1PVGA

Crystal structure of the atpase region of saccharomyces cerevisiae topoisomerase ii
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
400
structure length
378
Chain Sequence
b'SASDKYQKISQLEHILKRPDTYIGSVETQEQLQWIYDEETDCMIEKNVTIVPGLFKIFDEILVNAADNKVRDPSMKRIDVNIHAEEHTIEVKNDGKGIPIEIHNKENIYIPEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILETADLNVGQKYVQKWENNMSICHPPKITSYKKGPSYTKVTFKPDLTRFGMKELDNDILGVMRRRVYDINGSVRDINVYLNGKSLKIRNFKNYVELYLKSLIPTILYERINNRWEVAFAVSDISFQQISFVNSIATTMGGTHVNYITDQIVKKISEILKKVKSFQIKNNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCEIPLEYINKIMKTDLATRMFEIADA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA topoisomerase II
publication title Structure of the topoisomerase II ATPase region and its mechanism of inhibition by the chemotherapeutic agent ICRF-187
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 113
structure length 378
sequence length 400
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2003-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1pvgA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1pvgA01
1US7A 4JAUA 5IDMA 1ELOA 4XKAA 5D7RA 4WUCA 4JV5I 1I58A 4O0BA 2YGAA 2XHRA 2WERA 5F3KA 3A0ZA 4GGLA 4DR7E 1I59A 2BU6A 4URLA 2YK9A 4AWQA 4I3HA 2UXBE 4FW9A 4DPTA 5A2QC 1YT2A 2H55A 2F4VE 4E01A 2DEJA 4X65I 3T0ZA 4LF7I 1S4EA 3K98A 2BREA 2PNRA 2YEJA 4L93A 5M4KA 1XMOE 3D2RA 2V34A 4XD8A 3OWDA 4B3SE 2OI2A 1ZM2A 3TZ0A 2YGEA 3C11A 3R4PA 2C2AA 1H7UA 5BR8I 4OX9I 3EHGA 3K97A 3K17A 2YE9A 5GMDA 4U7OA 1EA6A 1HNZE 1Y8NA 2BSMA 2VWCA 4FWDA 4AWOA 4DV5I 1MU5A 5IDJA 1UY7A 5CTXA 2ZM6I 4CWTA 1AMWA 3INWA 5D7CA 3F0NA 1B63A 3Q5JA 4YY3E 5FLXQ 4BIZA 5CTYA 2JKIA 4K4OA 4O04A 4H81A 3U2KA 4JV5E 3EKOA 2XCMA 3RLPA 3D36A 4H7QA 2YI5A 4JYAI 4GCZA 3QT7A 4GKJI 3QT6A 4XC0A 5D6QA 3M6AA 3J7AM 4DR5I 1XNQI 3EHJA 3DGEA 3G7EA 4X65E 1YT1A 4LF7E 1FWLA 4LF8I 1MX0A 1TILA 2Q8HA 4HXWA 2UWDA 1EI1A 4JI0I 5IWAI 4KSHA 5BR8E 1RR9A 3ZXQA 2EXLA 4OX9E 2ZDXA 1YC1A 4JI4I 1UYEA 4JI2I 2UUAI 1ZW9A 2VCIA 1VISA 2WI4A 2YEEA 1QY8A 4QPKA 3RKZA 3R4MA 4DV5E 2UUBI 3H80A 1FI4A 3PYDA 2HK3A 4HYMA 2ZM6E 3D4JA 1UYLA 2WI6A 4XTJA 4NXMI 3FT5A 1K47A 2YEBA 4O05A 4BQJA 5LMNI 2BTZA 4RPFA 3T1HI 2YE5A 4XCLA 1UY6A 4DV2I 4M1KA 1Y8PA 1YESA 2UUCI 1AH6A 4JYAE 3WU3A 1NHJA 5M4EA 4GKJE 2CZ9A 1QYEA 2BU7A 2E5LI 4AS9A 3B82A 2XD6A 1Y4SA 4DR5E 2XDKA 1XNQE 4X66E 5J6AA 4DV7I 2ZKJA 1Z0BA 4GKKI 5GMEA 4KQVA 4HXZA 4LF8E 1YERA 3D0BA 2QF6A 4KTNA 4ASAA 4BQGA 4LFBI 2CCSA 4EEHA 1TC0A 5F5RA 3Q1QA 2HKEA 1U2RA 4LF5I 5IWAE 4JI0E 4CWPA 1UYHA 4XCJA 4L90A 4WUBA 4JI4E 3R4OA 4JI2E 2UUAE 2J7KA 4GFNA 1KTVA 4DV1I 3K60A 1FNMA 2V2QA 2BRCA 4R3AA 3OW6A 4DUYI 1FJGI 2UUBE 4DR4I 2WI2A 5C93A 2WI7A 2XJJA 2BYHA 4EMDA 4FMTA 4XKKA 4XE2A 3VADA 3GIEA 4NXME 4DV4E 4LF9I 1Z5CA 1RREA 2V2ZA 5LMNE 3B8HA 4B3TI 3HEKA 1YC3A 4O09A 1NHHA 3T1HE 4CE2A 4XDMA 2VQEI 2XDLA 3ZKBA 4Z7CA 4DV2E 2XHTA 4GEEA 4MOTA 2UUCE 1Y4UA 3GONA 4NH9A 3B27A 5FNCA 3PYGA 5LMUI 1ZWHA 4E00A 4DR1I 4XITA 2BT0A 3KE6A 4O07A 2FWYA 2E5LE 5M4NA 4DUZI 2GQPA 4LPBA 1UYMA 1ZXNA 1MG7A 4DV7E 1N32I 4JAVA 1FWKA 4GKKE 3WU5A 1BYQA 1YT0A 4L8ZA 3WU4A 3B25A 3NMQA 3QTFA 2WI5A 4EGHA 1Z5AA 4LFBE 4HY1A 4XKOA 4URMA 1U2OA 2YE6A 4ASGA 1Z0GA 3T10A 4LF5E 2YKJA 4L91A 2XHXA 3J81C 3CGZA 5M4HA 2GS8A 3HZ1A 3TTZA 3JAMC 1Z0CA 2XX2A 2V2VA 1B62A 2HK2A 4JQLA 1BKNA 4DV1E 1N34I 2YE2A 4YKTA 1YC4A 4DUYE 1FJGE 3O2FA 4DR3I 4DR4E 1AJ6A 4LWHA 1N33I 3HULA 1A4HA 3WU6A 4UTGA 5IT9Q 1TIDA 3ZZ0A 4AWPA 4LF9E 4DZYA 4B3TE 1Y8OA 1ZXMA 4KSGA 2XABA 4GT8A 2BU2A 3T1KA 2VQEE 4FCQA 2DEIA 3B24A 3HZ5A 4P52A 4X64I 5LMUE 2IWUA 2X7IA 2CCUA 1ID0A 1YSZA 4KHPI 4EGKA 4DR6I 4DUZE 4ED4A 1HNWI 3A0RA 1N32E 4EM7A 2YI6A 3R92A 4GQTA 3ZZTA 4U93A 3K1JA 3TZ5A 5GGZA 2K5BA 4H85A 3VHDA 2YKIA 3VHAA 5FWKA 2WEPA 3OTOI 2YGFA 1IBKI 4W7TA 3V2UC 4DPYA 3HYYA 5CF0A 4MBCA 1YS3A 2UXCI 4Z7YA 1JM6A 3SL2A 2V8PA 1H73A 1N34E 3INXA 2XDUA 3OPDA 4USKA 4DR3E 2YEFA 1ZM3A 4MYTA 3TZ4A 1N33E 4ASBA 1GKZA 4PRXA 2R3VA 1N36I 1S16A 3EHHA 4DU8A 1OSFA 4LWGA 4FN5A 3LNUA 4NXNI 2VCJA 1Z0WA 4HACA 1TBWA 3FT8A 4KP4A 1TC6A 1IBLI 4NH7A 4KFGA 1KZNA 1YSRA 4X64E 4DPUA 5A2QQ 2YKCA 4FCPA 3QT5A 2VQFI 4KHPE 1L0OA 3GIGB 3PEJA 4DR6E 1HNWE 3A0TA 3QDDA 3WHAA 4USMA 1A6FA 4R3MA 4XIPA 2LJPA 4XIRA 4DPWA 2CH4A 3A0YA 1BXDA 2WEQA 3OWBA 2BU5A 3CRLA 4FWGA 1WUUA 2FXSA 4EGIA 1OJ4A 2X36A 3OTOE 1IBKE 4HZ0A 5M4PA 4JI5I 1NZ0A 2UXCE 2JJCA 3O0IA 3GIGA 4HY6A 3TUHA 2H8MA 4YHHI 4B3RI 2YEGA 3T2SA 4LP0A 2BV3A 2BM0A 3B78A 4JI8I 4I5SA 2O1VA 2CCTA 2WI1A 4LFAI 4UROA 1U0ZA 4DUHA 5FLXC 4HZ5A 3R91A 3EKRA 5BOCA 1N36E 2HHHI 1S14A 4NXNE 4X9LA 1Z0VA 3FV5A 2E1RA 1PIEA 4NH8A 3Q5LA 1IBLE 1UYFA 1UYGA 2HCHA 2YKEA 2XJXA 4E02A 1H72C 3LTOA 2XEXA 2IOQA 2VQFE 4MP7A 1H74A 3LPSA 4ASFA 2YE8A 4MPEA 4CWRA 5CTUA 2AJ4A 3O6OA 2GFDA 3JZ3A 4XIQA 1B3QA 1H7SA 2HFUA 4DXLA 1BGQA 1Z5BA 1D6TA 4BIUA 2AKPA 4YKUA 2BU8A 2YKBA 4CWQA 3B28A 4YKXA 4P8OA 3CWVA 4JI5E 4LF4I 3ZM7A 1UYDA 1ZM9A 1DARA 2YECA 3IEDA 2FYPA 2XK2A 5FNDA 2VF3A 1Z0EA 4YHHE 4B3RE 4CWNA 1UYCA 1NHIA 5BODA 2Q8IA 4JI8E 4JASA 2NPFA 4LFAE 1QZRA 4MYUA 4JI3I 3PEHA 2HHHE 4DV3I 3V5RA 1HR0I 4P7AA 4DV0I 1PKPA 4LF6I 3J80Q 1GKXA 4X62I 3G7BA 4PL9A 1XNRI 4YKYA 1TH8A 2IORA 2E0AA 1Z59A 1AH8A 3CGYA 4Q20A 4DR1E 2O1UA 4DPXA 3QT8A 4LFCI 3PYFA 2Q8FA 5J71A 1HNXI 4B3MI 4DR2I 4B6CA 1Z0TA 2IWSA 2A2CA 4MB9A 2YEIA 4EMVA 2ZBKB 4LF4E 3MNRP 4MP2A 5M4MA 3BM9A 1UY8A 3ZZUA 1I94I 4YKWA 2XX4A 4JI1I 1AM1A 2VW5A 2Q2EB 4HACB 2YEAA 2QG0A 3B26A 1I5DA 4WUDA 2YE3A 3ZXOA 1XMQI 4ZKIA 1ZM4A 2YI0A 4QPJA 2YJWA 4JI3E 2BM1A 4DV3E 1HR0E 2QG2A 4X66I 3RLRA 3A0WA 4DV0E 2UXDI 4K0KI 4LF6E 4BAEA 2EFGA 1GJVA 2ESAA 1N0VC 4UT4A 4X62E 2IWXA 4YKQA 1XNRE 2UU9I 2XX5A 4CE3A 4JI7I 1KKHA 5LL6R 1KIJA 3J7AG 5CPHA 4JI6I 2ZDYA 2R42A 4DV6I 5L3JA 4LFCE 2IOPA 3VHCA 4EFUA 1HNXE 2YK2A 1XHKA 4B3ME 4DR2E 4YKZA 4CE1A 5CTWA 4PRVA 3HYZA 4FPPA 3J81Q 4MPCA 4BXIA 3T1YI 4URNA 4AQYI 2QFOA 3JAMQ 1UY9A 2HFSA 2CGFA 1J5EI 4JG4A 4FCRA 3RLQA 4EFTA 3CRKA 2WI3A 2XDSA 4B7PA 2BYIA 4DV4I 1I94E 4JI1E 2YEHA 2WW4A 4PU9A 3PYEA 4CWFA 1IBMI 3R4NA 4V25A 5IN9A 1I5CA 2CG9A 2XJGA 1XMQE 4V26A 2A2DA 5IT9C 4LWEA 1UYKA 2BZ5A 3J80C 1I5AA 3TZ2A 4DR7I 3G75A 5D7DA 3HHUA 4HYPA 1KVKA 4ZVIA 2UXBI 2UXDE 4K0KE 3OMUA 1PVGA 2ZITA 2FWZA 2Q8GA 3U67A 2F4VI 2UU9E 4R1FA 2YI7A 4CWSA 3EHFA 1N0UA 4YKRA 1XMOI 4JI7E 3A0XA 4MPNA 4B3SI 2YE4A 1R62A 2YEDA 5D6PA 3T0HA 4DU7A 4JI6E 3GIFA 4DV6E 2XDXA 1I5BA 3WQ9A 2O1WA 3H4LA 4LWIA 2HKJA 4CWOA 5FNFA 1HNZI 3T1YE 4AQYE 3C0EA 3U2DA 4FWHA 2YE7A 1J5EE 4U7NA 1THNA 3K99A 3Q5KA 2YJXA 3ZKDA 1FKAE 1YETA 1UYIA 4YY3I 2HG1A 4L94A 3BMYA 4LWFA 1UEKA 1IBME
chains in the Genus database with same CATH superfamily
1US7A 4JAUA 4IFDB 5IDMA 1ELOA 4XKAA 5D7RA 4FW5A 4WUCA 4JV5I 1I58A 4O0BA 2YGAA 2XHRA 2WERA 5F3KA 3A0ZA 4GGLA 4DR7E 1I59A 2VESA 4URLA 2BU6A 2YK9A 4AWQA 4I3HA 4LCGA 2UXBE 4FW9A 2PO1B 4DPTA 5A2QC 1YT2A 2H55A 2F4VE 4E01A 2DEJA 4X65I 3T0ZA 4LF7I 1S4EA 3K98A 2BREA 2PNRA 2YEJA 4L93A 5M4KA 1XMOE 3D2RA 2V34A 4XD8A 4IZKB 3OWDA 4B3SE 2OI2A 3Q6MA 1ZM2A 3TZ0A 2YGEA 3C11A 3R4PA 2C2AA 1H7UA 5K36B 5BR8I 4OX9I 3EHGA 3K97A 3K17A 2YE9A 4MU1A 5GMDA 2IERA 2PO1A 4U7OA 1EA6A 1HNZE 1Y8NA 2BSMA 2VWCA 4FWDA 4AWOA 4MU3A 4OO1C 4DV5I 1MU5A 5IDJA 1UY7A 5CTXA 2ZM6I 4CWTA 1AMWA 3INWA 5D7CA 3F0NA 1B63A 3Q5JA 3K85A 4YY3E 5FLXQ 4U3DA 4BIZA 2C38A 2JKIA 2JEAA 4K4OA 5CTYA 5K36A 4O04A 4QNJA 4H81A 3U2KA 4JV5E 3EKOA 2XCMA 3RLPA 3D36A 4H7QA 2YI5A 4JYAI 4GCZA 3QT7A 4GKJI 3QT6A 4XC0A 5D6QA 3M6AA 3Q6NA 4LCHA 4DR5I 3J7AM 1XNQI 3EHJA 2O3ZA 3DGEA 2JE6B 2Z5BB 3G7EA 4X65E 4OZEA 4LF7E 1YT1A 1FWLA 4LF8I 4BA2B 1MX0A 1TILA 2Q8HA 4HXWA 5C0XC 2UWDA 1EI1A 4JI0I 5JEAD 5IWAI 4KSHA 5BR8E 1RR9A 3ZXQA 2EXLA 4OX9E 2ZDXA 1YC1A 4FW6A 4N3OA 4JI4I 1UYEA 4JI2I 2UUAI 1ZW9A 2VCIA 1VISA 2WI4A 2YEEA 1QY8A 5DRQA 4QPKA 3RKZA 5JEAB 3R4MA 4DV5E 4BA1A 2UUBI 3H80A 3PYDA 1FI4A 2HK3A 4HYMA 2ZM6E 3D4JA 4BA2A 3NZKA 1UYLA 2WI6A 2JEBA 4XTJA 4NXMI 3FT5A 1K47A 2YEBA 4O05A 4BQJA 5LMNI 2BTZA 4RPFA 3T1HI 2YE5A 4XCLA 3GCMA 1UY6A 4DV2I 4M1KA 1Y8PA 3CYGA 1YESA 2UUCI 1AH6A 4JYAE 3WU3A 1NHJA 5M4EA 4GKJE 2CZ9A 1QYEA 2BU7A 1XXEA 2E5LI 4AS9A 3B82A 2XD6A 1Y4SA 4DR5E 3CDJA 1XNQE 4X66E 2XDKA 5J6AA 4DV7I 2ZKJA 1Z0BA 4GKKI 5GMEA 4KQVA 4HXZA 4LF8E 1YERA 3D0BA 2QF6A 4KTNA 4ASAA 4BQGA 4LFBI 2CCSA 4EEHA 1TC0A 4QNKA 2O1TA 2BA1G 5F5RA 3Q1QA 2HKEA 1U2RA 4IZJD 5IWAE 4JI0E 4LF5I 1UYHA 4XCJA 4L90A 4CWPA 2C1IA 4WUBA 4JI4E 3R4OA 4JI2E 2UUAE 2J7KA 4GFNA 1KTVA 4DV1I 3K60A 1FNMA 2V2QA 3H1CA 4IZJB 2BRCA 4DUYI 1FJGI 3OW6A 2UUBE 4R3AA 3L7ZB 4DR4I 2WI2A 5C93A 5JEAC 2WI7A 2BYHA 4EMDA 2XJJA 4FMTA 4XKKA 4XE2A 3VADA 3GIEA 4NXME 4DV4E 4LF9I 1Z5CA 1RREA 2V2ZA 5LMNE 3B8HA 4MU4A 4B3TI 1YC3A 3HEKA 4O09A 1NHHA 3T1HE 4CE2A 4XDMA 2F1DA 2VQEI 2XDLA 3ZKBA 4LPFA 4Z7CA 4DV2E 2XHTA 4GEEA 4MOTA 1Y4UA 2PNMA 3GONA 2UUCE 4NH9A 3B27A 5FNCA 3PYGA 5LMUI 1ZWHA 2NN6F 4IZJA 4DR1I 4E00A 4XITA 2BT0A 3KE6A 4O07A 2FWYA 3L7ZA 2E5LE 5M4NA 3GMEA 1OYPA 4DUZI 5DNXA 2GQPA 1UYMA 4LPBA 1ZXNA 1MG7A 4DV7E 4OO1F 1N32I 2GQ0A 4JAVA 1FWKA 4GKKE 3WU5A 1BYQA 1YT0A 4L8ZA 1R6LA 3WU4A 3B25A 3NMQA 3QTFA 2WI5A 4EGHA 1Z5AA 1RHYA 4LFBE 4HY1A 4XKOA 4URMA 1U2OA 5K36D 2YE6A 4ASGA 1Z0GA 3T10A 4LF5E 2YKJA 4L91A 2XHXA 3J81C 4IFDF 2C39A 3CGZA 5M4HA 2GS8A 3HZ1A 3TTZA 2C38B 1Z0CA 3JAMC 2JEAB 2V2VA 2XX2A 1B62A 2HK2A 4JQLA 1BKNA 4DV1E 1N34I 2YE2A 4YKTA 2NN6C 3S5TA 4GQUA 1YC4A 1YHCA 4DUYE 1FJGE 3O2FA 4DR3I 4DR4E 1AJ6A 4LWHA 1N33I 1OYSA 3HULA 2WP8B 1A4HA 3WU6A 4OO1E 4UTGA 5IT9Q 1TIDA 3ZZ0A 4AWPA 4LF9E 4DZYA 4B3TE 1Y8OA 1ZXMA 4KSGA 2XABA 4GT8A 2BU2A 3T1KA 2VQEE 4FCQA 4LOMA 5C0XF 2DEIA 4LCFA 3B24A 3HZ5A 3M7NG 4P52A 4X64I 5LMUE 2IWUA 4IFDC 2X7IA 2CCUA 1ID0A 1YSZA 4KHPI 5EKWA 4DR6I 4DUZE 4ED4A 1HNWI 4EGKA 2WP8A 2IESA 1N32E 3A0RA 4EM7A 2YI6A 3R92A 4GQTA 3ZZTA 4U93A 3K1JA 3TZ5A 4OKGA 2K5BA 4H85A 5GGZA 3VHDA 2YKIA 4BA1B 3VHAA 5FWKA 2WEPA 3OTOI 2YGFA 1IBKI 3P3CA 3V2UC 1Y5YA 4DPYA 3HYYA 4W7TA 4J3DA 5CF0A 2JEBB 4MBCA 1YS3A 2UXCI 5DRPA 4Z7YA 5C0XE 1JM6A 3SL2A 3P3EA 1YH8A 5JENA 2V8PA 1H73A 1N34E 3INXA 2XDUA 3PS1A 5K36C 3OPDA 1OYRA 4USKA 4DR3E 2YEFA 1ZM3A 4MYTA 2C37A 3TZ4A 1N33E 1F51A 4ASBA 1Y60A 1GKZA 4PRXA 2R3VA 1N36I 1S16A 3EHHA 4DU8A 1OSFA 4LWGA 3PRYA 4FN5A 3LNUA 4NXNI 2VCJA 1Z0WA 4HACA 1HK7A 1TBWA 2BR2A 3FT8A 4IS9A 4KP4A 1TC6A 1IBLI 4NH7A 4KFGA 1KZNA 1YSRA 4X64E 4DPUA 5A2QQ 4FW7A 2YKCA 4FCPA 3QT5A 2VQFI 4KHPE 1L0OA 3GIGB 2BA1D 4DR6E 1HNWE 5EL9A 3A0TA 3PEJA 3WHAA 4MDTA 4USMA 1A6FA 4R3MA 1E3HA 3U1YA 4XIPA 2LJPA 4XIRA 3DD6A 5JEAF 4DPWA 2CH4A 3A0YA 1BXDA 2WEQA 3LMMA 1UDOA 3OWBA 2BU5A 3CRLA 4FWGA 1WUUA 1USVA 2FXSA 1OJ4A 2GO4A 2X36A 4EGIA 3OTOE 1IBKE 4HZ0A 5M4PA 3KRNA 4JI5I 1NZ0A 2UXCE 2JJCA 1IXMA 3GIGA 3O0IA 4HY6A 3TUHA 2H8MA 4YHHI 4B3RI 2YEGA 3T2SA 4LP0A 5ELWA 2BV3A 2BM0A 3B78A 4JI8I 4I5SA 4FW3A 2O1VA 2CCTA 2WI1A 4LFAI 3M85G 1U0ZA 4UROA 5FLXC 4HZ5A 3R91A 3EKRA 4DUHA 5BOCA 5DRRA 1N36E 2HHHI 5JEAE 1UDQA 2PO2A 1S14A 4NXNE 4X9LA 1Z0VA 3FV5A 2E1RA 1PIEA 4NH8A 3Q5LA 1IBLE 1UYFA 1UYGA 2HCHA 2YKEA 2XJXA 4E02A 3QDDA 2AE8A 1H72C 3LTOA 2XEXA 2IOQA 2VQFE 2HHIA 4MP7A 1H74A 3LPSA 4ASFA 2YE8A 4MPEA 2C39B 4CWRA 5CTUA 2AJ4A 3O6OA 2GFDA 3JZ3A 4XIQA 1B3QA 4OO1B 1H7SA 2HFUA 4E72A 4DXLA 1BGQA 1Y6ZA 1Z5BA 1D6TA 4BIUA 2AKPA 4YKUA 2PNZB 2BU8A 2YKBA 4CWQA 3UHMA 3B28A 4YKXA 4P8OA 3CWVA 4JI5E 1R6MA 3U1KA 4LF4I 3ZM7A 1UYDA 1ZM9A 1DARA 2YECA 3IEDA 2FYPA 2XK2A 5FNDA 1UDNA 1Z0EA 2VF3A 4YHHE 4B3RE 2C1GA 4CWNA 1UYCA 1NHIA 1USUA 2Q8IA 5BODA 2GO3A 4JI8E 4JASA 2CVEA 4OO1A 2NPFA 2NN6E 4LFAE 3M7ND 3P76A 1UDSA 1QZRA 4MYUA 4JI3I 2PNZA 3PEHA 2HHHE 4DV3I 3V5RA 1HR0I 5C0XD 4P7AA 4DV0I 2BA0G 1PKPA 4LF6I 3J80Q 1GKXA 4X62I 3PS3A 2Z5EA 1XNRI 4IFDA 3G7BA 4PL9A 5C0XB 4YKYA 1TH8A 2IORA 2E0AA 1Z59A 1AH8A 3CGYA 4Q20A 4DR1E 4IFDE 4AIMA 2O1UA 5K36F 4DPXA 3QT8A 4LFCI 3P06A 3PYFA 2Q8FA 5J71A 1HNXI 4B3MI 4DR2I 4B6CA 3HKMA 1Z0TA 2IWSA 2Z5CB 2JT2A 2C37B 3P3GA 2A2CA 4MB9A 4IZKA 5C0XA 2YEIA 4EMVA 2ZBKB 4LF4E 1P42A 3MNRP 4MP2A 5M4MA 3BM9A 1UY8A 3ZZUA 1I94I 4YKWA 2XX4A 4JI1I 1AM1A 2VW5A 2Q2EB 4HACB 2YEAA 2QG0A 2BR2B 3B26A 1I5DA 4WUDA 2YE3A 3ZXOA 1XMQI 4ZKIA 1ZM4A 2YI0A 4QPJA 4AIDA 5DNLA 5K36E 2YJWA 4JI3E 2Z5CA 2BM1A 4DV3E 1HR0E 2QG2A 4X66I 3RLRA 3A0WA 4DV0E 2UXDI 4K0KI 4LF6E 4BAEA 1E3PA 2EFGA 1GJVA 2ESAA 1N0VC 3GLLA 4UT4A 4X62E 2IWXA 4YKQA 1XNRE 2UU9I 2XX5A 4CE3A 4JI7I 1KKHA 5LL6R 2FTKA 1KIJA 2CGEA 3J7AG 5CPHA 4JI6I 2ZDYA 2R42A 2PNLA 5L3JA 4DV6I 4LFCE 2IOPA 4U3BA 3VHCA 4EFUA 1HNXE 2YK2A 1XHKA 4B3ME 4DR2E 4YKZA 2JE6A 2Z5BA 4CE1A 5CTWA 4PRVA 3HYZA 4FPPA 3J81Q 4MPCA 4BXIA 3T1YI 4URNA 4AQYI 2QFOA 3JAMQ 1UY9A 2HFSA 2CGFA 3B4TA 4JG4A 3M85D 1J5EI 4MU0A 4FCRA 3RLQA 3CRKA 4EFTA 2WI3A 2XDSA 2PO2B 2BYIA 4DV4I 1I94E 4B7PA 4JI1E 2YEHA 2WW4A 4PU9A 3PYEA 4CWFA 1IBMI 3R4NA 4V25A 3CDIA 5IN9A 3PS2A 2CG9A 1I5CA 2XJGA 1XMQE 4V26A 2A2DA 5IT9C 4LWEA 5JEAA 1UYKA 2BZ5A 3J80C 1I5AA 3TZ2A 4DR7I 3BMYA 4AM3A 3G75A 3HHUA 4HYPA 5D7DA 1KVKA 4ZVIA 2UXBI 2UXDE 4K0KE 3OMUA 1PVGA 2ZITA 2FWZA 2Q8GA 3U67A 3HJCA 2WNRB 2F4VI 5DROA 4FW4A 2UU9E 4R1FA 2YI7A 4CWSA 2NN6D 3EHFA 1N0UA 4YKRA 1XMOI 4JI7E 3A0XA 4MPNA 4B3SI 2YE4A 1R62A 2YEDA 5D6PA 3T0HA 4DU7A 2PO0B 4JI6E 3GIFA 4DV6E 4OO1D 2XDXA 2NN6B 1I5BA 3WQ9A 2O1WA 2J65A 3H4LA 4LWIA 2HKJA 4CWOA 5FNFA 1HNZI 2WNRA 3T1YE 4AQYE 3C0EA 3U2DA 4FWHA 4ISAA 2YE7A 1J5EE 4U7NA 1THNA 3K99A 3Q5KA 2YJXA 4IFDD 3ZKDA 1FKAE 1YETA 1UYIA 2PO0A 4NBQA 2BA0D 4YY3I 2HG1A 1VI7A 4MQYA 4L94A 4LWFA 1UEKA 2NN6A 1IBME
chains in the Genus database with same CATH topology
1US7A 4JAUA 5IDMA 1ELOA 4XKAA 5D7RA 4WUCA 4JV5I 1I58A 4O0BA 2YGAA 2XHRA 2WERA 5F3KA 3A0ZA 4GGLA 4DR7E 1I59A 2BU6A 4URLA 2YK9A 4AWQA 4I3HA 2UXBE 4FW9A 4DPTA 5A2QC 1YT2A 2H55A 2F4VE 4E01A 2DEJA 4X65I 3T0ZA 4LF7I 1S4EA 3K98A 2BREA 2PNRA 2YEJA 4L93A 5M4KA 1XMOE 3D2RA 2V34A 4XD8A 4IZKB 3OWDA 4B3SE 2OI2A 3Q6MA 1ZM2A 3TZ0A 2YGEA 3C11A 3R4PA 2C2AA 1H7UA 5BR8I 4OX9I 3EHGA 3K97A 3K17A 2YE9A 5GMDA 4U7OA 1EA6A 1HNZE 1Y8NA 2BSMA 2VWCA 4FWDA 4AWOA 4DV5I 1MU5A 5IDJA 1UY7A 5CTXA 2ZM6I 4CWTA 1AMWA 3INWA 5D7CA 3F0NA 1B63A 3Q5JA 3K85A 4YY3E 5FLXQ 4BIZA 5CTYA 2JKIA 4K4OA 4O04A 4H81A 3U2KA 4JV5E 3EKOA 2XCMA 3RLPA 3D36A 4H7QA 2YI5A 4JYAI 4GCZA 3QT7A 4GKJI 3QT6A 4XC0A 5D6QA 3M6AA 3Q6NA 3J7AM 4DR5I 1XNQI 3EHJA 3DGEA 2Z5BB 3G7EA 4X65E 1YT1A 4LF7E 1FWLA 4LF8I 1MX0A 1TILA 2Q8HA 4HXWA 2UWDA 1EI1A 4JI0I 5IWAI 4KSHA 5BR8E 1RR9A 3ZXQA 2EXLA 4OX9E 2ZDXA 1YC1A 4N3OA 4JI4I 1UYEA 4JI2I 2UUAI 1ZW9A 2VCIA 1VISA 2WI4A 2YEEA 1QY8A 4QPKA 3RKZA 3R4MA 4DV5E 2UUBI 3H80A 1FI4A 3PYDA 2HK3A 4HYMA 2ZM6E 3D4JA 1UYLA 2WI6A 4XTJA 4NXMI 3FT5A 1K47A 2YEBA 4O05A 4BQJA 5LMNI 2BTZA 4RPFA 3T1HI 2YE5A 4XCLA 1UY6A 4DV2I 4M1KA 1Y8PA 1YESA 2UUCI 1AH6A 4JYAE 3WU3A 1NHJA 5M4EA 4GKJE 2CZ9A 1QYEA 2BU7A 2E5LI 4AS9A 3B82A 2XD6A 1Y4SA 4DR5E 2XDKA 1XNQE 4X66E 5J6AA 4DV7I 2ZKJA 1Z0BA 4GKKI 5GMEA 4KQVA 4HXZA 4LF8E 1YERA 3D0BA 2QF6A 4KTNA 4ASAA 4BQGA 4LFBI 2CCSA 4EEHA 1TC0A 2O1TA 5F5RA 3Q1QA 2HKEA 1U2RA 4IZJD 5IWAE 4JI0E 4LF5I 1UYHA 4XCJA 4L90A 4CWPA 4WUBA 4JI4E 3R4OA 4JI2E 2UUAE 2J7KA 4GFNA 1KTVA 4DV1I 3K60A 1FNMA 2V2QA 4IZJB 2BRCA 3OW6A 4DUYI 1FJGI 4R3AA 2UUBE 4DR4I 2WI2A 5C93A 2WI7A 2XJJA 2BYHA 4EMDA 4FMTA 4XKKA 4XE2A 3VADA 3GIEA 4NXME 4DV4E 4LF9I 1Z5CA 1RREA 2V2ZA 5LMNE 3B8HA 4B3TI 3HEKA 1YC3A 4O09A 1NHHA 3T1HE 4CE2A 4XDMA 2VQEI 2XDLA 3ZKBA 4Z7CA 4DV2E 2XHTA 4GEEA 4MOTA 1Y4UA 2PNMA 3GONA 2UUCE 4NH9A 3B27A 5FNCA 3PYGA 5LMUI 1ZWHA 4E00A 4IZJA 4DR1I 4XITA 2BT0A 3KE6A 4O07A 2FWYA 2E5LE 5M4NA 4DUZI 2GQPA 4LPBA 1UYMA 1ZXNA 1MG7A 4DV7E 1N32I 2GQ0A 4JAVA 1FWKA 4GKKE 3WU5A 1BYQA 1YT0A 4L8ZA 3WU4A 3B25A 3NMQA 3QTFA 2WI5A 4EGHA 1Z5AA 4LFBE 4HY1A 4XKOA 4URMA 1U2OA 2YE6A 4ASGA 1Z0GA 3T10A 4LF5E 2YKJA 4L91A 2XHXA 3J81C 3CGZA 5M4HA 2GS8A 3HZ1A 3TTZA 3JAMC 1Z0CA 2XX2A 2V2VA 1B62A 2HK2A 4JQLA 1BKNA 4DV1E 1N34I 2YE2A 4YKTA 1YC4A 4DUYE 1FJGE 3O2FA 4DR3I 4DR4E 1AJ6A 4LWHA 1N33I 3HULA 1A4HA 3WU6A 4UTGA 5IT9Q 1TIDA 3ZZ0A 4AWPA 4LF9E 4DZYA 4B3TE 1Y8OA 1ZXMA 4KSGA 2XABA 4GT8A 2BU2A 3T1KA 2VQEE 4FCQA 2DEIA 3B24A 3HZ5A 4P52A 4X64I 5LMUE 2IWUA 2X7IA 2CCUA 1ID0A 1YSZA 4KHPI 4EGKA 4DR6I 4DUZE 4ED4A 1HNWI 3A0RA 1N32E 4EM7A 2YI6A 3R92A 4GQTA 3ZZTA 4U93A 3K1JA 3TZ5A 5GGZA 2K5BA 4H85A 3VHDA 2YKIA 3VHAA 5FWKA 2WEPA 3OTOI 2YGFA 1IBKI 4W7TA 3V2UC 4DPYA 3HYYA 5CF0A 4MBCA 1YS3A 2UXCI 4Z7YA 1JM6A 3SL2A 2V8PA 1H73A 1N34E 3INXA 2XDUA 3OPDA 4USKA 4DR3E 2YEFA 1ZM3A 4MYTA 3TZ4A 1N33E 4ASBA 1GKZA 4PRXA 2R3VA 1N36I 1S16A 3EHHA 4DU8A 1OSFA 4LWGA 3PRYA 4FN5A 3LNUA 4NXNI 2VCJA 1Z0WA 4HACA 1HK7A 1TBWA 3FT8A 4KP4A 1TC6A 1IBLI 4NH7A 4KFGA 1KZNA 1YSRA 4X64E 4DPUA 5A2QQ 2YKCA 4FCPA 3QT5A 2VQFI 4KHPE 1L0OA 3GIGB 3PEJA 4DR6E 1HNWE 3A0TA 3QDDA 3WHAA 4USMA 1A6FA 4R3MA 4XIPA 2LJPA 4XIRA 4DPWA 2CH4A 3A0YA 1BXDA 2WEQA 3OWBA 2BU5A 3CRLA 4FWGA 1WUUA 1USVA 2FXSA 1OJ4A 2X36A 4EGIA 3OTOE 1IBKE 4HZ0A 5M4PA 4JI5I 1NZ0A 2UXCE 2JJCA 3O0IA 3GIGA 4HY6A 3TUHA 2H8MA 4YHHI 4B3RI 2YEGA 3T2SA 4LP0A 2BV3A 2BM0A 3B78A 4JI8I 4I5SA 2O1VA 2CCTA 2WI1A 4LFAI 4UROA 1U0ZA 4DUHA 5FLXC 4HZ5A 3R91A 3EKRA 5BOCA 1N36E 2HHHI 1S14A 4NXNE 4X9LA 1Z0VA 3FV5A 2E1RA 1PIEA 4NH8A 3Q5LA 1IBLE 1UYFA 1UYGA 2HCHA 2YKEA 2XJXA 4E02A 1H72C 3LTOA 2XEXA 2IOQA 2VQFE 4MP7A 1H74A 3LPSA 4ASFA 2YE8A 4MPEA 4CWRA 5CTUA 2AJ4A 3O6OA 2GFDA 3JZ3A 4XIQA 1B3QA 1H7SA 2HFUA 4DXLA 1BGQA 1Y6ZA 1Z5BA 1D6TA 4BIUA 2AKPA 4YKUA 2BU8A 2YKBA 4CWQA 3B28A 4YKXA 4P8OA 3CWVA 4JI5E 4LF4I 3ZM7A 1UYDA 1ZM9A 1DARA 2YECA 3IEDA 2FYPA 2XK2A 5FNDA 2VF3A 1Z0EA 4YHHE 4B3RE 4CWNA 1UYCA 1NHIA 1USUA 2Q8IA 5BODA 4JI8E 4JASA 2NPFA 4LFAE 1QZRA 4MYUA 4JI3I 3PEHA 2HHHE 4DV3I 3V5RA 1HR0I 4P7AA 4DV0I 1PKPA 4LF6I 3J80Q 1GKXA 4X62I 3G7BA 2Z5EA 1XNRI 4PL9A 4YKYA 1TH8A 2IORA 2E0AA 1Z59A 1AH8A 3CGYA 4Q20A 4DR1E 2O1UA 4DPXA 3QT8A 4LFCI 3P06A 3PYFA 2Q8FA 5J71A 1HNXI 4B3MI 4DR2I 4B6CA 1Z0TA 2IWSA 2Z5CB 2A2CA 4MB9A 4IZKA 2YEIA 4EMVA 2ZBKB 4LF4E 3MNRP 4MP2A 5M4MA 3BM9A 1UY8A 3ZZUA 1I94I 4YKWA 2XX4A 4JI1I 1AM1A 2VW5A 2Q2EB 4HACB 2YEAA 2QG0A 3B26A 1I5DA 4WUDA 2YE3A 3ZXOA 1XMQI 4ZKIA 1ZM4A 2YI0A 4QPJA 2YJWA 4JI3E 2Z5CA 2BM1A 4DV3E 1HR0E 2QG2A 4X66I 3RLRA 3A0WA 4DV0E 2UXDI 4K0KI 4LF6E 4BAEA 2EFGA 1GJVA 2ESAA 1N0VC 4UT4A 4X62E 2IWXA 4YKQA 1XNRE 2UU9I 2XX5A 4CE3A 4JI7I 1KKHA 5LL6R 1KIJA 2CGEA 3J7AG 5CPHA 4JI6I 2ZDYA 2R42A 2PNLA 5L3JA 4DV6I 4LFCE 2IOPA 3VHCA 4EFUA 1HNXE 2YK2A 1XHKA 4B3ME 4DR2E 4YKZA 2Z5BA 4CE1A 5CTWA 4PRVA 3HYZA 4FPPA 3J81Q 4MPCA 4BXIA 3T1YI 4URNA 4AQYI 2QFOA 3JAMQ 1UY9A 2HFSA 2CGFA 1J5EI 4JG4A 4FCRA 3RLQA 4EFTA 3CRKA 2WI3A 2XDSA 4B7PA 2BYIA 4DV4I 1I94E 4JI1E 2YEHA 2WW4A 4PU9A 3PYEA 4CWFA 1IBMI 3R4NA 4V25A 5IN9A 2CG9A 1I5CA 2XJGA 1XMQE 4V26A 2A2DA 5IT9C 4LWEA 1UYKA 2BZ5A 3J80C 1I5AA 3TZ2A 4DR7I 3G75A 5D7DA 3HHUA 4HYPA 1KVKA 4ZVIA 2UXBI 2UXDE 4K0KE 3OMUA 1PVGA 2ZITA 2FWZA 2Q8GA 3U67A 3HJCA 2F4VI 2UU9E 4R1FA 2YI7A 4CWSA 3EHFA 1N0UA 4YKRA 1XMOI 4JI7E 3A0XA 4MPNA 4B3SI 2YE4A 1R62A 2YEDA 5D6PA 3T0HA 4DU7A 4JI6E 3GIFA 4DV6E 2XDXA 1I5BA 3WQ9A 2O1WA 3H4LA 4LWIA 2HKJA 4CWOA 5FNFA 1HNZI 3T1YE 4AQYE 3C0EA 3U2DA 4FWHA 2YE7A 1J5EE 4U7NA 1THNA 3K99A 3Q5KA 2YJXA 3ZKDA 1FKAE 1YETA 1UYIA 4YY3I 2HG1A 4L94A 3BMYA 4LWFA 1UEKA 1IBME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1US7 A;  4JAU A;  5IDM A;  1ELO A;  4XKA A;  5D7R A;  4WUC A;  4JV5 I;  1I58 A;  4O0B A;  2YGA A;  2XHR A;  2WER A;  5F3K A;  3A0Z A;  4GGL A;  4DR7 E;  1I59 A;  2BU6 A;  4URL A;  2YK9 A;  4AWQ A;  4I3H A;  2UXB E;  4FW9 A;  4DPT A;  5A2Q C;  1YT2 A;  2H55 A;  2F4V E;  4E01 A;  2DEJ A;  4X65 I;  3T0Z A;  4LF7 I;  1S4E A;  3K98 A;  2BRE A;  2PNR A;  2YEJ A;  4L93 A;  5M4K A;  1XMO E;  3D2R A;  2V34 A;  4XD8 A;  3OWD A;  4B3S E;  2OI2 A;  1ZM2 A;  3TZ0 A;  2YGE A;  3C11 A;  3R4P A;  2C2A A;  1H7U A;  5BR8 I;  4OX9 I;  3EHG A;  3K97 A;  3K17 A;  2YE9 A;  5GMD A;  4U7O A;  1EA6 A;  1HNZ E;  1Y8N A;  2BSM A;  2VWC A;  4FWD A;  4AWO A;  4DV5 I;  1MU5 A;  5IDJ A;  1UY7 A;  5CTX A;  2ZM6 I;  4CWT A;  1AMW A;  3INW A;  5D7C A;  3F0N A;  1B63 A;  3Q5J A;  4YY3 E;  5FLX Q;  4BIZ A;  5CTY A;  2JKI A;  4K4O A;  4O04 A;  4H81 A;  3U2K A;  4JV5 E;  3EKO A;  2XCM A;  3RLP A;  3D36 A;  4H7Q A;  2YI5 A;  4JYA I;  4GCZ A;  3QT7 A;  4GKJ I;  3QT6 A;  4XC0 A;  5D6Q A;  3M6A A;  3J7A M;  4DR5 I;  1XNQ I;  3EHJ A;  3DGE A;  3G7E A;  4X65 E;  1YT1 A;  4LF7 E;  1FWL A;  4LF8 I;  1MX0 A;  1TIL A;  2Q8H A;  4HXW A;  2UWD A;  1EI1 A;  4JI0 I;  5IWA I;  4KSH A;  5BR8 E;  1RR9 A;  3ZXQ A;  2EXL A;  4OX9 E;  2ZDX A;  1YC1 A;  4JI4 I;  1UYE A;  4JI2 I;  2UUA I;  1ZW9 A;  2VCI A;  1VIS A;  2WI4 A;  2YEE A;  1QY8 A;  4QPK A;  3RKZ A;  3R4M A;  4DV5 E;  2UUB I;  3H80 A;  1FI4 A;  3PYD A;  2HK3 A;  4HYM A;  2ZM6 E;  3D4J A;  1UYL A;  2WI6 A;  4XTJ A;  4NXM I;  3FT5 A;  1K47 A;  2YEB A;  4O05 A;  4BQJ A;  5LMN I;  2BTZ A;  4RPF A;  3T1H I;  2YE5 A;  4XCL A;  1UY6 A;  4DV2 I;  4M1K A;  1Y8P A;  1YES A;  2UUC I;  1AH6 A;  4JYA E;  3WU3 A;  1NHJ A;  5M4E A;  4GKJ E;  2CZ9 A;  1QYE A;  2BU7 A;  2E5L I;  4AS9 A;  3B82 A;  2XD6 A;  1Y4S A;  4DR5 E;  2XDK A;  1XNQ E;  4X66 E;  5J6A A;  4DV7 I;  2ZKJ A;  1Z0B A;  4GKK I;  5GME A;  4KQV A;  4HXZ A;  4LF8 E;  1YER A;  3D0B A;  2QF6 A;  4KTN A;  4ASA A;  4BQG A;  4LFB I;  2CCS A;  4EEH A;  1TC0 A;  5F5R A;  3Q1Q A;  2HKE A;  1U2R A;  4LF5 I;  5IWA E;  4JI0 E;  4CWP A;  1UYH A;  4XCJ A;  4L90 A;  4WUB A;  4JI4 E;  3R4O A;  4JI2 E;  2UUA E;  2J7K A;  4GFN A;  1KTV A;  4DV1 I;  3K60 A;  1FNM A;  2V2Q A;  2BRC A;  4R3A A;  3OW6 A;  4DUY I;  1FJG I;  2UUB E;  4DR4 I;  2WI2 A;  5C93 A;  2WI7 A;  2XJJ A;  2BYH A;  4EMD A;  4FMT A;  4XKK A;  4XE2 A;  3VAD A;  3GIE A;  4NXM E;  4DV4 E;  4LF9 I;  1Z5C A;  1RRE A;  2V2Z A;  5LMN E;  3B8H A;  4B3T I;  3HEK A;  1YC3 A;  4O09 A;  1NHH A;  3T1H E;  4CE2 A;  4XDM A;  2VQE I;  2XDL A;  3ZKB A;  4Z7C A;  4DV2 E;  2XHT A;  4GEE A;  4MOT A;  2UUC E;  1Y4U A;  3GON A;  4NH9 A;  3B27 A;  5FNC A;  3PYG A;  5LMU I;  1ZWH A;  4E00 A;  4DR1 I;  4XIT A;  2BT0 A;  3KE6 A;  4O07 A;  2FWY A;  2E5L E;  5M4N A;  4DUZ I;  2GQP A;  4LPB A;  1UYM A;  1ZXN A;  1MG7 A;  4DV7 E;  1N32 I;  4JAV A;  1FWK A;  4GKK E;  3WU5 A;  1BYQ A;  1YT0 A;  4L8Z A;  3WU4 A;  3B25 A;  3NMQ A;  3QTF A;  2WI5 A;  4EGH A;  1Z5A A;  4LFB E;  4HY1 A;  4XKO A;  4URM A;  1U2O A;  2YE6 A;  4ASG A;  1Z0G A;  3T10 A;  4LF5 E;  2YKJ A;  4L91 A;  2XHX A;  3J81 C;  3CGZ A;  5M4H A;  2GS8 A;  3HZ1 A;  3TTZ A;  3JAM C;  1Z0C A;  2XX2 A;  2V2V A;  1B62 A;  2HK2 A;  4JQL A;  1BKN A;  4DV1 E;  1N34 I;  2YE2 A;  4YKT A;  1YC4 A;  4DUY E;  1FJG E;  3O2F A;  4DR3 I;  4DR4 E;  1AJ6 A;  4LWH A;  1N33 I;  3HUL A;  1A4H A;  3WU6 A;  4UTG A;  5IT9 Q;  1TID A;  3ZZ0 A;  4AWP A;  4LF9 E;  4DZY A;  4B3T E;  1Y8O A;  1ZXM A;  4KSG A;  2XAB A;  4GT8 A;  2BU2 A;  3T1K A;  2VQE E;  4FCQ A;  2DEI A;  3B24 A;  3HZ5 A;  4P52 A;  4X64 I;  5LMU E;  2IWU A;  2X7I A;  2CCU A;  1ID0 A;  1YSZ A;  4KHP I;  4EGK A;  4DR6 I;  4DUZ E;  4ED4 A;  1HNW I;  3A0R A;  1N32 E;  4EM7 A;  2YI6 A;  3R92 A;  4GQT A;  3ZZT A;  4U93 A;  3K1J A;  3TZ5 A;  5GGZ A;  2K5B A;  4H85 A;  3VHD A;  2YKI A;  3VHA A;  5FWK A;  2WEP A;  3OTO I;  2YGF A;  1IBK I;  4W7T A;  3V2U C;  4DPY A;  3HYY A;  5CF0 A;  4MBC A;  1YS3 A;  2UXC I;  4Z7Y A;  1JM6 A;  3SL2 A;  2V8P A;  1H73 A;  1N34 E;  3INX A;  2XDU A;  3OPD A;  4USK A;  4DR3 E;  2YEF A;  1ZM3 A;  4MYT A;  3TZ4 A;  1N33 E;  4ASB A;  1GKZ A;  4PRX A;  2R3V A;  1N36 I;  1S16 A;  3EHH A;  4DU8 A;  1OSF A;  4LWG A;  4FN5 A;  3LNU A;  4NXN I;  2VCJ A;  1Z0W A;  4HAC A;  1TBW A;  3FT8 A;  4KP4 A;  1TC6 A;  1IBL I;  4NH7 A;  4KFG A;  1KZN A;  1YSR A;  4X64 E;  4DPU A;  5A2Q Q;  2YKC A;  4FCP A;  3QT5 A;  2VQF I;  4KHP E;  1L0O A;  3GIG B;  3PEJ A;  4DR6 E;  1HNW E;  3A0T A;  3QDD A;  3WHA A;  4USM A;  1A6F A;  4R3M A;  4XIP A;  2LJP A;  4XIR A;  4DPW A;  2CH4 A;  3A0Y A;  1BXD A;  2WEQ A;  3OWB A;  2BU5 A;  3CRL A;  4FWG A;  1WUU A;  2FXS A;  4EGI A;  1OJ4 A;  2X36 A;  3OTO E;  1IBK E;  4HZ0 A;  5M4P A;  4JI5 I;  1NZ0 A;  2UXC E;  2JJC A;  3O0I A;  3GIG A;  4HY6 A;  3TUH A;  2H8M A;  4YHH I;  4B3R I;  2YEG A;  3T2S A;  4LP0 A;  2BV3 A;  2BM0 A;  3B78 A;  4JI8 I;  4I5S A;  2O1V A;  2CCT A;  2WI1 A;  4LFA I;  4URO A;  1U0Z A;  4DUH A;  5FLX C;  4HZ5 A;  3R91 A;  3EKR A;  5BOC A;  1N36 E;  2HHH I;  1S14 A;  4NXN E;  4X9L A;  1Z0V A;  3FV5 A;  2E1R A;  1PIE A;  4NH8 A;  3Q5L A;  1IBL E;  1UYF A;  1UYG A;  2HCH A;  2YKE A;  2XJX A;  4E02 A;  1H72 C;  3LTO A;  2XEX A;  2IOQ A;  2VQF E;  4MP7 A;  1H74 A;  3LPS A;  4ASF A;  2YE8 A;  4MPE A;  4CWR A;  5CTU A;  2AJ4 A;  3O6O A;  2GFD A;  3JZ3 A;  4XIQ A;  1B3Q A;  1H7S A;  2HFU A;  4DXL A;  1BGQ A;  1Z5B A;  1D6T A;  4BIU A;  2AKP A;  4YKU A;  2BU8 A;  2YKB A;  4CWQ A;  3B28 A;  4YKX A;  4P8O A;  3CWV A;  4JI5 E;  4LF4 I;  3ZM7 A;  1UYD A;  1ZM9 A;  1DAR A;  2YEC A;  3IED A;  2FYP A;  2XK2 A;  5FND A;  2VF3 A;  1Z0E A;  4YHH E;  4B3R E;  4CWN A;  1UYC A;  1NHI A;  5BOD A;  2Q8I A;  4JI8 E;  4JAS A;  2NPF A;  4LFA E;  1QZR A;  4MYU A;  4JI3 I;  3PEH A;  2HHH E;  4DV3 I;  3V5R A;  1HR0 I;  4P7A A;  4DV0 I;  1PKP A;  4LF6 I;  3J80 Q;  1GKX A;  4X62 I;  3G7B A;  4PL9 A;  1XNR I;  4YKY A;  1TH8 A;  2IOR A;  2E0A A;  1Z59 A;  1AH8 A;  3CGY A;  4Q20 A;  4DR1 E;  2O1U A;  4DPX A;  3QT8 A;  4LFC I;  3PYF A;  2Q8F A;  5J71 A;  1HNX I;  4B3M I;  4DR2 I;  4B6C A;  1Z0T A;  2IWS A;  2A2C A;  4MB9 A;  2YEI A;  4EMV A;  2ZBK B;  4LF4 E;  3MNR P;  4MP2 A;  5M4M A;  3BM9 A;  1UY8 A;  3ZZU A;  1I94 I;  4YKW A;  2XX4 A;  4JI1 I;  1AM1 A;  2VW5 A;  2Q2E B;  4HAC B;  2YEA A;  2QG0 A;  3B26 A;  1I5D A;  4WUD A;  2YE3 A;  3ZXO A;  1XMQ I;  4ZKI A;  1ZM4 A;  2YI0 A;  4QPJ A;  2YJW A;  4JI3 E;  2BM1 A;  4DV3 E;  1HR0 E;  2QG2 A;  4X66 I;  3RLR A;  3A0W A;  4DV0 E;  2UXD I;  4K0K I;  4LF6 E;  4BAE A;  2EFG A;  1GJV A;  2ESA A;  1N0V C;  4UT4 A;  4X62 E;  2IWX A;  4YKQ A;  1XNR E;  2UU9 I;  2XX5 A;  4CE3 A;  4JI7 I;  1KKH A;  5LL6 R;  1KIJ A;  3J7A G;  5CPH A;  4JI6 I;  2ZDY A;  2R42 A;  4DV6 I;  5L3J A;  4LFC E;  2IOP A;  3VHC A;  4EFU A;  1HNX E;  2YK2 A;  1XHK A;  4B3M E;  4DR2 E;  4YKZ A;  4CE1 A;  5CTW A;  4PRV A;  3HYZ A;  4FPP A;  3J81 Q;  4MPC A;  4BXI A;  3T1Y I;  4URN A;  4AQY I;  2QFO A;  3JAM Q;  1UY9 A;  2HFS A;  2CGF A;  1J5E I;  4JG4 A;  4FCR A;  3RLQ A;  4EFT A;  3CRK A;  2WI3 A;  2XDS A;  4B7P A;  2BYI A;  4DV4 I;  1I94 E;  4JI1 E;  2YEH A;  2WW4 A;  4PU9 A;  3PYE A;  4CWF A;  1IBM I;  3R4N A;  4V25 A;  5IN9 A;  1I5C A;  2CG9 A;  2XJG A;  1XMQ E;  4V26 A;  2A2D A;  5IT9 C;  4LWE A;  1UYK A;  2BZ5 A;  3J80 C;  1I5A A;  3TZ2 A;  4DR7 I;  3G75 A;  5D7D A;  3HHU A;  4HYP A;  1KVK A;  4ZVI A;  2UXB I;  2UXD E;  4K0K E;  3OMU A;  1PVG A;  2ZIT A;  2FWZ A;  2Q8G A;  3U67 A;  2F4V I;  2UU9 E;  4R1F A;  2YI7 A;  4CWS A;  3EHF A;  1N0U A;  4YKR A;  1XMO I;  4JI7 E;  3A0X A;  4MPN A;  4B3S I;  2YE4 A;  1R62 A;  2YED A;  5D6P A;  3T0H A;  4DU7 A;  4JI6 E;  3GIF A;  4DV6 E;  2XDX A;  1I5B A;  3WQ9 A;  2O1W A;  3H4L A;  4LWI A;  2HKJ A;  4CWO A;  5FNF A;  1HNZ I;  3T1Y E;  4AQY E;  3C0E A;  3U2D A;  4FWH A;  2YE7 A;  1J5E E;  4U7N A;  1THN A;  3K99 A;  3Q5K A;  2YJX A;  3ZKD A;  1FKA E;  1YET A;  1UYI A;  4YY3 I;  2HG1 A;  4L94 A;  3BMY A;  4LWF A;  1UEK A;  1IBM E; 
#chains in the Genus database with same CATH topology
 1US7 A;  4JAU A;  4IFD B;  5IDM A;  1ELO A;  4XKA A;  5D7R A;  4FW5 A;  4WUC A;  4JV5 I;  1I58 A;  4O0B A;  2YGA A;  2XHR A;  2WER A;  5F3K A;  3A0Z A;  4GGL A;  4DR7 E;  1I59 A;  2VES A;  4URL A;  2BU6 A;  2YK9 A;  4AWQ A;  4I3H A;  4LCG A;  2UXB E;  4FW9 A;  2PO1 B;  4DPT A;  5A2Q C;  1YT2 A;  2H55 A;  2F4V E;  4E01 A;  2DEJ A;  4X65 I;  3T0Z A;  4LF7 I;  1S4E A;  3K98 A;  2BRE A;  2PNR A;  2YEJ A;  4L93 A;  5M4K A;  1XMO E;  3D2R A;  2V34 A;  4XD8 A;  4IZK B;  3OWD A;  4B3S E;  2OI2 A;  3Q6M A;  1ZM2 A;  3TZ0 A;  2YGE A;  3C11 A;  3R4P A;  2C2A A;  1H7U A;  5K36 B;  5BR8 I;  4OX9 I;  3EHG A;  3K97 A;  3K17 A;  2YE9 A;  4MU1 A;  5GMD A;  2IER A;  2PO1 A;  4U7O A;  1EA6 A;  1HNZ E;  1Y8N A;  2BSM A;  2VWC A;  4FWD A;  4AWO A;  4MU3 A;  4OO1 C;  4DV5 I;  1MU5 A;  5IDJ A;  1UY7 A;  5CTX A;  2ZM6 I;  4CWT A;  1AMW A;  3INW A;  5D7C A;  3F0N A;  1B63 A;  3Q5J A;  3K85 A;  4YY3 E;  5FLX Q;  4U3D A;  4BIZ A;  2C38 A;  2JKI A;  2JEA A;  4K4O A;  5CTY A;  5K36 A;  4O04 A;  4QNJ A;  4H81 A;  3U2K A;  4JV5 E;  3EKO A;  2XCM A;  3RLP A;  3D36 A;  4H7Q A;  2YI5 A;  4JYA I;  4GCZ A;  3QT7 A;  4GKJ I;  3QT6 A;  4XC0 A;  5D6Q A;  3M6A A;  3Q6N A;  4LCH A;  4DR5 I;  3J7A M;  1XNQ I;  3EHJ A;  2O3Z A;  3DGE A;  2JE6 B;  2Z5B B;  3G7E A;  4X65 E;  4OZE A;  4LF7 E;  1YT1 A;  1FWL A;  4LF8 I;  4BA2 B;  1MX0 A;  1TIL A;  2Q8H A;  4HXW A;  5C0X C;  2UWD A;  1EI1 A;  4JI0 I;  5JEA D;  5IWA I;  4KSH A;  5BR8 E;  1RR9 A;  3ZXQ A;  2EXL A;  4OX9 E;  2ZDX A;  1YC1 A;  4FW6 A;  4N3O A;  4JI4 I;  1UYE A;  4JI2 I;  2UUA I;  1ZW9 A;  2VCI A;  1VIS A;  2WI4 A;  2YEE A;  1QY8 A;  5DRQ A;  4QPK A;  3RKZ A;  5JEA B;  3R4M A;  4DV5 E;  4BA1 A;  2UUB I;  3H80 A;  3PYD A;  1FI4 A;  2HK3 A;  4HYM A;  2ZM6 E;  3D4J A;  4BA2 A;  3NZK A;  1UYL A;  2WI6 A;  2JEB A;  4XTJ A;  4NXM I;  3FT5 A;  1K47 A;  2YEB A;  4O05 A;  4BQJ A;  5LMN I;  2BTZ A;  4RPF A;  3T1H I;  2YE5 A;  4XCL A;  3GCM A;  1UY6 A;  4DV2 I;  4M1K A;  1Y8P A;  3CYG A;  1YES A;  2UUC I;  1AH6 A;  4JYA E;  3WU3 A;  1NHJ A;  5M4E A;  4GKJ E;  2CZ9 A;  1QYE A;  2BU7 A;  1XXE A;  2E5L I;  4AS9 A;  3B82 A;  2XD6 A;  1Y4S A;  4DR5 E;  3CDJ A;  1XNQ E;  4X66 E;  2XDK A;  5J6A A;  4DV7 I;  2ZKJ A;  1Z0B A;  4GKK I;  5GME A;  4KQV A;  4HXZ A;  4LF8 E;  1YER A;  3D0B A;  2QF6 A;  4KTN A;  4ASA A;  4BQG A;  4LFB I;  2CCS A;  4EEH A;  1TC0 A;  4QNK A;  2O1T A;  2BA1 G;  5F5R A;  3Q1Q A;  2HKE A;  1U2R A;  4IZJ D;  5IWA E;  4JI0 E;  4LF5 I;  1UYH A;  4XCJ A;  4L90 A;  4CWP A;  2C1I A;  4WUB A;  4JI4 E;  3R4O A;  4JI2 E;  2UUA E;  2J7K A;  4GFN A;  1KTV A;  4DV1 I;  3K60 A;  1FNM A;  2V2Q A;  3H1C A;  4IZJ B;  2BRC A;  4DUY I;  1FJG I;  3OW6 A;  2UUB E;  4R3A A;  3L7Z B;  4DR4 I;  2WI2 A;  5C93 A;  5JEA C;  2WI7 A;  2BYH A;  4EMD A;  2XJJ A;  4FMT A;  4XKK A;  4XE2 A;  3VAD A;  3GIE A;  4NXM E;  4DV4 E;  4LF9 I;  1Z5C A;  1RRE A;  2V2Z A;  5LMN E;  3B8H A;  4MU4 A;  4B3T I;  1YC3 A;  3HEK A;  4O09 A;  1NHH A;  3T1H E;  4CE2 A;  4XDM A;  2F1D A;  2VQE I;  2XDL A;  3ZKB A;  4LPF A;  4Z7C A;  4DV2 E;  2XHT A;  4GEE A;  4MOT A;  1Y4U A;  2PNM A;  3GON A;  2UUC E;  4NH9 A;  3B27 A;  5FNC A;  3PYG A;  5LMU I;  1ZWH A;  2NN6 F;  4IZJ A;  4DR1 I;  4E00 A;  4XIT A;  2BT0 A;  3KE6 A;  4O07 A;  2FWY A;  3L7Z A;  2E5L E;  5M4N A;  3GME A;  1OYP A;  4DUZ I;  5DNX A;  2GQP A;  1UYM A;  4LPB A;  1ZXN A;  1MG7 A;  4DV7 E;  4OO1 F;  1N32 I;  2GQ0 A;  4JAV A;  1FWK A;  4GKK E;  3WU5 A;  1BYQ A;  1YT0 A;  4L8Z A;  1R6L A;  3WU4 A;  3B25 A;  3NMQ A;  3QTF A;  2WI5 A;  4EGH A;  1Z5A A;  1RHY A;  4LFB E;  4HY1 A;  4XKO A;  4URM A;  1U2O A;  5K36 D;  2YE6 A;  4ASG A;  1Z0G A;  3T10 A;  4LF5 E;  2YKJ A;  4L91 A;  2XHX A;  3J81 C;  4IFD F;  2C39 A;  3CGZ A;  5M4H A;  2GS8 A;  3HZ1 A;  3TTZ A;  2C38 B;  1Z0C A;  3JAM C;  2JEA B;  2V2V A;  2XX2 A;  1B62 A;  2HK2 A;  4JQL A;  1BKN A;  4DV1 E;  1N34 I;  2YE2 A;  4YKT A;  2NN6 C;  3S5T A;  4GQU A;  1YC4 A;  1YHC A;  4DUY E;  1FJG E;  3O2F A;  4DR3 I;  4DR4 E;  1AJ6 A;  4LWH A;  1N33 I;  1OYS A;  3HUL A;  2WP8 B;  1A4H A;  3WU6 A;  4OO1 E;  4UTG A;  5IT9 Q;  1TID A;  3ZZ0 A;  4AWP A;  4LF9 E;  4DZY A;  4B3T E;  1Y8O A;  1ZXM A;  4KSG A;  2XAB A;  4GT8 A;  2BU2 A;  3T1K A;  2VQE E;  4FCQ A;  4LOM A;  5C0X F;  2DEI A;  4LCF A;  3B24 A;  3HZ5 A;  3M7N G;  4P52 A;  4X64 I;  5LMU E;  2IWU A;  4IFD C;  2X7I A;  2CCU A;  1ID0 A;  1YSZ A;  4KHP I;  5EKW A;  4DR6 I;  4DUZ E;  4ED4 A;  1HNW I;  4EGK A;  2WP8 A;  2IES A;  1N32 E;  3A0R A;  4EM7 A;  2YI6 A;  3R92 A;  4GQT A;  3ZZT A;  4U93 A;  3K1J A;  3TZ5 A;  4OKG A;  2K5B A;  4H85 A;  5GGZ A;  3VHD A;  2YKI A;  4BA1 B;  3VHA A;  5FWK A;  2WEP A;  3OTO I;  2YGF A;  1IBK I;  3P3C A;  3V2U C;  1Y5Y A;  4DPY A;  3HYY A;  4W7T A;  4J3D A;  5CF0 A;  2JEB B;  4MBC A;  1YS3 A;  2UXC I;  5DRP A;  4Z7Y A;  5C0X E;  1JM6 A;  3SL2 A;  3P3E A;  1YH8 A;  5JEN A;  2V8P A;  1H73 A;  1N34 E;  3INX A;  2XDU A;  3PS1 A;  5K36 C;  3OPD A;  1OYR A;  4USK A;  4DR3 E;  2YEF A;  1ZM3 A;  4MYT A;  2C37 A;  3TZ4 A;  1N33 E;  1F51 A;  4ASB A;  1Y60 A;  1GKZ A;  4PRX A;  2R3V A;  1N36 I;  1S16 A;  3EHH A;  4DU8 A;  1OSF A;  4LWG A;  3PRY A;  4FN5 A;  3LNU A;  4NXN I;  2VCJ A;  1Z0W A;  4HAC A;  1HK7 A;  1TBW A;  2BR2 A;  3FT8 A;  4IS9 A;  4KP4 A;  1TC6 A;  1IBL I;  4NH7 A;  4KFG A;  1KZN A;  1YSR A;  4X64 E;  4DPU A;  5A2Q Q;  4FW7 A;  2YKC A;  4FCP A;  3QT5 A;  2VQF I;  4KHP E;  1L0O A;  3GIG B;  2BA1 D;  4DR6 E;  1HNW E;  5EL9 A;  3A0T A;  3PEJ A;  3WHA A;  4MDT A;  4USM A;  1A6F A;  4R3M A;  1E3H A;  3U1Y A;  4XIP A;  2LJP A;  4XIR A;  3DD6 A;  5JEA F;  4DPW A;  2CH4 A;  3A0Y A;  1BXD A;  2WEQ A;  3LMM A;  1UDO A;  3OWB A;  2BU5 A;  3CRL A;  4FWG A;  1WUU A;  1USV A;  2FXS A;  1OJ4 A;  2GO4 A;  2X36 A;  4EGI A;  3OTO E;  1IBK E;  4HZ0 A;  5M4P A;  3KRN A;  4JI5 I;  1NZ0 A;  2UXC E;  2JJC A;  1IXM A;  3GIG A;  3O0I A;  4HY6 A;  3TUH A;  2H8M A;  4YHH I;  4B3R I;  2YEG A;  3T2S A;  4LP0 A;  5ELW A;  2BV3 A;  2BM0 A;  3B78 A;  4JI8 I;  4I5S A;  4FW3 A;  2O1V A;  2CCT A;  2WI1 A;  4LFA I;  3M85 G;  1U0Z A;  4URO A;  5FLX C;  4HZ5 A;  3R91 A;  3EKR A;  4DUH A;  5BOC A;  5DRR A;  1N36 E;  2HHH I;  5JEA E;  1UDQ A;  2PO2 A;  1S14 A;  4NXN E;  4X9L A;  1Z0V A;  3FV5 A;  2E1R A;  1PIE A;  4NH8 A;  3Q5L A;  1IBL E;  1UYF A;  1UYG A;  2HCH A;  2YKE A;  2XJX A;  4E02 A;  3QDD A;  2AE8 A;  1H72 C;  3LTO A;  2XEX A;  2IOQ A;  2VQF E;  2HHI A;  4MP7 A;  1H74 A;  3LPS A;  4ASF A;  2YE8 A;  4MPE A;  2C39 B;  4CWR A;  5CTU A;  2AJ4 A;  3O6O A;  2GFD A;  3JZ3 A;  4XIQ A;  1B3Q A;  4OO1 B;  1H7S A;  2HFU A;  4E72 A;  4DXL A;  1BGQ A;  1Y6Z A;  1Z5B A;  1D6T A;  4BIU A;  2AKP A;  4YKU A;  2PNZ B;  2BU8 A;  2YKB A;  4CWQ A;  3UHM A;  3B28 A;  4YKX A;  4P8O A;  3CWV A;  4JI5 E;  1R6M A;  3U1K A;  4LF4 I;  3ZM7 A;  1UYD A;  1ZM9 A;  1DAR A;  2YEC A;  3IED A;  2FYP A;  2XK2 A;  5FND A;  1UDN A;  1Z0E A;  2VF3 A;  4YHH E;  4B3R E;  2C1G A;  4CWN A;  1UYC A;  1NHI A;  1USU A;  2Q8I A;  5BOD A;  2GO3 A;  4JI8 E;  4JAS A;  2CVE A;  4OO1 A;  2NPF A;  2NN6 E;  4LFA E;  3M7N D;  3P76 A;  1UDS A;  1QZR A;  4MYU A;  4JI3 I;  2PNZ A;  3PEH A;  2HHH E;  4DV3 I;  3V5R A;  1HR0 I;  5C0X D;  4P7A A;  4DV0 I;  2BA0 G;  1PKP A;  4LF6 I;  3J80 Q;  1GKX A;  4X62 I;  3PS3 A;  2Z5E A;  1XNR I;  4IFD A;  3G7B A;  4PL9 A;  5C0X B;  4YKY A;  1TH8 A;  2IOR A;  2E0A A;  1Z59 A;  1AH8 A;  3CGY A;  4Q20 A;  4DR1 E;  4IFD E;  4AIM A;  2O1U A;  5K36 F;  4DPX A;  3QT8 A;  4LFC I;  3P06 A;  3PYF A;  2Q8F A;  5J71 A;  1HNX I;  4B3M I;  4DR2 I;  4B6C A;  3HKM A;  1Z0T A;  2IWS A;  2Z5C B;  2JT2 A;  2C37 B;  3P3G A;  2A2C A;  4MB9 A;  4IZK A;  5C0X A;  2YEI A;  4EMV A;  2ZBK B;  4LF4 E;  1P42 A;  3MNR P;  4MP2 A;  5M4M A;  3BM9 A;  1UY8 A;  3ZZU A;  1I94 I;  4YKW A;  2XX4 A;  4JI1 I;  1AM1 A;  2VW5 A;  2Q2E B;  4HAC B;  2YEA A;  2QG0 A;  2BR2 B;  3B26 A;  1I5D A;  4WUD A;  2YE3 A;  3ZXO A;  1XMQ I;  4ZKI A;  1ZM4 A;  2YI0 A;  4QPJ A;  4AID A;  5DNL A;  5K36 E;  2YJW A;  4JI3 E;  2Z5C A;  2BM1 A;  4DV3 E;  1HR0 E;  2QG2 A;  4X66 I;  3RLR A;  3A0W A;  4DV0 E;  2UXD I;  4K0K I;  4LF6 E;  4BAE A;  1E3P A;  2EFG A;  1GJV A;  2ESA A;  1N0V C;  3GLL A;  4UT4 A;  4X62 E;  2IWX A;  4YKQ A;  1XNR E;  2UU9 I;  2XX5 A;  4CE3 A;  4JI7 I;  1KKH A;  5LL6 R;  2FTK A;  1KIJ A;  2CGE A;  3J7A G;  5CPH A;  4JI6 I;  2ZDY A;  2R42 A;  2PNL A;  5L3J A;  4DV6 I;  4LFC E;  2IOP A;  4U3B A;  3VHC A;  4EFU A;  1HNX E;  2YK2 A;  1XHK A;  4B3M E;  4DR2 E;  4YKZ A;  2JE6 A;  2Z5B A;  4CE1 A;  5CTW A;  4PRV A;  3HYZ A;  4FPP A;  3J81 Q;  4MPC A;  4BXI A;  3T1Y I;  4URN A;  4AQY I;  2QFO A;  3JAM Q;  1UY9 A;  2HFS A;  2CGF A;  3B4T A;  4JG4 A;  3M85 D;  1J5E I;  4MU0 A;  4FCR A;  3RLQ A;  3CRK A;  4EFT A;  2WI3 A;  2XDS A;  2PO2 B;  2BYI A;  4DV4 I;  1I94 E;  4B7P A;  4JI1 E;  2YEH A;  2WW4 A;  4PU9 A;  3PYE A;  4CWF A;  1IBM I;  3R4N A;  4V25 A;  3CDI A;  5IN9 A;  3PS2 A;  2CG9 A;  1I5C A;  2XJG A;  1XMQ E;  4V26 A;  2A2D A;  5IT9 C;  4LWE A;  5JEA A;  1UYK A;  2BZ5 A;  3J80 C;  1I5A A;  3TZ2 A;  4DR7 I;  3BMY A;  4AM3 A;  3G75 A;  3HHU A;  4HYP A;  5D7D A;  1KVK A;  4ZVI A;  2UXB I;  2UXD E;  4K0K E;  3OMU A;  1PVG A;  2ZIT A;  2FWZ A;  2Q8G A;  3U67 A;  3HJC A;  2WNR B;  2F4V I;  5DRO A;  4FW4 A;  2UU9 E;  4R1F A;  2YI7 A;  4CWS A;  2NN6 D;  3EHF A;  1N0U A;  4YKR A;  1XMO I;  4JI7 E;  3A0X A;  4MPN A;  4B3S I;  2YE4 A;  1R62 A;  2YED A;  5D6P A;  3T0H A;  4DU7 A;  2PO0 B;  4JI6 E;  3GIF A;  4DV6 E;  4OO1 D;  2XDX A;  2NN6 B;  1I5B A;  3WQ9 A;  2O1W A;  2J65 A;  3H4L A;  4LWI A;  2HKJ A;  4CWO A;  5FNF A;  1HNZ I;  2WNR A;  3T1Y E;  4AQY E;  3C0E A;  3U2D A;  4FWH A;  4ISA A;  2YE7 A;  1J5E E;  4U7N A;  1THN A;  3K99 A;  3Q5K A;  2YJX A;  4IFD D;  3ZKD A;  1FKA E;  1YET A;  1UYI A;  2PO0 A;  4NBQ A;  2BA0 D;  4YY3 I;  2HG1 A;  1VI7 A;  4MQY A;  4L94 A;  4LWF A;  1UEK A;  2NN6 A;  1IBM E; 
#chains in the Genus database with same CATH homology
 1US7 A;  4JAU A;  5IDM A;  1ELO A;  4XKA A;  5D7R A;  4WUC A;  4JV5 I;  1I58 A;  4O0B A;  2YGA A;  2XHR A;  2WER A;  5F3K A;  3A0Z A;  4GGL A;  4DR7 E;  1I59 A;  2BU6 A;  4URL A;  2YK9 A;  4AWQ A;  4I3H A;  2UXB E;  4FW9 A;  4DPT A;  5A2Q C;  1YT2 A;  2H55 A;  2F4V E;  4E01 A;  2DEJ A;  4X65 I;  3T0Z A;  4LF7 I;  1S4E A;  3K98 A;  2BRE A;  2PNR A;  2YEJ A;  4L93 A;  5M4K A;  1XMO E;  3D2R A;  2V34 A;  4XD8 A;  4IZK B;  3OWD A;  4B3S E;  2OI2 A;  3Q6M A;  1ZM2 A;  3TZ0 A;  2YGE A;  3C11 A;  3R4P A;  2C2A A;  1H7U A;  5BR8 I;  4OX9 I;  3EHG A;  3K97 A;  3K17 A;  2YE9 A;  5GMD A;  4U7O A;  1EA6 A;  1HNZ E;  1Y8N A;  2BSM A;  2VWC A;  4FWD A;  4AWO A;  4DV5 I;  1MU5 A;  5IDJ A;  1UY7 A;  5CTX A;  2ZM6 I;  4CWT A;  1AMW A;  3INW A;  5D7C A;  3F0N A;  1B63 A;  3Q5J A;  3K85 A;  4YY3 E;  5FLX Q;  4BIZ A;  5CTY A;  2JKI A;  4K4O A;  4O04 A;  4H81 A;  3U2K A;  4JV5 E;  3EKO A;  2XCM A;  3RLP A;  3D36 A;  4H7Q A;  2YI5 A;  4JYA I;  4GCZ A;  3QT7 A;  4GKJ I;  3QT6 A;  4XC0 A;  5D6Q A;  3M6A A;  3Q6N A;  3J7A M;  4DR5 I;  1XNQ I;  3EHJ A;  3DGE A;  2Z5B B;  3G7E A;  4X65 E;  1YT1 A;  4LF7 E;  1FWL A;  4LF8 I;  1MX0 A;  1TIL A;  2Q8H A;  4HXW A;  2UWD A;  1EI1 A;  4JI0 I;  5IWA I;  4KSH A;  5BR8 E;  1RR9 A;  3ZXQ A;  2EXL A;  4OX9 E;  2ZDX A;  1YC1 A;  4N3O A;  4JI4 I;  1UYE A;  4JI2 I;  2UUA I;  1ZW9 A;  2VCI A;  1VIS A;  2WI4 A;  2YEE A;  1QY8 A;  4QPK A;  3RKZ A;  3R4M A;  4DV5 E;  2UUB I;  3H80 A;  1FI4 A;  3PYD A;  2HK3 A;  4HYM A;  2ZM6 E;  3D4J A;  1UYL A;  2WI6 A;  4XTJ A;  4NXM I;  3FT5 A;  1K47 A;  2YEB A;  4O05 A;  4BQJ A;  5LMN I;  2BTZ A;  4RPF A;  3T1H I;  2YE5 A;  4XCL A;  1UY6 A;  4DV2 I;  4M1K A;  1Y8P A;  1YES A;  2UUC I;  1AH6 A;  4JYA E;  3WU3 A;  1NHJ A;  5M4E A;  4GKJ E;  2CZ9 A;  1QYE A;  2BU7 A;  2E5L I;  4AS9 A;  3B82 A;  2XD6 A;  1Y4S A;  4DR5 E;  2XDK A;  1XNQ E;  4X66 E;  5J6A A;  4DV7 I;  2ZKJ A;  1Z0B A;  4GKK I;  5GME A;  4KQV A;  4HXZ A;  4LF8 E;  1YER A;  3D0B A;  2QF6 A;  4KTN A;  4ASA A;  4BQG A;  4LFB I;  2CCS A;  4EEH A;  1TC0 A;  2O1T A;  5F5R A;  3Q1Q A;  2HKE A;  1U2R A;  4IZJ D;  5IWA E;  4JI0 E;  4LF5 I;  1UYH A;  4XCJ A;  4L90 A;  4CWP A;  4WUB A;  4JI4 E;  3R4O A;  4JI2 E;  2UUA E;  2J7K A;  4GFN A;  1KTV A;  4DV1 I;  3K60 A;  1FNM A;  2V2Q A;  4IZJ B;  2BRC A;  3OW6 A;  4DUY I;  1FJG I;  4R3A A;  2UUB E;  4DR4 I;  2WI2 A;  5C93 A;  2WI7 A;  2XJJ A;  2BYH A;  4EMD A;  4FMT A;  4XKK A;  4XE2 A;  3VAD A;  3GIE A;  4NXM E;  4DV4 E;  4LF9 I;  1Z5C A;  1RRE A;  2V2Z A;  5LMN E;  3B8H A;  4B3T I;  3HEK A;  1YC3 A;  4O09 A;  1NHH A;  3T1H E;  4CE2 A;  4XDM A;  2VQE I;  2XDL A;  3ZKB A;  4Z7C A;  4DV2 E;  2XHT A;  4GEE A;  4MOT A;  1Y4U A;  2PNM A;  3GON A;  2UUC E;  4NH9 A;  3B27 A;  5FNC A;  3PYG A;  5LMU I;  1ZWH A;  4E00 A;  4IZJ A;  4DR1 I;  4XIT A;  2BT0 A;  3KE6 A;  4O07 A;  2FWY A;  2E5L E;  5M4N A;  4DUZ I;  2GQP A;  4LPB A;  1UYM A;  1ZXN A;  1MG7 A;  4DV7 E;  1N32 I;  2GQ0 A;  4JAV A;  1FWK A;  4GKK E;  3WU5 A;  1BYQ A;  1YT0 A;  4L8Z A;  3WU4 A;  3B25 A;  3NMQ A;  3QTF A;  2WI5 A;  4EGH A;  1Z5A A;  4LFB E;  4HY1 A;  4XKO A;  4URM A;  1U2O A;  2YE6 A;  4ASG A;  1Z0G A;  3T10 A;  4LF5 E;  2YKJ A;  4L91 A;  2XHX A;  3J81 C;  3CGZ A;  5M4H A;  2GS8 A;  3HZ1 A;  3TTZ A;  3JAM C;  1Z0C A;  2XX2 A;  2V2V A;  1B62 A;  2HK2 A;  4JQL A;  1BKN A;  4DV1 E;  1N34 I;  2YE2 A;  4YKT A;  1YC4 A;  4DUY E;  1FJG E;  3O2F A;  4DR3 I;  4DR4 E;  1AJ6 A;  4LWH A;  1N33 I;  3HUL A;  1A4H A;  3WU6 A;  4UTG A;  5IT9 Q;  1TID A;  3ZZ0 A;  4AWP A;  4LF9 E;  4DZY A;  4B3T E;  1Y8O A;  1ZXM A;  4KSG A;  2XAB A;  4GT8 A;  2BU2 A;  3T1K A;  2VQE E;  4FCQ A;  2DEI A;  3B24 A;  3HZ5 A;  4P52 A;  4X64 I;  5LMU E;  2IWU A;  2X7I A;  2CCU A;  1ID0 A;  1YSZ A;  4KHP I;  4EGK A;  4DR6 I;  4DUZ E;  4ED4 A;  1HNW I;  3A0R A;  1N32 E;  4EM7 A;  2YI6 A;  3R92 A;  4GQT A;  3ZZT A;  4U93 A;  3K1J A;  3TZ5 A;  5GGZ A;  2K5B A;  4H85 A;  3VHD A;  2YKI A;  3VHA A;  5FWK A;  2WEP A;  3OTO I;  2YGF A;  1IBK I;  4W7T A;  3V2U C;  4DPY A;  3HYY A;  5CF0 A;  4MBC A;  1YS3 A;  2UXC I;  4Z7Y A;  1JM6 A;  3SL2 A;  2V8P A;  1H73 A;  1N34 E;  3INX A;  2XDU A;  3OPD A;  4USK A;  4DR3 E;  2YEF A;  1ZM3 A;  4MYT A;  3TZ4 A;  1N33 E;  4ASB A;  1GKZ A;  4PRX A;  2R3V A;  1N36 I;  1S16 A;  3EHH A;  4DU8 A;  1OSF A;  4LWG A;  3PRY A;  4FN5 A;  3LNU A;  4NXN I;  2VCJ A;  1Z0W A;  4HAC A;  1HK7 A;  1TBW A;  3FT8 A;  4KP4 A;  1TC6 A;  1IBL I;  4NH7 A;  4KFG A;  1KZN A;  1YSR A;  4X64 E;  4DPU A;  5A2Q Q;  2YKC A;  4FCP A;  3QT5 A;  2VQF I;  4KHP E;  1L0O A;  3GIG B;  3PEJ A;  4DR6 E;  1HNW E;  3A0T A;  3QDD A;  3WHA A;  4USM A;  1A6F A;  4R3M A;  4XIP A;  2LJP A;  4XIR A;  4DPW A;  2CH4 A;  3A0Y A;  1BXD A;  2WEQ A;  3OWB A;  2BU5 A;  3CRL A;  4FWG A;  1WUU A;  1USV A;  2FXS A;  1OJ4 A;  2X36 A;  4EGI A;  3OTO E;  1IBK E;  4HZ0 A;  5M4P A;  4JI5 I;  1NZ0 A;  2UXC E;  2JJC A;  3O0I A;  3GIG A;  4HY6 A;  3TUH A;  2H8M A;  4YHH I;  4B3R I;  2YEG A;  3T2S A;  4LP0 A;  2BV3 A;  2BM0 A;  3B78 A;  4JI8 I;  4I5S A;  2O1V A;  2CCT A;  2WI1 A;  4LFA I;  4URO A;  1U0Z A;  4DUH A;  5FLX C;  4HZ5 A;  3R91 A;  3EKR A;  5BOC A;  1N36 E;  2HHH I;  1S14 A;  4NXN E;  4X9L A;  1Z0V A;  3FV5 A;  2E1R A;  1PIE A;  4NH8 A;  3Q5L A;  1IBL E;  1UYF A;  1UYG A;  2HCH A;  2YKE A;  2XJX A;  4E02 A;  1H72 C;  3LTO A;  2XEX A;  2IOQ A;  2VQF E;  4MP7 A;  1H74 A;  3LPS A;  4ASF A;  2YE8 A;  4MPE A;  4CWR A;  5CTU A;  2AJ4 A;  3O6O A;  2GFD A;  3JZ3 A;  4XIQ A;  1B3Q A;  1H7S A;  2HFU A;  4DXL A;  1BGQ A;  1Y6Z A;  1Z5B A;  1D6T A;  4BIU A;  2AKP A;  4YKU A;  2BU8 A;  2YKB A;  4CWQ A;  3B28 A;  4YKX A;  4P8O A;  3CWV A;  4JI5 E;  4LF4 I;  3ZM7 A;  1UYD A;  1ZM9 A;  1DAR A;  2YEC A;  3IED A;  2FYP A;  2XK2 A;  5FND A;  2VF3 A;  1Z0E A;  4YHH E;  4B3R E;  4CWN A;  1UYC A;  1NHI A;  1USU A;  2Q8I A;  5BOD A;  4JI8 E;  4JAS A;  2NPF A;  4LFA E;  1QZR A;  4MYU A;  4JI3 I;  3PEH A;  2HHH E;  4DV3 I;  3V5R A;  1HR0 I;  4P7A A;  4DV0 I;  1PKP A;  4LF6 I;  3J80 Q;  1GKX A;  4X62 I;  3G7B A;  2Z5E A;  1XNR I;  4PL9 A;  4YKY A;  1TH8 A;  2IOR A;  2E0A A;  1Z59 A;  1AH8 A;  3CGY A;  4Q20 A;  4DR1 E;  2O1U A;  4DPX A;  3QT8 A;  4LFC I;  3P06 A;  3PYF A;  2Q8F A;  5J71 A;  1HNX I;  4B3M I;  4DR2 I;  4B6C A;  1Z0T A;  2IWS A;  2Z5C B;  2A2C A;  4MB9 A;  4IZK A;  2YEI A;  4EMV A;  2ZBK B;  4LF4 E;  3MNR P;  4MP2 A;  5M4M A;  3BM9 A;  1UY8 A;  3ZZU A;  1I94 I;  4YKW A;  2XX4 A;  4JI1 I;  1AM1 A;  2VW5 A;  2Q2E B;  4HAC B;  2YEA A;  2QG0 A;  3B26 A;  1I5D A;  4WUD A;  2YE3 A;  3ZXO A;  1XMQ I;  4ZKI A;  1ZM4 A;  2YI0 A;  4QPJ A;  2YJW A;  4JI3 E;  2Z5C A;  2BM1 A;  4DV3 E;  1HR0 E;  2QG2 A;  4X66 I;  3RLR A;  3A0W A;  4DV0 E;  2UXD I;  4K0K I;  4LF6 E;  4BAE A;  2EFG A;  1GJV A;  2ESA A;  1N0V C;  4UT4 A;  4X62 E;  2IWX A;  4YKQ A;  1XNR E;  2UU9 I;  2XX5 A;  4CE3 A;  4JI7 I;  1KKH A;  5LL6 R;  1KIJ A;  2CGE A;  3J7A G;  5CPH A;  4JI6 I;  2ZDY A;  2R42 A;  2PNL A;  5L3J A;  4DV6 I;  4LFC E;  2IOP A;  3VHC A;  4EFU A;  1HNX E;  2YK2 A;  1XHK A;  4B3M E;  4DR2 E;  4YKZ A;  2Z5B A;  4CE1 A;  5CTW A;  4PRV A;  3HYZ A;  4FPP A;  3J81 Q;  4MPC A;  4BXI A;  3T1Y I;  4URN A;  4AQY I;  2QFO A;  3JAM Q;  1UY9 A;  2HFS A;  2CGF A;  1J5E I;  4JG4 A;  4FCR A;  3RLQ A;  4EFT A;  3CRK A;  2WI3 A;  2XDS A;  4B7P A;  2BYI A;  4DV4 I;  1I94 E;  4JI1 E;  2YEH A;  2WW4 A;  4PU9 A;  3PYE A;  4CWF A;  1IBM I;  3R4N A;  4V25 A;  5IN9 A;  2CG9 A;  1I5C A;  2XJG A;  1XMQ E;  4V26 A;  2A2D A;  5IT9 C;  4LWE A;  1UYK A;  2BZ5 A;  3J80 C;  1I5A A;  3TZ2 A;  4DR7 I;  3G75 A;  5D7D A;  3HHU A;  4HYP A;  1KVK A;  4ZVI A;  2UXB I;  2UXD E;  4K0K E;  3OMU A;  1PVG A;  2ZIT A;  2FWZ A;  2Q8G A;  3U67 A;  3HJC A;  2F4V I;  2UU9 E;  4R1F A;  2YI7 A;  4CWS A;  3EHF A;  1N0U A;  4YKR A;  1XMO I;  4JI7 E;  3A0X A;  4MPN A;  4B3S I;  2YE4 A;  1R62 A;  2YED A;  5D6P A;  3T0H A;  4DU7 A;  4JI6 E;  3GIF A;  4DV6 E;  2XDX A;  1I5B A;  3WQ9 A;  2O1W A;  3H4L A;  4LWI A;  2HKJ A;  4CWO A;  5FNF A;  1HNZ I;  3T1Y E;  4AQY E;  3C0E A;  3U2D A;  4FWH A;  2YE7 A;  1J5E E;  4U7N A;  1THN A;  3K99 A;  3Q5K A;  2YJX A;  3ZKD A;  1FKA E;  1YET A;  1UYI A;  4YY3 I;  2HG1 A;  4L94 A;  3BMY A;  4LWF A;  1UEK A;  1IBM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...