4U7OA

Active histidine kinase bound with atp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
239
structure length
234
Chain Sequence
VTEQQKIDNDRKQFVSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRVDKQGGTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Transferase
molecule keywords Histidine protein kinase sensor protein
total genus 79
structure length 234
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4u7oA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4u7oA02
3IEDA 3ZRVA 4JAVA 4HZ0A 4KFGA 4P7AA 4CE2A 2YE4A 4XE2A 1UYHA 4MBCA 2YECA 5CTYA 1US7A 3RKZA 3A0RA 2CGFA 1B62A 4FPPA 4LC1A 2QG0A 4XIPA 4NH7A 2ZKJA 4KP4A 1YC4A 5F5RA 4U93A 3ZCCA 3T10A 2XX4A 2Q8HA 4PRXA 1YT2A 4BQJA 4LPBA 1YC3A 2YI0A 2XCMA 4KSHA 3CRLA 2IWXA 4CWRA 3VHDA 2QF6A 2GFDA 4P8OA 4FMTA 2WI4A 4YKQA 4ASAA 1ZWHA 2YEHA 4GT8A 3HEKA 4XITA 2Q8IA 3SL2A 2IWUA 3G75A 2YKCA 3H80A 2IWSA 1THNA 4XC0A 3FT8A 3B25A 4YKXA 1YC1A 4H81A 4L93A 4YKWA 4EMVA 5D7RA 4XIQA 3R4NA 2XX2A 3ZKBA 2BSMA 5M4EA 2YE8A 3R91A 1TC6A 2WERA 3RLPA 4BQGA 3TUHA 4NH8A 5J71A 2XDUA 3U2DA 4EFUA 2XDKA 5FWKA 5CF0A 2BT0A 3C0EA 2ESAA 1I58A 2XJXA 2XK2A 4EGIA 2YE6A 5GGZA 1GKZA 2WI6A 4ASGA 2WWWA 4JYBA 4PU9A 3TK1A 2XDXA 4MB9A 3EHJA 3ZKDA 4E01A 2BTZA 2YKJA 1YERA 5D7DA 3D36A 4X9LA 3TZ5A 3D2RA 2LFRA 3KE6A 4L8ZA 3RLRA 3RLQA 2YKBA 4XCLA 1ID0A 3U67A 1YETA 3K99A 2O1UA 4EM7A 4MT8A 4B7PA 4CWTA 1U2OA 4EFTA 5IDMA 4MPEA 1S14A 4XKKA 5BOCA 5D6PA 3Q5KA 3VHCA 4E02A 2O1WA 3EHHA 4MPNA 5F3KA 2Q8GA 1AH8A 4L90A 2H55A 2XX5A 1QYEA 2XD6A 4GT1A 3Q5JA 1ZXNA 3GIGA 3MD0A 2YGAA 1NHJA 4HY6A 4YKZA 3OMUA 3R4OA 2CCTA 2YKIA 2IOPA 2YE2A 2YEJA 4AWOA 5FNFA 4BAEA 2YI7A 4MPCA 3VADA 1EI1A 3GIFA 1NHHA 3WHAA 4JYCA 4XD8A 3A0ZA 4DZYA 4UROA 4AWPA 3CWVA 2BU6A 4KQVA 4YKTA 1Y8NA 5D6QA 1UYLA 5FNDA 2YJWA 2JKIA 3ZXOA 2K5BA 2VW5A 4R1FA 2YK2A 2XHXA 2XDLA 2XHRA 3BM9A 1IXMA 5B1NA 2P67A 3LNUA 1MX0A 1A4HA 1AH6A 3CGZA 1ZW9A 3O2FA 4GCZA 5J6AA 4I5SA 1GKXA 3R92A 4ZKIA 3G7BA 3O6OA 1UYKA 5CTWA 1I5DA 1Z5BA 5D7CA 3B24A 3EKRA 2HKJA 2VCIA 2XDSA 1PVGA 4YKUA 4B6CA 1Z5CA 3TZ0A 4I3HA 2FYPA 4QPKA 4HZ5A 1JOYA 3Q5LA 1UY6A 2FXSA 4HYMA 5M4MA 4H85A 2IORA 3OW6A 4EGKA 1YT1A 4PRVA 3A0YA 1Z5AA 4AWQA 4Q20A 4R3AA 1Y4SA 4E00A 2YE5A 3OPDA 4EEHA 1H7SA 4URMA 3INXA 3INWA 5CTUA 4AS9A 3DGEA 4JAUA 2CCSA 2YEIA 1UYIA 5M4NA 4KTNA 4CWQA 2WI7A 4CWSA 3HYYA 1TIDA 3K60A 4L91A 2E0AA 1ZXMA 1GJVA 4WUBA 4HY1A 3NMQA 5FNCA 1YSRA 3FT5A 3U2KA 1QY8A 2O1VA 2YJXA 2LFSA 2FWYA 1UYDA 3BMYA 2C2AA 2QM8A 1UYMA 1TBWA 1YSZA 3ZRWB 3HHUA 2PNRA 2EXLA 3R4PA 3OWBA 2BU7A 3B26A 4V25A 1I5BA 4CE3A 4XTJA 4YKRA 2FTKA 4MP2A 4GGLA 2QFOA 3K98A 3TZ4A 1BXDA 2YEDA 1S16A 4ASBA 3ZRWA 1TH8A 4YKYA 2HG1A 3GIEA 2YEEA 3LPSA 3B28A 4NH9A 2VWCA 3T0ZA 3OWDA 1U0ZA 4XKAA 3ZM7A 5L3JA 4EGHA 5IN9A 3C11A 3TZ2A 4HXZA 3P32A 1UY9A 2XJGA 2BZ5A 1TILA 3T1KA 2ZDYA 2WEQA 4O0BA 2YE9A 2UWDA 3CGYA 1F51A 2XHTA 4O07A 3FV5A 2WI5A 1OSFA 3NXSA 1UYCA 2BREA 4XCJA 2BYHA 3R4MA 2IOQA 2FWZA 3D0BA 5CTXA 1JM6A 2BYIA 3H4LA 1B63A 3HZ5A 3G7EA 4LWHA 3PEJA 4U7NA 3EKOA 4LP0A 4W7TA 2BRCA 2YE7A 4PL9A 1UYFA 4DUHA 2YE3A 4FCPA 4URLA 4BIZA 2H8MA 1R62A 4WUDA 4URNA 1Y4UA 4V26A 1YESA 4H7QA 2QG2A 5M4PA 3ZXQA 2WI3A 4HXWA 4K4OA 2HCHA 2VCJA 2YEGA 5C93A 4HYPA 3A0TA 4MTXA 2GQPA 4LWGA 2Q2EB 1YT0A 3PEHA 2QM7A 4U7OA 4O05A 3JZ3A 1BGQA 3VHAA 3O0IA 5CPHA 3EHFA 1NHIA 3MNRP 4JQLA 2BU5A 3T0HA 4MOTA 4O09A 4GQTA 4CWFA 1B3QA 4KSGA 3WQ9A 1Y8OA 4ZVIA 4GEEA 4L94A 4LWFA 4R3MA 3GIGB 4LWIA 1YS3A 2YEFA 1I5AA 4XDMA 2XJJA 1AMWA 1AM1A 5BODA 5M4KA 4FCQA 4XKOA 1BKNA 2WEPA 3HZ1A 3QDDA 1BYQA 3TTZA 5IDJA 2BU8A 4GFNA 4CE1A 2CCUA 5M4HA 1KIJA 3A0WA 2ZDXA 1I59A 1UY7A 2CH4A 4FCRA 2ZBKB 2CG9A 1UYEA 1KZNA 1TC0A 3HYZA 3A0XA 4XIRA 2YEBA 4QPJA 2YGEA 1L0OA 4O04A 3QTFA 3EHGA 1H7UA 2BU2A 4MP7A 4WUCA 4JASA 2WI2A 3B27A 2YKEA 3CRKA 1I5CA 1AJ6A 2YI5A 2YK9A 4CWOA 2YGFA 4BIUA 2WI1A 3K97A 4LWEA 1Z59A 2Q8FA 1QZRA 1UY8A 3ZRXA 1EA6A 2JJCA 2YEAA 4BXIA 5B1OA 2AKPA 1MU5A 2XABA 4ASFA 3T2SA 1UYGA 4CWPA 4CWNA 1Y8PA 2YI6A
chains in the Genus database with same CATH superfamily
2M6YA 2EZOA 3BCCH 4PV1B 4HZ0A 4ZHQA 4KFGA 1OCZB 3C3SA 1UJWB 4P7AA 4CE2A 5EC2C 2EULA 1CP9A 2DYRC 1MG1A 4HNAB 4XE2A 3TXSA 3JAKA 3WFVA 5BZBA 1RSOB 3CRAA 1OV9A 3BY6A 3F7VC 4B7EA 2ZKJA 4B3MO 2OYQA 5F5RA 3MDSA 3Q4HB 2XX4A 1SESA 4JAAA 5CA1A 5J2UA 1IVSA 4P30A 4PRXA 4JGSA 3P3PA 2F95B 1V9PA 2XCMA 4KSHA 5CA0A 4CWRA 3M8AA 5A9GA 4UCTA 3VHDA 3E86A 4MVZA 3JD0A 4P8OA 3JD1A 5LP6A 4O4LB 2WLMA 3RT3C 2YEHA 4XITA 3HEKA 1Y6XA 1DF5A 2KB1A 3SL2A 2YKCA 1VF6A 3THOA 4DUZO 1NKDA 3A0HZ 1YJ9V 4X88A 1JFFB 4MTFA 4YKXA 2Q0AA 1SQFA 1GK9A 3ZMTA 4XDKA 2VRZA 3RYIA 5BMVA 4WBNA 1KP3A 4JI6B 1FKAO 1ORQC 4U3JB 2YI9A 4LR3A 2XUMA 2YS8A 4MVRA 1M5IA 1TC6A 3JYCA 4NH8A 5L3DA 1YJWV 2XDKA 2ESAA 2XJXA 2E3CA 1H2GA 4X1IA 1VQ9V 2P06A 2WI6A 1G6UA 2F23A 4JYBA 4PU9A 2P7TC 3JARA 4TT3G 4R50A 4E01A 4JV5O 1YERA 2XOKG 4X9LA 4ZI7A 3ABUA 2LFRA 3X2QC 4L8ZA 3CEIA 4D7SA 2YKBA 3W7TA 1ID0A 3FB7C 1YETA 2ZE5A 4DR7B 5JH7B 3CS5A 4DR5B 4EM7A 4MT8A 1U2OA 3EHBB 5JCOC 4XKKA 3QTCA 4JTDB 3Q5KA 1JR9A 2BTOA 3VQVA 1Q6UA 4TWKA 2O1WA 5IJ0A 1OJHA 4L90A 3E22A 4GT1A 3FKSG 4IHJA 3ZS8C 3GIGA 5B1BB 4FFBB 1K8AW 1NHJA 4ZOLA 3R4OA 2CCTA 2N05A 1Z5WA 2YKIA 3LDEA 1WPXA 5CMUA 4MPCA 1SQQH 2JGUA 3CB2A 4GUNA 4XBFA 2QWOB 3A0ZA 2R9RB 4O4JB 3FAVB 1G8MA 2BU6A 2Q67A 4CS3A 4KQVA 2E76B 4YKTA 3CC2V 3JATB 1OCOB 3H1JH 4R1FA 4MTGA 4DRXB 5LOVB 1Q8IA 4X62O 2YK2A 1BQ0A 4DUYB 4H33A 5LA6A 4TUYB 1K4DC 2P67A 3T1CA 3K57A 1A4HA 5C8YB 3L72H 2QA4V 2UUAO 1VEWA 3VOUA 3E8FA 4RO2A 1XHXA 4FFKA 1MMMA 1B6QA 1LR1A 2WLLB 2Y4UA 4ZKIA 3O6OA 1UYKA 1YIJV 1Z5BA 2LO1A 3B24A 2ZM6O 4FVMA 2XDSA 2UXNA 1NR7A 4J9ZB 1DF4A 4OPHA 4I3HA 2X0LA 1N34B 1XNQO 4PDLA 4GX1A 1BL8A 2IW5A 4QPKA 1JOYA 2JS5A 3SYQA 2EILB 4H85A 3UT5B 3CRQA 1NI8A 2CK3G 4EGKA 1YT1A 3A0YA 1Z5AA 1BT8A 5BR8B 4Q20A 4R3AA 3OPDA 1H7SA 3MHSC 5IE9A 1CEZA 4E72A 3JD3A 4URMA 1PP9H 4D6TH 5GW7A 5M4NA 1XNRB 5EC1C 4CWSA 2YUAA 3BEHA 4FLVA 1K33A 2UXBO 4PJ0Z 2OCCB 1SC5B 3B8NA 4LF7O 4WUBA 3KG2A 2HEPA 3GWKC 4YHHB 4LCUC 3NMQA 2ADPA 1U96A 1P7BA 3U2KA 3CMEV 5KLVH 2C1GA 4Z2WA 3LNMB 2C2AA 3HKCA 2QM8A 4FZ1A 3HHUA 4MVMA 3JAKB 4DV2O 4UCOA 2IU0A 2EXLA 2DN9A 1RSOA 1NS1A 4TQFA 3OWBA 4UCVA 1XNQB 2RDCA 4FLUA 2FTKA 4GGLA 3FX7A 4DV6B 1BXDA 1NR1A 3DXRB 2UUCO 2UXCO 1S16A 1PM9A 4J11A 4I50B 3ZRWA 5KAFZ 1WP7A 2YEEA 3LPSA 1VF6C 1UPGA 2F93B 4NH9A 4KUMA 4XKAA 5CA0B 3ZM7A 5LP6C 1FD9A 2ZIOA 5IN9A 3ZIAG 1VARA 4R8CA 3VQXA 1UY9A 2XJGA 3T1KA 1GN3A 2ZDYA 3SGIA 1RFYA 1XMQO 2UWDA 4FLZA 3C90A 2WI5A 3NXSA 1UYCA 2BREA 2BYHA 3VQYA 4WF9V 4H13B 2HKOA 5BMVB 4LWHA 1JJ2U 2BRCA 2YXYA 1SQVH 2L35A 2PGGA 3ASOC 4KXRA 2Y0PA 4FCPA 4F6EA 4BIZA 5FNVA 1HNWB 3D3QA 4URNA 3K06A 4W4KA 3UQ8A 2WA4A 3CRMA 1OCOC 1YESA 4YIOA 2ZR3A 2QG2A 2VWKA 2ZNJA 3ZXQA 3G67A 3CCMV 2JDIG 2YEGA 2HR3A 3K0GA 4O2BA 1E1RG 3BHPA 4LWGA 2KKWA 2VQEB 3U10A 4ASUG 5JQGA 1YT0A 2LQTA 1Z5VA 4RQFA 1ZTEA 4U7OA 4X65B 3OD4A 4UCUA 3AEIA 3VHAA 5CPHA 1NHIA 3K9AA 5CN0A 2BSKB 4FK5C 3VQWA 3B8MA 4NXMO 2ITCC 2CTPA 1COWG 3QVNA 5IJ0B 4W4LA 3ZEDA 3ZMUA 1S0VA 4DYLA 3GIGB 1R6KA 1VQ4V 2PTMA 1N34O 2YEVB 3FYEB 3LDDA 4F4LA 5CB4A 1IBKB 4XDMA 1EN4A 2HJDA 1AM1A 1JMKC 3CP1A 2P6JA 4ZOLB 3L73H 4PA3A 5KAIZ 1KC8W 3IC7A 4J41A 3CCJV 2LJ2A 2WEPA 3HZ1A 1FFXB 5IDJA 2BU8A 3ABLC 1T5EA 1VQNV 2CCUA 1KB9F 2Q68A 2H94A 1TUBA 5DECA 4O4JA 4WCEV 1WA8A 1NTKH 2OTLV 1GO3F 2HG5C 2YGEA 4QNHB 2Q7HA 1L0OA 3SYPA 3L71H 2D2CB 1H7UA 2BU2A 4MP7A 3JATA 4DR6O 2GHYA 1AJ6A 2YI8A 5DN6G 4BIUA 4MVUA 2HLDG 1R6TA 2Q7GA 2YDEA 1L1FA 1IBMO 3P3NA 4GKKO 4ZHQB 2ZR2A 2JGDB 1UY8A 2CTQA 5C8YA 2UUBO 3N2GB 1QHTA 4HNAA 5B1OA 1Q3EA 1NVPD 1O9HA 5EBWC 5KUKA 3SJBC 3RYFB 4JPRA 2CDYA 1HR0B 1UYGA 2JJ1G 4DR1B 1A32A 3K59A 3A2FA 1Y8PA 3IEDA 2P90A 4JAVA 4X20A 4NB5A 1AR5A 4H0LB 2VWJA 3AG1B 2ZE7A 5CA1B 3FB5C 2ZIMA 3M99B 4B3RO 2YECA 5DM6V 1US7A 3RKZA 1IDSA 1N33O 2CGFA 1OCZC 2QEXV 3EVKA 4NH7A 1KKCA 1S5HC 2GTAA 1PNMA 3G80A 1V54B 1MZFA 4BIOA 1Q82W 1SERA 3T10A 2B5UA 3AG4B 4HYOA 3LSSA 1YT2A 3UT5A 4JI0O 1M56C 4JI3O 4LPBA 1H2SB 4WFHA 2QGNA 4GX0A 1R6NA 1S3JA 1EN5A 1K73W 2RMKB 4LF9O 4O4IB 4LFCO 2QF6A 4LF4B 1TA8A 1YDXA 4FMTA 3W7WA 4ASAA 1F23A 4GT8A 2Q8IA 2IWUA 1AR4A 2IWSA 4XC0A 1H8HG 2QR4A 1MNGA 3FT8A 3JSNA 3OTFA 5HFMA 3W7XA 1VQMV 1OHHG 4I55B 1EZVH 1YC1A 4L93A 4YKWA 4DV1B 2XX2A 2BSMA 5FL7G 2YE8A 4HZ3A 2O57A 2UU9B 1AI5A 2WERA 3RLPA 3TUHA 4QGPA 4LF6B 2OTJV 4JZGA 1HR0O 4EFUA 5FWKA 3C0EA 3H1HH 3TCUA 1PKXA 1RPOA 2FYUH 4JI2O 1YZBA 4Z1VA 2DYSB 2AZ2A 3WU2Z 3TK1A 5JH7A 2XDXA 5LL6Y 3K5MA 4MB9A 5L3CA 2PI4A 4NXNB 4JI5B 2BTZA 2MK3A 3T4DA 3D36A 4PDRA 3ABKC 2OCHA 3RLRA 2HJFC 4L8JA 2PUSA 1SA0B 1N32B 3H1KH 5BXZA 2E5LO 2O1UA 2UUCB 4B7PA 1XHZA 3E22B 2EIJC 3HKEB 5LYJA 1VQPV 3K5LA 1R3LC 2Q73A 4LH6A 3BPZA 5LXTA 5D6PA 4E02A 5K1PA 1XL6A 2QKSA 3RN4A 3ZBHA 5F3KA 1IURA 2Q8GA 2OWOA 3H1IH 1QCEA 2XX5A 1WB8A 4RWUA 3Q5JA 5LGNA 3MD0A 1WP8A 3S3XA 5GONA 4HY6A 3QO8A 2WLJA 2Q0OC 2IOPA 1AI6A 2YE2A 2VQFB 2YEJA 2FMLA 3OTOO 5L3FA 2F66C 5CA3A 4BAEA 2HHHO 3OMNB 4X8AA 2DQ0A 1XOUA 3QNEA 1YTFD 4LF6O 1O9GA 1EI1A 1NHHA 3GIFA 4DV0O 4JYCA 4NVPA 1MSDA 2BE3A 4UROA 1TAEA 1KUQA 4CH6A 1Y8NA 3ZXOA 3FB8C 3OMAB 2K5BA 4IL6Z 2UXDO 2VW5A 5JJNB 2Y0IA 2XHXA 3BM9A 1IXMA 3JD2A 4B7KA 1VP7A 1AI7A 1AH6A 4FLYA 4DW0A 4MVQA 1XDCA 4ABMA 2LGQA 3H01A 4Z1MG 1OCCB 2HP8A 4TQDA 4B3SO 1L8DA 1H38A 3ZN1A 2RJZA 5D7CA 2RCVA 5KMGA 1YTFB 2WAMA 4DW1A 1PVGA 1GH6A 5KHGA 3LSQA 5B1BC 1M90W 3HKDA 1Z5CA 4LFAB 5CB4B 2QWRB 4XDJA 2FYPA 1YCIA 4HZ5A 2BOCC 1GM8A 2VQFO 1F4NA 2FXSA 1H2NA 4DO2A 4LH7A 1XMQB 1M56B 2WLNA 1M1KW 4YJ2A 1NTMH 3BAAA 2IH1C 4E00A 2V7QG 4EEHA 1AROP 4LFCB 4GKKB 1K5SA 3DGEA 4JAUA 2EBOA 4CC5A 3ZRSA 4C7UA 1SQXH 4KTNA 3BA8A 3VBBA 3CD6V 4FLWA 3ETGA 1B04A 2ZCEA 3SJQC 2NN4A 5LHHA 4GLXA 2QTSA 2E0AA 4JYYA 4NTYA 3G71V 3HKCB 1GJVA 3N2GA 1SQBH 3AK3A 1SS3A 3RYFA 3IGAC 3ZHUA 4FM1A 2OCCC 2AHYA 1YSRA 5B66Z 2PYJA 2OT5A 2W6IG 1QY8A 2O1VA 2YJXA 2FWYA 4X20B 3ZHQA 3BMYA 1UYMA 1TBWA 4I50A 3ZRWB 2EIMB 4B3TO 2PNRA 3R4PA 1HNXB 3ABKB 4UV9A 4LFAO 2BU7A 3B26A 1K9MW 4CE3A 1ENVA 4MP2A 4CH4A 3TZ4A 2LP7A 4TV9A 3CCLV 4KHPB 2Q8VA 4BWAA 1BHAA 1BHBA 4UVAA 1TH8A 2HG1A 1S77D 1VF5B 3ABTA 4KL1A 1D5AA 2N04A 2LW1A 3TXQA 4IGGA 5EBLC 4EGHA 4DR2B 4O4IA 3ZMSA 4AI8A 1L0LH 1M57C 2BTQA 4UFZA 1TILA 2WEQA 4WFGA 2YE9A 1WJZA 2XHTA 3LUTB 2YC0A 3R4MA 4PHZA 5FNVB 3H4LA 3G7EA 3PEJA 4U7NA 3JASB 2H3OA 4R6ZA 3OR6C 4PL9A 1E79G 3J80N 2AHZA 3ZJZA 3I5DA 4DUHA 2YE3A 4URLA 5IY5C 1IBMB 2KG7A 4QE7A 3ASOB 1R62A 4WUDA 2WLIA 1Y4UA 4MTOA 5JQGB 4OGQB 2EX3A 1GN6A 2WI3A 3SYCA 1AILA 3LDCA 4J10A 2RNBA 2VCJA 5L3GA 1QQCA 3A0TA 2BSKA 2ETNA 3G6BA 1JPXA 4FIPC 4MW8A 3K9SA 3A8TA 3K03A 3K3WA 2ADQB 3PEHA 1F7YA 3CCRV 2E74B 1KU9A 5J9PC 4KFMA 4LBEC 2PF4E 5B1AC 2QKAA 3MNRP 3SPJA 3HKEA 5LYJB 2YXHA 2BU5A 3RVZA 5LXTB 4DR2O 3OR7C 4CWFA 1QR9A 1WAZA 2NLJC 1VQ6V 1MSWD 3WQ9A 3K04A 3AK2A 4X1YA 1YHQV 3B09A 2GSMB 4GEEA 1QVFU 1IBLO 1YS3A 2YEFA 2JK5C 4Q6GA 5GONB 1AMWA 5BODA 1QNMA 5M4KA 1CXZB 3I56V 4LF4O 4X1KA 1KYOF 1Y76B 1WA8B 4DR7O 4HAMA 3GVMA 4O2AB 3TTZA 3OTOB 1GN4A 3AK1A 2VS0A 4MVSA 5M4HA 4RUFA 2K1EA 1Q7YW 1DTOA 2KSDA 2M7WA 4EB6B 2YICA 4XDLA 3SJCC 2ZBKB 2DMXA 5F2VO 3G4SV 4XIRA 2XASA 3D3IA 2JGDA 4J7KA 2BCCH 2UUAB 4DV7B 5GTHZ 4H37A 3TGUH 2YK9A 5CBHA 4CWOA 4UV8A 2WI1A 3K97A 1FXKB 4DR4O 3ASNB 1QZRA 4X65O 4DV5B 2W0XA 2R72A 4FM0A 1WPBA 4O4HA 5ITZA 1SQPH 4LF9B 3KCYA 1D5NA 2BOBC 3A0BZ 1FJGB 3DC6A 3CC7V 2YI6A 3ZRVA 1HWYA 2CE4A 2CAZC 2HVKC 3RVYA 2EIKB 3CC4V 2YE4A 4MBCA 1P84F 3OEHG 5CTYA 4DUYO 1G1XB 1FXHA 1N0NA 3E35A 1PL4A 1I0HA 2ITDC 4KP4A 1YC4A 1K97A 4CH3A 5IYZB 4U93A 1AP6A 2HVJC 3AG3C 4UXNA 2Q8HA 4X89A 4PA6A 4HBNA 1Q6IA 3KZIZ 1QBZA 2DJVA 2R9AA 2V1DA 3CE2A 2IWXA 3CRLA 2ZDIA 5HFLA 2GV9A 2VQEO 4ZBMA 4JI2B 4I55A 4K0KB 4YKQA 1XQ8A 1AP5A 4N23A 2IJKA 3H80A 1NH2D 1THNA 3K5OA 3B25A 1I5XA 1LUVA 4I4TA 1TUEB 1FAFA 4LF5O 2JVDA 3DTUB 5M4EA 1MOFA 1EBOA 3R91A 5H2FZ 4MS2A 5J71A 3U2DA 5H9CA 3CCUV 2DWEC 3JCUZ 3JAWA 2AZ0A 4DV4B 1FJGO 2AGAA 4EGIA 2YE6A 1SA0A 4YJ3A 1GKZA 4LNUA 1L0NH 4ASGA 5B5EZ 1QR8A 4P9OA 4EKWA 3ZKDA 1EFRG 5BR8O 5EIBC 3D2RA 5EK0A 3FYIB 1PV0A 3R66A 2DOSA 1V54C 1Y74A 2UXBB 3U67A 4MW3A 2PY5A 2Q6AA 3K99A 4JI7B 5B1AB 4BW9A 3CWBH 1BS3A 4EFTA 1AI4A 2IBZH 4MPEA 3PN1A 5BY1A 1Q86W 2F43G 3CYOA 5B3SC 2DYRB 1XMOB 5BOCA 3M7MX 3VHCA 5JJJB 5JVDB 3HPLC 2OIGA 2EIJB 4MSWC 4E4EA 2LGWA 1AH8A 2BTQB 2H55A 2UXDB 5JWPA 5CBFA 1ZXNA 1VF7A 4JV5B 2CUGA 4A5UB 2ZINA 4YKZA 2NR5A 3OMUA 4DK0A 1VQ8V 4UB6Z 3JSLA 5JJEB 4DV1O 1KMIZ 4ICGA 4AWOA 2DWDC 4LFBB 4X64B 4F6RB 5FNFA 1HNZB 4RUEA 1GRJA 4IYHA 4UVBA 2W6JG 5A2QN 3J7AU 4XD8A 3NR7A 4DZYA 2WLIB 5EBMC 5D6QA 1UYLA 5FNDA 1GTOA 2GUZB 1P4RA 1VMGA 3AG2C 5IT9N 4YXWG 3CRRA 4K8ZA 3E8GA 1NT2B 1N0JA 2L6LA 2YIAA 2XDLA 2JEUA 3IJ4A 1FXKC 4B3SB 1OCRC 3LNUA 2X6AA 2IJIA 5KMGB 3CGZA 1ZW9A 2UXXA 4YIPA 4GCZA 1VQKV 2LW7A 4MVOA 4UCRA 5E1AC 2X6BA 1GKXA 3HKDB 3R92A 1RPRA 3RYHA 3IFXA 1Y67A 3G7BA 1I5DA 4J9YB 3LNNA 5FPOA 3CCEV 3B4SA 2A06H 5J2TA 5LBQA 1S5LZ 3OMIB 3EKRA 2W0FC 4X1YB 4JI7O 2VCIA 4YKUA 2EZPA 2XAGA 4YJ2B 1S72V 4AILC 1ZLZA 1BSMA 1UY6A 3L70H 1LUWA 1WNSA 1Y76A 4HYMA 3U0ZA 4O2AA 2IORA 1OZ0A 1AJNA 4DXWA 3OW2U 1SKVA 4DV0B 4K35A 2CTRA 1NZ6A 4IT5A 2CH7A 3WB1A 1VQLV 1Y4SA 3PJSK 5EYPA 4EB6A 3INXA 4AS9A 3B2EE 4B08A 1J5EB 2YEIA 4UUJC 5LHGA 3ZMZA 5IWAB 3E89A 1W0JG 3ZX6A 4GKJB 2A3QA 4UB8Z 1PD3A 3CMAV 4DR3O 4I0XA 4JI1O 3CCVV 2ODMA 1FXKA 1QLEB 1GN2A 1KKDA 4LF5B 4WFFA 2XT9A 3K60A 3TETA 1GAXA 1YF2A 2G38A 2Q69A 1YSCA 5KA6A 5FNCA 2C1IA 4P2ZA 3E2EA 3MHHC 1AVMA 3ZHSA 3T4ZA 4JTCB 2LFSA 4PI2A 4WFAV 4TV9B 1UYDA 1W2BU 3O9OA 3UCSC 3OT7A 3RYCA 3U11A 4CC6A 5KHJA 3WG7B 2F4VB 1AJQA 3I55V 1FYJA 1M93A 2ATKC 1K34A 1I5BA 1R1BA 4YKRA 1FPOA 4GX5A 1K5QA 4QIWF 3K98A 4YY3O 2YEDA 1Q43A 2GDSA 1M4UA 5IYZA 4ASBA 1Q6HA 2ZE6A 5KHHA 3T1YB 2Q5ZA 4DV2B 4X62B 3GIEA 5B3SB 2P5OA 4JYAB 3B28A 3LMMA 4LF8O 3IC9A 5FLXN 2Z0AA 1U0ZA 5L3JA 3C11A 3L9DA 4ZIBA 1ZL8B 4HXZA 4J80A 4WFEA 2IJHA 3JASA 1HDJA 3GWOA 4O07A 3N2KB 3SPIA 1SQGA 1JX9A 1M57B 2B9ZA 3F5TA 3D0BA 2KG7B 1JM6A 4PA9A 4I4TB 4IYIA 2BYIA 4AHCA 1V55B 1B63A 3RFRA 2GBOA 3EKOA 4W7TA 2YE7A 4PD4F 3OGIB 1K4CC 3J81N 2QM4A 1UYFA 2DE0X 4BW5A 5IWAO 2Y69C 1IXBA 2A7WA 3JAMN 1HW7A 5DEDA 2H8MA 1EM1A 4V26A 4LNUB 3G6EV 4PI0A 4NKGB 3CXCU 2EIMC 4JI8O 1KP2A 5IYCO 2HFEC 2YIDA 4JI3B 1NJIW 4HXWA 2HCHA 3O65A 1P49A 3K5NA 1N8RW 2IH3C 2F1MA 2ZNIA 1RM1B 4O05A 1H2LA 3JZ3A 4UCSA 1YEWA 3O0IA 3ABMC 1YITV 2F4VO 3APOA 4E2LA 3MAQA 1XMOO 2ZXWC 1U97A 3T0HA 4MOTA 4O09A 4X1KB 5JVDA 5KHIA 1B3QA 4KSGA 1Y8OA 4DK1A 2Q7EA 4JI5O 4L94A 4LWFA 3T1YO 4R3MA 4YHHO 3LSUA 2MW2B 1LNQA 1N36O 1FXVA 3T1HO 2XJJA 3L75H 4K3AA 5LMNB 4X66B 1N32O 4BR6A 5FPRA 2RQ6A 1WN7A 2A0LA 4OXSA 1BKNA 2E5LB 4XKOA 2ZM6B 3QDDA 1BYQA 5TISZ 4X64O 2JIZG 4OX9B 2B1IA 2YIBA 4LWSB 1KIJA 5IY5B 3F7YC 3SYOA 2CH4A 4FCRA 4DR4B 4DV6O 3SPGA 1TC0A 2JRIA 3A0XA 2YEBA 5LHIA 4O04A 3QTFA 1NTZH 3EHGA 4WUCA 3E8BA 3OEEG 2YKEA 3CRKA 2YI5A 4GYCB 4O4HB 4RAIA 5ITZB 4JI1B 4LWEA 1Z59A 3OE7G 1ZWIC 1WB7A 3N27A 2Q8FA 5IJ9A 4DR6B 3OFNG 3CCQV 4BXIA 3BFRA 2AKPA 4DV3B 3EFFK 3ASNC 4CZZA 2XAFA 4JI4B 2XABA 4G28B 3RYHB 5EZYA 2EINC 4D7TA 1GKFA 2ZKOA 2E75B 2WSSG 3AG7A 4FLXA 3CJHA 3R65A 4H44B 3QO5A 2X6CA 1UYHA 1TVKB 3A0RA 1B62A 4FPPA 4TV8A 1BE3H 1SRYA 4LC1A 2QG0A 4JTAB 3SDLA 4XIPA 4X66O 3X2QB 5KX5B 3BVOA 1W59A 3ZCCA 1J5EO 3H9VA 1NBMG 4QJFB 4FLTA 2QDOA 4BQJA 1ZAUA 3DC5A 4JYAO 1IX9A 1YC3A 2YI0A 3ZHVA 1BQZA 3S5TA 4DV4O 2CH7B 3AG3B 1ZUQA 2KQXA 4NTWA 2GFDA 1JQ0A 2JEXA 2WI4A 1ZWHA 2XNDG 1QU7A 5J2UB 2UXCB 2CGOA 3G75A 3C3TA 1KQSU 2QJ1A 1W0KG 5KHKA 2ARHA 4I0XB 3ZHRA 2Z3YA 4CBCA 2CGNA 3JAWB 4H81A 4EMVA 2PI5A 2Z5UA 4XIQA 3UO3A 2DQ3A 5D7RA 4YJ3B 3R4NA 3OUFA 1Q90D 3ZKBA 1RP3B 4AQYB 2JS3A 2WPDG 1UFIA 2K9PA 1XUQA 5AG2A 5CBGA 1IBLB 1HNXO 4NXNO 4BQGA 2XDUA 1JFFA 2Y69B 4JI4O 2QE7G 5IYDO 5CF0A 3H1LH 2BT0A 1I58A 3BA9A 3CPWU 2XK2A 5GGZA 1Y74B 3CRCA 3E83A 1YXBA 4WBNB 2WWWA 1P7GA 1OCCC 1I7FA 1SZTA 3EHJA 4X9QA 3RW0A 5KA5A 2YKJA 1QLNA 5D7DA 3TZ5A 4LF8B 2IU3A 3KE6A 3RLQA 4XCLA 5K1XA 2ZD9A 3JARB 4FJCC 3OAAG 3ABMB 4CWTA 5IDMA 2UU9O 1AB3A 1S14A 4EFBA 5LGUA 2ZXWB 1M9NA 4GX2A 4NR1A 4B3MB 3CYGA 3EHHA 4MPNA 1XBLA 2Y4TA 4R7CA 1QYEA 2XD6A 4F6RA 3ETDA 3ZHTA 4B3TB 2HHHB 3HR0A 2R70A 2PYLA 2YGAA 2NNUA 4UVCA 4WFBV 5KUMA 1URFA 5LMNO 2PZSA 5GTIZ 2P22C 1XREA 4KHPO 2DW4A 1DLBA 3D8CA 2GUZA 1I5YA 4DR5O 4B3RB 2YI7A 3VADA 1PNKA 4FFBA 3WHAA 4DR3B 4PA4A 1D2DA 1BCCH 2EJ7A 2V4DA 4AWPA 3CWVA 5H6QA 3ML0A 2YJWA 3HKBB 4U3FH 2JKIA 3F5WC 4NTXA 2WLHA 3OUSA 3CX5F 1GMGA 3OM3B 1I94O 1SETA 2JJ2G 1BGYH 3STZC 1N33B 3QO7A 2XHRA 4CS2A 5B1NA 3FAVA 4FZ0A 3AG2B 4IIJA 2X7RB 4CS4A 1MX0A 4K0KO 1Y66A 1EN6A 1K3EA 2N74A 3SR2C 3JALA 5J2TB 5E79Z 4RQEA 3O2FA 2R9IA 1PPJH 5J6AA 3S3WA 4I5SA 2DYSC 4G2KA 5LOVA 5JENA 2EINB 1JVMA 3KCXA 5CTWA 3GB7C 3BABA 3E8HA 2HKJA 3ETEA 2QWNB 2UUBB 3OGCC 4B6CA 3TZ0A 2EILC 1FS0G 1ZSPA 2WLLA 4N21A 2ZDIC 2QWQB 1VQ7V 5EYPB 3Q4HA 2ZT9B 3Q5LA 2OIEA 3SPCA 2ILMA 1HNZO 5M4MA 1KBHA 3OW6A 3W7SA 4PRVA 1ZX3A 1MA1A 4AWQA 2YE5A 1H2KA 1R73A 4QE9A 3INWA 5CTUA 4I9WA 2WLKA 4O4LA 5LP6B 2CCSA 1DGSA 3UKMA 4BAYA 2QTOA 1UYIA 4FM2A 1JA8A 1GM7A 4CWQA 2WI7A 1OCRB 3HYYA 3CHXA 1JCHA 1TIDA 3RYIB 5L3EA 1XILA 1Q81W 2QSAA 4PDVA 5IJ9B 4L91A 4OPAA 1I08A 4U3JA 3W7UA 1ZXMA 3UM7A 3RYCB 4HY1A 1X59A 4DUZB 1YJNV 4LP8A 5LMUB 2HHIA 1XL4A 2XAHA 3FT5A 5EZYB 4X1IB 5L3BA 1N4CA 3P30A 4NYKA 4YY3B 4K8XA 1PNLA 4JI6O 3CJHB 4LF7B 1Z2GA 1BZKA 1YSZA 2WA3A 3CCSV 5IYBO 1TGOA 2XHBA 2IJJA 4ZI7B 2RN9A 1XI1A 1S76D 3RWRD 4V25A 3B40A 4J7ZA 4TV8B 3WB2A 4XTJA 2QFOA 1R3KC 2XAQA 5KX5A 1ZL8A 5D5QA 1NQTA 2ZE8A 3FD9A 3HB3B 3UO2A 3QF7A 4YKYA 2CTWA 4J7JA 2H8PC 3N2KA 1KECA 4EEQA 1THZA 1N36B 4DR1O 2YXLA 3JCZA 3K08A 2VWCA 3T0ZA 1SF9A 3OWDA 2Y48A 1YI2V 3DSQA 3TZ2A 3DXRA 2AXTZ 3P32A 2BZ5A 1MZEA 4G27B 4EFEA 1GM9A 4O0BA 4IHJB 3ETQA 3CGYA 1BMFG 4P9PA 1F51A 4L87A 4GZRB 3FV5A 1NU1H 1OSFA 3B77A 1VIBA 4XCJA 1VQ5V 2IOQA 2FWZA 1QLEC 5CTXA 5D5PA 3HZ5A 2ZQMA 2EJRA 3APQA 1H2MA 4LP0A 1JJOA 2XTAA 3CXHF 1IZ3A 2P4VA 1ROPA 1V55C 5LMUO 4JZ2A 1R3JC 1SZXA 3WB0A 3CSXA 3SYAA 1EZJA 1YVWA 1G4YB 1NVPB 1MABG 1X4TA 3WG7C 3QG5A 4H7QA 5M4PA 4DRXA 3K79A 4PA7A 4K4OA 5LA6B 2FKXA 3T2MA 4TUYA 5C93A 4HYPA 2EIKC 2IM9A 2B1GA 1PL0A 4MTXA 2GQPA 2A79B 1CPYA 3BRCA 5JCOA 1DK1A 2Q2EB 4J42A 3EXAA 3SJAC 2QM7A 1B06A 4OX9O 1BGQA 3EHFA 4GKJO 1XEQA 4JQLA 1RM1C 4O2BB 3K0DA 2GTSA 1FFTB 3T1HB 2QWPB 2D3OW 1HNWO 4GQTA 2Q4PA 2P4KA 4LFBO 4PDMA 3L74H 1Y4MA 4ZVIA 1US6A 3RBZA 4LWIA 3ZMVA 1NH2B 5H6RA 1Q5OA 3RGBA 2XAJA 4LWSA 1VQOV 5LGTA 1I5AA 3ABLB 4FCQA 4NXMB 2AW9A 4DV5O 4I9QA 2FL4A 1K92A 2YIBD 3ZN0A 1HP8A 3AG4C 1S5JA 4GFNA 1I94B 4CE1A 4JI0B 3IAYA 4CH5A 2YEVA 3A0WA 1IBKO 3FB6C 4TOIA 1I59A 2ZDXA 1UY7A 2Q9LA 3TJTA 4PELA 2CG9A 1UYEA 2FB5A 1KZNA 1AJPA 3HYZA 3KKYA 2QKCA 3JD4A 4TSFG 4QPJA 4AQYO 1FFXA 2YSUB 3D36C 1QVGU 3FFQA 4JI8B 3HKBA 1R3IC 4JASA 2WI2A 4JF3A 3B27A 1XNRO 1I5CA 3SPHA 2YGFA 4DV3O 1K7DA 1TUBB 4IIJB 1E1QG 3K58A 1H8EG 3ICXA 3ZRXA 5H5NA 1EA6A 3JALB 4I7ZB 2JJCA 4DV7O 2YEAA 2A9HA 1AR1B 1WLEA 1J95A 3AG1C 1TVKA 3STLC 1MU5A 1F4MA 5EIBD 3T2SA 4ASFA 4CWPA 4CWNA 1KD1W
chains in the Genus database with same CATH topology
3IEDA 1GKFA 2P90A 4JAVA 3ZRVA 2EZOA 4HZ0A 2WSSG 1HWYA 2HVKC 3RVYA 4KFGA 1OCZB 2EIKB 3AG1B 1UJWB 3CC4V 4P7AA 2YE4A 5EC2C 4CE2A 1CP9A 2DYRC 1MG1A 3FB5C 3R65A 4XE2A 3WFVA 3M99B 2X6CA 3QO5A 5BZBA 1UYHA 2YECA 4MBCA 3OEHG 5DM6V 5CTYA 1US7A 3RKZA 3A0RA 1FXHA 2CGFA 1B62A 3E35A 4FPPA 3BY6A 1SRYA 1OCZC 3F7VC 4LC1A 4JTAB 2QG0A 2QEXV 4XIPA 4NH7A 2ITDC 3X2QB 1S5HC 2ZKJA 1PNMA 4KP4A 1YC4A 1K97A 1V54B 5F5RA 4U93A 3ZCCA 1Q82W 1SERA 2HVJC 3AG3C 2XX4A 3T10A 2B5UA 4UXNA 1SESA 3AG4B 4HYOA 3LSSA 4P30A 4PRXA 4X89A 4PA6A 1YT2A 1NBMG 4QJFB 2Q8HA 1M56C 4JGSA 4BQJA 4LPBA 1YC3A 4WFHA 2YI0A 1QBZA 1R6NA 1S3JA 4GX0A 2XCMA 4KSHA 1K73W 2V1DA 2IWXA 3CRLA 3AG3B 2ZDIA 4CWRA 5HFLA 4ZBMA 3E86A 4MVZA 2QF6A 2GFDA 3VHDA 3JD0A 4P8OA 1JQ0A 3JD1A 2JEXA 2WLMA 4FMTA 3W7WA 2WI4A 4YKQA 1F23A 2XNDG 1ZWHA 2YEHA 3HEKA 4GT8A 1DF5A 2KB1A 4XITA 2Q8IA 3SL2A 4N23A 2IJKA 2IWUA 3G75A 2YKCA 3H80A 1NH2D 1KQSU 1THNA 2IWSA 4XC0A 1H8HG 3FT8A 1W0KG 1NKDA 1YJ9V 4X88A 5HFMA 3W7XA 4MTFA 3B25A 4CBCA 1VQMV 1OHHG 2Z3YA 4YKXA 1I5XA 1GK9A 3ZMTA 4XDKA 1YC1A 4H81A 4L93A 4YKWA 4EMVA 2PI5A 2Z5UA 4XIQA 1TUEB 2DQ3A 5D7RA 3R4NA 2XX2A 3OUFA 3ZKBA 1KP3A 2BSMA 1ORQC 5FL7G 2WPDG 3DTUB 5M4EA 1MOFA 4HZ3A 4MVRA 1EBOA 2YE8A 3R91A 1TC6A 5CBGA 1AI5A 3JYCA 2WERA 3RLPA 2OTJV 4BQGA 3TUHA 4NH8A 4MS2A 2XDUA 5J71A 2Y69B 3U2DA 5H9CA 3CCUV 5L3DA 4EFUA 2QE7G 2DWEC 5IYDO 1YJWV 2XDKA 2BT0A 3C0EA 5CF0A 5FWKA 3TCUA 2ESAA 1I58A 3CPWU 2XJXA 1H2GA 1PKXA 1VQ9V 1RPOA 2XK2A 2YE6A 5GGZA 4EGIA 3E83A 1GKZA 2DYSB 2WI6A 4ASGA 2WWWA 4JYBA 4PU9A 1OCCC 1QR8A 3TK1A 2XDXA 2YI6A 2P7TC 4P9OA 4MB9A 5L3CA 1SZTA 4EKWA 4TT3G 4R50A 1EFRG 3RW0A 2PI4A 5KA5A 2BTZA 3EHJA 3ZKDA 2YKJA 4E01A 2MK3A 1YERA 3T4DA 3D36A 2XOKG 1QLNA 4X9LA 5D7DA 3TZ5A 3ABUA 4PDRA 3D2RA 5EK0A 2LFRA 2IU3A 3ABKC 3FYIB 3X2QC 3KE6A 4L8ZA 3RLRA 2HJFC 3RLQA 2YKBA 1V54C 3W7TA 4XCLA 1ID0A 3FB7C 3U67A 1YETA 4MW3A 2ZD9A 2Q6AA 3K99A 2O1UA 4FJCC 4EM7A 4MT8A 3OAAG 3ABMB 5B1AB 4B7PA 4CWTA 1U2OA 4EFTA 1AI4A 2EIJC 1VQPV 4MPEA 3EHBB 5IDMA 1Q86W 2F43G 1S14A 4XKKA 3CYOA 5B3SC 5LGUA 2DYRB 2ZXWB 1R3LC 5BOCA 4JTDB 5D6PA 3Q5KA 3VHCA 1M9NA 4E02A 4GX2A 1XL6A 2QKSA 3HPLC 4TWKA 2O1WA 3EHHA 4MPNA 4MSWC 2EIJB 5F3KA 2Q8GA 4WUCA 1AH8A 4L90A 4R7CA 1QCEA 1QYEA 2H55A 2XX5A 2XD6A 3ETDA 4GT1A 3FKSG 5CBFA 1ZXNA 3GIGA 3Q5JA 5B1BB 5LGNA 3MD0A 1K8AW 3ZXOA 2YGAA 1NHJA 2NNUA 4UVCA 4HY6A 3QO8A 4YKZA 4WFBV 2WLJA 5KUMA 3OMUA 1VQ8V 3R4OA 2CCTA 2YKIA 2IOPA 1AI6A 2YE2A 2YEJA 2DW4A 1DLBA 4AWOA 2DWDC 5L3FA 3LDEA 1WPXA 5CA3A 4RUEA 1I5YA 4BAEA 5CMUA 5FNFA 2YI7A 4MPCA 3VADA 1PNKA 3OMNB 4XIRA 4UVBA 2DQ0A 3QNEA 4X8AA 1YTFD 1EI1A 1NHHA 2W6JG 3GIFA 3WHAA 4XBFA 4JYCA 4PA4A 4XD8A 3A0ZA 4DZYA 2R9RB 4UROA 4AWPA 3CWVA 1G8MA 2BU6A 2Q67A 5H6QA 4KQVA 2WLIB 4YKTA 5EBMC 1Y8NA 5D6QA 1UYLA 5FNDA 1GTOA 3ML0A 2YJWA 1P4RA 3CC2V 2JKIA 3AG2C 3FB8C 3F5WC 3OMAB 2K5BA 2WLHA 3OUSA 1OCOB 4YXWG 2VW5A 1GMGA 4R1FA 3OM3B 4MTGA 3E8GA 1SETA 2JJ2G 2YK2A 2XHXA 2XDLA 3STZC 2JEUA 3QO7A 2XHRA 4H33A 1FXKC 3BM9A 1IXMA 1OCRC 5B1NA 3JD2A 1K4DC 2P67A 3T1CA 3AG2B 2X6AA 3LNUA 2X7RB 1AI7A 1MX0A 1A4HA 2IJIA 1AH6A 1Y66A 3CGZA 1K3EA 1ZW9A 2UXXA 3O2FA 4RQEA 4GCZA 1VQKV 2R9IA 4MVOA 5J6AA 5E1AC 2QA4V 4MVQA 4I5SA 2DYSC 2X6BA 4G2KA 1GKXA 3VOUA 3H01A 4Z1MG 3E8FA 4RO2A 3R92A 1OCCB 1RPRA 2EINB 3IFXA 1B6QA 1JVMA 2WLLB 4ZKIA 3G7BA 3O6OA 1H38A 1UYKA 5CTWA 3ZN1A 3GB7C 1YIJV 1I5DA 1Z5BA 3E8HA 4J9YB 3CCEV 1YTFB 5D7CA 3B24A 5LBQA 3EKRA 3OMIB 2HKJA 2W0FC 3ETEA 2WAMA 2VCIA 2XDSA 1PVGA 4YKUA 2UXNA 2EZPA 2XAGA 3LSQA 5B1BC 1NR7A 3OGCC 1M90W 4J9ZB 1DF4A 1Z5CA 3TZ0A 4B6CA 1S72V 2EILC 4I3HA 2X0LA 1FS0G 2WLLA 4N21A 2ZDIC 4PDLA 4XDJA 2FYPA 4GX1A 1BL8A 1VQ7V 2IW5A 4QPKA 4HZ5A 2BOCC 1GM8A 1JOYA 3SYQA 3Q5LA 1UY6A 1F4NA 2FXSA 3A0XA 4HYMA 3SPCA 4DO2A 2EILB 5M4MA 4H85A 1M56B 1OZ0A 1AJNA 2WLNA 4DXWA 3W7SA 1M1KW 2IORA 3OW6A 2CK3G 3OW2U 4EGKA 1YT1A 4PRVA 3A0YA 1Z5AA 4AWQA 4Q20A 4R3AA 2IH1C 1VQLV 1Y4SA 2V7QG 2YE5A 3OPDA 4E00A 1AROP 1H7SA 4EEHA 3MHSC 3PJSK 1CEZA 1R73A 3JD3A 4URMA 4QE9A 3INXA 3INWA 5CTUA 4AS9A 1K5SA 2WLKA 3DGEA 4I9WA 4JAUA 2EBOA 2CCSA 3UKMA 4BAYA 5GW7A 2QTOA 2YEIA 4UUJC 1UYIA 5LHGA 3ZMZA 3ZRSA 3E89A 1W0JG 1GM7A 5M4NA 5EC1C 4KTNA 4CWQA 2WI7A 1PD3A 3CMAV 4CWSA 1OCRB 3VBBA 3CD6V 3BEHA 3ETGA 3HYYA 3CCVV 1K33A 1FXKA 1JCHA 1TIDA 5L3EA 1QLEB 1Q81W 3SJQC 2OCCB 1KKDA 5LHHA 4WFFA 4PDVA 3K60A 4L91A 3B8NA 3TETA 3W7UA 2E0AA 1ZXMA 3UM7A 3G71V 1GJVA 4WUBA 3KG2A 2Q69A 1YSCA 5KA6A 4HY1A 3NMQA 4LCUC 5FNCA 1YJNV 3IGAC 4LP8A 2OCCC 4P2ZA 3E2EA 2AHYA 1YSRA 1XL4A 2XAHA 3MHHC 3FT5A 1P7BA 5L3BA 3P30A 3U2KA 3T4ZA 2OT5A 2W6IG 4JTCB 1QY8A 2O1VA 2YJXA 2LFSA 3CMEV 2FWYA 4WFAV 1UYDA 1PNLA 1W2BU 3LNMB 2C2AA 3BMYA 2QM8A 1UYMA 1TBWA 1YSZA 3CCSV 3ZRWB 3HHUA 2EIMB 4MVMA 3WG7B 5IYBO 2PNRA 2IJJA 2EXLA 2IU0A 3R4PA 1AJQA 3I55V 1S76D 3OWBA 2ATKC 3ABKB 4UV9A 2BU7A 3B26A 1K34A 1K9MW 1I5BA 4V25A 4CE3A 1ENVA 4XTJA 4YKRA 2FTKA 4MP2A 4GX5A 4GGLA 1K5QA 4QIWF 2QFOA 3K98A 1R3KC 2XAQA 3TZ4A 1BXDA 1NR1A 2LP7A 2YEDA 3CCLV 1NQTA 1BHAA 1S16A 1BHBA 4ASBA 3ZRWA 3HB3B 4UVAA 1TH8A 4YKYA 2HG1A 1S77D 3GIEA 3ABTA 5B3SB 2H8PC 2YEEA 3LPSA 3B28A 1KECA 1THZA 5EBLC 4NH9A 3JCZA 3K08A 4KUMA 2VWCA 3T0ZA 3OWDA 1U0ZA 2Y48A 4XKAA 3ZM7A 5L3JA 4EGHA 5IN9A 3C11A 3ZMSA 1YI2V 3ZIAG 3TZ2A 4HXZA 4R8CA 4WFEA 1M57C 3P32A 1UY9A 2XJGA 2BZ5A 2IJHA 1TILA 4G27B 2WEQA 2ZDYA 3T1KA 4WFGA 1GM9A 4O0BA 2YE9A 2UWDA 3CGYA 1BMFG 4P9PA 3GWOA 1F51A 4L87A 2XHTA 4O07A 3FV5A 3SPIA 2WI5A 3LUTB 3NXSA 1OSFA 3B77A 1UYCA 2BREA 1JX9A 2BYHA 4XCJA 1M57B 1VQ5V 3R4MA 2IOQA 4WF9V 2FWZA 1QLEC 3D0BA 5CTXA 1JM6A 4PA9A 2BYIA 3H4LA 1V55B 1B63A 3HZ5A 3G7EA 2HKOA 2EJRA 2ZQMA 4LWHA 1JJ2U 3PEJA 4U7NA 3EKOA 4LP0A 4W7TA 4R6ZA 3OR6C 2BRCA 2YE7A 4PL9A 3ASOC 1K4CC 1UYFA 1E79G 2AHZA 3ZJZA 4BW5A 4DUHA 1ROPA 1V55C 2YE3A 4ASAA 1R3JC 4FCPA 2Y69C 4URLA 5IY5C 4BIZA 3SYAA 1EZJA 4QE7A 2H8MA 3ASOB 1R62A 4WUDA 1G4YB 4URNA 2WLIA 1NVPB 3K06A 1Y4UA 1MABG 4MTOA 4V26A 3G6EV 3CXCU 1OCOC 1YESA 2EIMC 3WG7C 2ZR3A 2QG2A 4H7QA 1KP2A 3K79A 3ZXQA 5M4PA 5IYCO 2HFEC 3SYCA 2WI3A 4PA7A 1NJIW 3CCMV 4HXWA 3LDCA 2JDIG 4K4OA 2HCHA 2VCJA 5L3GA 3T2MA 2HR3A 5C93A 2YEGA 4HYPA 3K0GA 3A0TA 2EIKC 1E1RG 2B1GA 1PL0A 4MTXA 2GQPA 1JPXA 4LWGA 2A79B 4FIPC 1CPYA 4MW8A 2IH3C 1N8RW 4ASUG 2Q2EB 3K03A 1RM1B 1YT0A 3K3WA 3PEHA 3CCRV 4RQFA 2QM7A 4U7OA 5J9PC 4O05A 3JZ3A 3AEIA 1BGQA 4KFMA 3VHAA 3O0IA 4LBEC 5CPHA 3ABMC 5B1AC 1YITV 1NHIA 3EHFA 3MNRP 3SPJA 3K9AA 4JQLA 5CN0A 1RM1C 4E2LA 3K0DA 2BU5A 2ZXWC 3T0HA 1FFTB 3RVZA 4MOTA 2D3OW 3OR7C 4FK5C 4O09A 3B8MA 4GQTA 4CWFA 1QR9A 2ITCC 2NLJC 1B3QA 4KSGA 1VQ6V 1COWG 1MSWD 3K04A 4PDMA 1Y8OA 3WQ9A 1YHQV 1Y4MA 2GSMB 4ZVIA 4GEEA 4L94A 3ZMUA 1S0VA 1QVFU 3RBZA 3GIGB 4LWFA 4LWIA 3ZMVA 1NH2B 4R3MA 1R6KA 5H6RA 1VQ4V 1YS3A 2YEFA 2JK5C 2XAJA 2YEVB 3FYEB 3LDDA 4F4LA 5LGTA 1VQOV 1LNQA 1I5AA 2XJJA 1FXVA 3ABLB 1AM1A 1AMWA 4XDMA 5BODA 3CP1A 2P6JA 5M4KA 4FCQA 3I56V 4PA3A 1KC8W 3IC7A 2A0LA 4OXSA 3CCJV 1BKNA 4XKOA 4HAMA 2WEPA 1K92A 3HZ1A 1Y8PA 3QDDA 1BYQA 3ZN0A 3TTZA 2JIZG 5IDJA 2BU8A 3AG4C 3ABLC 4GFNA 1VQNV 4CE1A 2CCUA 2B1IA 4MVSA 5M4HA 2YEVA 1KIJA 3A0WA 4RUFA 5IY5B 2K1EA 2Q68A 3F7YC 1Q7YW 1DTOA 3FB6C 2ZDXA 3SYOA 2H94A 1I59A 2M7WA 1UY7A 4XDLA 2CH4A 4FCRA 2ZBKB 4PELA 3SPGA 1UYEA 4WCEV 2CG9A 1KZNA 1AJPA 1TC0A 3HYZA 2OTLV 3JD4A 3G4SV 2YEBA 2XASA 1GO3F 2HG5C 3D3IA 2YSUB 4QPJA 4TSFG 4QNHB 5LHIA 1QVGU 3SYPA 1L0OA 2YGEA 3EHGA 1H7UA 1R3IC 2BU2A 3E8BA 3QTFA 4MP7A 4O04A 3OEEG 4JASA 4JF3A 2GHYA 2WI2A 2YKEA 1I5CA 1AJ6A 3B27A 3CRKA 4H37A 3SPHA 2YI5A 2YK9A 5CBHA 4CWOA 2YGFA 4RAIA 4UV8A 5DN6G 4BIUA 1K7DA 4MVUA 2HLDG 2WI1A 3K97A 4LWEA 1L1FA 1FXKB 1Z59A 3OE7G 1E1QG 3ASNB 1H8EG 1ZWIC 2Q8FA 1QZRA 2ZR2A 1UY8A 3ZRXA 1EA6A 2JJCA 3OFNG 2YEAA 3CCQV 5B1OA 4BXIA 2A9HA 1NVPD 1AR1B 5EBWC 1WLEA 5KUKA 1J95A 3AG1C 3EFFK 2AKPA 3ASNC 4JPRA 4CZZA 3STLC 1MU5A 2XAFA 2XABA 1F4MA 4G28B 3T2SA 2BOBC 1UYGA 4ASFA 2JJ1G 4CWPA 2EINC 4CWNA 1KD1W 3CC7V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IED A;  3ZRV A;  4JAV A;  4HZ0 A;  4KFG A;  4P7A A;  4CE2 A;  2YE4 A;  4XE2 A;  1UYH A;  4MBC A;  2YEC A;  5CTY A;  1US7 A;  3RKZ A;  3A0R A;  2CGF A;  1B62 A;  4FPP A;  4LC1 A;  2QG0 A;  4XIP A;  4NH7 A;  2ZKJ A;  4KP4 A;  1YC4 A;  5F5R A;  4U93 A;  3ZCC A;  3T10 A;  2XX4 A;  2Q8H A;  4PRX A;  1YT2 A;  4BQJ A;  4LPB A;  1YC3 A;  2YI0 A;  2XCM A;  4KSH A;  3CRL A;  2IWX A;  4CWR A;  3VHD A;  2QF6 A;  2GFD A;  4P8O A;  4FMT A;  2WI4 A;  4YKQ A;  4ASA A;  1ZWH A;  2YEH A;  4GT8 A;  3HEK A;  4XIT A;  2Q8I A;  3SL2 A;  2IWU A;  3G75 A;  2YKC A;  3H80 A;  2IWS A;  1THN A;  4XC0 A;  3FT8 A;  3B25 A;  4YKX A;  1YC1 A;  4H81 A;  4L93 A;  4YKW A;  4EMV A;  5D7R A;  4XIQ A;  3R4N A;  2XX2 A;  3ZKB A;  2BSM A;  5M4E A;  2YE8 A;  3R91 A;  1TC6 A;  2WER A;  3RLP A;  4BQG A;  3TUH A;  4NH8 A;  5J71 A;  2XDU A;  3U2D A;  4EFU A;  2XDK A;  5FWK A;  5CF0 A;  2BT0 A;  3C0E A;  2ESA A;  1I58 A;  2XJX A;  2XK2 A;  4EGI A;  2YE6 A;  5GGZ A;  1GKZ A;  2WI6 A;  4ASG A;  2WWW A;  4JYB A;  4PU9 A;  3TK1 A;  2XDX A;  4MB9 A;  3EHJ A;  3ZKD A;  4E01 A;  2BTZ A;  2YKJ A;  1YER A;  5D7D A;  3D36 A;  4X9L A;  3TZ5 A;  3D2R A;  2LFR A;  3KE6 A;  4L8Z A;  3RLR A;  3RLQ A;  2YKB A;  4XCL A;  1ID0 A;  3U67 A;  1YET A;  3K99 A;  2O1U A;  4EM7 A;  4MT8 A;  4B7P A;  4CWT A;  1U2O A;  4EFT A;  5IDM A;  4MPE A;  1S14 A;  4XKK A;  5BOC A;  5D6P A;  3Q5K A;  3VHC A;  4E02 A;  2O1W A;  3EHH A;  4MPN A;  5F3K A;  2Q8G A;  1AH8 A;  4L90 A;  2H55 A;  2XX5 A;  1QYE A;  2XD6 A;  4GT1 A;  3Q5J A;  1ZXN A;  3GIG A;  3MD0 A;  2YGA A;  1NHJ A;  4HY6 A;  4YKZ A;  3OMU A;  3R4O A;  2CCT A;  2YKI A;  2IOP A;  2YE2 A;  2YEJ A;  4AWO A;  5FNF A;  4BAE A;  2YI7 A;  4MPC A;  3VAD A;  1EI1 A;  3GIF A;  1NHH A;  3WHA A;  4JYC A;  4XD8 A;  3A0Z A;  4DZY A;  4URO A;  4AWP A;  3CWV A;  2BU6 A;  4KQV A;  4YKT A;  1Y8N A;  5D6Q A;  1UYL A;  5FND A;  2YJW A;  2JKI A;  3ZXO A;  2K5B A;  2VW5 A;  4R1F A;  2YK2 A;  2XHX A;  2XDL A;  2XHR A;  3BM9 A;  1IXM A;  5B1N A;  2P67 A;  3LNU A;  1MX0 A;  1A4H A;  1AH6 A;  3CGZ A;  1ZW9 A;  3O2F A;  4GCZ A;  5J6A A;  4I5S A;  1GKX A;  3R92 A;  4ZKI A;  3G7B A;  3O6O A;  1UYK A;  5CTW A;  1I5D A;  1Z5B A;  5D7C A;  3B24 A;  3EKR A;  2HKJ A;  2VCI A;  2XDS A;  1PVG A;  4YKU A;  4B6C A;  1Z5C A;  3TZ0 A;  4I3H A;  2FYP A;  4QPK A;  4HZ5 A;  1JOY A;  3Q5L A;  1UY6 A;  2FXS A;  4HYM A;  5M4M A;  4H85 A;  2IOR A;  3OW6 A;  4EGK A;  1YT1 A;  4PRV A;  3A0Y A;  1Z5A A;  4AWQ A;  4Q20 A;  4R3A A;  1Y4S A;  4E00 A;  2YE5 A;  3OPD A;  4EEH A;  1H7S A;  4URM A;  3INX A;  3INW A;  5CTU A;  4AS9 A;  3DGE A;  4JAU A;  2CCS A;  2YEI A;  1UYI A;  5M4N A;  4KTN A;  4CWQ A;  2WI7 A;  4CWS A;  3HYY A;  1TID A;  3K60 A;  4L91 A;  2E0A A;  1ZXM A;  1GJV A;  4WUB A;  4HY1 A;  3NMQ A;  5FNC A;  1YSR A;  3FT5 A;  3U2K A;  1QY8 A;  2O1V A;  2YJX A;  2LFS A;  2FWY A;  1UYD A;  3BMY A;  2C2A A;  2QM8 A;  1UYM A;  1TBW A;  1YSZ A;  3ZRW B;  3HHU A;  2PNR A;  2EXL A;  3R4P A;  3OWB A;  2BU7 A;  3B26 A;  4V25 A;  1I5B A;  4CE3 A;  4XTJ A;  4YKR A;  2FTK A;  4MP2 A;  4GGL A;  2QFO A;  3K98 A;  3TZ4 A;  1BXD A;  2YED A;  1S16 A;  4ASB A;  3ZRW A;  1TH8 A;  4YKY A;  2HG1 A;  3GIE A;  2YEE A;  3LPS A;  3B28 A;  4NH9 A;  2VWC A;  3T0Z A;  3OWD A;  1U0Z A;  4XKA A;  3ZM7 A;  5L3J A;  4EGH A;  5IN9 A;  3C11 A;  3TZ2 A;  4HXZ A;  3P32 A;  1UY9 A;  2XJG A;  2BZ5 A;  1TIL A;  3T1K A;  2ZDY A;  2WEQ A;  4O0B A;  2YE9 A;  2UWD A;  3CGY A;  1F51 A;  2XHT A;  4O07 A;  3FV5 A;  2WI5 A;  1OSF A;  3NXS A;  1UYC A;  2BRE A;  4XCJ A;  2BYH A;  3R4M A;  2IOQ A;  2FWZ A;  3D0B A;  5CTX A;  1JM6 A;  2BYI A;  3H4L A;  1B63 A;  3HZ5 A;  3G7E A;  4LWH A;  3PEJ A;  4U7N A;  3EKO A;  4LP0 A;  4W7T A;  2BRC A;  2YE7 A;  4PL9 A;  1UYF A;  4DUH A;  2YE3 A;  4FCP A;  4URL A;  4BIZ A;  2H8M A;  1R62 A;  4WUD A;  4URN A;  1Y4U A;  4V26 A;  1YES A;  4H7Q A;  2QG2 A;  5M4P A;  3ZXQ A;  2WI3 A;  4HXW A;  4K4O A;  2HCH A;  2VCJ A;  2YEG A;  5C93 A;  4HYP A;  3A0T A;  4MTX A;  2GQP A;  4LWG A;  2Q2E B;  1YT0 A;  3PEH A;  2QM7 A;  4U7O A;  4O05 A;  3JZ3 A;  1BGQ A;  3VHA A;  3O0I A;  5CPH A;  3EHF A;  1NHI A;  3MNR P;  4JQL A;  2BU5 A;  3T0H A;  4MOT A;  4O09 A;  4GQT A;  4CWF A;  1B3Q A;  4KSG A;  3WQ9 A;  1Y8O A;  4ZVI A;  4GEE A;  4L94 A;  4LWF A;  4R3M A;  3GIG B;  4LWI A;  1YS3 A;  2YEF A;  1I5A A;  4XDM A;  2XJJ A;  1AMW A;  1AM1 A;  5BOD A;  5M4K A;  4FCQ A;  4XKO A;  1BKN A;  2WEP A;  3HZ1 A;  3QDD A;  1BYQ A;  3TTZ A;  5IDJ A;  2BU8 A;  4GFN A;  4CE1 A;  2CCU A;  5M4H A;  1KIJ A;  3A0W A;  2ZDX A;  1I59 A;  1UY7 A;  2CH4 A;  4FCR A;  2ZBK B;  2CG9 A;  1UYE A;  1KZN A;  1TC0 A;  3HYZ A;  3A0X A;  4XIR A;  2YEB A;  4QPJ A;  2YGE A;  1L0O A;  4O04 A;  3QTF A;  3EHG A;  1H7U A;  2BU2 A;  4MP7 A;  4WUC A;  4JAS A;  2WI2 A;  3B27 A;  2YKE A;  3CRK A;  1I5C A;  1AJ6 A;  2YI5 A;  2YK9 A;  4CWO A;  2YGF A;  4BIU A;  2WI1 A;  3K97 A;  4LWE A;  1Z59 A;  2Q8F A;  1QZR A;  1UY8 A;  3ZRX A;  1EA6 A;  2JJC A;  2YEA A;  4BXI A;  5B1O A;  2AKP A;  1MU5 A;  2XAB A;  4ASF A;  3T2S A;  1UYG A;  4CWP A;  4CWN A;  1Y8P A;  2YI6 A; 
#chains in the Genus database with same CATH topology
 2M6Y A;  2EZO A;  3BCC H;  4PV1 B;  4HZ0 A;  4ZHQ A;  4KFG A;  1OCZ B;  3C3S A;  1UJW B;  4P7A A;  4CE2 A;  5EC2 C;  2EUL A;  1CP9 A;  2DYR C;  1MG1 A;  4HNA B;  4XE2 A;  3TXS A;  3JAK A;  3WFV A;  5BZB A;  1RSO B;  3CRA A;  1OV9 A;  3BY6 A;  3F7V C;  4B7E A;  2ZKJ A;  4B3M O;  2OYQ A;  5F5R A;  3MDS A;  3Q4H B;  2XX4 A;  1SES A;  4JAA A;  5CA1 A;  5J2U A;  1IVS A;  4P30 A;  4PRX A;  4JGS A;  3P3P A;  2F95 B;  1V9P A;  2XCM A;  4KSH A;  5CA0 A;  4CWR A;  3M8A A;  5A9G A;  4UCT A;  3VHD A;  3E86 A;  4MVZ A;  3JD0 A;  4P8O A;  3JD1 A;  5LP6 A;  4O4L B;  2WLM A;  3RT3 C;  2YEH A;  4XIT A;  3HEK A;  1Y6X A;  1DF5 A;  2KB1 A;  3SL2 A;  2YKC A;  1VF6 A;  3THO A;  4DUZ O;  1NKD A;  3A0H Z;  1YJ9 V;  4X88 A;  1JFF B;  4MTF A;  4YKX A;  2Q0A A;  1SQF A;  1GK9 A;  3ZMT A;  4XDK A;  2VRZ A;  3RYI A;  5BMV A;  4WBN A;  1KP3 A;  4JI6 B;  1FKA O;  1ORQ C;  4U3J B;  2YI9 A;  4LR3 A;  2XUM A;  2YS8 A;  4MVR A;  1M5I A;  1TC6 A;  3JYC A;  4NH8 A;  5L3D A;  1YJW V;  2XDK A;  2ESA A;  2XJX A;  2E3C A;  1H2G A;  4X1I A;  1VQ9 V;  2P06 A;  2WI6 A;  1G6U A;  2F23 A;  4JYB A;  4PU9 A;  2P7T C;  3JAR A;  4TT3 G;  4R50 A;  4E01 A;  4JV5 O;  1YER A;  2XOK G;  4X9L A;  4ZI7 A;  3ABU A;  2LFR A;  3X2Q C;  4L8Z A;  3CEI A;  4D7S A;  2YKB A;  3W7T A;  1ID0 A;  3FB7 C;  1YET A;  2ZE5 A;  4DR7 B;  5JH7 B;  3CS5 A;  4DR5 B;  4EM7 A;  4MT8 A;  1U2O A;  3EHB B;  5JCO C;  4XKK A;  3QTC A;  4JTD B;  3Q5K A;  1JR9 A;  2BTO A;  3VQV A;  1Q6U A;  4TWK A;  2O1W A;  5IJ0 A;  1OJH A;  4L90 A;  3E22 A;  4GT1 A;  3FKS G;  4IHJ A;  3ZS8 C;  3GIG A;  5B1B B;  4FFB B;  1K8A W;  1NHJ A;  4ZOL A;  3R4O A;  2CCT A;  2N05 A;  1Z5W A;  2YKI A;  3LDE A;  1WPX A;  5CMU A;  4MPC A;  1SQQ H;  2JGU A;  3CB2 A;  4GUN A;  4XBF A;  2QWO B;  3A0Z A;  2R9R B;  4O4J B;  3FAV B;  1G8M A;  2BU6 A;  2Q67 A;  4CS3 A;  4KQV A;  2E76 B;  4YKT A;  3CC2 V;  3JAT B;  1OCO B;  3H1J H;  4R1F A;  4MTG A;  4DRX B;  5LOV B;  1Q8I A;  4X62 O;  2YK2 A;  1BQ0 A;  4DUY B;  4H33 A;  5LA6 A;  4TUY B;  1K4D C;  2P67 A;  3T1C A;  3K57 A;  1A4H A;  5C8Y B;  3L72 H;  2QA4 V;  2UUA O;  1VEW A;  3VOU A;  3E8F A;  4RO2 A;  1XHX A;  4FFK A;  1MMM A;  1B6Q A;  1LR1 A;  2WLL B;  2Y4U A;  4ZKI A;  3O6O A;  1UYK A;  1YIJ V;  1Z5B A;  2LO1 A;  3B24 A;  2ZM6 O;  4FVM A;  2XDS A;  2UXN A;  1NR7 A;  4J9Z B;  1DF4 A;  4OPH A;  4I3H A;  2X0L A;  1N34 B;  1XNQ O;  4PDL A;  4GX1 A;  1BL8 A;  2IW5 A;  4QPK A;  1JOY A;  2JS5 A;  3SYQ A;  2EIL B;  4H85 A;  3UT5 B;  3CRQ A;  1NI8 A;  2CK3 G;  4EGK A;  1YT1 A;  3A0Y A;  1Z5A A;  1BT8 A;  5BR8 B;  4Q20 A;  4R3A A;  3OPD A;  1H7S A;  3MHS C;  5IE9 A;  1CEZ A;  4E72 A;  3JD3 A;  4URM A;  1PP9 H;  4D6T H;  5GW7 A;  5M4N A;  1XNR B;  5EC1 C;  4CWS A;  2YUA A;  3BEH A;  4FLV A;  1K33 A;  2UXB O;  4PJ0 Z;  2OCC B;  1SC5 B;  3B8N A;  4LF7 O;  4WUB A;  3KG2 A;  2HEP A;  3GWK C;  4YHH B;  4LCU C;  3NMQ A;  2ADP A;  1U96 A;  1P7B A;  3U2K A;  3CME V;  5KLV H;  2C1G A;  4Z2W A;  3LNM B;  2C2A A;  3HKC A;  2QM8 A;  4FZ1 A;  3HHU A;  4MVM A;  3JAK B;  4DV2 O;  4UCO A;  2IU0 A;  2EXL A;  2DN9 A;  1RSO A;  1NS1 A;  4TQF A;  3OWB A;  4UCV A;  1XNQ B;  2RDC A;  4FLU A;  2FTK A;  4GGL A;  3FX7 A;  4DV6 B;  1BXD A;  1NR1 A;  3DXR B;  2UUC O;  2UXC O;  1S16 A;  1PM9 A;  4J11 A;  4I50 B;  3ZRW A;  5KAF Z;  1WP7 A;  2YEE A;  3LPS A;  1VF6 C;  1UPG A;  2F93 B;  4NH9 A;  4KUM A;  4XKA A;  5CA0 B;  3ZM7 A;  5LP6 C;  1FD9 A;  2ZIO A;  5IN9 A;  3ZIA G;  1VAR A;  4R8C A;  3VQX A;  1UY9 A;  2XJG A;  3T1K A;  1GN3 A;  2ZDY A;  3SGI A;  1RFY A;  1XMQ O;  2UWD A;  4FLZ A;  3C90 A;  2WI5 A;  3NXS A;  1UYC A;  2BRE A;  2BYH A;  3VQY A;  4WF9 V;  4H13 B;  2HKO A;  5BMV B;  4LWH A;  1JJ2 U;  2BRC A;  2YXY A;  1SQV H;  2L35 A;  2PGG A;  3ASO C;  4KXR A;  2Y0P A;  4FCP A;  4F6E A;  4BIZ A;  5FNV A;  1HNW B;  3D3Q A;  4URN A;  3K06 A;  4W4K A;  3UQ8 A;  2WA4 A;  3CRM A;  1OCO C;  1YES A;  4YIO A;  2ZR3 A;  2QG2 A;  2VWK A;  2ZNJ A;  3ZXQ A;  3G67 A;  3CCM V;  2JDI G;  2YEG A;  2HR3 A;  3K0G A;  4O2B A;  1E1R G;  3BHP A;  4LWG A;  2KKW A;  2VQE B;  3U10 A;  4ASU G;  5JQG A;  1YT0 A;  2LQT A;  1Z5V A;  4RQF A;  1ZTE A;  4U7O A;  4X65 B;  3OD4 A;  4UCU A;  3AEI A;  3VHA A;  5CPH A;  1NHI A;  3K9A A;  5CN0 A;  2BSK B;  4FK5 C;  3VQW A;  3B8M A;  4NXM O;  2ITC C;  2CTP A;  1COW G;  3QVN A;  5IJ0 B;  4W4L A;  3ZED A;  3ZMU A;  1S0V A;  4DYL A;  3GIG B;  1R6K A;  1VQ4 V;  2PTM A;  1N34 O;  2YEV B;  3FYE B;  3LDD A;  4F4L A;  5CB4 A;  1IBK B;  4XDM A;  1EN4 A;  2HJD A;  1AM1 A;  1JMK C;  3CP1 A;  2P6J A;  4ZOL B;  3L73 H;  4PA3 A;  5KAI Z;  1KC8 W;  3IC7 A;  4J41 A;  3CCJ V;  2LJ2 A;  2WEP A;  3HZ1 A;  1FFX B;  5IDJ A;  2BU8 A;  3ABL C;  1T5E A;  1VQN V;  2CCU A;  1KB9 F;  2Q68 A;  2H94 A;  1TUB A;  5DEC A;  4O4J A;  4WCE V;  1WA8 A;  1NTK H;  2OTL V;  1GO3 F;  2HG5 C;  2YGE A;  4QNH B;  2Q7H A;  1L0O A;  3SYP A;  3L71 H;  2D2C B;  1H7U A;  2BU2 A;  4MP7 A;  3JAT A;  4DR6 O;  2GHY A;  1AJ6 A;  2YI8 A;  5DN6 G;  4BIU A;  4MVU A;  2HLD G;  1R6T A;  2Q7G A;  2YDE A;  1L1F A;  1IBM O;  3P3N A;  4GKK O;  4ZHQ B;  2ZR2 A;  2JGD B;  1UY8 A;  2CTQ A;  5C8Y A;  2UUB O;  3N2G B;  1QHT A;  4HNA A;  5B1O A;  1Q3E A;  1NVP D;  1O9H A;  5EBW C;  5KUK A;  3SJB C;  3RYF B;  4JPR A;  2CDY A;  1HR0 B;  1UYG A;  2JJ1 G;  4DR1 B;  1A32 A;  3K59 A;  3A2F A;  1Y8P A;  3IED A;  2P90 A;  4JAV A;  4X20 A;  4NB5 A;  1AR5 A;  4H0L B;  2VWJ A;  3AG1 B;  2ZE7 A;  5CA1 B;  3FB5 C;  2ZIM A;  3M99 B;  4B3R O;  2YEC A;  5DM6 V;  1US7 A;  3RKZ A;  1IDS A;  1N33 O;  2CGF A;  1OCZ C;  2QEX V;  3EVK A;  4NH7 A;  1KKC A;  1S5H C;  2GTA A;  1PNM A;  3G80 A;  1V54 B;  1MZF A;  4BIO A;  1Q82 W;  1SER A;  3T10 A;  2B5U A;  3AG4 B;  4HYO A;  3LSS A;  1YT2 A;  3UT5 A;  4JI0 O;  1M56 C;  4JI3 O;  4LPB A;  1H2S B;  4WFH A;  2QGN A;  4GX0 A;  1R6N A;  1S3J A;  1EN5 A;  1K73 W;  2RMK B;  4LF9 O;  4O4I B;  4LFC O;  2QF6 A;  4LF4 B;  1TA8 A;  1YDX A;  4FMT A;  3W7W A;  4ASA A;  1F23 A;  4GT8 A;  2Q8I A;  2IWU A;  1AR4 A;  2IWS A;  4XC0 A;  1H8H G;  2QR4 A;  1MNG A;  3FT8 A;  3JSN A;  3OTF A;  5HFM A;  3W7X A;  1VQM V;  1OHH G;  4I55 B;  1EZV H;  1YC1 A;  4L93 A;  4YKW A;  4DV1 B;  2XX2 A;  2BSM A;  5FL7 G;  2YE8 A;  4HZ3 A;  2O57 A;  2UU9 B;  1AI5 A;  2WER A;  3RLP A;  3TUH A;  4QGP A;  4LF6 B;  2OTJ V;  4JZG A;  1HR0 O;  4EFU A;  5FWK A;  3C0E A;  3H1H H;  3TCU A;  1PKX A;  1RPO A;  2FYU H;  4JI2 O;  1YZB A;  4Z1V A;  2DYS B;  2AZ2 A;  3WU2 Z;  3TK1 A;  5JH7 A;  2XDX A;  5LL6 Y;  3K5M A;  4MB9 A;  5L3C A;  2PI4 A;  4NXN B;  4JI5 B;  2BTZ A;  2MK3 A;  3T4D A;  3D36 A;  4PDR A;  3ABK C;  2OCH A;  3RLR A;  2HJF C;  4L8J A;  2PUS A;  1SA0 B;  1N32 B;  3H1K H;  5BXZ A;  2E5L O;  2O1U A;  2UUC B;  4B7P A;  1XHZ A;  3E22 B;  2EIJ C;  3HKE B;  5LYJ A;  1VQP V;  3K5L A;  1R3L C;  2Q73 A;  4LH6 A;  3BPZ A;  5LXT A;  5D6P A;  4E02 A;  5K1P A;  1XL6 A;  2QKS A;  3RN4 A;  3ZBH A;  5F3K A;  1IUR A;  2Q8G A;  2OWO A;  3H1I H;  1QCE A;  2XX5 A;  1WB8 A;  4RWU A;  3Q5J A;  5LGN A;  3MD0 A;  1WP8 A;  3S3X A;  5GON A;  4HY6 A;  3QO8 A;  2WLJ A;  2Q0O C;  2IOP A;  1AI6 A;  2YE2 A;  2VQF B;  2YEJ A;  2FML A;  3OTO O;  5L3F A;  2F66 C;  5CA3 A;  4BAE A;  2HHH O;  3OMN B;  4X8A A;  2DQ0 A;  1XOU A;  3QNE A;  1YTF D;  4LF6 O;  1O9G A;  1EI1 A;  1NHH A;  3GIF A;  4DV0 O;  4JYC A;  4NVP A;  1MSD A;  2BE3 A;  4URO A;  1TAE A;  1KUQ A;  4CH6 A;  1Y8N A;  3ZXO A;  3FB8 C;  3OMA B;  2K5B A;  4IL6 Z;  2UXD O;  2VW5 A;  5JJN B;  2Y0I A;  2XHX A;  3BM9 A;  1IXM A;  3JD2 A;  4B7K A;  1VP7 A;  1AI7 A;  1AH6 A;  4FLY A;  4DW0 A;  4MVQ A;  1XDC A;  4ABM A;  2LGQ A;  3H01 A;  4Z1M G;  1OCC B;  2HP8 A;  4TQD A;  4B3S O;  1L8D A;  1H38 A;  3ZN1 A;  2RJZ A;  5D7C A;  2RCV A;  5KMG A;  1YTF B;  2WAM A;  4DW1 A;  1PVG A;  1GH6 A;  5KHG A;  3LSQ A;  5B1B C;  1M90 W;  3HKD A;  1Z5C A;  4LFA B;  5CB4 B;  2QWR B;  4XDJ A;  2FYP A;  1YCI A;  4HZ5 A;  2BOC C;  1GM8 A;  2VQF O;  1F4N A;  2FXS A;  1H2N A;  4DO2 A;  4LH7 A;  1XMQ B;  1M56 B;  2WLN A;  1M1K W;  4YJ2 A;  1NTM H;  3BAA A;  2IH1 C;  4E00 A;  2V7Q G;  4EEH A;  1ARO P;  4LFC B;  4GKK B;  1K5S A;  3DGE A;  4JAU A;  2EBO A;  4CC5 A;  3ZRS A;  4C7U A;  1SQX H;  4KTN A;  3BA8 A;  3VBB A;  3CD6 V;  4FLW A;  3ETG A;  1B04 A;  2ZCE A;  3SJQ C;  2NN4 A;  5LHH A;  4GLX A;  2QTS A;  2E0A A;  4JYY A;  4NTY A;  3G71 V;  3HKC B;  1GJV A;  3N2G A;  1SQB H;  3AK3 A;  1SS3 A;  3RYF A;  3IGA C;  3ZHU A;  4FM1 A;  2OCC C;  2AHY A;  1YSR A;  5B66 Z;  2PYJ A;  2OT5 A;  2W6I G;  1QY8 A;  2O1V A;  2YJX A;  2FWY A;  4X20 B;  3ZHQ A;  3BMY A;  1UYM A;  1TBW A;  4I50 A;  3ZRW B;  2EIM B;  4B3T O;  2PNR A;  3R4P A;  1HNX B;  3ABK B;  4UV9 A;  4LFA O;  2BU7 A;  3B26 A;  1K9M W;  4CE3 A;  1ENV A;  4MP2 A;  4CH4 A;  3TZ4 A;  2LP7 A;  4TV9 A;  3CCL V;  4KHP B;  2Q8V A;  4BWA A;  1BHA A;  1BHB A;  4UVA A;  1TH8 A;  2HG1 A;  1S77 D;  1VF5 B;  3ABT A;  4KL1 A;  1D5A A;  2N04 A;  2LW1 A;  3TXQ A;  4IGG A;  5EBL C;  4EGH A;  4DR2 B;  4O4I A;  3ZMS A;  4AI8 A;  1L0L H;  1M57 C;  2BTQ A;  4UFZ A;  1TIL A;  2WEQ A;  4WFG A;  2YE9 A;  1WJZ A;  2XHT A;  3LUT B;  2YC0 A;  3R4M A;  4PHZ A;  5FNV B;  3H4L A;  3G7E A;  3PEJ A;  4U7N A;  3JAS B;  2H3O A;  4R6Z A;  3OR6 C;  4PL9 A;  1E79 G;  3J80 N;  2AHZ A;  3ZJZ A;  3I5D A;  4DUH A;  2YE3 A;  4URL A;  5IY5 C;  1IBM B;  2KG7 A;  4QE7 A;  3ASO B;  1R62 A;  4WUD A;  2WLI A;  1Y4U A;  4MTO A;  5JQG B;  4OGQ B;  2EX3 A;  1GN6 A;  2WI3 A;  3SYC A;  1AIL A;  3LDC A;  4J10 A;  2RNB A;  2VCJ A;  5L3G A;  1QQC A;  3A0T A;  2BSK A;  2ETN A;  3G6B A;  1JPX A;  4FIP C;  4MW8 A;  3K9S A;  3A8T A;  3K03 A;  3K3W A;  2ADQ B;  3PEH A;  1F7Y A;  3CCR V;  2E74 B;  1KU9 A;  5J9P C;  4KFM A;  4LBE C;  2PF4 E;  5B1A C;  2QKA A;  3MNR P;  3SPJ A;  3HKE A;  5LYJ B;  2YXH A;  2BU5 A;  3RVZ A;  5LXT B;  4DR2 O;  3OR7 C;  4CWF A;  1QR9 A;  1WAZ A;  2NLJ C;  1VQ6 V;  1MSW D;  3WQ9 A;  3K04 A;  3AK2 A;  4X1Y A;  1YHQ V;  3B09 A;  2GSM B;  4GEE A;  1QVF U;  1IBL O;  1YS3 A;  2YEF A;  2JK5 C;  4Q6G A;  5GON B;  1AMW A;  5BOD A;  1QNM A;  5M4K A;  1CXZ B;  3I56 V;  4LF4 O;  4X1K A;  1KYO F;  1Y76 B;  1WA8 B;  4DR7 O;  4HAM A;  3GVM A;  4O2A B;  3TTZ A;  3OTO B;  1GN4 A;  3AK1 A;  2VS0 A;  4MVS A;  5M4H A;  4RUF A;  2K1E A;  1Q7Y W;  1DTO A;  2KSD A;  2M7W A;  4EB6 B;  2YIC A;  4XDL A;  3SJC C;  2ZBK B;  2DMX A;  5F2V O;  3G4S V;  4XIR A;  2XAS A;  3D3I A;  2JGD A;  4J7K A;  2BCC H;  2UUA B;  4DV7 B;  5GTH Z;  4H37 A;  3TGU H;  2YK9 A;  5CBH A;  4CWO A;  4UV8 A;  2WI1 A;  3K97 A;  1FXK B;  4DR4 O;  3ASN B;  1QZR A;  4X65 O;  4DV5 B;  2W0X A;  2R72 A;  4FM0 A;  1WPB A;  4O4H A;  5ITZ A;  1SQP H;  4LF9 B;  3KCY A;  1D5N A;  2BOB C;  3A0B Z;  1FJG B;  3DC6 A;  3CC7 V;  2YI6 A;  3ZRV A;  1HWY A;  2CE4 A;  2CAZ C;  2HVK C;  3RVY A;  2EIK B;  3CC4 V;  2YE4 A;  4MBC A;  1P84 F;  3OEH G;  5CTY A;  4DUY O;  1G1X B;  1FXH A;  1N0N A;  3E35 A;  1PL4 A;  1I0H A;  2ITD C;  4KP4 A;  1YC4 A;  1K97 A;  4CH3 A;  5IYZ B;  4U93 A;  1AP6 A;  2HVJ C;  3AG3 C;  4UXN A;  2Q8H A;  4X89 A;  4PA6 A;  4HBN A;  1Q6I A;  3KZI Z;  1QBZ A;  2DJV A;  2R9A A;  2V1D A;  3CE2 A;  2IWX A;  3CRL A;  2ZDI A;  5HFL A;  2GV9 A;  2VQE O;  4ZBM A;  4JI2 B;  4I55 A;  4K0K B;  4YKQ A;  1XQ8 A;  1AP5 A;  4N23 A;  2IJK A;  3H80 A;  1NH2 D;  1THN A;  3K5O A;  3B25 A;  1I5X A;  1LUV A;  4I4T A;  1TUE B;  1FAF A;  4LF5 O;  2JVD A;  3DTU B;  5M4E A;  1MOF A;  1EBO A;  3R91 A;  5H2F Z;  4MS2 A;  5J71 A;  3U2D A;  5H9C A;  3CCU V;  2DWE C;  3JCU Z;  3JAW A;  2AZ0 A;  4DV4 B;  1FJG O;  2AGA A;  4EGI A;  2YE6 A;  1SA0 A;  4YJ3 A;  1GKZ A;  4LNU A;  1L0N H;  4ASG A;  5B5E Z;  1QR8 A;  4P9O A;  4EKW A;  3ZKD A;  1EFR G;  5BR8 O;  5EIB C;  3D2R A;  5EK0 A;  3FYI B;  1PV0 A;  3R66 A;  2DOS A;  1V54 C;  1Y74 A;  2UXB B;  3U67 A;  4MW3 A;  2PY5 A;  2Q6A A;  3K99 A;  4JI7 B;  5B1A B;  4BW9 A;  3CWB H;  1BS3 A;  4EFT A;  1AI4 A;  2IBZ H;  4MPE A;  3PN1 A;  5BY1 A;  1Q86 W;  2F43 G;  3CYO A;  5B3S C;  2DYR B;  1XMO B;  5BOC A;  3M7M X;  3VHC A;  5JJJ B;  5JVD B;  3HPL C;  2OIG A;  2EIJ B;  4MSW C;  4E4E A;  2LGW A;  1AH8 A;  2BTQ B;  2H55 A;  2UXD B;  5JWP A;  5CBF A;  1ZXN A;  1VF7 A;  4JV5 B;  2CUG A;  4A5U B;  2ZIN A;  4YKZ A;  2NR5 A;  3OMU A;  4DK0 A;  1VQ8 V;  4UB6 Z;  3JSL A;  5JJE B;  4DV1 O;  1KMI Z;  4ICG A;  4AWO A;  2DWD C;  4LFB B;  4X64 B;  4F6R B;  5FNF A;  1HNZ B;  4RUE A;  1GRJ A;  4IYH A;  4UVB A;  2W6J G;  5A2Q N;  3J7A U;  4XD8 A;  3NR7 A;  4DZY A;  2WLI B;  5EBM C;  5D6Q A;  1UYL A;  5FND A;  1GTO A;  2GUZ B;  1P4R A;  1VMG A;  3AG2 C;  5IT9 N;  4YXW G;  3CRR A;  4K8Z A;  3E8G A;  1NT2 B;  1N0J A;  2L6L A;  2YIA A;  2XDL A;  2JEU A;  3IJ4 A;  1FXK C;  4B3S B;  1OCR C;  3LNU A;  2X6A A;  2IJI A;  5KMG B;  3CGZ A;  1ZW9 A;  2UXX A;  4YIP A;  4GCZ A;  1VQK V;  2LW7 A;  4MVO A;  4UCR A;  5E1A C;  2X6B A;  1GKX A;  3HKD B;  3R92 A;  1RPR A;  3RYH A;  3IFX A;  1Y67 A;  3G7B A;  1I5D A;  4J9Y B;  3LNN A;  5FPO A;  3CCE V;  3B4S A;  2A06 H;  5J2T A;  5LBQ A;  1S5L Z;  3OMI B;  3EKR A;  2W0F C;  4X1Y B;  4JI7 O;  2VCI A;  4YKU A;  2EZP A;  2XAG A;  4YJ2 B;  1S72 V;  4AIL C;  1ZLZ A;  1BSM A;  1UY6 A;  3L70 H;  1LUW A;  1WNS A;  1Y76 A;  4HYM A;  3U0Z A;  4O2A A;  2IOR A;  1OZ0 A;  1AJN A;  4DXW A;  3OW2 U;  1SKV A;  4DV0 B;  4K35 A;  2CTR A;  1NZ6 A;  4IT5 A;  2CH7 A;  3WB1 A;  1VQL V;  1Y4S A;  3PJS K;  5EYP A;  4EB6 A;  3INX A;  4AS9 A;  3B2E E;  4B08 A;  1J5E B;  2YEI A;  4UUJ C;  5LHG A;  3ZMZ A;  5IWA B;  3E89 A;  1W0J G;  3ZX6 A;  4GKJ B;  2A3Q A;  4UB8 Z;  1PD3 A;  3CMA V;  4DR3 O;  4I0X A;  4JI1 O;  3CCV V;  2ODM A;  1FXK A;  1QLE B;  1GN2 A;  1KKD A;  4LF5 B;  4WFF A;  2XT9 A;  3K60 A;  3TET A;  1GAX A;  1YF2 A;  2G38 A;  2Q69 A;  1YSC A;  5KA6 A;  5FNC A;  2C1I A;  4P2Z A;  3E2E A;  3MHH C;  1AVM A;  3ZHS A;  3T4Z A;  4JTC B;  2LFS A;  4PI2 A;  4WFA V;  4TV9 B;  1UYD A;  1W2B U;  3O9O A;  3UCS C;  3OT7 A;  3RYC A;  3U11 A;  4CC6 A;  5KHJ A;  3WG7 B;  2F4V B;  1AJQ A;  3I55 V;  1FYJ A;  1M93 A;  2ATK C;  1K34 A;  1I5B A;  1R1B A;  4YKR A;  1FPO A;  4GX5 A;  1K5Q A;  4QIW F;  3K98 A;  4YY3 O;  2YED A;  1Q43 A;  2GDS A;  1M4U A;  5IYZ A;  4ASB A;  1Q6H A;  2ZE6 A;  5KHH A;  3T1Y B;  2Q5Z A;  4DV2 B;  4X62 B;  3GIE A;  5B3S B;  2P5O A;  4JYA B;  3B28 A;  3LMM A;  4LF8 O;  3IC9 A;  5FLX N;  2Z0A A;  1U0Z A;  5L3J A;  3C11 A;  3L9D A;  4ZIB A;  1ZL8 B;  4HXZ A;  4J80 A;  4WFE A;  2IJH A;  3JAS A;  1HDJ A;  3GWO A;  4O07 A;  3N2K B;  3SPI A;  1SQG A;  1JX9 A;  1M57 B;  2B9Z A;  3F5T A;  3D0B A;  2KG7 B;  1JM6 A;  4PA9 A;  4I4T B;  4IYI A;  2BYI A;  4AHC A;  1V55 B;  1B63 A;  3RFR A;  2GBO A;  3EKO A;  4W7T A;  2YE7 A;  4PD4 F;  3OGI B;  1K4C C;  3J81 N;  2QM4 A;  1UYF A;  2DE0 X;  4BW5 A;  5IWA O;  2Y69 C;  1IXB A;  2A7W A;  3JAM N;  1HW7 A;  5DED A;  2H8M A;  1EM1 A;  4V26 A;  4LNU B;  3G6E V;  4PI0 A;  4NKG B;  3CXC U;  2EIM C;  4JI8 O;  1KP2 A;  5IYC O;  2HFE C;  2YID A;  4JI3 B;  1NJI W;  4HXW A;  2HCH A;  3O65 A;  1P49 A;  3K5N A;  1N8R W;  2IH3 C;  2F1M A;  2ZNI A;  1RM1 B;  4O05 A;  1H2L A;  3JZ3 A;  4UCS A;  1YEW A;  3O0I A;  3ABM C;  1YIT V;  2F4V O;  3APO A;  4E2L A;  3MAQ A;  1XMO O;  2ZXW C;  1U97 A;  3T0H A;  4MOT A;  4O09 A;  4X1K B;  5JVD A;  5KHI A;  1B3Q A;  4KSG A;  1Y8O A;  4DK1 A;  2Q7E A;  4JI5 O;  4L94 A;  4LWF A;  3T1Y O;  4R3M A;  4YHH O;  3LSU A;  2MW2 B;  1LNQ A;  1N36 O;  1FXV A;  3T1H O;  2XJJ A;  3L75 H;  4K3A A;  5LMN B;  4X66 B;  1N32 O;  4BR6 A;  5FPR A;  2RQ6 A;  1WN7 A;  2A0L A;  4OXS A;  1BKN A;  2E5L B;  4XKO A;  2ZM6 B;  3QDD A;  1BYQ A;  5TIS Z;  4X64 O;  2JIZ G;  4OX9 B;  2B1I A;  2YIB A;  4LWS B;  1KIJ A;  5IY5 B;  3F7Y C;  3SYO A;  2CH4 A;  4FCR A;  4DR4 B;  4DV6 O;  3SPG A;  1TC0 A;  2JRI A;  3A0X A;  2YEB A;  5LHI A;  4O04 A;  3QTF A;  1NTZ H;  3EHG A;  4WUC A;  3E8B A;  3OEE G;  2YKE A;  3CRK A;  2YI5 A;  4GYC B;  4O4H B;  4RAI A;  5ITZ B;  4JI1 B;  4LWE A;  1Z59 A;  3OE7 G;  1ZWI C;  1WB7 A;  3N27 A;  2Q8F A;  5IJ9 A;  4DR6 B;  3OFN G;  3CCQ V;  4BXI A;  3BFR A;  2AKP A;  4DV3 B;  3EFF K;  3ASN C;  4CZZ A;  2XAF A;  4JI4 B;  2XAB A;  4G28 B;  3RYH B;  5EZY A;  2EIN C;  4D7T A;  1GKF A;  2ZKO A;  2E75 B;  2WSS G;  3AG7 A;  4FLX A;  3CJH A;  3R65 A;  4H44 B;  3QO5 A;  2X6C A;  1UYH A;  1TVK B;  3A0R A;  1B62 A;  4FPP A;  4TV8 A;  1BE3 H;  1SRY A;  4LC1 A;  2QG0 A;  4JTA B;  3SDL A;  4XIP A;  4X66 O;  3X2Q B;  5KX5 B;  3BVO A;  1W59 A;  3ZCC A;  1J5E O;  3H9V A;  1NBM G;  4QJF B;  4FLT A;  2QDO A;  4BQJ A;  1ZAU A;  3DC5 A;  4JYA O;  1IX9 A;  1YC3 A;  2YI0 A;  3ZHV A;  1BQZ A;  3S5T A;  4DV4 O;  2CH7 B;  3AG3 B;  1ZUQ A;  2KQX A;  4NTW A;  2GFD A;  1JQ0 A;  2JEX A;  2WI4 A;  1ZWH A;  2XND G;  1QU7 A;  5J2U B;  2UXC B;  2CGO A;  3G75 A;  3C3T A;  1KQS U;  2QJ1 A;  1W0K G;  5KHK A;  2ARH A;  4I0X B;  3ZHR A;  2Z3Y A;  4CBC A;  2CGN A;  3JAW B;  4H81 A;  4EMV A;  2PI5 A;  2Z5U A;  4XIQ A;  3UO3 A;  2DQ3 A;  5D7R A;  4YJ3 B;  3R4N A;  3OUF A;  1Q90 D;  3ZKB A;  1RP3 B;  4AQY B;  2JS3 A;  2WPD G;  1UFI A;  2K9P A;  1XUQ A;  5AG2 A;  5CBG A;  1IBL B;  1HNX O;  4NXN O;  4BQG A;  2XDU A;  1JFF A;  2Y69 B;  4JI4 O;  2QE7 G;  5IYD O;  5CF0 A;  3H1L H;  2BT0 A;  1I58 A;  3BA9 A;  3CPW U;  2XK2 A;  5GGZ A;  1Y74 B;  3CRC A;  3E83 A;  1YXB A;  4WBN B;  2WWW A;  1P7G A;  1OCC C;  1I7F A;  1SZT A;  3EHJ A;  4X9Q A;  3RW0 A;  5KA5 A;  2YKJ A;  1QLN A;  5D7D A;  3TZ5 A;  4LF8 B;  2IU3 A;  3KE6 A;  3RLQ A;  4XCL A;  5K1X A;  2ZD9 A;  3JAR B;  4FJC C;  3OAA G;  3ABM B;  4CWT A;  5IDM A;  2UU9 O;  1AB3 A;  1S14 A;  4EFB A;  5LGU A;  2ZXW B;  1M9N A;  4GX2 A;  4NR1 A;  4B3M B;  3CYG A;  3EHH A;  4MPN A;  1XBL A;  2Y4T A;  4R7C A;  1QYE A;  2XD6 A;  4F6R A;  3ETD A;  3ZHT A;  4B3T B;  2HHH B;  3HR0 A;  2R70 A;  2PYL A;  2YGA A;  2NNU A;  4UVC A;  4WFB V;  5KUM A;  1URF A;  5LMN O;  2PZS A;  5GTI Z;  2P22 C;  1XRE A;  4KHP O;  2DW4 A;  1DLB A;  3D8C A;  2GUZ A;  1I5Y A;  4DR5 O;  4B3R B;  2YI7 A;  3VAD A;  1PNK A;  4FFB A;  3WHA A;  4DR3 B;  4PA4 A;  1D2D A;  1BCC H;  2EJ7 A;  2V4D A;  4AWP A;  3CWV A;  5H6Q A;  3ML0 A;  2YJW A;  3HKB B;  4U3F H;  2JKI A;  3F5W C;  4NTX A;  2WLH A;  3OUS A;  3CX5 F;  1GMG A;  3OM3 B;  1I94 O;  1SET A;  2JJ2 G;  1BGY H;  3STZ C;  1N33 B;  3QO7 A;  2XHR A;  4CS2 A;  5B1N A;  3FAV A;  4FZ0 A;  3AG2 B;  4IIJ A;  2X7R B;  4CS4 A;  1MX0 A;  4K0K O;  1Y66 A;  1EN6 A;  1K3E A;  2N74 A;  3SR2 C;  3JAL A;  5J2T B;  5E79 Z;  4RQE A;  3O2F A;  2R9I A;  1PPJ H;  5J6A A;  3S3W A;  4I5S A;  2DYS C;  4G2K A;  5LOV A;  5JEN A;  2EIN B;  1JVM A;  3KCX A;  5CTW A;  3GB7 C;  3BAB A;  3E8H A;  2HKJ A;  3ETE A;  2QWN B;  2UUB B;  3OGC C;  4B6C A;  3TZ0 A;  2EIL C;  1FS0 G;  1ZSP A;  2WLL A;  4N21 A;  2ZDI C;  2QWQ B;  1VQ7 V;  5EYP B;  3Q4H A;  2ZT9 B;  3Q5L A;  2OIE A;  3SPC A;  2ILM A;  1HNZ O;  5M4M A;  1KBH A;  3OW6 A;  3W7S A;  4PRV A;  1ZX3 A;  1MA1 A;  4AWQ A;  2YE5 A;  1H2K A;  1R73 A;  4QE9 A;  3INW A;  5CTU A;  4I9W A;  2WLK A;  4O4L A;  5LP6 B;  2CCS A;  1DGS A;  3UKM A;  4BAY A;  2QTO A;  1UYI A;  4FM2 A;  1JA8 A;  1GM7 A;  4CWQ A;  2WI7 A;  1OCR B;  3HYY A;  3CHX A;  1JCH A;  1TID A;  3RYI B;  5L3E A;  1XIL A;  1Q81 W;  2QSA A;  4PDV A;  5IJ9 B;  4L91 A;  4OPA A;  1I08 A;  4U3J A;  3W7U A;  1ZXM A;  3UM7 A;  3RYC B;  4HY1 A;  1X59 A;  4DUZ B;  1YJN V;  4LP8 A;  5LMU B;  2HHI A;  1XL4 A;  2XAH A;  3FT5 A;  5EZY B;  4X1I B;  5L3B A;  1N4C A;  3P30 A;  4NYK A;  4YY3 B;  4K8X A;  1PNL A;  4JI6 O;  3CJH B;  4LF7 B;  1Z2G A;  1BZK A;  1YSZ A;  2WA3 A;  3CCS V;  5IYB O;  1TGO A;  2XHB A;  2IJJ A;  4ZI7 B;  2RN9 A;  1XI1 A;  1S76 D;  3RWR D;  4V25 A;  3B40 A;  4J7Z A;  4TV8 B;  3WB2 A;  4XTJ A;  2QFO A;  1R3K C;  2XAQ A;  5KX5 A;  1ZL8 A;  5D5Q A;  1NQT A;  2ZE8 A;  3FD9 A;  3HB3 B;  3UO2 A;  3QF7 A;  4YKY A;  2CTW A;  4J7J A;  2H8P C;  3N2K A;  1KEC A;  4EEQ A;  1THZ A;  1N36 B;  4DR1 O;  2YXL A;  3JCZ A;  3K08 A;  2VWC A;  3T0Z A;  1SF9 A;  3OWD A;  2Y48 A;  1YI2 V;  3DSQ A;  3TZ2 A;  3DXR A;  2AXT Z;  3P32 A;  2BZ5 A;  1MZE A;  4G27 B;  4EFE A;  1GM9 A;  4O0B A;  4IHJ B;  3ETQ A;  3CGY A;  1BMF G;  4P9P A;  1F51 A;  4L87 A;  4GZR B;  3FV5 A;  1NU1 H;  1OSF A;  3B77 A;  1VIB A;  4XCJ A;  1VQ5 V;  2IOQ A;  2FWZ A;  1QLE C;  5CTX A;  5D5P A;  3HZ5 A;  2ZQM A;  2EJR A;  3APQ A;  1H2M A;  4LP0 A;  1JJO A;  2XTA A;  3CXH F;  1IZ3 A;  2P4V A;  1ROP A;  1V55 C;  5LMU O;  4JZ2 A;  1R3J C;  1SZX A;  3WB0 A;  3CSX A;  3SYA A;  1EZJ A;  1YVW A;  1G4Y B;  1NVP B;  1MAB G;  1X4T A;  3WG7 C;  3QG5 A;  4H7Q A;  5M4P A;  4DRX A;  3K79 A;  4PA7 A;  4K4O A;  5LA6 B;  2FKX A;  3T2M A;  4TUY A;  5C93 A;  4HYP A;  2EIK C;  2IM9 A;  2B1G A;  1PL0 A;  4MTX A;  2GQP A;  2A79 B;  1CPY A;  3BRC A;  5JCO A;  1DK1 A;  2Q2E B;  4J42 A;  3EXA A;  3SJA C;  2QM7 A;  1B06 A;  4OX9 O;  1BGQ A;  3EHF A;  4GKJ O;  1XEQ A;  4JQL A;  1RM1 C;  4O2B B;  3K0D A;  2GTS A;  1FFT B;  3T1H B;  2QWP B;  2D3O W;  1HNW O;  4GQT A;  2Q4P A;  2P4K A;  4LFB O;  4PDM A;  3L74 H;  1Y4M A;  4ZVI A;  1US6 A;  3RBZ A;  4LWI A;  3ZMV A;  1NH2 B;  5H6R A;  1Q5O A;  3RGB A;  2XAJ A;  4LWS A;  1VQO V;  5LGT A;  1I5A A;  3ABL B;  4FCQ A;  4NXM B;  2AW9 A;  4DV5 O;  4I9Q A;  2FL4 A;  1K92 A;  2YIB D;  3ZN0 A;  1HP8 A;  3AG4 C;  1S5J A;  4GFN A;  1I94 B;  4CE1 A;  4JI0 B;  3IAY A;  4CH5 A;  2YEV A;  3A0W A;  1IBK O;  3FB6 C;  4TOI A;  1I59 A;  2ZDX A;  1UY7 A;  2Q9L A;  3TJT A;  4PEL A;  2CG9 A;  1UYE A;  2FB5 A;  1KZN A;  1AJP A;  3HYZ A;  3KKY A;  2QKC A;  3JD4 A;  4TSF G;  4QPJ A;  4AQY O;  1FFX A;  2YSU B;  3D36 C;  1QVG U;  3FFQ A;  4JI8 B;  3HKB A;  1R3I C;  4JAS A;  2WI2 A;  4JF3 A;  3B27 A;  1XNR O;  1I5C A;  3SPH A;  2YGF A;  4DV3 O;  1K7D A;  1TUB B;  4IIJ B;  1E1Q G;  3K58 A;  1H8E G;  3ICX A;  3ZRX A;  5H5N A;  1EA6 A;  3JAL B;  4I7Z B;  2JJC A;  4DV7 O;  2YEA A;  2A9H A;  1AR1 B;  1WLE A;  1J95 A;  3AG1 C;  1TVK A;  3STL C;  1MU5 A;  1F4M A;  5EIB D;  3T2S A;  4ASF A;  4CWP A;  4CWN A;  1KD1 W; 
#chains in the Genus database with same CATH homology
 3IED A;  1GKF A;  2P90 A;  4JAV A;  3ZRV A;  2EZO A;  4HZ0 A;  2WSS G;  1HWY A;  2HVK C;  3RVY A;  4KFG A;  1OCZ B;  2EIK B;  3AG1 B;  1UJW B;  3CC4 V;  4P7A A;  2YE4 A;  5EC2 C;  4CE2 A;  1CP9 A;  2DYR C;  1MG1 A;  3FB5 C;  3R65 A;  4XE2 A;  3WFV A;  3M99 B;  2X6C A;  3QO5 A;  5BZB A;  1UYH A;  2YEC A;  4MBC A;  3OEH G;  5DM6 V;  5CTY A;  1US7 A;  3RKZ A;  3A0R A;  1FXH A;  2CGF A;  1B62 A;  3E35 A;  4FPP A;  3BY6 A;  1SRY A;  1OCZ C;  3F7V C;  4LC1 A;  4JTA B;  2QG0 A;  2QEX V;  4XIP A;  4NH7 A;  2ITD C;  3X2Q B;  1S5H C;  2ZKJ A;  1PNM A;  4KP4 A;  1YC4 A;  1K97 A;  1V54 B;  5F5R A;  4U93 A;  3ZCC A;  1Q82 W;  1SER A;  2HVJ C;  3AG3 C;  2XX4 A;  3T10 A;  2B5U A;  4UXN A;  1SES A;  3AG4 B;  4HYO A;  3LSS A;  4P30 A;  4PRX A;  4X89 A;  4PA6 A;  1YT2 A;  1NBM G;  4QJF B;  2Q8H A;  1M56 C;  4JGS A;  4BQJ A;  4LPB A;  1YC3 A;  4WFH A;  2YI0 A;  1QBZ A;  1R6N A;  1S3J A;  4GX0 A;  2XCM A;  4KSH A;  1K73 W;  2V1D A;  2IWX A;  3CRL A;  3AG3 B;  2ZDI A;  4CWR A;  5HFL A;  4ZBM A;  3E86 A;  4MVZ A;  2QF6 A;  2GFD A;  3VHD A;  3JD0 A;  4P8O A;  1JQ0 A;  3JD1 A;  2JEX A;  2WLM A;  4FMT A;  3W7W A;  2WI4 A;  4YKQ A;  1F23 A;  2XND G;  1ZWH A;  2YEH A;  3HEK A;  4GT8 A;  1DF5 A;  2KB1 A;  4XIT A;  2Q8I A;  3SL2 A;  4N23 A;  2IJK A;  2IWU A;  3G75 A;  2YKC A;  3H80 A;  1NH2 D;  1KQS U;  1THN A;  2IWS A;  4XC0 A;  1H8H G;  3FT8 A;  1W0K G;  1NKD A;  1YJ9 V;  4X88 A;  5HFM A;  3W7X A;  4MTF A;  3B25 A;  4CBC A;  1VQM V;  1OHH G;  2Z3Y A;  4YKX A;  1I5X A;  1GK9 A;  3ZMT A;  4XDK A;  1YC1 A;  4H81 A;  4L93 A;  4YKW A;  4EMV A;  2PI5 A;  2Z5U A;  4XIQ A;  1TUE B;  2DQ3 A;  5D7R A;  3R4N A;  2XX2 A;  3OUF A;  3ZKB A;  1KP3 A;  2BSM A;  1ORQ C;  5FL7 G;  2WPD G;  3DTU B;  5M4E A;  1MOF A;  4HZ3 A;  4MVR A;  1EBO A;  2YE8 A;  3R91 A;  1TC6 A;  5CBG A;  1AI5 A;  3JYC A;  2WER A;  3RLP A;  2OTJ V;  4BQG A;  3TUH A;  4NH8 A;  4MS2 A;  2XDU A;  5J71 A;  2Y69 B;  3U2D A;  5H9C A;  3CCU V;  5L3D A;  4EFU A;  2QE7 G;  2DWE C;  5IYD O;  1YJW V;  2XDK A;  2BT0 A;  3C0E A;  5CF0 A;  5FWK A;  3TCU A;  2ESA A;  1I58 A;  3CPW U;  2XJX A;  1H2G A;  1PKX A;  1VQ9 V;  1RPO A;  2XK2 A;  2YE6 A;  5GGZ A;  4EGI A;  3E83 A;  1GKZ A;  2DYS B;  2WI6 A;  4ASG A;  2WWW A;  4JYB A;  4PU9 A;  1OCC C;  1QR8 A;  3TK1 A;  2XDX A;  2YI6 A;  2P7T C;  4P9O A;  4MB9 A;  5L3C A;  1SZT A;  4EKW A;  4TT3 G;  4R50 A;  1EFR G;  3RW0 A;  2PI4 A;  5KA5 A;  2BTZ A;  3EHJ A;  3ZKD A;  2YKJ A;  4E01 A;  2MK3 A;  1YER A;  3T4D A;  3D36 A;  2XOK G;  1QLN A;  4X9L A;  5D7D A;  3TZ5 A;  3ABU A;  4PDR A;  3D2R A;  5EK0 A;  2LFR A;  2IU3 A;  3ABK C;  3FYI B;  3X2Q C;  3KE6 A;  4L8Z A;  3RLR A;  2HJF C;  3RLQ A;  2YKB A;  1V54 C;  3W7T A;  4XCL A;  1ID0 A;  3FB7 C;  3U67 A;  1YET A;  4MW3 A;  2ZD9 A;  2Q6A A;  3K99 A;  2O1U A;  4FJC C;  4EM7 A;  4MT8 A;  3OAA G;  3ABM B;  5B1A B;  4B7P A;  4CWT A;  1U2O A;  4EFT A;  1AI4 A;  2EIJ C;  1VQP V;  4MPE A;  3EHB B;  5IDM A;  1Q86 W;  2F43 G;  1S14 A;  4XKK A;  3CYO A;  5B3S C;  5LGU A;  2DYR B;  2ZXW B;  1R3L C;  5BOC A;  4JTD B;  5D6P A;  3Q5K A;  3VHC A;  1M9N A;  4E02 A;  4GX2 A;  1XL6 A;  2QKS A;  3HPL C;  4TWK A;  2O1W A;  3EHH A;  4MPN A;  4MSW C;  2EIJ B;  5F3K A;  2Q8G A;  4WUC A;  1AH8 A;  4L90 A;  4R7C A;  1QCE A;  1QYE A;  2H55 A;  2XX5 A;  2XD6 A;  3ETD A;  4GT1 A;  3FKS G;  5CBF A;  1ZXN A;  3GIG A;  3Q5J A;  5B1B B;  5LGN A;  3MD0 A;  1K8A W;  3ZXO A;  2YGA A;  1NHJ A;  2NNU A;  4UVC A;  4HY6 A;  3QO8 A;  4YKZ A;  4WFB V;  2WLJ A;  5KUM A;  3OMU A;  1VQ8 V;  3R4O A;  2CCT A;  2YKI A;  2IOP A;  1AI6 A;  2YE2 A;  2YEJ A;  2DW4 A;  1DLB A;  4AWO A;  2DWD C;  5L3F A;  3LDE A;  1WPX A;  5CA3 A;  4RUE A;  1I5Y A;  4BAE A;  5CMU A;  5FNF A;  2YI7 A;  4MPC A;  3VAD A;  1PNK A;  3OMN B;  4XIR A;  4UVB A;  2DQ0 A;  3QNE A;  4X8A A;  1YTF D;  1EI1 A;  1NHH A;  2W6J G;  3GIF A;  3WHA A;  4XBF A;  4JYC A;  4PA4 A;  4XD8 A;  3A0Z A;  4DZY A;  2R9R B;  4URO A;  4AWP A;  3CWV A;  1G8M A;  2BU6 A;  2Q67 A;  5H6Q A;  4KQV A;  2WLI B;  4YKT A;  5EBM C;  1Y8N A;  5D6Q A;  1UYL A;  5FND A;  1GTO A;  3ML0 A;  2YJW A;  1P4R A;  3CC2 V;  2JKI A;  3AG2 C;  3FB8 C;  3F5W C;  3OMA B;  2K5B A;  2WLH A;  3OUS A;  1OCO B;  4YXW G;  2VW5 A;  1GMG A;  4R1F A;  3OM3 B;  4MTG A;  3E8G A;  1SET A;  2JJ2 G;  2YK2 A;  2XHX A;  2XDL A;  3STZ C;  2JEU A;  3QO7 A;  2XHR A;  4H33 A;  1FXK C;  3BM9 A;  1IXM A;  1OCR C;  5B1N A;  3JD2 A;  1K4D C;  2P67 A;  3T1C A;  3AG2 B;  2X6A A;  3LNU A;  2X7R B;  1AI7 A;  1MX0 A;  1A4H A;  2IJI A;  1AH6 A;  1Y66 A;  3CGZ A;  1K3E A;  1ZW9 A;  2UXX A;  3O2F A;  4RQE A;  4GCZ A;  1VQK V;  2R9I A;  4MVO A;  5J6A A;  5E1A C;  2QA4 V;  4MVQ A;  4I5S A;  2DYS C;  2X6B A;  4G2K A;  1GKX A;  3VOU A;  3H01 A;  4Z1M G;  3E8F A;  4RO2 A;  3R92 A;  1OCC B;  1RPR A;  2EIN B;  3IFX A;  1B6Q A;  1JVM A;  2WLL B;  4ZKI A;  3G7B A;  3O6O A;  1H38 A;  1UYK A;  5CTW A;  3ZN1 A;  3GB7 C;  1YIJ V;  1I5D A;  1Z5B A;  3E8H A;  4J9Y B;  3CCE V;  1YTF B;  5D7C A;  3B24 A;  5LBQ A;  3EKR A;  3OMI B;  2HKJ A;  2W0F C;  3ETE A;  2WAM A;  2VCI A;  2XDS A;  1PVG A;  4YKU A;  2UXN A;  2EZP A;  2XAG A;  3LSQ A;  5B1B C;  1NR7 A;  3OGC C;  1M90 W;  4J9Z B;  1DF4 A;  1Z5C A;  3TZ0 A;  4B6C A;  1S72 V;  2EIL C;  4I3H A;  2X0L A;  1FS0 G;  2WLL A;  4N21 A;  2ZDI C;  4PDL A;  4XDJ A;  2FYP A;  4GX1 A;  1BL8 A;  1VQ7 V;  2IW5 A;  4QPK A;  4HZ5 A;  2BOC C;  1GM8 A;  1JOY A;  3SYQ A;  3Q5L A;  1UY6 A;  1F4N A;  2FXS A;  3A0X A;  4HYM A;  3SPC A;  4DO2 A;  2EIL B;  5M4M A;  4H85 A;  1M56 B;  1OZ0 A;  1AJN A;  2WLN A;  4DXW A;  3W7S A;  1M1K W;  2IOR A;  3OW6 A;  2CK3 G;  3OW2 U;  4EGK A;  1YT1 A;  4PRV A;  3A0Y A;  1Z5A A;  4AWQ A;  4Q20 A;  4R3A A;  2IH1 C;  1VQL V;  1Y4S A;  2V7Q G;  2YE5 A;  3OPD A;  4E00 A;  1ARO P;  1H7S A;  4EEH A;  3MHS C;  3PJS K;  1CEZ A;  1R73 A;  3JD3 A;  4URM A;  4QE9 A;  3INX A;  3INW A;  5CTU A;  4AS9 A;  1K5S A;  2WLK A;  3DGE A;  4I9W A;  4JAU A;  2EBO A;  2CCS A;  3UKM A;  4BAY A;  5GW7 A;  2QTO A;  2YEI A;  4UUJ C;  1UYI A;  5LHG A;  3ZMZ A;  3ZRS A;  3E89 A;  1W0J G;  1GM7 A;  5M4N A;  5EC1 C;  4KTN A;  4CWQ A;  2WI7 A;  1PD3 A;  3CMA V;  4CWS A;  1OCR B;  3VBB A;  3CD6 V;  3BEH A;  3ETG A;  3HYY A;  3CCV V;  1K33 A;  1FXK A;  1JCH A;  1TID A;  5L3E A;  1QLE B;  1Q81 W;  3SJQ C;  2OCC B;  1KKD A;  5LHH A;  4WFF A;  4PDV A;  3K60 A;  4L91 A;  3B8N A;  3TET A;  3W7U A;  2E0A A;  1ZXM A;  3UM7 A;  3G71 V;  1GJV A;  4WUB A;  3KG2 A;  2Q69 A;  1YSC A;  5KA6 A;  4HY1 A;  3NMQ A;  4LCU C;  5FNC A;  1YJN V;  3IGA C;  4LP8 A;  2OCC C;  4P2Z A;  3E2E A;  2AHY A;  1YSR A;  1XL4 A;  2XAH A;  3MHH C;  3FT5 A;  1P7B A;  5L3B A;  3P30 A;  3U2K A;  3T4Z A;  2OT5 A;  2W6I G;  4JTC B;  1QY8 A;  2O1V A;  2YJX A;  2LFS A;  3CME V;  2FWY A;  4WFA V;  1UYD A;  1PNL A;  1W2B U;  3LNM B;  2C2A A;  3BMY A;  2QM8 A;  1UYM A;  1TBW A;  1YSZ A;  3CCS V;  3ZRW B;  3HHU A;  2EIM B;  4MVM A;  3WG7 B;  5IYB O;  2PNR A;  2IJJ A;  2EXL A;  2IU0 A;  3R4P A;  1AJQ A;  3I55 V;  1S76 D;  3OWB A;  2ATK C;  3ABK B;  4UV9 A;  2BU7 A;  3B26 A;  1K34 A;  1K9M W;  1I5B A;  4V25 A;  4CE3 A;  1ENV A;  4XTJ A;  4YKR A;  2FTK A;  4MP2 A;  4GX5 A;  4GGL A;  1K5Q A;  4QIW F;  2QFO A;  3K98 A;  1R3K C;  2XAQ A;  3TZ4 A;  1BXD A;  1NR1 A;  2LP7 A;  2YED A;  3CCL V;  1NQT A;  1BHA A;  1S16 A;  1BHB A;  4ASB A;  3ZRW A;  3HB3 B;  4UVA A;  1TH8 A;  4YKY A;  2HG1 A;  1S77 D;  3GIE A;  3ABT A;  5B3S B;  2H8P C;  2YEE A;  3LPS A;  3B28 A;  1KEC A;  1THZ A;  5EBL C;  4NH9 A;  3JCZ A;  3K08 A;  4KUM A;  2VWC A;  3T0Z A;  3OWD A;  1U0Z A;  2Y48 A;  4XKA A;  3ZM7 A;  5L3J A;  4EGH A;  5IN9 A;  3C11 A;  3ZMS A;  1YI2 V;  3ZIA G;  3TZ2 A;  4HXZ A;  4R8C A;  4WFE A;  1M57 C;  3P32 A;  1UY9 A;  2XJG A;  2BZ5 A;  2IJH A;  1TIL A;  4G27 B;  2WEQ A;  2ZDY A;  3T1K A;  4WFG A;  1GM9 A;  4O0B A;  2YE9 A;  2UWD A;  3CGY A;  1BMF G;  4P9P A;  3GWO A;  1F51 A;  4L87 A;  2XHT A;  4O07 A;  3FV5 A;  3SPI A;  2WI5 A;  3LUT B;  3NXS A;  1OSF A;  3B77 A;  1UYC A;  2BRE A;  1JX9 A;  2BYH A;  4XCJ A;  1M57 B;  1VQ5 V;  3R4M A;  2IOQ A;  4WF9 V;  2FWZ A;  1QLE C;  3D0B A;  5CTX A;  1JM6 A;  4PA9 A;  2BYI A;  3H4L A;  1V55 B;  1B63 A;  3HZ5 A;  3G7E A;  2HKO A;  2EJR A;  2ZQM A;  4LWH A;  1JJ2 U;  3PEJ A;  4U7N A;  3EKO A;  4LP0 A;  4W7T A;  4R6Z A;  3OR6 C;  2BRC A;  2YE7 A;  4PL9 A;  3ASO C;  1K4C C;  1UYF A;  1E79 G;  2AHZ A;  3ZJZ A;  4BW5 A;  4DUH A;  1ROP A;  1V55 C;  2YE3 A;  4ASA A;  1R3J C;  4FCP A;  2Y69 C;  4URL A;  5IY5 C;  4BIZ A;  3SYA A;  1EZJ A;  4QE7 A;  2H8M A;  3ASO B;  1R62 A;  4WUD A;  1G4Y B;  4URN A;  2WLI A;  1NVP B;  3K06 A;  1Y4U A;  1MAB G;  4MTO A;  4V26 A;  3G6E V;  3CXC U;  1OCO C;  1YES A;  2EIM C;  3WG7 C;  2ZR3 A;  2QG2 A;  4H7Q A;  1KP2 A;  3K79 A;  3ZXQ A;  5M4P A;  5IYC O;  2HFE C;  3SYC A;  2WI3 A;  4PA7 A;  1NJI W;  3CCM V;  4HXW A;  3LDC A;  2JDI G;  4K4O A;  2HCH A;  2VCJ A;  5L3G A;  3T2M A;  2HR3 A;  5C93 A;  2YEG A;  4HYP A;  3K0G A;  3A0T A;  2EIK C;  1E1R G;  2B1G A;  1PL0 A;  4MTX A;  2GQP A;  1JPX A;  4LWG A;  2A79 B;  4FIP C;  1CPY A;  4MW8 A;  2IH3 C;  1N8R W;  4ASU G;  2Q2E B;  3K03 A;  1RM1 B;  1YT0 A;  3K3W A;  3PEH A;  3CCR V;  4RQF A;  2QM7 A;  4U7O A;  5J9P C;  4O05 A;  3JZ3 A;  3AEI A;  1BGQ A;  4KFM A;  3VHA A;  3O0I A;  4LBE C;  5CPH A;  3ABM C;  5B1A C;  1YIT V;  1NHI A;  3EHF A;  3MNR P;  3SPJ A;  3K9A A;  4JQL A;  5CN0 A;  1RM1 C;  4E2L A;  3K0D A;  2BU5 A;  2ZXW C;  3T0H A;  1FFT B;  3RVZ A;  4MOT A;  2D3O W;  3OR7 C;  4FK5 C;  4O09 A;  3B8M A;  4GQT A;  4CWF A;  1QR9 A;  2ITC C;  2NLJ C;  1B3Q A;  4KSG A;  1VQ6 V;  1COW G;  1MSW D;  3K04 A;  4PDM A;  1Y8O A;  3WQ9 A;  1YHQ V;  1Y4M A;  2GSM B;  4ZVI A;  4GEE A;  4L94 A;  3ZMU A;  1S0V A;  1QVF U;  3RBZ A;  3GIG B;  4LWF A;  4LWI A;  3ZMV A;  1NH2 B;  4R3M A;  1R6K A;  5H6R A;  1VQ4 V;  1YS3 A;  2YEF A;  2JK5 C;  2XAJ A;  2YEV B;  3FYE B;  3LDD A;  4F4L A;  5LGT A;  1VQO V;  1LNQ A;  1I5A A;  2XJJ A;  1FXV A;  3ABL B;  1AM1 A;  1AMW A;  4XDM A;  5BOD A;  3CP1 A;  2P6J A;  5M4K A;  4FCQ A;  3I56 V;  4PA3 A;  1KC8 W;  3IC7 A;  2A0L A;  4OXS A;  3CCJ V;  1BKN A;  4XKO A;  4HAM A;  2WEP A;  1K92 A;  3HZ1 A;  1Y8P A;  3QDD A;  1BYQ A;  3ZN0 A;  3TTZ A;  2JIZ G;  5IDJ A;  2BU8 A;  3AG4 C;  3ABL C;  4GFN A;  1VQN V;  4CE1 A;  2CCU A;  2B1I A;  4MVS A;  5M4H A;  2YEV A;  1KIJ A;  3A0W A;  4RUF A;  5IY5 B;  2K1E A;  2Q68 A;  3F7Y C;  1Q7Y W;  1DTO A;  3FB6 C;  2ZDX A;  3SYO A;  2H94 A;  1I59 A;  2M7W A;  1UY7 A;  4XDL A;  2CH4 A;  4FCR A;  2ZBK B;  4PEL A;  3SPG A;  1UYE A;  4WCE V;  2CG9 A;  1KZN A;  1AJP A;  1TC0 A;  3HYZ A;  2OTL V;  3JD4 A;  3G4S V;  2YEB A;  2XAS A;  1GO3 F;  2HG5 C;  3D3I A;  2YSU B;  4QPJ A;  4TSF G;  4QNH B;  5LHI A;  1QVG U;  3SYP A;  1L0O A;  2YGE A;  3EHG A;  1H7U A;  1R3I C;  2BU2 A;  3E8B A;  3QTF A;  4MP7 A;  4O04 A;  3OEE G;  4JAS A;  4JF3 A;  2GHY A;  2WI2 A;  2YKE A;  1I5C A;  1AJ6 A;  3B27 A;  3CRK A;  4H37 A;  3SPH A;  2YI5 A;  2YK9 A;  5CBH A;  4CWO A;  2YGF A;  4RAI A;  4UV8 A;  5DN6 G;  4BIU A;  1K7D A;  4MVU A;  2HLD G;  2WI1 A;  3K97 A;  4LWE A;  1L1F A;  1FXK B;  1Z59 A;  3OE7 G;  1E1Q G;  3ASN B;  1H8E G;  1ZWI C;  2Q8F A;  1QZR A;  2ZR2 A;  1UY8 A;  3ZRX A;  1EA6 A;  2JJC A;  3OFN G;  2YEA A;  3CCQ V;  5B1O A;  4BXI A;  2A9H A;  1NVP D;  1AR1 B;  5EBW C;  1WLE A;  5KUK A;  1J95 A;  3AG1 C;  3EFF K;  2AKP A;  3ASN C;  4JPR A;  4CZZ A;  3STL C;  1MU5 A;  2XAF A;  2XAB A;  1F4M A;  4G28 B;  3T2S A;  2BOB C;  1UYG A;  4ASF A;  2JJ1 G;  4CWP A;  2EIN C;  4CWN A;  1KD1 W;  3CC7 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...