1PVGA

Crystal structure of the atpase region of saccharomyces cerevisiae topoisomerase ii
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
400
structure length
378
Chain Sequence
SASDKYQKISQLEHILKRPDTYIGSVETQEQLQWIYDEETDCMIEKNVTIVPGLFKIFDEILVNAADNKVRDPSMKRIDVNIHAEEHTIEVKNDGKGIPIEIHNKENIYIPEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILETADLNVGQKYVQKWENNMSICHPPKITSYKKGPSYTKVTFKPDLTRFGMKELDNDILGVMRRRVYDINGSVRDINVYLNGKSLKIRNFKNYVELYLKSLIPTILYERINNRWEVAFAVSDISFQQISFVNSIATTMGGTHVNYITDQIVKKISEILKKVKSFQIKNNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCEIPLEYINKIMKTDLATRMFEIADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords DNA topoisomerase II
publication title Structure of the topoisomerase II ATPase region and its mechanism of inhibition by the chemotherapeutic agent ICRF-187
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 113
structure length 378
sequence length 400
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2003-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1pvgA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1pvgA01
4V25A 4HYMA 2CH4A 3M6AA 1R62A 5IT9Q 1Z59A 4KSGA 1XNQE 4O09A 1UY9A 1ZW9A 1Y8NA 2AKPA 4URLA 3A0ZA 3JAMC 2XCMA 4JI4E 1UYHA 4FWDA 2PNRA 4HYPA 3ZXOA 4MOTA 4DPUA 3EKRA 2WW4A 2YE4A 3RKZA 5C93A 5LMNI 1I94I 3J7AM 1UYCA 2K5BA 3TUHA 1Y8OA 3EKOA 4OX9E 4GKKI 2WI7A 4EFTA 1Z0CA 4E00A 4LFCI 1U2OA 4B3TI 3B27A 1H74A 4KHPE 3EHHA 3HZ5A 3INXA 5L3JA 1TC6A 3GIGB 4GQTA 5D7CA 2H55A 1AH6A 3FV5A 4Z7YA 3B24A 4K4OA 1TIDA 4YKWA 3RLPA 1N36I 5M4HA 2ZDYA 3PYGA 4DUZI 2X7IA 4DUYI 4NH8A 5FLXQ 4XD8A 4URMA 4NH9A 4JI2I 3VHAA 1U2RA 2V2QA 2VCJA 1UYMA 3J81C 1IBLE 1HNZE 1YC3A 2C2AA 5BR8E 2XHRA 1PVGA 3ZXQA 3ZZ0A 1TILA 2WI5A 1ELOA 5IT9C 4MPNA 3R91A 4LFAI 3OPDA 3TZ5A 4DV4I 2QF6A 2XHXA 3G7EA 5D7RA 4U7OA 1B3QA 3PYFA 2UXCI 3GIFA 1D6TA 4O0BA 3T2SA 4FN5A 2IOQA 4HY6A 3A0YA 3WHAA 3KE6A 1ZXMA 4CWNA 1YSZA 2GQPA 1BXDA 2YEEA 1GJVA 5IDMA 1ZM2A 2IORA 4AWPA 5LMNE 1I94E 2XD6A 4LFBI 1N32I 1YERA 1QZRA 1KZNA 4GKKE 2BU7A 2YE7A 4H7QA 5M4PA 3WU5A 4BXIA 4DV1I 4LFCE 2UXDI 1YC1A 3T10A 1HNWI 2EXLA 1ZM4A 2VQFI 2OI2A 5FLXC 1I5CA 4MP2A 3PYDA 4QPKA 2Q8IA 4CWOA 4L91A 5F5RA 4FW9A 3R92A 1N36E 3PEJA 2CG9A 2GS8A 1XNQI 2F4VE 4DUZE 1U0ZA 4DV2E 4DUYE 4LF6I 2YE8A 2YK9A 4FMTA 1N33I 2HHHI 2YGFA 4HACA 2YEIA 3B28A 4MPCA 4Q20A 4GT8A 5D6QA 4EGKA 4HXZA 3JZ3A 4DU7A 5BODA 3JAMQ 4MB9A 4LFAE 4I5SA 2WEPA 4H81A 4Z7CA 4DV4E 2CGFA 2YE3A 1EA6A 2CZ9A 2WEQA 3R4NA 4AS9A 4PRVA 3C0EA 1EI1A 2UXCE 1UY7A 3HYYA 4JI8I 2A2CA 3QT6A 1IBMI 4P8OA 4X62I 4R3MA 2XHTA 1YC4A 5A2QQ 1I59A 1Z0TA 2QFOA 2ZKJA 4EFUA 4ASGA 4CE2A 2YE6A 3WQ9A 4KP4A 2LJPA 1N32E 4FCPA 3VHDA 1HNZI 3OWBA 4LWGA 3T1KA 3K17A 4BAEA 4DV1E 4O05A 4NXMI 2UXDE 4X66E 1HR0I 2UUCE 4DV3I 1I5BA 1ZWHA 3Q5JA 2VQFE 1AM1A 1I58A 2AJ4A 4BIUA 2H8MA 1UEKA 3OW6A 3BM9A 2YI7A 3V5RA 4MYUA 4DU8A 4XIPA 5CF0A 3GONA 4USKA 3OTOE 4LF6E 2BYHA 2VQEI 3K60A 4JI6E 4WUBA 2HG1A 1N33E 2HHHE 1WUUA 2BT0A 4AWOA 4CE1A 1AH8A 2UUAI 4GFNA 3R4MA 2ZM6I 4DPYA 2WI3A 1FNMA 4E01A 2YEAA 3CWVA 2E5LE 4ASAA 3D4JA 3ZKDA 5M4EA 2O1UA 2BV3A 4YHHI 2Q2EB 2UU9I 2ESAA 1YESA 2IOPA 2VCIA 4UTGA 5A2QC 4FCRA 2BREA 1H7SA 3R4OA 2E1RA 2YEHA 1S16A 1NZ0A 2NPFA 4PU9A 2XX4A 5F3KA 4JI8E 3LNUA 1IBME 2UXBI 3VADA 4X62E 2F4VI 3Q5KA 2DEIA 1Z0EA 4DV2I 1Z0GA 1THNA 2XX5A 2BYIA 4MBCA 2XABA 2JJCA 2FWZA 4CWPA 4DPXA 4P7AA 1HNXI 1UYFA 3PYEA 2VW5A 4WUCA 4PL9A 4B3RE 4XE2A 1KKHA 4EMDA 3QT5A 2J7KA 1Z5AA 4NXME 3IEDA 4U7NA 1HR0E 4DV3E 3A0RA 4RPFA 2E0AA 5CTXA 3RLRA 2FWYA 5CTWA 1FJGI 2BM1A 1Y4SA 4XKOA 2BU8A 3K98A 5FNDA 2YJXA 3HYZA 2YECA 2VQEE 1Z5CA 1GKZA 1TH8A 5M4KA 3WU3A 4JV5I 2UUAE 4JASA 4KSHA 3GIGA 2ZM6E 4YY3E 5IWAI 1YETA 3B82A 4X64I 2GFDA 2HK3A 4DR1E 4DR6I 4MYTA 4DV0I 5BOCA 2HFSA 4JI0I 4W7TA 2Q8GA 4ASFA 4YHHE 2CCSA 2YE9A 3EHFA 2BTZA 2UU9E 4DV7I 4X66I 1K47A 4DV6E 2UUCI 2BM0A 3V2UC 2WI2A 5D7DA 3B26A 2HFUA 4HY1A 1AMWA 3FT5A 2XEXA 2XJJA 1KVKA 2XDLA 3O0IA 4LWEA 3T0ZA 3TZ0A 4CWQA 2UXBE 1B62A 3A0TA 4LWFA 4FWHA 4NH7A 4KTNA 4AWQA 5LMUI 2O1VA 1UYEA 4GKJI 4GGLA 5M4MA 4ZVIA 3OTOI 1OSFA 2XJGA 2DEJA 4JI6I 3U2DA 4YKUA 1HNXE 4E02A 4DPTA 2YEFA 3G75A 2BU5A 2A2DA 1BGQA 4LF5I 1GKXA 2XDKA 2E5LI 1TBWA 4NXNI 4B3SI 5D6PA 3R4PA 3H80A 4JI5I 3INWA 1UYKA 4I3HA 2ZITA 4M1KA 4JG4A 2WI6A 3HEKA 1FJGE 3HZ1A 3FT8A 4B6CA 4LF8E 1RR9A 1PKPA 3RLQA 1A6FA 3Q5LA 4CWTA 4DR7I 5GMDA 2BU2A 4JV5E 1QYEA 4XIRA 3J7AG 4B3MI 2XJXA 5IWAE 4UROA 1VISA 4DR4I 3A0XA 4X64E 4DXLA 4DR6E 4DV0E 4JI0E 2V8PA 2BRCA 2FYPA 4B3RI 3T1YI 3ZM7A 2YEDA 1XNRI 2XDSA 4CWFA 3O6OA 4DV5I 4DV7E 4DR2E 5GMEA 1Y4UA 1XHKA 3Q1QA 2YGAA 2Q8HA 5CPHA 1N34I 2XK2A 4FCQA 1TC0A 2VF3A 2ZBKB 2XDUA 3ZZUA 5LMUE 2CCUA 1QY8A 2YK2A 4GKJE 4O04A 3T1HI 4FWGA 3LPSA 3J80C 4JI3I 3MNRP 3OMUA 1PIEA 5J71A 2UUBE 1H72C 4LF5E 4YY3I 4YKYA 5CTYA 4JI1I 4AQYI 3WU4A 2BSMA 3NMQA 4JQLA 4DR1I 2JKIA 3EHGA 3OWDA 2WI1A 2V2ZA 4B3SE 4NXNE 4LF9I 4EGHA 4GCZA 1NHJA 4JI5E 2YI0A 3D2RA 4DR5E 4DV6I 1H73A 5LL6R 4LF7I 4YKTA 4XDMA 2IWXA 4DZYA 4JI7E 1YSRA 3B78A 3CRKA 5GGZA 4XCLA 4EMVA 3U67A 3TTZA 4EGIA 4DR7E 1AJ6A 1IBKI 1NHHA 1UY6A 3TZ4A 1A4HA 4LWIA 3QT7A 4B3ME 1FWLA 1FKAE 2XDXA 4DR4E 2WI4A 5FNFA 4U93A 1H7UA 4DPWA 1NHIA 4DUHA 3ZZTA 2Q8FA 2YEBA 3K97A 3T1YE 4ZKIA 3K1JA 1XNRE 1YS3A 4DV5E 2R42A 3O2FA 4XKAA 1N34E 1YT2A 3D36A 4BQGA 4JYAI 1BYQA 1UYGA 4CE3A 2YKEA 4B7PA 3H4LA 4HZ0A 4LF8I 4LF4E 2QG0A 4XCJA 1J5EI 3ZKBA 3T1HE 1FI4A 3PEHA 3K99A 5CTUA 4X65E 1XMOI 4XC0A 4JI3E 4LP0A 2UWDA 4GEEA 1UYIA 2YEGA 3QDDA 4YKQA 1US7A 3EHJA 4BQJA 4AQYE 4JI1E 3D0BA 4CWRA 4JAUA 3F0NA 4LWHA 1KIJA 1XMQI 1I5DA 4MPEA 1FWKA 3BMYA 2HKJA 4HACB 4LF9E 2O1WA 3CRLA 2YI6A 4K0KI 2YKIA 3C11A 4O07A 1ZM3A 1B63A 4DR2I 2WERA 1YT1A 4PRXA 4WUDA 2HKEA 4HXWA 4LF7E 5FWKA 5IN9A 5J6AA 3CGZA 3QT8A 2HCHA 2R3VA 1S14A 2VWCA 1IBKE 1I5AA 4DR3I 1UYLA 2EFGA 2QG2A 2HK2A 1DARA 2YKBA 4L94A 3DGEA 2UUBI 2BZ5A 5M4NA 4CWSA 4H85A 4BIZA 4B3TE 4USMA 1RREA 4L90A 3J80Q 1ZXNA 4HZ5A 3WU6A 2X36A 4LPBA 2V2VA 1Y8PA 4JYAE 2CCTA 2FXSA 2YKJA 3G7BA 4DR5I 4XKKA 4JI7I 1OJ4A 4L93A 5FNCA 2YKCA 1ZM9A 3HHUA 1YT0A 4JI2E 1J5EE 4YKRA 4JI4I 4KQVA 4ED4A 1XMOE 1L0OA 2YEJA 2YGEA 3T0HA 3GIEA 4X9LA 4P52A 3QTFA 1MX0A 3TZ2A 1MU5A 4OX9I 4XIQA 1XMQE 3HULA 4EEHA 4XITA 1JM6A 1Z5BA 4K0KE 4KHPI 3SL2A 4R1FA 4KFGA 2V34A 3A0WA 4URNA 2YE5A 3CGYA 3U2KA 3LTOA 2YJWA 1Z0BA 1Z0VA 3B8HA 1MG7A 4DR3E 1S4EA 4LF4I 2YE2A 4UT4A 1UYDA 4YKZA 4FPPA 4LFBE 4MP7A 1UY8A 2IWUA 4EM7A 4X65I 2ZDXA 4XTJA 1IBLI 2BU6A 4R3AA 3B25A 5BR8I 4ASBA 2YI5A 3VHCA 2XX2A 1ID0A 1BKNA 4JAVA 4QPJA 1Z0WA 2IWSA 1N0UA 3J81Q 4L8ZA 1HNWE 1KTVA 4YKXA 5IDJA 4V26A 1N0VC
chains in the Genus database with same CATH superfamily
4V25A 4HYMA 2CH4A 3M6AA 1R62A 5IT9Q 1Z59A 4KSGA 1XNQE 4O09A 1UY9A 1ZW9A 1Y8NA 4FW6A 3P3EA 2AKPA 4URLA 3A0ZA 3JAMC 2XCMA 5JEAF 2BA0D 2JE6B 4JI4E 4FWDA 1UYHA 2PNRA 4HYPA 3ZXOA 4MOTA 4DPUA 3EKRA 2WW4A 2YE4A 3RKZA 5C93A 5LMNI 1I94I 1YHCA 3J7AM 3CDJA 3Q6MA 1UYCA 1UDSA 2K5BA 1Y8OA 3TUHA 4BA2A 4OX9E 3EKOA 4GKKI 2WI7A 4EFTA 1Z0CA 5K36B 2NN6A 4E00A 2JEAA 4LFCI 1U2OA 4B3TI 3B27A 1H74A 4KHPE 3EHHA 3HZ5A 4J3DA 3PS1A 5L3JA 1TC6A 3GIGB 3INXA 3DD6A 4GQTA 5D7CA 3CDIA 1AH6A 2H55A 3FV5A 4Z7YA 3B24A 4K4OA 1TIDA 4YKWA 3RLPA 1N36I 5M4HA 2ZDYA 3PYGA 4DUZI 2X7IA 2F1DA 4QNKA 2IERA 3KRNA 4DUYI 5DNLA 4NH8A 5FLXQ 2WNRA 4XD8A 4URMA 4NH9A 4JI2I 3VHAA 1U2RA 2V2QA 2VCJA 1UYMA 3J81C 3GLLA 1IBLE 1HNZE 1YC3A 2C2AA 5BR8E 2XHRA 1PVGA 3ZXQA 4IZJB 3ZZ0A 4BA1A 1TILA 2WI5A 1ELOA 5IT9C 4MPNA 3R91A 4LFAI 4OO1A 3OPDA 3TZ5A 4DV4I 2QF6A 2XHXA 2Z5CA 3G7EA 5D7RA 4U7OA 1B3QA 3PYFA 2UXCI 3GIFA 4NBQA 4OZEA 1D6TA 4O0BA 3T2SA 2IOQA 2JEBA 4FN5A 5EL9A 3M7ND 3A0YA 3KE6A 1ZXMA 2BR2B 1YSZA 2GQPA 1R6MA 3WHAA 4CWNA 1BXDA 2YEEA 2IESA 1GJVA 2VESA 1ZM2A 5IDMA 3P3GA 2IORA 5DRQA 5K36F 5LMNE 1I94E 2XD6A 4LFBI 4AWPA 1N32I 1YERA 1QZRA 1KZNA 4GKKE 2BU7A 2YE7A 4H7QA 5M4PA 3WU5A 4BXIA 3PS3A 2BA0G 4DV1I 4LFCE 2UXDI 1YC1A 1XXEA 3T10A 1HNWI 2EXLA 1ZM4A 2C38B 2OI2A 5JEAC 5FLXC 2VQFI 3PYDA 1I5CA 4LPFA 4MP2A 4QPKA 4L91A 2PNZB 2Q8IA 5F5RA 4FW9A 2WP8A 3R92A 1N36E 3PEJA 2CG9A 2GS8A 1XNQI 2F4VE 4DUZE 1U0ZA 4DV2E 4DUYE 4LF6I 1OYRA 2YE8A 2YK9A 4FMTA 2C39B 2HHHI 1N33I 2YGFA 4HACA 1YH8A 2YEIA 3B28A 4MPCA 4Q20A 4GT8A 2CVEA 5D6QA 4EGKA 3GMEA 4HXZA 3JZ3A 4DU7A 5BODA 3JAMQ 4MB9A 4LFAE 3L7ZA 4I5SA 2BR2A 2WEPA 4H81A 4Z7CA 5C0XF 4E72A 4DV4E 2CGFA 2YE3A 1EA6A 2CZ9A 2WEQA 3R4NA 4AS9A 4PRVA 2PNLA 2C1IA 3C0EA 1EI1A 2UXCE 1UY7A 3HYYA 4JI8I 2A2CA 3QT6A 1IBMI 4P8OA 4X62I 4R3MA 2XHTA 1USVA 1YC4A 5A2QQ 1I59A 1Z0TA 2QFOA 2ZKJA 4EFUA 4ASGA 4CE2A 2YE6A 3WQ9A 4KP4A 2LJPA 3GCMA 1N32E 4FCPA 3VHDA 3HKMA 1HNZI 3OWBA 4LWGA 3M7NG 3T1KA 2PO0A 3K17A 4BAEA 2CGEA 4DV1E 4O05A 4NXMI 2UXDE 4X66E 1HR0I 2UUCE 4DV3I 1I5BA 1ZWHA 3Q5JA 2VQFE 1AM1A 1I58A 2AJ4A 4BIUA 2H8MA 1UEKA 5JEAA 3OW6A 3BM9A 2YI7A 3V5RA 4MYUA 4DU8A 4XIPA 1UDOA 5CF0A 3GONA 4USKA 3OTOE 4LF6E 2BYHA 2VQEI 3K60A 4JI6E 4WUBA 2PO2A 1N33E 2HHHE 2HG1A 1WUUA 2BT0A 4AWOA 4CE1A 1AH8A 2UUAI 4GFNA 3R4MA 3M85D 2ZM6I 4DPYA 4LCFA 2WI3A 4ISAA 1FNMA 4E01A 2YEAA 3CWVA 2E5LE 4ASAA 2GQ0A 3D4JA 3ZKDA 5M4EA 2O1UA 2Z5BB 2BV3A 4YHHI 1IXMA 2Q2EB 4FW5A 2UU9I 2ESAA 1YESA 2IOPA 2VCIA 4UTGA 5A2QC 4FCRA 2BREA 1H7SA 4IS9A 3R4OA 2E1RA 2YEHA 1S16A 1NZ0A 2NPFA 4PU9A 2XX4A 5F3KA 4JI8E 3LNUA 1IBME 2UXBI 5K36D 3VADA 4X62E 2F4VI 3Q5KA 2DEIA 1Z0EA 4DV2I 1Z0GA 1THNA 2XX5A 2BYIA 4MBCA 2XABA 2JJCA 2FWZA 4IFDB 4CWPA 4DPXA 3LMMA 2PO1B 4P7AA 1HNXI 1UYFA 3PYEA 3HJCA 2VW5A 1HK7A 4HY6A 4WUCA 4PL9A 4B3RE 4XE2A 1KKHA 2BA1G 4EMDA 3QT5A 2J7KA 1Z5AA 4NXME 3IEDA 4U7NA 1HR0E 4DV3E 4IFDD 3A0RA 2NN6F 2JE6A 4RPFA 2E0AA 5CTXA 3RLRA 2FWYA 5C0XB 2PNMA 5K36E 1FJGI 5CTWA 4IZJD 2BM1A 1Y4SA 4XKOA 2BU8A 3K98A 5FNDA 2YJXA 3HYZA 2YECA 2VQEE 1Z5CA 5K36A 1GKZA 1TH8A 5M4KA 3WU3A 2AE8A 4JV5I 2UUAE 4JASA 4KSHA 2J65A 2C1GA 5C0XD 2GO4A 3GIGA 2ZM6E 4YY3E 5IWAI 3NZKA 4LCGA 1YETA 3B82A 4X64I 2GFDA 2HK3A 4DR1E 4DR6I 4MYTA 4DV0I 5BOCA 2HFSA 4JI0I 4W7TA 2Q8GA 4ASFA 4YHHE 2CCSA 2YE9A 3EHFA 2BTZA 2UU9E 4DV7I 4X66I 1K47A 4DV6E 2UUCI 2BM0A 2Z5EA 3V2UC 3M85G 2WI2A 5D7DA 3B26A 2HFUA 4HY1A 1AMWA 3FT5A 2XEXA 2XJJA 1KVKA 2XDLA 3O0IA 4LWEA 3T0ZA 3TZ0A 4CWQA 2UXBE 1B62A 3A0TA 4LWFA 4FWHA 4NH7A 4IFDF 4KTNA 2O1VA 4IZJA 5LMUI 4AWQA 1UYEA 4GKJI 4GGLA 5M4MA 4ZVIA 3OTOI 1OSFA 4OKGA 2XJGA 2DEJA 4JI6I 5C0XE 1Y5YA 4IZKB 3U2DA 4MDTA 4YKUA 1HNXE 1R6LA 4E02A 4DPTA 2YEFA 3G75A 2BU5A 2A2DA 1BGQA 4LF5I 1GKXA 2C37B 2XDKA 2E5LI 1TBWA 4NXNI 4B3SI 5D6PA 3R4PA 3H80A 4FW4A 4JI5I 3INWA 1UYKA 4I3HA 2ZITA 4M1KA 3PS2A 4JG4A 2WI6A 1USUA 3HEKA 1FJGE 3HZ1A 3FT8A 4B6CA 4LF8E 1RR9A 1PKPA 3RLQA 1A6FA 3Q5LA 4CWTA 4DR7I 5GMDA 2BU2A 2WERA 2BA1D 4JV5E 1QYEA 4XIRA 3J7AG 4B3MI 3P76A 2HHIA 2C38A 2XJXA 5IWAE 4UROA 1VISA 4DR4I 3A0XA 2PNZA 4X64E 4DXLA 4DR6E 4DV0E 4JI0E 2V8PA 2BRCA 2FYPA 4B3RI 3T1YI 3ZM7A 2YEDA 1XNRI 2XDSA 4CWFA 3O6OA 5JENA 4DV5I 4GQUA 2GO3A 1Y4UA 5GMEA 4DV7E 4DR2E 1XHKA 3Q1QA 1Y60A 2C39A 2YGAA 1N34I 2XK2A 4FCQA 5CPHA 2Q8HA 1TC0A 4BA2B 2VF3A 2ZBKB 2XDUA 2NN6B 3ZZUA 5LMUE 2JEAB 5K36C 4AIDA 1QY8A 2CCUA 2YK2A 4GKJE 4O04A 1UDNA 3T1HI 5DROA 4FWGA 5DRRA 3U1KA 3LPSA 3J80C 4JI3I 3MNRP 3OMUA 1PIEA 5J71A 2UUBE 1H72C 2NN6D 4LF5E 4YY3I 4YKYA 4MU0A 4JI1I 4AQYI 5CTYA 3P3CA 3WU4A 2BSMA 3NMQA 4JQLA 4DR1I 1VI7A 2WNRB 2JKIA 3H1CA 3EHGA 3OWDA 2WI1A 2V2ZA 4B3SE 4NXNE 4LF9I 4EGHA 4GCZA 1NHJA 4JI5E 2YI0A 1RHYA 3D2RA 4DR5E 4DV6I 1H73A 5LL6R 4LF7I 4YKTA 4XDMA 2IWXA 4DZYA 4JI7E 4BA1B 1YSRA 3B78A 3CRKA 5GGZA 4XCLA 4EMVA 3U67A 1UDQA 3TTZA 4OO1B 4EGIA 4DR7E 1AJ6A 1IBKI 4FW7A 2Z5CB 1NHHA 1UY6A 3TZ4A 1A4HA 2O3ZA 4LWIA 3QT7A 4B3ME 1FWLA 2NN6E 1FKAE 5C0XC 2XDXA 4DR4E 2WI4A 5FNFA 2JEBB 4OO1D 4U93A 1H7UA 4DPWA 1NHIA 4DUHA 3ZZTA 2Q8FA 2YEBA 3K97A 3T1YE 3B4TA 3K1JA 4MU1A 1XNRE 1YS3A 3CYGA 4ZKIA 4DV5E 2R42A 3O2FA 4XKAA 1N34E 1YT2A 3D36A 4BQGA 4JYAI 1BYQA 1UYGA 4CE3A 2YKEA 4B7PA 3H4LA 1E3PA 4HZ0A 4N3OA 4LF8I 4LF4E 3Q6NA 4HXWA 2QG0A 4XCJA 2Z5BA 1J5EI 3ZKBA 3T1HE 1FI4A 4MQYA 3PEHA 3K99A 5CTUA 4X65E 1XMOI 4XC0A 5DRPA 4JI3E 4LP0A 4OO1E 2UWDA 4GEEA 1UYIA 2WP8B 2YEGA 3QDDA 4YKQA 1US7A 3EHJA 4BQJA 4AQYE 4JI1E 3D0BA 3P06A 4CWRA 4JAUA 3F0NA 4LWHA 1KIJA 1XMQI 1I5DA 4MPEA 1FWKA 3U1YA 4IFDE 2HKJA 2O1WA 4HACB 4LF9E 3BMYA 2YI6A 4K0KI 2YKIA 3C11A 3CRLA 4O07A 4MU3A 4LOMA 1ZM3A 1B63A 4DR2I 4OO1F 1YT1A 4PRXA 4WUDA 2HKEA 5FWKA 4LF7E 4IFDA 5IN9A 5J6AA 3CGZA 3QT8A 2PO1A 2HCHA 3L7ZB 2R3VA 1S14A 2VWCA 1IBKE 1I5AA 4DR3I 1UYLA 2EFGA 2QG2A 2FTKA 2HK2A 1OYPA 3PRYA 1DARA 2YKBA 3UHMA 4L94A 3DGEA 2UUBI 5C0XA 2BZ5A 5M4NA 4CWSA 4H85A 4BIZA 4B3TE 4USMA 1RREA 3S5TA 3K85A 4L90A 3J80Q 1ZXNA 4HZ5A 3WU6A 2X36A 4LPBA 4MU4A 2V2VA 1Y8PA 5EKWA 4JYAE 2CCTA 2FXSA 2YKJA 3G7BA 4DR5I 5ELWA 2PO0B 4XKKA 4JI7I 5DNXA 1OJ4A 4L93A 4U3BA 2YKCA 1ZM9A 5FNCA 3HHUA 1E3HA 4JI2E 1J5EE 1YT0A 4YKRA 4JI4I 4AIMA 4QNJA 4KQVA 4ED4A 1XMOE 1L0OA 4U3DA 2YEJA 2YGEA 1P42A 3T0HA 5JEAB 4AM3A 3GIEA 4X9LA 4P52A 3QTFA 1MX0A 3TZ2A 2NN6C 1MU5A 4OX9I 4XIQA 4LCHA 1XMQE 2PO2B 3HULA 4EEHA 4XITA 1JM6A 1Z5BA 4K0KE 4KHPI 3SL2A 2JT2A 4R1FA 4KFGA 2V34A 5JEAD 1F51A 3A0WA 4FW3A 4IZKA 2YE5A 4URNA 3CGYA 3U2KA 3LTOA 2YJWA 1OYSA 2C37A 1Z0BA 1Z0VA 3B8HA 1MG7A 4DR3E 1S4EA 4LF4I 2YE2A 4UT4A 1UYDA 4YKZA 4FPPA 4LFBE 4MP7A 1UY8A 2IWUA 4EM7A 4X65I 2ZDXA 4XTJA 1IBLI 2BU6A 4R3AA 3B25A 5BR8I 4ASBA 2YI5A 4OO1C 2XX2A 3VHCA 1ID0A 1BKNA 4JAVA 2O1TA 4QPJA 1Y6ZA 1Z0WA 2IWSA 1N0UA 5JEAE 3J81Q 1HNWE 4L8ZA 4CWOA 1KTVA 4YKXA 4IFDC 5IDJA 4V26A 1N0VC
chains in the Genus database with same CATH topology
4V25A 4HYMA 2CH4A 3M6AA 1R62A 5IT9Q 1Z59A 4KSGA 1XNQE 4O09A 1UY9A 1ZW9A 1Y8NA 2AKPA 4URLA 3A0ZA 3JAMC 2XCMA 4JI4E 1UYHA 4FWDA 2PNRA 4HYPA 3ZXOA 4MOTA 4DPUA 3EKRA 2WW4A 2YE4A 3RKZA 5C93A 5LMNI 1I94I 3J7AM 1UYCA 2K5BA 3Q6MA 3TUHA 1Y8OA 3EKOA 4OX9E 4GKKI 2WI7A 4EFTA 1Z0CA 4E00A 4LFCI 1U2OA 4B3TI 3B27A 1H74A 4KHPE 3EHHA 3HZ5A 3INXA 5L3JA 1TC6A 3GIGB 4GQTA 5D7CA 2H55A 1AH6A 3FV5A 4Z7YA 3B24A 4K4OA 1TIDA 4YKWA 3RLPA 1N36I 5M4HA 2ZDYA 3PYGA 4DUZI 2X7IA 4DUYI 4NH8A 5FLXQ 4XD8A 4URMA 4NH9A 4JI2I 3VHAA 1U2RA 2V2QA 2VCJA 1UYMA 3J81C 1IBLE 1HNZE 1YC3A 2C2AA 5BR8E 2XHRA 1PVGA 3ZXQA 4IZJB 3ZZ0A 1TILA 2WI5A 1ELOA 5IT9C 4MPNA 3R91A 4LFAI 3OPDA 3TZ5A 4DV4I 2QF6A 2XHXA 2Z5CA 3G7EA 5D7RA 4U7OA 1B3QA 3PYFA 2UXCI 3GIFA 1D6TA 4O0BA 3T2SA 2IOQA 4FN5A 4HY6A 3A0YA 3WHAA 3KE6A 1ZXMA 4CWNA 1YSZA 2GQPA 1BXDA 2YEEA 1GJVA 5IDMA 1ZM2A 2IORA 4AWPA 5LMNE 1I94E 2XD6A 4LFBI 1N32I 1YERA 1QZRA 1KZNA 4GKKE 2BU7A 2YE7A 4H7QA 5M4PA 3WU5A 4BXIA 4DV1I 4LFCE 2UXDI 1YC1A 3T10A 1HNWI 2EXLA 1ZM4A 2VQFI 2OI2A 5FLXC 1I5CA 4MP2A 3PYDA 4QPKA 2Q8IA 4CWOA 4L91A 5F5RA 4FW9A 3R92A 1N36E 3PEJA 2CG9A 2GS8A 1XNQI 2F4VE 4DUZE 1U0ZA 4DV2E 4DUYE 4LF6I 2YE8A 2YK9A 4FMTA 1N33I 2HHHI 2YGFA 4HACA 2YEIA 3B28A 4MPCA 4Q20A 4GT8A 5D6QA 4EGKA 4HXZA 3JZ3A 4DU7A 5BODA 3JAMQ 4MB9A 4LFAE 4I5SA 2WEPA 4H81A 4Z7CA 4DV4E 2CGFA 2YE3A 1EA6A 2CZ9A 2WEQA 3R4NA 4AS9A 4PRVA 2PNLA 3C0EA 1EI1A 2UXCE 1UY7A 3HYYA 4JI8I 2A2CA 3QT6A 1IBMI 4P8OA 4X62I 4R3MA 2XHTA 1USVA 1YC4A 5A2QQ 1I59A 1Z0TA 2QFOA 2ZKJA 4EFUA 4ASGA 4CE2A 2YE6A 3WQ9A 4KP4A 2LJPA 1N32E 4FCPA 3VHDA 1HNZI 3OWBA 4LWGA 3T1KA 3K17A 4BAEA 2CGEA 4DV1E 4O05A 4NXMI 2UXDE 4X66E 1HR0I 2UUCE 4DV3I 1I5BA 1ZWHA 3Q5JA 2VQFE 1AM1A 1I58A 2AJ4A 4BIUA 2H8MA 1UEKA 3OW6A 3BM9A 2YI7A 3V5RA 4MYUA 4DU8A 4XIPA 5CF0A 3GONA 4USKA 3OTOE 4LF6E 2BYHA 2VQEI 3K60A 4JI6E 4WUBA 2HG1A 1N33E 2HHHE 1WUUA 2BT0A 4AWOA 4CE1A 1AH8A 2UUAI 4GFNA 3R4MA 2ZM6I 4DPYA 2WI3A 1FNMA 4E01A 2YEAA 3CWVA 2E5LE 4ASAA 2GQ0A 3D4JA 3ZKDA 5M4EA 2O1UA 2Z5BB 2BV3A 4YHHI 2Q2EB 2UU9I 2ESAA 1YESA 2IOPA 2VCIA 4UTGA 5A2QC 4FCRA 2BREA 1H7SA 3R4OA 2E1RA 2YEHA 1S16A 1NZ0A 2NPFA 4PU9A 2XX4A 5F3KA 4JI8E 3LNUA 1IBME 2UXBI 3VADA 4X62E 2F4VI 3Q5KA 2DEIA 1Z0EA 4DV2I 1Z0GA 1THNA 2XX5A 2BYIA 4MBCA 2XABA 2JJCA 2FWZA 4CWPA 4DPXA 4P7AA 1HNXI 1UYFA 3PYEA 3HJCA 2VW5A 1HK7A 4WUCA 4PL9A 4B3RE 4XE2A 1KKHA 4EMDA 3QT5A 2J7KA 1Z5AA 4NXME 3IEDA 4U7NA 1HR0E 4DV3E 3A0RA 4RPFA 2E0AA 5CTXA 3RLRA 2FWYA 5CTWA 2PNMA 1FJGI 4IZJD 2BM1A 1Y4SA 4XKOA 2BU8A 3K98A 5FNDA 2YJXA 3HYZA 2YECA 2VQEE 1Z5CA 1GKZA 1TH8A 5M4KA 3WU3A 4JV5I 2UUAE 4JASA 4KSHA 3GIGA 2ZM6E 4YY3E 5IWAI 1YETA 3B82A 4X64I 2GFDA 2HK3A 4DR1E 4DR6I 4MYTA 4DV0I 5BOCA 2HFSA 4JI0I 4W7TA 2Q8GA 4ASFA 4YHHE 2CCSA 2YE9A 3EHFA 2BTZA 2UU9E 4DV7I 4X66I 1K47A 4DV6E 2UUCI 2BM0A 2Z5EA 3V2UC 2WI2A 5D7DA 3B26A 2HFUA 4HY1A 1AMWA 3FT5A 2XEXA 2XJJA 1KVKA 2XDLA 3O0IA 4LWEA 3T0ZA 3TZ0A 4CWQA 2UXBE 1B62A 3A0TA 4LWFA 4FWHA 4NH7A 4KTNA 4AWQA 2O1VA 4IZJA 5LMUI 1UYEA 4GKJI 4GGLA 5M4MA 4ZVIA 3OTOI 1OSFA 2XJGA 2DEJA 4JI6I 4IZKB 3U2DA 4YKUA 1HNXE 4E02A 4DPTA 2YEFA 3G75A 2BU5A 2A2DA 1BGQA 4LF5I 1GKXA 2XDKA 2E5LI 1TBWA 4NXNI 4B3SI 5D6PA 3R4PA 3H80A 4JI5I 3INWA 1UYKA 4I3HA 2ZITA 4M1KA 4JG4A 2WI6A 1USUA 3HEKA 1FJGE 3HZ1A 3FT8A 4B6CA 4LF8E 1RR9A 1PKPA 3RLQA 1A6FA 3Q5LA 4CWTA 4DR7I 5GMDA 2BU2A 4JV5E 1QYEA 4XIRA 3J7AG 4B3MI 2XJXA 5IWAE 4UROA 1VISA 4DR4I 3A0XA 4X64E 4DXLA 4DR6E 4DV0E 4JI0E 2V8PA 2BRCA 2FYPA 4B3RI 3T1YI 3ZM7A 2YEDA 1XNRI 2XDSA 4CWFA 3O6OA 4DV5I 4DV7E 1Y4UA 5GMEA 4DR2E 1XHKA 3Q1QA 2YGAA 2Q8HA 5CPHA 1N34I 2XK2A 4FCQA 1TC0A 2VF3A 2ZBKB 2XDUA 3ZZUA 5LMUE 2CCUA 1QY8A 2YK2A 4GKJE 4O04A 3T1HI 4FWGA 3LPSA 3J80C 4JI3I 3MNRP 3OMUA 1PIEA 5J71A 2UUBE 1H72C 4LF5E 4YY3I 4YKYA 5CTYA 4JI1I 4AQYI 3WU4A 2BSMA 3NMQA 4JQLA 4DR1I 2JKIA 3EHGA 3OWDA 2WI1A 2V2ZA 4B3SE 4NXNE 4LF9I 4EGHA 4GCZA 1NHJA 4JI5E 2YI0A 3D2RA 4DR5E 4DV6I 1H73A 5LL6R 4LF7I 4YKTA 4XDMA 2IWXA 4DZYA 4JI7E 1YSRA 3B78A 3CRKA 5GGZA 4XCLA 4EMVA 3U67A 3TTZA 4EGIA 4DR7E 1AJ6A 1IBKI 2Z5CB 1NHHA 1UY6A 3TZ4A 1A4HA 4LWIA 3QT7A 4B3ME 1FWLA 1FKAE 2XDXA 4DR4E 2WI4A 5FNFA 4U93A 1H7UA 4DPWA 1NHIA 4DUHA 3ZZTA 2Q8FA 2YEBA 3K97A 3T1YE 4ZKIA 3K1JA 1XNRE 1YS3A 4DV5E 2R42A 3O2FA 4XKAA 1N34E 1YT2A 3D36A 4BQGA 4JYAI 1BYQA 1UYGA 4CE3A 2YKEA 4B7PA 3H4LA 4HZ0A 4N3OA 4LF8I 4LF4E 3Q6NA 2QG0A 4XCJA 2Z5BA 1J5EI 3ZKBA 3T1HE 1FI4A 3PEHA 3K99A 5CTUA 4X65E 1XMOI 4XC0A 4JI3E 4LP0A 2UWDA 4GEEA 1UYIA 2YEGA 3QDDA 4YKQA 1US7A 3EHJA 4BQJA 4AQYE 4JI1E 3D0BA 3P06A 4CWRA 4JAUA 3F0NA 4LWHA 1KIJA 1XMQI 1I5DA 4MPEA 1FWKA 3BMYA 2HKJA 2O1WA 4HACB 4LF9E 3CRLA 2YI6A 4K0KI 2YKIA 3C11A 4O07A 1ZM3A 1B63A 4DR2I 2WERA 1YT1A 4PRXA 4WUDA 2HKEA 5FWKA 4LF7E 4HXWA 5IN9A 5J6AA 3CGZA 3QT8A 2HCHA 2R3VA 1S14A 2VWCA 1IBKE 1I5AA 4DR3I 1UYLA 2EFGA 2QG2A 2HK2A 3PRYA 1DARA 2YKBA 4L94A 3DGEA 2UUBI 2BZ5A 5M4NA 4CWSA 4H85A 4BIZA 4B3TE 4USMA 1RREA 3K85A 4L90A 3J80Q 1ZXNA 4HZ5A 3WU6A 2X36A 4LPBA 2V2VA 1Y8PA 4JYAE 2CCTA 2FXSA 2YKJA 3G7BA 4DR5I 4XKKA 4JI7I 1OJ4A 4L93A 5FNCA 2YKCA 1ZM9A 3HHUA 1YT0A 4JI2E 1J5EE 4YKRA 4JI4I 4KQVA 4ED4A 1XMOE 1L0OA 2YEJA 2YGEA 3T0HA 3GIEA 4X9LA 4P52A 3QTFA 1MX0A 3TZ2A 1MU5A 4OX9I 4XIQA 1XMQE 3HULA 4EEHA 4XITA 1JM6A 1Z5BA 4K0KE 4KHPI 3SL2A 4R1FA 4KFGA 2V34A 3A0WA 4IZKA 4URNA 2YE5A 3CGYA 3U2KA 3LTOA 2YJWA 1Z0BA 1Z0VA 3B8HA 1MG7A 4DR3E 1S4EA 4LF4I 2YE2A 4UT4A 1UYDA 4YKZA 4FPPA 4LFBE 4MP7A 1UY8A 2IWUA 4EM7A 4X65I 2ZDXA 4XTJA 1IBLI 2BU6A 4R3AA 3B25A 5BR8I 4ASBA 2YI5A 3VHCA 2XX2A 1ID0A 1BKNA 4JAVA 2O1TA 4QPJA 1Y6ZA 1Z0WA 2IWSA 1N0UA 3J81Q 4L8ZA 1HNWE 1KTVA 4YKXA 5IDJA 4V26A 1N0VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V25 A;  4HYM A;  2CH4 A;  3M6A A;  1R62 A;  5IT9 Q;  1Z59 A;  4KSG A;  1XNQ E;  4O09 A;  1UY9 A;  1ZW9 A;  1Y8N A;  2AKP A;  4URL A;  3A0Z A;  3JAM C;  2XCM A;  4JI4 E;  1UYH A;  4FWD A;  2PNR A;  4HYP A;  3ZXO A;  4MOT A;  4DPU A;  3EKR A;  2WW4 A;  2YE4 A;  3RKZ A;  5C93 A;  5LMN I;  1I94 I;  3J7A M;  1UYC A;  2K5B A;  3TUH A;  1Y8O A;  3EKO A;  4OX9 E;  4GKK I;  2WI7 A;  4EFT A;  1Z0C A;  4E00 A;  4LFC I;  1U2O A;  4B3T I;  3B27 A;  1H74 A;  4KHP E;  3EHH A;  3HZ5 A;  3INX A;  5L3J A;  1TC6 A;  3GIG B;  4GQT A;  5D7C A;  2H55 A;  1AH6 A;  3FV5 A;  4Z7Y A;  3B24 A;  4K4O A;  1TID A;  4YKW A;  3RLP A;  1N36 I;  5M4H A;  2ZDY A;  3PYG A;  4DUZ I;  2X7I A;  4DUY I;  4NH8 A;  5FLX Q;  4XD8 A;  4URM A;  4NH9 A;  4JI2 I;  3VHA A;  1U2R A;  2V2Q A;  2VCJ A;  1UYM A;  3J81 C;  1IBL E;  1HNZ E;  1YC3 A;  2C2A A;  5BR8 E;  2XHR A;  1PVG A;  3ZXQ A;  3ZZ0 A;  1TIL A;  2WI5 A;  1ELO A;  5IT9 C;  4MPN A;  3R91 A;  4LFA I;  3OPD A;  3TZ5 A;  4DV4 I;  2QF6 A;  2XHX A;  3G7E A;  5D7R A;  4U7O A;  1B3Q A;  3PYF A;  2UXC I;  3GIF A;  1D6T A;  4O0B A;  3T2S A;  4FN5 A;  2IOQ A;  4HY6 A;  3A0Y A;  3WHA A;  3KE6 A;  1ZXM A;  4CWN A;  1YSZ A;  2GQP A;  1BXD A;  2YEE A;  1GJV A;  5IDM A;  1ZM2 A;  2IOR A;  4AWP A;  5LMN E;  1I94 E;  2XD6 A;  4LFB I;  1N32 I;  1YER A;  1QZR A;  1KZN A;  4GKK E;  2BU7 A;  2YE7 A;  4H7Q A;  5M4P A;  3WU5 A;  4BXI A;  4DV1 I;  4LFC E;  2UXD I;  1YC1 A;  3T10 A;  1HNW I;  2EXL A;  1ZM4 A;  2VQF I;  2OI2 A;  5FLX C;  1I5C A;  4MP2 A;  3PYD A;  4QPK A;  2Q8I A;  4CWO A;  4L91 A;  5F5R A;  4FW9 A;  3R92 A;  1N36 E;  3PEJ A;  2CG9 A;  2GS8 A;  1XNQ I;  2F4V E;  4DUZ E;  1U0Z A;  4DV2 E;  4DUY E;  4LF6 I;  2YE8 A;  2YK9 A;  4FMT A;  1N33 I;  2HHH I;  2YGF A;  4HAC A;  2YEI A;  3B28 A;  4MPC A;  4Q20 A;  4GT8 A;  5D6Q A;  4EGK A;  4HXZ A;  3JZ3 A;  4DU7 A;  5BOD A;  3JAM Q;  4MB9 A;  4LFA E;  4I5S A;  2WEP A;  4H81 A;  4Z7C A;  4DV4 E;  2CGF A;  2YE3 A;  1EA6 A;  2CZ9 A;  2WEQ A;  3R4N A;  4AS9 A;  4PRV A;  3C0E A;  1EI1 A;  2UXC E;  1UY7 A;  3HYY A;  4JI8 I;  2A2C A;  3QT6 A;  1IBM I;  4P8O A;  4X62 I;  4R3M A;  2XHT A;  1YC4 A;  5A2Q Q;  1I59 A;  1Z0T A;  2QFO A;  2ZKJ A;  4EFU A;  4ASG A;  4CE2 A;  2YE6 A;  3WQ9 A;  4KP4 A;  2LJP A;  1N32 E;  4FCP A;  3VHD A;  1HNZ I;  3OWB A;  4LWG A;  3T1K A;  3K17 A;  4BAE A;  4DV1 E;  4O05 A;  4NXM I;  2UXD E;  4X66 E;  1HR0 I;  2UUC E;  4DV3 I;  1I5B A;  1ZWH A;  3Q5J A;  2VQF E;  1AM1 A;  1I58 A;  2AJ4 A;  4BIU A;  2H8M A;  1UEK A;  3OW6 A;  3BM9 A;  2YI7 A;  3V5R A;  4MYU A;  4DU8 A;  4XIP A;  5CF0 A;  3GON A;  4USK A;  3OTO E;  4LF6 E;  2BYH A;  2VQE I;  3K60 A;  4JI6 E;  4WUB A;  2HG1 A;  1N33 E;  2HHH E;  1WUU A;  2BT0 A;  4AWO A;  4CE1 A;  1AH8 A;  2UUA I;  4GFN A;  3R4M A;  2ZM6 I;  4DPY A;  2WI3 A;  1FNM A;  4E01 A;  2YEA A;  3CWV A;  2E5L E;  4ASA A;  3D4J A;  3ZKD A;  5M4E A;  2O1U A;  2BV3 A;  4YHH I;  2Q2E B;  2UU9 I;  2ESA A;  1YES A;  2IOP A;  2VCI A;  4UTG A;  5A2Q C;  4FCR A;  2BRE A;  1H7S A;  3R4O A;  2E1R A;  2YEH A;  1S16 A;  1NZ0 A;  2NPF A;  4PU9 A;  2XX4 A;  5F3K A;  4JI8 E;  3LNU A;  1IBM E;  2UXB I;  3VAD A;  4X62 E;  2F4V I;  3Q5K A;  2DEI A;  1Z0E A;  4DV2 I;  1Z0G A;  1THN A;  2XX5 A;  2BYI A;  4MBC A;  2XAB A;  2JJC A;  2FWZ A;  4CWP A;  4DPX A;  4P7A A;  1HNX I;  1UYF A;  3PYE A;  2VW5 A;  4WUC A;  4PL9 A;  4B3R E;  4XE2 A;  1KKH A;  4EMD A;  3QT5 A;  2J7K A;  1Z5A A;  4NXM E;  3IED A;  4U7N A;  1HR0 E;  4DV3 E;  3A0R A;  4RPF A;  2E0A A;  5CTX A;  3RLR A;  2FWY A;  5CTW A;  1FJG I;  2BM1 A;  1Y4S A;  4XKO A;  2BU8 A;  3K98 A;  5FND A;  2YJX A;  3HYZ A;  2YEC A;  2VQE E;  1Z5C A;  1GKZ A;  1TH8 A;  5M4K A;  3WU3 A;  4JV5 I;  2UUA E;  4JAS A;  4KSH A;  3GIG A;  2ZM6 E;  4YY3 E;  5IWA I;  1YET A;  3B82 A;  4X64 I;  2GFD A;  2HK3 A;  4DR1 E;  4DR6 I;  4MYT A;  4DV0 I;  5BOC A;  2HFS A;  4JI0 I;  4W7T A;  2Q8G A;  4ASF A;  4YHH E;  2CCS A;  2YE9 A;  3EHF A;  2BTZ A;  2UU9 E;  4DV7 I;  4X66 I;  1K47 A;  4DV6 E;  2UUC I;  2BM0 A;  3V2U C;  2WI2 A;  5D7D A;  3B26 A;  2HFU A;  4HY1 A;  1AMW A;  3FT5 A;  2XEX A;  2XJJ A;  1KVK A;  2XDL A;  3O0I A;  4LWE A;  3T0Z A;  3TZ0 A;  4CWQ A;  2UXB E;  1B62 A;  3A0T A;  4LWF A;  4FWH A;  4NH7 A;  4KTN A;  4AWQ A;  5LMU I;  2O1V A;  1UYE A;  4GKJ I;  4GGL A;  5M4M A;  4ZVI A;  3OTO I;  1OSF A;  2XJG A;  2DEJ A;  4JI6 I;  3U2D A;  4YKU A;  1HNX E;  4E02 A;  4DPT A;  2YEF A;  3G75 A;  2BU5 A;  2A2D A;  1BGQ A;  4LF5 I;  1GKX A;  2XDK A;  2E5L I;  1TBW A;  4NXN I;  4B3S I;  5D6P A;  3R4P A;  3H80 A;  4JI5 I;  3INW A;  1UYK A;  4I3H A;  2ZIT A;  4M1K A;  4JG4 A;  2WI6 A;  3HEK A;  1FJG E;  3HZ1 A;  3FT8 A;  4B6C A;  4LF8 E;  1RR9 A;  1PKP A;  3RLQ A;  1A6F A;  3Q5L A;  4CWT A;  4DR7 I;  5GMD A;  2BU2 A;  4JV5 E;  1QYE A;  4XIR A;  3J7A G;  4B3M I;  2XJX A;  5IWA E;  4URO A;  1VIS A;  4DR4 I;  3A0X A;  4X64 E;  4DXL A;  4DR6 E;  4DV0 E;  4JI0 E;  2V8P A;  2BRC A;  2FYP A;  4B3R I;  3T1Y I;  3ZM7 A;  2YED A;  1XNR I;  2XDS A;  4CWF A;  3O6O A;  4DV5 I;  4DV7 E;  4DR2 E;  5GME A;  1Y4U A;  1XHK A;  3Q1Q A;  2YGA A;  2Q8H A;  5CPH A;  1N34 I;  2XK2 A;  4FCQ A;  1TC0 A;  2VF3 A;  2ZBK B;  2XDU A;  3ZZU A;  5LMU E;  2CCU A;  1QY8 A;  2YK2 A;  4GKJ E;  4O04 A;  3T1H I;  4FWG A;  3LPS A;  3J80 C;  4JI3 I;  3MNR P;  3OMU A;  1PIE A;  5J71 A;  2UUB E;  1H72 C;  4LF5 E;  4YY3 I;  4YKY A;  5CTY A;  4JI1 I;  4AQY I;  3WU4 A;  2BSM A;  3NMQ A;  4JQL A;  4DR1 I;  2JKI A;  3EHG A;  3OWD A;  2WI1 A;  2V2Z A;  4B3S E;  4NXN E;  4LF9 I;  4EGH A;  4GCZ A;  1NHJ A;  4JI5 E;  2YI0 A;  3D2R A;  4DR5 E;  4DV6 I;  1H73 A;  5LL6 R;  4LF7 I;  4YKT A;  4XDM A;  2IWX A;  4DZY A;  4JI7 E;  1YSR A;  3B78 A;  3CRK A;  5GGZ A;  4XCL A;  4EMV A;  3U67 A;  3TTZ A;  4EGI A;  4DR7 E;  1AJ6 A;  1IBK I;  1NHH A;  1UY6 A;  3TZ4 A;  1A4H A;  4LWI A;  3QT7 A;  4B3M E;  1FWL A;  1FKA E;  2XDX A;  4DR4 E;  2WI4 A;  5FNF A;  4U93 A;  1H7U A;  4DPW A;  1NHI A;  4DUH A;  3ZZT A;  2Q8F A;  2YEB A;  3K97 A;  3T1Y E;  4ZKI A;  3K1J A;  1XNR E;  1YS3 A;  4DV5 E;  2R42 A;  3O2F A;  4XKA A;  1N34 E;  1YT2 A;  3D36 A;  4BQG A;  4JYA I;  1BYQ A;  1UYG A;  4CE3 A;  2YKE A;  4B7P A;  3H4L A;  4HZ0 A;  4LF8 I;  4LF4 E;  2QG0 A;  4XCJ A;  1J5E I;  3ZKB A;  3T1H E;  1FI4 A;  3PEH A;  3K99 A;  5CTU A;  4X65 E;  1XMO I;  4XC0 A;  4JI3 E;  4LP0 A;  2UWD A;  4GEE A;  1UYI A;  2YEG A;  3QDD A;  4YKQ A;  1US7 A;  3EHJ A;  4BQJ A;  4AQY E;  4JI1 E;  3D0B A;  4CWR A;  4JAU A;  3F0N A;  4LWH A;  1KIJ A;  1XMQ I;  1I5D A;  4MPE A;  1FWK A;  3BMY A;  2HKJ A;  4HAC B;  4LF9 E;  2O1W A;  3CRL A;  2YI6 A;  4K0K I;  2YKI A;  3C11 A;  4O07 A;  1ZM3 A;  1B63 A;  4DR2 I;  2WER A;  1YT1 A;  4PRX A;  4WUD A;  2HKE A;  4HXW A;  4LF7 E;  5FWK A;  5IN9 A;  5J6A A;  3CGZ A;  3QT8 A;  2HCH A;  2R3V A;  1S14 A;  2VWC A;  1IBK E;  1I5A A;  4DR3 I;  1UYL A;  2EFG A;  2QG2 A;  2HK2 A;  1DAR A;  2YKB A;  4L94 A;  3DGE A;  2UUB I;  2BZ5 A;  5M4N A;  4CWS A;  4H85 A;  4BIZ A;  4B3T E;  4USM A;  1RRE A;  4L90 A;  3J80 Q;  1ZXN A;  4HZ5 A;  3WU6 A;  2X36 A;  4LPB A;  2V2V A;  1Y8P A;  4JYA E;  2CCT A;  2FXS A;  2YKJ A;  3G7B A;  4DR5 I;  4XKK A;  4JI7 I;  1OJ4 A;  4L93 A;  5FNC A;  2YKC A;  1ZM9 A;  3HHU A;  1YT0 A;  4JI2 E;  1J5E E;  4YKR A;  4JI4 I;  4KQV A;  4ED4 A;  1XMO E;  1L0O A;  2YEJ A;  2YGE A;  3T0H A;  3GIE A;  4X9L A;  4P52 A;  3QTF A;  1MX0 A;  3TZ2 A;  1MU5 A;  4OX9 I;  4XIQ A;  1XMQ E;  3HUL A;  4EEH A;  4XIT A;  1JM6 A;  1Z5B A;  4K0K E;  4KHP I;  3SL2 A;  4R1F A;  4KFG A;  2V34 A;  3A0W A;  4URN A;  2YE5 A;  3CGY A;  3U2K A;  3LTO A;  2YJW A;  1Z0B A;  1Z0V A;  3B8H A;  1MG7 A;  4DR3 E;  1S4E A;  4LF4 I;  2YE2 A;  4UT4 A;  1UYD A;  4YKZ A;  4FPP A;  4LFB E;  4MP7 A;  1UY8 A;  2IWU A;  4EM7 A;  4X65 I;  2ZDX A;  4XTJ A;  1IBL I;  2BU6 A;  4R3A A;  3B25 A;  5BR8 I;  4ASB A;  2YI5 A;  3VHC A;  2XX2 A;  1ID0 A;  1BKN A;  4JAV A;  4QPJ A;  1Z0W A;  2IWS A;  1N0U A;  3J81 Q;  4L8Z A;  1HNW E;  1KTV A;  4YKX A;  5IDJ A;  4V26 A;  1N0V C; 
#chains in the Genus database with same CATH topology
 4V25 A;  4HYM A;  2CH4 A;  3M6A A;  1R62 A;  5IT9 Q;  1Z59 A;  4KSG A;  1XNQ E;  4O09 A;  1UY9 A;  1ZW9 A;  1Y8N A;  4FW6 A;  3P3E A;  2AKP A;  4URL A;  3A0Z A;  3JAM C;  2XCM A;  5JEA F;  2BA0 D;  2JE6 B;  4JI4 E;  4FWD A;  1UYH A;  2PNR A;  4HYP A;  3ZXO A;  4MOT A;  4DPU A;  3EKR A;  2WW4 A;  2YE4 A;  3RKZ A;  5C93 A;  5LMN I;  1I94 I;  1YHC A;  3J7A M;  3CDJ A;  3Q6M A;  1UYC A;  1UDS A;  2K5B A;  1Y8O A;  3TUH A;  4BA2 A;  4OX9 E;  3EKO A;  4GKK I;  2WI7 A;  4EFT A;  1Z0C A;  5K36 B;  2NN6 A;  4E00 A;  2JEA A;  4LFC I;  1U2O A;  4B3T I;  3B27 A;  1H74 A;  4KHP E;  3EHH A;  3HZ5 A;  4J3D A;  3PS1 A;  5L3J A;  1TC6 A;  3GIG B;  3INX A;  3DD6 A;  4GQT A;  5D7C A;  3CDI A;  1AH6 A;  2H55 A;  3FV5 A;  4Z7Y A;  3B24 A;  4K4O A;  1TID A;  4YKW A;  3RLP A;  1N36 I;  5M4H A;  2ZDY A;  3PYG A;  4DUZ I;  2X7I A;  2F1D A;  4QNK A;  2IER A;  3KRN A;  4DUY I;  5DNL A;  4NH8 A;  5FLX Q;  2WNR A;  4XD8 A;  4URM A;  4NH9 A;  4JI2 I;  3VHA A;  1U2R A;  2V2Q A;  2VCJ A;  1UYM A;  3J81 C;  3GLL A;  1IBL E;  1HNZ E;  1YC3 A;  2C2A A;  5BR8 E;  2XHR A;  1PVG A;  3ZXQ A;  4IZJ B;  3ZZ0 A;  4BA1 A;  1TIL A;  2WI5 A;  1ELO A;  5IT9 C;  4MPN A;  3R91 A;  4LFA I;  4OO1 A;  3OPD A;  3TZ5 A;  4DV4 I;  2QF6 A;  2XHX A;  2Z5C A;  3G7E A;  5D7R A;  4U7O A;  1B3Q A;  3PYF A;  2UXC I;  3GIF A;  4NBQ A;  4OZE A;  1D6T A;  4O0B A;  3T2S A;  2IOQ A;  2JEB A;  4FN5 A;  5EL9 A;  3M7N D;  3A0Y A;  3KE6 A;  1ZXM A;  2BR2 B;  1YSZ A;  2GQP A;  1R6M A;  3WHA A;  4CWN A;  1BXD A;  2YEE A;  2IES A;  1GJV A;  2VES A;  1ZM2 A;  5IDM A;  3P3G A;  2IOR A;  5DRQ A;  5K36 F;  5LMN E;  1I94 E;  2XD6 A;  4LFB I;  4AWP A;  1N32 I;  1YER A;  1QZR A;  1KZN A;  4GKK E;  2BU7 A;  2YE7 A;  4H7Q A;  5M4P A;  3WU5 A;  4BXI A;  3PS3 A;  2BA0 G;  4DV1 I;  4LFC E;  2UXD I;  1YC1 A;  1XXE A;  3T10 A;  1HNW I;  2EXL A;  1ZM4 A;  2C38 B;  2OI2 A;  5JEA C;  5FLX C;  2VQF I;  3PYD A;  1I5C A;  4LPF A;  4MP2 A;  4QPK A;  4L91 A;  2PNZ B;  2Q8I A;  5F5R A;  4FW9 A;  2WP8 A;  3R92 A;  1N36 E;  3PEJ A;  2CG9 A;  2GS8 A;  1XNQ I;  2F4V E;  4DUZ E;  1U0Z A;  4DV2 E;  4DUY E;  4LF6 I;  1OYR A;  2YE8 A;  2YK9 A;  4FMT A;  2C39 B;  2HHH I;  1N33 I;  2YGF A;  4HAC A;  1YH8 A;  2YEI A;  3B28 A;  4MPC A;  4Q20 A;  4GT8 A;  2CVE A;  5D6Q A;  4EGK A;  3GME A;  4HXZ A;  3JZ3 A;  4DU7 A;  5BOD A;  3JAM Q;  4MB9 A;  4LFA E;  3L7Z A;  4I5S A;  2BR2 A;  2WEP A;  4H81 A;  4Z7C A;  5C0X F;  4E72 A;  4DV4 E;  2CGF A;  2YE3 A;  1EA6 A;  2CZ9 A;  2WEQ A;  3R4N A;  4AS9 A;  4PRV A;  2PNL A;  2C1I A;  3C0E A;  1EI1 A;  2UXC E;  1UY7 A;  3HYY A;  4JI8 I;  2A2C A;  3QT6 A;  1IBM I;  4P8O A;  4X62 I;  4R3M A;  2XHT A;  1USV A;  1YC4 A;  5A2Q Q;  1I59 A;  1Z0T A;  2QFO A;  2ZKJ A;  4EFU A;  4ASG A;  4CE2 A;  2YE6 A;  3WQ9 A;  4KP4 A;  2LJP A;  3GCM A;  1N32 E;  4FCP A;  3VHD A;  3HKM A;  1HNZ I;  3OWB A;  4LWG A;  3M7N G;  3T1K A;  2PO0 A;  3K17 A;  4BAE A;  2CGE A;  4DV1 E;  4O05 A;  4NXM I;  2UXD E;  4X66 E;  1HR0 I;  2UUC E;  4DV3 I;  1I5B A;  1ZWH A;  3Q5J A;  2VQF E;  1AM1 A;  1I58 A;  2AJ4 A;  4BIU A;  2H8M A;  1UEK A;  5JEA A;  3OW6 A;  3BM9 A;  2YI7 A;  3V5R A;  4MYU A;  4DU8 A;  4XIP A;  1UDO A;  5CF0 A;  3GON A;  4USK A;  3OTO E;  4LF6 E;  2BYH A;  2VQE I;  3K60 A;  4JI6 E;  4WUB A;  2PO2 A;  1N33 E;  2HHH E;  2HG1 A;  1WUU A;  2BT0 A;  4AWO A;  4CE1 A;  1AH8 A;  2UUA I;  4GFN A;  3R4M A;  3M85 D;  2ZM6 I;  4DPY A;  4LCF A;  2WI3 A;  4ISA A;  1FNM A;  4E01 A;  2YEA A;  3CWV A;  2E5L E;  4ASA A;  2GQ0 A;  3D4J A;  3ZKD A;  5M4E A;  2O1U A;  2Z5B B;  2BV3 A;  4YHH I;  1IXM A;  2Q2E B;  4FW5 A;  2UU9 I;  2ESA A;  1YES A;  2IOP A;  2VCI A;  4UTG A;  5A2Q C;  4FCR A;  2BRE A;  1H7S A;  4IS9 A;  3R4O A;  2E1R A;  2YEH A;  1S16 A;  1NZ0 A;  2NPF A;  4PU9 A;  2XX4 A;  5F3K A;  4JI8 E;  3LNU A;  1IBM E;  2UXB I;  5K36 D;  3VAD A;  4X62 E;  2F4V I;  3Q5K A;  2DEI A;  1Z0E A;  4DV2 I;  1Z0G A;  1THN A;  2XX5 A;  2BYI A;  4MBC A;  2XAB A;  2JJC A;  2FWZ A;  4IFD B;  4CWP A;  4DPX A;  3LMM A;  2PO1 B;  4P7A A;  1HNX I;  1UYF A;  3PYE A;  3HJC A;  2VW5 A;  1HK7 A;  4HY6 A;  4WUC A;  4PL9 A;  4B3R E;  4XE2 A;  1KKH A;  2BA1 G;  4EMD A;  3QT5 A;  2J7K A;  1Z5A A;  4NXM E;  3IED A;  4U7N A;  1HR0 E;  4DV3 E;  4IFD D;  3A0R A;  2NN6 F;  2JE6 A;  4RPF A;  2E0A A;  5CTX A;  3RLR A;  2FWY A;  5C0X B;  2PNM A;  5K36 E;  1FJG I;  5CTW A;  4IZJ D;  2BM1 A;  1Y4S A;  4XKO A;  2BU8 A;  3K98 A;  5FND A;  2YJX A;  3HYZ A;  2YEC A;  2VQE E;  1Z5C A;  5K36 A;  1GKZ A;  1TH8 A;  5M4K A;  3WU3 A;  2AE8 A;  4JV5 I;  2UUA E;  4JAS A;  4KSH A;  2J65 A;  2C1G A;  5C0X D;  2GO4 A;  3GIG A;  2ZM6 E;  4YY3 E;  5IWA I;  3NZK A;  4LCG A;  1YET A;  3B82 A;  4X64 I;  2GFD A;  2HK3 A;  4DR1 E;  4DR6 I;  4MYT A;  4DV0 I;  5BOC A;  2HFS A;  4JI0 I;  4W7T A;  2Q8G A;  4ASF A;  4YHH E;  2CCS A;  2YE9 A;  3EHF A;  2BTZ A;  2UU9 E;  4DV7 I;  4X66 I;  1K47 A;  4DV6 E;  2UUC I;  2BM0 A;  2Z5E A;  3V2U C;  3M85 G;  2WI2 A;  5D7D A;  3B26 A;  2HFU A;  4HY1 A;  1AMW A;  3FT5 A;  2XEX A;  2XJJ A;  1KVK A;  2XDL A;  3O0I A;  4LWE A;  3T0Z A;  3TZ0 A;  4CWQ A;  2UXB E;  1B62 A;  3A0T A;  4LWF A;  4FWH A;  4NH7 A;  4IFD F;  4KTN A;  2O1V A;  4IZJ A;  5LMU I;  4AWQ A;  1UYE A;  4GKJ I;  4GGL A;  5M4M A;  4ZVI A;  3OTO I;  1OSF A;  4OKG A;  2XJG A;  2DEJ A;  4JI6 I;  5C0X E;  1Y5Y A;  4IZK B;  3U2D A;  4MDT A;  4YKU A;  1HNX E;  1R6L A;  4E02 A;  4DPT A;  2YEF A;  3G75 A;  2BU5 A;  2A2D A;  1BGQ A;  4LF5 I;  1GKX A;  2C37 B;  2XDK A;  2E5L I;  1TBW A;  4NXN I;  4B3S I;  5D6P A;  3R4P A;  3H80 A;  4FW4 A;  4JI5 I;  3INW A;  1UYK A;  4I3H A;  2ZIT A;  4M1K A;  3PS2 A;  4JG4 A;  2WI6 A;  1USU A;  3HEK A;  1FJG E;  3HZ1 A;  3FT8 A;  4B6C A;  4LF8 E;  1RR9 A;  1PKP A;  3RLQ A;  1A6F A;  3Q5L A;  4CWT A;  4DR7 I;  5GMD A;  2BU2 A;  2WER A;  2BA1 D;  4JV5 E;  1QYE A;  4XIR A;  3J7A G;  4B3M I;  3P76 A;  2HHI A;  2C38 A;  2XJX A;  5IWA E;  4URO A;  1VIS A;  4DR4 I;  3A0X A;  2PNZ A;  4X64 E;  4DXL A;  4DR6 E;  4DV0 E;  4JI0 E;  2V8P A;  2BRC A;  2FYP A;  4B3R I;  3T1Y I;  3ZM7 A;  2YED A;  1XNR I;  2XDS A;  4CWF A;  3O6O A;  5JEN A;  4DV5 I;  4GQU A;  2GO3 A;  1Y4U A;  5GME A;  4DV7 E;  4DR2 E;  1XHK A;  3Q1Q A;  1Y60 A;  2C39 A;  2YGA A;  1N34 I;  2XK2 A;  4FCQ A;  5CPH A;  2Q8H A;  1TC0 A;  4BA2 B;  2VF3 A;  2ZBK B;  2XDU A;  2NN6 B;  3ZZU A;  5LMU E;  2JEA B;  5K36 C;  4AID A;  1QY8 A;  2CCU A;  2YK2 A;  4GKJ E;  4O04 A;  1UDN A;  3T1H I;  5DRO A;  4FWG A;  5DRR A;  3U1K A;  3LPS A;  3J80 C;  4JI3 I;  3MNR P;  3OMU A;  1PIE A;  5J71 A;  2UUB E;  1H72 C;  2NN6 D;  4LF5 E;  4YY3 I;  4YKY A;  4MU0 A;  4JI1 I;  4AQY I;  5CTY A;  3P3C A;  3WU4 A;  2BSM A;  3NMQ A;  4JQL A;  4DR1 I;  1VI7 A;  2WNR B;  2JKI A;  3H1C A;  3EHG A;  3OWD A;  2WI1 A;  2V2Z A;  4B3S E;  4NXN E;  4LF9 I;  4EGH A;  4GCZ A;  1NHJ A;  4JI5 E;  2YI0 A;  1RHY A;  3D2R A;  4DR5 E;  4DV6 I;  1H73 A;  5LL6 R;  4LF7 I;  4YKT A;  4XDM A;  2IWX A;  4DZY A;  4JI7 E;  4BA1 B;  1YSR A;  3B78 A;  3CRK A;  5GGZ A;  4XCL A;  4EMV A;  3U67 A;  1UDQ A;  3TTZ A;  4OO1 B;  4EGI A;  4DR7 E;  1AJ6 A;  1IBK I;  4FW7 A;  2Z5C B;  1NHH A;  1UY6 A;  3TZ4 A;  1A4H A;  2O3Z A;  4LWI A;  3QT7 A;  4B3M E;  1FWL A;  2NN6 E;  1FKA E;  5C0X C;  2XDX A;  4DR4 E;  2WI4 A;  5FNF A;  2JEB B;  4OO1 D;  4U93 A;  1H7U A;  4DPW A;  1NHI A;  4DUH A;  3ZZT A;  2Q8F A;  2YEB A;  3K97 A;  3T1Y E;  3B4T A;  3K1J A;  4MU1 A;  1XNR E;  1YS3 A;  3CYG A;  4ZKI A;  4DV5 E;  2R42 A;  3O2F A;  4XKA A;  1N34 E;  1YT2 A;  3D36 A;  4BQG A;  4JYA I;  1BYQ A;  1UYG A;  4CE3 A;  2YKE A;  4B7P A;  3H4L A;  1E3P A;  4HZ0 A;  4N3O A;  4LF8 I;  4LF4 E;  3Q6N A;  4HXW A;  2QG0 A;  4XCJ A;  2Z5B A;  1J5E I;  3ZKB A;  3T1H E;  1FI4 A;  4MQY A;  3PEH A;  3K99 A;  5CTU A;  4X65 E;  1XMO I;  4XC0 A;  5DRP A;  4JI3 E;  4LP0 A;  4OO1 E;  2UWD A;  4GEE A;  1UYI A;  2WP8 B;  2YEG A;  3QDD A;  4YKQ A;  1US7 A;  3EHJ A;  4BQJ A;  4AQY E;  4JI1 E;  3D0B A;  3P06 A;  4CWR A;  4JAU A;  3F0N A;  4LWH A;  1KIJ A;  1XMQ I;  1I5D A;  4MPE A;  1FWK A;  3U1Y A;  4IFD E;  2HKJ A;  2O1W A;  4HAC B;  4LF9 E;  3BMY A;  2YI6 A;  4K0K I;  2YKI A;  3C11 A;  3CRL A;  4O07 A;  4MU3 A;  4LOM A;  1ZM3 A;  1B63 A;  4DR2 I;  4OO1 F;  1YT1 A;  4PRX A;  4WUD A;  2HKE A;  5FWK A;  4LF7 E;  4IFD A;  5IN9 A;  5J6A A;  3CGZ A;  3QT8 A;  2PO1 A;  2HCH A;  3L7Z B;  2R3V A;  1S14 A;  2VWC A;  1IBK E;  1I5A A;  4DR3 I;  1UYL A;  2EFG A;  2QG2 A;  2FTK A;  2HK2 A;  1OYP A;  3PRY A;  1DAR A;  2YKB A;  3UHM A;  4L94 A;  3DGE A;  2UUB I;  5C0X A;  2BZ5 A;  5M4N A;  4CWS A;  4H85 A;  4BIZ A;  4B3T E;  4USM A;  1RRE A;  3S5T A;  3K85 A;  4L90 A;  3J80 Q;  1ZXN A;  4HZ5 A;  3WU6 A;  2X36 A;  4LPB A;  4MU4 A;  2V2V A;  1Y8P A;  5EKW A;  4JYA E;  2CCT A;  2FXS A;  2YKJ A;  3G7B A;  4DR5 I;  5ELW A;  2PO0 B;  4XKK A;  4JI7 I;  5DNX A;  1OJ4 A;  4L93 A;  4U3B A;  2YKC A;  1ZM9 A;  5FNC A;  3HHU A;  1E3H A;  4JI2 E;  1J5E E;  1YT0 A;  4YKR A;  4JI4 I;  4AIM A;  4QNJ A;  4KQV A;  4ED4 A;  1XMO E;  1L0O A;  4U3D A;  2YEJ A;  2YGE A;  1P42 A;  3T0H A;  5JEA B;  4AM3 A;  3GIE A;  4X9L A;  4P52 A;  3QTF A;  1MX0 A;  3TZ2 A;  2NN6 C;  1MU5 A;  4OX9 I;  4XIQ A;  4LCH A;  1XMQ E;  2PO2 B;  3HUL A;  4EEH A;  4XIT A;  1JM6 A;  1Z5B A;  4K0K E;  4KHP I;  3SL2 A;  2JT2 A;  4R1F A;  4KFG A;  2V34 A;  5JEA D;  1F51 A;  3A0W A;  4FW3 A;  4IZK A;  2YE5 A;  4URN A;  3CGY A;  3U2K A;  3LTO A;  2YJW A;  1OYS A;  2C37 A;  1Z0B A;  1Z0V A;  3B8H A;  1MG7 A;  4DR3 E;  1S4E A;  4LF4 I;  2YE2 A;  4UT4 A;  1UYD A;  4YKZ A;  4FPP A;  4LFB E;  4MP7 A;  1UY8 A;  2IWU A;  4EM7 A;  4X65 I;  2ZDX A;  4XTJ A;  1IBL I;  2BU6 A;  4R3A A;  3B25 A;  5BR8 I;  4ASB A;  2YI5 A;  4OO1 C;  2XX2 A;  3VHC A;  1ID0 A;  1BKN A;  4JAV A;  2O1T A;  4QPJ A;  1Y6Z A;  1Z0W A;  2IWS A;  1N0U A;  5JEA E;  3J81 Q;  1HNW E;  4L8Z A;  4CWO A;  1KTV A;  4YKX A;  4IFD C;  5IDJ A;  4V26 A;  1N0V C; 
#chains in the Genus database with same CATH homology
 4V25 A;  4HYM A;  2CH4 A;  3M6A A;  1R62 A;  5IT9 Q;  1Z59 A;  4KSG A;  1XNQ E;  4O09 A;  1UY9 A;  1ZW9 A;  1Y8N A;  2AKP A;  4URL A;  3A0Z A;  3JAM C;  2XCM A;  4JI4 E;  1UYH A;  4FWD A;  2PNR A;  4HYP A;  3ZXO A;  4MOT A;  4DPU A;  3EKR A;  2WW4 A;  2YE4 A;  3RKZ A;  5C93 A;  5LMN I;  1I94 I;  3J7A M;  1UYC A;  2K5B A;  3Q6M A;  3TUH A;  1Y8O A;  3EKO A;  4OX9 E;  4GKK I;  2WI7 A;  4EFT A;  1Z0C A;  4E00 A;  4LFC I;  1U2O A;  4B3T I;  3B27 A;  1H74 A;  4KHP E;  3EHH A;  3HZ5 A;  3INX A;  5L3J A;  1TC6 A;  3GIG B;  4GQT A;  5D7C A;  2H55 A;  1AH6 A;  3FV5 A;  4Z7Y A;  3B24 A;  4K4O A;  1TID A;  4YKW A;  3RLP A;  1N36 I;  5M4H A;  2ZDY A;  3PYG A;  4DUZ I;  2X7I A;  4DUY I;  4NH8 A;  5FLX Q;  4XD8 A;  4URM A;  4NH9 A;  4JI2 I;  3VHA A;  1U2R A;  2V2Q A;  2VCJ A;  1UYM A;  3J81 C;  1IBL E;  1HNZ E;  1YC3 A;  2C2A A;  5BR8 E;  2XHR A;  1PVG A;  3ZXQ A;  4IZJ B;  3ZZ0 A;  1TIL A;  2WI5 A;  1ELO A;  5IT9 C;  4MPN A;  3R91 A;  4LFA I;  3OPD A;  3TZ5 A;  4DV4 I;  2QF6 A;  2XHX A;  2Z5C A;  3G7E A;  5D7R A;  4U7O A;  1B3Q A;  3PYF A;  2UXC I;  3GIF A;  1D6T A;  4O0B A;  3T2S A;  2IOQ A;  4FN5 A;  4HY6 A;  3A0Y A;  3WHA A;  3KE6 A;  1ZXM A;  4CWN A;  1YSZ A;  2GQP A;  1BXD A;  2YEE A;  1GJV A;  5IDM A;  1ZM2 A;  2IOR A;  4AWP A;  5LMN E;  1I94 E;  2XD6 A;  4LFB I;  1N32 I;  1YER A;  1QZR A;  1KZN A;  4GKK E;  2BU7 A;  2YE7 A;  4H7Q A;  5M4P A;  3WU5 A;  4BXI A;  4DV1 I;  4LFC E;  2UXD I;  1YC1 A;  3T10 A;  1HNW I;  2EXL A;  1ZM4 A;  2VQF I;  2OI2 A;  5FLX C;  1I5C A;  4MP2 A;  3PYD A;  4QPK A;  2Q8I A;  4CWO A;  4L91 A;  5F5R A;  4FW9 A;  3R92 A;  1N36 E;  3PEJ A;  2CG9 A;  2GS8 A;  1XNQ I;  2F4V E;  4DUZ E;  1U0Z A;  4DV2 E;  4DUY E;  4LF6 I;  2YE8 A;  2YK9 A;  4FMT A;  1N33 I;  2HHH I;  2YGF A;  4HAC A;  2YEI A;  3B28 A;  4MPC A;  4Q20 A;  4GT8 A;  5D6Q A;  4EGK A;  4HXZ A;  3JZ3 A;  4DU7 A;  5BOD A;  3JAM Q;  4MB9 A;  4LFA E;  4I5S A;  2WEP A;  4H81 A;  4Z7C A;  4DV4 E;  2CGF A;  2YE3 A;  1EA6 A;  2CZ9 A;  2WEQ A;  3R4N A;  4AS9 A;  4PRV A;  2PNL A;  3C0E A;  1EI1 A;  2UXC E;  1UY7 A;  3HYY A;  4JI8 I;  2A2C A;  3QT6 A;  1IBM I;  4P8O A;  4X62 I;  4R3M A;  2XHT A;  1USV A;  1YC4 A;  5A2Q Q;  1I59 A;  1Z0T A;  2QFO A;  2ZKJ A;  4EFU A;  4ASG A;  4CE2 A;  2YE6 A;  3WQ9 A;  4KP4 A;  2LJP A;  1N32 E;  4FCP A;  3VHD A;  1HNZ I;  3OWB A;  4LWG A;  3T1K A;  3K17 A;  4BAE A;  2CGE A;  4DV1 E;  4O05 A;  4NXM I;  2UXD E;  4X66 E;  1HR0 I;  2UUC E;  4DV3 I;  1I5B A;  1ZWH A;  3Q5J A;  2VQF E;  1AM1 A;  1I58 A;  2AJ4 A;  4BIU A;  2H8M A;  1UEK A;  3OW6 A;  3BM9 A;  2YI7 A;  3V5R A;  4MYU A;  4DU8 A;  4XIP A;  5CF0 A;  3GON A;  4USK A;  3OTO E;  4LF6 E;  2BYH A;  2VQE I;  3K60 A;  4JI6 E;  4WUB A;  2HG1 A;  1N33 E;  2HHH E;  1WUU A;  2BT0 A;  4AWO A;  4CE1 A;  1AH8 A;  2UUA I;  4GFN A;  3R4M A;  2ZM6 I;  4DPY A;  2WI3 A;  1FNM A;  4E01 A;  2YEA A;  3CWV A;  2E5L E;  4ASA A;  2GQ0 A;  3D4J A;  3ZKD A;  5M4E A;  2O1U A;  2Z5B B;  2BV3 A;  4YHH I;  2Q2E B;  2UU9 I;  2ESA A;  1YES A;  2IOP A;  2VCI A;  4UTG A;  5A2Q C;  4FCR A;  2BRE A;  1H7S A;  3R4O A;  2E1R A;  2YEH A;  1S16 A;  1NZ0 A;  2NPF A;  4PU9 A;  2XX4 A;  5F3K A;  4JI8 E;  3LNU A;  1IBM E;  2UXB I;  3VAD A;  4X62 E;  2F4V I;  3Q5K A;  2DEI A;  1Z0E A;  4DV2 I;  1Z0G A;  1THN A;  2XX5 A;  2BYI A;  4MBC A;  2XAB A;  2JJC A;  2FWZ A;  4CWP A;  4DPX A;  4P7A A;  1HNX I;  1UYF A;  3PYE A;  3HJC A;  2VW5 A;  1HK7 A;  4WUC A;  4PL9 A;  4B3R E;  4XE2 A;  1KKH A;  4EMD A;  3QT5 A;  2J7K A;  1Z5A A;  4NXM E;  3IED A;  4U7N A;  1HR0 E;  4DV3 E;  3A0R A;  4RPF A;  2E0A A;  5CTX A;  3RLR A;  2FWY A;  5CTW A;  2PNM A;  1FJG I;  4IZJ D;  2BM1 A;  1Y4S A;  4XKO A;  2BU8 A;  3K98 A;  5FND A;  2YJX A;  3HYZ A;  2YEC A;  2VQE E;  1Z5C A;  1GKZ A;  1TH8 A;  5M4K A;  3WU3 A;  4JV5 I;  2UUA E;  4JAS A;  4KSH A;  3GIG A;  2ZM6 E;  4YY3 E;  5IWA I;  1YET A;  3B82 A;  4X64 I;  2GFD A;  2HK3 A;  4DR1 E;  4DR6 I;  4MYT A;  4DV0 I;  5BOC A;  2HFS A;  4JI0 I;  4W7T A;  2Q8G A;  4ASF A;  4YHH E;  2CCS A;  2YE9 A;  3EHF A;  2BTZ A;  2UU9 E;  4DV7 I;  4X66 I;  1K47 A;  4DV6 E;  2UUC I;  2BM0 A;  2Z5E A;  3V2U C;  2WI2 A;  5D7D A;  3B26 A;  2HFU A;  4HY1 A;  1AMW A;  3FT5 A;  2XEX A;  2XJJ A;  1KVK A;  2XDL A;  3O0I A;  4LWE A;  3T0Z A;  3TZ0 A;  4CWQ A;  2UXB E;  1B62 A;  3A0T A;  4LWF A;  4FWH A;  4NH7 A;  4KTN A;  4AWQ A;  2O1V A;  4IZJ A;  5LMU I;  1UYE A;  4GKJ I;  4GGL A;  5M4M A;  4ZVI A;  3OTO I;  1OSF A;  2XJG A;  2DEJ A;  4JI6 I;  4IZK B;  3U2D A;  4YKU A;  1HNX E;  4E02 A;  4DPT A;  2YEF A;  3G75 A;  2BU5 A;  2A2D A;  1BGQ A;  4LF5 I;  1GKX A;  2XDK A;  2E5L I;  1TBW A;  4NXN I;  4B3S I;  5D6P A;  3R4P A;  3H80 A;  4JI5 I;  3INW A;  1UYK A;  4I3H A;  2ZIT A;  4M1K A;  4JG4 A;  2WI6 A;  1USU A;  3HEK A;  1FJG E;  3HZ1 A;  3FT8 A;  4B6C A;  4LF8 E;  1RR9 A;  1PKP A;  3RLQ A;  1A6F A;  3Q5L A;  4CWT A;  4DR7 I;  5GMD A;  2BU2 A;  4JV5 E;  1QYE A;  4XIR A;  3J7A G;  4B3M I;  2XJX A;  5IWA E;  4URO A;  1VIS A;  4DR4 I;  3A0X A;  4X64 E;  4DXL A;  4DR6 E;  4DV0 E;  4JI0 E;  2V8P A;  2BRC A;  2FYP A;  4B3R I;  3T1Y I;  3ZM7 A;  2YED A;  1XNR I;  2XDS A;  4CWF A;  3O6O A;  4DV5 I;  4DV7 E;  1Y4U A;  5GME A;  4DR2 E;  1XHK A;  3Q1Q A;  2YGA A;  2Q8H A;  5CPH A;  1N34 I;  2XK2 A;  4FCQ A;  1TC0 A;  2VF3 A;  2ZBK B;  2XDU A;  3ZZU A;  5LMU E;  2CCU A;  1QY8 A;  2YK2 A;  4GKJ E;  4O04 A;  3T1H I;  4FWG A;  3LPS A;  3J80 C;  4JI3 I;  3MNR P;  3OMU A;  1PIE A;  5J71 A;  2UUB E;  1H72 C;  4LF5 E;  4YY3 I;  4YKY A;  5CTY A;  4JI1 I;  4AQY I;  3WU4 A;  2BSM A;  3NMQ A;  4JQL A;  4DR1 I;  2JKI A;  3EHG A;  3OWD A;  2WI1 A;  2V2Z A;  4B3S E;  4NXN E;  4LF9 I;  4EGH A;  4GCZ A;  1NHJ A;  4JI5 E;  2YI0 A;  3D2R A;  4DR5 E;  4DV6 I;  1H73 A;  5LL6 R;  4LF7 I;  4YKT A;  4XDM A;  2IWX A;  4DZY A;  4JI7 E;  1YSR A;  3B78 A;  3CRK A;  5GGZ A;  4XCL A;  4EMV A;  3U67 A;  3TTZ A;  4EGI A;  4DR7 E;  1AJ6 A;  1IBK I;  2Z5C B;  1NHH A;  1UY6 A;  3TZ4 A;  1A4H A;  4LWI A;  3QT7 A;  4B3M E;  1FWL A;  1FKA E;  2XDX A;  4DR4 E;  2WI4 A;  5FNF A;  4U93 A;  1H7U A;  4DPW A;  1NHI A;  4DUH A;  3ZZT A;  2Q8F A;  2YEB A;  3K97 A;  3T1Y E;  4ZKI A;  3K1J A;  1XNR E;  1YS3 A;  4DV5 E;  2R42 A;  3O2F A;  4XKA A;  1N34 E;  1YT2 A;  3D36 A;  4BQG A;  4JYA I;  1BYQ A;  1UYG A;  4CE3 A;  2YKE A;  4B7P A;  3H4L A;  4HZ0 A;  4N3O A;  4LF8 I;  4LF4 E;  3Q6N A;  2QG0 A;  4XCJ A;  2Z5B A;  1J5E I;  3ZKB A;  3T1H E;  1FI4 A;  3PEH A;  3K99 A;  5CTU A;  4X65 E;  1XMO I;  4XC0 A;  4JI3 E;  4LP0 A;  2UWD A;  4GEE A;  1UYI A;  2YEG A;  3QDD A;  4YKQ A;  1US7 A;  3EHJ A;  4BQJ A;  4AQY E;  4JI1 E;  3D0B A;  3P06 A;  4CWR A;  4JAU A;  3F0N A;  4LWH A;  1KIJ A;  1XMQ I;  1I5D A;  4MPE A;  1FWK A;  3BMY A;  2HKJ A;  2O1W A;  4HAC B;  4LF9 E;  3CRL A;  2YI6 A;  4K0K I;  2YKI A;  3C11 A;  4O07 A;  1ZM3 A;  1B63 A;  4DR2 I;  2WER A;  1YT1 A;  4PRX A;  4WUD A;  2HKE A;  5FWK A;  4LF7 E;  4HXW A;  5IN9 A;  5J6A A;  3CGZ A;  3QT8 A;  2HCH A;  2R3V A;  1S14 A;  2VWC A;  1IBK E;  1I5A A;  4DR3 I;  1UYL A;  2EFG A;  2QG2 A;  2HK2 A;  3PRY A;  1DAR A;  2YKB A;  4L94 A;  3DGE A;  2UUB I;  2BZ5 A;  5M4N A;  4CWS A;  4H85 A;  4BIZ A;  4B3T E;  4USM A;  1RRE A;  3K85 A;  4L90 A;  3J80 Q;  1ZXN A;  4HZ5 A;  3WU6 A;  2X36 A;  4LPB A;  2V2V A;  1Y8P A;  4JYA E;  2CCT A;  2FXS A;  2YKJ A;  3G7B A;  4DR5 I;  4XKK A;  4JI7 I;  1OJ4 A;  4L93 A;  5FNC A;  2YKC A;  1ZM9 A;  3HHU A;  1YT0 A;  4JI2 E;  1J5E E;  4YKR A;  4JI4 I;  4KQV A;  4ED4 A;  1XMO E;  1L0O A;  2YEJ A;  2YGE A;  3T0H A;  3GIE A;  4X9L A;  4P52 A;  3QTF A;  1MX0 A;  3TZ2 A;  1MU5 A;  4OX9 I;  4XIQ A;  1XMQ E;  3HUL A;  4EEH A;  4XIT A;  1JM6 A;  1Z5B A;  4K0K E;  4KHP I;  3SL2 A;  4R1F A;  4KFG A;  2V34 A;  3A0W A;  4IZK A;  4URN A;  2YE5 A;  3CGY A;  3U2K A;  3LTO A;  2YJW A;  1Z0B A;  1Z0V A;  3B8H A;  1MG7 A;  4DR3 E;  1S4E A;  4LF4 I;  2YE2 A;  4UT4 A;  1UYD A;  4YKZ A;  4FPP A;  4LFB E;  4MP7 A;  1UY8 A;  2IWU A;  4EM7 A;  4X65 I;  2ZDX A;  4XTJ A;  1IBL I;  2BU6 A;  4R3A A;  3B25 A;  5BR8 I;  4ASB A;  2YI5 A;  3VHC A;  2XX2 A;  1ID0 A;  1BKN A;  4JAV A;  2O1T A;  4QPJ A;  1Y6Z A;  1Z0W A;  2IWS A;  1N0U A;  3J81 Q;  4L8Z A;  1HNW E;  1KTV A;  4YKX A;  5IDJ A;  4V26 A;  1N0V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...