3DGEA

Structure of a histidine kinase-response regulator complex reveals insights into two-component signaling and a novel cis-autophosphorylation mechanism
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
237
structure length
237
Chain Sequence
b'KRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein
publication title Structural Insight into Partner Specificity and Phosphoryl Transfer in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
total genus 69
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3dgeA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3dgeA02
2Q8FA 2CH4A 2WI4A 2YE6A 2GQPA 5D7RA 3TK1A 1L0OA 1KIJA 2VWCA 4HY6A 2YGEA 4O05A 5CTXA 3TTZA 1UY8A 2WI3A 4HYMA 1Y4UA 5M4PA 1MU5A 2XCMA 1NHJA 3T2SA 3RKZA 4LP0A 5F5RA 1TC0A 4QPJA 2YEAA 1ID0A 2YK2A 4P8OA 3G7EA 2LFRA 2YI0A 2YJWA 2YGAA 4R3MA 2BTZA 2YE5A 4MB9A 2YEIA 2ZBKB 2CCTA 2QM8A 1Z5AA 2XK2A 3KE6A 1Y8NA 3T1KA 4BQGA 1NHHA 4MOTA 3GIFA 1Y4SA 4KSGA 2YKIA 3IEDA 3T0HA 2IWSA 4GGLA 1YT1A 2QM7A 3NXSA 4FPPA 4YKWA 1YSRA 5J71A 2XJGA 2QFOA 1B63A 5FNCA 4ASBA 3P32A 2YI7A 3WQ9A 4P7AA 3A0TA 5D7CA 4GT1A 2P67A 4YKRA 4CWFA 1YC4A 2FYPA 4FMTA 3GIGB 3D0BA 4HY1A 5FNDA 4URNA 5M4HA 2XX2A 4GEEA 1UY9A 2YEJA 3TZ0A 1Y8PA 3VHDA 4MPNA 2IWUA 2O1UA 2FWZA 4HXZA 2QG0A 2YK9A 1YC3A 4JAVA 4ZKIA 3Q5KA 4I5SA 4XCJA 5D7DA 4KQVA 3ZRWB 1S16A 4H81A 5D6PA 3R92A 2YJXA 4XE2A 2JJCA 5IDMA 4LWIA 1YT2A 3Q5LA 4MPEA 2BT0A 2JKIA 4HZ5A 3PEJA 2YKEA 1GKZA 3OWDA 3A0RA 1UYHA 1A4HA 3HEKA 4MP2A 4U7OA 4AWOA 1BYQA 2WEPA 3R4OA 3DGEA 3GIEA 4L90A 4ASFA 1QZRA 3U2DA 4HXWA 3A0YA 4JAUA 4XDMA 1GKXA 3A0XA 4I3HA 4H7QA 2BYIA 3CGYA 1R62A 2FXSA 3K98A 4PU9A 1H7SA 4LC1A 1I5AA 3HYYA 3T10A 4B7PA 4PRVA 5F3KA 3VHCA 5M4NA 3FV5A 3ZKDA 4U7NA 1UYIA 2K5BA 2IWXA 3T0ZA 2LFSA 3RLPA 1AM1A 2CCUA 4CE3A 5B1NA 1QY8A 1TIDA 3VADA 2HCHA 3TZ4A 1AH6A 2XDLA 5C93A 3FT5A 4YKYA 3EKOA 2WI7A 3A0WA 2ZKJA 4JASA 4O0BA 2GFDA 3CGZA 2UWDA 1TC6A 3C11A 4EM7A 4ASGA 1I59A 1B62A 5BODA 4O07A 2YKCA 3O2FA 4XD8A 1UYLA 3G7BA 1H7UA 3HHUA 3H80A 2YE7A 2XX5A 3EHFA 2XX4A 4WUBA 3RLRA 5CTWA 1YS3A 2ESAA 4EEHA 1ZXMA 2CGFA 3NMQA 2XD6A 2BYHA 1BKNA 4XC0A 2EXLA 5IN9A 2WI1A 4O04A 4YKUA 1AMWA 4XIRA 4LPBA 4GCZA 4UROA 3ZXOA 4CE2A 4XTJA 4X9LA 3ZRVA 2CCSA 5GGZA 1IXMA 4CWRA 2H8MA 2QG2A 1AH8A 2BREA 4NH9A 4E00A 5L3JA 4KSHA 4O09A 3B28A 2XABA 4EGHA 5FWKA 5CTYA 4XITA 4FCPA 2BU5A 2YE9A 4MTXA 2AKPA 2VW5A 2XJJA 2YEFA 3O0IA 3TZ2A 4B6CA 2XJXA 5M4MA 3EHJA 4ASAA 4LWEA 2YE2A 4V25A 4BAEA 2YEHA 2FTKA 3R91A 5B1OA 3O6OA 4K4OA 3CRKA 3BM9A 3LNUA 2FWYA 3C0EA 3U67A 2IOQA 3PEHA 5CTUA 4XIPA 2YI6A 3R4MA 4W7TA 4FCQA 1THNA 4PL9A 2YECA 4HYPA 2YGFA 4BQJA 2XDXA 1YC1A 1TH8A 1TILA 2H55A 1TBWA 1YERA 4XCLA 4HZ0A 1QYEA 1YSZA 4URLA 2YKJA 4QPKA 4YKTA 3ZM7A 3B26A 2IORA 2YE8A 3MD0A 1Y8OA 2E0AA 3B24A 1BGQA 2XHRA 1EA6A 2C2AA 4MBCA 5M4KA 2WERA 3QDDA 3K99A 3TUHA 2Q8GA 4NH8A 3B25A 3B27A 1ZWHA 2Q8IA 4URMA 1BXDA 2Q2EB 3TZ5A 4JQLA 3ZCCA 4XIQA 1F51A 5J6AA 4EMVA 5FNFA 3HYZA 3G75A 4GFNA 4R3AA 3Q5JA 4XKOA 2WI5A 4AWPA 1U0ZA 3QTFA 1Z5CA 1UYCA 4GQTA 1PVGA 3OMUA 4U93A 1ZW9A 5BOCA 4KP4A 3CRLA 2YI5A 3K97A 3BMYA 2YEEA 1I5DA 4YKZA 1YESA 3SL2A 4AWQA 2Q8HA 1MX0A 2O1WA 2WEQA 4CE1A 1Z59A 4YKQA 1UYKA 4E02A 4MP7A 5CPHA 2IOPA 4XKKA 3D36A 4L93A 3VHAA 4GT8A 3FT8A 4JYBA 2WWWA 4EFUA 2ZDXA 3ZRXA 3OW6A 1JM6A 3H4LA 1S14A 4L8ZA 4PRXA 4L91A 2QF6A 4BIUA 2HKJA 3U2KA 1UYMA 3EKRA 1AJ6A 1KZNA 1EI1A 1UY7A 1UYDA 2PNRA 3D2RA 1YT0A 2BU7A 1JOYA 2XDKA 4NH7A 4EFTA 1NHIA 4CWNA 4YKXA 2YEBA 4EGKA 1UYEA 4CWQA 5M4EA 2BSMA 2BU6A 1GJVA 4JYCA 2YE3A 5D6QA 2XDSA 1I5CA 2YKBA 1I5BA 3A0ZA 2CG9A 3K60A 4LWHA 2YEGA 3INXA 2WI2A 3HZ1A 2BZ5A 3JZ3A 1U2OA 4XKAA 3R4PA 2XHTA 3R4NA 3ZKBA 3ZXQA 2XDUA 1YETA 4Q20A 4CWSA 2O1VA 3WHAA 2BRCA 4FCRA 4AS9A 1OSFA 5CF0A 4EGIA 4KFGA 4MT8A 4LWFA 3INWA 3HZ5A 3MNRP 4V26A 3RLQA 4KTNA 3GIGA 2HG1A 5IDJA 2ZDYA 4BXIA 4WUCA 1B3QA 4DZYA 4L94A 3LPSA 4WUDA 1US7A 4CWOA 2VCIA 2YEDA 3CWVA 3EHHA 2BU2A 4R1FA 3ZRWA 1UYGA 2XHXA 4LWGA 2BU8A 3EHGA 4CWTA 4H85A 3OWBA 1UYFA 4DUHA 2YE4A 4BIZA 4CWPA 3OPDA 1UY6A 4ZVIA 2VCJA 1Z5BA 4MPCA 2WI6A 1I58A 1ZXNA 4E01A
chains in the Genus database with same CATH superfamily
1VEWA 1E1RG 1WA8B 4J7KA 2WI4A 5K1PA 5D7RA 3TK1A 1XMQO 1L0OA 2WLLB 1S0VA 1I08A 1EFRG 1L0NH 2V4DA 1WJZA 3STZC 4HY6A 1FAFA 2YGEA 2QR4A 4HYMA 1Y4UA 3B09A 5M4PA 1VF6A 1IBKB 4FM2A 3TXSA 2HJDA 2W0XA 1VMGA 3CCEV 2A06H 3JASB 2EINC 5KLVH 4LH7A 3AG3C 1TC0A 1I94O 4I0XA 2YEAA 3P30A 1YTFB 1ID0A 2YK2A 4PI2A 2EIMC 1U97A 2QKCA 4R3MA 5B1AC 5B1BB 2IU3A 3TETA 2YEIA 3F7VC 2FB5A 2YEVA 1YHQV 3CCUV 2XK2A 3KE6A 1Y8NA 4K8ZA 1S77D 5KHHA 1B04A 4DUYB 4YJ2B 3GIFA 2DJVA 3MDSA 4KSGA 1R6TA 2YKIA 3VQYA 1QR9A 4GGLA 3LNMB 1NH2B 3NXSA 5F2VO 5JCOC 1YSRA 5J71A 1B63A 5FNCA 3ZJZA 4O2BB 2OT5A 1M56B 3ZX6A 3G67A 2ETNA 1QLEB 5DEDA 1FJGB 4FFBB 3RBZA 4GT1A 4YKRA 1IBLB 1FXHA 4L87A 1GN6A 4HY1A 2OIEA 5FNDA 3ZMUA 4O4HA 3CRRA 1VQ8V 2LW7A 3TZ0A 2V1DA 1Y8PA 3VHDA 4MPNA 4TSFG 2D2CB 4K0KB 2QG0A 1VQKV 3Q5KA 4JZ2A 4X66B 2X6BA 4FLVA 2WA4A 1SQBH 2CGOA 3SPGA 3UM7A 2HP8A 4B3MB 2GUZA 3BRCA 4H81A 2YI8A 5D6PA 1TVKB 1J5EB 4XE2A 5IDMA 2UXXA 2LP7A 2ZDIA 1KUQA 4CH4A 1H2NA 4FFKA 3OWDA 3HEKA 5LL6Y 2BE3A 1KU9A 4DV5B 3E8BA 5JH7A 4ABMA 3E83A 3A0YA 1IDSA 3Q4HA 3STLC 1LUVA 4ZI7A 4O4LA 4W4LA 3SPJA 3AG1B 1S5JA 2BYIA 3CGYA 1R62A 1PV0A 1H7SA 2PTMA 1YITV 4LC1A 3JALB 4B7PA 1GMGA 4DR4B 2IBZH 3UT5B 5F3KA 3QO5A 5M4NA 1H2LA 1PM9A 2EIJB 4DW1A 1NR1A 1QY8A 1TIDA 4WF9V 1WP8A 2NNUA 1AH6A 3ETQA 4DV6B 2XDLA 3FT5A 3KCYA 1SQVH 2HVJC 1QVGU 5IE9A 1MG1A 4GLXA 1M9NA 4Q6GA 3RYCB 1TC6A 4ZOLA 3ZIAG 3ZHRA 1R73A 3U0ZA 2XAJA 1I59A 4ASGA 1B62A 4TUYB 5BODA 5C8YA 5IJ9A 4IL6Z 5LXTB 3G7BA 2O57A 4DV2B 1BHAA 1N33O 2JIZG 1FPOA 2H3OA 3JAKB 4WUBA 1YS3A 2ESAA 3NMQA 1NVPD 4K8XA 4O4JA 5J2UA 1BKNA 3SYQA 2Q0OC 4LFCO 1AMWA 3U10A 2JEXA 2F23A 3JATA 2XAHA 4CE2A 2QWOB 1R1BA 1OCOB 3P3PA 1GKFA 3LSQA 3A2FA 2BSKB 3B28A 3FKSG 5CB4A 5J9PC 2XABA 4EGHA 4NKGB 1VIBA 3W7XA 2JGDA 3JCUZ 4B3RB 1BSMA 2YEFA 3K04A 5JVDB 3O0IA 2ILMA 2XJXA 2Z0AA 4DYLA 4NXMO 3CCJV 4YHHB 2W6JG 4LWEA 3ABLB 2ZR3A 3ASNB 2VQEB 3N2GB 4JI8B 1FFXB 2YEHA 1HNZO 4J9ZB 2ZE6A 5BR8O 1VF6C 1W2BU 3X2QC 3ZHTA 3LNUA 1NS1A 3C0EA 2IOQA 1S5LZ 4PHZA 2YI6A 3R4MA 4FCQA 4PL9A 2YECA 3CCSV 3RYHB 3VQXA 5EYPA 2GSMB 2WLNA 2JVDA 1TH8A 3RVYA 4X1IB 3SYOA 2CTWA 1ZSPA 4B3TO 1TBWA 4XCLA 1NJIW 4X62O 4JPRA 4YKTA 3B4SA 1R3LC 1Y74A 3CC7V 1K4DC 2CK3G 2E0AA 4JI6B 5LOVA 1BGQA 5CA0B 3WB0A 3OFNG 3SYCA 5M4KA 1K3EA 4JGSA 3K5OA 1R6KA 1ZWHA 2Q8IA 4URMA 1UFIA 1BGYH 3ZMSA 3RN4A 4X8AA 4QGPA 5L3GA 5LBQA 5LA6B 4XIQA 1NT2B 3FB8C 1RFYA 3ZN1A 3UO3A 1B6QA 2B9ZA 2YXYA 2EZPA 1U0ZA 4R8CA 1YDXA 3CJHA 4DUZO 3HKCB 1PVGA 5LMUB 1ZW9A 3B8NA 3P3NA 4YY3O 4JI7O 4KP4A 1DF4A 3CRLA 1OCRC 4LWSA 4DRXA 1S5HC 4LBEC 4X1YA 4WBNA 1SETA 1SQPH 4BAYA 1BZKA 3LDEA 1MX0A 3ASOC 3OR6C 1H2GA 2O1WA 1BQ0A 3J81N 1Z59A 4YKQA 2IW5A 5JQGB 3E8FA 2Q73A 3CYGA 4DR7B 2IOPA 1Y76A 1JQ0A 4JI5O 3D36A 2Y0PA 3CS5A 3VHAA 1FD9A 5FPRA 4EFUA 3E22B 5IYCO 4DV0O 2OTJV 2WLIB 4BIUA 4EFEA 2HKJA 3HR0A 3WG7B 3H9VA 4NVPA 3ZMVA 3RVZA 1HR0O 1NHIA 1JA8A 4YKXA 2YEBA 2P6JA 2UUCB 4CWQA 2M7WA 5BY1A 2YKBA 1YZBA 3F7YC 4TOIA 1I7FA 2YEGA 5LYJA 1N34O 2ARHA 3DXRB 3I55V 1U2OA 3D8CA 5LGUA 4X20B 1Q3EA 3R4NA 4NXNB 2XDUA 3JD4A 4CWSA 1XBLA 2X0LA 4UVCA 3WHAA 4FCRA 1JR9A 4AS9A 5DM6V 4TT3G 4LF5B 4LWFA 4V26A 2H8PC 2XTAA 3LSUA 1VP7A 1AI4A 2ZDYA 3K9SA 1B3QA 4WUCA 1VQLV 4DZYA 3F5WC 2GDSA 4EB6A 2GTAA 4PA6A 3CC4V 3LPSA 1US7A 4CWOA 3AG2B 2UXCB 2B1IA 3CMAV 3CWVA 1ZUQA 3HKBA 2BU2A 1CEZA 3JD1A 3CP1A 5HFMA 3OE7G 5GTIZ 4CWTA 4ZBMA 1KYOF 5KAIZ 1VQ9V 1G1XB 1WLEA 3OWBA 1UYFA 4DUHA 1XOUA 2CTQA 4BIZA 3BA9A 4PA3A 3K5LA 1ZTEA 3GWKC 2VCJA 3G6EV 3N2KB 4MPCA 2WI6A 3L71H 5EC1C 4R6ZA 1ZXNA 4E01A 5CN0A 1BL8A 3K06A 5AG2A 4P9PA 4UV9A 2D3OW 4DV1O 3J80N 2VWCA 4LP8A 5CTXA 4AQYB 2WI3A 3K5NA 1MOFA 1QR8A 1MU5A 2HR3A 3RKZA 1NI8A 4FLYA 3L73H 3CCLV 3B77A 2EBOA 4UV8A 4LFAB 3OUFA 4YJ3A 4GX1A 1GN4A 1M5IA 4X1KA 3CCRV 1RSOB 4DW0A 1K5QA 4P8OA 1HW7A 4LF9O 5IYZB 2YI0A 2YJWA 2YGAA 4KL1A 4MB9A 3ZBHA 5FLXN 2ODMA 2QM8A 1HNWB 4KHPB 1YI2V 1DGSA 4TV8A 3K0GA 2EILB 2F93B 4BQGA 3ETDA 1NHHA 5KUMA 2E3CA 3K9AA 1XHZA 2UUAB 4JI2B 2IWSA 4G27B 3OEHG 4X89A 3SJCC 1EZJA 4B08A 4LF8B 4XDLA 2G38A 1XNQB 2BTQA 2DWDC 3C90A 3P32A 4ASBA 2IH1C 4Z2WA 1COWG 3WQ9A 3CE2A 2F4VB 4P7AA 4PA7A 2Q9LA 5D7CA 1CP9A 1VARA 1G8MA 3B2EE 2P67A 4CWFA 2FYPA 3JARA 5LP6A 4R50A 1NVPB 5K1XA 2EIKC 3TXQA 3T1YB 2XX2A 4X65B 1V54B 4FK5C 2YEJA 2ITCC 3ABKB 4BIOA 3D3IA 3ETGA 4CZZA 2O1UA 4JYAO 4O2AA 4JAVA 4ZKIA 3SGIA 4I5SA 1XQ8A 3G71V 4EFBA 3JD0A 3CHXA 4RUFA 1U96A 4LF7B 2ZR2A 3R92A 2JJCA 1TA8A 4NTXA 4KFMA 2ZINA 4X88A 2IU0A 1YT2A 3HKDA 2BT0A 2WSSG 2JKIA 1IBKO 2YKEA 2QEXV 2HFEC 2Y4UA 1UYHA 1KMIZ 3D36C 1N0JA 1Y6XA 1AR5A 4U7OA 3CEIA 4AWOA 4JI0O 3A0HZ 5CA1A 2L35A 1JJOA 1BYQA 1TUBB 3DGEA 1EN4A 2WEPA 3R4OA 2EIJC 1QZRA 1OCZB 4ASFA 2Y4TA 3OR7C 3U2DA 4JAUA 1GK9A 1WB7A 2PGGA 1FKAO 2DYRC 4GKKO 4I3HA 4U3FH 1BCCH 4H7QA 2ZE5A 4JZGA 3T1CA 1IBMB 2QA4V 3CXCU 2FXSA 3K98A 1SQGA 3K5MA 2Q6AA 1F4NA 5IT9N 4B3SB 1LR1A 3DC5A 1I5AA 1VQNV 3HYYA 3T10A 2HHHO 2Q67A 4I50B 5EBWC 3D3QA 1Q90D 1OCCC 1P84F 3CRCA 2K5BA 4FLUA 3W7SA 1KKCA 3OAAG 1AM1A 2IJIA 5EZYB 4I55B 4CE3A 2JRIA 1R6NA 2EULA 2PYLA 1N4CA 1FFTB 3K3WA 3VADA 3TZ4A 1EBOA 4LF6O 1K97A 2WA3A 3EKOA 2WI7A 4LR3A 4MVOA 4I9WA 3A0WA 2A3QA 4O0BA 4GKJO 2Y0IA 3TJTA 2LW1A 3BAAA 3IAYA 2UWDA 3CGZA 1BS3A 5KMGB 3JAWA 1AVMA 3EVKA 1V55B 4MW3A 3S3XA 4BW9A 1P7GA 4MW8A 1AI7A 4DK0A 1Q7YW 3S5TA 1PPJH 1VF5B 3ABMB 5FNVB 4I4TA 4UB8Z 3HHUA 3H80A 2JK5C 2Q69A 4D6TH 3EHFA 2E5LB 4DR5B 3RLRA 1R3IC 3HKEB 4UCUA 5LHIA 3RW0A 5IJ0A 3BFRA 2CGFA 3H1LH 4DXWA 4U3JA 3H1IH 5IWAO 2ZM6B 4XC0A 2UUBB 2EXLA 1JJ2U 4PD4F 2WI1A 4WFBV 1E1QG 1HNXO 2OIGA 3RT3C 4XIRA 1M90W 4LPBA 3G4SV 3ABLC 2CH7B 3ASNC 4R7CA 3APQA 1K4CC 5GGZA 2R72A 1S3JA 4O4IA 2H8MA 3BEHA 4P30A 1RPOA 4E00A 5L3JA 4KSHA 4MVQA 4O09A 3FB5C 4HZ3A 5J2TA 2UXDO 1ZLZA 5FWKA 1XEQA 1KC8W 3RYFA 2BU5A 2XUMA 4WFFA 3CB2A 4CS2A 3CC2V 2YE9A 3IJ4A 3TZ2A 4ZIBA 2QDOA 2P4KA 3OTOO 3BPZA 2P4VA 2YI9A 1AI6A 1ZL8B 2DQ3A 3CWBH 3LDDA 5LHHA 3BM9A 2N05A 2FWYA 3L75H 4GZRB 3E2EA 4W7TA 2YDEA 3WFVA 1THNA 3OW2U 4HYPA 4OX9O 1MNGA 4IIJB 4YIPA 1YC1A 5GONB 5HFLA 1I5YA 1FXKB 2A0LA 2CGNA 2Q8VA 4DR1O 2DE0X 4RAIA 3TCUA 1N0NA 1D5AA 3RYIB 1QYEA 1YSZA 1NZ6A 1XMOO 2EJRA 4AILC 3B8MA 1Q81W 4MVMA 1L0LH 1AJPA 3K08A 4EKWA 1KP2A 2XHBA 4MBCA 4E2LA 2WERA 3K99A 4LF4O 4DV2O 1UJWB 3B25A 4K35A 2QTSA 3QO8A 2Q2EB 5ITZA 1Q43A 4PA4A 3ZCCA 1ZX3A 4JI4B 1TGOA 5IY5C 1FXVA 4ZHQB 5A9GA 4R3AA 5LP6C 4AWPA 3AG4B 3G80A 3T1HB 4LNUB 3JYCA 1V9PA 2DYSB 2QWQB 1B06A 3OMUA 3L70H 2V7QG 5BOCA 1N36O 2KG7A 2P22C 3BMYA 2OCCC 4HNAA 2UU9O 3NR7A 4PV1B 4JV5O 2LO1A 4AWQA 4DV7O 2B1GA 5KA5A 3UQ8A 4CE1A 1UYKA 1WA8A 1EN5A 1H2SB 4UCSA 2OCHA 2OYQA 4XKKA 3FFQA 2WLLA 4L93A 2VQEO 2ZDXA 3M8AA 5CA3A 3H4LA 4L91A 2E76B 1XNRB 2CTRA 2X6AA 1R3KC 3JASA 2YSUB 4DV4O 3CYOA 2AGAA 5KHJA 1EI1A 4XBFA 1WN7A 3JSLA 5KA6A 1TAEA 2EINB 1UYDA 2PNRA 3AG3B 3ZMTA 3KCXA 2VQFB 1JOYA 1YT0A 2BU7A 1WPBA 4NH7A 2BOBC 5CBGA 2PI4A 4J41A 3THOA 4CWNA 5B1AB 4TQDA 1FS0G 1UYEA 5M4EA 2BSMA 4ASUG 5D6QA 1K34A 3A0BZ 4RWUA 1DTOA 1HP8A 3BY6A 3IC7A 1I5BA 2CG9A 3A0ZA 3MHHC 4YJ2A 3INXA 3CRAA 2BZ5A 2QSAA 1VQPV 3JZ3A 3DSQA 2PZSA 3ABTA 4FJCC 2ZXWC 3UCSC 4F4LA 1H2MA 2AHZA 3OMIB 3ZKBA 1YETA 3T4DA 1QNMA 3AG2C 3QVNA 4O2BA 2O1VA 2HEPA 1F23A 3DC6A 4G28B 1ORQC 2Q7GA 2Q4PA 3OUSA 4PELA 4EGIA 1O9GA 4F6RB 1N33B 4FFBA 1AI5A 5LHGA 5KX5B 1YIJV 3RLQA 2H94A 4L94A 3H1HH 4LFCB 1YCIA 2MW2B 1AR4A 4UXNA 4TV9B 4WUDA 4J42A 4XDKA 1H8EG 2QKSA 1RPRA 5H2FZ 2YEDA 1UYGA 3QTCA 3QNEA 1WB8A 4DR7O 2IH3C 1SF9A 3ZHSA 4H85A 1TVKA 4WFGA 2YE4A 5KHIA 4B7KA 1Z5BA 2RDCA 5BXZA 2KSDA 5B3SB 4NXMB 3JSNA 1KQSU 3J7AU 2YE6A 2GQPA 1HNZB 5L3DA 5BR8B 2C1IA 1QHTA 4RQFA 1JFFB 1YF2A 1K33A 5H5NA 1IVSA 4O05A 3TTZA 2ZKOA 4PJ0Z 1SA0B 2P06A 1WNSA 1MABG 2ZCEA 3R65A 5F5RA 2QWPB 3SJAC 2YXLA 3W7UA 3L74H 1W59A 3JALA 4X62B 2CDYA 2ZQMA 3KKYA 2PY5A 3G7EA 2LFRA 3UT5A 4FIPC 1KB9F 2BTZA 1GAXA 1NH2D 3FX7A 2Q0AA 4N23A 2ZBKB 4NXNO 2CCTA 3I5DA 3VOUA 3T1KA 3ZN0A 1EZVH 1GO3F 3BA8A 3IEDA 5BMVB 2X7RB 2QWNB 3RYCA 2QM7A 1YT1A 4B7EA 2CE4A 4YKWA 1QLNA 4H0LB 2YC0A 3OEEG 4QNHB 4TUYA 2Q7HA 2YI7A 4IHJB 3QG5A 5LXTA 4DUZB 4JTDB 1K5SA 5FPOA 1YC4A 4F6EA 2RNBA 2Y69C 4FMTA 3GIGB 2RMKB 3JAKA 4URNA 2KKWA 4MS2A 5LMNO 1VQOV 2P5OA 5M4HA 3FAVB 4LFBO 4GEEA 1UY9A 3CMEV 1WPXA 1DLBA 4BW5A 1JCHA 1Q6IA 3DTUB 1XUQA 4HXZA 4DR3O 2Y48A 1YC3A 1IX9A 2DN9A 4JI5B 1LUWA 1CPYA 4MVUA 3ZRWB 2LGQA 4NR1A 4JI3O 2HJFC 2WLMA 2JS5A 2WAMA 2BSKA 1SC5B 4DV0B 4BR6A 2RQ6A 4LCUC 3UO2A 3Q5LA 2AZ0A 2JDIG 2VRZA 4D7TA 4JI1O 3LMMA 4HZ5A 1IZ3A 3HB3B 5JVDA 2P90A 2K9PA 3OMNB 4MP2A 2QM4A 2HLDG 4WCEV 2PYJA 3N2GA 3GIEA 1FFXA 2UXBO 3SJBC 3GB7C 4HXWA 1AJNA 4PDRA 3U11A 1MSDA 3N27A 3FD9A 4H13B 1MSWD 1BQZA 2CAZC 1N34B 3RYHA 2ZD9A 4PDVA 4I0XB 1MA1A 2ADQB 4DO2A 3BABA 4X1IA 2A7WA 4CBCA 3A8TA 2L6LA 5B1BC 2VWKA 3VHCA 3E8HA 4X64O 2F1MA 4ICGA 4KUMA 3FV5A 1Q6UA 4U7NA 3CCMV 3T0ZA 3RLPA 2YEVB 5B1NA 1AILA 5CA0A 1L8DA 1Q6HA 2F4VO 4JASA 2GFDA 1GM7A 2W6IG 3G6BA 1M56C 4MVSA 5LA6A 3SR2C 4EM7A 1QLEC 2UXNA 2CUGA 4I9QA 4RUEA 4O07A 1SS3A 3O2FA 1N32B 2R9RB 4XD8A 1UYLA 1AP6A 1H7UA 1P49A 1K8AW 2XX5A 4HBNA 5JJJB 3HKCA 4O4HB 5CTWA 3JD3A 3FYIB 2P7TC 4E72A 4O04A 1OCRB 3AK2A 4QIWF 3KG2A 5JQGA 5IYBO 1JPXA 4DV1B 4X9LA 1RM1B 1NBMG 1IXMA 1Z5WA 4CWRA 2GUZB 1K7DA 2QG2A 4OGQB 1AH8A 4DR2O 3TGUH 1AROP 4NH9A 1WAZA 3LUTB 3BCCH 3E22A 2BCCH 2RCVA 4XITA 2WLIA 2AKPA 2XJJA 1FXKC 2YICA 1I0HA 3W7TA 1IBMO 2RJZA 4H37A 2WPDG 4LF9B 4ASAA 4QJFB 4V25A 5GTHZ 3RFRA 1G6UA 3SJQC 1GN3A 2Q7EA 1Z2GA 1DF5A 2W0FC 2FTKA 2QTOA 2XASA 5JH7B 5FL7G 4J7ZA 1MZFA 3CRKA 3AG1C 3Q4HB 4ZI7B 4NTYA 4O4LB 2YIBA 3MHSC 4XIPA 4K3AA 4IYIA 4UFZA 2QGNA 1KKDA 2YGFA 4E4EA 1QU7A 2LJ2A 2H55A 3DXRA 3H1JH 2Z5UA 1NTZH 4UVAA 4JYYA 4HZ0A 4X20A 1GTOA 4LH6A 1PL0A 2WLHA 1PKXA 4EEQA 3B26A 4FVMA 1NTMH 2IORA 1SQXH 4J9YB 3MD0A 1Y8OA 5JENA 4DV3B 2XHRA 1EA6A 5EBLC 1OHHG 4IYHA 2FYUH 5JJNB 4JTAB 3QDDA 1P7BA 3TUHA 3I56V 4DUYO 3JCZA 2Q8GA 4NH8A 3B27A 5DECA 4ZOLB 1SKVA 5KHKA 1THZA 4FLXA 4N21A 3S3WA 5J6AA 1KD1W 4EMVA 4JYAB 4JTCB 5FNFA 4DR6B 3G75A 5C8YB 4GFNA 5IJ9B 4XKOA 1NR7A 1Z5CA 5B5EZ 1FJGO 4UCRA 4GQTA 4IGGA 1AR1B 1IBLO 3FB6C 1H2KA 1BE3H 4WFEA 1URFA 4O4JB 1M57B 2YEEA 5J2UB 1NQTA 1YESA 3VQWA 1OJHA 3RWRD 3CPWU 1A32A 3N2KA 3T4ZA 2IJKA 2Q8HA 2Q5ZA 3SL2A 4YIOA 5KUKA 1OCOC 3JATB 4K0KO 1YJWV 3APOA 4JI0B 1Z5VA 4PI0A 2ZNJA 5BZBA 3CRMA 4X66O 4CS3A 2DOSA 1D5NA 4GKKB 4B3MO 2XOKG 4GT8A 5CB4B 2PF4E 5A2QN 1BT8A 1HDJA 2ZIOA 1J5EO 3PN1A 1GN2A 1JM6A 2JGDB 1S14A 1KP3A 5CMUA 2XAQA 3SYPA 3U2KA 2YIBD 1UYMA 1GH6A 2KQXA 3EKRA 1NTKH 1XMQB 1AJ6A 5CBFA 1LNQA 2OTLV 1L1FA 2N74A 2HHHB 4UCTA 1RSOA 1F7YA 1UY7A 1O9HA 5IYZA 2XDKA 3ZHUA 4L8JA 4DV5O 4NTWA 4UCVA 3MAQA 4A5UB 3VQVA 4EGKA 1VF7A 2KB1A 4LF6B 2LGWA 1GJVA 4JYCA 2ZE8A 3H1KH 1I94B 4P2ZA 4W4KA 4FLTA 4LWHA 5EYPB 3OM3B 4GKJB 3K59A 4XKAA 4FZ1A 4DR4O 3PJSK 4QE9A 1SESA 1SERA 1Y74B 1XL6A 2OWOA 1Y66A 2QKAA 1MZEA 4JI4O 5LOVB 1OSFA 5CF0A 2Z3YA 2NR5A 3OGIB 3INWA 3MNRP 1F4MA 1GM9A 5H9CA 1QQCA 4KTNA 4DV6O 2XNDG 3T1HO 4NB5A 4BXIA 5KHGA 2AHYA 5IWAB 1ROPA 1M1KW 5B3SC 2EIKB 1HNXB 3E89A 1NU1H 1EM1A 2IJJA 4CH3A 2XAFA 2GHYA 4R1FA 1XI1A 3CJHB 3HPLC 2XHXA 4LWGA 3ZEDA 3EHGA 3SPCA 1JX9A 2UXDB 2JJ1G 4LWSB 4DRXB 3H01A 4X1YB 4WBNB 3OPDA 1UY6A 2JS3A 4ZVIA 2F43G 4GYCB 3CX5F 3O65A 3OTFA 3OTOB 2Q8FA 5IYDO 2CH4A 1XNRO 1Y76B 1KIJA 3CD6V 1S76D 2NN4A 3JAMN 1TUBA 5JJEB 2VQFO 4MTGA 1UY8A 4Z1VA 1XL4A 2GBOA 3WG7C 4OX9B 2XCMA 1NHJA 3T2SA 2DYRB 4LP0A 4DR1B 2E74B 3IFXA 4B3RO 1S72V 1PP9H 4QPJA 4MTFA 4YHHO 4I50A 1YJ9V 1XMOB 2LQTA 2JEUA 4JI8O 2YE5A 1OCCB 1XHXA 2ITDC 1SZTA 5EZYA 4I55A 1Z5AA 1EN6A 2QWRB 1I5XA 3E35A 4LF4B 4MOTA 2YS8A 5LYJB 1Y4SA 1CXZB 3T0HA 1T5EA 4FLZA 4FPPA 2XJGA 4FZ0A 2QFOA 2EIMB 5KMGA 4I7ZB 1US6A 3L9DA 5E1AC 2R70A 5FNVA 3A0TA 1W0KG 4JI6O 1VQ6V 3RGBA 1GRJA 3D0BA 1N36B 2QE7G 1RP3B 4HAMA 1YSCA 4CH6A 3HKEA 2AW9A 2UU9B 1N8RW 4JV5B 5H6RA 4EB6B 4DV7B 2IWUA 1JVMA 1BMFG 3QF7A 2HG5C 3LDCA 2FWZA 2YK9A 2F95B 4OPHA 3HKBB 4MVRA 2CH7A 4XCJA 5D7DA 2NLJC 3IGAC 4KQVA 4UCOA 3AG7A 1S16A 3GWOA 5H6QA 3ABUA 4IT5A 4J10A 1ZAUA 2YJXA 1QBZA 3WU2Z 4D7SA 5LMUO 1YEWA 1KECA 4LWIA 4MPEA 4NYKA 4DV4B 4TQFA 4AI8A 4HYOA 1AB3A 2Q68A 3PEJA 1GKZA 3FYEB 3A0RA 1Q8IA 1A4HA 2IM9A 4YXWG 1ZL8A 1ZWIC 4L90A 1W0JG 2JGUA 4XDMA 2BTOA 1GKXA 4PDLA 3A0XA 2ATKC 1H38A 2GTSA 4AHCA 4XDJA 5L3FA 4PU9A 4MTOA 3F5TA 4YJ3B 4IIJA 1KBHA 5KAFZ 5GONA 4X1KB 1FXKA 1Y4MA 2EZOA 4PRVA 3JD2A 1YTFD 1H8HG 3RYIA 3ZKDA 3ZMZA 1UYIA 1PL4A 2IWXA 2GV9A 2LFSA 2MK3A 4RQEA 2CCUA 2EILC 2C1GA 3R66A 4TV8B 2HKOA 3ZHVA 1HWYA 2UUCO 2HCHA 1UPGA 5C93A 4YKYA 4GUNA 4B3TB 1PNKA 2YXHA 1NKDA 3QO7A 4KXRA 2ZKJA 1J95A 2XAGA 1E79G 4H33A 5EIBD 3C11A 2E75B 2BTQB 3E86A 3CXHF 5L3EA 4ZHQA 3ZS8C 2YKCA 1K92A 5IY5B 1RM1C 5E79Z 4LNUA 2YE7A 3JARB 1TUEB 5CBHA 5LP6B 2ZE7A 4LF5O 1AP5A 2XX4A 1IURA 1PNLA 1V54C 3ML0A 5D5QA 2ZDIC 4EEHA 3ABKC 1ZXMA 1QVFU 4J7JA 1PD3A 3VBBA 4BWAA 4J11A 2XD6A 2BYHA 4CC5A 5IN9A 4YKUA 2EX3A 2OCCB 4UVBA 1P4RA 4O2AB 4GCZA 4UROA 3ZXOA 2UXCO 1OZ0A 4XTJA 1Q86W 3ZRVA 2CCSA 4YY3B 4JI7B 2CTPA 2ADPA 2FL4A 2BREA 3BVOA 3GVMA 4GX2A 1GM8A 2YIAA 3K03A 5CTYA 3HKDB 4FCPA 3AEIA 4MTXA 5LGTA 2VW5A 4B6CA 2BOCC 5M4MA 3EHJA 3CCVV 1OCZC 2YE2A 4BAEA 5CA1B 1X59A 5L3CA 3R91A 3AK3A 4CS4A 2K1EA 5B1OA 3O6OA 4K4OA 1XDCA 3SYAA 3U67A 5DN6G 3PEHA 5CTUA 3WB1A 4CH5A 1SZXA 4AQYO 2WLKA 3LNNA 4H44B 5LGNA 2X6CA 1YXBA 2DQ0A 3WB2A 4BQJA 2XDXA 4JF3A 2AZ2A 2DMXA 4LFAO 1TILA 1M4UA 5L3BA 1HR0B 4TWKA 1YERA 3B40A 4URLA 2QJ1A 4G2KA 4C7UA 4GX5A 2YKJA 4QPKA 5D5PA 3ZM7A 2ZXWB 2B5UA 3FB7C 5JCOA 1XREA 3UKMA 3X2QB 2YE8A 3LSSA 1Y67A 3B24A 1HNWO 5EC2C 4KHPO 2C2AA 1VQMV 4F6RA 5TISZ 3K58A 4P9OA 1K9MW 5KX5A 1N32O 1BHBA 3C3SA 5LMNB 2VWJA 3ZHQA 4QE7A 4LFBB 1M57C 1BXDA 1V55C 1X4TA 2UUAO 1AJQA 4JI2O 3TZ5A 3JAWB 2AXTZ 4JQLA 1F51A 4DR3B 1IXBA 3ABMC 4FM1A 1VQ4V 2R9AA 4TV9A 5EK0A 4PDMA 4LF8O 3HYZA 1XNQO 3SPHA 4I4TB 3Q5JA 3K57A 2WI5A 4MVZA 3QTFA 4JI3B 4RO2A 5EIBC 4J80A 2IJHA 1UYCA 2DW4A 4U93A 3SDLA 2PI5A 5IJ0B 2RN9A 4U3JB 2A79B 2EJ7A 4GX0A 2YI5A 3K97A 3O9OA 1I5DA 4YKZA 3T2MA 3T1YO 4JI1B 4X65O 3EFFK 4WFHA 1I58A 2WEQA 4PA9A 3ICXA 1OV9A 1Q5OA 4E02A 4MP7A 5CPHA 1M93A 2UXBB 3IC9A 4O4IB 1SQQH 3W7WA 1JFFA 2F66C 4X9QA 4JAAA 1SQFA 4LF7O 5J2TB 3FT8A 4JYBA 2WWWA 3CSXA 3BHPA 3CRQA 4WFAV 1SA0A 2FMLA 3OD4A 3ZRXA 3RYFB 3OW6A 2HHIA 2DWEC 4L8ZA 4PRXA 2QF6A 4OPAA 3EHBB 2ZNIA 1KZNA 3ASOB 4X64B 3D2RA 4EFTA 5JWPA 3OGCC 2XT9A 2M6YA 1VQ5V 2JJ2G 4FM0A 1MMMA 2YUAA 4OXSA 2BU6A 4Z1MG 2YE3A 2N04A 2XDSA 1I5CA 2VS0A 3K60A 4DV3O 1Q82W 2WI2A 3HZ1A 3AK1A 4UB6Z 3K79A 5BMVA 3M7MX 4B3SO 3R4PA 2XHTA 3OMAB 2PUSA 4DK1A 4UUJC 3ZXQA 1YJNV 2R9IA 4Q20A 2BRCA 1PNMA 5EBMC 3KZIZ 4IHJA 4KFGA 4DR6O 4MT8A 3E8GA 2A9HA 3HZ5A 2YIDA 1DK1A 3CCQV 2HG1A 3GIGA 5IDJA 3OT7A 2Y69B 3SPIA 3FAVA 5ITZB 2WLJA 3ZRSA 1JMKC 2ZIMA 2ZT9B 3AG4C 3C3TA 1QCEA 2VCIA 2DYSC 3EXAA 1WP7A 1YVWA 5GW7A 3ETEA 3EHHA 3L72H 1FYJA 3ZRWA 4DR2B 3K0DA 2BU8A 1G4YB 2FKXA 1ENVA 4CC6A 2E5LO 1D2DA 4DR5O 2KG7B 4CWPA 4HNAB 3M99B 4FLWA 1K73W 1SRYA 1R3JC 4MSWC 5B66Z 2ZM6O 1VQ7V 2UUBO 1XILA 2HVKC
chains in the Genus database with same CATH topology
1E1RG 2WI4A 5D7RA 3TK1A 1L0OA 2WLLB 1S0VA 1EFRG 3STZC 4HY6A 2YGEA 4HYMA 1Y4UA 5M4PA 3CCEV 2EINC 3AG3C 1TC0A 2YEAA 3P30A 1YTFB 1ID0A 2YK2A 2EIMC 4R3MA 5B1AC 5B1BB 2IU3A 3TETA 2YEIA 3F7VC 2YEVA 1YHQV 3CCUV 2XK2A 3KE6A 1Y8NA 1S77D 3GIFA 4KSGA 2YKIA 1QR9A 4GGLA 3LNMB 1NH2B 3NXSA 1YSRA 5J71A 1B63A 5FNCA 3ZJZA 2OT5A 1M56B 1QLEB 3RBZA 4GT1A 4YKRA 1FXHA 4L87A 4HY1A 5FNDA 3ZMUA 1VQ8V 3TZ0A 2V1DA 1Y8PA 3VHDA 4MPNA 4TSFG 2QG0A 1VQKV 3Q5KA 2X6BA 3SPGA 3UM7A 4H81A 5D6PA 4XE2A 2HVKC 5IDMA 2UXXA 2ZDIA 2LP7A 3OWDA 3HEKA 3E8BA 3E83A 3A0YA 3STLC 3SPJA 3AG1B 2BYIA 3CGYA 1R62A 1H7SA 1YITV 4LC1A 4B7PA 1GMGA 5F3KA 3QO5A 5M4NA 2EIJB 1NR1A 1QY8A 1TIDA 4WF9V 2NNUA 1AH6A 2XDLA 3FT5A 2HVJC 1QVGU 1MG1A 1M9NA 1TC6A 3ZIAG 1R73A 2XAJA 1I59A 4ASGA 1B62A 5BODA 3G7BA 1BHAA 2JIZG 4WUBA 1YS3A 2ESAA 3NMQA 1NVPD 1BKNA 3SYQA 1AMWA 2JEXA 2XAHA 4CE2A 1OCOB 1GKFA 3LSQA 3B28A 3FKSG 5J9PC 2XABA 4EGHA 3W7XA 2YEFA 3K04A 3O0IA 2XJXA 3CCJV 2W6JG 4LWEA 3ABLB 2ZR3A 3ASNB 2YEHA 4J9ZB 1W2BU 3X2QC 3LNUA 3C0EA 2IOQA 2YI6A 3R4MA 4FCQA 4PL9A 2YECA 3CCSV 2GSMB 2WLNA 1TH8A 3RVYA 3SYOA 1TBWA 4XCLA 1NJIW 4JPRA 4YKTA 1R3LC 3CC7V 1K4DC 2CK3G 2E0AA 1BGQA 3OFNG 3SYCA 5M4KA 1K3EA 4JGSA 1R6KA 1ZWHA 2Q8IA 4URMA 3ZMSA 4X8AA 5L3GA 5LBQA 4XIQA 3FB8C 3ZN1A 1B6QA 2EZPA 1U0ZA 4R8CA 1PVGA 1ZW9A 3B8NA 4KP4A 1DF4A 3CRLA 1OCRC 1S5HC 4LBEC 1SETA 4BAYA 3LDEA 1MX0A 3ASOC 3OR6C 1H2GA 2O1WA 1Z59A 4YKQA 2IW5A 3E8FA 2IOPA 1JQ0A 3D36A 3VHAA 4EFUA 5IYCO 2OTJV 2WLIB 4BIUA 2HKJA 3WG7B 3ZMVA 3RVZA 1NHIA 4YKXA 2YEBA 2P6JA 4CWQA 2M7WA 2YKBA 3F7YC 2YEGA 3I55V 1U2OA 5LGUA 3R4NA 2XDUA 3JD4A 4CWSA 2X0LA 4UVCA 3WHAA 4FCRA 4AS9A 5DM6V 4TT3G 4LWFA 4V26A 2H8PC 2ZDYA 1AI4A 4WUCA 1B3QA 1VQLV 4DZYA 3F5WC 4PA6A 3CC4V 3LPSA 1US7A 4CWOA 3AG2B 2B1IA 3CMAV 3CWVA 2BU2A 1CEZA 3JD1A 3CP1A 5HFMA 3OE7G 4CWTA 4ZBMA 1VQ9V 1WLEA 3OWBA 1UYFA 4DUHA 4BIZA 4PA3A 2VCJA 3G6EV 4MPCA 2WI6A 5EC1C 4R6ZA 1ZXNA 4E01A 5CN0A 1BL8A 3K06A 4P9PA 4UV9A 2D3OW 2VWCA 4LP8A 5CTXA 2WI3A 1MOFA 1QR8A 1MU5A 2HR3A 3RKZA 3CCLV 3B77A 2EBOA 4UV8A 3OUFA 4GX1A 3CCRV 1K5QA 4P8OA 2YI0A 2YJWA 2YGAA 4MB9A 2QM8A 1YI2V 3K0GA 2EILB 4BQGA 3ETDA 1NHHA 5KUMA 3K9AA 2IWSA 4G27B 3OEHG 4X89A 1EZJA 4XDLA 2DWDC 4ASBA 3P32A 2IH1C 1COWG 3WQ9A 4P7AA 4PA7A 5D7CA 1CP9A 1G8MA 2P67A 4CWFA 2FYPA 4R50A 1NVPB 2EIKC 2XX2A 1V54B 4FK5C 2YEJA 2ITCC 3ABKB 3D3IA 3ETGA 4CZZA 2O1UA 4JAVA 4ZKIA 4I5SA 3G71V 3JD0A 4RUFA 2ZR2A 3R92A 2JJCA 4KFMA 4X88A 2IU0A 1YT2A 2BT0A 2WSSG 2JKIA 2YKEA 2QEXV 2HFEC 1UYHA 4U7OA 4AWOA 1BYQA 2WEPA 3R4OA 3DGEA 2EIJC 1QZRA 1OCZB 4ASFA 3OR7C 3U2DA 4JAUA 1GK9A 2DYRC 4I3HA 4H7QA 3T1CA 2QA4V 3CXCU 2FXSA 3K98A 2Q6AA 1F4NA 1I5AA 1VQNV 3HYYA 3T10A 2Q67A 5EBWC 1OCCC 2K5BA 3W7SA 3OAAG 1AM1A 2IJIA 4CE3A 1R6NA 1FFTB 3K3WA 3VADA 3TZ4A 1EBOA 1K97A 3EKOA 2WI7A 4MVOA 4I9WA 3A0WA 4O0BA 3CGZA 2UWDA 1V55B 4MW3A 4MW8A 1AI7A 1Q7YW 3ABMB 3HHUA 3H80A 2JK5C 2Q69A 3EHFA 3RLRA 1R3IC 5LHIA 3RW0A 2CGFA 4DXWA 4XC0A 2EXLA 1JJ2U 2WI1A 4WFBV 1E1QG 4XIRA 1M90W 4LPBA 3G4SV 3ABLC 3ASNC 4R7CA 1K4CC 5GGZA 1S3JA 2H8MA 3BEHA 4P30A 1RPOA 4E00A 5L3JA 4KSHA 4MVQA 4O09A 3FB5C 4HZ3A 5FWKA 1KC8W 2BU5A 3CC2V 4WFFA 2YE9A 3TZ2A 1AI6A 2DQ3A 3LDDA 5LHHA 3BM9A 2FWYA 3E2EA 4W7TA 3WFVA 1THNA 3OW2U 4HYPA 1YC1A 1I5YA 1FXKB 2A0LA 5HFLA 4RAIA 3TCUA 1QYEA 1YSZA 2EJRA 3B8MA 1Q81W 4MVMA 1AJPA 3K08A 4EKWA 1KP2A 4MBCA 4E2LA 2WERA 3K99A 1UJWB 3B25A 3QO8A 2Q2EB 4PA4A 3ZCCA 5IY5C 1FXVA 4R3AA 4AWPA 3AG4B 3JYCA 2DYSB 3OMUA 2V7QG 5BOCA 3BMYA 2OCCC 4AWQA 2B1GA 5KA5A 4CE1A 1UYKA 4XKKA 2WLLA 4L93A 2ZDXA 3H4LA 5CA3A 4L91A 2X6AA 1R3KC 2YSUB 3CYOA 1EI1A 4XBFA 5KA6A 2EINB 1UYDA 2PNRA 3AG3B 3ZMTA 1YT0A 2BU7A 1JOYA 4NH7A 2BOBC 5CBGA 2PI4A 4CWNA 5B1AB 1FS0G 1UYEA 5M4EA 2BSMA 4ASUG 5D6QA 1K34A 1DTOA 3BY6A 3IC7A 1I5BA 2CG9A 3A0ZA 3MHHC 3INXA 2BZ5A 1VQPV 3JZ3A 3ABTA 4FJCC 2ZXWC 4F4LA 2AHZA 3OMIB 3ZKBA 1YETA 3T4DA 3AG2C 2O1VA 1F23A 4G28B 1ORQC 4PELA 3OUSA 4EGIA 1AI5A 5LHGA 1YIJV 3RLQA 2H94A 4L94A 4UXNA 4WUDA 4XDKA 1H8EG 2QKSA 1RPRA 2YEDA 1UYGA 3QNEA 2IH3C 4H85A 4WFGA 2YE4A 1Z5BA 5B3SB 1KQSU 2YE6A 2GQPA 5L3DA 4RQFA 1K33A 4O05A 3TTZA 1MABG 3R65A 5F5RA 3W7UA 2ZQMA 3G7EA 2LFRA 4FIPC 2BTZA 1NH2D 4N23A 2ZBKB 2CCTA 3VOUA 3T1KA 3ZN0A 1GO3F 3IEDA 2X7RB 1YT1A 2QM7A 4YKWA 1QLNA 3OEEG 4QNHB 2YI7A 4JTDB 1K5SA 1YC4A 2Y69C 4FMTA 3GIGB 4URNA 4MS2A 1VQOV 5M4HA 4GEEA 1UY9A 3CMEV 1WPXA 1DLBA 4BW5A 1JCHA 3DTUB 4HXZA 2Y48A 1YC3A 1CPYA 4MVUA 3ZRWB 2HJFC 2WLMA 2WAMA 4LCUC 3Q5LA 2JDIG 4HZ5A 3HB3B 2P90A 3OMNB 4MP2A 2HLDG 4WCEV 3GIEA 3GB7C 4HXWA 1AJNA 4PDRA 1MSWD 2ZD9A 4PDVA 4DO2A 4CBCA 5B1BC 3VHCA 3E8HA 4KUMA 3FV5A 4U7NA 3T0ZA 3CCMV 3RLPA 2YEVB 5B1NA 4JASA 2GFDA 1GM7A 2W6IG 1M56C 4MVSA 4EM7A 1QLEC 2UXNA 4RUEA 4O07A 3O2FA 2R9RB 4XD8A 1UYLA 1H7UA 1K8AW 2XX5A 5CTWA 3JD3A 3FYIB 2P7TC 4O04A 1OCRB 4QIWF 3KG2A 5IYBO 1JPXA 4X9LA 1RM1B 1IXMA 4CWRA 1K7DA 2QG2A 1AH8A 1AROP 4NH9A 3LUTB 4XITA 2WLIA 2AKPA 2XJJA 1FXKC 3W7TA 4H37A 2WPDG 4ASAA 4QJFB 4V25A 3SJQC 1DF5A 2W0FC 2FTKA 2QTOA 2XASA 5FL7G 3CRKA 3AG1C 3MHSC 4XIPA 1KKDA 2YGFA 2H55A 2Z5UA 4UVAA 4HZ0A 1GTOA 1PL0A 2WLHA 1PKXA 3B26A 2IORA 4J9YB 3MD0A 1Y8OA 2XHRA 1EA6A 5EBLC 1OHHG 4JTAB 3QDDA 1P7BA 3TUHA 3I56V 3JCZA 2Q8GA 4NH8A 3B27A 1THZA 4N21A 5J6AA 1KD1W 4EMVA 4JTCB 5FNFA 3G75A 4GFNA 4XKOA 1NR7A 1Z5CA 4GQTA 1AR1B 3FB6C 4WFEA 1M57B 2YEEA 1NQTA 1YESA 3CPWU 3T4ZA 3SL2A 2IJKA 2Q8HA 5KUKA 1OCOC 1YJWV 5BZBA 4GT8A 2XOKG 1JM6A 1S14A 1KP3A 5CMUA 2XAQA 3SYPA 3U2KA 1UYMA 3EKRA 1AJ6A 5CBFA 1LNQA 2OTLV 1L1FA 1UY7A 2XDKA 4EGKA 2KB1A 1GJVA 4JYCA 4P2ZA 4LWHA 3OM3B 4XKAA 3PJSK 4QE9A 1SESA 1SERA 1XL6A 1Y66A 1OSFA 5CF0A 2Z3YA 3INWA 3MNRP 1F4MA 1GM9A 5H9CA 4KTNA 2XNDG 4BXIA 2AHYA 1ROPA 1M1KW 5B3SC 2EIKB 3E89A 2IJJA 2XAFA 2GHYA 4R1FA 3HPLC 2XHXA 4LWGA 3EHGA 3SPCA 1JX9A 2JJ1G 3H01A 3OPDA 1UY6A 4ZVIA 2F43G 2Q8FA 5IYDO 2CH4A 1KIJA 3CD6V 1S76D 4MTGA 1UY8A 1XL4A 3WG7C 2XCMA 1NHJA 3T2SA 2DYRB 4LP0A 3IFXA 1S72V 4QPJA 4MTFA 1YJ9V 2JEUA 2YE5A 1OCCB 2ITDC 1SZTA 1Z5AA 1I5XA 3E35A 4MOTA 1Y4SA 3T0HA 4FPPA 2XJGA 2QFOA 2EIMB 5E1AC 3A0TA 1W0KG 1VQ6V 3D0BA 2QE7G 4HAMA 1YSCA 1N8RW 5H6RA 2IWUA 1JVMA 1BMFG 2HG5C 3LDCA 2FWZA 2YK9A 4MVRA 4XCJA 5D7DA 2NLJC 3IGAC 4KQVA 1S16A 3GWOA 5H6QA 3ABUA 2YJXA 1QBZA 1KECA 4LWIA 4MPEA 4HYOA 2Q68A 3PEJA 1GKZA 3FYEB 3A0RA 1A4HA 4YXWG 1ZWIC 4L90A 1W0JG 4XDMA 1GKXA 4PDLA 3A0XA 2ATKC 1H38A 4XDJA 5L3FA 4PU9A 4MTOA 1FXKA 1Y4MA 2EZOA 4PRVA 3JD2A 1YTFD 1H8HG 3ZKDA 3ZMZA 1UYIA 2IWXA 2LFSA 2MK3A 4RQEA 2CCUA 2EILC 2HKOA 1HWYA 2HCHA 5C93A 4YKYA 1PNKA 1NKDA 3QO7A 2ZKJA 1J95A 2XAGA 1E79G 4H33A 3C11A 3E86A 5L3EA 2YKCA 1K92A 5IY5B 1RM1C 2YE7A 1TUEB 5CBHA 2XX4A 1PNLA 1V54C 3ML0A 2ZDIC 4EEHA 3ABKC 1ZXMA 1QVFU 1PD3A 3VBBA 2XD6A 2BYHA 5IN9A 4YKUA 2OCCB 4UVBA 1P4RA 4GCZA 4UROA 3ZXOA 1OZ0A 4XTJA 1Q86W 3ZRVA 2CCSA 2BREA 4GX2A 1GM8A 3K03A 5CTYA 4FCPA 3AEIA 4MTXA 5LGTA 2VW5A 4B6CA 2BOCC 5M4MA 3EHJA 3CCVV 1OCZC 2YE2A 4BAEA 5L3CA 3R91A 2K1EA 5B1OA 3O6OA 4K4OA 3SYAA 3U67A 5DN6G 3PEHA 5CTUA 2WLKA 5LGNA 2X6CA 2DQ0A 4BQJA 2XDXA 4JF3A 1TILA 5L3BA 4TWKA 1YERA 4URLA 4G2KA 4GX5A 2YKJA 4QPKA 3ZM7A 2ZXWB 2B5UA 3FB7C 3UKMA 3X2QB 2YE8A 3LSSA 3B24A 5EC2C 2C2AA 1VQMV 4P9OA 1K9MW 1BHBA 4QE7A 1M57C 1BXDA 1V55C 1AJQA 3TZ5A 4JQLA 1F51A 3ABMC 1VQ4V 5EK0A 4PDMA 3HYZA 3SPHA 3Q5JA 2WI5A 4MVZA 3QTFA 4RO2A 2IJHA 1UYCA 2DW4A 4U93A 2PI5A 4GX0A 3K97A 2A79B 2YI5A 1I5DA 4YKZA 3T2MA 3EFFK 4WFHA 2WEQA 4PA9A 4E02A 4MP7A 5CPHA 3W7WA 3FT8A 4JYBA 2WWWA 4WFAV 3ZRXA 3OW6A 4L8ZA 2DWEC 4PRXA 2QF6A 3EHBB 1KZNA 3ASOB 3D2RA 4EFTA 3OGCC 1VQ5V 2JJ2G 4OXSA 2BU6A 4Z1MG 2YE3A 2XDSA 1I5CA 3K60A 1Q82W 2WI2A 3HZ1A 3K79A 3R4PA 2XHTA 3OMAB 4UUJC 3ZXQA 1YJNV 2R9IA 4Q20A 2BRCA 1PNMA 5EBMC 4KFGA 4MT8A 3E8GA 2A9HA 3HZ5A 3CCQV 2HG1A 3GIGA 5IDJA 2Y69B 3SPIA 2WLJA 3ZRSA 3AG4C 1QCEA 2VCIA 2DYSC 5GW7A 3ETEA 3EHHA 3ZRWA 3K0DA 2BU8A 1G4YB 1ENVA 4CWPA 3M99B 1K73W 1SRYA 1R3JC 4MSWC 1VQ7V 1I58A 1NBMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8F A;  2CH4 A;  2WI4 A;  2YE6 A;  2GQP A;  5D7R A;  3TK1 A;  1L0O A;  1KIJ A;  2VWC A;  4HY6 A;  2YGE A;  4O05 A;  5CTX A;  3TTZ A;  1UY8 A;  2WI3 A;  4HYM A;  1Y4U A;  5M4P A;  1MU5 A;  2XCM A;  1NHJ A;  3T2S A;  3RKZ A;  4LP0 A;  5F5R A;  1TC0 A;  4QPJ A;  2YEA A;  1ID0 A;  2YK2 A;  4P8O A;  3G7E A;  2LFR A;  2YI0 A;  2YJW A;  2YGA A;  4R3M A;  2BTZ A;  2YE5 A;  4MB9 A;  2YEI A;  2ZBK B;  2CCT A;  2QM8 A;  1Z5A A;  2XK2 A;  3KE6 A;  1Y8N A;  3T1K A;  4BQG A;  1NHH A;  4MOT A;  3GIF A;  1Y4S A;  4KSG A;  2YKI A;  3IED A;  3T0H A;  2IWS A;  4GGL A;  1YT1 A;  2QM7 A;  3NXS A;  4FPP A;  4YKW A;  1YSR A;  5J71 A;  2XJG A;  2QFO A;  1B63 A;  5FNC A;  4ASB A;  3P32 A;  2YI7 A;  3WQ9 A;  4P7A A;  3A0T A;  5D7C A;  4GT1 A;  2P67 A;  4YKR A;  4CWF A;  1YC4 A;  2FYP A;  4FMT A;  3GIG B;  3D0B A;  4HY1 A;  5FND A;  4URN A;  5M4H A;  2XX2 A;  4GEE A;  1UY9 A;  2YEJ A;  3TZ0 A;  1Y8P A;  3VHD A;  4MPN A;  2IWU A;  2O1U A;  2FWZ A;  4HXZ A;  2QG0 A;  2YK9 A;  1YC3 A;  4JAV A;  4ZKI A;  3Q5K A;  4I5S A;  4XCJ A;  5D7D A;  4KQV A;  3ZRW B;  1S16 A;  4H81 A;  5D6P A;  3R92 A;  2YJX A;  4XE2 A;  2JJC A;  5IDM A;  4LWI A;  1YT2 A;  3Q5L A;  4MPE A;  2BT0 A;  2JKI A;  4HZ5 A;  3PEJ A;  2YKE A;  1GKZ A;  3OWD A;  3A0R A;  1UYH A;  1A4H A;  3HEK A;  4MP2 A;  4U7O A;  4AWO A;  1BYQ A;  2WEP A;  3R4O A;  3DGE A;  3GIE A;  4L90 A;  4ASF A;  1QZR A;  3U2D A;  4HXW A;  3A0Y A;  4JAU A;  4XDM A;  1GKX A;  3A0X A;  4I3H A;  4H7Q A;  2BYI A;  3CGY A;  1R62 A;  2FXS A;  3K98 A;  4PU9 A;  1H7S A;  4LC1 A;  1I5A A;  3HYY A;  3T10 A;  4B7P A;  4PRV A;  5F3K A;  3VHC A;  5M4N A;  3FV5 A;  3ZKD A;  4U7N A;  1UYI A;  2K5B A;  2IWX A;  3T0Z A;  2LFS A;  3RLP A;  1AM1 A;  2CCU A;  4CE3 A;  5B1N A;  1QY8 A;  1TID A;  3VAD A;  2HCH A;  3TZ4 A;  1AH6 A;  2XDL A;  5C93 A;  3FT5 A;  4YKY A;  3EKO A;  2WI7 A;  3A0W A;  2ZKJ A;  4JAS A;  4O0B A;  2GFD A;  3CGZ A;  2UWD A;  1TC6 A;  3C11 A;  4EM7 A;  4ASG A;  1I59 A;  1B62 A;  5BOD A;  4O07 A;  2YKC A;  3O2F A;  4XD8 A;  1UYL A;  3G7B A;  1H7U A;  3HHU A;  3H80 A;  2YE7 A;  2XX5 A;  3EHF A;  2XX4 A;  4WUB A;  3RLR A;  5CTW A;  1YS3 A;  2ESA A;  4EEH A;  1ZXM A;  2CGF A;  3NMQ A;  2XD6 A;  2BYH A;  1BKN A;  4XC0 A;  2EXL A;  5IN9 A;  2WI1 A;  4O04 A;  4YKU A;  1AMW A;  4XIR A;  4LPB A;  4GCZ A;  4URO A;  3ZXO A;  4CE2 A;  4XTJ A;  4X9L A;  3ZRV A;  2CCS A;  5GGZ A;  1IXM A;  4CWR A;  2H8M A;  2QG2 A;  1AH8 A;  2BRE A;  4NH9 A;  4E00 A;  5L3J A;  4KSH A;  4O09 A;  3B28 A;  2XAB A;  4EGH A;  5FWK A;  5CTY A;  4XIT A;  4FCP A;  2BU5 A;  2YE9 A;  4MTX A;  2AKP A;  2VW5 A;  2XJJ A;  2YEF A;  3O0I A;  3TZ2 A;  4B6C A;  2XJX A;  5M4M A;  3EHJ A;  4ASA A;  4LWE A;  2YE2 A;  4V25 A;  4BAE A;  2YEH A;  2FTK A;  3R91 A;  5B1O A;  3O6O A;  4K4O A;  3CRK A;  3BM9 A;  3LNU A;  2FWY A;  3C0E A;  3U67 A;  2IOQ A;  3PEH A;  5CTU A;  4XIP A;  2YI6 A;  3R4M A;  4W7T A;  4FCQ A;  1THN A;  4PL9 A;  2YEC A;  4HYP A;  2YGF A;  4BQJ A;  2XDX A;  1YC1 A;  1TH8 A;  1TIL A;  2H55 A;  1TBW A;  1YER A;  4XCL A;  4HZ0 A;  1QYE A;  1YSZ A;  4URL A;  2YKJ A;  4QPK A;  4YKT A;  3ZM7 A;  3B26 A;  2IOR A;  2YE8 A;  3MD0 A;  1Y8O A;  2E0A A;  3B24 A;  1BGQ A;  2XHR A;  1EA6 A;  2C2A A;  4MBC A;  5M4K A;  2WER A;  3QDD A;  3K99 A;  3TUH A;  2Q8G A;  4NH8 A;  3B25 A;  3B27 A;  1ZWH A;  2Q8I A;  4URM A;  1BXD A;  2Q2E B;  3TZ5 A;  4JQL A;  3ZCC A;  4XIQ A;  1F51 A;  5J6A A;  4EMV A;  5FNF A;  3HYZ A;  3G75 A;  4GFN A;  4R3A A;  3Q5J A;  4XKO A;  2WI5 A;  4AWP A;  1U0Z A;  3QTF A;  1Z5C A;  1UYC A;  4GQT A;  1PVG A;  3OMU A;  4U93 A;  1ZW9 A;  5BOC A;  4KP4 A;  3CRL A;  2YI5 A;  3K97 A;  3BMY A;  2YEE A;  1I5D A;  4YKZ A;  1YES A;  3SL2 A;  4AWQ A;  2Q8H A;  1MX0 A;  2O1W A;  2WEQ A;  4CE1 A;  1Z59 A;  4YKQ A;  1UYK A;  4E02 A;  4MP7 A;  5CPH A;  2IOP A;  4XKK A;  3D36 A;  4L93 A;  3VHA A;  4GT8 A;  3FT8 A;  4JYB A;  2WWW A;  4EFU A;  2ZDX A;  3ZRX A;  3OW6 A;  1JM6 A;  3H4L A;  1S14 A;  4L8Z A;  4PRX A;  4L91 A;  2QF6 A;  4BIU A;  2HKJ A;  3U2K A;  1UYM A;  3EKR A;  1AJ6 A;  1KZN A;  1EI1 A;  1UY7 A;  1UYD A;  2PNR A;  3D2R A;  1YT0 A;  2BU7 A;  1JOY A;  2XDK A;  4NH7 A;  4EFT A;  1NHI A;  4CWN A;  4YKX A;  2YEB A;  4EGK A;  1UYE A;  4CWQ A;  5M4E A;  2BSM A;  2BU6 A;  1GJV A;  4JYC A;  2YE3 A;  5D6Q A;  2XDS A;  1I5C A;  2YKB A;  1I5B A;  3A0Z A;  2CG9 A;  3K60 A;  4LWH A;  2YEG A;  3INX A;  2WI2 A;  3HZ1 A;  2BZ5 A;  3JZ3 A;  1U2O A;  4XKA A;  3R4P A;  2XHT A;  3R4N A;  3ZKB A;  3ZXQ A;  2XDU A;  1YET A;  4Q20 A;  4CWS A;  2O1V A;  3WHA A;  2BRC A;  4FCR A;  4AS9 A;  1OSF A;  5CF0 A;  4EGI A;  4KFG A;  4MT8 A;  4LWF A;  3INW A;  3HZ5 A;  3MNR P;  4V26 A;  3RLQ A;  4KTN A;  3GIG A;  2HG1 A;  5IDJ A;  2ZDY A;  4BXI A;  4WUC A;  1B3Q A;  4DZY A;  4L94 A;  3LPS A;  4WUD A;  1US7 A;  4CWO A;  2VCI A;  2YED A;  3CWV A;  3EHH A;  2BU2 A;  4R1F A;  3ZRW A;  1UYG A;  2XHX A;  4LWG A;  2BU8 A;  3EHG A;  4CWT A;  4H85 A;  3OWB A;  1UYF A;  4DUH A;  2YE4 A;  4BIZ A;  4CWP A;  3OPD A;  1UY6 A;  4ZVI A;  2VCJ A;  1Z5B A;  4MPC A;  2WI6 A;  1I58 A;  1ZXN A;  4E01 A; 
#chains in the Genus database with same CATH topology
 1VEW A;  1E1R G;  1WA8 B;  4J7K A;  2WI4 A;  5K1P A;  5D7R A;  3TK1 A;  1XMQ O;  1L0O A;  2WLL B;  1S0V A;  1I08 A;  1EFR G;  1L0N H;  2V4D A;  1WJZ A;  3STZ C;  4HY6 A;  1FAF A;  2YGE A;  2QR4 A;  4HYM A;  1Y4U A;  3B09 A;  5M4P A;  1VF6 A;  1IBK B;  4FM2 A;  3TXS A;  2HJD A;  2W0X A;  1VMG A;  3CCE V;  2A06 H;  3JAS B;  2EIN C;  5KLV H;  4LH7 A;  3AG3 C;  1TC0 A;  1I94 O;  4I0X A;  2YEA A;  3P30 A;  1YTF B;  1ID0 A;  2YK2 A;  4PI2 A;  2EIM C;  1U97 A;  2QKC A;  4R3M A;  5B1A C;  5B1B B;  2IU3 A;  3TET A;  2YEI A;  3F7V C;  2FB5 A;  2YEV A;  1YHQ V;  3CCU V;  2XK2 A;  3KE6 A;  1Y8N A;  4K8Z A;  1S77 D;  5KHH A;  1B04 A;  4DUY B;  4YJ2 B;  3GIF A;  2DJV A;  3MDS A;  4KSG A;  1R6T A;  2YKI A;  3VQY A;  1QR9 A;  4GGL A;  3LNM B;  1NH2 B;  3NXS A;  5F2V O;  5JCO C;  1YSR A;  5J71 A;  1B63 A;  5FNC A;  3ZJZ A;  4O2B B;  2OT5 A;  1M56 B;  3ZX6 A;  3G67 A;  2ETN A;  1QLE B;  5DED A;  1FJG B;  4FFB B;  3RBZ A;  4GT1 A;  4YKR A;  1IBL B;  1FXH A;  4L87 A;  1GN6 A;  4HY1 A;  2OIE A;  5FND A;  3ZMU A;  4O4H A;  3CRR A;  1VQ8 V;  2LW7 A;  3TZ0 A;  2V1D A;  1Y8P A;  3VHD A;  4MPN A;  4TSF G;  2D2C B;  4K0K B;  2QG0 A;  1VQK V;  3Q5K A;  4JZ2 A;  4X66 B;  2X6B A;  4FLV A;  2WA4 A;  1SQB H;  2CGO A;  3SPG A;  3UM7 A;  2HP8 A;  4B3M B;  2GUZ A;  3BRC A;  4H81 A;  2YI8 A;  5D6P A;  1TVK B;  1J5E B;  4XE2 A;  5IDM A;  2UXX A;  2LP7 A;  2ZDI A;  1KUQ A;  4CH4 A;  1H2N A;  4FFK A;  3OWD A;  3HEK A;  5LL6 Y;  2BE3 A;  1KU9 A;  4DV5 B;  3E8B A;  5JH7 A;  4ABM A;  3E83 A;  3A0Y A;  1IDS A;  3Q4H A;  3STL C;  1LUV A;  4ZI7 A;  4O4L A;  4W4L A;  3SPJ A;  3AG1 B;  1S5J A;  2BYI A;  3CGY A;  1R62 A;  1PV0 A;  1H7S A;  2PTM A;  1YIT V;  4LC1 A;  3JAL B;  4B7P A;  1GMG A;  4DR4 B;  2IBZ H;  3UT5 B;  5F3K A;  3QO5 A;  5M4N A;  1H2L A;  1PM9 A;  2EIJ B;  4DW1 A;  1NR1 A;  1QY8 A;  1TID A;  4WF9 V;  1WP8 A;  2NNU A;  1AH6 A;  3ETQ A;  4DV6 B;  2XDL A;  3FT5 A;  3KCY A;  1SQV H;  2HVJ C;  1QVG U;  5IE9 A;  1MG1 A;  4GLX A;  1M9N A;  4Q6G A;  3RYC B;  1TC6 A;  4ZOL A;  3ZIA G;  3ZHR A;  1R73 A;  3U0Z A;  2XAJ A;  1I59 A;  4ASG A;  1B62 A;  4TUY B;  5BOD A;  5C8Y A;  5IJ9 A;  4IL6 Z;  5LXT B;  3G7B A;  2O57 A;  4DV2 B;  1BHA A;  1N33 O;  2JIZ G;  1FPO A;  2H3O A;  3JAK B;  4WUB A;  1YS3 A;  2ESA A;  3NMQ A;  1NVP D;  4K8X A;  4O4J A;  5J2U A;  1BKN A;  3SYQ A;  2Q0O C;  4LFC O;  1AMW A;  3U10 A;  2JEX A;  2F23 A;  3JAT A;  2XAH A;  4CE2 A;  2QWO B;  1R1B A;  1OCO B;  3P3P A;  1GKF A;  3LSQ A;  3A2F A;  2BSK B;  3B28 A;  3FKS G;  5CB4 A;  5J9P C;  2XAB A;  4EGH A;  4NKG B;  1VIB A;  3W7X A;  2JGD A;  3JCU Z;  4B3R B;  1BSM A;  2YEF A;  3K04 A;  5JVD B;  3O0I A;  2ILM A;  2XJX A;  2Z0A A;  4DYL A;  4NXM O;  3CCJ V;  4YHH B;  2W6J G;  4LWE A;  3ABL B;  2ZR3 A;  3ASN B;  2VQE B;  3N2G B;  4JI8 B;  1FFX B;  2YEH A;  1HNZ O;  4J9Z B;  2ZE6 A;  5BR8 O;  1VF6 C;  1W2B U;  3X2Q C;  3ZHT A;  3LNU A;  1NS1 A;  3C0E A;  2IOQ A;  1S5L Z;  4PHZ A;  2YI6 A;  3R4M A;  4FCQ A;  4PL9 A;  2YEC A;  3CCS V;  3RYH B;  3VQX A;  5EYP A;  2GSM B;  2WLN A;  2JVD A;  1TH8 A;  3RVY A;  4X1I B;  3SYO A;  2CTW A;  1ZSP A;  4B3T O;  1TBW A;  4XCL A;  1NJI W;  4X62 O;  4JPR A;  4YKT A;  3B4S A;  1R3L C;  1Y74 A;  3CC7 V;  1K4D C;  2CK3 G;  2E0A A;  4JI6 B;  5LOV A;  1BGQ A;  5CA0 B;  3WB0 A;  3OFN G;  3SYC A;  5M4K A;  1K3E A;  4JGS A;  3K5O A;  1R6K A;  1ZWH A;  2Q8I A;  4URM A;  1UFI A;  1BGY H;  3ZMS A;  3RN4 A;  4X8A A;  4QGP A;  5L3G A;  5LBQ A;  5LA6 B;  4XIQ A;  1NT2 B;  3FB8 C;  1RFY A;  3ZN1 A;  3UO3 A;  1B6Q A;  2B9Z A;  2YXY A;  2EZP A;  1U0Z A;  4R8C A;  1YDX A;  3CJH A;  4DUZ O;  3HKC B;  1PVG A;  5LMU B;  1ZW9 A;  3B8N A;  3P3N A;  4YY3 O;  4JI7 O;  4KP4 A;  1DF4 A;  3CRL A;  1OCR C;  4LWS A;  4DRX A;  1S5H C;  4LBE C;  4X1Y A;  4WBN A;  1SET A;  1SQP H;  4BAY A;  1BZK A;  3LDE A;  1MX0 A;  3ASO C;  3OR6 C;  1H2G A;  2O1W A;  1BQ0 A;  3J81 N;  1Z59 A;  4YKQ A;  2IW5 A;  5JQG B;  3E8F A;  2Q73 A;  3CYG A;  4DR7 B;  2IOP A;  1Y76 A;  1JQ0 A;  4JI5 O;  3D36 A;  2Y0P A;  3CS5 A;  3VHA A;  1FD9 A;  5FPR A;  4EFU A;  3E22 B;  5IYC O;  4DV0 O;  2OTJ V;  2WLI B;  4BIU A;  4EFE A;  2HKJ A;  3HR0 A;  3WG7 B;  3H9V A;  4NVP A;  3ZMV A;  3RVZ A;  1HR0 O;  1NHI A;  1JA8 A;  4YKX A;  2YEB A;  2P6J A;  2UUC B;  4CWQ A;  2M7W A;  5BY1 A;  2YKB A;  1YZB A;  3F7Y C;  4TOI A;  1I7F A;  2YEG A;  5LYJ A;  1N34 O;  2ARH A;  3DXR B;  3I55 V;  1U2O A;  3D8C A;  5LGU A;  4X20 B;  1Q3E A;  3R4N A;  4NXN B;  2XDU A;  3JD4 A;  4CWS A;  1XBL A;  2X0L A;  4UVC A;  3WHA A;  4FCR A;  1JR9 A;  4AS9 A;  5DM6 V;  4TT3 G;  4LF5 B;  4LWF A;  4V26 A;  2H8P C;  2XTA A;  3LSU A;  1VP7 A;  1AI4 A;  2ZDY A;  3K9S A;  1B3Q A;  4WUC A;  1VQL V;  4DZY A;  3F5W C;  2GDS A;  4EB6 A;  2GTA A;  4PA6 A;  3CC4 V;  3LPS A;  1US7 A;  4CWO A;  3AG2 B;  2UXC B;  2B1I A;  3CMA V;  3CWV A;  1ZUQ A;  3HKB A;  2BU2 A;  1CEZ A;  3JD1 A;  3CP1 A;  5HFM A;  3OE7 G;  5GTI Z;  4CWT A;  4ZBM A;  1KYO F;  5KAI Z;  1VQ9 V;  1G1X B;  1WLE A;  3OWB A;  1UYF A;  4DUH A;  1XOU A;  2CTQ A;  4BIZ A;  3BA9 A;  4PA3 A;  3K5L A;  1ZTE A;  3GWK C;  2VCJ A;  3G6E V;  3N2K B;  4MPC A;  2WI6 A;  3L71 H;  5EC1 C;  4R6Z A;  1ZXN A;  4E01 A;  5CN0 A;  1BL8 A;  3K06 A;  5AG2 A;  4P9P A;  4UV9 A;  2D3O W;  4DV1 O;  3J80 N;  2VWC A;  4LP8 A;  5CTX A;  4AQY B;  2WI3 A;  3K5N A;  1MOF A;  1QR8 A;  1MU5 A;  2HR3 A;  3RKZ A;  1NI8 A;  4FLY A;  3L73 H;  3CCL V;  3B77 A;  2EBO A;  4UV8 A;  4LFA B;  3OUF A;  4YJ3 A;  4GX1 A;  1GN4 A;  1M5I A;  4X1K A;  3CCR V;  1RSO B;  4DW0 A;  1K5Q A;  4P8O A;  1HW7 A;  4LF9 O;  5IYZ B;  2YI0 A;  2YJW A;  2YGA A;  4KL1 A;  4MB9 A;  3ZBH A;  5FLX N;  2ODM A;  2QM8 A;  1HNW B;  4KHP B;  1YI2 V;  1DGS A;  4TV8 A;  3K0G A;  2EIL B;  2F93 B;  4BQG A;  3ETD A;  1NHH A;  5KUM A;  2E3C A;  3K9A A;  1XHZ A;  2UUA B;  4JI2 B;  2IWS A;  4G27 B;  3OEH G;  4X89 A;  3SJC C;  1EZJ A;  4B08 A;  4LF8 B;  4XDL A;  2G38 A;  1XNQ B;  2BTQ A;  2DWD C;  3C90 A;  3P32 A;  4ASB A;  2IH1 C;  4Z2W A;  1COW G;  3WQ9 A;  3CE2 A;  2F4V B;  4P7A A;  4PA7 A;  2Q9L A;  5D7C A;  1CP9 A;  1VAR A;  1G8M A;  3B2E E;  2P67 A;  4CWF A;  2FYP A;  3JAR A;  5LP6 A;  4R50 A;  1NVP B;  5K1X A;  2EIK C;  3TXQ A;  3T1Y B;  2XX2 A;  4X65 B;  1V54 B;  4FK5 C;  2YEJ A;  2ITC C;  3ABK B;  4BIO A;  3D3I A;  3ETG A;  4CZZ A;  2O1U A;  4JYA O;  4O2A A;  4JAV A;  4ZKI A;  3SGI A;  4I5S A;  1XQ8 A;  3G71 V;  4EFB A;  3JD0 A;  3CHX A;  4RUF A;  1U96 A;  4LF7 B;  2ZR2 A;  3R92 A;  2JJC A;  1TA8 A;  4NTX A;  4KFM A;  2ZIN A;  4X88 A;  2IU0 A;  1YT2 A;  3HKD A;  2BT0 A;  2WSS G;  2JKI A;  1IBK O;  2YKE A;  2QEX V;  2HFE C;  2Y4U A;  1UYH A;  1KMI Z;  3D36 C;  1N0J A;  1Y6X A;  1AR5 A;  4U7O A;  3CEI A;  4AWO A;  4JI0 O;  3A0H Z;  5CA1 A;  2L35 A;  1JJO A;  1BYQ A;  1TUB B;  3DGE A;  1EN4 A;  2WEP A;  3R4O A;  2EIJ C;  1QZR A;  1OCZ B;  4ASF A;  2Y4T A;  3OR7 C;  3U2D A;  4JAU A;  1GK9 A;  1WB7 A;  2PGG A;  1FKA O;  2DYR C;  4GKK O;  4I3H A;  4U3F H;  1BCC H;  4H7Q A;  2ZE5 A;  4JZG A;  3T1C A;  1IBM B;  2QA4 V;  3CXC U;  2FXS A;  3K98 A;  1SQG A;  3K5M A;  2Q6A A;  1F4N A;  5IT9 N;  4B3S B;  1LR1 A;  3DC5 A;  1I5A A;  1VQN V;  3HYY A;  3T10 A;  2HHH O;  2Q67 A;  4I50 B;  5EBW C;  3D3Q A;  1Q90 D;  1OCC C;  1P84 F;  3CRC A;  2K5B A;  4FLU A;  3W7S A;  1KKC A;  3OAA G;  1AM1 A;  2IJI A;  5EZY B;  4I55 B;  4CE3 A;  2JRI A;  1R6N A;  2EUL A;  2PYL A;  1N4C A;  1FFT B;  3K3W A;  3VAD A;  3TZ4 A;  1EBO A;  4LF6 O;  1K97 A;  2WA3 A;  3EKO A;  2WI7 A;  4LR3 A;  4MVO A;  4I9W A;  3A0W A;  2A3Q A;  4O0B A;  4GKJ O;  2Y0I A;  3TJT A;  2LW1 A;  3BAA A;  3IAY A;  2UWD A;  3CGZ A;  1BS3 A;  5KMG B;  3JAW A;  1AVM A;  3EVK A;  1V55 B;  4MW3 A;  3S3X A;  4BW9 A;  1P7G A;  4MW8 A;  1AI7 A;  4DK0 A;  1Q7Y W;  3S5T A;  1PPJ H;  1VF5 B;  3ABM B;  5FNV B;  4I4T A;  4UB8 Z;  3HHU A;  3H80 A;  2JK5 C;  2Q69 A;  4D6T H;  3EHF A;  2E5L B;  4DR5 B;  3RLR A;  1R3I C;  3HKE B;  4UCU A;  5LHI A;  3RW0 A;  5IJ0 A;  3BFR A;  2CGF A;  3H1L H;  4DXW A;  4U3J A;  3H1I H;  5IWA O;  2ZM6 B;  4XC0 A;  2UUB B;  2EXL A;  1JJ2 U;  4PD4 F;  2WI1 A;  4WFB V;  1E1Q G;  1HNX O;  2OIG A;  3RT3 C;  4XIR A;  1M90 W;  4LPB A;  3G4S V;  3ABL C;  2CH7 B;  3ASN C;  4R7C A;  3APQ A;  1K4C C;  5GGZ A;  2R72 A;  1S3J A;  4O4I A;  2H8M A;  3BEH A;  4P30 A;  1RPO A;  4E00 A;  5L3J A;  4KSH A;  4MVQ A;  4O09 A;  3FB5 C;  4HZ3 A;  5J2T A;  2UXD O;  1ZLZ A;  5FWK A;  1XEQ A;  1KC8 W;  3RYF A;  2BU5 A;  2XUM A;  4WFF A;  3CB2 A;  4CS2 A;  3CC2 V;  2YE9 A;  3IJ4 A;  3TZ2 A;  4ZIB A;  2QDO A;  2P4K A;  3OTO O;  3BPZ A;  2P4V A;  2YI9 A;  1AI6 A;  1ZL8 B;  2DQ3 A;  3CWB H;  3LDD A;  5LHH A;  3BM9 A;  2N05 A;  2FWY A;  3L75 H;  4GZR B;  3E2E A;  4W7T A;  2YDE A;  3WFV A;  1THN A;  3OW2 U;  4HYP A;  4OX9 O;  1MNG A;  4IIJ B;  4YIP A;  1YC1 A;  5GON B;  5HFL A;  1I5Y A;  1FXK B;  2A0L A;  2CGN A;  2Q8V A;  4DR1 O;  2DE0 X;  4RAI A;  3TCU A;  1N0N A;  1D5A A;  3RYI B;  1QYE A;  1YSZ A;  1NZ6 A;  1XMO O;  2EJR A;  4AIL C;  3B8M A;  1Q81 W;  4MVM A;  1L0L H;  1AJP A;  3K08 A;  4EKW A;  1KP2 A;  2XHB A;  4MBC A;  4E2L A;  2WER A;  3K99 A;  4LF4 O;  4DV2 O;  1UJW B;  3B25 A;  4K35 A;  2QTS A;  3QO8 A;  2Q2E B;  5ITZ A;  1Q43 A;  4PA4 A;  3ZCC A;  1ZX3 A;  4JI4 B;  1TGO A;  5IY5 C;  1FXV A;  4ZHQ B;  5A9G A;  4R3A A;  5LP6 C;  4AWP A;  3AG4 B;  3G80 A;  3T1H B;  4LNU B;  3JYC A;  1V9P A;  2DYS B;  2QWQ B;  1B06 A;  3OMU A;  3L70 H;  2V7Q G;  5BOC A;  1N36 O;  2KG7 A;  2P22 C;  3BMY A;  2OCC C;  4HNA A;  2UU9 O;  3NR7 A;  4PV1 B;  4JV5 O;  2LO1 A;  4AWQ A;  4DV7 O;  2B1G A;  5KA5 A;  3UQ8 A;  4CE1 A;  1UYK A;  1WA8 A;  1EN5 A;  1H2S B;  4UCS A;  2OCH A;  2OYQ A;  4XKK A;  3FFQ A;  2WLL A;  4L93 A;  2VQE O;  2ZDX A;  3M8A A;  5CA3 A;  3H4L A;  4L91 A;  2E76 B;  1XNR B;  2CTR A;  2X6A A;  1R3K C;  3JAS A;  2YSU B;  4DV4 O;  3CYO A;  2AGA A;  5KHJ A;  1EI1 A;  4XBF A;  1WN7 A;  3JSL A;  5KA6 A;  1TAE A;  2EIN B;  1UYD A;  2PNR A;  3AG3 B;  3ZMT A;  3KCX A;  2VQF B;  1JOY A;  1YT0 A;  2BU7 A;  1WPB A;  4NH7 A;  2BOB C;  5CBG A;  2PI4 A;  4J41 A;  3THO A;  4CWN A;  5B1A B;  4TQD A;  1FS0 G;  1UYE A;  5M4E A;  2BSM A;  4ASU G;  5D6Q A;  1K34 A;  3A0B Z;  4RWU A;  1DTO A;  1HP8 A;  3BY6 A;  3IC7 A;  1I5B A;  2CG9 A;  3A0Z A;  3MHH C;  4YJ2 A;  3INX A;  3CRA A;  2BZ5 A;  2QSA A;  1VQP V;  3JZ3 A;  3DSQ A;  2PZS A;  3ABT A;  4FJC C;  2ZXW C;  3UCS C;  4F4L A;  1H2M A;  2AHZ A;  3OMI B;  3ZKB A;  1YET A;  3T4D A;  1QNM A;  3AG2 C;  3QVN A;  4O2B A;  2O1V A;  2HEP A;  1F23 A;  3DC6 A;  4G28 B;  1ORQ C;  2Q7G A;  2Q4P A;  3OUS A;  4PEL A;  4EGI A;  1O9G A;  4F6R B;  1N33 B;  4FFB A;  1AI5 A;  5LHG A;  5KX5 B;  1YIJ V;  3RLQ A;  2H94 A;  4L94 A;  3H1H H;  4LFC B;  1YCI A;  2MW2 B;  1AR4 A;  4UXN A;  4TV9 B;  4WUD A;  4J42 A;  4XDK A;  1H8E G;  2QKS A;  1RPR A;  5H2F Z;  2YED A;  1UYG A;  3QTC A;  3QNE A;  1WB8 A;  4DR7 O;  2IH3 C;  1SF9 A;  3ZHS A;  4H85 A;  1TVK A;  4WFG A;  2YE4 A;  5KHI A;  4B7K A;  1Z5B A;  2RDC A;  5BXZ A;  2KSD A;  5B3S B;  4NXM B;  3JSN A;  1KQS U;  3J7A U;  2YE6 A;  2GQP A;  1HNZ B;  5L3D A;  5BR8 B;  2C1I A;  1QHT A;  4RQF A;  1JFF B;  1YF2 A;  1K33 A;  5H5N A;  1IVS A;  4O05 A;  3TTZ A;  2ZKO A;  4PJ0 Z;  1SA0 B;  2P06 A;  1WNS A;  1MAB G;  2ZCE A;  3R65 A;  5F5R A;  2QWP B;  3SJA C;  2YXL A;  3W7U A;  3L74 H;  1W59 A;  3JAL A;  4X62 B;  2CDY A;  2ZQM A;  3KKY A;  2PY5 A;  3G7E A;  2LFR A;  3UT5 A;  4FIP C;  1KB9 F;  2BTZ A;  1GAX A;  1NH2 D;  3FX7 A;  2Q0A A;  4N23 A;  2ZBK B;  4NXN O;  2CCT A;  3I5D A;  3VOU A;  3T1K A;  3ZN0 A;  1EZV H;  1GO3 F;  3BA8 A;  3IED A;  5BMV B;  2X7R B;  2QWN B;  3RYC A;  2QM7 A;  1YT1 A;  4B7E A;  2CE4 A;  4YKW A;  1QLN A;  4H0L B;  2YC0 A;  3OEE G;  4QNH B;  4TUY A;  2Q7H A;  2YI7 A;  4IHJ B;  3QG5 A;  5LXT A;  4DUZ B;  4JTD B;  1K5S A;  5FPO A;  1YC4 A;  4F6E A;  2RNB A;  2Y69 C;  4FMT A;  3GIG B;  2RMK B;  3JAK A;  4URN A;  2KKW A;  4MS2 A;  5LMN O;  1VQO V;  2P5O A;  5M4H A;  3FAV B;  4LFB O;  4GEE A;  1UY9 A;  3CME V;  1WPX A;  1DLB A;  4BW5 A;  1JCH A;  1Q6I A;  3DTU B;  1XUQ A;  4HXZ A;  4DR3 O;  2Y48 A;  1YC3 A;  1IX9 A;  2DN9 A;  4JI5 B;  1LUW A;  1CPY A;  4MVU A;  3ZRW B;  2LGQ A;  4NR1 A;  4JI3 O;  2HJF C;  2WLM A;  2JS5 A;  2WAM A;  2BSK A;  1SC5 B;  4DV0 B;  4BR6 A;  2RQ6 A;  4LCU C;  3UO2 A;  3Q5L A;  2AZ0 A;  2JDI G;  2VRZ A;  4D7T A;  4JI1 O;  3LMM A;  4HZ5 A;  1IZ3 A;  3HB3 B;  5JVD A;  2P90 A;  2K9P A;  3OMN B;  4MP2 A;  2QM4 A;  2HLD G;  4WCE V;  2PYJ A;  3N2G A;  3GIE A;  1FFX A;  2UXB O;  3SJB C;  3GB7 C;  4HXW A;  1AJN A;  4PDR A;  3U11 A;  1MSD A;  3N27 A;  3FD9 A;  4H13 B;  1MSW D;  1BQZ A;  2CAZ C;  1N34 B;  3RYH A;  2ZD9 A;  4PDV A;  4I0X B;  1MA1 A;  2ADQ B;  4DO2 A;  3BAB A;  4X1I A;  2A7W A;  4CBC A;  3A8T A;  2L6L A;  5B1B C;  2VWK A;  3VHC A;  3E8H A;  4X64 O;  2F1M A;  4ICG A;  4KUM A;  3FV5 A;  1Q6U A;  4U7N A;  3CCM V;  3T0Z A;  3RLP A;  2YEV B;  5B1N A;  1AIL A;  5CA0 A;  1L8D A;  1Q6H A;  2F4V O;  4JAS A;  2GFD A;  1GM7 A;  2W6I G;  3G6B A;  1M56 C;  4MVS A;  5LA6 A;  3SR2 C;  4EM7 A;  1QLE C;  2UXN A;  2CUG A;  4I9Q A;  4RUE A;  4O07 A;  1SS3 A;  3O2F A;  1N32 B;  2R9R B;  4XD8 A;  1UYL A;  1AP6 A;  1H7U A;  1P49 A;  1K8A W;  2XX5 A;  4HBN A;  5JJJ B;  3HKC A;  4O4H B;  5CTW A;  3JD3 A;  3FYI B;  2P7T C;  4E72 A;  4O04 A;  1OCR B;  3AK2 A;  4QIW F;  3KG2 A;  5JQG A;  5IYB O;  1JPX A;  4DV1 B;  4X9L A;  1RM1 B;  1NBM G;  1IXM A;  1Z5W A;  4CWR A;  2GUZ B;  1K7D A;  2QG2 A;  4OGQ B;  1AH8 A;  4DR2 O;  3TGU H;  1ARO P;  4NH9 A;  1WAZ A;  3LUT B;  3BCC H;  3E22 A;  2BCC H;  2RCV A;  4XIT A;  2WLI A;  2AKP A;  2XJJ A;  1FXK C;  2YIC A;  1I0H A;  3W7T A;  1IBM O;  2RJZ A;  4H37 A;  2WPD G;  4LF9 B;  4ASA A;  4QJF B;  4V25 A;  5GTH Z;  3RFR A;  1G6U A;  3SJQ C;  1GN3 A;  2Q7E A;  1Z2G A;  1DF5 A;  2W0F C;  2FTK A;  2QTO A;  2XAS A;  5JH7 B;  5FL7 G;  4J7Z A;  1MZF A;  3CRK A;  3AG1 C;  3Q4H B;  4ZI7 B;  4NTY A;  4O4L B;  2YIB A;  3MHS C;  4XIP A;  4K3A A;  4IYI A;  4UFZ A;  2QGN A;  1KKD A;  2YGF A;  4E4E A;  1QU7 A;  2LJ2 A;  2H55 A;  3DXR A;  3H1J H;  2Z5U A;  1NTZ H;  4UVA A;  4JYY A;  4HZ0 A;  4X20 A;  1GTO A;  4LH6 A;  1PL0 A;  2WLH A;  1PKX A;  4EEQ A;  3B26 A;  4FVM A;  1NTM H;  2IOR A;  1SQX H;  4J9Y B;  3MD0 A;  1Y8O A;  5JEN A;  4DV3 B;  2XHR A;  1EA6 A;  5EBL C;  1OHH G;  4IYH A;  2FYU H;  5JJN B;  4JTA B;  3QDD A;  1P7B A;  3TUH A;  3I56 V;  4DUY O;  3JCZ A;  2Q8G A;  4NH8 A;  3B27 A;  5DEC A;  4ZOL B;  1SKV A;  5KHK A;  1THZ A;  4FLX A;  4N21 A;  3S3W A;  5J6A A;  1KD1 W;  4EMV A;  4JYA B;  4JTC B;  5FNF A;  4DR6 B;  3G75 A;  5C8Y B;  4GFN A;  5IJ9 B;  4XKO A;  1NR7 A;  1Z5C A;  5B5E Z;  1FJG O;  4UCR A;  4GQT A;  4IGG A;  1AR1 B;  1IBL O;  3FB6 C;  1H2K A;  1BE3 H;  4WFE A;  1URF A;  4O4J B;  1M57 B;  2YEE A;  5J2U B;  1NQT A;  1YES A;  3VQW A;  1OJH A;  3RWR D;  3CPW U;  1A32 A;  3N2K A;  3T4Z A;  2IJK A;  2Q8H A;  2Q5Z A;  3SL2 A;  4YIO A;  5KUK A;  1OCO C;  3JAT B;  4K0K O;  1YJW V;  3APO A;  4JI0 B;  1Z5V A;  4PI0 A;  2ZNJ A;  5BZB A;  3CRM A;  4X66 O;  4CS3 A;  2DOS A;  1D5N A;  4GKK B;  4B3M O;  2XOK G;  4GT8 A;  5CB4 B;  2PF4 E;  5A2Q N;  1BT8 A;  1HDJ A;  2ZIO A;  1J5E O;  3PN1 A;  1GN2 A;  1JM6 A;  2JGD B;  1S14 A;  1KP3 A;  5CMU A;  2XAQ A;  3SYP A;  3U2K A;  2YIB D;  1UYM A;  1GH6 A;  2KQX A;  3EKR A;  1NTK H;  1XMQ B;  1AJ6 A;  5CBF A;  1LNQ A;  2OTL V;  1L1F A;  2N74 A;  2HHH B;  4UCT A;  1RSO A;  1F7Y A;  1UY7 A;  1O9H A;  5IYZ A;  2XDK A;  3ZHU A;  4L8J A;  4DV5 O;  4NTW A;  4UCV A;  3MAQ A;  4A5U B;  3VQV A;  4EGK A;  1VF7 A;  2KB1 A;  4LF6 B;  2LGW A;  1GJV A;  4JYC A;  2ZE8 A;  3H1K H;  1I94 B;  4P2Z A;  4W4K A;  4FLT A;  4LWH A;  5EYP B;  3OM3 B;  4GKJ B;  3K59 A;  4XKA A;  4FZ1 A;  4DR4 O;  3PJS K;  4QE9 A;  1SES A;  1SER A;  1Y74 B;  1XL6 A;  2OWO A;  1Y66 A;  2QKA A;  1MZE A;  4JI4 O;  5LOV B;  1OSF A;  5CF0 A;  2Z3Y A;  2NR5 A;  3OGI B;  3INW A;  3MNR P;  1F4M A;  1GM9 A;  5H9C A;  1QQC A;  4KTN A;  4DV6 O;  2XND G;  3T1H O;  4NB5 A;  4BXI A;  5KHG A;  2AHY A;  5IWA B;  1ROP A;  1M1K W;  5B3S C;  2EIK B;  1HNX B;  3E89 A;  1NU1 H;  1EM1 A;  2IJJ A;  4CH3 A;  2XAF A;  2GHY A;  4R1F A;  1XI1 A;  3CJH B;  3HPL C;  2XHX A;  4LWG A;  3ZED A;  3EHG A;  3SPC A;  1JX9 A;  2UXD B;  2JJ1 G;  4LWS B;  4DRX B;  3H01 A;  4X1Y B;  4WBN B;  3OPD A;  1UY6 A;  2JS3 A;  4ZVI A;  2F43 G;  4GYC B;  3CX5 F;  3O65 A;  3OTF A;  3OTO B;  2Q8F A;  5IYD O;  2CH4 A;  1XNR O;  1Y76 B;  1KIJ A;  3CD6 V;  1S76 D;  2NN4 A;  3JAM N;  1TUB A;  5JJE B;  2VQF O;  4MTG A;  1UY8 A;  4Z1V A;  1XL4 A;  2GBO A;  3WG7 C;  4OX9 B;  2XCM A;  1NHJ A;  3T2S A;  2DYR B;  4LP0 A;  4DR1 B;  2E74 B;  3IFX A;  4B3R O;  1S72 V;  1PP9 H;  4QPJ A;  4MTF A;  4YHH O;  4I50 A;  1YJ9 V;  1XMO B;  2LQT A;  2JEU A;  4JI8 O;  2YE5 A;  1OCC B;  1XHX A;  2ITD C;  1SZT A;  5EZY A;  4I55 A;  1Z5A A;  1EN6 A;  2QWR B;  1I5X A;  3E35 A;  4LF4 B;  4MOT A;  2YS8 A;  5LYJ B;  1Y4S A;  1CXZ B;  3T0H A;  1T5E A;  4FLZ A;  4FPP A;  2XJG A;  4FZ0 A;  2QFO A;  2EIM B;  5KMG A;  4I7Z B;  1US6 A;  3L9D A;  5E1A C;  2R70 A;  5FNV A;  3A0T A;  1W0K G;  4JI6 O;  1VQ6 V;  3RGB A;  1GRJ A;  3D0B A;  1N36 B;  2QE7 G;  1RP3 B;  4HAM A;  1YSC A;  4CH6 A;  3HKE A;  2AW9 A;  2UU9 B;  1N8R W;  4JV5 B;  5H6R A;  4EB6 B;  4DV7 B;  2IWU A;  1JVM A;  1BMF G;  3QF7 A;  2HG5 C;  3LDC A;  2FWZ A;  2YK9 A;  2F95 B;  4OPH A;  3HKB B;  4MVR A;  2CH7 A;  4XCJ A;  5D7D A;  2NLJ C;  3IGA C;  4KQV A;  4UCO A;  3AG7 A;  1S16 A;  3GWO A;  5H6Q A;  3ABU A;  4IT5 A;  4J10 A;  1ZAU A;  2YJX A;  1QBZ A;  3WU2 Z;  4D7S A;  5LMU O;  1YEW A;  1KEC A;  4LWI A;  4MPE A;  4NYK A;  4DV4 B;  4TQF A;  4AI8 A;  4HYO A;  1AB3 A;  2Q68 A;  3PEJ A;  1GKZ A;  3FYE B;  3A0R A;  1Q8I A;  1A4H A;  2IM9 A;  4YXW G;  1ZL8 A;  1ZWI C;  4L90 A;  1W0J G;  2JGU A;  4XDM A;  2BTO A;  1GKX A;  4PDL A;  3A0X A;  2ATK C;  1H38 A;  2GTS A;  4AHC A;  4XDJ A;  5L3F A;  4PU9 A;  4MTO A;  3F5T A;  4YJ3 B;  4IIJ A;  1KBH A;  5KAF Z;  5GON A;  4X1K B;  1FXK A;  1Y4M A;  2EZO A;  4PRV A;  3JD2 A;  1YTF D;  1H8H G;  3RYI A;  3ZKD A;  3ZMZ A;  1UYI A;  1PL4 A;  2IWX A;  2GV9 A;  2LFS A;  2MK3 A;  4RQE A;  2CCU A;  2EIL C;  2C1G A;  3R66 A;  4TV8 B;  2HKO A;  3ZHV A;  1HWY A;  2UUC O;  2HCH A;  1UPG A;  5C93 A;  4YKY A;  4GUN A;  4B3T B;  1PNK A;  2YXH A;  1NKD A;  3QO7 A;  4KXR A;  2ZKJ A;  1J95 A;  2XAG A;  1E79 G;  4H33 A;  5EIB D;  3C11 A;  2E75 B;  2BTQ B;  3E86 A;  3CXH F;  5L3E A;  4ZHQ A;  3ZS8 C;  2YKC A;  1K92 A;  5IY5 B;  1RM1 C;  5E79 Z;  4LNU A;  2YE7 A;  3JAR B;  1TUE B;  5CBH A;  5LP6 B;  2ZE7 A;  4LF5 O;  1AP5 A;  2XX4 A;  1IUR A;  1PNL A;  1V54 C;  3ML0 A;  5D5Q A;  2ZDI C;  4EEH A;  3ABK C;  1ZXM A;  1QVF U;  4J7J A;  1PD3 A;  3VBB A;  4BWA A;  4J11 A;  2XD6 A;  2BYH A;  4CC5 A;  5IN9 A;  4YKU A;  2EX3 A;  2OCC B;  4UVB A;  1P4R A;  4O2A B;  4GCZ A;  4URO A;  3ZXO A;  2UXC O;  1OZ0 A;  4XTJ A;  1Q86 W;  3ZRV A;  2CCS A;  4YY3 B;  4JI7 B;  2CTP A;  2ADP A;  2FL4 A;  2BRE A;  3BVO A;  3GVM A;  4GX2 A;  1GM8 A;  2YIA A;  3K03 A;  5CTY A;  3HKD B;  4FCP A;  3AEI A;  4MTX A;  5LGT A;  2VW5 A;  4B6C A;  2BOC C;  5M4M A;  3EHJ A;  3CCV V;  1OCZ C;  2YE2 A;  4BAE A;  5CA1 B;  1X59 A;  5L3C A;  3R91 A;  3AK3 A;  4CS4 A;  2K1E A;  5B1O A;  3O6O A;  4K4O A;  1XDC A;  3SYA A;  3U67 A;  5DN6 G;  3PEH A;  5CTU A;  3WB1 A;  4CH5 A;  1SZX A;  4AQY O;  2WLK A;  3LNN A;  4H44 B;  5LGN A;  2X6C A;  1YXB A;  2DQ0 A;  3WB2 A;  4BQJ A;  2XDX A;  4JF3 A;  2AZ2 A;  2DMX A;  4LFA O;  1TIL A;  1M4U A;  5L3B A;  1HR0 B;  4TWK A;  1YER A;  3B40 A;  4URL A;  2QJ1 A;  4G2K A;  4C7U A;  4GX5 A;  2YKJ A;  4QPK A;  5D5P A;  3ZM7 A;  2ZXW B;  2B5U A;  3FB7 C;  5JCO A;  1XRE A;  3UKM A;  3X2Q B;  2YE8 A;  3LSS A;  1Y67 A;  3B24 A;  1HNW O;  5EC2 C;  4KHP O;  2C2A A;  1VQM V;  4F6R A;  5TIS Z;  3K58 A;  4P9O A;  1K9M W;  5KX5 A;  1N32 O;  1BHB A;  3C3S A;  5LMN B;  2VWJ A;  3ZHQ A;  4QE7 A;  4LFB B;  1M57 C;  1BXD A;  1V55 C;  1X4T A;  2UUA O;  1AJQ A;  4JI2 O;  3TZ5 A;  3JAW B;  2AXT Z;  4JQL A;  1F51 A;  4DR3 B;  1IXB A;  3ABM C;  4FM1 A;  1VQ4 V;  2R9A A;  4TV9 A;  5EK0 A;  4PDM A;  4LF8 O;  3HYZ A;  1XNQ O;  3SPH A;  4I4T B;  3Q5J A;  3K57 A;  2WI5 A;  4MVZ A;  3QTF A;  4JI3 B;  4RO2 A;  5EIB C;  4J80 A;  2IJH A;  1UYC A;  2DW4 A;  4U93 A;  3SDL A;  2PI5 A;  5IJ0 B;  2RN9 A;  4U3J B;  2A79 B;  2EJ7 A;  4GX0 A;  2YI5 A;  3K97 A;  3O9O A;  1I5D A;  4YKZ A;  3T2M A;  3T1Y O;  4JI1 B;  4X65 O;  3EFF K;  4WFH A;  1I58 A;  2WEQ A;  4PA9 A;  3ICX A;  1OV9 A;  1Q5O A;  4E02 A;  4MP7 A;  5CPH A;  1M93 A;  2UXB B;  3IC9 A;  4O4I B;  1SQQ H;  3W7W A;  1JFF A;  2F66 C;  4X9Q A;  4JAA A;  1SQF A;  4LF7 O;  5J2T B;  3FT8 A;  4JYB A;  2WWW A;  3CSX A;  3BHP A;  3CRQ A;  4WFA V;  1SA0 A;  2FML A;  3OD4 A;  3ZRX A;  3RYF B;  3OW6 A;  2HHI A;  2DWE C;  4L8Z A;  4PRX A;  2QF6 A;  4OPA A;  3EHB B;  2ZNI A;  1KZN A;  3ASO B;  4X64 B;  3D2R A;  4EFT A;  5JWP A;  3OGC C;  2XT9 A;  2M6Y A;  1VQ5 V;  2JJ2 G;  4FM0 A;  1MMM A;  2YUA A;  4OXS A;  2BU6 A;  4Z1M G;  2YE3 A;  2N04 A;  2XDS A;  1I5C A;  2VS0 A;  3K60 A;  4DV3 O;  1Q82 W;  2WI2 A;  3HZ1 A;  3AK1 A;  4UB6 Z;  3K79 A;  5BMV A;  3M7M X;  4B3S O;  3R4P A;  2XHT A;  3OMA B;  2PUS A;  4DK1 A;  4UUJ C;  3ZXQ A;  1YJN V;  2R9I A;  4Q20 A;  2BRC A;  1PNM A;  5EBM C;  3KZI Z;  4IHJ A;  4KFG A;  4DR6 O;  4MT8 A;  3E8G A;  2A9H A;  3HZ5 A;  2YID A;  1DK1 A;  3CCQ V;  2HG1 A;  3GIG A;  5IDJ A;  3OT7 A;  2Y69 B;  3SPI A;  3FAV A;  5ITZ B;  2WLJ A;  3ZRS A;  1JMK C;  2ZIM A;  2ZT9 B;  3AG4 C;  3C3T A;  1QCE A;  2VCI A;  2DYS C;  3EXA A;  1WP7 A;  1YVW A;  5GW7 A;  3ETE A;  3EHH A;  3L72 H;  1FYJ A;  3ZRW A;  4DR2 B;  3K0D A;  2BU8 A;  1G4Y B;  2FKX A;  1ENV A;  4CC6 A;  2E5L O;  1D2D A;  4DR5 O;  2KG7 B;  4CWP A;  4HNA B;  3M99 B;  4FLW A;  1K73 W;  1SRY A;  1R3J C;  4MSW C;  5B66 Z;  2ZM6 O;  1VQ7 V;  2UUB O;  1XIL A;  2HVK C; 
#chains in the Genus database with same CATH homology
 1E1R G;  2WI4 A;  5D7R A;  3TK1 A;  1L0O A;  2WLL B;  1S0V A;  1EFR G;  3STZ C;  4HY6 A;  2YGE A;  4HYM A;  1Y4U A;  5M4P A;  3CCE V;  2EIN C;  3AG3 C;  1TC0 A;  2YEA A;  3P30 A;  1YTF B;  1ID0 A;  2YK2 A;  2EIM C;  4R3M A;  5B1A C;  5B1B B;  2IU3 A;  3TET A;  2YEI A;  3F7V C;  2YEV A;  1YHQ V;  3CCU V;  2XK2 A;  3KE6 A;  1Y8N A;  1S77 D;  3GIF A;  4KSG A;  2YKI A;  1QR9 A;  4GGL A;  3LNM B;  1NH2 B;  3NXS A;  1YSR A;  5J71 A;  1B63 A;  5FNC A;  3ZJZ A;  2OT5 A;  1M56 B;  1QLE B;  3RBZ A;  4GT1 A;  4YKR A;  1FXH A;  4L87 A;  4HY1 A;  5FND A;  3ZMU A;  1VQ8 V;  3TZ0 A;  2V1D A;  1Y8P A;  3VHD A;  4MPN A;  4TSF G;  2QG0 A;  1VQK V;  3Q5K A;  2X6B A;  3SPG A;  3UM7 A;  4H81 A;  5D6P A;  4XE2 A;  2HVK C;  5IDM A;  2UXX A;  2ZDI A;  2LP7 A;  3OWD A;  3HEK A;  3E8B A;  3E83 A;  3A0Y A;  3STL C;  3SPJ A;  3AG1 B;  2BYI A;  3CGY A;  1R62 A;  1H7S A;  1YIT V;  4LC1 A;  4B7P A;  1GMG A;  5F3K A;  3QO5 A;  5M4N A;  2EIJ B;  1NR1 A;  1QY8 A;  1TID A;  4WF9 V;  2NNU A;  1AH6 A;  2XDL A;  3FT5 A;  2HVJ C;  1QVG U;  1MG1 A;  1M9N A;  1TC6 A;  3ZIA G;  1R73 A;  2XAJ A;  1I59 A;  4ASG A;  1B62 A;  5BOD A;  3G7B A;  1BHA A;  2JIZ G;  4WUB A;  1YS3 A;  2ESA A;  3NMQ A;  1NVP D;  1BKN A;  3SYQ A;  1AMW A;  2JEX A;  2XAH A;  4CE2 A;  1OCO B;  1GKF A;  3LSQ A;  3B28 A;  3FKS G;  5J9P C;  2XAB A;  4EGH A;  3W7X A;  2YEF A;  3K04 A;  3O0I A;  2XJX A;  3CCJ V;  2W6J G;  4LWE A;  3ABL B;  2ZR3 A;  3ASN B;  2YEH A;  4J9Z B;  1W2B U;  3X2Q C;  3LNU A;  3C0E A;  2IOQ A;  2YI6 A;  3R4M A;  4FCQ A;  4PL9 A;  2YEC A;  3CCS V;  2GSM B;  2WLN A;  1TH8 A;  3RVY A;  3SYO A;  1TBW A;  4XCL A;  1NJI W;  4JPR A;  4YKT A;  1R3L C;  3CC7 V;  1K4D C;  2CK3 G;  2E0A A;  1BGQ A;  3OFN G;  3SYC A;  5M4K A;  1K3E A;  4JGS A;  1R6K A;  1ZWH A;  2Q8I A;  4URM A;  3ZMS A;  4X8A A;  5L3G A;  5LBQ A;  4XIQ A;  3FB8 C;  3ZN1 A;  1B6Q A;  2EZP A;  1U0Z A;  4R8C A;  1PVG A;  1ZW9 A;  3B8N A;  4KP4 A;  1DF4 A;  3CRL A;  1OCR C;  1S5H C;  4LBE C;  1SET A;  4BAY A;  3LDE A;  1MX0 A;  3ASO C;  3OR6 C;  1H2G A;  2O1W A;  1Z59 A;  4YKQ A;  2IW5 A;  3E8F A;  2IOP A;  1JQ0 A;  3D36 A;  3VHA A;  4EFU A;  5IYC O;  2OTJ V;  2WLI B;  4BIU A;  2HKJ A;  3WG7 B;  3ZMV A;  3RVZ A;  1NHI A;  4YKX A;  2YEB A;  2P6J A;  4CWQ A;  2M7W A;  2YKB A;  3F7Y C;  2YEG A;  3I55 V;  1U2O A;  5LGU A;  3R4N A;  2XDU A;  3JD4 A;  4CWS A;  2X0L A;  4UVC A;  3WHA A;  4FCR A;  4AS9 A;  5DM6 V;  4TT3 G;  4LWF A;  4V26 A;  2H8P C;  2ZDY A;  1AI4 A;  4WUC A;  1B3Q A;  1VQL V;  4DZY A;  3F5W C;  4PA6 A;  3CC4 V;  3LPS A;  1US7 A;  4CWO A;  3AG2 B;  2B1I A;  3CMA V;  3CWV A;  2BU2 A;  1CEZ A;  3JD1 A;  3CP1 A;  5HFM A;  3OE7 G;  4CWT A;  4ZBM A;  1VQ9 V;  1WLE A;  3OWB A;  1UYF A;  4DUH A;  4BIZ A;  4PA3 A;  2VCJ A;  3G6E V;  4MPC A;  2WI6 A;  5EC1 C;  4R6Z A;  1ZXN A;  4E01 A;  5CN0 A;  1BL8 A;  3K06 A;  4P9P A;  4UV9 A;  2D3O W;  2VWC A;  4LP8 A;  5CTX A;  2WI3 A;  1MOF A;  1QR8 A;  1MU5 A;  2HR3 A;  3RKZ A;  3CCL V;  3B77 A;  2EBO A;  4UV8 A;  3OUF A;  4GX1 A;  3CCR V;  1K5Q A;  4P8O A;  2YI0 A;  2YJW A;  2YGA A;  4MB9 A;  2QM8 A;  1YI2 V;  3K0G A;  2EIL B;  4BQG A;  3ETD A;  1NHH A;  5KUM A;  3K9A A;  2IWS A;  4G27 B;  3OEH G;  4X89 A;  1EZJ A;  4XDL A;  2DWD C;  4ASB A;  3P32 A;  2IH1 C;  1COW G;  3WQ9 A;  4P7A A;  4PA7 A;  5D7C A;  1CP9 A;  1G8M A;  2P67 A;  4CWF A;  2FYP A;  4R50 A;  1NVP B;  2EIK C;  2XX2 A;  1V54 B;  4FK5 C;  2YEJ A;  2ITC C;  3ABK B;  3D3I A;  3ETG A;  4CZZ A;  2O1U A;  4JAV A;  4ZKI A;  4I5S A;  3G71 V;  3JD0 A;  4RUF A;  2ZR2 A;  3R92 A;  2JJC A;  4KFM A;  4X88 A;  2IU0 A;  1YT2 A;  2BT0 A;  2WSS G;  2JKI A;  2YKE A;  2QEX V;  2HFE C;  1UYH A;  4U7O A;  4AWO A;  1BYQ A;  2WEP A;  3R4O A;  3DGE A;  2EIJ C;  1QZR A;  1OCZ B;  4ASF A;  3OR7 C;  3U2D A;  4JAU A;  1GK9 A;  2DYR C;  4I3H A;  4H7Q A;  3T1C A;  2QA4 V;  3CXC U;  2FXS A;  3K98 A;  2Q6A A;  1F4N A;  1I5A A;  1VQN V;  3HYY A;  3T10 A;  2Q67 A;  5EBW C;  1OCC C;  2K5B A;  3W7S A;  3OAA G;  1AM1 A;  2IJI A;  4CE3 A;  1R6N A;  1FFT B;  3K3W A;  3VAD A;  3TZ4 A;  1EBO A;  1K97 A;  3EKO A;  2WI7 A;  4MVO A;  4I9W A;  3A0W A;  4O0B A;  3CGZ A;  2UWD A;  1V55 B;  4MW3 A;  4MW8 A;  1AI7 A;  1Q7Y W;  3ABM B;  3HHU A;  3H80 A;  2JK5 C;  2Q69 A;  3EHF A;  3RLR A;  1R3I C;  5LHI A;  3RW0 A;  2CGF A;  4DXW A;  4XC0 A;  2EXL A;  1JJ2 U;  2WI1 A;  4WFB V;  1E1Q G;  4XIR A;  1M90 W;  4LPB A;  3G4S V;  3ABL C;  3ASN C;  4R7C A;  1K4C C;  5GGZ A;  1S3J A;  2H8M A;  3BEH A;  4P30 A;  1RPO A;  4E00 A;  5L3J A;  4KSH A;  4MVQ A;  4O09 A;  3FB5 C;  4HZ3 A;  5FWK A;  1KC8 W;  2BU5 A;  3CC2 V;  4WFF A;  2YE9 A;  3TZ2 A;  1AI6 A;  2DQ3 A;  3LDD A;  5LHH A;  3BM9 A;  2FWY A;  3E2E A;  4W7T A;  3WFV A;  1THN A;  3OW2 U;  4HYP A;  1YC1 A;  1I5Y A;  1FXK B;  2A0L A;  5HFL A;  4RAI A;  3TCU A;  1QYE A;  1YSZ A;  2EJR A;  3B8M A;  1Q81 W;  4MVM A;  1AJP A;  3K08 A;  4EKW A;  1KP2 A;  4MBC A;  4E2L A;  2WER A;  3K99 A;  1UJW B;  3B25 A;  3QO8 A;  2Q2E B;  4PA4 A;  3ZCC A;  5IY5 C;  1FXV A;  4R3A A;  4AWP A;  3AG4 B;  3JYC A;  2DYS B;  3OMU A;  2V7Q G;  5BOC A;  3BMY A;  2OCC C;  4AWQ A;  2B1G A;  5KA5 A;  4CE1 A;  1UYK A;  4XKK A;  2WLL A;  4L93 A;  2ZDX A;  3H4L A;  5CA3 A;  4L91 A;  2X6A A;  1R3K C;  2YSU B;  3CYO A;  1EI1 A;  4XBF A;  5KA6 A;  2EIN B;  1UYD A;  2PNR A;  3AG3 B;  3ZMT A;  1YT0 A;  2BU7 A;  1JOY A;  4NH7 A;  2BOB C;  5CBG A;  2PI4 A;  4CWN A;  5B1A B;  1FS0 G;  1UYE A;  5M4E A;  2BSM A;  4ASU G;  5D6Q A;  1K34 A;  1DTO A;  3BY6 A;  3IC7 A;  1I5B A;  2CG9 A;  3A0Z A;  3MHH C;  3INX A;  2BZ5 A;  1VQP V;  3JZ3 A;  3ABT A;  4FJC C;  2ZXW C;  4F4L A;  2AHZ A;  3OMI B;  3ZKB A;  1YET A;  3T4D A;  3AG2 C;  2O1V A;  1F23 A;  4G28 B;  1ORQ C;  4PEL A;  3OUS A;  4EGI A;  1AI5 A;  5LHG A;  1YIJ V;  3RLQ A;  2H94 A;  4L94 A;  4UXN A;  4WUD A;  4XDK A;  1H8E G;  2QKS A;  1RPR A;  2YED A;  1UYG A;  3QNE A;  2IH3 C;  4H85 A;  4WFG A;  2YE4 A;  1Z5B A;  5B3S B;  1KQS U;  2YE6 A;  2GQP A;  5L3D A;  4RQF A;  1K33 A;  4O05 A;  3TTZ A;  1MAB G;  3R65 A;  5F5R A;  3W7U A;  2ZQM A;  3G7E A;  2LFR A;  4FIP C;  2BTZ A;  1NH2 D;  4N23 A;  2ZBK B;  2CCT A;  3VOU A;  3T1K A;  3ZN0 A;  1GO3 F;  3IED A;  2X7R B;  1YT1 A;  2QM7 A;  4YKW A;  1QLN A;  3OEE G;  4QNH B;  2YI7 A;  4JTD B;  1K5S A;  1YC4 A;  2Y69 C;  4FMT A;  3GIG B;  4URN A;  4MS2 A;  1VQO V;  5M4H A;  4GEE A;  1UY9 A;  3CME V;  1WPX A;  1DLB A;  4BW5 A;  1JCH A;  3DTU B;  4HXZ A;  2Y48 A;  1YC3 A;  1CPY A;  4MVU A;  3ZRW B;  2HJF C;  2WLM A;  2WAM A;  4LCU C;  3Q5L A;  2JDI G;  4HZ5 A;  3HB3 B;  2P90 A;  3OMN B;  4MP2 A;  2HLD G;  4WCE V;  3GIE A;  3GB7 C;  4HXW A;  1AJN A;  4PDR A;  1MSW D;  2ZD9 A;  4PDV A;  4DO2 A;  4CBC A;  5B1B C;  3VHC A;  3E8H A;  4KUM A;  3FV5 A;  4U7N A;  3T0Z A;  3CCM V;  3RLP A;  2YEV B;  5B1N A;  4JAS A;  2GFD A;  1GM7 A;  2W6I G;  1M56 C;  4MVS A;  4EM7 A;  1QLE C;  2UXN A;  4RUE A;  4O07 A;  3O2F A;  2R9R B;  4XD8 A;  1UYL A;  1H7U A;  1K8A W;  2XX5 A;  5CTW A;  3JD3 A;  3FYI B;  2P7T C;  4O04 A;  1OCR B;  4QIW F;  3KG2 A;  5IYB O;  1JPX A;  4X9L A;  1RM1 B;  1IXM A;  4CWR A;  1K7D A;  2QG2 A;  1AH8 A;  1ARO P;  4NH9 A;  3LUT B;  4XIT A;  2WLI A;  2AKP A;  2XJJ A;  1FXK C;  3W7T A;  4H37 A;  2WPD G;  4ASA A;  4QJF B;  4V25 A;  3SJQ C;  1DF5 A;  2W0F C;  2FTK A;  2QTO A;  2XAS A;  5FL7 G;  3CRK A;  3AG1 C;  3MHS C;  4XIP A;  1KKD A;  2YGF A;  2H55 A;  2Z5U A;  4UVA A;  4HZ0 A;  1GTO A;  1PL0 A;  2WLH A;  1PKX A;  3B26 A;  2IOR A;  4J9Y B;  3MD0 A;  1Y8O A;  2XHR A;  1EA6 A;  5EBL C;  1OHH G;  4JTA B;  3QDD A;  1P7B A;  3TUH A;  3I56 V;  3JCZ A;  2Q8G A;  4NH8 A;  3B27 A;  1THZ A;  4N21 A;  5J6A A;  1KD1 W;  4EMV A;  4JTC B;  5FNF A;  3G75 A;  4GFN A;  4XKO A;  1NR7 A;  1Z5C A;  4GQT A;  1AR1 B;  3FB6 C;  4WFE A;  1M57 B;  2YEE A;  1NQT A;  1YES A;  3CPW U;  3T4Z A;  3SL2 A;  2IJK A;  2Q8H A;  5KUK A;  1OCO C;  1YJW V;  5BZB A;  4GT8 A;  2XOK G;  1JM6 A;  1S14 A;  1KP3 A;  5CMU A;  2XAQ A;  3SYP A;  3U2K A;  1UYM A;  3EKR A;  1AJ6 A;  5CBF A;  1LNQ A;  2OTL V;  1L1F A;  1UY7 A;  2XDK A;  4EGK A;  2KB1 A;  1GJV A;  4JYC A;  4P2Z A;  4LWH A;  3OM3 B;  4XKA A;  3PJS K;  4QE9 A;  1SES A;  1SER A;  1XL6 A;  1Y66 A;  1OSF A;  5CF0 A;  2Z3Y A;  3INW A;  3MNR P;  1F4M A;  1GM9 A;  5H9C A;  4KTN A;  2XND G;  4BXI A;  2AHY A;  1ROP A;  1M1K W;  5B3S C;  2EIK B;  3E89 A;  2IJJ A;  2XAF A;  2GHY A;  4R1F A;  3HPL C;  2XHX A;  4LWG A;  3EHG A;  3SPC A;  1JX9 A;  2JJ1 G;  3H01 A;  3OPD A;  1UY6 A;  4ZVI A;  2F43 G;  2Q8F A;  5IYD O;  2CH4 A;  1KIJ A;  3CD6 V;  1S76 D;  4MTG A;  1UY8 A;  1XL4 A;  3WG7 C;  2XCM A;  1NHJ A;  3T2S A;  2DYR B;  4LP0 A;  3IFX A;  1S72 V;  4QPJ A;  4MTF A;  1YJ9 V;  2JEU A;  2YE5 A;  1OCC B;  2ITD C;  1SZT A;  1Z5A A;  1I5X A;  3E35 A;  4MOT A;  1Y4S A;  3T0H A;  4FPP A;  2XJG A;  2QFO A;  2EIM B;  5E1A C;  3A0T A;  1W0K G;  1VQ6 V;  3D0B A;  2QE7 G;  4HAM A;  1YSC A;  1N8R W;  5H6R A;  2IWU A;  1JVM A;  1BMF G;  2HG5 C;  3LDC A;  2FWZ A;  2YK9 A;  4MVR A;  4XCJ A;  5D7D A;  2NLJ C;  3IGA C;  4KQV A;  1S16 A;  3GWO A;  5H6Q A;  3ABU A;  2YJX A;  1QBZ A;  1KEC A;  4LWI A;  4MPE A;  4HYO A;  2Q68 A;  3PEJ A;  1GKZ A;  3FYE B;  3A0R A;  1A4H A;  4YXW G;  1ZWI C;  4L90 A;  1W0J G;  4XDM A;  1GKX A;  4PDL A;  3A0X A;  2ATK C;  1H38 A;  4XDJ A;  5L3F A;  4PU9 A;  4MTO A;  1FXK A;  1Y4M A;  2EZO A;  4PRV A;  3JD2 A;  1YTF D;  1H8H G;  3ZKD A;  3ZMZ A;  1UYI A;  2IWX A;  2LFS A;  2MK3 A;  4RQE A;  2CCU A;  2EIL C;  2HKO A;  1HWY A;  2HCH A;  5C93 A;  4YKY A;  1PNK A;  1NKD A;  3QO7 A;  2ZKJ A;  1J95 A;  2XAG A;  1E79 G;  4H33 A;  3C11 A;  3E86 A;  5L3E A;  2YKC A;  1K92 A;  5IY5 B;  1RM1 C;  2YE7 A;  1TUE B;  5CBH A;  2XX4 A;  1PNL A;  1V54 C;  3ML0 A;  2ZDI C;  4EEH A;  3ABK C;  1ZXM A;  1QVF U;  1PD3 A;  3VBB A;  2XD6 A;  2BYH A;  5IN9 A;  4YKU A;  2OCC B;  4UVB A;  1P4R A;  4GCZ A;  4URO A;  3ZXO A;  1OZ0 A;  4XTJ A;  1Q86 W;  3ZRV A;  2CCS A;  2BRE A;  4GX2 A;  1GM8 A;  3K03 A;  5CTY A;  4FCP A;  3AEI A;  4MTX A;  5LGT A;  2VW5 A;  4B6C A;  2BOC C;  5M4M A;  3EHJ A;  3CCV V;  1OCZ C;  2YE2 A;  4BAE A;  5L3C A;  3R91 A;  2K1E A;  5B1O A;  3O6O A;  4K4O A;  3SYA A;  3U67 A;  5DN6 G;  3PEH A;  5CTU A;  2WLK A;  5LGN A;  2X6C A;  2DQ0 A;  4BQJ A;  2XDX A;  4JF3 A;  1TIL A;  5L3B A;  4TWK A;  1YER A;  4URL A;  4G2K A;  4GX5 A;  2YKJ A;  4QPK A;  3ZM7 A;  2ZXW B;  2B5U A;  3FB7 C;  3UKM A;  3X2Q B;  2YE8 A;  3LSS A;  3B24 A;  5EC2 C;  2C2A A;  1VQM V;  4P9O A;  1K9M W;  1BHB A;  4QE7 A;  1M57 C;  1BXD A;  1V55 C;  1AJQ A;  3TZ5 A;  4JQL A;  1F51 A;  3ABM C;  1VQ4 V;  5EK0 A;  4PDM A;  3HYZ A;  3SPH A;  3Q5J A;  2WI5 A;  4MVZ A;  3QTF A;  4RO2 A;  2IJH A;  1UYC A;  2DW4 A;  4U93 A;  2PI5 A;  4GX0 A;  3K97 A;  2A79 B;  2YI5 A;  1I5D A;  4YKZ A;  3T2M A;  3EFF K;  4WFH A;  2WEQ A;  4PA9 A;  4E02 A;  4MP7 A;  5CPH A;  3W7W A;  3FT8 A;  4JYB A;  2WWW A;  4WFA V;  3ZRX A;  3OW6 A;  4L8Z A;  2DWE C;  4PRX A;  2QF6 A;  3EHB B;  1KZN A;  3ASO B;  3D2R A;  4EFT A;  3OGC C;  1VQ5 V;  2JJ2 G;  4OXS A;  2BU6 A;  4Z1M G;  2YE3 A;  2XDS A;  1I5C A;  3K60 A;  1Q82 W;  2WI2 A;  3HZ1 A;  3K79 A;  3R4P A;  2XHT A;  3OMA B;  4UUJ C;  3ZXQ A;  1YJN V;  2R9I A;  4Q20 A;  2BRC A;  1PNM A;  5EBM C;  4KFG A;  4MT8 A;  3E8G A;  2A9H A;  3HZ5 A;  3CCQ V;  2HG1 A;  3GIG A;  5IDJ A;  2Y69 B;  3SPI A;  2WLJ A;  3ZRS A;  3AG4 C;  1QCE A;  2VCI A;  2DYS C;  5GW7 A;  3ETE A;  3EHH A;  3ZRW A;  3K0D A;  2BU8 A;  1G4Y B;  1ENV A;  4CWP A;  3M99 B;  1K73 W;  1SRY A;  1R3J C;  4MSW C;  1VQ7 V;  1I58 A;  1NBM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...