4Q20A

Crystal structure of a c-terminal part of tyrosine kinase (divl) from caulobacter crescentus cb15 at 2.50 a resolution (psi community target, shapiro)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
233
structure length
231
Chain Sequence
b'ALADRSAALAEAERLKRDFVGNVSYELRTPLTTIIGYSELLERADSERGRNHVAAVRAAATQLARSIDDVLDMAQIDAGEMALEIEDIRVSDLLLNAQERALKDAQLGGVTLAVECEEDVGLIRGDGKRLAQTLDHLVENALRQTPPGGRVTLSARRALGEVRLDVSDTGRGVPFHVQAHIFDRFVGRDRGGPGLGLALVKALVELHGGWVALESEPGNGSTFTCHLPETQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein DivL
publication title Cell fate regulation governed by a repurposed bacterial histidine kinase.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Transferase
total genus 77
structure length 231
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4q20A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4q20A02
2UWDA 2XX2A 3Q5JA 4CE3A 1YC3A 4V26A 3HYZA 2WI1A 3ZXOA 5C93A 2BU2A 2YEBA 3B24A 1YT0A 4ASAA 1B62A 2H55A 3CGZA 2YK2A 3NMQA 4EEHA 2O1UA 3OMUA 3OWDA 3JZ3A 4GQTA 2E0AA 4O05A 3VHDA 1UYEA 2XX5A 1F51A 3EKRA 4AWQA 4CWRA 3TUHA 1UYMA 3ZXQA 4QPJA 1KIJA 4H7QA 2XJXA 1OSFA 2XDXA 3A0XA 3ZKBA 4EFTA 2QM7A 2FXSA 3DGEA 1YSRA 3T0ZA 5M4NA 1R62A 4KQVA 3PEJA 2BREA 4CWPA 1THNA 3TZ0A 4EGKA 1UY8A 1Y4SA 2YKCA 2YE7A 2YI6A 3T2SA 4URMA 3R4OA 5D7RA 2QF6A 1JOYA 1Z5AA 4X9LA 4XDMA 4CWTA 4HY6A 3ZKDA 3BMYA 4MPCA 4ASFA 5D6PA 2BRCA 3RLPA 4AS9A 1UYLA 3U67A 1YSZA 4ASGA 4PL9A 2O1VA 2YECA 2CCUA 3GIGB 4L8ZA 1Z59A 4MPNA 4NH7A 2Q8FA 1ZW9A 1TBWA 1TC6A 5FNDA 4JAVA 3R4PA 2JJCA 4KSHA 4KFGA 4LWGA 3ZRVA 2FTKA 1I5BA 4B6CA 1BXDA 4YKXA 3C11A 2EXLA 4XE2A 4O04A 1AJ6A 4YKUA 3IEDA 4CE1A 5IDJA 1UYDA 1MX0A 3ZRWA 2YKEA 1UYCA 2AKPA 4U7NA 3HHUA 3TZ5A 3RKZA 4E01A 3FV5A 3G75A 4HYMA 4WUBA 3OW6A 2BYHA 4KSGA 2YGFA 3Q5LA 4JASA 2BU5A 2YGEA 2BSMA 2YI0A 4YKRA 2VW5A 2YEAA 4GT8A 2YEHA 3R4NA 2CGFA 3K98A 4PRVA 1AH6A 1UYGA 2C2AA 2VCIA 2XJGA 2YEIA 2YE3A 2YGAA 2IWXA 2BU6A 1TC0A 2YJXA 3K60A 4I5SA 4E00A 3G7EA 1S16A 2XD6A 4XITA 2PNRA 5F3KA 4H85A 1I5CA 1UYIA 2CG9A 4R3MA 1YERA 1I59A 3CGYA 1Y8OA 3EHFA 3D0BA 2YI5A 3FT8A 2BYIA 4P7AA 3KE6A 4B7PA 3A0YA 1BYQA 4XIPA 2XX4A 3INWA 4V25A 1IXMA 4HY1A 4LWEA 1UYFA 3R92A 3ZCCA 4ASBA 4XCLA 1YT2A 1PVGA 2FWYA 4CWOA 2XDSA 2XHTA 3MD0A 4MP2A 3VHAA 3B27A 1A4HA 3K99A 4JQLA 4XTJA 3EHGA 5BODA 5M4KA 3TK1A 1I5AA 3O0IA 2YE5A 4CWFA 1YC4A 2VWCA 1UY6A 4EGIA 2LFSA 5D7DA 4LWHA 3QDDA 4KP4A 3R91A 2FYPA 4K4OA 4XIQA 4XKOA 3EHHA 1Z5CA 3A0WA 2P67A 2BT0A 4UROA 3VHCA 4I3HA 1AH8A 1NHJA 5GGZA 4O07A 1GKZA 2CCTA 2WEPA 4BXIA 4MB9A 1ZXNA 3ZRWB 3OPDA 1BGQA 4Q20A 3P32A 3VADA 2H8MA 2IOPA 3HZ5A 2HG1A 5D7CA 1JM6A 3ZM7A 2IOQA 2QFOA 4PU9A 2BU8A 5J6AA 2BZ5A 3HZ1A 1GKXA 2CCSA 4HZ0A 2YEFA 3U2KA 4AWOA 1QY8A 1YETA 4MOTA 3FT5A 2ZDYA 1UYKA 4EMVA 4YKYA 4BQGA 4HXWA 4CWSA 2GFDA 4L94A 4HZ5A 4L93A 4LC1A 3TTZA 1Y4UA 4MBCA 2ZDXA 5CTWA 1KZNA 2WI3A 1QZRA 1NHHA 4XIRA 4CE2A 3TZ4A 3OWBA 5M4HA 2XABA 3H80A 5M4EA 4JYCA 4R1FA 2YKIA 5M4MA 1TIDA 3EHJA 4LPBA 1I58A 2IORA 3RLQA 3A0RA 3Q5KA 4XKKA 2WI2A 2WI4A 4CWNA 3H4LA 4O09A 4HXZA 3ZRXA 3INXA 2BTZA 3A0TA 1BKNA 5M4PA 2ZBKB 4URNA 2JKIA 2XDLA 2Q8IA 3MNRP 1L0OA 4O0BA 1EI1A 1US7A 4EFUA 4ZVIA 2XHRA 4KTNA 1B3QA 3K97A 2YEEA 5CPHA 1Y8PA 4R3AA 1GJVA 2HCHA 3RLRA 4GT1A 2IWUA 4MP7A 1S14A 4GEEA 3O6OA 2QM8A 5L3JA 3WHAA 2WEQA 2O1WA 4WUDA 3CRKA 2IWSA 4URLA 4L91A 1AMWA 1ID0A 5IN9A 3WQ9A 5F5RA 4QPKA 4U93A 5B1NA 4XKAA 2XDKA 5FNFA 5CTUA 4WUCA 3B26A 4L90A 4W7TA 2HKJA 2WI7A 5CTXA 5IDMA 2GQPA 1B63A 2YEGA 3T0HA 1Y8NA 1UY7A 3C0EA 1TILA 4DZYA 5B1OA 2YEDA 4LWIA 3CWVA 2WERA 2Q8HA 1U0ZA 3QTFA 2QG0A 4FCPA 4BQJA 4DUHA 3T1KA 4YKTA 2YEJA 2WWWA 2YJWA 1YC1A 3TZ2A 4AWPA 4H81A 4EM7A 4U7OA 1ZXMA 3LPSA 4XD8A 4LP0A 1YESA 2FWZA 4GFNA 4FCRA 2YI7A 2WI5A 1H7UA 2ZKJA 2Q2EB 2YE9A 3LNUA 4ZKIA 4PRXA 2XCMA 5D6QA 2BU7A 4E02A 3NXSA 3D2RA 1U2OA 2CH4A 4BAEA 5J71A 4GGLA 3GIEA 4BIUA 4EGHA 4NH9A 1UYHA 4FCQA 3BM9A 1YT1A 4HYPA 4MTXA 3CRLA 1H7SA 4MPEA 5CTYA 2YE4A 4GCZA 4P8OA 3HEKA 2XK2A 1UY9A 3B25A 3SL2A 4XC0A 5BOCA 4CWQA 2XHXA 3EKOA 4NH8A 4BIZA 5FWKA 1NHIA 3T10A 1QYEA 4JYBA 2Q8GA 5CF0A 3B28A 3PEHA 1MU5A 2K5BA 2YK9A 2YKJA 2YE2A 4YKZA 1EA6A 1YS3A 4MT8A 2YKBA 4LWFA 4JAUA 1Z5BA 2ESAA 3A0ZA 4FMTA 5FNCA 2VCJA 3HYYA 2QG2A 2XDUA 3O2FA 4YKWA 3U2DA 4XCJA 2YE8A 1TH8A 3GIGA 1ZWHA 2YE6A 3GIFA 4YKQA 2XJJA 2LFRA 4FPPA 1AM1A 2WI6A 1I5DA 3G7BA 3R4MA 3D36A
chains in the Genus database with same CATH superfamily
1PNLA 4Q6GA 2EIMC 5J2TA 2WLHA 1I7FA 1E79G 4EEQA 4UV9A 2QR4A 5C93A 2BU2A 1GMGA 4MW3A 3BHPA 1AVMA 2UUAB 3TXQA 4JTDB 2X6CA 3CGZA 4LF7O 1QVGU 3OT7A 3OMUA 2JJ1G 2P4KA 3JZ3A 2E0AA 4O05A 5JJEB 3VHDA 5KHKA 2XX5A 1F51A 3SPGA 5DECA 1JA8A 2HFEC 1WB7A 3RVYA 4CWRA 1Y74B 4PA6A 4DUZB 1Q43A 1PM9A 3SYPA 4IT5A 1SETA 1S72V 2UUBO 1JFFB 5H9CA 3O9OA 1YJ9V 4MTGA 2V4DA 2JEXA 3T0ZA 3MHHC 1R62A 4CWPA 3F7YC 3LSSA 5IT9N 2BE3A 5KUKA 2UUCO 1Y4SA 3FX7A 4DW1A 2XUMA 3R4OA 3ZBHA 4WCEV 1OHHG 3JAKB 1FPOA 2CTWA 1Y76B 3U11A 4MVRA 3CCJV 4XDMA 2WLLB 4MPCA 1H38A 3C3TA 3ABKB 2ZDIA 1K8AW 3CP1A 3RWRD 2R70A 1AI6A 1I5YA 3U67A 1JX9A 4PL9A 2DQ0A 2O1VA 1YCIA 3GIGB 4NH7A 2ZM6O 1ZW9A 1OCCC 4I4TB 5FNDA 4JAVA 3R4PA 4W4LA 1ENVA 2JJCA 1RM1C 4KSHA 1BGYH 3ABMC 3H1IH 3H9VA 4JI3O 1I5BA 1XQ8A 3C11A 4TV9B 4YKXA 2A06H 2KKWA 4UCRA 2ZKOA 4XE2A 1YI2V 3E8HA 3W7UA 1ZSPA 1FXKC 3IEDA 4CE1A 1V9PA 1R3JC 2QTSA 4CH5A 3ZRWA 1SQXH 2N74A 1VARA 3ABLC 4G28B 1XNRO 3AG2C 3ZS8C 4X89A 4JTAB 2DW4A 2E75B 3CEIA 5EZYB 4QNHB 5B1AB 1GH6A 4WUBA 3OW6A 1Q81W 4KSGA 4X9QA 2FMLA 1SQFA 2HVKC 1R73A 1MZEA 2YI0A 3PN1A 3CRMA 4YKRA 3OFNG 4YJ3B 3SDLA 2G38A 3L70H 2CGFA 4JPRA 2N04A 1B04A 2XJGA 2IJJA 3N2GB 4PI0A 2FYUH 5TISZ 1WJZA 2F93B 1BZKA 1IZ3A 4UXNA 4DR6B 3B2EE 4FZ0A 3WU2Z 5K1PA 4XITA 1K33A 1Q86W 5F3KA 3RYFB 1Y6XA 3EXAA 3K0DA 1I5CA 2B1IA 2YXYA 1P49A 4AQYO 1I59A 1V54C 3RYCB 1L0LH 1WP7A 3CGYA 1YJNV 2YI5A 2W0FC 4IHJA 1S76D 4DYLA 2F23A 3CS5A 1MA1A 1SZTA 3CYOA 4ASBA 2FWYA 2Y4UA 1NU1H 1YVWA 2XHTA 3MD0A 4MP2A 2Q9LA 3K79A 4FM1A 4UVBA 3TJTA 2H3OA 4B7EA 1K73W 3L9DA 5BODA 3ZN0A 3AK2A 5M4KA 1X4TA 3UT5B 3KKYA 3O0IA 4DR3B 4LBEC 2UXXA 1HNXO 4QE7A 1OZ0A 2PI4A 4L87A 2OTLV 1S77D 4K0KB 3PJSK 3QDDA 3BPZA 4B3SB 4XIQA 1VP7A 3RYIB 2UUAO 2AGAA 1Z5CA 4X65B 1R6NA 4X1YB 2BT0A 2QKCA 2Q6AA 3OE7G 2H94A 1KP2A 1GKZA 2WEPA 1GM9A 2D2CB 2OIGA 2HLDG 4TV8B 1ZXNA 4O4LA 3H1LH 1G4YB 3VADA 2X0LA 1MNGA 2H8MA 1YITV 1JM6A 3ZM7A 2IOQA 2LO1A 2BU8A 5J6AA 4B3MB 2BZ5A 3HZ1A 1BT8A 2YDEA 2NLJC 1W0JG 2CCSA 2YEFA 5EIBC 1OCRC 4JI6B 1JVMA 1N34B 3JASA 1QY8A 4MOTA 2X6AA 4DV0B 4PA3A 2ZDYA 3FT5A 2E5LB 4YKYA 3N2KA 1SA0B 3TTZA 2DYRC 2F43G 3ETQA 1N36B 2XAJA 3K03A 1ZUQA 3APOA 1DF4A 4HNAB 5M4EA 4X20B 4R1FA 3M99B 4LNUA 3EHJA 1K92A 4JGSA 1I58A 3RLQA 4GUNA 2WI4A 4CBCA 5LP6B 2HHIA 1M1KW 4B3RB 3INXA 3A0TA 1DLBA 4CC5A 3CB2A 2JKIA 2XDLA 1XMQO 1KP3A 2Q8IA 4DV2O 1ZLZA 3K04A 1H2LA 3LNMB 4BIOA 3CCSV 5C8YB 2YEEA 4X64B 1ZL8A 4R3AA 3ZMSA 1WPBA 1CPYA 2HCHA 4CS2A 1S14A 5B5EZ 2EX3A 1AR1B 4DR5B 5CBGA 4L8JA 1JJ2U 4FJCC 2BCCH 2WEQA 1FXKA 4WUDA 1AR4A 3B4SA 1Z2GA 1M5IA 4JI4B 5L3EA 4URLA 4O2BA 3BY6A 4JI0O 2Q8VA 1COWG 3MAQA 1KD1W 4QPKA 3RYHA 2QSAA 5FNFA 1NTKH 4WUCA 3L74H 2UXCO 2YC0A 4L90A 4W7TA 4JI7O 4RO2A 4U3JA 5B3SC 2WAMA 2GBOA 3T0HA 3GWKC 4YJ2A 2ZR2A 1Y8NA 1NVPD 5CBHA 3JD2A 2CH7B 3ZMZA 3DXRA 1XHXA 1AJQA 2JJ2G 1IVSA 1PPJH 3HKDA 2PY5A 3HKCA 1TUBB 2D3OW 4CC6A 2WERA 1U0ZA 1NBMG 2KG7B 4BQJA 1RSOB 4LH7A 2YEJA 2HJFC 1Q6HA 2YJWA 2A9HA 1K3EA 1EN5A 3A8TA 1XUQA 2ZINA 1VQLV 4WFBV 2YE9A 4PA9A 1EBOA 5EYPA 1F23A 4LFCB 1M4UA 5D6QA 4E02A 1VQKV 2ZD9A 3AG1B 4UUJC 1GKFA 4DR3O 2E74B 1U2OA 5EBLC 3GIEA 4BIUA 3CE2A 3SYQA 4K0KO 2WLIA 1QLNA 3IGAC 4MTXA 2HJDA 4UB8Z 4H44B 4X65O 4DRXB 2RQ6A 1I08A 4WF9V 1J5EB 4GKKB 1W0KG 2ZNJA 3QG5A 3QO5A 5FPRA 4J7KA 4TWKA 5EIBD 5BOCA 2XHXA 1U97A 4UFZA 4BIZA 1Q5OA 2KSDA 3UM7A 3CCEV 5IE9A 4JYBA 1HNWB 2Q8GA 1MU5A 4KXRA 2K5BA 3G80A 2XAGA 3K5MA 2YKBA 4B3MO 2GTSA 1VF5B 1RPRA 1J95A 4ZIBA 1GTOA 4IGGA 1E1RG 2ESAA 5FNCA 4G2KA 2VCJA 4FFBB 3JATA 5J9PC 1LNQA 3O2FA 4YKWA 4JI6O 1PD3A 2E76B 1YSCA 4DV0O 1IURA 2OCCC 3RW0A 2YE6A 1WA8B 2EZPA 4DK1A 2E5LO 4I0XB 4YKQA 4AILC 1AM1A 2WI6A 3L71H 5LMNB 3E8GA 4CH4A 4LF6B 1D5AA 4EB6B 4WFAV 3OMAB 3K08A 1YC3A 3VQVA 4PDLA 1GAXA 4HYOA 4RAIA 2Y4TA 3OTOB 3JAWB 1QR8A 1FFXA 4KUMA 1Z5WA 1QNMA 3X2QB 4DK0A 2QTOA 4B3RO 3B24A 1YT0A 4QGPA 1HR0B 3E83A 5BR8B 1B06A 2H55A 3FYEB 5LOVA 4B3TB 1H2KA 1EFRG 2B1GA 3CCUV 4R6ZA 4P9PA 2QWRB 4LF4B 1F7YA 1SQQH 4X66B 1QLEB 4FM2A 4JZGA 3CPWU 3TUHA 1UYMA 4ZI7B 4DR5O 1ORQC 2EINC 2YIAA 2XDXA 3A0XA 3W7TA 3G4SV 3GWOA 4DV4O 5KHJA 3DGEA 4CS4A 4LP8A 1YSRA 3ML0A 5M4NA 4JI4O 3W7WA 1V55B 1YZBA 3TZ0A 1PNKA 2YIDA 3APQA 4DV7B 2GUZA 1Q6UA 4FLWA 1N33B 3T2SA 4URMA 2EJRA 5D7RA 3E2EA 3AG7A 1Z5AA 1X59A 5JH7A 5IYZB 3C3SA 4PA4A 3ZKDA 1NR1A 4MS2A 3LUTB 1LUVA 4AS9A 2YI9A 2BOBC 1GK9A 2MW2B 2GSMB 4UVAA 3K59A 1RFYA 5JWPA 2PF4E 2GV9A 1Z59A 3K9AA 2BTQB 1NI8A 3JALB 1VQ4V 2EJ7A 5BMVB 3QO7A 4KFGA 3ZRVA 5JJJB 2JK5C 3CJHB 2RJZA 5KAFZ 5J2TB 4P30A 1N4CA 4LFCO 1TVKA 2E3CA 2EIKB 1WP8A 5IJ9A 4RQFA 1KMIZ 1AJ6A 1UYDA 4CS3A 5LXTA 2YXLA 1H2MA 2YKEA 4U7NA 3HHUA 4LCUC 4E01A 4YIPA 2EILB 3FV5A 4LF8B 3O65A 2VS0A 3Q5LA 1LUWA 4E72A 4WFEA 2BU5A 2PTMA 2YGEA 3K58A 2BSMA 1BSMA 4GKKO 1J5EO 3F5WC 2YEAA 4H33A 4PRVA 1UYGA 3DTUB 2VCIA 1XOUA 2YEIA 5LA6A 2YE3A 5B66Z 2BU6A 5EBMC 4WBNA 1TC0A 3N27A 3CXHF 2YJXA 1SZXA 4E00A 4JYAB 1HNWO 3G7EA 1S16A 1IBLB 4NYKA 3KCXA 1S5JA 4H85A 1HW7A 2LW7A 1M56B 1UYIA 2CG9A 5JQGA 4R3MA 1SC5B 4LWSA 5H6QA 2R9AA 3FT8A 4P7AA 1RPOA 1FD9A 4XIPA 3MHSC 4O2AB 3INWA 4HY1A 4I55A 2HHHB 4LWEA 1K4DC 4XCLA 1YT2A 4CWOA 2CDYA 5LMNO 3CRQA 3IJ4A 2XASA 1A4HA 4DV1B 4XTJA 3TK1A 1EN4A 3AG4B 3WB0A 4LFBB 2IJKA 2UXNA 2Z3YA 3Q4HB 4CWFA 3ASOC 4J80A 4EGIA 3OTOO 4FLTA 1PKXA 4UCSA 2DN9A 5D7DA 1IDSA 4LWHA 1UPGA 3FD9A 1HR0O 1HP8A 1BS3A 5BR8O 1B6QA 4B3TO 1AH8A 4O4HA 1F4MA 3WG7C 5K1XA 3H1HH 3B8MA 4NXMB 3CRCA 4X66O 4BXIA 4MB9A 4DUYO 4X88A 3ZRWB 2QA4V 5KA5A 4D7SA 2OIEA 3IC9A 1NQTA 4LF5B 2OTJV 2IOPA 5D7CA 2IBZH 1YF2A 4PU9A 4UCVA 4W4KA 5ITZA 3T1CA 1P4RA 3GVMA 4YY3B 3CCVV 2PZSA 2JGUA 1WAZA 4RUEA 3OMNB 4UVCA 1YETA 2LGQA 1JFFA 1UYKA 3CCLV 3LNNA 1HNZB 3JAMN 5E79Z 1OCOB 2Y69B 3ZIAG 4L93A 4MVUA 2HVJC 3EHBB 5CTWA 2A79B 3UKMA 3SJAC 1GN2A 2QM4A 3CD6V 5M4HA 5FPOA 3P3PA 4X1IA 4LPBA 3AG3B 4DR4B 4E2LA 2IORA 4NVPA 4DXWA 3JAKA 3CWBH 4XKKA 4OXSA 5LMUB 2WLLA 2YSUB 4DR2B 2XHBA 4K3AA 3I55V 2ZBKB 2FKXA 1L0OA 3JCZA 4O0BA 1YTFB 1US7A 4EFUA 4ZVIA 2XHRA 4JZ2A 1IBMO 2EIJC 2NN4A 1GJVA 5LGNA 4I4TA 4BWAA 2ZCEA 3RLRA 2YEVB 4GT1A 2IWUA 3G6BA 4GZRB 1Q7YW 4UB6Z 3P30A 4J11A 4AHCA 4DV3O 2Q0AA 2QM8A 5L3JA 2O1WA 2LW1A 2OCHA 3STLC 4LF8O 2Y48A 1XL6A 3FAVA 2IWSA 3CHXA 2DWEC 1MABG 4DR7B 5B1BC 2Q7HA 1ID0A 5IN9A 3JD0A 1GO3F 1N0JA 4U93A 1VQ7V 5EZYA 4XKAA 4Z2WA 5CB4B 1Y66A 1G6UA 2ETNA 1IXBA 1SQGA 2HKJA 1OCZC 3U0ZA 2GQPA 4MTOA 4I7ZB 2AHZA 4JYAO 2WPDG 1IBLO 1K5SA 1N8RW 1F4NA 3UQ8A 2CTRA 1BMFG 3CCQV 3SYOA 2Q68A 3AEIA 3JASB 3OEEG 2OT5A 1PP9H 1XILA 4DW0A 1BHBA 4DUHA 2P7TC 3ASNC 1GM7A 2WWWA 4AWPA 1YC1A 3N2KB 2YIBD 3OEHG 1JQ0A 5DN6G 1YEWA 2BSKA 4A5UB 2HHHO 1K9MW 4FCRA 3RYCA 1DF5A 2YI7A 4LH6A 1AILA 2Q2EB 1NH2B 1QCEA 4DUZO 2JRIA 1VMGA 4MVMA 3K06A 4PRXA 3ZJZA 4DV1O 3RFRA 4LNUB 4JI5B 3JD1A 1MOFA 1R6KA 2QGNA 3H1JH 4LFBO 1K34A 2ZIMA 5J71A 5JENA 1I94B 5L3DA 2F1MA 2NNUA 2YUAA 4TQDA 3S5TA 4EGHA 1BQ0A 1FAFA 3B8NA 2ZR3A 4YXWG 1QR9A 4OPAA 1H2NA 3K3WA 2P22C 3W7SA 2AZ0A 5KMGB 4FZ1A 1OCCB 1XEQA 4TOIA 2PGGA 3HEKA 1RM1B 3RYIA 2CTPA 2ZE5A 3ABMB 4J10A 3B25A 4NXMO 4CWQA 3EKOA 4X1YA 3T10A 4O4IB 3B28A 3PEHA 4LF5O 2YKJA 4F6EA 2YE2A 1FXKB 1AROP 1WLEA 3TETA 2UU9B 3ZMVA 5J2UB 1P84F 1BL8A 4BR6A 3ABLB 2WSSG 5DEDA 4RWUA 4TV8A 3AG2B 4FLZA 5FL7G 1Z5BA 3HKBB 4ZHQA 4NTYA 3A0ZA 5IYCO 3HYYA 3RYHB 2WLMA 3U2DA 2W6JG 2YE8A 1TH8A 4NXNB 3GIFA 3RT3C 4WFFA 2XJJA 2LFRA 2H8PC 4TT3G 4YJ2B 1AI7A 1NZ6A 4GKJB 4PV1B 2P06A 1R3IC 2EULA 2A3QA 3DXRB 5BXZA 5IJ0B 1T5EA 2F4VB 3Q5JA 4CE3A 3JCUZ 3HKCB 4KL1A 3D3QA 4DR4O 4K35A 2WI1A 3ZXOA 5E1AC 5IY5C 3K9SA 2LJ2A 5LMUO 1AJPA 4HNAA 4X20A 3X2QC 4ASAA 1V54B 4X8AA 2RNBA 4DR2O 1B62A 1SRYA 3QO8A 3HKEB 5LP6A 3J81N 2PYLA 5EYPB 4GQTA 1OV9A 2QDOA 1XHZA 4DR6O 5KLVH 2LGWA 3BAAA 3EKRA 3B77A 5H6RA 1NKDA 1ZX3A 4JTCB 2VQFB 3ZXQA 4NTXA 2Z0AA 4NR1A 4QPJA 2WLIB 1KIJA 1VQNV 4H7QA 1WN7A 2EZOA 2CAZC 4KQVA 5CA0A 3PEJA 4B08A 4FFKA 2YI8A 5H5NA 4RUFA 3EVKA 4GX5A 2YE7A 3JARB 3FB5C 1M57C 1JPXA 3OUSA 2QF6A 2UXBB 3BCCH 4ZOLA 3JSNA 1GN4A 4X9LA 2X6BA 1EZJA 1Y67A 5KUMA 4HY6A 2IU3A 3ABUA 5JVDA 1A32A 1YIJV 2ZE8A 3LSUA 4B3SO 4DV6B 2ZXWC 4NTWA 3ZRSA 3R66A 2JGDB 4F6RB 1YSZA 2DYSC 3CXCU 3SPJA 3LDDA 2CCUA 1N0NA 4L8ZA 4MPNA 3CX5F 2IJHA 2CH7A 1VEWA 3T2MA 1OCRB 1QVFU 3U10A 4B7KA 4CH3A 2Y0PA 2DWDC 2EXLA 2DYRB 1NTZH 2FL4A 4JI5O 4X62B 3FFQA 4FLUA 5FNVB 3QTCA 4MVOA 1FFXB 1UYCA 5KHIA 4J9ZB 2RCVA 3TZ5A 4I9WA 5CA1A 3RKZA 3G75A 4HYMA 1N34O 2BYHA 4LF9B 2YGFA 2EILC 4JASA 5LOVB 3HPLC 2P6JA 2UXDB 1PL4A 1CP9A 4K8XA 4JV5B 1N36O 4I50A 4O4JB 2VW5A 4GT8A 5EC1C 4MVSA 4Z1MG 3K98A 2EBOA 2C2AA 4PDRA 3OD4A 5GTIZ 2YGAA 1IBKB 4LF7B 4TUYA 3UCSC 3K60A 4I5SA 3BEHA 4EFBA 2WA3A 2ZNIA 1NTMH 2PNRA 4GX2A 5IWAB 4LFAB 1KC8W 3ZEDA 4NB5A 2ZQMA 3EHFA 3D0BA 4UCOA 2UUBB 4C7UA 4KHPB 2GUZB 3BA8A 4B7PA 4NXNO 3UO2A 4V25A 1IXMA 4X64O 3R92A 1EM1A 5JH7B 1PVGA 2UUCB 2IW5A 3VHAA 3E22A 3B27A 1GN6A 5B3SB 3M7MX 2HP8A 4MVQA 3WB1A 3EHGA 1M93A 2LP7A 2F4VO 1I5AA 1N32B 2YE5A 3IAYA 3OGIB 1CEZA 1M9NA 1YC4A 1UY6A 4WFGA 3RVZA 1R6TA 4NKGB 2ZE6A 4YHHB 4XBFA 2FYPA 4XKOA 5JJNB 5KX5B 3EHHA 2Q73A 3A0WA 1DTOA 1URFA 4UROA 3VHCA 4H13B 3CC7V 3JAWA 2WLJA 3A2FA 1L8DA 4O07A 5LYJA 4JI2B 1TVKB 2ZM6B 2XNDG 2ZIOA 2R9IA 2XT9A 1H8HG 5LBQA 3OPDA 2ILMA 3ABKC 1Q90D 1KYOF 4JAAA 4XDJA 2HG1A 5F2VO 4X1KA 2QFOA 1KUQA 1GKXA 1KECA 3SGIA 1XNRB 5GONA 4ZI7A 3FB7C 1FS0G 5JCOC 2IJIA 3JD4A 5LA6B 4EMVA 4BQGA 3OTFA 4WBNB 4HZ5A 4IIJA 1L0NH 3VOUA 1Y4UA 5EK0A 2ODMA 3WFVA 1NS1A 5KAIZ 1FXVA 1QZRA 1VQ6V 4XIRA 4CE2A 3P3NA 3TZ4A 2XABA 1U96A 2YKIA 1TIDA 5B1AC 4DV6O 5IYZA 3Q5KA 3SJBC 4CWNA 3H4LA 3JYCA 4R7CA 4HXZA 3CRAA 2QJ1A 2BTZA 1PV0A 4XDLA 3MDSA 3K5LA 3MNRP 2R9RB 2OCCB 1PL0A 1SERA 4H37A 4IYHA 2Q69A 3JD3A 3K97A 3ZHUA 3FB8C 2BTQA 5CPHA 1XREA 1Y8PA 3VQYA 4X62O 2MK3A 3ZHTA 3O6OA 3CJHA 2XTAA 3SJCC 2FB5A 3OR7C 1WNSA 4JI1B 1ROPA 3B09A 5AG2A 1HNXB 1VIBA 4LF9O 3CRKA 2V7QG 3OMIB 1GM8A 1G1XB 4O4HB 2UXDO 1AMWA 3SYAA 4JV5O 3SPCA 2C1GA 5F5RA 4LF6O 2PYJA 1QU7A 5KHHA 2CTQA 3T4DA 3BVOA 1DK1A 4J42A 4OX9B 1IBKO 3THOA 2Q4PA 3JSLA 4PA7A 1D2DA 4UCTA 5ITZB 1TA8A 5IWAO 4DZYA 5B1OA 3RGBA 4LFAO 2YEDA 4LWIA 4EFEA 2EINB 1AJNA 4YIOA 4ABMA 3QTFA 1SQBH 2QG0A 3F7VC 4FCPA 4BAYA 4KHPO 2GTAA 2JVDA 1K5QA 3TZ2A 4H81A 4EM7A 4U7OA 4LF4O 1ZXMA 4XD8A 4LP0A 4GFNA 1ZTEA 2CUGA 2WI5A 2ZKJA 1AI5A 1P7GA 3G67A 3D8CA 3LNUA 3ZHQA 2XCMA 4X1IB 4O2AA 3VQWA 3D2RA 1N32O 3ZX6A 2CH4A 4BAEA 3A0HZ 3ETGA 4PD4F 5EBWC 3UO3A 1Y74A 4ASUG 4YHHO 3T1YB 2GDSA 4NH9A 1UYHA 4QE9A 1NJIW 3BM9A 3G6EV 4DV7O 1IX9A 2ADQB 2HG5C 5IYDO 3CRLA 2CGOA 1N33O 1NT2B 1FXHA 3Q4HA 4MPEA 4DO2A 1R3LC 5LL6Y 1ZAUA 4G27B 1WB8A 1OJHA 4GCZA 1K4CC 4JI2O 5LGTA 1HDJA 5LGUA 5EC2C 3SL2A 1XMQB 3CMAV 4DV2B 4Z1VA 1MSDA 1QYEA 4N23A 4F4LA 5CF0A 1Y76A 4YKZA 1EA6A 4IHJB 1YS3A 3FAVB 4MT8A 3STZC 1K7DA 1US6A 3F5TA 5LP6C 4MW8A 1MSWD 2AZ2A 3VQXA 1AP6A 2XAHA 2HEPA 4FMTA 2RDCA 2QG2A 4MVZA 4TSFG 1W2BU 1SF9A 3WB2A 3H1KH 3GIGA 4P9OA 2IU0A 3QVNA 1VF6C 4JI0B 3CMEV 4FPPA 2P5OA 3G7BA 2UXCB 2EIMB 2AW9A 2ARHA 4TV9A 5JCOA 4JI7B 2UWDA 2XX2A 3OR6C 5LHGA 3ABTA 2QWOB 3A0BZ 4V26A 3HYZA 1YTFD 2GHYA 1QBZA 1XL4A 4PELA 2M6YA 2YEBA 3IC7A 4GX0A 2PUSA 2BSKB 4OGQB 3TXSA 4CZZA 1TAEA 4O4LB 2YK2A 3ZN1A 4D6TH 1XMOB 3NMQA 1I0HA 2JIZG 4KFMA 2NR5A 4EEHA 2O1UA 3OWDA 4YJ3A 2Q67A 1FKAO 2RN9A 1UYEA 1TUEB 3KCYA 4AWQA 5IYBO 3N2GA 1H2SB 1AP5A 1MG1A 5CA3A 2KQXA 2WLKA 5BY1A 4MTFA 1VQPV 4JI8B 2XJXA 1OSFA 4JI1O 3ASOB 3ZKBA 2VWKA 4EFTA 2QM7A 3RYFA 2FXSA 2YEVA 1YDXA 5L3GA 4R8CA 2BREA 1BE3H 4J7ZA 2WLNA 1THNA 1JR9A 4EGKA 1UY8A 2ZT9B 1BHAA 2XOKG 3GB7C 3OW2U 2YKCA 3CC2V 2CK3G 2YI6A 5CMUA 2Q7EA 3WG7B 1JOYA 1L1FA 4OX9O 3AG1C 3ETEA 2DJVA 4CWTA 4PHZA 2YICA 5CB4A 5L3BA 3BMYA 4ASFA 1QQCA 5D6PA 2BTOA 2BRCA 3RLPA 1W59A 4IL6Z 3UT5A 4ZHQB 2YIBA 1ZWIC 1UYLA 4QJFB 4ASGA 1NH2D 3L73H 5L3FA 2YECA 3BABA 3BRCA 3DC5A 2O57A 4E4EA 1ZL8B 2JEUA 2Q8FA 1Q3EA 1TBWA 1Q6IA 1TC6A 4FK5C 2JS5A 4D7TA 3K5NA 2ADPA 4GYCB 4OPHA 4LWGA 2Q7GA 2FTKA 4B6CA 1BXDA 2XAQA 3OUFA 1FFTB 2QWNB 2W0XA 2WA4A 1E1QG 4O04A 4YKUA 1PNMA 5IDJA 2K9PA 1MX0A 4O2BB 2AKPA 1YJWV 4YY3O 2L35A 3EFFK 2JS3A 2P4VA 1S5HC 1BQZA 3LDEA 3T1YO 4J7JA 4U3JB 2A0LA 3LSQA 2XAFA 1HNZO 3AK1A 1QHTA 5DM6V 2PI5A 2M7WA 2Y0IA 1XI1A 2YEHA 2AXTZ 3R4NA 2QWPB 1AH6A 4LR3A 1EZVH 3HKDB 1R1BA 2IWXA 2DOSA 1SA0A 4FM0A 4WFHA 2EIJB 5KMGA 1KQSU 4UV8A 2XD6A 4I9QA 3L72H 4BW5A 5A2QN 5H2FZ 5CA0B 2P90A 3B40A 1YERA 5CBFA 1VQ8V 2VQEB 4O4IA 1Y8OA 1JMKC 4K8ZA 2BYIA 3KE6A 4DV4B 1M90W 3A0YA 4FIPC 1NVPB 5J2UA 1BYQA 4DV5B 2XX4A 5B1BB 1SQPH 1UYFA 3HKBA 4ZOLB 3ZCCA 3E89A 1QLEC 4BW9A 2XDSA 1THZA 5D5QA 5JVDB 3K99A 1H2GA 1XNQB 1OCZB 3FYIB 4JQLA 3KZIZ 3D3IA 1VF6A 2C1IA 5C8YA 1LR1A 4N21A 1GN3A 1VQ5V 1AB3A 2VWCA 4EKWA 4PDVA 2LFSA 3E86A 4DR7O 4KP4A 3R91A 3CRRA 4PI2A 3G71V 1V55C 5IJ0A 2OWOA 4K4OA 2DE0X 2BOCC 1Z5VA 1Y4MA 3RN4A 2P67A 4FVMA 3DSQA 4I3HA 3ASNB 1UJWB 1XMOO 1NHJA 5GGZA 3J7AU 1EN6A 3CCRV 2RMKB 4AI8A 4IYIA 4FLVA 2CCTA 1H8EG 4DR1B 3HB3B 1BGQA 4Q20A 1FJGB 3KG2A 3P32A 3JATB 2K1EA 3HKEA 5CA1B 1I5XA 4JI8O 1VQOV 3HZ5A 1JCHA 1HWYA 1S0VA 1GRJA 2VRZA 3ETDA 1XBLA 2V1DA 4HZ0A 4GX1A 3U2KA 1G8MA 1TUBA 5BZBA 4I50B 1SQVH 2KG7A 4AWOA 3ZMUA 1FYJA 5KHGA 1RSOA 3D36C 4CWSA 4HXWA 2GFDA 1SS3A 2LQTA 3T1HB 4L94A 4LC1A 4TUYB 1P7BA 3K0GA 1S5LZ 1NR7A 4MBCA 2EIKC 4HZ3A 3OAAG 2ZDXA 1KZNA 2VWJA 3CC4V 3HR0A 5GW7A 1I94O 2WI3A 3QNEA 2QE7G 3I5DA 1NHHA 4RQEA 3FB6C 4FLXA 3IFXA 3OWBA 3JARA 1Q8IA 3H80A 4QIWF 4TQFA 4JYCA 5L3CA 4MSWC 5M4MA 1YXBA 1VQ9V 3A0RA 4U3FH 2WI2A 2DMXA 4O09A 3ZHRA 3ZRXA 3E35A 1BKNA 5M4PA 3TCUA 4URNA 2Q0OC 5CN0A 3SJQC 2JGDA 3K5OA 1AI4A 4F6RA 3I56V 3E22B 4DRXA 5A9GA 1EI1A 2CE4A 4KTNA 1B3QA 2HR3A 3VBBA 2ITCC 1O9GA 2A7WA 2UU9O 3TGUH 4MP7A 4JYYA 2IH3C 2R72A 4GEEA 3BA9A 1Q82W 4JF3A 1M56C 1R3KC 2L6LA 1KKDA 3SR2C 3M8AA 3WHAA 1KKCA 3E8FA 1DGSA 5IY5B 2JDIG 2W6IG 3QF7A 4H0LB 5FNVA 5HFMA 3ZHVA 3OM3B 4FLYA 2ITDC 4L91A 3WQ9A 1KB9F 4FFBA 5LYJB 2F95B 2Z5UA 5B1NA 2XDKA 5CTUA 2N05A 2QKSA 4GKJO 3B26A 1RP3B 2WI7A 3C90A 5CTXA 1WA8A 5IDMA 4HBNA 1MZFA 4I0XA 2ZDIC 3NR7A 2F66C 1B63A 2YEGA 2IM9A 3AG4C 3K57A 3CSXA 4GLXA 3RBZA 4O4JA 4X1KB 1JJOA 4EB6A 1UY7A 5LHHA 1VF7A 4CH6A 4DUYB 1KBHA 3C0EA 2HKOA 1TILA 5GONB 3CYGA 4PDMA 4UCUA 3CWVA 2Q8HA 1KU9A 2VQEO 2QKAA 1O9HA 2B9ZA 1YHQV 1S3JA 3T1KA 4YKTA 2YXHA 4PJ0Z 1D5NA 5IJ9B 2ATKC 4DV5O 2DQ3A 2Q5ZA 3LPSA 4IIJB 1YESA 2FWZA 5LXTB 4JI3B 2IH1C 5HFLA 1SKVA 1H7UA 1BCCH 2VQFO 1M57B 3T4ZA 5FLXN 2CGNA 4ZKIA 1XNQO 2YS8A 4ICGA 2BU7A 3NXSA 3AK3A 1TGOA 4GGLA 1CXZB 2OYQA 3ZHSA 4J9YB 3H01A 2ZXWB 4FCQA 1YT1A 4HYPA 1H7SA 2DYSB 4XDKA 2KB1A 3SYCA 3S3XA 1XDCA 3ZMTA 3R65A 3L75H 1OCOC 2UXBO 2Y69C 2B5UA 5CTYA 2YE4A 2AHYA 4P8OA 1AR5A 2XK2A 1UY9A 3W7XA 5KX5A 4XC0A 1MMMA 2X7RB 1WPXA 5JQGB 4DR1O 3LMMA 4NH8A 3SPHA 5FWKA 1NHIA 4LWSB 1FJGO 3AG3C 1IBMB 4P2ZA 3E8BA 2YK9A 2QWQB 3DC6A 4HAMA 4J41A 4LWFA 5KA6A 4JAUA 2ZE7A 4I55B 4AQYB 4DV3B 2QEXV 2XDUA 3LDCA 1VQMV 3J80N 4XCJA 1UFIA 5D5PA 1ZWHA 3SPIA 3JALA 4R50A 3ICXA 5BMVA 4ZBMA 3T1HO 5GTHZ 1SESA 3CCMV 3BFRA 3OGCC 1I5DA 3FKSG 5LHIA 1K97A 3R4MA 3S3WA 3D36A
chains in the Genus database with same CATH topology
1PNLA 2EIMC 2WLHA 1E79G 4UV9A 5C93A 2BU2A 1GMGA 4MW3A 4JTDB 2X6CA 3CGZA 1QVGU 3OMUA 2JJ1G 3JZ3A 4O05A 2E0AA 3VHDA 2XX5A 1F51A 3SPGA 2HFEC 3RVYA 4CWRA 4PA6A 3SYPA 1SETA 1S72V 5H9CA 1YJ9V 4MTGA 2JEXA 3T0ZA 3MHHC 1R62A 4CWPA 3F7YC 3LSSA 5KUKA 1Y4SA 3R4OA 4WCEV 1OHHG 4MVRA 3CCJV 4XDMA 2WLLB 4MPCA 1H38A 3ABKB 2ZDIA 1K8AW 3CP1A 1AI6A 1I5YA 3U67A 1JX9A 4PL9A 2DQ0A 2O1VA 3GIGB 4NH7A 1ZW9A 1OCCC 5FNDA 4JAVA 3R4PA 2JJCA 1ENVA 1RM1C 4KSHA 3ABMC 1I5BA 4YKXA 3C11A 4XE2A 1YI2V 3E8HA 3W7UA 1FXKC 3IEDA 4CE1A 1R3JC 3ZRWA 3ABLC 4G28B 3AG2C 4X89A 4JTAB 2DW4A 4QNHB 4WUBA 5B1AB 3OW6A 1Q81W 4KSGA 2HVKC 1R73A 2YI0A 4YKRA 3OFNG 2CGFA 4JPRA 2XJGA 2IJJA 4UXNA 4XITA 1K33A 1Q86W 5F3KA 3K0DA 1I5CA 2B1IA 1I59A 1V54C 3CGYA 1YJNV 2YI5A 2W0FC 1S76D 1SZTA 3CYOA 4ASBA 2FWYA 2XHTA 3MD0A 4MP2A 3K79A 4UVBA 1K73W 5BODA 3ZN0A 5M4KA 3O0IA 4LBEC 2UXXA 4QE7A 1OZ0A 2PI4A 4L87A 2OTLV 1S77D 3PJSK 3QDDA 4XIQA 1Z5CA 1R6NA 2BT0A 2Q6AA 3OE7G 2H94A 1KP2A 1GKZA 2WEPA 1GM9A 2HLDG 1ZXNA 1G4YB 3VADA 2X0LA 2H8MA 1YITV 1JM6A 3ZM7A 2IOQA 2BU8A 5J6AA 2BZ5A 3HZ1A 2NLJC 1W0JG 2CCSA 2YEFA 1OCRC 1JVMA 1QY8A 4MOTA 2X6AA 3FT5A 4PA3A 2ZDYA 4YKYA 3TTZA 2DYRC 2F43G 2XAJA 3K03A 1DF4A 5M4EA 4R1FA 3M99B 3EHJA 1K92A 4JGSA 1I58A 3RLQA 2WI4A 4CBCA 1M1KW 3INXA 3A0TA 1DLBA 2JKIA 2XDLA 2Q8IA 1KP3A 3K04A 3LNMB 3CCSV 2YEEA 4R3AA 3ZMSA 1CPYA 2HCHA 1S14A 1AR1B 5CBGA 1JJ2U 4FJCC 2WEQA 1FXKA 4WUDA 5L3EA 4URLA 3BY6A 1COWG 1KD1W 4QPKA 5FNFA 4WUCA 4L90A 4W7TA 4RO2A 5B3SC 2WAMA 3T0HA 2ZR2A 1Y8NA 1NVPD 5CBHA 3JD2A 3ZMZA 1AJQA 2JJ2G 2D3OW 2WERA 1U0ZA 1NBMG 4BQJA 2YEJA 2HJFC 2YJWA 2A9HA 1K3EA 1VQLV 4WFBV 2YE9A 4PA9A 1EBOA 1F23A 5D6QA 4E02A 1VQKV 2ZD9A 3AG1B 4UUJC 1GKFA 1U2OA 5EBLC 3GIEA 4BIUA 3SYQA 2WLIA 1QLNA 3IGAC 4MTXA 4WF9V 1W0KG 3QO5A 4TWKA 5BOCA 2XHXA 4BIZA 3UM7A 3CCEV 4JYBA 2Q8GA 1MU5A 2K5BA 2XAGA 2YKBA 1RPRA 1J95A 1GTOA 1E1RG 2ESAA 5FNCA 4G2KA 2VCJA 5J9PC 1LNQA 3O2FA 4YKWA 1PD3A 1YSCA 2OCCC 3RW0A 2YE6A 2EZPA 4YKQA 1AM1A 2WI6A 3E8GA 4WFAV 3OMAB 3K08A 1YC3A 4PDLA 4HYOA 4RAIA 1QR8A 4KUMA 3X2QB 2QTOA 3B24A 1YT0A 3E83A 2H55A 3FYEB 1EFRG 2B1GA 3CCUV 4R6ZA 4P9PA 1QLEB 3CPWU 3TUHA 1UYMA 1ORQC 2EINC 2XDXA 3A0XA 3W7TA 3G4SV 3GWOA 3DGEA 1YSRA 4LP8A 3ML0A 5M4NA 3W7WA 1V55B 3TZ0A 1PNKA 3T2SA 4URMA 2EJRA 5D7RA 3E2EA 1Z5AA 4PA4A 3ZKDA 1NR1A 4MS2A 3LUTB 4AS9A 2BOBC 1GK9A 2GSMB 4UVAA 1Z59A 3K9AA 1VQ4V 3QO7A 4KFGA 3ZRVA 2JK5C 4P30A 2EIKB 4RQFA 1AJ6A 1UYDA 2YKEA 4U7NA 3HHUA 4LCUC 4E01A 3FV5A 2EILB 3Q5LA 4WFEA 2BU5A 2YGEA 2BSMA 3F5WC 2YEAA 4H33A 4PRVA 1UYGA 3DTUB 2VCIA 2YEIA 2YE3A 2BU6A 5EBMC 1TC0A 2YJXA 4E00A 3G7EA 1S16A 4H85A 1M56B 1UYIA 2CG9A 4R3MA 5H6QA 3FT8A 4P7AA 1RPOA 4XIPA 3MHSC 3INWA 4HY1A 4LWEA 1K4DC 4XCLA 1YT2A 4CWOA 2XASA 1A4HA 4XTJA 3TK1A 3AG4B 2IJKA 2UXNA 2Z3YA 4CWFA 3ASOC 4EGIA 1PKXA 5D7DA 4LWHA 1B6QA 1AH8A 1F4MA 3WG7C 3B8MA 4BXIA 4MB9A 4X88A 3ZRWB 2QA4V 5KA5A 1NQTA 2OTJV 2IOPA 5D7CA 4PU9A 3T1CA 1P4RA 3CCVV 4RUEA 3OMNB 4UVCA 1YETA 1UYKA 3CCLV 1OCOB 2Y69B 3ZIAG 4L93A 4MVUA 2HVJC 5CTWA 3EHBB 2A79B 3UKMA 3CD6V 5M4HA 4LPBA 3AG3B 4E2LA 2IORA 4DXWA 4XKKA 4OXSA 2WLLA 2YSUB 3I55V 2ZBKB 1L0OA 3JCZA 4O0BA 1YTFB 1US7A 4EFUA 4ZVIA 2XHRA 2EIJC 1GJVA 5LGNA 3RLRA 2YEVB 4GT1A 2IWUA 1Q7YW 3P30A 2QM8A 5L3JA 2O1WA 3STLC 2Y48A 1XL6A 2IWSA 2DWEC 1MABG 5B1BC 5IN9A 1ID0A 3JD0A 1GO3F 4U93A 1VQ7V 4XKAA 1Y66A 2HKJA 1OCZC 2GQPA 4MTOA 2AHZA 2WPDG 1K5SA 1N8RW 1F4NA 1BMFG 3CCQV 3SYOA 2Q68A 3AEIA 3OEEG 2OT5A 4DUHA 1BHBA 2P7TC 3ASNC 1GM7A 2WWWA 4AWPA 1YC1A 3OEHG 1JQ0A 5DN6G 1K9MW 4FCRA 1DF5A 2YI7A 2Q2EB 1NH2B 1QCEA 4MVMA 3K06A 4PRXA 3ZJZA 3JD1A 1MOFA 1R6KA 1K34A 5J71A 5L3DA 2NNUA 4EGHA 3B8NA 2ZR3A 4YXWG 1QR9A 3K3WA 3W7SA 1OCCB 3HEKA 1RM1B 3B25A 3ABMB 4CWQA 3EKOA 3T10A 3B28A 3PEHA 2YKJA 2YE2A 1FXKB 1AROP 1WLEA 3TETA 3ZMVA 1BL8A 3ABLB 2WSSG 1Z5BA 3AG2B 5FL7G 3A0ZA 5IYCO 3HYYA 2WLMA 3U2DA 2W6JG 2YE8A 1TH8A 3GIFA 4WFFA 2XJJA 2LFRA 2H8PC 4TT3G 1AI7A 1R3IC 3Q5JA 4CE3A 2WI1A 3ZXOA 5E1AC 5IY5C 1AJPA 3X2QC 4ASAA 1V54B 4X8AA 1B62A 1SRYA 3QO8A 4GQTA 3EKRA 3B77A 5H6RA 1NKDA 4JTCB 3ZXQA 4QPJA 2WLIB 1KIJA 1VQNV 4H7QA 2EZOA 4KQVA 3PEJA 4RUFA 4GX5A 2YE7A 3FB5C 1M57C 1JPXA 3OUSA 2QF6A 4X9LA 2X6BA 1EZJA 5KUMA 4HY6A 2IU3A 3ABUA 1YIJV 2ZXWC 3ZRSA 1YSZA 2DYSC 3CXCU 3SPJA 3LDDA 2CCUA 4L8ZA 4MPNA 2IJHA 3T2MA 1OCRB 1QVFU 2DWDC 2EXLA 2DYRB 4MVOA 1UYCA 4J9ZB 3TZ5A 4I9WA 3RKZA 3G75A 4HYMA 2BYHA 2YGFA 2EILC 4JASA 3HPLC 2P6JA 1CP9A 2VW5A 4GT8A 5EC1C 4MVSA 4Z1MG 3K98A 2EBOA 2C2AA 4PDRA 2YGAA 3K60A 4I5SA 3BEHA 2PNRA 4GX2A 1KC8W 2ZQMA 3EHFA 3D0BA 4B7PA 4V25A 1IXMA 3R92A 1PVGA 2IW5A 3VHAA 3B27A 5B3SB 4MVQA 3EHGA 2LP7A 1I5AA 2YE5A 1CEZA 1M9NA 1YC4A 1UY6A 4WFGA 3RVZA 4XBFA 2FYPA 4XKOA 3EHHA 3A0WA 1DTOA 4UROA 3VHCA 3CC7V 2WLJA 4O07A 2XNDG 2R9IA 1H8HG 5LBQA 3OPDA 3ABKC 4XDJA 2HG1A 2QFOA 1GKXA 1KECA 3FB7C 1FS0G 2IJIA 3JD4A 4EMVA 4BQGA 4HZ5A 1Y4UA 3VOUA 5EK0A 3WFVA 1FXVA 1QZRA 1VQ6V 4XIRA 4CE2A 3TZ4A 2XABA 2YKIA 1TIDA 5B1AC 3Q5KA 4CWNA 3H4LA 3JYCA 4R7CA 4HXZA 2BTZA 4XDLA 3MNRP 2R9RB 2OCCB 1PL0A 1SERA 4H37A 2Q69A 3JD3A 3K97A 3FB8C 5CPHA 1Y8PA 2MK3A 3O6OA 3OR7C 1ROPA 3CRKA 2V7QG 3OMIB 1GM8A 1AMWA 3SYAA 3SPCA 5F5RA 3T4DA 4PA7A 4DZYA 5B1OA 2YEDA 4LWIA 2EINB 1AJNA 3QTFA 2QG0A 3F7VC 4FCPA 4BAYA 1K5QA 3TZ2A 4H81A 4EM7A 4U7OA 1ZXMA 4XD8A 4LP0A 4GFNA 2WI5A 2ZKJA 1AI5A 3LNUA 2XCMA 3D2RA 2CH4A 4BAEA 3ETGA 5EBWC 4ASUG 4NH9A 1UYHA 4QE9A 1NJIW 3BM9A 3G6EV 5IYDO 3CRLA 2HG5C 1FXHA 4MPEA 4DO2A 1R3LC 4G27B 4GCZA 1K4CC 5LGTA 5LGUA 5EC2C 3SL2A 3CMAV 1QYEA 4N23A 4F4LA 5CF0A 4YKZA 1EA6A 1YS3A 4MT8A 3STZC 1K7DA 4MW8A 1MSWD 2XAHA 4FMTA 2QG2A 4MVZA 4TSFG 1W2BU 3GIGA 4P9OA 2IU0A 3CMEV 4FPPA 3G7BA 2EIMB 2UWDA 2XX2A 3OR6C 5LHGA 3ABTA 4V26A 3HYZA 1YTFD 2GHYA 1QBZA 1XL4A 4PELA 2YEBA 3IC7A 4GX0A 4CZZA 2YK2A 3ZN1A 3NMQA 2JIZG 4KFMA 4EEHA 2O1UA 3OWDA 2Q67A 1UYEA 1TUEB 4AWQA 5IYBO 1MG1A 5CA3A 2WLKA 4MTFA 1VQPV 2XJXA 1OSFA 3ASOB 3ZKBA 4EFTA 2QM7A 2FXSA 2YEVA 5L3GA 4R8CA 2BREA 2WLNA 1THNA 4EGKA 1UY8A 1BHAA 2XOKG 3GB7C 3OW2U 2YKCA 3CC2V 2CK3G 2YI6A 5CMUA 3WG7B 1JOYA 1L1FA 3AG1C 3ETEA 4CWTA 5L3BA 3BMYA 4ASFA 5D6PA 2BRCA 3RLPA 1ZWIC 1UYLA 4QJFB 4ASGA 1NH2D 5L3FA 2YECA 2JEUA 2Q8FA 1TBWA 1TC6A 4FK5C 4LWGA 2FTKA 4B6CA 1BXDA 2XAQA 3OUFA 1FFTB 1E1QG 4O04A 4YKUA 1PNMA 5IDJA 1MX0A 2AKPA 1YJWV 3EFFK 1S5HC 3LDEA 2A0LA 3LSQA 2XAFA 5DM6V 2PI5A 2M7WA 2YEHA 3R4NA 1AH6A 2IWXA 4WFHA 2EIJB 1KQSU 4UV8A 2XD6A 4BW5A 2P90A 1YERA 5CBFA 1VQ8V 1Y8OA 2BYIA 3KE6A 1M90W 3A0YA 4FIPC 1NVPB 1BYQA 2XX4A 5B1BB 1UYFA 3ZCCA 3E89A 1QLEC 2XDSA 1THZA 3K99A 1H2GA 1OCZB 3FYIB 4JQLA 3D3IA 4N21A 1VQ5V 2VWCA 4EKWA 4PDVA 2LFSA 3E86A 4KP4A 3R91A 3G71V 1V55C 4K4OA 2BOCC 1Y4MA 2P67A 4I3HA 3ASNB 1UJWB 1NHJA 5GGZA 3CCRV 2CCTA 1H8EG 3HB3B 1BGQA 4Q20A 3KG2A 3P32A 2K1EA 1I5XA 1VQOV 3HZ5A 1JCHA 1HWYA 1S0VA 3ETDA 2V1DA 4HZ0A 4GX1A 3U2KA 1G8MA 5BZBA 4AWOA 3ZMUA 4CWSA 4HXWA 2GFDA 4L94A 4LC1A 1P7BA 3K0GA 1NR7A 4MBCA 2EIKC 4HZ3A 3OAAG 2ZDXA 1KZNA 3CC4V 5GW7A 2WI3A 3QNEA 2QE7G 1NHHA 4RQEA 3FB6C 3IFXA 3OWBA 3H80A 4QIWF 4JYCA 5L3CA 4MSWC 5M4MA 1VQ9V 3A0RA 2WI2A 4O09A 3ZRXA 3E35A 1BKNA 5M4PA 3TCUA 4URNA 5CN0A 3SJQC 1AI4A 3I56V 1EI1A 4KTNA 1B3QA 2HR3A 3VBBA 2ITCC 4MP7A 2IH3C 4GEEA 1Q82W 4JF3A 1M56C 1R3KC 1KKDA 3WHAA 3E8FA 5IY5B 2JDIG 2W6IG 5HFMA 3OM3B 2ITDC 4L91A 3WQ9A 2Z5UA 5B1NA 2XDKA 5CTUA 3B26A 2QKSA 2WI7A 5CTXA 5IDMA 2ZDIC 1B63A 2YEGA 3AG4C 3RBZA 1UY7A 5LHHA 3C0EA 2HKOA 1TILA 4PDMA 3CWVA 2Q8HA 1YHQV 1S3JA 3T1KA 4YKTA 2ATKC 2DQ3A 3LPSA 1YESA 2FWZA 2IH1C 5HFLA 1H7UA 1M57B 3T4ZA 4ZKIA 2BU7A 3NXSA 4GGLA 4J9YB 3H01A 2ZXWB 4FCQA 1YT1A 4HYPA 1H7SA 2DYSB 4XDKA 2KB1A 3SYCA 3ZMTA 3R65A 1OCOC 2Y69C 2B5UA 5CTYA 2YE4A 2AHYA 4P8OA 2XK2A 1UY9A 3W7XA 4XC0A 2X7RB 1WPXA 4NH8A 3SPHA 5FWKA 1NHIA 3AG3C 4P2ZA 3E8BA 2YK9A 4HAMA 4LWFA 5KA6A 4JAUA 2QEXV 2XDUA 3LDCA 1VQMV 4XCJA 1ZWHA 3SPIA 4R50A 4ZBMA 1SESA 3CCMV 1I5DA 3OGCC 3FKSG 5LHIA 1K97A 3R4MA 3D36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWD A;  2XX2 A;  3Q5J A;  4CE3 A;  1YC3 A;  4V26 A;  3HYZ A;  2WI1 A;  3ZXO A;  5C93 A;  2BU2 A;  2YEB A;  3B24 A;  1YT0 A;  4ASA A;  1B62 A;  2H55 A;  3CGZ A;  2YK2 A;  3NMQ A;  4EEH A;  2O1U A;  3OMU A;  3OWD A;  3JZ3 A;  4GQT A;  2E0A A;  4O05 A;  3VHD A;  1UYE A;  2XX5 A;  1F51 A;  3EKR A;  4AWQ A;  4CWR A;  3TUH A;  1UYM A;  3ZXQ A;  4QPJ A;  1KIJ A;  4H7Q A;  2XJX A;  1OSF A;  2XDX A;  3A0X A;  3ZKB A;  4EFT A;  2QM7 A;  2FXS A;  3DGE A;  1YSR A;  3T0Z A;  5M4N A;  1R62 A;  4KQV A;  3PEJ A;  2BRE A;  4CWP A;  1THN A;  3TZ0 A;  4EGK A;  1UY8 A;  1Y4S A;  2YKC A;  2YE7 A;  2YI6 A;  3T2S A;  4URM A;  3R4O A;  5D7R A;  2QF6 A;  1JOY A;  1Z5A A;  4X9L A;  4XDM A;  4CWT A;  4HY6 A;  3ZKD A;  3BMY A;  4MPC A;  4ASF A;  5D6P A;  2BRC A;  3RLP A;  4AS9 A;  1UYL A;  3U67 A;  1YSZ A;  4ASG A;  4PL9 A;  2O1V A;  2YEC A;  2CCU A;  3GIG B;  4L8Z A;  1Z59 A;  4MPN A;  4NH7 A;  2Q8F A;  1ZW9 A;  1TBW A;  1TC6 A;  5FND A;  4JAV A;  3R4P A;  2JJC A;  4KSH A;  4KFG A;  4LWG A;  3ZRV A;  2FTK A;  1I5B A;  4B6C A;  1BXD A;  4YKX A;  3C11 A;  2EXL A;  4XE2 A;  4O04 A;  1AJ6 A;  4YKU A;  3IED A;  4CE1 A;  5IDJ A;  1UYD A;  1MX0 A;  3ZRW A;  2YKE A;  1UYC A;  2AKP A;  4U7N A;  3HHU A;  3TZ5 A;  3RKZ A;  4E01 A;  3FV5 A;  3G75 A;  4HYM A;  4WUB A;  3OW6 A;  2BYH A;  4KSG A;  2YGF A;  3Q5L A;  4JAS A;  2BU5 A;  2YGE A;  2BSM A;  2YI0 A;  4YKR A;  2VW5 A;  2YEA A;  4GT8 A;  2YEH A;  3R4N A;  2CGF A;  3K98 A;  4PRV A;  1AH6 A;  1UYG A;  2C2A A;  2VCI A;  2XJG A;  2YEI A;  2YE3 A;  2YGA A;  2IWX A;  2BU6 A;  1TC0 A;  2YJX A;  3K60 A;  4I5S A;  4E00 A;  3G7E A;  1S16 A;  2XD6 A;  4XIT A;  2PNR A;  5F3K A;  4H85 A;  1I5C A;  1UYI A;  2CG9 A;  4R3M A;  1YER A;  1I59 A;  3CGY A;  1Y8O A;  3EHF A;  3D0B A;  2YI5 A;  3FT8 A;  2BYI A;  4P7A A;  3KE6 A;  4B7P A;  3A0Y A;  1BYQ A;  4XIP A;  2XX4 A;  3INW A;  4V25 A;  1IXM A;  4HY1 A;  4LWE A;  1UYF A;  3R92 A;  3ZCC A;  4ASB A;  4XCL A;  1YT2 A;  1PVG A;  2FWY A;  4CWO A;  2XDS A;  2XHT A;  3MD0 A;  4MP2 A;  3VHA A;  3B27 A;  1A4H A;  3K99 A;  4JQL A;  4XTJ A;  3EHG A;  5BOD A;  5M4K A;  3TK1 A;  1I5A A;  3O0I A;  2YE5 A;  4CWF A;  1YC4 A;  2VWC A;  1UY6 A;  4EGI A;  2LFS A;  5D7D A;  4LWH A;  3QDD A;  4KP4 A;  3R91 A;  2FYP A;  4K4O A;  4XIQ A;  4XKO A;  3EHH A;  1Z5C A;  3A0W A;  2P67 A;  2BT0 A;  4URO A;  3VHC A;  4I3H A;  1AH8 A;  1NHJ A;  5GGZ A;  4O07 A;  1GKZ A;  2CCT A;  2WEP A;  4BXI A;  4MB9 A;  1ZXN A;  3ZRW B;  3OPD A;  1BGQ A;  4Q20 A;  3P32 A;  3VAD A;  2H8M A;  2IOP A;  3HZ5 A;  2HG1 A;  5D7C A;  1JM6 A;  3ZM7 A;  2IOQ A;  2QFO A;  4PU9 A;  2BU8 A;  5J6A A;  2BZ5 A;  3HZ1 A;  1GKX A;  2CCS A;  4HZ0 A;  2YEF A;  3U2K A;  4AWO A;  1QY8 A;  1YET A;  4MOT A;  3FT5 A;  2ZDY A;  1UYK A;  4EMV A;  4YKY A;  4BQG A;  4HXW A;  4CWS A;  2GFD A;  4L94 A;  4HZ5 A;  4L93 A;  4LC1 A;  3TTZ A;  1Y4U A;  4MBC A;  2ZDX A;  5CTW A;  1KZN A;  2WI3 A;  1QZR A;  1NHH A;  4XIR A;  4CE2 A;  3TZ4 A;  3OWB A;  5M4H A;  2XAB A;  3H80 A;  5M4E A;  4JYC A;  4R1F A;  2YKI A;  5M4M A;  1TID A;  3EHJ A;  4LPB A;  1I58 A;  2IOR A;  3RLQ A;  3A0R A;  3Q5K A;  4XKK A;  2WI2 A;  2WI4 A;  4CWN A;  3H4L A;  4O09 A;  4HXZ A;  3ZRX A;  3INX A;  2BTZ A;  3A0T A;  1BKN A;  5M4P A;  2ZBK B;  4URN A;  2JKI A;  2XDL A;  2Q8I A;  3MNR P;  1L0O A;  4O0B A;  1EI1 A;  1US7 A;  4EFU A;  4ZVI A;  2XHR A;  4KTN A;  1B3Q A;  3K97 A;  2YEE A;  5CPH A;  1Y8P A;  4R3A A;  1GJV A;  2HCH A;  3RLR A;  4GT1 A;  2IWU A;  4MP7 A;  1S14 A;  4GEE A;  3O6O A;  2QM8 A;  5L3J A;  3WHA A;  2WEQ A;  2O1W A;  4WUD A;  3CRK A;  2IWS A;  4URL A;  4L91 A;  1AMW A;  1ID0 A;  5IN9 A;  3WQ9 A;  5F5R A;  4QPK A;  4U93 A;  5B1N A;  4XKA A;  2XDK A;  5FNF A;  5CTU A;  4WUC A;  3B26 A;  4L90 A;  4W7T A;  2HKJ A;  2WI7 A;  5CTX A;  5IDM A;  2GQP A;  1B63 A;  2YEG A;  3T0H A;  1Y8N A;  1UY7 A;  3C0E A;  1TIL A;  4DZY A;  5B1O A;  2YED A;  4LWI A;  3CWV A;  2WER A;  2Q8H A;  1U0Z A;  3QTF A;  2QG0 A;  4FCP A;  4BQJ A;  4DUH A;  3T1K A;  4YKT A;  2YEJ A;  2WWW A;  2YJW A;  1YC1 A;  3TZ2 A;  4AWP A;  4H81 A;  4EM7 A;  4U7O A;  1ZXM A;  3LPS A;  4XD8 A;  4LP0 A;  1YES A;  2FWZ A;  4GFN A;  4FCR A;  2YI7 A;  2WI5 A;  1H7U A;  2ZKJ A;  2Q2E B;  2YE9 A;  3LNU A;  4ZKI A;  4PRX A;  2XCM A;  5D6Q A;  2BU7 A;  4E02 A;  3NXS A;  3D2R A;  1U2O A;  2CH4 A;  4BAE A;  5J71 A;  4GGL A;  3GIE A;  4BIU A;  4EGH A;  4NH9 A;  1UYH A;  4FCQ A;  3BM9 A;  1YT1 A;  4HYP A;  4MTX A;  3CRL A;  1H7S A;  4MPE A;  5CTY A;  2YE4 A;  4GCZ A;  4P8O A;  3HEK A;  2XK2 A;  1UY9 A;  3B25 A;  3SL2 A;  4XC0 A;  5BOC A;  4CWQ A;  2XHX A;  3EKO A;  4NH8 A;  4BIZ A;  5FWK A;  1NHI A;  3T10 A;  1QYE A;  4JYB A;  2Q8G A;  5CF0 A;  3B28 A;  3PEH A;  1MU5 A;  2K5B A;  2YK9 A;  2YKJ A;  2YE2 A;  4YKZ A;  1EA6 A;  1YS3 A;  4MT8 A;  2YKB A;  4LWF A;  4JAU A;  1Z5B A;  2ESA A;  3A0Z A;  4FMT A;  5FNC A;  2VCJ A;  3HYY A;  2QG2 A;  2XDU A;  3O2F A;  4YKW A;  3U2D A;  4XCJ A;  2YE8 A;  1TH8 A;  3GIG A;  1ZWH A;  2YE6 A;  3GIF A;  4YKQ A;  2XJJ A;  2LFR A;  4FPP A;  1AM1 A;  2WI6 A;  1I5D A;  3G7B A;  3R4M A;  3D36 A; 
#chains in the Genus database with same CATH topology
 1PNL A;  4Q6G A;  2EIM C;  5J2T A;  2WLH A;  1I7F A;  1E79 G;  4EEQ A;  4UV9 A;  2QR4 A;  5C93 A;  2BU2 A;  1GMG A;  4MW3 A;  3BHP A;  1AVM A;  2UUA B;  3TXQ A;  4JTD B;  2X6C A;  3CGZ A;  4LF7 O;  1QVG U;  3OT7 A;  3OMU A;  2JJ1 G;  2P4K A;  3JZ3 A;  2E0A A;  4O05 A;  5JJE B;  3VHD A;  5KHK A;  2XX5 A;  1F51 A;  3SPG A;  5DEC A;  1JA8 A;  2HFE C;  1WB7 A;  3RVY A;  4CWR A;  1Y74 B;  4PA6 A;  4DUZ B;  1Q43 A;  1PM9 A;  3SYP A;  4IT5 A;  1SET A;  1S72 V;  2UUB O;  1JFF B;  5H9C A;  3O9O A;  1YJ9 V;  4MTG A;  2V4D A;  2JEX A;  3T0Z A;  3MHH C;  1R62 A;  4CWP A;  3F7Y C;  3LSS A;  5IT9 N;  2BE3 A;  5KUK A;  2UUC O;  1Y4S A;  3FX7 A;  4DW1 A;  2XUM A;  3R4O A;  3ZBH A;  4WCE V;  1OHH G;  3JAK B;  1FPO A;  2CTW A;  1Y76 B;  3U11 A;  4MVR A;  3CCJ V;  4XDM A;  2WLL B;  4MPC A;  1H38 A;  3C3T A;  3ABK B;  2ZDI A;  1K8A W;  3CP1 A;  3RWR D;  2R70 A;  1AI6 A;  1I5Y A;  3U67 A;  1JX9 A;  4PL9 A;  2DQ0 A;  2O1V A;  1YCI A;  3GIG B;  4NH7 A;  2ZM6 O;  1ZW9 A;  1OCC C;  4I4T B;  5FND A;  4JAV A;  3R4P A;  4W4L A;  1ENV A;  2JJC A;  1RM1 C;  4KSH A;  1BGY H;  3ABM C;  3H1I H;  3H9V A;  4JI3 O;  1I5B A;  1XQ8 A;  3C11 A;  4TV9 B;  4YKX A;  2A06 H;  2KKW A;  4UCR A;  2ZKO A;  4XE2 A;  1YI2 V;  3E8H A;  3W7U A;  1ZSP A;  1FXK C;  3IED A;  4CE1 A;  1V9P A;  1R3J C;  2QTS A;  4CH5 A;  3ZRW A;  1SQX H;  2N74 A;  1VAR A;  3ABL C;  4G28 B;  1XNR O;  3AG2 C;  3ZS8 C;  4X89 A;  4JTA B;  2DW4 A;  2E75 B;  3CEI A;  5EZY B;  4QNH B;  5B1A B;  1GH6 A;  4WUB A;  3OW6 A;  1Q81 W;  4KSG A;  4X9Q A;  2FML A;  1SQF A;  2HVK C;  1R73 A;  1MZE A;  2YI0 A;  3PN1 A;  3CRM A;  4YKR A;  3OFN G;  4YJ3 B;  3SDL A;  2G38 A;  3L70 H;  2CGF A;  4JPR A;  2N04 A;  1B04 A;  2XJG A;  2IJJ A;  3N2G B;  4PI0 A;  2FYU H;  5TIS Z;  1WJZ A;  2F93 B;  1BZK A;  1IZ3 A;  4UXN A;  4DR6 B;  3B2E E;  4FZ0 A;  3WU2 Z;  5K1P A;  4XIT A;  1K33 A;  1Q86 W;  5F3K A;  3RYF B;  1Y6X A;  3EXA A;  3K0D A;  1I5C A;  2B1I A;  2YXY A;  1P49 A;  4AQY O;  1I59 A;  1V54 C;  3RYC B;  1L0L H;  1WP7 A;  3CGY A;  1YJN V;  2YI5 A;  2W0F C;  4IHJ A;  1S76 D;  4DYL A;  2F23 A;  3CS5 A;  1MA1 A;  1SZT A;  3CYO A;  4ASB A;  2FWY A;  2Y4U A;  1NU1 H;  1YVW A;  2XHT A;  3MD0 A;  4MP2 A;  2Q9L A;  3K79 A;  4FM1 A;  4UVB A;  3TJT A;  2H3O A;  4B7E A;  1K73 W;  3L9D A;  5BOD A;  3ZN0 A;  3AK2 A;  5M4K A;  1X4T A;  3UT5 B;  3KKY A;  3O0I A;  4DR3 B;  4LBE C;  2UXX A;  1HNX O;  4QE7 A;  1OZ0 A;  2PI4 A;  4L87 A;  2OTL V;  1S77 D;  4K0K B;  3PJS K;  3QDD A;  3BPZ A;  4B3S B;  4XIQ A;  1VP7 A;  3RYI B;  2UUA O;  2AGA A;  1Z5C A;  4X65 B;  1R6N A;  4X1Y B;  2BT0 A;  2QKC A;  2Q6A A;  3OE7 G;  2H94 A;  1KP2 A;  1GKZ A;  2WEP A;  1GM9 A;  2D2C B;  2OIG A;  2HLD G;  4TV8 B;  1ZXN A;  4O4L A;  3H1L H;  1G4Y B;  3VAD A;  2X0L A;  1MNG A;  2H8M A;  1YIT V;  1JM6 A;  3ZM7 A;  2IOQ A;  2LO1 A;  2BU8 A;  5J6A A;  4B3M B;  2BZ5 A;  3HZ1 A;  1BT8 A;  2YDE A;  2NLJ C;  1W0J G;  2CCS A;  2YEF A;  5EIB C;  1OCR C;  4JI6 B;  1JVM A;  1N34 B;  3JAS A;  1QY8 A;  4MOT A;  2X6A A;  4DV0 B;  4PA3 A;  2ZDY A;  3FT5 A;  2E5L B;  4YKY A;  3N2K A;  1SA0 B;  3TTZ A;  2DYR C;  2F43 G;  3ETQ A;  1N36 B;  2XAJ A;  3K03 A;  1ZUQ A;  3APO A;  1DF4 A;  4HNA B;  5M4E A;  4X20 B;  4R1F A;  3M99 B;  4LNU A;  3EHJ A;  1K92 A;  4JGS A;  1I58 A;  3RLQ A;  4GUN A;  2WI4 A;  4CBC A;  5LP6 B;  2HHI A;  1M1K W;  4B3R B;  3INX A;  3A0T A;  1DLB A;  4CC5 A;  3CB2 A;  2JKI A;  2XDL A;  1XMQ O;  1KP3 A;  2Q8I A;  4DV2 O;  1ZLZ A;  3K04 A;  1H2L A;  3LNM B;  4BIO A;  3CCS V;  5C8Y B;  2YEE A;  4X64 B;  1ZL8 A;  4R3A A;  3ZMS A;  1WPB A;  1CPY A;  2HCH A;  4CS2 A;  1S14 A;  5B5E Z;  2EX3 A;  1AR1 B;  4DR5 B;  5CBG A;  4L8J A;  1JJ2 U;  4FJC C;  2BCC H;  2WEQ A;  1FXK A;  4WUD A;  1AR4 A;  3B4S A;  1Z2G A;  1M5I A;  4JI4 B;  5L3E A;  4URL A;  4O2B A;  3BY6 A;  4JI0 O;  2Q8V A;  1COW G;  3MAQ A;  1KD1 W;  4QPK A;  3RYH A;  2QSA A;  5FNF A;  1NTK H;  4WUC A;  3L74 H;  2UXC O;  2YC0 A;  4L90 A;  4W7T A;  4JI7 O;  4RO2 A;  4U3J A;  5B3S C;  2WAM A;  2GBO A;  3T0H A;  3GWK C;  4YJ2 A;  2ZR2 A;  1Y8N A;  1NVP D;  5CBH A;  3JD2 A;  2CH7 B;  3ZMZ A;  3DXR A;  1XHX A;  1AJQ A;  2JJ2 G;  1IVS A;  1PPJ H;  3HKD A;  2PY5 A;  3HKC A;  1TUB B;  2D3O W;  4CC6 A;  2WER A;  1U0Z A;  1NBM G;  2KG7 B;  4BQJ A;  1RSO B;  4LH7 A;  2YEJ A;  2HJF C;  1Q6H A;  2YJW A;  2A9H A;  1K3E A;  1EN5 A;  3A8T A;  1XUQ A;  2ZIN A;  1VQL V;  4WFB V;  2YE9 A;  4PA9 A;  1EBO A;  5EYP A;  1F23 A;  4LFC B;  1M4U A;  5D6Q A;  4E02 A;  1VQK V;  2ZD9 A;  3AG1 B;  4UUJ C;  1GKF A;  4DR3 O;  2E74 B;  1U2O A;  5EBL C;  3GIE A;  4BIU A;  3CE2 A;  3SYQ A;  4K0K O;  2WLI A;  1QLN A;  3IGA C;  4MTX A;  2HJD A;  4UB8 Z;  4H44 B;  4X65 O;  4DRX B;  2RQ6 A;  1I08 A;  4WF9 V;  1J5E B;  4GKK B;  1W0K G;  2ZNJ A;  3QG5 A;  3QO5 A;  5FPR A;  4J7K A;  4TWK A;  5EIB D;  5BOC A;  2XHX A;  1U97 A;  4UFZ A;  4BIZ A;  1Q5O A;  2KSD A;  3UM7 A;  3CCE V;  5IE9 A;  4JYB A;  1HNW B;  2Q8G A;  1MU5 A;  4KXR A;  2K5B A;  3G80 A;  2XAG A;  3K5M A;  2YKB A;  4B3M O;  2GTS A;  1VF5 B;  1RPR A;  1J95 A;  4ZIB A;  1GTO A;  4IGG A;  1E1R G;  2ESA A;  5FNC A;  4G2K A;  2VCJ A;  4FFB B;  3JAT A;  5J9P C;  1LNQ A;  3O2F A;  4YKW A;  4JI6 O;  1PD3 A;  2E76 B;  1YSC A;  4DV0 O;  1IUR A;  2OCC C;  3RW0 A;  2YE6 A;  1WA8 B;  2EZP A;  4DK1 A;  2E5L O;  4I0X B;  4YKQ A;  4AIL C;  1AM1 A;  2WI6 A;  3L71 H;  5LMN B;  3E8G A;  4CH4 A;  4LF6 B;  1D5A A;  4EB6 B;  4WFA V;  3OMA B;  3K08 A;  1YC3 A;  3VQV A;  4PDL A;  1GAX A;  4HYO A;  4RAI A;  2Y4T A;  3OTO B;  3JAW B;  1QR8 A;  1FFX A;  4KUM A;  1Z5W A;  1QNM A;  3X2Q B;  4DK0 A;  2QTO A;  4B3R O;  3B24 A;  1YT0 A;  4QGP A;  1HR0 B;  3E83 A;  5BR8 B;  1B06 A;  2H55 A;  3FYE B;  5LOV A;  4B3T B;  1H2K A;  1EFR G;  2B1G A;  3CCU V;  4R6Z A;  4P9P A;  2QWR B;  4LF4 B;  1F7Y A;  1SQQ H;  4X66 B;  1QLE B;  4FM2 A;  4JZG A;  3CPW U;  3TUH A;  1UYM A;  4ZI7 B;  4DR5 O;  1ORQ C;  2EIN C;  2YIA A;  2XDX A;  3A0X A;  3W7T A;  3G4S V;  3GWO A;  4DV4 O;  5KHJ A;  3DGE A;  4CS4 A;  4LP8 A;  1YSR A;  3ML0 A;  5M4N A;  4JI4 O;  3W7W A;  1V55 B;  1YZB A;  3TZ0 A;  1PNK A;  2YID A;  3APQ A;  4DV7 B;  2GUZ A;  1Q6U A;  4FLW A;  1N33 B;  3T2S A;  4URM A;  2EJR A;  5D7R A;  3E2E A;  3AG7 A;  1Z5A A;  1X59 A;  5JH7 A;  5IYZ B;  3C3S A;  4PA4 A;  3ZKD A;  1NR1 A;  4MS2 A;  3LUT B;  1LUV A;  4AS9 A;  2YI9 A;  2BOB C;  1GK9 A;  2MW2 B;  2GSM B;  4UVA A;  3K59 A;  1RFY A;  5JWP A;  2PF4 E;  2GV9 A;  1Z59 A;  3K9A A;  2BTQ B;  1NI8 A;  3JAL B;  1VQ4 V;  2EJ7 A;  5BMV B;  3QO7 A;  4KFG A;  3ZRV A;  5JJJ B;  2JK5 C;  3CJH B;  2RJZ A;  5KAF Z;  5J2T B;  4P30 A;  1N4C A;  4LFC O;  1TVK A;  2E3C A;  2EIK B;  1WP8 A;  5IJ9 A;  4RQF A;  1KMI Z;  1AJ6 A;  1UYD A;  4CS3 A;  5LXT A;  2YXL A;  1H2M A;  2YKE A;  4U7N A;  3HHU A;  4LCU C;  4E01 A;  4YIP A;  2EIL B;  3FV5 A;  4LF8 B;  3O65 A;  2VS0 A;  3Q5L A;  1LUW A;  4E72 A;  4WFE A;  2BU5 A;  2PTM A;  2YGE A;  3K58 A;  2BSM A;  1BSM A;  4GKK O;  1J5E O;  3F5W C;  2YEA A;  4H33 A;  4PRV A;  1UYG A;  3DTU B;  2VCI A;  1XOU A;  2YEI A;  5LA6 A;  2YE3 A;  5B66 Z;  2BU6 A;  5EBM C;  4WBN A;  1TC0 A;  3N27 A;  3CXH F;  2YJX A;  1SZX A;  4E00 A;  4JYA B;  1HNW O;  3G7E A;  1S16 A;  1IBL B;  4NYK A;  3KCX A;  1S5J A;  4H85 A;  1HW7 A;  2LW7 A;  1M56 B;  1UYI A;  2CG9 A;  5JQG A;  4R3M A;  1SC5 B;  4LWS A;  5H6Q A;  2R9A A;  3FT8 A;  4P7A A;  1RPO A;  1FD9 A;  4XIP A;  3MHS C;  4O2A B;  3INW A;  4HY1 A;  4I55 A;  2HHH B;  4LWE A;  1K4D C;  4XCL A;  1YT2 A;  4CWO A;  2CDY A;  5LMN O;  3CRQ A;  3IJ4 A;  2XAS A;  1A4H A;  4DV1 B;  4XTJ A;  3TK1 A;  1EN4 A;  3AG4 B;  3WB0 A;  4LFB B;  2IJK A;  2UXN A;  2Z3Y A;  3Q4H B;  4CWF A;  3ASO C;  4J80 A;  4EGI A;  3OTO O;  4FLT A;  1PKX A;  4UCS A;  2DN9 A;  5D7D A;  1IDS A;  4LWH A;  1UPG A;  3FD9 A;  1HR0 O;  1HP8 A;  1BS3 A;  5BR8 O;  1B6Q A;  4B3T O;  1AH8 A;  4O4H A;  1F4M A;  3WG7 C;  5K1X A;  3H1H H;  3B8M A;  4NXM B;  3CRC A;  4X66 O;  4BXI A;  4MB9 A;  4DUY O;  4X88 A;  3ZRW B;  2QA4 V;  5KA5 A;  4D7S A;  2OIE A;  3IC9 A;  1NQT A;  4LF5 B;  2OTJ V;  2IOP A;  5D7C A;  2IBZ H;  1YF2 A;  4PU9 A;  4UCV A;  4W4K A;  5ITZ A;  3T1C A;  1P4R A;  3GVM A;  4YY3 B;  3CCV V;  2PZS A;  2JGU A;  1WAZ A;  4RUE A;  3OMN B;  4UVC A;  1YET A;  2LGQ A;  1JFF A;  1UYK A;  3CCL V;  3LNN A;  1HNZ B;  3JAM N;  5E79 Z;  1OCO B;  2Y69 B;  3ZIA G;  4L93 A;  4MVU A;  2HVJ C;  3EHB B;  5CTW A;  2A79 B;  3UKM A;  3SJA C;  1GN2 A;  2QM4 A;  3CD6 V;  5M4H A;  5FPO A;  3P3P A;  4X1I A;  4LPB A;  3AG3 B;  4DR4 B;  4E2L A;  2IOR A;  4NVP A;  4DXW A;  3JAK A;  3CWB H;  4XKK A;  4OXS A;  5LMU B;  2WLL A;  2YSU B;  4DR2 B;  2XHB A;  4K3A A;  3I55 V;  2ZBK B;  2FKX A;  1L0O A;  3JCZ A;  4O0B A;  1YTF B;  1US7 A;  4EFU A;  4ZVI A;  2XHR A;  4JZ2 A;  1IBM O;  2EIJ C;  2NN4 A;  1GJV A;  5LGN A;  4I4T A;  4BWA A;  2ZCE A;  3RLR A;  2YEV B;  4GT1 A;  2IWU A;  3G6B A;  4GZR B;  1Q7Y W;  4UB6 Z;  3P30 A;  4J11 A;  4AHC A;  4DV3 O;  2Q0A A;  2QM8 A;  5L3J A;  2O1W A;  2LW1 A;  2OCH A;  3STL C;  4LF8 O;  2Y48 A;  1XL6 A;  3FAV A;  2IWS A;  3CHX A;  2DWE C;  1MAB G;  4DR7 B;  5B1B C;  2Q7H A;  1ID0 A;  5IN9 A;  3JD0 A;  1GO3 F;  1N0J A;  4U93 A;  1VQ7 V;  5EZY A;  4XKA A;  4Z2W A;  5CB4 B;  1Y66 A;  1G6U A;  2ETN A;  1IXB A;  1SQG A;  2HKJ A;  1OCZ C;  3U0Z A;  2GQP A;  4MTO A;  4I7Z B;  2AHZ A;  4JYA O;  2WPD G;  1IBL O;  1K5S A;  1N8R W;  1F4N A;  3UQ8 A;  2CTR A;  1BMF G;  3CCQ V;  3SYO A;  2Q68 A;  3AEI A;  3JAS B;  3OEE G;  2OT5 A;  1PP9 H;  1XIL A;  4DW0 A;  1BHB A;  4DUH A;  2P7T C;  3ASN C;  1GM7 A;  2WWW A;  4AWP A;  1YC1 A;  3N2K B;  2YIB D;  3OEH G;  1JQ0 A;  5DN6 G;  1YEW A;  2BSK A;  4A5U B;  2HHH O;  1K9M W;  4FCR A;  3RYC A;  1DF5 A;  2YI7 A;  4LH6 A;  1AIL A;  2Q2E B;  1NH2 B;  1QCE A;  4DUZ O;  2JRI A;  1VMG A;  4MVM A;  3K06 A;  4PRX A;  3ZJZ A;  4DV1 O;  3RFR A;  4LNU B;  4JI5 B;  3JD1 A;  1MOF A;  1R6K A;  2QGN A;  3H1J H;  4LFB O;  1K34 A;  2ZIM A;  5J71 A;  5JEN A;  1I94 B;  5L3D A;  2F1M A;  2NNU A;  2YUA A;  4TQD A;  3S5T A;  4EGH A;  1BQ0 A;  1FAF A;  3B8N A;  2ZR3 A;  4YXW G;  1QR9 A;  4OPA A;  1H2N A;  3K3W A;  2P22 C;  3W7S A;  2AZ0 A;  5KMG B;  4FZ1 A;  1OCC B;  1XEQ A;  4TOI A;  2PGG A;  3HEK A;  1RM1 B;  3RYI A;  2CTP A;  2ZE5 A;  3ABM B;  4J10 A;  3B25 A;  4NXM O;  4CWQ A;  3EKO A;  4X1Y A;  3T10 A;  4O4I B;  3B28 A;  3PEH A;  4LF5 O;  2YKJ A;  4F6E A;  2YE2 A;  1FXK B;  1ARO P;  1WLE A;  3TET A;  2UU9 B;  3ZMV A;  5J2U B;  1P84 F;  1BL8 A;  4BR6 A;  3ABL B;  2WSS G;  5DED A;  4RWU A;  4TV8 A;  3AG2 B;  4FLZ A;  5FL7 G;  1Z5B A;  3HKB B;  4ZHQ A;  4NTY A;  3A0Z A;  5IYC O;  3HYY A;  3RYH B;  2WLM A;  3U2D A;  2W6J G;  2YE8 A;  1TH8 A;  4NXN B;  3GIF A;  3RT3 C;  4WFF A;  2XJJ A;  2LFR A;  2H8P C;  4TT3 G;  4YJ2 B;  1AI7 A;  1NZ6 A;  4GKJ B;  4PV1 B;  2P06 A;  1R3I C;  2EUL A;  2A3Q A;  3DXR B;  5BXZ A;  5IJ0 B;  1T5E A;  2F4V B;  3Q5J A;  4CE3 A;  3JCU Z;  3HKC B;  4KL1 A;  3D3Q A;  4DR4 O;  4K35 A;  2WI1 A;  3ZXO A;  5E1A C;  5IY5 C;  3K9S A;  2LJ2 A;  5LMU O;  1AJP A;  4HNA A;  4X20 A;  3X2Q C;  4ASA A;  1V54 B;  4X8A A;  2RNB A;  4DR2 O;  1B62 A;  1SRY A;  3QO8 A;  3HKE B;  5LP6 A;  3J81 N;  2PYL A;  5EYP B;  4GQT A;  1OV9 A;  2QDO A;  1XHZ A;  4DR6 O;  5KLV H;  2LGW A;  3BAA A;  3EKR A;  3B77 A;  5H6R A;  1NKD A;  1ZX3 A;  4JTC B;  2VQF B;  3ZXQ A;  4NTX A;  2Z0A A;  4NR1 A;  4QPJ A;  2WLI B;  1KIJ A;  1VQN V;  4H7Q A;  1WN7 A;  2EZO A;  2CAZ C;  4KQV A;  5CA0 A;  3PEJ A;  4B08 A;  4FFK A;  2YI8 A;  5H5N A;  4RUF A;  3EVK A;  4GX5 A;  2YE7 A;  3JAR B;  3FB5 C;  1M57 C;  1JPX A;  3OUS A;  2QF6 A;  2UXB B;  3BCC H;  4ZOL A;  3JSN A;  1GN4 A;  4X9L A;  2X6B A;  1EZJ A;  1Y67 A;  5KUM A;  4HY6 A;  2IU3 A;  3ABU A;  5JVD A;  1A32 A;  1YIJ V;  2ZE8 A;  3LSU A;  4B3S O;  4DV6 B;  2ZXW C;  4NTW A;  3ZRS A;  3R66 A;  2JGD B;  4F6R B;  1YSZ A;  2DYS C;  3CXC U;  3SPJ A;  3LDD A;  2CCU A;  1N0N A;  4L8Z A;  4MPN A;  3CX5 F;  2IJH A;  2CH7 A;  1VEW A;  3T2M A;  1OCR B;  1QVF U;  3U10 A;  4B7K A;  4CH3 A;  2Y0P A;  2DWD C;  2EXL A;  2DYR B;  1NTZ H;  2FL4 A;  4JI5 O;  4X62 B;  3FFQ A;  4FLU A;  5FNV B;  3QTC A;  4MVO A;  1FFX B;  1UYC A;  5KHI A;  4J9Z B;  2RCV A;  3TZ5 A;  4I9W A;  5CA1 A;  3RKZ A;  3G75 A;  4HYM A;  1N34 O;  2BYH A;  4LF9 B;  2YGF A;  2EIL C;  4JAS A;  5LOV B;  3HPL C;  2P6J A;  2UXD B;  1PL4 A;  1CP9 A;  4K8X A;  4JV5 B;  1N36 O;  4I50 A;  4O4J B;  2VW5 A;  4GT8 A;  5EC1 C;  4MVS A;  4Z1M G;  3K98 A;  2EBO A;  2C2A A;  4PDR A;  3OD4 A;  5GTI Z;  2YGA A;  1IBK B;  4LF7 B;  4TUY A;  3UCS C;  3K60 A;  4I5S A;  3BEH A;  4EFB A;  2WA3 A;  2ZNI A;  1NTM H;  2PNR A;  4GX2 A;  5IWA B;  4LFA B;  1KC8 W;  3ZED A;  4NB5 A;  2ZQM A;  3EHF A;  3D0B A;  4UCO A;  2UUB B;  4C7U A;  4KHP B;  2GUZ B;  3BA8 A;  4B7P A;  4NXN O;  3UO2 A;  4V25 A;  1IXM A;  4X64 O;  3R92 A;  1EM1 A;  5JH7 B;  1PVG A;  2UUC B;  2IW5 A;  3VHA A;  3E22 A;  3B27 A;  1GN6 A;  5B3S B;  3M7M X;  2HP8 A;  4MVQ A;  3WB1 A;  3EHG A;  1M93 A;  2LP7 A;  2F4V O;  1I5A A;  1N32 B;  2YE5 A;  3IAY A;  3OGI B;  1CEZ A;  1M9N A;  1YC4 A;  1UY6 A;  4WFG A;  3RVZ A;  1R6T A;  4NKG B;  2ZE6 A;  4YHH B;  4XBF A;  2FYP A;  4XKO A;  5JJN B;  5KX5 B;  3EHH A;  2Q73 A;  3A0W A;  1DTO A;  1URF A;  4URO A;  3VHC A;  4H13 B;  3CC7 V;  3JAW A;  2WLJ A;  3A2F A;  1L8D A;  4O07 A;  5LYJ A;  4JI2 B;  1TVK B;  2ZM6 B;  2XND G;  2ZIO A;  2R9I A;  2XT9 A;  1H8H G;  5LBQ A;  3OPD A;  2ILM A;  3ABK C;  1Q90 D;  1KYO F;  4JAA A;  4XDJ A;  2HG1 A;  5F2V O;  4X1K A;  2QFO A;  1KUQ A;  1GKX A;  1KEC A;  3SGI A;  1XNR B;  5GON A;  4ZI7 A;  3FB7 C;  1FS0 G;  5JCO C;  2IJI A;  3JD4 A;  5LA6 B;  4EMV A;  4BQG A;  3OTF A;  4WBN B;  4HZ5 A;  4IIJ A;  1L0N H;  3VOU A;  1Y4U A;  5EK0 A;  2ODM A;  3WFV A;  1NS1 A;  5KAI Z;  1FXV A;  1QZR A;  1VQ6 V;  4XIR A;  4CE2 A;  3P3N A;  3TZ4 A;  2XAB A;  1U96 A;  2YKI A;  1TID A;  5B1A C;  4DV6 O;  5IYZ A;  3Q5K A;  3SJB C;  4CWN A;  3H4L A;  3JYC A;  4R7C A;  4HXZ A;  3CRA A;  2QJ1 A;  2BTZ A;  1PV0 A;  4XDL A;  3MDS A;  3K5L A;  3MNR P;  2R9R B;  2OCC B;  1PL0 A;  1SER A;  4H37 A;  4IYH A;  2Q69 A;  3JD3 A;  3K97 A;  3ZHU A;  3FB8 C;  2BTQ A;  5CPH A;  1XRE A;  1Y8P A;  3VQY A;  4X62 O;  2MK3 A;  3ZHT A;  3O6O A;  3CJH A;  2XTA A;  3SJC C;  2FB5 A;  3OR7 C;  1WNS A;  4JI1 B;  1ROP A;  3B09 A;  5AG2 A;  1HNX B;  1VIB A;  4LF9 O;  3CRK A;  2V7Q G;  3OMI B;  1GM8 A;  1G1X B;  4O4H B;  2UXD O;  1AMW A;  3SYA A;  4JV5 O;  3SPC A;  2C1G A;  5F5R A;  4LF6 O;  2PYJ A;  1QU7 A;  5KHH A;  2CTQ A;  3T4D A;  3BVO A;  1DK1 A;  4J42 A;  4OX9 B;  1IBK O;  3THO A;  2Q4P A;  3JSL A;  4PA7 A;  1D2D A;  4UCT A;  5ITZ B;  1TA8 A;  5IWA O;  4DZY A;  5B1O A;  3RGB A;  4LFA O;  2YED A;  4LWI A;  4EFE A;  2EIN B;  1AJN A;  4YIO A;  4ABM A;  3QTF A;  1SQB H;  2QG0 A;  3F7V C;  4FCP A;  4BAY A;  4KHP O;  2GTA A;  2JVD A;  1K5Q A;  3TZ2 A;  4H81 A;  4EM7 A;  4U7O A;  4LF4 O;  1ZXM A;  4XD8 A;  4LP0 A;  4GFN A;  1ZTE A;  2CUG A;  2WI5 A;  2ZKJ A;  1AI5 A;  1P7G A;  3G67 A;  3D8C A;  3LNU A;  3ZHQ A;  2XCM A;  4X1I B;  4O2A A;  3VQW A;  3D2R A;  1N32 O;  3ZX6 A;  2CH4 A;  4BAE A;  3A0H Z;  3ETG A;  4PD4 F;  5EBW C;  3UO3 A;  1Y74 A;  4ASU G;  4YHH O;  3T1Y B;  2GDS A;  4NH9 A;  1UYH A;  4QE9 A;  1NJI W;  3BM9 A;  3G6E V;  4DV7 O;  1IX9 A;  2ADQ B;  2HG5 C;  5IYD O;  3CRL A;  2CGO A;  1N33 O;  1NT2 B;  1FXH A;  3Q4H A;  4MPE A;  4DO2 A;  1R3L C;  5LL6 Y;  1ZAU A;  4G27 B;  1WB8 A;  1OJH A;  4GCZ A;  1K4C C;  4JI2 O;  5LGT A;  1HDJ A;  5LGU A;  5EC2 C;  3SL2 A;  1XMQ B;  3CMA V;  4DV2 B;  4Z1V A;  1MSD A;  1QYE A;  4N23 A;  4F4L A;  5CF0 A;  1Y76 A;  4YKZ A;  1EA6 A;  4IHJ B;  1YS3 A;  3FAV B;  4MT8 A;  3STZ C;  1K7D A;  1US6 A;  3F5T A;  5LP6 C;  4MW8 A;  1MSW D;  2AZ2 A;  3VQX A;  1AP6 A;  2XAH A;  2HEP A;  4FMT A;  2RDC A;  2QG2 A;  4MVZ A;  4TSF G;  1W2B U;  1SF9 A;  3WB2 A;  3H1K H;  3GIG A;  4P9O A;  2IU0 A;  3QVN A;  1VF6 C;  4JI0 B;  3CME V;  4FPP A;  2P5O A;  3G7B A;  2UXC B;  2EIM B;  2AW9 A;  2ARH A;  4TV9 A;  5JCO A;  4JI7 B;  2UWD A;  2XX2 A;  3OR6 C;  5LHG A;  3ABT A;  2QWO B;  3A0B Z;  4V26 A;  3HYZ A;  1YTF D;  2GHY A;  1QBZ A;  1XL4 A;  4PEL A;  2M6Y A;  2YEB A;  3IC7 A;  4GX0 A;  2PUS A;  2BSK B;  4OGQ B;  3TXS A;  4CZZ A;  1TAE A;  4O4L B;  2YK2 A;  3ZN1 A;  4D6T H;  1XMO B;  3NMQ A;  1I0H A;  2JIZ G;  4KFM A;  2NR5 A;  4EEH A;  2O1U A;  3OWD A;  4YJ3 A;  2Q67 A;  1FKA O;  2RN9 A;  1UYE A;  1TUE B;  3KCY A;  4AWQ A;  5IYB O;  3N2G A;  1H2S B;  1AP5 A;  1MG1 A;  5CA3 A;  2KQX A;  2WLK A;  5BY1 A;  4MTF A;  1VQP V;  4JI8 B;  2XJX A;  1OSF A;  4JI1 O;  3ASO B;  3ZKB A;  2VWK A;  4EFT A;  2QM7 A;  3RYF A;  2FXS A;  2YEV A;  1YDX A;  5L3G A;  4R8C A;  2BRE A;  1BE3 H;  4J7Z A;  2WLN A;  1THN A;  1JR9 A;  4EGK A;  1UY8 A;  2ZT9 B;  1BHA A;  2XOK G;  3GB7 C;  3OW2 U;  2YKC A;  3CC2 V;  2CK3 G;  2YI6 A;  5CMU A;  2Q7E A;  3WG7 B;  1JOY A;  1L1F A;  4OX9 O;  3AG1 C;  3ETE A;  2DJV A;  4CWT A;  4PHZ A;  2YIC A;  5CB4 A;  5L3B A;  3BMY A;  4ASF A;  1QQC A;  5D6P A;  2BTO A;  2BRC A;  3RLP A;  1W59 A;  4IL6 Z;  3UT5 A;  4ZHQ B;  2YIB A;  1ZWI C;  1UYL A;  4QJF B;  4ASG A;  1NH2 D;  3L73 H;  5L3F A;  2YEC A;  3BAB A;  3BRC A;  3DC5 A;  2O57 A;  4E4E A;  1ZL8 B;  2JEU A;  2Q8F A;  1Q3E A;  1TBW A;  1Q6I A;  1TC6 A;  4FK5 C;  2JS5 A;  4D7T A;  3K5N A;  2ADP A;  4GYC B;  4OPH A;  4LWG A;  2Q7G A;  2FTK A;  4B6C A;  1BXD A;  2XAQ A;  3OUF A;  1FFT B;  2QWN B;  2W0X A;  2WA4 A;  1E1Q G;  4O04 A;  4YKU A;  1PNM A;  5IDJ A;  2K9P A;  1MX0 A;  4O2B B;  2AKP A;  1YJW V;  4YY3 O;  2L35 A;  3EFF K;  2JS3 A;  2P4V A;  1S5H C;  1BQZ A;  3LDE A;  3T1Y O;  4J7J A;  4U3J B;  2A0L A;  3LSQ A;  2XAF A;  1HNZ O;  3AK1 A;  1QHT A;  5DM6 V;  2PI5 A;  2M7W A;  2Y0I A;  1XI1 A;  2YEH A;  2AXT Z;  3R4N A;  2QWP B;  1AH6 A;  4LR3 A;  1EZV H;  3HKD B;  1R1B A;  2IWX A;  2DOS A;  1SA0 A;  4FM0 A;  4WFH A;  2EIJ B;  5KMG A;  1KQS U;  4UV8 A;  2XD6 A;  4I9Q A;  3L72 H;  4BW5 A;  5A2Q N;  5H2F Z;  5CA0 B;  2P90 A;  3B40 A;  1YER A;  5CBF A;  1VQ8 V;  2VQE B;  4O4I A;  1Y8O A;  1JMK C;  4K8Z A;  2BYI A;  3KE6 A;  4DV4 B;  1M90 W;  3A0Y A;  4FIP C;  1NVP B;  5J2U A;  1BYQ A;  4DV5 B;  2XX4 A;  5B1B B;  1SQP H;  1UYF A;  3HKB A;  4ZOL B;  3ZCC A;  3E89 A;  1QLE C;  4BW9 A;  2XDS A;  1THZ A;  5D5Q A;  5JVD B;  3K99 A;  1H2G A;  1XNQ B;  1OCZ B;  3FYI B;  4JQL A;  3KZI Z;  3D3I A;  1VF6 A;  2C1I A;  5C8Y A;  1LR1 A;  4N21 A;  1GN3 A;  1VQ5 V;  1AB3 A;  2VWC A;  4EKW A;  4PDV A;  2LFS A;  3E86 A;  4DR7 O;  4KP4 A;  3R91 A;  3CRR A;  4PI2 A;  3G71 V;  1V55 C;  5IJ0 A;  2OWO A;  4K4O A;  2DE0 X;  2BOC C;  1Z5V A;  1Y4M A;  3RN4 A;  2P67 A;  4FVM A;  3DSQ A;  4I3H A;  3ASN B;  1UJW B;  1XMO O;  1NHJ A;  5GGZ A;  3J7A U;  1EN6 A;  3CCR V;  2RMK B;  4AI8 A;  4IYI A;  4FLV A;  2CCT A;  1H8E G;  4DR1 B;  3HB3 B;  1BGQ A;  4Q20 A;  1FJG B;  3KG2 A;  3P32 A;  3JAT B;  2K1E A;  3HKE A;  5CA1 B;  1I5X A;  4JI8 O;  1VQO V;  3HZ5 A;  1JCH A;  1HWY A;  1S0V A;  1GRJ A;  2VRZ A;  3ETD A;  1XBL A;  2V1D A;  4HZ0 A;  4GX1 A;  3U2K A;  1G8M A;  1TUB A;  5BZB A;  4I50 B;  1SQV H;  2KG7 A;  4AWO A;  3ZMU A;  1FYJ A;  5KHG A;  1RSO A;  3D36 C;  4CWS A;  4HXW A;  2GFD A;  1SS3 A;  2LQT A;  3T1H B;  4L94 A;  4LC1 A;  4TUY B;  1P7B A;  3K0G A;  1S5L Z;  1NR7 A;  4MBC A;  2EIK C;  4HZ3 A;  3OAA G;  2ZDX A;  1KZN A;  2VWJ A;  3CC4 V;  3HR0 A;  5GW7 A;  1I94 O;  2WI3 A;  3QNE A;  2QE7 G;  3I5D A;  1NHH A;  4RQE A;  3FB6 C;  4FLX A;  3IFX A;  3OWB A;  3JAR A;  1Q8I A;  3H80 A;  4QIW F;  4TQF A;  4JYC A;  5L3C A;  4MSW C;  5M4M A;  1YXB A;  1VQ9 V;  3A0R A;  4U3F H;  2WI2 A;  2DMX A;  4O09 A;  3ZHR A;  3ZRX A;  3E35 A;  1BKN A;  5M4P A;  3TCU A;  4URN A;  2Q0O C;  5CN0 A;  3SJQ C;  2JGD A;  3K5O A;  1AI4 A;  4F6R A;  3I56 V;  3E22 B;  4DRX A;  5A9G A;  1EI1 A;  2CE4 A;  4KTN A;  1B3Q A;  2HR3 A;  3VBB A;  2ITC C;  1O9G A;  2A7W A;  2UU9 O;  3TGU H;  4MP7 A;  4JYY A;  2IH3 C;  2R72 A;  4GEE A;  3BA9 A;  1Q82 W;  4JF3 A;  1M56 C;  1R3K C;  2L6L A;  1KKD A;  3SR2 C;  3M8A A;  3WHA A;  1KKC A;  3E8F A;  1DGS A;  5IY5 B;  2JDI G;  2W6I G;  3QF7 A;  4H0L B;  5FNV A;  5HFM A;  3ZHV A;  3OM3 B;  4FLY A;  2ITD C;  4L91 A;  3WQ9 A;  1KB9 F;  4FFB A;  5LYJ B;  2F95 B;  2Z5U A;  5B1N A;  2XDK A;  5CTU A;  2N05 A;  2QKS A;  4GKJ O;  3B26 A;  1RP3 B;  2WI7 A;  3C90 A;  5CTX A;  1WA8 A;  5IDM A;  4HBN A;  1MZF A;  4I0X A;  2ZDI C;  3NR7 A;  2F66 C;  1B63 A;  2YEG A;  2IM9 A;  3AG4 C;  3K57 A;  3CSX A;  4GLX A;  3RBZ A;  4O4J A;  4X1K B;  1JJO A;  4EB6 A;  1UY7 A;  5LHH A;  1VF7 A;  4CH6 A;  4DUY B;  1KBH A;  3C0E A;  2HKO A;  1TIL A;  5GON B;  3CYG A;  4PDM A;  4UCU A;  3CWV A;  2Q8H A;  1KU9 A;  2VQE O;  2QKA A;  1O9H A;  2B9Z A;  1YHQ V;  1S3J A;  3T1K A;  4YKT A;  2YXH A;  4PJ0 Z;  1D5N A;  5IJ9 B;  2ATK C;  4DV5 O;  2DQ3 A;  2Q5Z A;  3LPS A;  4IIJ B;  1YES A;  2FWZ A;  5LXT B;  4JI3 B;  2IH1 C;  5HFL A;  1SKV A;  1H7U A;  1BCC H;  2VQF O;  1M57 B;  3T4Z A;  5FLX N;  2CGN A;  4ZKI A;  1XNQ O;  2YS8 A;  4ICG A;  2BU7 A;  3NXS A;  3AK3 A;  1TGO A;  4GGL A;  1CXZ B;  2OYQ A;  3ZHS A;  4J9Y B;  3H01 A;  2ZXW B;  4FCQ A;  1YT1 A;  4HYP A;  1H7S A;  2DYS B;  4XDK A;  2KB1 A;  3SYC A;  3S3X A;  1XDC A;  3ZMT A;  3R65 A;  3L75 H;  1OCO C;  2UXB O;  2Y69 C;  2B5U A;  5CTY A;  2YE4 A;  2AHY A;  4P8O A;  1AR5 A;  2XK2 A;  1UY9 A;  3W7X A;  5KX5 A;  4XC0 A;  1MMM A;  2X7R B;  1WPX A;  5JQG B;  4DR1 O;  3LMM A;  4NH8 A;  3SPH A;  5FWK A;  1NHI A;  4LWS B;  1FJG O;  3AG3 C;  1IBM B;  4P2Z A;  3E8B A;  2YK9 A;  2QWQ B;  3DC6 A;  4HAM A;  4J41 A;  4LWF A;  5KA6 A;  4JAU A;  2ZE7 A;  4I55 B;  4AQY B;  4DV3 B;  2QEX V;  2XDU A;  3LDC A;  1VQM V;  3J80 N;  4XCJ A;  1UFI A;  5D5P A;  1ZWH A;  3SPI A;  3JAL A;  4R50 A;  3ICX A;  5BMV A;  4ZBM A;  3T1H O;  5GTH Z;  1SES A;  3CCM V;  3BFR A;  3OGC C;  1I5D A;  3FKS G;  5LHI A;  1K97 A;  3R4M A;  3S3W A;  3D36 A; 
#chains in the Genus database with same CATH homology
 1PNL A;  2EIM C;  2WLH A;  1E79 G;  4UV9 A;  5C93 A;  2BU2 A;  1GMG A;  4MW3 A;  4JTD B;  2X6C A;  3CGZ A;  1QVG U;  3OMU A;  2JJ1 G;  3JZ3 A;  4O05 A;  2E0A A;  3VHD A;  2XX5 A;  1F51 A;  3SPG A;  2HFE C;  3RVY A;  4CWR A;  4PA6 A;  3SYP A;  1SET A;  1S72 V;  5H9C A;  1YJ9 V;  4MTG A;  2JEX A;  3T0Z A;  3MHH C;  1R62 A;  4CWP A;  3F7Y C;  3LSS A;  5KUK A;  1Y4S A;  3R4O A;  4WCE V;  1OHH G;  4MVR A;  3CCJ V;  4XDM A;  2WLL B;  4MPC A;  1H38 A;  3ABK B;  2ZDI A;  1K8A W;  3CP1 A;  1AI6 A;  1I5Y A;  3U67 A;  1JX9 A;  4PL9 A;  2DQ0 A;  2O1V A;  3GIG B;  4NH7 A;  1ZW9 A;  1OCC C;  5FND A;  4JAV A;  3R4P A;  2JJC A;  1ENV A;  1RM1 C;  4KSH A;  3ABM C;  1I5B A;  4YKX A;  3C11 A;  4XE2 A;  1YI2 V;  3E8H A;  3W7U A;  1FXK C;  3IED A;  4CE1 A;  1R3J C;  3ZRW A;  3ABL C;  4G28 B;  3AG2 C;  4X89 A;  4JTA B;  2DW4 A;  4QNH B;  4WUB A;  5B1A B;  3OW6 A;  1Q81 W;  4KSG A;  2HVK C;  1R73 A;  2YI0 A;  4YKR A;  3OFN G;  2CGF A;  4JPR A;  2XJG A;  2IJJ A;  4UXN A;  4XIT A;  1K33 A;  1Q86 W;  5F3K A;  3K0D A;  1I5C A;  2B1I A;  1I59 A;  1V54 C;  3CGY A;  1YJN V;  2YI5 A;  2W0F C;  1S76 D;  1SZT A;  3CYO A;  4ASB A;  2FWY A;  2XHT A;  3MD0 A;  4MP2 A;  3K79 A;  4UVB A;  1K73 W;  5BOD A;  3ZN0 A;  5M4K A;  3O0I A;  4LBE C;  2UXX A;  4QE7 A;  1OZ0 A;  2PI4 A;  4L87 A;  2OTL V;  1S77 D;  3PJS K;  3QDD A;  4XIQ A;  1Z5C A;  1R6N A;  2BT0 A;  2Q6A A;  3OE7 G;  2H94 A;  1KP2 A;  1GKZ A;  2WEP A;  1GM9 A;  2HLD G;  1ZXN A;  1G4Y B;  3VAD A;  2X0L A;  2H8M A;  1YIT V;  1JM6 A;  3ZM7 A;  2IOQ A;  2BU8 A;  5J6A A;  2BZ5 A;  3HZ1 A;  2NLJ C;  1W0J G;  2CCS A;  2YEF A;  1OCR C;  1JVM A;  1QY8 A;  4MOT A;  2X6A A;  3FT5 A;  4PA3 A;  2ZDY A;  4YKY A;  3TTZ A;  2DYR C;  2F43 G;  2XAJ A;  3K03 A;  1DF4 A;  5M4E A;  4R1F A;  3M99 B;  3EHJ A;  1K92 A;  4JGS A;  1I58 A;  3RLQ A;  2WI4 A;  4CBC A;  1M1K W;  3INX A;  3A0T A;  1DLB A;  2JKI A;  2XDL A;  2Q8I A;  1KP3 A;  3K04 A;  3LNM B;  3CCS V;  2YEE A;  4R3A A;  3ZMS A;  1CPY A;  2HCH A;  1S14 A;  1AR1 B;  5CBG A;  1JJ2 U;  4FJC C;  2WEQ A;  1FXK A;  4WUD A;  5L3E A;  4URL A;  3BY6 A;  1COW G;  1KD1 W;  4QPK A;  5FNF A;  4WUC A;  4L90 A;  4W7T A;  4RO2 A;  5B3S C;  2WAM A;  3T0H A;  2ZR2 A;  1Y8N A;  1NVP D;  5CBH A;  3JD2 A;  3ZMZ A;  1AJQ A;  2JJ2 G;  2D3O W;  2WER A;  1U0Z A;  1NBM G;  4BQJ A;  2YEJ A;  2HJF C;  2YJW A;  2A9H A;  1K3E A;  1VQL V;  4WFB V;  2YE9 A;  4PA9 A;  1EBO A;  1F23 A;  5D6Q A;  4E02 A;  1VQK V;  2ZD9 A;  3AG1 B;  4UUJ C;  1GKF A;  1U2O A;  5EBL C;  3GIE A;  4BIU A;  3SYQ A;  2WLI A;  1QLN A;  3IGA C;  4MTX A;  4WF9 V;  1W0K G;  3QO5 A;  4TWK A;  5BOC A;  2XHX A;  4BIZ A;  3UM7 A;  3CCE V;  4JYB A;  2Q8G A;  1MU5 A;  2K5B A;  2XAG A;  2YKB A;  1RPR A;  1J95 A;  1GTO A;  1E1R G;  2ESA A;  5FNC A;  4G2K A;  2VCJ A;  5J9P C;  1LNQ A;  3O2F A;  4YKW A;  1PD3 A;  1YSC A;  2OCC C;  3RW0 A;  2YE6 A;  2EZP A;  4YKQ A;  1AM1 A;  2WI6 A;  3E8G A;  4WFA V;  3OMA B;  3K08 A;  1YC3 A;  4PDL A;  4HYO A;  4RAI A;  1QR8 A;  4KUM A;  3X2Q B;  2QTO A;  3B24 A;  1YT0 A;  3E83 A;  2H55 A;  3FYE B;  1EFR G;  2B1G A;  3CCU V;  4R6Z A;  4P9P A;  1QLE B;  3CPW U;  3TUH A;  1UYM A;  1ORQ C;  2EIN C;  2XDX A;  3A0X A;  3W7T A;  3G4S V;  3GWO A;  3DGE A;  1YSR A;  4LP8 A;  3ML0 A;  5M4N A;  3W7W A;  1V55 B;  3TZ0 A;  1PNK A;  3T2S A;  4URM A;  2EJR A;  5D7R A;  3E2E A;  1Z5A A;  4PA4 A;  3ZKD A;  1NR1 A;  4MS2 A;  3LUT B;  4AS9 A;  2BOB C;  1GK9 A;  2GSM B;  4UVA A;  1Z59 A;  3K9A A;  1VQ4 V;  3QO7 A;  4KFG A;  3ZRV A;  2JK5 C;  4P30 A;  2EIK B;  4RQF A;  1AJ6 A;  1UYD A;  2YKE A;  4U7N A;  3HHU A;  4LCU C;  4E01 A;  3FV5 A;  2EIL B;  3Q5L A;  4WFE A;  2BU5 A;  2YGE A;  2BSM A;  3F5W C;  2YEA A;  4H33 A;  4PRV A;  1UYG A;  3DTU B;  2VCI A;  2YEI A;  2YE3 A;  2BU6 A;  5EBM C;  1TC0 A;  2YJX A;  4E00 A;  3G7E A;  1S16 A;  4H85 A;  1M56 B;  1UYI A;  2CG9 A;  4R3M A;  5H6Q A;  3FT8 A;  4P7A A;  1RPO A;  4XIP A;  3MHS C;  3INW A;  4HY1 A;  4LWE A;  1K4D C;  4XCL A;  1YT2 A;  4CWO A;  2XAS A;  1A4H A;  4XTJ A;  3TK1 A;  3AG4 B;  2IJK A;  2UXN A;  2Z3Y A;  4CWF A;  3ASO C;  4EGI A;  1PKX A;  5D7D A;  4LWH A;  1B6Q A;  1AH8 A;  1F4M A;  3WG7 C;  3B8M A;  4BXI A;  4MB9 A;  4X88 A;  3ZRW B;  2QA4 V;  5KA5 A;  1NQT A;  2OTJ V;  2IOP A;  5D7C A;  4PU9 A;  3T1C A;  1P4R A;  3CCV V;  4RUE A;  3OMN B;  4UVC A;  1YET A;  1UYK A;  3CCL V;  1OCO B;  2Y69 B;  3ZIA G;  4L93 A;  4MVU A;  2HVJ C;  5CTW A;  3EHB B;  2A79 B;  3UKM A;  3CD6 V;  5M4H A;  4LPB A;  3AG3 B;  4E2L A;  2IOR A;  4DXW A;  4XKK A;  4OXS A;  2WLL A;  2YSU B;  3I55 V;  2ZBK B;  1L0O A;  3JCZ A;  4O0B A;  1YTF B;  1US7 A;  4EFU A;  4ZVI A;  2XHR A;  2EIJ C;  1GJV A;  5LGN A;  3RLR A;  2YEV B;  4GT1 A;  2IWU A;  1Q7Y W;  3P30 A;  2QM8 A;  5L3J A;  2O1W A;  3STL C;  2Y48 A;  1XL6 A;  2IWS A;  2DWE C;  1MAB G;  5B1B C;  5IN9 A;  1ID0 A;  3JD0 A;  1GO3 F;  4U93 A;  1VQ7 V;  4XKA A;  1Y66 A;  2HKJ A;  1OCZ C;  2GQP A;  4MTO A;  2AHZ A;  2WPD G;  1K5S A;  1N8R W;  1F4N A;  1BMF G;  3CCQ V;  3SYO A;  2Q68 A;  3AEI A;  3OEE G;  2OT5 A;  4DUH A;  1BHB A;  2P7T C;  3ASN C;  1GM7 A;  2WWW A;  4AWP A;  1YC1 A;  3OEH G;  1JQ0 A;  5DN6 G;  1K9M W;  4FCR A;  1DF5 A;  2YI7 A;  2Q2E B;  1NH2 B;  1QCE A;  4MVM A;  3K06 A;  4PRX A;  3ZJZ A;  3JD1 A;  1MOF A;  1R6K A;  1K34 A;  5J71 A;  5L3D A;  2NNU A;  4EGH A;  3B8N A;  2ZR3 A;  4YXW G;  1QR9 A;  3K3W A;  3W7S A;  1OCC B;  3HEK A;  1RM1 B;  3B25 A;  3ABM B;  4CWQ A;  3EKO A;  3T10 A;  3B28 A;  3PEH A;  2YKJ A;  2YE2 A;  1FXK B;  1ARO P;  1WLE A;  3TET A;  3ZMV A;  1BL8 A;  3ABL B;  2WSS G;  1Z5B A;  3AG2 B;  5FL7 G;  3A0Z A;  5IYC O;  3HYY A;  2WLM A;  3U2D A;  2W6J G;  2YE8 A;  1TH8 A;  3GIF A;  4WFF A;  2XJJ A;  2LFR A;  2H8P C;  4TT3 G;  1AI7 A;  1R3I C;  3Q5J A;  4CE3 A;  2WI1 A;  3ZXO A;  5E1A C;  5IY5 C;  1AJP A;  3X2Q C;  4ASA A;  1V54 B;  4X8A A;  1B62 A;  1SRY A;  3QO8 A;  4GQT A;  3EKR A;  3B77 A;  5H6R A;  1NKD A;  4JTC B;  3ZXQ A;  4QPJ A;  2WLI B;  1KIJ A;  1VQN V;  4H7Q A;  2EZO A;  4KQV A;  3PEJ A;  4RUF A;  4GX5 A;  2YE7 A;  3FB5 C;  1M57 C;  1JPX A;  3OUS A;  2QF6 A;  4X9L A;  2X6B A;  1EZJ A;  5KUM A;  4HY6 A;  2IU3 A;  3ABU A;  1YIJ V;  2ZXW C;  3ZRS A;  1YSZ A;  2DYS C;  3CXC U;  3SPJ A;  3LDD A;  2CCU A;  4L8Z A;  4MPN A;  2IJH A;  3T2M A;  1OCR B;  1QVF U;  2DWD C;  2EXL A;  2DYR B;  4MVO A;  1UYC A;  4J9Z B;  3TZ5 A;  4I9W A;  3RKZ A;  3G75 A;  4HYM A;  2BYH A;  2YGF A;  2EIL C;  4JAS A;  3HPL C;  2P6J A;  1CP9 A;  2VW5 A;  4GT8 A;  5EC1 C;  4MVS A;  4Z1M G;  3K98 A;  2EBO A;  2C2A A;  4PDR A;  2YGA A;  3K60 A;  4I5S A;  3BEH A;  2PNR A;  4GX2 A;  1KC8 W;  2ZQM A;  3EHF A;  3D0B A;  4B7P A;  4V25 A;  1IXM A;  3R92 A;  1PVG A;  2IW5 A;  3VHA A;  3B27 A;  5B3S B;  4MVQ A;  3EHG A;  2LP7 A;  1I5A A;  2YE5 A;  1CEZ A;  1M9N A;  1YC4 A;  1UY6 A;  4WFG A;  3RVZ A;  4XBF A;  2FYP A;  4XKO A;  3EHH A;  3A0W A;  1DTO A;  4URO A;  3VHC A;  3CC7 V;  2WLJ A;  4O07 A;  2XND G;  2R9I A;  1H8H G;  5LBQ A;  3OPD A;  3ABK C;  4XDJ A;  2HG1 A;  2QFO A;  1GKX A;  1KEC A;  3FB7 C;  1FS0 G;  2IJI A;  3JD4 A;  4EMV A;  4BQG A;  4HZ5 A;  1Y4U A;  3VOU A;  5EK0 A;  3WFV A;  1FXV A;  1QZR A;  1VQ6 V;  4XIR A;  4CE2 A;  3TZ4 A;  2XAB A;  2YKI A;  1TID A;  5B1A C;  3Q5K A;  4CWN A;  3H4L A;  3JYC A;  4R7C A;  4HXZ A;  2BTZ A;  4XDL A;  3MNR P;  2R9R B;  2OCC B;  1PL0 A;  1SER A;  4H37 A;  2Q69 A;  3JD3 A;  3K97 A;  3FB8 C;  5CPH A;  1Y8P A;  2MK3 A;  3O6O A;  3OR7 C;  1ROP A;  3CRK A;  2V7Q G;  3OMI B;  1GM8 A;  1AMW A;  3SYA A;  3SPC A;  5F5R A;  3T4D A;  4PA7 A;  4DZY A;  5B1O A;  2YED A;  4LWI A;  2EIN B;  1AJN A;  3QTF A;  2QG0 A;  3F7V C;  4FCP A;  4BAY A;  1K5Q A;  3TZ2 A;  4H81 A;  4EM7 A;  4U7O A;  1ZXM A;  4XD8 A;  4LP0 A;  4GFN A;  2WI5 A;  2ZKJ A;  1AI5 A;  3LNU A;  2XCM A;  3D2R A;  2CH4 A;  4BAE A;  3ETG A;  5EBW C;  4ASU G;  4NH9 A;  1UYH A;  4QE9 A;  1NJI W;  3BM9 A;  3G6E V;  5IYD O;  3CRL A;  2HG5 C;  1FXH A;  4MPE A;  4DO2 A;  1R3L C;  4G27 B;  4GCZ A;  1K4C C;  5LGT A;  5LGU A;  5EC2 C;  3SL2 A;  3CMA V;  1QYE A;  4N23 A;  4F4L A;  5CF0 A;  4YKZ A;  1EA6 A;  1YS3 A;  4MT8 A;  3STZ C;  1K7D A;  4MW8 A;  1MSW D;  2XAH A;  4FMT A;  2QG2 A;  4MVZ A;  4TSF G;  1W2B U;  3GIG A;  4P9O A;  2IU0 A;  3CME V;  4FPP A;  3G7B A;  2EIM B;  2UWD A;  2XX2 A;  3OR6 C;  5LHG A;  3ABT A;  4V26 A;  3HYZ A;  1YTF D;  2GHY A;  1QBZ A;  1XL4 A;  4PEL A;  2YEB A;  3IC7 A;  4GX0 A;  4CZZ A;  2YK2 A;  3ZN1 A;  3NMQ A;  2JIZ G;  4KFM A;  4EEH A;  2O1U A;  3OWD A;  2Q67 A;  1UYE A;  1TUE B;  4AWQ A;  5IYB O;  1MG1 A;  5CA3 A;  2WLK A;  4MTF A;  1VQP V;  2XJX A;  1OSF A;  3ASO B;  3ZKB A;  4EFT A;  2QM7 A;  2FXS A;  2YEV A;  5L3G A;  4R8C A;  2BRE A;  2WLN A;  1THN A;  4EGK A;  1UY8 A;  1BHA A;  2XOK G;  3GB7 C;  3OW2 U;  2YKC A;  3CC2 V;  2CK3 G;  2YI6 A;  5CMU A;  3WG7 B;  1JOY A;  1L1F A;  3AG1 C;  3ETE A;  4CWT A;  5L3B A;  3BMY A;  4ASF A;  5D6P A;  2BRC A;  3RLP A;  1ZWI C;  1UYL A;  4QJF B;  4ASG A;  1NH2 D;  5L3F A;  2YEC A;  2JEU A;  2Q8F A;  1TBW A;  1TC6 A;  4FK5 C;  4LWG A;  2FTK A;  4B6C A;  1BXD A;  2XAQ A;  3OUF A;  1FFT B;  1E1Q G;  4O04 A;  4YKU A;  1PNM A;  5IDJ A;  1MX0 A;  2AKP A;  1YJW V;  3EFF K;  1S5H C;  3LDE A;  2A0L A;  3LSQ A;  2XAF A;  5DM6 V;  2PI5 A;  2M7W A;  2YEH A;  3R4N A;  1AH6 A;  2IWX A;  4WFH A;  2EIJ B;  1KQS U;  4UV8 A;  2XD6 A;  4BW5 A;  2P90 A;  1YER A;  5CBF A;  1VQ8 V;  1Y8O A;  2BYI A;  3KE6 A;  1M90 W;  3A0Y A;  4FIP C;  1NVP B;  1BYQ A;  2XX4 A;  5B1B B;  1UYF A;  3ZCC A;  3E89 A;  1QLE C;  2XDS A;  1THZ A;  3K99 A;  1H2G A;  1OCZ B;  3FYI B;  4JQL A;  3D3I A;  4N21 A;  1VQ5 V;  2VWC A;  4EKW A;  4PDV A;  2LFS A;  3E86 A;  4KP4 A;  3R91 A;  3G71 V;  1V55 C;  4K4O A;  2BOC C;  1Y4M A;  2P67 A;  4I3H A;  3ASN B;  1UJW B;  1NHJ A;  5GGZ A;  3CCR V;  2CCT A;  1H8E G;  3HB3 B;  1BGQ A;  4Q20 A;  3KG2 A;  3P32 A;  2K1E A;  1I5X A;  1VQO V;  3HZ5 A;  1JCH A;  1HWY A;  1S0V A;  3ETD A;  2V1D A;  4HZ0 A;  4GX1 A;  3U2K A;  1G8M A;  5BZB A;  4AWO A;  3ZMU A;  4CWS A;  4HXW A;  2GFD A;  4L94 A;  4LC1 A;  1P7B A;  3K0G A;  1NR7 A;  4MBC A;  2EIK C;  4HZ3 A;  3OAA G;  2ZDX A;  1KZN A;  3CC4 V;  5GW7 A;  2WI3 A;  3QNE A;  2QE7 G;  1NHH A;  4RQE A;  3FB6 C;  3IFX A;  3OWB A;  3H80 A;  4QIW F;  4JYC A;  5L3C A;  4MSW C;  5M4M A;  1VQ9 V;  3A0R A;  2WI2 A;  4O09 A;  3ZRX A;  3E35 A;  1BKN A;  5M4P A;  3TCU A;  4URN A;  5CN0 A;  3SJQ C;  1AI4 A;  3I56 V;  1EI1 A;  4KTN A;  1B3Q A;  2HR3 A;  3VBB A;  2ITC C;  4MP7 A;  2IH3 C;  4GEE A;  1Q82 W;  4JF3 A;  1M56 C;  1R3K C;  1KKD A;  3WHA A;  3E8F A;  5IY5 B;  2JDI G;  2W6I G;  5HFM A;  3OM3 B;  2ITD C;  4L91 A;  3WQ9 A;  2Z5U A;  5B1N A;  2XDK A;  5CTU A;  3B26 A;  2QKS A;  2WI7 A;  5CTX A;  5IDM A;  2ZDI C;  1B63 A;  2YEG A;  3AG4 C;  3RBZ A;  1UY7 A;  5LHH A;  3C0E A;  2HKO A;  1TIL A;  4PDM A;  3CWV A;  2Q8H A;  1YHQ V;  1S3J A;  3T1K A;  4YKT A;  2ATK C;  2DQ3 A;  3LPS A;  1YES A;  2FWZ A;  2IH1 C;  5HFL A;  1H7U A;  1M57 B;  3T4Z A;  4ZKI A;  2BU7 A;  3NXS A;  4GGL A;  4J9Y B;  3H01 A;  2ZXW B;  4FCQ A;  1YT1 A;  4HYP A;  1H7S A;  2DYS B;  4XDK A;  2KB1 A;  3SYC A;  3ZMT A;  3R65 A;  1OCO C;  2Y69 C;  2B5U A;  5CTY A;  2YE4 A;  2AHY A;  4P8O A;  2XK2 A;  1UY9 A;  3W7X A;  4XC0 A;  2X7R B;  1WPX A;  4NH8 A;  3SPH A;  5FWK A;  1NHI A;  3AG3 C;  4P2Z A;  3E8B A;  2YK9 A;  4HAM A;  4LWF A;  5KA6 A;  4JAU A;  2QEX V;  2XDU A;  3LDC A;  1VQM V;  4XCJ A;  1ZWH A;  3SPI A;  4R50 A;  4ZBM A;  1SES A;  3CCM V;  1I5D A;  3OGC C;  3FKS G;  5LHI A;  1K97 A;  3R4M A;  3D36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...