4Q20A

Crystal structure of a c-terminal part of tyrosine kinase (divl) from caulobacter crescentus cb15 at 2.50 a resolution (psi community target, shapiro)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
233
structure length
231
Chain Sequence
ALADRSAALAEAERLKRDFVGNVSYELRTPLTTIIGYSELLERADSERGRNHVAAVRAAATQLARSIDDVLDMAQIDAGEMALEIEDIRVSDLLLNAQERALKDAQLGGVTLAVECEEDVGLIRGDGKRLAQTLDHLVENALRQTPPGGRVTLSARRALGEVRLDVSDTGRGVPFHVQAHIFDRFVGRDRGGPGLGLALVKALVELHGGWVALESEPGNGSTFTCHLPETQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein DivL
publication title Cell fate regulation governed by a repurposed bacterial histidine kinase.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Transferase
total genus 77
structure length 231
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4q20A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4q20A02
4EGIA 2QM8A 4L94A 3VHCA 3RKZA 3ZKDA 4XDMA 4EGKA 3H4LA 3LPSA 3P32A 3OMUA 1UYEA 2YK2A 1UY8A 4GQTA 4CWRA 4LWIA 4MBCA 4E02A 5FNCA 2YE4A 4PL9A 3T2SA 3ZRXA 1TIDA 2YEIA 4URNA 4V26A 4CE3A 3OWDA 4BIUA 5B1NA 3A0XA 2Q8FA 1H7SA 2XDUA 2XHXA 5J71A 5M4MA 5BOCA 4EFTA 3EHJA 1ZWHA 3EKRA 3OW6A 2BU6A 4PU9A 5D7DA 3TZ0A 1B63A 4HYPA 4LP0A 2CH4A 1YESA 2WERA 4K4OA 1Y8PA 4MPCA 4YKQA 2XHTA 1YT0A 4BQGA 2WI3A 3R4NA 4U7NA 2XJJA 1JM6A 5CPHA 3GIGB 3D36A 1OSFA 4XKAA 3B26A 5C93A 2O1VA 2BREA 4AWOA 4AS9A 2YKBA 2BU5A 4FCRA 4P8OA 4GT8A 2CCSA 2E0AA 4B7PA 4XCLA 4DZYA 1ZXMA 2WI5A 4ASAA 1UYHA 4URLA 3Q5JA 2WWWA 1YSRA 1BGQA 3WHAA 1NHHA 3G7BA 2H8MA 1UYLA 4MOTA 1JOYA 5IDJA 2WI4A 4MP2A 2FWZA 3HZ1A 1ZW9A 5M4PA 2BYHA 2XJXA 2YGAA 4FCQA 5M4HA 3TUHA 2BT0A 3A0WA 3VHDA 3HEKA 4EGHA 3C0EA 2YGFA 2YEFA 3R91A 2WEQA 2K5BA 2YEHA 4H7QA 2HG1A 1Z5AA 1I5AA 4L90A 3TTZA 1YC4A 2BU7A 1PVGA 3QTFA 4HY1A 4HY6A 1A4HA 3K97A 3ZCCA 2IOPA 2ESAA 1ZXNA 4XIRA 2PNRA 1TH8A 2XHRA 3HYZA 3CGZA 4L8ZA 4XKKA 5CTYA 4WUDA 3K99A 4KQVA 4KP4A 5FWKA 2YEAA 1GKZA 5B1OA 1MU5A 3BMYA 4XC0A 2YKEA 4O09A 3RLRA 4EEHA 4CWSA 2VCIA 2YKIA 4PRXA 3GIGA 4LWGA 5FNFA 4JYBA 3B27A 3GIEA 1Z5BA 3ZKBA 4EFUA 5IN9A 5M4EA 4KFGA 5D7RA 1YETA 5D6PA 3VHAA 2YE8A 2YEJA 2UWDA 2QM7A 2QG2A 2YJWA 3A0ZA 3TK1A 5CF0A 4GT1A 2FYPA 2XK2A 4XIPA 4ASFA 2YKJA 2YE9A 4GFNA 5M4KA 1BYQA 1L0OA 4R1FA 1I5DA 1Y8OA 1UYIA 4ZVIA 4O04A 3A0TA 1UYDA 1YERA 5CTUA 3FV5A 4W7TA 3QDDA 5D7CA 2YGEA 5BODA 3ZXQA 3Q5LA 3K98A 3NMQA 4U93A 1EA6A 1UY7A 3R4OA 5CTWA 2CGFA 3C11A 3T1KA 2WI7A 4MB9A 2IWXA 4JASA 1BKNA 4HXZA 1UYGA 1YC1A 2WI2A 4LPBA 3NXSA 3OPDA 2BU8A 2Q8HA 3DGEA 1Y8NA 2QG0A 4BXIA 2JKIA 1AJ6A 1US7A 2YI0A 2QFOA 2ZDXA 3TZ2A 2VCJA 1MX0A 1UYFA 4YKRA 2FTKA 1I5BA 1YS3A 4UROA 2CCUA 2XDLA 4FMTA 1AM1A 4XD8A 5J6AA 4MPEA 1BXDA 4CE1A 3EHHA 3B28A 2YEEA 1Z5CA 2BRCA 2O1UA 4V25A 2BZ5A 4I5SA 3A0RA 3FT8A 3Q5KA 3CRLA 4MP7A 1TC0A 2FWYA 4O05A 1EI1A 4DUHA 4HZ5A 1U2OA 4KTNA 4R3MA 1Y4SA 3ZXOA 2HKJA 2XD6A 2HCHA 1UY9A 2IWUA 1YC3A 2EXLA 4YKUA 4ASGA 4GEEA 4L91A 1B3QA 4PRVA 3K60A 4H81A 1GJVA 2C2AA 4XITA 4LWHA 2Q8IA 1I5CA 3FT5A 4NH8A 3T0ZA 3VADA 4JAVA 2Q8GA 2YE5A 2XX5A 4NH9A 2VWCA 3KE6A 4FPPA 1TBWA 1YSZA 2P67A 1KIJA 3CRKA 4MT8A 3R4PA 4EM7A 4JAUA 4H85A 3U2KA 3B25A 4YKTA 4HZ0A 2BU2A 2XDSA 3O0IA 2CG9A 2XJGA 3JZ3A 4E00A 4U7OA 2WI6A 2YEBA 4CWFA 2YJXA 2BTZA 5F5RA 1Z59A 3U67A 3TZ4A 1R62A 4CWOA 3O6OA 3WQ9A 4CWTA 4ZKIA 4URMA 3R4MA 4CWQA 4YKXA 1QYEA 3HYYA 4YKWA 1UYMA 3CGYA 4KSHA 3D2RA 3BM9A 2XCMA 1UY6A 4LWEA 4MPNA 2IOQA 1THNA 3GIFA 3EKOA 1H7UA 4ASBA 3G75A 1B62A 1ID0A 3H80A 3ZRWB 4XCJA 2O1WA 2Q2EB 3O2FA 3TZ5A 1U0ZA 3PEJA 1QY8A 4AWQA 2YECA 3INWA 1AH6A 1UYCA 1YT2A 5L3JA 4E01A 1GKXA 2XDKA 2ZDYA 2YI5A 2YE6A 2XDXA 2LFSA 2YEGA 4P7AA 1NHJA 2BYIA 1I59A 5IDMA 2FXSA 1YT1A 3B24A 5M4NA 1I58A 4X9LA 2H55A 3G7EA 3INXA 4B6CA 2ZKJA 2QF6A 3ZM7A 4YKYA 4CWPA 4QPJA 2ZBKB 1NHIA 4Q20A 4HYMA 4O07A 4CWNA 2YI7A 2JJCA 1AMWA 1TILA 4GGLA 3T0HA 2YK9A 1UYKA 4HXWA 1IXMA 5D6QA 3OWBA 5F3KA 4R3AA 1TC6A 2GQPA 4I3HA 4WUBA 2XX4A 2YE3A 4AWPA 4O0BA 4L93A 3U2DA 1KZNA 4XE2A 4LWFA 2BSMA 3LNUA 2YE7A 5CTXA 3RLQA 3R92A 4NH7A 3A0YA 3ZRVA 4JYCA 3HZ5A 4JQLA 1S14A 3HHUA 2XABA 2WI1A 4MTXA 2YI6A 4WUCA 3T10A 1S16A 2YE2A 3MNRP 3ZRWA 4KSGA 3PEHA 3SL2A 4FCPA 2IWSA 2VW5A 1Y4UA 2YEDA 3IEDA 2AKPA 3MD0A 1AH8A 4XIQA 4QPKA 1F51A 1QZRA 4BIZA 2XX2A 3RLPA 4EMVA 2YKCA 4CE2A 3EHFA 3D0BA 5GGZA 4LC1A 2GFDA 2LFRA 4GCZA 2WEPA 4XTJA 2CCTA 4BQJA 5FNDA 2IORA 3CWVA 4BAEA 4XKOA 4YKZA 3EHGA
chains in the Genus database with same CATH superfamily
2JJ1G 1VEWA 3IGAC 4L94A 5KA6A 1Q7YW 3KZIZ 4B3RB 1FAFA 2GUZB 4XDMA 2B9ZA 3H4LA 2XAGA 3EVKA 5CBFA 2HHHB 2WSSG 1DGSA 3EXAA 1HP8A 4O4HA 1N4CA 3FB8C 4GQTA 4MBCA 1MZFA 2YI8A 2YE4A 4PL9A 4P30A 2QDOA 4FLWA 1TIDA 2YEIA 4RQFA 4J9YB 3KG2A 4CE3A 3OTOB 2Q8FA 2QM4A 4GX2A 2XDUA 3B40A 3D3IA 4EFTA 3EHJA 1ZWHA 1NR7A 1QLNA 3APQA 3RYHA 3TZ0A 4DV7B 2CH4A 1RM1B 3QO5A 5J2TB 1N32B 1YESA 4GLXA 1XBLA 2IW5A 1D5NA 4YKQA 2P4VA 2XHTA 2RCVA 1YITV 1YT0A 2HKOA 4JI5O 3JCZA 4O4LA 4X20B 3TXSA 4PA9A 5LMUO 1AILA 3JD3A 4D7SA 1Z2GA 3AG2C 2IJKA 1FXKA 3LSUA 4AS9A 2VRZA 1PNMA 4IGGA 4DV3B 2E0AA 2VQEB 4XCLA 4DZYA 4ASAA 3CYGA 3WHAA 1PL4A 2DN9A 4TT3G 2IU0A 2UUBO 3G7BA 3UKMA 4FFBB 5LGTA 4MOTA 3ZHUA 5IDJA 1YTFD 1V55C 2ODMA 4X64O 4NTWA 1NTMH 2FWZA 1Z5WA 4HNAB 3LSSA 2BT0A 1E79G 3CXHF 1VMGA 1HWYA 3RW0A 3C0EA 1VQ8V 2AHYA 2ZIOA 1OCZB 1P84F 1R6TA 5JH7B 2CDYA 5AG2A 4DV2B 1R3KC 1PPJH 3F5WC 3UQ8A 2YEVB 2WEQA 2FL4A 3U0ZA 3LDDA 4B3RO 3N2KB 4L90A 3W7XA 5GTHZ 3IFXA 3ZN1A 4FLXA 1PV0A 3QTFA 4TQFA 2HHHO 4LF7B 4HY6A 4G28B 1XMOB 1F4MA 4KHPB 2JIZG 2PUSA 2Q7HA 5J2UA 1KBHA 4ICGA 2IOPA 2OCHA 2IM9A 3A0HZ 1P49A 4MTFA 2XHRA 4XKKA 2K9PA 4LFBB 1GTOA 3OTOO 1RPRA 1UPGA 1MU5A 5B1OA 4O09A 1N0JA 3QNEA 4QE7A 4WCEV 2QWNB 3JAWB 4DRXB 4BIOA 2V1DA 4DV7O 4LWGA 5FPOA 3E8GA 4JAAA 2YDEA 1N32O 1FKAO 1G6UA 1NT2B 4DR1B 1GN6A 1YSCA 3K5NA 3THOA 5IN9A 5L3FA 5IYZA 5JENA 3MAQA 4KFGA 4I0XB 3CC2V 4NTYA 2XUMA 4OGQB 1YETA 1PP9H 1L0LH 5EYPB 3SPIA 3BCCH 4HAMA 2YJWA 1QLEC 1GKFA 4XIPA 4I7ZB 5ITZB 4WF9V 2WLHA 4J41A 2YXHA 2E76B 2VQEO 1Y8OA 1BGYH 1XL4A 3AG2B 1UYIA 1AP6A 2V7QG 2F4VB 4O04A 1UYDA 3VQVA 3OMNB 3FV5A 5CTUA 3QO7A 2ZR3A 3QDDA 5D7CA 4IIJB 4UV9A 1Y4MA 1SA0A 4F6RA 5KHGA 3JSLA 3NMQA 1WP7A 1NTZH 2DQ0A 3R4OA 4YHHB 4DR7B 1AI6A 1S76D 1BT8A 4MVOA 3QF7A 4UVCA 4FIPC 2IWXA 1V55B 2OIGA 4JASA 5IYBO 1B04A 4DV2O 4MVUA 3J81N 1UYGA 4L87A 1H2MA 3CE2A 3E8FA 1S5HC 3DGEA 5A2QN 4LF7O 4BXIA 5D5PA 5TISZ 2H94A 1XMOO 4KHPO 1VQ5V 1MMMA 1WNSA 3HKDA 3DTUB 4J80A 4ZI7A 1MX0A 1XUQA 2ZNIA 2FTKA 1I5BA 1YS3A 1CXZB 2YI9A 3E83A 1IVSA 1RPOA 5BZBA 4FMTA 4LFBO 1F4NA 2ZT9B 2WLLB 3ZHVA 2QWOB 3B28A 5FL7G 2R70A 4X1YA 1Z5CA 2M6YA 3C90A 2EIKC 1D5AA 3APOA 5IYCO 1AI5A 4I5SA 2AXTZ 3CRLA 1TC0A 4DR1O 4O4IA 1HW7A 5DEDA 3K9AA 4O05A 3ASNC 4LNUB 5LA6A 1YC3A 1K8AW 4ZHQB 4L91A 1MOFA 3K60A 4O2AA 1GJVA 4CBCA 4LWHA 3FT5A 2ZIMA 4DUZB 1QLEB 3BA9A 2KG7B 4G2KA 5GONB 2Q8GA 2XASA 2F4VO 3KE6A 1TBWA 3D8CA 4X62B 2P67A 1RSOB 1FJGB 1R6NA 1KIJA 3AG4B 2JGDB 3FD9A 2Q0AA 3TXQA 1OCRC 2HG5C 3OEEG 4KL1A 4E2LA 2WA4A 4YHHO 1CPYA 1SESA 4DR7O 3SYQA 3T1YB 2XT9A 2XDSA 2E75B 1PM9A 3BA8A 1EBOA 2XAFA 3JCUZ 4W4KA 2IJIA 4E00A 4FLVA 2LGWA 5K1PA 4LWSA 2YEBA 1HNZB 4RWUA 3G80A 1BE3H 2YJXA 5CMUA 4UCRA 3E8HA 1KKDA 1Z59A 3IAYA 2E74B 1QQCA 3WQ9A 3JASA 1YHQV 1NH2B 4YKXA 5BMVB 4D7TA 1QYEA 2NLJC 4J11A 2RDCA 1UYMA 3CGYA 5L3GA 2L6LA 4W4LA 3D2RA 3RYCA 4D6TH 3GWOA 4LWEA 1S5JA 4CS4A 2Q7EA 1THNA 4ASBA 2P22C 1KMIZ 4YIOA 5F2VO 4MW8A 2ADQB 2JS3A 4JI1B 3TZ5A 4XDKA 2WLIB 1U0ZA 3ZBHA 3PEJA 1TA8A 4J10A 4JTCB 3FX7A 1M9NA 4R8CA 5C8YB 3INWA 2EIKB 5B1BC 4KUMA 2YI5A 2P4KA 1W0JG 5B66Z 2LFSA 4P7AA 2BYIA 3OFNG 1I59A 5IDMA 3B24A 3CYOA 1CEZA 2CTQA 1SQQH 3ASNB 4X9LA 3S5TA 3LMMA 4B6CA 4UVAA 1AI7A 4YKYA 5JVDB 4CWPA 4QE9A 1MA1A 1NHIA 3HKEB 1XOUA 2A3QA 2Q73A 2ZD9A 5LL6Y 3A2FA 1JPXA 4A5UB 5KX5A 2Q9LA 3E89A 2FB5A 4MTGA 5JCOA 1K9MW 3T0HA 3ABLC 4C7UA 1FJGO 3RT3C 1FFXB 1Q8IA 2GQPA 5KHJA 4FJCC 3G71V 2PGGA 3T1YO 1MSDA 4GUNA 5KA5A 1KZNA 3CJHA 4B3TB 4LWFA 2BSMA 1OCRB 1YZBA 1K7DA 2YE7A 2FKXA 1Y76A 5CTXA 1HNZO 2LW1A 4X88A 3A0YA 4JYCA 3RBZA 3HZ5A 3E8BA 2ILMA 3ZX6A 1JA8A 3A0BZ 5JQGB 2UXDB 2YI6A 4JTDB 1I5XA 3W7UA 2P90A 4LF6B 1BQZA 2CTPA 2ARHA 2DYSC 3OR7C 1AP5A 5LHIA 5B1AC 4P9OA 3RVZA 2VW5A 5CBHA 3FYEB 5L3BA 1Y4UA 2AKPA 1RP3B 1XMQB 4QPKA 3BFRA 4IHJB 3RLPA 5GGZA 4LC1A 2NR5A 4MVRA 2GFDA 4JI1O 1NH2D 5IJ0B 4GCZA 1BQ0A 4XTJA 2CCTA 1YDXA 4BQJA 5FNDA 1Q90D 2OCCB 4BAEA 4YKZA 3UO2A 2ZNJA 2CTRA 3RKZA 2XTAA 4TV8A 5KUMA 3P32A 5LP6C 1WAZA 5B1BB 3OMUA 4X66B 2YK2A 2K1EA 1UY8A 4PJ0Z 4E02A 4XDLA 3AK2A 4HZ3A 1CP9A 2ZXWC 4V26A 3WB2A 3K0DA 3JALB 4BIUA 1G4YB 5B1NA 4Z1VA 3UM7A 1SS3A 3JD1A 2PI5A 3W7WA 2XOKG 1H7SA 5DECA 3KCYA 1Q5OA 3AK3A 5M4MA 2PZSA 2QKAA 4H33A 2BU6A 4PU9A 1B63A 5IWAB 3CCMV 4WFAV 1VF6A 4K4OA 1Y8PA 4MPCA 2Y48A 5JJNB 3S3XA 1ENVA 4B3TO 1KP3A 4FLZA 4BQGA 3R4NA 1IZ3A 1KECA 2XJJA 3L74H 4JI3B 3GIGB 1OCCB 3D36A 3H01A 4PA4A 1PKXA 3JD0A 3VQXA 3WG7C 1AROP 5C93A 2BREA 2YKBA 2ZDIC 4U3JA 1VIBA 4P8OA 2UXDO 4GT8A 4B7PA 2VQFB 4LF6O 3UT5A 2CH7A 1FXHA 3LUTB 4O2BA 2RMKB 3CEIA 1UYHA 1WN7A 5EIBD 3E35A 3Q5JA 4URLA 4LR3A 2WWWA 1K34A 2JGUA 3CSXA 1N33B 4UFZA 1BGQA 4G27B 3SJBC 5IY5C 4CZZA 1J95A 1XMQO 4N21A 2H8MA 1UYLA 2DYSB 5B1AB 2WI4A 3I55V 4MP2A 3HZ1A 2GUZA 5M4PA 4JPRA 3R65A 2BYHA 5M4HA 4FCQA 3A0WA 2YGFA 2LJ2A 3IC7A 3OEHG 4QNHB 3C3TA 5JJJB 2Y4UA 3R91A 1GK9A 2P06A 2WLMA 1Z5AA 3ABKC 1I5AA 2Y69C 3B8MA 3TTZA 1YC4A 4I4TB 4K8XA 2BU7A 2ZM6B 3MDSA 4YJ2B 2UUAB 3K97A 1WB8A 1J5EB 3ZCCA 2OTLV 4IYHA 1M93A 2PNRA 4L8ZA 5J2TA 4I55B 1H2LA 2CE4A 5LP6B 4LF9B 1K73W 4WUDA 3OTFA 1XHXA 4KP4A 5FWKA 2YEAA 3WB0A 5LBQA 3OE7G 4EEHA 4X20A 2ZXWB 1M57C 1QU7A 5FNFA 5IWAO 3B27A 4GX0A 4NKGB 3ABMB 5KMGB 2ITDC 4WBNB 2WLJA 2IH3C 3S3WA 2EJRA 2JS5A 1WP8A 5LGNA 4JI4B 2UWDA 4DXWA 4JI3O 2QG2A 3TK1A 2ZCEA 2XK2A 3ZHTA 4CH4A 4ASFA 4FFBA 2YKJA 1WLEA 4EFBA 5M4KA 2VQFO 5K1XA 1ZL8B 4LH6A 3WG7B 2BTOA 2PYJA 4HNAA 1VARA 4FLTA 3G67A 3A0TA 1N36B 1YERA 3ZMSA 4W7TA 3JARB 4UB6Z 5JH7A 4UCTA 5CN0A 5CA0A 1LUWA 3BAAA 4B7KA 2YEVA 2A9HA 4B7EA 3K98A 1I94B 3RWRD 1EA6A 3N2KA 5IY5B 1ZWIC 1WA8B 3CCEV 1ZLZA 1HNXB 4RQEA 3C11A 2HJFC 3SJQC 2WI7A 1AI4A 2AW9A 2NN4A 2YICA 4LFCB 1BKNA 2OTJV 3OAAG 2WI2A 2HLDG 1G1XB 2BU8A 1YVWA 2ZM6O 1Y8NA 2UUAO 1AJ6A 2JEXA 1J5EO 1IBLB 3ABKB 2Y69B 3JAWA 3QVNA 4DRXA 4LBEC 4GX1A 4YKRA 3H1KH 4YY3B 3K57A 2IJJA 5KUKA 4LF9O 2ETNA 2CCUA 3RFRA 4PELA 3JD2A 1XL6A 2ADPA 2YIBD 4MPEA 4I0XA 1FYJA 4FK5C 2GBOA 3EHHA 1SF9A 2YEEA 2O1UA 3ETEA 1TUBB 3CHXA 4V25A 1H8EG 2ZE7A 5EYPA 1VQKV 3Q5KA 4PA3A 1KUQA 1BMFG 1M57B 2F95B 5ITZA 1IURA 1EI1A 3ZN0A 4HZ5A 1U2OA 4KTNA 2DOSA 4UCUA 2HCHA 3H1IH 1X4TA 4JI4O 4YKUA 4ASGA 1BS3A 4IIJA 4TUYB 3FB5C 3SYCA 2M7WA 3T0ZA 1R73A 2E3CA 1B06A 4FFKA 2YE5A 4NH9A 1N36O 2Z3YA 3K9SA 5LHGA 3R4PA 1K3EA 4EM7A 1I94O 4JF3A 4PD4F 4H0LB 2QKCA 3L9DA 3WB1A 1HNXO 5A9GA 2BU2A 5IJ9B 3CX5F 3O0IA 3BY6A 3HKBB 4J7ZA 4UV8A 3JZ3A 4LFCO 5FPRA 4U7OA 2WI6A 3AK1A 2ZQMA 2ZE6A 3OT7A 4MVZA 1Y74B 3OMIB 4PA7A 2Q69A 1BCCH 5E79Z 5JJEB 4DV3O 1KC8W 3O6OA 2WLLA 3SJCC 4CWTA 3ZEDA 4ZKIA 3AG4C 3FB7C 4URMA 3K5MA 4H37A 1IBLO 3G4SV 3RYFB 1GRJA 4UB8Z 3L71H 4YKWA 4YY3O 1HDJA 1K5QA 3HB3B 2LW7A 3RYIB 2XCMA 1FS0G 1IBKB 1VQ9V 4MPNA 5EZYB 3B77A 3CCJV 4LNUA 3EKOA 3GIFA 4FLYA 3G75A 1ID0A 4X89A 3ICXA 3ZRWB 3OGCC 1BHBA 1QBZA 4ZHQA 1Y66A 2VS0A 3RN4A 3HPLC 2PYLA 1GKXA 5LOVB 2YE6A 5IT9N 3VQYA 1VQOV 2YEGA 2KG7A 5GONA 1SQGA 4JYAB 5M4NA 5DN6G 3P30A 1G8MA 2ITCC 2B5UA 2ZKJA 2QF6A 3ZM7A 3SJAC 4UCOA 2F23A 2Q8VA 2JGDA 4AQYB 1TVKB 4FLUA 4DYLA 3K0GA 4Q20A 3OGIB 3DC5A 1SRYA 4QIWF 4R6ZA 1NJIW 3CCSV 3OR6C 3CRMA 5L3DA 1TILA 4DV4B 3TETA 1LUVA 2YK9A 5B5EZ 4YJ3B 5F3KA 5H6RA 4F6EA 3OWBA 4R3AA 1PL0A 3BABA 4GYCB 4I3HA 4WUBA 1L1FA 2YE3A 2W0FC 3J80N 4LFAB 1ROPA 4TV9B 5H2FZ 4JI7B 1NI8A 2CK3G 1JX9A 5BMVA 3RLQA 3T4ZA 4JQLA 2QWPB 2WI1A 4MTXA 2Z0AA 3I5DA 3T10A 4I9WA 3ZIAG 3P3PA 1XNQB 3MNRP 3M99B 4KSGA 4BR6A 3L73H 4EFEA 1Q86W 5LXTB 2IWSA 3SDLA 2WLIA 5C8YA 4XIQA 1I08A 1IBKO 5BR8B 5EIBC 1QZRA 3TCUA 4EMVA 1IBMB 1EFRG 3E22B 4MVMA 2YKCA 1V9PA 4FZ1A 1M90W 2UXCB 2LFRA 3MHSC 1LNQA 1NZ6A 2WEPA 3K79A 2ZKOA 2HHIA 5JVDA 1E1RG 1NKDA 3K5OA 2CGOA 3EHBB 3ZKDA 3HKEA 4O4JB 4EGKA 4DUYB 1R3IC 3DXRB 4JYAO 4H44B 4AI8A 4X65B 1JR9A 5E1AC 4CWRA 3T2SA 2EULA 5KAIZ 4PV1B 4AQYO 3FAVB 1FFXA 3ZRXA 4I50B 1O9HA 1Q6HA 2R9RB 4RUFA 3ASOC 5IE9A 2R72A 4LF8B 2YSUB 4OXSA 1ZSPA 2OCCC 2OIEA 4DV4O 4DR5B 2AZ0A 3P3NA 1Q82W 4FM1A 3OW6A 2HFEC 3CWBH 5D7DA 4HYPA 4LP0A 1BHAA 2HVKC 1P7BA 2N74A 2YIDA 4EEQA 2XNDG 2LP7A 3K03A 1VQNV 4RO2A 3SYPA 1Y67A 4EB6A 5JQGA 4X9QA 5IYDO 4LFAO 3RVYA 4JI7O 4P9PA 4CH6A 2WI3A 1EN6A 1MNGA 4RUEA 3IJ4A 5CPHA 3AG3C 3L72H 4FZ0A 2RQ6A 2O1VA 4DUZO 2D2CB 2ATKC 4FCRA 4IHJA 3T2MA 2CCSA 2BSKB 1ZXMA 1XNQO 2BOCC 2EZOA 2IJHA 2WI5A 3SPHA 1E1QG 3JATB 4WFGA 4X62O 4RAIA 1YSRA 5IJ0A 1NHHA 3ZHSA 2EINC 5BR8O 1FD9A 1IBMO 1OCCC 2UXBB 4LP8A 3J7AU 3MHHC 1ZW9A 3AG7A 2XJXA 2YGAA 2UXCO 5L3EA 3VHDA 2QE7G 1IX9A 4EGHA 5EBMC 1ORQC 2DWEC 4JZ2A 4B3SB 1QNMA 2Q0OC 2UXNA 4OPHA 4DR4B 1Q81W 4UXNA 1GMGA 2Q7GA 2K5BA 4H7QA 1MZEA 2HG1A 3JALA 4DUYO 1FPOA 1MG1A 1PVGA 2RNBA 4MS2A 4F4LA 4HY1A 1S77D 4GX5A 1JJOA 1A4HA 4X65O 1P7GA 2ESAA 1DF4A 1ZXNA 4XIRA 1R6KA 3CGZA 1FFTB 2C1IA 2BTQB 3CCQV 4KQVA 4LF8O 3M7MX 1H2SB 1GKZA 3LNNA 4XC0A 3DC6A 1U96A 2YXLA 1NQTA 4DR5O 3RLRA 4CWSA 4MSWC 4NXMB 4Z2WA 1NVPD 2VCIA 2YKIA 3ASOB 5EBWC 4J7JA 4DO2A 2OT5A 4DW0A 4PRXA 3GIGA 4B08A 4JYBA 1Z5BA 4EFUA 4Q6GA 4DV0B 2IH1C 2E5LB 1SETA 2JK5C 4X1KB 4MTOA 3VBBA 2UUCB 2YE8A 3VHAA 3Q4HB 1GN2A 1EN5A 1YCIA 2JRIA 1W0KG 1K4DC 3CB2A 3L70H 4GT1A 1OHHG 1JMKC 5CB4B 2IBZH 1JFFB 4WFFA 2YE9A 4WFEA 1BYQA 1OV9A 3STLC 1L0OA 3AG3B 4R1FA 1I5DA 2R9AA 4J9ZB 3ABMC 4ZVIA 4IL6Z 1JJ2U 2UU9B 2BOBC 3FB6C 1Q6UA 1BSMA 5BODA 3HR0A 3ZXQA 2EBOA 4PHZA 3K3WA 3Q5LA 2QSAA 4U93A 1YXBA 2UXBO 1UY7A 2YIBA 3K06A 3K59A 2WLNA 3ZMVA 4I4TA 2EINB 2CGFA 1JCHA 5KLVH 1I7FA 1TAEA 4YJ2A 4B3SO 1QCEA 4DR4O 4HXZA 1YC1A 1SQBH 2O57A 1GM9A 4J7KA 4I55A 4LPBA 4R50A 1K5SA 5LP6A 2H3OA 2EX3A 4X8AA 2Q8HA 2QG0A 5J9PC 1H2GA 2DE0X 1US7A 3JAKB 5FNVB 1UFIA 2QFOA 1KD1W 3CCVV 1UYFA 1O9GA 2EILC 4K35A 4ASUG 4UROA 1KYOF 2Q6AA 4PI0A 1AM1A 2XDLA 1R3JC 5J6AA 5KMGA 1M5IA 4WBNA 1BXDA 4HBNA 3AEIA 4MVQA 2WA3A 4CE1A 1I5YA 4ZOLB 1XI1A 4NXMO 2BRCA 1XILA 2BZ5A 3JAMN 1SQVH 2XHBA 2JVDA 4BWAA 2R9IA 4DV0O 2HP8A 2FWYA 1S3JA 2F43G 4NVPA 1M56C 2HJDA 5LYJB 2E5LO 3ZXOA 4AHCA 1K4CC 2UUCO 2HKJA 1ZL8A 2XD6A 1UY9A 1A32A 2YXYA 4JI5B 4X66O 2ZDIA 1AR1B 1MABG 2QWQB 1B3QA 3JARA 2A79B 4H81A 2KB1A 1VQPV 3SGIA 2Q8IA 4X1IB 4NH8A 1X59A 1WA8A 3O9OA 2QA4V 1YI2V 1Y6XA 2WAMA 4FPPA 4K8ZA 1PNLA 1YSZA 3ETGA 3LNMB 1EN4A 5CA1B 4CS3A 3CRKA 3B8NA 5HFMA 1H2NA 1TUEB 4H85A 3U2KA 3B25A 1U97A 4JI6B 3ETQA 3CRQA 3O65A 4HZ0A 2MW2B 2CG9A 2XJGA 1K97A 3STZC 4UVBA 1S72V 2GTAA 4CWFA 3ZHQA 2GHYA 2BTZA 3OUFA 3SYAA 3ZMTA 5F5RA 4PDRA 5FLXN 1AVMA 2HVJC 3U67A 3TZ4A 4CWOA 5KHHA 1FXKC 4NXNB 3AG1B 1N33O 1TUBA 3HYYA 3NR7A 3SR2C 1ZTEA 1OJHA 1GAXA 2Y4TA 1YEWA 1UY6A 1Q3EA 1GM7A 3N2GB 3KKYA 2IOQA 4L8JA 4PI2A 1GO3F 1H7UA 2EILB 2JDIG 1B62A 3B4SA 3H80A 1DK1A 4XCJA 4NYKA 2O1WA 1H2KA 2H8PC 5EBLC 2Q2EB 2A7WA 1KB9F 2HR3A 1QY8A 4AWQA 2DWDC 4TUYA 1AH6A 1UYCA 1VQ7V 2B1IA 3GVMA 3R66A 2Y0PA 2LO1A 4IYIA 3LDCA 3C3SA 3E86A 2PF4E 4U3FH 3HKCB 3BEHA 2FXSA 1AJNA 4JI8B 1I58A 1M56B 2H55A 3G7EA 1H38A 1NU1H 3OMAB 4BW5A 1KP2A 1AR5A 3VOUA 1M4UA 5JWPA 4JI0B 4I9QA 4HYMA 4O07A 3K08A 3E2EA 3N27A 5IJ9A 4JYYA 3HKBA 4JV5B 4O4HB 5BXZA 4CS2A 4TWKA 1UYKA 2W6JG 3CC7V 1IXMA 1TC6A 2AZ2A 2QR4A 3B09A 1Y74A 3QTCA 4CH5A 4TOIA 4JI6O 1XNRB 3U2DA 4YXWG 4TSFG 2F66C 2CUGA 3M8AA 5EC1C 2MK3A 4XE2A 2XAQA 5B3SC 5EK0A 3LNUA 4NR1A 3RYFA 3RYHB 1XREA 2HEPA 2N04A 3LSQA 3ZRVA 5CA0B 3T1CA 1LR1A 3CD6V 3RYIA 4IT5A 5KHIA 5EZYA 4WUCA 4Z1MG 1YJWV 2QTOA 4O4LB 4NXNO 2YE2A 3ZRWA 1UJWB 3K04A 1JQ0A 3CMAV 3SL2A 2C1GA 3MD0A 1FXKB 2PY5A 2OWOA 1F51A 5CA3A 2XX2A 5LOVA 2X6AA 2KKWA 2WPDG 3EHFA 2EZPA 1QVFU 2LQTA 3FKSG 3F5TA 4EKWA 1AJPA 2BCCH 4OPAA 1P4RA 1S5LZ 1S0VA 1PD3A 1AJQA 2IORA 3CWVA 2GV9A 3JSNA 3X2QC 5CBGA 1TVKA 4EGIA 2EJ7A 2QM8A 2P7TC 3VHCA 2EIMC 4FM0A 4KXRA 5LHHA 3LPSA 3OM3B 4LH7A 4JI8O 3EFFK 1UYEA 2FYUH 4UCSA 4YJ3A 4LWIA 1VQLV 5FNCA 1Q43A 2CGNA 4URNA 4JI0O 3UCSC 3ABUA 3OWDA 3A0XA 1AR4A 2KQXA 2JEUA 1IDSA 2XHXA 5J71A 4TV9A 5J2UB 4JV5O 2UXXA 5BOCA 3EKRA 4H13B 3T1HB 4YIPA 4JI2B 3U10A 2WERA 4GZRB 4FVMA 4DK0A 5LMNB 1XNRO 1Z5VA 2DMXA 2GSMB 2CAZC 1N8RW 4FM2A 1HR0B 4U7NA 1F7YA 3A8TA 1SERA 5LXTA 1EM1A 1JM6A 1RSOA 1OSFA 4XKAA 4ZBMA 3B26A 4KFMA 3H9VA 4AWOA 2F93B 5B3SB 3KCXA 3ZHRA 2BU5A 5IYZB 2DQ3A 3E22A 2VWJA 2YIAA 4JZGA 2ZR2A 1VP7A 2QTSA 1OCOC 1THZA 5GW7A 4DV1B 4J42A 4LF4B 3JD4A 1JOYA 4DR3B 3CP1A 4O4JA 2X6CA 4UCVA 1WPXA 1VQMV 3DXRA 3TUHA 2XAHA 4GKJB 3HEKA 1SZTA 2YEFA 1SA0B 2QKSA 4F6RB 3FAVA 4I50A 2YEHA 3G6BA 3W7SA 2Q68A 4LF5B 1NBMG 3X2QB 5HFLA 3SPJA 2YC0A 1RFYA 2AHZA 2EIMB 2FMLA 1QVGU 4CC5A 2XAJA 1TH8A 3HYZA 5CTYA 3QO8A 1WB7A 4JTAB 2KSDA 1ZAUA 3H1JH 3K99A 2N05A 4PDMA 3BMYA 3CXCU 2YKEA 1I0HA 3HKDB 3T1HO 2BE3A 1VF7A 1WJZA 1WPBA 4ZI7B 2X7RB 3GIEA 4JI2O 3ZKBA 2Q67A 2A06H 5KHKA 3H1HH 5DM6V 5LMNO 4E4EA 5M4EA 2BSKA 5D7RA 2ZINA 5D6PA 1HR0O 4X1YB 1NVPB 2YEJA 1D2DA 3JATA 2QM7A 3A0ZA 5CF0A 2JJ2G 2LGQA 4AILC 2FYPA 2G38A 3FFQA 4O4IB 4XBFA 4OX9B 4GFNA 3BRCA 5LA6B 3CCUV 1IXBA 4K3AA 5H5NA 4DW1A 3F7VC 4XDJA 4MVSA 2QWRB 2YGEA 4O2AB 4DV1O 4UUJC 5JCOC 1SC5B 5H9CA 4LF4O 3CC4V 3H1LH 4DR3O 2D3OW 5CTWA 1OCOB 2Q4PA 4LCUC 1K33A 4K0KB 2VWKA 1KU9A 4CH3A 4GKJO 3T1KA 4MB9A 3W7TA 3K58A 4DR2B 3OW2U 1QR9A 1EZVH 2CTWA 3SPCA 1Q6IA 2YS8A 2BTQA 1SQFA 2Z5UA 3NXSA 3OPDA 4PDVA 3SPGA 3ZS8C 4LF5O 2ZE8A 4N23A 1ZX3A 2JKIA 3WFVA 3D3QA 2P5OA 2YI0A 2ZDXA 4LWSB 1EZJA 3TZ2A 2X0LA 2VCJA 3CCRV 4XD8A 2W6IG 4GKKB 5BY1A 2RN9A 3JASB 4ZIBA 1GN4A 3JYCA 4X1KA 1OZ0A 3Q4HA 3TGUH 1BL8A 5GTIZ 3A0RA 3FT8A 3RYCB 1B6QA 4DV5B 4MP7A 4QJFB 5CB4A 1NR1A 3WU2Z 3T4DA 1JFFA 4DUHA 4R3MA 1R1BA 1Y4SA 2DW4A 1F23A 2IWUA 2EXLA 5L3CA 5D5QA 4GEEA 3ZMUA 4PRVA 4DR6B 2A0LA 1QHTA 2C2AA 3CRCA 3PJSK 4R7CA 4XITA 4OX9O 1I5CA 4B3MB 3BPZA 3VADA 4EB6B 1SQXH 4JAVA 2PI4A 1SQPH 2X6BA 1PNKA 1BZKA 2XX5A 2VWCA 3CMEV 3RGBA 1DF5A 2OYQA 2WLKA 4MT8A 3CPWU 3CCLV 1GM8A 4ABMA 4E72A 4JAUA 3TJTA 4DK1A 5KX5B 4YKTA 1ZUQA 1YJ9V 4K0KO 3OD4A 1VF6C 2PTMA 1V54C 3B2EE 3JAKA 5FNVA 1HNWB 4DR2O 3ZJZA 2AGAA 1DTOA 3GWKC 1XHZA 1GN3A 2QEXV 3DSQA 1XQ8A 3CRAA 2DYRC 1YF2A 3D36C 3ABTA 1N34B 1R62A 3CJHB 3BVOA 1R3LC 3R4MA 4CWQA 4ZOLA 3G6EV 1Y76B 2GDSA 4DV6B 1FXVA 2QGNA 4KSHA 3UO3A 3BM9A 3ZRSA 2EIJC 2W0XA 2Y0IA 1NTKH 4GKKO 5LYJA 3SYOA 1GH6A 3OUSA 3O2FA 4NTXA 1KKCA 3VQWA 4DV5O 2YECA 4TQDA 1YT2A 1W2BU 1YJNV 5L3JA 3AG1C 1COWG 1QR8A 3IC9A 4X1IA 3ZMZA 1VQ4V 2XDKA 2ZDYA 4E01A 5H6QA 1SKVA 3ABLB 3ETDA 2XDXA 1VF5B 1AB3A 1NHJA 1SZXA 3CS5A 1YT1A 2QJ1A 5LGUA 1K92A 5KAFZ 3INXA 2L35A 4DR6O 5CA1A 3ML0A 4QPJA 4B3MO 2ZBKB 1YIJV 2Q5ZA 3PN1A 3QG5A 4TV8B 3L75H 2P6JA 1RM1C 4BAYA 4CWNA 2YI7A 1XDCA 2JJCA 1AMWA 4GGLA 1H8HG 1TGOA 3F7YC 2IU3A 1M1KW 4MW3A 4HXWA 5D6QA 1URFA 4P2ZA 2XX4A 4AWPA 2GTSA 4O0BA 1L8DA 2NNUA 4L93A 4PDLA 1HNWO 1US6A 2DJVA 1W59A 1L0NH 2F1MA 3GB7C 5LMUB 1XEQA 3R92A 4NH7A 1MSWD 1V54B 3LDEA 1S14A 3FYIB 3HHUA 4PA6A 4CC6A 1YTFB 3N2GA 1N34O 2V4DA 2XABA 3I56V 3CRRA 1S16A 1KQSU 2UU9O 4JGSA 3PEHA 1T5EA 4DV6O 2DYRB 4FCPA 2YUAA 1N0NA 2RJZA 4HYOA 2YEDA 4WFHA 3IEDA 1AH8A 2UUBB 4U3JB 4NB5A 5EC2C 4BIZA 3BHPA 4X64B 1OCZC 4CE2A 3UT5B 2CH7B 3D0BA 4O2BB 3K5LA 1VQ6V 1NS1A 2EIJB 3HKCA 1DLBA 2B1GA 2ZE5A 4BW9A 1JVMA 4QGPA 4WFBV 4XKOA 3U11A 3EHGA
chains in the Genus database with same CATH topology
2JJ1G 3IGAC 4L94A 5KA6A 1Q7YW 4XDMA 3H4LA 2XAGA 5CBFA 2WSSG 3FB8C 4GQTA 4MBCA 2YE4A 4PL9A 4P30A 1TIDA 2YEIA 4RQFA 4J9YB 3KG2A 4CE3A 2Q8FA 2XDUA 4GX2A 3D3IA 4EFTA 3EHJA 1ZWHA 1NR7A 1QLNA 3TZ0A 2CH4A 1RM1B 3QO5A 1YESA 2IW5A 4YKQA 2XHTA 1YITV 1YT0A 2HKOA 3JCZA 4PA9A 3JD3A 3AG2C 2IJKA 1FXKA 4AS9A 1PNMA 2E0AA 4XCLA 4DZYA 4ASAA 3WHAA 4TT3G 2IU0A 3G7BA 3UKMA 5LGTA 4MOTA 5IDJA 1YTFD 1V55C 2FWZA 3LSSA 2BT0A 1E79G 3RW0A 1HWYA 3C0EA 1VQ8V 2AHYA 1OCZB 2YGFA 1R3KC 3F5WC 2YEVB 2WEQA 3LDDA 4L90A 3W7XA 3ZN1A 3IFXA 3QTFA 4HY6A 4G28B 1F4MA 2JIZG 2IOPA 2XHRA 4MTFA 4XKKA 1GTOA 1RPRA 1MU5A 5B1OA 4O09A 3QNEA 4QE7A 4WCEV 2V1DA 4LWGA 3E8GA 1YSCA 5IN9A 5L3FA 4KFGA 3CC2V 1YETA 3SPIA 4HAMA 2YJWA 1QLEC 1GKFA 4XIPA 4WF9V 2WLHA 1Y8OA 1XL4A 3AG2B 1UYIA 2V7QG 4O04A 1UYDA 5CTUA 3OMNB 3FV5A 3QO7A 2ZR3A 3QDDA 5D7CA 4UV9A 1Y4MA 3NMQA 2DQ0A 3R4OA 1AI6A 1S76D 4MVOA 4UVCA 4FIPC 2IWXA 1V55B 4JASA 5IYBO 4MVUA 1UYGA 4L87A 3E8FA 1S5HC 3DGEA 4BXIA 2H94A 1VQ5V 3DTUB 1MX0A 2FTKA 1I5BA 1YS3A 3E83A 1RPOA 5BZBA 4FMTA 1F4NA 2WLLB 3B28A 5FL7G 1Z5CA 2EIKC 5IYCO 1AI5A 4I5SA 3CRLA 1TC0A 3K9AA 4O05A 3ASNC 1YC3A 1K8AW 4L91A 1MOFA 3K60A 1GJVA 4CBCA 4LWHA 3FT5A 1QLEB 4G2KA 2Q8GA 2XASA 3KE6A 1TBWA 2P67A 1R6NA 1KIJA 3AG4B 1OCRC 2HG5C 3OEEG 4E2LA 1CPYA 1SESA 3SYQA 2XDSA 1EBOA 2XAFA 2IJIA 4E00A 2YEBA 2YJXA 5CMUA 3E8HA 1KKDA 1Z59A 3WQ9A 1YHQV 1NH2B 4YKXA 1QYEA 2NLJC 1UYMA 3CGYA 5L3GA 3D2RA 3GWOA 4LWEA 1THNA 4ASBA 4MW8A 3TZ5A 4XDKA 2WLIB 1U0ZA 3PEJA 4JTCB 1M9NA 4R8CA 3INWA 2EIKB 5B1BC 4KUMA 2YI5A 1W0JG 2LFSA 4P7AA 2BYIA 3OFNG 1I59A 5IDMA 3B24A 3CYOA 1CEZA 3ASNB 4X9LA 4B6CA 4UVAA 1AI7A 4YKYA 4CWPA 4QE9A 1NHIA 2ZD9A 1JPXA 3E89A 4MTGA 1K9MW 3T0HA 3ABLC 2GQPA 4FJCC 3G71V 5KA5A 1KZNA 4LWFA 2BSMA 1OCRB 1K7DA 2YE7A 5CTXA 4X88A 3A0YA 4JYCA 3RBZA 3HZ5A 3E8BA 2YI6A 4JTDB 1I5XA 3W7UA 2P90A 2DYSC 3OR7C 5LHIA 5B1AC 4P9OA 3RVZA 2VW5A 5CBHA 3FYEB 5L3BA 1Y4UA 2AKPA 4QPKA 3RLPA 5GGZA 4LC1A 2GFDA 4MVRA 1NH2D 4GCZA 4XTJA 2CCTA 4BQJA 5FNDA 4BAEA 2OCCB 4YKZA 3RKZA 5KUMA 3P32A 5B1BB 3OMUA 2YK2A 2K1EA 1UY8A 4E02A 4XDLA 4HZ3A 1CP9A 2ZXWC 4V26A 3K0DA 4BIUA 1G4YB 5B1NA 2PI5A 3UM7A 3JD1A 3W7WA 2XOKG 1H7SA 5M4MA 4H33A 2BU6A 4PU9A 1B63A 3CCMV 4WFAV 4K4OA 1Y8PA 4MPCA 2Y48A 1ENVA 1KP3A 4BQGA 3R4NA 1KECA 2XJJA 3GIGB 1OCCB 3D36A 3H01A 4PA4A 1PKXA 3JD0A 3WG7C 1AROP 5C93A 2BREA 2YKBA 2ZDIC 4P8OA 4GT8A 4B7PA 1FXHA 3LUTB 1UYHA 4URLA 3E35A 3Q5JA 2WWWA 1K34A 1BGQA 4G27B 5IY5C 4CZZA 1J95A 4N21A 2H8MA 1UYLA 2DYSB 5B1AB 2WI4A 3I55V 4MP2A 3HZ1A 5M4PA 4JPRA 3R65A 2BYHA 5M4HA 4FCQA 3A0WA 3IC7A 3OEHG 4QNHB 3R91A 1GK9A 2WLMA 1Z5AA 3ABKC 1I5AA 2Y69C 3B8MA 3TTZA 1YC4A 2BU7A 3K97A 3ZCCA 2OTLV 2PNRA 4L8ZA 1K73W 4WUDA 4KP4A 5FWKA 2YEAA 5LBQA 3OE7G 4EEHA 2ZXWB 1M57C 5FNFA 3B27A 4GX0A 3ABMB 2ITDC 2WLJA 2IH3C 2EJRA 5LGNA 2UWDA 4DXWA 2QG2A 3TK1A 2XK2A 4ASFA 2YKJA 1WLEA 5M4KA 3WG7B 3A0TA 1YERA 3ZMSA 4W7TA 5CN0A 2YEVA 2A9HA 3K98A 1EA6A 5IY5B 1ZWIC 3CCEV 4RQEA 3C11A 2HJFC 3SJQC 2WI7A 1AI4A 1BKNA 2OTJV 3OAAG 2WI2A 2HLDG 2BU8A 1Y8NA 1AJ6A 2JEXA 3ABKB 2Y69B 4LBEC 4GX1A 4YKRA 2IJJA 5KUKA 2CCUA 4PELA 3JD2A 1XL6A 4MPEA 4FK5C 3EHHA 2YEEA 2O1UA 3ETEA 4V25A 1H8EG 1VQKV 3Q5KA 4PA3A 1BMFG 1M57B 1EI1A 3ZN0A 4HZ5A 1U2OA 4KTNA 2HCHA 4YKUA 4ASGA 3FB5C 3SYCA 2M7WA 3T0ZA 1R73A 2YE5A 4NH9A 2Z3YA 5LHGA 3R4PA 1K3EA 4EM7A 4JF3A 2BU2A 3O0IA 3BY6A 4UV8A 3JZ3A 4U7OA 2WI6A 2ZQMA 4MVZA 3OMIB 4PA7A 2Q69A 1KC8W 3O6OA 2WLLA 4CWTA 4ZKIA 3AG4C 3FB7C 4URMA 4H37A 3G4SV 4YKWA 1K5QA 3HB3B 2XCMA 1FS0G 1VQ9V 4MPNA 3B77A 3CCJV 3GIFA 3EKOA 3G75A 1ID0A 4X89A 3ZRWB 3OGCC 1BHBA 1QBZA 1Y66A 3HPLC 1GKXA 2YE6A 1VQOV 2YEGA 5M4NA 5DN6G 3P30A 1G8MA 2ITCC 2B5UA 2ZKJA 2QF6A 3ZM7A 3K0GA 4Q20A 4R6ZA 4QIWF 1SRYA 1NJIW 3CCSV 3OR6C 5L3DA 1TILA 3TETA 2YK9A 5F3KA 5H6RA 3OWBA 4R3AA 1PL0A 4I3HA 4WUBA 1L1FA 2YE3A 2W0FC 1ROPA 2CK3G 1JX9A 3RLQA 3T4ZA 4JQLA 2WI1A 4MTXA 3T10A 4I9WA 3ZIAG 3MNRP 3M99B 4KSGA 1Q86W 2IWSA 2WLIA 4XIQA 1QZRA 3TCUA 4EMVA 1EFRG 2YKCA 4MVMA 1M90W 2LFRA 3MHSC 1LNQA 2WEPA 3K79A 1E1RG 1NKDA 3EHBB 3ZKDA 4EGKA 1R3IC 5E1AC 4CWRA 3T2SA 3ZRXA 2R9RB 4RUFA 3ASOC 2YSUB 4OXSA 2OCCC 1Q82W 3OW6A 2HFEC 5D7DA 4HYPA 4LP0A 1BHAA 2HVKC 1P7BA 2XNDG 2LP7A 3K03A 1VQNV 4RO2A 3SYPA 5IYDO 3RVYA 4P9PA 2WI3A 4RUEA 5CPHA 3AG3C 2O1VA 2ATKC 4FCRA 3T2MA 2CCSA 1ZXMA 2BOCC 2EZOA 2IJHA 2WI5A 3SPHA 1E1QG 4WFGA 4RAIA 1YSRA 1NHHA 2EINC 1OCCC 4LP8A 3MHHC 1ZW9A 2XJXA 2YGAA 5L3EA 3VHDA 2QE7G 4EGHA 5EBMC 1ORQC 2DWEC 2UXNA 1Q81W 4UXNA 1GMGA 2K5BA 4H7QA 2HG1A 1MG1A 1PVGA 4MS2A 4F4LA 4HY1A 1S77D 4GX5A 1A4HA 2ESAA 1DF4A 1ZXNA 4XIRA 1R6KA 3CGZA 1FFTB 3CCQV 4KQVA 1GKZA 4XC0A 1NQTA 3RLRA 4CWSA 4MSWC 2VCIA 1NVPD 2YKIA 3ASOB 5EBWC 4DO2A 2OT5A 4PRXA 3GIGA 4JYBA 1Z5BA 4EFUA 2IH1C 1SETA 2JK5C 3VHAA 4MTOA 3VBBA 2YE8A 1W0KG 1K4DC 4GT1A 1OHHG 4WFFA 2YE9A 4WFEA 1BYQA 1L0OA 3STLC 3AG3B 4R1FA 1I5DA 4J9ZB 3ABMC 4ZVIA 1JJ2U 2BOBC 3FB6C 5BODA 3ZXQA 2EBOA 3K3WA 3Q5LA 4U93A 1UY7A 3K06A 2WLNA 3ZMVA 2EINB 2CGFA 1JCHA 1QCEA 4HXZA 1YC1A 1GM9A 4LPBA 4R50A 1K5SA 4X8AA 2Q8HA 2QG0A 5J9PC 1H2GA 1US7A 2QFOA 1KD1W 3CCVV 1UYFA 2EILC 4ASUG 4UROA 2XDLA 2Q6AA 1AM1A 1R3JC 5J6AA 1BXDA 3AEIA 4MVQA 4CE1A 1I5YA 2BRCA 2BZ5A 2FWYA 2R9IA 1S3JA 2F43G 1M56C 3ZXOA 1K4CC 2HKJA 2XD6A 1UY9A 2ZDIA 1AR1B 1MABG 1B3QA 2A79B 4H81A 2KB1A 1VQPV 2Q8IA 4NH8A 2QA4V 1YI2V 2WAMA 4FPPA 1PNLA 1YSZA 3ETGA 3LNMB 3CRKA 3B8NA 5HFMA 1TUEB 4H85A 3U2KA 3B25A 4HZ0A 2CG9A 2XJGA 1K97A 3STZC 4UVBA 1S72V 4CWFA 2GHYA 2BTZA 3OUFA 3SYAA 3ZMTA 5F5RA 4PDRA 2HVJC 3U67A 3TZ4A 4CWOA 1FXKC 3AG1B 3HYYA 1UY6A 1GM7A 2IOQA 1GO3F 1H7UA 2EILB 2JDIG 1B62A 3H80A 4XCJA 2O1WA 5EBLC 2H8PC 2Q2EB 2HR3A 1QY8A 4AWQA 2DWDC 1AH6A 1UYCA 1VQ7V 2B1IA 3LDCA 3E86A 2FXSA 3BEHA 1AJNA 1I58A 1M56B 2H55A 3G7EA 1H38A 3OMAB 4BW5A 1KP2A 3VOUA 4HYMA 4O07A 3K08A 3E2EA 4TWKA 1UYKA 2W6JG 3CC7V 1IXMA 1TC6A 3U2DA 4YXWG 4TSFG 5EC1C 2MK3A 4XE2A 2XAQA 5B3SC 5EK0A 3LNUA 3LSQA 3ZRVA 3T1CA 3CD6V 4WUCA 4Z1MG 1YJWV 2QTOA 2YE2A 3ZRWA 1UJWB 3K04A 1JQ0A 3CMAV 3SL2A 3MD0A 1FXKB 1F51A 5CA3A 2XX2A 2X6AA 2WPDG 3EHFA 2EZPA 1QVFU 3FKSG 4EKWA 1AJPA 1P4RA 1S0VA 1PD3A 1AJQA 2IORA 3CWVA 3X2QC 5CBGA 4EGIA 2QM8A 2P7TC 3VHCA 2EIMC 5LHHA 3LPSA 3OM3B 3EFFK 1UYEA 4LWIA 1VQLV 5FNCA 4URNA 3ABUA 3OWDA 3A0XA 2JEUA 2XHXA 5J71A 5BOCA 2UXXA 3EKRA 2WERA 2GSMB 1N8RW 4U7NA 1SERA 1JM6A 1OSFA 4XKAA 4ZBMA 3B26A 4KFMA 4AWOA 5B3SB 2BU5A 2DQ3A 2ZR2A 1OCOC 1THZA 5GW7A 3JD4A 1JOYA 3CP1A 2X6CA 1WPXA 1VQMV 3TUHA 2XAHA 3HEKA 1SZTA 2YEFA 2QKSA 2YEHA 3W7SA 2Q68A 1NBMG 3X2QB 5HFLA 3SPJA 2AHZA 2EIMB 1QVGU 2XAJA 1TH8A 3HYZA 5CTYA 3QO8A 4JTAB 3K99A 4PDMA 3BMYA 3CXCU 2YKEA 2X7RB 3GIEA 3ZKBA 2Q67A 5DM6V 5M4EA 5D7RA 5D6PA 1NVPB 2YEJA 2QM7A 3A0ZA 5CF0A 2JJ2G 2FYPA 4XBFA 4GFNA 3CCUV 3F7VC 4XDJA 4MVSA 2YGEA 4UUJC 5H9CA 3CC4V 2D3OW 5CTWA 1OCOB 4LCUC 1K33A 3T1KA 4MB9A 3W7TA 3OW2U 1QR9A 3SPCA 2Z5UA 3NXSA 3OPDA 4PDVA 3SPGA 4N23A 2JKIA 3WFVA 2YI0A 2ZDXA 1EZJA 3TZ2A 2X0LA 2VCJA 3CCRV 4XD8A 2W6IG 3JYCA 1OZ0A 1BL8A 3A0RA 3FT8A 1B6QA 4MP7A 4QJFB 1NR1A 3T4DA 4DUHA 4R3MA 1Y4SA 2DW4A 1F23A 2IWUA 2EXLA 5L3CA 4GEEA 3ZMUA 4PRVA 2A0LA 3PJSK 2C2AA 4R7CA 4XITA 1I5CA 3VADA 4JAVA 2PI4A 2X6BA 1PNKA 2XX5A 2VWCA 3CMEV 1DF5A 2WLKA 4MT8A 3CPWU 3CCLV 1GM8A 4JAUA 4YKTA 1YJ9V 1V54C 3ZJZA 1DTOA 2QEXV 2DYRC 1R62A 3ABTA 1R3LC 3R4MA 4CWQA 3G6EV 1FXVA 4KSHA 3BM9A 3ZRSA 2EIJC 3SYOA 3OUSA 3O2FA 2YECA 1YT2A 1W2BU 5L3JA 1YJNV 3AG1C 1COWG 4E01A 1QR8A 1VQ4V 3ZMZA 2XDKA 2ZDYA 5H6QA 3ABLB 3ETDA 2XDXA 1NHJA 1YT1A 5LGUA 1K92A 3INXA 3ML0A 4QPJA 2ZBKB 1YIJV 2P6JA 4CWNA 4BAYA 1RM1C 2YI7A 2JJCA 1AMWA 4GGLA 1H8HG 3F7YC 2IU3A 1M1KW 4MW3A 4HXWA 5D6QA 4P2ZA 2XX4A 4AWPA 4O0BA 2NNUA 4L93A 4PDLA 3GB7C 3R92A 4NH7A 1MSWD 1V54B 3LDEA 1S14A 3FYIB 3HHUA 4PA6A 1YTFB 2XABA 3I56V 1S16A 1KQSU 4JGSA 3PEHA 2DYRB 4FCPA 4HYOA 2YEDA 4WFHA 3IEDA 1AH8A 5EC2C 4BIZA 1OCZC 4CE2A 3D0BA 1VQ6V 2EIJB 1DLBA 2B1GA 1JVMA 4WFBV 4XKOA 3EHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EGI A;  2QM8 A;  4L94 A;  3VHC A;  3RKZ A;  3ZKD A;  4XDM A;  4EGK A;  3H4L A;  3LPS A;  3P32 A;  3OMU A;  1UYE A;  2YK2 A;  1UY8 A;  4GQT A;  4CWR A;  4LWI A;  4MBC A;  4E02 A;  5FNC A;  2YE4 A;  4PL9 A;  3T2S A;  3ZRX A;  1TID A;  2YEI A;  4URN A;  4V26 A;  4CE3 A;  3OWD A;  4BIU A;  5B1N A;  3A0X A;  2Q8F A;  1H7S A;  2XDU A;  2XHX A;  5J71 A;  5M4M A;  5BOC A;  4EFT A;  3EHJ A;  1ZWH A;  3EKR A;  3OW6 A;  2BU6 A;  4PU9 A;  5D7D A;  3TZ0 A;  1B63 A;  4HYP A;  4LP0 A;  2CH4 A;  1YES A;  2WER A;  4K4O A;  1Y8P A;  4MPC A;  4YKQ A;  2XHT A;  1YT0 A;  4BQG A;  2WI3 A;  3R4N A;  4U7N A;  2XJJ A;  1JM6 A;  5CPH A;  3GIG B;  3D36 A;  1OSF A;  4XKA A;  3B26 A;  5C93 A;  2O1V A;  2BRE A;  4AWO A;  4AS9 A;  2YKB A;  2BU5 A;  4FCR A;  4P8O A;  4GT8 A;  2CCS A;  2E0A A;  4B7P A;  4XCL A;  4DZY A;  1ZXM A;  2WI5 A;  4ASA A;  1UYH A;  4URL A;  3Q5J A;  2WWW A;  1YSR A;  1BGQ A;  3WHA A;  1NHH A;  3G7B A;  2H8M A;  1UYL A;  4MOT A;  1JOY A;  5IDJ A;  2WI4 A;  4MP2 A;  2FWZ A;  3HZ1 A;  1ZW9 A;  5M4P A;  2BYH A;  2XJX A;  2YGA A;  4FCQ A;  5M4H A;  3TUH A;  2BT0 A;  3A0W A;  3VHD A;  3HEK A;  4EGH A;  3C0E A;  2YGF A;  2YEF A;  3R91 A;  2WEQ A;  2K5B A;  2YEH A;  4H7Q A;  2HG1 A;  1Z5A A;  1I5A A;  4L90 A;  3TTZ A;  1YC4 A;  2BU7 A;  1PVG A;  3QTF A;  4HY1 A;  4HY6 A;  1A4H A;  3K97 A;  3ZCC A;  2IOP A;  2ESA A;  1ZXN A;  4XIR A;  2PNR A;  1TH8 A;  2XHR A;  3HYZ A;  3CGZ A;  4L8Z A;  4XKK A;  5CTY A;  4WUD A;  3K99 A;  4KQV A;  4KP4 A;  5FWK A;  2YEA A;  1GKZ A;  5B1O A;  1MU5 A;  3BMY A;  4XC0 A;  2YKE A;  4O09 A;  3RLR A;  4EEH A;  4CWS A;  2VCI A;  2YKI A;  4PRX A;  3GIG A;  4LWG A;  5FNF A;  4JYB A;  3B27 A;  3GIE A;  1Z5B A;  3ZKB A;  4EFU A;  5IN9 A;  5M4E A;  4KFG A;  5D7R A;  1YET A;  5D6P A;  3VHA A;  2YE8 A;  2YEJ A;  2UWD A;  2QM7 A;  2QG2 A;  2YJW A;  3A0Z A;  3TK1 A;  5CF0 A;  4GT1 A;  2FYP A;  2XK2 A;  4XIP A;  4ASF A;  2YKJ A;  2YE9 A;  4GFN A;  5M4K A;  1BYQ A;  1L0O A;  4R1F A;  1I5D A;  1Y8O A;  1UYI A;  4ZVI A;  4O04 A;  3A0T A;  1UYD A;  1YER A;  5CTU A;  3FV5 A;  4W7T A;  3QDD A;  5D7C A;  2YGE A;  5BOD A;  3ZXQ A;  3Q5L A;  3K98 A;  3NMQ A;  4U93 A;  1EA6 A;  1UY7 A;  3R4O A;  5CTW A;  2CGF A;  3C11 A;  3T1K A;  2WI7 A;  4MB9 A;  2IWX A;  4JAS A;  1BKN A;  4HXZ A;  1UYG A;  1YC1 A;  2WI2 A;  4LPB A;  3NXS A;  3OPD A;  2BU8 A;  2Q8H A;  3DGE A;  1Y8N A;  2QG0 A;  4BXI A;  2JKI A;  1AJ6 A;  1US7 A;  2YI0 A;  2QFO A;  2ZDX A;  3TZ2 A;  2VCJ A;  1MX0 A;  1UYF A;  4YKR A;  2FTK A;  1I5B A;  1YS3 A;  4URO A;  2CCU A;  2XDL A;  4FMT A;  1AM1 A;  4XD8 A;  5J6A A;  4MPE A;  1BXD A;  4CE1 A;  3EHH A;  3B28 A;  2YEE A;  1Z5C A;  2BRC A;  2O1U A;  4V25 A;  2BZ5 A;  4I5S A;  3A0R A;  3FT8 A;  3Q5K A;  3CRL A;  4MP7 A;  1TC0 A;  2FWY A;  4O05 A;  1EI1 A;  4DUH A;  4HZ5 A;  1U2O A;  4KTN A;  4R3M A;  1Y4S A;  3ZXO A;  2HKJ A;  2XD6 A;  2HCH A;  1UY9 A;  2IWU A;  1YC3 A;  2EXL A;  4YKU A;  4ASG A;  4GEE A;  4L91 A;  1B3Q A;  4PRV A;  3K60 A;  4H81 A;  1GJV A;  2C2A A;  4XIT A;  4LWH A;  2Q8I A;  1I5C A;  3FT5 A;  4NH8 A;  3T0Z A;  3VAD A;  4JAV A;  2Q8G A;  2YE5 A;  2XX5 A;  4NH9 A;  2VWC A;  3KE6 A;  4FPP A;  1TBW A;  1YSZ A;  2P67 A;  1KIJ A;  3CRK A;  4MT8 A;  3R4P A;  4EM7 A;  4JAU A;  4H85 A;  3U2K A;  3B25 A;  4YKT A;  4HZ0 A;  2BU2 A;  2XDS A;  3O0I A;  2CG9 A;  2XJG A;  3JZ3 A;  4E00 A;  4U7O A;  2WI6 A;  2YEB A;  4CWF A;  2YJX A;  2BTZ A;  5F5R A;  1Z59 A;  3U67 A;  3TZ4 A;  1R62 A;  4CWO A;  3O6O A;  3WQ9 A;  4CWT A;  4ZKI A;  4URM A;  3R4M A;  4CWQ A;  4YKX A;  1QYE A;  3HYY A;  4YKW A;  1UYM A;  3CGY A;  4KSH A;  3D2R A;  3BM9 A;  2XCM A;  1UY6 A;  4LWE A;  4MPN A;  2IOQ A;  1THN A;  3GIF A;  3EKO A;  1H7U A;  4ASB A;  3G75 A;  1B62 A;  1ID0 A;  3H80 A;  3ZRW B;  4XCJ A;  2O1W A;  2Q2E B;  3O2F A;  3TZ5 A;  1U0Z A;  3PEJ A;  1QY8 A;  4AWQ A;  2YEC A;  3INW A;  1AH6 A;  1UYC A;  1YT2 A;  5L3J A;  4E01 A;  1GKX A;  2XDK A;  2ZDY A;  2YI5 A;  2YE6 A;  2XDX A;  2LFS A;  2YEG A;  4P7A A;  1NHJ A;  2BYI A;  1I59 A;  5IDM A;  2FXS A;  1YT1 A;  3B24 A;  5M4N A;  1I58 A;  4X9L A;  2H55 A;  3G7E A;  3INX A;  4B6C A;  2ZKJ A;  2QF6 A;  3ZM7 A;  4YKY A;  4CWP A;  4QPJ A;  2ZBK B;  1NHI A;  4Q20 A;  4HYM A;  4O07 A;  4CWN A;  2YI7 A;  2JJC A;  1AMW A;  1TIL A;  4GGL A;  3T0H A;  2YK9 A;  1UYK A;  4HXW A;  1IXM A;  5D6Q A;  3OWB A;  5F3K A;  4R3A A;  1TC6 A;  2GQP A;  4I3H A;  4WUB A;  2XX4 A;  2YE3 A;  4AWP A;  4O0B A;  4L93 A;  3U2D A;  1KZN A;  4XE2 A;  4LWF A;  2BSM A;  3LNU A;  2YE7 A;  5CTX A;  3RLQ A;  3R92 A;  4NH7 A;  3A0Y A;  3ZRV A;  4JYC A;  3HZ5 A;  4JQL A;  1S14 A;  3HHU A;  2XAB A;  2WI1 A;  4MTX A;  2YI6 A;  4WUC A;  3T10 A;  1S16 A;  2YE2 A;  3MNR P;  3ZRW A;  4KSG A;  3PEH A;  3SL2 A;  4FCP A;  2IWS A;  2VW5 A;  1Y4U A;  2YED A;  3IED A;  2AKP A;  3MD0 A;  1AH8 A;  4XIQ A;  4QPK A;  1F51 A;  1QZR A;  4BIZ A;  2XX2 A;  3RLP A;  4EMV A;  2YKC A;  4CE2 A;  3EHF A;  3D0B A;  5GGZ A;  4LC1 A;  2GFD A;  2LFR A;  4GCZ A;  2WEP A;  4XTJ A;  2CCT A;  4BQJ A;  5FND A;  2IOR A;  3CWV A;  4BAE A;  4XKO A;  4YKZ A;  3EHG A; 
#chains in the Genus database with same CATH topology
 2JJ1 G;  1VEW A;  3IGA C;  4L94 A;  5KA6 A;  1Q7Y W;  3KZI Z;  4B3R B;  1FAF A;  2GUZ B;  4XDM A;  2B9Z A;  3H4L A;  2XAG A;  3EVK A;  5CBF A;  2HHH B;  2WSS G;  1DGS A;  3EXA A;  1HP8 A;  4O4H A;  1N4C A;  3FB8 C;  4GQT A;  4MBC A;  1MZF A;  2YI8 A;  2YE4 A;  4PL9 A;  4P30 A;  2QDO A;  4FLW A;  1TID A;  2YEI A;  4RQF A;  4J9Y B;  3KG2 A;  4CE3 A;  3OTO B;  2Q8F A;  2QM4 A;  4GX2 A;  2XDU A;  3B40 A;  3D3I A;  4EFT A;  3EHJ A;  1ZWH A;  1NR7 A;  1QLN A;  3APQ A;  3RYH A;  3TZ0 A;  4DV7 B;  2CH4 A;  1RM1 B;  3QO5 A;  5J2T B;  1N32 B;  1YES A;  4GLX A;  1XBL A;  2IW5 A;  1D5N A;  4YKQ A;  2P4V A;  2XHT A;  2RCV A;  1YIT V;  1YT0 A;  2HKO A;  4JI5 O;  3JCZ A;  4O4L A;  4X20 B;  3TXS A;  4PA9 A;  5LMU O;  1AIL A;  3JD3 A;  4D7S A;  1Z2G A;  3AG2 C;  2IJK A;  1FXK A;  3LSU A;  4AS9 A;  2VRZ A;  1PNM A;  4IGG A;  4DV3 B;  2E0A A;  2VQE B;  4XCL A;  4DZY A;  4ASA A;  3CYG A;  3WHA A;  1PL4 A;  2DN9 A;  4TT3 G;  2IU0 A;  2UUB O;  3G7B A;  3UKM A;  4FFB B;  5LGT A;  4MOT A;  3ZHU A;  5IDJ A;  1YTF D;  1V55 C;  2ODM A;  4X64 O;  4NTW A;  1NTM H;  2FWZ A;  1Z5W A;  4HNA B;  3LSS A;  2BT0 A;  1E79 G;  3CXH F;  1VMG A;  1HWY A;  3RW0 A;  3C0E A;  1VQ8 V;  2AHY A;  2ZIO A;  1OCZ B;  1P84 F;  1R6T A;  5JH7 B;  2CDY A;  5AG2 A;  4DV2 B;  1R3K C;  1PPJ H;  3F5W C;  3UQ8 A;  2YEV B;  2WEQ A;  2FL4 A;  3U0Z A;  3LDD A;  4B3R O;  3N2K B;  4L90 A;  3W7X A;  5GTH Z;  3IFX A;  3ZN1 A;  4FLX A;  1PV0 A;  3QTF A;  4TQF A;  2HHH O;  4LF7 B;  4HY6 A;  4G28 B;  1XMO B;  1F4M A;  4KHP B;  2JIZ G;  2PUS A;  2Q7H A;  5J2U A;  1KBH A;  4ICG A;  2IOP A;  2OCH A;  2IM9 A;  3A0H Z;  1P49 A;  4MTF A;  2XHR A;  4XKK A;  2K9P A;  4LFB B;  1GTO A;  3OTO O;  1RPR A;  1UPG A;  1MU5 A;  5B1O A;  4O09 A;  1N0J A;  3QNE A;  4QE7 A;  4WCE V;  2QWN B;  3JAW B;  4DRX B;  4BIO A;  2V1D A;  4DV7 O;  4LWG A;  5FPO A;  3E8G A;  4JAA A;  2YDE A;  1N32 O;  1FKA O;  1G6U A;  1NT2 B;  4DR1 B;  1GN6 A;  1YSC A;  3K5N A;  3THO A;  5IN9 A;  5L3F A;  5IYZ A;  5JEN A;  3MAQ A;  4KFG A;  4I0X B;  3CC2 V;  4NTY A;  2XUM A;  4OGQ B;  1YET A;  1PP9 H;  1L0L H;  5EYP B;  3SPI A;  3BCC H;  4HAM A;  2YJW A;  1QLE C;  1GKF A;  4XIP A;  4I7Z B;  5ITZ B;  4WF9 V;  2WLH A;  4J41 A;  2YXH A;  2E76 B;  2VQE O;  1Y8O A;  1BGY H;  1XL4 A;  3AG2 B;  1UYI A;  1AP6 A;  2V7Q G;  2F4V B;  4O04 A;  1UYD A;  3VQV A;  3OMN B;  3FV5 A;  5CTU A;  3QO7 A;  2ZR3 A;  3QDD A;  5D7C A;  4IIJ B;  4UV9 A;  1Y4M A;  1SA0 A;  4F6R A;  5KHG A;  3JSL A;  3NMQ A;  1WP7 A;  1NTZ H;  2DQ0 A;  3R4O A;  4YHH B;  4DR7 B;  1AI6 A;  1S76 D;  1BT8 A;  4MVO A;  3QF7 A;  4UVC A;  4FIP C;  2IWX A;  1V55 B;  2OIG A;  4JAS A;  5IYB O;  1B04 A;  4DV2 O;  4MVU A;  3J81 N;  1UYG A;  4L87 A;  1H2M A;  3CE2 A;  3E8F A;  1S5H C;  3DGE A;  5A2Q N;  4LF7 O;  4BXI A;  5D5P A;  5TIS Z;  2H94 A;  1XMO O;  4KHP O;  1VQ5 V;  1MMM A;  1WNS A;  3HKD A;  3DTU B;  4J80 A;  4ZI7 A;  1MX0 A;  1XUQ A;  2ZNI A;  2FTK A;  1I5B A;  1YS3 A;  1CXZ B;  2YI9 A;  3E83 A;  1IVS A;  1RPO A;  5BZB A;  4FMT A;  4LFB O;  1F4N A;  2ZT9 B;  2WLL B;  3ZHV A;  2QWO B;  3B28 A;  5FL7 G;  2R70 A;  4X1Y A;  1Z5C A;  2M6Y A;  3C90 A;  2EIK C;  1D5A A;  3APO A;  5IYC O;  1AI5 A;  4I5S A;  2AXT Z;  3CRL A;  1TC0 A;  4DR1 O;  4O4I A;  1HW7 A;  5DED A;  3K9A A;  4O05 A;  3ASN C;  4LNU B;  5LA6 A;  1YC3 A;  1K8A W;  4ZHQ B;  4L91 A;  1MOF A;  3K60 A;  4O2A A;  1GJV A;  4CBC A;  4LWH A;  3FT5 A;  2ZIM A;  4DUZ B;  1QLE B;  3BA9 A;  2KG7 B;  4G2K A;  5GON B;  2Q8G A;  2XAS A;  2F4V O;  3KE6 A;  1TBW A;  3D8C A;  4X62 B;  2P67 A;  1RSO B;  1FJG B;  1R6N A;  1KIJ A;  3AG4 B;  2JGD B;  3FD9 A;  2Q0A A;  3TXQ A;  1OCR C;  2HG5 C;  3OEE G;  4KL1 A;  4E2L A;  2WA4 A;  4YHH O;  1CPY A;  1SES A;  4DR7 O;  3SYQ A;  3T1Y B;  2XT9 A;  2XDS A;  2E75 B;  1PM9 A;  3BA8 A;  1EBO A;  2XAF A;  3JCU Z;  4W4K A;  2IJI A;  4E00 A;  4FLV A;  2LGW A;  5K1P A;  4LWS A;  2YEB A;  1HNZ B;  4RWU A;  3G80 A;  1BE3 H;  2YJX A;  5CMU A;  4UCR A;  3E8H A;  1KKD A;  1Z59 A;  3IAY A;  2E74 B;  1QQC A;  3WQ9 A;  3JAS A;  1YHQ V;  1NH2 B;  4YKX A;  5BMV B;  4D7T A;  1QYE A;  2NLJ C;  4J11 A;  2RDC A;  1UYM A;  3CGY A;  5L3G A;  2L6L A;  4W4L A;  3D2R A;  3RYC A;  4D6T H;  3GWO A;  4LWE A;  1S5J A;  4CS4 A;  2Q7E A;  1THN A;  4ASB A;  2P22 C;  1KMI Z;  4YIO A;  5F2V O;  4MW8 A;  2ADQ B;  2JS3 A;  4JI1 B;  3TZ5 A;  4XDK A;  2WLI B;  1U0Z A;  3ZBH A;  3PEJ A;  1TA8 A;  4J10 A;  4JTC B;  3FX7 A;  1M9N A;  4R8C A;  5C8Y B;  3INW A;  2EIK B;  5B1B C;  4KUM A;  2YI5 A;  2P4K A;  1W0J G;  5B66 Z;  2LFS A;  4P7A A;  2BYI A;  3OFN G;  1I59 A;  5IDM A;  3B24 A;  3CYO A;  1CEZ A;  2CTQ A;  1SQQ H;  3ASN B;  4X9L A;  3S5T A;  3LMM A;  4B6C A;  4UVA A;  1AI7 A;  4YKY A;  5JVD B;  4CWP A;  4QE9 A;  1MA1 A;  1NHI A;  3HKE B;  1XOU A;  2A3Q A;  2Q73 A;  2ZD9 A;  5LL6 Y;  3A2F A;  1JPX A;  4A5U B;  5KX5 A;  2Q9L A;  3E89 A;  2FB5 A;  4MTG A;  5JCO A;  1K9M W;  3T0H A;  3ABL C;  4C7U A;  1FJG O;  3RT3 C;  1FFX B;  1Q8I A;  2GQP A;  5KHJ A;  4FJC C;  3G71 V;  2PGG A;  3T1Y O;  1MSD A;  4GUN A;  5KA5 A;  1KZN A;  3CJH A;  4B3T B;  4LWF A;  2BSM A;  1OCR B;  1YZB A;  1K7D A;  2YE7 A;  2FKX A;  1Y76 A;  5CTX A;  1HNZ O;  2LW1 A;  4X88 A;  3A0Y A;  4JYC A;  3RBZ A;  3HZ5 A;  3E8B A;  2ILM A;  3ZX6 A;  1JA8 A;  3A0B Z;  5JQG B;  2UXD B;  2YI6 A;  4JTD B;  1I5X A;  3W7U A;  2P90 A;  4LF6 B;  1BQZ A;  2CTP A;  2ARH A;  2DYS C;  3OR7 C;  1AP5 A;  5LHI A;  5B1A C;  4P9O A;  3RVZ A;  2VW5 A;  5CBH A;  3FYE B;  5L3B A;  1Y4U A;  2AKP A;  1RP3 B;  1XMQ B;  4QPK A;  3BFR A;  4IHJ B;  3RLP A;  5GGZ A;  4LC1 A;  2NR5 A;  4MVR A;  2GFD A;  4JI1 O;  1NH2 D;  5IJ0 B;  4GCZ A;  1BQ0 A;  4XTJ A;  2CCT A;  1YDX A;  4BQJ A;  5FND A;  1Q90 D;  2OCC B;  4BAE A;  4YKZ A;  3UO2 A;  2ZNJ A;  2CTR A;  3RKZ A;  2XTA A;  4TV8 A;  5KUM A;  3P32 A;  5LP6 C;  1WAZ A;  5B1B B;  3OMU A;  4X66 B;  2YK2 A;  2K1E A;  1UY8 A;  4PJ0 Z;  4E02 A;  4XDL A;  3AK2 A;  4HZ3 A;  1CP9 A;  2ZXW C;  4V26 A;  3WB2 A;  3K0D A;  3JAL B;  4BIU A;  1G4Y B;  5B1N A;  4Z1V A;  3UM7 A;  1SS3 A;  3JD1 A;  2PI5 A;  3W7W A;  2XOK G;  1H7S A;  5DEC A;  3KCY A;  1Q5O A;  3AK3 A;  5M4M A;  2PZS A;  2QKA A;  4H33 A;  2BU6 A;  4PU9 A;  1B63 A;  5IWA B;  3CCM V;  4WFA V;  1VF6 A;  4K4O A;  1Y8P A;  4MPC A;  2Y48 A;  5JJN B;  3S3X A;  1ENV A;  4B3T O;  1KP3 A;  4FLZ A;  4BQG A;  3R4N A;  1IZ3 A;  1KEC A;  2XJJ A;  3L74 H;  4JI3 B;  3GIG B;  1OCC B;  3D36 A;  3H01 A;  4PA4 A;  1PKX A;  3JD0 A;  3VQX A;  3WG7 C;  1ARO P;  5C93 A;  2BRE A;  2YKB A;  2ZDI C;  4U3J A;  1VIB A;  4P8O A;  2UXD O;  4GT8 A;  4B7P A;  2VQF B;  4LF6 O;  3UT5 A;  2CH7 A;  1FXH A;  3LUT B;  4O2B A;  2RMK B;  3CEI A;  1UYH A;  1WN7 A;  5EIB D;  3E35 A;  3Q5J A;  4URL A;  4LR3 A;  2WWW A;  1K34 A;  2JGU A;  3CSX A;  1N33 B;  4UFZ A;  1BGQ A;  4G27 B;  3SJB C;  5IY5 C;  4CZZ A;  1J95 A;  1XMQ O;  4N21 A;  2H8M A;  1UYL A;  2DYS B;  5B1A B;  2WI4 A;  3I55 V;  4MP2 A;  3HZ1 A;  2GUZ A;  5M4P A;  4JPR A;  3R65 A;  2BYH A;  5M4H A;  4FCQ A;  3A0W A;  2YGF A;  2LJ2 A;  3IC7 A;  3OEH G;  4QNH B;  3C3T A;  5JJJ B;  2Y4U A;  3R91 A;  1GK9 A;  2P06 A;  2WLM A;  1Z5A A;  3ABK C;  1I5A A;  2Y69 C;  3B8M A;  3TTZ A;  1YC4 A;  4I4T B;  4K8X A;  2BU7 A;  2ZM6 B;  3MDS A;  4YJ2 B;  2UUA B;  3K97 A;  1WB8 A;  1J5E B;  3ZCC A;  2OTL V;  4IYH A;  1M93 A;  2PNR A;  4L8Z A;  5J2T A;  4I55 B;  1H2L A;  2CE4 A;  5LP6 B;  4LF9 B;  1K73 W;  4WUD A;  3OTF A;  1XHX A;  4KP4 A;  5FWK A;  2YEA A;  3WB0 A;  5LBQ A;  3OE7 G;  4EEH A;  4X20 A;  2ZXW B;  1M57 C;  1QU7 A;  5FNF A;  5IWA O;  3B27 A;  4GX0 A;  4NKG B;  3ABM B;  5KMG B;  2ITD C;  4WBN B;  2WLJ A;  2IH3 C;  3S3W A;  2EJR A;  2JS5 A;  1WP8 A;  5LGN A;  4JI4 B;  2UWD A;  4DXW A;  4JI3 O;  2QG2 A;  3TK1 A;  2ZCE A;  2XK2 A;  3ZHT A;  4CH4 A;  4ASF A;  4FFB A;  2YKJ A;  1WLE A;  4EFB A;  5M4K A;  2VQF O;  5K1X A;  1ZL8 B;  4LH6 A;  3WG7 B;  2BTO A;  2PYJ A;  4HNA A;  1VAR A;  4FLT A;  3G67 A;  3A0T A;  1N36 B;  1YER A;  3ZMS A;  4W7T A;  3JAR B;  4UB6 Z;  5JH7 A;  4UCT A;  5CN0 A;  5CA0 A;  1LUW A;  3BAA A;  4B7K A;  2YEV A;  2A9H A;  4B7E A;  3K98 A;  1I94 B;  3RWR D;  1EA6 A;  3N2K A;  5IY5 B;  1ZWI C;  1WA8 B;  3CCE V;  1ZLZ A;  1HNX B;  4RQE A;  3C11 A;  2HJF C;  3SJQ C;  2WI7 A;  1AI4 A;  2AW9 A;  2NN4 A;  2YIC A;  4LFC B;  1BKN A;  2OTJ V;  3OAA G;  2WI2 A;  2HLD G;  1G1X B;  2BU8 A;  1YVW A;  2ZM6 O;  1Y8N A;  2UUA O;  1AJ6 A;  2JEX A;  1J5E O;  1IBL B;  3ABK B;  2Y69 B;  3JAW A;  3QVN A;  4DRX A;  4LBE C;  4GX1 A;  4YKR A;  3H1K H;  4YY3 B;  3K57 A;  2IJJ A;  5KUK A;  4LF9 O;  2ETN A;  2CCU A;  3RFR A;  4PEL A;  3JD2 A;  1XL6 A;  2ADP A;  2YIB D;  4MPE A;  4I0X A;  1FYJ A;  4FK5 C;  2GBO A;  3EHH A;  1SF9 A;  2YEE A;  2O1U A;  3ETE A;  1TUB B;  3CHX A;  4V25 A;  1H8E G;  2ZE7 A;  5EYP A;  1VQK V;  3Q5K A;  4PA3 A;  1KUQ A;  1BMF G;  1M57 B;  2F95 B;  5ITZ A;  1IUR A;  1EI1 A;  3ZN0 A;  4HZ5 A;  1U2O A;  4KTN A;  2DOS A;  4UCU A;  2HCH A;  3H1I H;  1X4T A;  4JI4 O;  4YKU A;  4ASG A;  1BS3 A;  4IIJ A;  4TUY B;  3FB5 C;  3SYC A;  2M7W A;  3T0Z A;  1R73 A;  2E3C A;  1B06 A;  4FFK A;  2YE5 A;  4NH9 A;  1N36 O;  2Z3Y A;  3K9S A;  5LHG A;  3R4P A;  1K3E A;  4EM7 A;  1I94 O;  4JF3 A;  4PD4 F;  4H0L B;  2QKC A;  3L9D A;  3WB1 A;  1HNX O;  5A9G A;  2BU2 A;  5IJ9 B;  3CX5 F;  3O0I A;  3BY6 A;  3HKB B;  4J7Z A;  4UV8 A;  3JZ3 A;  4LFC O;  5FPR A;  4U7O A;  2WI6 A;  3AK1 A;  2ZQM A;  2ZE6 A;  3OT7 A;  4MVZ A;  1Y74 B;  3OMI B;  4PA7 A;  2Q69 A;  1BCC H;  5E79 Z;  5JJE B;  4DV3 O;  1KC8 W;  3O6O A;  2WLL A;  3SJC C;  4CWT A;  3ZED A;  4ZKI A;  3AG4 C;  3FB7 C;  4URM A;  3K5M A;  4H37 A;  1IBL O;  3G4S V;  3RYF B;  1GRJ A;  4UB8 Z;  3L71 H;  4YKW A;  4YY3 O;  1HDJ A;  1K5Q A;  3HB3 B;  2LW7 A;  3RYI B;  2XCM A;  1FS0 G;  1IBK B;  1VQ9 V;  4MPN A;  5EZY B;  3B77 A;  3CCJ V;  4LNU A;  3EKO A;  3GIF A;  4FLY A;  3G75 A;  1ID0 A;  4X89 A;  3ICX A;  3ZRW B;  3OGC C;  1BHB A;  1QBZ A;  4ZHQ A;  1Y66 A;  2VS0 A;  3RN4 A;  3HPL C;  2PYL A;  1GKX A;  5LOV B;  2YE6 A;  5IT9 N;  3VQY A;  1VQO V;  2YEG A;  2KG7 A;  5GON A;  1SQG A;  4JYA B;  5M4N A;  5DN6 G;  3P30 A;  1G8M A;  2ITC C;  2B5U A;  2ZKJ A;  2QF6 A;  3ZM7 A;  3SJA C;  4UCO A;  2F23 A;  2Q8V A;  2JGD A;  4AQY B;  1TVK B;  4FLU A;  4DYL A;  3K0G A;  4Q20 A;  3OGI B;  3DC5 A;  1SRY A;  4QIW F;  4R6Z A;  1NJI W;  3CCS V;  3OR6 C;  3CRM A;  5L3D A;  1TIL A;  4DV4 B;  3TET A;  1LUV A;  2YK9 A;  5B5E Z;  4YJ3 B;  5F3K A;  5H6R A;  4F6E A;  3OWB A;  4R3A A;  1PL0 A;  3BAB A;  4GYC B;  4I3H A;  4WUB A;  1L1F A;  2YE3 A;  2W0F C;  3J80 N;  4LFA B;  1ROP A;  4TV9 B;  5H2F Z;  4JI7 B;  1NI8 A;  2CK3 G;  1JX9 A;  5BMV A;  3RLQ A;  3T4Z A;  4JQL A;  2QWP B;  2WI1 A;  4MTX A;  2Z0A A;  3I5D A;  3T10 A;  4I9W A;  3ZIA G;  3P3P A;  1XNQ B;  3MNR P;  3M99 B;  4KSG A;  4BR6 A;  3L73 H;  4EFE A;  1Q86 W;  5LXT B;  2IWS A;  3SDL A;  2WLI A;  5C8Y A;  4XIQ A;  1I08 A;  1IBK O;  5BR8 B;  5EIB C;  1QZR A;  3TCU A;  4EMV A;  1IBM B;  1EFR G;  3E22 B;  4MVM A;  2YKC A;  1V9P A;  4FZ1 A;  1M90 W;  2UXC B;  2LFR A;  3MHS C;  1LNQ A;  1NZ6 A;  2WEP A;  3K79 A;  2ZKO A;  2HHI A;  5JVD A;  1E1R G;  1NKD A;  3K5O A;  2CGO A;  3EHB B;  3ZKD A;  3HKE A;  4O4J B;  4EGK A;  4DUY B;  1R3I C;  3DXR B;  4JYA O;  4H44 B;  4AI8 A;  4X65 B;  1JR9 A;  5E1A C;  4CWR A;  3T2S A;  2EUL A;  5KAI Z;  4PV1 B;  4AQY O;  3FAV B;  1FFX A;  3ZRX A;  4I50 B;  1O9H A;  1Q6H A;  2R9R B;  4RUF A;  3ASO C;  5IE9 A;  2R72 A;  4LF8 B;  2YSU B;  4OXS A;  1ZSP A;  2OCC C;  2OIE A;  4DV4 O;  4DR5 B;  2AZ0 A;  3P3N A;  1Q82 W;  4FM1 A;  3OW6 A;  2HFE C;  3CWB H;  5D7D A;  4HYP A;  4LP0 A;  1BHA A;  2HVK C;  1P7B A;  2N74 A;  2YID A;  4EEQ A;  2XND G;  2LP7 A;  3K03 A;  1VQN V;  4RO2 A;  3SYP A;  1Y67 A;  4EB6 A;  5JQG A;  4X9Q A;  5IYD O;  4LFA O;  3RVY A;  4JI7 O;  4P9P A;  4CH6 A;  2WI3 A;  1EN6 A;  1MNG A;  4RUE A;  3IJ4 A;  5CPH A;  3AG3 C;  3L72 H;  4FZ0 A;  2RQ6 A;  2O1V A;  4DUZ O;  2D2C B;  2ATK C;  4FCR A;  4IHJ A;  3T2M A;  2CCS A;  2BSK B;  1ZXM A;  1XNQ O;  2BOC C;  2EZO A;  2IJH A;  2WI5 A;  3SPH A;  1E1Q G;  3JAT B;  4WFG A;  4X62 O;  4RAI A;  1YSR A;  5IJ0 A;  1NHH A;  3ZHS A;  2EIN C;  5BR8 O;  1FD9 A;  1IBM O;  1OCC C;  2UXB B;  4LP8 A;  3J7A U;  3MHH C;  1ZW9 A;  3AG7 A;  2XJX A;  2YGA A;  2UXC O;  5L3E A;  3VHD A;  2QE7 G;  1IX9 A;  4EGH A;  5EBM C;  1ORQ C;  2DWE C;  4JZ2 A;  4B3S B;  1QNM A;  2Q0O C;  2UXN A;  4OPH A;  4DR4 B;  1Q81 W;  4UXN A;  1GMG A;  2Q7G A;  2K5B A;  4H7Q A;  1MZE A;  2HG1 A;  3JAL A;  4DUY O;  1FPO A;  1MG1 A;  1PVG A;  2RNB A;  4MS2 A;  4F4L A;  4HY1 A;  1S77 D;  4GX5 A;  1JJO A;  1A4H A;  4X65 O;  1P7G A;  2ESA A;  1DF4 A;  1ZXN A;  4XIR A;  1R6K A;  3CGZ A;  1FFT B;  2C1I A;  2BTQ B;  3CCQ V;  4KQV A;  4LF8 O;  3M7M X;  1H2S B;  1GKZ A;  3LNN A;  4XC0 A;  3DC6 A;  1U96 A;  2YXL A;  1NQT A;  4DR5 O;  3RLR A;  4CWS A;  4MSW C;  4NXM B;  4Z2W A;  1NVP D;  2VCI A;  2YKI A;  3ASO B;  5EBW C;  4J7J A;  4DO2 A;  2OT5 A;  4DW0 A;  4PRX A;  3GIG A;  4B08 A;  4JYB A;  1Z5B A;  4EFU A;  4Q6G A;  4DV0 B;  2IH1 C;  2E5L B;  1SET A;  2JK5 C;  4X1K B;  4MTO A;  3VBB A;  2UUC B;  2YE8 A;  3VHA A;  3Q4H B;  1GN2 A;  1EN5 A;  1YCI A;  2JRI A;  1W0K G;  1K4D C;  3CB2 A;  3L70 H;  4GT1 A;  1OHH G;  1JMK C;  5CB4 B;  2IBZ H;  1JFF B;  4WFF A;  2YE9 A;  4WFE A;  1BYQ A;  1OV9 A;  3STL C;  1L0O A;  3AG3 B;  4R1F A;  1I5D A;  2R9A A;  4J9Z B;  3ABM C;  4ZVI A;  4IL6 Z;  1JJ2 U;  2UU9 B;  2BOB C;  3FB6 C;  1Q6U A;  1BSM A;  5BOD A;  3HR0 A;  3ZXQ A;  2EBO A;  4PHZ A;  3K3W A;  3Q5L A;  2QSA A;  4U93 A;  1YXB A;  2UXB O;  1UY7 A;  2YIB A;  3K06 A;  3K59 A;  2WLN A;  3ZMV A;  4I4T A;  2EIN B;  2CGF A;  1JCH A;  5KLV H;  1I7F A;  1TAE A;  4YJ2 A;  4B3S O;  1QCE A;  4DR4 O;  4HXZ A;  1YC1 A;  1SQB H;  2O57 A;  1GM9 A;  4J7K A;  4I55 A;  4LPB A;  4R50 A;  1K5S A;  5LP6 A;  2H3O A;  2EX3 A;  4X8A A;  2Q8H A;  2QG0 A;  5J9P C;  1H2G A;  2DE0 X;  1US7 A;  3JAK B;  5FNV B;  1UFI A;  2QFO A;  1KD1 W;  3CCV V;  1UYF A;  1O9G A;  2EIL C;  4K35 A;  4ASU G;  4URO A;  1KYO F;  2Q6A A;  4PI0 A;  1AM1 A;  2XDL A;  1R3J C;  5J6A A;  5KMG A;  1M5I A;  4WBN A;  1BXD A;  4HBN A;  3AEI A;  4MVQ A;  2WA3 A;  4CE1 A;  1I5Y A;  4ZOL B;  1XI1 A;  4NXM O;  2BRC A;  1XIL A;  2BZ5 A;  3JAM N;  1SQV H;  2XHB A;  2JVD A;  4BWA A;  2R9I A;  4DV0 O;  2HP8 A;  2FWY A;  1S3J A;  2F43 G;  4NVP A;  1M56 C;  2HJD A;  5LYJ B;  2E5L O;  3ZXO A;  4AHC A;  1K4C C;  2UUC O;  2HKJ A;  1ZL8 A;  2XD6 A;  1UY9 A;  1A32 A;  2YXY A;  4JI5 B;  4X66 O;  2ZDI A;  1AR1 B;  1MAB G;  2QWQ B;  1B3Q A;  3JAR A;  2A79 B;  4H81 A;  2KB1 A;  1VQP V;  3SGI A;  2Q8I A;  4X1I B;  4NH8 A;  1X59 A;  1WA8 A;  3O9O A;  2QA4 V;  1YI2 V;  1Y6X A;  2WAM A;  4FPP A;  4K8Z A;  1PNL A;  1YSZ A;  3ETG A;  3LNM B;  1EN4 A;  5CA1 B;  4CS3 A;  3CRK A;  3B8N A;  5HFM A;  1H2N A;  1TUE B;  4H85 A;  3U2K A;  3B25 A;  1U97 A;  4JI6 B;  3ETQ A;  3CRQ A;  3O65 A;  4HZ0 A;  2MW2 B;  2CG9 A;  2XJG A;  1K97 A;  3STZ C;  4UVB A;  1S72 V;  2GTA A;  4CWF A;  3ZHQ A;  2GHY A;  2BTZ A;  3OUF A;  3SYA A;  3ZMT A;  5F5R A;  4PDR A;  5FLX N;  1AVM A;  2HVJ C;  3U67 A;  3TZ4 A;  4CWO A;  5KHH A;  1FXK C;  4NXN B;  3AG1 B;  1N33 O;  1TUB A;  3HYY A;  3NR7 A;  3SR2 C;  1ZTE A;  1OJH A;  1GAX A;  2Y4T A;  1YEW A;  1UY6 A;  1Q3E A;  1GM7 A;  3N2G B;  3KKY A;  2IOQ A;  4L8J A;  4PI2 A;  1GO3 F;  1H7U A;  2EIL B;  2JDI G;  1B62 A;  3B4S A;  3H80 A;  1DK1 A;  4XCJ A;  4NYK A;  2O1W A;  1H2K A;  2H8P C;  5EBL C;  2Q2E B;  2A7W A;  1KB9 F;  2HR3 A;  1QY8 A;  4AWQ A;  2DWD C;  4TUY A;  1AH6 A;  1UYC A;  1VQ7 V;  2B1I A;  3GVM A;  3R66 A;  2Y0P A;  2LO1 A;  4IYI A;  3LDC A;  3C3S A;  3E86 A;  2PF4 E;  4U3F H;  3HKC B;  3BEH A;  2FXS A;  1AJN A;  4JI8 B;  1I58 A;  1M56 B;  2H55 A;  3G7E A;  1H38 A;  1NU1 H;  3OMA B;  4BW5 A;  1KP2 A;  1AR5 A;  3VOU A;  1M4U A;  5JWP A;  4JI0 B;  4I9Q A;  4HYM A;  4O07 A;  3K08 A;  3E2E A;  3N27 A;  5IJ9 A;  4JYY A;  3HKB A;  4JV5 B;  4O4H B;  5BXZ A;  4CS2 A;  4TWK A;  1UYK A;  2W6J G;  3CC7 V;  1IXM A;  1TC6 A;  2AZ2 A;  2QR4 A;  3B09 A;  1Y74 A;  3QTC A;  4CH5 A;  4TOI A;  4JI6 O;  1XNR B;  3U2D A;  4YXW G;  4TSF G;  2F66 C;  2CUG A;  3M8A A;  5EC1 C;  2MK3 A;  4XE2 A;  2XAQ A;  5B3S C;  5EK0 A;  3LNU A;  4NR1 A;  3RYF A;  3RYH B;  1XRE A;  2HEP A;  2N04 A;  3LSQ A;  3ZRV A;  5CA0 B;  3T1C A;  1LR1 A;  3CD6 V;  3RYI A;  4IT5 A;  5KHI A;  5EZY A;  4WUC A;  4Z1M G;  1YJW V;  2QTO A;  4O4L B;  4NXN O;  2YE2 A;  3ZRW A;  1UJW B;  3K04 A;  1JQ0 A;  3CMA V;  3SL2 A;  2C1G A;  3MD0 A;  1FXK B;  2PY5 A;  2OWO A;  1F51 A;  5CA3 A;  2XX2 A;  5LOV A;  2X6A A;  2KKW A;  2WPD G;  3EHF A;  2EZP A;  1QVF U;  2LQT A;  3FKS G;  3F5T A;  4EKW A;  1AJP A;  2BCC H;  4OPA A;  1P4R A;  1S5L Z;  1S0V A;  1PD3 A;  1AJQ A;  2IOR A;  3CWV A;  2GV9 A;  3JSN A;  3X2Q C;  5CBG A;  1TVK A;  4EGI A;  2EJ7 A;  2QM8 A;  2P7T C;  3VHC A;  2EIM C;  4FM0 A;  4KXR A;  5LHH A;  3LPS A;  3OM3 B;  4LH7 A;  4JI8 O;  3EFF K;  1UYE A;  2FYU H;  4UCS A;  4YJ3 A;  4LWI A;  1VQL V;  5FNC A;  1Q43 A;  2CGN A;  4URN A;  4JI0 O;  3UCS C;  3ABU A;  3OWD A;  3A0X A;  1AR4 A;  2KQX A;  2JEU A;  1IDS A;  2XHX A;  5J71 A;  4TV9 A;  5J2U B;  4JV5 O;  2UXX A;  5BOC A;  3EKR A;  4H13 B;  3T1H B;  4YIP A;  4JI2 B;  3U10 A;  2WER A;  4GZR B;  4FVM A;  4DK0 A;  5LMN B;  1XNR O;  1Z5V A;  2DMX A;  2GSM B;  2CAZ C;  1N8R W;  4FM2 A;  1HR0 B;  4U7N A;  1F7Y A;  3A8T A;  1SER A;  5LXT A;  1EM1 A;  1JM6 A;  1RSO A;  1OSF A;  4XKA A;  4ZBM A;  3B26 A;  4KFM A;  3H9V A;  4AWO A;  2F93 B;  5B3S B;  3KCX A;  3ZHR A;  2BU5 A;  5IYZ B;  2DQ3 A;  3E22 A;  2VWJ A;  2YIA A;  4JZG A;  2ZR2 A;  1VP7 A;  2QTS A;  1OCO C;  1THZ A;  5GW7 A;  4DV1 B;  4J42 A;  4LF4 B;  3JD4 A;  1JOY A;  4DR3 B;  3CP1 A;  4O4J A;  2X6C A;  4UCV A;  1WPX A;  1VQM V;  3DXR A;  3TUH A;  2XAH A;  4GKJ B;  3HEK A;  1SZT A;  2YEF A;  1SA0 B;  2QKS A;  4F6R B;  3FAV A;  4I50 A;  2YEH A;  3G6B A;  3W7S A;  2Q68 A;  4LF5 B;  1NBM G;  3X2Q B;  5HFL A;  3SPJ A;  2YC0 A;  1RFY A;  2AHZ A;  2EIM B;  2FML A;  1QVG U;  4CC5 A;  2XAJ A;  1TH8 A;  3HYZ A;  5CTY A;  3QO8 A;  1WB7 A;  4JTA B;  2KSD A;  1ZAU A;  3H1J H;  3K99 A;  2N05 A;  4PDM A;  3BMY A;  3CXC U;  2YKE A;  1I0H A;  3HKD B;  3T1H O;  2BE3 A;  1VF7 A;  1WJZ A;  1WPB A;  4ZI7 B;  2X7R B;  3GIE A;  4JI2 O;  3ZKB A;  2Q67 A;  2A06 H;  5KHK A;  3H1H H;  5DM6 V;  5LMN O;  4E4E A;  5M4E A;  2BSK A;  5D7R A;  2ZIN A;  5D6P A;  1HR0 O;  4X1Y B;  1NVP B;  2YEJ A;  1D2D A;  3JAT A;  2QM7 A;  3A0Z A;  5CF0 A;  2JJ2 G;  2LGQ A;  4AIL C;  2FYP A;  2G38 A;  3FFQ A;  4O4I B;  4XBF A;  4OX9 B;  4GFN A;  3BRC A;  5LA6 B;  3CCU V;  1IXB A;  4K3A A;  5H5N A;  4DW1 A;  3F7V C;  4XDJ A;  4MVS A;  2QWR B;  2YGE A;  4O2A B;  4DV1 O;  4UUJ C;  5JCO C;  1SC5 B;  5H9C A;  4LF4 O;  3CC4 V;  3H1L H;  4DR3 O;  2D3O W;  5CTW A;  1OCO B;  2Q4P A;  4LCU C;  1K33 A;  4K0K B;  2VWK A;  1KU9 A;  4CH3 A;  4GKJ O;  3T1K A;  4MB9 A;  3W7T A;  3K58 A;  4DR2 B;  3OW2 U;  1QR9 A;  1EZV H;  2CTW A;  3SPC A;  1Q6I A;  2YS8 A;  2BTQ A;  1SQF A;  2Z5U A;  3NXS A;  3OPD A;  4PDV A;  3SPG A;  3ZS8 C;  4LF5 O;  2ZE8 A;  4N23 A;  1ZX3 A;  2JKI A;  3WFV A;  3D3Q A;  2P5O A;  2YI0 A;  2ZDX A;  4LWS B;  1EZJ A;  3TZ2 A;  2X0L A;  2VCJ A;  3CCR V;  4XD8 A;  2W6I G;  4GKK B;  5BY1 A;  2RN9 A;  3JAS B;  4ZIB A;  1GN4 A;  3JYC A;  4X1K A;  1OZ0 A;  3Q4H A;  3TGU H;  1BL8 A;  5GTI Z;  3A0R A;  3FT8 A;  3RYC B;  1B6Q A;  4DV5 B;  4MP7 A;  4QJF B;  5CB4 A;  1NR1 A;  3WU2 Z;  3T4D A;  1JFF A;  4DUH A;  4R3M A;  1R1B A;  1Y4S A;  2DW4 A;  1F23 A;  2IWU A;  2EXL A;  5L3C A;  5D5Q A;  4GEE A;  3ZMU A;  4PRV A;  4DR6 B;  2A0L A;  1QHT A;  2C2A A;  3CRC A;  3PJS K;  4R7C A;  4XIT A;  4OX9 O;  1I5C A;  4B3M B;  3BPZ A;  3VAD A;  4EB6 B;  1SQX H;  4JAV A;  2PI4 A;  1SQP H;  2X6B A;  1PNK A;  1BZK A;  2XX5 A;  2VWC A;  3CME V;  3RGB A;  1DF5 A;  2OYQ A;  2WLK A;  4MT8 A;  3CPW U;  3CCL V;  1GM8 A;  4ABM A;  4E72 A;  4JAU A;  3TJT A;  4DK1 A;  5KX5 B;  4YKT A;  1ZUQ A;  1YJ9 V;  4K0K O;  3OD4 A;  1VF6 C;  2PTM A;  1V54 C;  3B2E E;  3JAK A;  5FNV A;  1HNW B;  4DR2 O;  3ZJZ A;  2AGA A;  1DTO A;  3GWK C;  1XHZ A;  1GN3 A;  2QEX V;  3DSQ A;  1XQ8 A;  3CRA A;  2DYR C;  1YF2 A;  3D36 C;  3ABT A;  1N34 B;  1R62 A;  3CJH B;  3BVO A;  1R3L C;  3R4M A;  4CWQ A;  4ZOL A;  3G6E V;  1Y76 B;  2GDS A;  4DV6 B;  1FXV A;  2QGN A;  4KSH A;  3UO3 A;  3BM9 A;  3ZRS A;  2EIJ C;  2W0X A;  2Y0I A;  1NTK H;  4GKK O;  5LYJ A;  3SYO A;  1GH6 A;  3OUS A;  3O2F A;  4NTX A;  1KKC A;  3VQW A;  4DV5 O;  2YEC A;  4TQD A;  1YT2 A;  1W2B U;  1YJN V;  5L3J A;  3AG1 C;  1COW G;  1QR8 A;  3IC9 A;  4X1I A;  3ZMZ A;  1VQ4 V;  2XDK A;  2ZDY A;  4E01 A;  5H6Q A;  1SKV A;  3ABL B;  3ETD A;  2XDX A;  1VF5 B;  1AB3 A;  1NHJ A;  1SZX A;  3CS5 A;  1YT1 A;  2QJ1 A;  5LGU A;  1K92 A;  5KAF Z;  3INX A;  2L35 A;  4DR6 O;  5CA1 A;  3ML0 A;  4QPJ A;  4B3M O;  2ZBK B;  1YIJ V;  2Q5Z A;  3PN1 A;  3QG5 A;  4TV8 B;  3L75 H;  2P6J A;  1RM1 C;  4BAY A;  4CWN A;  2YI7 A;  1XDC A;  2JJC A;  1AMW A;  4GGL A;  1H8H G;  1TGO A;  3F7Y C;  2IU3 A;  1M1K W;  4MW3 A;  4HXW A;  5D6Q A;  1URF A;  4P2Z A;  2XX4 A;  4AWP A;  2GTS A;  4O0B A;  1L8D A;  2NNU A;  4L93 A;  4PDL A;  1HNW O;  1US6 A;  2DJV A;  1W59 A;  1L0N H;  2F1M A;  3GB7 C;  5LMU B;  1XEQ A;  3R92 A;  4NH7 A;  1MSW D;  1V54 B;  3LDE A;  1S14 A;  3FYI B;  3HHU A;  4PA6 A;  4CC6 A;  1YTF B;  3N2G A;  1N34 O;  2V4D A;  2XAB A;  3I56 V;  3CRR A;  1S16 A;  1KQS U;  2UU9 O;  4JGS A;  3PEH A;  1T5E A;  4DV6 O;  2DYR B;  4FCP A;  2YUA A;  1N0N A;  2RJZ A;  4HYO A;  2YED A;  4WFH A;  3IED A;  1AH8 A;  2UUB B;  4U3J B;  4NB5 A;  5EC2 C;  4BIZ A;  3BHP A;  4X64 B;  1OCZ C;  4CE2 A;  3UT5 B;  2CH7 B;  3D0B A;  4O2B B;  3K5L A;  1VQ6 V;  1NS1 A;  2EIJ B;  3HKC A;  1DLB A;  2B1G A;  2ZE5 A;  4BW9 A;  1JVM A;  4QGP A;  4WFB V;  4XKO A;  3U11 A;  3EHG A; 
#chains in the Genus database with same CATH homology
 2JJ1 G;  3IGA C;  4L94 A;  5KA6 A;  1Q7Y W;  4XDM A;  3H4L A;  2XAG A;  5CBF A;  2WSS G;  3FB8 C;  4GQT A;  4MBC A;  2YE4 A;  4PL9 A;  4P30 A;  1TID A;  2YEI A;  4RQF A;  4J9Y B;  3KG2 A;  4CE3 A;  2Q8F A;  2XDU A;  4GX2 A;  3D3I A;  4EFT A;  3EHJ A;  1ZWH A;  1NR7 A;  1QLN A;  3TZ0 A;  2CH4 A;  1RM1 B;  3QO5 A;  1YES A;  2IW5 A;  4YKQ A;  2XHT A;  1YIT V;  1YT0 A;  2HKO A;  3JCZ A;  4PA9 A;  3JD3 A;  3AG2 C;  2IJK A;  1FXK A;  4AS9 A;  1PNM A;  2E0A A;  4XCL A;  4DZY A;  4ASA A;  3WHA A;  4TT3 G;  2IU0 A;  3G7B A;  3UKM A;  5LGT A;  4MOT A;  5IDJ A;  1YTF D;  1V55 C;  2FWZ A;  3LSS A;  2BT0 A;  1E79 G;  3RW0 A;  1HWY A;  3C0E A;  1VQ8 V;  2AHY A;  1OCZ B;  2YGF A;  1R3K C;  3F5W C;  2YEV B;  2WEQ A;  3LDD A;  4L90 A;  3W7X A;  3ZN1 A;  3IFX A;  3QTF A;  4HY6 A;  4G28 B;  1F4M A;  2JIZ G;  2IOP A;  2XHR A;  4MTF A;  4XKK A;  1GTO A;  1RPR A;  1MU5 A;  5B1O A;  4O09 A;  3QNE A;  4QE7 A;  4WCE V;  2V1D A;  4LWG A;  3E8G A;  1YSC A;  5IN9 A;  5L3F A;  4KFG A;  3CC2 V;  1YET A;  3SPI A;  4HAM A;  2YJW A;  1QLE C;  1GKF A;  4XIP A;  4WF9 V;  2WLH A;  1Y8O A;  1XL4 A;  3AG2 B;  1UYI A;  2V7Q G;  4O04 A;  1UYD A;  5CTU A;  3OMN B;  3FV5 A;  3QO7 A;  2ZR3 A;  3QDD A;  5D7C A;  4UV9 A;  1Y4M A;  3NMQ A;  2DQ0 A;  3R4O A;  1AI6 A;  1S76 D;  4MVO A;  4UVC A;  4FIP C;  2IWX A;  1V55 B;  4JAS A;  5IYB O;  4MVU A;  1UYG A;  4L87 A;  3E8F A;  1S5H C;  3DGE A;  4BXI A;  2H94 A;  1VQ5 V;  3DTU B;  1MX0 A;  2FTK A;  1I5B A;  1YS3 A;  3E83 A;  1RPO A;  5BZB A;  4FMT A;  1F4N A;  2WLL B;  3B28 A;  5FL7 G;  1Z5C A;  2EIK C;  5IYC O;  1AI5 A;  4I5S A;  3CRL A;  1TC0 A;  3K9A A;  4O05 A;  3ASN C;  1YC3 A;  1K8A W;  4L91 A;  1MOF A;  3K60 A;  1GJV A;  4CBC A;  4LWH A;  3FT5 A;  1QLE B;  4G2K A;  2Q8G A;  2XAS A;  3KE6 A;  1TBW A;  2P67 A;  1R6N A;  1KIJ A;  3AG4 B;  1OCR C;  2HG5 C;  3OEE G;  4E2L A;  1CPY A;  1SES A;  3SYQ A;  2XDS A;  1EBO A;  2XAF A;  2IJI A;  4E00 A;  2YEB A;  2YJX A;  5CMU A;  3E8H A;  1KKD A;  1Z59 A;  3WQ9 A;  1YHQ V;  1NH2 B;  4YKX A;  1QYE A;  2NLJ C;  1UYM A;  3CGY A;  5L3G A;  3D2R A;  3GWO A;  4LWE A;  1THN A;  4ASB A;  4MW8 A;  3TZ5 A;  4XDK A;  2WLI B;  1U0Z A;  3PEJ A;  4JTC B;  1M9N A;  4R8C A;  3INW A;  2EIK B;  5B1B C;  4KUM A;  2YI5 A;  1W0J G;  2LFS A;  4P7A A;  2BYI A;  3OFN G;  1I59 A;  5IDM A;  3B24 A;  3CYO A;  1CEZ A;  3ASN B;  4X9L A;  4B6C A;  4UVA A;  1AI7 A;  4YKY A;  4CWP A;  4QE9 A;  1NHI A;  2ZD9 A;  1JPX A;  3E89 A;  4MTG A;  1K9M W;  3T0H A;  3ABL C;  2GQP A;  4FJC C;  3G71 V;  5KA5 A;  1KZN A;  4LWF A;  2BSM A;  1OCR B;  1K7D A;  2YE7 A;  5CTX A;  4X88 A;  3A0Y A;  4JYC A;  3RBZ A;  3HZ5 A;  3E8B A;  2YI6 A;  4JTD B;  1I5X A;  3W7U A;  2P90 A;  2DYS C;  3OR7 C;  5LHI A;  5B1A C;  4P9O A;  3RVZ A;  2VW5 A;  5CBH A;  3FYE B;  5L3B A;  1Y4U A;  2AKP A;  4QPK A;  3RLP A;  5GGZ A;  4LC1 A;  2GFD A;  4MVR A;  1NH2 D;  4GCZ A;  4XTJ A;  2CCT A;  4BQJ A;  5FND A;  4BAE A;  2OCC B;  4YKZ A;  3RKZ A;  5KUM A;  3P32 A;  5B1B B;  3OMU A;  2YK2 A;  2K1E A;  1UY8 A;  4E02 A;  4XDL A;  4HZ3 A;  1CP9 A;  2ZXW C;  4V26 A;  3K0D A;  4BIU A;  1G4Y B;  5B1N A;  2PI5 A;  3UM7 A;  3JD1 A;  3W7W A;  2XOK G;  1H7S A;  5M4M A;  4H33 A;  2BU6 A;  4PU9 A;  1B63 A;  3CCM V;  4WFA V;  4K4O A;  1Y8P A;  4MPC A;  2Y48 A;  1ENV A;  1KP3 A;  4BQG A;  3R4N A;  1KEC A;  2XJJ A;  3GIG B;  1OCC B;  3D36 A;  3H01 A;  4PA4 A;  1PKX A;  3JD0 A;  3WG7 C;  1ARO P;  5C93 A;  2BRE A;  2YKB A;  2ZDI C;  4P8O A;  4GT8 A;  4B7P A;  1FXH A;  3LUT B;  1UYH A;  4URL A;  3E35 A;  3Q5J A;  2WWW A;  1K34 A;  1BGQ A;  4G27 B;  5IY5 C;  4CZZ A;  1J95 A;  4N21 A;  2H8M A;  1UYL A;  2DYS B;  5B1A B;  2WI4 A;  3I55 V;  4MP2 A;  3HZ1 A;  5M4P A;  4JPR A;  3R65 A;  2BYH A;  5M4H A;  4FCQ A;  3A0W A;  3IC7 A;  3OEH G;  4QNH B;  3R91 A;  1GK9 A;  2WLM A;  1Z5A A;  3ABK C;  1I5A A;  2Y69 C;  3B8M A;  3TTZ A;  1YC4 A;  2BU7 A;  3K97 A;  3ZCC A;  2OTL V;  2PNR A;  4L8Z A;  1K73 W;  4WUD A;  4KP4 A;  5FWK A;  2YEA A;  5LBQ A;  3OE7 G;  4EEH A;  2ZXW B;  1M57 C;  5FNF A;  3B27 A;  4GX0 A;  3ABM B;  2ITD C;  2WLJ A;  2IH3 C;  2EJR A;  5LGN A;  2UWD A;  4DXW A;  2QG2 A;  3TK1 A;  2XK2 A;  4ASF A;  2YKJ A;  1WLE A;  5M4K A;  3WG7 B;  3A0T A;  1YER A;  3ZMS A;  4W7T A;  5CN0 A;  2YEV A;  2A9H A;  3K98 A;  1EA6 A;  5IY5 B;  1ZWI C;  3CCE V;  4RQE A;  3C11 A;  2HJF C;  3SJQ C;  2WI7 A;  1AI4 A;  1BKN A;  2OTJ V;  3OAA G;  2WI2 A;  2HLD G;  2BU8 A;  1Y8N A;  1AJ6 A;  2JEX A;  3ABK B;  2Y69 B;  4LBE C;  4GX1 A;  4YKR A;  2IJJ A;  5KUK A;  2CCU A;  4PEL A;  3JD2 A;  1XL6 A;  4MPE A;  4FK5 C;  3EHH A;  2YEE A;  2O1U A;  3ETE A;  4V25 A;  1H8E G;  1VQK V;  3Q5K A;  4PA3 A;  1BMF G;  1M57 B;  1EI1 A;  3ZN0 A;  4HZ5 A;  1U2O A;  4KTN A;  2HCH A;  4YKU A;  4ASG A;  3FB5 C;  3SYC A;  2M7W A;  3T0Z A;  1R73 A;  2YE5 A;  4NH9 A;  2Z3Y A;  5LHG A;  3R4P A;  1K3E A;  4EM7 A;  4JF3 A;  2BU2 A;  3O0I A;  3BY6 A;  4UV8 A;  3JZ3 A;  4U7O A;  2WI6 A;  2ZQM A;  4MVZ A;  3OMI B;  4PA7 A;  2Q69 A;  1KC8 W;  3O6O A;  2WLL A;  4CWT A;  4ZKI A;  3AG4 C;  3FB7 C;  4URM A;  4H37 A;  3G4S V;  4YKW A;  1K5Q A;  3HB3 B;  2XCM A;  1FS0 G;  1VQ9 V;  4MPN A;  3B77 A;  3CCJ V;  3GIF A;  3EKO A;  3G75 A;  1ID0 A;  4X89 A;  3ZRW B;  3OGC C;  1BHB A;  1QBZ A;  1Y66 A;  3HPL C;  1GKX A;  2YE6 A;  1VQO V;  2YEG A;  5M4N A;  5DN6 G;  3P30 A;  1G8M A;  2ITC C;  2B5U A;  2ZKJ A;  2QF6 A;  3ZM7 A;  3K0G A;  4Q20 A;  4R6Z A;  4QIW F;  1SRY A;  1NJI W;  3CCS V;  3OR6 C;  5L3D A;  1TIL A;  3TET A;  2YK9 A;  5F3K A;  5H6R A;  3OWB A;  4R3A A;  1PL0 A;  4I3H A;  4WUB A;  1L1F A;  2YE3 A;  2W0F C;  1ROP A;  2CK3 G;  1JX9 A;  3RLQ A;  3T4Z A;  4JQL A;  2WI1 A;  4MTX A;  3T10 A;  4I9W A;  3ZIA G;  3MNR P;  3M99 B;  4KSG A;  1Q86 W;  2IWS A;  2WLI A;  4XIQ A;  1QZR A;  3TCU A;  4EMV A;  1EFR G;  2YKC A;  4MVM A;  1M90 W;  2LFR A;  3MHS C;  1LNQ A;  2WEP A;  3K79 A;  1E1R G;  1NKD A;  3EHB B;  3ZKD A;  4EGK A;  1R3I C;  5E1A C;  4CWR A;  3T2S A;  3ZRX A;  2R9R B;  4RUF A;  3ASO C;  2YSU B;  4OXS A;  2OCC C;  1Q82 W;  3OW6 A;  2HFE C;  5D7D A;  4HYP A;  4LP0 A;  1BHA A;  2HVK C;  1P7B A;  2XND G;  2LP7 A;  3K03 A;  1VQN V;  4RO2 A;  3SYP A;  5IYD O;  3RVY A;  4P9P A;  2WI3 A;  4RUE A;  5CPH A;  3AG3 C;  2O1V A;  2ATK C;  4FCR A;  3T2M A;  2CCS A;  1ZXM A;  2BOC C;  2EZO A;  2IJH A;  2WI5 A;  3SPH A;  1E1Q G;  4WFG A;  4RAI A;  1YSR A;  1NHH A;  2EIN C;  1OCC C;  4LP8 A;  3MHH C;  1ZW9 A;  2XJX A;  2YGA A;  5L3E A;  3VHD A;  2QE7 G;  4EGH A;  5EBM C;  1ORQ C;  2DWE C;  2UXN A;  1Q81 W;  4UXN A;  1GMG A;  2K5B A;  4H7Q A;  2HG1 A;  1MG1 A;  1PVG A;  4MS2 A;  4F4L A;  4HY1 A;  1S77 D;  4GX5 A;  1A4H A;  2ESA A;  1DF4 A;  1ZXN A;  4XIR A;  1R6K A;  3CGZ A;  1FFT B;  3CCQ V;  4KQV A;  1GKZ A;  4XC0 A;  1NQT A;  3RLR A;  4CWS A;  4MSW C;  2VCI A;  1NVP D;  2YKI A;  3ASO B;  5EBW C;  4DO2 A;  2OT5 A;  4PRX A;  3GIG A;  4JYB A;  1Z5B A;  4EFU A;  2IH1 C;  1SET A;  2JK5 C;  3VHA A;  4MTO A;  3VBB A;  2YE8 A;  1W0K G;  1K4D C;  4GT1 A;  1OHH G;  4WFF A;  2YE9 A;  4WFE A;  1BYQ A;  1L0O A;  3STL C;  3AG3 B;  4R1F A;  1I5D A;  4J9Z B;  3ABM C;  4ZVI A;  1JJ2 U;  2BOB C;  3FB6 C;  5BOD A;  3ZXQ A;  2EBO A;  3K3W A;  3Q5L A;  4U93 A;  1UY7 A;  3K06 A;  2WLN A;  3ZMV A;  2EIN B;  2CGF A;  1JCH A;  1QCE A;  4HXZ A;  1YC1 A;  1GM9 A;  4LPB A;  4R50 A;  1K5S A;  4X8A A;  2Q8H A;  2QG0 A;  5J9P C;  1H2G A;  1US7 A;  2QFO A;  1KD1 W;  3CCV V;  1UYF A;  2EIL C;  4ASU G;  4URO A;  2XDL A;  2Q6A A;  1AM1 A;  1R3J C;  5J6A A;  1BXD A;  3AEI A;  4MVQ A;  4CE1 A;  1I5Y A;  2BRC A;  2BZ5 A;  2FWY A;  2R9I A;  1S3J A;  2F43 G;  1M56 C;  3ZXO A;  1K4C C;  2HKJ A;  2XD6 A;  1UY9 A;  2ZDI A;  1AR1 B;  1MAB G;  1B3Q A;  2A79 B;  4H81 A;  2KB1 A;  1VQP V;  2Q8I A;  4NH8 A;  2QA4 V;  1YI2 V;  2WAM A;  4FPP A;  1PNL A;  1YSZ A;  3ETG A;  3LNM B;  3CRK A;  3B8N A;  5HFM A;  1TUE B;  4H85 A;  3U2K A;  3B25 A;  4HZ0 A;  2CG9 A;  2XJG A;  1K97 A;  3STZ C;  4UVB A;  1S72 V;  4CWF A;  2GHY A;  2BTZ A;  3OUF A;  3SYA A;  3ZMT A;  5F5R A;  4PDR A;  2HVJ C;  3U67 A;  3TZ4 A;  4CWO A;  1FXK C;  3AG1 B;  3HYY A;  1UY6 A;  1GM7 A;  2IOQ A;  1GO3 F;  1H7U A;  2EIL B;  2JDI G;  1B62 A;  3H80 A;  4XCJ A;  2O1W A;  5EBL C;  2H8P C;  2Q2E B;  2HR3 A;  1QY8 A;  4AWQ A;  2DWD C;  1AH6 A;  1UYC A;  1VQ7 V;  2B1I A;  3LDC A;  3E86 A;  2FXS A;  3BEH A;  1AJN A;  1I58 A;  1M56 B;  2H55 A;  3G7E A;  1H38 A;  3OMA B;  4BW5 A;  1KP2 A;  3VOU A;  4HYM A;  4O07 A;  3K08 A;  3E2E A;  4TWK A;  1UYK A;  2W6J G;  3CC7 V;  1IXM A;  1TC6 A;  3U2D A;  4YXW G;  4TSF G;  5EC1 C;  2MK3 A;  4XE2 A;  2XAQ A;  5B3S C;  5EK0 A;  3LNU A;  3LSQ A;  3ZRV A;  3T1C A;  3CD6 V;  4WUC A;  4Z1M G;  1YJW V;  2QTO A;  2YE2 A;  3ZRW A;  1UJW B;  3K04 A;  1JQ0 A;  3CMA V;  3SL2 A;  3MD0 A;  1FXK B;  1F51 A;  5CA3 A;  2XX2 A;  2X6A A;  2WPD G;  3EHF A;  2EZP A;  1QVF U;  3FKS G;  4EKW A;  1AJP A;  1P4R A;  1S0V A;  1PD3 A;  1AJQ A;  2IOR A;  3CWV A;  3X2Q C;  5CBG A;  4EGI A;  2QM8 A;  2P7T C;  3VHC A;  2EIM C;  5LHH A;  3LPS A;  3OM3 B;  3EFF K;  1UYE A;  4LWI A;  1VQL V;  5FNC A;  4URN A;  3ABU A;  3OWD A;  3A0X A;  2JEU A;  2XHX A;  5J71 A;  5BOC A;  2UXX A;  3EKR A;  2WER A;  2GSM B;  1N8R W;  4U7N A;  1SER A;  1JM6 A;  1OSF A;  4XKA A;  4ZBM A;  3B26 A;  4KFM A;  4AWO A;  5B3S B;  2BU5 A;  2DQ3 A;  2ZR2 A;  1OCO C;  1THZ A;  5GW7 A;  3JD4 A;  1JOY A;  3CP1 A;  2X6C A;  1WPX A;  1VQM V;  3TUH A;  2XAH A;  3HEK A;  1SZT A;  2YEF A;  2QKS A;  2YEH A;  3W7S A;  2Q68 A;  1NBM G;  3X2Q B;  5HFL A;  3SPJ A;  2AHZ A;  2EIM B;  1QVG U;  2XAJ A;  1TH8 A;  3HYZ A;  5CTY A;  3QO8 A;  4JTA B;  3K99 A;  4PDM A;  3BMY A;  3CXC U;  2YKE A;  2X7R B;  3GIE A;  3ZKB A;  2Q67 A;  5DM6 V;  5M4E A;  5D7R A;  5D6P A;  1NVP B;  2YEJ A;  2QM7 A;  3A0Z A;  5CF0 A;  2JJ2 G;  2FYP A;  4XBF A;  4GFN A;  3CCU V;  3F7V C;  4XDJ A;  4MVS A;  2YGE A;  4UUJ C;  5H9C A;  3CC4 V;  2D3O W;  5CTW A;  1OCO B;  4LCU C;  1K33 A;  3T1K A;  4MB9 A;  3W7T A;  3OW2 U;  1QR9 A;  3SPC A;  2Z5U A;  3NXS A;  3OPD A;  4PDV A;  3SPG A;  4N23 A;  2JKI A;  3WFV A;  2YI0 A;  2ZDX A;  1EZJ A;  3TZ2 A;  2X0L A;  2VCJ A;  3CCR V;  4XD8 A;  2W6I G;  3JYC A;  1OZ0 A;  1BL8 A;  3A0R A;  3FT8 A;  1B6Q A;  4MP7 A;  4QJF B;  1NR1 A;  3T4D A;  4DUH A;  4R3M A;  1Y4S A;  2DW4 A;  1F23 A;  2IWU A;  2EXL A;  5L3C A;  4GEE A;  3ZMU A;  4PRV A;  2A0L A;  3PJS K;  2C2A A;  4R7C A;  4XIT A;  1I5C A;  3VAD A;  4JAV A;  2PI4 A;  2X6B A;  1PNK A;  2XX5 A;  2VWC A;  3CME V;  1DF5 A;  2WLK A;  4MT8 A;  3CPW U;  3CCL V;  1GM8 A;  4JAU A;  4YKT A;  1YJ9 V;  1V54 C;  3ZJZ A;  1DTO A;  2QEX V;  2DYR C;  1R62 A;  3ABT A;  1R3L C;  3R4M A;  4CWQ A;  3G6E V;  1FXV A;  4KSH A;  3BM9 A;  3ZRS A;  2EIJ C;  3SYO A;  3OUS A;  3O2F A;  2YEC A;  1YT2 A;  1W2B U;  5L3J A;  1YJN V;  3AG1 C;  1COW G;  4E01 A;  1QR8 A;  1VQ4 V;  3ZMZ A;  2XDK A;  2ZDY A;  5H6Q A;  3ABL B;  3ETD A;  2XDX A;  1NHJ A;  1YT1 A;  5LGU A;  1K92 A;  3INX A;  3ML0 A;  4QPJ A;  2ZBK B;  1YIJ V;  2P6J A;  4CWN A;  4BAY A;  1RM1 C;  2YI7 A;  2JJC A;  1AMW A;  4GGL A;  1H8H G;  3F7Y C;  2IU3 A;  1M1K W;  4MW3 A;  4HXW A;  5D6Q A;  4P2Z A;  2XX4 A;  4AWP A;  4O0B A;  2NNU A;  4L93 A;  4PDL A;  3GB7 C;  3R92 A;  4NH7 A;  1MSW D;  1V54 B;  3LDE A;  1S14 A;  3FYI B;  3HHU A;  4PA6 A;  1YTF B;  2XAB A;  3I56 V;  1S16 A;  1KQS U;  4JGS A;  3PEH A;  2DYR B;  4FCP A;  4HYO A;  2YED A;  4WFH A;  3IED A;  1AH8 A;  5EC2 C;  4BIZ A;  1OCZ C;  4CE2 A;  3D0B A;  1VQ6 V;  2EIJ B;  1DLB A;  2B1G A;  1JVM A;  4WFB V;  4XKO A;  3EHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...