5F5RA

Trap1n-adpnp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
225
structure length
225
Chain Sequence
PLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Heat shock protein 75 kDa, mitochondrial
publication title Mitochondrial Hsp90 is a ligand-activated molecular chaperone coupling ATP binding to dimer closure through a coiled-coil intermediate.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5f5rA00
2C2AA 2YKCA 4P7AA 5CTUA 2VCJA 4BXIA 3EHGA 1AJ6A 4E01A 1QZRA 4NH7A 4JAVA 4CWNA 4XKAA 1YESA 4ZVIA 3TZ5A 3RLQA 4Q20A 4B6CA 2ZDXA 2BU6A 2QG2A 2BU8A 1YT2A 1U0ZA 2XX2A 4GEEA 3R4NA 4ZKIA 5CTXA 3HEKA 4R1FA 4XDMA 2CGFA 3LPSA 2Q8GA 2UWDA 1YC1A 1GJVA 4LWEA 3O2FA 2YI0A 3FT8A 5M4KA 3A0XA 3CRKA 2BU5A 4CWSA 5F3KA 2YE4A 4LWGA 3OMUA 2BU7A 1TBWA 4H7QA 4HZ5A 1TILA 1Y8PA 1I5AA 1UYEA 4FCQA 2GQPA 4LPBA 3T2SA 4GCZA 3CGYA 1U2OA 4KFGA 4U7OA 2Q2EB 3C0EA 2XDXA 4MPEA 4HYMA 2IOQA 3INXA 4X9LA 3WQ9A 1EA6A 3HZ1A 3BMYA 2BSMA 4CWOA 4P8OA 1TC0A 4B7PA 1Z5AA 5BODA 2YEGA 3B25A 2XHXA 3Q5KA 1TC6A 2CH4A 4I3HA 4L90A 4O04A 4URMA 4CE3A 3HZ5A 4LWHA 4UROA 4KSHA 2EXLA 2YE7A 3R4MA 3D0BA 4DUHA 2XJGA 3OWDA 2CG9A 3R4OA 3A0ZA 5CPHA 4GT8A 5CF0A 2HG1A 4CWFA 2XABA 3T10A 2XK2A 4WUDA 1Z5CA 4MB9A 3TZ4A 1I59A 2BYIA 3A0TA 4EGIA 3QDDA 3U2KA 4E00A 4XTJA 4K4OA 2XX5A 2YKEA 4L94A 2Q8FA 4XIPA 3K60A 1A4HA 3ZM7A 2YGAA 3A0RA 1BKNA 1NHJA 2XHRA 4CWTA 2H8MA 3GIGA 2FYPA 2O1WA 1I5CA 4AWOA 3HHUA 2ZKJA 2WEQA 3B27A 2IORA 5D7DA 4YKUA 1YC3A 2VW5A 3A0YA 1THNA 4FMTA 1JM6A 4AWQA 2FWYA 2JJCA 2WEPA 4JQLA 4YKRA 1Y4SA 1L0OA 2BYHA 4ASFA 5C93A 1ZXNA 2O1VA 3LNUA 5M4MA 4LWFA 4R3AA 1TH8A 4H81A 1YSZA 3OPDA 4MP7A 4YKYA 4MBCA 4BIUA 1NHIA 1AM1A 3BM9A 5FWKA 5FNCA 3WHAA 2WI2A 4YKWA 4MPNA 2QF6A 1AH8A 4WUCA 1QYEA 4BQJA 2YI6A 1Y8NA 1UY9A 2YE8A 5CTYA 2BREA 3ZXOA 4EFTA 2YGEA 1B3QA 2XHTA 4ASGA 4DZYA 1KZNA 3EHJA 3OWBA 1UYHA 1AMWA 4EM7A 3RKZA 3D36A 4FCRA 3OW6A 3ZXQA 2WI5A 2YI5A 5J6AA 4CE2A 2ESAA 3TZ0A 1UYDA 2YECA 3B26A 4HZ0A 3CRLA 2XDKA 4GFNA 2YEBA 2YEIA 4ASBA 4KP4A 1S14A 4I5SA 4O05A 5D7RA 2YK9A 1UY6A 5J71A 2XDLA 4XE2A 2YE2A 2E0AA 2XJJA 2XJXA 2YEJA 3U67A 3VHCA 3RLPA 3GIEA 4L8ZA 1BXDA 1BGQA 1MX0A 2BU2A 1YT1A 4WUBA 1QY8A 2Q8IA 2WI6A 1OSFA 4KQVA 2YK2A 1NHHA 4URNA 4U7NA 1ZWHA 2YEFA 5F5RA 4L91A 4XIQA 4O07A 3K97A 2XDSA 3R92A 5FNFA 4BAEA 3K98A 3K99A 4XD8A 4XKKA 4NH8A 4GGLA 2ZDYA 3QTFA 4CWPA 1B62A 1Y8OA 2HCHA 2YE5A 4PL9A 4EMVA 3ZKDA 4H85A 2XD6A 3CGZA 1Y4UA 2YE3A 2BRCA 3INWA 3T1KA 1R62A 2WI4A 3EKOA 4LWIA 5BOCA 3KE6A 4YKTA 4XCJA 3Q5LA 4XITA 3G7EA 3H4LA 4MOTA 2FWZA 4R3MA 1UY7A 1I58A 5IN9A 1UYGA 2K5BA 4EGKA 3VADA 4FCPA 5CTWA 4YKQA 1UYIA 4L93A 4MP2A 2YE6A 4QPKA 3EHHA 3RLRA 4JAUA 2YE9A 2Q8HA 5M4NA 1TIDA 3IEDA 5M4PA 2VCIA 2YEEA 2CCUA 4U93A 1UYKA 1UYFA 2XCMA 4BIZA 4HYPA 4URLA 2AKPA 3G75A 1H7SA 1EI1A 2IWXA 3G7BA 3GIGB 2YJXA 4JASA 4YKZA 2YKIA 3EHFA 4ASAA 1S16A 2O1UA 1ID0A 2WI3A 5D6PA 4BQGA 3SL2A 3Q5JA 3MNRP 3TTZA 1I5BA 3TUHA 4GQTA 4QPJA 3R91A 2XDUA 1US7A 1YETA 4PU9A 3JZ3A 5D7CA 1MU5A 2YEDA 4MPCA 5IDMA 4HXWA 3PEHA 5M4HA 4HY1A 2FXSA 1H7UA 4V26A 3R4PA 4KTNA 4W7TA 1YERA 3VHAA 4AS9A 3B28A 4EFUA 2JKIA 3ZKBA 4KSGA 1UYCA 1YSRA 4HY6A 4YKXA 2YGFA 2BT0A 1B63A 5IDJA 4V25A 1PVGA 1YT0A 4PRXA 2YKJA 1GKZA 2PNRA 2IWSA 2YKBA 2YJWA 3D2RA 2YEHA 3T0ZA 5FNDA 2CCSA 3U2DA 2XX4A 1AH6A 2WI7A 4EEHA 4FPPA 5M4EA 3H80A 3VHDA 2YEAA 1I5DA 2CCTA 2QG0A 4CE1A 4O09A 2WI1A 5GGZA 2H55A 4LP0A 1YC4A 1KIJA 3FT5A 2IWUA 3DGEA 3O0IA 4E02A 4PRVA 1GKXA 2BZ5A 2QFOA 2WERA 3HYYA 4O0BA 1Z59A 3A0WA 2VWCA 3T0HA 3C11A 3PEJA 4NH9A 3NMQA 1UY8A 2YI7A 4HXZA 4CWRA 3TZ2A 2ZBKB 1BYQA 4XIRA 1UYMA 1ZXMA 2IOPA 3CWVA 1YS3A 4CWQA 3EKRA 2GFDA 4XC0A 1ZW9A 5L3JA 2BTZA 4XCLA 2HKJA 5D6QA 1UYLA 3O6OA 3FV5A 3HYZA 4EGHA 3GIFA 4AWPA 4XKOA 1Z5BA 3B24A
chains in the Genus database with same CATH superfamily
2C2AA 2YKCA 4P7AA 5CTUA 2VCJA 4BXIA 3EHGA 1AJ6A 4E01A 1QZRA 4NH7A 4JAVA 4CWNA 4XKAA 1YESA 4ZVIA 5JENA 3TZ5A 3RLQA 4Q20A 4B6CA 2ZDXA 2BU6A 2QG2A 2BU8A 1YT2A 1U0ZA 2XX2A 4GEEA 3R4NA 4ZKIA 5CTXA 3HEKA 4R1FA 4XDMA 2CGFA 3LPSA 2Q8GA 2UWDA 1YC1A 1GJVA 4LWEA 3O2FA 2YI0A 3FT8A 5M4KA 3A0XA 3CRKA 2BU5A 4CWSA 5F3KA 2YE4A 4LWGA 3OMUA 2BU7A 1TBWA 4H7QA 4HZ5A 1TILA 1Y8PA 1I5AA 1UYEA 4FCQA 2GQPA 4LPBA 3T2SA 4GCZA 3CGYA 1U2OA 4KFGA 4U7OA 2Q2EB 3C0EA 2XDXA 4MPEA 4HYMA 2IOQA 3INXA 4X9LA 3WQ9A 1EA6A 3HZ1A 3BMYA 2BSMA 4CWOA 4P8OA 1TC0A 4B7PA 1Z5AA 5BODA 2YEGA 3B25A 2XHXA 3Q5KA 1TC6A 2CH4A 4I3HA 4L90A 4O04A 4URMA 4CE3A 3HZ5A 4LWHA 4UROA 4KSHA 2EXLA 2YE7A 3R4MA 3D0BA 4DUHA 2XJGA 3OWDA 2CG9A 3R4OA 3A0ZA 5CPHA 4GT8A 5CF0A 2HG1A 4CWFA 2XABA 3T10A 2XK2A 4WUDA 1Z5CA 4MB9A 3TZ4A 1I59A 2BYIA 3A0TA 4EGIA 3QDDA 3U2KA 4E00A 4XTJA 4K4OA 2XX5A 2YKEA 4L94A 2Q8FA 4XIPA 3K60A 1A4HA 3ZM7A 2YGAA 3A0RA 1BKNA 1NHJA 2XHRA 3LMMA 4CWTA 2H8MA 3GIGA 2FYPA 2O1WA 1I5CA 4AWOA 3HHUA 2ZKJA 2WEQA 3B27A 2IORA 5D7DA 4YKUA 1YC3A 2VW5A 3A0YA 1THNA 4FMTA 1JM6A 4AWQA 2FWYA 2JJCA 2WEPA 4JQLA 4YKRA 1Y4SA 1L0OA 2BYHA 4ASFA 5C93A 1ZXNA 2O1VA 3LNUA 5M4MA 4LWFA 4R3AA 1TH8A 4H81A 1YSZA 3OPDA 4MP7A 4YKYA 4MBCA 4BIUA 1NHIA 1AM1A 3BM9A 5FWKA 5FNCA 3WHAA 2WI2A 4YKWA 4MPNA 2QF6A 1AH8A 4WUCA 1QYEA 4BQJA 2YI6A 1Y8NA 1UY9A 2YE8A 5CTYA 2BREA 3ZXOA 4EFTA 2YGEA 1B3QA 2XHTA 4ASGA 4DZYA 1KZNA 3EHJA 3OWBA 1UYHA 1AMWA 4EM7A 3RKZA 3D36A 4FCRA 3OW6A 3ZXQA 2WI5A 2YI5A 5J6AA 4CE2A 2ESAA 3TZ0A 1UYDA 2YECA 3B26A 4HZ0A 3CRLA 2XDKA 4GFNA 2YEBA 2YEIA 4ASBA 4KP4A 1S14A 4I5SA 4O05A 5D7RA 2YK9A 1UY6A 5J71A 2XDLA 4XE2A 2YE2A 2E0AA 2XJJA 2XJXA 2YEJA 3U67A 3VHCA 3RLPA 3GIEA 4L8ZA 1BXDA 1BGQA 1MX0A 2BU2A 1YT1A 4WUBA 1QY8A 2Q8IA 2WI6A 1OSFA 4KQVA 2YK2A 1NHHA 4URNA 4U7NA 1ZWHA 2YEFA 5F5RA 4L91A 4XIQA 4O07A 3K97A 2XDSA 3R92A 5FNFA 4BAEA 3K98A 3K99A 4XD8A 4XKKA 4NH8A 4GGLA 2ZDYA 3QTFA 4CWPA 1B62A 1Y8OA 2HCHA 2YE5A 4PL9A 4EMVA 3ZKDA 4H85A 2XD6A 1F51A 3CGZA 1Y4UA 2YE3A 2BRCA 3INWA 3T1KA 1R62A 2WI4A 3EKOA 4LWIA 5BOCA 3KE6A 4YKTA 4XCJA 3Q5LA 4XITA 3G7EA 3H4LA 4MOTA 2FWZA 4R3MA 1UY7A 1I58A 5IN9A 1UYGA 2K5BA 4EGKA 3VADA 4FCPA 5CTWA 4YKQA 1UYIA 4L93A 4MP2A 2YE6A 4QPKA 3EHHA 3RLRA 4JAUA 2YE9A 2C1GA 2Q8HA 5M4NA 1TIDA 3IEDA 5M4PA 2VCIA 2YEEA 2CCUA 4U93A 1UYKA 1UYFA 2XCMA 4BIZA 4HYPA 4URLA 2AKPA 3G75A 1H7SA 1EI1A 2IWXA 3G7BA 3GIGB 2YJXA 4JASA 1IXMA 2YKIA 3EHFA 4YKZA 4ASAA 1S16A 2O1UA 1ID0A 2WI3A 5D6PA 4BQGA 3SL2A 3Q5JA 3MNRP 3TTZA 1I5BA 3TUHA 4GQTA 4QPJA 3R91A 2XDUA 1US7A 1YETA 4PU9A 3JZ3A 5D7CA 1MU5A 2YEDA 4MPCA 5IDMA 4HXWA 3PEHA 5M4HA 4HY1A 2FXSA 1H7UA 4V26A 3R4PA 4KTNA 4W7TA 1YERA 3VHAA 4AS9A 3B28A 4EFUA 2JKIA 3ZKBA 4KSGA 1UYCA 1YSRA 4HY6A 4YKXA 4E72A 2YGFA 2BT0A 1B63A 5IDJA 4V25A 1PVGA 1YT0A 4PRXA 2YKJA 1GKZA 2FTKA 2PNRA 2IWSA 2YKBA 2C1IA 2YJWA 3D2RA 2YEHA 3T0ZA 5FNDA 2CCSA 3U2DA 2XX4A 1AH6A 2WI7A 4EEHA 4FPPA 3S5TA 5M4EA 3H80A 3VHDA 2YEAA 1I5DA 2CCTA 2QG0A 4CE1A 4O09A 2WI1A 5GGZA 2H55A 4LP0A 1YC4A 1KIJA 3FT5A 2IWUA 3DGEA 3O0IA 3CYGA 4E02A 4PRVA 1GKXA 2BZ5A 2QFOA 2WERA 3HYYA 4O0BA 1Z59A 3A0WA 2VWCA 3T0HA 3C11A 3PEJA 4NH9A 3NMQA 1UY8A 2YI7A 4HXZA 4CWRA 3TZ2A 2ZBKB 1BYQA 4XIRA 1UYMA 1ZXMA 2IOPA 3CWVA 1YS3A 4CWQA 3EKRA 2GFDA 4XC0A 2HHIA 1ZW9A 5L3JA 2BTZA 4XCLA 2HKJA 5D6QA 1UYLA 3O6OA 3FV5A 3HYZA 4EGHA 3GIFA 4AWPA 4XKOA 1Z5BA 3B24A
chains in the Genus database with same CATH topology
2C2AA 2YKCA 4P7AA 5CTUA 2VCJA 4BXIA 3EHGA 1AJ6A 4E01A 1QZRA 4NH7A 4JAVA 4CWNA 4XKAA 1YESA 4ZVIA 3TZ5A 3RLQA 4Q20A 4B6CA 2ZDXA 2BU6A 2QG2A 2BU8A 1YT2A 1U0ZA 2XX2A 4GEEA 3R4NA 4ZKIA 5CTXA 3HEKA 4R1FA 4XDMA 2CGFA 3LPSA 2Q8GA 2UWDA 1YC1A 1GJVA 4LWEA 3O2FA 2YI0A 3FT8A 5M4KA 3A0XA 3CRKA 2BU5A 4CWSA 5F3KA 2YE4A 4LWGA 3OMUA 2BU7A 1TBWA 4H7QA 4HZ5A 1TILA 1Y8PA 1I5AA 1UYEA 4FCQA 2GQPA 4LPBA 3T2SA 4GCZA 3CGYA 1U2OA 4KFGA 4U7OA 2Q2EB 3C0EA 2XDXA 4MPEA 4HYMA 2IOQA 3INXA 4X9LA 3WQ9A 1EA6A 3HZ1A 3BMYA 2BSMA 4CWOA 4P8OA 1TC0A 4B7PA 1Z5AA 5BODA 2YEGA 3B25A 2XHXA 3Q5KA 1TC6A 2CH4A 4I3HA 4L90A 4O04A 4URMA 4CE3A 3HZ5A 4LWHA 4UROA 4KSHA 2EXLA 2YE7A 3R4MA 3D0BA 4DUHA 2XJGA 3OWDA 2CG9A 3R4OA 3A0ZA 5CPHA 4GT8A 5CF0A 2HG1A 4CWFA 2XABA 3T10A 2XK2A 4WUDA 1Z5CA 4MB9A 3TZ4A 1I59A 2BYIA 3A0TA 4EGIA 3QDDA 3U2KA 4E00A 4XTJA 4K4OA 2XX5A 2YKEA 4L94A 2Q8FA 4XIPA 3K60A 1A4HA 3ZM7A 2YGAA 3A0RA 1BKNA 1NHJA 2XHRA 4CWTA 2H8MA 3GIGA 2FYPA 2O1WA 1I5CA 4AWOA 3HHUA 2ZKJA 2WEQA 3B27A 2IORA 5D7DA 4YKUA 1YC3A 2VW5A 3A0YA 1THNA 4FMTA 1JM6A 4AWQA 2FWYA 2JJCA 2WEPA 4JQLA 4YKRA 1Y4SA 1L0OA 2BYHA 4ASFA 5C93A 1ZXNA 2O1VA 3LNUA 5M4MA 4LWFA 4R3AA 1TH8A 4H81A 1YSZA 3OPDA 4MP7A 4YKYA 4MBCA 4BIUA 1NHIA 1AM1A 3BM9A 5FWKA 5FNCA 3WHAA 2WI2A 4YKWA 4MPNA 2QF6A 1AH8A 4WUCA 1QYEA 4BQJA 2YI6A 1Y8NA 1UY9A 2YE8A 5CTYA 2BREA 3ZXOA 4EFTA 2YGEA 1B3QA 2XHTA 4ASGA 4DZYA 1KZNA 3EHJA 3OWBA 1UYHA 1AMWA 4EM7A 3RKZA 3D36A 4FCRA 3OW6A 3ZXQA 2WI5A 2YI5A 5J6AA 4CE2A 2ESAA 3TZ0A 1UYDA 2YECA 3B26A 4HZ0A 3CRLA 2XDKA 4GFNA 2YEBA 2YEIA 4ASBA 4KP4A 1S14A 4I5SA 4O05A 5D7RA 2YK9A 1UY6A 5J71A 2XDLA 4XE2A 2YE2A 2E0AA 2XJJA 2XJXA 2YEJA 3U67A 3VHCA 3RLPA 3GIEA 4L8ZA 1BXDA 1BGQA 1MX0A 2BU2A 1YT1A 4WUBA 1QY8A 2Q8IA 2WI6A 1OSFA 4KQVA 2YK2A 1NHHA 4URNA 4U7NA 1ZWHA 2YEFA 5F5RA 4L91A 4XIQA 4O07A 3K97A 2XDSA 3R92A 5FNFA 4BAEA 3K98A 3K99A 4XD8A 4XKKA 4NH8A 4GGLA 2ZDYA 3QTFA 4CWPA 1B62A 1Y8OA 2HCHA 2YE5A 4PL9A 4EMVA 3ZKDA 4H85A 2XD6A 3CGZA 1Y4UA 2YE3A 2BRCA 3INWA 3T1KA 1R62A 2WI4A 3EKOA 4LWIA 5BOCA 3KE6A 4YKTA 4XCJA 3Q5LA 4XITA 3G7EA 3H4LA 4MOTA 2FWZA 4R3MA 1UY7A 1I58A 5IN9A 1UYGA 2K5BA 4EGKA 3VADA 4FCPA 5CTWA 4YKQA 1UYIA 4L93A 4MP2A 2YE6A 4QPKA 3EHHA 3RLRA 4JAUA 2YE9A 2Q8HA 5M4NA 1TIDA 3IEDA 5M4PA 2VCIA 2YEEA 2CCUA 4U93A 1UYKA 1UYFA 2XCMA 4BIZA 4HYPA 4URLA 2AKPA 3G75A 1H7SA 1EI1A 2IWXA 3G7BA 3GIGB 2YJXA 4JASA 4YKZA 2YKIA 3EHFA 4ASAA 1S16A 2O1UA 1ID0A 2WI3A 5D6PA 4BQGA 3SL2A 3Q5JA 3MNRP 3TTZA 1I5BA 3TUHA 4GQTA 4QPJA 3R91A 2XDUA 1US7A 1YETA 4PU9A 3JZ3A 5D7CA 1MU5A 2YEDA 4MPCA 5IDMA 4HXWA 3PEHA 5M4HA 4HY1A 2FXSA 1H7UA 4V26A 3R4PA 4KTNA 4W7TA 1YERA 3VHAA 4AS9A 3B28A 4EFUA 2JKIA 3ZKBA 4KSGA 1UYCA 1YSRA 4HY6A 4YKXA 2YGFA 2BT0A 1B63A 5IDJA 4V25A 1PVGA 1YT0A 4PRXA 2YKJA 1GKZA 2PNRA 2IWSA 2YKBA 2YJWA 3D2RA 2YEHA 3T0ZA 5FNDA 2CCSA 3U2DA 2XX4A 1AH6A 2WI7A 4EEHA 4FPPA 5M4EA 3H80A 3VHDA 2YEAA 1I5DA 2CCTA 2QG0A 4CE1A 4O09A 2WI1A 5GGZA 2H55A 4LP0A 1YC4A 1KIJA 3FT5A 2IWUA 3DGEA 3O0IA 4E02A 4PRVA 1GKXA 2BZ5A 2QFOA 2WERA 3HYYA 4O0BA 1Z59A 3A0WA 2VWCA 3T0HA 3C11A 3PEJA 4NH9A 3NMQA 1UY8A 2YI7A 4HXZA 4CWRA 3TZ2A 2ZBKB 1BYQA 4XIRA 1UYMA 1ZXMA 2IOPA 3CWVA 1YS3A 4CWQA 3EKRA 2GFDA 4XC0A 1ZW9A 5L3JA 2BTZA 4XCLA 2HKJA 5D6QA 1UYLA 3O6OA 3FV5A 3HYZA 4EGHA 3GIFA 4AWPA 4XKOA 1Z5BA 3B24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2A A;  2YKC A;  4P7A A;  5CTU A;  2VCJ A;  4BXI A;  3EHG A;  1AJ6 A;  4E01 A;  1QZR A;  4NH7 A;  4JAV A;  4CWN A;  4XKA A;  1YES A;  4ZVI A;  3TZ5 A;  3RLQ A;  4Q20 A;  4B6C A;  2ZDX A;  2BU6 A;  2QG2 A;  2BU8 A;  1YT2 A;  1U0Z A;  2XX2 A;  4GEE A;  3R4N A;  4ZKI A;  5CTX A;  3HEK A;  4R1F A;  4XDM A;  2CGF A;  3LPS A;  2Q8G A;  2UWD A;  1YC1 A;  1GJV A;  4LWE A;  3O2F A;  2YI0 A;  3FT8 A;  5M4K A;  3A0X A;  3CRK A;  2BU5 A;  4CWS A;  5F3K A;  2YE4 A;  4LWG A;  3OMU A;  2BU7 A;  1TBW A;  4H7Q A;  4HZ5 A;  1TIL A;  1Y8P A;  1I5A A;  1UYE A;  4FCQ A;  2GQP A;  4LPB A;  3T2S A;  4GCZ A;  3CGY A;  1U2O A;  4KFG A;  4U7O A;  2Q2E B;  3C0E A;  2XDX A;  4MPE A;  4HYM A;  2IOQ A;  3INX A;  4X9L A;  3WQ9 A;  1EA6 A;  3HZ1 A;  3BMY A;  2BSM A;  4CWO A;  4P8O A;  1TC0 A;  4B7P A;  1Z5A A;  5BOD A;  2YEG A;  3B25 A;  2XHX A;  3Q5K A;  1TC6 A;  2CH4 A;  4I3H A;  4L90 A;  4O04 A;  4URM A;  4CE3 A;  3HZ5 A;  4LWH A;  4URO A;  4KSH A;  2EXL A;  2YE7 A;  3R4M A;  3D0B A;  4DUH A;  2XJG A;  3OWD A;  2CG9 A;  3R4O A;  3A0Z A;  5CPH A;  4GT8 A;  5CF0 A;  2HG1 A;  4CWF A;  2XAB A;  3T10 A;  2XK2 A;  4WUD A;  1Z5C A;  4MB9 A;  3TZ4 A;  1I59 A;  2BYI A;  3A0T A;  4EGI A;  3QDD A;  3U2K A;  4E00 A;  4XTJ A;  4K4O A;  2XX5 A;  2YKE A;  4L94 A;  2Q8F A;  4XIP A;  3K60 A;  1A4H A;  3ZM7 A;  2YGA A;  3A0R A;  1BKN A;  1NHJ A;  2XHR A;  4CWT A;  2H8M A;  3GIG A;  2FYP A;  2O1W A;  1I5C A;  4AWO A;  3HHU A;  2ZKJ A;  2WEQ A;  3B27 A;  2IOR A;  5D7D A;  4YKU A;  1YC3 A;  2VW5 A;  3A0Y A;  1THN A;  4FMT A;  1JM6 A;  4AWQ A;  2FWY A;  2JJC A;  2WEP A;  4JQL A;  4YKR A;  1Y4S A;  1L0O A;  2BYH A;  4ASF A;  5C93 A;  1ZXN A;  2O1V A;  3LNU A;  5M4M A;  4LWF A;  4R3A A;  1TH8 A;  4H81 A;  1YSZ A;  3OPD A;  4MP7 A;  4YKY A;  4MBC A;  4BIU A;  1NHI A;  1AM1 A;  3BM9 A;  5FWK A;  5FNC A;  3WHA A;  2WI2 A;  4YKW A;  4MPN A;  2QF6 A;  1AH8 A;  4WUC A;  1QYE A;  4BQJ A;  2YI6 A;  1Y8N A;  1UY9 A;  2YE8 A;  5CTY A;  2BRE A;  3ZXO A;  4EFT A;  2YGE A;  1B3Q A;  2XHT A;  4ASG A;  4DZY A;  1KZN A;  3EHJ A;  3OWB A;  1UYH A;  1AMW A;  4EM7 A;  3RKZ A;  3D36 A;  4FCR A;  3OW6 A;  3ZXQ A;  2WI5 A;  2YI5 A;  5J6A A;  4CE2 A;  2ESA A;  3TZ0 A;  1UYD A;  2YEC A;  3B26 A;  4HZ0 A;  3CRL A;  2XDK A;  4GFN A;  2YEB A;  2YEI A;  4ASB A;  4KP4 A;  1S14 A;  4I5S A;  4O05 A;  5D7R A;  2YK9 A;  1UY6 A;  5J71 A;  2XDL A;  4XE2 A;  2YE2 A;  2E0A A;  2XJJ A;  2XJX A;  2YEJ A;  3U67 A;  3VHC A;  3RLP A;  3GIE A;  4L8Z A;  1BXD A;  1BGQ A;  1MX0 A;  2BU2 A;  1YT1 A;  4WUB A;  1QY8 A;  2Q8I A;  2WI6 A;  1OSF A;  4KQV A;  2YK2 A;  1NHH A;  4URN A;  4U7N A;  1ZWH A;  2YEF A;  5F5R A;  4L91 A;  4XIQ A;  4O07 A;  3K97 A;  2XDS A;  3R92 A;  5FNF A;  4BAE A;  3K98 A;  3K99 A;  4XD8 A;  4XKK A;  4NH8 A;  4GGL A;  2ZDY A;  3QTF A;  4CWP A;  1B62 A;  1Y8O A;  2HCH A;  2YE5 A;  4PL9 A;  4EMV A;  3ZKD A;  4H85 A;  2XD6 A;  3CGZ A;  1Y4U A;  2YE3 A;  2BRC A;  3INW A;  3T1K A;  1R62 A;  2WI4 A;  3EKO A;  4LWI A;  5BOC A;  3KE6 A;  4YKT A;  4XCJ A;  3Q5L A;  4XIT A;  3G7E A;  3H4L A;  4MOT A;  2FWZ A;  4R3M A;  1UY7 A;  1I58 A;  5IN9 A;  1UYG A;  2K5B A;  4EGK A;  3VAD A;  4FCP A;  5CTW A;  4YKQ A;  1UYI A;  4L93 A;  4MP2 A;  2YE6 A;  4QPK A;  3EHH A;  3RLR A;  4JAU A;  2YE9 A;  2Q8H A;  5M4N A;  1TID A;  3IED A;  5M4P A;  2VCI A;  2YEE A;  2CCU A;  4U93 A;  1UYK A;  1UYF A;  2XCM A;  4BIZ A;  4HYP A;  4URL A;  2AKP A;  3G75 A;  1H7S A;  1EI1 A;  2IWX A;  3G7B A;  3GIG B;  2YJX A;  4JAS A;  4YKZ A;  2YKI A;  3EHF A;  4ASA A;  1S16 A;  2O1U A;  1ID0 A;  2WI3 A;  5D6P A;  4BQG A;  3SL2 A;  3Q5J A;  3MNR P;  3TTZ A;  1I5B A;  3TUH A;  4GQT A;  4QPJ A;  3R91 A;  2XDU A;  1US7 A;  1YET A;  4PU9 A;  3JZ3 A;  5D7C A;  1MU5 A;  2YED A;  4MPC A;  5IDM A;  4HXW A;  3PEH A;  5M4H A;  4HY1 A;  2FXS A;  1H7U A;  4V26 A;  3R4P A;  4KTN A;  4W7T A;  1YER A;  3VHA A;  4AS9 A;  3B28 A;  4EFU A;  2JKI A;  3ZKB A;  4KSG A;  1UYC A;  1YSR A;  4HY6 A;  4YKX A;  2YGF A;  2BT0 A;  1B63 A;  5IDJ A;  4V25 A;  1PVG A;  1YT0 A;  4PRX A;  2YKJ A;  1GKZ A;  2PNR A;  2IWS A;  2YKB A;  2YJW A;  3D2R A;  2YEH A;  3T0Z A;  5FND A;  2CCS A;  3U2D A;  2XX4 A;  1AH6 A;  2WI7 A;  4EEH A;  4FPP A;  5M4E A;  3H80 A;  3VHD A;  2YEA A;  1I5D A;  2CCT A;  2QG0 A;  4CE1 A;  4O09 A;  2WI1 A;  5GGZ A;  2H55 A;  4LP0 A;  1YC4 A;  1KIJ A;  3FT5 A;  2IWU A;  3DGE A;  3O0I A;  4E02 A;  4PRV A;  1GKX A;  2BZ5 A;  2QFO A;  2WER A;  3HYY A;  4O0B A;  1Z59 A;  3A0W A;  2VWC A;  3T0H A;  3C11 A;  3PEJ A;  4NH9 A;  3NMQ A;  1UY8 A;  2YI7 A;  4HXZ A;  4CWR A;  3TZ2 A;  2ZBK B;  1BYQ A;  4XIR A;  1UYM A;  1ZXM A;  2IOP A;  3CWV A;  1YS3 A;  4CWQ A;  3EKR A;  2GFD A;  4XC0 A;  1ZW9 A;  5L3J A;  2BTZ A;  4XCL A;  2HKJ A;  5D6Q A;  1UYL A;  3O6O A;  3FV5 A;  3HYZ A;  4EGH A;  3GIF A;  4AWP A;  4XKO A;  1Z5B A;  3B24 A; 
#chains in the Genus database with same CATH topology
 2C2A A;  2YKC A;  4P7A A;  5CTU A;  2VCJ A;  4BXI A;  3EHG A;  1AJ6 A;  4E01 A;  1QZR A;  4NH7 A;  4JAV A;  4CWN A;  4XKA A;  1YES A;  4ZVI A;  5JEN A;  3TZ5 A;  3RLQ A;  4Q20 A;  4B6C A;  2ZDX A;  2BU6 A;  2QG2 A;  2BU8 A;  1YT2 A;  1U0Z A;  2XX2 A;  4GEE A;  3R4N A;  4ZKI A;  5CTX A;  3HEK A;  4R1F A;  4XDM A;  2CGF A;  3LPS A;  2Q8G A;  2UWD A;  1YC1 A;  1GJV A;  4LWE A;  3O2F A;  2YI0 A;  3FT8 A;  5M4K A;  3A0X A;  3CRK A;  2BU5 A;  4CWS A;  5F3K A;  2YE4 A;  4LWG A;  3OMU A;  2BU7 A;  1TBW A;  4H7Q A;  4HZ5 A;  1TIL A;  1Y8P A;  1I5A A;  1UYE A;  4FCQ A;  2GQP A;  4LPB A;  3T2S A;  4GCZ A;  3CGY A;  1U2O A;  4KFG A;  4U7O A;  2Q2E B;  3C0E A;  2XDX A;  4MPE A;  4HYM A;  2IOQ A;  3INX A;  4X9L A;  3WQ9 A;  1EA6 A;  3HZ1 A;  3BMY A;  2BSM A;  4CWO A;  4P8O A;  1TC0 A;  4B7P A;  1Z5A A;  5BOD A;  2YEG A;  3B25 A;  2XHX A;  3Q5K A;  1TC6 A;  2CH4 A;  4I3H A;  4L90 A;  4O04 A;  4URM A;  4CE3 A;  3HZ5 A;  4LWH A;  4URO A;  4KSH A;  2EXL A;  2YE7 A;  3R4M A;  3D0B A;  4DUH A;  2XJG A;  3OWD A;  2CG9 A;  3R4O A;  3A0Z A;  5CPH A;  4GT8 A;  5CF0 A;  2HG1 A;  4CWF A;  2XAB A;  3T10 A;  2XK2 A;  4WUD A;  1Z5C A;  4MB9 A;  3TZ4 A;  1I59 A;  2BYI A;  3A0T A;  4EGI A;  3QDD A;  3U2K A;  4E00 A;  4XTJ A;  4K4O A;  2XX5 A;  2YKE A;  4L94 A;  2Q8F A;  4XIP A;  3K60 A;  1A4H A;  3ZM7 A;  2YGA A;  3A0R A;  1BKN A;  1NHJ A;  2XHR A;  3LMM A;  4CWT A;  2H8M A;  3GIG A;  2FYP A;  2O1W A;  1I5C A;  4AWO A;  3HHU A;  2ZKJ A;  2WEQ A;  3B27 A;  2IOR A;  5D7D A;  4YKU A;  1YC3 A;  2VW5 A;  3A0Y A;  1THN A;  4FMT A;  1JM6 A;  4AWQ A;  2FWY A;  2JJC A;  2WEP A;  4JQL A;  4YKR A;  1Y4S A;  1L0O A;  2BYH A;  4ASF A;  5C93 A;  1ZXN A;  2O1V A;  3LNU A;  5M4M A;  4LWF A;  4R3A A;  1TH8 A;  4H81 A;  1YSZ A;  3OPD A;  4MP7 A;  4YKY A;  4MBC A;  4BIU A;  1NHI A;  1AM1 A;  3BM9 A;  5FWK A;  5FNC A;  3WHA A;  2WI2 A;  4YKW A;  4MPN A;  2QF6 A;  1AH8 A;  4WUC A;  1QYE A;  4BQJ A;  2YI6 A;  1Y8N A;  1UY9 A;  2YE8 A;  5CTY A;  2BRE A;  3ZXO A;  4EFT A;  2YGE A;  1B3Q A;  2XHT A;  4ASG A;  4DZY A;  1KZN A;  3EHJ A;  3OWB A;  1UYH A;  1AMW A;  4EM7 A;  3RKZ A;  3D36 A;  4FCR A;  3OW6 A;  3ZXQ A;  2WI5 A;  2YI5 A;  5J6A A;  4CE2 A;  2ESA A;  3TZ0 A;  1UYD A;  2YEC A;  3B26 A;  4HZ0 A;  3CRL A;  2XDK A;  4GFN A;  2YEB A;  2YEI A;  4ASB A;  4KP4 A;  1S14 A;  4I5S A;  4O05 A;  5D7R A;  2YK9 A;  1UY6 A;  5J71 A;  2XDL A;  4XE2 A;  2YE2 A;  2E0A A;  2XJJ A;  2XJX A;  2YEJ A;  3U67 A;  3VHC A;  3RLP A;  3GIE A;  4L8Z A;  1BXD A;  1BGQ A;  1MX0 A;  2BU2 A;  1YT1 A;  4WUB A;  1QY8 A;  2Q8I A;  2WI6 A;  1OSF A;  4KQV A;  2YK2 A;  1NHH A;  4URN A;  4U7N A;  1ZWH A;  2YEF A;  5F5R A;  4L91 A;  4XIQ A;  4O07 A;  3K97 A;  2XDS A;  3R92 A;  5FNF A;  4BAE A;  3K98 A;  3K99 A;  4XD8 A;  4XKK A;  4NH8 A;  4GGL A;  2ZDY A;  3QTF A;  4CWP A;  1B62 A;  1Y8O A;  2HCH A;  2YE5 A;  4PL9 A;  4EMV A;  3ZKD A;  4H85 A;  2XD6 A;  1F51 A;  3CGZ A;  1Y4U A;  2YE3 A;  2BRC A;  3INW A;  3T1K A;  1R62 A;  2WI4 A;  3EKO A;  4LWI A;  5BOC A;  3KE6 A;  4YKT A;  4XCJ A;  3Q5L A;  4XIT A;  3G7E A;  3H4L A;  4MOT A;  2FWZ A;  4R3M A;  1UY7 A;  1I58 A;  5IN9 A;  1UYG A;  2K5B A;  4EGK A;  3VAD A;  4FCP A;  5CTW A;  4YKQ A;  1UYI A;  4L93 A;  4MP2 A;  2YE6 A;  4QPK A;  3EHH A;  3RLR A;  4JAU A;  2YE9 A;  2C1G A;  2Q8H A;  5M4N A;  1TID A;  3IED A;  5M4P A;  2VCI A;  2YEE A;  2CCU A;  4U93 A;  1UYK A;  1UYF A;  2XCM A;  4BIZ A;  4HYP A;  4URL A;  2AKP A;  3G75 A;  1H7S A;  1EI1 A;  2IWX A;  3G7B A;  3GIG B;  2YJX A;  4JAS A;  1IXM A;  2YKI A;  3EHF A;  4YKZ A;  4ASA A;  1S16 A;  2O1U A;  1ID0 A;  2WI3 A;  5D6P A;  4BQG A;  3SL2 A;  3Q5J A;  3MNR P;  3TTZ A;  1I5B A;  3TUH A;  4GQT A;  4QPJ A;  3R91 A;  2XDU A;  1US7 A;  1YET A;  4PU9 A;  3JZ3 A;  5D7C A;  1MU5 A;  2YED A;  4MPC A;  5IDM A;  4HXW A;  3PEH A;  5M4H A;  4HY1 A;  2FXS A;  1H7U A;  4V26 A;  3R4P A;  4KTN A;  4W7T A;  1YER A;  3VHA A;  4AS9 A;  3B28 A;  4EFU A;  2JKI A;  3ZKB A;  4KSG A;  1UYC A;  1YSR A;  4HY6 A;  4YKX A;  4E72 A;  2YGF A;  2BT0 A;  1B63 A;  5IDJ A;  4V25 A;  1PVG A;  1YT0 A;  4PRX A;  2YKJ A;  1GKZ A;  2FTK A;  2PNR A;  2IWS A;  2YKB A;  2C1I A;  2YJW A;  3D2R A;  2YEH A;  3T0Z A;  5FND A;  2CCS A;  3U2D A;  2XX4 A;  1AH6 A;  2WI7 A;  4EEH A;  4FPP A;  3S5T A;  5M4E A;  3H80 A;  3VHD A;  2YEA A;  1I5D A;  2CCT A;  2QG0 A;  4CE1 A;  4O09 A;  2WI1 A;  5GGZ A;  2H55 A;  4LP0 A;  1YC4 A;  1KIJ A;  3FT5 A;  2IWU A;  3DGE A;  3O0I A;  3CYG A;  4E02 A;  4PRV A;  1GKX A;  2BZ5 A;  2QFO A;  2WER A;  3HYY A;  4O0B A;  1Z59 A;  3A0W A;  2VWC A;  3T0H A;  3C11 A;  3PEJ A;  4NH9 A;  3NMQ A;  1UY8 A;  2YI7 A;  4HXZ A;  4CWR A;  3TZ2 A;  2ZBK B;  1BYQ A;  4XIR A;  1UYM A;  1ZXM A;  2IOP A;  3CWV A;  1YS3 A;  4CWQ A;  3EKR A;  2GFD A;  4XC0 A;  2HHI A;  1ZW9 A;  5L3J A;  2BTZ A;  4XCL A;  2HKJ A;  5D6Q A;  1UYL A;  3O6O A;  3FV5 A;  3HYZ A;  4EGH A;  3GIF A;  4AWP A;  4XKO A;  1Z5B A;  3B24 A; 
#chains in the Genus database with same CATH homology
 2C2A A;  2YKC A;  4P7A A;  5CTU A;  2VCJ A;  4BXI A;  3EHG A;  1AJ6 A;  4E01 A;  1QZR A;  4NH7 A;  4JAV A;  4CWN A;  4XKA A;  1YES A;  4ZVI A;  3TZ5 A;  3RLQ A;  4Q20 A;  4B6C A;  2ZDX A;  2BU6 A;  2QG2 A;  2BU8 A;  1YT2 A;  1U0Z A;  2XX2 A;  4GEE A;  3R4N A;  4ZKI A;  5CTX A;  3HEK A;  4R1F A;  4XDM A;  2CGF A;  3LPS A;  2Q8G A;  2UWD A;  1YC1 A;  1GJV A;  4LWE A;  3O2F A;  2YI0 A;  3FT8 A;  5M4K A;  3A0X A;  3CRK A;  2BU5 A;  4CWS A;  5F3K A;  2YE4 A;  4LWG A;  3OMU A;  2BU7 A;  1TBW A;  4H7Q A;  4HZ5 A;  1TIL A;  1Y8P A;  1I5A A;  1UYE A;  4FCQ A;  2GQP A;  4LPB A;  3T2S A;  4GCZ A;  3CGY A;  1U2O A;  4KFG A;  4U7O A;  2Q2E B;  3C0E A;  2XDX A;  4MPE A;  4HYM A;  2IOQ A;  3INX A;  4X9L A;  3WQ9 A;  1EA6 A;  3HZ1 A;  3BMY A;  2BSM A;  4CWO A;  4P8O A;  1TC0 A;  4B7P A;  1Z5A A;  5BOD A;  2YEG A;  3B25 A;  2XHX A;  3Q5K A;  1TC6 A;  2CH4 A;  4I3H A;  4L90 A;  4O04 A;  4URM A;  4CE3 A;  3HZ5 A;  4LWH A;  4URO A;  4KSH A;  2EXL A;  2YE7 A;  3R4M A;  3D0B A;  4DUH A;  2XJG A;  3OWD A;  2CG9 A;  3R4O A;  3A0Z A;  5CPH A;  4GT8 A;  5CF0 A;  2HG1 A;  4CWF A;  2XAB A;  3T10 A;  2XK2 A;  4WUD A;  1Z5C A;  4MB9 A;  3TZ4 A;  1I59 A;  2BYI A;  3A0T A;  4EGI A;  3QDD A;  3U2K A;  4E00 A;  4XTJ A;  4K4O A;  2XX5 A;  2YKE A;  4L94 A;  2Q8F A;  4XIP A;  3K60 A;  1A4H A;  3ZM7 A;  2YGA A;  3A0R A;  1BKN A;  1NHJ A;  2XHR A;  4CWT A;  2H8M A;  3GIG A;  2FYP A;  2O1W A;  1I5C A;  4AWO A;  3HHU A;  2ZKJ A;  2WEQ A;  3B27 A;  2IOR A;  5D7D A;  4YKU A;  1YC3 A;  2VW5 A;  3A0Y A;  1THN A;  4FMT A;  1JM6 A;  4AWQ A;  2FWY A;  2JJC A;  2WEP A;  4JQL A;  4YKR A;  1Y4S A;  1L0O A;  2BYH A;  4ASF A;  5C93 A;  1ZXN A;  2O1V A;  3LNU A;  5M4M A;  4LWF A;  4R3A A;  1TH8 A;  4H81 A;  1YSZ A;  3OPD A;  4MP7 A;  4YKY A;  4MBC A;  4BIU A;  1NHI A;  1AM1 A;  3BM9 A;  5FWK A;  5FNC A;  3WHA A;  2WI2 A;  4YKW A;  4MPN A;  2QF6 A;  1AH8 A;  4WUC A;  1QYE A;  4BQJ A;  2YI6 A;  1Y8N A;  1UY9 A;  2YE8 A;  5CTY A;  2BRE A;  3ZXO A;  4EFT A;  2YGE A;  1B3Q A;  2XHT A;  4ASG A;  4DZY A;  1KZN A;  3EHJ A;  3OWB A;  1UYH A;  1AMW A;  4EM7 A;  3RKZ A;  3D36 A;  4FCR A;  3OW6 A;  3ZXQ A;  2WI5 A;  2YI5 A;  5J6A A;  4CE2 A;  2ESA A;  3TZ0 A;  1UYD A;  2YEC A;  3B26 A;  4HZ0 A;  3CRL A;  2XDK A;  4GFN A;  2YEB A;  2YEI A;  4ASB A;  4KP4 A;  1S14 A;  4I5S A;  4O05 A;  5D7R A;  2YK9 A;  1UY6 A;  5J71 A;  2XDL A;  4XE2 A;  2YE2 A;  2E0A A;  2XJJ A;  2XJX A;  2YEJ A;  3U67 A;  3VHC A;  3RLP A;  3GIE A;  4L8Z A;  1BXD A;  1BGQ A;  1MX0 A;  2BU2 A;  1YT1 A;  4WUB A;  1QY8 A;  2Q8I A;  2WI6 A;  1OSF A;  4KQV A;  2YK2 A;  1NHH A;  4URN A;  4U7N A;  1ZWH A;  2YEF A;  5F5R A;  4L91 A;  4XIQ A;  4O07 A;  3K97 A;  2XDS A;  3R92 A;  5FNF A;  4BAE A;  3K98 A;  3K99 A;  4XD8 A;  4XKK A;  4NH8 A;  4GGL A;  2ZDY A;  3QTF A;  4CWP A;  1B62 A;  1Y8O A;  2HCH A;  2YE5 A;  4PL9 A;  4EMV A;  3ZKD A;  4H85 A;  2XD6 A;  3CGZ A;  1Y4U A;  2YE3 A;  2BRC A;  3INW A;  3T1K A;  1R62 A;  2WI4 A;  3EKO A;  4LWI A;  5BOC A;  3KE6 A;  4YKT A;  4XCJ A;  3Q5L A;  4XIT A;  3G7E A;  3H4L A;  4MOT A;  2FWZ A;  4R3M A;  1UY7 A;  1I58 A;  5IN9 A;  1UYG A;  2K5B A;  4EGK A;  3VAD A;  4FCP A;  5CTW A;  4YKQ A;  1UYI A;  4L93 A;  4MP2 A;  2YE6 A;  4QPK A;  3EHH A;  3RLR A;  4JAU A;  2YE9 A;  2Q8H A;  5M4N A;  1TID A;  3IED A;  5M4P A;  2VCI A;  2YEE A;  2CCU A;  4U93 A;  1UYK A;  1UYF A;  2XCM A;  4BIZ A;  4HYP A;  4URL A;  2AKP A;  3G75 A;  1H7S A;  1EI1 A;  2IWX A;  3G7B A;  3GIG B;  2YJX A;  4JAS A;  4YKZ A;  2YKI A;  3EHF A;  4ASA A;  1S16 A;  2O1U A;  1ID0 A;  2WI3 A;  5D6P A;  4BQG A;  3SL2 A;  3Q5J A;  3MNR P;  3TTZ A;  1I5B A;  3TUH A;  4GQT A;  4QPJ A;  3R91 A;  2XDU A;  1US7 A;  1YET A;  4PU9 A;  3JZ3 A;  5D7C A;  1MU5 A;  2YED A;  4MPC A;  5IDM A;  4HXW A;  3PEH A;  5M4H A;  4HY1 A;  2FXS A;  1H7U A;  4V26 A;  3R4P A;  4KTN A;  4W7T A;  1YER A;  3VHA A;  4AS9 A;  3B28 A;  4EFU A;  2JKI A;  3ZKB A;  4KSG A;  1UYC A;  1YSR A;  4HY6 A;  4YKX A;  2YGF A;  2BT0 A;  1B63 A;  5IDJ A;  4V25 A;  1PVG A;  1YT0 A;  4PRX A;  2YKJ A;  1GKZ A;  2PNR A;  2IWS A;  2YKB A;  2YJW A;  3D2R A;  2YEH A;  3T0Z A;  5FND A;  2CCS A;  3U2D A;  2XX4 A;  1AH6 A;  2WI7 A;  4EEH A;  4FPP A;  5M4E A;  3H80 A;  3VHD A;  2YEA A;  1I5D A;  2CCT A;  2QG0 A;  4CE1 A;  4O09 A;  2WI1 A;  5GGZ A;  2H55 A;  4LP0 A;  1YC4 A;  1KIJ A;  3FT5 A;  2IWU A;  3DGE A;  3O0I A;  4E02 A;  4PRV A;  1GKX A;  2BZ5 A;  2QFO A;  2WER A;  3HYY A;  4O0B A;  1Z59 A;  3A0W A;  2VWC A;  3T0H A;  3C11 A;  3PEJ A;  4NH9 A;  3NMQ A;  1UY8 A;  2YI7 A;  4HXZ A;  4CWR A;  3TZ2 A;  2ZBK B;  1BYQ A;  4XIR A;  1UYM A;  1ZXM A;  2IOP A;  3CWV A;  1YS3 A;  4CWQ A;  3EKR A;  2GFD A;  4XC0 A;  1ZW9 A;  5L3J A;  2BTZ A;  4XCL A;  2HKJ A;  5D6Q A;  1UYL A;  3O6O A;  3FV5 A;  3HYZ A;  4EGH A;  3GIF A;  4AWP A;  4XKO A;  1Z5B A;  3B24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...