1PVGA

Crystal structure of the atpase region of saccharomyces cerevisiae topoisomerase ii
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
400
structure length
378
Chain Sequence
SASDKYQKISQLEHILKRPDTYIGSVETQEQLQWIYDEETDCMIEKNVTIVPGLFKIFDEILVNAADNKVRDPSMKRIDVNIHAEEHTIEVKNDGKGIPIEIHNKENIYIPEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILETADLNVGQKYVQKWENNMSICHPPKITSYKKGPSYTKVTFKPDLTRFGMKELDNDILGVMRRRVYDINGSVRDINVYLNGKSLKIRNFKNYVELYLKSLIPTILYERINNRWEVAFAVSDISFQQISFVNSIATTMGGTHVNYITDQIVKKISEILKKVKSFQIKNNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCEIPLEYINKIMKTDLATRMFEIADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the topoisomerase II ATPase region and its mechanism of inhibition by the chemotherapeutic agent ICRF-187
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
molecule keywords DNA topoisomerase II
total genus 113
structure length 378
sequence length 400
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2003-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1pvgA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1pvgA01
2EFGA 4DV0E 4LF6E 4NH7A 2V8PA 2HKEA 1KKHA 1Z0CA 2HFUA 3K98A 3O6OA 4KHPI 2XDXA 5BR8I 4DV4I 1QYEA 1AH8A 1ZM2A 1TILA 1U0ZA 1PKPA 4XCJA 4YKTA 3WHAA 4KHPE 3OWBA 3PEJA 4U93A 4JI5E 1THNA 1Z0VA 4CE3A 4DV7E 1YT1A 3K17A 4DV2I 4YKUA 4FWHA 3D36A 4KSHA 2YEFA 3TTZA 4LF8I 1US7A 2XDLA 5CTYA 2Q8HA 2YGEA 3EKOA 4LFBE 2BRCA 5M4PA 3JAMQ 5C93A 5GMEA 3B8HA 3T1HE 4JI3I 1UY8A 2CG9A 4QPKA 2XHTA 4O09A 1BXDA 3D4JA 3KE6A 4XCLA 4DV0I 4LF6I 1Y8PA 2O1WA 3B27A 3R4NA 3RLQA 4JI3E 3HYZA 4JI6E 1N32I 1HNWI 1HNXI 1I5DA 3R92A 3WQ9A 2IOPA 4BQJA 4MP2A 3VHAA 1XNRI 1ELOA 1PIEA 5J71A 4JASA 4L8ZA 4PRXA 1YT0A 5LMNE 5FLXC 2R42A 4L94A 2ZM6I 1NHHA 5CF0A 1H7UA 2QFOA 1YSRA 2BM1A 2IORA 2UXDE 4PL9A 4DR7I 3WU4A 4JAUA 2UUAE 5F3KA 4EM7A 4JI2I 1XMOE 2YK9A 2DEJA 3EHGA 4LWFA 4UROA 4DPXA 3G75A 4DR5E 2QG2A 3A0RA 4EMVA 4FCRA 4X66E 3ZXOA 3OW6A 2V2VA 3G7EA 1N36I 3HULA 4DV1E 3OPDA 3TZ0A 2UUBI 1FNMA 5D6QA 4LF9E 3LTOA 3K60A 2XDKA 3Q5JA 4BQGA 4MYUA 2JKIA 3INWA 2YEAA 5J6AA 1XHKA 1UYKA 2HHHE 1NHIA 4JI4E 3F0NA 4JI7E 1Z5BA 2BV3A 4HACB 1N34I 4X64E 1TIDA 2XHXA 2YE3A 3GIGB 2XDUA 2YE6A 4LF5E 4OX9I 4YKWA 2YEDA 4AQYI 3FV5A 3LNUA 1N33I 1Z59A 1UYEA 3B24A 2V34A 4V25A 1UYCA 1N33E 4XITA 3HZ5A 4K0KI 1H74A 1TC0A 1K47A 2YJXA 1S4EA 2LJPA 4JI5I 1I59A 1N0UA 1UY7A 2OI2A 1EA6A 3HYYA 2R3VA 3CRLA 5IDMA 2ESAA 2YKCA 3QT7A 2ZBKB 2UXCI 3B25A 2CCSA 2H8MA 2WI7A 2XD6A 4BAEA 4Q20A 3Q5LA 3J81Q 3ZZUA 3B82A 2Q8FA 4CWRA 1Y4UA 4QPJA 1HNZE 2XHRA 4ASAA 4DR2E 4JI6I 3OTOI 1IBKI 1S16A 2JJCA 3K99A 3CWVA 4WUDA 4HXWA 4MPEA 4ED4A 1QZRA 2BU7A 1KVKA 1HR0I 4DR6E 1UYHA 4K0KE 3GIFA 4AWPA 4EEHA 4XE2A 4XD8A 2BU8A 2ZM6E 3OMUA 4CWPA 4ZVIA 1YS3A 4DUHA 1Z0GA 4YKQA 2WW4A 4CWOA 2YKEA 1ZM9A 4L93A 2YEBA 4DR1E 2C2AA 2V2QA 4DV3E 4LPBA 3A0ZA 4HACA 3JAMC 1L0OA 4ASGA 4U7OA 4JI0E 2FYPA 3A0TA 5BR8E 3FT5A 3HZ1A 4YHHI 4JV5I 1ZWHA 5GMDA 4YKRA 4B3RE 2EXLA 1IBME 4LF9I 3U67A 4EFUA 4X66I 4LF4E 3R4MA 4MP7A 3PYEA 1MG7A 2PNRA 4HY6A 4B7PA 4CWFA 2ZKJA 4L90A 3RLRA 2XABA 3R91A 4CWSA 1XMOI 4KP4A 2VCJA 3ZM7A 4DR3I 2WI3A 3K1JA 1N34E 4DR7E 4CWTA 2HFSA 4JYAE 3J81C 2UUAI 3WU5A 4XIPA 1BKNA 2BU2A 2YEJA 2YE8A 4LF7E 4JI1I 2Q8IA 1FKAE 4LF7I 1PVGA 2UU9I 1ZM3A 1ZM4A 1FJGE 2F4VE 4URLA 2YKBA 1TH8A 4Z7CA 2YK2A 3PEHA 2HCHA 5BODA 3LPSA 2BT0A 3EHFA 4CWNA 1MX0A 4CWQA 5D6PA 4DPTA 4H7QA 2E0AA 4URMA 2BSMA 4DUYI 1YSZA 2GQPA 3EHJA 2QG0A 4FPPA 4LWHA 1AJ6A 3FT8A 4MPNA 1A4HA 4O04A 3QTFA 1J5EE 5D7CA 4EGKA 4X65I 3V5RA 2BREA 2HG1A 2YI5A 1J5EI 4XKAA 4DUZI 5M4NA 3PYDA 4X65E 3NMQA 4FN5A 5M4KA 2XX4A 4JI8I 3EHHA 4LFCI 4AQYE 4LF5I 4OX9E 2UUCI 2YE2A 2UWDA 4CE2A 4P7AA 3H80A 1H72C 4HYPA 4E00A 4DPUA 4DV5E 3CGZA 5CTWA 1OJ4A 1NHJA 5LMUE 1KIJA 2CH4A 2UUCE 4GT8A 4GCZA 5LL6R 1WUUA 4GGLA 4X9LA 5LMUI 4B3ME 2UXBE 4DV5I 4DV4E 2YEEA 4DUZE 3WU6A 3M6AA 1HNXE 2WERA 4DU7A 2X7IA 2O1UA 4NH9A 2BU6A 4O07A 5IN9A 1UYGA 2XX5A 1UY6A 4NXNE 3BMYA 4XIRA 2XJGA 1Z0TA 4R3MA 4XKKA 2DEIA 2XJJA 3J7AG 4PU9A 4EGIA 1UEKA 4B3MI 4DZYA 5A2QC 3H4LA 4XC0A 1YERA 4EFTA 1KZNA 3DGEA 2E5LI 1GKZA 5D7DA 1GKXA 3SL2A 3ZXQA 4AWQA 4B3TI 2IWXA 4NH8A 1EI1A 2VQFI 4DV3I 2VW5A 2VCIA 4P8OA 3WU3A 1HNWE 4RPFA 4H85A 4JI0I 4E01A 2NPFA 3B26A 5GGZA 2WI1A 3U2DA 2A2DA 1TC6A 1XMQI 1N36E 3HEKA 4DR1I 3GIEA 1ZXMA 4DR6I 3TZ2A 4ZKIA 4DR4E 1I5CA 2YECA 4MYTA 4UTGA 4USMA 3T1YE 4O05A 2YGAA 3HHUA 3TZ4A 4FCPA 4I5SA 4DV2E 1BYQA 4BIZA 4HXZA 5D7RA 2HK2A 2HHHI 4JI4I 5IT9Q 1JM6A 4MB9A 3Q5KA 4LF4I 4E02A 1YC1A 4LFBI 4NXME 2FWZA 1GJVA 4W7TA 2ZDXA 2H55A 1YETA 4YHHE 4JV5E 1Y4SA 2WEQA 2YEIA 1B62A 2F4VI 4DV1I 4MPCA 3TZ5A 3VHDA 2X36A 3B28A 4DR5I 1Y8NA 2CCUA 2QF6A 1AMWA 4LWEA 1H73A 5F5RA 5L3JA 4JI1E 1Z5AA 2VQEI 2YE9A 3A0WA 4DU8A 3R4OA 4DR4I 1FI4A 2YEHA 4V26A 5A2QQ 2VWCA 3T1YI 3GONA 3PYFA 3K97A 1H7SA 5FNDA 4JI2E 3QT5A 2BTZA 4USKA 2UXDI 1Y8OA 2WI6A 3RKZA 1U2OA 5IWAI 1YESA 3U2KA 3O0IA 2YI7A 1UYFA 2UXBI 4B6CA 1HNZI 4KQVA 2A2CA 1XNQE 1I94I 4HZ0A 4KTNA 4XTJA 2XX2A 4CE1A 3OWDA 4HZ5A 1NZ0A 2YI0A 4O0BA 4H81A 2YJWA 4LP0A 1Z0WA 1Z0EA 2E1RA 2FWYA 4KFGA 1I58A 5CTUA 4FW9A 4LWIA 1AH6A 4PRVA 3O2FA 1B63A 4KSGA 5CPHA 2YKJA 2HKJA 4LFAI 3R4PA 2WEPA 5CTXA 2J7KA 5IT9C 3MNRP 2WI2A 3T2SA 4R1FA 4XDMA 5M4EA 4YY3I 3ZKDA 4X62I 4EMDA 2GFDA 3RLPA 3T1HI 2IWUA 3B78A 1XMQE 4YY3E 4X62E 4GEEA 4LWGA 4YKYA 4B3SI 1I5AA 3QDDA 5M4HA 1RREA 4DV7I 4X64I 3Q1QA 1UYMA 2XCMA 1IBMI 1KTVA 1FWKA 2YE5A 2BM0A 4YKXA 4Z7YA 3OTOE 1IBKE 2XJXA 4AS9A 2FXSA 4DR2I 2YE7A 4JAVA 4EGHA 5M4MA 1FWLA 3BM9A 2AJ4A 3J80C 4JG4A 1UYIA 3V2UC 3QT6A 4NXMI 1VISA 4DPWA 4JQLA 3T0HA 1ZW9A 3QT8A 2E5LE 1U2RA 4B3SE 1N32E 2UXCE 3EKRA 1YC4A 1TBWA 4DPYA 5IDJA 1D6TA 4U7NA 1Z0BA 2WI5A 4M1KA 4R3AA 1AM1A 1BGQA 2ZDYA 4NXNI 2XK2A 2AKPA 4LF8E 1Z5CA 4FWDA 4GFNA 4FCQA 3C0EA 1R62A 3C11A 1B3QA 5LMNI 4FMTA 2VQFE 1FJGI 3PYGA 4GKKI 3TUHA 2Q2EB 5FNCA 1DARA 3ZKBA 1UYDA 4GKKE 4BXIA 3ZZ0A 2BYHA 2IOQA 4B3TE 1I94E 3D0BA 5FWKA 3ZZTA 1XNRE 3G7BA 3GIGA 4HY1A 4GQTA 4DR3E 5IWAE 3J7AM 4LFCE 3INXA 1UY9A 3CRKA 3T1KA 4JYAI 1MU5A 4DXLA 1S14A 2VF3A 3VADA 2V2ZA 2K5BA 1IBLI 4XIQA 4GKJI 2YE4A 4I3HA 4B3RI 2BZ5A 5BOCA 1OSFA 2Q8GA 5FLXQ 3A0XA 3CGYA 2VQEE 4MOTA 4DV6E 2CGFA 4K4OA 3A0YA 4XKOA 1YC3A 4WUBA 1N0VC 4WUCA 4JI7I 4LFAE 3VHCA 4FWGA 5FNFA 2XDSA 1XNQI 3JZ3A 2HK3A 4L91A 2CZ9A 1A6FA 4P52A 4ASFA 4AWOA 1RR9A 2UU9E 1ID0A 1QY8A 4JI8E 2IWSA 2CCTA 2YEGA 4UT4A 1ZXNA 2UUBE 4BIUA 1HR0E 3D2RA 4HYMA 4DV6I 1UYLA 2BYIA 1YT2A 3T10A 3J80Q 2BU5A 1IBLE 4ASBA 2XEXA 4GKJE 4DUYE 2ZITA 2O1VA 4YKZA 3T0ZA 3IEDA 2WI4A 2YI6A 2YGFA 1I5BA 4MBCA 4URNA 2GS8A 2YKIA
chains in the Genus database with same CATH superfamily
2EFGA 4DV0E 4LF6E 4NH7A 2V8PA 3L7ZA 2HKEA 2O3ZA 5EKWA 1KKHA 1Z0CA 2HFUA 3K98A 3O6OA 4KHPI 4MDTA 2XDXA 2GQ0A 5JEAA 4DV4I 5BR8I 1AH8A 1ZM2A 1QYEA 1TILA 1U0ZA 2JE6A 1PKPA 1F51A 5K36D 4FW3A 4XCJA 4YKTA 3WHAA 4KHPE 3OWBA 3PEJA 4U93A 4JI5E 2Z5BA 1Z0VA 4IFDB 1THNA 4DV7E 1YT1A 4CE3A 3K17A 1XXEA 4DV2I 4YKUA 4FWHA 1UDNA 5JEAF 3D36A 2YEFA 4KSHA 3TTZA 5JENA 4LF8I 1US7A 2XDLA 5CTYA 2Q8HA 1Y5YA 2YGEA 3EKOA 4LFBE 2BRCA 5M4PA 3JAMQ 5C93A 5GMEA 3B8HA 3T1HE 4JI3I 1UY8A 2CG9A 4QPKA 2XHTA 4O09A 1BXDA 3D4JA 4IFDA 3KE6A 4XCLA 4DV0I 4LF6I 1Y8PA 2O1WA 3B27A 3R4NA 3RLQA 4JI3E 3LMMA 3HYZA 4JI6E 1N32I 5C0XE 1HNWI 1HNXI 1I5DA 3R92A 3S5TA 3WQ9A 2IOPA 4BQJA 4MP2A 3VHAA 1XNRI 1ELOA 1PIEA 5J71A 4JASA 4L8ZA 4PRXA 1YT0A 5LMNE 5FLXC 2R42A 4L94A 2ZM6I 1NHHA 5CF0A 5K36B 1H7UA 2QFOA 1YSRA 2BM1A 2IORA 2UXDE 2NN6F 4PL9A 4DR7I 5EL9A 3WU4A 4JAUA 2UUAE 4BA2B 4OO1C 5F3KA 2PNMA 4IZJB 4EM7A 4JI2I 4LCGA 1XMOE 2YK9A 3UHMA 2DEJA 3EHGA 1R6MA 4LWFA 4MU0A 4UROA 2JEBB 4DPXA 3G75A 4DR5E 4IZKA 4MU3A 2QG2A 3A0RA 4EMVA 4FCRA 4X66E 3ZXOA 3OW6A 2V2VA 3G7EA 1N36I 1USUA 3HULA 4DV1E 3OPDA 1E3PA 3TZ0A 2UUBI 4IZJA 1FNMA 5D6QA 3HJCA 4LF9E 3LTOA 3K60A 2XDKA 3Q5JA 4BQGA 2WP8B 4MYUA 3M7ND 2JKIA 2YEAA 3INWA 5J6AA 1XHKA 1UYKA 2HHHE 1NHIA 4IZJD 4JI4E 3F0NA 4LCHA 5DRRA 4JI7E 1Z5BA 2BV3A 4FW5A 3B4TA 4HACB 1N34I 4X64E 2C37B 4FW4A 1TIDA 2XHXA 2XDUA 2YE6A 4LF5E 4OX9I 2YE3A 2J65A 4YKWA 2YEDA 4AQYI 3FV5A 3LNUA 1N33I 1Z59A 1UYEA 3B24A 4GQUA 2V34A 4V25A 3K85A 1UYCA 1N33E 4XITA 1YH8A 3HZ5A 2GO4A 1H74A 4K0KI 1TC0A 1K47A 2C1GA 5DNLA 1S4EA 1E3HA 2LJPA 2YJXA 4JI5I 1I59A 1N0UA 1UY7A 2OI2A 1EA6A 3HYYA 2R3VA 3CRLA 5IDMA 4MU1A 2ESAA 2YKCA 3QT7A 2ZBKB 2UXCI 3B25A 2CCSA 4E72A 3CDIA 2H8MA 2WI7A 2XD6A 4BAEA 4Q20A 3Q5LA 3U1KA 3J81Q 3ZZUA 3B82A 2Q8FA 2CGEA 4CWRA 1Y4UA 4QPJA 3KRNA 1HNZE 4OO1B 2XHRA 4ASAA 4DR2E 3P06A 4JI6I 3OTOI 1IBKI 1OYPA 1S16A 2JJCA 3K99A 3CWVA 3PS3A 4WUDA 4HXWA 4ED4A 2YK2A 5C0XC 4MPEA 1QZRA 2BU7A 1KVKA 1HR0I 2PO1A 4DR6E 1UYHA 2FTKA 4K0KE 3GIFA 4AWPA 4EEHA 4XE2A 4XD8A 2BU8A 2ZM6E 3OMUA 4CWPA 4ZVIA 1YS3A 4DUHA 1Z0GA 4YKQA 2PO0A 2WW4A 4CWOA 2YKEA 1ZM9A 4LOMA 4L93A 2YEBA 5K36F 4DR1E 2C2AA 2V2QA 4DV3E 1Y60A 4LPBA 3A0ZA 4HACA 2NN6B 5DNXA 3JAMC 1L0OA 4ASGA 4U7OA 4JI0E 4OO1F 2FYPA 3A0TA 5BR8E 4IZKB 3FT5A 3HZ1A 4YHHI 4JV5I 1ZWHA 5GMDA 4YKRA 4B3RE 2EXLA 1IBME 4LF9I 2IESA 3U67A 4EFUA 4X66I 4LF4E 3R4MA 4MP7A 4LCFA 3P76A 3PYEA 1MG7A 2PNRA 4HY6A 4B7PA 4CWFA 2ZKJA 4L90A 3RLRA 2XABA 3R91A 4CWSA 2WP8A 1XMOI 4KP4A 2VCJA 3ZM7A 4OZEA 2PNZA 4DR3I 2WI3A 3K1JA 3DD6A 1N34E 4DR7E 4CWTA 2HFSA 4JYAE 3J81C 3M85G 3WU5A 2UUAI 4XIPA 1BKNA 2BU2A 4AIDA 2YEJA 2YE8A 4LF7E 2PO2A 4JI1I 2BR2A 2Q8IA 1FKAE 4LF7I 1PVGA 2UU9I 1ZM3A 1ZM4A 1FJGE 2F4VE 1YHCA 4URLA 1Y6ZA 2Z5EA 2PNZB 4Z7CA 1TH8A 3PEHA 2JEAB 2HCHA 5BODA 3LPSA 5K36A 2C37A 2BT0A 3EHFA 4CWNA 1MX0A 4CWQA 5D6PA 4DPTA 4H7QA 2E0AA 4URMA 2BSMA 4DUYI 1YSZA 2HHIA 2GQPA 3EHJA 2QG0A 4FPPA 4LWHA 1AJ6A 3FT8A 4MPNA 1A4HA 4O04A 3QTFA 3Q6MA 1J5EE 5D7CA 4EGKA 4X65I 2VESA 3V5RA 2BREA 1OYSA 2HG1A 1J5EI 1VI7A 2YI5A 4DUZI 4XKAA 4QNKA 5C0XF 5M4NA 3PYDA 4X65E 3NMQA 4BA1A 4FN5A 5M4KA 2XX4A 4OKGA 3GLLA 4J3DA 4JI8I 3EHHA 4LFCI 4AQYE 4LF5I 4OX9E 2UUCI 1IXMA 2YE2A 2UWDA 4CE2A 4P7AA 3H80A 1H72C 4HYPA 4E00A 4DPUA 4DV5E 3CGZA 5CTWA 1OJ4A 1NHJA 4QNJA 5LMUE 1KIJA 4OO1D 2CH4A 2UUCE 4GT8A 4GCZA 5LL6R 1WUUA 5K36E 4GGLA 4X9LA 5LMUI 3NZKA 2WNRA 4B3ME 4DV5I 2UXBE 4DV4E 1UDQA 4DUZE 2YEEA 3WU6A 3M6AA 1HNXE 2WERA 2O1UA 2X7IA 4DU7A 4NH9A 2JEAA 2JT2A 4MU4A 5K36C 1UYGA 2BU6A 2NN6A 4O07A 5IN9A 2XX5A 1UY6A 4NXNE 5C0XB 3BMYA 4XIRA 2PO2B 2XJGA 1Z0TA 4R3MA 4XKKA 2DEIA 5JEAC 4IFDD 3J7AG 4PU9A 2XJJA 4EGIA 1UEKA 4AIMA 4B3MI 5A2QC 4DZYA 3H4LA 4XC0A 4IFDC 1YERA 4EFTA 1KZNA 3DGEA 2E5LI 1GKZA 5D7DA 1GKXA 3CDJA 3SL2A 3ZXQA 4AWQA 5C0XA 4B3TI 2IWXA 4NH8A 1EI1A 2VQFI 4DV3I 2VW5A 2VCIA 2BA0G 4P8OA 3WU3A 2C38B 4IFDE 1HNWE 1OYRA 4RPFA 4H85A 4JI0I 1USVA 4E01A 3PS2A 2NPFA 3B26A 2WI1A 5GGZA 3U2DA 2A2DA 1TC6A 1XMQI 1N36E 3HEKA 2WNRB 4DR1I 4LPFA 3GIEA 1ZXMA 4DR6I 3TZ2A 4ZKIA 4DR4E 3CYGA 1I5CA 2YECA 4MYTA 4UTGA 4USMA 3T1YE 4O05A 2YGAA 3HHUA 3TZ4A 4FCPA 4I5SA 3PRYA 4DV2E 1BYQA 4BIZA 4HXZA 2NN6D 3PS1A 5D7RA 2HK2A 2HHHI 4JI4I 2GO3A 2JE6B 5IT9Q 1JM6A 3P3EA 3M7NG 4MB9A 3Q5KA 4LF4I 4E02A 2PO0B 1YC1A 4LFBI 4IS9A 4NXME 2FWZA 1GJVA 4W7TA 2ZDXA 3L7ZB 2CVEA 2YKBA 4FW6A 2H55A 1YETA 1Y4SA 4YHHE 4JV5E 2JEBA 2WEQA 2YEIA 1B62A 2F4VI 4DV1I 4MPCA 3TZ5A 3VHDA 2X36A 3B28A 4DR5I 1Y8NA 2CCUA 2QF6A 1AMWA 4LWEA 1H73A 5F5RA 5L3JA 4JI1E 1Z5AA 2VQEI 2YE9A 3A0WA 4DU8A 2IERA 4DR4I 1FI4A 2YEHA 3R4OA 5A2QQ 4V26A 4N3OA 2VWCA 3T1YI 3GONA 3PYFA 3K97A 1H7SA 5FNDA 3QT5A 4JI2E 2BTZA 4USKA 2UXDI 1Y8OA 2WI6A 1RHYA 3RKZA 1U2OA 5IWAI 3HKMA 1YESA 3U2KA 3O0IA 2YI7A 1UYFA 2UXBI 4B6CA 1HNZI 4KQVA 5DRQA 3U1YA 2A2CA 1I94I 1XNQE 2PO1B 4HZ0A 2C1IA 4KTNA 4XTJA 2C39A 2XX2A 4CE1A 3OWDA 4HZ5A 1NZ0A 2YI0A 4O0BA 4H81A 4AM3A 2YJWA 4LP0A 1Z0WA 1Z0EA 2E1RA 2FWYA 4KFGA 1I58A 5CTUA 4FW9A 4LWIA 1AH6A 4PRVA 3O2FA 1B63A 4KSGA 5CPHA 2YKJA 2HKJA 4LFAI 3R4PA 2WEPA 2BA1G 2J7KA 5CTXA 5IT9C 3MNRP 2WI2A 3T2SA 4R1FA 4XDMA 5M4EA 2Z5BB 4YY3I 3ZKDA 4X62I 4EMDA 2GFDA 3RLPA 3T1HI 2IWUA 3B78A 1XMQE 4YY3E 4X62E 4GEEA 4LWGA 3GCMA 4YKYA 4B3SI 1I5AA 3QDDA 5M4HA 1RREA 4DV7I 4X64I 3Q1QA 1UYMA 2XCMA 1IBMI 1KTVA 1FWKA 2YE5A 2BM0A 4YKXA 4MQYA 4Z7YA 3OTOE 1IBKE 2XJXA 2FXSA 4DR2I 2YE7A 1R6LA 4JAVA 4AS9A 4EGHA 1FWLA 5M4MA 3BM9A 5C0XD 2AJ4A 3J80C 4JG4A 1UYIA 3V2UC 3QT6A 4NXMI 1VISA 4DPWA 1HK7A 4JQLA 3T0HA 1ZW9A 4BA2A 3QT8A 2E5LE 1U2RA 4IFDF 4B3SE 1N32E 3GIGB 2UXCE 3EKRA 1YC4A 4NBQA 5JEAB 1TBWA 4DPYA 5IDJA 1D6TA 4U7NA 1Z0BA 2WI5A 3Q6NA 4M1KA 4R3AA 1P42A 1UDSA 2Z5CA 1AM1A 1BGQA 2ZDYA 4NXNI 2XK2A 2AKPA 4LF8E 1Z5CA 4FWDA 4GFNA 3H1CA 4FW7A 4FCQA 3C0EA 1R62A 3C11A 1B3QA 5LMNI 3GMEA 2VQFE 1FJGI 3PYGA 4GKKI 4FMTA 3P3GA 3TUHA 2Q2EB 2NN6C 5FNCA 2BA1D 1DARA 3ZKBA 1UYDA 4U3BA 4GKKE 1UDOA 4BXIA 3ZZ0A 2BA0D 2BYHA 2IOQA 4B3TE 1I94E 5FWKA 3D0BA 3ZZTA 1XNRE 3G7BA 3GIGA 4HY1A 4GQTA 2NN6E 5DRPA 5IWAE 4DR3E 3J7AM 4LFCE 3INXA 1UY9A 3CRKA 3T1KA 5JEAE 4JYAI 1MU5A 4DXLA 1S14A 2VF3A 2AE8A 3VADA 2V2ZA 2K5BA 4ISAA 1IBLI 4XIQA 4GKJI 2YE4A 4I3HA 4B3RI 2BZ5A 5BOCA 1OSFA 2Q8GA 5FLXQ 3A0XA 3CGYA 2VQEE 4MOTA 4DV6E 2CGFA 4K4OA 4BA1B 3A0YA 2C39B 5JEAD 3P3CA 1YC3A 2F1DA 4XKOA 4WUBA 1N0VC 4WUCA 2Z5CB 4JI7I 5DROA 4LFAE 3VHCA 4FWGA 5FNFA 2XDSA 1XNQI 3JZ3A 2HK3A 3M85D 4L91A 2CZ9A 4P52A 1A6FA 5ELWA 4OO1E 1RR9A 4ASFA 4AWOA 2UU9E 1ID0A 1QY8A 4JI8E 2IWSA 2CCTA 2YEGA 2PNLA 4OO1A 4UT4A 1ZXNA 2UUBE 4BIUA 1HR0E 3D2RA 4HYMA 4DV6I 1UYLA 2C38A 2BYIA 1YT2A 3T10A 3J80Q 2BU5A 1IBLE 4ASBA 2XEXA 4GKJE 2O1TA 4DUYE 2ZITA 2O1VA 4YKZA 3T0ZA 3IEDA 2WI4A 2YI6A 2YGFA 1I5BA 4MBCA 4U3DA 4URNA 2BR2B 2GS8A 2YKIA
chains in the Genus database with same CATH topology
2EFGA 4DV0E 4LF6E 4NH7A 2V8PA 2HKEA 1KKHA 1Z0CA 2HFUA 3K98A 3O6OA 4KHPI 2XDXA 2GQ0A 5BR8I 4DV4I 1QYEA 1AH8A 1ZM2A 1TILA 1U0ZA 1PKPA 4XCJA 4YKTA 3WHAA 4KHPE 3OWBA 3PEJA 4U93A 4JI5E 2Z5BA 1Z0VA 1THNA 4CE3A 4DV7E 1YT1A 3K17A 4DV2I 4YKUA 4FWHA 3D36A 4KSHA 2YEFA 3TTZA 4LF8I 1US7A 2XDLA 5CTYA 2Q8HA 2YGEA 3EKOA 4LFBE 2BRCA 5M4PA 3JAMQ 5C93A 5GMEA 3B8HA 3T1HE 4JI3I 1UY8A 2CG9A 4QPKA 2XHTA 4O09A 1BXDA 3D4JA 3KE6A 4XCLA 4DV0I 4LF6I 1Y8PA 2O1WA 3B27A 3R4NA 3RLQA 4JI3E 3HYZA 4JI6E 1N32I 1HNWI 1HNXI 1I5DA 3R92A 3WQ9A 2IOPA 4BQJA 4MP2A 3VHAA 1XNRI 1ELOA 1PIEA 5J71A 4JASA 4L8ZA 4PRXA 1YT0A 5LMNE 5FLXC 2R42A 4L94A 2ZM6I 1NHHA 5CF0A 1H7UA 2QFOA 1YSRA 2BM1A 2IORA 2UXDE 4PL9A 4DR7I 3WU4A 4JAUA 2UUAE 5F3KA 2PNMA 4IZJB 4EM7A 4JI2I 1XMOE 2YK9A 2DEJA 3EHGA 4LWFA 4UROA 4DPXA 3G75A 4DR5E 4IZKA 2QG2A 3A0RA 4EMVA 4FCRA 4X66E 3ZXOA 3OW6A 2V2VA 3G7EA 1N36I 1USUA 3HULA 4DV1E 3OPDA 3TZ0A 2UUBI 4IZJA 1FNMA 5D6QA 3HJCA 4LF9E 3LTOA 3K60A 2XDKA 3Q5JA 4BQGA 4MYUA 2JKIA 3INWA 2YEAA 5J6AA 1XHKA 1UYKA 2HHHE 1NHIA 4IZJD 4JI4E 3F0NA 4JI7E 1Z5BA 2BV3A 4HACB 1N34I 4X64E 1TIDA 2XHXA 2YE3A 3GIGB 2XDUA 2YE6A 4LF5E 4OX9I 4YKWA 2YEDA 4AQYI 3FV5A 3LNUA 1N33I 1Z59A 1UYEA 3B24A 2V34A 4V25A 3K85A 1UYCA 1N33E 4XITA 3HZ5A 4K0KI 1H74A 1TC0A 1K47A 2YJXA 1S4EA 2LJPA 4JI5I 1I59A 1N0UA 1UY7A 2OI2A 1EA6A 3HYYA 2R3VA 3CRLA 5IDMA 2ESAA 2YKCA 3QT7A 2ZBKB 2UXCI 3B25A 2CCSA 2H8MA 2WI7A 2XD6A 4BAEA 4Q20A 3Q5LA 3J81Q 3ZZUA 3B82A 2Q8FA 2CGEA 4CWRA 1Y4UA 4QPJA 1HNZE 2XHRA 4ASAA 4DR2E 3P06A 4JI6I 3OTOI 1IBKI 1S16A 2JJCA 3K99A 3CWVA 4WUDA 4HXWA 4MPEA 4ED4A 2YK2A 1QZRA 2BU7A 1KVKA 1HR0I 4DR6E 1UYHA 4K0KE 3GIFA 4AWPA 4EEHA 4XE2A 4XD8A 2BU8A 2ZM6E 3OMUA 4CWPA 4ZVIA 1YS3A 4DUHA 1Z0GA 4YKQA 2WW4A 4CWOA 2YKEA 1ZM9A 4L93A 2YEBA 4DR1E 2C2AA 2V2QA 4DV3E 4LPBA 3A0ZA 4HACA 3JAMC 1L0OA 4ASGA 4U7OA 4JI0E 2FYPA 3A0TA 5BR8E 4IZKB 3FT5A 3HZ1A 4YHHI 4JV5I 1ZWHA 5GMDA 4YKRA 4B3RE 2EXLA 1IBME 4LF9I 3U67A 4EFUA 4X66I 4LF4E 3R4MA 4MP7A 3PYEA 1MG7A 2PNRA 4HY6A 4B7PA 4CWFA 2ZKJA 4L90A 3RLRA 2XABA 3R91A 4CWSA 1XMOI 4KP4A 2VCJA 3ZM7A 4DR3I 2WI3A 3K1JA 1N34E 4DR7E 4CWTA 2HFSA 4JYAE 3J81C 2UUAI 3WU5A 4XIPA 1BKNA 2BU2A 2YEJA 2YE8A 4LF7E 4JI1I 2Q8IA 1FKAE 4LF7I 1PVGA 2UU9I 1ZM3A 1ZM4A 1FJGE 2F4VE 4URLA 2YKBA 1Y6ZA 2Z5EA 4Z7CA 1TH8A 3PEHA 2HCHA 5BODA 3LPSA 2BT0A 3EHFA 4CWNA 1MX0A 4CWQA 5D6PA 4DPTA 4H7QA 2E0AA 4URMA 2BSMA 4DUYI 1YSZA 2GQPA 3EHJA 2QG0A 4FPPA 4LWHA 1AJ6A 3FT8A 4MPNA 1A4HA 4O04A 3QTFA 3Q6MA 1J5EE 5D7CA 4EGKA 4X65I 3V5RA 2BREA 2HG1A 2YI5A 1J5EI 4XKAA 4DUZI 5M4NA 3PYDA 4X65E 3NMQA 4FN5A 5M4KA 2XX4A 4JI8I 3EHHA 4LFCI 4AQYE 4LF5I 4OX9E 2UUCI 2YE2A 2UWDA 4CE2A 4P7AA 3H80A 1H72C 4HYPA 4E00A 4DPUA 4DV5E 3CGZA 5CTWA 1OJ4A 1NHJA 5LMUE 1KIJA 2CH4A 2UUCE 4GT8A 4GCZA 5LL6R 1WUUA 4GGLA 4X9LA 5LMUI 4B3ME 2UXBE 4DV5I 4DV4E 2YEEA 4DUZE 3WU6A 3M6AA 1HNXE 2WERA 2O1UA 2X7IA 4DU7A 4NH9A 2BU6A 4O07A 5IN9A 1UYGA 2XX5A 1UY6A 4NXNE 3BMYA 4XIRA 2XJGA 1Z0TA 4R3MA 4XKKA 2DEIA 2XJJA 3J7AG 4PU9A 4EGIA 1UEKA 4B3MI 4DZYA 5A2QC 3H4LA 4XC0A 1YERA 4EFTA 1KZNA 3DGEA 2E5LI 1GKZA 5D7DA 1GKXA 3SL2A 3ZXQA 4AWQA 4B3TI 2IWXA 4NH8A 1EI1A 2VQFI 4DV3I 2VW5A 2VCIA 4P8OA 3WU3A 1HNWE 4RPFA 4H85A 4JI0I 1USVA 4E01A 2NPFA 3B26A 5GGZA 2WI1A 3U2DA 2A2DA 1TC6A 1XMQI 1N36E 3HEKA 4DR1I 3GIEA 1ZXMA 4DR6I 3TZ2A 4ZKIA 4DR4E 1I5CA 2YECA 4MYTA 4UTGA 4USMA 3T1YE 4O05A 2YGAA 3HHUA 3TZ4A 4FCPA 4I5SA 3PRYA 4DV2E 1BYQA 4BIZA 4HXZA 5D7RA 2HK2A 2HHHI 4JI4I 5IT9Q 1JM6A 4MB9A 3Q5KA 4LF4I 4E02A 1YC1A 4LFBI 4NXME 2FWZA 1GJVA 4W7TA 2ZDXA 2H55A 1YETA 1Y4SA 4YHHE 4JV5E 2WEQA 2YEIA 1B62A 2F4VI 4DV1I 4MPCA 3TZ5A 3VHDA 2X36A 3B28A 4DR5I 1Y8NA 2CCUA 2QF6A 1AMWA 4LWEA 1H73A 5F5RA 5L3JA 4JI1E 1Z5AA 2VQEI 2YE9A 3A0WA 4DU8A 3R4OA 4DR4I 1FI4A 2YEHA 4V26A 5A2QQ 4N3OA 2VWCA 3T1YI 3GONA 3PYFA 3K97A 1H7SA 5FNDA 3QT5A 4JI2E 2BTZA 4USKA 2UXDI 1Y8OA 2WI6A 3RKZA 1U2OA 5IWAI 1YESA 3U2KA 3O0IA 2YI7A 1UYFA 2UXBI 4B6CA 1HNZI 4KQVA 2A2CA 1XNQE 1I94I 4HZ0A 4KTNA 4XTJA 2XX2A 4CE1A 3OWDA 4HZ5A 1NZ0A 2YI0A 4O0BA 4H81A 2YJWA 4LP0A 1Z0WA 1Z0EA 2E1RA 2FWYA 4KFGA 1I58A 5CTUA 4FW9A 4LWIA 1AH6A 4PRVA 3O2FA 1B63A 4KSGA 5CPHA 2YKJA 2HKJA 4LFAI 3R4PA 2WEPA 5CTXA 2J7KA 5IT9C 3MNRP 2WI2A 3T2SA 4R1FA 4XDMA 5M4EA 2Z5BB 4YY3I 3ZKDA 4X62I 4EMDA 2GFDA 3RLPA 3T1HI 2IWUA 3B78A 1XMQE 4YY3E 4X62E 4GEEA 4LWGA 4YKYA 4B3SI 1I5AA 3QDDA 5M4HA 1RREA 4DV7I 4X64I 3Q1QA 1UYMA 2XCMA 1IBMI 1KTVA 1FWKA 2YE5A 2BM0A 4YKXA 4Z7YA 3OTOE 1IBKE 2XJXA 4AS9A 2FXSA 4DR2I 2YE7A 4JAVA 4EGHA 5M4MA 1FWLA 3BM9A 2AJ4A 3J80C 4JG4A 1UYIA 3V2UC 3QT6A 4NXMI 1VISA 4DPWA 1HK7A 4JQLA 3T0HA 1ZW9A 3QT8A 2E5LE 1U2RA 4B3SE 1N32E 2UXCE 3EKRA 1YC4A 1TBWA 4DPYA 5IDJA 1D6TA 4U7NA 1Z0BA 2WI5A 3Q6NA 4M1KA 4R3AA 2Z5CA 1AM1A 1BGQA 2ZDYA 4NXNI 2XK2A 2AKPA 4LF8E 1Z5CA 4FWDA 4GFNA 4FCQA 3C0EA 1R62A 3C11A 1B3QA 5LMNI 4FMTA 2VQFE 1FJGI 3PYGA 4GKKI 3TUHA 2Q2EB 5FNCA 1DARA 3ZKBA 1UYDA 4GKKE 4BXIA 3ZZ0A 2BYHA 2IOQA 4B3TE 1I94E 5FWKA 3D0BA 3ZZTA 1XNRE 3G7BA 3GIGA 4HY1A 4GQTA 4DR3E 5IWAE 3J7AM 4LFCE 3INXA 1UY9A 3CRKA 3T1KA 4JYAI 1MU5A 4DXLA 1S14A 2VF3A 3VADA 2V2ZA 2K5BA 1IBLI 4XIQA 4GKJI 2YE4A 4I3HA 4B3RI 2BZ5A 5BOCA 1OSFA 2Q8GA 5FLXQ 3A0XA 3CGYA 2VQEE 4MOTA 4DV6E 2CGFA 4K4OA 3A0YA 4XKOA 1YC3A 4WUBA 1N0VC 4WUCA 2Z5CB 4JI7I 4LFAE 3VHCA 4FWGA 5FNFA 2XDSA 1XNQI 3JZ3A 2HK3A 4L91A 2CZ9A 1A6FA 4P52A 4ASFA 4AWOA 1RR9A 2UU9E 1ID0A 1QY8A 4JI8E 2IWSA 2CCTA 2YEGA 2PNLA 4UT4A 1ZXNA 2UUBE 4BIUA 1HR0E 3D2RA 4HYMA 4DV6I 1UYLA 2BYIA 1YT2A 3T10A 3J80Q 2BU5A 1IBLE 4ASBA 2XEXA 4GKJE 2O1TA 4DUYE 2ZITA 2O1VA 4YKZA 3T0ZA 3IEDA 2WI4A 2YI6A 2YGFA 1I5BA 4MBCA 4URNA 2GS8A 2YKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFG A;  4DV0 E;  4LF6 E;  4NH7 A;  2V8P A;  2HKE A;  1KKH A;  1Z0C A;  2HFU A;  3K98 A;  3O6O A;  4KHP I;  2XDX A;  5BR8 I;  4DV4 I;  1QYE A;  1AH8 A;  1ZM2 A;  1TIL A;  1U0Z A;  1PKP A;  4XCJ A;  4YKT A;  3WHA A;  4KHP E;  3OWB A;  3PEJ A;  4U93 A;  4JI5 E;  1THN A;  1Z0V A;  4CE3 A;  4DV7 E;  1YT1 A;  3K17 A;  4DV2 I;  4YKU A;  4FWH A;  3D36 A;  4KSH A;  2YEF A;  3TTZ A;  4LF8 I;  1US7 A;  2XDL A;  5CTY A;  2Q8H A;  2YGE A;  3EKO A;  4LFB E;  2BRC A;  5M4P A;  3JAM Q;  5C93 A;  5GME A;  3B8H A;  3T1H E;  4JI3 I;  1UY8 A;  2CG9 A;  4QPK A;  2XHT A;  4O09 A;  1BXD A;  3D4J A;  3KE6 A;  4XCL A;  4DV0 I;  4LF6 I;  1Y8P A;  2O1W A;  3B27 A;  3R4N A;  3RLQ A;  4JI3 E;  3HYZ A;  4JI6 E;  1N32 I;  1HNW I;  1HNX I;  1I5D A;  3R92 A;  3WQ9 A;  2IOP A;  4BQJ A;  4MP2 A;  3VHA A;  1XNR I;  1ELO A;  1PIE A;  5J71 A;  4JAS A;  4L8Z A;  4PRX A;  1YT0 A;  5LMN E;  5FLX C;  2R42 A;  4L94 A;  2ZM6 I;  1NHH A;  5CF0 A;  1H7U A;  2QFO A;  1YSR A;  2BM1 A;  2IOR A;  2UXD E;  4PL9 A;  4DR7 I;  3WU4 A;  4JAU A;  2UUA E;  5F3K A;  4EM7 A;  4JI2 I;  1XMO E;  2YK9 A;  2DEJ A;  3EHG A;  4LWF A;  4URO A;  4DPX A;  3G75 A;  4DR5 E;  2QG2 A;  3A0R A;  4EMV A;  4FCR A;  4X66 E;  3ZXO A;  3OW6 A;  2V2V A;  3G7E A;  1N36 I;  3HUL A;  4DV1 E;  3OPD A;  3TZ0 A;  2UUB I;  1FNM A;  5D6Q A;  4LF9 E;  3LTO A;  3K60 A;  2XDK A;  3Q5J A;  4BQG A;  4MYU A;  2JKI A;  3INW A;  2YEA A;  5J6A A;  1XHK A;  1UYK A;  2HHH E;  1NHI A;  4JI4 E;  3F0N A;  4JI7 E;  1Z5B A;  2BV3 A;  4HAC B;  1N34 I;  4X64 E;  1TID A;  2XHX A;  2YE3 A;  3GIG B;  2XDU A;  2YE6 A;  4LF5 E;  4OX9 I;  4YKW A;  2YED A;  4AQY I;  3FV5 A;  3LNU A;  1N33 I;  1Z59 A;  1UYE A;  3B24 A;  2V34 A;  4V25 A;  1UYC A;  1N33 E;  4XIT A;  3HZ5 A;  4K0K I;  1H74 A;  1TC0 A;  1K47 A;  2YJX A;  1S4E A;  2LJP A;  4JI5 I;  1I59 A;  1N0U A;  1UY7 A;  2OI2 A;  1EA6 A;  3HYY A;  2R3V A;  3CRL A;  5IDM A;  2ESA A;  2YKC A;  3QT7 A;  2ZBK B;  2UXC I;  3B25 A;  2CCS A;  2H8M A;  2WI7 A;  2XD6 A;  4BAE A;  4Q20 A;  3Q5L A;  3J81 Q;  3ZZU A;  3B82 A;  2Q8F A;  4CWR A;  1Y4U A;  4QPJ A;  1HNZ E;  2XHR A;  4ASA A;  4DR2 E;  4JI6 I;  3OTO I;  1IBK I;  1S16 A;  2JJC A;  3K99 A;  3CWV A;  4WUD A;  4HXW A;  4MPE A;  4ED4 A;  1QZR A;  2BU7 A;  1KVK A;  1HR0 I;  4DR6 E;  1UYH A;  4K0K E;  3GIF A;  4AWP A;  4EEH A;  4XE2 A;  4XD8 A;  2BU8 A;  2ZM6 E;  3OMU A;  4CWP A;  4ZVI A;  1YS3 A;  4DUH A;  1Z0G A;  4YKQ A;  2WW4 A;  4CWO A;  2YKE A;  1ZM9 A;  4L93 A;  2YEB A;  4DR1 E;  2C2A A;  2V2Q A;  4DV3 E;  4LPB A;  3A0Z A;  4HAC A;  3JAM C;  1L0O A;  4ASG A;  4U7O A;  4JI0 E;  2FYP A;  3A0T A;  5BR8 E;  3FT5 A;  3HZ1 A;  4YHH I;  4JV5 I;  1ZWH A;  5GMD A;  4YKR A;  4B3R E;  2EXL A;  1IBM E;  4LF9 I;  3U67 A;  4EFU A;  4X66 I;  4LF4 E;  3R4M A;  4MP7 A;  3PYE A;  1MG7 A;  2PNR A;  4HY6 A;  4B7P A;  4CWF A;  2ZKJ A;  4L90 A;  3RLR A;  2XAB A;  3R91 A;  4CWS A;  1XMO I;  4KP4 A;  2VCJ A;  3ZM7 A;  4DR3 I;  2WI3 A;  3K1J A;  1N34 E;  4DR7 E;  4CWT A;  2HFS A;  4JYA E;  3J81 C;  2UUA I;  3WU5 A;  4XIP A;  1BKN A;  2BU2 A;  2YEJ A;  2YE8 A;  4LF7 E;  4JI1 I;  2Q8I A;  1FKA E;  4LF7 I;  1PVG A;  2UU9 I;  1ZM3 A;  1ZM4 A;  1FJG E;  2F4V E;  4URL A;  2YKB A;  1TH8 A;  4Z7C A;  2YK2 A;  3PEH A;  2HCH A;  5BOD A;  3LPS A;  2BT0 A;  3EHF A;  4CWN A;  1MX0 A;  4CWQ A;  5D6P A;  4DPT A;  4H7Q A;  2E0A A;  4URM A;  2BSM A;  4DUY I;  1YSZ A;  2GQP A;  3EHJ A;  2QG0 A;  4FPP A;  4LWH A;  1AJ6 A;  3FT8 A;  4MPN A;  1A4H A;  4O04 A;  3QTF A;  1J5E E;  5D7C A;  4EGK A;  4X65 I;  3V5R A;  2BRE A;  2HG1 A;  2YI5 A;  1J5E I;  4XKA A;  4DUZ I;  5M4N A;  3PYD A;  4X65 E;  3NMQ A;  4FN5 A;  5M4K A;  2XX4 A;  4JI8 I;  3EHH A;  4LFC I;  4AQY E;  4LF5 I;  4OX9 E;  2UUC I;  2YE2 A;  2UWD A;  4CE2 A;  4P7A A;  3H80 A;  1H72 C;  4HYP A;  4E00 A;  4DPU A;  4DV5 E;  3CGZ A;  5CTW A;  1OJ4 A;  1NHJ A;  5LMU E;  1KIJ A;  2CH4 A;  2UUC E;  4GT8 A;  4GCZ A;  5LL6 R;  1WUU A;  4GGL A;  4X9L A;  5LMU I;  4B3M E;  2UXB E;  4DV5 I;  4DV4 E;  2YEE A;  4DUZ E;  3WU6 A;  3M6A A;  1HNX E;  2WER A;  4DU7 A;  2X7I A;  2O1U A;  4NH9 A;  2BU6 A;  4O07 A;  5IN9 A;  1UYG A;  2XX5 A;  1UY6 A;  4NXN E;  3BMY A;  4XIR A;  2XJG A;  1Z0T A;  4R3M A;  4XKK A;  2DEI A;  2XJJ A;  3J7A G;  4PU9 A;  4EGI A;  1UEK A;  4B3M I;  4DZY A;  5A2Q C;  3H4L A;  4XC0 A;  1YER A;  4EFT A;  1KZN A;  3DGE A;  2E5L I;  1GKZ A;  5D7D A;  1GKX A;  3SL2 A;  3ZXQ A;  4AWQ A;  4B3T I;  2IWX A;  4NH8 A;  1EI1 A;  2VQF I;  4DV3 I;  2VW5 A;  2VCI A;  4P8O A;  3WU3 A;  1HNW E;  4RPF A;  4H85 A;  4JI0 I;  4E01 A;  2NPF A;  3B26 A;  5GGZ A;  2WI1 A;  3U2D A;  2A2D A;  1TC6 A;  1XMQ I;  1N36 E;  3HEK A;  4DR1 I;  3GIE A;  1ZXM A;  4DR6 I;  3TZ2 A;  4ZKI A;  4DR4 E;  1I5C A;  2YEC A;  4MYT A;  4UTG A;  4USM A;  3T1Y E;  4O05 A;  2YGA A;  3HHU A;  3TZ4 A;  4FCP A;  4I5S A;  4DV2 E;  1BYQ A;  4BIZ A;  4HXZ A;  5D7R A;  2HK2 A;  2HHH I;  4JI4 I;  5IT9 Q;  1JM6 A;  4MB9 A;  3Q5K A;  4LF4 I;  4E02 A;  1YC1 A;  4LFB I;  4NXM E;  2FWZ A;  1GJV A;  4W7T A;  2ZDX A;  2H55 A;  1YET A;  4YHH E;  4JV5 E;  1Y4S A;  2WEQ A;  2YEI A;  1B62 A;  2F4V I;  4DV1 I;  4MPC A;  3TZ5 A;  3VHD A;  2X36 A;  3B28 A;  4DR5 I;  1Y8N A;  2CCU A;  2QF6 A;  1AMW A;  4LWE A;  1H73 A;  5F5R A;  5L3J A;  4JI1 E;  1Z5A A;  2VQE I;  2YE9 A;  3A0W A;  4DU8 A;  3R4O A;  4DR4 I;  1FI4 A;  2YEH A;  4V26 A;  5A2Q Q;  2VWC A;  3T1Y I;  3GON A;  3PYF A;  3K97 A;  1H7S A;  5FND A;  4JI2 E;  3QT5 A;  2BTZ A;  4USK A;  2UXD I;  1Y8O A;  2WI6 A;  3RKZ A;  1U2O A;  5IWA I;  1YES A;  3U2K A;  3O0I A;  2YI7 A;  1UYF A;  2UXB I;  4B6C A;  1HNZ I;  4KQV A;  2A2C A;  1XNQ E;  1I94 I;  4HZ0 A;  4KTN A;  4XTJ A;  2XX2 A;  4CE1 A;  3OWD A;  4HZ5 A;  1NZ0 A;  2YI0 A;  4O0B A;  4H81 A;  2YJW A;  4LP0 A;  1Z0W A;  1Z0E A;  2E1R A;  2FWY A;  4KFG A;  1I58 A;  5CTU A;  4FW9 A;  4LWI A;  1AH6 A;  4PRV A;  3O2F A;  1B63 A;  4KSG A;  5CPH A;  2YKJ A;  2HKJ A;  4LFA I;  3R4P A;  2WEP A;  5CTX A;  2J7K A;  5IT9 C;  3MNR P;  2WI2 A;  3T2S A;  4R1F A;  4XDM A;  5M4E A;  4YY3 I;  3ZKD A;  4X62 I;  4EMD A;  2GFD A;  3RLP A;  3T1H I;  2IWU A;  3B78 A;  1XMQ E;  4YY3 E;  4X62 E;  4GEE A;  4LWG A;  4YKY A;  4B3S I;  1I5A A;  3QDD A;  5M4H A;  1RRE A;  4DV7 I;  4X64 I;  3Q1Q A;  1UYM A;  2XCM A;  1IBM I;  1KTV A;  1FWK A;  2YE5 A;  2BM0 A;  4YKX A;  4Z7Y A;  3OTO E;  1IBK E;  2XJX A;  4AS9 A;  2FXS A;  4DR2 I;  2YE7 A;  4JAV A;  4EGH A;  5M4M A;  1FWL A;  3BM9 A;  2AJ4 A;  3J80 C;  4JG4 A;  1UYI A;  3V2U C;  3QT6 A;  4NXM I;  1VIS A;  4DPW A;  4JQL A;  3T0H A;  1ZW9 A;  3QT8 A;  2E5L E;  1U2R A;  4B3S E;  1N32 E;  2UXC E;  3EKR A;  1YC4 A;  1TBW A;  4DPY A;  5IDJ A;  1D6T A;  4U7N A;  1Z0B A;  2WI5 A;  4M1K A;  4R3A A;  1AM1 A;  1BGQ A;  2ZDY A;  4NXN I;  2XK2 A;  2AKP A;  4LF8 E;  1Z5C A;  4FWD A;  4GFN A;  4FCQ A;  3C0E A;  1R62 A;  3C11 A;  1B3Q A;  5LMN I;  4FMT A;  2VQF E;  1FJG I;  3PYG A;  4GKK I;  3TUH A;  2Q2E B;  5FNC A;  1DAR A;  3ZKB A;  1UYD A;  4GKK E;  4BXI A;  3ZZ0 A;  2BYH A;  2IOQ A;  4B3T E;  1I94 E;  3D0B A;  5FWK A;  3ZZT A;  1XNR E;  3G7B A;  3GIG A;  4HY1 A;  4GQT A;  4DR3 E;  5IWA E;  3J7A M;  4LFC E;  3INX A;  1UY9 A;  3CRK A;  3T1K A;  4JYA I;  1MU5 A;  4DXL A;  1S14 A;  2VF3 A;  3VAD A;  2V2Z A;  2K5B A;  1IBL I;  4XIQ A;  4GKJ I;  2YE4 A;  4I3H A;  4B3R I;  2BZ5 A;  5BOC A;  1OSF A;  2Q8G A;  5FLX Q;  3A0X A;  3CGY A;  2VQE E;  4MOT A;  4DV6 E;  2CGF A;  4K4O A;  3A0Y A;  4XKO A;  1YC3 A;  4WUB A;  1N0V C;  4WUC A;  4JI7 I;  4LFA E;  3VHC A;  4FWG A;  5FNF A;  2XDS A;  1XNQ I;  3JZ3 A;  2HK3 A;  4L91 A;  2CZ9 A;  1A6F A;  4P52 A;  4ASF A;  4AWO A;  1RR9 A;  2UU9 E;  1ID0 A;  1QY8 A;  4JI8 E;  2IWS A;  2CCT A;  2YEG A;  4UT4 A;  1ZXN A;  2UUB E;  4BIU A;  1HR0 E;  3D2R A;  4HYM A;  4DV6 I;  1UYL A;  2BYI A;  1YT2 A;  3T10 A;  3J80 Q;  2BU5 A;  1IBL E;  4ASB A;  2XEX A;  4GKJ E;  4DUY E;  2ZIT A;  2O1V A;  4YKZ A;  3T0Z A;  3IED A;  2WI4 A;  2YI6 A;  2YGF A;  1I5B A;  4MBC A;  4URN A;  2GS8 A;  2YKI A; 
#chains in the Genus database with same CATH topology
 2EFG A;  4DV0 E;  4LF6 E;  4NH7 A;  2V8P A;  3L7Z A;  2HKE A;  2O3Z A;  5EKW A;  1KKH A;  1Z0C A;  2HFU A;  3K98 A;  3O6O A;  4KHP I;  4MDT A;  2XDX A;  2GQ0 A;  5JEA A;  4DV4 I;  5BR8 I;  1AH8 A;  1ZM2 A;  1QYE A;  1TIL A;  1U0Z A;  2JE6 A;  1PKP A;  1F51 A;  5K36 D;  4FW3 A;  4XCJ A;  4YKT A;  3WHA A;  4KHP E;  3OWB A;  3PEJ A;  4U93 A;  4JI5 E;  2Z5B A;  1Z0V A;  4IFD B;  1THN A;  4DV7 E;  1YT1 A;  4CE3 A;  3K17 A;  1XXE A;  4DV2 I;  4YKU A;  4FWH A;  1UDN A;  5JEA F;  3D36 A;  2YEF A;  4KSH A;  3TTZ A;  5JEN A;  4LF8 I;  1US7 A;  2XDL A;  5CTY A;  2Q8H A;  1Y5Y A;  2YGE A;  3EKO A;  4LFB E;  2BRC A;  5M4P A;  3JAM Q;  5C93 A;  5GME A;  3B8H A;  3T1H E;  4JI3 I;  1UY8 A;  2CG9 A;  4QPK A;  2XHT A;  4O09 A;  1BXD A;  3D4J A;  4IFD A;  3KE6 A;  4XCL A;  4DV0 I;  4LF6 I;  1Y8P A;  2O1W A;  3B27 A;  3R4N A;  3RLQ A;  4JI3 E;  3LMM A;  3HYZ A;  4JI6 E;  1N32 I;  5C0X E;  1HNW I;  1HNX I;  1I5D A;  3R92 A;  3S5T A;  3WQ9 A;  2IOP A;  4BQJ A;  4MP2 A;  3VHA A;  1XNR I;  1ELO A;  1PIE A;  5J71 A;  4JAS A;  4L8Z A;  4PRX A;  1YT0 A;  5LMN E;  5FLX C;  2R42 A;  4L94 A;  2ZM6 I;  1NHH A;  5CF0 A;  5K36 B;  1H7U A;  2QFO A;  1YSR A;  2BM1 A;  2IOR A;  2UXD E;  2NN6 F;  4PL9 A;  4DR7 I;  5EL9 A;  3WU4 A;  4JAU A;  2UUA E;  4BA2 B;  4OO1 C;  5F3K A;  2PNM A;  4IZJ B;  4EM7 A;  4JI2 I;  4LCG A;  1XMO E;  2YK9 A;  3UHM A;  2DEJ A;  3EHG A;  1R6M A;  4LWF A;  4MU0 A;  4URO A;  2JEB B;  4DPX A;  3G75 A;  4DR5 E;  4IZK A;  4MU3 A;  2QG2 A;  3A0R A;  4EMV A;  4FCR A;  4X66 E;  3ZXO A;  3OW6 A;  2V2V A;  3G7E A;  1N36 I;  1USU A;  3HUL A;  4DV1 E;  3OPD A;  1E3P A;  3TZ0 A;  2UUB I;  4IZJ A;  1FNM A;  5D6Q A;  3HJC A;  4LF9 E;  3LTO A;  3K60 A;  2XDK A;  3Q5J A;  4BQG A;  2WP8 B;  4MYU A;  3M7N D;  2JKI A;  2YEA A;  3INW A;  5J6A A;  1XHK A;  1UYK A;  2HHH E;  1NHI A;  4IZJ D;  4JI4 E;  3F0N A;  4LCH A;  5DRR A;  4JI7 E;  1Z5B A;  2BV3 A;  4FW5 A;  3B4T A;  4HAC B;  1N34 I;  4X64 E;  2C37 B;  4FW4 A;  1TID A;  2XHX A;  2XDU A;  2YE6 A;  4LF5 E;  4OX9 I;  2YE3 A;  2J65 A;  4YKW A;  2YED A;  4AQY I;  3FV5 A;  3LNU A;  1N33 I;  1Z59 A;  1UYE A;  3B24 A;  4GQU A;  2V34 A;  4V25 A;  3K85 A;  1UYC A;  1N33 E;  4XIT A;  1YH8 A;  3HZ5 A;  2GO4 A;  1H74 A;  4K0K I;  1TC0 A;  1K47 A;  2C1G A;  5DNL A;  1S4E A;  1E3H A;  2LJP A;  2YJX A;  4JI5 I;  1I59 A;  1N0U A;  1UY7 A;  2OI2 A;  1EA6 A;  3HYY A;  2R3V A;  3CRL A;  5IDM A;  4MU1 A;  2ESA A;  2YKC A;  3QT7 A;  2ZBK B;  2UXC I;  3B25 A;  2CCS A;  4E72 A;  3CDI A;  2H8M A;  2WI7 A;  2XD6 A;  4BAE A;  4Q20 A;  3Q5L A;  3U1K A;  3J81 Q;  3ZZU A;  3B82 A;  2Q8F A;  2CGE A;  4CWR A;  1Y4U A;  4QPJ A;  3KRN A;  1HNZ E;  4OO1 B;  2XHR A;  4ASA A;  4DR2 E;  3P06 A;  4JI6 I;  3OTO I;  1IBK I;  1OYP A;  1S16 A;  2JJC A;  3K99 A;  3CWV A;  3PS3 A;  4WUD A;  4HXW A;  4ED4 A;  2YK2 A;  5C0X C;  4MPE A;  1QZR A;  2BU7 A;  1KVK A;  1HR0 I;  2PO1 A;  4DR6 E;  1UYH A;  2FTK A;  4K0K E;  3GIF A;  4AWP A;  4EEH A;  4XE2 A;  4XD8 A;  2BU8 A;  2ZM6 E;  3OMU A;  4CWP A;  4ZVI A;  1YS3 A;  4DUH A;  1Z0G A;  4YKQ A;  2PO0 A;  2WW4 A;  4CWO A;  2YKE A;  1ZM9 A;  4LOM A;  4L93 A;  2YEB A;  5K36 F;  4DR1 E;  2C2A A;  2V2Q A;  4DV3 E;  1Y60 A;  4LPB A;  3A0Z A;  4HAC A;  2NN6 B;  5DNX A;  3JAM C;  1L0O A;  4ASG A;  4U7O A;  4JI0 E;  4OO1 F;  2FYP A;  3A0T A;  5BR8 E;  4IZK B;  3FT5 A;  3HZ1 A;  4YHH I;  4JV5 I;  1ZWH A;  5GMD A;  4YKR A;  4B3R E;  2EXL A;  1IBM E;  4LF9 I;  2IES A;  3U67 A;  4EFU A;  4X66 I;  4LF4 E;  3R4M A;  4MP7 A;  4LCF A;  3P76 A;  3PYE A;  1MG7 A;  2PNR A;  4HY6 A;  4B7P A;  4CWF A;  2ZKJ A;  4L90 A;  3RLR A;  2XAB A;  3R91 A;  4CWS A;  2WP8 A;  1XMO I;  4KP4 A;  2VCJ A;  3ZM7 A;  4OZE A;  2PNZ A;  4DR3 I;  2WI3 A;  3K1J A;  3DD6 A;  1N34 E;  4DR7 E;  4CWT A;  2HFS A;  4JYA E;  3J81 C;  3M85 G;  3WU5 A;  2UUA I;  4XIP A;  1BKN A;  2BU2 A;  4AID A;  2YEJ A;  2YE8 A;  4LF7 E;  2PO2 A;  4JI1 I;  2BR2 A;  2Q8I A;  1FKA E;  4LF7 I;  1PVG A;  2UU9 I;  1ZM3 A;  1ZM4 A;  1FJG E;  2F4V E;  1YHC A;  4URL A;  1Y6Z A;  2Z5E A;  2PNZ B;  4Z7C A;  1TH8 A;  3PEH A;  2JEA B;  2HCH A;  5BOD A;  3LPS A;  5K36 A;  2C37 A;  2BT0 A;  3EHF A;  4CWN A;  1MX0 A;  4CWQ A;  5D6P A;  4DPT A;  4H7Q A;  2E0A A;  4URM A;  2BSM A;  4DUY I;  1YSZ A;  2HHI A;  2GQP A;  3EHJ A;  2QG0 A;  4FPP A;  4LWH A;  1AJ6 A;  3FT8 A;  4MPN A;  1A4H A;  4O04 A;  3QTF A;  3Q6M A;  1J5E E;  5D7C A;  4EGK A;  4X65 I;  2VES A;  3V5R A;  2BRE A;  1OYS A;  2HG1 A;  1J5E I;  1VI7 A;  2YI5 A;  4DUZ I;  4XKA A;  4QNK A;  5C0X F;  5M4N A;  3PYD A;  4X65 E;  3NMQ A;  4BA1 A;  4FN5 A;  5M4K A;  2XX4 A;  4OKG A;  3GLL A;  4J3D A;  4JI8 I;  3EHH A;  4LFC I;  4AQY E;  4LF5 I;  4OX9 E;  2UUC I;  1IXM A;  2YE2 A;  2UWD A;  4CE2 A;  4P7A A;  3H80 A;  1H72 C;  4HYP A;  4E00 A;  4DPU A;  4DV5 E;  3CGZ A;  5CTW A;  1OJ4 A;  1NHJ A;  4QNJ A;  5LMU E;  1KIJ A;  4OO1 D;  2CH4 A;  2UUC E;  4GT8 A;  4GCZ A;  5LL6 R;  1WUU A;  5K36 E;  4GGL A;  4X9L A;  5LMU I;  3NZK A;  2WNR A;  4B3M E;  4DV5 I;  2UXB E;  4DV4 E;  1UDQ A;  4DUZ E;  2YEE A;  3WU6 A;  3M6A A;  1HNX E;  2WER A;  2O1U A;  2X7I A;  4DU7 A;  4NH9 A;  2JEA A;  2JT2 A;  4MU4 A;  5K36 C;  1UYG A;  2BU6 A;  2NN6 A;  4O07 A;  5IN9 A;  2XX5 A;  1UY6 A;  4NXN E;  5C0X B;  3BMY A;  4XIR A;  2PO2 B;  2XJG A;  1Z0T A;  4R3M A;  4XKK A;  2DEI A;  5JEA C;  4IFD D;  3J7A G;  4PU9 A;  2XJJ A;  4EGI A;  1UEK A;  4AIM A;  4B3M I;  5A2Q C;  4DZY A;  3H4L A;  4XC0 A;  4IFD C;  1YER A;  4EFT A;  1KZN A;  3DGE A;  2E5L I;  1GKZ A;  5D7D A;  1GKX A;  3CDJ A;  3SL2 A;  3ZXQ A;  4AWQ A;  5C0X A;  4B3T I;  2IWX A;  4NH8 A;  1EI1 A;  2VQF I;  4DV3 I;  2VW5 A;  2VCI A;  2BA0 G;  4P8O A;  3WU3 A;  2C38 B;  4IFD E;  1HNW E;  1OYR A;  4RPF A;  4H85 A;  4JI0 I;  1USV A;  4E01 A;  3PS2 A;  2NPF A;  3B26 A;  2WI1 A;  5GGZ A;  3U2D A;  2A2D A;  1TC6 A;  1XMQ I;  1N36 E;  3HEK A;  2WNR B;  4DR1 I;  4LPF A;  3GIE A;  1ZXM A;  4DR6 I;  3TZ2 A;  4ZKI A;  4DR4 E;  3CYG A;  1I5C A;  2YEC A;  4MYT A;  4UTG A;  4USM A;  3T1Y E;  4O05 A;  2YGA A;  3HHU A;  3TZ4 A;  4FCP A;  4I5S A;  3PRY A;  4DV2 E;  1BYQ A;  4BIZ A;  4HXZ A;  2NN6 D;  3PS1 A;  5D7R A;  2HK2 A;  2HHH I;  4JI4 I;  2GO3 A;  2JE6 B;  5IT9 Q;  1JM6 A;  3P3E A;  3M7N G;  4MB9 A;  3Q5K A;  4LF4 I;  4E02 A;  2PO0 B;  1YC1 A;  4LFB I;  4IS9 A;  4NXM E;  2FWZ A;  1GJV A;  4W7T A;  2ZDX A;  3L7Z B;  2CVE A;  2YKB A;  4FW6 A;  2H55 A;  1YET A;  1Y4S A;  4YHH E;  4JV5 E;  2JEB A;  2WEQ A;  2YEI A;  1B62 A;  2F4V I;  4DV1 I;  4MPC A;  3TZ5 A;  3VHD A;  2X36 A;  3B28 A;  4DR5 I;  1Y8N A;  2CCU A;  2QF6 A;  1AMW A;  4LWE A;  1H73 A;  5F5R A;  5L3J A;  4JI1 E;  1Z5A A;  2VQE I;  2YE9 A;  3A0W A;  4DU8 A;  2IER A;  4DR4 I;  1FI4 A;  2YEH A;  3R4O A;  5A2Q Q;  4V26 A;  4N3O A;  2VWC A;  3T1Y I;  3GON A;  3PYF A;  3K97 A;  1H7S A;  5FND A;  3QT5 A;  4JI2 E;  2BTZ A;  4USK A;  2UXD I;  1Y8O A;  2WI6 A;  1RHY A;  3RKZ A;  1U2O A;  5IWA I;  3HKM A;  1YES A;  3U2K A;  3O0I A;  2YI7 A;  1UYF A;  2UXB I;  4B6C A;  1HNZ I;  4KQV A;  5DRQ A;  3U1Y A;  2A2C A;  1I94 I;  1XNQ E;  2PO1 B;  4HZ0 A;  2C1I A;  4KTN A;  4XTJ A;  2C39 A;  2XX2 A;  4CE1 A;  3OWD A;  4HZ5 A;  1NZ0 A;  2YI0 A;  4O0B A;  4H81 A;  4AM3 A;  2YJW A;  4LP0 A;  1Z0W A;  1Z0E A;  2E1R A;  2FWY A;  4KFG A;  1I58 A;  5CTU A;  4FW9 A;  4LWI A;  1AH6 A;  4PRV A;  3O2F A;  1B63 A;  4KSG A;  5CPH A;  2YKJ A;  2HKJ A;  4LFA I;  3R4P A;  2WEP A;  2BA1 G;  2J7K A;  5CTX A;  5IT9 C;  3MNR P;  2WI2 A;  3T2S A;  4R1F A;  4XDM A;  5M4E A;  2Z5B B;  4YY3 I;  3ZKD A;  4X62 I;  4EMD A;  2GFD A;  3RLP A;  3T1H I;  2IWU A;  3B78 A;  1XMQ E;  4YY3 E;  4X62 E;  4GEE A;  4LWG A;  3GCM A;  4YKY A;  4B3S I;  1I5A A;  3QDD A;  5M4H A;  1RRE A;  4DV7 I;  4X64 I;  3Q1Q A;  1UYM A;  2XCM A;  1IBM I;  1KTV A;  1FWK A;  2YE5 A;  2BM0 A;  4YKX A;  4MQY A;  4Z7Y A;  3OTO E;  1IBK E;  2XJX A;  2FXS A;  4DR2 I;  2YE7 A;  1R6L A;  4JAV A;  4AS9 A;  4EGH A;  1FWL A;  5M4M A;  3BM9 A;  5C0X D;  2AJ4 A;  3J80 C;  4JG4 A;  1UYI A;  3V2U C;  3QT6 A;  4NXM I;  1VIS A;  4DPW A;  1HK7 A;  4JQL A;  3T0H A;  1ZW9 A;  4BA2 A;  3QT8 A;  2E5L E;  1U2R A;  4IFD F;  4B3S E;  1N32 E;  3GIG B;  2UXC E;  3EKR A;  1YC4 A;  4NBQ A;  5JEA B;  1TBW A;  4DPY A;  5IDJ A;  1D6T A;  4U7N A;  1Z0B A;  2WI5 A;  3Q6N A;  4M1K A;  4R3A A;  1P42 A;  1UDS A;  2Z5C A;  1AM1 A;  1BGQ A;  2ZDY A;  4NXN I;  2XK2 A;  2AKP A;  4LF8 E;  1Z5C A;  4FWD A;  4GFN A;  3H1C A;  4FW7 A;  4FCQ A;  3C0E A;  1R62 A;  3C11 A;  1B3Q A;  5LMN I;  3GME A;  2VQF E;  1FJG I;  3PYG A;  4GKK I;  4FMT A;  3P3G A;  3TUH A;  2Q2E B;  2NN6 C;  5FNC A;  2BA1 D;  1DAR A;  3ZKB A;  1UYD A;  4U3B A;  4GKK E;  1UDO A;  4BXI A;  3ZZ0 A;  2BA0 D;  2BYH A;  2IOQ A;  4B3T E;  1I94 E;  5FWK A;  3D0B A;  3ZZT A;  1XNR E;  3G7B A;  3GIG A;  4HY1 A;  4GQT A;  2NN6 E;  5DRP A;  5IWA E;  4DR3 E;  3J7A M;  4LFC E;  3INX A;  1UY9 A;  3CRK A;  3T1K A;  5JEA E;  4JYA I;  1MU5 A;  4DXL A;  1S14 A;  2VF3 A;  2AE8 A;  3VAD A;  2V2Z A;  2K5B A;  4ISA A;  1IBL I;  4XIQ A;  4GKJ I;  2YE4 A;  4I3H A;  4B3R I;  2BZ5 A;  5BOC A;  1OSF A;  2Q8G A;  5FLX Q;  3A0X A;  3CGY A;  2VQE E;  4MOT A;  4DV6 E;  2CGF A;  4K4O A;  4BA1 B;  3A0Y A;  2C39 B;  5JEA D;  3P3C A;  1YC3 A;  2F1D A;  4XKO A;  4WUB A;  1N0V C;  4WUC A;  2Z5C B;  4JI7 I;  5DRO A;  4LFA E;  3VHC A;  4FWG A;  5FNF A;  2XDS A;  1XNQ I;  3JZ3 A;  2HK3 A;  3M85 D;  4L91 A;  2CZ9 A;  4P52 A;  1A6F A;  5ELW A;  4OO1 E;  1RR9 A;  4ASF A;  4AWO A;  2UU9 E;  1ID0 A;  1QY8 A;  4JI8 E;  2IWS A;  2CCT A;  2YEG A;  2PNL A;  4OO1 A;  4UT4 A;  1ZXN A;  2UUB E;  4BIU A;  1HR0 E;  3D2R A;  4HYM A;  4DV6 I;  1UYL A;  2C38 A;  2BYI A;  1YT2 A;  3T10 A;  3J80 Q;  2BU5 A;  1IBL E;  4ASB A;  2XEX A;  4GKJ E;  2O1T A;  4DUY E;  2ZIT A;  2O1V A;  4YKZ A;  3T0Z A;  3IED A;  2WI4 A;  2YI6 A;  2YGF A;  1I5B A;  4MBC A;  4U3D A;  4URN A;  2BR2 B;  2GS8 A;  2YKI A; 
#chains in the Genus database with same CATH homology
 2EFG A;  4DV0 E;  4LF6 E;  4NH7 A;  2V8P A;  2HKE A;  1KKH A;  1Z0C A;  2HFU A;  3K98 A;  3O6O A;  4KHP I;  2XDX A;  2GQ0 A;  5BR8 I;  4DV4 I;  1QYE A;  1AH8 A;  1ZM2 A;  1TIL A;  1U0Z A;  1PKP A;  4XCJ A;  4YKT A;  3WHA A;  4KHP E;  3OWB A;  3PEJ A;  4U93 A;  4JI5 E;  2Z5B A;  1Z0V A;  1THN A;  4CE3 A;  4DV7 E;  1YT1 A;  3K17 A;  4DV2 I;  4YKU A;  4FWH A;  3D36 A;  4KSH A;  2YEF A;  3TTZ A;  4LF8 I;  1US7 A;  2XDL A;  5CTY A;  2Q8H A;  2YGE A;  3EKO A;  4LFB E;  2BRC A;  5M4P A;  3JAM Q;  5C93 A;  5GME A;  3B8H A;  3T1H E;  4JI3 I;  1UY8 A;  2CG9 A;  4QPK A;  2XHT A;  4O09 A;  1BXD A;  3D4J A;  3KE6 A;  4XCL A;  4DV0 I;  4LF6 I;  1Y8P A;  2O1W A;  3B27 A;  3R4N A;  3RLQ A;  4JI3 E;  3HYZ A;  4JI6 E;  1N32 I;  1HNW I;  1HNX I;  1I5D A;  3R92 A;  3WQ9 A;  2IOP A;  4BQJ A;  4MP2 A;  3VHA A;  1XNR I;  1ELO A;  1PIE A;  5J71 A;  4JAS A;  4L8Z A;  4PRX A;  1YT0 A;  5LMN E;  5FLX C;  2R42 A;  4L94 A;  2ZM6 I;  1NHH A;  5CF0 A;  1H7U A;  2QFO A;  1YSR A;  2BM1 A;  2IOR A;  2UXD E;  4PL9 A;  4DR7 I;  3WU4 A;  4JAU A;  2UUA E;  5F3K A;  2PNM A;  4IZJ B;  4EM7 A;  4JI2 I;  1XMO E;  2YK9 A;  2DEJ A;  3EHG A;  4LWF A;  4URO A;  4DPX A;  3G75 A;  4DR5 E;  4IZK A;  2QG2 A;  3A0R A;  4EMV A;  4FCR A;  4X66 E;  3ZXO A;  3OW6 A;  2V2V A;  3G7E A;  1N36 I;  1USU A;  3HUL A;  4DV1 E;  3OPD A;  3TZ0 A;  2UUB I;  4IZJ A;  1FNM A;  5D6Q A;  3HJC A;  4LF9 E;  3LTO A;  3K60 A;  2XDK A;  3Q5J A;  4BQG A;  4MYU A;  2JKI A;  3INW A;  2YEA A;  5J6A A;  1XHK A;  1UYK A;  2HHH E;  1NHI A;  4IZJ D;  4JI4 E;  3F0N A;  4JI7 E;  1Z5B A;  2BV3 A;  4HAC B;  1N34 I;  4X64 E;  1TID A;  2XHX A;  2YE3 A;  3GIG B;  2XDU A;  2YE6 A;  4LF5 E;  4OX9 I;  4YKW A;  2YED A;  4AQY I;  3FV5 A;  3LNU A;  1N33 I;  1Z59 A;  1UYE A;  3B24 A;  2V34 A;  4V25 A;  3K85 A;  1UYC A;  1N33 E;  4XIT A;  3HZ5 A;  4K0K I;  1H74 A;  1TC0 A;  1K47 A;  2YJX A;  1S4E A;  2LJP A;  4JI5 I;  1I59 A;  1N0U A;  1UY7 A;  2OI2 A;  1EA6 A;  3HYY A;  2R3V A;  3CRL A;  5IDM A;  2ESA A;  2YKC A;  3QT7 A;  2ZBK B;  2UXC I;  3B25 A;  2CCS A;  2H8M A;  2WI7 A;  2XD6 A;  4BAE A;  4Q20 A;  3Q5L A;  3J81 Q;  3ZZU A;  3B82 A;  2Q8F A;  2CGE A;  4CWR A;  1Y4U A;  4QPJ A;  1HNZ E;  2XHR A;  4ASA A;  4DR2 E;  3P06 A;  4JI6 I;  3OTO I;  1IBK I;  1S16 A;  2JJC A;  3K99 A;  3CWV A;  4WUD A;  4HXW A;  4MPE A;  4ED4 A;  2YK2 A;  1QZR A;  2BU7 A;  1KVK A;  1HR0 I;  4DR6 E;  1UYH A;  4K0K E;  3GIF A;  4AWP A;  4EEH A;  4XE2 A;  4XD8 A;  2BU8 A;  2ZM6 E;  3OMU A;  4CWP A;  4ZVI A;  1YS3 A;  4DUH A;  1Z0G A;  4YKQ A;  2WW4 A;  4CWO A;  2YKE A;  1ZM9 A;  4L93 A;  2YEB A;  4DR1 E;  2C2A A;  2V2Q A;  4DV3 E;  4LPB A;  3A0Z A;  4HAC A;  3JAM C;  1L0O A;  4ASG A;  4U7O A;  4JI0 E;  2FYP A;  3A0T A;  5BR8 E;  4IZK B;  3FT5 A;  3HZ1 A;  4YHH I;  4JV5 I;  1ZWH A;  5GMD A;  4YKR A;  4B3R E;  2EXL A;  1IBM E;  4LF9 I;  3U67 A;  4EFU A;  4X66 I;  4LF4 E;  3R4M A;  4MP7 A;  3PYE A;  1MG7 A;  2PNR A;  4HY6 A;  4B7P A;  4CWF A;  2ZKJ A;  4L90 A;  3RLR A;  2XAB A;  3R91 A;  4CWS A;  1XMO I;  4KP4 A;  2VCJ A;  3ZM7 A;  4DR3 I;  2WI3 A;  3K1J A;  1N34 E;  4DR7 E;  4CWT A;  2HFS A;  4JYA E;  3J81 C;  2UUA I;  3WU5 A;  4XIP A;  1BKN A;  2BU2 A;  2YEJ A;  2YE8 A;  4LF7 E;  4JI1 I;  2Q8I A;  1FKA E;  4LF7 I;  1PVG A;  2UU9 I;  1ZM3 A;  1ZM4 A;  1FJG E;  2F4V E;  4URL A;  2YKB A;  1Y6Z A;  2Z5E A;  4Z7C A;  1TH8 A;  3PEH A;  2HCH A;  5BOD A;  3LPS A;  2BT0 A;  3EHF A;  4CWN A;  1MX0 A;  4CWQ A;  5D6P A;  4DPT A;  4H7Q A;  2E0A A;  4URM A;  2BSM A;  4DUY I;  1YSZ A;  2GQP A;  3EHJ A;  2QG0 A;  4FPP A;  4LWH A;  1AJ6 A;  3FT8 A;  4MPN A;  1A4H A;  4O04 A;  3QTF A;  3Q6M A;  1J5E E;  5D7C A;  4EGK A;  4X65 I;  3V5R A;  2BRE A;  2HG1 A;  2YI5 A;  1J5E I;  4XKA A;  4DUZ I;  5M4N A;  3PYD A;  4X65 E;  3NMQ A;  4FN5 A;  5M4K A;  2XX4 A;  4JI8 I;  3EHH A;  4LFC I;  4AQY E;  4LF5 I;  4OX9 E;  2UUC I;  2YE2 A;  2UWD A;  4CE2 A;  4P7A A;  3H80 A;  1H72 C;  4HYP A;  4E00 A;  4DPU A;  4DV5 E;  3CGZ A;  5CTW A;  1OJ4 A;  1NHJ A;  5LMU E;  1KIJ A;  2CH4 A;  2UUC E;  4GT8 A;  4GCZ A;  5LL6 R;  1WUU A;  4GGL A;  4X9L A;  5LMU I;  4B3M E;  2UXB E;  4DV5 I;  4DV4 E;  2YEE A;  4DUZ E;  3WU6 A;  3M6A A;  1HNX E;  2WER A;  2O1U A;  2X7I A;  4DU7 A;  4NH9 A;  2BU6 A;  4O07 A;  5IN9 A;  1UYG A;  2XX5 A;  1UY6 A;  4NXN E;  3BMY A;  4XIR A;  2XJG A;  1Z0T A;  4R3M A;  4XKK A;  2DEI A;  2XJJ A;  3J7A G;  4PU9 A;  4EGI A;  1UEK A;  4B3M I;  4DZY A;  5A2Q C;  3H4L A;  4XC0 A;  1YER A;  4EFT A;  1KZN A;  3DGE A;  2E5L I;  1GKZ A;  5D7D A;  1GKX A;  3SL2 A;  3ZXQ A;  4AWQ A;  4B3T I;  2IWX A;  4NH8 A;  1EI1 A;  2VQF I;  4DV3 I;  2VW5 A;  2VCI A;  4P8O A;  3WU3 A;  1HNW E;  4RPF A;  4H85 A;  4JI0 I;  1USV A;  4E01 A;  2NPF A;  3B26 A;  5GGZ A;  2WI1 A;  3U2D A;  2A2D A;  1TC6 A;  1XMQ I;  1N36 E;  3HEK A;  4DR1 I;  3GIE A;  1ZXM A;  4DR6 I;  3TZ2 A;  4ZKI A;  4DR4 E;  1I5C A;  2YEC A;  4MYT A;  4UTG A;  4USM A;  3T1Y E;  4O05 A;  2YGA A;  3HHU A;  3TZ4 A;  4FCP A;  4I5S A;  3PRY A;  4DV2 E;  1BYQ A;  4BIZ A;  4HXZ A;  5D7R A;  2HK2 A;  2HHH I;  4JI4 I;  5IT9 Q;  1JM6 A;  4MB9 A;  3Q5K A;  4LF4 I;  4E02 A;  1YC1 A;  4LFB I;  4NXM E;  2FWZ A;  1GJV A;  4W7T A;  2ZDX A;  2H55 A;  1YET A;  1Y4S A;  4YHH E;  4JV5 E;  2WEQ A;  2YEI A;  1B62 A;  2F4V I;  4DV1 I;  4MPC A;  3TZ5 A;  3VHD A;  2X36 A;  3B28 A;  4DR5 I;  1Y8N A;  2CCU A;  2QF6 A;  1AMW A;  4LWE A;  1H73 A;  5F5R A;  5L3J A;  4JI1 E;  1Z5A A;  2VQE I;  2YE9 A;  3A0W A;  4DU8 A;  3R4O A;  4DR4 I;  1FI4 A;  2YEH A;  4V26 A;  5A2Q Q;  4N3O A;  2VWC A;  3T1Y I;  3GON A;  3PYF A;  3K97 A;  1H7S A;  5FND A;  3QT5 A;  4JI2 E;  2BTZ A;  4USK A;  2UXD I;  1Y8O A;  2WI6 A;  3RKZ A;  1U2O A;  5IWA I;  1YES A;  3U2K A;  3O0I A;  2YI7 A;  1UYF A;  2UXB I;  4B6C A;  1HNZ I;  4KQV A;  2A2C A;  1XNQ E;  1I94 I;  4HZ0 A;  4KTN A;  4XTJ A;  2XX2 A;  4CE1 A;  3OWD A;  4HZ5 A;  1NZ0 A;  2YI0 A;  4O0B A;  4H81 A;  2YJW A;  4LP0 A;  1Z0W A;  1Z0E A;  2E1R A;  2FWY A;  4KFG A;  1I58 A;  5CTU A;  4FW9 A;  4LWI A;  1AH6 A;  4PRV A;  3O2F A;  1B63 A;  4KSG A;  5CPH A;  2YKJ A;  2HKJ A;  4LFA I;  3R4P A;  2WEP A;  5CTX A;  2J7K A;  5IT9 C;  3MNR P;  2WI2 A;  3T2S A;  4R1F A;  4XDM A;  5M4E A;  2Z5B B;  4YY3 I;  3ZKD A;  4X62 I;  4EMD A;  2GFD A;  3RLP A;  3T1H I;  2IWU A;  3B78 A;  1XMQ E;  4YY3 E;  4X62 E;  4GEE A;  4LWG A;  4YKY A;  4B3S I;  1I5A A;  3QDD A;  5M4H A;  1RRE A;  4DV7 I;  4X64 I;  3Q1Q A;  1UYM A;  2XCM A;  1IBM I;  1KTV A;  1FWK A;  2YE5 A;  2BM0 A;  4YKX A;  4Z7Y A;  3OTO E;  1IBK E;  2XJX A;  4AS9 A;  2FXS A;  4DR2 I;  2YE7 A;  4JAV A;  4EGH A;  5M4M A;  1FWL A;  3BM9 A;  2AJ4 A;  3J80 C;  4JG4 A;  1UYI A;  3V2U C;  3QT6 A;  4NXM I;  1VIS A;  4DPW A;  1HK7 A;  4JQL A;  3T0H A;  1ZW9 A;  3QT8 A;  2E5L E;  1U2R A;  4B3S E;  1N32 E;  2UXC E;  3EKR A;  1YC4 A;  1TBW A;  4DPY A;  5IDJ A;  1D6T A;  4U7N A;  1Z0B A;  2WI5 A;  3Q6N A;  4M1K A;  4R3A A;  2Z5C A;  1AM1 A;  1BGQ A;  2ZDY A;  4NXN I;  2XK2 A;  2AKP A;  4LF8 E;  1Z5C A;  4FWD A;  4GFN A;  4FCQ A;  3C0E A;  1R62 A;  3C11 A;  1B3Q A;  5LMN I;  4FMT A;  2VQF E;  1FJG I;  3PYG A;  4GKK I;  3TUH A;  2Q2E B;  5FNC A;  1DAR A;  3ZKB A;  1UYD A;  4GKK E;  4BXI A;  3ZZ0 A;  2BYH A;  2IOQ A;  4B3T E;  1I94 E;  5FWK A;  3D0B A;  3ZZT A;  1XNR E;  3G7B A;  3GIG A;  4HY1 A;  4GQT A;  4DR3 E;  5IWA E;  3J7A M;  4LFC E;  3INX A;  1UY9 A;  3CRK A;  3T1K A;  4JYA I;  1MU5 A;  4DXL A;  1S14 A;  2VF3 A;  3VAD A;  2V2Z A;  2K5B A;  1IBL I;  4XIQ A;  4GKJ I;  2YE4 A;  4I3H A;  4B3R I;  2BZ5 A;  5BOC A;  1OSF A;  2Q8G A;  5FLX Q;  3A0X A;  3CGY A;  2VQE E;  4MOT A;  4DV6 E;  2CGF A;  4K4O A;  3A0Y A;  4XKO A;  1YC3 A;  4WUB A;  1N0V C;  4WUC A;  2Z5C B;  4JI7 I;  4LFA E;  3VHC A;  4FWG A;  5FNF A;  2XDS A;  1XNQ I;  3JZ3 A;  2HK3 A;  4L91 A;  2CZ9 A;  1A6F A;  4P52 A;  4ASF A;  4AWO A;  1RR9 A;  2UU9 E;  1ID0 A;  1QY8 A;  4JI8 E;  2IWS A;  2CCT A;  2YEG A;  2PNL A;  4UT4 A;  1ZXN A;  2UUB E;  4BIU A;  1HR0 E;  3D2R A;  4HYM A;  4DV6 I;  1UYL A;  2BYI A;  1YT2 A;  3T10 A;  3J80 Q;  2BU5 A;  1IBL E;  4ASB A;  2XEX A;  4GKJ E;  2O1T A;  4DUY E;  2ZIT A;  2O1V A;  4YKZ A;  3T0Z A;  3IED A;  2WI4 A;  2YI6 A;  2YGF A;  1I5B A;  4MBC A;  4URN A;  2GS8 A;  2YKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...