1PVGA

Crystal structure of the atpase region of saccharomyces cerevisiae topoisomerase ii
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
400
structure length
378
Chain Sequence
b'SASDKYQKISQLEHILKRPDTYIGSVETQEQLQWIYDEETDCMIEKNVTIVPGLFKIFDEILVNAADNKVRDPSMKRIDVNIHAEEHTIEVKNDGKGIPIEIHNKENIYIPEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILETADLNVGQKYVQKWENNMSICHPPKITSYKKGPSYTKVTFKPDLTRFGMKELDNDILGVMRRRVYDINGSVRDINVYLNGKSLKIRNFKNYVELYLKSLIPTILYERINNRWEVAFAVSDISFQQISFVNSIATTMGGTHVNYITDQIVKKISEILKKVKSFQIKNNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCEIPLEYINKIMKTDLATRMFEIADA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA topoisomerase II
publication title Structure of the topoisomerase II ATPase region and its mechanism of inhibition by the chemotherapeutic agent ICRF-187
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 113
structure length 378
sequence length 400
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2003-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1pvgA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1pvgA01
5LMNE 4GT8A 2VQEE 4XC0A 4RPFA 1GKXA 4MPEA 1RR9A 4U7NA 4YKUA 4YKZA 4DV2I 4UTGA 2CZ9A 1IBME 2EXLA 2UU9E 2YKBA 4FPPA 1YS3A 3EHHA 3QTFA 3TZ0A 4OX9E 4JAVA 4ED4A 4X62E 4PU9A 4FN5A 1Z0VA 3K1JA 4JI6I 3JZ3A 5GGZA 2GQPA 3VHCA 3OPDA 4B6CA 5GMDA 4DPTA 1Z0GA 4V25A 3LNUA 4GFNA 4HZ0A 4YHHI 5LL6R 3G7EA 2ZDYA 3WU6A 4DPXA 4XDMA 4DR5I 1Z0BA 4DV5I 4O04A 4UROA 1ZXMA 1XHKA 3T1YE 3CRKA 4DR6I 2AKPA 2A2DA 2R42A 3H80A 3OWDA 3QT5A 1KZNA 5FNDA 3PYDA 1UYDA 1Z0TA 4LPBA 5J6AA 4LP0A 4CWPA 1WUUA 2BTZA 4DV7E 1N34I 4JI3I 4CE2A 4JI1E 1HNWE 4CWFA 1S4EA 5IWAI 2XX4A 4EEHA 1HNZI 1N0VC 2XJJA 2UU9I 1BGQA 2YE9A 1U2RA 4XCLA 3A0RA 4DR4I 4BAEA 4YKTA 2WERA 4KHPE 1A4HA 4XKAA 1ZW9A 1PIEA 4DV3E 4HY1A 1UYGA 2CCUA 2JKIA 1EA6A 1I94I 1S14A 5IT9Q 5IT9C 4LF8I 3J80Q 3J80C 1YERA 4I5SA 2O1WA 4NXNE 3PEHA 1J5EE 4JI0I 4DPWA 1OSFA 4XTJA 4AS9A 1MG7A 1I5AA 3EHFA 4GGLA 5M4HA 3K17A 4DUYI 2CG9A 4KSHA 1Y8OA 4ASAA 3V2UC 4ZKIA 1UYIA 4KQVA 2ZM6E 2UXDE 2VW5A 2FXSA 3DGEA 4FWHA 2BT0A 2XDSA 3KE6A 1H74A 3R4OA 4KTNA 3WQ9A 2UUCI 4XKKA 3B27A 3F0NA 3QT6A 3CGYA 4LFAI 5BR8I 3B24A 1YESA 2BM1A 4DV7I 1I5DA 4EMDA 1MX0A 4LF6E 4JI1I 1HNWI 1UYKA 2VQFE 4YKQA 2XEXA 4LF5I 1US7A 1I59A 3T0ZA 2BSMA 3D2RA 3PEJA 1ZM2A 4GKJE 1YC4A 5F3KA 4DV1E 4XKOA 2UUBE 1ZM3A 1D6TA 2YGAA 3O6OA 4X65E 4HACA 3U2KA 1FWLA 3PYEA 1J5EI 1XNRE 4JYAE 1ZWHA 2IWSA 1UY8A 2ZITA 4LF9E 4K0KE 1I58A 3INXA 5FLXC 3GONA 3PYFA 2E1RA 1N33E 2WI3A 1GKZA 3K99A 3TUHA 3O2FA 3EKRA 4BIUA 2ZM6I 2UXDI 4ASBA 4KSGA 3SL2A 3T0HA 3Q5JA 4NH9A 3EHJA 2HHHE 1EI1A 4LFCE 2Q2EB 4GQTA 4CWTA 1BXDA 3D0BA 4FMTA 1H73A 4O09A 1VISA 2VF3A 4LF6I 1UYLA 3K98A 2HCHA 3B25A 3R4MA 1Z5CA 2UUAE 1FI4A 1N0UA 2Q8IA 5FNCA 4URLA 2E5LE 4O05A 4ASFA 5BOCA 2YKCA 4HYPA 3FT8A 3GIEA 4LF4E 5CTYA 5F5RA 2XDKA 4AQYE 1H72C 3ZM7A 4GKJI 2WI1A 3HZ1A 2OI2A 1TC6A 2H55A 4XITA 4FCRA 4NXME 4X64E 3C0EA 1UY6A 4MPCA 4X65I 2BZ5A 1XNRI 4JYAI 4L93A 2Q8FA 2YEIA 4L91A 4DPUA 1ID0A 4DR1E 1YSRA 1N33I 4MOTA 4CWSA 2V34A 3HULA 4E02A 2IORA 4HACB 1HR0E 2HKEA 4R3AA 2XHXA 3G7BA 2AJ4A 3RLPA 2YKIA 4XE2A 3T10A 4O0BA 4I3HA 1QY8A 2BU6A 2UWDA 4BQJA 2IWUA 1RREA 1YT0A 1B3QA 4P8OA 4EM7A 2WEQA 3J81C 2UUAI 4DV6E 2BRCA 2E5LI 2V2QA 4JI2E 4MB9A 5LMUI 3INWA 4LF4I 1KKHA 1HNXI 4AQYI 4QPKA 5LMNI 1AH8A 2VQEI 2YI7A 2YI6A 4E01A 1UEKA 4JAUA 4L94A 4NXMI 2JJCA 1FNMA 4XIRA 3TZ2A 4X64I 4GKKE 1IBMI 2X7IA 2VCJA 1YT2A 2WI5A 4JV5E 2YGEA 4K4OA 5C93A 1TILA 1H7SA 2YEFA 2GFDA 3VHDA 4OX9I 2QG0A 4X62I 4URMA 3QDDA 1S16A 2YJXA 3BMYA 5IDMA 4FW9A 3RKZA 4AWQA 4CWRA 1N32E 4M1KA 4GCZA 4GEEA 4JI8E 4LWGA 3V5RA 1MU5A 2CH4A 4MBCA 1UY9A 4H81A 1KTVA 4DV0E 3A0XA 3LPSA 4JASA 5GMEA 1YT1A 4EGHA 2YEGA 4QPJA 4MP7A 4YKXA 4DR3E 2WEPA 2YE6A 3HYYA 4R1FA 1B63A 2FYPA 2H8MA 2BV3A 3T1YI 3Q5LA 4B3RE 4JI2I 4MPNA 4MYUA 3R4NA 3T1HE 3J7AM 3BM9A 4EGKA 4X9LA 2BYHA 1AH6A 3T1KA 1FKAE 1UYMA 4WUCA 2BU7A 4XIQA 3B28A 1BKNA 2YEAA 2ZBKB 2R3VA 1OJ4A 2BREA 3WU4A 4JV5I 4JI5E 2J7KA 1Y8NA 3WHAA 2HFUA 3C11A 3JAMQ 3JAMC 1ZXNA 3O0IA 1Z0EA 3QT8A 4KHPI 4DV3I 2UXCE 1Z59A 2CCSA 1PVGA 5M4PA 2ZKJA 1K47A 3RLRA 4NXNI 4DUZE 2BU2A 2CCTA 1XNQE 4HXWA 1FJGE 4KP4A 5M4MA 4L8ZA 1TBWA 5FLXQ 5IDJA 2VCIA 1A6FA 1U2OA 2BU8A 4JI4E 4X66E 2HK2A 2CGFA 3R4PA 4PL9A 1JM6A 2K5BA 1KIJA 1XMQE 3GIFA 3CWVA 1R62A 2XX5A 4FCQA 2FWZA 3J7AG 3GIGA 4E00A 2EFGA 3PYGA 4PRXA 4U7OA 3ZXOA 3T1HI 2XCMA 4DV2E 1H7UA 4JI7E 1L0OA 5J71A 4DR7E 3CGZA 3B8HA 4LF7E 3ZKDA 4ZVIA 1TC0A 2VQFI 5BODA 1AJ6A 3ZZTA 4JI5I 1NHJA 1Z0WA 3R92A 5D7CA 3FV5A 2YEHA 2YE8A 1NHIA 4DV1I 2UXCI 2UUBI 2X36A 2QG2A 4MP2A 4BIZA 4DU7A 2WI6A 4YHHE 1XNQI 1FJGI 4WUBA 5L3JA 4LFBE 1UYFA 4H7QA 4LF9I 4K0KI 2O1VA 1IBKE 3B82A 5IN9A 2HG1A 2WI7A 4DR5E 2YEJA 1AM1A 4X66I 1Z0CA 3OMUA 2IOPA 4ASGA 2A2CA 4DR6E 4YKWA 4DR2E 1XMQI 1I5BA 4XD8A 3OW6A 3TZ5A 4B3ME 4JI3E 1N34E 3NMQA 2HHHI 3A0ZA 2XDLA 4LFCI 4H85A 4JI7I 5IWAE 4Q20A 1HNZE 4O07A 4XIPA 1IBLE 4DR7I 3FT5A 4LF7I 4DR4E 3J81Q 2HK3A 2IWXA 3EKOA 2V2VA 2XX2A 3GIGB 2YEEA 3R91A 3Q5KA 4BQGA 4EFTA 2YEDA 1I94E 4WUDA 2NPFA 4LF8E 4LWIA 2Q8HA 2UXBE 3OWBA 4EGIA 2YKJA 4JI0E 3HZ5A 2HFSA 3K60A 1TIDA 2YJWA 2XHTA 2YKEA 3HHUA 3VHAA 4B7PA 1ZM9A 4LFBI 4DUYE 4CE3A 2XD6A 2YK2A 1IBKI 1QZRA 5CTUA 3ZZUA 1PKPA 4DR1I 2ZDXA 3RLQA 3M6AA 1HR0I 4L90A 4YKYA 1ZM4A 4DR2I 2UUCE 4YKRA 2YE5A 4NH7A 4FWDA 4LFAE 1I5CA 5BR8E 2XHRA 4B3MI 1THNA 4V26A 1YC1A 3TTZA 1NZ0A 4AWPA 4LWHA 4DXLA 3EHGA 5A2QQ 5A2QC 4P52A 4LF5E 3B78A 1XMOE 1IBLI 1DARA 2F4VE 2VWCA 2YE3A 4CWOA 4DZYA 3A0WA 3ZZ0A 3A0TA 4EFUA 4DV6I 3ZKBA 3D4JA 3B26A 3K97A 1GJVA 3VADA 2BU5A 1KVKA 4USKA 1B62A 3Q1QA 3G75A 4R3MA 5M4KA 4FCPA 2UXBI 3TZ4A 4DV4E 3MNRP 4EMVA 2V8PA 2Q8GA 1Y4SA 4GKKI 2E0AA 1YC3A 2XK2A 1NHHA 1N36E 5CTXA 1Y8PA 1AMWA 1YETA 2C2AA 4LWFA 4Z7CA 2QF6A 2XJXA 3U2DA 5M4EA 3H4LA 4HYMA 4MYTA 2YECA 3HEKA 4JQLA 4YY3E 5D6PA 1Z5AA 2DEJA 1N32I 1UYCA 2GS8A 4W7TA 4JI8I 2WI2A 4Z7YA 1FWKA 4UT4A 2YK9A 5D7DA 4AWOA 5D6QA 3T2SA 1BYQA 3QT7A 4DV0I 5CF0A 4FWGA 3D36A 1YSZA 4CE1A 1U0ZA 1QYEA 2HKJA 3OTOE 4B3TE 2YGFA 3CRLA 2YE7A 4P7AA 4DR3I 2BYIA 1XMOI 2F4VI 2XJGA 5D7RA 2O1UA 5M4NA 4USMA 4B3SE 2YE4A 2YI0A 5FWKA 4B3RI 2XABA 3HYZA 3IEDA 4HY6A 4HXZA 4LWEA 4CWQA 2YEBA 4DV4I 1UYHA 2ESAA 1N36I 4JI6E 1ELOA 2LJPA 2WI4A 4JG4A 1Z5BA 4PRVA 4CWNA 2YE2A 5FNFA 4YY3I 2IOQA 4DPYA 1TH8A 4HZ5A 1UY7A 4DUHA 2YI5A 4BXIA 4U93A 4URNA 4DUZI 3WU3A 3WU5A 2XDXA 2FWYA 2DEIA 2PNRA 3U67A 3ZXQA 5CTWA 4DV5E 2BM0A 3OTOI 4B3TI 2WW4A 4JI4I 1Y4UA 4XCJA 3A0YA 4DU8A 3LTOA 2QFOA 5LMUE 1UYEA 2XDUA 4NH8A 1HNXE 4B3SI 2V2ZA 5CPHA 4KFGA
chains in the Genus database with same CATH superfamily
5LMNE 2CGEA 2VQEE 4GT8A 4XC0A 4RPFA 1GKXA 4MPEA 1RR9A 2JEBA 4U7NA 4YKUA 4QNKA 4DV2I 4UTGA 4YKZA 2CZ9A 1IBME 2EXLA 2UU9E 2YKBA 4FPPA 1YS3A 3EHHA 3QTFA 2WNRA 3TZ0A 4OX9E 4JAVA 4FW5A 4ED4A 4X62E 4PU9A 4FN5A 1Z0VA 3K1JA 5K36C 4JI6I 3JZ3A 1UDNA 5GGZA 3K85A 2GQPA 3VHCA 1UDQA 3OPDA 4B6CA 5GMDA 4DPTA 2GO4A 1Z0GA 4V25A 3LNUA 4GFNA 4HZ0A 4IS9A 4YHHI 5LL6R 4IZKB 3G7EA 2ZDYA 3WU6A 4DPXA 4XDMA 4DR5I 1Z0BA 4DV5I 2CVEA 4O04A 4UROA 1ZXMA 1XHKA 3T1YE 3CRKA 3P3EA 4DR6I 4IFDC 2A2DA 2R42A 2AKPA 3H80A 3QT5A 3OWDA 1KZNA 3CYGA 5FNDA 3PYDA 1UYDA 1Z0TA 4LPBA 5J6AA 2HHIA 4LP0A 1WUUA 2C37B 5JEAF 2BTZA 4DV7E 1N34I 4JI3I 4CWPA 4CE2A 3GCMA 5EKWA 4JI1E 1HNWE 5K36E 4CWFA 1S4EA 5IWAI 2XX4A 4EEHA 1HNZI 1N0VC 5C0XB 2XJJA 2UU9I 1BGQA 2YE9A 1U2RA 4XCLA 3A0RA 2C39A 4DR4I 4BAEA 4YKTA 2WERA 1OYPA 4KHPE 1A4HA 4XKAA 3HJCA 1ZW9A 1PIEA 4DV3E 4HY1A 1UYGA 2CCUA 2JKIA 1EA6A 4OO1D 1I94I 2BA1G 1S14A 5IT9Q 5IT9C 4LF8I 3J80Q 3J80C 1YERA 4I5SA 2O1WA 4NXNE 3PEHA 2WNRB 1J5EE 5DNLA 4JI0I 4DPWA 1OSFA 4XTJA 4AS9A 1MG7A 1I5AA 4IFDE 3EHFA 4GGLA 5M4HA 4IFDA 2CG9A 2GQ0A 3K17A 4DUYI 4KSHA 1Y8OA 4ASAA 3V2UC 4ZKIA 1UYIA 4KQVA 2ZM6E 2UXDE 2VW5A 2FXSA 3DGEA 4FWHA 2BT0A 2XDSA 3KE6A 1H74A 3R4OA 4OO1E 4KTNA 2UUCI 4XKKA 3WQ9A 4OO1A 3B27A 5M4EA 3F0NA 3QT6A 3CGYA 4LFAI 5BR8I 3B24A 1YESA 1YH8A 2BM1A 4DV7I 1I5DA 4EMDA 1MX0A 4LF6E 4JI1I 1HNWI 1UYKA 2VQFE 1OYRA 1YHCA 2XEXA 4YKQA 4LF5I 1US7A 1I59A 3T0ZA 2BSMA 3D2RA 3PEJA 1ZM2A 2J65A 4N3OA 3UHMA 4GKJE 1YC4A 3U1YA 5F3KA 4DV1E 4MU1A 4XKOA 2UUBE 1ZM3A 1D6TA 2YGAA 2C39B 5C0XC 4FW3A 3O6OA 4X65E 4HACA 3U2KA 1FWLA 3PYEA 1J5EI 1XNRE 4JYAE 1ZWHA 2IWSA 1UY8A 2ZITA 4LF9E 4K0KE 1I58A 3INXA 5FLXC 3GONA 3PYFA 2E1RA 1N33E 2WI3A 4DZYA 1GKZA 2PO0A 3K99A 3TUHA 3O2FA 3EKRA 4AM3A 3B4TA 4ISAA 4BIUA 5JEAD 2ZM6I 2UXDI 1P42A 4ASBA 4U3DA 1HK7A 4KSGA 3SL2A 3T0HA 3Q5JA 4NH9A 4LCHA 3EHJA 2HHHE 1EI1A 4LFCE 2Q2EB 4GQTA 4CWTA 1BXDA 3D0BA 4FMTA 1H73A 4O09A 1VISA 2VF3A 4LF6I 1UYLA 3K98A 2HCHA 3B25A 3R4MA 1Z5CA 2UUAE 1FI4A 1N0UA 2Q8IA 1Y5YA 2Z5CA 4OO1B 4BA2A 5FNCA 4URLA 2E5LE 4O05A 5C0XE 4ASFA 5BOCA 2YKCA 1OYSA 4HYPA 3FT8A 3GIEA 4LF4E 4OZEA 5CTYA 5F5RA 5JENA 5JEAE 4AQYE 2XDKA 1H72C 5JEAA 3ZM7A 4GKJI 2WI1A 3HZ1A 3VHAA 2OI2A 1TC6A 2H55A 4XITA 4QNJA 4NXME 4FCRA 2PNZA 4X64E 3C0EA 1UY6A 4MPCA 4X65I 2BZ5A 1XNRI 4JYAI 4L93A 2Q8FA 2YEIA 3P3CA 4DPUA 4L91A 1ID0A 4DR1E 1YSRA 1N33I 4MOTA 4CWSA 2V34A 3HULA 2JEAA 4E02A 2IORA 4HACB 1HR0E 2HKEA 4R3AA 2XHXA 2NN6D 3G7BA 2AJ4A 3M7ND 3RLPA 2YKIA 4XE2A 3T10A 4O0BA 4I3HA 2PO0B 1QY8A 2BU6A 2UWDA 4BQJA 2IWUA 1RREA 1YT0A 1B3QA 4P8OA 4EM7A 2WEQA 3J81C 2UUAI 4DV6E 2BRCA 2E5LI 2V2QA 4JI2E 4MB9A 5LMUI 3INWA 2F1DA 4LF4I 1KKHA 1HNXI 4LOMA 4AQYI 1UDOA 4QPKA 5LMNI 1AH8A 2VQEI 2YI7A 2YI6A 4E01A 1UEKA 2Z5CB 4JAUA 4BA2B 4NXMI 2JJCA 1FNMA 4L94A 4XIRA 4X64I 3TZ2A 4OO1C 4GKKE 1IBMI 2JT2A 2X7IA 2VCJA 1YT2A 2WI5A 3S5TA 4JV5E 2YGEA 4K4OA 5C93A 5JEAB 1H7SA 1TILA 2YEFA 2GFDA 3VHDA 4OX9I 3GLLA 2QG0A 4X62I 4URMA 2O3ZA 3QDDA 1S16A 2YJXA 3BMYA 5IDMA 2PNZB 4FW9A 3RKZA 4AWQA 4CWRA 1F51A 1N32E 4M1KA 4GCZA 2Z5EA 4GEEA 4JI8E 4LWGA 4LCGA 3V5RA 1MU5A 2CH4A 3M7NG 4LCFA 4MBCA 1UY9A 4H81A 1KTVA 4DV0E 3A0XA 3LPSA 1USVA 2JEAB 4JASA 5GMEA 1YT1A 3P3GA 2YEGA 4EGHA 4QPJA 4MP7A 4YKXA 4DR3E 2WEPA 2YE6A 3HYYA 4R1FA 1B63A 2FYPA 2H8MA 2BV3A 3T1YI 3Q5LA 4B3RE 4JI2I 4MPNA 4MYUA 3R4NA 3T1HE 3J7AM 3BM9A 4EGKA 4X9LA 2NN6F 1AH6A 2BYHA 3T1KA 1E3HA 1FKAE 1UYMA 4WUCA 2BU7A 4XIQA 3B28A 1BKNA 2YEAA 2ZBKB 3HKMA 2R3VA 1OJ4A 2BREA 3WU4A 4BA1A 4JI5E 4JV5I 2J7KA 2NN6B 1Y8NA 3WHAA 3DD6A 2HFUA 3C11A 3JAMQ 3JAMC 1ZXNA 3O0IA 1Z0EA 3QT8A 4KHPI 3P06A 3M85D 4DV3I 3L7ZA 2UXCE 1Z59A 2CCSA 5DRRA 1PVGA 5M4PA 2ZKJA 1K47A 3RLRA 4NXNI 4DUZE 2BU2A 3GMEA 1XNQE 2C38B 1FJGE 2CCTA 3LMMA 4HXWA 4MDTA 5JEAC 4KP4A 4L8ZA 1TBWA 5M4MA 2PNMA 5FLXQ 5IDJA 2VCIA 1A6FA 1U2OA 2BU8A 4JI4E 4X66E 2HK2A 2CGFA 5K36F 3R4PA 4PL9A 1JM6A 3PS2A 1KIJA 2K5BA 1XMQE 3GIFA 3CWVA 1R62A 1R6LA 2XX5A 4FCQA 2PNLA 2FWZA 3J7AG 3GIGA 4E00A 2EFGA 3PYGA 4PRXA 4U7OA 3ZXOA 3T1HI 2XCMA 4DV2E 1H7UA 4JI7E 1L0OA 5J71A 4DR7E 4IZJD 3CGZA 3B8HA 4LF7E 3ZKDA 4MQYA 4ZVIA 2VQFI 1TC0A 5BODA 1AJ6A 3ZZTA 4JI5I 1NHJA 1Z0WA 5DNXA 3R92A 5D7CA 3FV5A 2C1IA 2YEHA 3M85G 2YE8A 1NHIA 4DV1I 2UXCI 2UUBI 2X36A 2QG2A 4MP2A 4BIZA 4DU7A 1E3PA 2JE6A 4BA1B 2PO2A 4MU0A 1Y6ZA 4YHHE 1XNQI 1FJGI 2NN6C 4WUBA 5L3JA 2PO1B 4LFBE 1UYFA 4LF9I 4K0KI 4H7QA 2O1VA 1IBKE 4IZJA 3B82A 3L7ZB 5IN9A 2HG1A 2WI7A 2IERA 4DR5E 2YEJA 1AM1A 4X66I 1Z0CA 3OMUA 2FTKA 2IOPA 4ASGA 1Y60A 2BA0D 2A2CA 4DR6E 4YKWA 4DR2E 1XMQI 2WP8B 1I5BA 4XD8A 3OW6A 3TZ5A 4B3ME 4JI3E 1N34E 3NMQA 2HHHI 3A0ZA 2XDLA 4LFCI 4H85A 4JI7I 5IWAE 3CDJA 4Q20A 1HNZE 4O07A 4XIPA 3CDIA 1IBLE 4DR7I 3FT5A 4LF7I 4DR4E 3J81Q 2HK3A 2IWXA 3EKOA 2BR2A 2V2VA 2XX2A 2YEEA 3GIGB 3R91A 3Q5KA 4BQGA 4EFTA 4FW6A 4E72A 2YEDA 2NN6E 1I94E 2BA1D 4WUDA 2NPFA 4LF8E 2NN6A 4LWIA 1RHYA 2Q8HA 2UXBE 3OWBA 4EGIA 5DRQA 2YKJA 4JI0E 3HZ5A 2HFSA 3K60A 5DRPA 5K36D 1TIDA 1VI7A 2XHTA 2YKEA 2YJWA 3HHUA 2GO3A 1ZM9A 4LFBI 4DUYE 4B7PA 4CE3A 4OKGA 2XD6A 2YK2A 1IBKI 1QZRA 5CTUA 2C38A 2O1TA 3ZZUA 1PKPA 4DR1I 2ZDXA 3RLQA 3M6AA 2JE6B 1USUA 2PO2B 4MU4A 3U1KA 2BA0G 4AIMA 1HR0I 4L90A 5EL9A 1XXEA 1ZM4A 4FW4A 4DR2I 2UUCE 4YKRA 4YKYA 2YE5A 4NH7A 4IZJB 4FWDA 5C0XF 4LFAE 1I5CA 3PS1A 5BR8E 3H1CA 2XHRA 4B3MI 1THNA 4V26A 1UDSA 1YC1A 3TTZA 1NZ0A 4AWPA 4LWHA 4DXLA 3NZKA 5A2QQ 5A2QC 4P52A 4IFDD 5K36A 3EHGA 4LF5E 2Z5BA 3B78A 1XMOE 1DARA 1IBLI 2F4VE 2VWCA 2YE3A 4AIDA 3A0WA 4CWOA 3ZZ0A 3A0TA 4EFUA 4DV6I 3ZKBA 3D4JA 3B26A 3K97A 2JEBB 1GJVA 2IESA 2BU5A 3VADA 3KRNA 1KVKA 4USKA 1B62A 3Q1QA 2WI6A 3G75A 4R3MA 5M4KA 4FCPA 2UXBI 3TZ4A 2BR2B 4DV4E 3MNRP 4EMVA 2V8PA 2Q8GA 1Y4SA 4GKKI 2E0AA 1YC3A 2XK2A 1NHHA 1N36E 5CTXA 1Y8PA 1AMWA 1YETA 2C2AA 4MU3A 4FW7A 4LWFA 4Z7CA 2PO1A 2QF6A 2XJXA 3U2DA 2C1GA 3H4LA 4HYMA 4MYTA 2YECA 3HEKA 4JQLA 4YY3E 5D6PA 1Z5AA 2DEJA 1N32I 1UYCA 2GS8A 4W7TA 4JI8I 2WI2A 4Z7YA 1FWKA 4NBQA 4UT4A 2YK9A 4GQUA 5D7DA 2WP8A 5D6QA 3T2SA 1BYQA 3QT7A 4AWOA 4DV0I 5CF0A 4FWGA 3D36A 1YSZA 5ELWA 4CE1A 1U0ZA 1QYEA 2HKJA 3OTOE 4B3TE 2YGFA 3CRLA 2YE7A 4P7AA 4DR3I 2BYIA 1XMOI 2F4VI 3P76A 2AE8A 2XJGA 5D7RA 2O1UA 4J3DA 4USMA 5M4NA 4LPFA 4B3SE 2YE4A 2YI0A 5FWKA 4B3RI 2XABA 3HYZA 3IEDA 5K36B 4HY6A 4HXZA 4LWEA 4CWQA 2Z5BB 3PS3A 4U3BA 2YEBA 4DV4I 1UYHA 2ESAA 1N36I 4JI6E 1ELOA 2LJPA 4IFDF 2WI4A 5C0XD 4IZKA 2VESA 4JG4A 1Z5BA 4PRVA 4CWNA 1IXMA 2YE2A 1R6MA 5FNFA 2IOQA 4YY3I 3Q6MA 4DPYA 1TH8A 4HZ5A 1UY7A 4DUHA 3PRYA 2YI5A 4BXIA 5DROA 4IFDB 4U93A 4URNA 4DUZI 3WU3A 4OO1F 3WU5A 2XDXA 2FWYA 2DEIA 2PNRA 3U67A 3ZXQA 3Q6NA 5CTWA 2C37A 2BM0A 3OTOI 4DV5E 1Y4UA 2WW4A 4B3TI 4JI4I 4XCJA 3A0YA 4DU8A 3LTOA 2QFOA 5LMUE 5C0XA 1UYEA 2XDUA 4NH8A 1HNXE 4B3SI 2V2ZA 5CPHA 4KFGA
chains in the Genus database with same CATH topology
5LMNE 2CGEA 2VQEE 4GT8A 4XC0A 4RPFA 1GKXA 4MPEA 1RR9A 4U7NA 4YKUA 4YKZA 4DV2I 4UTGA 2CZ9A 1IBME 2EXLA 2UU9E 2YKBA 4FPPA 1YS3A 3EHHA 3QTFA 3TZ0A 4OX9E 4JAVA 4ED4A 4X62E 4PU9A 4FN5A 1Z0VA 3K1JA 4JI6I 3JZ3A 5GGZA 3K85A 2GQPA 3VHCA 3OPDA 4B6CA 5GMDA 4DPTA 1Z0GA 4V25A 3LNUA 4GFNA 4HZ0A 4YHHI 5LL6R 4IZKB 3G7EA 2ZDYA 3WU6A 4DPXA 4XDMA 4DR5I 1Z0BA 4DV5I 4O04A 4UROA 1ZXMA 1XHKA 3T1YE 3CRKA 4DR6I 2AKPA 2A2DA 2R42A 3H80A 3OWDA 3QT5A 1KZNA 5FNDA 3PYDA 1UYDA 1Z0TA 4LPBA 5J6AA 4LP0A 4CWPA 1WUUA 2BTZA 4DV7E 1N34I 4JI3I 4CE2A 4JI1E 1HNWE 4CWFA 1S4EA 5IWAI 2XX4A 4EEHA 1HNZI 1N0VC 2XJJA 2UU9I 1BGQA 2YE9A 1U2RA 4XCLA 3A0RA 4DR4I 4BAEA 4YKTA 2WERA 4KHPE 1A4HA 4XKAA 3HJCA 1ZW9A 1PIEA 4DV3E 4HY1A 1UYGA 2CCUA 2JKIA 1EA6A 1I94I 1S14A 5IT9Q 5IT9C 4LF8I 3J80Q 3J80C 1YERA 4I5SA 2O1WA 4NXNE 3PEHA 1J5EE 4JI0I 4DPWA 1OSFA 4XTJA 4AS9A 1MG7A 1I5AA 3EHFA 4GGLA 5M4HA 2CG9A 2GQ0A 3K17A 4DUYI 4KSHA 1Y8OA 4ASAA 3V2UC 4ZKIA 1UYIA 4KQVA 2ZM6E 2UXDE 2VW5A 2FXSA 3DGEA 4FWHA 2BT0A 2XDSA 3KE6A 1H74A 3R4OA 4KTNA 3WQ9A 2UUCI 4XKKA 3B27A 3F0NA 3QT6A 3CGYA 4LFAI 5BR8I 3B24A 1YESA 2BM1A 4DV7I 1I5DA 4EMDA 1MX0A 4LF6E 4JI1I 1HNWI 1UYKA 2VQFE 4YKQA 2XEXA 4LF5I 1US7A 1I59A 3T0ZA 2BSMA 3D2RA 3PEJA 1ZM2A 4N3OA 4GKJE 1YC4A 5F3KA 4DV1E 4XKOA 2UUBE 1ZM3A 1D6TA 2YGAA 3O6OA 4X65E 4HACA 3U2KA 1FWLA 3PYEA 1J5EI 1XNRE 4JYAE 1ZWHA 2IWSA 1UY8A 2ZITA 4LF9E 4K0KE 1I58A 3INXA 5FLXC 3GONA 3PYFA 2E1RA 1N33E 2WI3A 4DZYA 1GKZA 3K99A 3TUHA 3O2FA 3EKRA 4BIUA 2ZM6I 2UXDI 4ASBA 1HK7A 4KSGA 3SL2A 3T0HA 3Q5JA 4NH9A 3EHJA 2HHHE 1EI1A 4LFCE 2Q2EB 4GQTA 4CWTA 1BXDA 3D0BA 4FMTA 1H73A 4O09A 1VISA 2VF3A 4LF6I 1UYLA 3K98A 2HCHA 3B25A 3R4MA 1Z5CA 2UUAE 1FI4A 1N0UA 2Q8IA 2Z5CA 5FNCA 4URLA 2E5LE 4O05A 4ASFA 5BOCA 2YKCA 4HYPA 3FT8A 3GIEA 4LF4E 5CTYA 5F5RA 2XDKA 4AQYE 1H72C 3ZM7A 4GKJI 2WI1A 3HZ1A 2OI2A 1TC6A 2H55A 4XITA 4FCRA 4NXME 4X64E 3C0EA 1UY6A 4MPCA 4X65I 2BZ5A 1XNRI 4JYAI 4L93A 2Q8FA 2YEIA 4L91A 4DPUA 1ID0A 4DR1E 1YSRA 1N33I 4MOTA 4CWSA 2V34A 3HULA 4E02A 2IORA 4HACB 1HR0E 2HKEA 4R3AA 2XHXA 3G7BA 2AJ4A 3RLPA 2YKIA 4XE2A 3T10A 4O0BA 4I3HA 1QY8A 2BU6A 2UWDA 4BQJA 2IWUA 1RREA 1YT0A 1B3QA 4P8OA 4EM7A 2WEQA 3J81C 2UUAI 4DV6E 2BRCA 2E5LI 2V2QA 4JI2E 4MB9A 5LMUI 3INWA 4LF4I 1KKHA 1HNXI 4AQYI 4QPKA 5LMNI 1AH8A 2VQEI 2YI7A 2YI6A 4E01A 1UEKA 2Z5CB 4JAUA 4L94A 4NXMI 2JJCA 1FNMA 4XIRA 3TZ2A 4X64I 4GKKE 1IBMI 2X7IA 2VCJA 1YT2A 2WI5A 4JV5E 2YGEA 4K4OA 5C93A 1TILA 1H7SA 2YEFA 2GFDA 3VHDA 4OX9I 2QG0A 4X62I 4URMA 3QDDA 1S16A 2YJXA 3BMYA 5IDMA 4FW9A 3RKZA 4AWQA 4CWRA 1N32E 4M1KA 4GCZA 2Z5EA 4GEEA 4JI8E 4LWGA 3V5RA 1MU5A 2CH4A 4MBCA 1UY9A 4H81A 1KTVA 4DV0E 3A0XA 3LPSA 1USVA 4JASA 5GMEA 1YT1A 4EGHA 2YEGA 4QPJA 4MP7A 4YKXA 4DR3E 2WEPA 2YE6A 3HYYA 4R1FA 1B63A 2FYPA 2H8MA 2BV3A 3T1YI 3Q5LA 4B3RE 4JI2I 4MPNA 4MYUA 3R4NA 3T1HE 3J7AM 3BM9A 4EGKA 4X9LA 2BYHA 1AH6A 3T1KA 1FKAE 1UYMA 4WUCA 2BU7A 4XIQA 3B28A 1BKNA 2YEAA 2ZBKB 2R3VA 1OJ4A 2BREA 3WU4A 4JV5I 4JI5E 2J7KA 1Y8NA 3WHAA 2HFUA 3C11A 3JAMQ 3JAMC 1ZXNA 3O0IA 1Z0EA 3QT8A 4KHPI 3P06A 4DV3I 2UXCE 1Z59A 2CCSA 1PVGA 5M4PA 2ZKJA 1K47A 3RLRA 4NXNI 4DUZE 2BU2A 2CCTA 1XNQE 4HXWA 1FJGE 4KP4A 5M4MA 4L8ZA 1TBWA 2PNMA 5FLXQ 5IDJA 2VCIA 1A6FA 1U2OA 2BU8A 4JI4E 4X66E 2HK2A 2CGFA 3R4PA 4PL9A 1JM6A 2K5BA 1KIJA 1XMQE 3GIFA 3CWVA 1R62A 2XX5A 4FCQA 2PNLA 2FWZA 3J7AG 3GIGA 4E00A 2EFGA 3PYGA 4PRXA 4U7OA 3ZXOA 3T1HI 2XCMA 4DV2E 1H7UA 4JI7E 1L0OA 5J71A 4DR7E 4IZJD 3CGZA 3B8HA 4LF7E 3ZKDA 4ZVIA 1TC0A 2VQFI 5BODA 1AJ6A 3ZZTA 4JI5I 1NHJA 1Z0WA 3R92A 5D7CA 3FV5A 2YEHA 2YE8A 1NHIA 4DV1I 2UXCI 2UUBI 2X36A 2QG2A 4MP2A 4BIZA 4DU7A 1Y6ZA 4YHHE 1XNQI 1FJGI 4WUBA 5L3JA 4LFBE 1UYFA 2WI6A 4H7QA 4LF9I 4K0KI 2O1VA 1IBKE 4IZJA 3B82A 5IN9A 2HG1A 2WI7A 4DR5E 2YEJA 1AM1A 4X66I 1Z0CA 3OMUA 2IOPA 4ASGA 2A2CA 4DR6E 4YKWA 4DR2E 1XMQI 1I5BA 4XD8A 3OW6A 3TZ5A 4B3ME 4JI3E 1N34E 3NMQA 2HHHI 3A0ZA 2XDLA 4LFCI 4H85A 4JI7I 5IWAE 4Q20A 1HNZE 4O07A 4XIPA 1IBLE 4DR7I 3FT5A 4LF7I 4DR4E 3J81Q 2HK3A 2IWXA 3EKOA 2V2VA 2XX2A 3GIGB 2YEEA 3R91A 3Q5KA 4BQGA 4EFTA 2YEDA 1I94E 4WUDA 2NPFA 4LF8E 4LWIA 2Q8HA 2UXBE 3OWBA 4EGIA 2YKJA 4JI0E 3HZ5A 2HFSA 3K60A 1TIDA 2YJWA 2XHTA 2YKEA 3HHUA 3VHAA 4B7PA 1ZM9A 4LFBI 4DUYE 4CE3A 2XD6A 2YK2A 1IBKI 1QZRA 5CTUA 2O1TA 3ZZUA 1PKPA 4DR1I 2ZDXA 3RLQA 3M6AA 1USUA 1HR0I 4L90A 4YKYA 1ZM4A 4DR2I 2UUCE 4YKRA 2YE5A 4NH7A 4IZJB 4FWDA 4LFAE 1I5CA 5BR8E 2XHRA 4B3MI 1THNA 4V26A 1YC1A 3TTZA 1NZ0A 4AWPA 4LWHA 4DXLA 3EHGA 5A2QQ 5A2QC 4P52A 4LF5E 2Z5BA 3B78A 1XMOE 1DARA 1IBLI 2F4VE 2VWCA 2YE3A 4CWOA 3A0WA 3ZZ0A 3A0TA 4EFUA 4DV6I 3ZKBA 3D4JA 3B26A 3K97A 1GJVA 3VADA 2BU5A 1KVKA 4USKA 1B62A 3Q1QA 3G75A 4R3MA 5M4KA 4FCPA 2UXBI 3TZ4A 4DV4E 3MNRP 4EMVA 2V8PA 2Q8GA 1Y4SA 4GKKI 2E0AA 1YC3A 2XK2A 1NHHA 1N36E 5CTXA 1Y8PA 1AMWA 1YETA 2C2AA 4LWFA 4Z7CA 2QF6A 2XJXA 3U2DA 5M4EA 3H4LA 4HYMA 4MYTA 2YECA 3HEKA 4JQLA 4YY3E 5D6PA 1Z5AA 2DEJA 1N32I 1UYCA 2GS8A 4W7TA 4JI8I 2WI2A 4Z7YA 1FWKA 4UT4A 2YK9A 5D7DA 4AWOA 5D6QA 3T2SA 1BYQA 3QT7A 4DV0I 5CF0A 4FWGA 3D36A 1YSZA 4CE1A 1U0ZA 1QYEA 2HKJA 3OTOE 4B3TE 2YGFA 3CRLA 2YE7A 4P7AA 4DR3I 2BYIA 1XMOI 2F4VI 2XJGA 5D7RA 2O1UA 5M4NA 4USMA 4B3SE 2YE4A 2YI0A 5FWKA 4B3RI 2XABA 3HYZA 3IEDA 4HY6A 4HXZA 4LWEA 4CWQA 2Z5BB 2YEBA 4DV4I 1UYHA 2ESAA 1N36I 4JI6E 1ELOA 2LJPA 2WI4A 4IZKA 4JG4A 1Z5BA 4PRVA 4CWNA 2YE2A 5FNFA 2IOQA 4YY3I 3Q6MA 4DPYA 1TH8A 4HZ5A 1UY7A 4DUHA 3PRYA 2YI5A 4BXIA 4U93A 4URNA 4DUZI 3WU3A 3WU5A 2XDXA 2FWYA 2DEIA 2PNRA 3U67A 3ZXQA 3Q6NA 5CTWA 4DV5E 2BM0A 3OTOI 4B3TI 1Y4UA 2WW4A 4JI4I 4XCJA 3A0YA 4DU8A 3LTOA 2QFOA 5LMUE 1UYEA 2XDUA 4NH8A 1HNXE 4B3SI 2V2ZA 5CPHA 4KFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN E;  4GT8 A;  2VQE E;  4XC0 A;  4RPF A;  1GKX A;  4MPE A;  1RR9 A;  4U7N A;  4YKU A;  4YKZ A;  4DV2 I;  4UTG A;  2CZ9 A;  1IBM E;  2EXL A;  2UU9 E;  2YKB A;  4FPP A;  1YS3 A;  3EHH A;  3QTF A;  3TZ0 A;  4OX9 E;  4JAV A;  4ED4 A;  4X62 E;  4PU9 A;  4FN5 A;  1Z0V A;  3K1J A;  4JI6 I;  3JZ3 A;  5GGZ A;  2GQP A;  3VHC A;  3OPD A;  4B6C A;  5GMD A;  4DPT A;  1Z0G A;  4V25 A;  3LNU A;  4GFN A;  4HZ0 A;  4YHH I;  5LL6 R;  3G7E A;  2ZDY A;  3WU6 A;  4DPX A;  4XDM A;  4DR5 I;  1Z0B A;  4DV5 I;  4O04 A;  4URO A;  1ZXM A;  1XHK A;  3T1Y E;  3CRK A;  4DR6 I;  2AKP A;  2A2D A;  2R42 A;  3H80 A;  3OWD A;  3QT5 A;  1KZN A;  5FND A;  3PYD A;  1UYD A;  1Z0T A;  4LPB A;  5J6A A;  4LP0 A;  4CWP A;  1WUU A;  2BTZ A;  4DV7 E;  1N34 I;  4JI3 I;  4CE2 A;  4JI1 E;  1HNW E;  4CWF A;  1S4E A;  5IWA I;  2XX4 A;  4EEH A;  1HNZ I;  1N0V C;  2XJJ A;  2UU9 I;  1BGQ A;  2YE9 A;  1U2R A;  4XCL A;  3A0R A;  4DR4 I;  4BAE A;  4YKT A;  2WER A;  4KHP E;  1A4H A;  4XKA A;  1ZW9 A;  1PIE A;  4DV3 E;  4HY1 A;  1UYG A;  2CCU A;  2JKI A;  1EA6 A;  1I94 I;  1S14 A;  5IT9 Q;  5IT9 C;  4LF8 I;  3J80 Q;  3J80 C;  1YER A;  4I5S A;  2O1W A;  4NXN E;  3PEH A;  1J5E E;  4JI0 I;  4DPW A;  1OSF A;  4XTJ A;  4AS9 A;  1MG7 A;  1I5A A;  3EHF A;  4GGL A;  5M4H A;  3K17 A;  4DUY I;  2CG9 A;  4KSH A;  1Y8O A;  4ASA A;  3V2U C;  4ZKI A;  1UYI A;  4KQV A;  2ZM6 E;  2UXD E;  2VW5 A;  2FXS A;  3DGE A;  4FWH A;  2BT0 A;  2XDS A;  3KE6 A;  1H74 A;  3R4O A;  4KTN A;  3WQ9 A;  2UUC I;  4XKK A;  3B27 A;  3F0N A;  3QT6 A;  3CGY A;  4LFA I;  5BR8 I;  3B24 A;  1YES A;  2BM1 A;  4DV7 I;  1I5D A;  4EMD A;  1MX0 A;  4LF6 E;  4JI1 I;  1HNW I;  1UYK A;  2VQF E;  4YKQ A;  2XEX A;  4LF5 I;  1US7 A;  1I59 A;  3T0Z A;  2BSM A;  3D2R A;  3PEJ A;  1ZM2 A;  4GKJ E;  1YC4 A;  5F3K A;  4DV1 E;  4XKO A;  2UUB E;  1ZM3 A;  1D6T A;  2YGA A;  3O6O A;  4X65 E;  4HAC A;  3U2K A;  1FWL A;  3PYE A;  1J5E I;  1XNR E;  4JYA E;  1ZWH A;  2IWS A;  1UY8 A;  2ZIT A;  4LF9 E;  4K0K E;  1I58 A;  3INX A;  5FLX C;  3GON A;  3PYF A;  2E1R A;  1N33 E;  2WI3 A;  1GKZ A;  3K99 A;  3TUH A;  3O2F A;  3EKR A;  4BIU A;  2ZM6 I;  2UXD I;  4ASB A;  4KSG A;  3SL2 A;  3T0H A;  3Q5J A;  4NH9 A;  3EHJ A;  2HHH E;  1EI1 A;  4LFC E;  2Q2E B;  4GQT A;  4CWT A;  1BXD A;  3D0B A;  4FMT A;  1H73 A;  4O09 A;  1VIS A;  2VF3 A;  4LF6 I;  1UYL A;  3K98 A;  2HCH A;  3B25 A;  3R4M A;  1Z5C A;  2UUA E;  1FI4 A;  1N0U A;  2Q8I A;  5FNC A;  4URL A;  2E5L E;  4O05 A;  4ASF A;  5BOC A;  2YKC A;  4HYP A;  3FT8 A;  3GIE A;  4LF4 E;  5CTY A;  5F5R A;  2XDK A;  4AQY E;  1H72 C;  3ZM7 A;  4GKJ I;  2WI1 A;  3HZ1 A;  2OI2 A;  1TC6 A;  2H55 A;  4XIT A;  4FCR A;  4NXM E;  4X64 E;  3C0E A;  1UY6 A;  4MPC A;  4X65 I;  2BZ5 A;  1XNR I;  4JYA I;  4L93 A;  2Q8F A;  2YEI A;  4L91 A;  4DPU A;  1ID0 A;  4DR1 E;  1YSR A;  1N33 I;  4MOT A;  4CWS A;  2V34 A;  3HUL A;  4E02 A;  2IOR A;  4HAC B;  1HR0 E;  2HKE A;  4R3A A;  2XHX A;  3G7B A;  2AJ4 A;  3RLP A;  2YKI A;  4XE2 A;  3T10 A;  4O0B A;  4I3H A;  1QY8 A;  2BU6 A;  2UWD A;  4BQJ A;  2IWU A;  1RRE A;  1YT0 A;  1B3Q A;  4P8O A;  4EM7 A;  2WEQ A;  3J81 C;  2UUA I;  4DV6 E;  2BRC A;  2E5L I;  2V2Q A;  4JI2 E;  4MB9 A;  5LMU I;  3INW A;  4LF4 I;  1KKH A;  1HNX I;  4AQY I;  4QPK A;  5LMN I;  1AH8 A;  2VQE I;  2YI7 A;  2YI6 A;  4E01 A;  1UEK A;  4JAU A;  4L94 A;  4NXM I;  2JJC A;  1FNM A;  4XIR A;  3TZ2 A;  4X64 I;  4GKK E;  1IBM I;  2X7I A;  2VCJ A;  1YT2 A;  2WI5 A;  4JV5 E;  2YGE A;  4K4O A;  5C93 A;  1TIL A;  1H7S A;  2YEF A;  2GFD A;  3VHD A;  4OX9 I;  2QG0 A;  4X62 I;  4URM A;  3QDD A;  1S16 A;  2YJX A;  3BMY A;  5IDM A;  4FW9 A;  3RKZ A;  4AWQ A;  4CWR A;  1N32 E;  4M1K A;  4GCZ A;  4GEE A;  4JI8 E;  4LWG A;  3V5R A;  1MU5 A;  2CH4 A;  4MBC A;  1UY9 A;  4H81 A;  1KTV A;  4DV0 E;  3A0X A;  3LPS A;  4JAS A;  5GME A;  1YT1 A;  4EGH A;  2YEG A;  4QPJ A;  4MP7 A;  4YKX A;  4DR3 E;  2WEP A;  2YE6 A;  3HYY A;  4R1F A;  1B63 A;  2FYP A;  2H8M A;  2BV3 A;  3T1Y I;  3Q5L A;  4B3R E;  4JI2 I;  4MPN A;  4MYU A;  3R4N A;  3T1H E;  3J7A M;  3BM9 A;  4EGK A;  4X9L A;  2BYH A;  1AH6 A;  3T1K A;  1FKA E;  1UYM A;  4WUC A;  2BU7 A;  4XIQ A;  3B28 A;  1BKN A;  2YEA A;  2ZBK B;  2R3V A;  1OJ4 A;  2BRE A;  3WU4 A;  4JV5 I;  4JI5 E;  2J7K A;  1Y8N A;  3WHA A;  2HFU A;  3C11 A;  3JAM Q;  3JAM C;  1ZXN A;  3O0I A;  1Z0E A;  3QT8 A;  4KHP I;  4DV3 I;  2UXC E;  1Z59 A;  2CCS A;  1PVG A;  5M4P A;  2ZKJ A;  1K47 A;  3RLR A;  4NXN I;  4DUZ E;  2BU2 A;  2CCT A;  1XNQ E;  4HXW A;  1FJG E;  4KP4 A;  5M4M A;  4L8Z A;  1TBW A;  5FLX Q;  5IDJ A;  2VCI A;  1A6F A;  1U2O A;  2BU8 A;  4JI4 E;  4X66 E;  2HK2 A;  2CGF A;  3R4P A;  4PL9 A;  1JM6 A;  2K5B A;  1KIJ A;  1XMQ E;  3GIF A;  3CWV A;  1R62 A;  2XX5 A;  4FCQ A;  2FWZ A;  3J7A G;  3GIG A;  4E00 A;  2EFG A;  3PYG A;  4PRX A;  4U7O A;  3ZXO A;  3T1H I;  2XCM A;  4DV2 E;  1H7U A;  4JI7 E;  1L0O A;  5J71 A;  4DR7 E;  3CGZ A;  3B8H A;  4LF7 E;  3ZKD A;  4ZVI A;  1TC0 A;  2VQF I;  5BOD A;  1AJ6 A;  3ZZT A;  4JI5 I;  1NHJ A;  1Z0W A;  3R92 A;  5D7C A;  3FV5 A;  2YEH A;  2YE8 A;  1NHI A;  4DV1 I;  2UXC I;  2UUB I;  2X36 A;  2QG2 A;  4MP2 A;  4BIZ A;  4DU7 A;  2WI6 A;  4YHH E;  1XNQ I;  1FJG I;  4WUB A;  5L3J A;  4LFB E;  1UYF A;  4H7Q A;  4LF9 I;  4K0K I;  2O1V A;  1IBK E;  3B82 A;  5IN9 A;  2HG1 A;  2WI7 A;  4DR5 E;  2YEJ A;  1AM1 A;  4X66 I;  1Z0C A;  3OMU A;  2IOP A;  4ASG A;  2A2C A;  4DR6 E;  4YKW A;  4DR2 E;  1XMQ I;  1I5B A;  4XD8 A;  3OW6 A;  3TZ5 A;  4B3M E;  4JI3 E;  1N34 E;  3NMQ A;  2HHH I;  3A0Z A;  2XDL A;  4LFC I;  4H85 A;  4JI7 I;  5IWA E;  4Q20 A;  1HNZ E;  4O07 A;  4XIP A;  1IBL E;  4DR7 I;  3FT5 A;  4LF7 I;  4DR4 E;  3J81 Q;  2HK3 A;  2IWX A;  3EKO A;  2V2V A;  2XX2 A;  3GIG B;  2YEE A;  3R91 A;  3Q5K A;  4BQG A;  4EFT A;  2YED A;  1I94 E;  4WUD A;  2NPF A;  4LF8 E;  4LWI A;  2Q8H A;  2UXB E;  3OWB A;  4EGI A;  2YKJ A;  4JI0 E;  3HZ5 A;  2HFS A;  3K60 A;  1TID A;  2YJW A;  2XHT A;  2YKE A;  3HHU A;  3VHA A;  4B7P A;  1ZM9 A;  4LFB I;  4DUY E;  4CE3 A;  2XD6 A;  2YK2 A;  1IBK I;  1QZR A;  5CTU A;  3ZZU A;  1PKP A;  4DR1 I;  2ZDX A;  3RLQ A;  3M6A A;  1HR0 I;  4L90 A;  4YKY A;  1ZM4 A;  4DR2 I;  2UUC E;  4YKR A;  2YE5 A;  4NH7 A;  4FWD A;  4LFA E;  1I5C A;  5BR8 E;  2XHR A;  4B3M I;  1THN A;  4V26 A;  1YC1 A;  3TTZ A;  1NZ0 A;  4AWP A;  4LWH A;  4DXL A;  3EHG A;  5A2Q Q;  5A2Q C;  4P52 A;  4LF5 E;  3B78 A;  1XMO E;  1IBL I;  1DAR A;  2F4V E;  2VWC A;  2YE3 A;  4CWO A;  4DZY A;  3A0W A;  3ZZ0 A;  3A0T A;  4EFU A;  4DV6 I;  3ZKB A;  3D4J A;  3B26 A;  3K97 A;  1GJV A;  3VAD A;  2BU5 A;  1KVK A;  4USK A;  1B62 A;  3Q1Q A;  3G75 A;  4R3M A;  5M4K A;  4FCP A;  2UXB I;  3TZ4 A;  4DV4 E;  3MNR P;  4EMV A;  2V8P A;  2Q8G A;  1Y4S A;  4GKK I;  2E0A A;  1YC3 A;  2XK2 A;  1NHH A;  1N36 E;  5CTX A;  1Y8P A;  1AMW A;  1YET A;  2C2A A;  4LWF A;  4Z7C A;  2QF6 A;  2XJX A;  3U2D A;  5M4E A;  3H4L A;  4HYM A;  4MYT A;  2YEC A;  3HEK A;  4JQL A;  4YY3 E;  5D6P A;  1Z5A A;  2DEJ A;  1N32 I;  1UYC A;  2GS8 A;  4W7T A;  4JI8 I;  2WI2 A;  4Z7Y A;  1FWK A;  4UT4 A;  2YK9 A;  5D7D A;  4AWO A;  5D6Q A;  3T2S A;  1BYQ A;  3QT7 A;  4DV0 I;  5CF0 A;  4FWG A;  3D36 A;  1YSZ A;  4CE1 A;  1U0Z A;  1QYE A;  2HKJ A;  3OTO E;  4B3T E;  2YGF A;  3CRL A;  2YE7 A;  4P7A A;  4DR3 I;  2BYI A;  1XMO I;  2F4V I;  2XJG A;  5D7R A;  2O1U A;  5M4N A;  4USM A;  4B3S E;  2YE4 A;  2YI0 A;  5FWK A;  4B3R I;  2XAB A;  3HYZ A;  3IED A;  4HY6 A;  4HXZ A;  4LWE A;  4CWQ A;  2YEB A;  4DV4 I;  1UYH A;  2ESA A;  1N36 I;  4JI6 E;  1ELO A;  2LJP A;  2WI4 A;  4JG4 A;  1Z5B A;  4PRV A;  4CWN A;  2YE2 A;  5FNF A;  4YY3 I;  2IOQ A;  4DPY A;  1TH8 A;  4HZ5 A;  1UY7 A;  4DUH A;  2YI5 A;  4BXI A;  4U93 A;  4URN A;  4DUZ I;  3WU3 A;  3WU5 A;  2XDX A;  2FWY A;  2DEI A;  2PNR A;  3U67 A;  3ZXQ A;  5CTW A;  4DV5 E;  2BM0 A;  3OTO I;  4B3T I;  2WW4 A;  4JI4 I;  1Y4U A;  4XCJ A;  3A0Y A;  4DU8 A;  3LTO A;  2QFO A;  5LMU E;  1UYE A;  2XDU A;  4NH8 A;  1HNX E;  4B3S I;  2V2Z A;  5CPH A;  4KFG A; 
#chains in the Genus database with same CATH topology
 5LMN E;  2CGE A;  2VQE E;  4GT8 A;  4XC0 A;  4RPF A;  1GKX A;  4MPE A;  1RR9 A;  2JEB A;  4U7N A;  4YKU A;  4QNK A;  4DV2 I;  4UTG A;  4YKZ A;  2CZ9 A;  1IBM E;  2EXL A;  2UU9 E;  2YKB A;  4FPP A;  1YS3 A;  3EHH A;  3QTF A;  2WNR A;  3TZ0 A;  4OX9 E;  4JAV A;  4FW5 A;  4ED4 A;  4X62 E;  4PU9 A;  4FN5 A;  1Z0V A;  3K1J A;  5K36 C;  4JI6 I;  3JZ3 A;  1UDN A;  5GGZ A;  3K85 A;  2GQP A;  3VHC A;  1UDQ A;  3OPD A;  4B6C A;  5GMD A;  4DPT A;  2GO4 A;  1Z0G A;  4V25 A;  3LNU A;  4GFN A;  4HZ0 A;  4IS9 A;  4YHH I;  5LL6 R;  4IZK B;  3G7E A;  2ZDY A;  3WU6 A;  4DPX A;  4XDM A;  4DR5 I;  1Z0B A;  4DV5 I;  2CVE A;  4O04 A;  4URO A;  1ZXM A;  1XHK A;  3T1Y E;  3CRK A;  3P3E A;  4DR6 I;  4IFD C;  2A2D A;  2R42 A;  2AKP A;  3H80 A;  3QT5 A;  3OWD A;  1KZN A;  3CYG A;  5FND A;  3PYD A;  1UYD A;  1Z0T A;  4LPB A;  5J6A A;  2HHI A;  4LP0 A;  1WUU A;  2C37 B;  5JEA F;  2BTZ A;  4DV7 E;  1N34 I;  4JI3 I;  4CWP A;  4CE2 A;  3GCM A;  5EKW A;  4JI1 E;  1HNW E;  5K36 E;  4CWF A;  1S4E A;  5IWA I;  2XX4 A;  4EEH A;  1HNZ I;  1N0V C;  5C0X B;  2XJJ A;  2UU9 I;  1BGQ A;  2YE9 A;  1U2R A;  4XCL A;  3A0R A;  2C39 A;  4DR4 I;  4BAE A;  4YKT A;  2WER A;  1OYP A;  4KHP E;  1A4H A;  4XKA A;  3HJC A;  1ZW9 A;  1PIE A;  4DV3 E;  4HY1 A;  1UYG A;  2CCU A;  2JKI A;  1EA6 A;  4OO1 D;  1I94 I;  2BA1 G;  1S14 A;  5IT9 Q;  5IT9 C;  4LF8 I;  3J80 Q;  3J80 C;  1YER A;  4I5S A;  2O1W A;  4NXN E;  3PEH A;  2WNR B;  1J5E E;  5DNL A;  4JI0 I;  4DPW A;  1OSF A;  4XTJ A;  4AS9 A;  1MG7 A;  1I5A A;  4IFD E;  3EHF A;  4GGL A;  5M4H A;  4IFD A;  2CG9 A;  2GQ0 A;  3K17 A;  4DUY I;  4KSH A;  1Y8O A;  4ASA A;  3V2U C;  4ZKI A;  1UYI A;  4KQV A;  2ZM6 E;  2UXD E;  2VW5 A;  2FXS A;  3DGE A;  4FWH A;  2BT0 A;  2XDS A;  3KE6 A;  1H74 A;  3R4O A;  4OO1 E;  4KTN A;  2UUC I;  4XKK A;  3WQ9 A;  4OO1 A;  3B27 A;  5M4E A;  3F0N A;  3QT6 A;  3CGY A;  4LFA I;  5BR8 I;  3B24 A;  1YES A;  1YH8 A;  2BM1 A;  4DV7 I;  1I5D A;  4EMD A;  1MX0 A;  4LF6 E;  4JI1 I;  1HNW I;  1UYK A;  2VQF E;  1OYR A;  1YHC A;  2XEX A;  4YKQ A;  4LF5 I;  1US7 A;  1I59 A;  3T0Z A;  2BSM A;  3D2R A;  3PEJ A;  1ZM2 A;  2J65 A;  4N3O A;  3UHM A;  4GKJ E;  1YC4 A;  3U1Y A;  5F3K A;  4DV1 E;  4MU1 A;  4XKO A;  2UUB E;  1ZM3 A;  1D6T A;  2YGA A;  2C39 B;  5C0X C;  4FW3 A;  3O6O A;  4X65 E;  4HAC A;  3U2K A;  1FWL A;  3PYE A;  1J5E I;  1XNR E;  4JYA E;  1ZWH A;  2IWS A;  1UY8 A;  2ZIT A;  4LF9 E;  4K0K E;  1I58 A;  3INX A;  5FLX C;  3GON A;  3PYF A;  2E1R A;  1N33 E;  2WI3 A;  4DZY A;  1GKZ A;  2PO0 A;  3K99 A;  3TUH A;  3O2F A;  3EKR A;  4AM3 A;  3B4T A;  4ISA A;  4BIU A;  5JEA D;  2ZM6 I;  2UXD I;  1P42 A;  4ASB A;  4U3D A;  1HK7 A;  4KSG A;  3SL2 A;  3T0H A;  3Q5J A;  4NH9 A;  4LCH A;  3EHJ A;  2HHH E;  1EI1 A;  4LFC E;  2Q2E B;  4GQT A;  4CWT A;  1BXD A;  3D0B A;  4FMT A;  1H73 A;  4O09 A;  1VIS A;  2VF3 A;  4LF6 I;  1UYL A;  3K98 A;  2HCH A;  3B25 A;  3R4M A;  1Z5C A;  2UUA E;  1FI4 A;  1N0U A;  2Q8I A;  1Y5Y A;  2Z5C A;  4OO1 B;  4BA2 A;  5FNC A;  4URL A;  2E5L E;  4O05 A;  5C0X E;  4ASF A;  5BOC A;  2YKC A;  1OYS A;  4HYP A;  3FT8 A;  3GIE A;  4LF4 E;  4OZE A;  5CTY A;  5F5R A;  5JEN A;  5JEA E;  4AQY E;  2XDK A;  1H72 C;  5JEA A;  3ZM7 A;  4GKJ I;  2WI1 A;  3HZ1 A;  3VHA A;  2OI2 A;  1TC6 A;  2H55 A;  4XIT A;  4QNJ A;  4NXM E;  4FCR A;  2PNZ A;  4X64 E;  3C0E A;  1UY6 A;  4MPC A;  4X65 I;  2BZ5 A;  1XNR I;  4JYA I;  4L93 A;  2Q8F A;  2YEI A;  3P3C A;  4DPU A;  4L91 A;  1ID0 A;  4DR1 E;  1YSR A;  1N33 I;  4MOT A;  4CWS A;  2V34 A;  3HUL A;  2JEA A;  4E02 A;  2IOR A;  4HAC B;  1HR0 E;  2HKE A;  4R3A A;  2XHX A;  2NN6 D;  3G7B A;  2AJ4 A;  3M7N D;  3RLP A;  2YKI A;  4XE2 A;  3T10 A;  4O0B A;  4I3H A;  2PO0 B;  1QY8 A;  2BU6 A;  2UWD A;  4BQJ A;  2IWU A;  1RRE A;  1YT0 A;  1B3Q A;  4P8O A;  4EM7 A;  2WEQ A;  3J81 C;  2UUA I;  4DV6 E;  2BRC A;  2E5L I;  2V2Q A;  4JI2 E;  4MB9 A;  5LMU I;  3INW A;  2F1D A;  4LF4 I;  1KKH A;  1HNX I;  4LOM A;  4AQY I;  1UDO A;  4QPK A;  5LMN I;  1AH8 A;  2VQE I;  2YI7 A;  2YI6 A;  4E01 A;  1UEK A;  2Z5C B;  4JAU A;  4BA2 B;  4NXM I;  2JJC A;  1FNM A;  4L94 A;  4XIR A;  4X64 I;  3TZ2 A;  4OO1 C;  4GKK E;  1IBM I;  2JT2 A;  2X7I A;  2VCJ A;  1YT2 A;  2WI5 A;  3S5T A;  4JV5 E;  2YGE A;  4K4O A;  5C93 A;  5JEA B;  1H7S A;  1TIL A;  2YEF A;  2GFD A;  3VHD A;  4OX9 I;  3GLL A;  2QG0 A;  4X62 I;  4URM A;  2O3Z A;  3QDD A;  1S16 A;  2YJX A;  3BMY A;  5IDM A;  2PNZ B;  4FW9 A;  3RKZ A;  4AWQ A;  4CWR A;  1F51 A;  1N32 E;  4M1K A;  4GCZ A;  2Z5E A;  4GEE A;  4JI8 E;  4LWG A;  4LCG A;  3V5R A;  1MU5 A;  2CH4 A;  3M7N G;  4LCF A;  4MBC A;  1UY9 A;  4H81 A;  1KTV A;  4DV0 E;  3A0X A;  3LPS A;  1USV A;  2JEA B;  4JAS A;  5GME A;  1YT1 A;  3P3G A;  2YEG A;  4EGH A;  4QPJ A;  4MP7 A;  4YKX A;  4DR3 E;  2WEP A;  2YE6 A;  3HYY A;  4R1F A;  1B63 A;  2FYP A;  2H8M A;  2BV3 A;  3T1Y I;  3Q5L A;  4B3R E;  4JI2 I;  4MPN A;  4MYU A;  3R4N A;  3T1H E;  3J7A M;  3BM9 A;  4EGK A;  4X9L A;  2NN6 F;  1AH6 A;  2BYH A;  3T1K A;  1E3H A;  1FKA E;  1UYM A;  4WUC A;  2BU7 A;  4XIQ A;  3B28 A;  1BKN A;  2YEA A;  2ZBK B;  3HKM A;  2R3V A;  1OJ4 A;  2BRE A;  3WU4 A;  4BA1 A;  4JI5 E;  4JV5 I;  2J7K A;  2NN6 B;  1Y8N A;  3WHA A;  3DD6 A;  2HFU A;  3C11 A;  3JAM Q;  3JAM C;  1ZXN A;  3O0I A;  1Z0E A;  3QT8 A;  4KHP I;  3P06 A;  3M85 D;  4DV3 I;  3L7Z A;  2UXC E;  1Z59 A;  2CCS A;  5DRR A;  1PVG A;  5M4P A;  2ZKJ A;  1K47 A;  3RLR A;  4NXN I;  4DUZ E;  2BU2 A;  3GME A;  1XNQ E;  2C38 B;  1FJG E;  2CCT A;  3LMM A;  4HXW A;  4MDT A;  5JEA C;  4KP4 A;  4L8Z A;  1TBW A;  5M4M A;  2PNM A;  5FLX Q;  5IDJ A;  2VCI A;  1A6F A;  1U2O A;  2BU8 A;  4JI4 E;  4X66 E;  2HK2 A;  2CGF A;  5K36 F;  3R4P A;  4PL9 A;  1JM6 A;  3PS2 A;  1KIJ A;  2K5B A;  1XMQ E;  3GIF A;  3CWV A;  1R62 A;  1R6L A;  2XX5 A;  4FCQ A;  2PNL A;  2FWZ A;  3J7A G;  3GIG A;  4E00 A;  2EFG A;  3PYG A;  4PRX A;  4U7O A;  3ZXO A;  3T1H I;  2XCM A;  4DV2 E;  1H7U A;  4JI7 E;  1L0O A;  5J71 A;  4DR7 E;  4IZJ D;  3CGZ A;  3B8H A;  4LF7 E;  3ZKD A;  4MQY A;  4ZVI A;  2VQF I;  1TC0 A;  5BOD A;  1AJ6 A;  3ZZT A;  4JI5 I;  1NHJ A;  1Z0W A;  5DNX A;  3R92 A;  5D7C A;  3FV5 A;  2C1I A;  2YEH A;  3M85 G;  2YE8 A;  1NHI A;  4DV1 I;  2UXC I;  2UUB I;  2X36 A;  2QG2 A;  4MP2 A;  4BIZ A;  4DU7 A;  1E3P A;  2JE6 A;  4BA1 B;  2PO2 A;  4MU0 A;  1Y6Z A;  4YHH E;  1XNQ I;  1FJG I;  2NN6 C;  4WUB A;  5L3J A;  2PO1 B;  4LFB E;  1UYF A;  4LF9 I;  4K0K I;  4H7Q A;  2O1V A;  1IBK E;  4IZJ A;  3B82 A;  3L7Z B;  5IN9 A;  2HG1 A;  2WI7 A;  2IER A;  4DR5 E;  2YEJ A;  1AM1 A;  4X66 I;  1Z0C A;  3OMU A;  2FTK A;  2IOP A;  4ASG A;  1Y60 A;  2BA0 D;  2A2C A;  4DR6 E;  4YKW A;  4DR2 E;  1XMQ I;  2WP8 B;  1I5B A;  4XD8 A;  3OW6 A;  3TZ5 A;  4B3M E;  4JI3 E;  1N34 E;  3NMQ A;  2HHH I;  3A0Z A;  2XDL A;  4LFC I;  4H85 A;  4JI7 I;  5IWA E;  3CDJ A;  4Q20 A;  1HNZ E;  4O07 A;  4XIP A;  3CDI A;  1IBL E;  4DR7 I;  3FT5 A;  4LF7 I;  4DR4 E;  3J81 Q;  2HK3 A;  2IWX A;  3EKO A;  2BR2 A;  2V2V A;  2XX2 A;  2YEE A;  3GIG B;  3R91 A;  3Q5K A;  4BQG A;  4EFT A;  4FW6 A;  4E72 A;  2YED A;  2NN6 E;  1I94 E;  2BA1 D;  4WUD A;  2NPF A;  4LF8 E;  2NN6 A;  4LWI A;  1RHY A;  2Q8H A;  2UXB E;  3OWB A;  4EGI A;  5DRQ A;  2YKJ A;  4JI0 E;  3HZ5 A;  2HFS A;  3K60 A;  5DRP A;  5K36 D;  1TID A;  1VI7 A;  2XHT A;  2YKE A;  2YJW A;  3HHU A;  2GO3 A;  1ZM9 A;  4LFB I;  4DUY E;  4B7P A;  4CE3 A;  4OKG A;  2XD6 A;  2YK2 A;  1IBK I;  1QZR A;  5CTU A;  2C38 A;  2O1T A;  3ZZU A;  1PKP A;  4DR1 I;  2ZDX A;  3RLQ A;  3M6A A;  2JE6 B;  1USU A;  2PO2 B;  4MU4 A;  3U1K A;  2BA0 G;  4AIM A;  1HR0 I;  4L90 A;  5EL9 A;  1XXE A;  1ZM4 A;  4FW4 A;  4DR2 I;  2UUC E;  4YKR A;  4YKY A;  2YE5 A;  4NH7 A;  4IZJ B;  4FWD A;  5C0X F;  4LFA E;  1I5C A;  3PS1 A;  5BR8 E;  3H1C A;  2XHR A;  4B3M I;  1THN A;  4V26 A;  1UDS A;  1YC1 A;  3TTZ A;  1NZ0 A;  4AWP A;  4LWH A;  4DXL A;  3NZK A;  5A2Q Q;  5A2Q C;  4P52 A;  4IFD D;  5K36 A;  3EHG A;  4LF5 E;  2Z5B A;  3B78 A;  1XMO E;  1DAR A;  1IBL I;  2F4V E;  2VWC A;  2YE3 A;  4AID A;  3A0W A;  4CWO A;  3ZZ0 A;  3A0T A;  4EFU A;  4DV6 I;  3ZKB A;  3D4J A;  3B26 A;  3K97 A;  2JEB B;  1GJV A;  2IES A;  2BU5 A;  3VAD A;  3KRN A;  1KVK A;  4USK A;  1B62 A;  3Q1Q A;  2WI6 A;  3G75 A;  4R3M A;  5M4K A;  4FCP A;  2UXB I;  3TZ4 A;  2BR2 B;  4DV4 E;  3MNR P;  4EMV A;  2V8P A;  2Q8G A;  1Y4S A;  4GKK I;  2E0A A;  1YC3 A;  2XK2 A;  1NHH A;  1N36 E;  5CTX A;  1Y8P A;  1AMW A;  1YET A;  2C2A A;  4MU3 A;  4FW7 A;  4LWF A;  4Z7C A;  2PO1 A;  2QF6 A;  2XJX A;  3U2D A;  2C1G A;  3H4L A;  4HYM A;  4MYT A;  2YEC A;  3HEK A;  4JQL A;  4YY3 E;  5D6P A;  1Z5A A;  2DEJ A;  1N32 I;  1UYC A;  2GS8 A;  4W7T A;  4JI8 I;  2WI2 A;  4Z7Y A;  1FWK A;  4NBQ A;  4UT4 A;  2YK9 A;  4GQU A;  5D7D A;  2WP8 A;  5D6Q A;  3T2S A;  1BYQ A;  3QT7 A;  4AWO A;  4DV0 I;  5CF0 A;  4FWG A;  3D36 A;  1YSZ A;  5ELW A;  4CE1 A;  1U0Z A;  1QYE A;  2HKJ A;  3OTO E;  4B3T E;  2YGF A;  3CRL A;  2YE7 A;  4P7A A;  4DR3 I;  2BYI A;  1XMO I;  2F4V I;  3P76 A;  2AE8 A;  2XJG A;  5D7R A;  2O1U A;  4J3D A;  4USM A;  5M4N A;  4LPF A;  4B3S E;  2YE4 A;  2YI0 A;  5FWK A;  4B3R I;  2XAB A;  3HYZ A;  3IED A;  5K36 B;  4HY6 A;  4HXZ A;  4LWE A;  4CWQ A;  2Z5B B;  3PS3 A;  4U3B A;  2YEB A;  4DV4 I;  1UYH A;  2ESA A;  1N36 I;  4JI6 E;  1ELO A;  2LJP A;  4IFD F;  2WI4 A;  5C0X D;  4IZK A;  2VES A;  4JG4 A;  1Z5B A;  4PRV A;  4CWN A;  1IXM A;  2YE2 A;  1R6M A;  5FNF A;  2IOQ A;  4YY3 I;  3Q6M A;  4DPY A;  1TH8 A;  4HZ5 A;  1UY7 A;  4DUH A;  3PRY A;  2YI5 A;  4BXI A;  5DRO A;  4IFD B;  4U93 A;  4URN A;  4DUZ I;  3WU3 A;  4OO1 F;  3WU5 A;  2XDX A;  2FWY A;  2DEI A;  2PNR A;  3U67 A;  3ZXQ A;  3Q6N A;  5CTW A;  2C37 A;  2BM0 A;  3OTO I;  4DV5 E;  1Y4U A;  2WW4 A;  4B3T I;  4JI4 I;  4XCJ A;  3A0Y A;  4DU8 A;  3LTO A;  2QFO A;  5LMU E;  5C0X A;  1UYE A;  2XDU A;  4NH8 A;  1HNX E;  4B3S I;  2V2Z A;  5CPH A;  4KFG A; 
#chains in the Genus database with same CATH homology
 5LMN E;  2CGE A;  2VQE E;  4GT8 A;  4XC0 A;  4RPF A;  1GKX A;  4MPE A;  1RR9 A;  4U7N A;  4YKU A;  4YKZ A;  4DV2 I;  4UTG A;  2CZ9 A;  1IBM E;  2EXL A;  2UU9 E;  2YKB A;  4FPP A;  1YS3 A;  3EHH A;  3QTF A;  3TZ0 A;  4OX9 E;  4JAV A;  4ED4 A;  4X62 E;  4PU9 A;  4FN5 A;  1Z0V A;  3K1J A;  4JI6 I;  3JZ3 A;  5GGZ A;  3K85 A;  2GQP A;  3VHC A;  3OPD A;  4B6C A;  5GMD A;  4DPT A;  1Z0G A;  4V25 A;  3LNU A;  4GFN A;  4HZ0 A;  4YHH I;  5LL6 R;  4IZK B;  3G7E A;  2ZDY A;  3WU6 A;  4DPX A;  4XDM A;  4DR5 I;  1Z0B A;  4DV5 I;  4O04 A;  4URO A;  1ZXM A;  1XHK A;  3T1Y E;  3CRK A;  4DR6 I;  2AKP A;  2A2D A;  2R42 A;  3H80 A;  3OWD A;  3QT5 A;  1KZN A;  5FND A;  3PYD A;  1UYD A;  1Z0T A;  4LPB A;  5J6A A;  4LP0 A;  4CWP A;  1WUU A;  2BTZ A;  4DV7 E;  1N34 I;  4JI3 I;  4CE2 A;  4JI1 E;  1HNW E;  4CWF A;  1S4E A;  5IWA I;  2XX4 A;  4EEH A;  1HNZ I;  1N0V C;  2XJJ A;  2UU9 I;  1BGQ A;  2YE9 A;  1U2R A;  4XCL A;  3A0R A;  4DR4 I;  4BAE A;  4YKT A;  2WER A;  4KHP E;  1A4H A;  4XKA A;  3HJC A;  1ZW9 A;  1PIE A;  4DV3 E;  4HY1 A;  1UYG A;  2CCU A;  2JKI A;  1EA6 A;  1I94 I;  1S14 A;  5IT9 Q;  5IT9 C;  4LF8 I;  3J80 Q;  3J80 C;  1YER A;  4I5S A;  2O1W A;  4NXN E;  3PEH A;  1J5E E;  4JI0 I;  4DPW A;  1OSF A;  4XTJ A;  4AS9 A;  1MG7 A;  1I5A A;  3EHF A;  4GGL A;  5M4H A;  2CG9 A;  2GQ0 A;  3K17 A;  4DUY I;  4KSH A;  1Y8O A;  4ASA A;  3V2U C;  4ZKI A;  1UYI A;  4KQV A;  2ZM6 E;  2UXD E;  2VW5 A;  2FXS A;  3DGE A;  4FWH A;  2BT0 A;  2XDS A;  3KE6 A;  1H74 A;  3R4O A;  4KTN A;  3WQ9 A;  2UUC I;  4XKK A;  3B27 A;  3F0N A;  3QT6 A;  3CGY A;  4LFA I;  5BR8 I;  3B24 A;  1YES A;  2BM1 A;  4DV7 I;  1I5D A;  4EMD A;  1MX0 A;  4LF6 E;  4JI1 I;  1HNW I;  1UYK A;  2VQF E;  4YKQ A;  2XEX A;  4LF5 I;  1US7 A;  1I59 A;  3T0Z A;  2BSM A;  3D2R A;  3PEJ A;  1ZM2 A;  4N3O A;  4GKJ E;  1YC4 A;  5F3K A;  4DV1 E;  4XKO A;  2UUB E;  1ZM3 A;  1D6T A;  2YGA A;  3O6O A;  4X65 E;  4HAC A;  3U2K A;  1FWL A;  3PYE A;  1J5E I;  1XNR E;  4JYA E;  1ZWH A;  2IWS A;  1UY8 A;  2ZIT A;  4LF9 E;  4K0K E;  1I58 A;  3INX A;  5FLX C;  3GON A;  3PYF A;  2E1R A;  1N33 E;  2WI3 A;  4DZY A;  1GKZ A;  3K99 A;  3TUH A;  3O2F A;  3EKR A;  4BIU A;  2ZM6 I;  2UXD I;  4ASB A;  1HK7 A;  4KSG A;  3SL2 A;  3T0H A;  3Q5J A;  4NH9 A;  3EHJ A;  2HHH E;  1EI1 A;  4LFC E;  2Q2E B;  4GQT A;  4CWT A;  1BXD A;  3D0B A;  4FMT A;  1H73 A;  4O09 A;  1VIS A;  2VF3 A;  4LF6 I;  1UYL A;  3K98 A;  2HCH A;  3B25 A;  3R4M A;  1Z5C A;  2UUA E;  1FI4 A;  1N0U A;  2Q8I A;  2Z5C A;  5FNC A;  4URL A;  2E5L E;  4O05 A;  4ASF A;  5BOC A;  2YKC A;  4HYP A;  3FT8 A;  3GIE A;  4LF4 E;  5CTY A;  5F5R A;  2XDK A;  4AQY E;  1H72 C;  3ZM7 A;  4GKJ I;  2WI1 A;  3HZ1 A;  2OI2 A;  1TC6 A;  2H55 A;  4XIT A;  4FCR A;  4NXM E;  4X64 E;  3C0E A;  1UY6 A;  4MPC A;  4X65 I;  2BZ5 A;  1XNR I;  4JYA I;  4L93 A;  2Q8F A;  2YEI A;  4L91 A;  4DPU A;  1ID0 A;  4DR1 E;  1YSR A;  1N33 I;  4MOT A;  4CWS A;  2V34 A;  3HUL A;  4E02 A;  2IOR A;  4HAC B;  1HR0 E;  2HKE A;  4R3A A;  2XHX A;  3G7B A;  2AJ4 A;  3RLP A;  2YKI A;  4XE2 A;  3T10 A;  4O0B A;  4I3H A;  1QY8 A;  2BU6 A;  2UWD A;  4BQJ A;  2IWU A;  1RRE A;  1YT0 A;  1B3Q A;  4P8O A;  4EM7 A;  2WEQ A;  3J81 C;  2UUA I;  4DV6 E;  2BRC A;  2E5L I;  2V2Q A;  4JI2 E;  4MB9 A;  5LMU I;  3INW A;  4LF4 I;  1KKH A;  1HNX I;  4AQY I;  4QPK A;  5LMN I;  1AH8 A;  2VQE I;  2YI7 A;  2YI6 A;  4E01 A;  1UEK A;  2Z5C B;  4JAU A;  4L94 A;  4NXM I;  2JJC A;  1FNM A;  4XIR A;  3TZ2 A;  4X64 I;  4GKK E;  1IBM I;  2X7I A;  2VCJ A;  1YT2 A;  2WI5 A;  4JV5 E;  2YGE A;  4K4O A;  5C93 A;  1TIL A;  1H7S A;  2YEF A;  2GFD A;  3VHD A;  4OX9 I;  2QG0 A;  4X62 I;  4URM A;  3QDD A;  1S16 A;  2YJX A;  3BMY A;  5IDM A;  4FW9 A;  3RKZ A;  4AWQ A;  4CWR A;  1N32 E;  4M1K A;  4GCZ A;  2Z5E A;  4GEE A;  4JI8 E;  4LWG A;  3V5R A;  1MU5 A;  2CH4 A;  4MBC A;  1UY9 A;  4H81 A;  1KTV A;  4DV0 E;  3A0X A;  3LPS A;  1USV A;  4JAS A;  5GME A;  1YT1 A;  4EGH A;  2YEG A;  4QPJ A;  4MP7 A;  4YKX A;  4DR3 E;  2WEP A;  2YE6 A;  3HYY A;  4R1F A;  1B63 A;  2FYP A;  2H8M A;  2BV3 A;  3T1Y I;  3Q5L A;  4B3R E;  4JI2 I;  4MPN A;  4MYU A;  3R4N A;  3T1H E;  3J7A M;  3BM9 A;  4EGK A;  4X9L A;  2BYH A;  1AH6 A;  3T1K A;  1FKA E;  1UYM A;  4WUC A;  2BU7 A;  4XIQ A;  3B28 A;  1BKN A;  2YEA A;  2ZBK B;  2R3V A;  1OJ4 A;  2BRE A;  3WU4 A;  4JV5 I;  4JI5 E;  2J7K A;  1Y8N A;  3WHA A;  2HFU A;  3C11 A;  3JAM Q;  3JAM C;  1ZXN A;  3O0I A;  1Z0E A;  3QT8 A;  4KHP I;  3P06 A;  4DV3 I;  2UXC E;  1Z59 A;  2CCS A;  1PVG A;  5M4P A;  2ZKJ A;  1K47 A;  3RLR A;  4NXN I;  4DUZ E;  2BU2 A;  2CCT A;  1XNQ E;  4HXW A;  1FJG E;  4KP4 A;  5M4M A;  4L8Z A;  1TBW A;  2PNM A;  5FLX Q;  5IDJ A;  2VCI A;  1A6F A;  1U2O A;  2BU8 A;  4JI4 E;  4X66 E;  2HK2 A;  2CGF A;  3R4P A;  4PL9 A;  1JM6 A;  2K5B A;  1KIJ A;  1XMQ E;  3GIF A;  3CWV A;  1R62 A;  2XX5 A;  4FCQ A;  2PNL A;  2FWZ A;  3J7A G;  3GIG A;  4E00 A;  2EFG A;  3PYG A;  4PRX A;  4U7O A;  3ZXO A;  3T1H I;  2XCM A;  4DV2 E;  1H7U A;  4JI7 E;  1L0O A;  5J71 A;  4DR7 E;  4IZJ D;  3CGZ A;  3B8H A;  4LF7 E;  3ZKD A;  4ZVI A;  1TC0 A;  2VQF I;  5BOD A;  1AJ6 A;  3ZZT A;  4JI5 I;  1NHJ A;  1Z0W A;  3R92 A;  5D7C A;  3FV5 A;  2YEH A;  2YE8 A;  1NHI A;  4DV1 I;  2UXC I;  2UUB I;  2X36 A;  2QG2 A;  4MP2 A;  4BIZ A;  4DU7 A;  1Y6Z A;  4YHH E;  1XNQ I;  1FJG I;  4WUB A;  5L3J A;  4LFB E;  1UYF A;  2WI6 A;  4H7Q A;  4LF9 I;  4K0K I;  2O1V A;  1IBK E;  4IZJ A;  3B82 A;  5IN9 A;  2HG1 A;  2WI7 A;  4DR5 E;  2YEJ A;  1AM1 A;  4X66 I;  1Z0C A;  3OMU A;  2IOP A;  4ASG A;  2A2C A;  4DR6 E;  4YKW A;  4DR2 E;  1XMQ I;  1I5B A;  4XD8 A;  3OW6 A;  3TZ5 A;  4B3M E;  4JI3 E;  1N34 E;  3NMQ A;  2HHH I;  3A0Z A;  2XDL A;  4LFC I;  4H85 A;  4JI7 I;  5IWA E;  4Q20 A;  1HNZ E;  4O07 A;  4XIP A;  1IBL E;  4DR7 I;  3FT5 A;  4LF7 I;  4DR4 E;  3J81 Q;  2HK3 A;  2IWX A;  3EKO A;  2V2V A;  2XX2 A;  3GIG B;  2YEE A;  3R91 A;  3Q5K A;  4BQG A;  4EFT A;  2YED A;  1I94 E;  4WUD A;  2NPF A;  4LF8 E;  4LWI A;  2Q8H A;  2UXB E;  3OWB A;  4EGI A;  2YKJ A;  4JI0 E;  3HZ5 A;  2HFS A;  3K60 A;  1TID A;  2YJW A;  2XHT A;  2YKE A;  3HHU A;  3VHA A;  4B7P A;  1ZM9 A;  4LFB I;  4DUY E;  4CE3 A;  2XD6 A;  2YK2 A;  1IBK I;  1QZR A;  5CTU A;  2O1T A;  3ZZU A;  1PKP A;  4DR1 I;  2ZDX A;  3RLQ A;  3M6A A;  1USU A;  1HR0 I;  4L90 A;  4YKY A;  1ZM4 A;  4DR2 I;  2UUC E;  4YKR A;  2YE5 A;  4NH7 A;  4IZJ B;  4FWD A;  4LFA E;  1I5C A;  5BR8 E;  2XHR A;  4B3M I;  1THN A;  4V26 A;  1YC1 A;  3TTZ A;  1NZ0 A;  4AWP A;  4LWH A;  4DXL A;  3EHG A;  5A2Q Q;  5A2Q C;  4P52 A;  4LF5 E;  2Z5B A;  3B78 A;  1XMO E;  1DAR A;  1IBL I;  2F4V E;  2VWC A;  2YE3 A;  4CWO A;  3A0W A;  3ZZ0 A;  3A0T A;  4EFU A;  4DV6 I;  3ZKB A;  3D4J A;  3B26 A;  3K97 A;  1GJV A;  3VAD A;  2BU5 A;  1KVK A;  4USK A;  1B62 A;  3Q1Q A;  3G75 A;  4R3M A;  5M4K A;  4FCP A;  2UXB I;  3TZ4 A;  4DV4 E;  3MNR P;  4EMV A;  2V8P A;  2Q8G A;  1Y4S A;  4GKK I;  2E0A A;  1YC3 A;  2XK2 A;  1NHH A;  1N36 E;  5CTX A;  1Y8P A;  1AMW A;  1YET A;  2C2A A;  4LWF A;  4Z7C A;  2QF6 A;  2XJX A;  3U2D A;  5M4E A;  3H4L A;  4HYM A;  4MYT A;  2YEC A;  3HEK A;  4JQL A;  4YY3 E;  5D6P A;  1Z5A A;  2DEJ A;  1N32 I;  1UYC A;  2GS8 A;  4W7T A;  4JI8 I;  2WI2 A;  4Z7Y A;  1FWK A;  4UT4 A;  2YK9 A;  5D7D A;  4AWO A;  5D6Q A;  3T2S A;  1BYQ A;  3QT7 A;  4DV0 I;  5CF0 A;  4FWG A;  3D36 A;  1YSZ A;  4CE1 A;  1U0Z A;  1QYE A;  2HKJ A;  3OTO E;  4B3T E;  2YGF A;  3CRL A;  2YE7 A;  4P7A A;  4DR3 I;  2BYI A;  1XMO I;  2F4V I;  2XJG A;  5D7R A;  2O1U A;  5M4N A;  4USM A;  4B3S E;  2YE4 A;  2YI0 A;  5FWK A;  4B3R I;  2XAB A;  3HYZ A;  3IED A;  4HY6 A;  4HXZ A;  4LWE A;  4CWQ A;  2Z5B B;  2YEB A;  4DV4 I;  1UYH A;  2ESA A;  1N36 I;  4JI6 E;  1ELO A;  2LJP A;  2WI4 A;  4IZK A;  4JG4 A;  1Z5B A;  4PRV A;  4CWN A;  2YE2 A;  5FNF A;  2IOQ A;  4YY3 I;  3Q6M A;  4DPY A;  1TH8 A;  4HZ5 A;  1UY7 A;  4DUH A;  3PRY A;  2YI5 A;  4BXI A;  4U93 A;  4URN A;  4DUZ I;  3WU3 A;  3WU5 A;  2XDX A;  2FWY A;  2DEI A;  2PNR A;  3U67 A;  3ZXQ A;  3Q6N A;  5CTW A;  4DV5 E;  2BM0 A;  3OTO I;  4B3T I;  1Y4U A;  2WW4 A;  4JI4 I;  4XCJ A;  3A0Y A;  4DU8 A;  3LTO A;  2QFO A;  5LMU E;  1UYE A;  2XDU A;  4NH8 A;  1HNX E;  4B3S I;  2V2Z A;  5CPH A;  4KFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...