1PVGA

Crystal structure of the atpase region of saccharomyces cerevisiae topoisomerase ii
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
400
structure length
378
Chain Sequence
SASDKYQKISQLEHILKRPDTYIGSVETQEQLQWIYDEETDCMIEKNVTIVPGLFKIFDEILVNAADNKVRDPSMKRIDVNIHAEEHTIEVKNDGKGIPIEIHNKENIYIPEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILETADLNVGQKYVQKWENNMSICHPPKITSYKKGPSYTKVTFKPDLTRFGMKELDNDILGVMRRRVYDINGSVRDINVYLNGKSLKIRNFKNYVELYLKSLIPTILYERINNRWEVAFAVSDISFQQISFVNSIATTMGGTHVNYITDQIVKKISEILKKVKSFQIKNNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCEIPLEYINKIMKTDLATRMFEIADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the topoisomerase II ATPase region and its mechanism of inhibition by the chemotherapeutic agent ICRF-187
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
molecule keywords DNA topoisomerase II
total genus 113
structure length 378
sequence length 400
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2003-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1pvgA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1pvgA01
1D6TA 4YKUA 3T1HI 2CG9A 4UT4A 4XKKA 3EHHA 2UU9I 4DR6I 3T1YI 3HZ1A 4PL9A 5IDMA 3R92A 4XDMA 2O1VA 3WHAA 1KVKA 4X64E 3RLPA 3IEDA 2UWDA 1Z0TA 4BIZA 3CGZA 1UYFA 3T0ZA 2V2VA 4CE2A 1WUUA 1UY7A 2YE9A 4E02A 4JI0E 2QG2A 4OX9I 1N32E 2YE6A 3OMUA 4L91A 4DR3E 5A2QQ 3QTFA 1PKPA 2UU9E 4MP7A 2IOQA 5D7RA 2VQEI 5C93A 1N34E 4LF9I 4L8ZA 3PYGA 4B3RI 2O1UA 2BU8A 3QT7A 4DZYA 2IOPA 4H7QA 3VHCA 1UYGA 2IWSA 2JKIA 3K60A 3R4NA 1YSZA 1FJGE 2O1WA 3FT5A 4EGIA 3TZ4A 5F5RA 4O05A 4B3ME 3ZZ0A 4KHPE 4JI8E 4L90A 3NMQA 4DV3I 3G75A 5LMNE 2Q2EB 3ZZTA 2VQFI 2H55A 3ZM7A 4DV1E 5IT9Q 4R3AA 4KFGA 4HYPA 2DEJA 4DR7I 2R42A 1HNWI 4LF4I 4DUYE 4NXME 4LP0A 5M4EA 1Y4UA 4HY6A 1PIEA 4YKZA 3JAMQ 4GKJI 1TH8A 2E1RA 1IBKE 4MPEA 2XABA 4MB9A 2YGEA 4P8OA 4B3MI 4URLA 2YE2A 5CTXA 3ZKBA 2VCJA 3B82A 2JJCA 5CPHA 4JYAI 2WI2A 1QYEA 4X9LA 1ZXNA 4EFUA 4DUZI 1PVGA 4LF8I 1KIJA 2VW5A 4LPBA 4JI7E 4K0KE 3J81Q 4LFBE 4DUYI 4LF4E 1A6FA 4HACA 5BOCA 2WW4A 1YC1A 3G7EA 4UTGA 1AM1A 3B26A 2UUAI 4YKWA 4FCPA 5IN9A 2UUCI 2CZ9A 1UYIA 2WEPA 4R3MA 2YKBA 4XTJA 2BM0A 1N36E 4DR3I 4ZVIA 4I5SA 4X64I 2H8MA 4JI3I 3FV5A 2UXCI 4DV5E 2YI6A 1BKNA 4DXLA 3QT8A 2BREA 3C0EA 3B8HA 4MOTA 3EKRA 5L3JA 4ASGA 3D2RA 2LJPA 2IWXA 1UY9A 2EFGA 2GS8A 3M6AA 1ZM2A 4LFCE 3B78A 1N34I 2XEXA 2UUBE 4EM7A 2YEJA 4Z7CA 4V25A 1H7SA 1S4EA 4GQTA 4DV6I 1YESA 2UXCE 2FYPA 2XDXA 4P7AA 4DPXA 4JI4E 1TBWA 1YS3A 1NZ0A 4FMTA 1Z0BA 4NH7A 4GKJE 1HNZE 3J7AG 2WI4A 4B6CA 1I94E 2YEAA 3O6OA 4QPKA 3T1KA 4DPYA 1TIDA 4USMA 3CGYA 2YEEA 3GIFA 5J6AA 1NHIA 2HKJA 2YEGA 5IDJA 4JV5I 4EFTA 4YKYA 4PRVA 1N0VC 1AH6A 4URMA 2HHHE 1K47A 2YK2A 2V2QA 4DV2E 2YI0A 4L93A 4BQGA 5CTUA 3OWBA 1IBMI 4YY3E 1L0OA 2XDLA 5CF0A 2NPFA 1U2OA 2CGFA 4DU8A 2YEIA 4O0BA 5GMEA 4NXNI 3ZXQA 2WI3A 4CWNA 1BGQA 2ZITA 4DR5I 2UXDI 4CWSA 5IWAI 4XC0A 4YHHE 4CWRA 4LF7I 3ZZUA 3TUHA 4XIQA 3GIEA 4KSHA 2YECA 4DV2I 2UUCE 4DPWA 4DR1I 3Q5KA 4X66E 5LMNI 3RLQA 2HFUA 3PEJA 3F0NA 3V5RA 1MG7A 3QT5A 5BR8I 2YKCA 2X36A 4JAUA 2XHRA 4DR5E 5FNCA 3K97A 1Z0EA 4JI6I 3A0ZA 3T2SA 1RREA 1ZM9A 4WUBA 4XKOA 4U93A 3LNUA 1ZM3A 4E00A 4BIUA 4B3TE 1FNMA 4JI7I 2QFOA 1YT0A 4LF5I 5FWKA 4USKA 1HNZI 2YE7A 4JAVA 4HY1A 2PNRA 1IBLE 4PRXA 4MYUA 4U7NA 3OPDA 2YE4A 1QZRA 4BQJA 4H81A 3HYZA 3RLRA 1Y8NA 4GEEA 3PYFA 3K99A 2VQEE 4MYTA 2F4VI 1N0UA 3V2UC 5CTYA 4CWQA 4KSGA 4B3SI 2XJXA 4KTNA 5D6QA 2HHHI 4UROA 1Z5AA 2CH4A 4GKKI 4DV1I 4XIPA 3HZ5A 4URNA 2QF6A 2ZKJA 4FW9A 2BRCA 1XNRE 4LWEA 4XKAA 1Y8OA 1XMQI 4LFAE 4EMDA 3JZ3A 5BODA 2BTZA 1I5DA 2BU5A 3VHDA 5GGZA 1BYQA 4XCJA 3R91A 1TC6A 5FNFA 1Y8PA 2V8PA 2YI5A 5D7CA 1B63A 1HR0E 4PU9A 4FPPA 4DV5I 4V26A 5M4HA 2YEBA 3EHFA 1B3QA 2FWYA 5M4NA 2XCMA 2XHTA 2GQPA 2YGAA 4LFBI 3PYDA 3HYYA 4YKTA 4FCRA 5LL6R 1NHJA 2UXBE 1H7UA 3C11A 3K1JA 4NH9A 2ZM6E 4DPUA 1FI4A 1FWKA 5IWAE 1UYMA 4CWPA 4LF7E 2XK2A 4RPFA 4YKXA 4X62I 1R62A 1YETA 3D0BA 1H73A 2YJWA 4LF8E 1Z5BA 2HG1A 1UYEA 2WI6A 4W7TA 4ZKIA 2A2CA 2YKEA 4QPJA 4WUDA 4AWOA 4X66I 1UYHA 2UUAE 2HFSA 1GJVA 3OTOI 3OW6A 4JI5E 4EGKA 4KQVA 1ELOA 3TTZA 4AQYI 3R4OA 4KHPI 4M1KA 4JI6E 2YE8A 2A2DA 4DPTA 1YC4A 3B27A 3BMYA 4DV4E 4XD8A 4DR6E 2HCHA 1HNXE 1UY8A 3R4PA 1ZXMA 1BXDA 3PYEA 2DEIA 2UUBI 2UXDE 2R3VA 1KKHA 5FNDA 4DR2E 4DR7E 4HZ5A 2ZBKB 4JI2I 1XNQI 1YT2A 4WUCA 3OTOE 4MPNA 2V34A 1XMQE 1KTVA 1XHKA 2FWZA 1UYDA 3WQ9A 4BXIA 1OSFA 4LWGA 3WU3A 5CTWA 1I94I 4YHHI 1AJ6A 3HHUA 2CCSA 4DV7I 2BU7A 4HYMA 1UEKA 3U2KA 4AWPA 4B3RE 2IORA 1Z0WA 4GCZA 2YEFA 1JM6A 1MU5A 3INWA 3LTOA 5A2QC 4LWIA 4O04A 5IT9C 5BR8E 4MBCA 4HXZA 2BV3A 1N33E 4XCLA 1Z59A 4DV3E 1TC0A 1ZM4A 4DV7E 1I5AA 3WU5A 2BU6A 4X65I 4JQLA 1AMWA 2XX2A 2WI7A 1HNWE 5D7DA 3OWDA 4LWFA 1IBLI 4AWQA 4R1FA 3ZXOA 4GKKE 3CRLA 2IWUA 3A0TA 1B62A 1EA6A 3EHJA 3EHGA 4FCQA 4DU7A 3LPSA 3T1YE 4ASBA 2F4VE 4JYAE 3Q5LA 4MP2A 1XMOI 4DUZE 2AJ4A 2WI1A 3ZKDA 1FKAE 1MX0A 3DGEA 4EEHA 3J81C 2BU2A 2YJXA 3HULA 3H80A 1OJ4A 3Q5JA 4I3HA 2VWCA 2HKEA 3TZ5A 4OX9E 1N32I 4FWHA 4B3TI 1UYKA 3GIGA 2E0AA 1A4HA 1YT1A 4JASA 4KP4A 4JI8I 1GKXA 3EKOA 2YEDA 2BM1A 4LF9E 4XIRA 1N36I 2E5LE 2Q8GA 1NHHA 4K4OA 4O09A 2XX4A 1UY6A 4GFNA 3T0HA 1US7A 4JI2E 1ID0A 3INXA 4X62E 4DR4E 2ZDXA 1I59A 4DUHA 3TZ2A 1J5EE 1TILA 2UXBI 1Z5CA 1H72C 3K17A 2ZM6I 1IBKI 4YY3I 4GT8A 4LF6E 2HK3A 3T1HE 3A0YA 2YEHA 2XDKA 3A0WA 3CWVA 1S16A 5GMDA 4LWHA 3VHAA 4E01A 2YGFA 3U2DA 4YKRA 3WU4A 4DV4I 2CCTA 3QDDA 4JI4I 3JAMC 1H74A 1Y4SA 2Q8HA 2OI2A 1AH8A 3J7AM 4NH8A 2BSMA 1XNRI 2XD6A 3FT8A 2X7IA 4LFAI 2C2AA 5M4PA 4JI1I 3A0RA 5FLXQ 3B28A 1S14A 1RR9A 4O07A 1I58A 1HR0I 2YE5A 1XMOE 4B7PA 4CWTA 1QY8A 3J80Q 3Q1QA 2XDSA 2VQFE 1UYLA 4Z7YA 1XNQE 4CWFA 2XDUA 4EMVA 1YC3A 2YK9A 1DARA 3MNRP 2XX5A 1FJGI 5LMUE 2ZDYA 3SL2A 3T10A 4CWOA 5M4KA 2XJGA 4LF5E 3BM9A 1FWLA 2J7KA 1KZNA 4JI1E 4FWDA 4P52A 4YKQA 4DV0E 3HEKA 4HZ0A 5M4MA 3CRKA 4ASFA 4LFCI 2WERA 4JI3E 4JI5I 1YSRA 2QG0A 2CCUA 1YERA 3KE6A 2E5LI 3O0IA 4AS9A 4CE3A 2EXLA 1GKZA 2YI7A 3U67A 1Z0CA 2GFDA 4B3SE 5LMUI 4Q20A 4K0KI 4BAEA 3GIGB 1ZWHA 4U7OA 4EGHA 4DR1E 2XHXA 3TZ0A 4LF6I 2Q8FA 1THNA 2XJJA 1EI1A 2BYIA 4ASAA 1I5CA 3D36A 4H85A 4JI0I 1VISA 2YE3A 2WI5A 4DV6E 5FLXC 4X65E 3R4MA 2K5BA 4DR4I 1Z0GA 3RKZA 2VCIA 1HNXI 2HK2A 1J5EI 3G7BA 4MPCA 2YKJA 4FWGA 2WEQA 4FN5A 3J80C 2BZ5A 4DR2I 2BYHA 4CE1A 3GONA 3B24A 3H4LA 5F3KA 3O2FA 1IBME 1ZW9A 4NXMI 4XITA 4JG4A 4HXWA 4HACB 1U2RA 5D6PA 4JV5E 2V2ZA 2YKIA 1U0ZA 1UYCA 4GGLA 2BT0A 5J71A 4L94A 3A0XA 2VF3A 2ESAA 3D4JA 3WU6A 3VADA 3B25A 2Q8IA 3QT6A 4XE2A 2AKPA 1I5BA 2FXSA 4NXNE 3K98A 3PEHA 1Z0VA 1N33I 4DV0I 4ED4A 4AQYE
chains in the Genus database with same CATH superfamily
1D6TA 4YKUA 5DRQA 3T1HI 2CG9A 4UT4A 3P3GA 4XKKA 3EHHA 2UU9I 4DR6I 5JEAE 3T1YI 3HZ1A 4PL9A 5IDMA 3R92A 4XDMA 2O1VA 3WHAA 2BA0G 1KVKA 4IZKB 4X64E 3L7ZA 3IEDA 3RLPA 2UWDA 1Z0TA 4BIZA 3P3EA 3CGZA 1UYFA 2JEAA 3T0ZA 2V2VA 5C0XC 4CE2A 1WUUA 2PO0A 1UY7A 2YE9A 3P06A 4E02A 4JI0E 4GQUA 2QG2A 4OX9I 1N32E 2YE6A 3OMUA 4L91A 4DR3E 5A2QQ 3QTFA 1PKPA 2UU9E 4MP7A 2IOQA 5D7RA 2VQEI 5C93A 5C0XE 1N34E 4LF9I 4L8ZA 3PYGA 4B3RI 2O1UA 2BU8A 3QT7A 4DZYA 2IOPA 4H7QA 3VHCA 1UYGA 4IFDE 2IWSA 2JKIA 3K60A 3R4NA 1YSZA 1FJGE 2O1WA 3FT5A 4EGIA 3TZ4A 2CVEA 5F5RA 4O05A 1E3HA 4B3ME 3ZZ0A 4KHPE 4JI8E 4L90A 3NMQA 5DNLA 4DV3I 3G75A 5LMNE 2Q2EB 3ZZTA 2VQFI 2O1TA 2H55A 2Z5BA 1Y5YA 3ZM7A 5DNXA 4QNJA 4DV1E 5IT9Q 4R3AA 4KFGA 4HYPA 2DEJA 4DR7I 2R42A 1HNWI 4DUYE 4LF4I 4NXME 4LP0A 5M4EA 1Y4UA 4HY6A 1PIEA 4YKZA 3JAMQ 4GKJI 1TH8A 2E1RA 1IBKE 4MPEA 2XABA 4MB9A 2J65A 3UHMA 2YGEA 4P8OA 4B3MI 4URLA 5C0XD 2YE2A 3ZKBA 5CTXA 3HJCA 2VCJA 3B82A 2JJCA 5CPHA 2Z5CB 4JYAI 2WI2A 1QYEA 4FW5A 1ZXNA 4BA1B 4DUZI 1PVGA 4X9LA 4EFUA 4LF8I 1KIJA 2VW5A 4LPBA 4JI7E 4K0KE 3J81Q 4U3BA 3DD6A 4LFBE 4DUYI 4LF4E 5K36F 1A6FA 4HACA 5BOCA 2WW4A 2C1IA 1YC1A 4U3DA 3G7EA 4UTGA 2PO1A 1AM1A 4FW6A 3B26A 2UUAI 4YKWA 4FCPA 5IN9A 2UUCI 2CZ9A 1UYIA 2WEPA 4R3MA 2YKBA 4XTJA 4BA2B 2BM0A 4OO1D 1N36E 4DR3I 4ZVIA 4I5SA 4X64I 3L7ZB 4LCFA 2H8MA 4JI3I 3FV5A 2UXCI 1UDNA 5K36A 4OO1C 2BR2B 4DV5E 2YI6A 1BKNA 4DXLA 3QT8A 1VI7A 1YH8A 3B8HA 2BREA 3C0EA 5L3JA 3EKRA 4MOTA 4ASGA 5JENA 3D2RA 3KRNA 2LJPA 2IWXA 1UY9A 3U1YA 2EFGA 4IFDF 2GS8A 3M6AA 1ZM2A 4LFCE 3B78A 1N34I 2XEXA 2UUBE 4EM7A 2YEJA 4Z7CA 4V25A 1H7SA 1S4EA 4GQTA 2NN6B 4DV6I 1YESA 2UXCE 3M7ND 2FYPA 2XDXA 4P7AA 4DPXA 3CDJA 4JI4E 1TBWA 1YS3A 2C38B 1NZ0A 4OO1F 4FMTA 1Z0BA 2NN6A 5K36B 4GKJE 4NH7A 1HNZE 3J7AG 2WI4A 4B6CA 1I94E 2YEAA 3O6OA 4QPKA 5K36C 3T1KA 4DPYA 1TIDA 4USMA 3CGYA 2YEEA 3GIFA 5J6AA 3P76A 1NHIA 2HKJA 2YEGA 5IDJA 4JV5I 4EFTA 4YKYA 4PRVA 1N0VC 1AH6A 4QNKA 4URMA 2HHHE 1K47A 3PS1A 2V2QA 4DV2E 2YI0A 2YK2A 4L93A 4BQGA 5CTUA 1OYRA 2JE6A 3OWBA 1IBMI 4YY3E 1L0OA 2XDLA 5CF0A 2NPFA 4AIMA 1U2OA 2CGFA 4DU8A 2YEIA 3K85A 4O0BA 3M85D 5GMEA 4NXNI 3PS3A 3PS2A 2WI3A 3ZXQA 3S5TA 4CWNA 5JEAD 2ZITA 4DR5I 2UXDI 1BGQA 2NN6D 2WP8A 4CWSA 5IWAI 4XC0A 4YHHE 4CWRA 4LF7I 3ZZUA 3TUHA 4XIQA 3GIEA 2JEAB 4KSHA 2YECA 4DV2I 2UUCE 4DPWA 4DR1I 5DRPA 3Q5KA 4X66E 5LMNI 3RLQA 2HFUA 3PEJA 3F0NA 3V5RA 1MG7A 3QT5A 5BR8I 2YKCA 2X36A 4JAUA 2XHRA 4DR5E 5FNCA 3K97A 5JEAB 1Z0EA 2Z5EA 4JI6I 3GMEA 3A0ZA 4MQYA 3T2SA 1RREA 1ZM9A 2C39B 4WUBA 1OYSA 4XKOA 4U93A 3LNUA 3U1KA 1ZM3A 4IZJA 4BIUA 4E00A 4B3TE 1FNMA 4JI7I 2QFOA 1YT0A 4LF5I 5FWKA 4N3OA 4USKA 1HNZI 3M7NG 2YE7A 4HY1A 2PNRA 4JAVA 1IBLE 4PRXA 4MYUA 4OKGA 4IS9A 4U7NA 2WNRB 2YE4A 3OPDA 1QZRA 4BQJA 4H81A 3HYZA 3RLRA 1Y8NA 2PO2B 4IZJD 4GEEA 3PYFA 3K99A 2JEBB 2VQEE 2JE6B 4MYTA 4IFDD 2F4VI 1N0UA 3V2UC 5CTYA 4CWQA 4BA2A 4KSGA 2PNMA 2WNRA 4B3SI 2XJXA 4KTNA 5D6QA 2HHHI 4UROA 1Z5AA 2CH4A 4GKKI 4DV1I 4XIPA 3HZ5A 3CYGA 4URNA 2QF6A 2ZKJA 4FW9A 2BRCA 1XNRE 4LWEA 4XKAA 1Y8OA 1XMQI 4LFAE 4EMDA 2GQ0A 3HKMA 3JZ3A 5BODA 2BTZA 1I5DA 5C0XA 2BU5A 3VHDA 5GGZA 4FW4A 1BYQA 4MU3A 4XCJA 1TC6A 3R91A 5FNFA 1Y8PA 2V8PA 2YI5A 5D7CA 1B63A 4LCHA 4PU9A 1HR0E 4FPPA 4BA1A 4DV5I 4V26A 5M4HA 2YEBA 3EHFA 1B3QA 2FWYA 4MU4A 4IZKA 5M4NA 2XCMA 2XHTA 2GQPA 2YGAA 4LFBI 3PYDA 3HYYA 4YKTA 4FCRA 5LL6R 1XXEA 1NHJA 2NN6F 1H7UA 2UXBE 3C11A 2C39A 3K1JA 4NH9A 2ZM6E 4DPUA 1FI4A 1FWKA 3P3CA 5IWAE 1UYMA 4EMVA 4CWPA 5JEAA 4LF7E 2XK2A 4RPFA 4YKXA 4X62I 4OO1B 1R62A 1YETA 3D0BA 1H73A 2YJWA 3GLLA 4LF8E 1Z5BA 2HG1A 1UYEA 2WI6A 4W7TA 4ZKIA 2WP8B 2A2CA 3PRYA 2YKEA 4QPJA 4WUDA 4AWOA 4X66I 1UYHA 2UUAE 2HFSA 1GJVA 3OTOI 3OW6A 4JI5E 4EGKA 1P42A 4KQVA 1ELOA 2GO3A 3TTZA 4AQYI 3R4OA 4KHPI 4M1KA 4JI6E 2YE8A 2A2DA 4DPTA 1YC4A 3B27A 3BMYA 4DV4E 4XD8A 4DR6E 2HCHA 1HNXE 1UY8A 3R4PA 1ZXMA 1BXDA 3PYEA 2DEIA 2UUBI 3Q6NA 2UXDE 2R3VA 1KKHA 5FNDA 4DR2E 4DR7E 3LMMA 4HZ5A 2IESA 2ZBKB 2BA0D 1YHCA 2PNLA 4JI2I 4MDTA 2F1DA 1XNQI 1YT2A 2C1GA 4WUCA 3OTOE 4MPNA 2V34A 1XMQE 1KTVA 1XHKA 2FWZA 1UYDA 3WQ9A 4BXIA 1OSFA 4LWGA 4FW7A 3WU3A 1OYPA 5CTWA 1RHYA 1I94I 4YHHI 1AJ6A 3HHUA 2CCSA 4DV7I 2FTKA 2BU7A 4HYMA 1UEKA 3U2KA 2JT2A 4AWPA 4B3RE 2IORA 1Z0WA 4GCZA 2YEFA 1JM6A 1MU5A 4IZJB 3INWA 3LTOA 5A2QC 4LWIA 5JEAF 5EL9A 4LOMA 4O04A 2Z5BB 5IT9C 1IXMA 5BR8E 4MBCA 4HXZA 4AM3A 2BV3A 1N33E 4XCLA 1Z59A 4DV3E 1TC0A 1ZM4A 2BR2A 4DV7E 1I5AA 3WU5A 2CGEA 2BU6A 4X65I 4JQLA 1AMWA 2XX2A 2WI7A 1HNWE 5D7DA 3OWDA 4LWFA 1IBLI 4AWQA 4R1FA 3ZXOA 4GKKE 3CRLA 2IWUA 3A0TA 1B62A 1EA6A 3CDIA 5K36D 3EHJA 3EHGA 4FCQA 4DU7A 3LPSA 3T1YE 4ASBA 2PNZB 2F4VE 2NN6C 4JYAE 3Q5LA 4MP2A 1XMOI 2Z5CA 4DUZE 2AJ4A 2WI1A 3ZKDA 1FKAE 1MX0A 3DGEA 4EEHA 3J81C 2BU2A 2YJXA 3HULA 3H80A 3NZKA 1OJ4A 3Q5JA 4I3HA 2VWCA 2HKEA 4MU1A 3TZ5A 4OX9E 1N32I 4FWHA 4B3TI 1UYKA 3GIGA 2E0AA 1A4HA 1YT1A 4JASA 4KP4A 5EKWA 4JI8I 1GKXA 3EKOA 2YEDA 1HK7A 2BM1A 1UDQA 4LF9E 4XIRA 1N36I 2E5LE 2Q8GA 1NHHA 4K4OA 4O09A 2XX4A 1UY6A 4GFNA 2C37A 3T0HA 1US7A 4JI2E 1ID0A 3INXA 4X62E 4DR4E 2ZDXA 1I59A 4DUHA 4IFDC 3TZ2A 1J5EE 1TILA 2UXBI 1Z5CA 3GCMA 1H72C 3K17A 2ZM6I 1IBKI 4YY3I 4GT8A 4LF6E 2HK3A 3T1HE 3A0YA 2YEHA 5DRRA 2XDKA 4E72A 1Y6ZA 3A0WA 3CWVA 1S16A 5GMDA 4LWHA 2AE8A 3VHAA 4E01A 5K36E 2YGFA 4YKRA 3U2DA 1E3PA 4ISAA 3WU4A 4DV4I 2CCTA 3QDDA 4JI4I 4LCGA 2O3ZA 2IERA 3JAMC 1H74A 1Y4SA 2Q8HA 2OI2A 1AH8A 3J7AM 2PNZA 2BSMA 1XNRI 4NH8A 2XD6A 3FT8A 2X7IA 4LFAI 2C2AA 5M4PA 2GO4A 4JI1I 3A0RA 5FLXQ 3B28A 1S14A 1RR9A 2PO1B 4O07A 1USVA 1I58A 1HR0I 2YE5A 1XMOE 4B7PA 1R6LA 1QY8A 3J80Q 3Q1QA 2XDSA 2VQFE 1UYLA 4CWTA 4Z7YA 1XNQE 4CWFA 2XDUA 5C0XF 5JEAC 1YC3A 1DARA 2YK9A 2XX5A 1FJGI 5LMUE 2ZDYA 3MNRP 3SL2A 3T10A 4CWOA 5M4KA 2BA1D 1F51A 2XJGA 4LF5E 3BM9A 1FWLA 2J7KA 1KZNA 4JI1E 4FWDA 4P52A 1R6MA 4YKQA 4DV0E 3HEKA 4HZ0A 2NN6E 5M4MA 3CRKA 4AIDA 2HHIA 4ASFA 4LFCI 2WERA 4OO1A 4JI3E 4JI5I 4J3DA 1YSRA 2CCUA 1YERA 2QG0A 2E5LI 3KE6A 3O0IA 4AS9A 4CE3A 2EXLA 1GKZA 2YI7A 5ELWA 4OO1E 3U67A 1Z0CA 2GFDA 4B3SE 1UDSA 5LMUI 4Q20A 4NBQA 4K0KI 4BAEA 3GIGB 5C0XB 1ZWHA 4U7OA 4EGHA 4DR1E 2BA1G 2XHXA 3TZ0A 4LF6I 2Q8FA 1THNA 2XJJA 1EI1A 2BYIA 4ASAA 1I5CA 3D36A 1USUA 4H85A 4JI0I 1VISA 2YE3A 2WI5A 4OZEA 4DV6E 5FLXC 4X65E 3R4MA 2K5BA 4DR4I 1Z0GA 3RKZA 2VCIA 1HNXI 2HK2A 1J5EI 3G7BA 4MPCA 2YKJA 2VESA 4FWGA 5DROA 4FN5A 2WEQA 2JEBA 3J80C 2BZ5A 1Y60A 4DR2I 2BYHA 4CE1A 3GONA 3H1CA 2PO2A 3B24A 3H4LA 5F3KA 3Q6MA 3O2FA 1IBME 1ZW9A 4NXMI 4XITA 4JG4A 4HXWA 4HACB 1U2RA 5D6PA 4JV5E 2V2ZA 2YKIA 1U0ZA 2PO0B 1UYCA 3B4TA 4GGLA 2BT0A 5J71A 4L94A 3A0XA 4IFDB 3M85G 2C38A 2VF3A 2ESAA 3D4JA 1UDOA 3WU6A 3VADA 3B25A 2Q8IA 3QT6A 4XE2A 2C37B 4LPFA 2AKPA 4MU0A 1I5BA 2FXSA 4NXNE 3K98A 3PEHA 1Z0VA 4IFDA 4FW3A 1N33I 4DV0I 4ED4A 4AQYE
chains in the Genus database with same CATH topology
1D6TA 4YKUA 3T1HI 2CG9A 4UT4A 4XKKA 3EHHA 2UU9I 4DR6I 3T1YI 3HZ1A 4PL9A 5IDMA 3R92A 4XDMA 2O1VA 3WHAA 1KVKA 4IZKB 4X64E 3RLPA 3IEDA 2UWDA 1Z0TA 4BIZA 3CGZA 1UYFA 3T0ZA 2V2VA 4CE2A 1WUUA 1UY7A 2YE9A 3P06A 4E02A 4JI0E 2QG2A 4OX9I 1N32E 2YE6A 3OMUA 4L91A 4DR3E 5A2QQ 3QTFA 1PKPA 2UU9E 4MP7A 2IOQA 5D7RA 2VQEI 5C93A 1N34E 4LF9I 4L8ZA 3PYGA 4B3RI 2O1UA 2BU8A 3QT7A 4DZYA 2IOPA 4H7QA 3VHCA 1UYGA 2IWSA 2JKIA 3K60A 3R4NA 1YSZA 1FJGE 2O1WA 3FT5A 4EGIA 3TZ4A 5F5RA 4O05A 4B3ME 3ZZ0A 4KHPE 4JI8E 4L90A 3NMQA 4DV3I 3G75A 5LMNE 2Q2EB 3ZZTA 2VQFI 2O1TA 2H55A 2Z5BA 3ZM7A 4DV1E 5IT9Q 4R3AA 4KFGA 4HYPA 2DEJA 4DR7I 2R42A 1HNWI 4DUYE 4LF4I 4NXME 4LP0A 5M4EA 1Y4UA 4HY6A 1PIEA 4YKZA 3JAMQ 4GKJI 1TH8A 2E1RA 1IBKE 4MPEA 2XABA 4MB9A 2YGEA 4P8OA 4B3MI 4URLA 2YE2A 5CTXA 3ZKBA 3HJCA 2VCJA 3B82A 2JJCA 5CPHA 2Z5CB 4JYAI 2WI2A 1QYEA 4X9LA 1ZXNA 4EFUA 4DUZI 1PVGA 4LF8I 1KIJA 2VW5A 4LPBA 4JI7E 4K0KE 3J81Q 4LFBE 4DUYI 4LF4E 1A6FA 4HACA 5BOCA 2WW4A 1YC1A 3G7EA 4UTGA 1AM1A 3B26A 2UUAI 4YKWA 4FCPA 5IN9A 2UUCI 2CZ9A 1UYIA 2WEPA 4R3MA 2YKBA 4XTJA 2BM0A 1N36E 4DR3I 4ZVIA 4I5SA 4X64I 2H8MA 4JI3I 3FV5A 2UXCI 4DV5E 2YI6A 1BKNA 4DXLA 3QT8A 2BREA 3C0EA 3B8HA 4MOTA 3EKRA 5L3JA 4ASGA 3D2RA 2LJPA 2IWXA 1UY9A 2EFGA 2GS8A 3M6AA 1ZM2A 4LFCE 3B78A 1N34I 2XEXA 2UUBE 4EM7A 2YEJA 4Z7CA 4V25A 1H7SA 1S4EA 4GQTA 4DV6I 1YESA 2UXCE 2FYPA 2XDXA 4P7AA 4DPXA 4JI4E 1TBWA 1YS3A 1NZ0A 4FMTA 1Z0BA 4NH7A 4GKJE 1HNZE 3J7AG 2WI4A 4B6CA 1I94E 2YEAA 3O6OA 4QPKA 3T1KA 4DPYA 1TIDA 4USMA 3CGYA 2YEEA 3GIFA 5J6AA 1NHIA 2HKJA 2YEGA 5IDJA 4JV5I 4EFTA 4YKYA 4PRVA 1N0VC 1AH6A 4URMA 2HHHE 1K47A 2YK2A 2V2QA 4DV2E 2YI0A 4L93A 4BQGA 5CTUA 3OWBA 1IBMI 4YY3E 1L0OA 2XDLA 5CF0A 2NPFA 1U2OA 2CGFA 4DU8A 2YEIA 3K85A 4O0BA 5GMEA 4NXNI 3ZXQA 2WI3A 4CWNA 1BGQA 2ZITA 4DR5I 2UXDI 4CWSA 5IWAI 4XC0A 4YHHE 4CWRA 4LF7I 3ZZUA 3TUHA 4XIQA 3GIEA 4KSHA 2YECA 4DV2I 2UUCE 4DPWA 4DR1I 3Q5KA 4X66E 5LMNI 3RLQA 2HFUA 3PEJA 3F0NA 3V5RA 1MG7A 3QT5A 5BR8I 2YKCA 2X36A 4JAUA 2XHRA 4DR5E 5FNCA 3K97A 1Z0EA 2Z5EA 4JI6I 3A0ZA 3T2SA 1RREA 1ZM9A 4WUBA 4XKOA 4U93A 3LNUA 1ZM3A 4IZJA 4BIUA 4E00A 4B3TE 1FNMA 4JI7I 2QFOA 1YT0A 4LF5I 5FWKA 4N3OA 4USKA 1HNZI 2YE7A 4JAVA 4HY1A 2PNRA 1IBLE 4PRXA 4MYUA 4U7NA 3OPDA 2YE4A 1QZRA 4BQJA 4H81A 3HYZA 3RLRA 1Y8NA 4IZJD 4GEEA 3PYFA 3K99A 2VQEE 4MYTA 2F4VI 1N0UA 3V2UC 5CTYA 4CWQA 4KSGA 2PNMA 4B3SI 2XJXA 4KTNA 5D6QA 2HHHI 4UROA 1Z5AA 2CH4A 4GKKI 4DV1I 4XIPA 3HZ5A 4URNA 2QF6A 2ZKJA 4FW9A 2BRCA 1XNRE 4LWEA 4XKAA 1Y8OA 1XMQI 4LFAE 4EMDA 2GQ0A 3JZ3A 5BODA 2BTZA 1I5DA 2BU5A 3VHDA 5GGZA 1BYQA 4XCJA 3R91A 1TC6A 5FNFA 1Y8PA 2V8PA 2YI5A 5D7CA 1B63A 1HR0E 4PU9A 4FPPA 4DV5I 4V26A 5M4HA 2YEBA 3EHFA 1B3QA 2FWYA 4IZKA 5M4NA 2XCMA 2XHTA 2GQPA 2YGAA 4LFBI 3PYDA 3HYYA 4YKTA 4FCRA 5LL6R 1NHJA 2UXBE 1H7UA 3C11A 3K1JA 4NH9A 2ZM6E 4DPUA 1FI4A 1FWKA 5IWAE 1UYMA 4CWPA 4LF7E 2XK2A 4RPFA 4YKXA 4X62I 1R62A 1YETA 3D0BA 1H73A 2YJWA 4LF8E 1Z5BA 2HG1A 1UYEA 2WI6A 4W7TA 4ZKIA 2A2CA 3PRYA 2YKEA 4QPJA 4WUDA 4AWOA 4X66I 1UYHA 2UUAE 2HFSA 1GJVA 3OTOI 3OW6A 4JI5E 4EGKA 4KQVA 1ELOA 3TTZA 4AQYI 3R4OA 4KHPI 4M1KA 4JI6E 2YE8A 2A2DA 4DPTA 1YC4A 3B27A 3BMYA 4DV4E 4XD8A 4DR6E 2HCHA 1HNXE 1UY8A 3R4PA 1ZXMA 1BXDA 3PYEA 2DEIA 2UUBI 3Q6NA 2UXDE 2R3VA 1KKHA 5FNDA 4DR2E 4DR7E 4HZ5A 2ZBKB 2PNLA 4JI2I 1XNQI 1YT2A 4WUCA 3OTOE 4MPNA 2V34A 1XMQE 1KTVA 1XHKA 2FWZA 1UYDA 3WQ9A 4BXIA 1OSFA 4LWGA 3WU3A 5CTWA 1I94I 4YHHI 1AJ6A 3HHUA 2CCSA 4DV7I 2BU7A 4HYMA 1UEKA 3U2KA 4AWPA 4B3RE 2IORA 1Z0WA 4GCZA 2YEFA 1JM6A 1MU5A 4IZJB 3INWA 3LTOA 5A2QC 4LWIA 4O04A 2Z5BB 5IT9C 5BR8E 4MBCA 4HXZA 2BV3A 1N33E 4XCLA 1Z59A 4DV3E 1TC0A 1ZM4A 4DV7E 1I5AA 3WU5A 2CGEA 2BU6A 4X65I 4JQLA 1AMWA 2XX2A 2WI7A 1HNWE 5D7DA 3OWDA 4LWFA 1IBLI 4AWQA 4R1FA 3ZXOA 4GKKE 3CRLA 2IWUA 3A0TA 1B62A 1EA6A 3EHJA 3EHGA 4FCQA 4DU7A 3LPSA 3T1YE 4ASBA 2F4VE 4JYAE 3Q5LA 4MP2A 1XMOI 2Z5CA 4DUZE 2AJ4A 2WI1A 3ZKDA 1FKAE 1MX0A 3DGEA 4EEHA 3J81C 2BU2A 2YJXA 3HULA 3H80A 1OJ4A 3Q5JA 4I3HA 2VWCA 2HKEA 3TZ5A 4OX9E 1N32I 4FWHA 4B3TI 1UYKA 3GIGA 2E0AA 1A4HA 1YT1A 4JASA 4KP4A 4JI8I 1GKXA 3EKOA 2YEDA 1HK7A 2BM1A 4LF9E 4XIRA 1N36I 2E5LE 2Q8GA 1NHHA 4K4OA 4O09A 2XX4A 1UY6A 4GFNA 3T0HA 1US7A 4JI2E 1ID0A 3INXA 4X62E 4DR4E 2ZDXA 1I59A 4DUHA 3TZ2A 1J5EE 1TILA 2UXBI 1Z5CA 1H72C 3K17A 2ZM6I 1IBKI 4YY3I 4GT8A 4LF6E 2HK3A 3T1HE 3A0YA 2YEHA 2XDKA 1Y6ZA 3A0WA 3CWVA 1S16A 5GMDA 4LWHA 3VHAA 4E01A 2YGFA 3U2DA 4YKRA 3WU4A 4DV4I 2CCTA 3QDDA 4JI4I 3JAMC 1H74A 1Y4SA 2Q8HA 2OI2A 1AH8A 3J7AM 4NH8A 2BSMA 1XNRI 2XD6A 3FT8A 2X7IA 4LFAI 2C2AA 5M4PA 4JI1I 3A0RA 5FLXQ 3B28A 1S14A 1RR9A 4O07A 1USVA 1I58A 1HR0I 2YE5A 1XMOE 4B7PA 4CWTA 1QY8A 3J80Q 3Q1QA 2XDSA 2VQFE 1UYLA 4Z7YA 1XNQE 4CWFA 2XDUA 4EMVA 1YC3A 2YK9A 1DARA 3MNRP 2XX5A 1FJGI 5LMUE 2ZDYA 3SL2A 3T10A 4CWOA 5M4KA 2XJGA 4LF5E 3BM9A 1FWLA 2J7KA 1KZNA 4JI1E 4FWDA 4P52A 4YKQA 4DV0E 3HEKA 4HZ0A 5M4MA 3CRKA 4ASFA 4LFCI 2WERA 4JI3E 4JI5I 1YSRA 2QG0A 2CCUA 1YERA 3KE6A 2E5LI 3O0IA 4AS9A 4CE3A 2EXLA 1GKZA 2YI7A 3U67A 1Z0CA 2GFDA 4B3SE 5LMUI 4Q20A 4K0KI 4BAEA 3GIGB 1ZWHA 4U7OA 4EGHA 4DR1E 2XHXA 3TZ0A 4LF6I 2Q8FA 1THNA 2XJJA 1EI1A 2BYIA 4ASAA 1I5CA 3D36A 1USUA 4H85A 4JI0I 1VISA 2YE3A 2WI5A 4DV6E 5FLXC 4X65E 3R4MA 2K5BA 4DR4I 1Z0GA 3RKZA 2VCIA 1HNXI 2HK2A 1J5EI 3G7BA 4MPCA 2YKJA 4FWGA 2WEQA 4FN5A 3J80C 2BZ5A 4DR2I 2BYHA 4CE1A 3GONA 3B24A 3H4LA 5F3KA 3Q6MA 3O2FA 1IBME 1ZW9A 4NXMI 4XITA 4JG4A 4HXWA 4HACB 1U2RA 5D6PA 4JV5E 2V2ZA 2YKIA 1U0ZA 1UYCA 4GGLA 2BT0A 5J71A 4L94A 3A0XA 2VF3A 2ESAA 3D4JA 3WU6A 3VADA 3B25A 2Q8IA 3QT6A 4XE2A 2AKPA 1I5BA 2FXSA 4NXNE 3K98A 3PEHA 1Z0VA 1N33I 4DV0I 4ED4A 4AQYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D6T A;  4YKU A;  3T1H I;  2CG9 A;  4UT4 A;  4XKK A;  3EHH A;  2UU9 I;  4DR6 I;  3T1Y I;  3HZ1 A;  4PL9 A;  5IDM A;  3R92 A;  4XDM A;  2O1V A;  3WHA A;  1KVK A;  4X64 E;  3RLP A;  3IED A;  2UWD A;  1Z0T A;  4BIZ A;  3CGZ A;  1UYF A;  3T0Z A;  2V2V A;  4CE2 A;  1WUU A;  1UY7 A;  2YE9 A;  4E02 A;  4JI0 E;  2QG2 A;  4OX9 I;  1N32 E;  2YE6 A;  3OMU A;  4L91 A;  4DR3 E;  5A2Q Q;  3QTF A;  1PKP A;  2UU9 E;  4MP7 A;  2IOQ A;  5D7R A;  2VQE I;  5C93 A;  1N34 E;  4LF9 I;  4L8Z A;  3PYG A;  4B3R I;  2O1U A;  2BU8 A;  3QT7 A;  4DZY A;  2IOP A;  4H7Q A;  3VHC A;  1UYG A;  2IWS A;  2JKI A;  3K60 A;  3R4N A;  1YSZ A;  1FJG E;  2O1W A;  3FT5 A;  4EGI A;  3TZ4 A;  5F5R A;  4O05 A;  4B3M E;  3ZZ0 A;  4KHP E;  4JI8 E;  4L90 A;  3NMQ A;  4DV3 I;  3G75 A;  5LMN E;  2Q2E B;  3ZZT A;  2VQF I;  2H55 A;  3ZM7 A;  4DV1 E;  5IT9 Q;  4R3A A;  4KFG A;  4HYP A;  2DEJ A;  4DR7 I;  2R42 A;  1HNW I;  4LF4 I;  4DUY E;  4NXM E;  4LP0 A;  5M4E A;  1Y4U A;  4HY6 A;  1PIE A;  4YKZ A;  3JAM Q;  4GKJ I;  1TH8 A;  2E1R A;  1IBK E;  4MPE A;  2XAB A;  4MB9 A;  2YGE A;  4P8O A;  4B3M I;  4URL A;  2YE2 A;  5CTX A;  3ZKB A;  2VCJ A;  3B82 A;  2JJC A;  5CPH A;  4JYA I;  2WI2 A;  1QYE A;  4X9L A;  1ZXN A;  4EFU A;  4DUZ I;  1PVG A;  4LF8 I;  1KIJ A;  2VW5 A;  4LPB A;  4JI7 E;  4K0K E;  3J81 Q;  4LFB E;  4DUY I;  4LF4 E;  1A6F A;  4HAC A;  5BOC A;  2WW4 A;  1YC1 A;  3G7E A;  4UTG A;  1AM1 A;  3B26 A;  2UUA I;  4YKW A;  4FCP A;  5IN9 A;  2UUC I;  2CZ9 A;  1UYI A;  2WEP A;  4R3M A;  2YKB A;  4XTJ A;  2BM0 A;  1N36 E;  4DR3 I;  4ZVI A;  4I5S A;  4X64 I;  2H8M A;  4JI3 I;  3FV5 A;  2UXC I;  4DV5 E;  2YI6 A;  1BKN A;  4DXL A;  3QT8 A;  2BRE A;  3C0E A;  3B8H A;  4MOT A;  3EKR A;  5L3J A;  4ASG A;  3D2R A;  2LJP A;  2IWX A;  1UY9 A;  2EFG A;  2GS8 A;  3M6A A;  1ZM2 A;  4LFC E;  3B78 A;  1N34 I;  2XEX A;  2UUB E;  4EM7 A;  2YEJ A;  4Z7C A;  4V25 A;  1H7S A;  1S4E A;  4GQT A;  4DV6 I;  1YES A;  2UXC E;  2FYP A;  2XDX A;  4P7A A;  4DPX A;  4JI4 E;  1TBW A;  1YS3 A;  1NZ0 A;  4FMT A;  1Z0B A;  4NH7 A;  4GKJ E;  1HNZ E;  3J7A G;  2WI4 A;  4B6C A;  1I94 E;  2YEA A;  3O6O A;  4QPK A;  3T1K A;  4DPY A;  1TID A;  4USM A;  3CGY A;  2YEE A;  3GIF A;  5J6A A;  1NHI A;  2HKJ A;  2YEG A;  5IDJ A;  4JV5 I;  4EFT A;  4YKY A;  4PRV A;  1N0V C;  1AH6 A;  4URM A;  2HHH E;  1K47 A;  2YK2 A;  2V2Q A;  4DV2 E;  2YI0 A;  4L93 A;  4BQG A;  5CTU A;  3OWB A;  1IBM I;  4YY3 E;  1L0O A;  2XDL A;  5CF0 A;  2NPF A;  1U2O A;  2CGF A;  4DU8 A;  2YEI A;  4O0B A;  5GME A;  4NXN I;  3ZXQ A;  2WI3 A;  4CWN A;  1BGQ A;  2ZIT A;  4DR5 I;  2UXD I;  4CWS A;  5IWA I;  4XC0 A;  4YHH E;  4CWR A;  4LF7 I;  3ZZU A;  3TUH A;  4XIQ A;  3GIE A;  4KSH A;  2YEC A;  4DV2 I;  2UUC E;  4DPW A;  4DR1 I;  3Q5K A;  4X66 E;  5LMN I;  3RLQ A;  2HFU A;  3PEJ A;  3F0N A;  3V5R A;  1MG7 A;  3QT5 A;  5BR8 I;  2YKC A;  2X36 A;  4JAU A;  2XHR A;  4DR5 E;  5FNC A;  3K97 A;  1Z0E A;  4JI6 I;  3A0Z A;  3T2S A;  1RRE A;  1ZM9 A;  4WUB A;  4XKO A;  4U93 A;  3LNU A;  1ZM3 A;  4E00 A;  4BIU A;  4B3T E;  1FNM A;  4JI7 I;  2QFO A;  1YT0 A;  4LF5 I;  5FWK A;  4USK A;  1HNZ I;  2YE7 A;  4JAV A;  4HY1 A;  2PNR A;  1IBL E;  4PRX A;  4MYU A;  4U7N A;  3OPD A;  2YE4 A;  1QZR A;  4BQJ A;  4H81 A;  3HYZ A;  3RLR A;  1Y8N A;  4GEE A;  3PYF A;  3K99 A;  2VQE E;  4MYT A;  2F4V I;  1N0U A;  3V2U C;  5CTY A;  4CWQ A;  4KSG A;  4B3S I;  2XJX A;  4KTN A;  5D6Q A;  2HHH I;  4URO A;  1Z5A A;  2CH4 A;  4GKK I;  4DV1 I;  4XIP A;  3HZ5 A;  4URN A;  2QF6 A;  2ZKJ A;  4FW9 A;  2BRC A;  1XNR E;  4LWE A;  4XKA A;  1Y8O A;  1XMQ I;  4LFA E;  4EMD A;  3JZ3 A;  5BOD A;  2BTZ A;  1I5D A;  2BU5 A;  3VHD A;  5GGZ A;  1BYQ A;  4XCJ A;  3R91 A;  1TC6 A;  5FNF A;  1Y8P A;  2V8P A;  2YI5 A;  5D7C A;  1B63 A;  1HR0 E;  4PU9 A;  4FPP A;  4DV5 I;  4V26 A;  5M4H A;  2YEB A;  3EHF A;  1B3Q A;  2FWY A;  5M4N A;  2XCM A;  2XHT A;  2GQP A;  2YGA A;  4LFB I;  3PYD A;  3HYY A;  4YKT A;  4FCR A;  5LL6 R;  1NHJ A;  2UXB E;  1H7U A;  3C11 A;  3K1J A;  4NH9 A;  2ZM6 E;  4DPU A;  1FI4 A;  1FWK A;  5IWA E;  1UYM A;  4CWP A;  4LF7 E;  2XK2 A;  4RPF A;  4YKX A;  4X62 I;  1R62 A;  1YET A;  3D0B A;  1H73 A;  2YJW A;  4LF8 E;  1Z5B A;  2HG1 A;  1UYE A;  2WI6 A;  4W7T A;  4ZKI A;  2A2C A;  2YKE A;  4QPJ A;  4WUD A;  4AWO A;  4X66 I;  1UYH A;  2UUA E;  2HFS A;  1GJV A;  3OTO I;  3OW6 A;  4JI5 E;  4EGK A;  4KQV A;  1ELO A;  3TTZ A;  4AQY I;  3R4O A;  4KHP I;  4M1K A;  4JI6 E;  2YE8 A;  2A2D A;  4DPT A;  1YC4 A;  3B27 A;  3BMY A;  4DV4 E;  4XD8 A;  4DR6 E;  2HCH A;  1HNX E;  1UY8 A;  3R4P A;  1ZXM A;  1BXD A;  3PYE A;  2DEI A;  2UUB I;  2UXD E;  2R3V A;  1KKH A;  5FND A;  4DR2 E;  4DR7 E;  4HZ5 A;  2ZBK B;  4JI2 I;  1XNQ I;  1YT2 A;  4WUC A;  3OTO E;  4MPN A;  2V34 A;  1XMQ E;  1KTV A;  1XHK A;  2FWZ A;  1UYD A;  3WQ9 A;  4BXI A;  1OSF A;  4LWG A;  3WU3 A;  5CTW A;  1I94 I;  4YHH I;  1AJ6 A;  3HHU A;  2CCS A;  4DV7 I;  2BU7 A;  4HYM A;  1UEK A;  3U2K A;  4AWP A;  4B3R E;  2IOR A;  1Z0W A;  4GCZ A;  2YEF A;  1JM6 A;  1MU5 A;  3INW A;  3LTO A;  5A2Q C;  4LWI A;  4O04 A;  5IT9 C;  5BR8 E;  4MBC A;  4HXZ A;  2BV3 A;  1N33 E;  4XCL A;  1Z59 A;  4DV3 E;  1TC0 A;  1ZM4 A;  4DV7 E;  1I5A A;  3WU5 A;  2BU6 A;  4X65 I;  4JQL A;  1AMW A;  2XX2 A;  2WI7 A;  1HNW E;  5D7D A;  3OWD A;  4LWF A;  1IBL I;  4AWQ A;  4R1F A;  3ZXO A;  4GKK E;  3CRL A;  2IWU A;  3A0T A;  1B62 A;  1EA6 A;  3EHJ A;  3EHG A;  4FCQ A;  4DU7 A;  3LPS A;  3T1Y E;  4ASB A;  2F4V E;  4JYA E;  3Q5L A;  4MP2 A;  1XMO I;  4DUZ E;  2AJ4 A;  2WI1 A;  3ZKD A;  1FKA E;  1MX0 A;  3DGE A;  4EEH A;  3J81 C;  2BU2 A;  2YJX A;  3HUL A;  3H80 A;  1OJ4 A;  3Q5J A;  4I3H A;  2VWC A;  2HKE A;  3TZ5 A;  4OX9 E;  1N32 I;  4FWH A;  4B3T I;  1UYK A;  3GIG A;  2E0A A;  1A4H A;  1YT1 A;  4JAS A;  4KP4 A;  4JI8 I;  1GKX A;  3EKO A;  2YED A;  2BM1 A;  4LF9 E;  4XIR A;  1N36 I;  2E5L E;  2Q8G A;  1NHH A;  4K4O A;  4O09 A;  2XX4 A;  1UY6 A;  4GFN A;  3T0H A;  1US7 A;  4JI2 E;  1ID0 A;  3INX A;  4X62 E;  4DR4 E;  2ZDX A;  1I59 A;  4DUH A;  3TZ2 A;  1J5E E;  1TIL A;  2UXB I;  1Z5C A;  1H72 C;  3K17 A;  2ZM6 I;  1IBK I;  4YY3 I;  4GT8 A;  4LF6 E;  2HK3 A;  3T1H E;  3A0Y A;  2YEH A;  2XDK A;  3A0W A;  3CWV A;  1S16 A;  5GMD A;  4LWH A;  3VHA A;  4E01 A;  2YGF A;  3U2D A;  4YKR A;  3WU4 A;  4DV4 I;  2CCT A;  3QDD A;  4JI4 I;  3JAM C;  1H74 A;  1Y4S A;  2Q8H A;  2OI2 A;  1AH8 A;  3J7A M;  4NH8 A;  2BSM A;  1XNR I;  2XD6 A;  3FT8 A;  2X7I A;  4LFA I;  2C2A A;  5M4P A;  4JI1 I;  3A0R A;  5FLX Q;  3B28 A;  1S14 A;  1RR9 A;  4O07 A;  1I58 A;  1HR0 I;  2YE5 A;  1XMO E;  4B7P A;  4CWT A;  1QY8 A;  3J80 Q;  3Q1Q A;  2XDS A;  2VQF E;  1UYL A;  4Z7Y A;  1XNQ E;  4CWF A;  2XDU A;  4EMV A;  1YC3 A;  2YK9 A;  1DAR A;  3MNR P;  2XX5 A;  1FJG I;  5LMU E;  2ZDY A;  3SL2 A;  3T10 A;  4CWO A;  5M4K A;  2XJG A;  4LF5 E;  3BM9 A;  1FWL A;  2J7K A;  1KZN A;  4JI1 E;  4FWD A;  4P52 A;  4YKQ A;  4DV0 E;  3HEK A;  4HZ0 A;  5M4M A;  3CRK A;  4ASF A;  4LFC I;  2WER A;  4JI3 E;  4JI5 I;  1YSR A;  2QG0 A;  2CCU A;  1YER A;  3KE6 A;  2E5L I;  3O0I A;  4AS9 A;  4CE3 A;  2EXL A;  1GKZ A;  2YI7 A;  3U67 A;  1Z0C A;  2GFD A;  4B3S E;  5LMU I;  4Q20 A;  4K0K I;  4BAE A;  3GIG B;  1ZWH A;  4U7O A;  4EGH A;  4DR1 E;  2XHX A;  3TZ0 A;  4LF6 I;  2Q8F A;  1THN A;  2XJJ A;  1EI1 A;  2BYI A;  4ASA A;  1I5C A;  3D36 A;  4H85 A;  4JI0 I;  1VIS A;  2YE3 A;  2WI5 A;  4DV6 E;  5FLX C;  4X65 E;  3R4M A;  2K5B A;  4DR4 I;  1Z0G A;  3RKZ A;  2VCI A;  1HNX I;  2HK2 A;  1J5E I;  3G7B A;  4MPC A;  2YKJ A;  4FWG A;  2WEQ A;  4FN5 A;  3J80 C;  2BZ5 A;  4DR2 I;  2BYH A;  4CE1 A;  3GON A;  3B24 A;  3H4L A;  5F3K A;  3O2F A;  1IBM E;  1ZW9 A;  4NXM I;  4XIT A;  4JG4 A;  4HXW A;  4HAC B;  1U2R A;  5D6P A;  4JV5 E;  2V2Z A;  2YKI A;  1U0Z A;  1UYC A;  4GGL A;  2BT0 A;  5J71 A;  4L94 A;  3A0X A;  2VF3 A;  2ESA A;  3D4J A;  3WU6 A;  3VAD A;  3B25 A;  2Q8I A;  3QT6 A;  4XE2 A;  2AKP A;  1I5B A;  2FXS A;  4NXN E;  3K98 A;  3PEH A;  1Z0V A;  1N33 I;  4DV0 I;  4ED4 A;  4AQY E; 
#chains in the Genus database with same CATH topology
 1D6T A;  4YKU A;  5DRQ A;  3T1H I;  2CG9 A;  4UT4 A;  3P3G A;  4XKK A;  3EHH A;  2UU9 I;  4DR6 I;  5JEA E;  3T1Y I;  3HZ1 A;  4PL9 A;  5IDM A;  3R92 A;  4XDM A;  2O1V A;  3WHA A;  2BA0 G;  1KVK A;  4IZK B;  4X64 E;  3L7Z A;  3IED A;  3RLP A;  2UWD A;  1Z0T A;  4BIZ A;  3P3E A;  3CGZ A;  1UYF A;  2JEA A;  3T0Z A;  2V2V A;  5C0X C;  4CE2 A;  1WUU A;  2PO0 A;  1UY7 A;  2YE9 A;  3P06 A;  4E02 A;  4JI0 E;  4GQU A;  2QG2 A;  4OX9 I;  1N32 E;  2YE6 A;  3OMU A;  4L91 A;  4DR3 E;  5A2Q Q;  3QTF A;  1PKP A;  2UU9 E;  4MP7 A;  2IOQ A;  5D7R A;  2VQE I;  5C93 A;  5C0X E;  1N34 E;  4LF9 I;  4L8Z A;  3PYG A;  4B3R I;  2O1U A;  2BU8 A;  3QT7 A;  4DZY A;  2IOP A;  4H7Q A;  3VHC A;  1UYG A;  4IFD E;  2IWS A;  2JKI A;  3K60 A;  3R4N A;  1YSZ A;  1FJG E;  2O1W A;  3FT5 A;  4EGI A;  3TZ4 A;  2CVE A;  5F5R A;  4O05 A;  1E3H A;  4B3M E;  3ZZ0 A;  4KHP E;  4JI8 E;  4L90 A;  3NMQ A;  5DNL A;  4DV3 I;  3G75 A;  5LMN E;  2Q2E B;  3ZZT A;  2VQF I;  2O1T A;  2H55 A;  2Z5B A;  1Y5Y A;  3ZM7 A;  5DNX A;  4QNJ A;  4DV1 E;  5IT9 Q;  4R3A A;  4KFG A;  4HYP A;  2DEJ A;  4DR7 I;  2R42 A;  1HNW I;  4DUY E;  4LF4 I;  4NXM E;  4LP0 A;  5M4E A;  1Y4U A;  4HY6 A;  1PIE A;  4YKZ A;  3JAM Q;  4GKJ I;  1TH8 A;  2E1R A;  1IBK E;  4MPE A;  2XAB A;  4MB9 A;  2J65 A;  3UHM A;  2YGE A;  4P8O A;  4B3M I;  4URL A;  5C0X D;  2YE2 A;  3ZKB A;  5CTX A;  3HJC A;  2VCJ A;  3B82 A;  2JJC A;  5CPH A;  2Z5C B;  4JYA I;  2WI2 A;  1QYE A;  4FW5 A;  1ZXN A;  4BA1 B;  4DUZ I;  1PVG A;  4X9L A;  4EFU A;  4LF8 I;  1KIJ A;  2VW5 A;  4LPB A;  4JI7 E;  4K0K E;  3J81 Q;  4U3B A;  3DD6 A;  4LFB E;  4DUY I;  4LF4 E;  5K36 F;  1A6F A;  4HAC A;  5BOC A;  2WW4 A;  2C1I A;  1YC1 A;  4U3D A;  3G7E A;  4UTG A;  2PO1 A;  1AM1 A;  4FW6 A;  3B26 A;  2UUA I;  4YKW A;  4FCP A;  5IN9 A;  2UUC I;  2CZ9 A;  1UYI A;  2WEP A;  4R3M A;  2YKB A;  4XTJ A;  4BA2 B;  2BM0 A;  4OO1 D;  1N36 E;  4DR3 I;  4ZVI A;  4I5S A;  4X64 I;  3L7Z B;  4LCF A;  2H8M A;  4JI3 I;  3FV5 A;  2UXC I;  1UDN A;  5K36 A;  4OO1 C;  2BR2 B;  4DV5 E;  2YI6 A;  1BKN A;  4DXL A;  3QT8 A;  1VI7 A;  1YH8 A;  3B8H A;  2BRE A;  3C0E A;  5L3J A;  3EKR A;  4MOT A;  4ASG A;  5JEN A;  3D2R A;  3KRN A;  2LJP A;  2IWX A;  1UY9 A;  3U1Y A;  2EFG A;  4IFD F;  2GS8 A;  3M6A A;  1ZM2 A;  4LFC E;  3B78 A;  1N34 I;  2XEX A;  2UUB E;  4EM7 A;  2YEJ A;  4Z7C A;  4V25 A;  1H7S A;  1S4E A;  4GQT A;  2NN6 B;  4DV6 I;  1YES A;  2UXC E;  3M7N D;  2FYP A;  2XDX A;  4P7A A;  4DPX A;  3CDJ A;  4JI4 E;  1TBW A;  1YS3 A;  2C38 B;  1NZ0 A;  4OO1 F;  4FMT A;  1Z0B A;  2NN6 A;  5K36 B;  4GKJ E;  4NH7 A;  1HNZ E;  3J7A G;  2WI4 A;  4B6C A;  1I94 E;  2YEA A;  3O6O A;  4QPK A;  5K36 C;  3T1K A;  4DPY A;  1TID A;  4USM A;  3CGY A;  2YEE A;  3GIF A;  5J6A A;  3P76 A;  1NHI A;  2HKJ A;  2YEG A;  5IDJ A;  4JV5 I;  4EFT A;  4YKY A;  4PRV A;  1N0V C;  1AH6 A;  4QNK A;  4URM A;  2HHH E;  1K47 A;  3PS1 A;  2V2Q A;  4DV2 E;  2YI0 A;  2YK2 A;  4L93 A;  4BQG A;  5CTU A;  1OYR A;  2JE6 A;  3OWB A;  1IBM I;  4YY3 E;  1L0O A;  2XDL A;  5CF0 A;  2NPF A;  4AIM A;  1U2O A;  2CGF A;  4DU8 A;  2YEI A;  3K85 A;  4O0B A;  3M85 D;  5GME A;  4NXN I;  3PS3 A;  3PS2 A;  2WI3 A;  3ZXQ A;  3S5T A;  4CWN A;  5JEA D;  2ZIT A;  4DR5 I;  2UXD I;  1BGQ A;  2NN6 D;  2WP8 A;  4CWS A;  5IWA I;  4XC0 A;  4YHH E;  4CWR A;  4LF7 I;  3ZZU A;  3TUH A;  4XIQ A;  3GIE A;  2JEA B;  4KSH A;  2YEC A;  4DV2 I;  2UUC E;  4DPW A;  4DR1 I;  5DRP A;  3Q5K A;  4X66 E;  5LMN I;  3RLQ A;  2HFU A;  3PEJ A;  3F0N A;  3V5R A;  1MG7 A;  3QT5 A;  5BR8 I;  2YKC A;  2X36 A;  4JAU A;  2XHR A;  4DR5 E;  5FNC A;  3K97 A;  5JEA B;  1Z0E A;  2Z5E A;  4JI6 I;  3GME A;  3A0Z A;  4MQY A;  3T2S A;  1RRE A;  1ZM9 A;  2C39 B;  4WUB A;  1OYS A;  4XKO A;  4U93 A;  3LNU A;  3U1K A;  1ZM3 A;  4IZJ A;  4BIU A;  4E00 A;  4B3T E;  1FNM A;  4JI7 I;  2QFO A;  1YT0 A;  4LF5 I;  5FWK A;  4N3O A;  4USK A;  1HNZ I;  3M7N G;  2YE7 A;  4HY1 A;  2PNR A;  4JAV A;  1IBL E;  4PRX A;  4MYU A;  4OKG A;  4IS9 A;  4U7N A;  2WNR B;  2YE4 A;  3OPD A;  1QZR A;  4BQJ A;  4H81 A;  3HYZ A;  3RLR A;  1Y8N A;  2PO2 B;  4IZJ D;  4GEE A;  3PYF A;  3K99 A;  2JEB B;  2VQE E;  2JE6 B;  4MYT A;  4IFD D;  2F4V I;  1N0U A;  3V2U C;  5CTY A;  4CWQ A;  4BA2 A;  4KSG A;  2PNM A;  2WNR A;  4B3S I;  2XJX A;  4KTN A;  5D6Q A;  2HHH I;  4URO A;  1Z5A A;  2CH4 A;  4GKK I;  4DV1 I;  4XIP A;  3HZ5 A;  3CYG A;  4URN A;  2QF6 A;  2ZKJ A;  4FW9 A;  2BRC A;  1XNR E;  4LWE A;  4XKA A;  1Y8O A;  1XMQ I;  4LFA E;  4EMD A;  2GQ0 A;  3HKM A;  3JZ3 A;  5BOD A;  2BTZ A;  1I5D A;  5C0X A;  2BU5 A;  3VHD A;  5GGZ A;  4FW4 A;  1BYQ A;  4MU3 A;  4XCJ A;  1TC6 A;  3R91 A;  5FNF A;  1Y8P A;  2V8P A;  2YI5 A;  5D7C A;  1B63 A;  4LCH A;  4PU9 A;  1HR0 E;  4FPP A;  4BA1 A;  4DV5 I;  4V26 A;  5M4H A;  2YEB A;  3EHF A;  1B3Q A;  2FWY A;  4MU4 A;  4IZK A;  5M4N A;  2XCM A;  2XHT A;  2GQP A;  2YGA A;  4LFB I;  3PYD A;  3HYY A;  4YKT A;  4FCR A;  5LL6 R;  1XXE A;  1NHJ A;  2NN6 F;  1H7U A;  2UXB E;  3C11 A;  2C39 A;  3K1J A;  4NH9 A;  2ZM6 E;  4DPU A;  1FI4 A;  1FWK A;  3P3C A;  5IWA E;  1UYM A;  4EMV A;  4CWP A;  5JEA A;  4LF7 E;  2XK2 A;  4RPF A;  4YKX A;  4X62 I;  4OO1 B;  1R62 A;  1YET A;  3D0B A;  1H73 A;  2YJW A;  3GLL A;  4LF8 E;  1Z5B A;  2HG1 A;  1UYE A;  2WI6 A;  4W7T A;  4ZKI A;  2WP8 B;  2A2C A;  3PRY A;  2YKE A;  4QPJ A;  4WUD A;  4AWO A;  4X66 I;  1UYH A;  2UUA E;  2HFS A;  1GJV A;  3OTO I;  3OW6 A;  4JI5 E;  4EGK A;  1P42 A;  4KQV A;  1ELO A;  2GO3 A;  3TTZ A;  4AQY I;  3R4O A;  4KHP I;  4M1K A;  4JI6 E;  2YE8 A;  2A2D A;  4DPT A;  1YC4 A;  3B27 A;  3BMY A;  4DV4 E;  4XD8 A;  4DR6 E;  2HCH A;  1HNX E;  1UY8 A;  3R4P A;  1ZXM A;  1BXD A;  3PYE A;  2DEI A;  2UUB I;  3Q6N A;  2UXD E;  2R3V A;  1KKH A;  5FND A;  4DR2 E;  4DR7 E;  3LMM A;  4HZ5 A;  2IES A;  2ZBK B;  2BA0 D;  1YHC A;  2PNL A;  4JI2 I;  4MDT A;  2F1D A;  1XNQ I;  1YT2 A;  2C1G A;  4WUC A;  3OTO E;  4MPN A;  2V34 A;  1XMQ E;  1KTV A;  1XHK A;  2FWZ A;  1UYD A;  3WQ9 A;  4BXI A;  1OSF A;  4LWG A;  4FW7 A;  3WU3 A;  1OYP A;  5CTW A;  1RHY A;  1I94 I;  4YHH I;  1AJ6 A;  3HHU A;  2CCS A;  4DV7 I;  2FTK A;  2BU7 A;  4HYM A;  1UEK A;  3U2K A;  2JT2 A;  4AWP A;  4B3R E;  2IOR A;  1Z0W A;  4GCZ A;  2YEF A;  1JM6 A;  1MU5 A;  4IZJ B;  3INW A;  3LTO A;  5A2Q C;  4LWI A;  5JEA F;  5EL9 A;  4LOM A;  4O04 A;  2Z5B B;  5IT9 C;  1IXM A;  5BR8 E;  4MBC A;  4HXZ A;  4AM3 A;  2BV3 A;  1N33 E;  4XCL A;  1Z59 A;  4DV3 E;  1TC0 A;  1ZM4 A;  2BR2 A;  4DV7 E;  1I5A A;  3WU5 A;  2CGE A;  2BU6 A;  4X65 I;  4JQL A;  1AMW A;  2XX2 A;  2WI7 A;  1HNW E;  5D7D A;  3OWD A;  4LWF A;  1IBL I;  4AWQ A;  4R1F A;  3ZXO A;  4GKK E;  3CRL A;  2IWU A;  3A0T A;  1B62 A;  1EA6 A;  3CDI A;  5K36 D;  3EHJ A;  3EHG A;  4FCQ A;  4DU7 A;  3LPS A;  3T1Y E;  4ASB A;  2PNZ B;  2F4V E;  2NN6 C;  4JYA E;  3Q5L A;  4MP2 A;  1XMO I;  2Z5C A;  4DUZ E;  2AJ4 A;  2WI1 A;  3ZKD A;  1FKA E;  1MX0 A;  3DGE A;  4EEH A;  3J81 C;  2BU2 A;  2YJX A;  3HUL A;  3H80 A;  3NZK A;  1OJ4 A;  3Q5J A;  4I3H A;  2VWC A;  2HKE A;  4MU1 A;  3TZ5 A;  4OX9 E;  1N32 I;  4FWH A;  4B3T I;  1UYK A;  3GIG A;  2E0A A;  1A4H A;  1YT1 A;  4JAS A;  4KP4 A;  5EKW A;  4JI8 I;  1GKX A;  3EKO A;  2YED A;  1HK7 A;  2BM1 A;  1UDQ A;  4LF9 E;  4XIR A;  1N36 I;  2E5L E;  2Q8G A;  1NHH A;  4K4O A;  4O09 A;  2XX4 A;  1UY6 A;  4GFN A;  2C37 A;  3T0H A;  1US7 A;  4JI2 E;  1ID0 A;  3INX A;  4X62 E;  4DR4 E;  2ZDX A;  1I59 A;  4DUH A;  4IFD C;  3TZ2 A;  1J5E E;  1TIL A;  2UXB I;  1Z5C A;  3GCM A;  1H72 C;  3K17 A;  2ZM6 I;  1IBK I;  4YY3 I;  4GT8 A;  4LF6 E;  2HK3 A;  3T1H E;  3A0Y A;  2YEH A;  5DRR A;  2XDK A;  4E72 A;  1Y6Z A;  3A0W A;  3CWV A;  1S16 A;  5GMD A;  4LWH A;  2AE8 A;  3VHA A;  4E01 A;  5K36 E;  2YGF A;  4YKR A;  3U2D A;  1E3P A;  4ISA A;  3WU4 A;  4DV4 I;  2CCT A;  3QDD A;  4JI4 I;  4LCG A;  2O3Z A;  2IER A;  3JAM C;  1H74 A;  1Y4S A;  2Q8H A;  2OI2 A;  1AH8 A;  3J7A M;  2PNZ A;  2BSM A;  1XNR I;  4NH8 A;  2XD6 A;  3FT8 A;  2X7I A;  4LFA I;  2C2A A;  5M4P A;  2GO4 A;  4JI1 I;  3A0R A;  5FLX Q;  3B28 A;  1S14 A;  1RR9 A;  2PO1 B;  4O07 A;  1USV A;  1I58 A;  1HR0 I;  2YE5 A;  1XMO E;  4B7P A;  1R6L A;  1QY8 A;  3J80 Q;  3Q1Q A;  2XDS A;  2VQF E;  1UYL A;  4CWT A;  4Z7Y A;  1XNQ E;  4CWF A;  2XDU A;  5C0X F;  5JEA C;  1YC3 A;  1DAR A;  2YK9 A;  2XX5 A;  1FJG I;  5LMU E;  2ZDY A;  3MNR P;  3SL2 A;  3T10 A;  4CWO A;  5M4K A;  2BA1 D;  1F51 A;  2XJG A;  4LF5 E;  3BM9 A;  1FWL A;  2J7K A;  1KZN A;  4JI1 E;  4FWD A;  4P52 A;  1R6M A;  4YKQ A;  4DV0 E;  3HEK A;  4HZ0 A;  2NN6 E;  5M4M A;  3CRK A;  4AID A;  2HHI A;  4ASF A;  4LFC I;  2WER A;  4OO1 A;  4JI3 E;  4JI5 I;  4J3D A;  1YSR A;  2CCU A;  1YER A;  2QG0 A;  2E5L I;  3KE6 A;  3O0I A;  4AS9 A;  4CE3 A;  2EXL A;  1GKZ A;  2YI7 A;  5ELW A;  4OO1 E;  3U67 A;  1Z0C A;  2GFD A;  4B3S E;  1UDS A;  5LMU I;  4Q20 A;  4NBQ A;  4K0K I;  4BAE A;  3GIG B;  5C0X B;  1ZWH A;  4U7O A;  4EGH A;  4DR1 E;  2BA1 G;  2XHX A;  3TZ0 A;  4LF6 I;  2Q8F A;  1THN A;  2XJJ A;  1EI1 A;  2BYI A;  4ASA A;  1I5C A;  3D36 A;  1USU A;  4H85 A;  4JI0 I;  1VIS A;  2YE3 A;  2WI5 A;  4OZE A;  4DV6 E;  5FLX C;  4X65 E;  3R4M A;  2K5B A;  4DR4 I;  1Z0G A;  3RKZ A;  2VCI A;  1HNX I;  2HK2 A;  1J5E I;  3G7B A;  4MPC A;  2YKJ A;  2VES A;  4FWG A;  5DRO A;  4FN5 A;  2WEQ A;  2JEB A;  3J80 C;  2BZ5 A;  1Y60 A;  4DR2 I;  2BYH A;  4CE1 A;  3GON A;  3H1C A;  2PO2 A;  3B24 A;  3H4L A;  5F3K A;  3Q6M A;  3O2F A;  1IBM E;  1ZW9 A;  4NXM I;  4XIT A;  4JG4 A;  4HXW A;  4HAC B;  1U2R A;  5D6P A;  4JV5 E;  2V2Z A;  2YKI A;  1U0Z A;  2PO0 B;  1UYC A;  3B4T A;  4GGL A;  2BT0 A;  5J71 A;  4L94 A;  3A0X A;  4IFD B;  3M85 G;  2C38 A;  2VF3 A;  2ESA A;  3D4J A;  1UDO A;  3WU6 A;  3VAD A;  3B25 A;  2Q8I A;  3QT6 A;  4XE2 A;  2C37 B;  4LPF A;  2AKP A;  4MU0 A;  1I5B A;  2FXS A;  4NXN E;  3K98 A;  3PEH A;  1Z0V A;  4IFD A;  4FW3 A;  1N33 I;  4DV0 I;  4ED4 A;  4AQY E; 
#chains in the Genus database with same CATH homology
 1D6T A;  4YKU A;  3T1H I;  2CG9 A;  4UT4 A;  4XKK A;  3EHH A;  2UU9 I;  4DR6 I;  3T1Y I;  3HZ1 A;  4PL9 A;  5IDM A;  3R92 A;  4XDM A;  2O1V A;  3WHA A;  1KVK A;  4IZK B;  4X64 E;  3RLP A;  3IED A;  2UWD A;  1Z0T A;  4BIZ A;  3CGZ A;  1UYF A;  3T0Z A;  2V2V A;  4CE2 A;  1WUU A;  1UY7 A;  2YE9 A;  3P06 A;  4E02 A;  4JI0 E;  2QG2 A;  4OX9 I;  1N32 E;  2YE6 A;  3OMU A;  4L91 A;  4DR3 E;  5A2Q Q;  3QTF A;  1PKP A;  2UU9 E;  4MP7 A;  2IOQ A;  5D7R A;  2VQE I;  5C93 A;  1N34 E;  4LF9 I;  4L8Z A;  3PYG A;  4B3R I;  2O1U A;  2BU8 A;  3QT7 A;  4DZY A;  2IOP A;  4H7Q A;  3VHC A;  1UYG A;  2IWS A;  2JKI A;  3K60 A;  3R4N A;  1YSZ A;  1FJG E;  2O1W A;  3FT5 A;  4EGI A;  3TZ4 A;  5F5R A;  4O05 A;  4B3M E;  3ZZ0 A;  4KHP E;  4JI8 E;  4L90 A;  3NMQ A;  4DV3 I;  3G75 A;  5LMN E;  2Q2E B;  3ZZT A;  2VQF I;  2O1T A;  2H55 A;  2Z5B A;  3ZM7 A;  4DV1 E;  5IT9 Q;  4R3A A;  4KFG A;  4HYP A;  2DEJ A;  4DR7 I;  2R42 A;  1HNW I;  4DUY E;  4LF4 I;  4NXM E;  4LP0 A;  5M4E A;  1Y4U A;  4HY6 A;  1PIE A;  4YKZ A;  3JAM Q;  4GKJ I;  1TH8 A;  2E1R A;  1IBK E;  4MPE A;  2XAB A;  4MB9 A;  2YGE A;  4P8O A;  4B3M I;  4URL A;  2YE2 A;  5CTX A;  3ZKB A;  3HJC A;  2VCJ A;  3B82 A;  2JJC A;  5CPH A;  2Z5C B;  4JYA I;  2WI2 A;  1QYE A;  4X9L A;  1ZXN A;  4EFU A;  4DUZ I;  1PVG A;  4LF8 I;  1KIJ A;  2VW5 A;  4LPB A;  4JI7 E;  4K0K E;  3J81 Q;  4LFB E;  4DUY I;  4LF4 E;  1A6F A;  4HAC A;  5BOC A;  2WW4 A;  1YC1 A;  3G7E A;  4UTG A;  1AM1 A;  3B26 A;  2UUA I;  4YKW A;  4FCP A;  5IN9 A;  2UUC I;  2CZ9 A;  1UYI A;  2WEP A;  4R3M A;  2YKB A;  4XTJ A;  2BM0 A;  1N36 E;  4DR3 I;  4ZVI A;  4I5S A;  4X64 I;  2H8M A;  4JI3 I;  3FV5 A;  2UXC I;  4DV5 E;  2YI6 A;  1BKN A;  4DXL A;  3QT8 A;  2BRE A;  3C0E A;  3B8H A;  4MOT A;  3EKR A;  5L3J A;  4ASG A;  3D2R A;  2LJP A;  2IWX A;  1UY9 A;  2EFG A;  2GS8 A;  3M6A A;  1ZM2 A;  4LFC E;  3B78 A;  1N34 I;  2XEX A;  2UUB E;  4EM7 A;  2YEJ A;  4Z7C A;  4V25 A;  1H7S A;  1S4E A;  4GQT A;  4DV6 I;  1YES A;  2UXC E;  2FYP A;  2XDX A;  4P7A A;  4DPX A;  4JI4 E;  1TBW A;  1YS3 A;  1NZ0 A;  4FMT A;  1Z0B A;  4NH7 A;  4GKJ E;  1HNZ E;  3J7A G;  2WI4 A;  4B6C A;  1I94 E;  2YEA A;  3O6O A;  4QPK A;  3T1K A;  4DPY A;  1TID A;  4USM A;  3CGY A;  2YEE A;  3GIF A;  5J6A A;  1NHI A;  2HKJ A;  2YEG A;  5IDJ A;  4JV5 I;  4EFT A;  4YKY A;  4PRV A;  1N0V C;  1AH6 A;  4URM A;  2HHH E;  1K47 A;  2YK2 A;  2V2Q A;  4DV2 E;  2YI0 A;  4L93 A;  4BQG A;  5CTU A;  3OWB A;  1IBM I;  4YY3 E;  1L0O A;  2XDL A;  5CF0 A;  2NPF A;  1U2O A;  2CGF A;  4DU8 A;  2YEI A;  3K85 A;  4O0B A;  5GME A;  4NXN I;  3ZXQ A;  2WI3 A;  4CWN A;  1BGQ A;  2ZIT A;  4DR5 I;  2UXD I;  4CWS A;  5IWA I;  4XC0 A;  4YHH E;  4CWR A;  4LF7 I;  3ZZU A;  3TUH A;  4XIQ A;  3GIE A;  4KSH A;  2YEC A;  4DV2 I;  2UUC E;  4DPW A;  4DR1 I;  3Q5K A;  4X66 E;  5LMN I;  3RLQ A;  2HFU A;  3PEJ A;  3F0N A;  3V5R A;  1MG7 A;  3QT5 A;  5BR8 I;  2YKC A;  2X36 A;  4JAU A;  2XHR A;  4DR5 E;  5FNC A;  3K97 A;  1Z0E A;  2Z5E A;  4JI6 I;  3A0Z A;  3T2S A;  1RRE A;  1ZM9 A;  4WUB A;  4XKO A;  4U93 A;  3LNU A;  1ZM3 A;  4IZJ A;  4BIU A;  4E00 A;  4B3T E;  1FNM A;  4JI7 I;  2QFO A;  1YT0 A;  4LF5 I;  5FWK A;  4N3O A;  4USK A;  1HNZ I;  2YE7 A;  4JAV A;  4HY1 A;  2PNR A;  1IBL E;  4PRX A;  4MYU A;  4U7N A;  3OPD A;  2YE4 A;  1QZR A;  4BQJ A;  4H81 A;  3HYZ A;  3RLR A;  1Y8N A;  4IZJ D;  4GEE A;  3PYF A;  3K99 A;  2VQE E;  4MYT A;  2F4V I;  1N0U A;  3V2U C;  5CTY A;  4CWQ A;  4KSG A;  2PNM A;  4B3S I;  2XJX A;  4KTN A;  5D6Q A;  2HHH I;  4URO A;  1Z5A A;  2CH4 A;  4GKK I;  4DV1 I;  4XIP A;  3HZ5 A;  4URN A;  2QF6 A;  2ZKJ A;  4FW9 A;  2BRC A;  1XNR E;  4LWE A;  4XKA A;  1Y8O A;  1XMQ I;  4LFA E;  4EMD A;  2GQ0 A;  3JZ3 A;  5BOD A;  2BTZ A;  1I5D A;  2BU5 A;  3VHD A;  5GGZ A;  1BYQ A;  4XCJ A;  3R91 A;  1TC6 A;  5FNF A;  1Y8P A;  2V8P A;  2YI5 A;  5D7C A;  1B63 A;  1HR0 E;  4PU9 A;  4FPP A;  4DV5 I;  4V26 A;  5M4H A;  2YEB A;  3EHF A;  1B3Q A;  2FWY A;  4IZK A;  5M4N A;  2XCM A;  2XHT A;  2GQP A;  2YGA A;  4LFB I;  3PYD A;  3HYY A;  4YKT A;  4FCR A;  5LL6 R;  1NHJ A;  2UXB E;  1H7U A;  3C11 A;  3K1J A;  4NH9 A;  2ZM6 E;  4DPU A;  1FI4 A;  1FWK A;  5IWA E;  1UYM A;  4CWP A;  4LF7 E;  2XK2 A;  4RPF A;  4YKX A;  4X62 I;  1R62 A;  1YET A;  3D0B A;  1H73 A;  2YJW A;  4LF8 E;  1Z5B A;  2HG1 A;  1UYE A;  2WI6 A;  4W7T A;  4ZKI A;  2A2C A;  3PRY A;  2YKE A;  4QPJ A;  4WUD A;  4AWO A;  4X66 I;  1UYH A;  2UUA E;  2HFS A;  1GJV A;  3OTO I;  3OW6 A;  4JI5 E;  4EGK A;  4KQV A;  1ELO A;  3TTZ A;  4AQY I;  3R4O A;  4KHP I;  4M1K A;  4JI6 E;  2YE8 A;  2A2D A;  4DPT A;  1YC4 A;  3B27 A;  3BMY A;  4DV4 E;  4XD8 A;  4DR6 E;  2HCH A;  1HNX E;  1UY8 A;  3R4P A;  1ZXM A;  1BXD A;  3PYE A;  2DEI A;  2UUB I;  3Q6N A;  2UXD E;  2R3V A;  1KKH A;  5FND A;  4DR2 E;  4DR7 E;  4HZ5 A;  2ZBK B;  2PNL A;  4JI2 I;  1XNQ I;  1YT2 A;  4WUC A;  3OTO E;  4MPN A;  2V34 A;  1XMQ E;  1KTV A;  1XHK A;  2FWZ A;  1UYD A;  3WQ9 A;  4BXI A;  1OSF A;  4LWG A;  3WU3 A;  5CTW A;  1I94 I;  4YHH I;  1AJ6 A;  3HHU A;  2CCS A;  4DV7 I;  2BU7 A;  4HYM A;  1UEK A;  3U2K A;  4AWP A;  4B3R E;  2IOR A;  1Z0W A;  4GCZ A;  2YEF A;  1JM6 A;  1MU5 A;  4IZJ B;  3INW A;  3LTO A;  5A2Q C;  4LWI A;  4O04 A;  2Z5B B;  5IT9 C;  5BR8 E;  4MBC A;  4HXZ A;  2BV3 A;  1N33 E;  4XCL A;  1Z59 A;  4DV3 E;  1TC0 A;  1ZM4 A;  4DV7 E;  1I5A A;  3WU5 A;  2CGE A;  2BU6 A;  4X65 I;  4JQL A;  1AMW A;  2XX2 A;  2WI7 A;  1HNW E;  5D7D A;  3OWD A;  4LWF A;  1IBL I;  4AWQ A;  4R1F A;  3ZXO A;  4GKK E;  3CRL A;  2IWU A;  3A0T A;  1B62 A;  1EA6 A;  3EHJ A;  3EHG A;  4FCQ A;  4DU7 A;  3LPS A;  3T1Y E;  4ASB A;  2F4V E;  4JYA E;  3Q5L A;  4MP2 A;  1XMO I;  2Z5C A;  4DUZ E;  2AJ4 A;  2WI1 A;  3ZKD A;  1FKA E;  1MX0 A;  3DGE A;  4EEH A;  3J81 C;  2BU2 A;  2YJX A;  3HUL A;  3H80 A;  1OJ4 A;  3Q5J A;  4I3H A;  2VWC A;  2HKE A;  3TZ5 A;  4OX9 E;  1N32 I;  4FWH A;  4B3T I;  1UYK A;  3GIG A;  2E0A A;  1A4H A;  1YT1 A;  4JAS A;  4KP4 A;  4JI8 I;  1GKX A;  3EKO A;  2YED A;  1HK7 A;  2BM1 A;  4LF9 E;  4XIR A;  1N36 I;  2E5L E;  2Q8G A;  1NHH A;  4K4O A;  4O09 A;  2XX4 A;  1UY6 A;  4GFN A;  3T0H A;  1US7 A;  4JI2 E;  1ID0 A;  3INX A;  4X62 E;  4DR4 E;  2ZDX A;  1I59 A;  4DUH A;  3TZ2 A;  1J5E E;  1TIL A;  2UXB I;  1Z5C A;  1H72 C;  3K17 A;  2ZM6 I;  1IBK I;  4YY3 I;  4GT8 A;  4LF6 E;  2HK3 A;  3T1H E;  3A0Y A;  2YEH A;  2XDK A;  1Y6Z A;  3A0W A;  3CWV A;  1S16 A;  5GMD A;  4LWH A;  3VHA A;  4E01 A;  2YGF A;  3U2D A;  4YKR A;  3WU4 A;  4DV4 I;  2CCT A;  3QDD A;  4JI4 I;  3JAM C;  1H74 A;  1Y4S A;  2Q8H A;  2OI2 A;  1AH8 A;  3J7A M;  4NH8 A;  2BSM A;  1XNR I;  2XD6 A;  3FT8 A;  2X7I A;  4LFA I;  2C2A A;  5M4P A;  4JI1 I;  3A0R A;  5FLX Q;  3B28 A;  1S14 A;  1RR9 A;  4O07 A;  1USV A;  1I58 A;  1HR0 I;  2YE5 A;  1XMO E;  4B7P A;  4CWT A;  1QY8 A;  3J80 Q;  3Q1Q A;  2XDS A;  2VQF E;  1UYL A;  4Z7Y A;  1XNQ E;  4CWF A;  2XDU A;  4EMV A;  1YC3 A;  2YK9 A;  1DAR A;  3MNR P;  2XX5 A;  1FJG I;  5LMU E;  2ZDY A;  3SL2 A;  3T10 A;  4CWO A;  5M4K A;  2XJG A;  4LF5 E;  3BM9 A;  1FWL A;  2J7K A;  1KZN A;  4JI1 E;  4FWD A;  4P52 A;  4YKQ A;  4DV0 E;  3HEK A;  4HZ0 A;  5M4M A;  3CRK A;  4ASF A;  4LFC I;  2WER A;  4JI3 E;  4JI5 I;  1YSR A;  2QG0 A;  2CCU A;  1YER A;  3KE6 A;  2E5L I;  3O0I A;  4AS9 A;  4CE3 A;  2EXL A;  1GKZ A;  2YI7 A;  3U67 A;  1Z0C A;  2GFD A;  4B3S E;  5LMU I;  4Q20 A;  4K0K I;  4BAE A;  3GIG B;  1ZWH A;  4U7O A;  4EGH A;  4DR1 E;  2XHX A;  3TZ0 A;  4LF6 I;  2Q8F A;  1THN A;  2XJJ A;  1EI1 A;  2BYI A;  4ASA A;  1I5C A;  3D36 A;  1USU A;  4H85 A;  4JI0 I;  1VIS A;  2YE3 A;  2WI5 A;  4DV6 E;  5FLX C;  4X65 E;  3R4M A;  2K5B A;  4DR4 I;  1Z0G A;  3RKZ A;  2VCI A;  1HNX I;  2HK2 A;  1J5E I;  3G7B A;  4MPC A;  2YKJ A;  4FWG A;  2WEQ A;  4FN5 A;  3J80 C;  2BZ5 A;  4DR2 I;  2BYH A;  4CE1 A;  3GON A;  3B24 A;  3H4L A;  5F3K A;  3Q6M A;  3O2F A;  1IBM E;  1ZW9 A;  4NXM I;  4XIT A;  4JG4 A;  4HXW A;  4HAC B;  1U2R A;  5D6P A;  4JV5 E;  2V2Z A;  2YKI A;  1U0Z A;  1UYC A;  4GGL A;  2BT0 A;  5J71 A;  4L94 A;  3A0X A;  2VF3 A;  2ESA A;  3D4J A;  3WU6 A;  3VAD A;  3B25 A;  2Q8I A;  3QT6 A;  4XE2 A;  2AKP A;  1I5B A;  2FXS A;  4NXN E;  3K98 A;  3PEH A;  1Z0V A;  1N33 I;  4DV0 I;  4ED4 A;  4AQY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...