4Q20A

Crystal structure of a c-terminal part of tyrosine kinase (divl) from caulobacter crescentus cb15 at 2.50 a resolution (psi community target, shapiro)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
233
structure length
231
Chain Sequence
ALADRSAALAEAERLKRDFVGNVSYELRTPLTTIIGYSELLERADSERGRNHVAAVRAAATQLARSIDDVLDMAQIDAGEMALEIEDIRVSDLLLNAQERALKDAQLGGVTLAVECEEDVGLIRGDGKRLAQTLDHLVENALRQTPPGGRVTLSARRALGEVRLDVSDTGRGVPFHVQAHIFDRFVGRDRGGPGLGLALVKALVELHGGWVALESEPGNGSTFTCHLPETQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cell fate regulation governed by a repurposed bacterial histidine kinase.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Transferase
molecule keywords Sensor protein DivL
total genus 77
structure length 231
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4q20A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4q20A02
3ZCCA 2EXLA 4U93A 3HYYA 2YEAA 2CCTA 5IN9A 3GIGA 1QY8A 2YEDA 1F51A 2WI7A 5D7CA 5CTUA 4KSHA 1S16A 3D2RA 3GIEA 2BREA 1ZXNA 2Q8IA 2XABA 3TZ2A 5CF0A 3B25A 2Q8HA 4FPPA 1MX0A 4L91A 4EEHA 3T10A 1JM6A 1MU5A 4GEEA 2WI1A 1YSZA 2WI3A 4O04A 4CWQA 3OWDA 3LNUA 1EA6A 5J71A 2BRCA 4MPCA 4EMVA 1UY8A 3G7EA 1ID0A 1THNA 3ZRVA 1Y4SA 3EHJA 3BMYA 2XDKA 4P7AA 3NMQA 3A0WA 1B62A 4KTNA 1AH6A 4O0BA 2YGAA 4XC0A 4AWPA 4GT1A 2YJXA 1JOYA 3R92A 5CTWA 4URNA 2YEJA 2FTKA 3D36A 4YKXA 1B63A 2BZ5A 2YKJA 1UYDA 3ZRWA 4XKKA 4URMA 5FNDA 4FCQA 1YESA 2YGFA 3INWA 3RLPA 2YEBA 5B1NA 3C0EA 4XE2A 4ASGA 2LFSA 4LWGA 5L3JA 4XD8A 1YC4A 3ZXQA 2BU8A 2H8MA 4EGHA 1NHIA 3K99A 1GKXA 1BXDA 3HZ1A 3O0IA 4L8ZA 1Z5BA 4HYMA 4PU9A 2QG0A 2WWWA 1UY7A 4GFNA 1NHJA 2VWCA 4NH7A 5F5RA 2HCHA 5BODA 4LWFA 4LC1A 3R4NA 1AMWA 3A0XA 4FMTA 2Q8FA 1UY6A 3HEKA 4P8OA 2XHXA 4L94A 3U2KA 5IDMA 3MD0A 2YEGA 4HZ0A 5M4NA 3KE6A 3OPDA 3U67A 2YE4A 1Y8NA 2JJCA 1Z59A 2K5BA 2UWDA 2YK2A 2IORA 2IWXA 2PNRA 4QPKA 4CWRA 1YC3A 2BYIA 4WUDA 4Q20A 4R3MA 4AWOA 2WI2A 2BU5A 3FT8A 1TC6A 4LP0A 3Q5KA 2YGEA 3U2DA 1ZXMA 4LWHA 2BU2A 3H80A 1ZW9A 1UYEA 3O2FA 1KIJA 4YKZA 1AH8A 2VCIA 2YKCA 2VCJA 4AWQA 3A0YA 4ASBA 4R3AA 2CCUA 3ZRWB 4XKOA 4B7PA 1YSRA 2QF6A 1H7SA 1U2OA 2ZKJA 4CWNA 3QTFA 3HYZA 4EFTA 1S14A 2ESAA 2FXSA 2VW5A 2YK9A 2YEIA 2QM7A 3B28A 2XX4A 2YE7A 1YT2A 3B27A 3GIGB 2YEEA 4V25A 4JAVA 3B26A 1YS3A 4MP7A 2XD6A 3LPSA 3EKOA 3T1KA 5J6AA 4LWIA 3ZKBA 1Y8PA 2XK2A 1UYKA 1KZNA 5D6PA 4CE1A 4LPBA 2XX5A 1YERA 2JKIA 3EHGA 3C11A 2HKJA 4AS9A 3CWVA 4JYBA 4H81A 5CTXA 2IOPA 5C93A 2E0AA 4W7TA 4B6CA 3H4LA 4DZYA 3T2SA 2YI5A 2AKPA 2YI0A 2IWSA 4I5SA 4K4OA 2IOQA 4GQTA 4R1FA 3GIFA 4XCLA 1UYLA 1UYIA 4ZKIA 3CGZA 4WUCA 4LWEA 3TK1A 4E01A 1Y8OA 4MT8A 3PEJA 2XHRA 4CWFA 2XJGA 5D7RA 4NH9A 2P67A 2YI6A 5M4KA 3K97A 2O1WA 1PVGA 3D0BA 5GGZA 4MOTA 5FNFA 2YEHA 3A0TA 1U0ZA 4YKUA 2O1UA 4YKTA 4MPNA 2XDUA 2YECA 5IDJA 3A0RA 1A4HA 1EI1A 1UYCA 4QPJA 5F3KA 4HXWA 1UYGA 4MPEA 1I5CA 4HY6A 1BYQA 3FV5A 3CRLA 3HHUA 3QDDA 1I5AA 4JAUA 3WQ9A 2XCMA 4BIZA 4I3HA 3TUHA 3RKZA 5CPHA 2WEQA 1BGQA 2YE6A 3TTZA 4L93A 4YKRA 4JASA 3OMUA 2Q2EB 4CWOA 4PRXA 4L90A 4O05A 1YT1A 4WUBA 1ZWHA 4KQVA 3G7BA 3Q5JA 3K60A 4MB9A 2YKEA 1TBWA 2BYHA 4HZ5A 1AM1A 1GKZA 1QYEA 4XIPA 5BOCA 3O6OA 1YC1A 4GCZA 1UYFA 2QFOA 3CGYA 4E02A 4JYCA 3Q5LA 4MTXA 2GFDA 2CG9A 2WI5A 3G75A 1I5DA 1R62A 2XDLA 2WERA 4CE3A 2CCSA 4XIQA 4DUHA 3BM9A 2YE5A 1I58A 2BSMA 2WI4A 5B1OA 5M4MA 1TILA 2YKIA 4YKQA 3R4OA 5M4PA 2C2AA 1TH8A 4FCRA 4MP2A 3VHDA 4U7NA 3CRKA 2LFRA 5CTYA 2QM8A 2ZDYA 1I5BA 3PEHA 3WHAA 2XJJA 4ASFA 4HXZA 4U7OA 2Q8GA 3ZXOA 2BTZA 3ZRXA 4XKAA 1NHHA 4CWPA 1US7A 2FWZA 2YE3A 4EGIA 3RLQA 1YT0A 3A0ZA 1TC0A 5M4HA 4BIUA 3MNRP 4H7QA 2YE2A 5D6QA 3OW6A 4MBCA 3EKRA 3B24A 4YKYA 3T0ZA 4HYPA 4XCJA 4BXIA 3TZ5A 4KFGA 4V26A 4FCPA 3SL2A 3EHFA 2XDSA 1UYHA 4X9LA 1Y4UA 1UY9A 2FYPA 4PL9A 4CWSA 4CWTA 4GT8A 2GQPA 2IWUA 4ZVIA 3R4MA 3JZ3A 2HG1A 3FT5A 2YEFA 4GGLA 5D7DA 4BAEA 2QG2A 3TZ4A 5FNCA 2XJXA 2YKBA 1Z5AA 3NXSA 4BQJA 3EHHA 2YJWA 3OWBA 1UYMA 1YETA 4HY1A 4JQLA 2WI6A 2BU7A 1GJVA 1H7UA 4XIRA 1AJ6A 2BU6A 4XITA 2YE8A 3ZM7A 4EGKA 4CE2A 1OSFA 2WEPA 4EFUA 5FWKA 3VHAA 3INXA 2FWYA 4YKWA 3HZ5A 3P32A 4URLA 2YI7A 3TZ0A 2YE9A 1BKNA 1Z5CA 4PRVA 1I59A 4O07A 1IXMA 1B3QA 2BT0A 2O1VA 3K98A 3VADA 2H55A 4NH8A 3RLRA 3ZKDA 3DGEA 4UROA 4KSGA 3R91A 4E00A 4XTJA 2CGFA 2XHTA 2XDXA 1L0OA 4O09A 1QZRA 1TIDA 4ASAA 4BQGA 2ZDXA 2XX2A 2ZBKB 2CH4A 3IEDA 3T0HA 3VHCA 4KP4A 4EM7A 4H85A 5M4EA 3R4PA 4XDMA
chains in the Genus database with same CATH superfamily
1CP9A 3ZCCA 3Q4HA 2X6AA 4A5UB 5IYDO 3HYYA 2RMKB 3FD9A 1HR0O 2ADPA 5IN9A 1F51A 1G6UA 5D7CA 5J9PC 4JTCB 3KKYA 3L73H 5LYJB 1NT2B 3K57A 1SQQH 4WBNB 3U11A 1GK9A 2QWOB 2Q4PA 5JCOC 3LSSA 1S5LZ 4NXMO 1HW7A 2Q8HA 4JPRA 1MX0A 1HNXO 2EIMB 5H2FZ 3RYCB 2Q0AA 1KP2A 4X88A 3CCUV 1GTOA 1XMQB 3A2FA 1MZFA 2RNBA 4NVPA 3LNUA 2ZD9A 1OCZC 5LP6A 5J71A 4FFKA 5GONB 4E72A 4CS4A 4CZZA 4G2KA 2XTAA 2PGGA 2F93B 3IC9A 1M9NA 1NR7A 3G7EA 1SETA 3T1YB 1TGOA 2LW1A 3QO5A 1K33A 3BMYA 4JI0O 5BXZA 2UXCO 4P7AA 4AHCA 5LXTA 2EIJB 4O0BA 2YGAA 5B66Z 2ZM6O 3LDCA 5IWAB 3IAYA 2YJXA 1JOYA 2CH7A 4MVRA 3R92A 2Z3YA 1VQNV 2G38A 1HNXB 1B63A 1E79G 3G67A 5LXTB 1K5SA 2P06A 4XKKA 4FCQA 2DOSA 4DUZB 1YESA 5LMUB 1Q8IA 4YJ2B 4DV7B 3RLPA 1K3EA 1QVFU 2EBOA 5B1NA 2ZQMA 5LA6B 4ASGA 1VIBA 2Q5ZA 5L3JA 2LW7A 2BU8A 5DEDA 4MVMA 1Y74B 3BEHA 1AR1B 4P30A 1BXDA 3HZ1A 3O0IA 4UUJC 4RUFA 4L8ZA 3ABLC 4PU9A 4RWUA 4K0KB 4FLWA 5L3CA 1NJIW 3BY6A 1UY7A 2YXHA 2VWCA 4OXSA 4FM2A 4FLUA 2DMXA 2YIBD 5KA6A 4LC1A 1AMWA 3A0XA 4FMTA 1HWYA 4PA4A 4JI5O 3HEKA 2YIBA 4L94A 3U2KA 5IDMA 1IVSA 3MD0A 5JQGB 1TAEA 3FAVA 1EN4A 5IJ9A 1IBKO 3SYQA 2KKWA 5IJ0A 4QNHB 1XNRO 3K9SA 1VQ8V 4DV1B 5ITZA 4G28B 4O2BA 4MVQA 2IJKA 2QKCA 1JX9A 2BU5A 3FT8A 1FXKC 1SQBH 4DV6B 4DR2B 4B3TB 2QTSA 5LA6A 3ABUA 3GWKC 1ZXMA 4LWHA 1ZW9A 3O2FA 1KIJA 4YKZA 3C90A 2JGDA 3OUSA 4R3AA 3SPCA 3P3PA 1YCIA 1IBLB 2ZT9B 4YY3B 1PV0A 3ABKC 2QF6A 2ZKJA 1UJWB 4PELA 4CWNA 1YIJV 1FJGO 1L0LH 3E8GA 1IBMB 3JAWA 4WBNA 4HYOA 2YE7A 1CPYA 3N2KA 3GIGB 1MNGA 1V54C 5K1XA 2YEEA 4I7ZB 2E5LB 3HKCA 4GX0A 2Q73A 2HHHO 1PD3A 3SJQC 2E75B 4JGSA 4LH6A 3JAWB 1AP5A 1TVKA 3RYHA 4MP7A 2RJZA 3LPSA 3EKOA 2GTSA 1YZBA 2IM9A 4PI0A 4DW0A 4LNUA 4QE7A 2KG7B 5KUMA 1UYKA 1KZNA 2YICA 4O4HA 4CE1A 4DV3B 1O9GA 3DTUB 3ABLB 1W59A 3ZHUA 3APOA 3CRAA 1R1BA 2EILC 1XMOO 1N34O 4JYBA 5KHIA 2OCCB 3AG2B 4YHHO 1R73A 4H81A 2BSKB 3OW2U 4OPAA 2IOPA 1PNMA 4W7TA 3ZMTA 3FYIB 4B6CA 1SKVA 2BOBC 1SQPH 3LNMB 1D2DA 3T2SA 4X64B 3DC5A 2CDYA 2YI0A 4PDLA 4I5SA 2Y69C 5J2UB 4GQTA 2L35A 4R1FA 3VOUA 3CGZA 4DO2A 1OHHG 1M4UA 2VWKA 1VQ6V 1YJ9V 1SQXH 4LF7B 2E3CA 2XHRA 4FLVA 4JI4O 5D7RA 4RUEA 1ZWIC 3K79A 4FM0A 1W0KG 3K97A 1N36B 2KB1A 2BTQA 2YEHA 4UV9A 5FNVB 3A0RA 3IGAC 1EI1A 2H3OA 1Y74A 4Z2WA 4QPJA 2PTMA 4NXNO 4X1IA 1UYGA 1N8RW 1BSMA 5ITZB 4LF8O 4TV9A 3SDLA 4HNAA 2F4VO 1I5AA 4WCEV 5C8YB 3WG7C 5BZBA 4DK1A 4BIZA 5H6QA 2UXDB 2Y4TA 1Q6UA 1BGQA 2YE6A 3TTZA 4DR7O 3KZIZ 1DF4A 1P4RA 1N0JA 1PKXA 2Q2EB 3QO7A 2IH3C 4DV6O 5BR8B 4KQVA 4MB9A 2YKEA 5FPRA 1TBWA 2BYHA 1AM1A 3KCXA 1QYEA 5IY5B 4JI6B 5KMGA 3ZX6A 1EM1A 5J2TB 4E02A 2X7RB 4DR5B 3Q5LA 2W6JG 4YXWG 3ZS8C 4CH4A 4MTXA 1PPJH 3OEEG 3G75A 2XDLA 2WERA 2IU0A 2CTPA 3FB7C 4IYIA 2YE5A 5LP6C 1I58A 2BSMA 2EULA 4O4IB 2HG5C 3UKMA 4CC6A 2YKIA 2RDCA 2PI4A 1R6NA 3APQA 1WA8A 5CA0A 1HDJA 4MP2A 3JALA 2DYSC 4U7NA 4UVCA 4DV1O 3CC2V 5H9CA 2QM8A 2Y0PA 4K3AA 3K5LA 2F95B 3PEHA 3FX7A 4AI8A 4U7OA 2YDEA 2P4VA 5JH7A 4L8JA 3UO2A 2BTZA 3ZXOA 1US7A 3M7MX 4UCTA 1KP3A 2H8PC 4PHZA 4X65B 3RLQA 3A0ZA 2RQ6A 1FJGB 4H7QA 2YI8A 1Y76A 4MBCA 1CEZA 4HYPA 1M57C 4BXIA 3ABMB 4O4LA 3TZ5A 1TUEB 2JDIG 3CE2A 2PYJA 3EHFA 4B7KA 1FXVA 3JASA 4X9LA 1K97A 3G4SV 5CBHA 4CWSA 1K73W 1K8AW 4NXMB 4XDJA 2IWUA 1XNQO 5C8YA 5GW7A 3R4MA 2HG1A 3FT5A 1K4DC 2YEFA 3SYOA 4BAEA 4LF9O 4TV8A 3TZ4A 3SYPA 4J7KA 1SQFA 5IT9N 4DUYO 1W2BU 4LF5B 3SJAC 1FFXA 3OWBA 1YETA 3C3SA 2ZIOA 3BABA 1YJWV 2Q7HA 1GJVA 4YY3O 1H7UA 2WLKA 4DR3O 5JCOA 4DV2O 2BU6A 2LGWA 3CMAV 1RPRA 4CS3A 2ZM6B 1RP3B 4XITA 1OCCB 2P6JA 1AJNA 4EFUA 3VHAA 2R9IA 3BA9A 4MS2A 3MAQA 3O9OA 5L3DA 1I59A 1LUVA 2GUZB 4O07A 4AQYO 1DF5A 1WLEA 2OIGA 4WFBV 4GX1A 4DV7O 3ETEA 1YXBA 2UXXA 4RO2A 4I9WA 2H94A 2DWEC 4FM1A 5LOVA 2AZ0A 2CGFA 2XHTA 2ATKC 2E74B 1SZXA 2QEXV 1TIDA 3LNNA 2D2CB 1WP8A 2RCVA 4JI8B 2E5LO 1F4MA 4EFEA 5M4EA 4H85A 1R6KA 2UXCB 3UCSC 1AR5A 4XDMA 5EBMC 1DTOA 1SC5B 3GVMA 2QKSA 1WPBA 4U93A 4MSWC 4YIOA 4GKKO 2QM4A 5CBFA 5LOVB 2YEAA 4TUYB 5B1BC 2V4DA 3GIGA 2EX3A 2WI7A 1GH6A 4I4TA 4KSHA 1YI2V 3D2RA 3GIEA 4B7EA 4DR7B 3CS5A 2Q8IA 1QR9A 4JTDB 1NR1A 5B1AC 2UUBO 4JI8O 2OWOA 1VF5B 5LMUO 3B25A 4FPPA 3CRMA 2ZE7A 4GKJO 2EILB 1UFIA 2Z0AA 5L3EA 3S3WA 4DR2O 1WB8A 4PD4F 4CWQA 1NTKH 1YJNV 2QKAA 2VQEO 1GN2A 1K92A 5H6RA 2BRCA 5KAFZ 1G8MA 3F5WC 4UVBA 3F7VC 4AQYB 3C3TA 4LCUC 1UY8A 4CH5A 3ZIAG 4I0XA 4N23A 5AG2A 3ZMZA 2NLJC 5JENA 1L1FA 2HJFC 3FB6C 4XC0A 4KFMA 3ZHSA 1Z2GA 4GT1A 3RYIA 3JD1A 5IYZB 5CTWA 3RW0A 2FTKA 5LHGA 3D36A 1S5JA 2WLHA 2AHZA 2BZ5A 5EYPA 1FAFA 5EZYA 2Y69B 4GLXA 1Y6XA 5EZYB 2YGFA 3ABTA 3W7XA 1SA0B 3THOA 2XNDG 2JGUA 1PL4A 3C0EA 4XE2A 4TT3G 1QR8A 4JV5O 4LWGA 2ZINA 1Y67A 2B9ZA 5KX5A 3SR2C 1XNQB 3ZXQA 2UXNA 3X2QC 3BHPA 2H8MA 3OMAB 5FPOA 1NHIA 4MVSA 2XT9A 1K4CC 3RYFA 4JV5B 1EBOA 4YJ3B 1QLNA 1Z5BA 3KCYA 4ABMA 3OT7A 3K5OA 1KUQA 5D5PA 3CRCA 1BHBA 1NHJA 2R9RB 4TQDA 4NH7A 2HR3A 4ZHQB 4DYLA 2CK3G 3T2MA 4DV2B 3B2EE 2WLNA 1XBLA 2PY5A 4P8OA 1N0NA 3CCMV 1N32B 2DYRC 3EFFK 2YEGA 4JTAB 3K06A 5M4NA 3U0ZA 2B1IA 1S77D 2CH7B 1IBMO 2L6LA 3FYEB 3E22B 2IORA 1TA8A 4UCUA 1JJ2U 2BYIA 4Q20A 2WI2A 1I7FA 2N05A 2WLIB 2ARHA 1TC6A 1H2GA 2AHYA 4Z1MG 3U2DA 2DW4A 3A0HZ 1AI4A 4NTYA 1AH8A 3LDDA 3SPHA 2Y0IA 3JD4A 1Q90D 3A0YA 3CMEV 4MTFA 2CCUA 1XL6A 3ZRWB 3DSQA 2B5UA 3ASOC 5HFLA 4XKOA 4XDKA 5DN6G 1H7SA 1U2OA 2OTJV 1VQOV 3WG7B 3OTFA 4EFTA 2AW9A 4LFBB 4NYKA 3G6EV 1S14A 2FXSA 2YEIA 3K3WA 4GZRB 4PA6A 3BA8A 2HHIA 2GV9A 3OD4A 2CGNA 3K08A 2BTOA 3SPIA 1AJQA 1KB9F 4JAVA 4TOIA 1XMOB 4JI1O 2OCHA 4QIWF 3B26A 5BMVA 1YS3A 1FXHA 1NQTA 2XD6A 3CSXA 3IJ4A 1RSOA 4X1IB 2A79B 3EVKA 1Z5WA 3EHBB 4KXRA 4P9PA 1GAXA 2XK2A 2UUAB 3T4DA 4O4JA 1P84F 2JKIA 3EHGA 3C11A 2HKJA 4AS9A 3MDSA 3ICXA 4DR1B 1H2NA 5D5QA 3ZN1A 1FXKA 1EZJA 5C93A 2UXBO 2CUGA 5B3SC 2YI5A 4ICGA 4QE9A 4FLXA 3W7WA 2RN9A 4K4OA 3RVZA 4JI5B 1AB3A 4W4LA 4XCLA 1UYIA 2UU9O 4UB6Z 4WUCA 4LWEA 3OR6C 4MW8A 4MTGA 3TJTA 1RM1B 1O9HA 2XJGA 3DC6A 3QG5A 1FS0G 4NH9A 2B1GA 5M4KA 1VP7A 4D7TA 1PVGA 1Y76B 4MOTA 5FNFA 1U0ZA 3U10A 4YKTA 2WLJA 3UQ8A 2YECA 5IDJA 1A4HA 3J7AU 4PA3A 1IBLO 1F4NA 4RAIA 2D3OW 1VF6C 2K1EA 5F3KA 3AK3A 4HXWA 2WPDG 4MTOA 4MPEA 5EBWC 4HY6A 3G80A 3CX5F 3AG3C 4JAUA 2QTOA 1ROPA 3AG3B 5KHHA 1PNKA 3TUHA 3RKZA 4LNUB 3SJCC 4BW5A 4G27B 2F43G 3SYAA 1B04A 4L87A 3HKEB 4CH6A 1HR0B 4L90A 2NN4A 1YT1A 1NVPD 1ZWHA 1J5EB 3G7BA 4YHHB 2WA4A 4B3SB 4X62B 1GKZA 1W0JG 3E22A 2JRIA 3SPGA 1FPOA 1YC1A 2ZNJA 1AVMA 2QFOA 2ODMA 5BY1A 3CGYA 1Q81W 2P4KA 2M7WA 2P22C 3R66A 2GFDA 4LWSB 1OCOC 4FLTA 1QU7A 3K9AA 4FZ0A 4LR3A 2BE3A 2CCSA 1S72V 5TISZ 4DUHA 4LF6B 5M4MA 3AK1A 3RWRD 2HFEC 3JYCA 4DV4O 1X4TA 1X59A 4WFGA 3R4OA 1VQ4V 1K7DA 5KAIZ 3ZHRA 2VQFO 5IJ9B 4DV5O 3ML0A 3VHDA 4DR5O 2LFRA 4X1YB 5KLVH 2ZDYA 4I55A 3AG4C 3HKEA 2Q8GA 4X8AA 3ZRXA 1R3IC 1Q7YW 3CJHA 5KMGB 2ZE8A 4DR4B 2FWZA 2YE3A 4EGIA 3A0BZ 1YT0A 1GN4A 4BIUA 3CP1A 4X1YA 2XAGA 2XHBA 1G4YB 2YE2A 1NTZH 4PI2A 5D6QA 3EKRA 1SA0A 3B24A 4YKYA 3T0ZA 2Q0OC 4DR3B 5IE9A 1LR1A 1XMQO 3CJHB 2CE4A 1VF7A 4FK5C 4FCPA 3SL2A 1S0VA 1UYHA 5LYJA 3KG2A 4RQEA 1Y4UA 3VQWA 3HKDA 1FXKB 4LWSA 2QWQB 4GT8A 4ZVIA 3CWBH 4X1KB 3DXRB 2IU3A 4LF5O 5D7DA 4YIPA 1BQ0A 2WAMA 1RM1C 5FNCA 2JEXA 3FB8C 1P49A 3BFRA 2DQ0A 1EN6A 3G6BA 5LMNO 4K8ZA 1MSWD 1H8EG 5LGTA 1U96A 1KQSU 3ABKB 1SERA 3OM3B 1Q43A 3LUTB 1H8HG 3B8NA 1JVMA 2UUAO 2KQXA 1XHXA 1Q6IA 5FWKA 1ZLZA 1BE3H 3M8AA 2UUCB 2YEVB 3CRQA 4LF4B 4ZI7A 3HZ5A 4IHJA 1QHTA 1VEWA 2YI7A 1LNQA 1S3JA 4GKKB 1FFTB 4PRVA 1EFRG 4JI7O 2X6CA 4BW9A 4DRXA 1IXMA 4PDMA 4FLYA 1B3QA 2O1VA 2Q7EA 4GYCB 4NH8A 4PV1B 3UT5B 4UROA 4KSGA 1E1RG 5A9GA 3GWOA 1L0OA 3ZMSA 1FD9A 4ASAA 2ITCC 3ZN0A 4X66B 2YC0A 5LP6B 4X20B 1BZKA 2ZR3A 2ZBKB 1I5XA 1Q86W 3R4PA 5IWAO 5A2QN 2EXLA 3JSNA 3L70H 3JCZA 2JJ1G 4ZI7B 2YEDA 1Q3EA 1S16A 4R50A 1J5EO 5B5EZ 3HKCB 2XAQA 1ZL8A 3IFXA 3DXRA 1JR9A 1ENVA 4L91A 1VQ9V 4EEHA 3T10A 1R3JC 1JM6A 1MU5A 4O4JB 4AILC 4GEEA 1THZA 2WI1A 1D5NA 1R3KC 1YSZA 2WI3A 5CB4B 4D7SA 1EA6A 3H01A 4ASUG 2R70A 1PP9H 4JAAA 4DR1O 4NKGB 1ID0A 3N2GA 1HNWB 1KU9A 1Y4SA 2A06H 3EHJA 3JATA 1N36O 3A0WA 2MK3A 4EEQA 4LF7O 1B62A 1WB7A 4KTNA 1AH6A 2VQEB 4PJ0Z 1L0NH 5E79Z 5LL6Y 1NBMG 3L9DA 4URNA 2ZXWB 4GKJB 1MSDA 3ZRSA 1AR4A 2ZDIA 2YKJA 4I50B 1SQGA 3AG1C 2HLDG 1T5EA 5FNDA 1XL4A 2Z5UA 3QVNA 5L3FA 3QTCA 3T1HO 3INWA 3OMIB 1GRJA 1UPGA 3OGIB 3B40A 1HNZO 1KBHA 4H13B 1WA8B 2LFSA 4XD8A 1YC4A 5JVDA 4WFHA 5EBLC 4DR4O 4RQFA 1HNWO 1XEQA 3K99A 1V55B 1GKXA 1K5QA 3OTOB 4HYMA 4H44B 4LFCO 2QG0A 4IIJB 1JA8A 3ETGA 2HP8A 2ZKOA 5H5NA 4GFNA 1US6A 1YTFB 2HCHA 4LWFA 3K59A 1Q6HA 1KECA 2E76B 5FL7G 4BIOA 2ADQB 1N33O 3R4NA 3ZHTA 1P7GA 4WFAV 4J11A 1Q5OA 4I0XB 3JAMN 1YITV 4ZOLA 4B3RB 1L8DA 3ETQA 2ZCEA 4OPHA 3RYCA 5BR8O 2VWJA 4IGGA 3OPDA 5LHIA 2HJDA 3I5DA 2EZOA 1MZEA 3LMMA 1Z59A 1BMFG 2GHYA 3S5TA 2IWXA 3ZMVA 4CWRA 3E35A 1YC3A 3N2GB 4WUDA 4R3MA 2QR4A 4AWOA 5IY5C 1SS3A 4LP0A 3Q5KA 2BU2A 3H80A 3T4ZA 1UYEA 5CMUA 2YKCA 3K5NA 2VCJA 4AWQA 2DWDC 3CC4V 3OEHG 3JATB 1M5IA 3L74H 3E8HA 1IZ3A 4B7PA 1KKCA 1YSRA 1Y4MA 2JEUA 4DRXB 3I56V 3BCCH 3QTFA 1MOFA 1VF6A 4BR6A 1I94O 2N04A 2YK9A 3HKBA 1FYJA 4UVAA 3B28A 1ZAUA 3E89A 5DM6V 1YT2A 3B27A 2EIKB 4JI7B 4V25A 4IYHA 4FVMA 3JARA 2ZDIC 5J2UA 3MHHC 1JMKC 4MVZA 4B3MO 4UFZA 1YDXA 2N74A 3J80N 3F7YC 5L3BA 4TSFG 2GBOA 5E1AC 3ZKBA 1Y8PA 2OT5A 2PZSA 4NB5A 2OYQA 4LPBA 2XX5A 3O65A 3S3XA 2F66C 1QLEB 1V55C 1SZTA 4BWAA 2Y48A 3CWVA 2EJ7A 3GB7C 2ZIMA 3JAKA 4DUYB 4LF4O 4Q6GA 4F6EA 3AEIA 4GX5A 1RSOB 3H4LA 4JYYA 3ZMUA 4DZYA 4FIPC 4E2LA 4DV0O 2AKPA 3P3NA 3W7UA 4LFAO 1I0HA 2DN9A 3VQXA 3QF7A 1Q82W 1AI7A 3OAAG 1UYLA 4ZKIA 1QLEC 4LF6O 3TK1A 5EK0A 3JARB 1XHZA 1H38A 2PUSA 2NR5A 3SPJA 1YEWA 1SRYA 3JD2A 2EIJC 3HB3B 2QWPB 2YI6A 3EXAA 3T1YO 2ZR2A 4X65O 5GGZA 1XUQA 4OGQB 3ASNB 5EIBD 2O1UA 4MPNA 2XDUA 2A9HA 4KL1A 1YSCA 3LSQA 2W0XA 4JI2O 1UYCA 3JCUZ 2YXYA 3JAKB 4ZBMA 1I94B 1HP8A 4LFBO 1YVWA 2UXDO 1NVPB 3FV5A 3HKDB 3ZJZA 3HHUA 3K5MA 3QDDA 2EINB 2IH1C 3WQ9A 3UM7A 2F1MA 2XCMA 4I3HA 1WN7A 4F4LA 2UXBB 2PYLA 1G1XB 3TCUA 2JGDB 2GUZA 4L93A 3M99B 2DYSB 4LFCB 4JASA 5JQGA 5LBQA 4O05A 3HR0A 3D3IA 4IIJA 4WUBA 5KHKA 3AG2C 3Q5JA 3CCJV 2PI5A 4JYAO 1WJZA 2VQFB 3T1CA 5J2TA 4XIPA 4GCZA 1WNSA 1I08A 3HKBB 1GO3F 4J9ZB 3OUFA 2FKXA 2CG9A 1I5DA 4CE3A 3QO8A 1Z5VA 4TV9B 1IXBA 3BM9A 2WI4A 3STLC 1R6TA 2ITDC 2XUMA 1CXZB 2CTWA 4YKQA 4FLZA 3RT3C 1M56C 2C2AA 5EYPB 4H37A 1OZ0A 4YJ2A 3CRKA 4XBFA 3OTOO 1VQMV 1VMGA 5CTYA 3K58A 4ASFA 4HXZA 3JASB 1GM8A 1P7BA 5KUKA 4XKAA 3H1KH 3R65A 1NHHA 3TGUH 2EIMC 1ZUQA 1TC0A 2XOKG 3ZHVA 3RYIB 5JJJB 3BRCA 1S5HC 3H1IH 1D5AA 4XCJA 4W4KA 2CTRA 2IBZH 4WF9V 2WA3A 4V26A 2BOCC 1KD1W 4JI6O 2HHHB 2YI9A 4HAMA 3PJSK 4JZGA 4PL9A 3L71H 1OJHA 2ZXWC 1H2MA 1GM9A 2QGNA 1BL8A 5CA0B 4JI3O 1RPOA 1NTMH 4B3RO 5K1PA 3NXSA 1Z5AA 1B6QA 2YJWA 3CB2A 2DYRB 3CHXA 1NKDA 4NR1A 2WI6A 4XIRA 5LGNA 5HFMA 2F4VB 1COWG 1AJ6A 4C7UA 1BQZA 1ZL8B 1YF2A 2KSDA 2R9AA 4EGKA 4CE2A 2WEPA 2A7WA 2FWYA 1OV9A 4YKWA 3TETA 4X20A 3P32A 1BKNA 3RYHB 1Z5CA 3B8MA 4PDVA 1XQ8A 2QJ1A 2XAFA 1OCCC 2BT0A 3VADA 1ORQC 4P9OA 3H1LH 3RLRA 3DGEA 3R91A 1M56B 1VQPV 4U3FH 1IDSA 3CD6V 4KHPB 2XDXA 1NS1A 2UUCO 1VQKV 4U3JB 3B4SA 1QZRA 2FB5A 4D6TH 1SQVH 4UXNA 2HEPA 2O57A 1JFFA 2YEVA 5CA1B 2Q67A 4K0KO 2CH4A 1R3LC 3IEDA 5FNVA 3T0HA 5CA1A 5LGUA 3VHCA 1NZ6A 4KP4A 4EM7A 2BTQB 2DQ3A 5GTHZ 3BPZA 5L3GA 3JSLA 1BT8A 1IURA 5IJ0B 3W7TA 2LGQA 3ZEDA 1FKAO 2CCTA 2A3QA 1QY8A 4DK0A 5CTUA 2HVKC 4JI4B 1AJPA 3PN1A 2BREA 1ZXNA 5DECA 1VQ7V 1XNRB 1AP6A 3FB5C 2YXLA 2V7QG 2XABA 3WB1A 2CTQA 1KC8W 4WFFA 3TZ2A 1OCZB 5CF0A 4X66O 1N4CA 1AILA 1DLBA 2EINC 4O04A 3OWDA 5IYCO 4H0LB 2QWRB 5B1AB 3CRRA 1GMGA 1E1QG 4ZIBA 5KX5B 4MPCA 1XILA 4EMVA 4TWKA 3ZHQA 5GTIZ 5EC1C 2OTLV 3FAVB 1THNA 4FFBB 2ILMA 4O2AA 2V1DA 3ZRVA 5IYBO 2XDKA 2ZE5A 2GSMB 3NMQA 1N33B 2Q68A 3CCLV 4AWPA 4I55B 3A8TA 2IJIA 4MVOA 2QSAA 4XDLA 1B06A 2YEJA 4UCRA 2LP7A 4DXWA 4YKXA 4WFEA 5CBGA 3LDEA 1UYDA 1F23A 4QJFB 3OE7G 3ZRWA 1BCCH 4URMA 2AGAA 4CC5A 2JS3A 1LUWA 4HZ3A 4X64O 5JH7B 2UUBB 3FKSG 4ZOLB 2YEBA 1GN3A 1YTFD 2WLIA 3L75H 2IJHA 5JWPA 2Q9LA 2WSSG 2VS0A 5CA3A 1H2KA 1QQCA 1N32O 4EGHA 1ZSPA 2EZPA 2YIAA 4B08A 2PF4E 1N34B 2FMLA 1OCRB 2OIEA 3OR7C 1NU1H 1XOUA 3E8BA 4X1KA 2W0FC 2WWWA 1QNMA 4PA7A 4JZ2A 5F5RA 2AZ2A 5BODA 2WLMA 4UCOA 1J95A 1VQ5V 3RVYA 4O2BB 1NH2B 2Q8FA 1UY6A 1KKDA 2XHXA 1GN6A 2X0LA 4HZ0A 3KE6A 3F5TA 4LF9B 3U67A 1OCOB 3K0GA 4F6RA 2YE4A 1Y8NA 2JJCA 3IC7A 2K5BA 1S76D 2UWDA 2YK2A 3BAAA 2PNRA 5GONA 4QPKA 4I50A 4DUZO 1BGYH 5JJNB 4DV4B 4UB8Z 3VBBA 5B3SB 2YGEA 1F7YA 4K35A 3H1HH 3HPLC 2GDSA 2VCIA 4HNAB 4I9QA 4ASBA 1M57B 2MW2B 2GTAA 2UU9B 4R7CA 4UV8A 1JCHA 5KHGA 2XASA 3LSUA 5FLXN 3AK2A 5IYZA 4N21A 3HYZA 4LF8B 2ESAA 2VW5A 5LMNB 1DK1A 2QM7A 4IT5A 2XX4A 2DJVA 4HBNA 1TUBA 1EN5A 3VQVA 3H9VA 1JFFB 4LH7A 1MMMA 4EB6B 3K0DA 1I5YA 3T1KA 1V54B 5KA5A 5J6AA 2EIKC 2QA4V 4LWIA 4E4EA 3AG7A 2BSKA 1V9PA 4I4TB 4CBCA 5D6PA 4TUYA 4UCVA 1YERA 1OCRC 1PNLA 4X62O 2ETNA 4J7ZA 4UCSA 2YS8A 3E2EA 4DW1A 3ETDA 4U3JA 4O4HB 3I55V 2LO1A 4JYAB 1HNZB 2KG7A 5CTXA 1XI1A 3CXCU 2E0AA 1TVKB 1VARA 1K9MW 1PL0A 4GX2A 1AI6A 2IWSA 3AG1B 3CYOA 2X6BA 2IOQA 3GIFA 1AI5A 1DGSA 3D3QA 5BMVB 4NTXA 2C1GA 4J41A 4LP8A 5EIBC 3E83A 4J80A 4E01A 1Y8OA 4NXNB 2A0LA 1M90W 2JIZG 3N2KB 4MT8A 1KYOF 2QDOA 2QE7G 1MA1A 4FZ1A 3PEJA 4CWFA 3WB2A 4EB6A 3SJBC 2WLLA 2P90A 2IW5A 2P67A 2VRZA 1QCEA 1ZX3A 4LBEC 2O1WA 3D0BA 4JI2B 3A0TA 3ASNC 4J7JA 4YKUA 4B3SO 1VQLV 3OMNB 3ABMC 2Y4UA 1YHQV 3QNEA 4PDRA 3ZBHA 1MABG 2AXTZ 4ZHQA 2XAJA 1I5CA 1NI8A 1BYQA 3RFRA 3J81N 2P5OA 2DE0X 4DR6O 3CRLA 1XDCA 3JD0A 1RFYA 3WFVA 1WAZA 4JI1B 5CPHA 2C1IA 4MVUA 2WEQA 3CCVV 4TV8B 3D8CA 4J42A 3ASOB 4F6RB 4LFAB 3CEIA 2W6IG 4YKRA 1IX9A 1AROP 3OMUA 4CWOA 4PRXA 3E8FA 4PA9A 2F23A 3K60A 2OCCC 4YJ3A 2FL4A 4HZ5A 5BOCA 3O6OA 1QBZA 1H2LA 1U97A 3CXHF 4O4LB 3TXQA 1UYFA 3JD3A 4JYCA 1H2SB 3JALB 1PM9A 2NNUA 2WI5A 1M93A 1R62A 4XIQA 4CS2A 2JVDA 3UO3A 4R8CA 5LHHA 5B1OA 1TILA 3L72H 4B3MB 5M4PA 1KMIZ 5EC2C 3G71V 1TH8A 4FCRA 2QWNB 4P2ZA 2YSUB 2XAHA 1I5BA 3WHAA 1SF9A 2XJJA 3K04A 5F2VO 4TQFA 4EKWA 4CWPA 3CCQV 5CB4A 1Y66A 4MW3A 2LQTA 1WP7A 3STZC 4DV3O 5M4HA 1QVGU 2Q6AA 3VQYA 3D36C 3MNRP 1EZVH 3X2QB 3OW6A 1WPXA 1JPXA 2R72A 3WU2Z 3CPWU 3K03A 1XREA 4KFGA 5JJEB 2JK5C 4B3TO 2EJRA 3NR7A 2JS5A 2Q69A 5B1BB 4OX9B 2XDSA 1UY9A 2FYPA 1JQ0A 2ZE6A 3TXSA 4CWTA 2CGOA 2GQPA 2ZNIA 3CYGA 2YIDA 3CCSV 1A32A 3JZ3A 4NTWA 1JJOA 2K9PA 4GGLA 3RN4A 1IBKB 2QG2A 3RYFB 4JI0B 3UT5A 2XJXA 1BHAA 3WB0A 3T1HB 2YKBA 4JI3B 4X9QA 4K8XA 4O4IA 4QGPA 4BQJA 3EHHA 2IJJA 5JVDB 1UYMA 4IL6Z 4HY1A 4JQLA 3OGCC 1BS3A 4Z1VA 4H33A 2BU7A 2BCCH 4JF3A 3P30A 4OX9O 4FJCC 4IHJB 2HVJC 3Q4HB 2LJ2A 4EFBA 2YE8A 3ZM7A 1M1KW 2JJ2G 1OSFA 2P7TC 3RGBA 1URFA 4FFBA 4O2AB 3INXA 3B09A 2YUAA 1ZTEA 2FYUH 3FFQA 3RBZA 4DV0B 4URLA 3TZ0A 2Q7GA 3CCRV 2YE9A 3H1JH 3AG4B 3MHSC 1GM7A 4J10A 3BVOA 3SYCA 3B77A 4DV5B 3CC7V 3K98A 1FFXB 4R6ZA 2H55A 1TUBB 1MG1A 3ZKDA 3E86A 3W7SA 4E00A 4XTJA 4GUNA 2HKOA 2Q8VA 4O09A 2WLLB 3OFNG 5KHJA 2CAZC 1NH2D 4X89A 2M6YA 4DR6B 3N27A 4J9YB 4KHPO 3SGIA 4BQGA 2ZDXA 2XX2A 1SESA 1GKFA 4BAYA 3CCEV 5CN0A 4KUMA 1K34A 4CH3A
chains in the Genus database with same CATH topology
1CP9A 3ZCCA 2QKSA 3W7TA 2EXLA 4U93A 2X6AA 4MSWC 5IYDO 3HYYA 5CBFA 3JCZA 2YEAA 5B1BC 2CCTA 2JJ1G 3GIGA 1QY8A 2YEDA 1F51A 2WI7A 5D7CA 2HVKC 5J9PC 4JTCB 4KSHA 5CTUA 1S16A 4R50A 1YI2V 3D2RA 1AJPA 3GIEA 2BREA 1ZXNA 2XAQA 1VQ7V 2Q8IA 1QR9A 3FB5C 1GK9A 4JTDB 3LSSA 1NR1A 2V7QG 5B1AC 1KC8W 2XABA 3TZ2A 4WFFA 3IFXA 1OCZB 5CF0A 3B25A 2Q8HA 4JPRA 4FPPA 1MX0A 1ENVA 2EIMB 4L91A 1KP2A 1VQ9V 4EEHA 4X88A 3CCUV 2EILB 1R3JC 1JM6A 3T10A 1MU5A 5L3EA 1GTOA 4GEEA 1THZA 2WI1A 1R3KC 1DLBA 2EINC 1YSZA 2WI3A 4O04A 4CWQA 3OWDA 1YJNV 3LNUA 5IYCO 1EA6A 2ZD9A 1OCZC 1K92A 5H6RA 2BRCA 5J71A 5B1AB 1GMGA 1E1QG 3H01A 1G8MA 3F5WC 4UVBA 4MPCA 4ASUG 4CZZA 4G2KA 4EMVA 3F7VC 4TWKA 4LCUC 1M9NA 1UY8A 1NR7A 3G7EA 5EC1C 1SETA 1ID0A 3ZIAG 2OTLV 1THNA 3QO5A 3ZRVA 2V1DA 1Y4SA 1K33A 4N23A 3EHJA 3BMYA 5IYBO 2XDKA 3ZMZA 4P7AA 2NLJC 3NMQA 2GSMB 3A0WA 2MK3A 1B62A 2EIJB 1L1FA 2HJFC 2Q68A 3FB6C 1AH6A 2YGAA 4KTNA 4O0BA 4XC0A 3CCLV 3LDCA 4AWPA 4KFMA 4GT1A 2YJXA 1JOYA 1NBMG 3JD1A 4MVRA 3R92A 2IJIA 5CTWA 4MVOA 4XDLA 3RW0A 4URNA 2YEJA 2FTKA 2ZXWB 2Z3YA 2LP7A 3D36A 3ZRSA 5LHGA 4DXWA 1VQNV 4YKXA 2WLHA 1B63A 4WFEA 1E79G 2AHZA 2ZDIA 3LDEA 5CBGA 2BZ5A 1UYDA 1F23A 2YKJA 3AG1C 4QJFB 1K5SA 2HLDG 3OE7G 3ZRWA 4XKKA 2Y69B 4URMA 5FNDA 1XL4A 2Z5UA 5L3FA 4FCQA 1YESA 4HZ3A 3ABTA 3W7XA 2YGFA 3INWA 3OMIB 3RLPA 1K3EA 3FKSG 1QVFU 2XNDG 2YEBA 2EBOA 5B1NA 1YTFD 2ZQMA 2WLIA 3C0EA 4XE2A 4TT3G 4ASGA 2IJHA 1QR8A 2LFSA 4LWGA 5L3JA 4XD8A 1YC4A 4WFHA 5EBLC 3ZXQA 2WSSG 2UXNA 3X2QC 5CA3A 2BU8A 2H8MA 3OMAB 4RQFA 4EGHA 1NHIA 4MVMA 3K99A 4MVSA 1V55B 3BEHA 1AR1B 1GKXA 4P30A 1BXDA 1K4CC 2EZPA 1K5QA 3HZ1A 3O0IA 1OCRB 3OR7C 4UUJC 4RUFA 3E8BA 1EBOA 4L8ZA 1QLNA 1Z5BA 3ABLC 4HYMA 4PU9A 2W0FC 2QG0A 5L3CA 1NJIW 3BY6A 2WWWA 3ETGA 1UY7A 4PA7A 4GFNA 1BHBA 1NHJA 2R9RB 2VWCA 1YTFB 4NH7A 2HR3A 2HCHA 4OXSA 5F5RA 5BODA 2WLMA 4LWFA 1J95A 5KA6A 2CK3G 1KECA 3T2MA 1VQ5V 5FL7G 3RVYA 1NH2B 4LC1A 3R4NA 1AMWA 2WLNA 3A0XA 4FMTA 1HWYA 2Q8FA 4PA4A 1UY6A 3HEKA 4P8OA 4WFAV 1KKDA 2XHXA 4L94A 3U2KA 5IDMA 3MD0A 3CCMV 2DYRC 3EFFK 2YEGA 2X0LA 4JTAB 4HZ0A 3K06A 1YITV 5M4NA 3KE6A 3OPDA 3U67A 2B1IA 5LHIA 3SYQA 1OCOB 3K0GA 1S77D 4QNHB 2QF6A 2YE4A 2EZOA 1Y8NA 1VQ8V 2JJCA 3IC7A 1Z59A 1BMFG 3FYEB 1S76D 2K5BA 2UWDA 2YK2A 2IORA 2GHYA 4G28B 2IWXA 2PNRA 4QPKA 1JJ2U 3ZMVA 4CWRA 3E35A 1YC3A 2BYIA 4MVQA 2IJKA 4WUDA 4Q20A 4R3MA 4AWOA 1JX9A 5IY5C 2WI2A 2BU5A 3FT8A 1FXKC 3VBBA 2WLIB 1TC6A 3ABUA 1H2GA 2AHYA 4LP0A 3Q5KA 4Z1MG 5B3SB 2YGEA 3U2DA 1ZXMA 4LWHA 2DW4A 2BU2A 1AI4A 3HPLC 1ZW9A 3T4ZA 1UYEA 3H80A 3O2FA 5CMUA 1KIJA 4YKZA 1AH8A 2VCIA 3LDDA 2YKCA 3SPHA 3JD4A 2VCJA 4AWQA 3A0YA 4ASBA 5IN9A 2DWDC 1M57B 3OEHG 3OUSA 3CMEV 4MTFA 3SPCA 3CC4V 2CCUA 1XL6A 3ZRWB 4R3AA 2B5UA 3ASOC 5HFLA 3E8HA 4R7CA 4XKOA 4B7PA 4XDKA 1YSRA 1Y4MA 3ABKC 5DN6G 1H7SA 4UV8A 1JCHA 2JEUA 1UJWB 4PELA 1U2OA 3I56V 2XASA 2ZKJA 4CWNA 1YIJV 2OTJV 1MOFA 4N21A 3HYZA 1VQOV 3WG7B 3QTFA 4EFTA 3G6EV 1S14A 3E8GA 2ESAA 2FXSA 2VW5A 2YK9A 2YEIA 3K3WA 2QM7A 4PA6A 4UVAA 4HYOA 3B28A 2XX4A 2YE7A 3E89A 5DM6V 1YT2A 1CPYA 3B27A 2EIKB 3GIGB 3K08A 1V54C 2YEEA 3SPIA 1AJQA 4GX0A 4V25A 4JAVA 2ZDIC 1PD3A 3SJQC 3MHHC 4QIWF 3B26A 4JGSA 1YS3A 4MP7A 1FXHA 1NQTA 3K0DA 4MVZA 2XD6A 3LPSA 3EKOA 3F7YC 1I5YA 5L3BA 3T1KA 1V54B 2A79B 5KA5A 4TSFG 2EIKC 2QA4V 5J6AA 5E1AC 4LWIA 3ZKBA 1Y8PA 2OT5A 3EHBB 4P9PA 4QE7A 2XK2A 5KUMA 1UYKA 4CBCA 3T4DA 1KZNA 5D6PA 4CE1A 4LPBA 2XX5A 3DTUB 3ABLB 1OCRC 1YERA 1PNLA 2JKIA 3EHGA 3C11A 1QLEB 1V55C 2EILC 3E2EA 2HKJA 1SZTA 4AS9A 2Y48A 3CWVA 3GB7C 4JYBA 3ETDA 2OCCB 3ZN1A 3I55V 1FXKA 1EZJA 3AG2B 1R73A 4H81A 3AEIA 5CTXA 3OW2U 4GX5A 2IOPA 3CXCU 5C93A 1PNMA 2E0AA 4W7TA 3ZMTA 3FYIB 4B6CA 1K9MW 2BOBC 3LNMB 3H4LA 1PL0A 4DZYA 3ZMUA 3T2SA 4FIPC 4GX2A 4E2LA 1AI6A 5B3SC 3W7UA 2AKPA 2YI5A 4QE9A 2YI0A 2IWSA 3AG1B 4I5SA 3CYOA 2X6BA 2Y69C 4PDLA 3RVZA 3W7WA 4K4OA 2IOQA 4GQTA 4R1FA 3GIFA 1Q82W 1AI7A 1AI5A 3OAAG 1UYIA 1UYLA 4XCLA 3VOUA 4ZKIA 3CGZA 4WUCA 1QLEC 4LP8A 4LWEA 3OR6C 4MW8A 3E83A 1OHHG 4DO2A 4MTGA 3TK1A 5EK0A 4E01A 1RM1B 1Y8OA 1VQ6V 1H38A 2A0LA 1YJ9V 1M90W 2JIZG 3SPJA 4MT8A 2QE7G 3PEJA 2XHRA 1SRYA 3JD2A 4CWFA 2XJGA 2EIJC 1FS0G 2WLLA 3HB3B 5D7RA 4CE3A 2P90A 2IW5A 2P67A 1ZWIC 1QCEA 2B1GA 4LBEC 4RUEA 2YI6A 4NH9A 5M4KA 3K79A 2ZR2A 1W0KG 3K97A 2O1WA 1PVGA 3D0BA 5GGZA 2KB1A 4MOTA 5FNFA 2YEHA 3A0TA 3ASNC 1U0ZA 4YKUA 3ASNB 4UV9A 2O1UA 2WLJA 4MPNA 2XDUA 2YECA 2A9HA 5IDJA 1YSCA 4YKTA 3A0RA 1A4HA 3IGAC 3LSQA 4PA3A 1EI1A 1F4NA 1VQLV 4RAIA 1UYCA 3OMNB 3ABMC 4QPJA 2D3OW 2K1EA 1YHQV 5F3KA 3QNEA 4PDRA 1MABG 4ZBMA 1UYGA 1N8RW 4HXWA 2WPDG 2XAJA 4MTOA 5EBWC 1I5CA 4HY6A 4MPEA 1BYQA 1NVPB 3FV5A 3ZJZA 3CRLA 3HHUA 3QDDA 1I5AA 3AG3C 4WCEV 2EINB 4JAUA 3JD0A 2IH1C 3WG7C 3WQ9A 3UM7A 2QTOA 5BZBA 1ROPA 3AG3B 4BIZA 3WFVA 2XCMA 4I3HA 1PNKA 3TUHA 5H6QA 3RKZA 5CPHA 4MVUA 2WEQA 4F4LA 3CCVV 1BGQA 2YE6A 3TCUA 3ASOB 4G27B 4BW5A 2F43G 3TTZA 3SYAA 4L93A 3M99B 4L87A 1DF4A 1P4RA 2DYSB 2W6IG 4YKRA 1PKXA 4JASA 1AROP 2Q2EB 3OMUA 3QO7A 4CWOA 4PRXA 2IH3C 3E8FA 5LBQA 4L90A 4O05A 1YT1A 3D3IA 1NVPD 4WUBA 1ZWHA 3AG2C 3G7BA 4PA9A 3Q5JA 3K60A 3CCJV 2PI5A 4KQVA 2OCCC 4MB9A 2YKEA 1TBWA 2BYHA 4HZ5A 1AM1A 3T1CA 1GKZA 1QYEA 1W0JG 5IY5B 4XIPA 5BOCA 3SPGA 3O6OA 1YC1A 1QBZA 4GCZA 1UYFA 2QFOA 1GO3F 3CGYA 3JD3A 2X7RB 1Q81W 4E02A 4JYCA 2M7WA 2W6JG 4J9ZB 4YXWG 3Q5LA 4MTXA 2GFDA 3OUFA 2CG9A 2NNUA 1OCOC 2WI5A 3OEEG 3K9AA 1I5DA 1R62A 2XDLA 2WERA 2IU0A 2CCSA 3QO8A 1S72V 3G75A 4XIQA 4DUHA 3FB7C 3BM9A 2YE5A 1I58A 2BSMA 2WI4A 4R8CA 5LHHA 5B1OA 3STLC 1TILA 2HG5C 2ITDC 3UKMA 5M4MA 2YKIA 4YKQA 2HFEC 3JYCA 4WFGA 2PI4A 3R4OA 5M4PA 1R6NA 1VQ4V 1K7DA 5EC2C 3G71V 1M56C 2C2AA 1TH8A 4H37A 4FCRA 4MP2A 3ML0A 1OZ0A 3VHDA 2DYSC 4P2ZA 4U7NA 4UVCA 3CRKA 2LFRA 4XBFA 3CC2V 1VQMV 2YSUB 5H9CA 5CTYA 2QM8A 2XAHA 2ZDYA 1I5BA 3PEHA 3WHAA 2XJJA 4ASFA 3AG4C 4HXZA 4U7OA 2Q8GA 1GM8A 1P7BA 3K04A 4X8AA 2BTZA 5KUKA 3ZXOA 3ZRXA 4XKAA 3R65A 1R3IC 1Q7YW 1NHHA 4CWPA 4EKWA 1US7A 3CCQV 1Y66A 2FWZA 2YE3A 1KP3A 4MW3A 2H8PC 3RLQA 3STZC 1YT0A 2EIMC 3A0ZA 1TC0A 4EGIA 5M4HA 1QVGU 2Q6AA 2XOKG 3CP1A 4BIUA 2XAGA 3MNRP 4H7QA 1G4YB 3X2QB 2YE2A 5D6QA 3OW6A 1WPXA 1S5HC 4MBCA 3EKRA 3B24A 4YKYA 1CEZA 1JPXA 3T0ZA 4HYPA 1M57C 4XCJA 3ABMB 3CPWU 4BXIA 3K03A 3TZ5A 4WF9V 1TUEB 4KFGA 4FK5C 2JDIG 2JK5C 4V26A 4FCPA 2BOCC 3SL2A 1S0VA 3EHFA 2EJRA 1KD1W 2Q69A 5B1BB 1UYHA 2XDSA 1FXVA 4X9LA 4HAMA 3KG2A 4RQEA 1K97A 1UY9A 1Y4UA 2FYPA 3PJSK 3G4SV 1JQ0A 1FXKB 5CBHA 4PL9A 4CWSA 4CWTA 4GT8A 1K73W 1K8AW 2GQPA 2IWUA 4XDJA 4ZVIA 3CCSV 5GW7A 2ZXWC 3JZ3A 3R4MA 2HG1A 1GM9A 1K4DC 1BL8A 2IU3A 3FT5A 2YEFA 3SYOA 4GGLA 5D7DA 4BAEA 1RPOA 2QG2A 3TZ4A 2WAMA 3SYPA 1RM1C 5FNCA 2JEXA 3FB8C 2XJXA 1BHAA 2YKBA 2DQ0A 1W2BU 1MSWD 3NXSA 1Z5AA 3EHHA 1H8EG 1B6QA 5LGTA 2YJWA 2IJJA 4BQJA 2DYRB 1KQSU 3OWBA 3ABKB 1UYMA 1YETA 1SERA 1NKDA 3OM3B 4HY1A 4JQLA 3OGCC 2WI6A 2BU7A 4H33A 1YJWV 3LUTB 1GJVA 1H7UA 4JF3A 1H8HG 3P30A 5LGNA 3B8NA 2WLKA 4XIRA 4FJCC 5HFMA 2HVJC 1COWG 1JVMA 1AJ6A 2BU6A 3CMAV 1RPRA 4XITA 2YE8A 3ZM7A 1M1KW 1OCCB 2P6JA 2JJ2G 4EGKA 4CE2A 1OSFA 2WEPA 2P7TC 1AJNA 4EFUA 5FWKA 3VHAA 2R9IA 4MS2A 3INXA 2FWYA 4YKWA 3TETA 2YEVB 3HZ5A 3P32A 3RBZA 4URLA 2YI7A 3TZ0A 1LNQA 3CCRV 1S3JA 5L3DA 2YE9A 1BKNA 1Z5CA 1FFTB 3B8MA 4PDVA 1EFRG 3AG4B 3MHSC 1GM7A 2X6CA 1I59A 4PRVA 4O07A 2XAFA 1DF5A 1WLEA 1IXMA 1OCCC 3SYCA 3B77A 4WFBV 4PDMA 4GX1A 3ETEA 1B3QA 3CC7V 2BT0A 2O1VA 3K98A 3VADA 1ORQC 4P9OA 4R6ZA 2UXXA 4RO2A 4I9WA 1MG1A 2H55A 4NH8A 2H94A 2DWEC 3RLRA 3ZKDA 3DGEA 3E86A 4KSGA 3W7SA 4UROA 3R91A 4XTJA 1M56B 1VQPV 4E00A 1E1RG 2CGFA 2HKOA 2XHTA 3CD6V 2ATKC 3GWOA 2XDXA 1L0OA 3ZMSA 4O09A 2WLLB 1VQKV 1QZRA 3OFNG 2QEXV 1NH2D 1TIDA 4ASAA 4X89A 2ITCC 3ZN0A 4J9YB 4UXNA 4BQGA 2YEVA 2Q67A 2ZDXA 2XX2A 1SESA 2ZR3A 2CH4A 1R3LC 2ZBKB 1GKFA 4BAYA 3IEDA 3T0HA 3CCEV 5LGUA 3VHCA 5CN0A 1F4MA 4KP4A 4EM7A 4H85A 5M4EA 1I5XA 1R6KA 1Q86W 4KUMA 2DQ3A 3R4PA 5L3GA 4XDMA 5EBMC 1K34A 1DTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCC A;  2EXL A;  4U93 A;  3HYY A;  2YEA A;  2CCT A;  5IN9 A;  3GIG A;  1QY8 A;  2YED A;  1F51 A;  2WI7 A;  5D7C A;  5CTU A;  4KSH A;  1S16 A;  3D2R A;  3GIE A;  2BRE A;  1ZXN A;  2Q8I A;  2XAB A;  3TZ2 A;  5CF0 A;  3B25 A;  2Q8H A;  4FPP A;  1MX0 A;  4L91 A;  4EEH A;  3T10 A;  1JM6 A;  1MU5 A;  4GEE A;  2WI1 A;  1YSZ A;  2WI3 A;  4O04 A;  4CWQ A;  3OWD A;  3LNU A;  1EA6 A;  5J71 A;  2BRC A;  4MPC A;  4EMV A;  1UY8 A;  3G7E A;  1ID0 A;  1THN A;  3ZRV A;  1Y4S A;  3EHJ A;  3BMY A;  2XDK A;  4P7A A;  3NMQ A;  3A0W A;  1B62 A;  4KTN A;  1AH6 A;  4O0B A;  2YGA A;  4XC0 A;  4AWP A;  4GT1 A;  2YJX A;  1JOY A;  3R92 A;  5CTW A;  4URN A;  2YEJ A;  2FTK A;  3D36 A;  4YKX A;  1B63 A;  2BZ5 A;  2YKJ A;  1UYD A;  3ZRW A;  4XKK A;  4URM A;  5FND A;  4FCQ A;  1YES A;  2YGF A;  3INW A;  3RLP A;  2YEB A;  5B1N A;  3C0E A;  4XE2 A;  4ASG A;  2LFS A;  4LWG A;  5L3J A;  4XD8 A;  1YC4 A;  3ZXQ A;  2BU8 A;  2H8M A;  4EGH A;  1NHI A;  3K99 A;  1GKX A;  1BXD A;  3HZ1 A;  3O0I A;  4L8Z A;  1Z5B A;  4HYM A;  4PU9 A;  2QG0 A;  2WWW A;  1UY7 A;  4GFN A;  1NHJ A;  2VWC A;  4NH7 A;  5F5R A;  2HCH A;  5BOD A;  4LWF A;  4LC1 A;  3R4N A;  1AMW A;  3A0X A;  4FMT A;  2Q8F A;  1UY6 A;  3HEK A;  4P8O A;  2XHX A;  4L94 A;  3U2K A;  5IDM A;  3MD0 A;  2YEG A;  4HZ0 A;  5M4N A;  3KE6 A;  3OPD A;  3U67 A;  2YE4 A;  1Y8N A;  2JJC A;  1Z59 A;  2K5B A;  2UWD A;  2YK2 A;  2IOR A;  2IWX A;  2PNR A;  4QPK A;  4CWR A;  1YC3 A;  2BYI A;  4WUD A;  4Q20 A;  4R3M A;  4AWO A;  2WI2 A;  2BU5 A;  3FT8 A;  1TC6 A;  4LP0 A;  3Q5K A;  2YGE A;  3U2D A;  1ZXM A;  4LWH A;  2BU2 A;  3H80 A;  1ZW9 A;  1UYE A;  3O2F A;  1KIJ A;  4YKZ A;  1AH8 A;  2VCI A;  2YKC A;  2VCJ A;  4AWQ A;  3A0Y A;  4ASB A;  4R3A A;  2CCU A;  3ZRW B;  4XKO A;  4B7P A;  1YSR A;  2QF6 A;  1H7S A;  1U2O A;  2ZKJ A;  4CWN A;  3QTF A;  3HYZ A;  4EFT A;  1S14 A;  2ESA A;  2FXS A;  2VW5 A;  2YK9 A;  2YEI A;  2QM7 A;  3B28 A;  2XX4 A;  2YE7 A;  1YT2 A;  3B27 A;  3GIG B;  2YEE A;  4V25 A;  4JAV A;  3B26 A;  1YS3 A;  4MP7 A;  2XD6 A;  3LPS A;  3EKO A;  3T1K A;  5J6A A;  4LWI A;  3ZKB A;  1Y8P A;  2XK2 A;  1UYK A;  1KZN A;  5D6P A;  4CE1 A;  4LPB A;  2XX5 A;  1YER A;  2JKI A;  3EHG A;  3C11 A;  2HKJ A;  4AS9 A;  3CWV A;  4JYB A;  4H81 A;  5CTX A;  2IOP A;  5C93 A;  2E0A A;  4W7T A;  4B6C A;  3H4L A;  4DZY A;  3T2S A;  2YI5 A;  2AKP A;  2YI0 A;  2IWS A;  4I5S A;  4K4O A;  2IOQ A;  4GQT A;  4R1F A;  3GIF A;  4XCL A;  1UYL A;  1UYI A;  4ZKI A;  3CGZ A;  4WUC A;  4LWE A;  3TK1 A;  4E01 A;  1Y8O A;  4MT8 A;  3PEJ A;  2XHR A;  4CWF A;  2XJG A;  5D7R A;  4NH9 A;  2P67 A;  2YI6 A;  5M4K A;  3K97 A;  2O1W A;  1PVG A;  3D0B A;  5GGZ A;  4MOT A;  5FNF A;  2YEH A;  3A0T A;  1U0Z A;  4YKU A;  2O1U A;  4YKT A;  4MPN A;  2XDU A;  2YEC A;  5IDJ A;  3A0R A;  1A4H A;  1EI1 A;  1UYC A;  4QPJ A;  5F3K A;  4HXW A;  1UYG A;  4MPE A;  1I5C A;  4HY6 A;  1BYQ A;  3FV5 A;  3CRL A;  3HHU A;  3QDD A;  1I5A A;  4JAU A;  3WQ9 A;  2XCM A;  4BIZ A;  4I3H A;  3TUH A;  3RKZ A;  5CPH A;  2WEQ A;  1BGQ A;  2YE6 A;  3TTZ A;  4L93 A;  4YKR A;  4JAS A;  3OMU A;  2Q2E B;  4CWO A;  4PRX A;  4L90 A;  4O05 A;  1YT1 A;  4WUB A;  1ZWH A;  4KQV A;  3G7B A;  3Q5J A;  3K60 A;  4MB9 A;  2YKE A;  1TBW A;  2BYH A;  4HZ5 A;  1AM1 A;  1GKZ A;  1QYE A;  4XIP A;  5BOC A;  3O6O A;  1YC1 A;  4GCZ A;  1UYF A;  2QFO A;  3CGY A;  4E02 A;  4JYC A;  3Q5L A;  4MTX A;  2GFD A;  2CG9 A;  2WI5 A;  3G75 A;  1I5D A;  1R62 A;  2XDL A;  2WER A;  4CE3 A;  2CCS A;  4XIQ A;  4DUH A;  3BM9 A;  2YE5 A;  1I58 A;  2BSM A;  2WI4 A;  5B1O A;  5M4M A;  1TIL A;  2YKI A;  4YKQ A;  3R4O A;  5M4P A;  2C2A A;  1TH8 A;  4FCR A;  4MP2 A;  3VHD A;  4U7N A;  3CRK A;  2LFR A;  5CTY A;  2QM8 A;  2ZDY A;  1I5B A;  3PEH A;  3WHA A;  2XJJ A;  4ASF A;  4HXZ A;  4U7O A;  2Q8G A;  3ZXO A;  2BTZ A;  3ZRX A;  4XKA A;  1NHH A;  4CWP A;  1US7 A;  2FWZ A;  2YE3 A;  4EGI A;  3RLQ A;  1YT0 A;  3A0Z A;  1TC0 A;  5M4H A;  4BIU A;  3MNR P;  4H7Q A;  2YE2 A;  5D6Q A;  3OW6 A;  4MBC A;  3EKR A;  3B24 A;  4YKY A;  3T0Z A;  4HYP A;  4XCJ A;  4BXI A;  3TZ5 A;  4KFG A;  4V26 A;  4FCP A;  3SL2 A;  3EHF A;  2XDS A;  1UYH A;  4X9L A;  1Y4U A;  1UY9 A;  2FYP A;  4PL9 A;  4CWS A;  4CWT A;  4GT8 A;  2GQP A;  2IWU A;  4ZVI A;  3R4M A;  3JZ3 A;  2HG1 A;  3FT5 A;  2YEF A;  4GGL A;  5D7D A;  4BAE A;  2QG2 A;  3TZ4 A;  5FNC A;  2XJX A;  2YKB A;  1Z5A A;  3NXS A;  4BQJ A;  3EHH A;  2YJW A;  3OWB A;  1UYM A;  1YET A;  4HY1 A;  4JQL A;  2WI6 A;  2BU7 A;  1GJV A;  1H7U A;  4XIR A;  1AJ6 A;  2BU6 A;  4XIT A;  2YE8 A;  3ZM7 A;  4EGK A;  4CE2 A;  1OSF A;  2WEP A;  4EFU A;  5FWK A;  3VHA A;  3INX A;  2FWY A;  4YKW A;  3HZ5 A;  3P32 A;  4URL A;  2YI7 A;  3TZ0 A;  2YE9 A;  1BKN A;  1Z5C A;  4PRV A;  1I59 A;  4O07 A;  1IXM A;  1B3Q A;  2BT0 A;  2O1V A;  3K98 A;  3VAD A;  2H55 A;  4NH8 A;  3RLR A;  3ZKD A;  3DGE A;  4URO A;  4KSG A;  3R91 A;  4E00 A;  4XTJ A;  2CGF A;  2XHT A;  2XDX A;  1L0O A;  4O09 A;  1QZR A;  1TID A;  4ASA A;  4BQG A;  2ZDX A;  2XX2 A;  2ZBK B;  2CH4 A;  3IED A;  3T0H A;  3VHC A;  4KP4 A;  4EM7 A;  4H85 A;  5M4E A;  3R4P A;  4XDM A; 
#chains in the Genus database with same CATH topology
 1CP9 A;  3ZCC A;  3Q4H A;  2X6A A;  4A5U B;  5IYD O;  3HYY A;  2RMK B;  3FD9 A;  1HR0 O;  2ADP A;  5IN9 A;  1F51 A;  1G6U A;  5D7C A;  5J9P C;  4JTC B;  3KKY A;  3L73 H;  5LYJ B;  1NT2 B;  3K57 A;  1SQQ H;  4WBN B;  3U11 A;  1GK9 A;  2QWO B;  2Q4P A;  5JCO C;  3LSS A;  1S5L Z;  4NXM O;  1HW7 A;  2Q8H A;  4JPR A;  1MX0 A;  1HNX O;  2EIM B;  5H2F Z;  3RYC B;  2Q0A A;  1KP2 A;  4X88 A;  3CCU V;  1GTO A;  1XMQ B;  3A2F A;  1MZF A;  2RNB A;  4NVP A;  3LNU A;  2ZD9 A;  1OCZ C;  5LP6 A;  5J71 A;  4FFK A;  5GON B;  4E72 A;  4CS4 A;  4CZZ A;  4G2K A;  2XTA A;  2PGG A;  2F93 B;  3IC9 A;  1M9N A;  1NR7 A;  3G7E A;  1SET A;  3T1Y B;  1TGO A;  2LW1 A;  3QO5 A;  1K33 A;  3BMY A;  4JI0 O;  5BXZ A;  2UXC O;  4P7A A;  4AHC A;  5LXT A;  2EIJ B;  4O0B A;  2YGA A;  5B66 Z;  2ZM6 O;  3LDC A;  5IWA B;  3IAY A;  2YJX A;  1JOY A;  2CH7 A;  4MVR A;  3R92 A;  2Z3Y A;  1VQN V;  2G38 A;  1HNX B;  1B63 A;  1E79 G;  3G67 A;  5LXT B;  1K5S A;  2P06 A;  4XKK A;  4FCQ A;  2DOS A;  4DUZ B;  1YES A;  5LMU B;  1Q8I A;  4YJ2 B;  4DV7 B;  3RLP A;  1K3E A;  1QVF U;  2EBO A;  5B1N A;  2ZQM A;  5LA6 B;  4ASG A;  1VIB A;  2Q5Z A;  5L3J A;  2LW7 A;  2BU8 A;  5DED A;  4MVM A;  1Y74 B;  3BEH A;  1AR1 B;  4P30 A;  1BXD A;  3HZ1 A;  3O0I A;  4UUJ C;  4RUF A;  4L8Z A;  3ABL C;  4PU9 A;  4RWU A;  4K0K B;  4FLW A;  5L3C A;  1NJI W;  3BY6 A;  1UY7 A;  2YXH A;  2VWC A;  4OXS A;  4FM2 A;  4FLU A;  2DMX A;  2YIB D;  5KA6 A;  4LC1 A;  1AMW A;  3A0X A;  4FMT A;  1HWY A;  4PA4 A;  4JI5 O;  3HEK A;  2YIB A;  4L94 A;  3U2K A;  5IDM A;  1IVS A;  3MD0 A;  5JQG B;  1TAE A;  3FAV A;  1EN4 A;  5IJ9 A;  1IBK O;  3SYQ A;  2KKW A;  5IJ0 A;  4QNH B;  1XNR O;  3K9S A;  1VQ8 V;  4DV1 B;  5ITZ A;  4G28 B;  4O2B A;  4MVQ A;  2IJK A;  2QKC A;  1JX9 A;  2BU5 A;  3FT8 A;  1FXK C;  1SQB H;  4DV6 B;  4DR2 B;  4B3T B;  2QTS A;  5LA6 A;  3ABU A;  3GWK C;  1ZXM A;  4LWH A;  1ZW9 A;  3O2F A;  1KIJ A;  4YKZ A;  3C90 A;  2JGD A;  3OUS A;  4R3A A;  3SPC A;  3P3P A;  1YCI A;  1IBL B;  2ZT9 B;  4YY3 B;  1PV0 A;  3ABK C;  2QF6 A;  2ZKJ A;  1UJW B;  4PEL A;  4CWN A;  1YIJ V;  1FJG O;  1L0L H;  3E8G A;  1IBM B;  3JAW A;  4WBN A;  4HYO A;  2YE7 A;  1CPY A;  3N2K A;  3GIG B;  1MNG A;  1V54 C;  5K1X A;  2YEE A;  4I7Z B;  2E5L B;  3HKC A;  4GX0 A;  2Q73 A;  2HHH O;  1PD3 A;  3SJQ C;  2E75 B;  4JGS A;  4LH6 A;  3JAW B;  1AP5 A;  1TVK A;  3RYH A;  4MP7 A;  2RJZ A;  3LPS A;  3EKO A;  2GTS A;  1YZB A;  2IM9 A;  4PI0 A;  4DW0 A;  4LNU A;  4QE7 A;  2KG7 B;  5KUM A;  1UYK A;  1KZN A;  2YIC A;  4O4H A;  4CE1 A;  4DV3 B;  1O9G A;  3DTU B;  3ABL B;  1W59 A;  3ZHU A;  3APO A;  3CRA A;  1R1B A;  2EIL C;  1XMO O;  1N34 O;  4JYB A;  5KHI A;  2OCC B;  3AG2 B;  4YHH O;  1R73 A;  4H81 A;  2BSK B;  3OW2 U;  4OPA A;  2IOP A;  1PNM A;  4W7T A;  3ZMT A;  3FYI B;  4B6C A;  1SKV A;  2BOB C;  1SQP H;  3LNM B;  1D2D A;  3T2S A;  4X64 B;  3DC5 A;  2CDY A;  2YI0 A;  4PDL A;  4I5S A;  2Y69 C;  5J2U B;  4GQT A;  2L35 A;  4R1F A;  3VOU A;  3CGZ A;  4DO2 A;  1OHH G;  1M4U A;  2VWK A;  1VQ6 V;  1YJ9 V;  1SQX H;  4LF7 B;  2E3C A;  2XHR A;  4FLV A;  4JI4 O;  5D7R A;  4RUE A;  1ZWI C;  3K79 A;  4FM0 A;  1W0K G;  3K97 A;  1N36 B;  2KB1 A;  2BTQ A;  2YEH A;  4UV9 A;  5FNV B;  3A0R A;  3IGA C;  1EI1 A;  2H3O A;  1Y74 A;  4Z2W A;  4QPJ A;  2PTM A;  4NXN O;  4X1I A;  1UYG A;  1N8R W;  1BSM A;  5ITZ B;  4LF8 O;  4TV9 A;  3SDL A;  4HNA A;  2F4V O;  1I5A A;  4WCE V;  5C8Y B;  3WG7 C;  5BZB A;  4DK1 A;  4BIZ A;  5H6Q A;  2UXD B;  2Y4T A;  1Q6U A;  1BGQ A;  2YE6 A;  3TTZ A;  4DR7 O;  3KZI Z;  1DF4 A;  1P4R A;  1N0J A;  1PKX A;  2Q2E B;  3QO7 A;  2IH3 C;  4DV6 O;  5BR8 B;  4KQV A;  4MB9 A;  2YKE A;  5FPR A;  1TBW A;  2BYH A;  1AM1 A;  3KCX A;  1QYE A;  5IY5 B;  4JI6 B;  5KMG A;  3ZX6 A;  1EM1 A;  5J2T B;  4E02 A;  2X7R B;  4DR5 B;  3Q5L A;  2W6J G;  4YXW G;  3ZS8 C;  4CH4 A;  4MTX A;  1PPJ H;  3OEE G;  3G75 A;  2XDL A;  2WER A;  2IU0 A;  2CTP A;  3FB7 C;  4IYI A;  2YE5 A;  5LP6 C;  1I58 A;  2BSM A;  2EUL A;  4O4I B;  2HG5 C;  3UKM A;  4CC6 A;  2YKI A;  2RDC A;  2PI4 A;  1R6N A;  3APQ A;  1WA8 A;  5CA0 A;  1HDJ A;  4MP2 A;  3JAL A;  2DYS C;  4U7N A;  4UVC A;  4DV1 O;  3CC2 V;  5H9C A;  2QM8 A;  2Y0P A;  4K3A A;  3K5L A;  2F95 B;  3PEH A;  3FX7 A;  4AI8 A;  4U7O A;  2YDE A;  2P4V A;  5JH7 A;  4L8J A;  3UO2 A;  2BTZ A;  3ZXO A;  1US7 A;  3M7M X;  4UCT A;  1KP3 A;  2H8P C;  4PHZ A;  4X65 B;  3RLQ A;  3A0Z A;  2RQ6 A;  1FJG B;  4H7Q A;  2YI8 A;  1Y76 A;  4MBC A;  1CEZ A;  4HYP A;  1M57 C;  4BXI A;  3ABM B;  4O4L A;  3TZ5 A;  1TUE B;  2JDI G;  3CE2 A;  2PYJ A;  3EHF A;  4B7K A;  1FXV A;  3JAS A;  4X9L A;  1K97 A;  3G4S V;  5CBH A;  4CWS A;  1K73 W;  1K8A W;  4NXM B;  4XDJ A;  2IWU A;  1XNQ O;  5C8Y A;  5GW7 A;  3R4M A;  2HG1 A;  3FT5 A;  1K4D C;  2YEF A;  3SYO A;  4BAE A;  4LF9 O;  4TV8 A;  3TZ4 A;  3SYP A;  4J7K A;  1SQF A;  5IT9 N;  4DUY O;  1W2B U;  4LF5 B;  3SJA C;  1FFX A;  3OWB A;  1YET A;  3C3S A;  2ZIO A;  3BAB A;  1YJW V;  2Q7H A;  1GJV A;  4YY3 O;  1H7U A;  2WLK A;  4DR3 O;  5JCO A;  4DV2 O;  2BU6 A;  2LGW A;  3CMA V;  1RPR A;  4CS3 A;  2ZM6 B;  1RP3 B;  4XIT A;  1OCC B;  2P6J A;  1AJN A;  4EFU A;  3VHA A;  2R9I A;  3BA9 A;  4MS2 A;  3MAQ A;  3O9O A;  5L3D A;  1I59 A;  1LUV A;  2GUZ B;  4O07 A;  4AQY O;  1DF5 A;  1WLE A;  2OIG A;  4WFB V;  4GX1 A;  4DV7 O;  3ETE A;  1YXB A;  2UXX A;  4RO2 A;  4I9W A;  2H94 A;  2DWE C;  4FM1 A;  5LOV A;  2AZ0 A;  2CGF A;  2XHT A;  2ATK C;  2E74 B;  1SZX A;  2QEX V;  1TID A;  3LNN A;  2D2C B;  1WP8 A;  2RCV A;  4JI8 B;  2E5L O;  1F4M A;  4EFE A;  5M4E A;  4H85 A;  1R6K A;  2UXC B;  3UCS C;  1AR5 A;  4XDM A;  5EBM C;  1DTO A;  1SC5 B;  3GVM A;  2QKS A;  1WPB A;  4U93 A;  4MSW C;  4YIO A;  4GKK O;  2QM4 A;  5CBF A;  5LOV B;  2YEA A;  4TUY B;  5B1B C;  2V4D A;  3GIG A;  2EX3 A;  2WI7 A;  1GH6 A;  4I4T A;  4KSH A;  1YI2 V;  3D2R A;  3GIE A;  4B7E A;  4DR7 B;  3CS5 A;  2Q8I A;  1QR9 A;  4JTD B;  1NR1 A;  5B1A C;  2UUB O;  4JI8 O;  2OWO A;  1VF5 B;  5LMU O;  3B25 A;  4FPP A;  3CRM A;  2ZE7 A;  4GKJ O;  2EIL B;  1UFI A;  2Z0A A;  5L3E A;  3S3W A;  4DR2 O;  1WB8 A;  4PD4 F;  4CWQ A;  1NTK H;  1YJN V;  2QKA A;  2VQE O;  1GN2 A;  1K92 A;  5H6R A;  2BRC A;  5KAF Z;  1G8M A;  3F5W C;  4UVB A;  3F7V C;  4AQY B;  3C3T A;  4LCU C;  1UY8 A;  4CH5 A;  3ZIA G;  4I0X A;  4N23 A;  5AG2 A;  3ZMZ A;  2NLJ C;  5JEN A;  1L1F A;  2HJF C;  3FB6 C;  4XC0 A;  4KFM A;  3ZHS A;  1Z2G A;  4GT1 A;  3RYI A;  3JD1 A;  5IYZ B;  5CTW A;  3RW0 A;  2FTK A;  5LHG A;  3D36 A;  1S5J A;  2WLH A;  2AHZ A;  2BZ5 A;  5EYP A;  1FAF A;  5EZY A;  2Y69 B;  4GLX A;  1Y6X A;  5EZY B;  2YGF A;  3ABT A;  3W7X A;  1SA0 B;  3THO A;  2XND G;  2JGU A;  1PL4 A;  3C0E A;  4XE2 A;  4TT3 G;  1QR8 A;  4JV5 O;  4LWG A;  2ZIN A;  1Y67 A;  2B9Z A;  5KX5 A;  3SR2 C;  1XNQ B;  3ZXQ A;  2UXN A;  3X2Q C;  3BHP A;  2H8M A;  3OMA B;  5FPO A;  1NHI A;  4MVS A;  2XT9 A;  1K4C C;  3RYF A;  4JV5 B;  1EBO A;  4YJ3 B;  1QLN A;  1Z5B A;  3KCY A;  4ABM A;  3OT7 A;  3K5O A;  1KUQ A;  5D5P A;  3CRC A;  1BHB A;  1NHJ A;  2R9R B;  4TQD A;  4NH7 A;  2HR3 A;  4ZHQ B;  4DYL A;  2CK3 G;  3T2M A;  4DV2 B;  3B2E E;  2WLN A;  1XBL A;  2PY5 A;  4P8O A;  1N0N A;  3CCM V;  1N32 B;  2DYR C;  3EFF K;  2YEG A;  4JTA B;  3K06 A;  5M4N A;  3U0Z A;  2B1I A;  1S77 D;  2CH7 B;  1IBM O;  2L6L A;  3FYE B;  3E22 B;  2IOR A;  1TA8 A;  4UCU A;  1JJ2 U;  2BYI A;  4Q20 A;  2WI2 A;  1I7F A;  2N05 A;  2WLI B;  2ARH A;  1TC6 A;  1H2G A;  2AHY A;  4Z1M G;  3U2D A;  2DW4 A;  3A0H Z;  1AI4 A;  4NTY A;  1AH8 A;  3LDD A;  3SPH A;  2Y0I A;  3JD4 A;  1Q90 D;  3A0Y A;  3CME V;  4MTF A;  2CCU A;  1XL6 A;  3ZRW B;  3DSQ A;  2B5U A;  3ASO C;  5HFL A;  4XKO A;  4XDK A;  5DN6 G;  1H7S A;  1U2O A;  2OTJ V;  1VQO V;  3WG7 B;  3OTF A;  4EFT A;  2AW9 A;  4LFB B;  4NYK A;  3G6E V;  1S14 A;  2FXS A;  2YEI A;  3K3W A;  4GZR B;  4PA6 A;  3BA8 A;  2HHI A;  2GV9 A;  3OD4 A;  2CGN A;  3K08 A;  2BTO A;  3SPI A;  1AJQ A;  1KB9 F;  4JAV A;  4TOI A;  1XMO B;  4JI1 O;  2OCH A;  4QIW F;  3B26 A;  5BMV A;  1YS3 A;  1FXH A;  1NQT A;  2XD6 A;  3CSX A;  3IJ4 A;  1RSO A;  4X1I B;  2A79 B;  3EVK A;  1Z5W A;  3EHB B;  4KXR A;  4P9P A;  1GAX A;  2XK2 A;  2UUA B;  3T4D A;  4O4J A;  1P84 F;  2JKI A;  3EHG A;  3C11 A;  2HKJ A;  4AS9 A;  3MDS A;  3ICX A;  4DR1 B;  1H2N A;  5D5Q A;  3ZN1 A;  1FXK A;  1EZJ A;  5C93 A;  2UXB O;  2CUG A;  5B3S C;  2YI5 A;  4ICG A;  4QE9 A;  4FLX A;  3W7W A;  2RN9 A;  4K4O A;  3RVZ A;  4JI5 B;  1AB3 A;  4W4L A;  4XCL A;  1UYI A;  2UU9 O;  4UB6 Z;  4WUC A;  4LWE A;  3OR6 C;  4MW8 A;  4MTG A;  3TJT A;  1RM1 B;  1O9H A;  2XJG A;  3DC6 A;  3QG5 A;  1FS0 G;  4NH9 A;  2B1G A;  5M4K A;  1VP7 A;  4D7T A;  1PVG A;  1Y76 B;  4MOT A;  5FNF A;  1U0Z A;  3U10 A;  4YKT A;  2WLJ A;  3UQ8 A;  2YEC A;  5IDJ A;  1A4H A;  3J7A U;  4PA3 A;  1IBL O;  1F4N A;  4RAI A;  2D3O W;  1VF6 C;  2K1E A;  5F3K A;  3AK3 A;  4HXW A;  2WPD G;  4MTO A;  4MPE A;  5EBW C;  4HY6 A;  3G80 A;  3CX5 F;  3AG3 C;  4JAU A;  2QTO A;  1ROP A;  3AG3 B;  5KHH A;  1PNK A;  3TUH A;  3RKZ A;  4LNU B;  3SJC C;  4BW5 A;  4G27 B;  2F43 G;  3SYA A;  1B04 A;  4L87 A;  3HKE B;  4CH6 A;  1HR0 B;  4L90 A;  2NN4 A;  1YT1 A;  1NVP D;  1ZWH A;  1J5E B;  3G7B A;  4YHH B;  2WA4 A;  4B3S B;  4X62 B;  1GKZ A;  1W0J G;  3E22 A;  2JRI A;  3SPG A;  1FPO A;  1YC1 A;  2ZNJ A;  1AVM A;  2QFO A;  2ODM A;  5BY1 A;  3CGY A;  1Q81 W;  2P4K A;  2M7W A;  2P22 C;  3R66 A;  2GFD A;  4LWS B;  1OCO C;  4FLT A;  1QU7 A;  3K9A A;  4FZ0 A;  4LR3 A;  2BE3 A;  2CCS A;  1S72 V;  5TIS Z;  4DUH A;  4LF6 B;  5M4M A;  3AK1 A;  3RWR D;  2HFE C;  3JYC A;  4DV4 O;  1X4T A;  1X59 A;  4WFG A;  3R4O A;  1VQ4 V;  1K7D A;  5KAI Z;  3ZHR A;  2VQF O;  5IJ9 B;  4DV5 O;  3ML0 A;  3VHD A;  4DR5 O;  2LFR A;  4X1Y B;  5KLV H;  2ZDY A;  4I55 A;  3AG4 C;  3HKE A;  2Q8G A;  4X8A A;  3ZRX A;  1R3I C;  1Q7Y W;  3CJH A;  5KMG B;  2ZE8 A;  4DR4 B;  2FWZ A;  2YE3 A;  4EGI A;  3A0B Z;  1YT0 A;  1GN4 A;  4BIU A;  3CP1 A;  4X1Y A;  2XAG A;  2XHB A;  1G4Y B;  2YE2 A;  1NTZ H;  4PI2 A;  5D6Q A;  3EKR A;  1SA0 A;  3B24 A;  4YKY A;  3T0Z A;  2Q0O C;  4DR3 B;  5IE9 A;  1LR1 A;  1XMQ O;  3CJH B;  2CE4 A;  1VF7 A;  4FK5 C;  4FCP A;  3SL2 A;  1S0V A;  1UYH A;  5LYJ A;  3KG2 A;  4RQE A;  1Y4U A;  3VQW A;  3HKD A;  1FXK B;  4LWS A;  2QWQ B;  4GT8 A;  4ZVI A;  3CWB H;  4X1K B;  3DXR B;  2IU3 A;  4LF5 O;  5D7D A;  4YIP A;  1BQ0 A;  2WAM A;  1RM1 C;  5FNC A;  2JEX A;  3FB8 C;  1P49 A;  3BFR A;  2DQ0 A;  1EN6 A;  3G6B A;  5LMN O;  4K8Z A;  1MSW D;  1H8E G;  5LGT A;  1U96 A;  1KQS U;  3ABK B;  1SER A;  3OM3 B;  1Q43 A;  3LUT B;  1H8H G;  3B8N A;  1JVM A;  2UUA O;  2KQX A;  1XHX A;  1Q6I A;  5FWK A;  1ZLZ A;  1BE3 H;  3M8A A;  2UUC B;  2YEV B;  3CRQ A;  4LF4 B;  4ZI7 A;  3HZ5 A;  4IHJ A;  1QHT A;  1VEW A;  2YI7 A;  1LNQ A;  1S3J A;  4GKK B;  1FFT B;  4PRV A;  1EFR G;  4JI7 O;  2X6C A;  4BW9 A;  4DRX A;  1IXM A;  4PDM A;  4FLY A;  1B3Q A;  2O1V A;  2Q7E A;  4GYC B;  4NH8 A;  4PV1 B;  3UT5 B;  4URO A;  4KSG A;  1E1R G;  5A9G A;  3GWO A;  1L0O A;  3ZMS A;  1FD9 A;  4ASA A;  2ITC C;  3ZN0 A;  4X66 B;  2YC0 A;  5LP6 B;  4X20 B;  1BZK A;  2ZR3 A;  2ZBK B;  1I5X A;  1Q86 W;  3R4P A;  5IWA O;  5A2Q N;  2EXL A;  3JSN A;  3L70 H;  3JCZ A;  2JJ1 G;  4ZI7 B;  2YED A;  1Q3E A;  1S16 A;  4R50 A;  1J5E O;  5B5E Z;  3HKC B;  2XAQ A;  1ZL8 A;  3IFX A;  3DXR A;  1JR9 A;  1ENV A;  4L91 A;  1VQ9 V;  4EEH A;  3T10 A;  1R3J C;  1JM6 A;  1MU5 A;  4O4J B;  4AIL C;  4GEE A;  1THZ A;  2WI1 A;  1D5N A;  1R3K C;  1YSZ A;  2WI3 A;  5CB4 B;  4D7S A;  1EA6 A;  3H01 A;  4ASU G;  2R70 A;  1PP9 H;  4JAA A;  4DR1 O;  4NKG B;  1ID0 A;  3N2G A;  1HNW B;  1KU9 A;  1Y4S A;  2A06 H;  3EHJ A;  3JAT A;  1N36 O;  3A0W A;  2MK3 A;  4EEQ A;  4LF7 O;  1B62 A;  1WB7 A;  4KTN A;  1AH6 A;  2VQE B;  4PJ0 Z;  1L0N H;  5E79 Z;  5LL6 Y;  1NBM G;  3L9D A;  4URN A;  2ZXW B;  4GKJ B;  1MSD A;  3ZRS A;  1AR4 A;  2ZDI A;  2YKJ A;  4I50 B;  1SQG A;  3AG1 C;  2HLD G;  1T5E A;  5FND A;  1XL4 A;  2Z5U A;  3QVN A;  5L3F A;  3QTC A;  3T1H O;  3INW A;  3OMI B;  1GRJ A;  1UPG A;  3OGI B;  3B40 A;  1HNZ O;  1KBH A;  4H13 B;  1WA8 B;  2LFS A;  4XD8 A;  1YC4 A;  5JVD A;  4WFH A;  5EBL C;  4DR4 O;  4RQF A;  1HNW O;  1XEQ A;  3K99 A;  1V55 B;  1GKX A;  1K5Q A;  3OTO B;  4HYM A;  4H44 B;  4LFC O;  2QG0 A;  4IIJ B;  1JA8 A;  3ETG A;  2HP8 A;  2ZKO A;  5H5N A;  4GFN A;  1US6 A;  1YTF B;  2HCH A;  4LWF A;  3K59 A;  1Q6H A;  1KEC A;  2E76 B;  5FL7 G;  4BIO A;  2ADQ B;  1N33 O;  3R4N A;  3ZHT A;  1P7G A;  4WFA V;  4J11 A;  1Q5O A;  4I0X B;  3JAM N;  1YIT V;  4ZOL A;  4B3R B;  1L8D A;  3ETQ A;  2ZCE A;  4OPH A;  3RYC A;  5BR8 O;  2VWJ A;  4IGG A;  3OPD A;  5LHI A;  2HJD A;  3I5D A;  2EZO A;  1MZE A;  3LMM A;  1Z59 A;  1BMF G;  2GHY A;  3S5T A;  2IWX A;  3ZMV A;  4CWR A;  3E35 A;  1YC3 A;  3N2G B;  4WUD A;  4R3M A;  2QR4 A;  4AWO A;  5IY5 C;  1SS3 A;  4LP0 A;  3Q5K A;  2BU2 A;  3H80 A;  3T4Z A;  1UYE A;  5CMU A;  2YKC A;  3K5N A;  2VCJ A;  4AWQ A;  2DWD C;  3CC4 V;  3OEH G;  3JAT B;  1M5I A;  3L74 H;  3E8H A;  1IZ3 A;  4B7P A;  1KKC A;  1YSR A;  1Y4M A;  2JEU A;  4DRX B;  3I56 V;  3BCC H;  3QTF A;  1MOF A;  1VF6 A;  4BR6 A;  1I94 O;  2N04 A;  2YK9 A;  3HKB A;  1FYJ A;  4UVA A;  3B28 A;  1ZAU A;  3E89 A;  5DM6 V;  1YT2 A;  3B27 A;  2EIK B;  4JI7 B;  4V25 A;  4IYH A;  4FVM A;  3JAR A;  2ZDI C;  5J2U A;  3MHH C;  1JMK C;  4MVZ A;  4B3M O;  4UFZ A;  1YDX A;  2N74 A;  3J80 N;  3F7Y C;  5L3B A;  4TSF G;  2GBO A;  5E1A C;  3ZKB A;  1Y8P A;  2OT5 A;  2PZS A;  4NB5 A;  2OYQ A;  4LPB A;  2XX5 A;  3O65 A;  3S3X A;  2F66 C;  1QLE B;  1V55 C;  1SZT A;  4BWA A;  2Y48 A;  3CWV A;  2EJ7 A;  3GB7 C;  2ZIM A;  3JAK A;  4DUY B;  4LF4 O;  4Q6G A;  4F6E A;  3AEI A;  4GX5 A;  1RSO B;  3H4L A;  4JYY A;  3ZMU A;  4DZY A;  4FIP C;  4E2L A;  4DV0 O;  2AKP A;  3P3N A;  3W7U A;  4LFA O;  1I0H A;  2DN9 A;  3VQX A;  3QF7 A;  1Q82 W;  1AI7 A;  3OAA G;  1UYL A;  4ZKI A;  1QLE C;  4LF6 O;  3TK1 A;  5EK0 A;  3JAR B;  1XHZ A;  1H38 A;  2PUS A;  2NR5 A;  3SPJ A;  1YEW A;  1SRY A;  3JD2 A;  2EIJ C;  3HB3 B;  2QWP B;  2YI6 A;  3EXA A;  3T1Y O;  2ZR2 A;  4X65 O;  5GGZ A;  1XUQ A;  4OGQ B;  3ASN B;  5EIB D;  2O1U A;  4MPN A;  2XDU A;  2A9H A;  4KL1 A;  1YSC A;  3LSQ A;  2W0X A;  4JI2 O;  1UYC A;  3JCU Z;  2YXY A;  3JAK B;  4ZBM A;  1I94 B;  1HP8 A;  4LFB O;  1YVW A;  2UXD O;  1NVP B;  3FV5 A;  3HKD B;  3ZJZ A;  3HHU A;  3K5M A;  3QDD A;  2EIN B;  2IH1 C;  3WQ9 A;  3UM7 A;  2F1M A;  2XCM A;  4I3H A;  1WN7 A;  4F4L A;  2UXB B;  2PYL A;  1G1X B;  3TCU A;  2JGD B;  2GUZ A;  4L93 A;  3M99 B;  2DYS B;  4LFC B;  4JAS A;  5JQG A;  5LBQ A;  4O05 A;  3HR0 A;  3D3I A;  4IIJ A;  4WUB A;  5KHK A;  3AG2 C;  3Q5J A;  3CCJ V;  2PI5 A;  4JYA O;  1WJZ A;  2VQF B;  3T1C A;  5J2T A;  4XIP A;  4GCZ A;  1WNS A;  1I08 A;  3HKB B;  1GO3 F;  4J9Z B;  3OUF A;  2FKX A;  2CG9 A;  1I5D A;  4CE3 A;  3QO8 A;  1Z5V A;  4TV9 B;  1IXB A;  3BM9 A;  2WI4 A;  3STL C;  1R6T A;  2ITD C;  2XUM A;  1CXZ B;  2CTW A;  4YKQ A;  4FLZ A;  3RT3 C;  1M56 C;  2C2A A;  5EYP B;  4H37 A;  1OZ0 A;  4YJ2 A;  3CRK A;  4XBF A;  3OTO O;  1VQM V;  1VMG A;  5CTY A;  3K58 A;  4ASF A;  4HXZ A;  3JAS B;  1GM8 A;  1P7B A;  5KUK A;  4XKA A;  3H1K H;  3R65 A;  1NHH A;  3TGU H;  2EIM C;  1ZUQ A;  1TC0 A;  2XOK G;  3ZHV A;  3RYI B;  5JJJ B;  3BRC A;  1S5H C;  3H1I H;  1D5A A;  4XCJ A;  4W4K A;  2CTR A;  2IBZ H;  4WF9 V;  2WA3 A;  4V26 A;  2BOC C;  1KD1 W;  4JI6 O;  2HHH B;  2YI9 A;  4HAM A;  3PJS K;  4JZG A;  4PL9 A;  3L71 H;  1OJH A;  2ZXW C;  1H2M A;  1GM9 A;  2QGN A;  1BL8 A;  5CA0 B;  4JI3 O;  1RPO A;  1NTM H;  4B3R O;  5K1P A;  3NXS A;  1Z5A A;  1B6Q A;  2YJW A;  3CB2 A;  2DYR B;  3CHX A;  1NKD A;  4NR1 A;  2WI6 A;  4XIR A;  5LGN A;  5HFM A;  2F4V B;  1COW G;  1AJ6 A;  4C7U A;  1BQZ A;  1ZL8 B;  1YF2 A;  2KSD A;  2R9A A;  4EGK A;  4CE2 A;  2WEP A;  2A7W A;  2FWY A;  1OV9 A;  4YKW A;  3TET A;  4X20 A;  3P32 A;  1BKN A;  3RYH B;  1Z5C A;  3B8M A;  4PDV A;  1XQ8 A;  2QJ1 A;  2XAF A;  1OCC C;  2BT0 A;  3VAD A;  1ORQ C;  4P9O A;  3H1L H;  3RLR A;  3DGE A;  3R91 A;  1M56 B;  1VQP V;  4U3F H;  1IDS A;  3CD6 V;  4KHP B;  2XDX A;  1NS1 A;  2UUC O;  1VQK V;  4U3J B;  3B4S A;  1QZR A;  2FB5 A;  4D6T H;  1SQV H;  4UXN A;  2HEP A;  2O57 A;  1JFF A;  2YEV A;  5CA1 B;  2Q67 A;  4K0K O;  2CH4 A;  1R3L C;  3IED A;  5FNV A;  3T0H A;  5CA1 A;  5LGU A;  3VHC A;  1NZ6 A;  4KP4 A;  4EM7 A;  2BTQ B;  2DQ3 A;  5GTH Z;  3BPZ A;  5L3G A;  3JSL A;  1BT8 A;  1IUR A;  5IJ0 B;  3W7T A;  2LGQ A;  3ZED A;  1FKA O;  2CCT A;  2A3Q A;  1QY8 A;  4DK0 A;  5CTU A;  2HVK C;  4JI4 B;  1AJP A;  3PN1 A;  2BRE A;  1ZXN A;  5DEC A;  1VQ7 V;  1XNR B;  1AP6 A;  3FB5 C;  2YXL A;  2V7Q G;  2XAB A;  3WB1 A;  2CTQ A;  1KC8 W;  4WFF A;  3TZ2 A;  1OCZ B;  5CF0 A;  4X66 O;  1N4C A;  1AIL A;  1DLB A;  2EIN C;  4O04 A;  3OWD A;  5IYC O;  4H0L B;  2QWR B;  5B1A B;  3CRR A;  1GMG A;  1E1Q G;  4ZIB A;  5KX5 B;  4MPC A;  1XIL A;  4EMV A;  4TWK A;  3ZHQ A;  5GTI Z;  5EC1 C;  2OTL V;  3FAV B;  1THN A;  4FFB B;  2ILM A;  4O2A A;  2V1D A;  3ZRV A;  5IYB O;  2XDK A;  2ZE5 A;  2GSM B;  3NMQ A;  1N33 B;  2Q68 A;  3CCL V;  4AWP A;  4I55 B;  3A8T A;  2IJI A;  4MVO A;  2QSA A;  4XDL A;  1B06 A;  2YEJ A;  4UCR A;  2LP7 A;  4DXW A;  4YKX A;  4WFE A;  5CBG A;  3LDE A;  1UYD A;  1F23 A;  4QJF B;  3OE7 G;  3ZRW A;  1BCC H;  4URM A;  2AGA A;  4CC5 A;  2JS3 A;  1LUW A;  4HZ3 A;  4X64 O;  5JH7 B;  2UUB B;  3FKS G;  4ZOL B;  2YEB A;  1GN3 A;  1YTF D;  2WLI A;  3L75 H;  2IJH A;  5JWP A;  2Q9L A;  2WSS G;  2VS0 A;  5CA3 A;  1H2K A;  1QQC A;  1N32 O;  4EGH A;  1ZSP A;  2EZP A;  2YIA A;  4B08 A;  2PF4 E;  1N34 B;  2FML A;  1OCR B;  2OIE A;  3OR7 C;  1NU1 H;  1XOU A;  3E8B A;  4X1K A;  2W0F C;  2WWW A;  1QNM A;  4PA7 A;  4JZ2 A;  5F5R A;  2AZ2 A;  5BOD A;  2WLM A;  4UCO A;  1J95 A;  1VQ5 V;  3RVY A;  4O2B B;  1NH2 B;  2Q8F A;  1UY6 A;  1KKD A;  2XHX A;  1GN6 A;  2X0L A;  4HZ0 A;  3KE6 A;  3F5T A;  4LF9 B;  3U67 A;  1OCO B;  3K0G A;  4F6R A;  2YE4 A;  1Y8N A;  2JJC A;  3IC7 A;  2K5B A;  1S76 D;  2UWD A;  2YK2 A;  3BAA A;  2PNR A;  5GON A;  4QPK A;  4I50 A;  4DUZ O;  1BGY H;  5JJN B;  4DV4 B;  4UB8 Z;  3VBB A;  5B3S B;  2YGE A;  1F7Y A;  4K35 A;  3H1H H;  3HPL C;  2GDS A;  2VCI A;  4HNA B;  4I9Q A;  4ASB A;  1M57 B;  2MW2 B;  2GTA A;  2UU9 B;  4R7C A;  4UV8 A;  1JCH A;  5KHG A;  2XAS A;  3LSU A;  5FLX N;  3AK2 A;  5IYZ A;  4N21 A;  3HYZ A;  4LF8 B;  2ESA A;  2VW5 A;  5LMN B;  1DK1 A;  2QM7 A;  4IT5 A;  2XX4 A;  2DJV A;  4HBN A;  1TUB A;  1EN5 A;  3VQV A;  3H9V A;  1JFF B;  4LH7 A;  1MMM A;  4EB6 B;  3K0D A;  1I5Y A;  3T1K A;  1V54 B;  5KA5 A;  5J6A A;  2EIK C;  2QA4 V;  4LWI A;  4E4E A;  3AG7 A;  2BSK A;  1V9P A;  4I4T B;  4CBC A;  5D6P A;  4TUY A;  4UCV A;  1YER A;  1OCR C;  1PNL A;  4X62 O;  2ETN A;  4J7Z A;  4UCS A;  2YS8 A;  3E2E A;  4DW1 A;  3ETD A;  4U3J A;  4O4H B;  3I55 V;  2LO1 A;  4JYA B;  1HNZ B;  2KG7 A;  5CTX A;  1XI1 A;  3CXC U;  2E0A A;  1TVK B;  1VAR A;  1K9M W;  1PL0 A;  4GX2 A;  1AI6 A;  2IWS A;  3AG1 B;  3CYO A;  2X6B A;  2IOQ A;  3GIF A;  1AI5 A;  1DGS A;  3D3Q A;  5BMV B;  4NTX A;  2C1G A;  4J41 A;  4LP8 A;  5EIB C;  3E83 A;  4J80 A;  4E01 A;  1Y8O A;  4NXN B;  2A0L A;  1M90 W;  2JIZ G;  3N2K B;  4MT8 A;  1KYO F;  2QDO A;  2QE7 G;  1MA1 A;  4FZ1 A;  3PEJ A;  4CWF A;  3WB2 A;  4EB6 A;  3SJB C;  2WLL A;  2P90 A;  2IW5 A;  2P67 A;  2VRZ A;  1QCE A;  1ZX3 A;  4LBE C;  2O1W A;  3D0B A;  4JI2 B;  3A0T A;  3ASN C;  4J7J A;  4YKU A;  4B3S O;  1VQL V;  3OMN B;  3ABM C;  2Y4U A;  1YHQ V;  3QNE A;  4PDR A;  3ZBH A;  1MAB G;  2AXT Z;  4ZHQ A;  2XAJ A;  1I5C A;  1NI8 A;  1BYQ A;  3RFR A;  3J81 N;  2P5O A;  2DE0 X;  4DR6 O;  3CRL A;  1XDC A;  3JD0 A;  1RFY A;  3WFV A;  1WAZ A;  4JI1 B;  5CPH A;  2C1I A;  4MVU A;  2WEQ A;  3CCV V;  4TV8 B;  3D8C A;  4J42 A;  3ASO B;  4F6R B;  4LFA B;  3CEI A;  2W6I G;  4YKR A;  1IX9 A;  1ARO P;  3OMU A;  4CWO A;  4PRX A;  3E8F A;  4PA9 A;  2F23 A;  3K60 A;  2OCC C;  4YJ3 A;  2FL4 A;  4HZ5 A;  5BOC A;  3O6O A;  1QBZ A;  1H2L A;  1U97 A;  3CXH F;  4O4L B;  3TXQ A;  1UYF A;  3JD3 A;  4JYC A;  1H2S B;  3JAL B;  1PM9 A;  2NNU A;  2WI5 A;  1M93 A;  1R62 A;  4XIQ A;  4CS2 A;  2JVD A;  3UO3 A;  4R8C A;  5LHH A;  5B1O A;  1TIL A;  3L72 H;  4B3M B;  5M4P A;  1KMI Z;  5EC2 C;  3G71 V;  1TH8 A;  4FCR A;  2QWN B;  4P2Z A;  2YSU B;  2XAH A;  1I5B A;  3WHA A;  1SF9 A;  2XJJ A;  3K04 A;  5F2V O;  4TQF A;  4EKW A;  4CWP A;  3CCQ V;  5CB4 A;  1Y66 A;  4MW3 A;  2LQT A;  1WP7 A;  3STZ C;  4DV3 O;  5M4H A;  1QVG U;  2Q6A A;  3VQY A;  3D36 C;  3MNR P;  1EZV H;  3X2Q B;  3OW6 A;  1WPX A;  1JPX A;  2R72 A;  3WU2 Z;  3CPW U;  3K03 A;  1XRE A;  4KFG A;  5JJE B;  2JK5 C;  4B3T O;  2EJR A;  3NR7 A;  2JS5 A;  2Q69 A;  5B1B B;  4OX9 B;  2XDS A;  1UY9 A;  2FYP A;  1JQ0 A;  2ZE6 A;  3TXS A;  4CWT A;  2CGO A;  2GQP A;  2ZNI A;  3CYG A;  2YID A;  3CCS V;  1A32 A;  3JZ3 A;  4NTW A;  1JJO A;  2K9P A;  4GGL A;  3RN4 A;  1IBK B;  2QG2 A;  3RYF B;  4JI0 B;  3UT5 A;  2XJX A;  1BHA A;  3WB0 A;  3T1H B;  2YKB A;  4JI3 B;  4X9Q A;  4K8X A;  4O4I A;  4QGP A;  4BQJ A;  3EHH A;  2IJJ A;  5JVD B;  1UYM A;  4IL6 Z;  4HY1 A;  4JQL A;  3OGC C;  1BS3 A;  4Z1V A;  4H33 A;  2BU7 A;  2BCC H;  4JF3 A;  3P30 A;  4OX9 O;  4FJC C;  4IHJ B;  2HVJ C;  3Q4H B;  2LJ2 A;  4EFB A;  2YE8 A;  3ZM7 A;  1M1K W;  2JJ2 G;  1OSF A;  2P7T C;  3RGB A;  1URF A;  4FFB A;  4O2A B;  3INX A;  3B09 A;  2YUA A;  1ZTE A;  2FYU H;  3FFQ A;  3RBZ A;  4DV0 B;  4URL A;  3TZ0 A;  2Q7G A;  3CCR V;  2YE9 A;  3H1J H;  3AG4 B;  3MHS C;  1GM7 A;  4J10 A;  3BVO A;  3SYC A;  3B77 A;  4DV5 B;  3CC7 V;  3K98 A;  1FFX B;  4R6Z A;  2H55 A;  1TUB B;  1MG1 A;  3ZKD A;  3E86 A;  3W7S A;  4E00 A;  4XTJ A;  4GUN A;  2HKO A;  2Q8V A;  4O09 A;  2WLL B;  3OFN G;  5KHJ A;  2CAZ C;  1NH2 D;  4X89 A;  2M6Y A;  4DR6 B;  3N27 A;  4J9Y B;  4KHP O;  3SGI A;  4BQG A;  2ZDX A;  2XX2 A;  1SES A;  1GKF A;  4BAY A;  3CCE V;  5CN0 A;  4KUM A;  1K34 A;  4CH3 A; 
#chains in the Genus database with same CATH homology
 1CP9 A;  3ZCC A;  2QKS A;  3W7T A;  2EXL A;  4U93 A;  2X6A A;  4MSW C;  5IYD O;  3HYY A;  5CBF A;  3JCZ A;  2YEA A;  5B1B C;  2CCT A;  2JJ1 G;  3GIG A;  1QY8 A;  2YED A;  1F51 A;  2WI7 A;  5D7C A;  2HVK C;  5J9P C;  4JTC B;  4KSH A;  5CTU A;  1S16 A;  4R50 A;  1YI2 V;  3D2R A;  1AJP A;  3GIE A;  2BRE A;  1ZXN A;  2XAQ A;  1VQ7 V;  2Q8I A;  1QR9 A;  3FB5 C;  1GK9 A;  4JTD B;  3LSS A;  1NR1 A;  2V7Q G;  5B1A C;  1KC8 W;  2XAB A;  3TZ2 A;  4WFF A;  3IFX A;  1OCZ B;  5CF0 A;  3B25 A;  2Q8H A;  4JPR A;  4FPP A;  1MX0 A;  1ENV A;  2EIM B;  4L91 A;  1KP2 A;  1VQ9 V;  4EEH A;  4X88 A;  3CCU V;  2EIL B;  1R3J C;  1JM6 A;  3T10 A;  1MU5 A;  5L3E A;  1GTO A;  4GEE A;  1THZ A;  2WI1 A;  1R3K C;  1DLB A;  2EIN C;  1YSZ A;  2WI3 A;  4O04 A;  4CWQ A;  3OWD A;  1YJN V;  3LNU A;  5IYC O;  1EA6 A;  2ZD9 A;  1OCZ C;  1K92 A;  5H6R A;  2BRC A;  5J71 A;  5B1A B;  1GMG A;  1E1Q G;  3H01 A;  1G8M A;  3F5W C;  4UVB A;  4MPC A;  4ASU G;  4CZZ A;  4G2K A;  4EMV A;  3F7V C;  4TWK A;  4LCU C;  1M9N A;  1UY8 A;  1NR7 A;  3G7E A;  5EC1 C;  1SET A;  1ID0 A;  3ZIA G;  2OTL V;  1THN A;  3QO5 A;  3ZRV A;  2V1D A;  1Y4S A;  1K33 A;  4N23 A;  3EHJ A;  3BMY A;  5IYB O;  2XDK A;  3ZMZ A;  4P7A A;  2NLJ C;  3NMQ A;  2GSM B;  3A0W A;  2MK3 A;  1B62 A;  2EIJ B;  1L1F A;  2HJF C;  2Q68 A;  3FB6 C;  1AH6 A;  2YGA A;  4KTN A;  4O0B A;  4XC0 A;  3CCL V;  3LDC A;  4AWP A;  4KFM A;  4GT1 A;  2YJX A;  1JOY A;  1NBM G;  3JD1 A;  4MVR A;  3R92 A;  2IJI A;  5CTW A;  4MVO A;  4XDL A;  3RW0 A;  4URN A;  2YEJ A;  2FTK A;  2ZXW B;  2Z3Y A;  2LP7 A;  3D36 A;  3ZRS A;  5LHG A;  4DXW A;  1VQN V;  4YKX A;  2WLH A;  1B63 A;  4WFE A;  1E79 G;  2AHZ A;  2ZDI A;  3LDE A;  5CBG A;  2BZ5 A;  1UYD A;  1F23 A;  2YKJ A;  3AG1 C;  4QJF B;  1K5S A;  2HLD G;  3OE7 G;  3ZRW A;  4XKK A;  2Y69 B;  4URM A;  5FND A;  1XL4 A;  2Z5U A;  5L3F A;  4FCQ A;  1YES A;  4HZ3 A;  3ABT A;  3W7X A;  2YGF A;  3INW A;  3OMI B;  3RLP A;  1K3E A;  3FKS G;  1QVF U;  2XND G;  2YEB A;  2EBO A;  5B1N A;  1YTF D;  2ZQM A;  2WLI A;  3C0E A;  4XE2 A;  4TT3 G;  4ASG A;  2IJH A;  1QR8 A;  2LFS A;  4LWG A;  5L3J A;  4XD8 A;  1YC4 A;  4WFH A;  5EBL C;  3ZXQ A;  2WSS G;  2UXN A;  3X2Q C;  5CA3 A;  2BU8 A;  2H8M A;  3OMA B;  4RQF A;  4EGH A;  1NHI A;  4MVM A;  3K99 A;  4MVS A;  1V55 B;  3BEH A;  1AR1 B;  1GKX A;  4P30 A;  1BXD A;  1K4C C;  2EZP A;  1K5Q A;  3HZ1 A;  3O0I A;  1OCR B;  3OR7 C;  4UUJ C;  4RUF A;  3E8B A;  1EBO A;  4L8Z A;  1QLN A;  1Z5B A;  3ABL C;  4HYM A;  4PU9 A;  2W0F C;  2QG0 A;  5L3C A;  1NJI W;  3BY6 A;  2WWW A;  3ETG A;  1UY7 A;  4PA7 A;  4GFN A;  1BHB A;  1NHJ A;  2R9R B;  2VWC A;  1YTF B;  4NH7 A;  2HR3 A;  2HCH A;  4OXS A;  5F5R A;  5BOD A;  2WLM A;  4LWF A;  1J95 A;  5KA6 A;  2CK3 G;  1KEC A;  3T2M A;  1VQ5 V;  5FL7 G;  3RVY A;  1NH2 B;  4LC1 A;  3R4N A;  1AMW A;  2WLN A;  3A0X A;  4FMT A;  1HWY A;  2Q8F A;  4PA4 A;  1UY6 A;  3HEK A;  4P8O A;  4WFA V;  1KKD A;  2XHX A;  4L94 A;  3U2K A;  5IDM A;  3MD0 A;  3CCM V;  2DYR C;  3EFF K;  2YEG A;  2X0L A;  4JTA B;  4HZ0 A;  3K06 A;  1YIT V;  5M4N A;  3KE6 A;  3OPD A;  3U67 A;  2B1I A;  5LHI A;  3SYQ A;  1OCO B;  3K0G A;  1S77 D;  4QNH B;  2QF6 A;  2YE4 A;  2EZO A;  1Y8N A;  1VQ8 V;  2JJC A;  3IC7 A;  1Z59 A;  1BMF G;  3FYE B;  1S76 D;  2K5B A;  2UWD A;  2YK2 A;  2IOR A;  2GHY A;  4G28 B;  2IWX A;  2PNR A;  4QPK A;  1JJ2 U;  3ZMV A;  4CWR A;  3E35 A;  1YC3 A;  2BYI A;  4MVQ A;  2IJK A;  4WUD A;  4Q20 A;  4R3M A;  4AWO A;  1JX9 A;  5IY5 C;  2WI2 A;  2BU5 A;  3FT8 A;  1FXK C;  3VBB A;  2WLI B;  1TC6 A;  3ABU A;  1H2G A;  2AHY A;  4LP0 A;  3Q5K A;  4Z1M G;  5B3S B;  2YGE A;  3U2D A;  1ZXM A;  4LWH A;  2DW4 A;  2BU2 A;  1AI4 A;  3HPL C;  1ZW9 A;  3T4Z A;  1UYE A;  3H80 A;  3O2F A;  5CMU A;  1KIJ A;  4YKZ A;  1AH8 A;  2VCI A;  3LDD A;  2YKC A;  3SPH A;  3JD4 A;  2VCJ A;  4AWQ A;  3A0Y A;  4ASB A;  5IN9 A;  2DWD C;  1M57 B;  3OEH G;  3OUS A;  3CME V;  4MTF A;  3SPC A;  3CC4 V;  2CCU A;  1XL6 A;  3ZRW B;  4R3A A;  2B5U A;  3ASO C;  5HFL A;  3E8H A;  4R7C A;  4XKO A;  4B7P A;  4XDK A;  1YSR A;  1Y4M A;  3ABK C;  5DN6 G;  1H7S A;  4UV8 A;  1JCH A;  2JEU A;  1UJW B;  4PEL A;  1U2O A;  3I56 V;  2XAS A;  2ZKJ A;  4CWN A;  1YIJ V;  2OTJ V;  1MOF A;  4N21 A;  3HYZ A;  1VQO V;  3WG7 B;  3QTF A;  4EFT A;  3G6E V;  1S14 A;  3E8G A;  2ESA A;  2FXS A;  2VW5 A;  2YK9 A;  2YEI A;  3K3W A;  2QM7 A;  4PA6 A;  4UVA A;  4HYO A;  3B28 A;  2XX4 A;  2YE7 A;  3E89 A;  5DM6 V;  1YT2 A;  1CPY A;  3B27 A;  2EIK B;  3GIG B;  3K08 A;  1V54 C;  2YEE A;  3SPI A;  1AJQ A;  4GX0 A;  4V25 A;  4JAV A;  2ZDI C;  1PD3 A;  3SJQ C;  3MHH C;  4QIW F;  3B26 A;  4JGS A;  1YS3 A;  4MP7 A;  1FXH A;  1NQT A;  3K0D A;  4MVZ A;  2XD6 A;  3LPS A;  3EKO A;  3F7Y C;  1I5Y A;  5L3B A;  3T1K A;  1V54 B;  2A79 B;  5KA5 A;  4TSF G;  2EIK C;  2QA4 V;  5J6A A;  5E1A C;  4LWI A;  3ZKB A;  1Y8P A;  2OT5 A;  3EHB B;  4P9P A;  4QE7 A;  2XK2 A;  5KUM A;  1UYK A;  4CBC A;  3T4D A;  1KZN A;  5D6P A;  4CE1 A;  4LPB A;  2XX5 A;  3DTU B;  3ABL B;  1OCR C;  1YER A;  1PNL A;  2JKI A;  3EHG A;  3C11 A;  1QLE B;  1V55 C;  2EIL C;  3E2E A;  2HKJ A;  1SZT A;  4AS9 A;  2Y48 A;  3CWV A;  3GB7 C;  4JYB A;  3ETD A;  2OCC B;  3ZN1 A;  3I55 V;  1FXK A;  1EZJ A;  3AG2 B;  1R73 A;  4H81 A;  3AEI A;  5CTX A;  3OW2 U;  4GX5 A;  2IOP A;  3CXC U;  5C93 A;  1PNM A;  2E0A A;  4W7T A;  3ZMT A;  3FYI B;  4B6C A;  1K9M W;  2BOB C;  3LNM B;  3H4L A;  1PL0 A;  4DZY A;  3ZMU A;  3T2S A;  4FIP C;  4GX2 A;  4E2L A;  1AI6 A;  5B3S C;  3W7U A;  2AKP A;  2YI5 A;  4QE9 A;  2YI0 A;  2IWS A;  3AG1 B;  4I5S A;  3CYO A;  2X6B A;  2Y69 C;  4PDL A;  3RVZ A;  3W7W A;  4K4O A;  2IOQ A;  4GQT A;  4R1F A;  3GIF A;  1Q82 W;  1AI7 A;  1AI5 A;  3OAA G;  1UYI A;  1UYL A;  4XCL A;  3VOU A;  4ZKI A;  3CGZ A;  4WUC A;  1QLE C;  4LP8 A;  4LWE A;  3OR6 C;  4MW8 A;  3E83 A;  1OHH G;  4DO2 A;  4MTG A;  3TK1 A;  5EK0 A;  4E01 A;  1RM1 B;  1Y8O A;  1VQ6 V;  1H38 A;  2A0L A;  1YJ9 V;  1M90 W;  2JIZ G;  3SPJ A;  4MT8 A;  2QE7 G;  3PEJ A;  2XHR A;  1SRY A;  3JD2 A;  4CWF A;  2XJG A;  2EIJ C;  1FS0 G;  2WLL A;  3HB3 B;  5D7R A;  4CE3 A;  2P90 A;  2IW5 A;  2P67 A;  1ZWI C;  1QCE A;  2B1G A;  4LBE C;  4RUE A;  2YI6 A;  4NH9 A;  5M4K A;  3K79 A;  2ZR2 A;  1W0K G;  3K97 A;  2O1W A;  1PVG A;  3D0B A;  5GGZ A;  2KB1 A;  4MOT A;  5FNF A;  2YEH A;  3A0T A;  3ASN C;  1U0Z A;  4YKU A;  3ASN B;  4UV9 A;  2O1U A;  2WLJ A;  4MPN A;  2XDU A;  2YEC A;  2A9H A;  5IDJ A;  1YSC A;  4YKT A;  3A0R A;  1A4H A;  3IGA C;  3LSQ A;  4PA3 A;  1EI1 A;  1F4N A;  1VQL V;  4RAI A;  1UYC A;  3OMN B;  3ABM C;  4QPJ A;  2D3O W;  2K1E A;  1YHQ V;  5F3K A;  3QNE A;  4PDR A;  1MAB G;  4ZBM A;  1UYG A;  1N8R W;  4HXW A;  2WPD G;  2XAJ A;  4MTO A;  5EBW C;  1I5C A;  4HY6 A;  4MPE A;  1BYQ A;  1NVP B;  3FV5 A;  3ZJZ A;  3CRL A;  3HHU A;  3QDD A;  1I5A A;  3AG3 C;  4WCE V;  2EIN B;  4JAU A;  3JD0 A;  2IH1 C;  3WG7 C;  3WQ9 A;  3UM7 A;  2QTO A;  5BZB A;  1ROP A;  3AG3 B;  4BIZ A;  3WFV A;  2XCM A;  4I3H A;  1PNK A;  3TUH A;  5H6Q A;  3RKZ A;  5CPH A;  4MVU A;  2WEQ A;  4F4L A;  3CCV V;  1BGQ A;  2YE6 A;  3TCU A;  3ASO B;  4G27 B;  4BW5 A;  2F43 G;  3TTZ A;  3SYA A;  4L93 A;  3M99 B;  4L87 A;  1DF4 A;  1P4R A;  2DYS B;  2W6I G;  4YKR A;  1PKX A;  4JAS A;  1ARO P;  2Q2E B;  3OMU A;  3QO7 A;  4CWO A;  4PRX A;  2IH3 C;  3E8F A;  5LBQ A;  4L90 A;  4O05 A;  1YT1 A;  3D3I A;  1NVP D;  4WUB A;  1ZWH A;  3AG2 C;  3G7B A;  4PA9 A;  3Q5J A;  3K60 A;  3CCJ V;  2PI5 A;  4KQV A;  2OCC C;  4MB9 A;  2YKE A;  1TBW A;  2BYH A;  4HZ5 A;  1AM1 A;  3T1C A;  1GKZ A;  1QYE A;  1W0J G;  5IY5 B;  4XIP A;  5BOC A;  3SPG A;  3O6O A;  1YC1 A;  1QBZ A;  4GCZ A;  1UYF A;  2QFO A;  1GO3 F;  3CGY A;  3JD3 A;  2X7R B;  1Q81 W;  4E02 A;  4JYC A;  2M7W A;  2W6J G;  4J9Z B;  4YXW G;  3Q5L A;  4MTX A;  2GFD A;  3OUF A;  2CG9 A;  2NNU A;  1OCO C;  2WI5 A;  3OEE G;  3K9A A;  1I5D A;  1R62 A;  2XDL A;  2WER A;  2IU0 A;  2CCS A;  3QO8 A;  1S72 V;  3G75 A;  4XIQ A;  4DUH A;  3FB7 C;  3BM9 A;  2YE5 A;  1I58 A;  2BSM A;  2WI4 A;  4R8C A;  5LHH A;  5B1O A;  3STL C;  1TIL A;  2HG5 C;  2ITD C;  3UKM A;  5M4M A;  2YKI A;  4YKQ A;  2HFE C;  3JYC A;  4WFG A;  2PI4 A;  3R4O A;  5M4P A;  1R6N A;  1VQ4 V;  1K7D A;  5EC2 C;  3G71 V;  1M56 C;  2C2A A;  1TH8 A;  4H37 A;  4FCR A;  4MP2 A;  3ML0 A;  1OZ0 A;  3VHD A;  2DYS C;  4P2Z A;  4U7N A;  4UVC A;  3CRK A;  2LFR A;  4XBF A;  3CC2 V;  1VQM V;  2YSU B;  5H9C A;  5CTY A;  2QM8 A;  2XAH A;  2ZDY A;  1I5B A;  3PEH A;  3WHA A;  2XJJ A;  4ASF A;  3AG4 C;  4HXZ A;  4U7O A;  2Q8G A;  1GM8 A;  1P7B A;  3K04 A;  4X8A A;  2BTZ A;  5KUK A;  3ZXO A;  3ZRX A;  4XKA A;  3R65 A;  1R3I C;  1Q7Y W;  1NHH A;  4CWP A;  4EKW A;  1US7 A;  3CCQ V;  1Y66 A;  2FWZ A;  2YE3 A;  1KP3 A;  4MW3 A;  2H8P C;  3RLQ A;  3STZ C;  1YT0 A;  2EIM C;  3A0Z A;  1TC0 A;  4EGI A;  5M4H A;  1QVG U;  2Q6A A;  2XOK G;  3CP1 A;  4BIU A;  2XAG A;  3MNR P;  4H7Q A;  1G4Y B;  3X2Q B;  2YE2 A;  5D6Q A;  3OW6 A;  1WPX A;  1S5H C;  4MBC A;  3EKR A;  3B24 A;  4YKY A;  1CEZ A;  1JPX A;  3T0Z A;  4HYP A;  1M57 C;  4XCJ A;  3ABM B;  3CPW U;  4BXI A;  3K03 A;  3TZ5 A;  4WF9 V;  1TUE B;  4KFG A;  4FK5 C;  2JDI G;  2JK5 C;  4V26 A;  4FCP A;  2BOC C;  3SL2 A;  1S0V A;  3EHF A;  2EJR A;  1KD1 W;  2Q69 A;  5B1B B;  1UYH A;  2XDS A;  1FXV A;  4X9L A;  4HAM A;  3KG2 A;  4RQE A;  1K97 A;  1UY9 A;  1Y4U A;  2FYP A;  3PJS K;  3G4S V;  1JQ0 A;  1FXK B;  5CBH A;  4PL9 A;  4CWS A;  4CWT A;  4GT8 A;  1K73 W;  1K8A W;  2GQP A;  2IWU A;  4XDJ A;  4ZVI A;  3CCS V;  5GW7 A;  2ZXW C;  3JZ3 A;  3R4M A;  2HG1 A;  1GM9 A;  1K4D C;  1BL8 A;  2IU3 A;  3FT5 A;  2YEF A;  3SYO A;  4GGL A;  5D7D A;  4BAE A;  1RPO A;  2QG2 A;  3TZ4 A;  2WAM A;  3SYP A;  1RM1 C;  5FNC A;  2JEX A;  3FB8 C;  2XJX A;  1BHA A;  2YKB A;  2DQ0 A;  1W2B U;  1MSW D;  3NXS A;  1Z5A A;  3EHH A;  1H8E G;  1B6Q A;  5LGT A;  2YJW A;  2IJJ A;  4BQJ A;  2DYR B;  1KQS U;  3OWB A;  3ABK B;  1UYM A;  1YET A;  1SER A;  1NKD A;  3OM3 B;  4HY1 A;  4JQL A;  3OGC C;  2WI6 A;  2BU7 A;  4H33 A;  1YJW V;  3LUT B;  1GJV A;  1H7U A;  4JF3 A;  1H8H G;  3P30 A;  5LGN A;  3B8N A;  2WLK A;  4XIR A;  4FJC C;  5HFM A;  2HVJ C;  1COW G;  1JVM A;  1AJ6 A;  2BU6 A;  3CMA V;  1RPR A;  4XIT A;  2YE8 A;  3ZM7 A;  1M1K W;  1OCC B;  2P6J A;  2JJ2 G;  4EGK A;  4CE2 A;  1OSF A;  2WEP A;  2P7T C;  1AJN A;  4EFU A;  5FWK A;  3VHA A;  2R9I A;  4MS2 A;  3INX A;  2FWY A;  4YKW A;  3TET A;  2YEV B;  3HZ5 A;  3P32 A;  3RBZ A;  4URL A;  2YI7 A;  3TZ0 A;  1LNQ A;  3CCR V;  1S3J A;  5L3D A;  2YE9 A;  1BKN A;  1Z5C A;  1FFT B;  3B8M A;  4PDV A;  1EFR G;  3AG4 B;  3MHS C;  1GM7 A;  2X6C A;  1I59 A;  4PRV A;  4O07 A;  2XAF A;  1DF5 A;  1WLE A;  1IXM A;  1OCC C;  3SYC A;  3B77 A;  4WFB V;  4PDM A;  4GX1 A;  3ETE A;  1B3Q A;  3CC7 V;  2BT0 A;  2O1V A;  3K98 A;  3VAD A;  1ORQ C;  4P9O A;  4R6Z A;  2UXX A;  4RO2 A;  4I9W A;  1MG1 A;  2H55 A;  4NH8 A;  2H94 A;  2DWE C;  3RLR A;  3ZKD A;  3DGE A;  3E86 A;  4KSG A;  3W7S A;  4URO A;  3R91 A;  4XTJ A;  1M56 B;  1VQP V;  4E00 A;  1E1R G;  2CGF A;  2HKO A;  2XHT A;  3CD6 V;  2ATK C;  3GWO A;  2XDX A;  1L0O A;  3ZMS A;  4O09 A;  2WLL B;  1VQK V;  1QZR A;  3OFN G;  2QEX V;  1NH2 D;  1TID A;  4ASA A;  4X89 A;  2ITC C;  3ZN0 A;  4J9Y B;  4UXN A;  4BQG A;  2YEV A;  2Q67 A;  2ZDX A;  2XX2 A;  1SES A;  2ZR3 A;  2CH4 A;  1R3L C;  2ZBK B;  1GKF A;  4BAY A;  3IED A;  3T0H A;  3CCE V;  5LGU A;  3VHC A;  5CN0 A;  1F4M A;  4KP4 A;  4EM7 A;  4H85 A;  5M4E A;  1I5X A;  1R6K A;  1Q86 W;  4KUM A;  2DQ3 A;  3R4P A;  5L3G A;  4XDM A;  5EBM C;  1K34 A;  1DTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...