3ZHR A;  4XKK A;  3R4O A;  1KUQ A;  2WLK A;  2Q8V A;  3JAT A;  5J2U A;  2ZE5 A;  4NR1 A;  4FVM A;  1TUE B;  4BAY A;  5EZY B;  1D5N A;  4YY3 B;  3RBZ A;  1FPO A;  1YS3 A;  1PV0 A;  1JM6 A;  3WB2 A;  2PI5 A;  2MK3 A;  3BVO A;  3H4L A;  4X1I A;  5KA5 A;  2EXL A;  1TUB B;  3ZRS A;  2ZIN A;  4DZY A;  1ZL8 B;  4DR1 O;  4ZKI A;  4RUE A;  4EEH A;  4JZG A;  4WFH A;  4DV5 B;  5EK0 A;  1FS0 G;  3LDD A;  2JIZ G;  1MX0 A;  1YJ9 V;  1SZT A;  1BCC H;  5KA6 A;  4HNA A;  4EFE A;  2EIK C;  4DUY B;  3IAY A;  4IHJ B;  5JVD A;  4FM0 A;  4LC1 A;  1M90 W;  3CGY A;  4U3J A;  4JI7 B;  3VHA A;  2BCC H;  4QE7 A;  2DYR B;  3ABL C;  1AIL A;  3JD1 A;  2P67 A;  2LJ2 A;  1XRE A;  1UPG A;  3G80 A;  4O4L A;  3OTF A;  3INW A;  3S5T A;  3G67 A;  1RM1 B;  2YGF A;  2EBO A;  3UCS C;  4TOI A;  3K03 A;  4DV6 O;  3FT5 A;  4GKJ O;  1SS3 A;  2HKJ A;  2LO1 A;  1EA6 A;  4O2A B;  2ZDI C;  3ASO B;  3SYQ A;  4UCU A;  3D2R A;  5FPR A;  3UQ8 A;  2JEX A;  4DV4 O;  1J5E B;  3HEK A;  3B24 A;  1AP6 A;  3RFR A;  2QR4 A;  2CGF A;  3JD2 A;  1HNW B;  4DR6 O;  2HLD G;  1XIL A;  3F7Y C;  1U97 A;  2EIL C;  2AZ2 A;  3K5N A;  3K0D A;  3RW0 A;  1IX9 A;  3K04 A;  4I0X B;  3WU2 Z;  4JTD B;  1M4U A;  4DV6 B;  1N34 O;  1N33 B;  4X1Y B;  3CCM V;  2NN4 A;  3CJH B;  2HCH A;  2AGA A;  1BT8 A;  2DW4 A;  4C7U A;  1G6U A;  4MVO A;  2Z0A A;  4KTN A;  3N2G B;  2ZIO A;  4F6R B;  5LP6 A;  5B1B C;  3CC4 V;  1UYC A;  2BYH A;  3J81 N;  4UVC A;  3RLR A;  5IYD O;  2UXD B;  1VEW A;  4E72 A;  4X66 O;  4TQD A;  1Y66 A;  3K5O A;  3T10 A;  2PI4 A;  1S16 A;  1XOU A;  1ARO P;  4LNU B;  3CC7 V;  4NYK A;  4O4I B;  2YEF A;  2AZ0 A;  2XAS A;  2JJ2 G;  1PPJ H;  2HKO A;  2XK2 A;  2ODM A;  2X0L A;  1FAF A;  4UV8 A;  1XNR O;  3O0I A;  4HZ0 A;  3LNU A;  4KFM A;  3HZ5 A;  1PD3 A;  2BU8 A;  5CN0 A;  2G38 A;  5LA6 B;  3KE6 A;  2CCS A;  1AH6 A;  1B06 A;  5FNV A;  1D5A A;  2D3O W;  1YJW V;  1KP3 A;  2ZQM A;  1ZLZ A;  2P22 C;  2WLH A;  4H37 A;  4CC5 A;  1VAR A;  2Q69 A;  5B1B B;  1NH2 D;  2YXL A;  1SC5 B;  3GWO A;  2GQP A;  2WI2 A;  2YI7 A;  4LNU A;  3SYC A;  4DK1 A;  5IWA O;  1IBK B;  3VHC A;  1DF4 A;  2ZBK B;  3LUT B;  4J42 A;  4DW0 A;  3QTF A;  2NLJ C;  1XMO B;  1IZ3 A;  1ZUQ A;  1RM1 C;  2YE9 A;  4LFB O;  4NVP A;  1Z2G A;  3RYC B;  2QTS A;  3DSQ A;  3APQ A;  2HVK C;  5H6R A;  1XMO O;  1YTF D;  3K08 A;  3ABK B;  2ZD9 A;  5FNF A;  5B1O A;  1R3L C;  4URL A;  3F5W C;  5CMU A;  2OYQ A;  2XX5 A;  1NR1 A;  1VF7 A;  5GON B;  2QM7 A;  3D36 C;  1VQO V;  2YKB A;  4B7E A;  5EC1 C;  4MTO A;  2F95 B;  2CDY A;  4TV8 B;  4LWE A;  1SER A;  1IDS A;  4B7K A;  4DUZ O;  2IU3 A;  5CA0 B;  4H85 A;  4YJ2 A;  4LFA B;  2YXH A;  2WLI B;  2YI8 A;  4O07 A;  4FLU A;  2HVJ C;  5JJJ B;  1H2M A;  4B3S B;  2BRE A;  4GX2 A;  1X4T A;  1SQQ H;  3OEE G;  5D7D A;  4EB6 B;  1FKA O;  1JQ0 A;  1AI4 A;  2R9R B;  2XHR A;  4UUJ C;  4K3A A;  4L8Z A;  2IJH A;  3ETE A;  4PDR A;  4DR1 B;  5IYB O;  2VCI A;  2XND G;  2DYS C;  4KXR A;  5LBQ A;  3BAB A;  5CBG A;  1R73 A;  4U3F H;  1GMG A;  2Y69 C;  2P4K A;  5TIS Z;  2UUA B;  4MB9 A;  3U67 A;  3B77 A;  1K73 W;  1ZWI C;  1Q43 A;  3T1Y O;  2Q68 A;  1TIL A;  4XCL A;  3UO2 A;  4ZHQ A;  4WUD A;  2OCH A;  1TBW A;  4WCE V;  3M99 B;  3A0H Z;  1Z59 A;  3R4P A;  2HG1 A;  4YKU A;  2A06 H;  3ZHV A;  3QNE A;  4BWA A;  3TZ4 A;  2JJC A;  4LF9 O;  3ZKB A;  3FYE B;  2ZKO A;  4URO A;  1L1F A;  2UXX A;  2R72 A;  1BQ0 A;  4NB5 A;  4WFE A;  4TV9 B;  3JAW B;  1F4M A;  2VWK A;  1THN A;  1GN3 A;  5JCO C;  1UJW B;  3CXC U;  2DWD C;  5LL6 Y;  1RPR A;  4DV3 B;  4JPR A;  5DM6 V;  3G75 A;  4LPB A;  3CP1 A;  1EBO A;  3TCU A;  4W7T A;  4X1Y A;  4X9L A;  3EKO A;  3Q5J A;  2R9A A;  3ZHU A;  2QWQ B;  3ASO C;  3OMN B;  1NJI W;  2IWU A;  3HZ1 A;  5JCO A;  4N23 A;  3JSL A;  1JX9 A;  2ILM A;  3Q4H A;  3ZMS A;  5KUM A;  2YE7 A;  2OTJ V;  3LPS A;  1SET A;  2AHY A;  4R7C A;  4X66 B;  3SR2 C;  4GX0 A;  2ZM6 O;  2DWE C;  3E8G A;  1SF9 A;  4GFN A;  2YEI A;  3APO A;  2PYJ A;  1OCZ B;  2DOS A;  4K4O A;  3W7X A;  2BTQ A;  1Q5O A;  3CCQ V;  4JI4 B;  1S14 A;  3U10 A;  2BE3 A;  4JF3 A;  3Q5L A;  4DV1 B;  5IJ9 A;  4PA7 A;  3FAV A;  1UY6 A;  4P9O A;  1CEZ A;  2KB1 A;  1Y8O A;  3SPG A;  2IOQ A;  4FPP A;  3K06 A;  1YCI A;  2H8P C;  4K8X A;  2PF4 E;  4LF8 O;  4F6R A;  2QWN B;  5LP6 B;  5DEC A;  1GJV A;  5J6A A;  5IN9 A;  2HEP A;  4LF5 O;  3U0Z A;  3K97 A;  3B28 A;  4PA4 A;  3EFF K;  1Z5W A;  3OTO B;  1RSO B;  4GUN A;  3BFR A;  5FNV B;  4ASG A;  3EHG A;  1UYE A;  3K9A A;  1YT2 A;  4E4E A;  3B8M A;  1NTM H;  1YHQ V;  1HWY A;  3B09 A;  5JQG B;  3G71 V;  1CXZ B;  4G28 B;  3AK3 A;  5J2T B;  1UYK A;  2XT9 A;  1S5H C;  2JS5 A;  1Y8P A;  4MT8 A;  2WAM A;  1ZWH A;  3AG2 C;  3HPL C;  4XIR A;  3LSS A;  1OCO B;  4YHH O;  1I94 B;  4O04 A;  3G6E V;  4ASA A;  2UUB B;  3VOU A;  1W2B U;  1R6K A;  3GIF A;  1SQX H;  4KP4 A;  4DV2 O;  4FLT A;  3CCS V;  2YEG A;  1PNK A;  4U3J B;  3RWR D;  3CE2 A;  4MVU A;  2BSK A;  3M7M X;  2X6C A;  1E79 G;  3CCJ V;  4Z1M G;  4NXN O;  3E2E A;  2YE5 A;  3AG3 C;  3CCV V;  1GM8 A;  4YY3 O;  5FND A;  3BRC A;  3KG2 A;  2BZ5 A;  5HFL A;  4BW9 A;  1OCC B;  2QKC A;  4MPN A;  3SPJ A;  2Q6A A;  3ABT A;  1ZAU A;  2JJ1 G;  1VIB A;  1VQ5 V;  1VQ9 V;  3ZBH A;  3OUF A;  4JAA A;  2ATK C;  2KG7 A;  4I50 A;  1HR0 O;  1H38 A;  4FJC C;  4DV3 O;  1VQP V;  4CWR A;  4X1I B;  4J7J A;  1Y76 B;  1NS1 A;  4RUF A;  4GYC B;  2YEH A;  1N0J A;  2ZCE A;  2F43 G;  4H44 B;  4I5S A;  1H8E G;  4EB6 A;  4CH4 A;  1JCH A;  3H80 A;  2CTQ A;  2FYU H;  2Y69 B;  1XI1 A;  1VQ4 V;  4MPC A;  2RDC A;  5KUK A;  3T1C A;  4LFC O;  2WI5 A;  4PA3 A;  4TT3 G;  4MVS A;  1QLE C;  1M56 B;  4J10 A;  4MVR A;  3D8C A;  3L75 H;  2LW1 A;  1GM9 A;  4O4I A;  2BYI A;  1M5I A; 
#chains in the Genus database with same CATH homology
 1QYE A;  4MTX A;  4XKK A;  5LGT A;  1K33 A;  4MS2 A;  3R4O A;  2WI1 A;  4YKR A;  2EJR A;  1F23 A;  2WLK A;  3A0R A;  3E86 A;  4KSH A;  4DO2 A;  3WHA A;  1PNL A;  2A9H A;  1TUE B;  4BAY A;  2B1I A;  5J9P C;  3CWV A;  3LNM B;  4MBC A;  5L3J A;  3RBZ A;  1YJN V;  1VQ8 V;  3LDC A;  1YS3 A;  4WFF A;  2OCC C;  4CWT A;  1JM6 A;  5D6P A;  5L3C A;  1ROP A;  2PI5 A;  1GKF A;  2MK3 A;  4XDL A;  2AKP A;  3H4L A;  3TET A;  4CBC A;  5KA5 A;  3A0Z A;  2EXL A;  3VAD A;  4CE3 A;  3RVZ A;  3ZRS A;  1NHH A;  4DZY A;  2IJK A;  5L3E A;  4WFG A;  1I5B A;  1TH8 A;  4U7N A;  1XL4 A;  4QPK A;  4GT1 A;  4ZKI A;  4CWS A;  5BOD A;  1K4C C;  4RUE A;  4H33 A;  2YK9 A;  4EEH A;  4MW3 A;  4WFH A;  3LSQ A;  2V7Q G;  4LBE C;  2VWC A;  5EK0 A;  4I9W A;  5CTX A;  1N8R W;  4HYM A;  1FS0 G;  4XCJ A;  3AEI A;  3LDD A;  3CC2 V;  2IU0 A;  1AJ6 A;  4GEE A;  2JIZ G;  1GM7 A;  3DGE A;  4MVQ A;  1YJ9 V;  1MX0 A;  4PRX A;  1SZT A;  4XDJ A;  1AM1 A;  4KFG A;  4YKY A;  5KA6 A;  2LFR A;  1EI1 A;  3ZXQ A;  4X8A A;  1UYH A;  2EIK C;  2C2A A;  3INX A;  1QLE B;  1WLE A;  2FWY A;  3OW6 A;  1E1R G;  3IFX A;  2AHZ A;  4LC1 A;  3R91 A;  5IYC O;  4BAE A;  1M90 W;  4LWG A;  3CGY A;  3WQ9 A;  3VHA A;  1COW G;  5M4E A;  5M4P A;  4QE7 A;  3EKR A;  2DYR B;  2ZR3 A;  3ABL C;  3CMA V;  1H7U A;  2YE5 A;  3JD1 A;  2P67 A;  5LHI A;  3GIE A;  3B25 A;  3ZRW A;  3HHU A;  3AG1 B;  5LHH A;  1NH2 B;  1KQS U;  1KKD A;  2BRC A;  2XAB A;  3INW A;  1OZ0 A;  2Q67 A;  3CME V;  1RM1 B;  2X7R B;  4EKW A;  2H8M A;  2IOP A;  1GK9 A;  1GKX A;  1NHJ A;  2WLI A;  1M57 B;  3T4D A;  2YGF A;  2EBO A;  4P8O A;  3K03 A;  2EIJ B;  3FT5 A;  4BQG A;  1YSZ A;  2O1U A;  1U2O A;  3TK1 A;  4LWF A;  3T2S A;  3AG1 C;  1YES A;  2DYR C;  4YKT A;  2HKJ A;  1EA6 A;  5CTU A;  2ZDI C;  2HR3 A;  3ASO B;  2YE6 A;  4CE1 A;  3SYQ A;  1R3K C;  4E2L A;  3D2R A;  4WUC A;  2XJX A;  1YI2 V;  2K5B A;  2JEX A;  3CCU V;  3HEK A;  1EFR G;  3SYP A;  3B24 A;  4XIT A;  4WFA V;  4HXW A;  4MP2 A;  2CGF A;  2YEJ A;  3JD2 A;  2HLD G;  4X89 A;  1L0O A;  1TC6 A;  3F7Y C;  4MPE A;  1P7B A;  2EIL C;  4PEL A;  1LNQ A;  4I3H A;  1KP2 A;  3ZM7 A;  3ABM C;  1ID0 A;  2FYP A;  1V54 B;  5HFM A;  3K0D A;  3RW0 A;  2YE4 A;  4XC0 A;  1S77 D;  2QFO A;  1WPX A;  2EZO A;  3K04 A;  4XIP A;  4NH7 A;  4JTD B;  1I58 A;  2YEB A;  4MTF A;  4YKX A;  2O1W A;  2BOC C;  3AG4 B;  3CCM V;  4QIW F;  2HCH A;  4RAI A;  2Q8H A;  1I5Y A;  2DW4 A;  3CCL V;  2GFD A;  2YJX A;  5CA3 A;  4MVO A;  4KTN A;  1AJQ A;  3E8F A;  4JGS A;  2JEU A;  4JYC A;  3EHJ A;  2H94 A;  4E00 A;  4H7Q A;  4PL9 A;  3B27 A;  4L90 A;  5B1B C;  3CC4 V;  1M9N A;  4XDK A;  1UYC A;  2BYH A;  1EZJ A;  4UVC A;  4QNH B;  1TID A;  2Y48 A;  2BU6 A;  3A0Y A;  3RLR A;  5B1A C;  1NR7 A;  5IYD O;  1UYF A;  2HFE C;  3STL C;  2Q2E B;  4H81 A;  3JCZ A;  4HZ5 A;  4P2Z A;  5L3D A;  1Y66 A;  1YC3 A;  2BU5 A;  3T10 A;  3FB5 C;  1QCE A;  2FXS A;  3R4N A;  2QG2 A;  5EBW C;  1FXK B;  1M56 C;  2PI4 A;  2GHY A;  4UV9 A;  1S16 A;  1ARO P;  1KC8 W;  3CC7 V;  2QTO A;  2BSM A;  3OMA B;  3OEH G;  1TC0 A;  1Z5B A;  4XIQ A;  3K79 A;  2CG9 A;  4R3M A;  2YEF A;  1GTO A;  3IC7 A;  2XAS A;  2JJ2 G;  4KUM A;  1K8A W;  1OSF A;  4CZZ A;  1ZW9 A;  4YKQ A;  3ZXO A;  4ASB A;  2HKO A;  4EMV A;  2XK2 A;  4HXZ A;  2X0L A;  4R50 A;  4UV8 A;  3RVY A;  1Q7Y W;  3BMY A;  3O0I A;  4FCP A;  4XD8 A;  3X2Q C;  5FWK A;  3Q5K A;  2YE3 A;  2DQ3 A;  3LNU A;  4KFM A;  4HZ0 A;  3HZ5 A;  1PD3 A;  1PL0 A;  2BU8 A;  4ZVI A;  1BMF G;  3ASN C;  4PDL A;  3OUS A;  5B3S C;  3IED A;  5CN0 A;  2UXN A;  1AI5 A;  1YET A;  3NMQ A;  3KE6 A;  2CCS A;  1AH6 A;  4XBF A;  1AI7 A;  1M57 C;  1YER A;  4E02 A;  2P6J A;  3MHS C;  2D3O W;  1YJW V;  1F4N A;  1KP3 A;  3OW2 U;  1YIJ V;  1I5C A;  2ZQM A;  2WLH A;  3ZMV A;  2ZDX A;  4H37 A;  5B1N A;  1G4Y B;  3K60 A;  2Q69 A;  4J9Z B;  2O1V A;  1H2G A;  4HAM A;  4YKZ A;  5B1B B;  1NH2 D;  1I59 A;  2XAH A;  3MHH C;  2WWW A;  4G27 B;  3GWO A;  1V55 C;  4CWO A;  5EC2 C;  4JYB A;  3IGA C;  2YKI A;  2CH4 A;  2GQP A;  2WI2 A;  2XX2 A;  2YI7 A;  4JAV A;  2YI0 A;  3CRK A;  1B6Q A;  4RO2 A;  3SYC A;  4ASF A;  3ZIA G;  3VHC A;  5M4H A;  3SPI A;  3ZMZ A;  1DF4 A;  2ZBK B;  3LUT B;  3SYO A;  1VQ7 V;  3QTF A;  2YSU B;  2NLJ C;  4AWO A;  2XDX A;  4EGH A;  1MAB G;  1QVF U;  3FYI B;  3QDD A;  1RM1 C;  3H01 A;  1V54 C;  5D6Q A;  5CPH A;  1Q82 W;  3ABL B;  4LP8 A;  1BGQ A;  2YE9 A;  1K5S A;  3GIG B;  4DUH A;  2BOB C;  2WI7 A;  2XJG A;  3AG2 B;  3T0H A;  1NHI A;  2HVK C;  5H6R A;  2JKI A;  1ZXN A;  2YI6 A;  4QJF B;  3O6O A;  2WLN A;  1YTF D;  3K08 A;  1S0V A;  4XKO A;  3TZ0 A;  3ML0 A;  1E1Q G;  3ABK B;  1Q86 W;  2ZD9 A;  1VQM V;  4L94 A;  5FNF A;  3MD0 A;  5B1O A;  1R3L C;  2VCJ A;  4URL A;  4MOT A;  3F5W C;  3JD4 A;  5CMU A;  3K99 A;  2XX5 A;  5FNC A;  4L91 A;  4URN A;  1NR1 A;  1CPY A;  2WEP A;  1DLB A;  3OE7 G;  3OR6 C;  4L87 A;  2GSM B;  2DQ0 A;  4G2K A;  5LHG A;  2QM7 A;  1K5Q A;  1VQO V;  2YKB A;  5BZB A;  5H6Q A;  2XHT A;  5EC1 C;  4MTO A;  4XE2 A;  1R6N A;  4LWE A;  1JVM A;  1SER A;  3W7S A;  3TZ5 A;  4B6C A;  4P30 A;  1OCR C;  5M4K A;  2IU3 A;  2ZR2 A;  4H85 A;  3EHH A;  4EGK A;  1Y4U A;  5IDM A;  2WLI B;  1I5D A;  2QA4 V;  1V55 B;  4ASU G;  3E83 A;  3E89 A;  2PNR A;  4O07 A;  5F5R A;  2HVJ C;  2BRE A;  1K3E A;  1AI6 A;  3HB3 B;  3JD3 A;  1H7S A;  4GX2 A;  4YXW G;  1GKZ A;  2CCU A;  2WPD G;  3OWD A;  2XCM A;  3RLQ A;  3OEE G;  1ZXM A;  1B63 A;  3FV5 A;  5D7D A;  1VQN V;  2YEC A;  1JQ0 A;  4JAU A;  3TZ2 A;  4PRV A;  5B1A B;  1AI4 A;  2A79 B;  2R9R B;  1VQK V;  4UUJ C;  1R62 A;  2XHR A;  2YK2 A;  4L8Z A;  2IWX A;  2IJH A;  3VHD A;  3ETE A;  3OFN G;  4PDR A;  4HYP A;  2WI3 A;  5CTW A;  5IYB O;  2V1D A;  2XND G;  2DYS C;  5LBQ A;  2VCI A;  3GIG A;  3E8H A;  3RLP A;  2ZXW C;  3F7V C;  2WLL B;  1IXM A;  4L93 A;  1QY8 A;  5M4N A;  4ZBM A;  3CCE V;  5CBG A;  1R73 A;  1GMG A;  2JDI G;  2Y69 C;  3OMI B;  3R65 A;  1PVG A;  2YI5 A;  4MB9 A;  2Q8G A;  3U67 A;  2OCC B;  3B77 A;  1K73 W;  4R8C A;  1ZWI C;  3LDE A;  1R3I C;  1THZ A;  4FK5 C;  2XAQ A;  2Q68 A;  3FB6 C;  4X88 A;  3HYZ A;  3D0B A;  3ZN0 A;  1TIL A;  4XCL A;  2EIN C;  3MNR P;  1DTO A;  3JD0 A;  3SYA A;  2DYS B;  3E8B A;  1VQL V;  2XX4 A;  1DF5 A;  1FXH A;  3OAA G;  1K9M W;  2W6J G;  1UYM A;  4XTJ A;  4V26 A;  4NH8 A;  2QEX V;  4O05 A;  4HY6 A;  4WUD A;  4JAS A;  3QO7 A;  3T1K A;  4MTG A;  5L3G A;  1BKN A;  1TBW A;  1QZR A;  3OWB A;  4EFU A;  1QVG U;  4WCE V;  1AMW A;  2FWZ A;  2WSS G;  3G4S V;  3M99 B;  2Z5U A;  3C11 A;  1B3Q A;  2YKE A;  1Z59 A;  1FXK A;  2HG1 A;  3R4P A;  4YKU A;  3G7E A;  4CWF A;  3QNE A;  5CBH A;  5EBM C;  3DTU B;  5IY5 B;  3TZ4 A;  1UYI A;  2JJC A;  1K34 A;  4LWI A;  2YEV B;  4TWK A;  3C0E A;  2YE2 A;  4GGL A;  3FYE B;  5BOC A;  3ZKB A;  5LGU A;  4URO A;  1L1F A;  5GGZ A;  3WG7 B;  1FFT B;  5FL7 G;  4AS9 A;  2UXX A;  2ZDY A;  2ITC C;  1MU5 A;  4JQL A;  4WFE A;  3PEJ A;  2QM8 A;  5F3K A;  1F4M A;  2H55 A;  4U93 A;  1THN A;  3AG3 B;  4R1F A;  3ZKD A;  1UJW B;  3CXC U;  1Z5A A;  1Q81 W;  2DWD C;  3D3I A;  1U0Z A;  1RPR A;  2EIJ C;  4JPR A;  3T2M A;  5DM6 V;  3G75 A;  4P7A A;  5CTY A;  1FXV A;  4LPB A;  4AWQ A;  3CP1 A;  4AWP A;  4V25 A;  2QE7 G;  1EBO A;  3K3W A;  3TCU A;  3B26 A;  3PEH A;  1YTF B;  4W7T A;  4XDM A;  3ASN B;  4UVA A;  4X9L A;  2YGA A;  3UM7 A;  4BIZ A;  3EKO A;  2QG0 A;  1Y4S A;  3Q5J A;  4LWH A;  5DN6 G;  3A0T A;  1GO3 F;  2IH1 C;  3X2Q B;  4KQV A;  1AH8 A;  1NJI W;  3ASO C;  3OMN B;  2IWU A;  3HZ1 A;  1UY7 A;  1JPX A;  2EIM C;  4HY1 A;  4N23 A;  3QO5 A;  2P7T C;  1JX9 A;  4J9Y B;  2EIK B;  1NVP B;  3ZMS A;  1UY9 A;  4GX5 A;  2IH3 C;  2W0F C;  3WFV A;  2IOR A;  5KUM A;  3R4M A;  4BIU A;  2A0L A;  2YE7 A;  1MSW D;  1BXD A;  4EFT A;  2OTJ V;  2Q8I A;  4MSW C;  3U2K A;  2XD6 A;  3LPS A;  1SET A;  2AHY A;  4Q20 A;  4R7C A;  3VBB A;  1VQ6 V;  3ETD A;  4GX0 A;  4EM7 A;  4WF9 V;  2DWE C;  3E8G A;  1H8H G;  1KEC A;  4YKW A;  1A4H A;  1K92 A;  3ZJZ A;  4GFN A;  2YEI A;  3K0G A;  2YEV A;  2B5U A;  4TSF G;  1OCZ B;  4K4O A;  4N21 A;  2R9I A;  3GB7 C;  1OCC C;  4PA9 A;  5IDJ A;  3W7X A;  1YT1 A;  2XDS A;  3CCQ V;  3G7B A;  1S14 A;  3SJQ C;  3STZ C;  1UYG A;  4JF3 A;  4GQT A;  3WG7 C;  3P30 A;  3Q5L A;  2EZP A;  3ABU A;  1W0J G;  4MP7 A;  2P90 A;  3O2F A;  1YSC A;  4PA7 A;  3SPH A;  2YE8 A;  1OCZ C;  1ORQ C;  2W6I G;  3EHB B;  3ZMU A;  3ZRX A;  5L3B A;  4P9O A;  1UY6 A;  4UXN A;  4FCR A;  2FTK A;  4QE9 A;  1CEZ A;  5L3F A;  2KB1 A;  1S76 D;  3SPG A;  1Y8O A;  2IOQ A;  2QF6 A;  2IJJ A;  4FPP A;  3FT8 A;  3K06 A;  4FIP C;  1BL8 A;  2H8P C;  2LP7 A;  3ABM B;  3T0Z A;  2JK5 C;  5M4M A;  1J95 A;  2BTZ A;  1YIT V;  2XAG A;  2BT0 A;  3OMU A;  1GJV A;  1PNM A;  4XKA A;  5E1A C;  1B62 A;  5IN9 A;  5J6A A;  4WFB V;  1US7 A;  3K97 A;  3B28 A;  4E01 A;  4FCQ A;  4PA4 A;  3EFF K;  2CCT A;  4BQJ A;  2WLL A;  3BEH A;  3UKM A;  3OR7 C;  2EIM B;  1G8M A;  2XJJ A;  3U2D A;  3BY6 A;  4CWN A;  1AJN A;  1NQT A;  3CCR V;  3OM3 B;  4GCZ A;  1OCR B;  4R3A A;  2YJW A;  4MVM A;  4DXW A;  4ASG A;  1UYD A;  3EHG A;  3ZCC A;  3SL2 A;  4JTA B;  1Z5C A;  3ZMT A;  2YKJ A;  1UYE A;  1K97 A;  3K9A A;  2HJF C;  3W7T A;  1YT2 A;  3B8M A;  4U7O A;  1YHQ V;  1HWY A;  2WI4 A;  3JZ3 A;  3G71 V;  2BU7 A;  4BXI A;  5C93 A;  3K98 A;  5B3S B;  3RKZ A;  4UVB A;  3QO8 A;  4G28 B;  3W7W A;  1CP9 A;  5CBF A;  1Y8N A;  1RPO A;  4WUB A;  4JTC B;  2M7W A;  1QBZ A;  1XL6 A;  2OT5 A;  1UYK A;  2IW5 A;  2YKC A;  2EIN B;  1S5H C;  2UWD A;  1AR1 B;  2VW5 A;  1Y8P A;  4MT8 A;  2WAM A;  1KD1 W;  1ZWH A;  1SES A;  1AJP A;  3R92 A;  2B1G A;  3AG2 C;  4BW5 A;  4CE2 A;  1W0K G;  2OTL V;  3TTZ A;  1NBM G;  3HPL C;  1JOY A;  2WI6 A;  2XDK A;  3LSS A;  5IY5 C;  4XIR A;  3JYC A;  1OCO B;  3I55 V;  2ESA A;  4O04 A;  3G6E V;  4ASA A;  2WLM A;  4MVZ A;  2Q8F A;  4HZ3 A;  1K4D C;  3VOU A;  5CF0 A;  1SRY A;  2ZXW B;  1W2B U;  1R6K A;  2WEQ A;  3NXS A;  3GIF A;  4NH9 A;  2Z3Y A;  4B7P A;  5D7R A;  4KP4 A;  1QR8 A;  5EBL C;  5J71 A;  3ZN1 A;  2YEE A;  3CCS V;  2ZKJ A;  3I56 V;  1YT0 A;  1QR9 A;  1MG1 A;  1S3J A;  4MW8 A;  2YEG A;  3EHF A;  3HYY A;  1PNK A;  3FKS G;  3FB7 C;  3CGZ A;  2XOK G;  4MVU A;  3SPC A;  3T4Z A;  2WLJ A;  1JJ2 U;  1MOF A;  2IJI A;  3P32 A;  3PJS K;  2X6C A;  1E79 G;  3CCJ V;  2EIL B;  2NNU A;  4Z1M G;  1K7D A;  2HG5 C;  3AG3 C;  3CPW U;  3CCV V;  3E2E A;  1NVP D;  2YED A;  1GM8 A;  2E0A A;  4KSG A;  3E35 A;  5FND A;  3KG2 A;  2BZ5 A;  2IWS A;  5HFL A;  1UYL A;  3BM9 A;  3ABK C;  1OCC B;  1ENV A;  1R3J C;  5D7C A;  4O09 A;  2X6A A;  4URM A;  4MPN A;  1YC1 A;  3CYO A;  4PDV A;  4OXS A;  3A0W A;  2BU2 A;  3SPJ A;  2Q6A A;  4RQE A;  3ABT A;  2CK3 G;  1F51 A;  2JJ1 G;  2XAJ A;  3AG4 C;  1VQ5 V;  1VQ9 V;  1Y4M A;  1UY8 A;  3CRL A;  2YEA A;  4LP0 A;  4RQF A;  4R6Z A;  3OUF A;  1BHB A;  2WER A;  4F4L A;  2ATK C;  1QLN A;  2K1E A;  3ZRW B;  1KZN A;  4O0B A;  1H38 A;  4FJC C;  3A0X A;  4PDM A;  5GW7 A;  1VQP V;  1S72 V;  1OHH G;  3B8N A;  4QPJ A;  4EGI A;  1YSR A;  2XDU A;  3ZRV A;  4CWR A;  4P9P A;  1M1K W;  4CWQ A;  4CWP A;  2XDL A;  3OGC C;  1P4R A;  4HYO A;  3OPD A;  2LFS A;  4RUF A;  1NKD A;  1PKX A;  1BHA A;  2YEH A;  2F43 G;  2ITD C;  4GX1 A;  3W7U A;  4I5S A;  3CD6 V;  1H8E G;  2XHX A;  1JCH A;  3H80 A;  2Y69 B;  1VQ4 V;  1I5X A;  1OCO C;  2XAF A;  1KIJ A;  4MPC A;  2X6B A;  1YC4 A;  2ZDI A;  4FMT A;  3T1C A;  5KUK A;  2WI5 A;  4PU9 A;  4PA3 A;  4TT3 G;  2YGE A;  4MVS A;  1QLE C;  3TUH A;  1FXK C;  1M56 B;  3FB8 C;  1BYQ A;  5H9C A;  4GT8 A;  5LGN A;  4MVR A;  4PA6 A;  3D36 A;  4LCU C;  1GM9 A;  1I5A A;  2BYI A;  2QKS A;  3ETG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...