1PVGA

Crystal structure of the atpase region of saccharomyces cerevisiae topoisomerase ii
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
400
structure length
378
Chain Sequence
SASDKYQKISQLEHILKRPDTYIGSVETQEQLQWIYDEETDCMIEKNVTIVPGLFKIFDEILVNAADNKVRDPSMKRIDVNIHAEEHTIEVKNDGKGIPIEIHNKENIYIPEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILETADLNVGQKYVQKWENNMSICHPPKITSYKKGPSYTKVTFKPDLTRFGMKELDNDILGVMRRRVYDINGSVRDINVYLNGKSLKIRNFKNYVELYLKSLIPTILYERINNRWEVAFAVSDISFQQISFVNSIATTMGGTHVNYITDQIVKKISEILKKVKSFQIKNNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCEIPLEYINKIMKTDLATRMFEIADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA topoisomerase II
publication title Structure of the topoisomerase II ATPase region and its mechanism of inhibition by the chemotherapeutic agent ICRF-187
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 113
structure length 378
sequence length 400
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2003-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1pvgA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1pvgA01
2CGFA 4LF4I 2XX4A 2YK2A 1ZWHA 3BMYA 5CF0A 4LF4E 5IT9Q 2WI6A 4USMA 2ESAA 4JYAI 1I58A 2ZKJA 4KP4A 3R92A 4EEHA 4EGKA 3QT7A 1UYIA 4JYAE 2ZBKB 3LPSA 4P52A 1J5EI 4GKJI 2YJWA 4K4OA 4RPFA 3J80Q 4GKJE 1J5EE 4PU9A 2XK2A 3CRKA 2VF3A 3VHAA 4MP2A 4ASAA 2DEJA 5BR8I 2YKEA 2BU6A 2CG9A 5BR8E 4YKZA 4CWOA 4JI6I 1ZXNA 4XD8A 4X65I 4LF8I 1ID0A 2QG2A 4B7PA 2UUCE 4X64E 2PNRA 4X65E 3JAMC 3B24A 4GT8A 1S14A 4QPJA 5D6QA 4BXIA 1RR9A 4E02A 2V2QA 3B27A 5CPHA 4KQVA 2XJGA 3WQ9A 1UYMA 4AWQA 1US7A 1Z0WA 4XDMA 4LFCI 4ED4A 1KIJA 2WI1A 3QDDA 4LFCE 1KZNA 1Z0EA 3ZXOA 4OX9I 3HZ5A 2V8PA 2VQEI 4L8ZA 3U2DA 3K60A 4HACA 1N36I 4DUHA 2VQEE 1GKZA 1N36E 4O05A 4FWGA 1YC1A 1HNXI 3T0HA 4LWGA 1YC3A 4DU7A 4AQYI 1UYLA 3A0XA 2DEIA 3QT6A 4JG4A 5LL6R 3ZM7A 1KTVA 4AQYE 4FMTA 2Q8IA 4AWPA 1YETA 4FCPA 5IT9C 2WEQA 4MBCA 4U7NA 4LWIA 4ASGA 4H7QA 3RLPA 1H73A 1ZM4A 1B63A 4GGLA 5FNCA 2XCMA 3J80C 2BTZA 2QF6A 2YKIA 4HXZA 3MNRP 1AH8A 2XJXA 3R4OA 4YKRA 1A4HA 1QY8A 3ZKDA 2HCHA 2V34A 4LF6E 1R62A 2UU9I 4DV5I 1YERA 2A2CA 3K1JA 4UTGA 1UY9A 2UU9E 4DV5E 4B3RI 1GKXA 1IBMI 4JV5I 4MYUA 4NH7A 1IBME 4JV5E 1OSFA 1VISA 2UWDA 4BAEA 3ZZTA 4R3MA 2QG0A 2R42A 1YESA 2BU7A 3JZ3A 2XD6A 3TZ0A 4EMDA 4HXWA 4LWFA 4LPBA 2WI3A 4GEEA 3OWDA 2BT0A 4LWEA 4AWOA 4MYTA 1ZXMA 4JI8I 2Q8FA 3BM9A 2XJJA 4DUYI 2YE4A 4UROA 1N0UA 3TZ4A 4DUYE 3R4NA 3WU5A 4NH9A 2WI2A 4JI7E 4WUCA 4XCLA 3CGZA 3B26A 5FNDA 3INWA 1IBLI 3FV5A 1ZM9A 4GFNA 4P8OA 1ZM3A 1IBLE 4GKKI 2EXLA 1B62A 4FWDA 4JI0E 5M4EA 1FKAE 4DR6I 4MPNA 4DR1I 3KE6A 4YY3E 4GKKE 1Z5AA 4DR6E 3H4LA 4DR1E 2QFOA 2Q2EB 2UXCI 1I5BA 1NHHA 1XMQE 4MB9A 4AS9A 3A0WA 2UXCE 2BZ5A 3C11A 4V26A 3OW6A 4FWHA 4DV2I 5D6PA 5CTUA 4GQTA 1UY7A 4DV2E 2CH4A 3LNUA 4YKQA 3D36A 3RKZA 4DXLA 4PRXA 1XNQE 2BRCA 2YKJA 1HNWI 2O1VA 3SL2A 1Z0TA 2YEIA 1HNWE 4DV0E 2BYHA 1EA6A 4MP7A 4FW9A 3T1YI 1ZM2A 5M4KA 4DV4E 1GJVA 1Z5CA 4U93A 3T1YE 3PYEA 4K0KI 3B25A 4DUZI 2UUCI 3T1HI 2CCSA 4X64I 4K0KE 4L94A 2V2ZA 4DUZE 3T1HE 1D6TA 4WUDA 2R3VA 3GONA 1HNZI 5IWAI 2YE7A 5CTWA 4DR7I 4H81A 3Q5JA 1HNZE 5IWAE 1THNA 4DR7E 4JQLA 3CRLA 4EGIA 1KVKA 3OTOI 4JI1E 1N33I 2XHXA 1I59A 4LFAI 4GCZA 1U0ZA 1DARA 3OTOE 1N33E 4CWNA 1QYEA 4LFAE 5FLXQ 2FWZA 4R1FA 4URLA 4B6CA 2HFUA 4XIQA 3ZZUA 3U67A 2YE3A 4YKTA 4LP0A 4DPWA 4DR3E 4URNA 2HKJA 5BODA 2WERA 3QTFA 1H74A 2YE2A 4DV3E 4U7OA 3VADA 3J7AM 2GQPA 2JKIA 4XCJA 3Q1QA 1I5DA 2BU8A 2IWSA 4FCRA 3K98A 1FWKA 4XITA 2XX2A 1Z0CA 3H80A 2VWCA 1YS3A 4HZ0A 2HKEA 2UXBE 1UYFA 5D7CA 3T0ZA 3VHDA 3EHFA 5A2QQ 3ZKBA 2X7IA 5IDJA 4HACB 1I94I 3PYDA 1I94E 3OWBA 4NH8A 3GIGA 3G7EA 5D7DA 5M4MA 2XHRA 3WU6A 5LMNE 1UYEA 1Z0BA 3J81Q 1OJ4A 2YJXA 1UY8A 3INXA 1H7UA 2YI6A 4EGHA 4LF6I 2IOPA 3NMQA 4O0BA 2X36A 3D0BA 1U2RA 2GFDA 3HEKA 2VCJA 1FJGE 2OI2A 2XDUA 4JI5I 1TH8A 4YKWA 4E01A 1TBWA 1Y8PA 3QT5A 3C0EA 3R4PA 4ZKIA 2E1RA 3HULA 1HR0I 4B3MI 4JI5E 3O0IA 1UEKA 1N32I 4O09A 2EFGA 4DPTA 1HR0E 4B3ME 3HYZA 1N32E 4HYPA 4X66I 1NHJA 4B3SI 3TZ5A 3OPDA 3FT8A 4X66E 4WUBA 4B3SE 2XDXA 2HK3A 4HYMA 4KTNA 2HFSA 3RLRA 1B3QA 4BQJA 3WU3A 5FLXC 1N0VC 4LF9I 4DR4I 2YEHA 2UXDE 1XHKA 3PEHA 4LF9E 4DR4E 2YGEA 4B3TI 1MG7A 3O2FA 2NPFA 4B3TE 5M4PA 2VW5A 1MU5A 5M4NA 4FPPA 4LF7I 3J7AG 4KFGA 3TZ2A 1ELOA 5GMEA 2O1WA 2BYIA 4LF7E 4JI7I 4XC0A 4QPKA 4XKOA 1S4EA 2VQFI 2CCUA 1NHIA 2VQFE 4JI0I 4LWHA 1ZW9A 4CWQA 1YT1A 1UYCA 3EHJA 3WHAA 4YY3I 3QT8A 5A2QC 4JI3I 3V2UC 5FNFA 2V2VA 2AJ4A 4JI3E 1XMQI 4LF5I 2YKCA 4YKXA 4Q20A 4CE3A 4EMVA 4LF5E 3B28A 4R3AA 2WI5A 3G75A 4EFTA 5FWKA 5LMUI 3J81C 2BU2A 2UUAI 5LMUE 4DPXA 2Q8GA 1Z0VA 2UUAE 1XNQI 2HG1A 3T10A 1H7SA 2VCIA 4L91A 2J7KA 2XDLA 1QZRA 1N34I 4EFUA 4I3HA 4DV0I 4URMA 5C93A 1MX0A 2IOQA 4DV4I 1I5CA 1N34E 3U2KA 3ZXQA 1FNMA 2K5BA 2YEFA 4JAVA 4MPEA 4XTJA 2IWXA 1XNRI 2BM0A 4E00A 4I5SA 4HY1A 1XNRE 2O1UA 4JI4I 3IEDA 1BYQA 1BXDA 2YI7A 4JI4E 2IWUA 3TUHA 3F0NA 4BIZA 4DV1I 4KSHA 3GIEA 1NZ0A 3LTOA 1L0OA 1YSZA 2YI5A 4DV1E 5IDMA 4NXNI 2H8MA 3CGYA 4JI1I 3M6AA 4NXNE 1Z59A 2BV3A 4Z7CA 2BREA 3CWVA 1Z0GA 2GS8A 2H55A 4X62I 4DR3I 1K47A 2YEBA 4JI6E 2E0AA 4X62E 4LF8E 2FYPA 1A6FA 1UYGA 2YKBA 3A0RA 2JJCA 4HY6A 4DV3I 4FCQA 1I5AA 1H72C 3B82A 3D4JA 1YC4A 2FWYA 2FXSA 1JM6A 2LJPA 2YGAA 2ZDXA 1UYHA 2YE8A 2WW4A 3G7BA 2HK2A 1PIEA 3DGEA 4CWRA 3R4MA 1PVGA 4YHHI 4DR5I 3RLQA 4DV6I 4JAUA 2YEAA 3EKRA 2UXBI 4YHHE 4DR5E 4XIPA 3ZZ0A 4DV6E 1WUUA 3O6OA 1UYDA 3EHHA 5F5RA 3B8HA 2C2AA 4MPCA 3EKOA 1FI4A 2YK9A 2ZDYA 1EI1A 1KKHA 4MOTA 4BIUA 2XDKA 3D2RA 1RREA 4OX9E 4KSGA 2BSMA 4XKKA 4DZYA 1Y4UA 4JASA 5LMNI 2XX5A 4XKAA 1UY6A 2WI7A 4YKUA 2YI0A 4PRVA 1BKNA 1HNXE 1Y8NA 1YT0A 3K97A 2WEPA 2ZITA 4USKA 3FT5A 1U2OA 5J71A 4ASFA 1YT2A 4CWPA 1Z5BA 4P7AA 3R91A 1TC0A 1FJGI 5M4HA 4V25A 3T2SA 2ZM6I 1AJ6A 3PEJA 4CWFA 4CWSA 1S16A 3TTZA 4ASBA 4DR2I 2BM1A 2ZM6E 1AMWA 1IBKI 2Q8HA 5F3KA 5GMDA 4DR2E 1IBKE 2YE6A 4XE2A 3GIGB 1XMOI 2YEDA 1Y8OA 4YKYA 4Z7YA 4CWTA 2HHHI 4ZVIA 1XMOE 4UT4A 2HHHE 4BQGA 1AH6A 2UXDI 4L90A 3PYFA 4FN5A 1TIDA 3EHGA 2XHTA 2IORA 2YECA 3V5RA 4LFBI 2YEEA 5GGZA 3VHCA 2YEJA 4LFBE 1TILA 2E5LI 4B3RE 4EM7A 3HZ1A 2E5LE 4H85A 2YE5A 1BGQA 1TC6A 3JAMQ 3GIFA 3HHUA 4XIRA 1YSRA 4W7TA 3Q5KA 4M1KA 2XABA 4X9LA 1UYKA 5BOCA 3OMUA 3A0TA 4HZ5A 3WU4A 5IN9A 4KHPI 4NXMI 2A2DA 4DPUA 2F4VI 5D7RA 3PYGA 2WI4A 4CE2A 4KHPE 4NXME 3B78A 2XDSA 4O07A 2F4VE 2YGFA 3T1KA 2UUBI 3A0ZA 5J6AA 4L93A 1AM1A 2YEGA 2UUBE 2CZ9A 4JI8E 5L3JA 4DU8A 2BU5A 4DPYA 3A0YA 4JI2I 3K17A 3HYYA 4O04A 3K99A 1PKPA 4JI2E 4CE1A 4PL9A 4DV7I 2XEXA 5CTXA 4DV7E 1Y4SA 1FWLA 5CTYA 2AKPA 3Q5LA 2CCTA 2YE9A
chains in the Genus database with same CATH superfamily
2CGFA 4LF4I 2XX4A 2YK2A 4IFDE 1ZWHA 3BMYA 5CF0A 4LF4E 5IT9Q 2WI6A 4USMA 2ESAA 4JYAI 1I58A 2ZKJA 4KP4A 3R92A 4EEHA 4EGKA 3QT7A 1UYIA 4JYAE 2ZBKB 2PO1A 4MU0A 3LPSA 4P52A 1J5EI 4GKJI 2YJWA 2PO2A 4K4OA 2PNLA 4RPFA 3J80Q 4GKJE 1J5EE 4PU9A 2XK2A 3CRKA 2VF3A 2Z5CA 3P3EA 5C0XD 3VHAA 4MP2A 4ASAA 2DEJA 5BR8I 2YKEA 5JEAF 2BU6A 1P42A 2CG9A 5BR8E 2Z5BA 4YKZA 4CWOA 1OYSA 4JI6I 1ZXNA 4XD8A 4X65I 4LF8I 1ID0A 2QG2A 4B7PA 2UUCE 4X64E 4IZKB 2PNRA 4X65E 3JAMC 3B24A 4GT8A 1S14A 4QPJA 5D6QA 4BXIA 4NBQA 1RR9A 4E02A 2J65A 2V2QA 4IFDA 3B27A 5CPHA 3GCMA 4KQVA 2XJGA 3WQ9A 1UYMA 4AWQA 1US7A 1Z0WA 2BR2A 2C1IA 4XDMA 4LFCI 4ED4A 5C0XF 1KIJA 2WI1A 3QDDA 2Z5BB 4LFCE 1KZNA 1Z0EA 3ZXOA 4OX9I 5K36C 3HZ5A 2V8PA 2VQEI 4L8ZA 3U2DA 3K60A 4AIDA 4HACA 1N36I 4DUHA 2VQEE 3HKMA 1GKZA 1N36E 3PS2A 4O05A 2PNMA 3CDJA 4FWGA 1YC1A 1HNXI 3T0HA 4LWGA 4IFDB 1YC3A 2BA0D 4DU7A 4AQYI 1UYLA 3A0XA 3DD6A 2DEIA 3QT6A 4JG4A 5LL6R 3ZM7A 1KTVA 4AQYE 4FMTA 2Q8IA 4AWPA 1YETA 4FCPA 5IT9C 2WEQA 4MBCA 4U7NA 4LWIA 2PO0A 4ASGA 1HK7A 4H7QA 3RLPA 3Q6MA 1H73A 1ZM4A 1B63A 5JEAE 4GGLA 5FNCA 2NN6C 2XCMA 3J80C 2BTZA 1IXMA 2QF6A 4BA1B 4HXZA 2YKIA 3MNRP 1AH8A 2XJXA 3R4OA 4YKRA 2BA0G 1A4HA 1QY8A 3ZKDA 4IZJA 2HCHA 2V34A 4LF6E 1R62A 3Q6NA 2UU9I 4DV5I 1YERA 2A2CA 3K1JA 4UTGA 1UY9A 2UU9E 4DV5E 4B3RI 2C37A 1GKXA 4LCGA 1IBMI 4JV5I 4MYUA 2F1DA 2O1TA 1E3HA 4NH7A 2WP8B 1IBME 4JV5E 1OSFA 1VISA 2UWDA 4BAEA 3ZZTA 4R3MA 2QG0A 2R42A 1YESA 2BU7A 4IZJD 5JEAA 3JZ3A 5DRQA 2XD6A 3TZ0A 4EMDA 4HXWA 4LWFA 4LPBA 2WI3A 2JEBB 4GEEA 3OWDA 2BT0A 4LWEA 4AWOA 4MYTA 1ZXMA 3HJCA 4JI8I 2Q8FA 3BM9A 2XJJA 4DUYI 2YE4A 4UROA 1N0UA 2CVEA 4DUYE 3R4NA 3TZ4A 3WU5A 4NH9A 2WI2A 4JI7E 4WUCA 4XCLA 3CGZA 3B26A 5FNDA 3INWA 1IBLI 5JEAB 3FV5A 4AIMA 1ZM9A 4GFNA 4P8OA 1ZM3A 1IBLE 4GKKI 2EXLA 1B62A 4FWDA 4JI0E 5M4EA 1FKAE 4DR6I 4MPNA 4DR1I 3KE6A 4YY3E 4GKKE 1Z5AA 4DR6E 3H4LA 4DR1E 4U3BA 2Q2EB 5ELWA 2QFOA 2UXCI 1I5BA 1NHHA 1XMQE 4MB9A 4AS9A 3A0WA 2UXCE 4OO1E 4FW5A 2BZ5A 3C11A 3OW6A 4V26A 4FWHA 4DV2I 5D6PA 5CTUA 4GQTA 1UY7A 4DV2E 2CH4A 2GO4A 3LNUA 4YKQA 3D36A 3RKZA 4DXLA 4PRXA 1XNQE 5C0XB 2BRCA 1HNWI 2O1VA 2YKJA 1YH8A 4FW3A 3B4TA 3SL2A 1Y60A 1Z0TA 2JEAA 2YEIA 4LCHA 1HNWE 4DV0E 5EKWA 1EA6A 2BYHA 4FW9A 3T1YI 1ZM2A 4MP7A 4DV4E 1GJVA 1Z5CA 2NN6A 5M4KA 4U93A 3T1YE 3PYEA 4K0KI 3B25A 4DUZI 3T1HI 1USUA 2UUCI 4X64I 2CCSA 4K0KE 4L94A 2V2ZA 4DUZE 5JENA 3T1HE 1D6TA 4QNJA 4WUDA 2R3VA 2PO1B 2IESA 3GONA 1HNZI 5IWAI 2YE7A 5CTWA 2PO2B 4DR7I 4H81A 3Q5JA 1HNZE 1XXEA 5IWAE 1THNA 4DR7E 4JQLA 3CRLA 2Z5CB 4EGIA 1KVKA 3OTOI 4JI1E 1N33I 4OO1A 2XHXA 1I59A 4LFAI 4GCZA 1U0ZA 1DARA 3OTOE 1N33E 3S5TA 4CWNA 1QYEA 4OKGA 4LFAE 2NN6D 1OYPA 5FLXQ 2FWZA 4R1FA 4URLA 4B6CA 1Y5YA 2HFUA 4XIQA 3ZZUA 3U67A 2YE3A 4YKTA 4QNKA 4LP0A 4DPWA 4DR3E 2FTKA 4URNA 2HKJA 5BODA 2WERA 3QTFA 1H74A 2YE2A 4DV3E 4U7OA 3VADA 3J7AM 2GQPA 3PS1A 2JKIA 4XCJA 3Q1QA 3GMEA 2C38A 1I5DA 2BU8A 2IWSA 4OO1D 4FCRA 3K98A 1FWKA 2BR2B 4XITA 2XX2A 1Z0CA 3H80A 2VWCA 1YS3A 4HZ0A 2HKEA 3GLLA 2UXBE 1UYFA 5D7CA 3T0ZA 3P3CA 3EHFA 3VHDA 5A2QQ 3ZKBA 2NN6F 3U1YA 2X7IA 5IDJA 4HACB 1I94I 3PYDA 3U1KA 3PRYA 1I94E 3OWBA 4NH8A 3GIGA 3G7EA 5D7DA 5M4MA 2XHRA 3WU6A 5LMNE 1UYEA 1Z0BA 5DNLA 3J81Q 1OJ4A 2YJXA 1UY8A 5EL9A 1H7UA 2YI6A 3INXA 4EGHA 2IOPA 4LF6I 3NMQA 4O0BA 2X36A 1F51A 3D0BA 4GQUA 1U2RA 2GFDA 3HEKA 2PNZA 2VCJA 1FJGE 4OO1F 2OI2A 2XDUA 2PO0B 4JI5I 1TH8A 2C1GA 4YKWA 4E01A 1TBWA 1Y8PA 3QT5A 3C0EA 3R4PA 4ZKIA 2E1RA 3HULA 5DRRA 1HR0I 4B3MI 4JI5E 5K36E 3O0IA 1UEKA 1N32I 4O09A 2EFGA 4DPTA 1HR0E 4B3ME 3M7ND 1R6MA 3HYZA 1N32E 4HYPA 4X66I 1NHJA 4B3SI 3TZ5A 3OPDA 3FT8A 4X66E 4WUBA 3P76A 4B3SE 2JE6A 2C39A 2HK3A 2XDXA 4HYMA 4KTNA 4IZJB 2HFSA 3RLRA 1B3QA 4BQJA 3WU3A 5FLXC 1N0VC 4LF9I 4DR4I 3PS3A 2YEHA 2UXDE 4ISAA 1XHKA 4IFDC 3PEHA 4LF9E 3KRNA 4DR4E 2YGEA 4B3TI 1MG7A 2C37B 3O2FA 2NPFA 4B3TE 5M4PA 2WNRA 2VW5A 1MU5A 3L7ZA 5M4NA 4FPPA 4LF7I 3J7AG 3M7NG 4KFGA 3TZ2A 1ELOA 2O1WA 5GMEA 2BYIA 4LF7E 4LOMA 4JI7I 2NN6E 4XC0A 4QPKA 4XKOA 1S4EA 4MU3A 2VQFI 2CCUA 4LCFA 2VESA 1NHIA 2VQFE 4JI0I 4LWHA 1ZW9A 5K36A 1YT1A 1UYCA 3EHJA 3WHAA 4CWQA 4YY3I 3QT8A 5A2QC 4JI3I 3V2UC 5FNFA 2V2VA 2AJ4A 4JI3E 1XMQI 4LF5I 2YKCA 4YKXA 2WNRB 4Q20A 4CE3A 4EMVA 4LF5E 4IS9A 3B28A 4R3AA 2WI5A 3G75A 4EFTA 5FWKA 5LMUI 3J81C 2BU2A 2UUAI 5LMUE 4DPXA 2Q8GA 1Z0VA 2CGEA 3CDIA 2UUAE 1XNQI 3UHMA 2HG1A 3T10A 1H7SA 2VCIA 4L91A 2J7KA 2XDLA 1QZRA 1N34I 4EFUA 4I3HA 4DV0I 4URMA 5C93A 1MX0A 2IOQA 5K36D 4DV4I 1I5CA 1N34E 3U2KA 3ZXQA 1FNMA 2Z5EA 2K5BA 2YEFA 4JAVA 4MPEA 4XTJA 2IWXA 1XNRI 2BM0A 4E00A 4I5SA 4FW4A 4HY1A 1XNRE 2O1UA 4JI4I 3IEDA 4IZKA 1BYQA 2AKPA 1BXDA 2YI7A 4JI4E 2IWUA 3TUHA 3F0NA 4BIZA 4DV1I 4KSHA 4J3DA 3GIEA 1NZ0A 2AE8A 3LTOA 1L0OA 1UDNA 4DV1E 1YSZA 2YI5A 5IDMA 4NXNI 2H8MA 3CGYA 1VI7A 3M6AA 4JI1I 4NXNE 2JEAB 1Z59A 2BV3A 2NN6B 3NZKA 4Z7CA 5K36F 2BREA 2JT2A 3CWVA 1Z0GA 5JEAC 2GS8A 3H1CA 2H55A 4X62I 1RHYA 4DR3I 1K47A 2YEBA 3P06A 2BA1D 4JI6E 4LPFA 2E0AA 4X62E 4LF8E 2FYPA 1A6FA 1OYRA 1UYGA 2YKBA 2JJCA 3A0RA 4HY6A 4DV3I 4FCQA 1I5AA 1H72C 3B82A 3D4JA 1YC4A 2FWYA 2FXSA 4MU1A 1Y6ZA 2LJPA 1JM6A 2YGAA 1UYHA 2ZDXA 2YE8A 2WW4A 3G7BA 2HK2A 1PIEA 3DGEA 1USVA 3R4MA 1PVGA 4YHHI 4DR5I 3RLQA 4CWRA 5DNXA 4DV6I 4OO1B 4JAUA 2YEAA 3EKRA 2UXBI 2O3ZA 4YHHE 4DR5E 3CYGA 3ZZ0A 4DV6E 1WUUA 4XIPA 3O6OA 1UYDA 3EHHA 5F5RA 3K85A 3B8HA 5C0XC 2C2AA 4MPCA 3EKOA 1FI4A 2YK9A 2ZDYA 3LMMA 1R6LA 1EI1A 1KKHA 2BA1G 4MOTA 4BIUA 2XDKA 3D2RA 1RREA 4OX9E 4KSGA 2BSMA 4XKKA 1UDSA 4DZYA 1Y4UA 4FW7A 4JASA 5LMNI 2XX5A 4XKAA 4BA1A 1UY6A 2WI7A 4YKUA 2YI0A 4PRVA 1BKNA 1HNXE 1Y8NA 4IFDD 1YT0A 3K97A 2WEPA 2ZITA 4U3DA 4USKA 3FT5A 1U2OA 2C38B 5J71A 4ASFA 1YT2A 4CWPA 4AM3A 1Z5BA 4P7AA 3R91A 1TC0A 1FJGI 5M4HA 4V25A 3T2SA 2ZM6I 1AJ6A 3PEJA 4CWFA 4CWSA 1S16A 4MQYA 3TTZA 4ASBA 4DR2I 2BM1A 2ZM6E 1AMWA 4E72A 1IBKI 2Q8HA 5F3KA 5GMDA 4DR2E 4N3OA 1IBKE 2YE6A 2WP8A 4XE2A 3GIGB 1XMOI 2YEDA 1Y8OA 4YKYA 1E3PA 4Z7YA 4CWTA 2HHHI 4ZVIA 1XMOE 4UT4A 2HHHE 4BQGA 1AH6A 2UXDI 4IFDF 4L90A 3PYFA 4FN5A 1TIDA 2PNZB 3EHGA 2XHTA 2IORA 2YECA 3V5RA 4LFBI 5DROA 2YEEA 5GGZA 3VHCA 2JEBA 1YHCA 2YEJA 4LFBE 4OO1C 5C0XE 1TILA 2E5LI 2GO3A 4B3RE 4EM7A 4FW6A 4MU4A 3M85D 2E5LE 3HZ1A 4H85A 2YE5A 1BGQA 1TC6A 3JAMQ 2JE6B 3GIFA 3HHUA 4XIRA 2C39B 1YSRA 4W7TA 3Q5KA 4M1KA 2XABA 4X9LA 1UYKA 5BOCA 3OMUA 3A0TA 5DRPA 3WU4A 4HZ5A 5IN9A 4KHPI 4NXMI 1UDOA 4BA2A 2A2DA 4DPUA 2F4VI 5D7RA 3PYGA 2WI4A 1UDQA 4KHPE 4NXME 3B78A 3P3GA 2XDSA 4CE2A 4O07A 2F4VE 2YGFA 3T1KA 2UUBI 3A0ZA 5J6AA 4L93A 3L7ZB 1AM1A 2YEGA 3M85G 2CZ9A 4JI8E 2UUBE 2IERA 4DU8A 5L3JA 2BU5A 4DPYA 3A0YA 4JI2I 3K17A 3HYYA 4O04A 3K99A 1PKPA 4JI2E 4CE1A 4PL9A 2GQ0A 4DV7I 2XEXA 2HHIA 5CTXA 1Y4SA 4DV7E 1FWLA 5CTYA 5C0XA 5JEAD 5K36B 4MDTA 4BA2B 3Q5LA 2CCTA 2YE9A 4OZEA
chains in the Genus database with same CATH topology
2CGFA 4LF4I 2XX4A 2YK2A 1ZWHA 3BMYA 5CF0A 4LF4E 5IT9Q 2WI6A 4USMA 2ESAA 4JYAI 1I58A 2ZKJA 4KP4A 3R92A 4EEHA 4EGKA 3QT7A 1UYIA 4JYAE 2ZBKB 3LPSA 4P52A 1J5EI 4GKJI 2YJWA 4K4OA 2PNLA 4RPFA 3J80Q 4GKJE 1J5EE 4PU9A 2XK2A 3CRKA 2VF3A 2Z5CA 3VHAA 4MP2A 4ASAA 2DEJA 5BR8I 2YKEA 2BU6A 2CG9A 5BR8E 2Z5BA 4YKZA 4CWOA 4JI6I 1ZXNA 4XD8A 4X65I 4LF8I 1ID0A 2QG2A 4B7PA 2UUCE 4X64E 4IZKB 2PNRA 4X65E 3JAMC 3B24A 4GT8A 1S14A 4QPJA 5D6QA 4BXIA 1RR9A 4E02A 2V2QA 3B27A 5CPHA 4KQVA 2XJGA 3WQ9A 1UYMA 4AWQA 1US7A 1Z0WA 4XDMA 4LFCI 4ED4A 1KIJA 2WI1A 3QDDA 2Z5BB 4LFCE 1KZNA 1Z0EA 3ZXOA 4OX9I 3HZ5A 2V8PA 2VQEI 4L8ZA 3U2DA 3K60A 4HACA 1N36I 4DUHA 2VQEE 1GKZA 1N36E 4O05A 2PNMA 4FWGA 1YC1A 1HNXI 3T0HA 4LWGA 1YC3A 4DU7A 4AQYI 1UYLA 3A0XA 2DEIA 3QT6A 4JG4A 5LL6R 3ZM7A 1KTVA 4AQYE 4FMTA 2Q8IA 4AWPA 1YETA 4FCPA 5IT9C 2WEQA 4MBCA 4U7NA 4LWIA 4ASGA 1HK7A 4H7QA 3RLPA 3Q6MA 1H73A 1ZM4A 1B63A 4GGLA 5FNCA 2XCMA 3J80C 2BTZA 2QF6A 2YKIA 4HXZA 3MNRP 1AH8A 2XJXA 3R4OA 4YKRA 1A4HA 1QY8A 3ZKDA 4IZJA 2HCHA 2V34A 4LF6E 1R62A 3Q6NA 2UU9I 4DV5I 1YERA 2A2CA 3K1JA 4UTGA 1UY9A 2UU9E 4DV5E 4B3RI 1GKXA 1IBMI 4JV5I 4MYUA 2O1TA 4NH7A 1IBME 4JV5E 1OSFA 1VISA 2UWDA 4BAEA 3ZZTA 4R3MA 2QG0A 2R42A 1YESA 2BU7A 4IZJD 3JZ3A 2XD6A 3TZ0A 4EMDA 4HXWA 4LWFA 4LPBA 2WI3A 4GEEA 3OWDA 2BT0A 4LWEA 4AWOA 4MYTA 1ZXMA 3HJCA 4JI8I 2Q8FA 3BM9A 2XJJA 4DUYI 2YE4A 4UROA 1N0UA 3TZ4A 4DUYE 3R4NA 3WU5A 4NH9A 2WI2A 4JI7E 4WUCA 4XCLA 3CGZA 3B26A 5FNDA 3INWA 1IBLI 3FV5A 1ZM9A 4GFNA 4P8OA 1ZM3A 1IBLE 4GKKI 2EXLA 1B62A 4FWDA 4JI0E 5M4EA 1FKAE 4DR6I 4MPNA 4DR1I 3KE6A 4YY3E 4GKKE 1Z5AA 4DR6E 3H4LA 4DR1E 2QFOA 2Q2EB 2UXCI 1I5BA 1NHHA 1XMQE 4MB9A 4AS9A 3A0WA 2UXCE 2BZ5A 3C11A 4V26A 3OW6A 4FWHA 4DV2I 5D6PA 5CTUA 4GQTA 1UY7A 4DV2E 2CH4A 3LNUA 4YKQA 3D36A 3RKZA 4DXLA 4PRXA 1XNQE 2BRCA 2YKJA 1HNWI 2O1VA 3SL2A 1Z0TA 2YEIA 1HNWE 4DV0E 2BYHA 1EA6A 4MP7A 4FW9A 3T1YI 1ZM2A 5M4KA 4DV4E 1GJVA 1Z5CA 4U93A 3T1YE 3PYEA 4K0KI 3B25A 4DUZI 3T1HI 1USUA 2UUCI 4X64I 2CCSA 4K0KE 4L94A 2V2ZA 4DUZE 3T1HE 1D6TA 4WUDA 2R3VA 3GONA 1HNZI 5IWAI 2YE7A 5CTWA 4DR7I 4H81A 3Q5JA 1HNZE 5IWAE 1THNA 4DR7E 4JQLA 3CRLA 2Z5CB 4EGIA 1KVKA 3OTOI 4JI1E 1N33I 2XHXA 1I59A 4LFAI 4GCZA 1U0ZA 1DARA 3OTOE 1N33E 4CWNA 1QYEA 4LFAE 5FLXQ 2FWZA 4R1FA 4URLA 4B6CA 2HFUA 4XIQA 3ZZUA 3U67A 2YE3A 4YKTA 4LP0A 4DPWA 4DR3E 4URNA 2HKJA 5BODA 2WERA 3QTFA 1H74A 2YE2A 4DV3E 4U7OA 3VADA 3J7AM 2GQPA 2JKIA 4XCJA 3Q1QA 1I5DA 2BU8A 2IWSA 4FCRA 3K98A 1FWKA 4XITA 2XX2A 1Z0CA 3H80A 2VWCA 1YS3A 4HZ0A 2HKEA 2UXBE 1UYFA 5D7CA 3T0ZA 3VHDA 3EHFA 5A2QQ 3ZKBA 2X7IA 5IDJA 4HACB 1I94I 3PYDA 3PRYA 1I94E 3OWBA 4NH8A 3GIGA 3G7EA 5D7DA 5M4MA 2XHRA 3WU6A 5LMNE 1UYEA 1Z0BA 3J81Q 1OJ4A 2YJXA 1UY8A 3INXA 1H7UA 2YI6A 4EGHA 2IOPA 4LF6I 3NMQA 4O0BA 2X36A 3D0BA 1U2RA 2GFDA 3HEKA 2VCJA 1FJGE 2OI2A 2XDUA 4JI5I 1TH8A 4YKWA 4E01A 1TBWA 1Y8PA 3QT5A 3C0EA 3R4PA 4ZKIA 2E1RA 3HULA 1HR0I 4B3MI 4JI5E 3O0IA 1UEKA 1N32I 4O09A 2EFGA 4DPTA 1HR0E 4B3ME 3HYZA 1N32E 4HYPA 4X66I 1NHJA 4B3SI 3TZ5A 3OPDA 3FT8A 4X66E 4WUBA 4B3SE 2XDXA 2HK3A 4HYMA 4KTNA 4IZJB 2HFSA 3RLRA 1B3QA 4BQJA 3WU3A 5FLXC 1N0VC 4LF9I 4DR4I 2YEHA 2UXDE 1XHKA 3PEHA 4LF9E 4DR4E 2YGEA 4B3TI 1MG7A 3O2FA 2NPFA 4B3TE 5M4PA 2VW5A 1MU5A 5M4NA 4FPPA 4LF7I 3J7AG 4KFGA 3TZ2A 1ELOA 2O1WA 5GMEA 2BYIA 4LF7E 4JI7I 4XC0A 4QPKA 4XKOA 1S4EA 2VQFI 2CCUA 1NHIA 2VQFE 4JI0I 4LWHA 1ZW9A 4CWQA 1YT1A 1UYCA 3EHJA 3WHAA 4YY3I 3QT8A 5A2QC 4JI3I 3V2UC 5FNFA 2V2VA 2AJ4A 4JI3E 1XMQI 4LF5I 2YKCA 4YKXA 4Q20A 4CE3A 4EMVA 4LF5E 3B28A 4R3AA 2WI5A 3G75A 4EFTA 5FWKA 5LMUI 3J81C 2BU2A 2UUAI 5LMUE 4DPXA 2Q8GA 1Z0VA 2CGEA 2UUAE 1XNQI 2HG1A 3T10A 1H7SA 2VCIA 4L91A 2J7KA 2XDLA 1QZRA 1N34I 4EFUA 4I3HA 4DV0I 4URMA 5C93A 1MX0A 2IOQA 4DV4I 1I5CA 1N34E 3U2KA 3ZXQA 1FNMA 2Z5EA 2K5BA 2YEFA 4JAVA 4MPEA 4XTJA 2IWXA 1XNRI 2BM0A 4E00A 4I5SA 4HY1A 1XNRE 2O1UA 4JI4I 3IEDA 4IZKA 1BYQA 1BXDA 2YI7A 4JI4E 2IWUA 3TUHA 3F0NA 4BIZA 4DV1I 4KSHA 3GIEA 1NZ0A 3LTOA 1L0OA 1YSZA 2YI5A 4DV1E 5IDMA 4NXNI 2H8MA 3CGYA 4JI1I 3M6AA 4NXNE 1Z59A 2BV3A 4Z7CA 2BREA 3CWVA 1Z0GA 2GS8A 2H55A 4X62I 4DR3I 1K47A 2YEBA 3P06A 4JI6E 2E0AA 4X62E 4LF8E 2FYPA 1A6FA 1UYGA 2YKBA 3A0RA 2JJCA 4HY6A 4DV3I 4FCQA 1I5AA 1H72C 3B82A 3D4JA 1YC4A 2FWYA 2FXSA 1Y6ZA 2LJPA 1JM6A 2YGAA 1UYHA 2ZDXA 2YE8A 2WW4A 3G7BA 2HK2A 1PIEA 3DGEA 1USVA 3R4MA 1PVGA 4YHHI 4DR5I 3RLQA 4CWRA 4DV6I 4JAUA 2YEAA 3EKRA 2UXBI 4YHHE 4DR5E 4XIPA 3ZZ0A 4DV6E 1WUUA 3O6OA 1UYDA 3EHHA 5F5RA 3K85A 3B8HA 2C2AA 4MPCA 3EKOA 1FI4A 2YK9A 2ZDYA 1EI1A 1KKHA 4MOTA 4BIUA 2XDKA 3D2RA 1RREA 4OX9E 4KSGA 2BSMA 4XKKA 4DZYA 1Y4UA 4JASA 5LMNI 2XX5A 4XKAA 1UY6A 2WI7A 4YKUA 2YI0A 4PRVA 1BKNA 1HNXE 1Y8NA 1YT0A 3K97A 2WEPA 2ZITA 4USKA 3FT5A 1U2OA 5J71A 4ASFA 1YT2A 4CWPA 1Z5BA 4P7AA 3R91A 1TC0A 1FJGI 5M4HA 4V25A 3T2SA 2ZM6I 1AJ6A 3PEJA 4CWFA 4CWSA 1S16A 3TTZA 4ASBA 4DR2I 2BM1A 2ZM6E 1AMWA 1IBKI 2Q8HA 5F3KA 5GMDA 4DR2E 4N3OA 1IBKE 2YE6A 4XE2A 3GIGB 1XMOI 2YEDA 1Y8OA 4YKYA 4Z7YA 4CWTA 2HHHI 4ZVIA 1XMOE 4UT4A 2HHHE 4BQGA 1AH6A 2UXDI 4L90A 3PYFA 4FN5A 1TIDA 3EHGA 2XHTA 2IORA 2YECA 3V5RA 4LFBI 2YEEA 5GGZA 3VHCA 2YEJA 4LFBE 1TILA 2E5LI 4B3RE 4EM7A 3HZ1A 2E5LE 4H85A 2YE5A 1BGQA 1TC6A 3JAMQ 3GIFA 3HHUA 4XIRA 1YSRA 4W7TA 3Q5KA 4M1KA 2XABA 4X9LA 1UYKA 5BOCA 3OMUA 3A0TA 4HZ5A 3WU4A 5IN9A 4KHPI 4NXMI 2A2DA 4DPUA 2F4VI 5D7RA 3PYGA 2WI4A 4CE2A 4KHPE 4NXME 3B78A 2XDSA 4O07A 2F4VE 2YGFA 3T1KA 2UUBI 3A0ZA 5J6AA 4L93A 1AM1A 2YEGA 2CZ9A 4JI8E 2UUBE 5L3JA 4DU8A 2BU5A 4DPYA 3A0YA 4JI2I 3K17A 3HYYA 4O04A 3K99A 1PKPA 4JI2E 4CE1A 4PL9A 2GQ0A 4DV7I 2XEXA 5CTXA 1Y4SA 4DV7E 1FWLA 5CTYA 2AKPA 3Q5LA 2CCTA 2YE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CGF A;  4LF4 I;  2XX4 A;  2YK2 A;  1ZWH A;  3BMY A;  5CF0 A;  4LF4 E;  5IT9 Q;  2WI6 A;  4USM A;  2ESA A;  4JYA I;  1I58 A;  2ZKJ A;  4KP4 A;  3R92 A;  4EEH A;  4EGK A;  3QT7 A;  1UYI A;  4JYA E;  2ZBK B;  3LPS A;  4P52 A;  1J5E I;  4GKJ I;  2YJW A;  4K4O A;  4RPF A;  3J80 Q;  4GKJ E;  1J5E E;  4PU9 A;  2XK2 A;  3CRK A;  2VF3 A;  3VHA A;  4MP2 A;  4ASA A;  2DEJ A;  5BR8 I;  2YKE A;  2BU6 A;  2CG9 A;  5BR8 E;  4YKZ A;  4CWO A;  4JI6 I;  1ZXN A;  4XD8 A;  4X65 I;  4LF8 I;  1ID0 A;  2QG2 A;  4B7P A;  2UUC E;  4X64 E;  2PNR A;  4X65 E;  3JAM C;  3B24 A;  4GT8 A;  1S14 A;  4QPJ A;  5D6Q A;  4BXI A;  1RR9 A;  4E02 A;  2V2Q A;  3B27 A;  5CPH A;  4KQV A;  2XJG A;  3WQ9 A;  1UYM A;  4AWQ A;  1US7 A;  1Z0W A;  4XDM A;  4LFC I;  4ED4 A;  1KIJ A;  2WI1 A;  3QDD A;  4LFC E;  1KZN A;  1Z0E A;  3ZXO A;  4OX9 I;  3HZ5 A;  2V8P A;  2VQE I;  4L8Z A;  3U2D A;  3K60 A;  4HAC A;  1N36 I;  4DUH A;  2VQE E;  1GKZ A;  1N36 E;  4O05 A;  4FWG A;  1YC1 A;  1HNX I;  3T0H A;  4LWG A;  1YC3 A;  4DU7 A;  4AQY I;  1UYL A;  3A0X A;  2DEI A;  3QT6 A;  4JG4 A;  5LL6 R;  3ZM7 A;  1KTV A;  4AQY E;  4FMT A;  2Q8I A;  4AWP A;  1YET A;  4FCP A;  5IT9 C;  2WEQ A;  4MBC A;  4U7N A;  4LWI A;  4ASG A;  4H7Q A;  3RLP A;  1H73 A;  1ZM4 A;  1B63 A;  4GGL A;  5FNC A;  2XCM A;  3J80 C;  2BTZ A;  2QF6 A;  2YKI A;  4HXZ A;  3MNR P;  1AH8 A;  2XJX A;  3R4O A;  4YKR A;  1A4H A;  1QY8 A;  3ZKD A;  2HCH A;  2V34 A;  4LF6 E;  1R62 A;  2UU9 I;  4DV5 I;  1YER A;  2A2C A;  3K1J A;  4UTG A;  1UY9 A;  2UU9 E;  4DV5 E;  4B3R I;  1GKX A;  1IBM I;  4JV5 I;  4MYU A;  4NH7 A;  1IBM E;  4JV5 E;  1OSF A;  1VIS A;  2UWD A;  4BAE A;  3ZZT A;  4R3M A;  2QG0 A;  2R42 A;  1YES A;  2BU7 A;  3JZ3 A;  2XD6 A;  3TZ0 A;  4EMD A;  4HXW A;  4LWF A;  4LPB A;  2WI3 A;  4GEE A;  3OWD A;  2BT0 A;  4LWE A;  4AWO A;  4MYT A;  1ZXM A;  4JI8 I;  2Q8F A;  3BM9 A;  2XJJ A;  4DUY I;  2YE4 A;  4URO A;  1N0U A;  3TZ4 A;  4DUY E;  3R4N A;  3WU5 A;  4NH9 A;  2WI2 A;  4JI7 E;  4WUC A;  4XCL A;  3CGZ A;  3B26 A;  5FND A;  3INW A;  1IBL I;  3FV5 A;  1ZM9 A;  4GFN A;  4P8O A;  1ZM3 A;  1IBL E;  4GKK I;  2EXL A;  1B62 A;  4FWD A;  4JI0 E;  5M4E A;  1FKA E;  4DR6 I;  4MPN A;  4DR1 I;  3KE6 A;  4YY3 E;  4GKK E;  1Z5A A;  4DR6 E;  3H4L A;  4DR1 E;  2QFO A;  2Q2E B;  2UXC I;  1I5B A;  1NHH A;  1XMQ E;  4MB9 A;  4AS9 A;  3A0W A;  2UXC E;  2BZ5 A;  3C11 A;  4V26 A;  3OW6 A;  4FWH A;  4DV2 I;  5D6P A;  5CTU A;  4GQT A;  1UY7 A;  4DV2 E;  2CH4 A;  3LNU A;  4YKQ A;  3D36 A;  3RKZ A;  4DXL A;  4PRX A;  1XNQ E;  2BRC A;  2YKJ A;  1HNW I;  2O1V A;  3SL2 A;  1Z0T A;  2YEI A;  1HNW E;  4DV0 E;  2BYH A;  1EA6 A;  4MP7 A;  4FW9 A;  3T1Y I;  1ZM2 A;  5M4K A;  4DV4 E;  1GJV A;  1Z5C A;  4U93 A;  3T1Y E;  3PYE A;  4K0K I;  3B25 A;  4DUZ I;  2UUC I;  3T1H I;  2CCS A;  4X64 I;  4K0K E;  4L94 A;  2V2Z A;  4DUZ E;  3T1H E;  1D6T A;  4WUD A;  2R3V A;  3GON A;  1HNZ I;  5IWA I;  2YE7 A;  5CTW A;  4DR7 I;  4H81 A;  3Q5J A;  1HNZ E;  5IWA E;  1THN A;  4DR7 E;  4JQL A;  3CRL A;  4EGI A;  1KVK A;  3OTO I;  4JI1 E;  1N33 I;  2XHX A;  1I59 A;  4LFA I;  4GCZ A;  1U0Z A;  1DAR A;  3OTO E;  1N33 E;  4CWN A;  1QYE A;  4LFA E;  5FLX Q;  2FWZ A;  4R1F A;  4URL A;  4B6C A;  2HFU A;  4XIQ A;  3ZZU A;  3U67 A;  2YE3 A;  4YKT A;  4LP0 A;  4DPW A;  4DR3 E;  4URN A;  2HKJ A;  5BOD A;  2WER A;  3QTF A;  1H74 A;  2YE2 A;  4DV3 E;  4U7O A;  3VAD A;  3J7A M;  2GQP A;  2JKI A;  4XCJ A;  3Q1Q A;  1I5D A;  2BU8 A;  2IWS A;  4FCR A;  3K98 A;  1FWK A;  4XIT A;  2XX2 A;  1Z0C A;  3H80 A;  2VWC A;  1YS3 A;  4HZ0 A;  2HKE A;  2UXB E;  1UYF A;  5D7C A;  3T0Z A;  3VHD A;  3EHF A;  5A2Q Q;  3ZKB A;  2X7I A;  5IDJ A;  4HAC B;  1I94 I;  3PYD A;  1I94 E;  3OWB A;  4NH8 A;  3GIG A;  3G7E A;  5D7D A;  5M4M A;  2XHR A;  3WU6 A;  5LMN E;  1UYE A;  1Z0B A;  3J81 Q;  1OJ4 A;  2YJX A;  1UY8 A;  3INX A;  1H7U A;  2YI6 A;  4EGH A;  4LF6 I;  2IOP A;  3NMQ A;  4O0B A;  2X36 A;  3D0B A;  1U2R A;  2GFD A;  3HEK A;  2VCJ A;  1FJG E;  2OI2 A;  2XDU A;  4JI5 I;  1TH8 A;  4YKW A;  4E01 A;  1TBW A;  1Y8P A;  3QT5 A;  3C0E A;  3R4P A;  4ZKI A;  2E1R A;  3HUL A;  1HR0 I;  4B3M I;  4JI5 E;  3O0I A;  1UEK A;  1N32 I;  4O09 A;  2EFG A;  4DPT A;  1HR0 E;  4B3M E;  3HYZ A;  1N32 E;  4HYP A;  4X66 I;  1NHJ A;  4B3S I;  3TZ5 A;  3OPD A;  3FT8 A;  4X66 E;  4WUB A;  4B3S E;  2XDX A;  2HK3 A;  4HYM A;  4KTN A;  2HFS A;  3RLR A;  1B3Q A;  4BQJ A;  3WU3 A;  5FLX C;  1N0V C;  4LF9 I;  4DR4 I;  2YEH A;  2UXD E;  1XHK A;  3PEH A;  4LF9 E;  4DR4 E;  2YGE A;  4B3T I;  1MG7 A;  3O2F A;  2NPF A;  4B3T E;  5M4P A;  2VW5 A;  1MU5 A;  5M4N A;  4FPP A;  4LF7 I;  3J7A G;  4KFG A;  3TZ2 A;  1ELO A;  5GME A;  2O1W A;  2BYI A;  4LF7 E;  4JI7 I;  4XC0 A;  4QPK A;  4XKO A;  1S4E A;  2VQF I;  2CCU A;  1NHI A;  2VQF E;  4JI0 I;  4LWH A;  1ZW9 A;  4CWQ A;  1YT1 A;  1UYC A;  3EHJ A;  3WHA A;  4YY3 I;  3QT8 A;  5A2Q C;  4JI3 I;  3V2U C;  5FNF A;  2V2V A;  2AJ4 A;  4JI3 E;  1XMQ I;  4LF5 I;  2YKC A;  4YKX A;  4Q20 A;  4CE3 A;  4EMV A;  4LF5 E;  3B28 A;  4R3A A;  2WI5 A;  3G75 A;  4EFT A;  5FWK A;  5LMU I;  3J81 C;  2BU2 A;  2UUA I;  5LMU E;  4DPX A;  2Q8G A;  1Z0V A;  2UUA E;  1XNQ I;  2HG1 A;  3T10 A;  1H7S A;  2VCI A;  4L91 A;  2J7K A;  2XDL A;  1QZR A;  1N34 I;  4EFU A;  4I3H A;  4DV0 I;  4URM A;  5C93 A;  1MX0 A;  2IOQ A;  4DV4 I;  1I5C A;  1N34 E;  3U2K A;  3ZXQ A;  1FNM A;  2K5B A;  2YEF A;  4JAV A;  4MPE A;  4XTJ A;  2IWX A;  1XNR I;  2BM0 A;  4E00 A;  4I5S A;  4HY1 A;  1XNR E;  2O1U A;  4JI4 I;  3IED A;  1BYQ A;  1BXD A;  2YI7 A;  4JI4 E;  2IWU A;  3TUH A;  3F0N A;  4BIZ A;  4DV1 I;  4KSH A;  3GIE A;  1NZ0 A;  3LTO A;  1L0O A;  1YSZ A;  2YI5 A;  4DV1 E;  5IDM A;  4NXN I;  2H8M A;  3CGY A;  4JI1 I;  3M6A A;  4NXN E;  1Z59 A;  2BV3 A;  4Z7C A;  2BRE A;  3CWV A;  1Z0G A;  2GS8 A;  2H55 A;  4X62 I;  4DR3 I;  1K47 A;  2YEB A;  4JI6 E;  2E0A A;  4X62 E;  4LF8 E;  2FYP A;  1A6F A;  1UYG A;  2YKB A;  3A0R A;  2JJC A;  4HY6 A;  4DV3 I;  4FCQ A;  1I5A A;  1H72 C;  3B82 A;  3D4J A;  1YC4 A;  2FWY A;  2FXS A;  1JM6 A;  2LJP A;  2YGA A;  2ZDX A;  1UYH A;  2YE8 A;  2WW4 A;  3G7B A;  2HK2 A;  1PIE A;  3DGE A;  4CWR A;  3R4M A;  1PVG A;  4YHH I;  4DR5 I;  3RLQ A;  4DV6 I;  4JAU A;  2YEA A;  3EKR A;  2UXB I;  4YHH E;  4DR5 E;  4XIP A;  3ZZ0 A;  4DV6 E;  1WUU A;  3O6O A;  1UYD A;  3EHH A;  5F5R A;  3B8H A;  2C2A A;  4MPC A;  3EKO A;  1FI4 A;  2YK9 A;  2ZDY A;  1EI1 A;  1KKH A;  4MOT A;  4BIU A;  2XDK A;  3D2R A;  1RRE A;  4OX9 E;  4KSG A;  2BSM A;  4XKK A;  4DZY A;  1Y4U A;  4JAS A;  5LMN I;  2XX5 A;  4XKA A;  1UY6 A;  2WI7 A;  4YKU A;  2YI0 A;  4PRV A;  1BKN A;  1HNX E;  1Y8N A;  1YT0 A;  3K97 A;  2WEP A;  2ZIT A;  4USK A;  3FT5 A;  1U2O A;  5J71 A;  4ASF A;  1YT2 A;  4CWP A;  1Z5B A;  4P7A A;  3R91 A;  1TC0 A;  1FJG I;  5M4H A;  4V25 A;  3T2S A;  2ZM6 I;  1AJ6 A;  3PEJ A;  4CWF A;  4CWS A;  1S16 A;  3TTZ A;  4ASB A;  4DR2 I;  2BM1 A;  2ZM6 E;  1AMW A;  1IBK I;  2Q8H A;  5F3K A;  5GMD A;  4DR2 E;  1IBK E;  2YE6 A;  4XE2 A;  3GIG B;  1XMO I;  2YED A;  1Y8O A;  4YKY A;  4Z7Y A;  4CWT A;  2HHH I;  4ZVI A;  1XMO E;  4UT4 A;  2HHH E;  4BQG A;  1AH6 A;  2UXD I;  4L90 A;  3PYF A;  4FN5 A;  1TID A;  3EHG A;  2XHT A;  2IOR A;  2YEC A;  3V5R A;  4LFB I;  2YEE A;  5GGZ A;  3VHC A;  2YEJ A;  4LFB E;  1TIL A;  2E5L I;  4B3R E;  4EM7 A;  3HZ1 A;  2E5L E;  4H85 A;  2YE5 A;  1BGQ A;  1TC6 A;  3JAM Q;  3GIF A;  3HHU A;  4XIR A;  1YSR A;  4W7T A;  3Q5K A;  4M1K A;  2XAB A;  4X9L A;  1UYK A;  5BOC A;  3OMU A;  3A0T A;  4HZ5 A;  3WU4 A;  5IN9 A;  4KHP I;  4NXM I;  2A2D A;  4DPU A;  2F4V I;  5D7R A;  3PYG A;  2WI4 A;  4CE2 A;  4KHP E;  4NXM E;  3B78 A;  2XDS A;  4O07 A;  2F4V E;  2YGF A;  3T1K A;  2UUB I;  3A0Z A;  5J6A A;  4L93 A;  1AM1 A;  2YEG A;  2UUB E;  2CZ9 A;  4JI8 E;  5L3J A;  4DU8 A;  2BU5 A;  4DPY A;  3A0Y A;  4JI2 I;  3K17 A;  3HYY A;  4O04 A;  3K99 A;  1PKP A;  4JI2 E;  4CE1 A;  4PL9 A;  4DV7 I;  2XEX A;  5CTX A;  4DV7 E;  1Y4S A;  1FWL A;  5CTY A;  2AKP A;  3Q5L A;  2CCT A;  2YE9 A; 
#chains in the Genus database with same CATH topology
 2CGF A;  4LF4 I;  2XX4 A;  2YK2 A;  4IFD E;  1ZWH A;  3BMY A;  5CF0 A;  4LF4 E;  5IT9 Q;  2WI6 A;  4USM A;  2ESA A;  4JYA I;  1I58 A;  2ZKJ A;  4KP4 A;  3R92 A;  4EEH A;  4EGK A;  3QT7 A;  1UYI A;  4JYA E;  2ZBK B;  2PO1 A;  4MU0 A;  3LPS A;  4P52 A;  1J5E I;  4GKJ I;  2YJW A;  2PO2 A;  4K4O A;  2PNL A;  4RPF A;  3J80 Q;  4GKJ E;  1J5E E;  4PU9 A;  2XK2 A;  3CRK A;  2VF3 A;  2Z5C A;  3P3E A;  5C0X D;  3VHA A;  4MP2 A;  4ASA A;  2DEJ A;  5BR8 I;  2YKE A;  5JEA F;  2BU6 A;  1P42 A;  2CG9 A;  5BR8 E;  2Z5B A;  4YKZ A;  4CWO A;  1OYS A;  4JI6 I;  1ZXN A;  4XD8 A;  4X65 I;  4LF8 I;  1ID0 A;  2QG2 A;  4B7P A;  2UUC E;  4X64 E;  4IZK B;  2PNR A;  4X65 E;  3JAM C;  3B24 A;  4GT8 A;  1S14 A;  4QPJ A;  5D6Q A;  4BXI A;  4NBQ A;  1RR9 A;  4E02 A;  2J65 A;  2V2Q A;  4IFD A;  3B27 A;  5CPH A;  3GCM A;  4KQV A;  2XJG A;  3WQ9 A;  1UYM A;  4AWQ A;  1US7 A;  1Z0W A;  2BR2 A;  2C1I A;  4XDM A;  4LFC I;  4ED4 A;  5C0X F;  1KIJ A;  2WI1 A;  3QDD A;  2Z5B B;  4LFC E;  1KZN A;  1Z0E A;  3ZXO A;  4OX9 I;  5K36 C;  3HZ5 A;  2V8P A;  2VQE I;  4L8Z A;  3U2D A;  3K60 A;  4AID A;  4HAC A;  1N36 I;  4DUH A;  2VQE E;  3HKM A;  1GKZ A;  1N36 E;  3PS2 A;  4O05 A;  2PNM A;  3CDJ A;  4FWG A;  1YC1 A;  1HNX I;  3T0H A;  4LWG A;  4IFD B;  1YC3 A;  2BA0 D;  4DU7 A;  4AQY I;  1UYL A;  3A0X A;  3DD6 A;  2DEI A;  3QT6 A;  4JG4 A;  5LL6 R;  3ZM7 A;  1KTV A;  4AQY E;  4FMT A;  2Q8I A;  4AWP A;  1YET A;  4FCP A;  5IT9 C;  2WEQ A;  4MBC A;  4U7N A;  4LWI A;  2PO0 A;  4ASG A;  1HK7 A;  4H7Q A;  3RLP A;  3Q6M A;  1H73 A;  1ZM4 A;  1B63 A;  5JEA E;  4GGL A;  5FNC A;  2NN6 C;  2XCM A;  3J80 C;  2BTZ A;  1IXM A;  2QF6 A;  4BA1 B;  4HXZ A;  2YKI A;  3MNR P;  1AH8 A;  2XJX A;  3R4O A;  4YKR A;  2BA0 G;  1A4H A;  1QY8 A;  3ZKD A;  4IZJ A;  2HCH A;  2V34 A;  4LF6 E;  1R62 A;  3Q6N A;  2UU9 I;  4DV5 I;  1YER A;  2A2C A;  3K1J A;  4UTG A;  1UY9 A;  2UU9 E;  4DV5 E;  4B3R I;  2C37 A;  1GKX A;  4LCG A;  1IBM I;  4JV5 I;  4MYU A;  2F1D A;  2O1T A;  1E3H A;  4NH7 A;  2WP8 B;  1IBM E;  4JV5 E;  1OSF A;  1VIS A;  2UWD A;  4BAE A;  3ZZT A;  4R3M A;  2QG0 A;  2R42 A;  1YES A;  2BU7 A;  4IZJ D;  5JEA A;  3JZ3 A;  5DRQ A;  2XD6 A;  3TZ0 A;  4EMD A;  4HXW A;  4LWF A;  4LPB A;  2WI3 A;  2JEB B;  4GEE A;  3OWD A;  2BT0 A;  4LWE A;  4AWO A;  4MYT A;  1ZXM A;  3HJC A;  4JI8 I;  2Q8F A;  3BM9 A;  2XJJ A;  4DUY I;  2YE4 A;  4URO A;  1N0U A;  2CVE A;  4DUY E;  3R4N A;  3TZ4 A;  3WU5 A;  4NH9 A;  2WI2 A;  4JI7 E;  4WUC A;  4XCL A;  3CGZ A;  3B26 A;  5FND A;  3INW A;  1IBL I;  5JEA B;  3FV5 A;  4AIM A;  1ZM9 A;  4GFN A;  4P8O A;  1ZM3 A;  1IBL E;  4GKK I;  2EXL A;  1B62 A;  4FWD A;  4JI0 E;  5M4E A;  1FKA E;  4DR6 I;  4MPN A;  4DR1 I;  3KE6 A;  4YY3 E;  4GKK E;  1Z5A A;  4DR6 E;  3H4L A;  4DR1 E;  4U3B A;  2Q2E B;  5ELW A;  2QFO A;  2UXC I;  1I5B A;  1NHH A;  1XMQ E;  4MB9 A;  4AS9 A;  3A0W A;  2UXC E;  4OO1 E;  4FW5 A;  2BZ5 A;  3C11 A;  3OW6 A;  4V26 A;  4FWH A;  4DV2 I;  5D6P A;  5CTU A;  4GQT A;  1UY7 A;  4DV2 E;  2CH4 A;  2GO4 A;  3LNU A;  4YKQ A;  3D36 A;  3RKZ A;  4DXL A;  4PRX A;  1XNQ E;  5C0X B;  2BRC A;  1HNW I;  2O1V A;  2YKJ A;  1YH8 A;  4FW3 A;  3B4T A;  3SL2 A;  1Y60 A;  1Z0T A;  2JEA A;  2YEI A;  4LCH A;  1HNW E;  4DV0 E;  5EKW A;  1EA6 A;  2BYH A;  4FW9 A;  3T1Y I;  1ZM2 A;  4MP7 A;  4DV4 E;  1GJV A;  1Z5C A;  2NN6 A;  5M4K A;  4U93 A;  3T1Y E;  3PYE A;  4K0K I;  3B25 A;  4DUZ I;  3T1H I;  1USU A;  2UUC I;  4X64 I;  2CCS A;  4K0K E;  4L94 A;  2V2Z A;  4DUZ E;  5JEN A;  3T1H E;  1D6T A;  4QNJ A;  4WUD A;  2R3V A;  2PO1 B;  2IES A;  3GON A;  1HNZ I;  5IWA I;  2YE7 A;  5CTW A;  2PO2 B;  4DR7 I;  4H81 A;  3Q5J A;  1HNZ E;  1XXE A;  5IWA E;  1THN A;  4DR7 E;  4JQL A;  3CRL A;  2Z5C B;  4EGI A;  1KVK A;  3OTO I;  4JI1 E;  1N33 I;  4OO1 A;  2XHX A;  1I59 A;  4LFA I;  4GCZ A;  1U0Z A;  1DAR A;  3OTO E;  1N33 E;  3S5T A;  4CWN A;  1QYE A;  4OKG A;  4LFA E;  2NN6 D;  1OYP A;  5FLX Q;  2FWZ A;  4R1F A;  4URL A;  4B6C A;  1Y5Y A;  2HFU A;  4XIQ A;  3ZZU A;  3U67 A;  2YE3 A;  4YKT A;  4QNK A;  4LP0 A;  4DPW A;  4DR3 E;  2FTK A;  4URN A;  2HKJ A;  5BOD A;  2WER A;  3QTF A;  1H74 A;  2YE2 A;  4DV3 E;  4U7O A;  3VAD A;  3J7A M;  2GQP A;  3PS1 A;  2JKI A;  4XCJ A;  3Q1Q A;  3GME A;  2C38 A;  1I5D A;  2BU8 A;  2IWS A;  4OO1 D;  4FCR A;  3K98 A;  1FWK A;  2BR2 B;  4XIT A;  2XX2 A;  1Z0C A;  3H80 A;  2VWC A;  1YS3 A;  4HZ0 A;  2HKE A;  3GLL A;  2UXB E;  1UYF A;  5D7C A;  3T0Z A;  3P3C A;  3EHF A;  3VHD A;  5A2Q Q;  3ZKB A;  2NN6 F;  3U1Y A;  2X7I A;  5IDJ A;  4HAC B;  1I94 I;  3PYD A;  3U1K A;  3PRY A;  1I94 E;  3OWB A;  4NH8 A;  3GIG A;  3G7E A;  5D7D A;  5M4M A;  2XHR A;  3WU6 A;  5LMN E;  1UYE A;  1Z0B A;  5DNL A;  3J81 Q;  1OJ4 A;  2YJX A;  1UY8 A;  5EL9 A;  1H7U A;  2YI6 A;  3INX A;  4EGH A;  2IOP A;  4LF6 I;  3NMQ A;  4O0B A;  2X36 A;  1F51 A;  3D0B A;  4GQU A;  1U2R A;  2GFD A;  3HEK A;  2PNZ A;  2VCJ A;  1FJG E;  4OO1 F;  2OI2 A;  2XDU A;  2PO0 B;  4JI5 I;  1TH8 A;  2C1G A;  4YKW A;  4E01 A;  1TBW A;  1Y8P A;  3QT5 A;  3C0E A;  3R4P A;  4ZKI A;  2E1R A;  3HUL A;  5DRR A;  1HR0 I;  4B3M I;  4JI5 E;  5K36 E;  3O0I A;  1UEK A;  1N32 I;  4O09 A;  2EFG A;  4DPT A;  1HR0 E;  4B3M E;  3M7N D;  1R6M A;  3HYZ A;  1N32 E;  4HYP A;  4X66 I;  1NHJ A;  4B3S I;  3TZ5 A;  3OPD A;  3FT8 A;  4X66 E;  4WUB A;  3P76 A;  4B3S E;  2JE6 A;  2C39 A;  2HK3 A;  2XDX A;  4HYM A;  4KTN A;  4IZJ B;  2HFS A;  3RLR A;  1B3Q A;  4BQJ A;  3WU3 A;  5FLX C;  1N0V C;  4LF9 I;  4DR4 I;  3PS3 A;  2YEH A;  2UXD E;  4ISA A;  1XHK A;  4IFD C;  3PEH A;  4LF9 E;  3KRN A;  4DR4 E;  2YGE A;  4B3T I;  1MG7 A;  2C37 B;  3O2F A;  2NPF A;  4B3T E;  5M4P A;  2WNR A;  2VW5 A;  1MU5 A;  3L7Z A;  5M4N A;  4FPP A;  4LF7 I;  3J7A G;  3M7N G;  4KFG A;  3TZ2 A;  1ELO A;  2O1W A;  5GME A;  2BYI A;  4LF7 E;  4LOM A;  4JI7 I;  2NN6 E;  4XC0 A;  4QPK A;  4XKO A;  1S4E A;  4MU3 A;  2VQF I;  2CCU A;  4LCF A;  2VES A;  1NHI A;  2VQF E;  4JI0 I;  4LWH A;  1ZW9 A;  5K36 A;  1YT1 A;  1UYC A;  3EHJ A;  3WHA A;  4CWQ A;  4YY3 I;  3QT8 A;  5A2Q C;  4JI3 I;  3V2U C;  5FNF A;  2V2V A;  2AJ4 A;  4JI3 E;  1XMQ I;  4LF5 I;  2YKC A;  4YKX A;  2WNR B;  4Q20 A;  4CE3 A;  4EMV A;  4LF5 E;  4IS9 A;  3B28 A;  4R3A A;  2WI5 A;  3G75 A;  4EFT A;  5FWK A;  5LMU I;  3J81 C;  2BU2 A;  2UUA I;  5LMU E;  4DPX A;  2Q8G A;  1Z0V A;  2CGE A;  3CDI A;  2UUA E;  1XNQ I;  3UHM A;  2HG1 A;  3T10 A;  1H7S A;  2VCI A;  4L91 A;  2J7K A;  2XDL A;  1QZR A;  1N34 I;  4EFU A;  4I3H A;  4DV0 I;  4URM A;  5C93 A;  1MX0 A;  2IOQ A;  5K36 D;  4DV4 I;  1I5C A;  1N34 E;  3U2K A;  3ZXQ A;  1FNM A;  2Z5E A;  2K5B A;  2YEF A;  4JAV A;  4MPE A;  4XTJ A;  2IWX A;  1XNR I;  2BM0 A;  4E00 A;  4I5S A;  4FW4 A;  4HY1 A;  1XNR E;  2O1U A;  4JI4 I;  3IED A;  4IZK A;  1BYQ A;  2AKP A;  1BXD A;  2YI7 A;  4JI4 E;  2IWU A;  3TUH A;  3F0N A;  4BIZ A;  4DV1 I;  4KSH A;  4J3D A;  3GIE A;  1NZ0 A;  2AE8 A;  3LTO A;  1L0O A;  1UDN A;  4DV1 E;  1YSZ A;  2YI5 A;  5IDM A;  4NXN I;  2H8M A;  3CGY A;  1VI7 A;  3M6A A;  4JI1 I;  4NXN E;  2JEA B;  1Z59 A;  2BV3 A;  2NN6 B;  3NZK A;  4Z7C A;  5K36 F;  2BRE A;  2JT2 A;  3CWV A;  1Z0G A;  5JEA C;  2GS8 A;  3H1C A;  2H55 A;  4X62 I;  1RHY A;  4DR3 I;  1K47 A;  2YEB A;  3P06 A;  2BA1 D;  4JI6 E;  4LPF A;  2E0A A;  4X62 E;  4LF8 E;  2FYP A;  1A6F A;  1OYR A;  1UYG A;  2YKB A;  2JJC A;  3A0R A;  4HY6 A;  4DV3 I;  4FCQ A;  1I5A A;  1H72 C;  3B82 A;  3D4J A;  1YC4 A;  2FWY A;  2FXS A;  4MU1 A;  1Y6Z A;  2LJP A;  1JM6 A;  2YGA A;  1UYH A;  2ZDX A;  2YE8 A;  2WW4 A;  3G7B A;  2HK2 A;  1PIE A;  3DGE A;  1USV A;  3R4M A;  1PVG A;  4YHH I;  4DR5 I;  3RLQ A;  4CWR A;  5DNX A;  4DV6 I;  4OO1 B;  4JAU A;  2YEA A;  3EKR A;  2UXB I;  2O3Z A;  4YHH E;  4DR5 E;  3CYG A;  3ZZ0 A;  4DV6 E;  1WUU A;  4XIP A;  3O6O A;  1UYD A;  3EHH A;  5F5R A;  3K85 A;  3B8H A;  5C0X C;  2C2A A;  4MPC A;  3EKO A;  1FI4 A;  2YK9 A;  2ZDY A;  3LMM A;  1R6L A;  1EI1 A;  1KKH A;  2BA1 G;  4MOT A;  4BIU A;  2XDK A;  3D2R A;  1RRE A;  4OX9 E;  4KSG A;  2BSM A;  4XKK A;  1UDS A;  4DZY A;  1Y4U A;  4FW7 A;  4JAS A;  5LMN I;  2XX5 A;  4XKA A;  4BA1 A;  1UY6 A;  2WI7 A;  4YKU A;  2YI0 A;  4PRV A;  1BKN A;  1HNX E;  1Y8N A;  4IFD D;  1YT0 A;  3K97 A;  2WEP A;  2ZIT A;  4U3D A;  4USK A;  3FT5 A;  1U2O A;  2C38 B;  5J71 A;  4ASF A;  1YT2 A;  4CWP A;  4AM3 A;  1Z5B A;  4P7A A;  3R91 A;  1TC0 A;  1FJG I;  5M4H A;  4V25 A;  3T2S A;  2ZM6 I;  1AJ6 A;  3PEJ A;  4CWF A;  4CWS A;  1S16 A;  4MQY A;  3TTZ A;  4ASB A;  4DR2 I;  2BM1 A;  2ZM6 E;  1AMW A;  4E72 A;  1IBK I;  2Q8H A;  5F3K A;  5GMD A;  4DR2 E;  4N3O A;  1IBK E;  2YE6 A;  2WP8 A;  4XE2 A;  3GIG B;  1XMO I;  2YED A;  1Y8O A;  4YKY A;  1E3P A;  4Z7Y A;  4CWT A;  2HHH I;  4ZVI A;  1XMO E;  4UT4 A;  2HHH E;  4BQG A;  1AH6 A;  2UXD I;  4IFD F;  4L90 A;  3PYF A;  4FN5 A;  1TID A;  2PNZ B;  3EHG A;  2XHT A;  2IOR A;  2YEC A;  3V5R A;  4LFB I;  5DRO A;  2YEE A;  5GGZ A;  3VHC A;  2JEB A;  1YHC A;  2YEJ A;  4LFB E;  4OO1 C;  5C0X E;  1TIL A;  2E5L I;  2GO3 A;  4B3R E;  4EM7 A;  4FW6 A;  4MU4 A;  3M85 D;  2E5L E;  3HZ1 A;  4H85 A;  2YE5 A;  1BGQ A;  1TC6 A;  3JAM Q;  2JE6 B;  3GIF A;  3HHU A;  4XIR A;  2C39 B;  1YSR A;  4W7T A;  3Q5K A;  4M1K A;  2XAB A;  4X9L A;  1UYK A;  5BOC A;  3OMU A;  3A0T A;  5DRP A;  3WU4 A;  4HZ5 A;  5IN9 A;  4KHP I;  4NXM I;  1UDO A;  4BA2 A;  2A2D A;  4DPU A;  2F4V I;  5D7R A;  3PYG A;  2WI4 A;  1UDQ A;  4KHP E;  4NXM E;  3B78 A;  3P3G A;  2XDS A;  4CE2 A;  4O07 A;  2F4V E;  2YGF A;  3T1K A;  2UUB I;  3A0Z A;  5J6A A;  4L93 A;  3L7Z B;  1AM1 A;  2YEG A;  3M85 G;  2CZ9 A;  4JI8 E;  2UUB E;  2IER A;  4DU8 A;  5L3J A;  2BU5 A;  4DPY A;  3A0Y A;  4JI2 I;  3K17 A;  3HYY A;  4O04 A;  3K99 A;  1PKP A;  4JI2 E;  4CE1 A;  4PL9 A;  2GQ0 A;  4DV7 I;  2XEX A;  2HHI A;  5CTX A;  1Y4S A;  4DV7 E;  1FWL A;  5CTY A;  5C0X A;  5JEA D;  5K36 B;  4MDT A;  4BA2 B;  3Q5L A;  2CCT A;  2YE9 A;  4OZE A; 
#chains in the Genus database with same CATH homology
 2CGF A;  4LF4 I;  2XX4 A;  2YK2 A;  1ZWH A;  3BMY A;  5CF0 A;  4LF4 E;  5IT9 Q;  2WI6 A;  4USM A;  2ESA A;  4JYA I;  1I58 A;  2ZKJ A;  4KP4 A;  3R92 A;  4EEH A;  4EGK A;  3QT7 A;  1UYI A;  4JYA E;  2ZBK B;  3LPS A;  4P52 A;  1J5E I;  4GKJ I;  2YJW A;  4K4O A;  2PNL A;  4RPF A;  3J80 Q;  4GKJ E;  1J5E E;  4PU9 A;  2XK2 A;  3CRK A;  2VF3 A;  2Z5C A;  3VHA A;  4MP2 A;  4ASA A;  2DEJ A;  5BR8 I;  2YKE A;  2BU6 A;  2CG9 A;  5BR8 E;  2Z5B A;  4YKZ A;  4CWO A;  4JI6 I;  1ZXN A;  4XD8 A;  4X65 I;  4LF8 I;  1ID0 A;  2QG2 A;  4B7P A;  2UUC E;  4X64 E;  4IZK B;  2PNR A;  4X65 E;  3JAM C;  3B24 A;  4GT8 A;  1S14 A;  4QPJ A;  5D6Q A;  4BXI A;  1RR9 A;  4E02 A;  2V2Q A;  3B27 A;  5CPH A;  4KQV A;  2XJG A;  3WQ9 A;  1UYM A;  4AWQ A;  1US7 A;  1Z0W A;  4XDM A;  4LFC I;  4ED4 A;  1KIJ A;  2WI1 A;  3QDD A;  2Z5B B;  4LFC E;  1KZN A;  1Z0E A;  3ZXO A;  4OX9 I;  3HZ5 A;  2V8P A;  2VQE I;  4L8Z A;  3U2D A;  3K60 A;  4HAC A;  1N36 I;  4DUH A;  2VQE E;  1GKZ A;  1N36 E;  4O05 A;  2PNM A;  4FWG A;  1YC1 A;  1HNX I;  3T0H A;  4LWG A;  1YC3 A;  4DU7 A;  4AQY I;  1UYL A;  3A0X A;  2DEI A;  3QT6 A;  4JG4 A;  5LL6 R;  3ZM7 A;  1KTV A;  4AQY E;  4FMT A;  2Q8I A;  4AWP A;  1YET A;  4FCP A;  5IT9 C;  2WEQ A;  4MBC A;  4U7N A;  4LWI A;  4ASG A;  1HK7 A;  4H7Q A;  3RLP A;  3Q6M A;  1H73 A;  1ZM4 A;  1B63 A;  4GGL A;  5FNC A;  2XCM A;  3J80 C;  2BTZ A;  2QF6 A;  2YKI A;  4HXZ A;  3MNR P;  1AH8 A;  2XJX A;  3R4O A;  4YKR A;  1A4H A;  1QY8 A;  3ZKD A;  4IZJ A;  2HCH A;  2V34 A;  4LF6 E;  1R62 A;  3Q6N A;  2UU9 I;  4DV5 I;  1YER A;  2A2C A;  3K1J A;  4UTG A;  1UY9 A;  2UU9 E;  4DV5 E;  4B3R I;  1GKX A;  1IBM I;  4JV5 I;  4MYU A;  2O1T A;  4NH7 A;  1IBM E;  4JV5 E;  1OSF A;  1VIS A;  2UWD A;  4BAE A;  3ZZT A;  4R3M A;  2QG0 A;  2R42 A;  1YES A;  2BU7 A;  4IZJ D;  3JZ3 A;  2XD6 A;  3TZ0 A;  4EMD A;  4HXW A;  4LWF A;  4LPB A;  2WI3 A;  4GEE A;  3OWD A;  2BT0 A;  4LWE A;  4AWO A;  4MYT A;  1ZXM A;  3HJC A;  4JI8 I;  2Q8F A;  3BM9 A;  2XJJ A;  4DUY I;  2YE4 A;  4URO A;  1N0U A;  3TZ4 A;  4DUY E;  3R4N A;  3WU5 A;  4NH9 A;  2WI2 A;  4JI7 E;  4WUC A;  4XCL A;  3CGZ A;  3B26 A;  5FND A;  3INW A;  1IBL I;  3FV5 A;  1ZM9 A;  4GFN A;  4P8O A;  1ZM3 A;  1IBL E;  4GKK I;  2EXL A;  1B62 A;  4FWD A;  4JI0 E;  5M4E A;  1FKA E;  4DR6 I;  4MPN A;  4DR1 I;  3KE6 A;  4YY3 E;  4GKK E;  1Z5A A;  4DR6 E;  3H4L A;  4DR1 E;  2QFO A;  2Q2E B;  2UXC I;  1I5B A;  1NHH A;  1XMQ E;  4MB9 A;  4AS9 A;  3A0W A;  2UXC E;  2BZ5 A;  3C11 A;  4V26 A;  3OW6 A;  4FWH A;  4DV2 I;  5D6P A;  5CTU A;  4GQT A;  1UY7 A;  4DV2 E;  2CH4 A;  3LNU A;  4YKQ A;  3D36 A;  3RKZ A;  4DXL A;  4PRX A;  1XNQ E;  2BRC A;  2YKJ A;  1HNW I;  2O1V A;  3SL2 A;  1Z0T A;  2YEI A;  1HNW E;  4DV0 E;  2BYH A;  1EA6 A;  4MP7 A;  4FW9 A;  3T1Y I;  1ZM2 A;  5M4K A;  4DV4 E;  1GJV A;  1Z5C A;  4U93 A;  3T1Y E;  3PYE A;  4K0K I;  3B25 A;  4DUZ I;  3T1H I;  1USU A;  2UUC I;  4X64 I;  2CCS A;  4K0K E;  4L94 A;  2V2Z A;  4DUZ E;  3T1H E;  1D6T A;  4WUD A;  2R3V A;  3GON A;  1HNZ I;  5IWA I;  2YE7 A;  5CTW A;  4DR7 I;  4H81 A;  3Q5J A;  1HNZ E;  5IWA E;  1THN A;  4DR7 E;  4JQL A;  3CRL A;  2Z5C B;  4EGI A;  1KVK A;  3OTO I;  4JI1 E;  1N33 I;  2XHX A;  1I59 A;  4LFA I;  4GCZ A;  1U0Z A;  1DAR A;  3OTO E;  1N33 E;  4CWN A;  1QYE A;  4LFA E;  5FLX Q;  2FWZ A;  4R1F A;  4URL A;  4B6C A;  2HFU A;  4XIQ A;  3ZZU A;  3U67 A;  2YE3 A;  4YKT A;  4LP0 A;  4DPW A;  4DR3 E;  4URN A;  2HKJ A;  5BOD A;  2WER A;  3QTF A;  1H74 A;  2YE2 A;  4DV3 E;  4U7O A;  3VAD A;  3J7A M;  2GQP A;  2JKI A;  4XCJ A;  3Q1Q A;  1I5D A;  2BU8 A;  2IWS A;  4FCR A;  3K98 A;  1FWK A;  4XIT A;  2XX2 A;  1Z0C A;  3H80 A;  2VWC A;  1YS3 A;  4HZ0 A;  2HKE A;  2UXB E;  1UYF A;  5D7C A;  3T0Z A;  3VHD A;  3EHF A;  5A2Q Q;  3ZKB A;  2X7I A;  5IDJ A;  4HAC B;  1I94 I;  3PYD A;  3PRY A;  1I94 E;  3OWB A;  4NH8 A;  3GIG A;  3G7E A;  5D7D A;  5M4M A;  2XHR A;  3WU6 A;  5LMN E;  1UYE A;  1Z0B A;  3J81 Q;  1OJ4 A;  2YJX A;  1UY8 A;  3INX A;  1H7U A;  2YI6 A;  4EGH A;  2IOP A;  4LF6 I;  3NMQ A;  4O0B A;  2X36 A;  3D0B A;  1U2R A;  2GFD A;  3HEK A;  2VCJ A;  1FJG E;  2OI2 A;  2XDU A;  4JI5 I;  1TH8 A;  4YKW A;  4E01 A;  1TBW A;  1Y8P A;  3QT5 A;  3C0E A;  3R4P A;  4ZKI A;  2E1R A;  3HUL A;  1HR0 I;  4B3M I;  4JI5 E;  3O0I A;  1UEK A;  1N32 I;  4O09 A;  2EFG A;  4DPT A;  1HR0 E;  4B3M E;  3HYZ A;  1N32 E;  4HYP A;  4X66 I;  1NHJ A;  4B3S I;  3TZ5 A;  3OPD A;  3FT8 A;  4X66 E;  4WUB A;  4B3S E;  2XDX A;  2HK3 A;  4HYM A;  4KTN A;  4IZJ B;  2HFS A;  3RLR A;  1B3Q A;  4BQJ A;  3WU3 A;  5FLX C;  1N0V C;  4LF9 I;  4DR4 I;  2YEH A;  2UXD E;  1XHK A;  3PEH A;  4LF9 E;  4DR4 E;  2YGE A;  4B3T I;  1MG7 A;  3O2F A;  2NPF A;  4B3T E;  5M4P A;  2VW5 A;  1MU5 A;  5M4N A;  4FPP A;  4LF7 I;  3J7A G;  4KFG A;  3TZ2 A;  1ELO A;  2O1W A;  5GME A;  2BYI A;  4LF7 E;  4JI7 I;  4XC0 A;  4QPK A;  4XKO A;  1S4E A;  2VQF I;  2CCU A;  1NHI A;  2VQF E;  4JI0 I;  4LWH A;  1ZW9 A;  4CWQ A;  1YT1 A;  1UYC A;  3EHJ A;  3WHA A;  4YY3 I;  3QT8 A;  5A2Q C;  4JI3 I;  3V2U C;  5FNF A;  2V2V A;  2AJ4 A;  4JI3 E;  1XMQ I;  4LF5 I;  2YKC A;  4YKX A;  4Q20 A;  4CE3 A;  4EMV A;  4LF5 E;  3B28 A;  4R3A A;  2WI5 A;  3G75 A;  4EFT A;  5FWK A;  5LMU I;  3J81 C;  2BU2 A;  2UUA I;  5LMU E;  4DPX A;  2Q8G A;  1Z0V A;  2CGE A;  2UUA E;  1XNQ I;  2HG1 A;  3T10 A;  1H7S A;  2VCI A;  4L91 A;  2J7K A;  2XDL A;  1QZR A;  1N34 I;  4EFU A;  4I3H A;  4DV0 I;  4URM A;  5C93 A;  1MX0 A;  2IOQ A;  4DV4 I;  1I5C A;  1N34 E;  3U2K A;  3ZXQ A;  1FNM A;  2Z5E A;  2K5B A;  2YEF A;  4JAV A;  4MPE A;  4XTJ A;  2IWX A;  1XNR I;  2BM0 A;  4E00 A;  4I5S A;  4HY1 A;  1XNR E;  2O1U A;  4JI4 I;  3IED A;  4IZK A;  1BYQ A;  1BXD A;  2YI7 A;  4JI4 E;  2IWU A;  3TUH A;  3F0N A;  4BIZ A;  4DV1 I;  4KSH A;  3GIE A;  1NZ0 A;  3LTO A;  1L0O A;  1YSZ A;  2YI5 A;  4DV1 E;  5IDM A;  4NXN I;  2H8M A;  3CGY A;  4JI1 I;  3M6A A;  4NXN E;  1Z59 A;  2BV3 A;  4Z7C A;  2BRE A;  3CWV A;  1Z0G A;  2GS8 A;  2H55 A;  4X62 I;  4DR3 I;  1K47 A;  2YEB A;  3P06 A;  4JI6 E;  2E0A A;  4X62 E;  4LF8 E;  2FYP A;  1A6F A;  1UYG A;  2YKB A;  3A0R A;  2JJC A;  4HY6 A;  4DV3 I;  4FCQ A;  1I5A A;  1H72 C;  3B82 A;  3D4J A;  1YC4 A;  2FWY A;  2FXS A;  1Y6Z A;  2LJP A;  1JM6 A;  2YGA A;  1UYH A;  2ZDX A;  2YE8 A;  2WW4 A;  3G7B A;  2HK2 A;  1PIE A;  3DGE A;  1USV A;  3R4M A;  1PVG A;  4YHH I;  4DR5 I;  3RLQ A;  4CWR A;  4DV6 I;  4JAU A;  2YEA A;  3EKR A;  2UXB I;  4YHH E;  4DR5 E;  4XIP A;  3ZZ0 A;  4DV6 E;  1WUU A;  3O6O A;  1UYD A;  3EHH A;  5F5R A;  3K85 A;  3B8H A;  2C2A A;  4MPC A;  3EKO A;  1FI4 A;  2YK9 A;  2ZDY A;  1EI1 A;  1KKH A;  4MOT A;  4BIU A;  2XDK A;  3D2R A;  1RRE A;  4OX9 E;  4KSG A;  2BSM A;  4XKK A;  4DZY A;  1Y4U A;  4JAS A;  5LMN I;  2XX5 A;  4XKA A;  1UY6 A;  2WI7 A;  4YKU A;  2YI0 A;  4PRV A;  1BKN A;  1HNX E;  1Y8N A;  1YT0 A;  3K97 A;  2WEP A;  2ZIT A;  4USK A;  3FT5 A;  1U2O A;  5J71 A;  4ASF A;  1YT2 A;  4CWP A;  1Z5B A;  4P7A A;  3R91 A;  1TC0 A;  1FJG I;  5M4H A;  4V25 A;  3T2S A;  2ZM6 I;  1AJ6 A;  3PEJ A;  4CWF A;  4CWS A;  1S16 A;  3TTZ A;  4ASB A;  4DR2 I;  2BM1 A;  2ZM6 E;  1AMW A;  1IBK I;  2Q8H A;  5F3K A;  5GMD A;  4DR2 E;  4N3O A;  1IBK E;  2YE6 A;  4XE2 A;  3GIG B;  1XMO I;  2YED A;  1Y8O A;  4YKY A;  4Z7Y A;  4CWT A;  2HHH I;  4ZVI A;  1XMO E;  4UT4 A;  2HHH E;  4BQG A;  1AH6 A;  2UXD I;  4L90 A;  3PYF A;  4FN5 A;  1TID A;  3EHG A;  2XHT A;  2IOR A;  2YEC A;  3V5R A;  4LFB I;  2YEE A;  5GGZ A;  3VHC A;  2YEJ A;  4LFB E;  1TIL A;  2E5L I;  4B3R E;  4EM7 A;  3HZ1 A;  2E5L E;  4H85 A;  2YE5 A;  1BGQ A;  1TC6 A;  3JAM Q;  3GIF A;  3HHU A;  4XIR A;  1YSR A;  4W7T A;  3Q5K A;  4M1K A;  2XAB A;  4X9L A;  1UYK A;  5BOC A;  3OMU A;  3A0T A;  4HZ5 A;  3WU4 A;  5IN9 A;  4KHP I;  4NXM I;  2A2D A;  4DPU A;  2F4V I;  5D7R A;  3PYG A;  2WI4 A;  4CE2 A;  4KHP E;  4NXM E;  3B78 A;  2XDS A;  4O07 A;  2F4V E;  2YGF A;  3T1K A;  2UUB I;  3A0Z A;  5J6A A;  4L93 A;  1AM1 A;  2YEG A;  2CZ9 A;  4JI8 E;  2UUB E;  5L3J A;  4DU8 A;  2BU5 A;  4DPY A;  3A0Y A;  4JI2 I;  3K17 A;  3HYY A;  4O04 A;  3K99 A;  1PKP A;  4JI2 E;  4CE1 A;  4PL9 A;  2GQ0 A;  4DV7 I;  2XEX A;  5CTX A;  1Y4S A;  4DV7 E;  1FWL A;  5CTY A;  2AKP A;  3Q5L A;  2CCT A;  2YE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...