4Q20A

Crystal structure of a c-terminal part of tyrosine kinase (divl) from caulobacter crescentus cb15 at 2.50 a resolution (psi community target, shapiro)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
233
structure length
231
Chain Sequence
ALADRSAALAEAERLKRDFVGNVSYELRTPLTTIIGYSELLERADSERGRNHVAAVRAAATQLARSIDDVLDMAQIDAGEMALEIEDIRVSDLLLNAQERALKDAQLGGVTLAVECEEDVGLIRGDGKRLAQTLDHLVENALRQTPPGGRVTLSARRALGEVRLDVSDTGRGVPFHVQAHIFDRFVGRDRGGPGLGLALVKALVELHGGWVALESEPGNGSTFTCHLPETQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor protein DivL
publication title Cell fate regulation governed by a repurposed bacterial histidine kinase.
pubmed doi rcsb
source organism Caulobacter crescentus
total genus 77
structure length 231
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4q20A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4q20A02
4CWQA 4WUCA 3ZRXA 2IWSA 2YKEA 3A0XA 4CWRA 2IOQA 2WI6A 3QDDA 4LWEA 4E00A 4P7AA 3GIFA 5CTUA 1GJVA 2XDXA 4CWSA 2VWCA 4L8ZA 1JOYA 3PEHA 4GT8A 1QY8A 4O04A 4URMA 3JZ3A 4YKWA 1UYMA 3PEJA 4H81A 4L93A 1YS3A 3EHGA 3EHFA 1UYDA 2XCMA 2WI4A 3A0ZA 2YEJA 2ZDXA 1UYGA 3TZ0A 5D7DA 2QG0A 4V25A 2YI7A 4GFNA 2YE6A 4JYCA 3R92A 3T0HA 4NH8A 3G7BA 3HZ5A 1OSFA 2ESAA 4B6CA 3GIGA 3T1KA 1THNA 2GFDA 1I5CA 1Y8OA 4WUDA 2CGFA 5F5RA 3OMUA 3HHUA 3ZRVA 2O1VA 3MNRP 2H8MA 2YGEA 3H4LA 3INXA 2WI1A 4XKAA 2BSMA 3H80A 2VW5A 4HXWA 1TC6A 2YI5A 4UROA 3HEKA 2Q8HA 4KSGA 2XDKA 5CPHA 1YSRA 4JAVA 1Z5AA 4MPNA 1QYEA 2C2AA 1UYHA 2Q2EB 2YGFA 1U0ZA 2QM7A 4KP4A 3IEDA 5J6AA 1ID0A 1ZXMA 4JYBA 5CTWA 4NH9A 4MT8A 3ZXOA 3R4NA 3TUHA 2ZBKB 2CCUA 3CGYA 3QTFA 1UYEA 1JM6A 3VHCA 5F3KA 3RLPA 1UYLA 4YKQA 5FNCA 3ZCCA 2BU6A 4HY6A 1US7A 4U7NA 3OPDA 4DUHA 1IXMA 2HCHA 4ZVIA 2WERA 2XJGA 1ZWHA 5M4NA 4BXIA 1TBWA 4XKOA 1I59A 4YKZA 1B63A 4BIZA 5IDMA 1TH8A 2QFOA 2YEBA 4AWQA 1YC1A 2O1UA 1UYIA 4WUBA 1UYCA 4L91A 5BOCA 2AKPA 3K60A 4YKYA 3D2RA 2CCTA 2YE9A 4GGLA 3GIEA 5M4HA 2XHRA 4EMVA 4EFUA 2HKJA 5J71A 2YEHA 1YT0A 1H7SA 2YI0A 2Q8FA 2YKIA 3TZ5A 1Y8NA 1U2OA 3A0WA 4MP7A 4GT1A 1Z59A 4BIUA 4MBCA 5D7CA 2YGAA 3NMQA 4L90A 5FNFA 2VCIA 1TC0A 1YC4A 4GEEA 5B1NA 2BRCA 1R62A 4O0BA 3O2FA 4KFGA 1UYKA 4XIRA 2BYIA 4MPEA 4YKRA 2QG2A 1A4HA 1UY7A 1PVGA 3KE6A 1F51A 3HYYA 4XE2A 4FCRA 4E02A 3ZXQA 3TK1A 3EHHA 3CWVA 2ZDYA 1BXDA 1I5DA 4CE1A 4JAUA 3FT8A 4I3HA 4LPBA 2YE4A 4LWIA 2QF6A 3INWA 1H7UA 3VHDA 2P67A 3ZRWA 4LC1A 2YE2A 1AH8A 3U67A 2YEDA 4EGIA 4XTJA 4AS9A 2YKBA 5D6QA 3LNUA 3WQ9A 1S16A 4YKTA 3CRLA 1EI1A 3HZ1A 3K98A 3WHAA 3RLRA 4FCPA 1QZRA 1MX0A 4CWTA 2EXLA 4XKKA 3FT5A 2BREA 2PNRA 3OW6A 1AH6A 2IORA 2YK9A 3B25A 4HZ5A 3G7EA 4NH7A 4XIQA 3CRKA 3B27A 4O05A 4PRVA 4LP0A 4CE2A 1I5AA 3VHAA 3RKZA 1YESA 3T2SA 3Q5LA 4KTNA 1Y8PA 4I5SA 3O6OA 4HYPA 4H85A 2YEAA 2JJCA 3C0EA 2YJXA 2BU5A 3HYZA 3Q5KA 2YK2A 4U7OA 3D0BA 3CGZA 4K4OA 4BQGA 2XDLA 3TZ2A 2XJXA 2YKCA 1Y4UA 3RLQA 1S14A 1KIJA 1I58A 4CWPA 4ASFA 2XK2A 1ZW9A 3P32A 2LFRA 4URNA 4X9LA 3EHJA 4PL9A 3T10A 4L94A 1I5BA 2YE5A 2CH4A 2Q8IA 5IN9A 1YT1A 4LWHA 2YKJA 2BU7A 2E0AA 3BM9A 3A0TA 4KSHA 2XD6A 5M4KA 5CF0A 3K97A 2O1WA 2FWZA 4FMTA 4QPJA 4XCJA 1YSZA 3O0IA 3OWDA 3EKOA 2YEIA 4CWNA 4CE3A 5D7RA 3B26A 2BU2A 5C93A 2YEEA 3BMYA 4O09A 5BODA 5CTXA 2BU8A 3A0RA 3GIGB 5L3JA 1YETA 1AM1A 4CWFA 4R3AA 3B28A 3SL2A 1TILA 5FNDA 2Q8GA 3LPSA 3C11A 3G75A 3DGEA 2BT0A 3ZKBA 3VADA 3ZRWB 1NHJA 4AWPA 2WWWA 2WI3A 4EM7A 5IDJA 2XJJA 2YE3A 3R4PA 2YECA 4FPPA 3U2KA 4W7TA 2IWXA 3R91A 4P8OA 5M4EA 4V26A 4XDMA 2BYHA 4YKUA 3MD0A 1Z5CA 2FWYA 1TIDA 4MOTA 2IOPA 4YKXA 4HYMA 2FTKA 1YT2A 1MU5A 2FXSA 3TZ4A 4MP2A 4XITA 3T0ZA 2IWUA 4MPCA 4HY1A 5M4MA 2CCSA 3TTZA 4QPKA 1BYQA 3Q5JA 1L0OA 2XDUA 4PU9A 5CTYA 4EGHA 1NHIA 2XABA 4LWGA 1EA6A 2XX2A 1UYFA 4EFTA 4BQJA 4EGKA 4HXZA 2YEGA 2K5BA 3A0YA 4LWFA 4R1FA 3ZKDA 3NXSA 2XDSA 2YJWA 1UY6A 3D36A 1BKNA 1UY8A 2YE7A 3OWBA 1Z5BA 4FCQA 2BTZA 2BZ5A 2FYPA 2H55A 3K99A 2QM8A 4MB9A 4JASA 3U2DA 4AWOA 2CG9A 2YI6A 2HG1A 2XX5A 2WI7A 5GGZA 4URLA 2GQPA 4HZ0A 5B1OA 2VCJA 4JQLA 1B62A 1YERA 1UY9A 3R4OA 1Y4SA 2JKIA 2YE8A 2XHTA 3FV5A 4GCZA 4DZYA 1AMWA 4XC0A 4ASAA 4XCLA 4EEHA 4XD8A 2ZKJA 2WEPA 2XHXA 5M4PA 4U93A 2WI5A 4MTXA 4ASGA 2WI2A 4R3MA 4KQVA 1GKZA 1YC3A 1B3QA 1NHHA 2UWDA 1GKXA 4ZKIA 4PRXA 4ASBA 4Q20A 3EKRA 4B7PA 1AJ6A 2XX4A 1ZXNA 3B24A 3R4MA 4XIPA 5FWKA 2WEQA 4O07A 4E01A 3ZM7A 4CWOA 2YEFA 1BGQA 5D6PA 1KZNA 4H7QA 4BAEA 4GQTA 2LFSA
chains in the Genus database with same CATH superfamily
3J80N 3S3WA 3A0XA 3CE2A 5JQGA 3QDDA 4LWEA 1OCOB 2A7WA 2UXBO 1JOYA 1Q82W 2AGAA 1L1FA 1QY8A 1WAZA 4O04A 5JVDB 4DK1A 3H1KH 4YKWA 1UYMA 4NTYA 4DV5O 1M4UA 1R6KA 3ABLC 4LFCO 4MTOA 2BE3A 1F4MA 4LF9B 1OV9A 3EHGA 2DYSB 1FFXA 5BMVA 2QKCA 4JI0O 3K0GA 2EIMC 5H2FZ 4KFMA 2UUCB 2N74A 3R66A 1NVPD 1I0HA 5KA6A 2Q5ZA 5D7DA 3TETA 3ASNB 3R92A 3BHPA 5JCOA 1NVPB 2F4VB 3G7BA 2ZNJA 4YY3B 1K33A 3KZIZ 2NN4A 1HWYA 2ZE7A 1S0VA 4WUDA 2CGFA 4AHCA 4Z1VA 5CA1B 2YUAA 3E86A 3FB6C 2OT5A 5GONB 3MNRP 3ZMVA 2EINB 3WB0A 2YGEA 3OAAG 4PJ0Z 4FLTA 3ZMZA 3QF7A 1Q6UA 4X1YB 4ICGA 1R73A 1G8MA 3H80A 3RFRA 4WFEA 4GKJB 1N8RW 2W0FC 3JSNA 1TC6A 1H2GA 2Q8HA 4MVZA 2ODMA 1VQ9V 3ABKB 1D5NA 3AG4B 2C2AA 2YXHA 4JYAO 3ZJZA 2DQ3A 1GTOA 4O2AB 1ZAUA 2P6JA 5LYJB 2ZM6B 2FYUH 2JGDB 3T1HO 3IEDA 4RWUA 3JD4A 2A79B 1TVKA 2WA3A 1SZXA 1ID0A 4GKKO 3D8CA 4YXWG 4NH9A 3R4NA 1MNGA 3QTFA 1J5EO 4JI3B 2Y69C 4X1KA 4GX0A 3RLPA 5JQGB 5FNCA 2BU6A 3ETEA 1US7A 3AG2B 1PNLA 2AXTZ 3K04A 4DUHA 4EB6B 1W59A 1I7FA 3G6BA 5HFMA 1Q43A 1I59A 4NTWA 4FM0A 2R9AA 3QTCA 4AWQA 4CH3A 1FXHA 1NTMH 4DR5B 2PF4E 3BEHA 4W4LA 1TUBA 2EX3A 2R70A 2W6IG 4PDMA 1VQLV 1FFXB 1WP8A 1NT2B 1SQXH 1EN5A 3JAKB 1IBLB 2CTWA 2AKPA 3K60A 4QIWF 3TXQA 3D2RA 2YE9A 4GGLA 3GIEA 4Z1MG 2XHRA 1WPBA 4ZI7A 4W4KA 2YI0A 4PA7A 2Q8FA 2YKIA 2QA4V 5KHHA 4MP7A 1SQGA 4UCSA 4MBCA 1JVMA 3N27A 5E1AC 4F4LA 3NMQA 4L90A 1R3LC 2DWEC 3B09A 3H1LH 4JI2B 4J9ZB 5E79Z 5K1XA 1QQCA 2JJ2G 5LP6C 3WFVA 1G1XB 3ZRSA 1YC4A 4X66B 1YHQV 4NXMB 2JDIG 4O0BA 1N33B 3OMIB 4MPEA 3A0BZ 4KUMA 1XMQO 1OCCC 1SKVA 2ZR2A 1IXBA 3KE6A 3SYAA 2CTQA 4GLXA 1FXVA 5KAFZ 2ADPA 1NH2B 1XHXA 5DEDA 3TK1A 2ZCEA 5CBGA 4PA4A 3OTOO 1K4CC 5KX5A 1GO3F 1YITV 1Q7YW 4ZOLA 2BCCH 4LWIA 1DK1A 2GDSA 3EFFK 4O4IA 1CXZB 4UB6Z 2DMXA 1E1QG 4DR2O 4B7KA 3U67A 2EZPA 2YEDA 1FJGB 1OCOC 2KG7B 4H33A 1BT8A 3HZ1A 3UO3A 3K98A 3OEEG 1H2LA 2QM4A 4L87A 4FCPA 5BY1A 5CA0A 1WB8A 1LNQA 3DTUB 4FZ0A 2BREA 3OW6A 2IORA 5JWPA 2QKAA 3LDDA 3JCZA 4XIQA 4I50A 1SETA 3B27A 3CRQA 4PRVA 1EN6A 3D36C 3VHAA 1TUBB 3OEHG 3Q5LA 3M8AA 1DGSA 1R3IC 3ASNC 2MW2B 4X9QA 3C0EA 1YF2A 1N34O 3Q5KA 2YK2A 3R65A 4UCRA 2R72A 3CCEV 1KP2A 3BA8A 4YIPA 4K4OA 1QLEB 3TZ2A 3LDCA 4DV2O 2XJXA 4NXNO 2YKCA 1EBOA 4KHPO 5L3DA 1L0LH 1I58A 3JCUZ 5LHGA 1JPXA 2EINC 3N2GB 3EHJA 3ABMB 2HHHB 1H2MA 2XT9A 5KHGA 3CXCU 4QGPA 4F6EA 4NVPA 2P90A 3VBBA 5LHHA 1MZEA 2WAMA 1FPOA 2BU7A 3B8MA 2A9HA 1XDCA 5IYCO 4FMTA 3DC5A 3F5WC 3AG4C 1ZUQA 4PA9A 4QPJA 3O0IA 2QWOB 4XCJA 4LR3A 2L35A 2KSDA 1QLNA 4HYOA 3OUFA 3HKDA 5BODA 1RSOA 5CTXA 4YJ2B 2YEVB 4P2ZA 3SJAC 3K5LA 3CYGA 1AM1A 4QE7A 4AQYO 4CWFA 2ZINA 1NTZH 2Q69A 5KX5B 1AVMA 1ZSPA 4R3AA 3SL2A 1K8AW 4R6ZA 1HW7A 4ZOLB 3UT5A 5FNDA 2E5LB 4BW9A 2F66C 3T1YB 1KP3A 1YJWV 4OXSA 5IT9N 3RVZA 1CPYA 4EM7A 3AG2C 2P5OA 5CN0A 2NLJC 2LQTA 1HNZO 2QJ1A 1XREA 1DF5A 3R4PA 4FPPA 5CA0B 4WBNA 2ZIMA 3RW0A 4V26A 4XDMA 2BYHA 4YKUA 1Z5CA 2FWYA 2ZT9B 4I50B 1K73W 2YXLA 1VQ7V 4HYMA 2E76B 3CHXA 2FXSA 1BL8A 1RM1B 2YC0A 1BS3A 4XITA 3THOA 2UXDB 3T0ZA 5IYBO 1Y6XA 5M4MA 3ZN0A 4QPKA 1L0OA 3P3PA 1AI4A 1IBKO 4EFTA 3SGIA 1UYFA 4HXZA 3CC2V 5IJ9A 1OCRB 2YJWA 4IYIA 1BKNA 2HVKC 2RN9A 1Z5VA 4DO2A 4J7ZA 5IWAB 3JARB 1Z5BA 4MB9A 1P7GA 3U2DA 4J7KA 4AWOA 3G71V 2CG9A 1JJ2U 2YI6A 2F95B 2XX5A 3JAWB 3U0ZA 2F43G 5EYPA 3I56V 2LJ2A 4CC5A 1VMGA 3LMMA 2CAZC 3CCVV 2BSKA 1Y4SA 4LWSA 2PY5A 4I9WA 1AMWA 4N23A 4ASAA 2OTLV 2QWRB 4LCUC 2O57A 4G2KA 4A5UB 2JEXA 2ZKJA 4U93A 2XAQA 3W7TA 1HNWO 4MTXA 4B3MB 4R3MA 1SRYA 4DYLA 3ASOB 4UUJC 5J2TB 3FYIB 4B3RB 2IJJA 2QWNB 1Q6IA 4GYCB 4DR4B 1N32B 4TUYA 1AJQA 1XEQA 4B7EA 3EKRA 3FAVB 1AJ6A 4JI4B 3H1JH 2IBZH 1GM8A 2XX4A 3B24A 4LF4B 4NB5A 5LOVA 2YIDA 5LXTA 3HKEA 3STZC 4EEQA 3ZM7A 1JMKC 2YEFA 1URFA 2WLNA 5D6PA 4H7QA 4OX9O 1IX9A 4BAEA 4GKJO 4CWQA 1M1KW 4DUYO 3E22B 2IWSA 1Q86W 4DV1O 5FL7G 2OTJV 2YKEA 3ZHUA 1H8EG 4PDRA 4P7AA 3GIFA 5CTUA 3OM3B 4JI5B 1GJVA 3CCJV 4L8ZA 1PM9A 3PEHA 4B3TB 1L0NH 1K34A 2P4KA 3JZ3A 4O4LA 5FNVB 3FB8C 2NNUA 3K03A 2Y48A 3OE7G 5IJ9B 4I4TB 3ZHVA 1LUWA 5L3EA 4BAYA 2G38A 4N21A 4JI3O 3RYFA 1GMGA 3A0ZA 5C8YB 3G4SV 4CS4A 3B8NA 2ETNA 5A2QN 4JI6O 4FLWA 3D3QA 2Y69B 2QG0A 2YI7A 4JYCA 2XUMA 3L70H 4LFBB 2Q9LA 5JJNB 1V54C 1K5SA 3T1KA 4JI7B 1I5CA 1Y8OA 1Q81W 4CZZA 4DR5O 1CEZA 2QSAA 1ORQC 1IBLO 2O1VA 3OT7A 4LWSB 3H4LA 3INXA 3OMNB 2EZOA 3C3SA 2HEPA 3QG5A 4J10A 5LA6B 2VW5A 1HNXB 4HXWA 4UROA 1Y76A 3UCSC 1F7YA 5CB4B 1Z5AA 3MHHC 1JX9A 4MPNA 2JJ1G 1UYHA 2Q2EB 1FXKA 1W0JG 5D5QA 4NKGB 2RCVA 4DV0B 3CS5A 1M5IA 4DK0A 3ICXA 1XNQO 3BA9A 1VIBA 2UUAB 2CCUA 1U96A 5LP6B 4DW0A 2X6BA 1KB9F 5F3KA 4LF5O 4PELA 5JH7B 2OCCC 4K8XA 1O9HA 2ZE5A 3ZCCA 1XQ8A 1MMMA 3ZN1A 1WPXA 4U7NA 5L3BA 3TCUA 1AR4A 4X20B 2NR5A 3CEIA 2WERA 2XJGA 1ZWHA 4ZVIA 2KB1A 4BXIA 2Q6AA 3AG3C 4ABMA 1XNRO 1TH8A 3EHBB 1M93A 2K1EA 2O1UA 2VWJA 5H6QA 3OUSA 5ITZA 1UYIA 2Y4TA 2JS5A 1VQOV 1GKFA 3A0HZ 3Q4HB 4DR3O 4BW5A 4L91A 3KCXA 3LSQA 2JVDA 4FLZA 3CMAV 4YKYA 3WB2A 2Y4UA 2PUSA 2Z5UA 5GW7A 2W0XA 3B4SA 3RVYA 1BHAA 3D3IA 3TZ5A 1F23A 5JJEB 1IDSA 1P4RA 2M6YA 3IGAC 3LUTB 2YGAA 4DR6B 5BXZA 1BCCH 2A06H 4JF3A 3O65A 4FLYA 4Z2WA 5FNFA 2VCIA 2CUGA 2CTPA 3S3XA 4PI0A 2QGNA 5B1NA 3WB1A 2UXNA 4TQDA 3O2FA 3ASOC 2LP7A 2Q7GA 4ASUG 4XIRA 1Y76B 2F93B 1D5AA 5JJJB 4FFBB 3JD2A 1N36O 4K0KB 2HKOA 5D5PA 3U10A 1IURA 1FXKB 2QTSA 1YVWA 4DV7B 1F51A 2HHIA 2B1IA 1M9NA 4X64B 1VQ8V 2WLLB 1KUQA 3SYPA 4E02A 3JALA 4Q6GA 3UM7A 2Y0IA 1NJIW 2ZKOA 1E79G 3GVMA 2ZDYA 1BXDA 2FMLA 4YJ3A 3FT8A 4I3HA 4LPBA 1S3JA 4FVMA 4X1IA 2QF6A 1COWG 1SS3A 2UXXA 1FKAO 1P7BA 4AS9A 4I7ZB 3JD1A 1KKDA 5D6QA 4U3JB 1S72V 3LNUA 1NU1H 3L72H 1YXBA 3CRLA 3RT3C 3H1HH 3WHAA 4LF6B 2JS3A 3SPJA 4CS3A 4I0XA 4TT3G 5FPRA 1QZRA 1MX0A 2EXLA 2DYRB 2WLIB 3ZMUA 3FT5A 3X2QC 2Q4PA 2YK9A 1R3KC 3B25A 4HZ5A 2AZ0A 1X59A 4X62B 4LP0A 5LHIA 2D2CB 2H8PC 3T1YO 1I5AA 1UJWB 3T2SA 4KTNA 4XDLA 2HG5C 4I5SA 3O6OA 3K08A 4HYPA 3JD3A 3K5NA 3BPZA 4TQFA 3JYCA 2BU5A 4WCEV 5BR8B 3EXAA 4JAAA 5LMUB 3D0BA 4JZ2A 3CGZA 2VQFB 4BWAA 3F7YC 2XDLA 4DW1A 1EM1A 1VF6A 4GZRB 3RN4A 3SPGA 3CYOA 3SJCC 4DXWA 2XK2A 1PNMA 1B6QA 3BVOA 2LFRA 4PL9A 1I94O 4L94A 2XHBA 2Q8IA 1IVSA 5BMVB 2GTSA 5IN9A 2VS0A 4PDLA 3A0TA 5M4KA 4B08A 1NTKH 3K97A 2FWZA 3W7SA 3LSSA 1AJPA 2IH3C 2JIZG 4PD4F 4DUZO 5C93A 4DR1B 2YEEA 4WFBV 4FLVA 4O09A 5IJ0A 1THZA 3JALB 2Q7EA 3TJTA 4LF8B 2HR3A 1HR0O 1PPJH 5HFLA 1W0KG 3K59A 1H2NA 1IBMB 1JQ0A 2ZDIA 3GWOA 4JTDB 3LPSA 3C11A 2QEXV 3ZKBA 5K1PA 1S5LZ 2M7WA 2X0LA 2EJ7A 2PYJA 1WJZA 2WI3A 2DQ0A 2JK5C 3J7AU 2XJJA 2HVJC 1GN6A 2Y0PA 3ML0A 4DR7B 2BOCC 1CP9A 4I0XB 1MA1A 5EZYA 4JV5B 3R91A 4P8OA 5M4EA 5L3GA 1P84F 5EK0A 4DV3O 2JGUA 2R9RB 3RYHA 3K5OA 2HLDG 4MOTA 2IOPA 1JFFA 1TVKB 4AI8A 2CH7A 2CK3G 4LP8A 2WLHA 4B3RO 1H8HG 1QHTA 4DR4O 4JYYA 1N32O 3CXHF 4IHJA 4CBCA 4GX2A 5KHJA 1AJNA 4MPCA 2CCSA 2N04A 3SYQA 1XHZA 1BYQA 2OYQA 4LF4O 4X1KB 4EGHA 2XABA 4LWGA 3E8FA 4G28B 4P9PA 1K97A 5LMNB 4E2LA 2K5BA 3IC9A 3APQA 3WU2Z 4O2BA 1B04A 1MOFA 4PI2A 5H5NA 1Y66A 4LFAB 1UY8A 1YSCA 3CRRA 3OWBA 3E8BA 4JI5O 4FCQA 5F2VO 3U11A 4PA3A 3PJSK 2VQEO 3I5DA 4JI8O 3M7MX 2UXBB 1WA8A 2YIAA 2XOKG 3BFRA 2BTQA 4ZHQA 4ZI7B 4DV6O 1FXKC 1S76D 4PDVA 2UXCO 1UY9A 4DV5B 1VQ6V 2JKIA 2YE8A 2XHTA 2B1GA 2EIKC 3OGIB 2UUBO 2EULA 1AR1B 1AP6A 2Q67A 2Q8VA 2LW1A 1Q3EA 1TA8A 4I55A 4ASGA 3K79A 4CS2A 3OW2U 2ITCC 1GKZA 3OTFA 1YC3A 1DTOA 2E3CA 2UWDA 4PRXA 5IYZA 3OD4A 4H0LB 4XBFA 1V54B 2YIBA 1S5HC 4O07A 1ZLZA 3ZBHA 3RYIA 2DYRC 5LGTA 1K3EA 5A9GA 1RP3B 2P06A 3VOUA 4LH7A 2IW5A 1PNKA 2CH7B 2IOQA 4E00A 1GK9A 4IHJB 2PYLA 4CWSA 4O4IB 3FYEB 3UO2A 2Q0OC 5DECA 1H2KA 2F23A 4GT8A 4JYAB 3E35A 4R50A 4URMA 1AI5A 3QO5A 3T1HB 3PEJA 4H81A 4L93A 2EIJB 3EHFA 4O2BB 3CPWU 2IH1C 2XCMA 2WI4A 2DE0X 1J5EB 3TZ0A 1AI6A 1GN3A 4GFNA 3ZEDA 2YE6A 2OCCB 1RFYA 3T0HA 2V1DA 5KA5A 1AB3A 1PD3A 1OSFA 4LF7O 3HR0A 4B6CA 1XILA 3GIGA 5JENA 3AG3B 5F5RA 2BOBC 3K9SA 2XAFA 3BY6A 2IU3A 3ZRVA 1EZJA 3OMAB 4QJFB 3ZS8C 3FX7A 1V55B 3CRCA 4MVQA 1I5XA 4XKAA 3CJHA 2RMKB 3KG2A 1FS0G 4O4JA 2LW7A 1YTFD 2YI5A 4I55B 4KSGA 2P4VA 5CPHA 3IJ4A 4JAVA 1YSRA 2YIBD 3A2FA 2CGNA 3ZIAG 3VQXA 1ZTEA 1U0ZA 3CCSV 4H37A 4KP4A 3DC6A 1SA0A 2QWPB 1LR1A 4LF9O 5J6AA 1ZXMA 1JR9A 2CE4A 4UCOA 4EFEA 3HKDB 4MT8A 5KHKA 2R9IA 1RSOB 2XAGA 3TUHA 2UUCO 2ZBKB 3JATA 3CGYA 1UYEA 2ZQMA 1G6UA 4J41A 3VHCA 1PL4A 2K9PA 3UT5B 1QU7A 3ZX6A 3LDEA 5DM6V 1UYLA 4YKQA 3AG7A 1FYJA 2F4VO 5KAIZ 3OPDA 3AEIA 1Q8IA 1WN7A 3F5TA 4YY3O 1XMQB 4TV8A 3ZHTA 2HCHA 1OCZC 4TSFG 5M4NA 1TBWA 4XKOA 1Y74A 2ZXWC 1V9PA 1SC5B 2PZSA 1YC1A 1VF6C 3B77A 4HZ3A 1D2DA 3OTOB 4WBNB 2A3QA 4UB8Z 1VQKV 5KHIA 4CH6A 5BOCA 1Z5WA 1YZBA 2UU9B 2CCTA 3S5TA 4IT5A 5M4HA 2HKJA 2PI4A 3VQVA 3RYCA 2YEHA 3OFNG 2RDCA 3I55V 3CCLV 4X88A 2ZM6O 3A0WA 4J7JA 3G67A 2OWOA 1GN4A 4DRXA 2DWDC 1Z59A 1SF9A 1K4DC 3X2QB 2YXYA 4P9OA 5KMGA 3QNEA 1I5YA 4GX1A 4WFHA 5IY5B 1TC0A 4GEEA 1NR1A 1RPRA 2BRCA 4BR6A 2ZDIC 2OCHA 3CJHB 1R62A 4KFGA 4TV9A 5B1BC 3K57A 4L8JA 2BYIA 4YKRA 1WP7A 2QG2A 4AILC 2ZIOA 1GM9A 1N34B 2ZD9A 1GRJA 4R8CA 4F6RA 2P7TC 4WFAV 5H9CA 3HYYA 4XE2A 1XMOB 4FCRA 3TXSA 5EYPB 1MSDA 3EHHA 3CWVA 2Z0AA 4NXNB 1SA0B 1I5DA 3LNMB 2H94A 4J80A 3QO7A 4X89A 2HJFC 4J42A 5FPOA 2BSKB 3T1CA 4LBEC 1P49A 2XAJA 2XTAA 3HKBA 3INWA 3VHDA 1PL0A 3JATB 2P67A 2X7RB 3ZRWA 4LC1A 1AH8A 4EGIA 1KECA 4WF9V 2YKBA 4UCTA 3WQ9A 3FB5C 4JGSA 2X6CA 4YKTA 2GBOA 3K9AA 2ADQB 2EBOA 3RLRA 4TUYB 3T4ZA 4D7SA 4CWTA 4XKKA 4WFGA 3SR2C 2PNRA 1KBHA 2YICA 1AH6A 5LOVB 4JI2O 1IBMO 3G7EA 3J81N 2EIJC 3SYOA 5LXTB 2DN9A 3CRKA 4AQYB 1J95A 3APOA 3HKEB 3RKZA 4X66O 4NXMO 4I9QA 4PA6A 1K7DA 3OGCC 1N33O 4UFZA 5B5EZ 1NR7A 4HAMA 4RO2A 4H85A 4U3FH 3GB7C 2JJCA 4UVCA 4RAIA 2YJXA 2HJDA 3HYZA 5CA1A 3RYCB 4BQGA 1M57B 5GONA 3IFXA 5CMUA 4OPHA 5B3SB 3W7XA 3ETQA 4D7TA 2YI9A 1VEWA 1HDJA 5IYDO 1XL4A 4X1YA 4O4LB 4NYKA 1ZW9A 4URNA 5KMGB 4X9LA 1V55C 3K58A 1W2BU 3G80A 4MSWC 4FM1A 4ZIBA 3RYFB 4DV4B 1AI7A 1FJGO 2E0AA 1JA8A 3BM9A 4KSHA 1NKDA 4O2AA 1ZL8A 5LYJA 5EBWC 5LMNO 1YSZA 3OWDA 3EKOA 1IBKB 2YEIA 1SQVH 4CE3A 2CGOA 4OPAA 3F7VC 5D7RA 3B26A 2BU2A 2Q73A 4RQEA 4MVSA 1S77D 4FZ1A 5L3JA 4J11A 4K3AA 1YETA 3CMEV 5FLXN 3JAMN 1BSMA 2B5UA 5J9PC 3B28A 4NTXA 2ZR3A 1Q5OA 1FD9A 2L6LA 3LNNA 3HKBB 3DGEA 2BT0A 1XOUA 4MTGA 3MDSA 4K35A 3ZRWB 4EB6A 4AWPA 2WWWA 1K9MW 5J2UA 3ETDA 1SERA 3VQYA 3WG7B 2YE3A 1AP5A 1TGOA 2YECA 3L73H 4W7TA 3CCMV 3JAKA 1SQBH 4P30A 4UV9A 2EIKB 2HHHO 3NR7A 3ZHSA 1Y4MA 2FTKA 1MU5A 2C1GA 3CWBH 1HNWB 2IWUA 3HKCA 1N0JA 1KYOF 1UPGA 1NQTA 4KL1A 3L9DA 3Q5JA 2D3OW 3SDLA 1BE3H 1M56C 1NHIA 4UXNA 1EA6A 3HPLC 4BQJA 2ARHA 3B40A 4EGKA 3W7UA 4R1FA 3ZKDA 3NXSA 1PKXA 5LL6Y 1UY6A 3KKYA 3UQ8A 1YEWA 1OZ0A 1QNMA 2E5LO 4OX9B 5IY5C 5ITZB 4B3SB 4DUYB 2CDYA 3CD6V 2BZ5A 2H55A 1IZ3A 3K99A 5CBHA 4DV1B 3SJQC 2AW9A 4JASA 2V4DA 1S5JA 1O9GA 4ZBMA 2C1IA 2WI7A 3E8HA 4URLA 1ZL8B 4FK5C 4HZ0A 2EJRA 2V7QG 4KXRA 3T4DA 2AHZA 5B1OA 2E74B 5B1AB 4JQLA 3HB3B 3R4OA 3IAYA 4GCZA 1QR8A 4JI1B 4XC0A 1FAFA 3IC7A 1ENVA 4NR1A 3CX5F 4XD8A 2XHXA 2KG7A 2WI5A 2UXDO 3UKMA 4JI6B 4KQVA 2AHYA 1YIJV 1GAXA 1NHHA 2W6JG 1GKXA 4ZKIA 4ASBA 4E72A 2PGGA 1T5EA 5J2UB 1JJOA 1ZXNA 2OIEA 3R4MA 2QTOA 5FWKA 4E01A 3SPHA 1A32A 5CA3A 4UVBA 3RBZA 4JTCB 4HNAA 2FB5A 2BTOA 2PI5A 3SJBC 1BQ0A 1BGQA 4LNUA 1E1RG 5IWAO 4GQTA 4WUCA 1OHHG 3ZRXA 4IYHA 4YJ3B 5LGNA 4CWRA 1K5QA 2WI6A 4YHHB 4X1IB 5H6RA 2XDXA 4MVUA 2VWCA 1Y67A 3HKCB 3BRCA 1MZFA 1GN2A 1M57C 2A0LA 2XAHA 5B3SC 1SQQH 3N2GA 3EVKA 1YS3A 1ZX3A 1Q90D 1KU9A 1UYDA 2FKXA 1R6TA 1XNQB 5B66Z 2QKSA 2AZ2A 2YEJA 4PV1B 4B3MO 1WB7A 2ZDXA 1UYGA 3ABTA 3FKSG 1I08A 1H2SB 1NH2D 4V25A 2B9ZA 4LF5B 4FIPC 3OR6C 5AG2A 3LSUA 1GM7A 4NH8A 1ROPA 4JI4O 3OR7C 2RJZA 3HZ5A 2EILC 2MK3A 2ESAA 4YJ2A 2YEVA 1THNA 1OCZB 2GFDA 3AG1B 3OMUA 2ZXWB 1HP8A 2QE7G 3P3NA 1XNRB 1MSWD 3HHUA 1XI1A 2H8MA 5TISZ 5GTIZ 2UU9O 2WI1A 4DR3B 3CRAA 4X65B 2BSMA 2XNDG 2WSSG 2WA4A 4H13B 3HEKA 3A8TA 2XDKA 3QO8A 2JEUA 4B3TO 2RQ6A 1QYEA 4X8AA 2YGFA 4OGQB 1SESA 3WG7C 5GTHZ 2ZNIA 2QM7A 3N2KA 1Z2GA 3E2EA 2DYSC 4JYBA 2WLJA 3E8GA 5CTWA 4HNAB 2VWKA 4LFCB 5IJ0B 3ZXOA 2IJKA 1VQPV 4QNHB 1JM6A 2LGWA 4LNUB 4MVRA 4JI0B 2GTAA 2CTRA 1QVGU 3E89A 4LFBO 5B1BB 2E75B 2OIGA 2RNBA 4HY6A 4FLUA 4IIJA 2Q0AA 2ZE8A 1IXMA 2Q7HA 3K0DA 1XMOO 1N36B 4JI7O 2P22C 3ABUA 1YJ9V 1MG1A 1QCEA 1XUQA 4BIZA 1B63A 4YKZA 5IDMA 2QFOA 3CCRV 2YEBA 1BMFG 4XDJA 3JARA 5EZYB 3MHSC 1K92A 3E83A 4WUBA 1UYCA 3JASA 3RYHB 1HNXO 4O4HA 1JFFB 1US6A 4XDKA 3JAWA 3ABKC 4EMVA 4EFUA 1R3JC 5EBMC 5J71A 4CH4A 3ZMSA 4H44B 1YT0A 1H7SA 4HBNA 4DV0O 3AK1A 4K8ZA 2QWQB 1Y8NA 5LBQA 1U2OA 1YDXA 3H01A 4GT1A 3O9OA 2XASA 4BIUA 4UV8A 5D7CA 5B1AC 1H38A 1AILA 4CH5A 2UUAO 4EFBA 4GKKB 1EN4A 3L71H 4D6TH 5J2TA 5CBFA 2IU0A 3SPCA 3TGUH 1WNSA 1G4YB 3FAVA 1VQ4V 1UYKA 4GX5A 5LGUA 3K3WA 1A4HA 1UY7A 1PVGA 2LGQA 3QVNA 3AK3A 1UFIA 3STLC 1WA8B 1MABG 3ZXQA 2BTQB 4ZHQB 3N2KB 3E22A 5KLVH 3G6EV 4CE1A 4JAUA 5EC1C 2IJIA 1VQ5V 1EFRG 2YE4A 5IE9A 4DV4O 2YI8A 4R7CA 1I94B 1BQZA 1H7UA 3GWKC 2YE2A 4JZGA 1ZWIC 4XTJA 2ATKC 4FFKA 1S16A 3L74H 1EI1A 5EIBD 5JCOC 5FNVA 5BZBA 2DJVA 4IIJB 1YCIA 4I4TA 4DUZB 1VQNV 3B2EE 3L75H 1YTFB 5IYZB 3KCYA 2X6AA 3DXRA 2HP8A 2GV9A 4DR6O 4G27B 3BABA 5C8YA 4NH7A 2GHYA 3RYIB 1KMIZ 4O05A 3C3TA 3W7WA 1HR0B 4CE2A 1FFTB 1YESA 4RQFA 1XBLA 1DF4A 3JASB 1NS1A 2HFEC 4CC6A 1Y8PA 1WLEA 4O4HB 3ZHRA 1AROP 3JSLA 2YEAA 2IJHA 3CP1A 1XL6A 3MAQA 1VQMV 1M90W 4K0KO 4TOIA 2FL4A 4U7OA 5EBLC 4DV7O 3FB7C 2Q68A 3PN1A 4X64O 2F1MA 1N4CA 1AR5A 2H3OA 3ABLB 3AG1C 4TWKA 4FM2A 1Y4UA 4MVMA 4FLXA 3RLQA 1S14A 1KIJA 4BIOA 4DV3B 4CWPA 1N0NA 4ASFA 2KKWA 2EIMB 3AK2A 3P32A 5LA6A 3T10A 3ETGA 1I5BA 2YE5A 3CCQV 1YI2V 2CH4A 3H9VA 5CB4A 4J9YB 1YT1A 4LWHA 2YKJA 4MVOA 1KC8W 4MS2A 3T2MA 2XD6A 5CF0A 2O1WA 4IGGA 4DR2B 4LF6O 1NZ6A 1BZKA 4CWNA 1M56B 2VRZA 5KUMA 2GUZA 1GH6A 3BMYA 3CRMA 3K5MA 2BU8A 3A0RA 2QR4A 1YJNV 3GIGB 1OJHA 5LP6A 4X62O 4B3SO 2DW4A 5L3CA 5JH7A 1TILA 5EC2C 2Q8GA 5L3FA 3G75A 3ZMTA 1VF7A 3VADA 1NHJA 4X20A 4WFFA 5IDJA 5BR8O 2VQEB 5LMUO 4O4JB 4JI8B 4JPRA 2VQFO 1NI8A 3FD9A 1QLEC 3U2KA 4DV6B 4JI1O 2IWXA 1VARA 2YSUB 2UXCB 4RUEA 1PV0A 4IL6Z 3DXRB 3Q4HA 3MD0A 1SQPH 2WPDG 3M99B 4DV2B 1QBZA 4KHPB 3ABMC 1KQSU 1TIDA 2UUBB 4GUNA 4YKXA 1YT2A 1NBMG 3K06A 1RPOA 3TZ4A 1SZTA 4MP2A 4HY1A 4UCUA 4UCVA 3TTZA 3RGBA 2XDUA 4PU9A 5CTYA 2QDOA 3CB2A 3CSXA 5JVDA 1QVFU 2XX2A 2Z3YA 4JTAB 4EKWA 4DR1O 2YEGA 2IM9A 3A0YA 4LWFA 1L8DA 4TV8B 3BCCH 2XDSA 4LF8O 4YIOA 3D36A 2WLMA 2ITDC 2DOSA 1Y74B 3SPIA 1VP7A 4MTFA 5KUKA 4YHHO 2WLKA 2YE7A 1TAEA 3JD0A 3CCUV 2BTZA 2FYPA 4FFBA 2QM8A 1VF5B 4FJCC 4C7UA 1TUEB 3H1IH 2N05A 1SQFA 2HG1A 1X4TA 5GGZA 2WLLA 2ZE6A 1B06A 2GQPA 3FFQA 3P30A 3CC4V 1R1BA 4DR7O 4JV5O 2JRIA 4LH6A 3SYCA 2VCJA 1HNZB 1B62A 2GSMB 1YERA 1PP9H 2GUZB 3FV5A 1LUVA 1KKCA 4DRXB 4MW3A 5DN6G 4DZYA 2YDEA 2PTMA 4XCLA 3DSQA 3ZHQA 4EEHA 4PHZA 2WEPA 5M4PA 1RM1C 4U3JA 1KD1W 2KQXA 1BGYH 2WI2A 3BAAA 1JCHA 3C90A 1F4NA 1BHBA 3RWRD 1B3QA 1OCCB 4B7PA 4Q20A 2WLIA 4QE9A 4RUFA 4TV9B 2ILMA 1EZVH 1U97A 2JGDA 2EILB 4LF7B 1QR9A 4XIPA 2WEQA 4MW8A 3VQWA 1OCRC 2LO1A 4UVAA 4F6RB 4E4EA 1DLBA 5EIBC 4LFAO 4CWOA 1Q6HA 2YS8A 1KZNA 4X65O 3CC7V 1R6NA 2LFSA
chains in the Genus database with same CATH topology
3A0XA 3QDDA 4LWEA 1OCOB 1JOYA 1Q82W 1L1FA 1QY8A 4O04A 4YKWA 1UYMA 1R6KA 3ABLC 4MTOA 1F4MA 3EHGA 2DYSB 3K0GA 2EIMC 4KFMA 1NVPD 5KA6A 5D7DA 3TETA 3ASNB 3R92A 1NVPB 3G7BA 1K33A 1HWYA 1S0VA 4WUDA 2CGFA 3E86A 3FB6C 2OT5A 3MNRP 3ZMVA 2EINB 2YGEA 3OAAG 3ZMZA 1R73A 1G8MA 3H80A 4WFEA 1N8RW 2W0FC 1TC6A 1H2GA 2Q8HA 4MVZA 1VQ9V 3ABKB 3AG4B 2C2AA 3ZJZA 2DQ3A 1GTOA 2P6JA 3IEDA 3JD4A 2A79B 1ID0A 4YXWG 4NH9A 3R4NA 3QTFA 2Y69C 4GX0A 3RLPA 5FNCA 2BU6A 3ETEA 1US7A 3AG2B 1PNLA 3K04A 4DUHA 5HFMA 1I59A 4AWQA 1FXHA 3BEHA 4PDMA 1VQLV 2W6IG 2AKPA 3K60A 4QIWF 3D2RA 2YE9A 4GGLA 3GIEA 4Z1MG 2XHRA 2YI0A 4PA7A 2Q8FA 2YKIA 2QA4V 4MP7A 4MBCA 1JVMA 5E1AC 4F4LA 3NMQA 4L90A 1R3LC 2DWEC 4J9ZB 2JJ2G 3WFVA 3ZRSA 1YC4A 1YHQV 2JDIG 4O0BA 3OMIB 4MPEA 4KUMA 1OCCC 2ZR2A 3KE6A 3SYAA 1FXVA 1NH2B 3TK1A 5CBGA 4PA4A 1K4CC 1GO3F 1YITV 1Q7YW 4LWIA 3EFFK 1E1QG 3U67A 2EZPA 2YEDA 1OCOC 4H33A 3HZ1A 3K98A 3OEEG 4L87A 4FCPA 1LNQA 3DTUB 2BREA 3OW6A 2IORA 3LDDA 3JCZA 4XIQA 1SETA 3B27A 4PRVA 3VHAA 3OEHG 3Q5LA 1R3IC 3ASNC 3C0EA 3Q5KA 2YK2A 3R65A 3CCEV 1KP2A 4K4OA 1QLEB 3TZ2A 3LDCA 2XJXA 2YKCA 1EBOA 5L3DA 1I58A 5LHGA 1JPXA 2EINC 3EHJA 3ABMB 3CXCU 2P90A 3VBBA 5LHHA 2WAMA 2BU7A 3B8MA 2A9HA 5IYCO 4FMTA 3F5WC 3AG4C 4XCJA 4QPJA 4PA9A 3O0IA 1QLNA 4HYOA 3OUFA 5BODA 5CTXA 2YEVB 4P2ZA 1AM1A 4QE7A 4CWFA 2Q69A 4R3AA 3SL2A 1K8AW 4R6ZA 5FNDA 1KP3A 1YJWV 4OXSA 3RVZA 1CPYA 4EM7A 3AG2C 5CN0A 2NLJC 1DF5A 3R4PA 4FPPA 3RW0A 4V26A 4XDMA 2BYHA 4YKUA 1Z5CA 2FWYA 1K73W 1VQ7V 4HYMA 2FXSA 1BL8A 1RM1B 4XITA 3T0ZA 5IYBO 5M4MA 3ZN0A 4QPKA 1L0OA 1AI4A 4EFTA 1UYFA 4HXZA 3CC2V 1OCRB 2YJWA 1BKNA 2HVKC 4DO2A 1Z5BA 4MB9A 3U2DA 4AWOA 3G71V 2CG9A 1JJ2U 2YI6A 2XX5A 2F43G 3I56V 3CCVV 1Y4SA 4I9WA 1AMWA 4N23A 4ASAA 2OTLV 4LCUC 4G2KA 2JEXA 2ZKJA 4U93A 2XAQA 3W7TA 4MTXA 4R3MA 1SRYA 3ASOB 4UUJC 3FYIB 2IJJA 1AJQA 3EKRA 1AJ6A 1GM8A 2XX4A 3B24A 3STZC 3ZM7A 2YEFA 2WLNA 5D6PA 4H7QA 4BAEA 4CWQA 1M1KW 2IWSA 1Q86W 2OTJV 5FL7G 2YKEA 1H8EG 4PDRA 4P7AA 3GIFA 5CTUA 3OM3B 1GJVA 3CCJV 4L8ZA 3PEHA 1K34A 3JZ3A 3FB8C 2NNUA 3K03A 2Y48A 3OE7G 5L3EA 4BAYA 4N21A 1GMGA 3A0ZA 3G4SV 3B8NA 2Y69B 2QG0A 2YI7A 4JYCA 1V54C 1K5SA 3T1KA 1I5CA 1Y8OA 1Q81W 4CZZA 1CEZA 1ORQC 2O1VA 3H4LA 3INXA 3OMNB 2EZOA 2VW5A 4HXWA 4UROA 1Z5AA 3MHHC 1JX9A 4MPNA 2JJ1G 1UYHA 2Q2EB 1FXKA 1W0JG 2CCUA 2X6BA 5F3KA 4PELA 2OCCC 3ZCCA 3ZN1A 1WPXA 4U7NA 5L3BA 3TCUA 4ZVIA 2WERA 2XJGA 1ZWHA 2KB1A 4BXIA 2Q6AA 3AG3C 1TH8A 3EHBB 2K1EA 2O1UA 5H6QA 3OUSA 1UYIA 1VQOV 1GKFA 4L91A 4BW5A 3LSQA 4YKYA 3CMAV 2Z5UA 5GW7A 3RVYA 1BHAA 3D3IA 3TZ5A 1F23A 1P4RA 3LUTB 3IGAC 2YGAA 4JF3A 5FNFA 2VCIA 5B1NA 2UXNA 3O2FA 3ASOC 2LP7A 4ASUG 4XIRA 3JD2A 2HKOA 1FXKB 1F51A 2B1IA 1M9NA 1VQ8V 2WLLB 4E02A 3SYPA 3UM7A 1NJIW 1E79G 2ZDYA 1BXDA 3FT8A 4I3HA 4LPBA 1S3JA 2QF6A 1COWG 2UXXA 1P7BA 4AS9A 3JD1A 1KKDA 5D6QA 1S72V 3LNUA 3CRLA 3WHAA 3SPJA 4TT3G 1QZRA 1MX0A 2EXLA 2DYRB 2WLIB 3ZMUA 3FT5A 3X2QC 2YK9A 1R3KC 3B25A 4HZ5A 4LP0A 5LHIA 2H8PC 1I5AA 1UJWB 3T2SA 4KTNA 4XDLA 2HG5C 4I5SA 3O6OA 3K08A 4HYPA 3JD3A 3JYCA 2BU5A 4WCEV 3D0BA 3CGZA 3F7YC 2XDLA 3SPGA 3CYOA 4DXWA 2XK2A 1PNMA 1B6QA 2LFRA 4PL9A 4L94A 2Q8IA 5IN9A 4PDLA 3A0TA 5M4KA 3K97A 2FWZA 3W7SA 3LSSA 1AJPA 2IH3C 2JIZG 5C93A 2YEEA 4WFBV 4O09A 1THZA 2HR3A 5HFLA 1W0KG 1JQ0A 2ZDIA 3GWOA 4JTDB 3LPSA 3C11A 2QEXV 3ZKBA 2M7WA 2X0LA 2WI3A 2DQ0A 2JK5C 2XJJA 2HVJC 3ML0A 2BOCC 1CP9A 3R91A 4P8OA 5M4EA 5L3GA 5EK0A 2R9RB 2HLDG 4MOTA 2IOPA 2CK3G 4LP8A 2WLHA 1H8HG 4CBCA 4GX2A 4MPCA 1AJNA 2CCSA 3SYQA 1BYQA 4EGHA 2XABA 4LWGA 3E8FA 4G28B 4P9PA 1K97A 4E2LA 2K5BA 1MOFA 1Y66A 1UY8A 1YSCA 3OWBA 3E8BA 4FCQA 4PA3A 3PJSK 2XOKG 1FXKC 1S76D 4PDVA 1UY9A 1VQ6V 2JKIA 2YE8A 2XHTA 2B1GA 2EIKC 1AR1B 2Q67A 4ASGA 3K79A 3OW2U 2ITCC 1GKZA 1YC3A 1DTOA 2UWDA 4PRXA 4XBFA 1V54B 1S5HC 4O07A 5LGTA 2DYRC 1K3EA 3VOUA 2IW5A 1PNKA 2IOQA 4E00A 1GK9A 4CWSA 3FYEB 4GT8A 3E35A 4R50A 4URMA 1AI5A 3QO5A 3PEJA 4H81A 4L93A 2EIJB 3EHFA 3CPWU 2IH1C 2XCMA 2WI4A 3TZ0A 1AI6A 4GFNA 2YE6A 2OCCB 3T0HA 2V1DA 5KA5A 1PD3A 1OSFA 4B6CA 3GIGA 3AG3B 5F5RA 2BOBC 2XAFA 3BY6A 2IU3A 3ZRVA 1EZJA 3OMAB 4QJFB 1V55B 4MVQA 1I5XA 4XKAA 3KG2A 1FS0G 1YTFD 2YI5A 4KSGA 5CPHA 1YSRA 4JAVA 3ZIAG 1U0ZA 3CCSV 4H37A 4KP4A 5J6AA 1ZXMA 4MT8A 2R9IA 2XAGA 3TUHA 2ZBKB 3CGYA 1UYEA 2ZQMA 3VHCA 3LDEA 5DM6V 1UYLA 4YKQA 3OPDA 3AEIA 2HCHA 1OCZC 4TSFG 5M4NA 1TBWA 4XKOA 2ZXWC 1YC1A 3B77A 4HZ3A 1VQKV 5BOCA 2CCTA 5M4HA 2HKJA 2PI4A 2YEHA 3OFNG 3I55V 3CCLV 4X88A 3A0WA 2DWDC 1Z59A 1K4DC 3X2QB 4P9OA 3QNEA 1I5YA 4GX1A 4WFHA 5IY5B 1TC0A 4GEEA 1NR1A 1RPRA 2BRCA 2ZDIC 1R62A 4KFGA 5B1BC 2BYIA 4YKRA 2QG2A 1GM9A 2ZD9A 4R8CA 2P7TC 4WFAV 5H9CA 3HYYA 4XE2A 4FCRA 3EHHA 3CWVA 1I5DA 3LNMB 2H94A 4X89A 3QO7A 2HJFC 3T1CA 4LBEC 2XAJA 3INWA 3VHDA 1PL0A 2P67A 2X7RB 3ZRWA 4LC1A 1AH8A 4EGIA 1KECA 4WF9V 2YKBA 3WQ9A 3FB5C 4JGSA 2X6CA 4YKTA 3K9AA 2EBOA 3RLRA 3T4ZA 4CWTA 4XKKA 4WFGA 2PNRA 1AH6A 3G7EA 2EIJC 3SYOA 3CRKA 1J95A 3RKZA 4PA6A 1K7DA 3OGCC 1NR7A 4HAMA 4RO2A 4H85A 3GB7C 2JJCA 4UVCA 4RAIA 2YJXA 3HYZA 4BQGA 1M57B 3IFXA 5CMUA 3W7XA 5B3SB 5IYDO 1XL4A 1ZW9A 4URNA 4X9LA 1V55C 1W2BU 4MSWC 1AI7A 2E0AA 3BM9A 4KSHA 1NKDA 5EBWC 1YSZA 3OWDA 3EKOA 2YEIA 4CE3A 3F7VC 5D7RA 3B26A 2BU2A 4RQEA 4MVSA 1S77D 5L3JA 1YETA 3CMEV 2B5UA 5J9PC 3B28A 2ZR3A 3DGEA 2BT0A 4MTGA 3ZRWB 4AWPA 2WWWA 1K9MW 3ETDA 1SERA 3WG7B 2YE3A 2YECA 4W7TA 3CCMV 4P30A 4UV9A 2EIKB 1Y4MA 2FTKA 1MU5A 2IWUA 1NQTA 3Q5JA 2D3OW 1M56C 1NHIA 4UXNA 1EA6A 3HPLC 4BQJA 4EGKA 3W7UA 4R1FA 3ZKDA 3NXSA 1PKXA 1UY6A 1OZ0A 5IY5C 3CD6V 2BZ5A 2H55A 3K99A 5CBHA 3SJQC 4JASA 4ZBMA 2WI7A 3E8HA 4URLA 4FK5C 4HZ0A 2EJRA 2V7QG 3T4DA 2AHZA 5B1OA 5B1AB 4JQLA 3HB3B 3R4OA 4GCZA 1QR8A 4XC0A 3IC7A 1ENVA 4XD8A 2XHXA 2WI5A 3UKMA 4KQVA 2AHYA 1YIJV 4ASBA 1NHHA 2W6JG 4ZKIA 1GKXA 1ZXNA 3R4MA 2QTOA 5FWKA 4E01A 3SPHA 5CA3A 4UVBA 3RBZA 4JTCB 2PI5A 1BGQA 4GQTA 1E1RG 4WUCA 1OHHG 3ZRXA 5LGNA 4CWRA 1K5QA 2WI6A 5H6RA 2XDXA 4MVUA 2VWCA 1M57C 2A0LA 2XAHA 5B3SC 1YS3A 1UYDA 2QKSA 2YEJA 2ZDXA 1UYGA 3ABTA 3FKSG 1NH2D 4V25A 4FIPC 3OR6C 1GM7A 4NH8A 1ROPA 3OR7C 3HZ5A 2EILC 2MK3A 2ESAA 2YEVA 1THNA 1OCZB 2GFDA 3AG1B 3OMUA 2ZXWB 2QE7G 1MSWD 3HHUA 2H8MA 2WI1A 2BSMA 2XNDG 2WSSG 3HEKA 2XDKA 3QO8A 2JEUA 1QYEA 4X8AA 2YGFA 1SESA 3WG7C 2QM7A 3E2EA 2DYSC 4JYBA 2WLJA 3E8GA 5CTWA 3ZXOA 2IJKA 1VQPV 4QNHB 1JM6A 4MVRA 1QVGU 3E89A 5B1BB 4HY6A 1IXMA 3K0DA 3ABUA 1YJ9V 1MG1A 1QCEA 1B63A 4BIZA 4YKZA 5IDMA 2QFOA 3CCRV 2YEBA 1BMFG 4XDJA 3MHSC 1K92A 3E83A 4WUBA 1UYCA 4XDKA 3ABKC 4EMVA 4EFUA 1R3JC 5EBMC 5J71A 3ZMSA 1YT0A 1H7SA 1Y8NA 5LBQA 1U2OA 3H01A 4GT1A 2XASA 4BIUA 4UV8A 5D7CA 5B1AC 1H38A 5CBFA 2IU0A 3SPCA 1G4YB 1VQ4V 1UYKA 4GX5A 5LGUA 3K3WA 1A4HA 1UY7A 1PVGA 3STLC 1MABG 3ZXQA 3G6EV 4CE1A 4JAUA 5EC1C 2IJIA 1VQ5V 1EFRG 2YE4A 4R7CA 1H7UA 2YE2A 1ZWIC 4XTJA 2ATKC 1S16A 1EI1A 5BZBA 1VQNV 1YTFB 2X6AA 4G27B 4NH7A 2GHYA 4O05A 3W7WA 4CE2A 1FFTB 1YESA 4RQFA 1DF4A 2HFEC 1Y8PA 1WLEA 1AROP 2YEAA 2IJHA 3CP1A 1XL6A 1VQMV 1M90W 4U7OA 5EBLC 3FB7C 2Q68A 3AG1C 4TWKA 3ABLB 1Y4UA 4MVMA 3RLQA 1S14A 1KIJA 4CWPA 4ASFA 2EIMB 3P32A 3T10A 3ETGA 1I5BA 2YE5A 3CCQV 1YI2V 2CH4A 4J9YB 1YT1A 4LWHA 2YKJA 4MVOA 1KC8W 4MS2A 3T2MA 2XD6A 5CF0A 2O1WA 4CWNA 1M56B 5KUMA 3BMYA 2BU8A 3A0RA 1YJNV 3GIGB 2DW4A 5L3CA 1TILA 5EC2C 2Q8GA 5L3FA 3G75A 3ZMTA 3VADA 1NHJA 4WFFA 5IDJA 4JPRA 1QLEC 3U2KA 2IWXA 2YSUB 4RUEA 3MD0A 2WPDG 3M99B 1QBZA 1TIDA 3ABMC 1KQSU 4YKXA 1YT2A 1NBMG 3K06A 1RPOA 3TZ4A 1SZTA 4MP2A 4HY1A 3TTZA 2XDUA 4PU9A 5CTYA 1QVFU 2XX2A 2Z3YA 4JTAB 4EKWA 2YEGA 3A0YA 4LWFA 2XDSA 3D36A 2WLMA 2ITDC 3SPIA 4MTFA 5KUKA 2WLKA 2YE7A 3JD0A 3CCUV 2BTZA 2FYPA 2QM8A 4FJCC 1TUEB 2HG1A 5GGZA 2WLLA 2GQPA 3P30A 3CC4V 3SYCA 2VCJA 1B62A 2GSMB 1YERA 3FV5A 4MW3A 5DN6G 4DZYA 4XCLA 4EEHA 2WEPA 5M4PA 1RM1C 1KD1W 2WI2A 1JCHA 1F4NA 1BHBA 1B3QA 1OCCB 4B7PA 4Q20A 2WLIA 4QE9A 4RUFA 2EILB 1QR9A 4XIPA 2WEQA 4MW8A 1OCRC 4UVAA 1DLBA 4CWOA 1KZNA 3CC7V 1R6NA 2LFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CWQ A;  4WUC A;  3ZRX A;  2IWS A;  2YKE A;  3A0X A;  4CWR A;  2IOQ A;  2WI6 A;  3QDD A;  4LWE A;  4E00 A;  4P7A A;  3GIF A;  5CTU A;  1GJV A;  2XDX A;  4CWS A;  2VWC A;  4L8Z A;  1JOY A;  3PEH A;  4GT8 A;  1QY8 A;  4O04 A;  4URM A;  3JZ3 A;  4YKW A;  1UYM A;  3PEJ A;  4H81 A;  4L93 A;  1YS3 A;  3EHG A;  3EHF A;  1UYD A;  2XCM A;  2WI4 A;  3A0Z A;  2YEJ A;  2ZDX A;  1UYG A;  3TZ0 A;  5D7D A;  2QG0 A;  4V25 A;  2YI7 A;  4GFN A;  2YE6 A;  4JYC A;  3R92 A;  3T0H A;  4NH8 A;  3G7B A;  3HZ5 A;  1OSF A;  2ESA A;  4B6C A;  3GIG A;  3T1K A;  1THN A;  2GFD A;  1I5C A;  1Y8O A;  4WUD A;  2CGF A;  5F5R A;  3OMU A;  3HHU A;  3ZRV A;  2O1V A;  3MNR P;  2H8M A;  2YGE A;  3H4L A;  3INX A;  2WI1 A;  4XKA A;  2BSM A;  3H80 A;  2VW5 A;  4HXW A;  1TC6 A;  2YI5 A;  4URO A;  3HEK A;  2Q8H A;  4KSG A;  2XDK A;  5CPH A;  1YSR A;  4JAV A;  1Z5A A;  4MPN A;  1QYE A;  2C2A A;  1UYH A;  2Q2E B;  2YGF A;  1U0Z A;  2QM7 A;  4KP4 A;  3IED A;  5J6A A;  1ID0 A;  1ZXM A;  4JYB A;  5CTW A;  4NH9 A;  4MT8 A;  3ZXO A;  3R4N A;  3TUH A;  2ZBK B;  2CCU A;  3CGY A;  3QTF A;  1UYE A;  1JM6 A;  3VHC A;  5F3K A;  3RLP A;  1UYL A;  4YKQ A;  5FNC A;  3ZCC A;  2BU6 A;  4HY6 A;  1US7 A;  4U7N A;  3OPD A;  4DUH A;  1IXM A;  2HCH A;  4ZVI A;  2WER A;  2XJG A;  1ZWH A;  5M4N A;  4BXI A;  1TBW A;  4XKO A;  1I59 A;  4YKZ A;  1B63 A;  4BIZ A;  5IDM A;  1TH8 A;  2QFO A;  2YEB A;  4AWQ A;  1YC1 A;  2O1U A;  1UYI A;  4WUB A;  1UYC A;  4L91 A;  5BOC A;  2AKP A;  3K60 A;  4YKY A;  3D2R A;  2CCT A;  2YE9 A;  4GGL A;  3GIE A;  5M4H A;  2XHR A;  4EMV A;  4EFU A;  2HKJ A;  5J71 A;  2YEH A;  1YT0 A;  1H7S A;  2YI0 A;  2Q8F A;  2YKI A;  3TZ5 A;  1Y8N A;  1U2O A;  3A0W A;  4MP7 A;  4GT1 A;  1Z59 A;  4BIU A;  4MBC A;  5D7C A;  2YGA A;  3NMQ A;  4L90 A;  5FNF A;  2VCI A;  1TC0 A;  1YC4 A;  4GEE A;  5B1N A;  2BRC A;  1R62 A;  4O0B A;  3O2F A;  4KFG A;  1UYK A;  4XIR A;  2BYI A;  4MPE A;  4YKR A;  2QG2 A;  1A4H A;  1UY7 A;  1PVG A;  3KE6 A;  1F51 A;  3HYY A;  4XE2 A;  4FCR A;  4E02 A;  3ZXQ A;  3TK1 A;  3EHH A;  3CWV A;  2ZDY A;  1BXD A;  1I5D A;  4CE1 A;  4JAU A;  3FT8 A;  4I3H A;  4LPB A;  2YE4 A;  4LWI A;  2QF6 A;  3INW A;  1H7U A;  3VHD A;  2P67 A;  3ZRW A;  4LC1 A;  2YE2 A;  1AH8 A;  3U67 A;  2YED A;  4EGI A;  4XTJ A;  4AS9 A;  2YKB A;  5D6Q A;  3LNU A;  3WQ9 A;  1S16 A;  4YKT A;  3CRL A;  1EI1 A;  3HZ1 A;  3K98 A;  3WHA A;  3RLR A;  4FCP A;  1QZR A;  1MX0 A;  4CWT A;  2EXL A;  4XKK A;  3FT5 A;  2BRE A;  2PNR A;  3OW6 A;  1AH6 A;  2IOR A;  2YK9 A;  3B25 A;  4HZ5 A;  3G7E A;  4NH7 A;  4XIQ A;  3CRK A;  3B27 A;  4O05 A;  4PRV A;  4LP0 A;  4CE2 A;  1I5A A;  3VHA A;  3RKZ A;  1YES A;  3T2S A;  3Q5L A;  4KTN A;  1Y8P A;  4I5S A;  3O6O A;  4HYP A;  4H85 A;  2YEA A;  2JJC A;  3C0E A;  2YJX A;  2BU5 A;  3HYZ A;  3Q5K A;  2YK2 A;  4U7O A;  3D0B A;  3CGZ A;  4K4O A;  4BQG A;  2XDL A;  3TZ2 A;  2XJX A;  2YKC A;  1Y4U A;  3RLQ A;  1S14 A;  1KIJ A;  1I58 A;  4CWP A;  4ASF A;  2XK2 A;  1ZW9 A;  3P32 A;  2LFR A;  4URN A;  4X9L A;  3EHJ A;  4PL9 A;  3T10 A;  4L94 A;  1I5B A;  2YE5 A;  2CH4 A;  2Q8I A;  5IN9 A;  1YT1 A;  4LWH A;  2YKJ A;  2BU7 A;  2E0A A;  3BM9 A;  3A0T A;  4KSH A;  2XD6 A;  5M4K A;  5CF0 A;  3K97 A;  2O1W A;  2FWZ A;  4FMT A;  4QPJ A;  4XCJ A;  1YSZ A;  3O0I A;  3OWD A;  3EKO A;  2YEI A;  4CWN A;  4CE3 A;  5D7R A;  3B26 A;  2BU2 A;  5C93 A;  2YEE A;  3BMY A;  4O09 A;  5BOD A;  5CTX A;  2BU8 A;  3A0R A;  3GIG B;  5L3J A;  1YET A;  1AM1 A;  4CWF A;  4R3A A;  3B28 A;  3SL2 A;  1TIL A;  5FND A;  2Q8G A;  3LPS A;  3C11 A;  3G75 A;  3DGE A;  2BT0 A;  3ZKB A;  3VAD A;  3ZRW B;  1NHJ A;  4AWP A;  2WWW A;  2WI3 A;  4EM7 A;  5IDJ A;  2XJJ A;  2YE3 A;  3R4P A;  2YEC A;  4FPP A;  3U2K A;  4W7T A;  2IWX A;  3R91 A;  4P8O A;  5M4E A;  4V26 A;  4XDM A;  2BYH A;  4YKU A;  3MD0 A;  1Z5C A;  2FWY A;  1TID A;  4MOT A;  2IOP A;  4YKX A;  4HYM A;  2FTK A;  1YT2 A;  1MU5 A;  2FXS A;  3TZ4 A;  4MP2 A;  4XIT A;  3T0Z A;  2IWU A;  4MPC A;  4HY1 A;  5M4M A;  2CCS A;  3TTZ A;  4QPK A;  1BYQ A;  3Q5J A;  1L0O A;  2XDU A;  4PU9 A;  5CTY A;  4EGH A;  1NHI A;  2XAB A;  4LWG A;  1EA6 A;  2XX2 A;  1UYF A;  4EFT A;  4BQJ A;  4EGK A;  4HXZ A;  2YEG A;  2K5B A;  3A0Y A;  4LWF A;  4R1F A;  3ZKD A;  3NXS A;  2XDS A;  2YJW A;  1UY6 A;  3D36 A;  1BKN A;  1UY8 A;  2YE7 A;  3OWB A;  1Z5B A;  4FCQ A;  2BTZ A;  2BZ5 A;  2FYP A;  2H55 A;  3K99 A;  2QM8 A;  4MB9 A;  4JAS A;  3U2D A;  4AWO A;  2CG9 A;  2YI6 A;  2HG1 A;  2XX5 A;  2WI7 A;  5GGZ A;  4URL A;  2GQP A;  4HZ0 A;  5B1O A;  2VCJ A;  4JQL A;  1B62 A;  1YER A;  1UY9 A;  3R4O A;  1Y4S A;  2JKI A;  2YE8 A;  2XHT A;  3FV5 A;  4GCZ A;  4DZY A;  1AMW A;  4XC0 A;  4ASA A;  4XCL A;  4EEH A;  4XD8 A;  2ZKJ A;  2WEP A;  2XHX A;  5M4P A;  4U93 A;  2WI5 A;  4MTX A;  4ASG A;  2WI2 A;  4R3M A;  4KQV A;  1GKZ A;  1YC3 A;  1B3Q A;  1NHH A;  2UWD A;  1GKX A;  4ZKI A;  4PRX A;  4ASB A;  4Q20 A;  3EKR A;  4B7P A;  1AJ6 A;  2XX4 A;  1ZXN A;  3B24 A;  3R4M A;  4XIP A;  5FWK A;  2WEQ A;  4O07 A;  4E01 A;  3ZM7 A;  4CWO A;  2YEF A;  1BGQ A;  5D6P A;  1KZN A;  4H7Q A;  4BAE A;  4GQT A;  2LFS A; 
#chains in the Genus database with same CATH topology
 3J80 N;  3S3W A;  3A0X A;  3CE2 A;  5JQG A;  3QDD A;  4LWE A;  1OCO B;  2A7W A;  2UXB O;  1JOY A;  1Q82 W;  2AGA A;  1L1F A;  1QY8 A;  1WAZ A;  4O04 A;  5JVD B;  4DK1 A;  3H1K H;  4YKW A;  1UYM A;  4NTY A;  4DV5 O;  1M4U A;  1R6K A;  3ABL C;  4LFC O;  4MTO A;  2BE3 A;  1F4M A;  4LF9 B;  1OV9 A;  3EHG A;  2DYS B;  1FFX A;  5BMV A;  2QKC A;  4JI0 O;  3K0G A;  2EIM C;  5H2F Z;  4KFM A;  2UUC B;  2N74 A;  3R66 A;  1NVP D;  1I0H A;  5KA6 A;  2Q5Z A;  5D7D A;  3TET A;  3ASN B;  3R92 A;  3BHP A;  5JCO A;  1NVP B;  2F4V B;  3G7B A;  2ZNJ A;  4YY3 B;  1K33 A;  3KZI Z;  2NN4 A;  1HWY A;  2ZE7 A;  1S0V A;  4WUD A;  2CGF A;  4AHC A;  4Z1V A;  5CA1 B;  2YUA A;  3E86 A;  3FB6 C;  2OT5 A;  5GON B;  3MNR P;  3ZMV A;  2EIN B;  3WB0 A;  2YGE A;  3OAA G;  4PJ0 Z;  4FLT A;  3ZMZ A;  3QF7 A;  1Q6U A;  4X1Y B;  4ICG A;  1R73 A;  1G8M A;  3H80 A;  3RFR A;  4WFE A;  4GKJ B;  1N8R W;  2W0F C;  3JSN A;  1TC6 A;  1H2G A;  2Q8H A;  4MVZ A;  2ODM A;  1VQ9 V;  3ABK B;  1D5N A;  3AG4 B;  2C2A A;  2YXH A;  4JYA O;  3ZJZ A;  2DQ3 A;  1GTO A;  4O2A B;  1ZAU A;  2P6J A;  5LYJ B;  2ZM6 B;  2FYU H;  2JGD B;  3T1H O;  3IED A;  4RWU A;  3JD4 A;  2A79 B;  1TVK A;  2WA3 A;  1SZX A;  1ID0 A;  4GKK O;  3D8C A;  4YXW G;  4NH9 A;  3R4N A;  1MNG A;  3QTF A;  1J5E O;  4JI3 B;  2Y69 C;  4X1K A;  4GX0 A;  3RLP A;  5JQG B;  5FNC A;  2BU6 A;  3ETE A;  1US7 A;  3AG2 B;  1PNL A;  2AXT Z;  3K04 A;  4DUH A;  4EB6 B;  1W59 A;  1I7F A;  3G6B A;  5HFM A;  1Q43 A;  1I59 A;  4NTW A;  4FM0 A;  2R9A A;  3QTC A;  4AWQ A;  4CH3 A;  1FXH A;  1NTM H;  4DR5 B;  2PF4 E;  3BEH A;  4W4L A;  1TUB A;  2EX3 A;  2R70 A;  2W6I G;  4PDM A;  1VQL V;  1FFX B;  1WP8 A;  1NT2 B;  1SQX H;  1EN5 A;  3JAK B;  1IBL B;  2CTW A;  2AKP A;  3K60 A;  4QIW F;  3TXQ A;  3D2R A;  2YE9 A;  4GGL A;  3GIE A;  4Z1M G;  2XHR A;  1WPB A;  4ZI7 A;  4W4K A;  2YI0 A;  4PA7 A;  2Q8F A;  2YKI A;  2QA4 V;  5KHH A;  4MP7 A;  1SQG A;  4UCS A;  4MBC A;  1JVM A;  3N27 A;  5E1A C;  4F4L A;  3NMQ A;  4L90 A;  1R3L C;  2DWE C;  3B09 A;  3H1L H;  4JI2 B;  4J9Z B;  5E79 Z;  5K1X A;  1QQC A;  2JJ2 G;  5LP6 C;  3WFV A;  1G1X B;  3ZRS A;  1YC4 A;  4X66 B;  1YHQ V;  4NXM B;  2JDI G;  4O0B A;  1N33 B;  3OMI B;  4MPE A;  3A0B Z;  4KUM A;  1XMQ O;  1OCC C;  1SKV A;  2ZR2 A;  1IXB A;  3KE6 A;  3SYA A;  2CTQ A;  4GLX A;  1FXV A;  5KAF Z;  2ADP A;  1NH2 B;  1XHX A;  5DED A;  3TK1 A;  2ZCE A;  5CBG A;  4PA4 A;  3OTO O;  1K4C C;  5KX5 A;  1GO3 F;  1YIT V;  1Q7Y W;  4ZOL A;  2BCC H;  4LWI A;  1DK1 A;  2GDS A;  3EFF K;  4O4I A;  1CXZ B;  4UB6 Z;  2DMX A;  1E1Q G;  4DR2 O;  4B7K A;  3U67 A;  2EZP A;  2YED A;  1FJG B;  1OCO C;  2KG7 B;  4H33 A;  1BT8 A;  3HZ1 A;  3UO3 A;  3K98 A;  3OEE G;  1H2L A;  2QM4 A;  4L87 A;  4FCP A;  5BY1 A;  5CA0 A;  1WB8 A;  1LNQ A;  3DTU B;  4FZ0 A;  2BRE A;  3OW6 A;  2IOR A;  5JWP A;  2QKA A;  3LDD A;  3JCZ A;  4XIQ A;  4I50 A;  1SET A;  3B27 A;  3CRQ A;  4PRV A;  1EN6 A;  3D36 C;  3VHA A;  1TUB B;  3OEH G;  3Q5L A;  3M8A A;  1DGS A;  1R3I C;  3ASN C;  2MW2 B;  4X9Q A;  3C0E A;  1YF2 A;  1N34 O;  3Q5K A;  2YK2 A;  3R65 A;  4UCR A;  2R72 A;  3CCE V;  1KP2 A;  3BA8 A;  4YIP A;  4K4O A;  1QLE B;  3TZ2 A;  3LDC A;  4DV2 O;  2XJX A;  4NXN O;  2YKC A;  1EBO A;  4KHP O;  5L3D A;  1L0L H;  1I58 A;  3JCU Z;  5LHG A;  1JPX A;  2EIN C;  3N2G B;  3EHJ A;  3ABM B;  2HHH B;  1H2M A;  2XT9 A;  5KHG A;  3CXC U;  4QGP A;  4F6E A;  4NVP A;  2P90 A;  3VBB A;  5LHH A;  1MZE A;  2WAM A;  1FPO A;  2BU7 A;  3B8M A;  2A9H A;  1XDC A;  5IYC O;  4FMT A;  3DC5 A;  3F5W C;  3AG4 C;  1ZUQ A;  4PA9 A;  4QPJ A;  3O0I A;  2QWO B;  4XCJ A;  4LR3 A;  2L35 A;  2KSD A;  1QLN A;  4HYO A;  3OUF A;  3HKD A;  5BOD A;  1RSO A;  5CTX A;  4YJ2 B;  2YEV B;  4P2Z A;  3SJA C;  3K5L A;  3CYG A;  1AM1 A;  4QE7 A;  4AQY O;  4CWF A;  2ZIN A;  1NTZ H;  2Q69 A;  5KX5 B;  1AVM A;  1ZSP A;  4R3A A;  3SL2 A;  1K8A W;  4R6Z A;  1HW7 A;  4ZOL B;  3UT5 A;  5FND A;  2E5L B;  4BW9 A;  2F66 C;  3T1Y B;  1KP3 A;  1YJW V;  4OXS A;  5IT9 N;  3RVZ A;  1CPY A;  4EM7 A;  3AG2 C;  2P5O A;  5CN0 A;  2NLJ C;  2LQT A;  1HNZ O;  2QJ1 A;  1XRE A;  1DF5 A;  3R4P A;  4FPP A;  5CA0 B;  4WBN A;  2ZIM A;  3RW0 A;  4V26 A;  4XDM A;  2BYH A;  4YKU A;  1Z5C A;  2FWY A;  2ZT9 B;  4I50 B;  1K73 W;  2YXL A;  1VQ7 V;  4HYM A;  2E76 B;  3CHX A;  2FXS A;  1BL8 A;  1RM1 B;  2YC0 A;  1BS3 A;  4XIT A;  3THO A;  2UXD B;  3T0Z A;  5IYB O;  1Y6X A;  5M4M A;  3ZN0 A;  4QPK A;  1L0O A;  3P3P A;  1AI4 A;  1IBK O;  4EFT A;  3SGI A;  1UYF A;  4HXZ A;  3CC2 V;  5IJ9 A;  1OCR B;  2YJW A;  4IYI A;  1BKN A;  2HVK C;  2RN9 A;  1Z5V A;  4DO2 A;  4J7Z A;  5IWA B;  3JAR B;  1Z5B A;  4MB9 A;  1P7G A;  3U2D A;  4J7K A;  4AWO A;  3G71 V;  2CG9 A;  1JJ2 U;  2YI6 A;  2F95 B;  2XX5 A;  3JAW B;  3U0Z A;  2F43 G;  5EYP A;  3I56 V;  2LJ2 A;  4CC5 A;  1VMG A;  3LMM A;  2CAZ C;  3CCV V;  2BSK A;  1Y4S A;  4LWS A;  2PY5 A;  4I9W A;  1AMW A;  4N23 A;  4ASA A;  2OTL V;  2QWR B;  4LCU C;  2O57 A;  4G2K A;  4A5U B;  2JEX A;  2ZKJ A;  4U93 A;  2XAQ A;  3W7T A;  1HNW O;  4MTX A;  4B3M B;  4R3M A;  1SRY A;  4DYL A;  3ASO B;  4UUJ C;  5J2T B;  3FYI B;  4B3R B;  2IJJ A;  2QWN B;  1Q6I A;  4GYC B;  4DR4 B;  1N32 B;  4TUY A;  1AJQ A;  1XEQ A;  4B7E A;  3EKR A;  3FAV B;  1AJ6 A;  4JI4 B;  3H1J H;  2IBZ H;  1GM8 A;  2XX4 A;  3B24 A;  4LF4 B;  4NB5 A;  5LOV A;  2YID A;  5LXT A;  3HKE A;  3STZ C;  4EEQ A;  3ZM7 A;  1JMK C;  2YEF A;  1URF A;  2WLN A;  5D6P A;  4H7Q A;  4OX9 O;  1IX9 A;  4BAE A;  4GKJ O;  4CWQ A;  1M1K W;  4DUY O;  3E22 B;  2IWS A;  1Q86 W;  4DV1 O;  5FL7 G;  2OTJ V;  2YKE A;  3ZHU A;  1H8E G;  4PDR A;  4P7A A;  3GIF A;  5CTU A;  3OM3 B;  4JI5 B;  1GJV A;  3CCJ V;  4L8Z A;  1PM9 A;  3PEH A;  4B3T B;  1L0N H;  1K34 A;  2P4K A;  3JZ3 A;  4O4L A;  5FNV B;  3FB8 C;  2NNU A;  3K03 A;  2Y48 A;  3OE7 G;  5IJ9 B;  4I4T B;  3ZHV A;  1LUW A;  5L3E A;  4BAY A;  2G38 A;  4N21 A;  4JI3 O;  3RYF A;  1GMG A;  3A0Z A;  5C8Y B;  3G4S V;  4CS4 A;  3B8N A;  2ETN A;  5A2Q N;  4JI6 O;  4FLW A;  3D3Q A;  2Y69 B;  2QG0 A;  2YI7 A;  4JYC A;  2XUM A;  3L70 H;  4LFB B;  2Q9L A;  5JJN B;  1V54 C;  1K5S A;  3T1K A;  4JI7 B;  1I5C A;  1Y8O A;  1Q81 W;  4CZZ A;  4DR5 O;  1CEZ A;  2QSA A;  1ORQ C;  1IBL O;  2O1V A;  3OT7 A;  4LWS B;  3H4L A;  3INX A;  3OMN B;  2EZO A;  3C3S A;  2HEP A;  3QG5 A;  4J10 A;  5LA6 B;  2VW5 A;  1HNX B;  4HXW A;  4URO A;  1Y76 A;  3UCS C;  1F7Y A;  5CB4 B;  1Z5A A;  3MHH C;  1JX9 A;  4MPN A;  2JJ1 G;  1UYH A;  2Q2E B;  1FXK A;  1W0J G;  5D5Q A;  4NKG B;  2RCV A;  4DV0 B;  3CS5 A;  1M5I A;  4DK0 A;  3ICX A;  1XNQ O;  3BA9 A;  1VIB A;  2UUA B;  2CCU A;  1U96 A;  5LP6 B;  4DW0 A;  2X6B A;  1KB9 F;  5F3K A;  4LF5 O;  4PEL A;  5JH7 B;  2OCC C;  4K8X A;  1O9H A;  2ZE5 A;  3ZCC A;  1XQ8 A;  1MMM A;  3ZN1 A;  1WPX A;  4U7N A;  5L3B A;  3TCU A;  1AR4 A;  4X20 B;  2NR5 A;  3CEI A;  2WER A;  2XJG A;  1ZWH A;  4ZVI A;  2KB1 A;  4BXI A;  2Q6A A;  3AG3 C;  4ABM A;  1XNR O;  1TH8 A;  3EHB B;  1M93 A;  2K1E A;  2O1U A;  2VWJ A;  5H6Q A;  3OUS A;  5ITZ A;  1UYI A;  2Y4T A;  2JS5 A;  1VQO V;  1GKF A;  3A0H Z;  3Q4H B;  4DR3 O;  4BW5 A;  4L91 A;  3KCX A;  3LSQ A;  2JVD A;  4FLZ A;  3CMA V;  4YKY A;  3WB2 A;  2Y4U A;  2PUS A;  2Z5U A;  5GW7 A;  2W0X A;  3B4S A;  3RVY A;  1BHA A;  3D3I A;  3TZ5 A;  1F23 A;  5JJE B;  1IDS A;  1P4R A;  2M6Y A;  3IGA C;  3LUT B;  2YGA A;  4DR6 B;  5BXZ A;  1BCC H;  2A06 H;  4JF3 A;  3O65 A;  4FLY A;  4Z2W A;  5FNF A;  2VCI A;  2CUG A;  2CTP A;  3S3X A;  4PI0 A;  2QGN A;  5B1N A;  3WB1 A;  2UXN A;  4TQD A;  3O2F A;  3ASO C;  2LP7 A;  2Q7G A;  4ASU G;  4XIR A;  1Y76 B;  2F93 B;  1D5A A;  5JJJ B;  4FFB B;  3JD2 A;  1N36 O;  4K0K B;  2HKO A;  5D5P A;  3U10 A;  1IUR A;  1FXK B;  2QTS A;  1YVW A;  4DV7 B;  1F51 A;  2HHI A;  2B1I A;  1M9N A;  4X64 B;  1VQ8 V;  2WLL B;  1KUQ A;  3SYP A;  4E02 A;  3JAL A;  4Q6G A;  3UM7 A;  2Y0I A;  1NJI W;  2ZKO A;  1E79 G;  3GVM A;  2ZDY A;  1BXD A;  2FML A;  4YJ3 A;  3FT8 A;  4I3H A;  4LPB A;  1S3J A;  4FVM A;  4X1I A;  2QF6 A;  1COW G;  1SS3 A;  2UXX A;  1FKA O;  1P7B A;  4AS9 A;  4I7Z B;  3JD1 A;  1KKD A;  5D6Q A;  4U3J B;  1S72 V;  3LNU A;  1NU1 H;  3L72 H;  1YXB A;  3CRL A;  3RT3 C;  3H1H H;  3WHA A;  4LF6 B;  2JS3 A;  3SPJ A;  4CS3 A;  4I0X A;  4TT3 G;  5FPR A;  1QZR A;  1MX0 A;  2EXL A;  2DYR B;  2WLI B;  3ZMU A;  3FT5 A;  3X2Q C;  2Q4P A;  2YK9 A;  1R3K C;  3B25 A;  4HZ5 A;  2AZ0 A;  1X59 A;  4X62 B;  4LP0 A;  5LHI A;  2D2C B;  2H8P C;  3T1Y O;  1I5A A;  1UJW B;  3T2S A;  4KTN A;  4XDL A;  2HG5 C;  4I5S A;  3O6O A;  3K08 A;  4HYP A;  3JD3 A;  3K5N A;  3BPZ A;  4TQF A;  3JYC A;  2BU5 A;  4WCE V;  5BR8 B;  3EXA A;  4JAA A;  5LMU B;  3D0B A;  4JZ2 A;  3CGZ A;  2VQF B;  4BWA A;  3F7Y C;  2XDL A;  4DW1 A;  1EM1 A;  1VF6 A;  4GZR B;  3RN4 A;  3SPG A;  3CYO A;  3SJC C;  4DXW A;  2XK2 A;  1PNM A;  1B6Q A;  3BVO A;  2LFR A;  4PL9 A;  1I94 O;  4L94 A;  2XHB A;  2Q8I A;  1IVS A;  5BMV B;  2GTS A;  5IN9 A;  2VS0 A;  4PDL A;  3A0T A;  5M4K A;  4B08 A;  1NTK H;  3K97 A;  2FWZ A;  3W7S A;  3LSS A;  1AJP A;  2IH3 C;  2JIZ G;  4PD4 F;  4DUZ O;  5C93 A;  4DR1 B;  2YEE A;  4WFB V;  4FLV A;  4O09 A;  5IJ0 A;  1THZ A;  3JAL B;  2Q7E A;  3TJT A;  4LF8 B;  2HR3 A;  1HR0 O;  1PPJ H;  5HFL A;  1W0K G;  3K59 A;  1H2N A;  1IBM B;  1JQ0 A;  2ZDI A;  3GWO A;  4JTD B;  3LPS A;  3C11 A;  2QEX V;  3ZKB A;  5K1P A;  1S5L Z;  2M7W A;  2X0L A;  2EJ7 A;  2PYJ A;  1WJZ A;  2WI3 A;  2DQ0 A;  2JK5 C;  3J7A U;  2XJJ A;  2HVJ C;  1GN6 A;  2Y0P A;  3ML0 A;  4DR7 B;  2BOC C;  1CP9 A;  4I0X B;  1MA1 A;  5EZY A;  4JV5 B;  3R91 A;  4P8O A;  5M4E A;  5L3G A;  1P84 F;  5EK0 A;  4DV3 O;  2JGU A;  2R9R B;  3RYH A;  3K5O A;  2HLD G;  4MOT A;  2IOP A;  1JFF A;  1TVK B;  4AI8 A;  2CH7 A;  2CK3 G;  4LP8 A;  2WLH A;  4B3R O;  1H8H G;  1QHT A;  4DR4 O;  4JYY A;  1N32 O;  3CXH F;  4IHJ A;  4CBC A;  4GX2 A;  5KHJ A;  1AJN A;  4MPC A;  2CCS A;  2N04 A;  3SYQ A;  1XHZ A;  1BYQ A;  2OYQ A;  4LF4 O;  4X1K B;  4EGH A;  2XAB A;  4LWG A;  3E8F A;  4G28 B;  4P9P A;  1K97 A;  5LMN B;  4E2L A;  2K5B A;  3IC9 A;  3APQ A;  3WU2 Z;  4O2B A;  1B04 A;  1MOF A;  4PI2 A;  5H5N A;  1Y66 A;  4LFA B;  1UY8 A;  1YSC A;  3CRR A;  3OWB A;  3E8B A;  4JI5 O;  4FCQ A;  5F2V O;  3U11 A;  4PA3 A;  3PJS K;  2VQE O;  3I5D A;  4JI8 O;  3M7M X;  2UXB B;  1WA8 A;  2YIA A;  2XOK G;  3BFR A;  2BTQ A;  4ZHQ A;  4ZI7 B;  4DV6 O;  1FXK C;  1S76 D;  4PDV A;  2UXC O;  1UY9 A;  4DV5 B;  1VQ6 V;  2JKI A;  2YE8 A;  2XHT A;  2B1G A;  2EIK C;  3OGI B;  2UUB O;  2EUL A;  1AR1 B;  1AP6 A;  2Q67 A;  2Q8V A;  2LW1 A;  1Q3E A;  1TA8 A;  4I55 A;  4ASG A;  3K79 A;  4CS2 A;  3OW2 U;  2ITC C;  1GKZ A;  3OTF A;  1YC3 A;  1DTO A;  2E3C A;  2UWD A;  4PRX A;  5IYZ A;  3OD4 A;  4H0L B;  4XBF A;  1V54 B;  2YIB A;  1S5H C;  4O07 A;  1ZLZ A;  3ZBH A;  3RYI A;  2DYR C;  5LGT A;  1K3E A;  5A9G A;  1RP3 B;  2P06 A;  3VOU A;  4LH7 A;  2IW5 A;  1PNK A;  2CH7 B;  2IOQ A;  4E00 A;  1GK9 A;  4IHJ B;  2PYL A;  4CWS A;  4O4I B;  3FYE B;  3UO2 A;  2Q0O C;  5DEC A;  1H2K A;  2F23 A;  4GT8 A;  4JYA B;  3E35 A;  4R50 A;  4URM A;  1AI5 A;  3QO5 A;  3T1H B;  3PEJ A;  4H81 A;  4L93 A;  2EIJ B;  3EHF A;  4O2B B;  3CPW U;  2IH1 C;  2XCM A;  2WI4 A;  2DE0 X;  1J5E B;  3TZ0 A;  1AI6 A;  1GN3 A;  4GFN A;  3ZED A;  2YE6 A;  2OCC B;  1RFY A;  3T0H A;  2V1D A;  5KA5 A;  1AB3 A;  1PD3 A;  1OSF A;  4LF7 O;  3HR0 A;  4B6C A;  1XIL A;  3GIG A;  5JEN A;  3AG3 B;  5F5R A;  2BOB C;  3K9S A;  2XAF A;  3BY6 A;  2IU3 A;  3ZRV A;  1EZJ A;  3OMA B;  4QJF B;  3ZS8 C;  3FX7 A;  1V55 B;  3CRC A;  4MVQ A;  1I5X A;  4XKA A;  3CJH A;  2RMK B;  3KG2 A;  1FS0 G;  4O4J A;  2LW7 A;  1YTF D;  2YI5 A;  4I55 B;  4KSG A;  2P4V A;  5CPH A;  3IJ4 A;  4JAV A;  1YSR A;  2YIB D;  3A2F A;  2CGN A;  3ZIA G;  3VQX A;  1ZTE A;  1U0Z A;  3CCS V;  4H37 A;  4KP4 A;  3DC6 A;  1SA0 A;  2QWP B;  1LR1 A;  4LF9 O;  5J6A A;  1ZXM A;  1JR9 A;  2CE4 A;  4UCO A;  4EFE A;  3HKD B;  4MT8 A;  5KHK A;  2R9I A;  1RSO B;  2XAG A;  3TUH A;  2UUC O;  2ZBK B;  3JAT A;  3CGY A;  1UYE A;  2ZQM A;  1G6U A;  4J41 A;  3VHC A;  1PL4 A;  2K9P A;  3UT5 B;  1QU7 A;  3ZX6 A;  3LDE A;  5DM6 V;  1UYL A;  4YKQ A;  3AG7 A;  1FYJ A;  2F4V O;  5KAI Z;  3OPD A;  3AEI A;  1Q8I A;  1WN7 A;  3F5T A;  4YY3 O;  1XMQ B;  4TV8 A;  3ZHT A;  2HCH A;  1OCZ C;  4TSF G;  5M4N A;  1TBW A;  4XKO A;  1Y74 A;  2ZXW C;  1V9P A;  1SC5 B;  2PZS A;  1YC1 A;  1VF6 C;  3B77 A;  4HZ3 A;  1D2D A;  3OTO B;  4WBN B;  2A3Q A;  4UB8 Z;  1VQK V;  5KHI A;  4CH6 A;  5BOC A;  1Z5W A;  1YZB A;  2UU9 B;  2CCT A;  3S5T A;  4IT5 A;  5M4H A;  2HKJ A;  2PI4 A;  3VQV A;  3RYC A;  2YEH A;  3OFN G;  2RDC A;  3I55 V;  3CCL V;  4X88 A;  2ZM6 O;  3A0W A;  4J7J A;  3G67 A;  2OWO A;  1GN4 A;  4DRX A;  2DWD C;  1Z59 A;  1SF9 A;  1K4D C;  3X2Q B;  2YXY A;  4P9O A;  5KMG A;  3QNE A;  1I5Y A;  4GX1 A;  4WFH A;  5IY5 B;  1TC0 A;  4GEE A;  1NR1 A;  1RPR A;  2BRC A;  4BR6 A;  2ZDI C;  2OCH A;  3CJH B;  1R62 A;  4KFG A;  4TV9 A;  5B1B C;  3K57 A;  4L8J A;  2BYI A;  4YKR A;  1WP7 A;  2QG2 A;  4AIL C;  2ZIO A;  1GM9 A;  1N34 B;  2ZD9 A;  1GRJ A;  4R8C A;  4F6R A;  2P7T C;  4WFA V;  5H9C A;  3HYY A;  4XE2 A;  1XMO B;  4FCR A;  3TXS A;  5EYP B;  1MSD A;  3EHH A;  3CWV A;  2Z0A A;  4NXN B;  1SA0 B;  1I5D A;  3LNM B;  2H94 A;  4J80 A;  3QO7 A;  4X89 A;  2HJF C;  4J42 A;  5FPO A;  2BSK B;  3T1C A;  4LBE C;  1P49 A;  2XAJ A;  2XTA A;  3HKB A;  3INW A;  3VHD A;  1PL0 A;  3JAT B;  2P67 A;  2X7R B;  3ZRW A;  4LC1 A;  1AH8 A;  4EGI A;  1KEC A;  4WF9 V;  2YKB A;  4UCT A;  3WQ9 A;  3FB5 C;  4JGS A;  2X6C A;  4YKT A;  2GBO A;  3K9A A;  2ADQ B;  2EBO A;  3RLR A;  4TUY B;  3T4Z A;  4D7S A;  4CWT A;  4XKK A;  4WFG A;  3SR2 C;  2PNR A;  1KBH A;  2YIC A;  1AH6 A;  5LOV B;  4JI2 O;  1IBM O;  3G7E A;  3J81 N;  2EIJ C;  3SYO A;  5LXT B;  2DN9 A;  3CRK A;  4AQY B;  1J95 A;  3APO A;  3HKE B;  3RKZ A;  4X66 O;  4NXM O;  4I9Q A;  4PA6 A;  1K7D A;  3OGC C;  1N33 O;  4UFZ A;  5B5E Z;  1NR7 A;  4HAM A;  4RO2 A;  4H85 A;  4U3F H;  3GB7 C;  2JJC A;  4UVC A;  4RAI A;  2YJX A;  2HJD A;  3HYZ A;  5CA1 A;  3RYC B;  4BQG A;  1M57 B;  5GON A;  3IFX A;  5CMU A;  4OPH A;  5B3S B;  3W7X A;  3ETQ A;  4D7T A;  2YI9 A;  1VEW A;  1HDJ A;  5IYD O;  1XL4 A;  4X1Y A;  4O4L B;  4NYK A;  1ZW9 A;  4URN A;  5KMG B;  4X9L A;  1V55 C;  3K58 A;  1W2B U;  3G80 A;  4MSW C;  4FM1 A;  4ZIB A;  3RYF B;  4DV4 B;  1AI7 A;  1FJG O;  2E0A A;  1JA8 A;  3BM9 A;  4KSH A;  1NKD A;  4O2A A;  1ZL8 A;  5LYJ A;  5EBW C;  5LMN O;  1YSZ A;  3OWD A;  3EKO A;  1IBK B;  2YEI A;  1SQV H;  4CE3 A;  2CGO A;  4OPA A;  3F7V C;  5D7R A;  3B26 A;  2BU2 A;  2Q73 A;  4RQE A;  4MVS A;  1S77 D;  4FZ1 A;  5L3J A;  4J11 A;  4K3A A;  1YET A;  3CME V;  5FLX N;  3JAM N;  1BSM A;  2B5U A;  5J9P C;  3B28 A;  4NTX A;  2ZR3 A;  1Q5O A;  1FD9 A;  2L6L A;  3LNN A;  3HKB B;  3DGE A;  2BT0 A;  1XOU A;  4MTG A;  3MDS A;  4K35 A;  3ZRW B;  4EB6 A;  4AWP A;  2WWW A;  1K9M W;  5J2U A;  3ETD A;  1SER A;  3VQY A;  3WG7 B;  2YE3 A;  1AP5 A;  1TGO A;  2YEC A;  3L73 H;  4W7T A;  3CCM V;  3JAK A;  1SQB H;  4P30 A;  4UV9 A;  2EIK B;  2HHH O;  3NR7 A;  3ZHS A;  1Y4M A;  2FTK A;  1MU5 A;  2C1G A;  3CWB H;  1HNW B;  2IWU A;  3HKC A;  1N0J A;  1KYO F;  1UPG A;  1NQT A;  4KL1 A;  3L9D A;  3Q5J A;  2D3O W;  3SDL A;  1BE3 H;  1M56 C;  1NHI A;  4UXN A;  1EA6 A;  3HPL C;  4BQJ A;  2ARH A;  3B40 A;  4EGK A;  3W7U A;  4R1F A;  3ZKD A;  3NXS A;  1PKX A;  5LL6 Y;  1UY6 A;  3KKY A;  3UQ8 A;  1YEW A;  1OZ0 A;  1QNM A;  2E5L O;  4OX9 B;  5IY5 C;  5ITZ B;  4B3S B;  4DUY B;  2CDY A;  3CD6 V;  2BZ5 A;  2H55 A;  1IZ3 A;  3K99 A;  5CBH A;  4DV1 B;  3SJQ C;  2AW9 A;  4JAS A;  2V4D A;  1S5J A;  1O9G A;  4ZBM A;  2C1I A;  2WI7 A;  3E8H A;  4URL A;  1ZL8 B;  4FK5 C;  4HZ0 A;  2EJR A;  2V7Q G;  4KXR A;  3T4D A;  2AHZ A;  5B1O A;  2E74 B;  5B1A B;  4JQL A;  3HB3 B;  3R4O A;  3IAY A;  4GCZ A;  1QR8 A;  4JI1 B;  4XC0 A;  1FAF A;  3IC7 A;  1ENV A;  4NR1 A;  3CX5 F;  4XD8 A;  2XHX A;  2KG7 A;  2WI5 A;  2UXD O;  3UKM A;  4JI6 B;  4KQV A;  2AHY A;  1YIJ V;  1GAX A;  1NHH A;  2W6J G;  1GKX A;  4ZKI A;  4ASB A;  4E72 A;  2PGG A;  1T5E A;  5J2U B;  1JJO A;  1ZXN A;  2OIE A;  3R4M A;  2QTO A;  5FWK A;  4E01 A;  3SPH A;  1A32 A;  5CA3 A;  4UVB A;  3RBZ A;  4JTC B;  4HNA A;  2FB5 A;  2BTO A;  2PI5 A;  3SJB C;  1BQ0 A;  1BGQ A;  4LNU A;  1E1R G;  5IWA O;  4GQT A;  4WUC A;  1OHH G;  3ZRX A;  4IYH A;  4YJ3 B;  5LGN A;  4CWR A;  1K5Q A;  2WI6 A;  4YHH B;  4X1I B;  5H6R A;  2XDX A;  4MVU A;  2VWC A;  1Y67 A;  3HKC B;  3BRC A;  1MZF A;  1GN2 A;  1M57 C;  2A0L A;  2XAH A;  5B3S C;  1SQQ H;  3N2G A;  3EVK A;  1YS3 A;  1ZX3 A;  1Q90 D;  1KU9 A;  1UYD A;  2FKX A;  1R6T A;  1XNQ B;  5B66 Z;  2QKS A;  2AZ2 A;  2YEJ A;  4PV1 B;  4B3M O;  1WB7 A;  2ZDX A;  1UYG A;  3ABT A;  3FKS G;  1I08 A;  1H2S B;  1NH2 D;  4V25 A;  2B9Z A;  4LF5 B;  4FIP C;  3OR6 C;  5AG2 A;  3LSU A;  1GM7 A;  4NH8 A;  1ROP A;  4JI4 O;  3OR7 C;  2RJZ A;  3HZ5 A;  2EIL C;  2MK3 A;  2ESA A;  4YJ2 A;  2YEV A;  1THN A;  1OCZ B;  2GFD A;  3AG1 B;  3OMU A;  2ZXW B;  1HP8 A;  2QE7 G;  3P3N A;  1XNR B;  1MSW D;  3HHU A;  1XI1 A;  2H8M A;  5TIS Z;  5GTI Z;  2UU9 O;  2WI1 A;  4DR3 B;  3CRA A;  4X65 B;  2BSM A;  2XND G;  2WSS G;  2WA4 A;  4H13 B;  3HEK A;  3A8T A;  2XDK A;  3QO8 A;  2JEU A;  4B3T O;  2RQ6 A;  1QYE A;  4X8A A;  2YGF A;  4OGQ B;  1SES A;  3WG7 C;  5GTH Z;  2ZNI A;  2QM7 A;  3N2K A;  1Z2G A;  3E2E A;  2DYS C;  4JYB A;  2WLJ A;  3E8G A;  5CTW A;  4HNA B;  2VWK A;  4LFC B;  5IJ0 B;  3ZXO A;  2IJK A;  1VQP V;  4QNH B;  1JM6 A;  2LGW A;  4LNU B;  4MVR A;  4JI0 B;  2GTA A;  2CTR A;  1QVG U;  3E89 A;  4LFB O;  5B1B B;  2E75 B;  2OIG A;  2RNB A;  4HY6 A;  4FLU A;  4IIJ A;  2Q0A A;  2ZE8 A;  1IXM A;  2Q7H A;  3K0D A;  1XMO O;  1N36 B;  4JI7 O;  2P22 C;  3ABU A;  1YJ9 V;  1MG1 A;  1QCE A;  1XUQ A;  4BIZ A;  1B63 A;  4YKZ A;  5IDM A;  2QFO A;  3CCR V;  2YEB A;  1BMF G;  4XDJ A;  3JAR A;  5EZY B;  3MHS C;  1K92 A;  3E83 A;  4WUB A;  1UYC A;  3JAS A;  3RYH B;  1HNX O;  4O4H A;  1JFF B;  1US6 A;  4XDK A;  3JAW A;  3ABK C;  4EMV A;  4EFU A;  1R3J C;  5EBM C;  5J71 A;  4CH4 A;  3ZMS A;  4H44 B;  1YT0 A;  1H7S A;  4HBN A;  4DV0 O;  3AK1 A;  4K8Z A;  2QWQ B;  1Y8N A;  5LBQ A;  1U2O A;  1YDX A;  3H01 A;  4GT1 A;  3O9O A;  2XAS A;  4BIU A;  4UV8 A;  5D7C A;  5B1A C;  1H38 A;  1AIL A;  4CH5 A;  2UUA O;  4EFB A;  4GKK B;  1EN4 A;  3L71 H;  4D6T H;  5J2T A;  5CBF A;  2IU0 A;  3SPC A;  3TGU H;  1WNS A;  1G4Y B;  3FAV A;  1VQ4 V;  1UYK A;  4GX5 A;  5LGU A;  3K3W A;  1A4H A;  1UY7 A;  1PVG A;  2LGQ A;  3QVN A;  3AK3 A;  1UFI A;  3STL C;  1WA8 B;  1MAB G;  3ZXQ A;  2BTQ B;  4ZHQ B;  3N2K B;  3E22 A;  5KLV H;  3G6E V;  4CE1 A;  4JAU A;  5EC1 C;  2IJI A;  1VQ5 V;  1EFR G;  2YE4 A;  5IE9 A;  4DV4 O;  2YI8 A;  4R7C A;  1I94 B;  1BQZ A;  1H7U A;  3GWK C;  2YE2 A;  4JZG A;  1ZWI C;  4XTJ A;  2ATK C;  4FFK A;  1S16 A;  3L74 H;  1EI1 A;  5EIB D;  5JCO C;  5FNV A;  5BZB A;  2DJV A;  4IIJ B;  1YCI A;  4I4T A;  4DUZ B;  1VQN V;  3B2E E;  3L75 H;  1YTF B;  5IYZ B;  3KCY A;  2X6A A;  3DXR A;  2HP8 A;  2GV9 A;  4DR6 O;  4G27 B;  3BAB A;  5C8Y A;  4NH7 A;  2GHY A;  3RYI B;  1KMI Z;  4O05 A;  3C3T A;  3W7W A;  1HR0 B;  4CE2 A;  1FFT B;  1YES A;  4RQF A;  1XBL A;  1DF4 A;  3JAS B;  1NS1 A;  2HFE C;  4CC6 A;  1Y8P A;  1WLE A;  4O4H B;  3ZHR A;  1ARO P;  3JSL A;  2YEA A;  2IJH A;  3CP1 A;  1XL6 A;  3MAQ A;  1VQM V;  1M90 W;  4K0K O;  4TOI A;  2FL4 A;  4U7O A;  5EBL C;  4DV7 O;  3FB7 C;  2Q68 A;  3PN1 A;  4X64 O;  2F1M A;  1N4C A;  1AR5 A;  2H3O A;  3ABL B;  3AG1 C;  4TWK A;  4FM2 A;  1Y4U A;  4MVM A;  4FLX A;  3RLQ A;  1S14 A;  1KIJ A;  4BIO A;  4DV3 B;  4CWP A;  1N0N A;  4ASF A;  2KKW A;  2EIM B;  3AK2 A;  3P32 A;  5LA6 A;  3T10 A;  3ETG A;  1I5B A;  2YE5 A;  3CCQ V;  1YI2 V;  2CH4 A;  3H9V A;  5CB4 A;  4J9Y B;  1YT1 A;  4LWH A;  2YKJ A;  4MVO A;  1KC8 W;  4MS2 A;  3T2M A;  2XD6 A;  5CF0 A;  2O1W A;  4IGG A;  4DR2 B;  4LF6 O;  1NZ6 A;  1BZK A;  4CWN A;  1M56 B;  2VRZ A;  5KUM A;  2GUZ A;  1GH6 A;  3BMY A;  3CRM A;  3K5M A;  2BU8 A;  3A0R A;  2QR4 A;  1YJN V;  3GIG B;  1OJH A;  5LP6 A;  4X62 O;  4B3S O;  2DW4 A;  5L3C A;  5JH7 A;  1TIL A;  5EC2 C;  2Q8G A;  5L3F A;  3G75 A;  3ZMT A;  1VF7 A;  3VAD A;  1NHJ A;  4X20 A;  4WFF A;  5IDJ A;  5BR8 O;  2VQE B;  5LMU O;  4O4J B;  4JI8 B;  4JPR A;  2VQF O;  1NI8 A;  3FD9 A;  1QLE C;  3U2K A;  4DV6 B;  4JI1 O;  2IWX A;  1VAR A;  2YSU B;  2UXC B;  4RUE A;  1PV0 A;  4IL6 Z;  3DXR B;  3Q4H A;  3MD0 A;  1SQP H;  2WPD G;  3M99 B;  4DV2 B;  1QBZ A;  4KHP B;  3ABM C;  1KQS U;  1TID A;  2UUB B;  4GUN A;  4YKX A;  1YT2 A;  1NBM G;  3K06 A;  1RPO A;  3TZ4 A;  1SZT A;  4MP2 A;  4HY1 A;  4UCU A;  4UCV A;  3TTZ A;  3RGB A;  2XDU A;  4PU9 A;  5CTY A;  2QDO A;  3CB2 A;  3CSX A;  5JVD A;  1QVF U;  2XX2 A;  2Z3Y A;  4JTA B;  4EKW A;  4DR1 O;  2YEG A;  2IM9 A;  3A0Y A;  4LWF A;  1L8D A;  4TV8 B;  3BCC H;  2XDS A;  4LF8 O;  4YIO A;  3D36 A;  2WLM A;  2ITD C;  2DOS A;  1Y74 B;  3SPI A;  1VP7 A;  4MTF A;  5KUK A;  4YHH O;  2WLK A;  2YE7 A;  1TAE A;  3JD0 A;  3CCU V;  2BTZ A;  2FYP A;  4FFB A;  2QM8 A;  1VF5 B;  4FJC C;  4C7U A;  1TUE B;  3H1I H;  2N05 A;  1SQF A;  2HG1 A;  1X4T A;  5GGZ A;  2WLL A;  2ZE6 A;  1B06 A;  2GQP A;  3FFQ A;  3P30 A;  3CC4 V;  1R1B A;  4DR7 O;  4JV5 O;  2JRI A;  4LH6 A;  3SYC A;  2VCJ A;  1HNZ B;  1B62 A;  2GSM B;  1YER A;  1PP9 H;  2GUZ B;  3FV5 A;  1LUV A;  1KKC A;  4DRX B;  4MW3 A;  5DN6 G;  4DZY A;  2YDE A;  2PTM A;  4XCL A;  3DSQ A;  3ZHQ A;  4EEH A;  4PHZ A;  2WEP A;  5M4P A;  1RM1 C;  4U3J A;  1KD1 W;  2KQX A;  1BGY H;  2WI2 A;  3BAA A;  1JCH A;  3C90 A;  1F4N A;  1BHB A;  3RWR D;  1B3Q A;  1OCC B;  4B7P A;  4Q20 A;  2WLI A;  4QE9 A;  4RUF A;  4TV9 B;  2ILM A;  1EZV H;  1U97 A;  2JGD A;  2EIL B;  4LF7 B;  1QR9 A;  4XIP A;  2WEQ A;  4MW8 A;  3VQW A;  1OCR C;  2LO1 A;  4UVA A;  4F6R B;  4E4E A;  1DLB A;  5EIB C;  4LFA O;  4CWO A;  1Q6H A;  2YS8 A;  1KZN A;  4X65 O;  3CC7 V;  1R6N A;  2LFS A; 
#chains in the Genus database with same CATH homology
 3A0X A;  3QDD A;  4LWE A;  1OCO B;  1JOY A;  1Q82 W;  1L1F A;  1QY8 A;  4O04 A;  4YKW A;  1UYM A;  1R6K A;  3ABL C;  4MTO A;  1F4M A;  3EHG A;  2DYS B;  3K0G A;  2EIM C;  4KFM A;  1NVP D;  5KA6 A;  5D7D A;  3TET A;  3ASN B;  3R92 A;  1NVP B;  3G7B A;  1K33 A;  1HWY A;  1S0V A;  4WUD A;  2CGF A;  3E86 A;  3FB6 C;  2OT5 A;  3MNR P;  3ZMV A;  2EIN B;  2YGE A;  3OAA G;  3ZMZ A;  1R73 A;  1G8M A;  3H80 A;  4WFE A;  1N8R W;  2W0F C;  1TC6 A;  1H2G A;  2Q8H A;  4MVZ A;  1VQ9 V;  3ABK B;  3AG4 B;  2C2A A;  3ZJZ A;  2DQ3 A;  1GTO A;  2P6J A;  3IED A;  3JD4 A;  2A79 B;  1ID0 A;  4YXW G;  4NH9 A;  3R4N A;  3QTF A;  2Y69 C;  4GX0 A;  3RLP A;  5FNC A;  2BU6 A;  3ETE A;  1US7 A;  3AG2 B;  1PNL A;  3K04 A;  4DUH A;  5HFM A;  1I59 A;  4AWQ A;  1FXH A;  3BEH A;  4PDM A;  1VQL V;  2W6I G;  2AKP A;  3K60 A;  4QIW F;  3D2R A;  2YE9 A;  4GGL A;  3GIE A;  4Z1M G;  2XHR A;  2YI0 A;  4PA7 A;  2Q8F A;  2YKI A;  2QA4 V;  4MP7 A;  4MBC A;  1JVM A;  5E1A C;  4F4L A;  3NMQ A;  4L90 A;  1R3L C;  2DWE C;  4J9Z B;  2JJ2 G;  3WFV A;  3ZRS A;  1YC4 A;  1YHQ V;  2JDI G;  4O0B A;  3OMI B;  4MPE A;  4KUM A;  1OCC C;  2ZR2 A;  3KE6 A;  3SYA A;  1FXV A;  1NH2 B;  3TK1 A;  5CBG A;  4PA4 A;  1K4C C;  1GO3 F;  1YIT V;  1Q7Y W;  4LWI A;  3EFF K;  1E1Q G;  3U67 A;  2EZP A;  2YED A;  1OCO C;  4H33 A;  3HZ1 A;  3K98 A;  3OEE G;  4L87 A;  4FCP A;  1LNQ A;  3DTU B;  2BRE A;  3OW6 A;  2IOR A;  3LDD A;  3JCZ A;  4XIQ A;  1SET A;  3B27 A;  4PRV A;  3VHA A;  3OEH G;  3Q5L A;  1R3I C;  3ASN C;  3C0E A;  3Q5K A;  2YK2 A;  3R65 A;  3CCE V;  1KP2 A;  4K4O A;  1QLE B;  3TZ2 A;  3LDC A;  2XJX A;  2YKC A;  1EBO A;  5L3D A;  1I58 A;  5LHG A;  1JPX A;  2EIN C;  3EHJ A;  3ABM B;  3CXC U;  2P90 A;  3VBB A;  5LHH A;  2WAM A;  2BU7 A;  3B8M A;  2A9H A;  5IYC O;  4FMT A;  3F5W C;  3AG4 C;  4XCJ A;  4QPJ A;  4PA9 A;  3O0I A;  1QLN A;  4HYO A;  3OUF A;  5BOD A;  5CTX A;  2YEV B;  4P2Z A;  1AM1 A;  4QE7 A;  4CWF A;  2Q69 A;  4R3A A;  3SL2 A;  1K8A W;  4R6Z A;  5FND A;  1KP3 A;  1YJW V;  4OXS A;  3RVZ A;  1CPY A;  4EM7 A;  3AG2 C;  5CN0 A;  2NLJ C;  1DF5 A;  3R4P A;  4FPP A;  3RW0 A;  4V26 A;  4XDM A;  2BYH A;  4YKU A;  1Z5C A;  2FWY A;  1K73 W;  1VQ7 V;  4HYM A;  2FXS A;  1BL8 A;  1RM1 B;  4XIT A;  3T0Z A;  5IYB O;  5M4M A;  3ZN0 A;  4QPK A;  1L0O A;  1AI4 A;  4EFT A;  1UYF A;  4HXZ A;  3CC2 V;  1OCR B;  2YJW A;  1BKN A;  2HVK C;  4DO2 A;  1Z5B A;  4MB9 A;  3U2D A;  4AWO A;  3G71 V;  2CG9 A;  1JJ2 U;  2YI6 A;  2XX5 A;  2F43 G;  3I56 V;  3CCV V;  1Y4S A;  4I9W A;  1AMW A;  4N23 A;  4ASA A;  2OTL V;  4LCU C;  4G2K A;  2JEX A;  2ZKJ A;  4U93 A;  2XAQ A;  3W7T A;  4MTX A;  4R3M A;  1SRY A;  3ASO B;  4UUJ C;  3FYI B;  2IJJ A;  1AJQ A;  3EKR A;  1AJ6 A;  1GM8 A;  2XX4 A;  3B24 A;  3STZ C;  3ZM7 A;  2YEF A;  2WLN A;  5D6P A;  4H7Q A;  4BAE A;  4CWQ A;  1M1K W;  2IWS A;  1Q86 W;  2OTJ V;  5FL7 G;  2YKE A;  1H8E G;  4PDR A;  4P7A A;  3GIF A;  5CTU A;  3OM3 B;  1GJV A;  3CCJ V;  4L8Z A;  3PEH A;  1K34 A;  3JZ3 A;  3FB8 C;  2NNU A;  3K03 A;  2Y48 A;  3OE7 G;  5L3E A;  4BAY A;  4N21 A;  1GMG A;  3A0Z A;  3G4S V;  3B8N A;  2Y69 B;  2QG0 A;  2YI7 A;  4JYC A;  1V54 C;  1K5S A;  3T1K A;  1I5C A;  1Y8O A;  1Q81 W;  4CZZ A;  1CEZ A;  1ORQ C;  2O1V A;  3H4L A;  3INX A;  3OMN B;  2EZO A;  2VW5 A;  4HXW A;  4URO A;  1Z5A A;  3MHH C;  1JX9 A;  4MPN A;  2JJ1 G;  1UYH A;  2Q2E B;  1FXK A;  1W0J G;  2CCU A;  2X6B A;  5F3K A;  4PEL A;  2OCC C;  3ZCC A;  3ZN1 A;  1WPX A;  4U7N A;  5L3B A;  3TCU A;  4ZVI A;  2WER A;  2XJG A;  1ZWH A;  2KB1 A;  4BXI A;  2Q6A A;  3AG3 C;  1TH8 A;  3EHB B;  2K1E A;  2O1U A;  5H6Q A;  3OUS A;  1UYI A;  1VQO V;  1GKF A;  4L91 A;  4BW5 A;  3LSQ A;  4YKY A;  3CMA V;  2Z5U A;  5GW7 A;  3RVY A;  1BHA A;  3D3I A;  3TZ5 A;  1F23 A;  1P4R A;  3LUT B;  3IGA C;  2YGA A;  4JF3 A;  5FNF A;  2VCI A;  5B1N A;  2UXN A;  3O2F A;  3ASO C;  2LP7 A;  4ASU G;  4XIR A;  3JD2 A;  2HKO A;  1FXK B;  1F51 A;  2B1I A;  1M9N A;  1VQ8 V;  2WLL B;  4E02 A;  3SYP A;  3UM7 A;  1NJI W;  1E79 G;  2ZDY A;  1BXD A;  3FT8 A;  4I3H A;  4LPB A;  1S3J A;  2QF6 A;  1COW G;  2UXX A;  1P7B A;  4AS9 A;  3JD1 A;  1KKD A;  5D6Q A;  1S72 V;  3LNU A;  3CRL A;  3WHA A;  3SPJ A;  4TT3 G;  1QZR A;  1MX0 A;  2EXL A;  2DYR B;  2WLI B;  3ZMU A;  3FT5 A;  3X2Q C;  2YK9 A;  1R3K C;  3B25 A;  4HZ5 A;  4LP0 A;  5LHI A;  2H8P C;  1I5A A;  1UJW B;  3T2S A;  4KTN A;  4XDL A;  2HG5 C;  4I5S A;  3O6O A;  3K08 A;  4HYP A;  3JD3 A;  3JYC A;  2BU5 A;  4WCE V;  3D0B A;  3CGZ A;  3F7Y C;  2XDL A;  3SPG A;  3CYO A;  4DXW A;  2XK2 A;  1PNM A;  1B6Q A;  2LFR A;  4PL9 A;  4L94 A;  2Q8I A;  5IN9 A;  4PDL A;  3A0T A;  5M4K A;  3K97 A;  2FWZ A;  3W7S A;  3LSS A;  1AJP A;  2IH3 C;  2JIZ G;  5C93 A;  2YEE A;  4WFB V;  4O09 A;  1THZ A;  2HR3 A;  5HFL A;  1W0K G;  1JQ0 A;  2ZDI A;  3GWO A;  4JTD B;  3LPS A;  3C11 A;  2QEX V;  3ZKB A;  2M7W A;  2X0L A;  2WI3 A;  2DQ0 A;  2JK5 C;  2XJJ A;  2HVJ C;  3ML0 A;  2BOC C;  1CP9 A;  3R91 A;  4P8O A;  5M4E A;  5L3G A;  5EK0 A;  2R9R B;  2HLD G;  4MOT A;  2IOP A;  2CK3 G;  4LP8 A;  2WLH A;  1H8H G;  4CBC A;  4GX2 A;  4MPC A;  1AJN A;  2CCS A;  3SYQ A;  1BYQ A;  4EGH A;  2XAB A;  4LWG A;  3E8F A;  4G28 B;  4P9P A;  1K97 A;  4E2L A;  2K5B A;  1MOF A;  1Y66 A;  1UY8 A;  1YSC A;  3OWB A;  3E8B A;  4FCQ A;  4PA3 A;  3PJS K;  2XOK G;  1FXK C;  1S76 D;  4PDV A;  1UY9 A;  1VQ6 V;  2JKI A;  2YE8 A;  2XHT A;  2B1G A;  2EIK C;  1AR1 B;  2Q67 A;  4ASG A;  3K79 A;  3OW2 U;  2ITC C;  1GKZ A;  1YC3 A;  1DTO A;  2UWD A;  4PRX A;  4XBF A;  1V54 B;  1S5H C;  4O07 A;  5LGT A;  2DYR C;  1K3E A;  3VOU A;  2IW5 A;  1PNK A;  2IOQ A;  4E00 A;  1GK9 A;  4CWS A;  3FYE B;  4GT8 A;  3E35 A;  4R50 A;  4URM A;  1AI5 A;  3QO5 A;  3PEJ A;  4H81 A;  4L93 A;  2EIJ B;  3EHF A;  3CPW U;  2IH1 C;  2XCM A;  2WI4 A;  3TZ0 A;  1AI6 A;  4GFN A;  2YE6 A;  2OCC B;  3T0H A;  2V1D A;  5KA5 A;  1PD3 A;  1OSF A;  4B6C A;  3GIG A;  3AG3 B;  5F5R A;  2BOB C;  2XAF A;  3BY6 A;  2IU3 A;  3ZRV A;  1EZJ A;  3OMA B;  4QJF B;  1V55 B;  4MVQ A;  1I5X A;  4XKA A;  3KG2 A;  1FS0 G;  1YTF D;  2YI5 A;  4KSG A;  5CPH A;  1YSR A;  4JAV A;  3ZIA G;  1U0Z A;  3CCS V;  4H37 A;  4KP4 A;  5J6A A;  1ZXM A;  4MT8 A;  2R9I A;  2XAG A;  3TUH A;  2ZBK B;  3CGY A;  1UYE A;  2ZQM A;  3VHC A;  3LDE A;  5DM6 V;  1UYL A;  4YKQ A;  3OPD A;  3AEI A;  2HCH A;  1OCZ C;  4TSF G;  5M4N A;  1TBW A;  4XKO A;  2ZXW C;  1YC1 A;  3B77 A;  4HZ3 A;  1VQK V;  5BOC A;  2CCT A;  5M4H A;  2HKJ A;  2PI4 A;  2YEH A;  3OFN G;  3I55 V;  3CCL V;  4X88 A;  3A0W A;  2DWD C;  1Z59 A;  1K4D C;  3X2Q B;  4P9O A;  3QNE A;  1I5Y A;  4GX1 A;  4WFH A;  5IY5 B;  1TC0 A;  4GEE A;  1NR1 A;  1RPR A;  2BRC A;  2ZDI C;  1R62 A;  4KFG A;  5B1B C;  2BYI A;  4YKR A;  2QG2 A;  1GM9 A;  2ZD9 A;  4R8C A;  2P7T C;  4WFA V;  5H9C A;  3HYY A;  4XE2 A;  4FCR A;  3EHH A;  3CWV A;  1I5D A;  3LNM B;  2H94 A;  4X89 A;  3QO7 A;  2HJF C;  3T1C A;  4LBE C;  2XAJ A;  3INW A;  3VHD A;  1PL0 A;  2P67 A;  2X7R B;  3ZRW A;  4LC1 A;  1AH8 A;  4EGI A;  1KEC A;  4WF9 V;  2YKB A;  3WQ9 A;  3FB5 C;  4JGS A;  2X6C A;  4YKT A;  3K9A A;  2EBO A;  3RLR A;  3T4Z A;  4CWT A;  4XKK A;  4WFG A;  2PNR A;  1AH6 A;  3G7E A;  2EIJ C;  3SYO A;  3CRK A;  1J95 A;  3RKZ A;  4PA6 A;  1K7D A;  3OGC C;  1NR7 A;  4HAM A;  4RO2 A;  4H85 A;  3GB7 C;  2JJC A;  4UVC A;  4RAI A;  2YJX A;  3HYZ A;  4BQG A;  1M57 B;  3IFX A;  5CMU A;  3W7X A;  5B3S B;  5IYD O;  1XL4 A;  1ZW9 A;  4URN A;  4X9L A;  1V55 C;  1W2B U;  4MSW C;  1AI7 A;  2E0A A;  3BM9 A;  4KSH A;  1NKD A;  5EBW C;  1YSZ A;  3OWD A;  3EKO A;  2YEI A;  4CE3 A;  3F7V C;  5D7R A;  3B26 A;  2BU2 A;  4RQE A;  4MVS A;  1S77 D;  5L3J A;  1YET A;  3CME V;  2B5U A;  5J9P C;  3B28 A;  2ZR3 A;  3DGE A;  2BT0 A;  4MTG A;  3ZRW B;  4AWP A;  2WWW A;  1K9M W;  3ETD A;  1SER A;  3WG7 B;  2YE3 A;  2YEC A;  4W7T A;  3CCM V;  4P30 A;  4UV9 A;  2EIK B;  1Y4M A;  2FTK A;  1MU5 A;  2IWU A;  1NQT A;  3Q5J A;  2D3O W;  1M56 C;  1NHI A;  4UXN A;  1EA6 A;  3HPL C;  4BQJ A;  4EGK A;  3W7U A;  4R1F A;  3ZKD A;  3NXS A;  1PKX A;  1UY6 A;  1OZ0 A;  5IY5 C;  3CD6 V;  2BZ5 A;  2H55 A;  3K99 A;  5CBH A;  3SJQ C;  4JAS A;  4ZBM A;  2WI7 A;  3E8H A;  4URL A;  4FK5 C;  4HZ0 A;  2EJR A;  2V7Q G;  3T4D A;  2AHZ A;  5B1O A;  5B1A B;  4JQL A;  3HB3 B;  3R4O A;  4GCZ A;  1QR8 A;  4XC0 A;  3IC7 A;  1ENV A;  4XD8 A;  2XHX A;  2WI5 A;  3UKM A;  4KQV A;  2AHY A;  1YIJ V;  4ASB A;  1NHH A;  2W6J G;  4ZKI A;  1GKX A;  1ZXN A;  3R4M A;  2QTO A;  5FWK A;  4E01 A;  3SPH A;  5CA3 A;  4UVB A;  3RBZ A;  4JTC B;  2PI5 A;  1BGQ A;  4GQT A;  1E1R G;  4WUC A;  1OHH G;  3ZRX A;  5LGN A;  4CWR A;  1K5Q A;  2WI6 A;  5H6R A;  2XDX A;  4MVU A;  2VWC A;  1M57 C;  2A0L A;  2XAH A;  5B3S C;  1YS3 A;  1UYD A;  2QKS A;  2YEJ A;  2ZDX A;  1UYG A;  3ABT A;  3FKS G;  1NH2 D;  4V25 A;  4FIP C;  3OR6 C;  1GM7 A;  4NH8 A;  1ROP A;  3OR7 C;  3HZ5 A;  2EIL C;  2MK3 A;  2ESA A;  2YEV A;  1THN A;  1OCZ B;  2GFD A;  3AG1 B;  3OMU A;  2ZXW B;  2QE7 G;  1MSW D;  3HHU A;  2H8M A;  2WI1 A;  2BSM A;  2XND G;  2WSS G;  3HEK A;  2XDK A;  3QO8 A;  2JEU A;  1QYE A;  4X8A A;  2YGF A;  1SES A;  3WG7 C;  2QM7 A;  3E2E A;  2DYS C;  4JYB A;  2WLJ A;  3E8G A;  5CTW A;  3ZXO A;  2IJK A;  1VQP V;  4QNH B;  1JM6 A;  4MVR A;  1QVG U;  3E89 A;  5B1B B;  4HY6 A;  1IXM A;  3K0D A;  3ABU A;  1YJ9 V;  1MG1 A;  1QCE A;  1B63 A;  4BIZ A;  4YKZ A;  5IDM A;  2QFO A;  3CCR V;  2YEB A;  1BMF G;  4XDJ A;  3MHS C;  1K92 A;  3E83 A;  4WUB A;  1UYC A;  4XDK A;  3ABK C;  4EMV A;  4EFU A;  1R3J C;  5EBM C;  5J71 A;  3ZMS A;  1YT0 A;  1H7S A;  1Y8N A;  5LBQ A;  1U2O A;  3H01 A;  4GT1 A;  2XAS A;  4BIU A;  4UV8 A;  5D7C A;  5B1A C;  1H38 A;  5CBF A;  2IU0 A;  3SPC A;  1G4Y B;  1VQ4 V;  1UYK A;  4GX5 A;  5LGU A;  3K3W A;  1A4H A;  1UY7 A;  1PVG A;  3STL C;  1MAB G;  3ZXQ A;  3G6E V;  4CE1 A;  4JAU A;  5EC1 C;  2IJI A;  1VQ5 V;  1EFR G;  2YE4 A;  4R7C A;  1H7U A;  2YE2 A;  1ZWI C;  4XTJ A;  2ATK C;  1S16 A;  1EI1 A;  5BZB A;  1VQN V;  1YTF B;  2X6A A;  4G27 B;  4NH7 A;  2GHY A;  4O05 A;  3W7W A;  4CE2 A;  1FFT B;  1YES A;  4RQF A;  1DF4 A;  2HFE C;  1Y8P A;  1WLE A;  1ARO P;  2YEA A;  2IJH A;  3CP1 A;  1XL6 A;  1VQM V;  1M90 W;  4U7O A;  5EBL C;  3FB7 C;  2Q68 A;  3AG1 C;  4TWK A;  3ABL B;  1Y4U A;  4MVM A;  3RLQ A;  1S14 A;  1KIJ A;  4CWP A;  4ASF A;  2EIM B;  3P32 A;  3T10 A;  3ETG A;  1I5B A;  2YE5 A;  3CCQ V;  1YI2 V;  2CH4 A;  4J9Y B;  1YT1 A;  4LWH A;  2YKJ A;  4MVO A;  1KC8 W;  4MS2 A;  3T2M A;  2XD6 A;  5CF0 A;  2O1W A;  4CWN A;  1M56 B;  5KUM A;  3BMY A;  2BU8 A;  3A0R A;  1YJN V;  3GIG B;  2DW4 A;  5L3C A;  1TIL A;  5EC2 C;  2Q8G A;  5L3F A;  3G75 A;  3ZMT A;  3VAD A;  1NHJ A;  4WFF A;  5IDJ A;  4JPR A;  1QLE C;  3U2K A;  2IWX A;  2YSU B;  4RUE A;  3MD0 A;  2WPD G;  3M99 B;  1QBZ A;  1TID A;  3ABM C;  1KQS U;  4YKX A;  1YT2 A;  1NBM G;  3K06 A;  1RPO A;  3TZ4 A;  1SZT A;  4MP2 A;  4HY1 A;  3TTZ A;  2XDU A;  4PU9 A;  5CTY A;  1QVF U;  2XX2 A;  2Z3Y A;  4JTA B;  4EKW A;  2YEG A;  3A0Y A;  4LWF A;  2XDS A;  3D36 A;  2WLM A;  2ITD C;  3SPI A;  4MTF A;  5KUK A;  2WLK A;  2YE7 A;  3JD0 A;  3CCU V;  2BTZ A;  2FYP A;  2QM8 A;  4FJC C;  1TUE B;  2HG1 A;  5GGZ A;  2WLL A;  2GQP A;  3P30 A;  3CC4 V;  3SYC A;  2VCJ A;  1B62 A;  2GSM B;  1YER A;  3FV5 A;  4MW3 A;  5DN6 G;  4DZY A;  4XCL A;  4EEH A;  2WEP A;  5M4P A;  1RM1 C;  1KD1 W;  2WI2 A;  1JCH A;  1F4N A;  1BHB A;  1B3Q A;  1OCC B;  4B7P A;  4Q20 A;  2WLI A;  4QE9 A;  4RUF A;  2EIL B;  1QR9 A;  4XIP A;  2WEQ A;  4MW8 A;  1OCR C;  4UVA A;  1DLB A;  4CWO A;  1KZN A;  3CC7 V;  1R6N A;  2LFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...