4Q20A

Crystal structure of a c-terminal part of tyrosine kinase (divl) from caulobacter crescentus cb15 at 2.50 a resolution (psi community target, shapiro)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
233
structure length
231
Chain Sequence
ALADRSAALAEAERLKRDFVGNVSYELRTPLTTIIGYSELLERADSERGRNHVAAVRAAATQLARSIDDVLDMAQIDAGEMALEIEDIRVSDLLLNAQERALKDAQLGGVTLAVECEEDVGLIRGDGKRLAQTLDHLVENALRQTPPGGRVTLSARRALGEVRLDVSDTGRGVPFHVQAHIFDRFVGRDRGGPGLGLALVKALVELHGGWVALESEPGNGSTFTCHLPETQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cell fate regulation governed by a repurposed bacterial histidine kinase.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Transferase
molecule keywords Sensor protein DivL
total genus 77
structure length 231
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4q20A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4q20A02
5D7RA 2BZ5A 3A0TA 4O05A 3D36A 4XIRA 4WUCA 3EHFA 1S14A 1R62A 2QG2A 2UWDA 4FCPA 4U7NA 2QM7A 3P32A 2XDKA 4URMA 3K97A 3K99A 4R3AA 2XABA 4L8ZA 4KTNA 1I5DA 1MX0A 1ZXNA 2YKBA 2YJXA 1ZWHA 4CWOA 4YKUA 1NHJA 2YE9A 5CTYA 1Y4UA 4URNA 2BU8A 2WI3A 4FCRA 4HXWA 2YE8A 2YEBA 2YE7A 1UY8A 4U7OA 4CWQA 2YGFA 4L91A 1TBWA 2HCHA 2BSMA 2ZKJA 3LPSA 1BKNA 4AS9A 3EHHA 1AH6A 4CE1A 2XD6A 2IWUA 1Y8PA 2QG0A 1UY6A 2FXSA 1YETA 1I5CA 5C93A 3K98A 2YEEA 1TIDA 2YE4A 4WUBA 1Z5AA 3GIEA 4ASBA 4LC1A 2VCIA 4E01A 3CRLA 3T1KA 3VADA 4EEHA 4AWPA 3QTFA 4YKQA 4BQJA 2QFOA 1B3QA 3T2SA 4GCZA 3Q5LA 2BYHA 1QY8A 2XHTA 4XKKA 3VHAA 2YKJA 2YEDA 4W7TA 1GKXA 3HYZA 2CH4A 4O09A 3OPDA 1UYIA 3CRKA 1YC4A 4DUHA 4PRVA 2HG1A 1BGQA 4XITA 2XHRA 4QPJA 3U2DA 2WI4A 1EA6A 3HZ1A 2BU6A 3PEHA 2EXLA 4CE2A 5IDMA 4UROA 5FNCA 4R3MA 1KZNA 4GT1A 2BTZA 3QDDA 1YT1A 2WEPA 3H4LA 3ZRVA 2VW5A 2XDLA 3OW6A 4EGKA 2IORA 1TH8A 1AM1A 2CGFA 3EKRA 4WUDA 3VHCA 4Q20A 3ZCCA 4AWOA 2YEIA 4CE3A 3O2FA 3B25A 4PU9A 1TC0A 3MNRP 4I5SA 2YI6A 2ZDYA 3OWBA 4BIUA 2CCUA 4U93A 4MT8A 3NMQA 1ID0A 2GQPA 2YE2A 2YJWA 4URLA 3G7BA 2YI5A 3R4PA 4ZKIA 5D6PA 4MBCA 1NHIA 4XCLA 2YEJA 4FMTA 3TZ5A 2H8MA 1AJ6A 5B1OA 2YEGA 4XIPA 3OMUA 4V26A 5L3JA 4MOTA 1UY9A 2XJGA 5IDJA 4KSGA 5FWKA 5GGZA 3ZRWA 4NH7A 1L0OA 2Q2EB 4MP2A 4GQTA 2E0AA 4HYMA 4O0BA 2FYPA 1TC6A 3T10A 2AKPA 3BM9A 4LWIA 3G75A 4XKAA 4YKZA 1H7SA 3FT8A 4EGHA 4MPNA 1UY7A 3EKOA 3Q5KA 3T0HA 3ZKDA 2YEFA 4MPEA 2O1WA 2YE5A 4KSHA 2XX2A 3GIFA 2Q8IA 2YGEA 2CG9A 2WI5A 4V25A 4KP4A 1OSFA 4FCQA 2BREA 5FNDA 3PEJA 4NH9A 2Q8HA 2CCTA 2LFSA 4B6CA 4BAEA 1YT0A 3LNUA 4PRXA 3ZRWB 4XIQA 2BU2A 1UYGA 3R4MA 1YC3A 4BIZA 3A0RA 3ZM7A 4CWSA 4PL9A 4NH8A 1Z5CA 2YK9A 2WI7A 4BQGA 4JAUA 1IXMA 4BXIA 2H55A 1Z5BA 5M4PA 3B24A 1YC1A 3C11A 3GIGB 2GFDA 4GGLA 1UYFA 5M4NA 5M4EA 1JOYA 2YKCA 4LPBA 5F3KA 2O1UA 2WI2A 4FPPA 4B7PA 5M4HA 5CPHA 2PNRA 3RLRA 1UYMA 3Q5JA 4HYPA 5CTWA 3FT5A 1PVGA 4EGIA 2QF6A 3A0XA 2ESAA 5J6AA 3B27A 1H7UA 4EFUA 3K60A 2BU5A 2Q8FA 1NHHA 1AH8A 2IOQA 2YECA 3IEDA 4ASFA 3TUHA 1YERA 1UYHA 2K5BA 2XK2A 3OWDA 3ZXOA 4P7AA 2P67A 3R4NA 3U67A 5IN9A 4JASA 1I5AA 1MU5A 4O04A 4CWNA 2LFRA 1GKZA 3U2KA 3INWA 5BOCA 2VWCA 2BYIA 4LP0A 4LWHA 1UYDA 4XD8A 1QYEA 3BMYA 4P8OA 2JKIA 4JYBA 4E02A 2XHXA 3GIGA 3KE6A 2QM8A 1Y8OA 3HYYA 2YGAA 3TZ0A 1YSRA 1GJVA 4XE2A 1UYEA 4HXZA 4O07A 4LWFA 4X9LA 2HKJA 4L94A 2CCSA 1US7A 4YKRA 1KIJA 1F51A 4GEEA 4LWEA 2YE6A 2BRCA 4H7QA 4ASGA 3A0ZA 3T0ZA 3HEKA 4KQVA 3R4OA 4L90A 1B62A 4EMVA 4E00A 1UYCA 2FWZA 5CTXA 4ZVIA 5FNFA 2WI1A 3WHAA 2YEHA 2BU7A 1YT2A 5BODA 4YKXA 4HY1A 5B1NA 2XDXA 4L93A 4I3HA 2WI6A 2XCMA 4HZ5A 2YKEA 3VHDA 1I5BA 3B26A 3G7EA 4CWRA 1I59A 1B63A 4K4OA 3O0IA 5M4MA 1YESA 3CGZA 4JQLA 1Z59A 3CGYA 4DZYA 3MD0A 2XDSA 3R92A 4XTJA 3D0BA 1TILA 1ZXMA 1I58A 4XC0A 3ZXQA 4YKYA 3HHUA 4H85A 3INXA 2JJCA 3TK1A 5F5RA 3RKZA 1UYKA 3A0YA 3TZ4A 3C0EA 2YEAA 2XDUA 2BT0A 2FWYA 1JM6A 1U2OA 2YKIA 4MP7A 4CWTA 2ZDXA 4CWFA 2VCJA 3R91A 4XKOA 3A0WA 1Y4SA 3H80A 1UYLA 3EHJA 4XDMA 2WEQA 2WERA 5D6QA 4ASAA 4HZ0A 4EM7A 4MPCA 2ZBKB 1S16A 1U0ZA 2IOPA 5CF0A 1ZW9A 4HY6A 2WWWA 4GT8A 4QPKA 5D7DA 4YKWA 3D2RA 2XX5A 3RLPA 3O6OA 4R1FA 1BXDA 1Y8NA 5M4KA 1YS3A 1EI1A 1A4HA 3RLQA 4AWQA 5J71A 3EHGA 3JZ3A 4MB9A 3SL2A 4XCJA 1BYQA 2XX4A 3NXSA 2XJJA 2Q8GA 3B28A 2IWXA 3ZKBA 4H81A 4YKTA 2YE3A 5CTUA 1THNA 2O1VA 3DGEA 4CWPA 2IWSA 1QZRA 3FV5A 2YI7A 3HZ5A 3CWVA 1AMWA 4JAVA 3TTZA 4EFTA 4GFNA 4KFGA 5D7CA 2YK2A 2FTKA 1YSZA 2XJXA 4MTXA 3ZRXA 2YI0A 4LWGA 2C2AA 3TZ2A 3WQ9A 4JYCA
chains in the Genus database with same CATH superfamily
2BZ5A 3A0TA 3IGAC 3ABLB 1M4UA 3L73H 2YC0A 1P7BA 2PI5A 5E79Z 1XI1A 3RYFA 1QBZA 3P32A 2XDKA 4URMA 1QHTA 3K99A 4R3AA 3EXAA 3S5TA 4G27B 1WN7A 4KTNA 5B5EZ 1NR1A 5FPOA 3FAVB 3K0DA 3OGIB 2YJXA 1IURA 4YKUA 3HKEA 3JALA 2C1IA 1Y4UA 4URNA 1Y76B 1HP8A 2WI3A 2GUZA 4K3AA 3K06A 3DC5A 2V4DA 1NTKH 4U7OA 2YGFA 4L91A 4PA9A 4GKKO 4HNAB 4LFAO 3K5LA 1GMGA 4LF9O 3LPSA 1TAEA 4P9PA 4TUYB 1DF4A 3ZMTA 1M56C 1MOFA 2F93B 2AXTZ 1AILA 2E3CA 2YEEA 1SZTA 4PA7A 4DR6B 5LGUA 3N27A 3QNEA 2AGAA 4TQFA 1Z5AA 4ASBA 2ZCEA 2Y4UA 4UB8Z 4WFAV 2XAFA 1NT2B 3A8TA 4LC1A 1QCEA 4AQYO 1MNGA 3CRLA 3VADA 2QE7G 2EJRA 4EEHA 3QTFA 5GTIZ 3L72H 4BQJA 1TA8A 1YJ9V 3OEHG 3E86A 3Q5LA 1BL8A 2ZIOA 5IT9N 1WJZA 2VS0A 1NI8A 2JGUA 1EM1A 3OM3B 1F4MA 5IYZA 1GKXA 1UYIA 1I08A 2WSSG 3HKCA 2Q7HA 1FJGO 4WFEA 4DK1A 1GRJA 2WI4A 1NKDA 1AP6A 3THOA 3DC6A 5IDMA 4JI0B 4UROA 4JYAB 5FNCA 3W7WA 1K4CC 2ZE6A 2XAHA 1NVPD 3SJBC 3QDDA 2WEPA 3H1LH 2Q6AA 3AG2C 3ZHUA 4JI1O 4JI8B 1IDSA 5LA6B 1AI6A 4X8AA 3EKRA 4WUDA 1KYOF 3VHCA 4O4JA 1SF9A 2YI8A 4YJ3B 1NR7A 3O2FA 3BAAA 3B25A 4PU9A 2BSKA 3CE2A 3MNRP 4B7KA 4FM2A 2YXYA 4U93A 4LF8B 2YE2A 2P4VA 4URLA 3R4PA 2JEXA 5JCOA 3JSNA 4CZZA 4MBCA 5L3FA 3ZN0A 1N34B 3TZ5A 2H8MA 2CTQA 4XIPA 3RYIB 5L3JA 2XJGA 5IDJA 4LH6A 2WLKA 4BW5A 3RYCB 3T1YO 1FXKC 2PTMA 3ZRWA 1L0OA 2Q2EB 4MP2A 5LGTA 4O0BA 2JS3A 1TC6A 3T10A 4YJ3A 3RYCA 4LF6B 4LWIA 3G75A 4XKAA 3I56V 3F5WC 2EIMC 4AILC 4MPNA 1H38A 1DLBA 1OCZB 3T0HA 3FB7C 1KU9A 2CE4A 1N36O 2AZ0A 4MPEA 1LUWA 2XT9A 2DOSA 3GIFA 3DSQA 5L3DA 4KP4A 2YIBA 3PEJA 1NTZH 2JEUA 1KECA 2CH7B 2OIGA 2JVDA 3E22B 4FLUA 5LBQA 1Q90D 3JD0A 3K5OA 2BU2A 2JGDB 1HNWB 4NXMB 3KZIZ 4U3FH 1YCIA 4H44B 3T1YB 3C90A 4GX2A 4PL9A 4BAYA 2YK9A 4PV1B 3HKEB 3FD9A 5BMVB 4DR1O 1ZUQA 4BQGA 4AI8A 4EFBA 1Z5BA 3AG3B 4FFKA 2YIAA 3GIGB 1OCRC 2XOKG 3R66A 5EIBD 2GFDA 4GGLA 3AG7A 1R3JC 2YKCA 3P30A 5F3KA 4FPPA 4I9QA 3RLRA 1JJOA 3Q5JA 3STLC 1SQBH 1YZBA 2B5UA 1PVGA 4DK0A 4EGIA 4Q6GA 4GX5A 1WB7A 2AZ2A 5JVDA 2ZINA 5J6AA 3E8BA 3KCYA 2BU5A 1NHHA 4CC5A 1PD3A 2CUGA 3ZRSA 3TJTA 3CCMV 2IOQA 4ASFA 4QJFB 1YERA 4H13B 5IY5B 4ABMA 2RDCA 1RP3B 2K5BA 4RQEA 3OWDA 2CTPA 1Q6UA 3R4NA 3U67A 2UUCB 4O04A 5IJ9A 2LFRA 2QWQB 4JV5B 3ASNC 3U2KA 5EIBC 2VWCA 3LDEA 4J41A 2ZDIA 4DUYO 5ITZA 3U0ZA 1UYDA 4P8OA 4JAAA 5KX5A 3TZ0A 1YSRA 2ZE7A 1GJVA 3APQA 1VQ9V 4JI2O 4HXZA 4RQFA 5DECA 4CS2A 1A32A 5E1AC 1KIJA 3EVKA 3JARB 4WFHA 5CBFA 4I0XB 4ZOLB 2VQEB 3T0ZA 2QEXV 2UXBB 2PF4E 3RYFB 2X6BA 5LMNB 4KQVA 4L90A 1SQQH 1B62A 4DV5B 1UYCA 3ASOB 1H2KA 3WHAA 1I94O 1S5HC 2W0XA 1YT2A 1MSWD 3E8GA 4PDRA 4YKXA 4HY1A 1XMQB 1I5XA 5KLVH 2Z0AA 2ZQMA 2XUMA 4HZ5A 4DV6B 1UPGA 1V54C 1YEWA 3WFVA 2HG5C 1GO3F 2DW4A 2PI4A 1GH6A 3L70H 3CCRV 4JI2B 4O2AA 2UXCO 2R72A 3VBBA 2E5LO 1Z59A 2EIMB 3SYOA 2UXDO 1NTMH 3RVYA 2KQXA 4OPHA 1TILA 1ZXMA 1I58A 4XC0A 3ZXQA 3AG4B 1GN4A 1KMIZ 4YKYA 4H85A 3E2EA 2JJCA 5F5RA 4LBEC 5LMNO 2QKAA 3K59A 2Q8VA 2N74A 2MW2B 2YEAA 4OXSA 4LFBO 3LNNA 1ENVA 1JFFA 2R9AA 4CWFA 1Q86W 3R91A 4ZHQA 2UUAO 3A0WA 1Y4SA 3H80A 5F2VO 2QWPB 5L3GA 5L3BA 3LNMB 3S3WA 3SYQA 1AR4A 3GB7C 4UV8A 1VEWA 2ZBKB 4D7TA 3QO5A 1TUBB 4WBNB 4L8JA 1JR9A 5IY5C 5LMUO 1ZW9A 4C7UA 4DR7O 1K34A 2ZT9B 1G8MA 1XHZA 1N33O 3IAYA 3OEEG 2UUBB 1XNRB 3ZMUA 3J81N 1BGYH 4R1FA 1DGSA 1BXDA 4X1KA 2JGDA 1SQPH 2JJ2G 1QQCA 1Y6XA 5CA1B 4LWSB 5IYCO 1RM1B 1M90W 3F7VC 3K3WA 4FZ0A 3G71V 3K0GA 2A7WA 3RLQA 5ITZB 4MB9A 3FKSG 3SL2A 1AB3A 2V7QG 3NXSA 5CB4A 4JI4O 1XMOB 4IIJA 3B28A 1MMMA 3ZKBA 3CC7V 2CAZC 4WBNA 4B3TO 2EILC 2ZE5A 4JYYA 2O1VA 4K0KB 4O4LA 3IC9A 1ZX3A 5JJJB 3B77A 3CWVA 3H1KH 2NR5A 2QGNA 1F23A 4LF5O 1NS1A 5JH7B 3O9OA 5C8YA 3SPGA 4FJCC 2ADPA 1FFTB 4WFFA 1LR1A 1YSZA 2ZDIC 5EYPA 2QM4A 2CTRA 2Q67A 2CGNA 4JTDB 4YIPA 3ABMB 1HNZB 4JYCA 3EFFK 2DE0X 5IE9A 4U3JA 5D7RA 4O05A 3D36A 4AQYB 4F6EA 2FKXA 1R62A 4U7NA 4KUMA 1XMOO 1N0NA 2QM7A 4DV0O 1OCOC 3K97A 5J9PC 3BCCH 2HLDG 2B1GA 3G6EV 1VQ8V 1MZEA 4E72A 3ML0A 1I5DA 3HKDA 2QSAA 5CTYA 1EZJA 1EN6A 3SJQC 3BFRA 1JX9A 2YEBA 1K97A 1Q6HA 4CWQA 4DR2B 1XREA 1NVPB 1TBWA 3FB8C 2A9HA 4TOIA 4AS9A 1TVKB 5A2QN 3FYIB 4TT3G 3CRAA 1AH6A 1BS3A 5LHIA 3RN4A 2OT5A 3NR7A 1FXKB 1QLEC 2WLHA 4WUBA 1H2SB 4BWAA 1R3KC 3B09A 1OCCB 1YXBA 2GSMB 2B1IA 3CJHA 4ICGA 4LF8O 2E76B 4X65B 4AWPA 1EFRG 4YKQA 2QFOA 1KC8W 4ZHQB 3SDLA 4U3JB 4GCZA 1OJHA 3CEIA 2ZNIA 1CEZA 4J80A 3UQ8A 4IYIA 2WAMA 2OCCB 1VMGA 3JCUZ 4W7TA 2CH4A 4O09A 3OPDA 1BHBA 3BA9A 4B08A 3HZ1A 2BU6A 2L6LA 1WPXA 2DYSC 2EXLA 5GONB 1ORQC 2K9PA 4PI2A 2ILMA 1BQ0A 1R1BA 3OUFA 4OX9O 4MVOA 4R3MA 1KZNA 2BTZA 1MSDA 4JI7O 1VP7A 3LMMA 4FZ1A 3H4LA 2YDEA 1SS3A 1JFFB 1E1QG 2GV9A 1U96A 2VW5A 4EGKA 1UFIA 2IORA 1AI5A 3K03A 2KKWA 5JENA 4GX1A 3CYOA 3ZCCA 4AWOA 4CE3A 1T5EA 1RPOA 1KP2A 1QR8A 2F4VO 1KBHA 2YI6A 2HJDA 3OWBA 3MDSA 4R7CA 3ZMZA 2GQPA 2YJWA 2YS8A 3SYPA 1RPRA 2R70A 1AJ6A 3OE7G 2YEGA 1QR9A 1K5QA 1QNMA 2JDIG 2D2CB 4OX9B 2WPDG 1R6KA 4X1KB 4KSGA 2LW1A 1FXHA 5GGZA 2LW7A 4GQTA 1OCRB 2E0AA 4HYMA 2A06H 5JQGA 4JI7B 2FYPA 5A9GA 5D5PA 2AKPA 1IX9A 3BM9A 1B06A 3IFXA 3ABKB 1M57B 4YKZA 3GVMA 2OWOA 3K9AA 1M5IA 1SQGA 2JIZG 3WU2Z 3G80A 4J9ZB 2OYQA 5GONA 1Q82W 1HWYA 2WI5A 4CH4A 2PYLA 3UT5A 3OMNB 3HKDB 4YXWG 5BXZA 1QLEB 4UUJC 1OCOB 4E2LA 1K73W 1OSFA 2BREA 4FCQA 1EZVH 4NH9A 2Q8HA 3E35A 4XDKA 4B6CA 4BAEA 4GYCB 3U10A 1MZFA 4PRXA 3FX7A 2BTQA 4XIQA 3SYCA 4IGGA 1Q3EA 1UYGA 4K8XA 1M9NA 2QTOA 3A0RA 3TXSA 2OCHA 4Z2WA 1RSOB 2BOBC 4JTCB 1Z5CA 2WI7A 4J7KA 5IWAO 5GTHZ 3B24A 4DV3B 2ODMA 5LGNA 3QO8A 3T2MA 2NLJC 1NQTA 5M4NA 1UYFA 5TISZ 1JOYA 4PA4A 2YXLA 4K8ZA 2WI2A 1ZAUA 2DMXA 5M4HA 2A0LA 4TUYA 2KSDA 4AHCA 3JD2A 4GKJB 1UYMA 2WLJA 3CCSV 2MK3A 5GW7A 2VQEO 3FT5A 2W6IG 4GUNA 2VQFB 3SPJA 4OPAA 3A0XA 3IC7A 3B27A 5D5QA 1AVMA 5J2UA 4DR5B 5FL7G 2L35A 3JAWA 4JZ2A 1L0LH 1XQ8A 2Q8FA 1V55C 4B7EA 1XMQO 4L87A 4JYAO 4MVQA 3IEDA 3CCLV 1L8DA 4DV6O 1FXKA 2X6CA 4EKWA 2RQ6A 1QVGU 4FLYA 4P7AA 1Q6IA 4DV2O 3WG7B 3PJSK 2EZOA 1GKZA 1ZLZA 5B1AC 2QDOA 4X1YB 4LH7A 5H6QA 1GM9A 4KHPB 1J5EO 5JCOC 2BE3A 4XD8A 5FPRA 1QYEA 4E02A 2P5OA 2XHXA 1YDXA 4H37A 3W7SA 2QM8A 2HHHO 3HYYA 4H33A 3RYIA 1KP3A 3VQVA 3AG2B 1NH2B 5KHKA 1SQXH 4X9LA 3AG4C 5EYPB 1Y76A 1XILA 3WB1A 1W59A 1UJWB 1RSOA 1P84F 1F51A 2EIJB 4B3SO 4GEEA 1YSCA 2YE6A 4IHJA 1L0NH 1Z2GA 4LP8A 2M6YA 5EZYB 1TUBA 1MA1A 4O4HA 3R4OA 3S3XA 3F5TA 4X62O 2BSKB 5CTXA 3SPIA 3UT5B 3FYEB 5BODA 3D8CA 2EIKC 3N2KA 2P7TC 4YJ2A 2HJFC 1FFXB 4DR7B 2WI6A 4XBFA 3QO7A 1I5BA 3CC2V 5CA1A 1JA8A 4UCTA 1H8HG 1VIBA 4CS3A 4FM0A 3CGZA 4PD4F 1Q5OA 3CGYA 4X9QA 3MD0A 3JD1A 1FPOA 4WCEV 3B4SA 2P6JA 4LF4B 5K1XA 5LYJA 3D0BA 5EC2C 4DRXA 4G2KA 1ZWIC 3ABMC 3HHUA 3M99B 4O2BB 4B3TB 3RKZA 1UYKA 3A0YA 3OGCC 3OMIB 4MW8A 1JM6A 4HYOA 4JF3A 3WB0A 5H5NA 2YKIA 4O4IA 4UCSA 1WA8A 3ASOC 3CWBH 4LNUB 4UFZA 1UYLA 3EHJA 4XDMA 4W4LA 3ZHVA 5CA0A 3A2FA 4IT5A 4DV1O 3T1HB 1XUQA 4MPCA 3OTOO 4DRXB 4O4HB 2IOPA 1XOUA 2A79B 5CF0A 5DN6G 4HY6A 3ETEA 3JARA 3D3IA 4YKWA 2ZIMA 1K8AW 4BIOA 1XNQB 1BQZA 2HP8A 2IU0A 2BOCC 5DM6V 1Z5VA 2EINC 1H2NA 4R6ZA 2KB1A 1DF5A 4OGQB 1CP9A 4AWQA 4XCJA 1XEQA 2XJJA 4H81A 4A5UB 3LUTB 4NB5A 2O57A 3ETGA 4MTGA 4JI6B 1PL4A 1TGOA 3B2EE 3AG1B 2DYSB 3CS5A 1QZRA 2IWSA 3FV5A 3OTOB 2YI7A 2Q7EA 1THZA 1GTOA 1AMWA 3TTZA 4DO2A 4EFTA 4GFNA 4TV9B 1W0KG 3SGIA 1HNXB 4I55A 3W7XA 1J95A 5B66Z 1B6QA 5IYZB 4MTXA 4KL1A 4P9OA 2XAGA 3L9DA 4LR3A 3GWOA 1AI7A 2X6AA 3CJHB 1XNQO 5DEDA 2C2AA 4MVUA 1MABG 1KKDA 1M1KW 1PPJH 4XIRA 3SYAA 4WUCA 2JS5A 3EHFA 1PKXA 1S14A 5EBWC 2QG2A 1BMFG 1VQKV 4DR4B 2WLIA 2Y4TA 2ITDC 1US6A 1VQLV 4WFBV 4TSFG 4FFBB 4EB6B 5B3SB 4J9YB 4UVCA 2XABA 2OIEA 5EK0A 5FLXN 4DR6O 4LCUC 1Q43A 4L8ZA 2XHBA 1ZWHA 3R65A 4J11A 4FCRA 3JATA 4HXWA 5KHGA 2E5LB 1VQ4V 1DTOA 4DV4B 1TUEB 2AHZA 2Y48A 2CH7A 3M7MX 2BSMA 4N21A 2BTQB 5HFMA 2ZKJA 1GM8A 2CTWA 2DYRB 1H2LA 2IJIA 2UXXA 5CMUA 2ZXWC 2XD6A 4PELA 4X88A 1Y8PA 5KAFZ 3CCVV 2FXSA 2EINB 1RM1C 3CYGA 3N2GA 2ATKC 5CA0B 4O4JB 2YE4A 4JI5B 2GBOA 1N8RW 1I5YA 5LP6A 3I55V 3DXRB 4E01A 3T1KA 3M8AA 2Q0OC 1I0HA 4I50A 5IJ0B 4UCVA 1FAFA 5EBLC 2ZR2A 3D3QA 3T2SA 1AJPA 4MTOA 1QY8A 3SPCA 2XHTA 4O2BA 4JI1B 2IH3C 1COWG 4XKKA 1U97A 2DWEC 3JD4A 4F6RA 1K7DA 1MG1A 3CRKA 4PRVA 2AHYA 1BGQA 2XHRA 5LHHA 3RWRD 3U2DA 2H94A 2IJJA 3B8MA 3RBZA 4QE9A 5LYJB 2RMKB 1EA6A 3PEHA 1WAZA 2N04A 4UCRA 4CE2A 5H9CA 4KFMA 4MVMA 4GT1A 5KA5A 1VQOV 2X7RB 1N34O 1HR0O 1SQVH 1YT1A 4XDJA 2W0FC 2ZD9A 3BA8A 5AG2A 1G1XB 3K57A 2P22C 1URFA 4J7ZA 3ZRVA 4FLVA 4UCOA 1ROPA 5JVDB 1L1FA 1TH8A 1QU7A 2LJ2A 4NKGB 2E74B 4Q20A 1WNSA 4EEQA 2PGGA 4NR1A 4IL6Z 4BIUA 3G67A 2CCUA 1CXZB 2WLLB 1ID0A 4PJ0Z 2QKCA 4ZKIA 3AG1C 1NHIA 1IZ3A 3X2QB 2YEJA 4XCLA 1PV0A 1HNZO 3CMAV 2FMLA 3OMUA 4V26A 2BTOA 4MOTA 3OW2U 2HKOA 3JCZA 5FWKA 1AJQA 1HW7A 1M93A 4NH7A 2ZM6B 1N32B 5JJEB 4D6TH 4B3RB 2QJ1A 3FFQA 4WF9V 1H7SA 3FT8A 4EGHA 2HFEC 4DR1B 1UY7A 3EKOA 3Q5KA 3E22A 3B40A 3K5MA 2YEFA 2ITCC 2DQ0A 4KSHA 3QVNA 2Q8IA 2CG9A 4NTYA 4V25A 1VF5B 2Q7GA 3OR6C 4W4KA 3P3PA 1SA0B 2LFSA 2DQ3A 4MVRA 3RVZA 3LNUA 5B1BB 3U11A 2F66C 1V55B 2YEVA 3H1JH 4X66B 4FLWA 5JWPA 3R4MA 1YC3A 1VQMV 1BT8A 1QVFU 1GAXA 3ZM7A 3OMAB 4CWSA 1VQ7V 2DN9A 1N32O 1FXVA 4E4EA 4B3RO 1PNKA 4BXIA 4P2ZA 2F95B 2H55A 2FYUH 2JJ1G 1J5EB 1N36B 5M4PA 3HB3B 2GDSA 2HEPA 3C11A 2W6JG 3K04A 5FNVA 4FFBA 4EB6A 1KQSU 4LPBA 3CC4V 3B8NA 2O1UA 3ZMSA 3K08A 4HAMA 4PA6A 4FLXA 3UO2A 5CPHA 2Y0PA 4TV9A 3WB2A 2OTJV 4B7PA 3UO3A 2PNRA 3ZJZA 1BHAA 4QGPA 2WLMA 1HNWO 4HYPA 1Z5WA 2QWRB 1Q7YW 1NBMG 4DUYB 5H2FZ 2QF6A 4LFCB 4JI3O 2ESAA 2ARHA 3STZC 3ZHQA 2F1MA 1KB9F 3VQYA 1R3LC 3P3NA 3H9VA 2YECA 4GX0A 2QKSA 4I4TA 4PI0A 1R6NA 5LXTB 1WP8A 5BR8B 2XK2A 3ZXOA 1YIJV 1EN4A 2P67A 2K1EA 5IN9A 1R6TA 4LNUA 3H1HH 3LSUA 1MU5A 4CWNA 1PM9A 3A0BZ 2QR4A 3HR0A 3INWA 1K5SA 1P4RA 4LP0A 4HNAA 4LF4O 3BMYA 3RFRA 3GIGA 1Y8OA 2RJZA 4LWSA 3UM7A 4NXNO 2F4VB 1UYEA 3OTFA 1K9MW 1SC5B 1K4DC 3IJ4A 4DR3O 3JAKB 5J2TB 4O07A 4RO2A 4LWFA 2ADQB 1S72V 4L94A 5B1BC 2CCSA 3ABKC 4CBCA 4YKRA 2IW5A 3AEIA 4PDVA 2LGQA 3JASA 5JQGB 2QWNB 2LGWA 4R8CA 4LWEA 5L3CA 4H0LB 1VQ6V 2BRCA 2UXDB 3JD3A 4Z1MG 4HZ3A 4EMVA 4JV5O 1GKFA 5BR8O 2FWZA 4ZVIA 5FNFA 1H2GA 4YHHB 4FK5C 4NTWA 2BU7A 3JAWB 2VWJA 5B1NA 4LF7B 2XDXA 4L93A 4I3HA 1K92A 1KKCA 3BEHA 3B26A 4CWRA 5KX5B 2YEVB 4UVBA 2XTAA 1B63A 4K4OA 2UUAB 3QG5A 4NXNB 1YESA 1IBLO 1R73A 4DR3B 2M7WA 4DZYA 1OCZC 2XDSA 1P49A 3R92A 3AK3A 1O9GA 1JJ2U 4LF9B 1XHXA 1OZ0A 3TK1A 4D7SA 5LXTA 3JYCA 5EC1C 3CRCA 3ETDA 3N2GB 3ZEDA 2ZE8A 4YHHO 4Z1VA 2FL4A 1JPXA 1U2OA 4DV3O 4CWTA 3VQXA 4XKOA 4LF7O 3CB2A 3ZMVA 2ZKOA 2JRIA 2QA4V 1YF2A 2LO1A 4EFEA 2WEQA 1VF6A 2WERA 2Q4PA 4O4LB 4ASAA 4QE7A 1BZKA 3AG3C 4FIPC 4WFGA 4DW1A 1XDCA 2AW9A 1Y4MA 3OAAG 1OHHG 3CCEV 1FD9A 4B3MB 3CRRA 3ABTA 4GT8A 4QPKA 3CCJV 2FB5A 5D7DA 2VQFO 3D2RA 4DR4O 1XL4A 2X0LA 1WPBA 1FJGB 2YIDA 4NVPA 1F4NA 3RLPA 4DR5O 5FNVB 3O6OA 1P7GA 2YI9A 4PDMA 4FLZA 1GN6A 3BY6A 3LDCA 1YS3A 4TQDA 1Y74A 1IBMO 3ZN1A 1A4HA 1QLNA 1AROP 2ZR3A 3HPLC 4DUZB 3EHGA 5J71A 4GZRB 4RUEA 4DXWA 2BCCH 1S0VA 1BYQA 2XX4A 4RAIA 4YIOA 4YKTA 3CRMA 2YE3A 4ASUG 2OTLV 3ZS8C 1D5NA 5LMUB 4ZOLA 2HR3A 1N33B 3HZ5A 4JAVA 3VQWA 1JQ0A 3BPZA 4IHJB 2HHHB 4KFGA 1XNRO 4B3MO 2UXNA 2PZSA 4F6RB 1Y67A 3ZRXA 4I4TB 3RT3C 1AP5A 2YI0A 1H8EG 2F23A 3CCQV 3ABUA 1VQPV 1CPYA 1G4YB 3TZ2A 4TV8B 1Q81W 2IBZH 4JI5O 2H3OA 3OD4A 4JI4B 5IYDO 3RYHA 4PA3A 3PN1A 3T1CA 2YICA 2UWDA 4K35A 4FCPA 1R3IC 2WA3A 1IVSA 3KCXA 2RN9A 3L75H 4LF6O 2N05A 3QF7A 2B9ZA 3JALB 4J10A 4LF5B 3TGUH 2KG7A 2Q5ZA 3ZHSA 2NNUA 3ZHRA 4BW9A 1MX0A 3AK1A 1ZXNA 2YKBA 5CN0A 3FB5C 4CWOA 2HVJC 1NHJA 2YE9A 2BU8A 1LNQA 5J2UB 4TV8A 2YE8A 2YE7A 1NH2D 1UY8A 3D36C 2HCHA 1YVWA 2C1GA 4MTFA 1HR0B 4YJ2B 1BKNA 2Q9LA 3EHHA 1Y74B 4CC6A 1JVMA 4CE1A 2LQTA 4NXMO 2IWUA 2QG0A 4X20B 1UY6A 4DV0B 5IJ9B 3APOA 1EBOA 1I5CA 1YETA 5C93A 3ZBHA 2R9IA 3BRCA 3K98A 1VQ5V 3TCUA 1TIDA 5HFLA 3ABLC 3GIEA 4X20A 1X4TA 2VCIA 1TVKA 4DW0A 1YTFD 4GLXA 3LDDA 1YITV 4MVSA 1B3QA 4DR2O 4I55B 5LP6B 2BYHA 5LOVA 3AK2A 2EZPA 4I7ZB 2H8PC 3VHAA 2YKJA 2YEDA 2F43G 3I5DA 3DXRA 3HYZA 2V1DA 1YC4A 4DUHA 4PDLA 2HG1A 5IJ0A 1DK1A 4XITA 4QPJA 3UCSC 2ETNA 5CBHA 5KUKA 1Q8IA 2YUAA 3RW0A 2WLLA 3SJAC 3ZX6A 2Q68A 2DYRC 3E89A 5JH7A 1OV9A 2Z5UA 4X65O 3CSXA 4IIJB 3SPHA 4QIWF 5BMVA 3CMEV 4G28B 3W7TA 5CBGA 4RUFA 1KUQA 3ICXA 3CD6V 3OW6A 5LL6Y 2XDLA 4HBNA 5K1PA 3DTUB 5KUMA 1AM1A 3JATB 2CGFA 2YEIA 1W2BU 1WA8B 4X66O 1TC0A 5C8YB 1GK9A 4I5SA 1HNXO 1VQNV 2ZDYA 3F7YC 1NU1H 4MT8A 3SJCC 2A3QA 3NMQA 3KKYA 5LHGA 2YI5A 3G7BA 3H1IH 2IJHA 3HKBA 5D6PA 3CXCU 1GN3A 4J7JA 4UV9A 4FMTA 5B1OA 1KD1W 1SKVA 1UY9A 1IBKO 1K33A 5CB4B 1FYJA 2P06A 3OT7A 1FKAO 2UU9O 4CH6A 2EBOA 5LOVB 5LA6A 4DV7B 2Q69A 1SQFA 1SESA 3H01A 3CXHF 4J42A 4MSWC 1OCCC 3JAKA 5J2TA 2RCVA 3OFNG 4JZGA 4JI0O 1GN2A 3WG7C 2P90A 3ASNB 3ZKDA 1BCCH 1ZL8A 5LP6C 3HKBB 2O1WA 1GM7A 2YE5A 2XX2A 2YGEA 4CH5A 2HVKC 5EZYA 5KMGA 4ZI7A 1NZ6A 2PY5A 2UXCB 4JI8O 5FNDA 4DV4O 1F7YA 5KHJA 2IM9A 2CCTA 2EIKB 1YT0A 4UB6Z 3ZRWB 3N2KB 4GKJO 1N0JA 2VWKA 4X1IB 4XDLA 1PNLA 3GWKC 1RFYA 3RGBA 3LSQA 1N4CA 4BIZA 1IBKB 1V9PA 3KG2A 3MHSC 2UU9B 1YJNV 2Q0AA 4DV7O 4I50B 4NH8A 3VOUA 2IJKA 4LFBB 1AR5A 1SZXA 4JAUA 1IXMA 1K3EA 4FVMA 4X1YA 1EN5A 1YC1A 5B1AB 1SETA 5M4EA 2PYJA 4JTAB 1JCHA 3OR7C 3MAQA 3E8HA 2D3OW 3FB6C 5BZBA 3K9SA 3T4ZA 4BR6A 4IYHA 1WLEA 1NJIW 3MHHC 5H6RA 4DV2B 2EJ7A 4N23A 3ZHTA 1D5AA 3ZIAG 5CTWA 4NYKA 3K79A 4CH3A 1S77D 4KHPO 2EIJC 2E75B 4TWKA 1VF7A 2GTSA 1SRYA 1AR1B 2UUBO 5IWAB 1H7UA 4EFUA 1PNMA 3K60A 5JJNB 4RWUA 5KA6A 3BHPA 3K5NA 3OUSA 1AH8A 3TUHA 1AI4A 2YSUB 3CRQA 2QWOB 3JASB 3J7AU 3L71H 1UYHA 3C3TA 5KHIA 2GHYA 1WP7A 2EX3A 1M57C 4JASA 3CHXA 1I5AA 2Y0IA 1IBLB 2WLIB 2KG7B 4X64O 3TETA 4K0KO 4X62B 1IXBA 1FS0G 3A0HZ 4X89A 2YIBD 5IYBO 1HDJA 5BOCA 1FFXA 2P4KA 3G4SV 2BYIA 4LWHA 1X59A 2JKIA 4JYBA 3QTCA 1G6UA 3KE6A 3K58A 2YGAA 2G38A 2XNDG 1AJNA 3C3SA 4XE2A 5CA3A 2HKJA 1US7A 3RYHB 2EILB 2XASA 3EHBB 3FAVA 3J80N 4H7QA 4ASGA 3A0ZA 1W0JG 4DYLA 2LP7A 4YY3O 3HEKA 1VARA 4JPRA 2ZM6O 4KXRA 4E00A 3JAMN 2WI1A 3BVOA 3X2QC 2YEHA 2Y69C 5KMGB 4X64B 2PUSA 4QNHB 3CP1A 3TXQA 2NN4A 2XCMA 4UCUA 4O2AB 5EBMC 4R50A 2YKEA 2Z3YA 3O65A 3VHDA 3G7EA 3CX5F 1I59A 1JMKC 3O0IA 5KHHA 5L3EA 2UUCO 5M4MA 4B3SB 1ZL8B 2DWDC 4JQLA 1YI2V 4I0XA 4F4LA 2GTAA 1BSMA 3LSSA 3Q4HB 4JGSA 4DV1B 2VRZA 3T1HO 1IBMB 3E83A 3SR2C 5KAIZ 4XTJA 4DUZO 1S5JA 1YJWV 3Q4HA 3INXA 1Y66A 3ETQA 4FM1A 4YY3B 3TZ4A 3C0EA 1ZSPA 2XDUA 2BT0A 2FWYA 4MVZA 1XBLA 2CDYA 4CS4A 3HKCB 1H2MA 4MP7A 2ZDXA 2VCJA 2XAQA 2OCCC 2UXBO 2XAJA 2RNBA 1BE3H 4DV5O 2ZXWB 1E79G 5D6QA 4P30A 1I7FA 1E1RG 1PP9H 3E8FA 4HZ0A 2JK5C 1I94B 4EM7A 1YTFB 1WB8A 2WLNA 2YXHA 1S16A 1U0ZA 1V54B 4JI6O 3BABA 1LUVA 4ZI7B 1ZTEA 2WWWA 2HHIA 1S5LZ 4JI3B 4LFCO 4MS2A 3UKMA 2QTSA 4I9WA 1S3JA 2XX5A 3JSLA 1S76D 1Y8NA 4MW3A 4X1IA 2Q73A 5M4KA 1EI1A 1SERA 1O9HA 1VF6C 5B3SC 4O4IB 3JZ3A 1PL0A 3L74H 2R9RB 2Y69B 2Q8GA 2DJVA 2IWXA 1B04A 4NTXA 5CTUA 2WA4A 1THNA 3T4DA 4ZIBA 2IH1C 4ZBMA 1D2DA 4UXNA 3DGEA 4CWPA 2EULA 3G6BA 3W7UA 4UVAA 1XL6A 5D7CA 1YHQV 2YK2A 4FLTA 2FTKA 2ZNJA 2CGOA 2XJXA 5BY1A 3CCUV 4PHZA 2CK3G 4GKKB 4LFAB 4LWGA 2IU3A 1M56B 3WQ9A 2GUZB 3CPWU 1SA0A
chains in the Genus database with same CATH topology
1KKDA 5D7RA 2BZ5A 5IYDO 4PA3A 1M1KW 3A0TA 3IGAC 4O05A 3D36A 4XIRA 3SYAA 3ABLB 3T1CA 4WUCA 3EHFA 1PKXA 1S14A 5EBWC 1R62A 1BMFG 1P7BA 1VQKV 2QG2A 2UWDA 4FCPA 2WLIA 2PI5A 4U7NA 4XCJA 2ITDC 4KUMA 1VQLV 1R3IC 4WFBV 4TSFG 2QM7A 1QBZA 3P32A 5B3SB 2XDKA 1OCOC 4URMA 4J9YB 3K97A 5J9PC 4UVCA 3K99A 4R3AA 2HLDG 2B1GA 3G6EV 1VQ8V 2XABA 4G27B 5EK0A 4LCUC 4L8ZA 3ML0A 1I5DA 2NNUA 4KTNA 1NR1A 1MX0A 3K0DA 1ZXNA 2YKBA 2YJXA 1ZWHA 5CN0A 3FB5C 4YKUA 4CWOA 2HVJC 1NHJA 2YE9A 5CTYA 1EZJA 1Y4UA 4URNA 2BU8A 3R65A 1LNQA 3SJQC 2WI3A 4FCRA 4HXWA 2YE8A 1JX9A 2YEBA 3K06A 1VQ4V 1K97A 2YE7A 1NH2D 1UY8A 1DTOA 4U7OA 4CWQA 2YGFA 4L91A 1NVPB 1TBWA 1TUEB 4PA9A 2HCHA 3FB8C 2AHZA 2A9HA 2Y48A 2BSMA 4N21A 1GMGA 4MTFA 5HFMA 2ZKJA 3LPSA 1GM8A 1BKNA 4AS9A 4P9PA 2DYRB 2IJIA 2UXXA 3FYIB 4TT3G 1AH6A 3EHHA 1JVMA 5CMUA 2ZXWC 5LHIA 1DF4A 2XD6A 4CE1A 2IWUA 4PELA 4X88A 1Y8PA 2QG0A 3ZMTA 1UY6A 1M56C 1MOFA 2EINB 2OT5A 1EBOA 3CCVV 1RM1C 5C93A 1I5CA 1YETA 2R9IA 3K98A 1VQ5V 2ATKC 1FXKB 1SZTA 3TCUA 1QLEC 2WLHA 4PA7A 5LGUA 1TIDA 5HFLA 3ABLC 3QNEA 2YE4A 4WUBA 1Z5AA 3GIEA 4ASBA 1R3KC 4WFAV 2XAFA 4LC1A 1N8RW 1OCCB 1I5YA 2GSMB 1QCEA 2B1IA 2VCIA 3I55V 4E01A 3CRLA 3T1KA 3VADA 1YTFD 2QE7G 2EJRA 3LDDA 4EEHA 1YITV 3QTFA 1EFRG 4AWPA 5EBLC 2ZR2A 4YKQA 2QFOA 1YJ9V 4MVSA 1KC8W 1B3QA 4BQJA 3T2SA 3OEHG 3E86A 4GCZA 3Q5LA 1BL8A 2BYHA 1AJPA 4MTOA 1QY8A 3SPCA 1CEZA 2XHTA 2IH3C 1COWG 2EZPA 4XKKA 2WAMA 2H8PC 2DWEC 3JD4A 3VHAA 2OCCB 2YKJA 3OM3B 1F4MA 2YEDA 1K7DA 2F43G 1MG1A 4W7TA 1GKXA 3HYZA 2CH4A 2V1DA 3OPDA 1UYIA 3CRKA 1YC4A 4O09A 2WSSG 4DUHA 4PRVA 2AHYA 4PDLA 1BHBA 1BGQA 2HG1A 4XITA 2XHRA 4WFEA 5LHHA 4QPJA 3U2DA 2H94A 5CBHA 3TUHA 2IJJA 3B8MA 3RBZA 4QE9A 2WI4A 5KUKA 1NKDA 1EA6A 2BU6A 3RW0A 3HZ1A 3PEHA 1WPXA 2DYSC 2WLLA 2EXLA 4CE2A 5IDMA 1ORQC 5H9CA 2Q68A 3OUFA 3E89A 2DYRC 4KFMA 4UROA 5FNCA 4MVOA 4MVMA 1KZNA 4R3MA 4GT1A 5KA5A 1VQOV 3W7WA 2X7RB 2Z5UA 1K4CC 1NVPD 2XAHA 2BTZA 4ASFA 3QDDA 1YT1A 2WEPA 4XDJA 3SPHA 3H4LA 2W0FC 2ZD9A 4QIWF 3CMEV 4G28B 3W7TA 5CBGA 2Q6AA 4RUFA 3AG2C 3ZRVA 1E1QG 3CD6V 1ROPA 2VW5A 2XDLA 3OW6A 1AI6A 3DTUB 4EGKA 2IORA 1L1FA 1AI5A 3K03A 5KUMA 1TH8A 4X8AA 1AM1A 2CGFA 3EKRA 4WUDA 4GX1A 3VHCA 3CYOA 4Q20A 3ZCCA 4AWOA 2YEIA 4CE3A 1NR7A 3O2FA 1W2BU 3B25A 4PU9A 1TC0A 3MNRP 1RPOA 2FXSA 1GK9A 4I5SA 1KP2A 1QR8A 1VQNV 2YI6A 2ZDYA 3F7YC 4BIUA 3OWBA 2CCUA 2WLLB 4U93A 4MT8A 3ZMZA 4R7CA 1ID0A 2GQPA 2YE2A 2YJWA 3NMQA 4URLA 5LHGA 2YI5A 3G7BA 3R4PA 2JEXA 2IJHA 3SYPA 3AG1C 4CZZA 4ZKIA 4MBCA 5D6PA 3CXCU 1NHIA 1RPRA 3X2QB 4XCLA 2YEJA 5L3FA 4UV9A 4FMTA 3ZN0A 3TZ5A 3CMAV 2H8MA 1AJ6A 3OE7G 5B1OA 1QR9A 2YEGA 4XIPA 1K5QA 1KD1W 3OMUA 4V26A 4MOTA 2JDIG 1UY9A 2XJGA 3OW2U 5L3JA 1K33A 5IDJA 2HKOA 2WPDG 3JCZA 1R6KA 2WLKA 4BW5A 4KSGA 1AJQA 5FWKA 2EBOA 1FXHA 5GGZA 1FXKC 3ZRWA 4NH7A 2Q69A 1L0OA 2Q2EB 4MP2A 1SESA 4GQTA 1OCRB 5LGTA 2E0AA 4HYMA 4O0BA 2FYPA 3H01A 1TC6A 4MSWC 3T10A 2AKPA 1OCCC 3BM9A 3IFXA 4LWIA 3ABKB 4WF9V 3I56V 1M57B 3G75A 3F5WC 3OFNG 1H7SA 3FT8A 4XKAA 4YKZA 4EGHA 2EIMC 2HFEC 4MPNA 1UY7A 3WG7C 1H38A 3EKOA 3Q5KA 1DLBA 1OCZB 2P90A 3K9AA 3T0HA 3ASNB 3FB7C 2JIZG 3ZKDA 2YEFA 4MPEA 2ITCC 2DQ0A 4J9ZB 2O1WA 1GM7A 2YE5A 4KSHA 2XX2A 1Q82W 3GIFA 2YGEA 2CG9A 1HWYA 2WI5A 2Q8IA 2HVKC 4V25A 5L3DA 3OMNB 4KP4A 4YXWG 1OSFA 1QLEB 4UUJC 1OCOB 4E2LA 1K73W 2BREA 4FCQA 3OR6C 5FNDA 3PEJA 4NH9A 2Q8HA 2CCTA 2LFSA 2DQ3A 3E35A 4MVRA 4XDKA 4B6CA 2JEUA 4BAEA 1KECA 2EIKB 3RVZA 1YT0A 3LNUA 4PRXA 5B1BB 3ZRWB 4XIQA 3SYCA 5LBQA 3JD0A 1V55B 2YEVA 2BU2A 4XDLA 1PNLA 1UYGA 3R4MA 1YC3A 1VQMV 3LSQA 4BIZA 1M9NA 2QTOA 3KG2A 1QVFU 3A0RA 3ZM7A 3MHSC 2BOBC 4JTCB 3OMAB 1YJNV 4GX2A 4CWSA 1VQ7V 4PL9A 4BAYA 1Z5CA 4NH8A 3VOUA 2YK9A 2IJKA 2WI7A 1FXVA 4BQGA 4JAUA 1IXMA 1K3EA 1PNKA 4P2ZA 4BXIA 2H55A 1Z5BA 2JJ1G 3AG3B 5M4PA 3B24A 3HB3B 5LGNA 3QO8A 1YC1A 3C11A 2W6JG 3GIGB 5B1AB 1SETA 1OCRC 2XOKG 3T2MA 2NLJC 1NQTA 3K04A 2GFDA 4GGLA 1UYFA 5M4NA 1R3JC 1KQSU 5M4EA 1JOYA 3P30A 2YKCA 4LPBA 4PA4A 4JTAB 1JCHA 3B8NA 3OR7C 3CC4V 2O1UA 3E8HA 3ZMSA 3FB6C 2D3OW 2WI2A 3K08A 4HAMA 5BZBA 4FPPA 4PA6A 3T4ZA 5CPHA 2A0LA 4B7PA 5M4HA 2OTJV 1WLEA 1NJIW 3MHHC 5H6RA 2PNRA 3ZJZA 3RLRA 3JD2A 4N23A 1UYMA 2WLJA 3ZIAG 1BHAA 2WLMA 3Q5JA 3STLC 3CCSV 4HYPA 5CTWA 2MK3A 3K79A 5GW7A 1S77D 1Q7YW 3FT5A 1NBMG 2B5UA 2EIJC 2W6IG 1PVGA 4EGIA 4GX5A 4TWKA 3SPJA 2QF6A 3A0XA 1SRYA 3IC7A 2ESAA 3STZC 3E8BA 1AR1B 3B27A 5J6AA 1H7UA 4EFUA 1PNMA 5FL7G 2BU5A 3K60A 5KA6A 2Q8FA 1V55C 1NHHA 1PD3A 3OUSA 4L87A 1R3LC 3ZRSA 3CCMV 1AH8A 4MVQA 1AI4A 2YSUB 3CCLV 4QJFB 1YERA 2IOQA 2YECA 3IEDA 5IY5B 4GX0A 2QKSA 1UYHA 1FXKA 1R6NA 2K5BA 2X6CA 4EKWA 4RQEA 2XK2A 3OWDA 3ZXOA 1YIJV 1QVGU 4P7AA 2GHYA 2K1EA 2P67A 3R4NA 1M57C 3U67A 5IN9A 4JASA 1I5AA 1MU5A 4O04A 2WLIB 4CWNA 3WG7B 2LFRA 3PJSK 2EZOA 3TETA 1GKZA 5B1AC 1FS0G 3ASNC 4X89A 3INWA 5BOCA 5IYBO 3U2KA 3G4SV 2BYIA 2VWCA 5H6QA 1K5SA 1P4RA 1GM9A 3LDEA 4LP0A 2ZDIA 4LWHA 1UYDA 5F3KA 4XD8A 1QYEA 3BMYA 4P8OA 2JKIA 4JYBA 4E02A 2XHXA 3W7SA 4H37A 3GIGA 2QM8A 1Y8OA 3KE6A 3HYYA 4H33A 2YGAA 3TZ0A 2XNDG 3UM7A 1AJNA 1GJVA 1VQ9V 1YSRA 1KP3A 4JYCA 1UYEA 4HXZA 4XE2A 3AG2B 1K9MW 4RQFA 1NH2B 1K4DC 5CA3A 4O07A 4RO2A 2YEEA 4LWFA 1S72V 3AG4C 5B1BC 2CCSA 2HKJA 1US7A 4L94A 4X9LA 2EILB 2XASA 3ABKC 4CBCA 2IW5A 1UJWB 3AEIA 4PDVA 5E1AC 1KIJA 4YKRA 4R8CA 3EHBB 1F51A 2EIJB 4GEEA 4LWEA 1YSCA 4WFHA 2YE6A 5L3CA 1VQ6V 5CBFA 2BRCA 4LP8A 4H7QA 4ASGA 3A0ZA 1W0JG 3T0ZA 3JD3A 2LP7A 2QEXV 3HEKA 4KQVA 2X6BA 3R4OA 4Z1MG 4JPRA 4L90A 1B62A 4HZ3A 4EMVA 4E00A 1GKFA 1UYCA 2FWZA 5CTXA 4ZVIA 3ASOB 1H2GA 2WI1A 5FNFA 3X2QC 3WHAA 2YEHA 1S5HC 4FK5C 2Y69C 3SPIA 3FYEB 1YT2A 2BU7A 5BODA 1MSWD 3E8GA 2EIKC 4PDRA 4YKXA 4HY1A 2P7TC 4QNHB 2HJFC 1I5XA 3CP1A 5B1NA 2XDXA 4L93A 4I3HA 1K92A 2ZQMA 2WI6A 2XCMA 5EBMC 4HZ5A 4XBFA 4R50A 3QO7A 2Z3YA 3BEHA 3CC2V 1I5BA 2YKEA 3B26A 3G7EA 1V54C 3VHDA 4CWRA 2YEVB 2HG5C 3WFVA 1I59A 4UVBA 1B63A 1GO3F 2DW4A 2PI4A 3O0IA 4K4OA 1H8HG 5L3EA 5M4MA 3CCRV 1YESA 1R73A 3CGZA 2DWDC 3VBBA 4JQLA 2M7WA 1YI2V 1Z59A 3CGYA 3MD0A 3JD1A 4F4LA 4WCEV 4DZYA 2EIMB 3SYOA 2P6JA 3LSSA 1A4HA 1OCZC 4JGSA 3RVYA 2XDSA 3R92A 3E83A 4XTJA 1JJ2U 1TILA 3D0BA 5EC2C 1ZXMA 1I58A 4G2KA 1ZWIC 4XC0A 3ZXQA 3AG4B 3ABMC 1YJWV 4YKYA 3HHUA 1OZ0A 4H85A 3INXA 3E2EA 1Y66A 2JJCA 3M99B 3TK1A 5F5RA 4LBEC 3RKZA 1UYKA 3JYCA 5EC1C 3A0YA 3C0EA 3TZ4A 2YEAA 3ETDA 2BT0A 4OXSA 2FWYA 2XDUA 3OGCC 4MVZA 3OMIB 4MW8A 1JM6A 1ENVA 1JPXA 4HYOA 4JF3A 1U2OA 2YKIA 4MP7A 4CWTA 2ZDXA 4CWFA 1Q86W 2VCJA 2XAQA 3R91A 4XKOA 2OCCC 3A0WA 3ASOC 3ZMVA 1Y4SA 3H80A 2XAJA 1UYLA 5L3GA 5L3BA 2QA4V 3EHJA 3LNMB 2ZXWB 4XDMA 2WEQA 1E79G 3SYQA 2WERA 5D6QA 4ASAA 4P30A 1E1RG 3E8FA 4QE7A 4UV8A 3GB7C 4HZ0A 2JK5C 4EM7A 4MPCA 1YTFB 3AG3C 2ZBKB 2WLNA 3QO5A 4FIPC 4WFGA 1S16A 1U0ZA 2IOPA 2A79B 1V54B 1Y4MA 5CF0A 3OAAG 1OHHG 5IY5C 3CCEV 5DN6G 1ZW9A 4HY6A 2WWWA 3ETEA 1K34A 3ABTA 4GT8A 3SL2A 3D3IA 1G8MA 4QPKA 3CCJV 5D7DA 4YKWA 3D2RA 1XL4A 3OEEG 2X0LA 4MS2A 3UKMA 1K8AW 4I9WA 1S3JA 1F4NA 2XX5A 3ZMUA 3RLPA 3O6OA 4R1FA 1BXDA 1S76D 1Y8NA 4MW3A 5M4KA 4PDMA 2JJ2G 2IU0A 2BOCC 5DM6V 3BY6A 2EINC 3LDCA 5IYCO 1RM1B 4R6ZA 1M90W 1EI1A 1YS3A 2KB1A 1DF5A 3F7VC 3ZN1A 3K3WA 3G71V 5B3SC 1SERA 1AROP 2ZR3A 3HPLC 1CP9A 3K0GA 1QLNA 3EHGA 3RLQA 4AWQA 5J71A 3JZ3A 1PL0A 3FKSG 2R9RB 4RUEA 2V7QG 3NXSA 4DXWA 1S0VA 2Y69B 1BYQA 2XJJA 2XX4A 4RAIA 3B28A 2Q8GA 2IWXA 3ZKBA 4H81A 3CC7V 4YKTA 2YE3A 3LUTB 5CTUA 2EILC 4ASUG 1THNA 3T4DA 2O1VA 2OTLV 2IH1C 3ETGA 4MTGA 4ZBMA 3AG1B 4UXNA 2DYSB 3DGEA 4CWPA 2HR3A 3B77A 1QZRA 2IWSA 3FV5A 2YI7A 3W7UA 3CWVA 1THZA 3HZ5A 1GTOA 4JAVA 1AMWA 3TTZA 4UVAA 4DO2A 4EFTA 1XL6A 4GFNA 1JQ0A 1F23A 1W0KG 4KFGA 5D7CA 3SPGA 2UXNA 1YHQV 4FJCC 3W7XA 1J95A 4WFFA 1FFTB 2YK2A 2FTKA 1B6QA 1YSZA 2XJXA 4MTXA 2ZDIC 4P9OA 2XAGA 3ZRXA 3CCUV 3GWOA 2YI0A 1AI7A 1H8EG 3CCQV 2X6AA 2Q67A 4MB9A 3ABUA 4JTDB 2CK3G 1VQPV 1CPYA 1G4YB 4LWGA 2C2AA 2IU3A 1M56B 3ABMB 4MVUA 1MABG 1Q81W 3TZ2A 3EFFK 3WQ9A 3CPWU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D7R A;  2BZ5 A;  3A0T A;  4O05 A;  3D36 A;  4XIR A;  4WUC A;  3EHF A;  1S14 A;  1R62 A;  2QG2 A;  2UWD A;  4FCP A;  4U7N A;  2QM7 A;  3P32 A;  2XDK A;  4URM A;  3K97 A;  3K99 A;  4R3A A;  2XAB A;  4L8Z A;  4KTN A;  1I5D A;  1MX0 A;  1ZXN A;  2YKB A;  2YJX A;  1ZWH A;  4CWO A;  4YKU A;  1NHJ A;  2YE9 A;  5CTY A;  1Y4U A;  4URN A;  2BU8 A;  2WI3 A;  4FCR A;  4HXW A;  2YE8 A;  2YEB A;  2YE7 A;  1UY8 A;  4U7O A;  4CWQ A;  2YGF A;  4L91 A;  1TBW A;  2HCH A;  2BSM A;  2ZKJ A;  3LPS A;  1BKN A;  4AS9 A;  3EHH A;  1AH6 A;  4CE1 A;  2XD6 A;  2IWU A;  1Y8P A;  2QG0 A;  1UY6 A;  2FXS A;  1YET A;  1I5C A;  5C93 A;  3K98 A;  2YEE A;  1TID A;  2YE4 A;  4WUB A;  1Z5A A;  3GIE A;  4ASB A;  4LC1 A;  2VCI A;  4E01 A;  3CRL A;  3T1K A;  3VAD A;  4EEH A;  4AWP A;  3QTF A;  4YKQ A;  4BQJ A;  2QFO A;  1B3Q A;  3T2S A;  4GCZ A;  3Q5L A;  2BYH A;  1QY8 A;  2XHT A;  4XKK A;  3VHA A;  2YKJ A;  2YED A;  4W7T A;  1GKX A;  3HYZ A;  2CH4 A;  4O09 A;  3OPD A;  1UYI A;  3CRK A;  1YC4 A;  4DUH A;  4PRV A;  2HG1 A;  1BGQ A;  4XIT A;  2XHR A;  4QPJ A;  3U2D A;  2WI4 A;  1EA6 A;  3HZ1 A;  2BU6 A;  3PEH A;  2EXL A;  4CE2 A;  5IDM A;  4URO A;  5FNC A;  4R3M A;  1KZN A;  4GT1 A;  2BTZ A;  3QDD A;  1YT1 A;  2WEP A;  3H4L A;  3ZRV A;  2VW5 A;  2XDL A;  3OW6 A;  4EGK A;  2IOR A;  1TH8 A;  1AM1 A;  2CGF A;  3EKR A;  4WUD A;  3VHC A;  4Q20 A;  3ZCC A;  4AWO A;  2YEI A;  4CE3 A;  3O2F A;  3B25 A;  4PU9 A;  1TC0 A;  3MNR P;  4I5S A;  2YI6 A;  2ZDY A;  3OWB A;  4BIU A;  2CCU A;  4U93 A;  4MT8 A;  3NMQ A;  1ID0 A;  2GQP A;  2YE2 A;  2YJW A;  4URL A;  3G7B A;  2YI5 A;  3R4P A;  4ZKI A;  5D6P A;  4MBC A;  1NHI A;  4XCL A;  2YEJ A;  4FMT A;  3TZ5 A;  2H8M A;  1AJ6 A;  5B1O A;  2YEG A;  4XIP A;  3OMU A;  4V26 A;  5L3J A;  4MOT A;  1UY9 A;  2XJG A;  5IDJ A;  4KSG A;  5FWK A;  5GGZ A;  3ZRW A;  4NH7 A;  1L0O A;  2Q2E B;  4MP2 A;  4GQT A;  2E0A A;  4HYM A;  4O0B A;  2FYP A;  1TC6 A;  3T10 A;  2AKP A;  3BM9 A;  4LWI A;  3G75 A;  4XKA A;  4YKZ A;  1H7S A;  3FT8 A;  4EGH A;  4MPN A;  1UY7 A;  3EKO A;  3Q5K A;  3T0H A;  3ZKD A;  2YEF A;  4MPE A;  2O1W A;  2YE5 A;  4KSH A;  2XX2 A;  3GIF A;  2Q8I A;  2YGE A;  2CG9 A;  2WI5 A;  4V25 A;  4KP4 A;  1OSF A;  4FCQ A;  2BRE A;  5FND A;  3PEJ A;  4NH9 A;  2Q8H A;  2CCT A;  2LFS A;  4B6C A;  4BAE A;  1YT0 A;  3LNU A;  4PRX A;  3ZRW B;  4XIQ A;  2BU2 A;  1UYG A;  3R4M A;  1YC3 A;  4BIZ A;  3A0R A;  3ZM7 A;  4CWS A;  4PL9 A;  4NH8 A;  1Z5C A;  2YK9 A;  2WI7 A;  4BQG A;  4JAU A;  1IXM A;  4BXI A;  2H55 A;  1Z5B A;  5M4P A;  3B24 A;  1YC1 A;  3C11 A;  3GIG B;  2GFD A;  4GGL A;  1UYF A;  5M4N A;  5M4E A;  1JOY A;  2YKC A;  4LPB A;  5F3K A;  2O1U A;  2WI2 A;  4FPP A;  4B7P A;  5M4H A;  5CPH A;  2PNR A;  3RLR A;  1UYM A;  3Q5J A;  4HYP A;  5CTW A;  3FT5 A;  1PVG A;  4EGI A;  2QF6 A;  3A0X A;  2ESA A;  5J6A A;  3B27 A;  1H7U A;  4EFU A;  3K60 A;  2BU5 A;  2Q8F A;  1NHH A;  1AH8 A;  2IOQ A;  2YEC A;  3IED A;  4ASF A;  3TUH A;  1YER A;  1UYH A;  2K5B A;  2XK2 A;  3OWD A;  3ZXO A;  4P7A A;  2P67 A;  3R4N A;  3U67 A;  5IN9 A;  4JAS A;  1I5A A;  1MU5 A;  4O04 A;  4CWN A;  2LFR A;  1GKZ A;  3U2K A;  3INW A;  5BOC A;  2VWC A;  2BYI A;  4LP0 A;  4LWH A;  1UYD A;  4XD8 A;  1QYE A;  3BMY A;  4P8O A;  2JKI A;  4JYB A;  4E02 A;  2XHX A;  3GIG A;  3KE6 A;  2QM8 A;  1Y8O A;  3HYY A;  2YGA A;  3TZ0 A;  1YSR A;  1GJV A;  4XE2 A;  1UYE A;  4HXZ A;  4O07 A;  4LWF A;  4X9L A;  2HKJ A;  4L94 A;  2CCS A;  1US7 A;  4YKR A;  1KIJ A;  1F51 A;  4GEE A;  4LWE A;  2YE6 A;  2BRC A;  4H7Q A;  4ASG A;  3A0Z A;  3T0Z A;  3HEK A;  4KQV A;  3R4O A;  4L90 A;  1B62 A;  4EMV A;  4E00 A;  1UYC A;  2FWZ A;  5CTX A;  4ZVI A;  5FNF A;  2WI1 A;  3WHA A;  2YEH A;  2BU7 A;  1YT2 A;  5BOD A;  4YKX A;  4HY1 A;  5B1N A;  2XDX A;  4L93 A;  4I3H A;  2WI6 A;  2XCM A;  4HZ5 A;  2YKE A;  3VHD A;  1I5B A;  3B26 A;  3G7E A;  4CWR A;  1I59 A;  1B63 A;  4K4O A;  3O0I A;  5M4M A;  1YES A;  3CGZ A;  4JQL A;  1Z59 A;  3CGY A;  4DZY A;  3MD0 A;  2XDS A;  3R92 A;  4XTJ A;  3D0B A;  1TIL A;  1ZXM A;  1I58 A;  4XC0 A;  3ZXQ A;  4YKY A;  3HHU A;  4H85 A;  3INX A;  2JJC A;  3TK1 A;  5F5R A;  3RKZ A;  1UYK A;  3A0Y A;  3TZ4 A;  3C0E A;  2YEA A;  2XDU A;  2BT0 A;  2FWY A;  1JM6 A;  1U2O A;  2YKI A;  4MP7 A;  4CWT A;  2ZDX A;  4CWF A;  2VCJ A;  3R91 A;  4XKO A;  3A0W A;  1Y4S A;  3H80 A;  1UYL A;  3EHJ A;  4XDM A;  2WEQ A;  2WER A;  5D6Q A;  4ASA A;  4HZ0 A;  4EM7 A;  4MPC A;  2ZBK B;  1S16 A;  1U0Z A;  2IOP A;  5CF0 A;  1ZW9 A;  4HY6 A;  2WWW A;  4GT8 A;  4QPK A;  5D7D A;  4YKW A;  3D2R A;  2XX5 A;  3RLP A;  3O6O A;  4R1F A;  1BXD A;  1Y8N A;  5M4K A;  1YS3 A;  1EI1 A;  1A4H A;  3RLQ A;  4AWQ A;  5J71 A;  3EHG A;  3JZ3 A;  4MB9 A;  3SL2 A;  4XCJ A;  1BYQ A;  2XX4 A;  3NXS A;  2XJJ A;  2Q8G A;  3B28 A;  2IWX A;  3ZKB A;  4H81 A;  4YKT A;  2YE3 A;  5CTU A;  1THN A;  2O1V A;  3DGE A;  4CWP A;  2IWS A;  1QZR A;  3FV5 A;  2YI7 A;  3HZ5 A;  3CWV A;  1AMW A;  4JAV A;  3TTZ A;  4EFT A;  4GFN A;  4KFG A;  5D7C A;  2YK2 A;  2FTK A;  1YSZ A;  2XJX A;  4MTX A;  3ZRX A;  2YI0 A;  4LWG A;  2C2A A;  3TZ2 A;  3WQ9 A;  4JYC A; 
#chains in the Genus database with same CATH topology
 2BZ5 A;  3A0T A;  3IGA C;  3ABL B;  1M4U A;  3L73 H;  2YC0 A;  1P7B A;  2PI5 A;  5E79 Z;  1XI1 A;  3RYF A;  1QBZ A;  3P32 A;  2XDK A;  4URM A;  1QHT A;  3K99 A;  4R3A A;  3EXA A;  3S5T A;  4G27 B;  1WN7 A;  4KTN A;  5B5E Z;  1NR1 A;  5FPO A;  3FAV B;  3K0D A;  3OGI B;  2YJX A;  1IUR A;  4YKU A;  3HKE A;  3JAL A;  2C1I A;  1Y4U A;  4URN A;  1Y76 B;  1HP8 A;  2WI3 A;  2GUZ A;  4K3A A;  3K06 A;  3DC5 A;  2V4D A;  1NTK H;  4U7O A;  2YGF A;  4L91 A;  4PA9 A;  4GKK O;  4HNA B;  4LFA O;  3K5L A;  1GMG A;  4LF9 O;  3LPS A;  1TAE A;  4P9P A;  4TUY B;  1DF4 A;  3ZMT A;  1M56 C;  1MOF A;  2F93 B;  2AXT Z;  1AIL A;  2E3C A;  2YEE A;  1SZT A;  4PA7 A;  4DR6 B;  5LGU A;  3N27 A;  3QNE A;  2AGA A;  4TQF A;  1Z5A A;  4ASB A;  2ZCE A;  2Y4U A;  4UB8 Z;  4WFA V;  2XAF A;  1NT2 B;  3A8T A;  4LC1 A;  1QCE A;  4AQY O;  1MNG A;  3CRL A;  3VAD A;  2QE7 G;  2EJR A;  4EEH A;  3QTF A;  5GTI Z;  3L72 H;  4BQJ A;  1TA8 A;  1YJ9 V;  3OEH G;  3E86 A;  3Q5L A;  1BL8 A;  2ZIO A;  5IT9 N;  1WJZ A;  2VS0 A;  1NI8 A;  2JGU A;  1EM1 A;  3OM3 B;  1F4M A;  5IYZ A;  1GKX A;  1UYI A;  1I08 A;  2WSS G;  3HKC A;  2Q7H A;  1FJG O;  4WFE A;  4DK1 A;  1GRJ A;  2WI4 A;  1NKD A;  1AP6 A;  3THO A;  3DC6 A;  5IDM A;  4JI0 B;  4URO A;  4JYA B;  5FNC A;  3W7W A;  1K4C C;  2ZE6 A;  2XAH A;  1NVP D;  3SJB C;  3QDD A;  2WEP A;  3H1L H;  2Q6A A;  3AG2 C;  3ZHU A;  4JI1 O;  4JI8 B;  1IDS A;  5LA6 B;  1AI6 A;  4X8A A;  3EKR A;  4WUD A;  1KYO F;  3VHC A;  4O4J A;  1SF9 A;  2YI8 A;  4YJ3 B;  1NR7 A;  3O2F A;  3BAA A;  3B25 A;  4PU9 A;  2BSK A;  3CE2 A;  3MNR P;  4B7K A;  4FM2 A;  2YXY A;  4U93 A;  4LF8 B;  2YE2 A;  2P4V A;  4URL A;  3R4P A;  2JEX A;  5JCO A;  3JSN A;  4CZZ A;  4MBC A;  5L3F A;  3ZN0 A;  1N34 B;  3TZ5 A;  2H8M A;  2CTQ A;  4XIP A;  3RYI B;  5L3J A;  2XJG A;  5IDJ A;  4LH6 A;  2WLK A;  4BW5 A;  3RYC B;  3T1Y O;  1FXK C;  2PTM A;  3ZRW A;  1L0O A;  2Q2E B;  4MP2 A;  5LGT A;  4O0B A;  2JS3 A;  1TC6 A;  3T10 A;  4YJ3 A;  3RYC A;  4LF6 B;  4LWI A;  3G75 A;  4XKA A;  3I56 V;  3F5W C;  2EIM C;  4AIL C;  4MPN A;  1H38 A;  1DLB A;  1OCZ B;  3T0H A;  3FB7 C;  1KU9 A;  2CE4 A;  1N36 O;  2AZ0 A;  4MPE A;  1LUW A;  2XT9 A;  2DOS A;  3GIF A;  3DSQ A;  5L3D A;  4KP4 A;  2YIB A;  3PEJ A;  1NTZ H;  2JEU A;  1KEC A;  2CH7 B;  2OIG A;  2JVD A;  3E22 B;  4FLU A;  5LBQ A;  1Q90 D;  3JD0 A;  3K5O A;  2BU2 A;  2JGD B;  1HNW B;  4NXM B;  3KZI Z;  4U3F H;  1YCI A;  4H44 B;  3T1Y B;  3C90 A;  4GX2 A;  4PL9 A;  4BAY A;  2YK9 A;  4PV1 B;  3HKE B;  3FD9 A;  5BMV B;  4DR1 O;  1ZUQ A;  4BQG A;  4AI8 A;  4EFB A;  1Z5B A;  3AG3 B;  4FFK A;  2YIA A;  3GIG B;  1OCR C;  2XOK G;  3R66 A;  5EIB D;  2GFD A;  4GGL A;  3AG7 A;  1R3J C;  2YKC A;  3P30 A;  5F3K A;  4FPP A;  4I9Q A;  3RLR A;  1JJO A;  3Q5J A;  3STL C;  1SQB H;  1YZB A;  2B5U A;  1PVG A;  4DK0 A;  4EGI A;  4Q6G A;  4GX5 A;  1WB7 A;  2AZ2 A;  5JVD A;  2ZIN A;  5J6A A;  3E8B A;  3KCY A;  2BU5 A;  1NHH A;  4CC5 A;  1PD3 A;  2CUG A;  3ZRS A;  3TJT A;  3CCM V;  2IOQ A;  4ASF A;  4QJF B;  1YER A;  4H13 B;  5IY5 B;  4ABM A;  2RDC A;  1RP3 B;  2K5B A;  4RQE A;  3OWD A;  2CTP A;  1Q6U A;  3R4N A;  3U67 A;  2UUC B;  4O04 A;  5IJ9 A;  2LFR A;  2QWQ B;  4JV5 B;  3ASN C;  3U2K A;  5EIB C;  2VWC A;  3LDE A;  4J41 A;  2ZDI A;  4DUY O;  5ITZ A;  3U0Z A;  1UYD A;  4P8O A;  4JAA A;  5KX5 A;  3TZ0 A;  1YSR A;  2ZE7 A;  1GJV A;  3APQ A;  1VQ9 V;  4JI2 O;  4HXZ A;  4RQF A;  5DEC A;  4CS2 A;  1A32 A;  5E1A C;  1KIJ A;  3EVK A;  3JAR B;  4WFH A;  5CBF A;  4I0X B;  4ZOL B;  2VQE B;  3T0Z A;  2QEX V;  2UXB B;  2PF4 E;  3RYF B;  2X6B A;  5LMN B;  4KQV A;  4L90 A;  1SQQ H;  1B62 A;  4DV5 B;  1UYC A;  3ASO B;  1H2K A;  3WHA A;  1I94 O;  1S5H C;  2W0X A;  1YT2 A;  1MSW D;  3E8G A;  4PDR A;  4YKX A;  4HY1 A;  1XMQ B;  1I5X A;  5KLV H;  2Z0A A;  2ZQM A;  2XUM A;  4HZ5 A;  4DV6 B;  1UPG A;  1V54 C;  1YEW A;  3WFV A;  2HG5 C;  1GO3 F;  2DW4 A;  2PI4 A;  1GH6 A;  3L70 H;  3CCR V;  4JI2 B;  4O2A A;  2UXC O;  2R72 A;  3VBB A;  2E5L O;  1Z59 A;  2EIM B;  3SYO A;  2UXD O;  1NTM H;  3RVY A;  2KQX A;  4OPH A;  1TIL A;  1ZXM A;  1I58 A;  4XC0 A;  3ZXQ A;  3AG4 B;  1GN4 A;  1KMI Z;  4YKY A;  4H85 A;  3E2E A;  2JJC A;  5F5R A;  4LBE C;  5LMN O;  2QKA A;  3K59 A;  2Q8V A;  2N74 A;  2MW2 B;  2YEA A;  4OXS A;  4LFB O;  3LNN A;  1ENV A;  1JFF A;  2R9A A;  4CWF A;  1Q86 W;  3R91 A;  4ZHQ A;  2UUA O;  3A0W A;  1Y4S A;  3H80 A;  5F2V O;  2QWP B;  5L3G A;  5L3B A;  3LNM B;  3S3W A;  3SYQ A;  1AR4 A;  3GB7 C;  4UV8 A;  1VEW A;  2ZBK B;  4D7T A;  3QO5 A;  1TUB B;  4WBN B;  4L8J A;  1JR9 A;  5IY5 C;  5LMU O;  1ZW9 A;  4C7U A;  4DR7 O;  1K34 A;  2ZT9 B;  1G8M A;  1XHZ A;  1N33 O;  3IAY A;  3OEE G;  2UUB B;  1XNR B;  3ZMU A;  3J81 N;  1BGY H;  4R1F A;  1DGS A;  1BXD A;  4X1K A;  2JGD A;  1SQP H;  2JJ2 G;  1QQC A;  1Y6X A;  5CA1 B;  4LWS B;  5IYC O;  1RM1 B;  1M90 W;  3F7V C;  3K3W A;  4FZ0 A;  3G71 V;  3K0G A;  2A7W A;  3RLQ A;  5ITZ B;  4MB9 A;  3FKS G;  3SL2 A;  1AB3 A;  2V7Q G;  3NXS A;  5CB4 A;  4JI4 O;  1XMO B;  4IIJ A;  3B28 A;  1MMM A;  3ZKB A;  3CC7 V;  2CAZ C;  4WBN A;  4B3T O;  2EIL C;  2ZE5 A;  4JYY A;  2O1V A;  4K0K B;  4O4L A;  3IC9 A;  1ZX3 A;  5JJJ B;  3B77 A;  3CWV A;  3H1K H;  2NR5 A;  2QGN A;  1F23 A;  4LF5 O;  1NS1 A;  5JH7 B;  3O9O A;  5C8Y A;  3SPG A;  4FJC C;  2ADP A;  1FFT B;  4WFF A;  1LR1 A;  1YSZ A;  2ZDI C;  5EYP A;  2QM4 A;  2CTR A;  2Q67 A;  2CGN A;  4JTD B;  4YIP A;  3ABM B;  1HNZ B;  4JYC A;  3EFF K;  2DE0 X;  5IE9 A;  4U3J A;  5D7R A;  4O05 A;  3D36 A;  4AQY B;  4F6E A;  2FKX A;  1R62 A;  4U7N A;  4KUM A;  1XMO O;  1N0N A;  2QM7 A;  4DV0 O;  1OCO C;  3K97 A;  5J9P C;  3BCC H;  2HLD G;  2B1G A;  3G6E V;  1VQ8 V;  1MZE A;  4E72 A;  3ML0 A;  1I5D A;  3HKD A;  2QSA A;  5CTY A;  1EZJ A;  1EN6 A;  3SJQ C;  3BFR A;  1JX9 A;  2YEB A;  1K97 A;  1Q6H A;  4CWQ A;  4DR2 B;  1XRE A;  1NVP B;  1TBW A;  3FB8 C;  2A9H A;  4TOI A;  4AS9 A;  1TVK B;  5A2Q N;  3FYI B;  4TT3 G;  3CRA A;  1AH6 A;  1BS3 A;  5LHI A;  3RN4 A;  2OT5 A;  3NR7 A;  1FXK B;  1QLE C;  2WLH A;  4WUB A;  1H2S B;  4BWA A;  1R3K C;  3B09 A;  1OCC B;  1YXB A;  2GSM B;  2B1I A;  3CJH A;  4ICG A;  4LF8 O;  2E76 B;  4X65 B;  4AWP A;  1EFR G;  4YKQ A;  2QFO A;  1KC8 W;  4ZHQ B;  3SDL A;  4U3J B;  4GCZ A;  1OJH A;  3CEI A;  2ZNI A;  1CEZ A;  4J80 A;  3UQ8 A;  4IYI A;  2WAM A;  2OCC B;  1VMG A;  3JCU Z;  4W7T A;  2CH4 A;  4O09 A;  3OPD A;  1BHB A;  3BA9 A;  4B08 A;  3HZ1 A;  2BU6 A;  2L6L A;  1WPX A;  2DYS C;  2EXL A;  5GON B;  1ORQ C;  2K9P A;  4PI2 A;  2ILM A;  1BQ0 A;  1R1B A;  3OUF A;  4OX9 O;  4MVO A;  4R3M A;  1KZN A;  2BTZ A;  1MSD A;  4JI7 O;  1VP7 A;  3LMM A;  4FZ1 A;  3H4L A;  2YDE A;  1SS3 A;  1JFF B;  1E1Q G;  2GV9 A;  1U96 A;  2VW5 A;  4EGK A;  1UFI A;  2IOR A;  1AI5 A;  3K03 A;  2KKW A;  5JEN A;  4GX1 A;  3CYO A;  3ZCC A;  4AWO A;  4CE3 A;  1T5E A;  1RPO A;  1KP2 A;  1QR8 A;  2F4V O;  1KBH A;  2YI6 A;  2HJD A;  3OWB A;  3MDS A;  4R7C A;  3ZMZ A;  2GQP A;  2YJW A;  2YS8 A;  3SYP A;  1RPR A;  2R70 A;  1AJ6 A;  3OE7 G;  2YEG A;  1QR9 A;  1K5Q A;  1QNM A;  2JDI G;  2D2C B;  4OX9 B;  2WPD G;  1R6K A;  4X1K B;  4KSG A;  2LW1 A;  1FXH A;  5GGZ A;  2LW7 A;  4GQT A;  1OCR B;  2E0A A;  4HYM A;  2A06 H;  5JQG A;  4JI7 B;  2FYP A;  5A9G A;  5D5P A;  2AKP A;  1IX9 A;  3BM9 A;  1B06 A;  3IFX A;  3ABK B;  1M57 B;  4YKZ A;  3GVM A;  2OWO A;  3K9A A;  1M5I A;  1SQG A;  2JIZ G;  3WU2 Z;  3G80 A;  4J9Z B;  2OYQ A;  5GON A;  1Q82 W;  1HWY A;  2WI5 A;  4CH4 A;  2PYL A;  3UT5 A;  3OMN B;  3HKD B;  4YXW G;  5BXZ A;  1QLE B;  4UUJ C;  1OCO B;  4E2L A;  1K73 W;  1OSF A;  2BRE A;  4FCQ A;  1EZV H;  4NH9 A;  2Q8H A;  3E35 A;  4XDK A;  4B6C A;  4BAE A;  4GYC B;  3U10 A;  1MZF A;  4PRX A;  3FX7 A;  2BTQ A;  4XIQ A;  3SYC A;  4IGG A;  1Q3E A;  1UYG A;  4K8X A;  1M9N A;  2QTO A;  3A0R A;  3TXS A;  2OCH A;  4Z2W A;  1RSO B;  2BOB C;  4JTC B;  1Z5C A;  2WI7 A;  4J7K A;  5IWA O;  5GTH Z;  3B24 A;  4DV3 B;  2ODM A;  5LGN A;  3QO8 A;  3T2M A;  2NLJ C;  1NQT A;  5M4N A;  1UYF A;  5TIS Z;  1JOY A;  4PA4 A;  2YXL A;  4K8Z A;  2WI2 A;  1ZAU A;  2DMX A;  5M4H A;  2A0L A;  4TUY A;  2KSD A;  4AHC A;  3JD2 A;  4GKJ B;  1UYM A;  2WLJ A;  3CCS V;  2MK3 A;  5GW7 A;  2VQE O;  3FT5 A;  2W6I G;  4GUN A;  2VQF B;  3SPJ A;  4OPA A;  3A0X A;  3IC7 A;  3B27 A;  5D5Q A;  1AVM A;  5J2U A;  4DR5 B;  5FL7 G;  2L35 A;  3JAW A;  4JZ2 A;  1L0L H;  1XQ8 A;  2Q8F A;  1V55 C;  4B7E A;  1XMQ O;  4L87 A;  4JYA O;  4MVQ A;  3IED A;  3CCL V;  1L8D A;  4DV6 O;  1FXK A;  2X6C A;  4EKW A;  2RQ6 A;  1QVG U;  4FLY A;  4P7A A;  1Q6I A;  4DV2 O;  3WG7 B;  3PJS K;  2EZO A;  1GKZ A;  1ZLZ A;  5B1A C;  2QDO A;  4X1Y B;  4LH7 A;  5H6Q A;  1GM9 A;  4KHP B;  1J5E O;  5JCO C;  2BE3 A;  4XD8 A;  5FPR A;  1QYE A;  4E02 A;  2P5O A;  2XHX A;  1YDX A;  4H37 A;  3W7S A;  2QM8 A;  2HHH O;  3HYY A;  4H33 A;  3RYI A;  1KP3 A;  3VQV A;  3AG2 B;  1NH2 B;  5KHK A;  1SQX H;  4X9L A;  3AG4 C;  5EYP B;  1Y76 A;  1XIL A;  3WB1 A;  1W59 A;  1UJW B;  1RSO A;  1P84 F;  1F51 A;  2EIJ B;  4B3S O;  4GEE A;  1YSC A;  2YE6 A;  4IHJ A;  1L0N H;  1Z2G A;  4LP8 A;  2M6Y A;  5EZY B;  1TUB A;  1MA1 A;  4O4H A;  3R4O A;  3S3X A;  3F5T A;  4X62 O;  2BSK B;  5CTX A;  3SPI A;  3UT5 B;  3FYE B;  5BOD A;  3D8C A;  2EIK C;  3N2K A;  2P7T C;  4YJ2 A;  2HJF C;  1FFX B;  4DR7 B;  2WI6 A;  4XBF A;  3QO7 A;  1I5B A;  3CC2 V;  5CA1 A;  1JA8 A;  4UCT A;  1H8H G;  1VIB A;  4CS3 A;  4FM0 A;  3CGZ A;  4PD4 F;  1Q5O A;  3CGY A;  4X9Q A;  3MD0 A;  3JD1 A;  1FPO A;  4WCE V;  3B4S A;  2P6J A;  4LF4 B;  5K1X A;  5LYJ A;  3D0B A;  5EC2 C;  4DRX A;  4G2K A;  1ZWI C;  3ABM C;  3HHU A;  3M99 B;  4O2B B;  4B3T B;  3RKZ A;  1UYK A;  3A0Y A;  3OGC C;  3OMI B;  4MW8 A;  1JM6 A;  4HYO A;  4JF3 A;  3WB0 A;  5H5N A;  2YKI A;  4O4I A;  4UCS A;  1WA8 A;  3ASO C;  3CWB H;  4LNU B;  4UFZ A;  1UYL A;  3EHJ A;  4XDM A;  4W4L A;  3ZHV A;  5CA0 A;  3A2F A;  4IT5 A;  4DV1 O;  3T1H B;  1XUQ A;  4MPC A;  3OTO O;  4DRX B;  4O4H B;  2IOP A;  1XOU A;  2A79 B;  5CF0 A;  5DN6 G;  4HY6 A;  3ETE A;  3JAR A;  3D3I A;  4YKW A;  2ZIM A;  1K8A W;  4BIO A;  1XNQ B;  1BQZ A;  2HP8 A;  2IU0 A;  2BOC C;  5DM6 V;  1Z5V A;  2EIN C;  1H2N A;  4R6Z A;  2KB1 A;  1DF5 A;  4OGQ B;  1CP9 A;  4AWQ A;  4XCJ A;  1XEQ A;  2XJJ A;  4H81 A;  4A5U B;  3LUT B;  4NB5 A;  2O57 A;  3ETG A;  4MTG A;  4JI6 B;  1PL4 A;  1TGO A;  3B2E E;  3AG1 B;  2DYS B;  3CS5 A;  1QZR A;  2IWS A;  3FV5 A;  3OTO B;  2YI7 A;  2Q7E A;  1THZ A;  1GTO A;  1AMW A;  3TTZ A;  4DO2 A;  4EFT A;  4GFN A;  4TV9 B;  1W0K G;  3SGI A;  1HNX B;  4I55 A;  3W7X A;  1J95 A;  5B66 Z;  1B6Q A;  5IYZ B;  4MTX A;  4KL1 A;  4P9O A;  2XAG A;  3L9D A;  4LR3 A;  3GWO A;  1AI7 A;  2X6A A;  3CJH B;  1XNQ O;  5DED A;  2C2A A;  4MVU A;  1MAB G;  1KKD A;  1M1K W;  1PPJ H;  4XIR A;  3SYA A;  4WUC A;  2JS5 A;  3EHF A;  1PKX A;  1S14 A;  5EBW C;  2QG2 A;  1BMF G;  1VQK V;  4DR4 B;  2WLI A;  2Y4T A;  2ITD C;  1US6 A;  1VQL V;  4WFB V;  4TSF G;  4FFB B;  4EB6 B;  5B3S B;  4J9Y B;  4UVC A;  2XAB A;  2OIE A;  5EK0 A;  5FLX N;  4DR6 O;  4LCU C;  1Q43 A;  4L8Z A;  2XHB A;  1ZWH A;  3R65 A;  4J11 A;  4FCR A;  3JAT A;  4HXW A;  5KHG A;  2E5L B;  1VQ4 V;  1DTO A;  4DV4 B;  1TUE B;  2AHZ A;  2Y48 A;  2CH7 A;  3M7M X;  2BSM A;  4N21 A;  2BTQ B;  5HFM A;  2ZKJ A;  1GM8 A;  2CTW A;  2DYR B;  1H2L A;  2IJI A;  2UXX A;  5CMU A;  2ZXW C;  2XD6 A;  4PEL A;  4X88 A;  1Y8P A;  5KAF Z;  3CCV V;  2FXS A;  2EIN B;  1RM1 C;  3CYG A;  3N2G A;  2ATK C;  5CA0 B;  4O4J B;  2YE4 A;  4JI5 B;  2GBO A;  1N8R W;  1I5Y A;  5LP6 A;  3I55 V;  3DXR B;  4E01 A;  3T1K A;  3M8A A;  2Q0O C;  1I0H A;  4I50 A;  5IJ0 B;  4UCV A;  1FAF A;  5EBL C;  2ZR2 A;  3D3Q A;  3T2S A;  1AJP A;  4MTO A;  1QY8 A;  3SPC A;  2XHT A;  4O2B A;  4JI1 B;  2IH3 C;  1COW G;  4XKK A;  1U97 A;  2DWE C;  3JD4 A;  4F6R A;  1K7D A;  1MG1 A;  3CRK A;  4PRV A;  2AHY A;  1BGQ A;  2XHR A;  5LHH A;  3RWR D;  3U2D A;  2H94 A;  2IJJ A;  3B8M A;  3RBZ A;  4QE9 A;  5LYJ B;  2RMK B;  1EA6 A;  3PEH A;  1WAZ A;  2N04 A;  4UCR A;  4CE2 A;  5H9C A;  4KFM A;  4MVM A;  4GT1 A;  5KA5 A;  1VQO V;  2X7R B;  1N34 O;  1HR0 O;  1SQV H;  1YT1 A;  4XDJ A;  2W0F C;  2ZD9 A;  3BA8 A;  5AG2 A;  1G1X B;  3K57 A;  2P22 C;  1URF A;  4J7Z A;  3ZRV A;  4FLV A;  4UCO A;  1ROP A;  5JVD B;  1L1F A;  1TH8 A;  1QU7 A;  2LJ2 A;  4NKG B;  2E74 B;  4Q20 A;  1WNS A;  4EEQ A;  2PGG A;  4NR1 A;  4IL6 Z;  4BIU A;  3G67 A;  2CCU A;  1CXZ B;  2WLL B;  1ID0 A;  4PJ0 Z;  2QKC A;  4ZKI A;  3AG1 C;  1NHI A;  1IZ3 A;  3X2Q B;  2YEJ A;  4XCL A;  1PV0 A;  1HNZ O;  3CMA V;  2FML A;  3OMU A;  4V26 A;  2BTO A;  4MOT A;  3OW2 U;  2HKO A;  3JCZ A;  5FWK A;  1AJQ A;  1HW7 A;  1M93 A;  4NH7 A;  2ZM6 B;  1N32 B;  5JJE B;  4D6T H;  4B3R B;  2QJ1 A;  3FFQ A;  4WF9 V;  1H7S A;  3FT8 A;  4EGH A;  2HFE C;  4DR1 B;  1UY7 A;  3EKO A;  3Q5K A;  3E22 A;  3B40 A;  3K5M A;  2YEF A;  2ITC C;  2DQ0 A;  4KSH A;  3QVN A;  2Q8I A;  2CG9 A;  4NTY A;  4V25 A;  1VF5 B;  2Q7G A;  3OR6 C;  4W4K A;  3P3P A;  1SA0 B;  2LFS A;  2DQ3 A;  4MVR A;  3RVZ A;  3LNU A;  5B1B B;  3U11 A;  2F66 C;  1V55 B;  2YEV A;  3H1J H;  4X66 B;  4FLW A;  5JWP A;  3R4M A;  1YC3 A;  1VQM V;  1BT8 A;  1QVF U;  1GAX A;  3ZM7 A;  3OMA B;  4CWS A;  1VQ7 V;  2DN9 A;  1N32 O;  1FXV A;  4E4E A;  4B3R O;  1PNK A;  4BXI A;  4P2Z A;  2F95 B;  2H55 A;  2FYU H;  2JJ1 G;  1J5E B;  1N36 B;  5M4P A;  3HB3 B;  2GDS A;  2HEP A;  3C11 A;  2W6J G;  3K04 A;  5FNV A;  4FFB A;  4EB6 A;  1KQS U;  4LPB A;  3CC4 V;  3B8N A;  2O1U A;  3ZMS A;  3K08 A;  4HAM A;  4PA6 A;  4FLX A;  3UO2 A;  5CPH A;  2Y0P A;  4TV9 A;  3WB2 A;  2OTJ V;  4B7P A;  3UO3 A;  2PNR A;  3ZJZ A;  1BHA A;  4QGP A;  2WLM A;  1HNW O;  4HYP A;  1Z5W A;  2QWR B;  1Q7Y W;  1NBM G;  4DUY B;  5H2F Z;  2QF6 A;  4LFC B;  4JI3 O;  2ESA A;  2ARH A;  3STZ C;  3ZHQ A;  2F1M A;  1KB9 F;  3VQY A;  1R3L C;  3P3N A;  3H9V A;  2YEC A;  4GX0 A;  2QKS A;  4I4T A;  4PI0 A;  1R6N A;  5LXT B;  1WP8 A;  5BR8 B;  2XK2 A;  3ZXO A;  1YIJ V;  1EN4 A;  2P67 A;  2K1E A;  5IN9 A;  1R6T A;  4LNU A;  3H1H H;  3LSU A;  1MU5 A;  4CWN A;  1PM9 A;  3A0B Z;  2QR4 A;  3HR0 A;  3INW A;  1K5S A;  1P4R A;  4LP0 A;  4HNA A;  4LF4 O;  3BMY A;  3RFR A;  3GIG A;  1Y8O A;  2RJZ A;  4LWS A;  3UM7 A;  4NXN O;  2F4V B;  1UYE A;  3OTF A;  1K9M W;  1SC5 B;  1K4D C;  3IJ4 A;  4DR3 O;  3JAK B;  5J2T B;  4O07 A;  4RO2 A;  4LWF A;  2ADQ B;  1S72 V;  4L94 A;  5B1B C;  2CCS A;  3ABK C;  4CBC A;  4YKR A;  2IW5 A;  3AEI A;  4PDV A;  2LGQ A;  3JAS A;  5JQG B;  2QWN B;  2LGW A;  4R8C A;  4LWE A;  5L3C A;  4H0L B;  1VQ6 V;  2BRC A;  2UXD B;  3JD3 A;  4Z1M G;  4HZ3 A;  4EMV A;  4JV5 O;  1GKF A;  5BR8 O;  2FWZ A;  4ZVI A;  5FNF A;  1H2G A;  4YHH B;  4FK5 C;  4NTW A;  2BU7 A;  3JAW B;  2VWJ A;  5B1N A;  4LF7 B;  2XDX A;  4L93 A;  4I3H A;  1K92 A;  1KKC A;  3BEH A;  3B26 A;  4CWR A;  5KX5 B;  2YEV B;  4UVB A;  2XTA A;  1B63 A;  4K4O A;  2UUA B;  3QG5 A;  4NXN B;  1YES A;  1IBL O;  1R73 A;  4DR3 B;  2M7W A;  4DZY A;  1OCZ C;  2XDS A;  1P49 A;  3R92 A;  3AK3 A;  1O9G A;  1JJ2 U;  4LF9 B;  1XHX A;  1OZ0 A;  3TK1 A;  4D7S A;  5LXT A;  3JYC A;  5EC1 C;  3CRC A;  3ETD A;  3N2G B;  3ZED A;  2ZE8 A;  4YHH O;  4Z1V A;  2FL4 A;  1JPX A;  1U2O A;  4DV3 O;  4CWT A;  3VQX A;  4XKO A;  4LF7 O;  3CB2 A;  3ZMV A;  2ZKO A;  2JRI A;  2QA4 V;  1YF2 A;  2LO1 A;  4EFE A;  2WEQ A;  1VF6 A;  2WER A;  2Q4P A;  4O4L B;  4ASA A;  4QE7 A;  1BZK A;  3AG3 C;  4FIP C;  4WFG A;  4DW1 A;  1XDC A;  2AW9 A;  1Y4M A;  3OAA G;  1OHH G;  3CCE V;  1FD9 A;  4B3M B;  3CRR A;  3ABT A;  4GT8 A;  4QPK A;  3CCJ V;  2FB5 A;  5D7D A;  2VQF O;  3D2R A;  4DR4 O;  1XL4 A;  2X0L A;  1WPB A;  1FJG B;  2YID A;  4NVP A;  1F4N A;  3RLP A;  4DR5 O;  5FNV B;  3O6O A;  1P7G A;  2YI9 A;  4PDM A;  4FLZ A;  1GN6 A;  3BY6 A;  3LDC A;  1YS3 A;  4TQD A;  1Y74 A;  1IBM O;  3ZN1 A;  1A4H A;  1QLN A;  1ARO P;  2ZR3 A;  3HPL C;  4DUZ B;  3EHG A;  5J71 A;  4GZR B;  4RUE A;  4DXW A;  2BCC H;  1S0V A;  1BYQ A;  2XX4 A;  4RAI A;  4YIO A;  4YKT A;  3CRM A;  2YE3 A;  4ASU G;  2OTL V;  3ZS8 C;  1D5N A;  5LMU B;  4ZOL A;  2HR3 A;  1N33 B;  3HZ5 A;  4JAV A;  3VQW A;  1JQ0 A;  3BPZ A;  4IHJ B;  2HHH B;  4KFG A;  1XNR O;  4B3M O;  2UXN A;  2PZS A;  4F6R B;  1Y67 A;  3ZRX A;  4I4T B;  3RT3 C;  1AP5 A;  2YI0 A;  1H8E G;  2F23 A;  3CCQ V;  3ABU A;  1VQP V;  1CPY A;  1G4Y B;  3TZ2 A;  4TV8 B;  1Q81 W;  2IBZ H;  4JI5 O;  2H3O A;  3OD4 A;  4JI4 B;  5IYD O;  3RYH A;  4PA3 A;  3PN1 A;  3T1C A;  2YIC A;  2UWD A;  4K35 A;  4FCP A;  1R3I C;  2WA3 A;  1IVS A;  3KCX A;  2RN9 A;  3L75 H;  4LF6 O;  2N05 A;  3QF7 A;  2B9Z A;  3JAL B;  4J10 A;  4LF5 B;  3TGU H;  2KG7 A;  2Q5Z A;  3ZHS A;  2NNU A;  3ZHR A;  4BW9 A;  1MX0 A;  3AK1 A;  1ZXN A;  2YKB A;  5CN0 A;  3FB5 C;  4CWO A;  2HVJ C;  1NHJ A;  2YE9 A;  2BU8 A;  1LNQ A;  5J2U B;  4TV8 A;  2YE8 A;  2YE7 A;  1NH2 D;  1UY8 A;  3D36 C;  2HCH A;  1YVW A;  2C1G A;  4MTF A;  1HR0 B;  4YJ2 B;  1BKN A;  2Q9L A;  3EHH A;  1Y74 B;  4CC6 A;  1JVM A;  4CE1 A;  2LQT A;  4NXM O;  2IWU A;  2QG0 A;  4X20 B;  1UY6 A;  4DV0 B;  5IJ9 B;  3APO A;  1EBO A;  1I5C A;  1YET A;  5C93 A;  3ZBH A;  2R9I A;  3BRC A;  3K98 A;  1VQ5 V;  3TCU A;  1TID A;  5HFL A;  3ABL C;  3GIE A;  4X20 A;  1X4T A;  2VCI A;  1TVK A;  4DW0 A;  1YTF D;  4GLX A;  3LDD A;  1YIT V;  4MVS A;  1B3Q A;  4DR2 O;  4I55 B;  5LP6 B;  2BYH A;  5LOV A;  3AK2 A;  2EZP A;  4I7Z B;  2H8P C;  3VHA A;  2YKJ A;  2YED A;  2F43 G;  3I5D A;  3DXR A;  3HYZ A;  2V1D A;  1YC4 A;  4DUH A;  4PDL A;  2HG1 A;  5IJ0 A;  1DK1 A;  4XIT A;  4QPJ A;  3UCS C;  2ETN A;  5CBH A;  5KUK A;  1Q8I A;  2YUA A;  3RW0 A;  2WLL A;  3SJA C;  3ZX6 A;  2Q68 A;  2DYR C;  3E89 A;  5JH7 A;  1OV9 A;  2Z5U A;  4X65 O;  3CSX A;  4IIJ B;  3SPH A;  4QIW F;  5BMV A;  3CME V;  4G28 B;  3W7T A;  5CBG A;  4RUF A;  1KUQ A;  3ICX A;  3CD6 V;  3OW6 A;  5LL6 Y;  2XDL A;  4HBN A;  5K1P A;  3DTU B;  5KUM A;  1AM1 A;  3JAT B;  2CGF A;  2YEI A;  1W2B U;  1WA8 B;  4X66 O;  1TC0 A;  5C8Y B;  1GK9 A;  4I5S A;  1HNX O;  1VQN V;  2ZDY A;  3F7Y C;  1NU1 H;  4MT8 A;  3SJC C;  2A3Q A;  3NMQ A;  3KKY A;  5LHG A;  2YI5 A;  3G7B A;  3H1I H;  2IJH A;  3HKB A;  5D6P A;  3CXC U;  1GN3 A;  4J7J A;  4UV9 A;  4FMT A;  5B1O A;  1KD1 W;  1SKV A;  1UY9 A;  1IBK O;  1K33 A;  5CB4 B;  1FYJ A;  2P06 A;  3OT7 A;  1FKA O;  2UU9 O;  4CH6 A;  2EBO A;  5LOV B;  5LA6 A;  4DV7 B;  2Q69 A;  1SQF A;  1SES A;  3H01 A;  3CXH F;  4J42 A;  4MSW C;  1OCC C;  3JAK A;  5J2T A;  2RCV A;  3OFN G;  4JZG A;  4JI0 O;  1GN2 A;  3WG7 C;  2P90 A;  3ASN B;  3ZKD A;  1BCC H;  1ZL8 A;  5LP6 C;  3HKB B;  2O1W A;  1GM7 A;  2YE5 A;  2XX2 A;  2YGE A;  4CH5 A;  2HVK C;  5EZY A;  5KMG A;  4ZI7 A;  1NZ6 A;  2PY5 A;  2UXC B;  4JI8 O;  5FND A;  4DV4 O;  1F7Y A;  5KHJ A;  2IM9 A;  2CCT A;  2EIK B;  1YT0 A;  4UB6 Z;  3ZRW B;  3N2K B;  4GKJ O;  1N0J A;  2VWK A;  4X1I B;  4XDL A;  1PNL A;  3GWK C;  1RFY A;  3RGB A;  3LSQ A;  1N4C A;  4BIZ A;  1IBK B;  1V9P A;  3KG2 A;  3MHS C;  2UU9 B;  1YJN V;  2Q0A A;  4DV7 O;  4I50 B;  4NH8 A;  3VOU A;  2IJK A;  4LFB B;  1AR5 A;  1SZX A;  4JAU A;  1IXM A;  1K3E A;  4FVM A;  4X1Y A;  1EN5 A;  1YC1 A;  5B1A B;  1SET A;  5M4E A;  2PYJ A;  4JTA B;  1JCH A;  3OR7 C;  3MAQ A;  3E8H A;  2D3O W;  3FB6 C;  5BZB A;  3K9S A;  3T4Z A;  4BR6 A;  4IYH A;  1WLE A;  1NJI W;  3MHH C;  5H6R A;  4DV2 B;  2EJ7 A;  4N23 A;  3ZHT A;  1D5A A;  3ZIA G;  5CTW A;  4NYK A;  3K79 A;  4CH3 A;  1S77 D;  4KHP O;  2EIJ C;  2E75 B;  4TWK A;  1VF7 A;  2GTS A;  1SRY A;  1AR1 B;  2UUB O;  5IWA B;  1H7U A;  4EFU A;  1PNM A;  3K60 A;  5JJN B;  4RWU A;  5KA6 A;  3BHP A;  3K5N A;  3OUS A;  1AH8 A;  3TUH A;  1AI4 A;  2YSU B;  3CRQ A;  2QWO B;  3JAS B;  3J7A U;  3L71 H;  1UYH A;  3C3T A;  5KHI A;  2GHY A;  1WP7 A;  2EX3 A;  1M57 C;  4JAS A;  3CHX A;  1I5A A;  2Y0I A;  1IBL B;  2WLI B;  2KG7 B;  4X64 O;  3TET A;  4K0K O;  4X62 B;  1IXB A;  1FS0 G;  3A0H Z;  4X89 A;  2YIB D;  5IYB O;  1HDJ A;  5BOC A;  1FFX A;  2P4K A;  3G4S V;  2BYI A;  4LWH A;  1X59 A;  2JKI A;  4JYB A;  3QTC A;  1G6U A;  3KE6 A;  3K58 A;  2YGA A;  2G38 A;  2XND G;  1AJN A;  3C3S A;  4XE2 A;  5CA3 A;  2HKJ A;  1US7 A;  3RYH B;  2EIL B;  2XAS A;  3EHB B;  3FAV A;  3J80 N;  4H7Q A;  4ASG A;  3A0Z A;  1W0J G;  4DYL A;  2LP7 A;  4YY3 O;  3HEK A;  1VAR A;  4JPR A;  2ZM6 O;  4KXR A;  4E00 A;  3JAM N;  2WI1 A;  3BVO A;  3X2Q C;  2YEH A;  2Y69 C;  5KMG B;  4X64 B;  2PUS A;  4QNH B;  3CP1 A;  3TXQ A;  2NN4 A;  2XCM A;  4UCU A;  4O2A B;  5EBM C;  4R50 A;  2YKE A;  2Z3Y A;  3O65 A;  3VHD A;  3G7E A;  3CX5 F;  1I59 A;  1JMK C;  3O0I A;  5KHH A;  5L3E A;  2UUC O;  5M4M A;  4B3S B;  1ZL8 B;  2DWD C;  4JQL A;  1YI2 V;  4I0X A;  4F4L A;  2GTA A;  1BSM A;  3LSS A;  3Q4H B;  4JGS A;  4DV1 B;  2VRZ A;  3T1H O;  1IBM B;  3E83 A;  3SR2 C;  5KAI Z;  4XTJ A;  4DUZ O;  1S5J A;  1YJW V;  3Q4H A;  3INX A;  1Y66 A;  3ETQ A;  4FM1 A;  4YY3 B;  3TZ4 A;  3C0E A;  1ZSP A;  2XDU A;  2BT0 A;  2FWY A;  4MVZ A;  1XBL A;  2CDY A;  4CS4 A;  3HKC B;  1H2M A;  4MP7 A;  2ZDX A;  2VCJ A;  2XAQ A;  2OCC C;  2UXB O;  2XAJ A;  2RNB A;  1BE3 H;  4DV5 O;  2ZXW B;  1E79 G;  5D6Q A;  4P30 A;  1I7F A;  1E1R G;  1PP9 H;  3E8F A;  4HZ0 A;  2JK5 C;  1I94 B;  4EM7 A;  1YTF B;  1WB8 A;  2WLN A;  2YXH A;  1S16 A;  1U0Z A;  1V54 B;  4JI6 O;  3BAB A;  1LUV A;  4ZI7 B;  1ZTE A;  2WWW A;  2HHI A;  1S5L Z;  4JI3 B;  4LFC O;  4MS2 A;  3UKM A;  2QTS A;  4I9W A;  1S3J A;  2XX5 A;  3JSL A;  1S76 D;  1Y8N A;  4MW3 A;  4X1I A;  2Q73 A;  5M4K A;  1EI1 A;  1SER A;  1O9H A;  1VF6 C;  5B3S C;  4O4I B;  3JZ3 A;  1PL0 A;  3L74 H;  2R9R B;  2Y69 B;  2Q8G A;  2DJV A;  2IWX A;  1B04 A;  4NTX A;  5CTU A;  2WA4 A;  1THN A;  3T4D A;  4ZIB A;  2IH1 C;  4ZBM A;  1D2D A;  4UXN A;  3DGE A;  4CWP A;  2EUL A;  3G6B A;  3W7U A;  4UVA A;  1XL6 A;  5D7C A;  1YHQ V;  2YK2 A;  4FLT A;  2FTK A;  2ZNJ A;  2CGO A;  2XJX A;  5BY1 A;  3CCU V;  4PHZ A;  2CK3 G;  4GKK B;  4LFA B;  4LWG A;  2IU3 A;  1M56 B;  3WQ9 A;  2GUZ B;  3CPW U;  1SA0 A; 
#chains in the Genus database with same CATH homology
 1KKD A;  5D7R A;  2BZ5 A;  5IYD O;  4PA3 A;  1M1K W;  3A0T A;  3IGA C;  4O05 A;  3D36 A;  4XIR A;  3SYA A;  3ABL B;  3T1C A;  4WUC A;  3EHF A;  1PKX A;  1S14 A;  5EBW C;  1R62 A;  1BMF G;  1P7B A;  1VQK V;  2QG2 A;  2UWD A;  4FCP A;  2WLI A;  2PI5 A;  4U7N A;  4XCJ A;  2ITD C;  4KUM A;  1VQL V;  1R3I C;  4WFB V;  4TSF G;  2QM7 A;  1QBZ A;  3P32 A;  5B3S B;  2XDK A;  1OCO C;  4URM A;  4J9Y B;  3K97 A;  5J9P C;  4UVC A;  3K99 A;  4R3A A;  2HLD G;  2B1G A;  3G6E V;  1VQ8 V;  2XAB A;  4G27 B;  5EK0 A;  4LCU C;  4L8Z A;  3ML0 A;  1I5D A;  2NNU A;  4KTN A;  1NR1 A;  1MX0 A;  3K0D A;  1ZXN A;  2YKB A;  2YJX A;  1ZWH A;  5CN0 A;  3FB5 C;  4YKU A;  4CWO A;  2HVJ C;  1NHJ A;  2YE9 A;  5CTY A;  1EZJ A;  1Y4U A;  4URN A;  2BU8 A;  3R65 A;  1LNQ A;  3SJQ C;  2WI3 A;  4FCR A;  4HXW A;  2YE8 A;  1JX9 A;  2YEB A;  3K06 A;  1VQ4 V;  1K97 A;  2YE7 A;  1NH2 D;  1UY8 A;  1DTO A;  4U7O A;  4CWQ A;  2YGF A;  4L91 A;  1NVP B;  1TBW A;  1TUE B;  4PA9 A;  2HCH A;  3FB8 C;  2AHZ A;  2A9H A;  2Y48 A;  2BSM A;  4N21 A;  1GMG A;  4MTF A;  5HFM A;  2ZKJ A;  3LPS A;  1GM8 A;  1BKN A;  4AS9 A;  4P9P A;  2DYR B;  2IJI A;  2UXX A;  3FYI B;  4TT3 G;  1AH6 A;  3EHH A;  1JVM A;  5CMU A;  2ZXW C;  5LHI A;  1DF4 A;  2XD6 A;  4CE1 A;  2IWU A;  4PEL A;  4X88 A;  1Y8P A;  2QG0 A;  3ZMT A;  1UY6 A;  1M56 C;  1MOF A;  2EIN B;  2OT5 A;  1EBO A;  3CCV V;  1RM1 C;  5C93 A;  1I5C A;  1YET A;  2R9I A;  3K98 A;  1VQ5 V;  2ATK C;  1FXK B;  1SZT A;  3TCU A;  1QLE C;  2WLH A;  4PA7 A;  5LGU A;  1TID A;  5HFL A;  3ABL C;  3QNE A;  2YE4 A;  4WUB A;  1Z5A A;  3GIE A;  4ASB A;  1R3K C;  4WFA V;  2XAF A;  4LC1 A;  1N8R W;  1OCC B;  1I5Y A;  2GSM B;  1QCE A;  2B1I A;  2VCI A;  3I55 V;  4E01 A;  3CRL A;  3T1K A;  3VAD A;  1YTF D;  2QE7 G;  2EJR A;  3LDD A;  4EEH A;  1YIT V;  3QTF A;  1EFR G;  4AWP A;  5EBL C;  2ZR2 A;  4YKQ A;  2QFO A;  1YJ9 V;  4MVS A;  1KC8 W;  1B3Q A;  4BQJ A;  3T2S A;  3OEH G;  3E86 A;  4GCZ A;  3Q5L A;  1BL8 A;  2BYH A;  1AJP A;  4MTO A;  1QY8 A;  3SPC A;  1CEZ A;  2XHT A;  2IH3 C;  1COW G;  2EZP A;  4XKK A;  2WAM A;  2H8P C;  2DWE C;  3JD4 A;  3VHA A;  2OCC B;  2YKJ A;  3OM3 B;  1F4M A;  2YED A;  1K7D A;  2F43 G;  1MG1 A;  4W7T A;  1GKX A;  3HYZ A;  2CH4 A;  2V1D A;  3OPD A;  1UYI A;  3CRK A;  1YC4 A;  4O09 A;  2WSS G;  4DUH A;  4PRV A;  2AHY A;  4PDL A;  1BHB A;  1BGQ A;  2HG1 A;  4XIT A;  2XHR A;  4WFE A;  5LHH A;  4QPJ A;  3U2D A;  2H94 A;  5CBH A;  3TUH A;  2IJJ A;  3B8M A;  3RBZ A;  4QE9 A;  2WI4 A;  5KUK A;  1NKD A;  1EA6 A;  2BU6 A;  3RW0 A;  3HZ1 A;  3PEH A;  1WPX A;  2DYS C;  2WLL A;  2EXL A;  4CE2 A;  5IDM A;  1ORQ C;  5H9C A;  2Q68 A;  3OUF A;  3E89 A;  2DYR C;  4KFM A;  4URO A;  5FNC A;  4MVO A;  4MVM A;  1KZN A;  4R3M A;  4GT1 A;  5KA5 A;  1VQO V;  3W7W A;  2X7R B;  2Z5U A;  1K4C C;  1NVP D;  2XAH A;  2BTZ A;  4ASF A;  3QDD A;  1YT1 A;  2WEP A;  4XDJ A;  3SPH A;  3H4L A;  2W0F C;  2ZD9 A;  4QIW F;  3CME V;  4G28 B;  3W7T A;  5CBG A;  2Q6A A;  4RUF A;  3AG2 C;  3ZRV A;  1E1Q G;  3CD6 V;  1ROP A;  2VW5 A;  2XDL A;  3OW6 A;  1AI6 A;  3DTU B;  4EGK A;  2IOR A;  1L1F A;  1AI5 A;  3K03 A;  5KUM A;  1TH8 A;  4X8A A;  1AM1 A;  2CGF A;  3EKR A;  4WUD A;  4GX1 A;  3VHC A;  3CYO A;  4Q20 A;  3ZCC A;  4AWO A;  2YEI A;  4CE3 A;  1NR7 A;  3O2F A;  1W2B U;  3B25 A;  4PU9 A;  1TC0 A;  3MNR P;  1RPO A;  2FXS A;  1GK9 A;  4I5S A;  1KP2 A;  1QR8 A;  1VQN V;  2YI6 A;  2ZDY A;  3F7Y C;  4BIU A;  3OWB A;  2CCU A;  2WLL B;  4U93 A;  4MT8 A;  3ZMZ A;  4R7C A;  1ID0 A;  2GQP A;  2YE2 A;  2YJW A;  3NMQ A;  4URL A;  5LHG A;  2YI5 A;  3G7B A;  3R4P A;  2JEX A;  2IJH A;  3SYP A;  3AG1 C;  4CZZ A;  4ZKI A;  4MBC A;  5D6P A;  3CXC U;  1NHI A;  1RPR A;  3X2Q B;  4XCL A;  2YEJ A;  5L3F A;  4UV9 A;  4FMT A;  3ZN0 A;  3TZ5 A;  3CMA V;  2H8M A;  1AJ6 A;  3OE7 G;  5B1O A;  1QR9 A;  2YEG A;  4XIP A;  1K5Q A;  1KD1 W;  3OMU A;  4V26 A;  4MOT A;  2JDI G;  1UY9 A;  2XJG A;  3OW2 U;  5L3J A;  1K33 A;  5IDJ A;  2HKO A;  2WPD G;  3JCZ A;  1R6K A;  2WLK A;  4BW5 A;  4KSG A;  1AJQ A;  5FWK A;  2EBO A;  1FXH A;  5GGZ A;  1FXK C;  3ZRW A;  4NH7 A;  2Q69 A;  1L0O A;  2Q2E B;  4MP2 A;  1SES A;  4GQT A;  1OCR B;  5LGT A;  2E0A A;  4HYM A;  4O0B A;  2FYP A;  3H01 A;  1TC6 A;  4MSW C;  3T10 A;  2AKP A;  1OCC C;  3BM9 A;  3IFX A;  4LWI A;  3ABK B;  4WF9 V;  3I56 V;  1M57 B;  3G75 A;  3F5W C;  3OFN G;  1H7S A;  3FT8 A;  4XKA A;  4YKZ A;  4EGH A;  2EIM C;  2HFE C;  4MPN A;  1UY7 A;  3WG7 C;  1H38 A;  3EKO A;  3Q5K A;  1DLB A;  1OCZ B;  2P90 A;  3K9A A;  3T0H A;  3ASN B;  3FB7 C;  2JIZ G;  3ZKD A;  2YEF A;  4MPE A;  2ITC C;  2DQ0 A;  4J9Z B;  2O1W A;  1GM7 A;  2YE5 A;  4KSH A;  2XX2 A;  1Q82 W;  3GIF A;  2YGE A;  2CG9 A;  1HWY A;  2WI5 A;  2Q8I A;  2HVK C;  4V25 A;  5L3D A;  3OMN B;  4KP4 A;  4YXW G;  1OSF A;  1QLE B;  4UUJ C;  1OCO B;  4E2L A;  1K73 W;  2BRE A;  4FCQ A;  3OR6 C;  5FND A;  3PEJ A;  4NH9 A;  2Q8H A;  2CCT A;  2LFS A;  2DQ3 A;  3E35 A;  4MVR A;  4XDK A;  4B6C A;  2JEU A;  4BAE A;  1KEC A;  2EIK B;  3RVZ A;  1YT0 A;  3LNU A;  4PRX A;  5B1B B;  3ZRW B;  4XIQ A;  3SYC A;  5LBQ A;  3JD0 A;  1V55 B;  2YEV A;  2BU2 A;  4XDL A;  1PNL A;  1UYG A;  3R4M A;  1YC3 A;  1VQM V;  3LSQ A;  4BIZ A;  1M9N A;  2QTO A;  3KG2 A;  1QVF U;  3A0R A;  3ZM7 A;  3MHS C;  2BOB C;  4JTC B;  3OMA B;  1YJN V;  4GX2 A;  4CWS A;  1VQ7 V;  4PL9 A;  4BAY A;  1Z5C A;  4NH8 A;  3VOU A;  2YK9 A;  2IJK A;  2WI7 A;  1FXV A;  4BQG A;  4JAU A;  1IXM A;  1K3E A;  1PNK A;  4P2Z A;  4BXI A;  2H55 A;  1Z5B A;  2JJ1 G;  3AG3 B;  5M4P A;  3B24 A;  3HB3 B;  5LGN A;  3QO8 A;  1YC1 A;  3C11 A;  2W6J G;  3GIG B;  5B1A B;  1SET A;  1OCR C;  2XOK G;  3T2M A;  2NLJ C;  1NQT A;  3K04 A;  2GFD A;  4GGL A;  1UYF A;  5M4N A;  1R3J C;  1KQS U;  5M4E A;  1JOY A;  3P30 A;  2YKC A;  4LPB A;  4PA4 A;  4JTA B;  1JCH A;  3B8N A;  3OR7 C;  3CC4 V;  2O1U A;  3E8H A;  3ZMS A;  3FB6 C;  2D3O W;  2WI2 A;  3K08 A;  4HAM A;  5BZB A;  4FPP A;  4PA6 A;  3T4Z A;  5CPH A;  2A0L A;  4B7P A;  5M4H A;  2OTJ V;  1WLE A;  1NJI W;  3MHH C;  5H6R A;  2PNR A;  3ZJZ A;  3RLR A;  3JD2 A;  4N23 A;  1UYM A;  2WLJ A;  3ZIA G;  1BHA A;  2WLM A;  3Q5J A;  3STL C;  3CCS V;  4HYP A;  5CTW A;  2MK3 A;  3K79 A;  5GW7 A;  1S77 D;  1Q7Y W;  3FT5 A;  1NBM G;  2B5U A;  2EIJ C;  2W6I G;  1PVG A;  4EGI A;  4GX5 A;  4TWK A;  3SPJ A;  2QF6 A;  3A0X A;  1SRY A;  3IC7 A;  2ESA A;  3STZ C;  3E8B A;  1AR1 B;  3B27 A;  5J6A A;  1H7U A;  4EFU A;  1PNM A;  5FL7 G;  2BU5 A;  3K60 A;  5KA6 A;  2Q8F A;  1V55 C;  1NHH A;  1PD3 A;  3OUS A;  4L87 A;  1R3L C;  3ZRS A;  3CCM V;  1AH8 A;  4MVQ A;  1AI4 A;  2YSU B;  3CCL V;  4QJF B;  1YER A;  2IOQ A;  2YEC A;  3IED A;  5IY5 B;  4GX0 A;  2QKS A;  1UYH A;  1FXK A;  1R6N A;  2K5B A;  2X6C A;  4EKW A;  4RQE A;  2XK2 A;  3OWD A;  3ZXO A;  1YIJ V;  1QVG U;  4P7A A;  2GHY A;  2K1E A;  2P67 A;  3R4N A;  1M57 C;  3U67 A;  5IN9 A;  4JAS A;  1I5A A;  1MU5 A;  4O04 A;  2WLI B;  4CWN A;  3WG7 B;  2LFR A;  3PJS K;  2EZO A;  3TET A;  1GKZ A;  5B1A C;  1FS0 G;  3ASN C;  4X89 A;  3INW A;  5BOC A;  5IYB O;  3U2K A;  3G4S V;  2BYI A;  2VWC A;  5H6Q A;  1K5S A;  1P4R A;  1GM9 A;  3LDE A;  4LP0 A;  2ZDI A;  4LWH A;  1UYD A;  5F3K A;  4XD8 A;  1QYE A;  3BMY A;  4P8O A;  2JKI A;  4JYB A;  4E02 A;  2XHX A;  3W7S A;  4H37 A;  3GIG A;  2QM8 A;  1Y8O A;  3KE6 A;  3HYY A;  4H33 A;  2YGA A;  3TZ0 A;  2XND G;  3UM7 A;  1AJN A;  1GJV A;  1VQ9 V;  1YSR A;  1KP3 A;  4JYC A;  1UYE A;  4HXZ A;  4XE2 A;  3AG2 B;  1K9M W;  4RQF A;  1NH2 B;  1K4D C;  5CA3 A;  4O07 A;  4RO2 A;  2YEE A;  4LWF A;  1S72 V;  3AG4 C;  5B1B C;  2CCS A;  2HKJ A;  1US7 A;  4L94 A;  4X9L A;  2EIL B;  2XAS A;  3ABK C;  4CBC A;  2IW5 A;  1UJW B;  3AEI A;  4PDV A;  5E1A C;  1KIJ A;  4YKR A;  4R8C A;  3EHB B;  1F51 A;  2EIJ B;  4GEE A;  4LWE A;  1YSC A;  4WFH A;  2YE6 A;  5L3C A;  1VQ6 V;  5CBF A;  2BRC A;  4LP8 A;  4H7Q A;  4ASG A;  3A0Z A;  1W0J G;  3T0Z A;  3JD3 A;  2LP7 A;  2QEX V;  3HEK A;  4KQV A;  2X6B A;  3R4O A;  4Z1M G;  4JPR A;  4L90 A;  1B62 A;  4HZ3 A;  4EMV A;  4E00 A;  1GKF A;  1UYC A;  2FWZ A;  5CTX A;  4ZVI A;  3ASO B;  1H2G A;  2WI1 A;  5FNF A;  3X2Q C;  3WHA A;  2YEH A;  1S5H C;  4FK5 C;  2Y69 C;  3SPI A;  3FYE B;  1YT2 A;  2BU7 A;  5BOD A;  1MSW D;  3E8G A;  2EIK C;  4PDR A;  4YKX A;  4HY1 A;  2P7T C;  4QNH B;  2HJF C;  1I5X A;  3CP1 A;  5B1N A;  2XDX A;  4L93 A;  4I3H A;  1K92 A;  2ZQM A;  2WI6 A;  2XCM A;  5EBM C;  4HZ5 A;  4XBF A;  4R50 A;  3QO7 A;  2Z3Y A;  3BEH A;  3CC2 V;  1I5B A;  2YKE A;  3B26 A;  3G7E A;  1V54 C;  3VHD A;  4CWR A;  2YEV B;  2HG5 C;  3WFV A;  1I59 A;  4UVB A;  1B63 A;  1GO3 F;  2DW4 A;  2PI4 A;  3O0I A;  4K4O A;  1H8H G;  5L3E A;  5M4M A;  3CCR V;  1YES A;  1R73 A;  3CGZ A;  2DWD C;  3VBB A;  4JQL A;  2M7W A;  1YI2 V;  1Z59 A;  3CGY A;  3MD0 A;  3JD1 A;  4F4L A;  4WCE V;  4DZY A;  2EIM B;  3SYO A;  2P6J A;  3LSS A;  1A4H A;  1OCZ C;  4JGS A;  3RVY A;  2XDS A;  3R92 A;  3E83 A;  4XTJ A;  1JJ2 U;  1TIL A;  3D0B A;  5EC2 C;  1ZXM A;  1I58 A;  4G2K A;  1ZWI C;  4XC0 A;  3ZXQ A;  3AG4 B;  3ABM C;  1YJW V;  4YKY A;  3HHU A;  1OZ0 A;  4H85 A;  3INX A;  3E2E A;  1Y66 A;  2JJC A;  3M99 B;  3TK1 A;  5F5R A;  4LBE C;  3RKZ A;  1UYK A;  3JYC A;  5EC1 C;  3A0Y A;  3C0E A;  3TZ4 A;  2YEA A;  3ETD A;  2BT0 A;  4OXS A;  2FWY A;  2XDU A;  3OGC C;  4MVZ A;  3OMI B;  4MW8 A;  1JM6 A;  1ENV A;  1JPX A;  4HYO A;  4JF3 A;  1U2O A;  2YKI A;  4MP7 A;  4CWT A;  2ZDX A;  4CWF A;  1Q86 W;  2VCJ A;  2XAQ A;  3R91 A;  4XKO A;  2OCC C;  3A0W A;  3ASO C;  3ZMV A;  1Y4S A;  3H80 A;  2XAJ A;  1UYL A;  5L3G A;  5L3B A;  2QA4 V;  3EHJ A;  3LNM B;  2ZXW B;  4XDM A;  2WEQ A;  1E79 G;  3SYQ A;  2WER A;  5D6Q A;  4ASA A;  4P30 A;  1E1R G;  3E8F A;  4QE7 A;  4UV8 A;  3GB7 C;  4HZ0 A;  2JK5 C;  4EM7 A;  4MPC A;  1YTF B;  3AG3 C;  2ZBK B;  2WLN A;  3QO5 A;  4FIP C;  4WFG A;  1S16 A;  1U0Z A;  2IOP A;  2A79 B;  1V54 B;  1Y4M A;  5CF0 A;  3OAA G;  1OHH G;  5IY5 C;  3CCE V;  5DN6 G;  1ZW9 A;  4HY6 A;  2WWW A;  3ETE A;  1K34 A;  3ABT A;  4GT8 A;  3SL2 A;  3D3I A;  1G8M A;  4QPK A;  3CCJ V;  5D7D A;  4YKW A;  3D2R A;  1XL4 A;  3OEE G;  2X0L A;  4MS2 A;  3UKM A;  1K8A W;  4I9W A;  1S3J A;  1F4N A;  2XX5 A;  3ZMU A;  3RLP A;  3O6O A;  4R1F A;  1BXD A;  1S76 D;  1Y8N A;  4MW3 A;  5M4K A;  4PDM A;  2JJ2 G;  2IU0 A;  2BOC C;  5DM6 V;  3BY6 A;  2EIN C;  3LDC A;  5IYC O;  1RM1 B;  4R6Z A;  1M90 W;  1EI1 A;  1YS3 A;  2KB1 A;  1DF5 A;  3F7V C;  3ZN1 A;  3K3W A;  3G71 V;  5B3S C;  1SER A;  1ARO P;  2ZR3 A;  3HPL C;  1CP9 A;  3K0G A;  1QLN A;  3EHG A;  3RLQ A;  4AWQ A;  5J71 A;  3JZ3 A;  1PL0 A;  3FKS G;  2R9R B;  4RUE A;  2V7Q G;  3NXS A;  4DXW A;  1S0V A;  2Y69 B;  1BYQ A;  2XJJ A;  2XX4 A;  4RAI A;  3B28 A;  2Q8G A;  2IWX A;  3ZKB A;  4H81 A;  3CC7 V;  4YKT A;  2YE3 A;  3LUT B;  5CTU A;  2EIL C;  4ASU G;  1THN A;  3T4D A;  2O1V A;  2OTL V;  2IH1 C;  3ETG A;  4MTG A;  4ZBM A;  3AG1 B;  4UXN A;  2DYS B;  3DGE A;  4CWP A;  2HR3 A;  3B77 A;  1QZR A;  2IWS A;  3FV5 A;  2YI7 A;  3W7U A;  3CWV A;  1THZ A;  3HZ5 A;  1GTO A;  4JAV A;  1AMW A;  3TTZ A;  4UVA A;  4DO2 A;  4EFT A;  1XL6 A;  4GFN A;  1JQ0 A;  1F23 A;  1W0K G;  4KFG A;  5D7C A;  3SPG A;  2UXN A;  1YHQ V;  4FJC C;  3W7X A;  1J95 A;  4WFF A;  1FFT B;  2YK2 A;  2FTK A;  1B6Q A;  1YSZ A;  2XJX A;  4MTX A;  2ZDI C;  4P9O A;  2XAG A;  3ZRX A;  3CCU V;  3GWO A;  2YI0 A;  1AI7 A;  1H8E G;  3CCQ V;  2X6A A;  2Q67 A;  4MB9 A;  3ABU A;  4JTD B;  2CK3 G;  1VQP V;  1CPY A;  1G4Y B;  4LWG A;  2C2A A;  2IU3 A;  1M56 B;  3ABM B;  4MVU A;  1MAB G;  1Q81 W;  3TZ2 A;  3EFF K;  3WQ9 A;  3CPW U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...