4U7OA

Active histidine kinase bound with atp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
239
structure length
234
Chain Sequence
VTEQQKIDNDRKQFVSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRVDKQGGTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histidine protein kinase sensor protein
publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum
total genus 79
structure length 234
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4u7oA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4u7oA02
3ZRXA 2JKIA 3KE6A 1AM1A 3R4NA 5BODA 3ZXQA 4E02A 2YGEA 1YC4A 3D0BA 4FCRA 2XDSA 2BREA 3CRLA 2YI7A 1EA6A 4LPBA 5B1OA 4W7TA 2CCSA 4LWFA 5FNDA 4LWGA 3O6OA 3U2DA 5D7RA 3TZ4A 3VADA 3CGZA 3INXA 2GQPA 2YKEA 4LWIA 4MPCA 2XX2A 2XHTA 3A0YA 4YKQA 3WQ9A 4XIRA 3B27A 4XCLA 4HZ0A 3C11A 2VCIA 4L91A 4CWNA 2BSMA 2XK2A 1B62A 4FCQA 4GEEA 4CWTA 3MNRP 4GCZA 3ZRWA 2QM7A 4H7QA 2WI6A 4XCJA 4EFUA 5D6PA 1TILA 4URNA 4JASA 1ZXNA 2Q2EB 3LPSA 3TTZA 4JQLA 5L3JA 4MPNA 4GGLA 2ZBKB 1Y8OA 4MBCA 3ZKDA 4B7PA 3JZ3A 4WUDA 4XITA 1U0ZA 2WI1A 3FT8A 4B6CA 4AWQA 1JM6A 3EKRA 4KSHA 3EHFA 4GT8A 1UYGA 4XDMA 4XIQA 4XTJA 3D36A 5FNCA 3A0WA 4XIPA 2CGFA 3T0ZA 2WI3A 1I5DA 3C0EA 3RKZA 4E00A 2YEGA 1BYQA 4EGIA 1MX0A 4P8OA 4MP2A 4U7NA 4CWFA 4AWPA 2BZ5A 4BQJA 4MPEA 1TIDA 5M4HA 2XHRA 3FV5A 3O0IA 3OMUA 2YE5A 3T0HA 1UYIA 1Z5BA 2ESAA 2XJJA 1I58A 5J71A 4XC0A 2YKBA 1UY8A 1I5AA 3CRKA 1GKZA 2YGAA 2YI6A 2BU7A 2XX4A 2FWYA 3T1KA 4FPPA 3Q5LA 1UY7A 5M4NA 4BIUA 1BGQA 4YKYA 2FYPA 1H7SA 4L94A 2CCTA 4BIZA 1UYCA 5J6AA 2YKCA 4AWOA 1YSZA 1ID0A 1YSRA 2CG9A 2Q8FA 4UROA 3QDDA 4MB9A 4HY6A 4PRXA 2YEEA 2JJCA 3EHGA 4CWQA 2Q8GA 5CF0A 4KTNA 1US7A 2YKJA 3K98A 4U93A 2CCUA 2YECA 3B28A 4CE1A 3D2RA 2YEJA 5BOCA 1Y8NA 4GT1A 3HEKA 3VHAA 4HY1A 3TK1A 5GGZA 3T10A 3R4OA 1YS3A 4NH9A 1YT1A 4EGHA 2ZDYA 2WI7A 4URMA 5D7CA 2P67A 2FXSA 3DGEA 4EM7A 2CH4A 4EEHA 2IWUA 1A4HA 2HCHA 1NHIA 2QFOA 2WERA 2H55A 4O07A 3R91A 3R92A 1ZXMA 2QM8A 2IWSA 1UYHA 3B25A 3OPDA 4R3MA 3ZXOA 2VWCA 5CTUA 3BMYA 2WEQA 2BU5A 3GIGA 1UYFA 1I5CA 1PVGA 1UY9A 3K99A 4EFTA 4URLA 1KZNA 5M4EA 4LWEA 1MU5A 3GIEA 2O1UA 1Y4SA 1B63A 2XD6A 2YEAA 3B26A 1YT2A 1EI1A 4YKUA 1AH6A 3RLRA 2BYIA 2YI5A 3TZ2A 4NH7A 4JAVA 4EGKA 3OWDA 3U2KA 3WHAA 2EXLA 2IOQA 3NMQA 1B3QA 5M4PA 4YKXA 4ASGA 1Z5CA 1UYEA 4XD8A 4CWSA 3CWVA 3G75A 2WI4A 2IWXA 1IXMA 2XX5A 4YKWA 4FCPA 4AS9A 3H80A 1NHJA 3SL2A 5C93A 1UYLA 1YETA 4O05A 2BTZA 3R4MA 4CE3A 2YEHA 3P32A 4MOTA 1NHHA 4LWHA 3HZ1A 1GKXA 4L8ZA 3RLQA 4CE2A 4JAUA 2YE3A 4R3AA 4CWPA 3CGYA 3VHDA 3ZKBA 1S14A 1BXDA 4NH8A 2YK2A 3VHCA 1UY6A 3INWA 1OSFA 3ZCCA 3TUHA 3OWBA 3H4LA 4KQVA 3OW6A 4V25A 1I5BA 4HXZA 1F51A 3EHHA 3ZRWB 2WI2A 2HKJA 3U67A 2XDLA 2C2AA 4CWRA 2YEBA 4XKAA 1L0OA 2XCMA 3GIFA 3TZ0A 2WWWA 2VCJA 2FWZA 2YI0A 4H81A 2WI5A 4BQGA 4XKOA 4L93A 5IN9A 2E0AA 3K97A 4KP4A 1S16A 1Y8PA 2YJWA 3T2SA 4I3HA 2XJGA 5IDMA 2Q8IA 4E01A 4Q20A 3HZ5A 5B1NA 2AKPA 5IDJA 2BU6A 2IORA 1QZRA 3PEJA 2YE6A 4QPJA 5CPHA 2LFRA 1AMWA 4HYMA 2XHXA 4YKTA 1Y4UA 2UWDA 4JYBA 4R1FA 4O09A 1YT0A 2O1WA 4I5SA 4XKKA 4P7AA 5CTYA 3MD0A 4GQTA 4ASFA 2YKIA 4DUHA 4EMVA 4MT8A 2IOPA 5M4MA 3K60A 3LNUA 3NXSA 1YERA 2YE8A 3EKOA 4MTXA 2K5BA 1YESA 5FWKA 2YE7A 3G7EA 1UYDA 5M4KA 2VW5A 4U7OA 2O1VA 2QG0A 5CTWA 1H7UA 2YEFA 3G7BA 4X9LA 2GFDA 2YE4A 2BYHA 2XDXA 3Q5KA 4PU9A 3RLPA 4ZVIA 5CTXA 1BKNA 4BXIA 2XDKA 3HHUA 2YEDA 1THNA 2PNRA 2HG1A 2XABA 4KFGA 4YKRA 1UYKA 4K4OA 4WUBA 1YC3A 4YKZA 4ASBA 3R4PA 3O2FA 2FTKA 3EHJA 4WUCA 4CWOA 2QG2A 1I59A 1U2OA 2YE9A 1GJVA 3A0XA 1TC0A 4KSGA 2H8MA 3BM9A 1ZWHA 3QTFA 1AH8A 4MP7A 3Q5JA 2XDUA 5D7DA 4ASAA 4DZYA 1ZW9A 4HYPA 2Q8HA 3A0TA 1KIJA 1JOYA 3FT5A 4LP0A 2LFSA 1Z5AA 4BAEA 1QYEA 1TH8A 4H85A 4O04A 2ZDXA 3A0RA 4XE2A 2BRCA 3ZRVA 2YGFA 4PL9A 3A0ZA 4HZ5A 1AJ6A 3HYYA 2BT0A 3HYZA 4HXWA 4L90A 5FNFA 2YE2A 1TC6A 3IEDA 2QF6A 2YJXA 5F5RA 2WEPA 2BU2A 1QY8A 2XJXA 4JYCA 1YC1A 3PEHA 2ZKJA 3B24A 4QPKA 1TBWA 3GIGB 4O0BA 3ZM7A 2YEIA 4V26A 2YK9A 4FMTA 1R62A 1UYMA 4LC1A 3TZ5A 1Z59A 4PRVA 2BU8A 4ZKIA 4GFNA 5F3KA 5D6QA
chains in the Genus database with same CATH superfamily
3M8AA 4O4HA 3RVZA 4CS3A 5JQGB 3FYIB 1M5IA 3KE6A 1AM1A 4JZGA 5BODA 4XBFA 2KG7B 3ZXQA 1L0LH 3CS5A 1IX9A 3LSSA 2RQ6A 3E83A 1YJNV 2BREA 3JALA 2YI7A 3T4DA 1EA6A 3K5LA 1I7FA 4LPBA 5B1OA 3C3TA 2Q7GA 4F6EA 4LWFA 5FNDA 5IY5B 3H1JH 5EZYA 1S5HC 2AZ0A 3O6OA 3WFVA 1TUBA 3THOA 5CBHA 1HNWB 2XX2A 5FNVA 4JI5B 3M99B 3W7SA 1BS3A 4YKQA 1Q6HA 4LF8O 4XIRA 4DUZB 5H6RA 3ZMZA 3CRCA 2ZXWB 2VQFB 4H33A 2BSMA 1M56B 2QTOA 4X88A 1Y67A 4B3MB 4BWAA 4GEEA 4CWTA 3JAKB 4GCZA 3ZRWA 2DQ0A 1BMFG 1K3EA 2QM7A 1SF9A 3CD6V 4XCJA 1FXVA 3A8TA 1XMOB 1TILA 4URNA 3CRMA 2Q0OC 1QLEC 1YJ9V 1KD1W 4JQLA 3IJ4A 4BIOA 4MPNA 3CCJV 1VF6C 2YXHA 2UU9O 2ZBKB 4MBCA 3ZKDA 1JM6A 2UUAO 5J2UB 3EKRA 1N36B 2IJIA 3H1HH 4XDKA 4X62B 5IYDO 1IVSA 4XTJA 1BHAA 2QR4A 3D36A 1NI8A 5IYZA 5FNCA 4XIPA 2W0FC 3CCMV 2DW4A 4ABMA 1BL8A 1I5DA 3C0EA 1E1RG 4TT3G 2IU3A 3CYGA 1BYQA 3PN1A 1NZ6A 1MX0A 2UUCO 4P8OA 3JD2A 5JJNB 2UXCO 4NYKA 4BQJA 4LFBO 4PA4A 2OT5A 1UYIA 2ESAA 1I58A 1SESA 2GV9A 2YI9A 3QNEA 5BMVA 4KHPB 1SQPH 2Q9LA 3X2QB 2UXDB 1UY8A 1F7YA 4R6ZA 3CWBH 2FWYA 3T1KA 1BGYH 5GTIZ 1GRJA 2HJDA 2ITDC 3ZIAG 5LGNA 2P7TC 4DV0O 1H7SA 4L94A 3AG3C 1TVKB 2Q8FA 4MVSA 3D8CA 3CCQV 4UROA 1SKVA 3QDDA 1V9PA 4JYAB 2CUGA 1S3JA 2E3CA 2NNUA 2EILB 1US7A 3UO2A 1YSCA 4U93A 4J80A 1AP5A 1H2MA 2Q0AA 3RBZA 3D2RA 4CE1A 4JI4O 2DYRC 5K1XA 4DR2O 1Y8NA 2CGNA 1GO3F 3T1CA 3U0ZA 1P4RA 5LOVB 3HEKA 3TK1A 2DE0X 1JFFB 4NH9A 2VRZA 3CEIA 3F5WC 2UUBO 2FXSA 2ATKC 4TWKA 4QE9A 1XOUA 4J7KA 3H1LH 1H2NA 2CTWA 3P3NA 4I9WA 1NHIA 2WERA 2H55A 5B3SB 3L70H 5B1BC 4WBNB 3EXAA 2Z5UA 3ML0A 3ZXOA 4X64B 4JPRA 4ZHQB 4B3SB 3BMYA 2WLJA 4OGQB 3OW2U 2BU5A 3JAWB 1SERA 2A9HA 1NVPB 5C8YB 3ICXA 2IH1C 3SJBC 3K99A 3CCVV 1KZNA 2QSAA 4DO2A 1VQ5V 4HNAA 3OMNB 3U10A 2FKXA 2B1GA 1Y4SA 1B63A 4TQFA 1YT2A 1VIBA 3RLRA 2ETNA 2BYIA 5BY1A 4LF4O 4DV6B 3WHAA 2IOQA 1AI4A 3L72H 5M4PA 4YKXA 4ASGA 4MVOA 1Z5CA 1FXHA 4Z2WA 4XD8A 3CWVA 2ZIMA 3ABLB 3E22A 1COWG 2WI4A 4NXNB 4JI1O 2HEPA 1EN6A 1LUWA 1RPRA 4GX0A 3WB0A 2AZ2A 2BE3A 2UXNA 3H80A 1WB8A 1NHJA 1BT8A 5FPRA 1H2LA 3VOUA 4PDVA 4H0LB 4LWSB 1V54B 3ABKC 4CE3A 2X6AA 2ZDIC 4MOTA 4I7ZB 2K1EA 1GKXA 2KQXA 4CE2A 1G6UA 3N2KB 5CA0B 2YSUB 2YE3A 4H13B 3OGCC 1RPOA 2DOSA 3L74H 2YXLA 3GVMA 1M57B 3JARA 3ZX6A 4CH5A 4WBNA 4FLUA 3TUHA 3OW6A 1QBZA 3JD0A 1K8AW 4B7EA 4BW9A 2XAHA 2F66C 3JAWA 3CCLV 4HXZA 1FFTB 4TOIA 5L3EA 2EINB 2WI2A 5B1AC 2WSSG 2XDLA 3DXRB 4O4JA 1SQFA 2NLJC 3E89A 3QO7A 1V55B 5EYPB 1NTMH 3MHSC 4XKAA 4X20B 4LF5B 3TZ0A 1N33O 2YI0A 4MSWC 1Q7YW 5KHHA 4XKOA 1IBMB 3K5NA 1VQPV 3IC9A 2E0AA 3K97A 4JTAB 3OTOO 4DR4O 3GWOA 4OPAA 2XJGA 5K1PA 4AILC 2Q8IA 3K0DA 2AKPA 4LR3A 4CBCA 1QZRA 2WLIB 5L3CA 2QGNA 5CPHA 2LFRA 5LGTA 4RUFA 1AJPA 1XNRO 2UWDA 2WLMA 4JYBA 5CB4A 4HBNA 1IBKO 3JD3A 4LWSA 1URFA 4O09A 3OD4A 2O1WA 4P7AA 5CTYA 4GQTA 4ASFA 1U96A 2Q7HA 5CA0A 4MT8A 4AQYO 3CXHF 3NXSA 3SPJA 4GLXA 3LDDA 3RYFA 4MTXA 1W2BU 2K5BA 1O9HA 1TA8A 4LH7A 3APQA 2ADQB 1L0NH 2QWOB 4NTXA 5M4KA 1W0JG 4R50A 2VW5A 1E1QG 4U7OA 1HNZB 3RYHA 2QG0A 4X9LA 1ORQC 3K79A 1KUQA 3Q5KA 1R3LC 1BKNA 1H2GA 2P4VA 3DC6A 4EEQA 4YJ2A 4YJ3A 2IH3C 2C1IA 1M1KW 3HKEB 1J5EB 4UB6Z 1PNKA 5KA6A 3BVOA 4YKZA 1Z5VA 4DV2B 5LBQA 4F6RB 3JASB 4JI7B 1OCZB 2XUMA 4I9QA 3EHJA 4WUCA 5GONB 2QG2A 2WLLB 1I59A 5CA3A 2YE9A 1GJVA 3A0XA 1NR1A 4WFEA 1SS3A 3OR7C 4DV1O 5D7DA 4PI0A 2Q68A 3ZJZA 3VQWA 3CP1A 4O4LB 2JGDB 1N32O 4AI8A 1R1BA 5CMUA 3P30A 1VQLV 1NR7A 1ZWIC 2ZR3A 4D7SA 4H85A 2ZDXA 3A0RA 3SJCC 3O65A 4J9YB 3A0ZA 4HZ5A 1AJ6A 2ZKOA 2QJ1A 2BT0A 4HXWA 4L90A 4I0XB 1XILA 2E5LB 3OT7A 1XNQO 3LDCA 3HKBB 1MOFA 5JVDA 1QY8A 2XJXA 2RN9A 4K0KB 1NQTA 4QE7A 2ZIOA 5B66Z 2AXTZ 1WAZA 2HVJC 2NN4A 4TQDA 1HR0O 2C1GA 3RYCA 4U3FH 4K35A 3CB2A 4PA6A 3K9SA 3TZ5A 2AHYA 5KHGA 4PRVA 4E2LA 1K92A 3HB3B 4R7CA 3G6EV 3CE2A 2LP7A 4B3RB 1HP8A 2RCVA 4JF3A 4YHHB 3E35A 4GYCB 2IW5A 1ZX3A 2YGEA 5GONA 2ILMA 2FMLA 4LNUB 2XDSA 3ZHUA 3LNMB 2EIJB 5L3FA 2VQEB 3U2DA 3VADA 3INXA 2CK3G 2YKEA 3AK3A 3C3SA 4LWIA 3KCYA 2PZSA 2HKOA 2OWOA 5A2QN 3FD9A 3N2GB 3A0YA 3K59A 1SZTA 4XCLA 4HZ0A 5IWAB 1BQZA 3SYPA 4FCQA 2F4VB 4JTDB 1HNWO 3WG7B 1HDJA 3MNRP 1CP9A 4JI5O 3HKDB 4ZBMA 2LGWA 4DUZO 2JIZG 4X1KA 4FK5C 4TV9B 2EIKC 2VQFO 4DK0A 4B3MO 3LPSA 1W59A 5BXZA 2UXXA 3UO3A 3A2FA 3ZRSA 3C90A 2Q4PA 1XMOO 4B7KA 1U0ZA 4WFGA 1P84F 3HKCB 1YCIA 4E4EA 3EHBB 4J42A 1AILA 1N34B 2EJ7A 1VF5B 2Y69B 1UYGA 4K3AA 3ETGA 4LFCB 1CXZB 3A0WA 4I50B 4JI2B 2WI3A 4CH6A 5H2FZ 3N27A 2JDIG 1N36O 4E00A 1VQKV 1AI5A 1SA0A 2Q69A 1K97A 4X62O 1NT2B 4NTYA 4CWFA 3TCUA 2XHRA 2F23A 5LHHA 2X7RB 4TUYB 3OMUA 4E72A 2ZQMA 4WF9V 3T0HA 1AR1B 1AVMA 1BE3H 1YJWV 1IURA 2XJJA 1QLEB 1FXKC 5J2TB 2ITCC 3TXSA 1I5AA 3R65A 2DYSC 2A0LA 3BFRA 4DR7B 1WNSA 4FPPA 1GN4A 3KKYA 3Q5LA 1EFRG 4BIUA 2Q5ZA 4KHPO 4FLZA 3JSLA 3W7UA 1P49A 2UXDO 4YXWG 5HFLA 2CCTA 5CN0A 2V7QG 2YKCA 4O2AB 3T1HB 4AWOA 2CG9A 1PNMA 2X6BA 4GZRB 1S0VA 3AG2C 4MB9A 1YITV 3E2EA 2ZNJA 4HY6A 4PRXA 3OMIB 1AI7A 4CWQA 1FD9A 2Q8GA 3B8NA 1PKXA 4J7JA 2YC0A 2H3OA 1AR5A 3HKCA 2YECA 3TETA 1VMGA 4DV4B 5BOCA 1QR8A 4JYAO 2B5UA 4GT1A 4J11A 4NB5A 5CA1A 4I50A 2Y4UA 4J7ZA 5GGZA 3T10A 1YS3A 2A79B 1JQ0A 2WI7A 4L8JA 5IJ0B 1B04A 2W6JG 4QNHB 4EM7A 3DTUB 3ASOC 3Q4HA 4DUYB 1H8HG 5JH7B 3M7MX 3K0GA 1N4CA 2B9ZA 1A4HA 3LMMA 1S72V 3JAMN 2HHIA 1HNXB 2QFOA 2HHHB 1ZXMA 2GBOA 3RWRD 1WN7A 5JCOA 2XAGA 3HR0A 4XDLA 1DK1A 4LFAB 2E74B 2KSDA 3I5DA 4DV7B 1UYFA 1MG1A 4D6TH 4KXRA 4EFTA 1XMQB 5M4EA 2BSKB 4LWEA 1CEZA 2N74A 3GIEA 1WP8A 4X64O 2HJFC 4B3SO 2O1UA 1JX9A 2YEAA 4FLTA 1SQVH 4CH3A 1BZKA 4NH7A 5JQGA 3SYCA 3OWDA 4WCEV 4GKKB 3NMQA 1B3QA 2G38A 5BR8B 2KG7A 2M7WA 2RMKB 3O9OA 4MS2A 4K8XA 1UYEA 2LJ2A 3UM7A 4WFHA 2Q6AA 3SGIA 1KC8W 4DR6B 4DV6O 2HG5C 2A7WA 3CC4V 4WFBV 5B1BB 1F4MA 5H5NA 4NXMB 3QTCA 3K5OA 5IYCO 3SL2A 1FJGB 3OFNG 1RP3B 2BTZA 1A32A 2HFEC 2GTAA 4PDMA 2FL4A 1IDSA 1I08A 2P22C 4L8ZA 4PELA 3E8GA 2JS3A 1SQQH 3CGYA 3ETEA 3VHDA 3FB6C 3JAKA 3ZKBA 2WPDG 5KHJA 3CXCU 3D36C 2HLDG 4NH8A 2XAFA 3WB1A 3INWA 4MTOA 3OUFA 4JV5B 4YY3B 3H4LA 2A06H 2VWKA 1X59A 3OTFA 2M6YA 3DSQA 4X65B 3B77A 4ZOLB 1AP6A 4IHJB 5BZBA 3EHHA 3MHHC 2HKJA 4J41A 4EKWA 1GM7A 3T2MA 4P9PA 3AG7A 2H94A 1Y74B 3GIFA 2WWWA 2VCJA 5J2UA 1S5LZ 1T5EA 3BCCH 4D7TA 3F5TA 4H81A 3ETDA 1KYOF 4JYYA 4KFMA 5IN9A 1PPJH 3ABKB 1MSDA 4KP4A 2YJWA 3J81N 3T2SA 4LF9B 3SYOA 4LF5O 5KHKA 3BY6A 4YIPA 4RQEA 4UV8A 5FLXN 1I94B 2IJKA 3HZ5A 2EJRA 2IORA 2Z3YA 3ZEDA 5CBGA 1IBMO 1JA8A 2YE6A 5D5QA 4QPJA 4EFEA 3OM3B 2OTJV 1M93A 4JI0B 4HAMA 4JAAA 1XQ8A 4I55B 4GX5A 3S3XA 3CRRA 1BQ0A 4TSFG 2JGUA 2D2CB 1NTZH 1TAEA 5B1AB 4FM1A 3TGUH 5EIBC 2XT9A 3QF7A 1K34A 1QVGU 3IGAC 3K3WA 1MNGA 4X89A 2YIBA 4EFBA 4X8AA 2YE7A 2OCCB 3SR2C 1UYDA 4JI3B 3RN4A 1E79G 1TVKA 2XAQA 1B6QA 4DW1A 1Y76B 2YE4A 2UU9B 3CRQA 4RAIA 1GK9A 5CBFA 4ZVIA 5KLVH 4BXIA 2XTAA 2UUAB 3CCRV 2YEDA 2BCCH 1HNZO 2CAZC 3X2QC 2JS5A 3F7VC 2XABA 4UCVA 4YKRA 4FLWA 3SJQC 4ZI7B 4WUBA 1YC3A 5LOVA 4ASBA 3O2FA 5HFMA 5H9CA 2OIGA 1JFFA 1WA8B 4CWOA 1U2OA 5JJJB 4DV3B 1WB7A 3OEEG 2R9AA 3RGBA 1J5EO 4IT5A 2H8MA 4UCTA 4DV2O 3QTFA 2UXBB 3K57A 3Q5JA 4RUEA 4QJFB 4JI7O 4DZYA 4HYPA 2Q8HA 1Q90D 4J9ZB 4JI6B 1KIJA 1S76D 2QKCA 4LP0A 1KP2A 2XHBA 2CTPA 1Z5AA 4DR3B 4O04A 2BRCA 2YGFA 4PL9A 1AB3A 4MVRA 4ZHQA 4FLVA 2Y4TA 3QVNA 2YEVB 2YE2A 5C8YA 2PY5A 4P2ZA 5TISZ 2OYQA 2RDCA 5L3BA 1N8RW 2WEPA 4G27B 4CZZA 1SETA 1ZL8B 2ZKJA 3PEHA 1L8DA 4QPKA 2YXYA 1XREA 3GIGB 3ZM7A 2YEIA 1Y76A 4V26A 2E5LO 2YI8A 4FMTA 2GHYA 3RVYA 1UYMA 2QWPB 4LC1A 1Z59A 4DW0A 4K0KO 2BU8A 4ZKIA 5EBWC 1K7DA 4PD4F 2XAJA 1SQBH 2Y0IA 1OCCC 4FVMA 2ARHA 2JKIA 2GSMB 3R4NA 4RO2A 4B3TB 1J95A 1XL6A 3G4SV 1OCRC 1WA8A 1K5QA 1YC4A 3D0BA 4FCRA 4MVQA 3AG4C 2QA4V 4C7UA 4Z1VA 4Z1MG 4B3RO 3L73H 4W7TA 4WFFA 2JEXA 2PGGA 3ETQA 4W4KA 4YHHO 2EZPA 4LWGA 3FAVB 5D7RA 1Q86W 5LYJB 3CGZA 2GQPA 3N2KA 1U97A 4U3JB 5LMUB 2WLNA 1DTOA 4I4TB 1Z5WA 1S5JA 1NH2D 4J10A 2AW9A 3OMAB 3G6BA 2VQEO 1B62A 3P3PA 1YHQV 5IJ9B 1PV0A 3W7XA 2LO1A 2EIMC 4NTWA 4H7QA 2WI6A 2YS8A 2KKWA 3DXRA 5IWAO 1ZL8A 5D6PA 2EZOA 1Y4MA 5LP6B 4FFBB 5EYPA 1PL4A 4X20A 4BR6A 2Q2EB 3RYIB 2F4VO 5L3JA 3KG2A 1R6TA 4GGLA 5EK0A 2HR3A 1Y8OA 3JZ3A 4XITA 2RJZA 1K9MW 2ODMA 5LXTB 3FT8A 4B6CA 4KSHA 3EHFA 2F93B 5AG2A 1MA1A 2DN9A 3AG1C 3B40A 3STZC 2IBZH 4GX1A 1Y66A 3ZMUA 4XDMA 4XIQA 4N21A 2BOBC 3CCSV 2WLIA 4DYLA 1WPBA 2W0XA 3T0ZA 2LGQA 3RKZA 1W0KG 3ZS8C 1N34O 2ZE5A 3BPZA 1FYJA 4EGIA 4HYOA 1CPYA 4B08A 4MP2A 4U7NA 5ITZB 2ZR2A 3FAVA 1GN3A 1WPXA 4AWPA 3H01A 2YIAA 5LYJA 3B2EE 2BZ5A 4MPEA 4U3JA 1K33A 1VQ4V 4JI2O 1Z2GA 4DR5B 2EIKB 4IYHA 3UT5B 3LSQA 3BHPA 2QKSA 5J71A 4RQFA 3CRKA 1GKZA 1D5NA 1YF2A 5IYBO 2XX4A 3ZBHA 5IJ9A 1PNLA 3ZHTA 1UY7A 4PDLA 1GKFA 4MTGA 3JYCA 5LP6A 1Y6XA 2O57A 4FFBA 5KX5B 4BIZA 3CPWU 5J6AA 1K5SA 1YSRA 4IIJB 1AJQA 4FLXA 4DR7O 1EN5A 4MW8A 1VQ7V 1IBLB 4BW5A 1VF7A 4X9QA 4MTFA 3APOA 1I5XA 3HKEA 5CF0A 4KTNA 2Q67A 2YKJA 4F6RA 3JASA 3K98A 1M9NA 1GM9A 3T1HO 2YICA 4UV9A 4IGGA 3VQXA 1EM1A 3CSXA 2WLLA 1DF5A 5FL7G 2R72A 1D2DA 1R6KA 4P30A 5LGUA 1R3KC 5F2VO 1FXKB 3CRAA 1PP9H 1FFXB 4HY1A 3R4OA 3CJHB 1YT1A 2DYSB 5D7CA 3SPIA 1RM1C 1H8EG 4O4LA 2JGDA 2EULA 1LNQA 3DGEA 2F1MA 2CH4A 4ASUG 2IWUA 5KA5A 2P90A 5EBLC 4F4LA 4MW3A 2HCHA 1Q8IA 3HPLC 4FIPC 4O07A 3R92A 5EIBD 1H2KA 3FFQA 2IJHA 4I0XA 4GX2A 4DUYO 3HKBA 3CYOA 1YDXA 5DECA 3I56V 4EB6B 1AI6A 2JJ2G 1HNXO 1JMKC 2AGAA 2HHHO 4Q6GA 1I5CA 3ASNC 4URLA 1HWYA 3E8FA 5KX5A 1MU5A 1KKCA 2R9IA 4LFAO 1EI1A 2ZE6A 1AH6A 4DV7O 2YI5A 4O2BB 2Z0AA 1XMQO 1Q81W 4K8ZA 3U2KA 2EXLA 3ASOB 3E86A 4LF7B 2EBOA 1P7BA 2PYLA 3L71H 4FM0A 4CWSA 5H6QA 2QWRB 4LNUA 1YEWA 4O4HB 2IWXA 5EC1C 4JGSA 4GKJB 1NH2B 1NTKH 4YKWA 4UCRA 2ZINA 1KU9A 4GKKO 4FCPA 4AS9A 5BR8O 1DGSA 3B4SA 2P6JA 3E8BA 3FX7A 2LW1A 1LUVA 3K5MA 1UYLA 1YETA 3CCUV 3JALB 1KBHA 4O05A 3N2GA 4UFZA 4DR6O 1SQGA 1XDCA 2YEHA 2Q7EA 3FKSG 3ZN0A 1NHHA 4LWHA 4FZ0A 1D5AA 4CH4A 1TUBB 3AK2A 4NXMO 4R3AA 1FJGO 4CWPA 2LW7A 1OJHA 1PD3A 3ZMVA 2E75B 4PJ0Z 1EZJA 3ABMC 1IZ3A 1XNQB 1S14A 3HKDA 3U11A 1OSFA 2ZE8A 3OWBA 4TV9A 4KQVA 1I5BA 3ZMTA 3OR6C 4DV5B 3ZRWB 3U67A 2BOCC 2C2AA 2CTQA 2YUAA 4JV5O 4YY3O 1XHZA 1OCOC 1Q82W 1L0OA 2XCMA 4X65O 3UQ8A 3G71V 2FWZA 1QHTA 3KCXA 3CCEV 1VQ8V 3IC7A 2CTRA 1THZA 2PTMA 4L93A 1S16A 3A0HZ 2BTQB 1M4UA 2OTLV 4I3HA 4UCSA 4X66B 5IDMA 4E01A 4Q20A 1FKAO 1R3JC 1JCHA 5B1NA 4G2KA 1XHXA 4UUJC 2ADPA 3I55V 3ABUA 3PEJA 3A0BZ 5B5EZ 5IYZB 3W7TA 4LF9O 4HYMA 1Y4UA 4TUYA 4XDJA 3AG3B 2WLHA 1I94O 1FAFA 2QTSA 4I5SA 5J2TA 4XKKA 2Q73A 1PM9A 4EMVA 4DUHA 1VF6A 5M4MA 2Y69C 3K60A 3LNUA 4R8CA 2ZT9B 4JI0O 3T1YB 1GH6A 1QNMA 4JZ2A 4LF6B 1SRYA 5BMVB 2JEUA 5KAIZ 5LMNB 2ZM6B 2DYRB 2FYUH 5FWKA 5EBMC 4CS2A 4O2AA 2CH7B 1H7UA 1Q6IA 2YEFA 2V1DA 2L6LA 3KZIZ 3K58A 3WB2A 2XDXA 4PV1B 5CTXA 3AK1A 3OE7G 5JJEB 3HHUA 4FJCC 4UCOA 4JI3O 4CC6A 1THNA 2PNRA 5JCOC 4DR1B 2HG1A 3FB8C 4KFGA 1HW7A 1TUEB 5JENA 4K4OA 4OX9B 2BTQA 1VQOV 3R4PA 2FTKA 3F7YC 2QEXV 5IJ0A 3UCSC 1FPOA 1WP7A 4NXNO 4KSGA 5JH7A 3BM9A 3SDLA 4MP7A 3STLC 1N0NA 4FM2A 5IT9N 1ZW9A 1SC5B 3A0TA 1ZLZA 3FT5A 1JJOA 4DV3O 2LFSA 4H37A 5A9GA 3ZHVA 1QYEA 1TH8A 4XE2A 3OAAG 2UXBO 2MW2B 1VARA 1MMMA 4PA7A 1ENVA 2IJJA 3HYYA 4QIWF 4JI6O 5FPOA 3HYZA 2X6CA 1GN2A 5IY5C 4DR3O 1UPGA 3QO5A 1M90W 2BSKA 3B09A 2R9RB 4JI8B 3J80N 2CH7A 3OGIB 2YK9A 2DWDC 2KB1A 2ZXWC 1WJZA 4HNAB 1M56C 4TV8B 1UJWB 1DLBA 3JATB 1K4DC 5GW7A 2L35A 4GFNA 5D6QA 3ZRXA 5LHIA 3TJTA 4UB8Z 1PL0A 2CE4A 1QR9A 3MAQA 3BA8A 1Q43A 4X1IB 4E02A 1L1FA 3E22B 3CRLA 4PDRA 1B06A 1VEWA 4LF8B 1YTFD 1XUQA 2NR5A 4CS4A 2CCSA 3GB7C 4B3TO 2WA4A 3CC7V 2PUSA 3OEHG 3TZ4A 3OUSA 2Q8VA 4MPCA 4DRXB 2JVDA 1US6A 2XHTA 3GWKC 3WQ9A 1Q5OA 1QU7A 3B27A 3K04A 1F4NA 2JJ1G 3C11A 2VCIA 4L91A 1K4CC 4CWNA 3SPGA 2CGOA 2PI4A 2MK3A 3ZMSA 2XK2A 4ZOLA 4IHJA 5LMUO 3EVKA 3JARB 1OZ0A 2GDSA 3BRCA 4EFUA 2PF4E 4YIOA 5DM6V 1NKDA 5L3DA 3ABTA 1OCCB 2WLKA 1BHBA 4JASA 1ZXNA 1Y74A 3SPCA 3TTZA 1OCRB 3ZHRA 2QKAA 3H9VA 4ICGA 4UVCA 4O4JB 4TV8A 3AG4B 1NJIW 3BEHA 3JATA 4B7PA 4WUDA 2ZDIA 2WI1A 2BTOA 2DWEC 4AWQA 2YIDA 1AROP 2ZE7A 2R70A 3VBBA 1JVMA 3JCZA 4GT8A 2UUCB 3NR7A 3RFRA 1KECA 3CX5F 5E79Z 2UXCB 2YDEA 4X1IA 4LFBB 2CGFA 3W7WA 2FB5A 3G80A 3K9AA 4X1YB 2EX3A 4BAYA 3TXQA 2EILC 2YEGA 1ZTEA 4I55A 1AR4A 2DMXA 2OCHA 2EIMB 1TGOA 4PI2A 5M4HA 1TIDA 3FV5A 4DRXA 3O0IA 1ZSPA 5CB4B 2YE5A 1Z5BA 2GUZB 4OPHA 5LA6B 3RT3C 4DV0B 4PA3A 4XC0A 2YKBA 2YGAA 3MDSA 4LP8A 2YI6A 2BU7A 5E1AC 4DR5O 3RYFB 1YI2V 3S3WA 3B8MA 5M4NA 1RSOB 5EC2C 1BGQA 1OHHG 4YKYA 5GTHZ 3AG1B 2FYPA 5B3SC 3VQVA 1UYCA 3IAYA 1SQXH 1YSZA 1ID0A 3RYHB 3LNNA 4QGPA 1QQCA 4JI4B 3L9DA 1P7GA 2LQTA 5JWPA 4DR2B 4AHCA 4MVMA 1QVFU 1KB9F 2YEEA 2JJCA 3EHGA 4ZI7A 4W4LA 3WU2Z 2CCUA 4YJ2B 4YJ3B 3B28A 2F43G 2YEJA 1IBLO 1IXBA 2E76B 2UUBB 1GAXA 2OCCC 1VP7A 2JK5C 1VQNV 3QO8A 1EBOA 2F95B 3VHAA 5DN6G 3E8HA 3ZHQA 4X1YA 4EGHA 2XOKG 2ZDYA 2IM9A 4URMA 2P67A 4EEHA 3H1KH 2HP8A 2P5OA 1JJ2U 3ABLC 3R66A 2V4DA 2K9PA 3R91A 2GUZA 1FS0G 2YEVA 2QM8A 5LA6A 3JCUZ 2IWSA 1UYHA 1F23A 3B25A 3OPDA 4R3MA 1K73W 2QE7G 3FB5C 2VWCA 5CTUA 2PYJA 1KP3A 1NBMG 2WEQA 3JSNA 1V54C 3GIGA 1XEQA 1H2SB 1RSOA 1PVGA 1UY9A 1R73A 4P9OA 4LF4B 1Q3EA 3G67A 5JVDB 3UKMA 2DQ3A 2VWJA 1VQ6V 1LR1A 5KMGB 1M57C 4FZ1A 2XD6A 3B26A 4YKUA 4DK1A 3RW0A 3RYCB 3D3IA 4KL1A 3TZ2A 1X4TA 4JI1B 4JAVA 1MZEA 4UCUA 4EGKA 2VS0A 1RM1B 1YTFB 2EINC 3LUTB 3G75A 1NS1A 1RFYA 4UVBA 3S5TA 1IXMA 2XNDG 2XX5A 1BSMA 1V55C 3SPHA 3SYQA 4O4IB 1DF4A 1I0HA 2PI5A 2DJVA 5KHIA 2Y0PA 4LFCO 4LF7O 4A5UB 5C93A 1NU1H 2ZNIA 2QWNB 5L3GA 4I4TA 3R4MA 3K08A 2P06A 4ZIBA 4GKJO 3P32A 3CMEV 2XASA 2B1IA 3ASNB 3HZ1A 2W6IG 1R3IC 3RLQA 4G28B 3ZHSA 4JAUA 2WA3A 4UVAA 2Y48A 1VQMV 1JR9A 3JD4A 1BXDA 2YK2A 3VHCA 1UY6A 1QLNA 3ZCCA 3AEIA 1GMGA 4V25A 1WLEA 1UFIA 3RYIA 1N33B 1F51A 3T4ZA 2JRIA 2ZD9A 4IL6Z 3BAAA 4UXNA 5KUMA 4LCUC 5J9PC 4X1KB 4CWRA 1XL4A 4HZ3A 1EZVH 2YEBA 5KMGA 3OTOB 4DR4B 1G4YB 5LXTA 2OIEA 4DV5O 3IFXA 2A3QA 2WI5A 3SYAA 2IU0A 4BQGA 2ZCEA 1Y8PA 4PHZA 1BCCH 1XNRB 3FYEB 2WAMA 1KKDA 5KUKA 1IBKB 2AHZA 1Q6UA 2CDYA 5LP6C 4DV4O 5IDJA 2BU6A 4O4IA 1EN4A 3ABMB 5ITZA 2X0LA 4IYIA 2P4KA 3EFFK 1AMWA 1GN6A 2QM4A 4AQYB 3L75H 4X66O 2XHXA 4FFKA 4YKTA 3UT5A 1QCEA 4R1FA 1AJNA 5DEDA 1SA0B 1ZUQA 1YT0A 3QG5A 1OCZC 1R6NA 1ROPA 3AG2B 3MD0A 2YKIA 1SZXA 4NVPA 2RNBA 1YIJV 2IOPA 1YERA 1OCOB 2YE8A 2N04A 3EKOA 4L87A 1JPXA 3BA9A 4DXWA 3DC5A 1YESA 1N0JA 2H8PC 5IE9A 3G7EA 2N05A 5KAFZ 4IIJA 2O1VA 5CTWA 3T1YO 3JD1A 3G7BA 4LF6O 1H38A 2GFDA 2BYHA 1MZFA 3PJSK 5LMNO 1KMIZ 4PU9A 2ZM6O 3RLPA 2XDKA 1KQSU 1GM8A 1VQ9V 1MABG 4MVUA 1MSWD 2YIBD 4GUNA 1UYKA 3LDEA 4DV1B 1FXKA 1OV9A 1FFXA 1YVWA 3LSUA 5D5PA 2GTSA 3VQYA 3CJHA 5LHGA 4DR1O 1N32B 1TC0A 4N23A 4LBEC 4LH6A 4OX9O 5CA1B 1ZWHA 1AH8A 1I5YA 4RWUA 2XDUA 4MVZA 4NKGB 5EZYB 4PA9A 4ASAA 1JOYA 1YXBA 5FNVB 2QWQB 4BAEA 2HVKC 3Q4HB 3ZN1A 4WFAV 3ZRVA 1XI1A 2D3OW 3FB7C 4EB6A 1HR0B 4H44B 5FNFA 3CHXA 3K06A 4FLYA 2EIJC 1TC6A 3IEDA 2QF6A 2YJXA 5F5RA 2BU2A 1G1XB 4JYCA 1YC1A 5LL6Y 3B24A 3SJAC 1XBLA 1G8MA 1TBWA 3BABA 4O0BA 3CC2V 4O2BA 4JTCB 1O9GA 3D3QA 3H1IH 2QDOA 1R62A 4KUMA 4CC5A 3K03A 4NR1A 4OXSA 3WG7C 3CMAV 1GTOA 3J7AU 4JI8O 1NVPD 1YZBA 1ZAUA 5F3KA 1S77D
chains in the Genus database with same CATH topology
3RVZA 3FYIB 3KE6A 1AM1A 5BODA 4XBFA 3ZXQA 3LSSA 3E83A 1YJNV 2BREA 2YI7A 3T4DA 1EA6A 4LPBA 5B1OA 4LWFA 5FNDA 5IY5B 1S5HC 3O6OA 3WFVA 5CBHA 2XX2A 3M99B 3W7SA 4YKQA 4XIRA 5H6RA 3ZMZA 2ZXWB 4H33A 2BSMA 1M56B 2QTOA 4X88A 4GEEA 4CWTA 4GCZA 3ZRWA 2DQ0A 1BMFG 1K3EA 2QM7A 3CD6V 4XCJA 1FXVA 4URNA 1TILA 1QLEC 1YJ9V 1KD1W 4JQLA 4MPNA 3CCJV 2ZBKB 4MBCA 3ZKDA 1JM6A 3EKRA 2IJIA 4XDKA 5IYDO 4XTJA 1BHAA 3D36A 5FNCA 4XIPA 2W0FC 3CCMV 2DW4A 1BL8A 1I5DA 3C0EA 1E1RG 4TT3G 2IU3A 1BYQA 1MX0A 4P8OA 3JD2A 4BQJA 4PA4A 2OT5A 1UYIA 2ESAA 1I58A 1SESA 3QNEA 3X2QB 1UY8A 4R6ZA 2FWYA 3T1KA 2ITDC 3ZIAG 5LGNA 2P7TC 1H7SA 4L94A 3AG3C 2Q8FA 4MVSA 3CCQV 4UROA 3QDDA 1S3JA 2NNUA 2EILB 1US7A 1YSCA 4U93A 3RBZA 4CE1A 3D2RA 2DYRC 1Y8NA 1GO3F 3T1CA 1P4RA 3HEKA 3TK1A 4NH9A 3F5WC 2FXSA 2ATKC 4TWKA 4QE9A 4I9WA 1NHIA 2WERA 2H55A 5B3SB 5B1BC 2Z5UA 3ML0A 3ZXOA 4JPRA 3BMYA 2WLJA 3OW2U 2BU5A 1SERA 2A9HA 1NVPB 2IH1C 3K99A 3CCVV 1KZNA 4DO2A 1VQ5V 3OMNB 2B1GA 1Y4SA 1B63A 1YT2A 3RLRA 2BYIA 3WHAA 2IOQA 1AI4A 5M4PA 4YKXA 4ASGA 4MVOA 1Z5CA 1FXHA 4XD8A 3CWVA 3ABLB 2WI4A 1COWG 1RPRA 4GX0A 2UXNA 3H80A 1NHJA 3VOUA 4PDVA 1V54B 3ABKC 4CE3A 2X6AA 2ZDIC 4MOTA 2K1EA 1GKXA 4CE2A 2YSUB 2YE3A 3OGCC 1RPOA 1M57B 3TUHA 3OW6A 1QBZA 3JD0A 1K8AW 2XAHA 3CCLV 4HXZA 1FFTB 5L3EA 2EINB 2WI2A 5B1AC 2WSSG 2XDLA 2NLJC 3E89A 3QO7A 1V55B 4XKAA 3MHSC 3TZ0A 2YI0A 4MSWC 1Q7YW 4XKOA 2E0AA 1VQPV 3K97A 4JTAB 3GWOA 2XJGA 2Q8IA 3K0DA 2AKPA 4CBCA 1QZRA 2WLIB 5L3CA 5CPHA 2LFRA 5LGTA 4RUFA 1AJPA 2UWDA 2WLMA 4JYBA 3JD3A 4O09A 2O1WA 4P7AA 5CTYA 4GQTA 4ASFA 4MT8A 3NXSA 3SPJA 3LDDA 4MTXA 1W2BU 2K5BA 5M4KA 1W0JG 4R50A 2VW5A 1E1QG 4U7OA 2QG0A 4X9LA 1ORQC 3K79A 3Q5KA 1R3LC 1BKNA 1H2GA 2IH3C 1M1KW 1PNKA 5KA6A 4YKZA 5LBQA 1OCZB 3EHJA 4WUCA 2QG2A 2WLLB 1I59A 5CA3A 2YE9A 1GJVA 3A0XA 1NR1A 4WFEA 3OR7C 5D7DA 2Q68A 3ZJZA 3CP1A 5CMUA 3P30A 1VQLV 1NR7A 1ZWIC 2ZR3A 4H85A 2ZDXA 3A0RA 4J9YB 3A0ZA 4HZ5A 1AJ6A 2BT0A 4HXWA 4L90A 3LDCA 1MOFA 1QY8A 2XJXA 1NQTA 4QE7A 2HVJC 4PA6A 3TZ5A 2AHYA 4PRVA 4E2LA 1K92A 3HB3B 4R7CA 3G6EV 2LP7A 4JF3A 3E35A 2IW5A 2YGEA 2XDSA 3LNMB 2EIJB 5L3FA 3U2DA 3VADA 3INXA 2CK3G 2YKEA 4LWIA 2HKOA 3A0YA 1SZTA 4XCLA 4HZ0A 3SYPA 4FCQA 4JTDB 3WG7B 3MNRP 1CP9A 4ZBMA 2JIZG 4FK5C 2EIKC 3LPSA 2UXXA 3ZRSA 1U0ZA 4WFGA 3EHBB 2Y69B 1UYGA 3ETGA 3A0WA 2WI3A 2JDIG 4E00A 1VQKV 1AI5A 2Q69A 1K97A 4CWFA 3TCUA 2XHRA 5LHHA 2X7RB 3OMUA 2ZQMA 4WF9V 3T0HA 1AR1B 1YJWV 2XJJA 1QLEB 1FXKC 2ITCC 1I5AA 3R65A 2DYSC 2A0LA 4FPPA 3Q5LA 1EFRG 4BIUA 3W7UA 4YXWG 5HFLA 2CCTA 5CN0A 2V7QG 2YKCA 4AWOA 2CG9A 1PNMA 2X6BA 1S0VA 3AG2C 4MB9A 1YITV 3E2EA 4HY6A 4PRXA 3OMIB 1AI7A 4CWQA 2Q8GA 3B8NA 1PKXA 2YECA 3TETA 5BOCA 1QR8A 2B5UA 4GT1A 5GGZA 3T10A 1YS3A 2A79B 1JQ0A 2WI7A 2W6JG 4QNHB 4EM7A 3DTUB 3ASOC 1H8HG 3K0GA 1A4HA 1S72V 2QFOA 1ZXMA 2XAGA 4XDLA 1UYFA 1MG1A 4EFTA 5M4EA 4LWEA 1CEZA 3GIEA 2HJFC 2O1UA 1JX9A 2YEAA 4NH7A 3SYCA 3OWDA 4WCEV 3NMQA 1B3QA 2M7WA 4MS2A 1UYEA 3UM7A 4WFHA 2Q6AA 1KC8W 2HG5C 3CC4V 4WFBV 5B1BB 1F4MA 5IYCO 3SL2A 3OFNG 2BTZA 2HFEC 4PDMA 4L8ZA 4PELA 3E8GA 3CGYA 3ETEA 3VHDA 3FB6C 3ZKBA 2WPDG 3CXCU 2HLDG 4NH8A 2XAFA 3INWA 4MTOA 3OUFA 3H4LA 3B77A 5BZBA 3EHHA 3MHHC 2HKJA 4EKWA 1GM7A 3T2MA 4P9PA 2H94A 3GIFA 2WWWA 2VCJA 4H81A 3ETDA 4KFMA 5IN9A 3ABKB 4KP4A 2YJWA 3T2SA 3SYOA 3BY6A 4RQEA 4UV8A 2IJKA 3HZ5A 2EJRA 2IORA 2Z3YA 5CBGA 2YE6A 4QPJA 3OM3B 2OTJV 4HAMA 4GX5A 4TSFG 5B1AB 1K34A 1QVGU 3IGAC 3K3WA 4X89A 4X8AA 2YE7A 2OCCB 1UYDA 1E79G 2XAQA 1B6QA 2YE4A 4RAIA 1GK9A 5CBFA 4ZVIA 4BXIA 3CCRV 2YEDA 3X2QC 3F7VC 2XABA 4YKRA 3SJQC 4WUBA 1YC3A 4ASBA 3O2FA 5HFMA 5H9CA 4CWOA 1U2OA 3OEEG 2H8MA 3QTFA 3Q5JA 4RUEA 4QJFB 4DZYA 4HYPA 2Q8HA 4J9ZB 1KIJA 1S76D 4LP0A 1KP2A 1Z5AA 4O04A 2BRCA 2YGFA 4PL9A 4MVRA 2YEVB 2YE2A 4P2ZA 5L3BA 1N8RW 2WEPA 4G27B 4CZZA 1SETA 3PEHA 2ZKJA 4QPKA 3GIGB 3ZM7A 2YEIA 4V26A 4FMTA 2GHYA 3RVYA 1UYMA 4LC1A 1Z59A 2BU8A 4ZKIA 5EBWC 1K7DA 2XAJA 1OCCC 2JKIA 2GSMB 3R4NA 4RO2A 1J95A 1XL6A 3G4SV 1OCRC 1K5QA 1YC4A 3D0BA 4FCRA 4MVQA 3AG4C 2QA4V 4Z1MG 4W7TA 4WFFA 2JEXA 2EZPA 4LWGA 5D7RA 1Q86W 3CGZA 2GQPA 2WLNA 1DTOA 1NH2D 3OMAB 1B62A 1YHQV 3W7XA 2EIMC 4H7QA 2WI6A 5D6PA 2EZOA 1Y4MA 2Q2EB 5L3JA 3KG2A 4GGLA 5EK0A 2HR3A 1Y8OA 3JZ3A 4XITA 1K9MW 3FT8A 4B6CA 4KSHA 3EHFA 3AG1C 3STZC 4GX1A 1Y66A 3ZMUA 4XDMA 4XIQA 4N21A 2BOBC 3CCSV 2WLIA 3T0ZA 3RKZA 1W0KG 4EGIA 4HYOA 1CPYA 4MP2A 4U7NA 2ZR2A 1WPXA 4AWPA 3H01A 2BZ5A 4MPEA 1K33A 1VQ4V 2EIKB 3LSQA 2QKSA 5J71A 4RQFA 3CRKA 1GKZA 5IYBO 2XX4A 1PNLA 1UY7A 4PDLA 1GKFA 4MTGA 3JYCA 4BIZA 3CPWU 5J6AA 1K5SA 1YSRA 1AJQA 4MW8A 1VQ7V 4BW5A 4MTFA 1I5XA 5CF0A 4KTNA 2Q67A 2YKJA 3K98A 1M9NA 1GM9A 4UV9A 2WLLA 1DF5A 5FL7G 1R6KA 4P30A 5LGUA 1R3KC 1FXKB 4HY1A 3R4OA 1YT1A 2DYSB 5D7CA 3SPIA 1RM1C 1H8EG 1LNQA 3DGEA 2CH4A 4ASUG 2IWUA 5KA5A 2P90A 5EBLC 4F4LA 4MW3A 2HCHA 4FIPC 3HPLC 4O07A 3R92A 2IJHA 4GX2A 3CYOA 3I56V 1AI6A 2JJ2G 1I5CA 3ASNC 4URLA 1HWYA 3E8FA 1MU5A 2R9IA 1EI1A 1AH6A 2YI5A 1Q81W 3U2KA 2EXLA 3ASOB 3E86A 2EBOA 1P7BA 4CWSA 5H6QA 2IWXA 5EC1C 4JGSA 1NH2B 4YKWA 4FCPA 4AS9A 2P6JA 3E8BA 1UYLA 1YETA 3CCUV 4O05A 2YEHA 3FKSG 3ZN0A 1NHHA 4LWHA 4R3AA 4CWPA 3ZMVA 1PD3A 1EZJA 3ABMC 1S14A 1OSFA 3OWBA 4KQVA 1I5BA 3ZMTA 3OR6C 3ZRWB 3U67A 2BOCC 2C2AA 1OCOC 1Q82W 1L0OA 2XCMA 3G71V 2FWZA 3CCEV 1VQ8V 3IC7A 1THZA 4L93A 1S16A 2OTLV 4I3HA 5IDMA 4E01A 4Q20A 1R3JC 1JCHA 5B1NA 4G2KA 4UUJC 3I55V 3ABUA 3PEJA 3W7TA 4HYMA 1Y4UA 4XDJA 3AG3B 2WLHA 4I5SA 4XKKA 4EMVA 4DUHA 5M4MA 2Y69C 3K60A 3LNUA 4R8CA 1SRYA 2JEUA 2DYRB 5FWKA 5EBMC 1H7UA 2YEFA 2V1DA 2XDXA 5CTXA 3OE7G 3HHUA 4FJCC 1THNA 2PNRA 2HG1A 3FB8C 4KFGA 1TUEB 4K4OA 1VQOV 3R4PA 2FTKA 3F7YC 2QEXV 4KSGA 3BM9A 4MP7A 3STLC 1ZW9A 3A0TA 3FT5A 2LFSA 4H37A 1QYEA 1TH8A 4XE2A 3OAAG 4PA7A 1ENVA 2IJJA 3HYYA 4QIWF 3HYZA 2X6CA 5IY5C 3QO5A 1M90W 2R9RB 2YK9A 2DWDC 2KB1A 2ZXWC 1M56C 1UJWB 1DLBA 1K4DC 5GW7A 4GFNA 5D6QA 3ZRXA 5LHIA 1PL0A 1QR9A 4E02A 1L1FA 3CRLA 4PDRA 1YTFD 2CCSA 3GB7C 3CC7V 3TZ4A 3OEHG 3OUSA 4MPCA 2XHTA 3WQ9A 3B27A 3K04A 1F4NA 2JJ1G 3C11A 2VCIA 4L91A 1K4CC 4CWNA 3SPGA 2PI4A 2MK3A 3ZMSA 2XK2A 1OZ0A 4EFUA 5DM6V 1NKDA 5L3DA 3ABTA 1OCCB 2WLKA 1BHBA 4JASA 1ZXNA 3SPCA 3TTZA 1OCRB 4UVCA 3AG4B 1NJIW 3BEHA 4B7PA 4WUDA 2ZDIA 2WI1A 2DWEC 4AWQA 1AROP 3VBBA 1JVMA 3JCZA 4GT8A 1KECA 2CGFA 3W7WA 3K9AA 4BAYA 2EILC 2YEGA 2EIMB 5M4HA 1TIDA 3FV5A 3O0IA 2YE5A 1Z5BA 4XC0A 4PA3A 2YKBA 2YGAA 4LP8A 2YI6A 2BU7A 5E1AC 1YI2V 3B8MA 5M4NA 5EC2C 1BGQA 1OHHG 4YKYA 3AG1B 2FYPA 5B3SC 1UYCA 1YSZA 1ID0A 1QVFU 4MVMA 2YEEA 2JJCA 3EHGA 2CCUA 3B28A 2F43G 2YEJA 2OCCC 2JK5C 1VQNV 3QO8A 1EBOA 3VHAA 5DN6G 3E8HA 4EGHA 2XOKG 2ZDYA 4URMA 2P67A 4EEHA 1JJ2U 3ABLC 3R91A 1FS0G 2YEVA 2QM8A 2IWSA 1UYHA 1F23A 3B25A 3OPDA 4R3MA 1K73W 2QE7G 3FB5C 2VWCA 5CTUA 2WEQA 1KP3A 1NBMG 1V54C 3GIGA 1PVGA 1UY9A 1R73A 4P9OA 3UKMA 2DQ3A 1VQ6V 1M57C 2XD6A 3B26A 4YKUA 3RW0A 3D3IA 3TZ2A 4JAVA 4EGKA 1RM1B 1YTFB 2EINC 3LUTB 3G75A 4UVBA 1IXMA 2XNDG 2XX5A 1V55C 3SPHA 3SYQA 1DF4A 2PI5A 5C93A 5L3GA 3R4MA 3K08A 3P32A 3CMEV 2XASA 2B1IA 3ASNB 3HZ1A 2W6IG 1R3IC 3RLQA 4G28B 4JAUA 2Y48A 4UVAA 1VQMV 3JD4A 1BXDA 2YK2A 3VHCA 1UY6A 1QLNA 3ZCCA 3AEIA 1GMGA 4V25A 1F51A 3T4ZA 2ZD9A 4UXNA 5KUMA 4LCUC 5J9PC 4CWRA 1XL4A 4HZ3A 2YEBA 1G4YB 3IFXA 2WI5A 3SYAA 2IU0A 4BQGA 1Y8PA 3FYEB 2WAMA 1KKDA 5KUKA 2AHZA 5IDJA 2BU6A 3ABMB 2X0LA 3EFFK 1AMWA 2XHXA 4YKTA 1QCEA 4R1FA 1AJNA 1YT0A 1OCZC 1R6NA 1ROPA 3AG2B 3MD0A 2YKIA 1YIJV 2IOPA 1YERA 1OCOB 2YE8A 3EKOA 4L87A 1JPXA 4DXWA 1YESA 2H8PC 3G7EA 2O1VA 5CTWA 3JD1A 3G7BA 1H38A 2GFDA 2BYHA 3PJSK 4PU9A 3RLPA 2XDKA 1KQSU 1GM8A 1VQ9V 1MABG 4MVUA 1MSWD 1UYKA 3LDEA 1FXKA 5LHGA 1TC0A 4N23A 4LBEC 1ZWHA 1AH8A 1I5YA 2XDUA 4MVZA 4PA9A 4ASAA 1JOYA 4BAEA 2HVKC 3ZN1A 4WFAV 3ZRVA 2D3OW 3FB7C 5FNFA 3K06A 2EIJC 1TC6A 3IEDA 2QF6A 5F5RA 2YJXA 2BU2A 4JYCA 1YC1A 3B24A 1G8MA 1TBWA 4O0BA 3CC2V 4JTCB 1R62A 4KUMA 3K03A 4OXSA 3WG7C 3CMAV 1GTOA 1NVPD 1WLEA 5F3KA 1S77D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRX A;  2JKI A;  3KE6 A;  1AM1 A;  3R4N A;  5BOD A;  3ZXQ A;  4E02 A;  2YGE A;  1YC4 A;  3D0B A;  4FCR A;  2XDS A;  2BRE A;  3CRL A;  2YI7 A;  1EA6 A;  4LPB A;  5B1O A;  4W7T A;  2CCS A;  4LWF A;  5FND A;  4LWG A;  3O6O A;  3U2D A;  5D7R A;  3TZ4 A;  3VAD A;  3CGZ A;  3INX A;  2GQP A;  2YKE A;  4LWI A;  4MPC A;  2XX2 A;  2XHT A;  3A0Y A;  4YKQ A;  3WQ9 A;  4XIR A;  3B27 A;  4XCL A;  4HZ0 A;  3C11 A;  2VCI A;  4L91 A;  4CWN A;  2BSM A;  2XK2 A;  1B62 A;  4FCQ A;  4GEE A;  4CWT A;  3MNR P;  4GCZ A;  3ZRW A;  2QM7 A;  4H7Q A;  2WI6 A;  4XCJ A;  4EFU A;  5D6P A;  1TIL A;  4URN A;  4JAS A;  1ZXN A;  2Q2E B;  3LPS A;  3TTZ A;  4JQL A;  5L3J A;  4MPN A;  4GGL A;  2ZBK B;  1Y8O A;  4MBC A;  3ZKD A;  4B7P A;  3JZ3 A;  4WUD A;  4XIT A;  1U0Z A;  2WI1 A;  3FT8 A;  4B6C A;  4AWQ A;  1JM6 A;  3EKR A;  4KSH A;  3EHF A;  4GT8 A;  1UYG A;  4XDM A;  4XIQ A;  4XTJ A;  3D36 A;  5FNC A;  3A0W A;  4XIP A;  2CGF A;  3T0Z A;  2WI3 A;  1I5D A;  3C0E A;  3RKZ A;  4E00 A;  2YEG A;  1BYQ A;  4EGI A;  1MX0 A;  4P8O A;  4MP2 A;  4U7N A;  4CWF A;  4AWP A;  2BZ5 A;  4BQJ A;  4MPE A;  1TID A;  5M4H A;  2XHR A;  3FV5 A;  3O0I A;  3OMU A;  2YE5 A;  3T0H A;  1UYI A;  1Z5B A;  2ESA A;  2XJJ A;  1I58 A;  5J71 A;  4XC0 A;  2YKB A;  1UY8 A;  1I5A A;  3CRK A;  1GKZ A;  2YGA A;  2YI6 A;  2BU7 A;  2XX4 A;  2FWY A;  3T1K A;  4FPP A;  3Q5L A;  1UY7 A;  5M4N A;  4BIU A;  1BGQ A;  4YKY A;  2FYP A;  1H7S A;  4L94 A;  2CCT A;  4BIZ A;  1UYC A;  5J6A A;  2YKC A;  4AWO A;  1YSZ A;  1ID0 A;  1YSR A;  2CG9 A;  2Q8F A;  4URO A;  3QDD A;  4MB9 A;  4HY6 A;  4PRX A;  2YEE A;  2JJC A;  3EHG A;  4CWQ A;  2Q8G A;  5CF0 A;  4KTN A;  1US7 A;  2YKJ A;  3K98 A;  4U93 A;  2CCU A;  2YEC A;  3B28 A;  4CE1 A;  3D2R A;  2YEJ A;  5BOC A;  1Y8N A;  4GT1 A;  3HEK A;  3VHA A;  4HY1 A;  3TK1 A;  5GGZ A;  3T10 A;  3R4O A;  1YS3 A;  4NH9 A;  1YT1 A;  4EGH A;  2ZDY A;  2WI7 A;  4URM A;  5D7C A;  2P67 A;  2FXS A;  3DGE A;  4EM7 A;  2CH4 A;  4EEH A;  2IWU A;  1A4H A;  2HCH A;  1NHI A;  2QFO A;  2WER A;  2H55 A;  4O07 A;  3R91 A;  3R92 A;  1ZXM A;  2QM8 A;  2IWS A;  1UYH A;  3B25 A;  3OPD A;  4R3M A;  3ZXO A;  2VWC A;  5CTU A;  3BMY A;  2WEQ A;  2BU5 A;  3GIG A;  1UYF A;  1I5C A;  1PVG A;  1UY9 A;  3K99 A;  4EFT A;  4URL A;  1KZN A;  5M4E A;  4LWE A;  1MU5 A;  3GIE A;  2O1U A;  1Y4S A;  1B63 A;  2XD6 A;  2YEA A;  3B26 A;  1YT2 A;  1EI1 A;  4YKU A;  1AH6 A;  3RLR A;  2BYI A;  2YI5 A;  3TZ2 A;  4NH7 A;  4JAV A;  4EGK A;  3OWD A;  3U2K A;  3WHA A;  2EXL A;  2IOQ A;  3NMQ A;  1B3Q A;  5M4P A;  4YKX A;  4ASG A;  1Z5C A;  1UYE A;  4XD8 A;  4CWS A;  3CWV A;  3G75 A;  2WI4 A;  2IWX A;  1IXM A;  2XX5 A;  4YKW A;  4FCP A;  4AS9 A;  3H80 A;  1NHJ A;  3SL2 A;  5C93 A;  1UYL A;  1YET A;  4O05 A;  2BTZ A;  3R4M A;  4CE3 A;  2YEH A;  3P32 A;  4MOT A;  1NHH A;  4LWH A;  3HZ1 A;  1GKX A;  4L8Z A;  3RLQ A;  4CE2 A;  4JAU A;  2YE3 A;  4R3A A;  4CWP A;  3CGY A;  3VHD A;  3ZKB A;  1S14 A;  1BXD A;  4NH8 A;  2YK2 A;  3VHC A;  1UY6 A;  3INW A;  1OSF A;  3ZCC A;  3TUH A;  3OWB A;  3H4L A;  4KQV A;  3OW6 A;  4V25 A;  1I5B A;  4HXZ A;  1F51 A;  3EHH A;  3ZRW B;  2WI2 A;  2HKJ A;  3U67 A;  2XDL A;  2C2A A;  4CWR A;  2YEB A;  4XKA A;  1L0O A;  2XCM A;  3GIF A;  3TZ0 A;  2WWW A;  2VCJ A;  2FWZ A;  2YI0 A;  4H81 A;  2WI5 A;  4BQG A;  4XKO A;  4L93 A;  5IN9 A;  2E0A A;  3K97 A;  4KP4 A;  1S16 A;  1Y8P A;  2YJW A;  3T2S A;  4I3H A;  2XJG A;  5IDM A;  2Q8I A;  4E01 A;  4Q20 A;  3HZ5 A;  5B1N A;  2AKP A;  5IDJ A;  2BU6 A;  2IOR A;  1QZR A;  3PEJ A;  2YE6 A;  4QPJ A;  5CPH A;  2LFR A;  1AMW A;  4HYM A;  2XHX A;  4YKT A;  1Y4U A;  2UWD A;  4JYB A;  4R1F A;  4O09 A;  1YT0 A;  2O1W A;  4I5S A;  4XKK A;  4P7A A;  5CTY A;  3MD0 A;  4GQT A;  4ASF A;  2YKI A;  4DUH A;  4EMV A;  4MT8 A;  2IOP A;  5M4M A;  3K60 A;  3LNU A;  3NXS A;  1YER A;  2YE8 A;  3EKO A;  4MTX A;  2K5B A;  1YES A;  5FWK A;  2YE7 A;  3G7E A;  1UYD A;  5M4K A;  2VW5 A;  4U7O A;  2O1V A;  2QG0 A;  5CTW A;  1H7U A;  2YEF A;  3G7B A;  4X9L A;  2GFD A;  2YE4 A;  2BYH A;  2XDX A;  3Q5K A;  4PU9 A;  3RLP A;  4ZVI A;  5CTX A;  1BKN A;  4BXI A;  2XDK A;  3HHU A;  2YED A;  1THN A;  2PNR A;  2HG1 A;  2XAB A;  4KFG A;  4YKR A;  1UYK A;  4K4O A;  4WUB A;  1YC3 A;  4YKZ A;  4ASB A;  3R4P A;  3O2F A;  2FTK A;  3EHJ A;  4WUC A;  4CWO A;  2QG2 A;  1I59 A;  1U2O A;  2YE9 A;  1GJV A;  3A0X A;  1TC0 A;  4KSG A;  2H8M A;  3BM9 A;  1ZWH A;  3QTF A;  1AH8 A;  4MP7 A;  3Q5J A;  2XDU A;  5D7D A;  4ASA A;  4DZY A;  1ZW9 A;  4HYP A;  2Q8H A;  3A0T A;  1KIJ A;  1JOY A;  3FT5 A;  4LP0 A;  2LFS A;  1Z5A A;  4BAE A;  1QYE A;  1TH8 A;  4H85 A;  4O04 A;  2ZDX A;  3A0R A;  4XE2 A;  2BRC A;  3ZRV A;  2YGF A;  4PL9 A;  3A0Z A;  4HZ5 A;  1AJ6 A;  3HYY A;  2BT0 A;  3HYZ A;  4HXW A;  4L90 A;  5FNF A;  2YE2 A;  1TC6 A;  3IED A;  2QF6 A;  2YJX A;  5F5R A;  2WEP A;  2BU2 A;  1QY8 A;  2XJX A;  4JYC A;  1YC1 A;  3PEH A;  2ZKJ A;  3B24 A;  4QPK A;  1TBW A;  3GIG B;  4O0B A;  3ZM7 A;  2YEI A;  4V26 A;  2YK9 A;  4FMT A;  1R62 A;  1UYM A;  4LC1 A;  3TZ5 A;  1Z59 A;  4PRV A;  2BU8 A;  4ZKI A;  4GFN A;  5F3K A;  5D6Q A; 
#chains in the Genus database with same CATH topology
 3M8A A;  4O4H A;  3RVZ A;  4CS3 A;  5JQG B;  3FYI B;  1M5I A;  3KE6 A;  1AM1 A;  4JZG A;  5BOD A;  4XBF A;  2KG7 B;  3ZXQ A;  1L0L H;  3CS5 A;  1IX9 A;  3LSS A;  2RQ6 A;  3E83 A;  1YJN V;  2BRE A;  3JAL A;  2YI7 A;  3T4D A;  1EA6 A;  3K5L A;  1I7F A;  4LPB A;  5B1O A;  3C3T A;  2Q7G A;  4F6E A;  4LWF A;  5FND A;  5IY5 B;  3H1J H;  5EZY A;  1S5H C;  2AZ0 A;  3O6O A;  3WFV A;  1TUB A;  3THO A;  5CBH A;  1HNW B;  2XX2 A;  5FNV A;  4JI5 B;  3M99 B;  3W7S A;  1BS3 A;  4YKQ A;  1Q6H A;  4LF8 O;  4XIR A;  4DUZ B;  5H6R A;  3ZMZ A;  3CRC A;  2ZXW B;  2VQF B;  4H33 A;  2BSM A;  1M56 B;  2QTO A;  4X88 A;  1Y67 A;  4B3M B;  4BWA A;  4GEE A;  4CWT A;  3JAK B;  4GCZ A;  3ZRW A;  2DQ0 A;  1BMF G;  1K3E A;  2QM7 A;  1SF9 A;  3CD6 V;  4XCJ A;  1FXV A;  3A8T A;  1XMO B;  1TIL A;  4URN A;  3CRM A;  2Q0O C;  1QLE C;  1YJ9 V;  1KD1 W;  4JQL A;  3IJ4 A;  4BIO A;  4MPN A;  3CCJ V;  1VF6 C;  2YXH A;  2UU9 O;  2ZBK B;  4MBC A;  3ZKD A;  1JM6 A;  2UUA O;  5J2U B;  3EKR A;  1N36 B;  2IJI A;  3H1H H;  4XDK A;  4X62 B;  5IYD O;  1IVS A;  4XTJ A;  1BHA A;  2QR4 A;  3D36 A;  1NI8 A;  5IYZ A;  5FNC A;  4XIP A;  2W0F C;  3CCM V;  2DW4 A;  4ABM A;  1BL8 A;  1I5D A;  3C0E A;  1E1R G;  4TT3 G;  2IU3 A;  3CYG A;  1BYQ A;  3PN1 A;  1NZ6 A;  1MX0 A;  2UUC O;  4P8O A;  3JD2 A;  5JJN B;  2UXC O;  4NYK A;  4BQJ A;  4LFB O;  4PA4 A;  2OT5 A;  1UYI A;  2ESA A;  1I58 A;  1SES A;  2GV9 A;  2YI9 A;  3QNE A;  5BMV A;  4KHP B;  1SQP H;  2Q9L A;  3X2Q B;  2UXD B;  1UY8 A;  1F7Y A;  4R6Z A;  3CWB H;  2FWY A;  3T1K A;  1BGY H;  5GTI Z;  1GRJ A;  2HJD A;  2ITD C;  3ZIA G;  5LGN A;  2P7T C;  4DV0 O;  1H7S A;  4L94 A;  3AG3 C;  1TVK B;  2Q8F A;  4MVS A;  3D8C A;  3CCQ V;  4URO A;  1SKV A;  3QDD A;  1V9P A;  4JYA B;  2CUG A;  1S3J A;  2E3C A;  2NNU A;  2EIL B;  1US7 A;  3UO2 A;  1YSC A;  4U93 A;  4J80 A;  1AP5 A;  1H2M A;  2Q0A A;  3RBZ A;  3D2R A;  4CE1 A;  4JI4 O;  2DYR C;  5K1X A;  4DR2 O;  1Y8N A;  2CGN A;  1GO3 F;  3T1C A;  3U0Z A;  1P4R A;  5LOV B;  3HEK A;  3TK1 A;  2DE0 X;  1JFF B;  4NH9 A;  2VRZ A;  3CEI A;  3F5W C;  2UUB O;  2FXS A;  2ATK C;  4TWK A;  4QE9 A;  1XOU A;  4J7K A;  3H1L H;  1H2N A;  2CTW A;  3P3N A;  4I9W A;  1NHI A;  2WER A;  2H55 A;  5B3S B;  3L70 H;  5B1B C;  4WBN B;  3EXA A;  2Z5U A;  3ML0 A;  3ZXO A;  4X64 B;  4JPR A;  4ZHQ B;  4B3S B;  3BMY A;  2WLJ A;  4OGQ B;  3OW2 U;  2BU5 A;  3JAW B;  1SER A;  2A9H A;  1NVP B;  5C8Y B;  3ICX A;  2IH1 C;  3SJB C;  3K99 A;  3CCV V;  1KZN A;  2QSA A;  4DO2 A;  1VQ5 V;  4HNA A;  3OMN B;  3U10 A;  2FKX A;  2B1G A;  1Y4S A;  1B63 A;  4TQF A;  1YT2 A;  1VIB A;  3RLR A;  2ETN A;  2BYI A;  5BY1 A;  4LF4 O;  4DV6 B;  3WHA A;  2IOQ A;  1AI4 A;  3L72 H;  5M4P A;  4YKX A;  4ASG A;  4MVO A;  1Z5C A;  1FXH A;  4Z2W A;  4XD8 A;  3CWV A;  2ZIM A;  3ABL B;  3E22 A;  1COW G;  2WI4 A;  4NXN B;  4JI1 O;  2HEP A;  1EN6 A;  1LUW A;  1RPR A;  4GX0 A;  3WB0 A;  2AZ2 A;  2BE3 A;  2UXN A;  3H80 A;  1WB8 A;  1NHJ A;  1BT8 A;  5FPR A;  1H2L A;  3VOU A;  4PDV A;  4H0L B;  4LWS B;  1V54 B;  3ABK C;  4CE3 A;  2X6A A;  2ZDI C;  4MOT A;  4I7Z B;  2K1E A;  1GKX A;  2KQX A;  4CE2 A;  1G6U A;  3N2K B;  5CA0 B;  2YSU B;  2YE3 A;  4H13 B;  3OGC C;  1RPO A;  2DOS A;  3L74 H;  2YXL A;  3GVM A;  1M57 B;  3JAR A;  3ZX6 A;  4CH5 A;  4WBN A;  4FLU A;  3TUH A;  3OW6 A;  1QBZ A;  3JD0 A;  1K8A W;  4B7E A;  4BW9 A;  2XAH A;  2F66 C;  3JAW A;  3CCL V;  4HXZ A;  1FFT B;  4TOI A;  5L3E A;  2EIN B;  2WI2 A;  5B1A C;  2WSS G;  2XDL A;  3DXR B;  4O4J A;  1SQF A;  2NLJ C;  3E89 A;  3QO7 A;  1V55 B;  5EYP B;  1NTM H;  3MHS C;  4XKA A;  4X20 B;  4LF5 B;  3TZ0 A;  1N33 O;  2YI0 A;  4MSW C;  1Q7Y W;  5KHH A;  4XKO A;  1IBM B;  3K5N A;  1VQP V;  3IC9 A;  2E0A A;  3K97 A;  4JTA B;  3OTO O;  4DR4 O;  3GWO A;  4OPA A;  2XJG A;  5K1P A;  4AIL C;  2Q8I A;  3K0D A;  2AKP A;  4LR3 A;  4CBC A;  1QZR A;  2WLI B;  5L3C A;  2QGN A;  5CPH A;  2LFR A;  5LGT A;  4RUF A;  1AJP A;  1XNR O;  2UWD A;  2WLM A;  4JYB A;  5CB4 A;  4HBN A;  1IBK O;  3JD3 A;  4LWS A;  1URF A;  4O09 A;  3OD4 A;  2O1W A;  4P7A A;  5CTY A;  4GQT A;  4ASF A;  1U96 A;  2Q7H A;  5CA0 A;  4MT8 A;  4AQY O;  3CXH F;  3NXS A;  3SPJ A;  4GLX A;  3LDD A;  3RYF A;  4MTX A;  1W2B U;  2K5B A;  1O9H A;  1TA8 A;  4LH7 A;  3APQ A;  2ADQ B;  1L0N H;  2QWO B;  4NTX A;  5M4K A;  1W0J G;  4R50 A;  2VW5 A;  1E1Q G;  4U7O A;  1HNZ B;  3RYH A;  2QG0 A;  4X9L A;  1ORQ C;  3K79 A;  1KUQ A;  3Q5K A;  1R3L C;  1BKN A;  1H2G A;  2P4V A;  3DC6 A;  4EEQ A;  4YJ2 A;  4YJ3 A;  2IH3 C;  2C1I A;  1M1K W;  3HKE B;  1J5E B;  4UB6 Z;  1PNK A;  5KA6 A;  3BVO A;  4YKZ A;  1Z5V A;  4DV2 B;  5LBQ A;  4F6R B;  3JAS B;  4JI7 B;  1OCZ B;  2XUM A;  4I9Q A;  3EHJ A;  4WUC A;  5GON B;  2QG2 A;  2WLL B;  1I59 A;  5CA3 A;  2YE9 A;  1GJV A;  3A0X A;  1NR1 A;  4WFE A;  1SS3 A;  3OR7 C;  4DV1 O;  5D7D A;  4PI0 A;  2Q68 A;  3ZJZ A;  3VQW A;  3CP1 A;  4O4L B;  2JGD B;  1N32 O;  4AI8 A;  1R1B A;  5CMU A;  3P30 A;  1VQL V;  1NR7 A;  1ZWI C;  2ZR3 A;  4D7S A;  4H85 A;  2ZDX A;  3A0R A;  3SJC C;  3O65 A;  4J9Y B;  3A0Z A;  4HZ5 A;  1AJ6 A;  2ZKO A;  2QJ1 A;  2BT0 A;  4HXW A;  4L90 A;  4I0X B;  1XIL A;  2E5L B;  3OT7 A;  1XNQ O;  3LDC A;  3HKB B;  1MOF A;  5JVD A;  1QY8 A;  2XJX A;  2RN9 A;  4K0K B;  1NQT A;  4QE7 A;  2ZIO A;  5B66 Z;  2AXT Z;  1WAZ A;  2HVJ C;  2NN4 A;  4TQD A;  1HR0 O;  2C1G A;  3RYC A;  4U3F H;  4K35 A;  3CB2 A;  4PA6 A;  3K9S A;  3TZ5 A;  2AHY A;  5KHG A;  4PRV A;  4E2L A;  1K92 A;  3HB3 B;  4R7C A;  3G6E V;  3CE2 A;  2LP7 A;  4B3R B;  1HP8 A;  2RCV A;  4JF3 A;  4YHH B;  3E35 A;  4GYC B;  2IW5 A;  1ZX3 A;  2YGE A;  5GON A;  2ILM A;  2FML A;  4LNU B;  2XDS A;  3ZHU A;  3LNM B;  2EIJ B;  5L3F A;  2VQE B;  3U2D A;  3VAD A;  3INX A;  2CK3 G;  2YKE A;  3AK3 A;  3C3S A;  4LWI A;  3KCY A;  2PZS A;  2HKO A;  2OWO A;  5A2Q N;  3FD9 A;  3N2G B;  3A0Y A;  3K59 A;  1SZT A;  4XCL A;  4HZ0 A;  5IWA B;  1BQZ A;  3SYP A;  4FCQ A;  2F4V B;  4JTD B;  1HNW O;  3WG7 B;  1HDJ A;  3MNR P;  1CP9 A;  4JI5 O;  3HKD B;  4ZBM A;  2LGW A;  4DUZ O;  2JIZ G;  4X1K A;  4FK5 C;  4TV9 B;  2EIK C;  2VQF O;  4DK0 A;  4B3M O;  3LPS A;  1W59 A;  5BXZ A;  2UXX A;  3UO3 A;  3A2F A;  3ZRS A;  3C90 A;  2Q4P A;  1XMO O;  4B7K A;  1U0Z A;  4WFG A;  1P84 F;  3HKC B;  1YCI A;  4E4E A;  3EHB B;  4J42 A;  1AIL A;  1N34 B;  2EJ7 A;  1VF5 B;  2Y69 B;  1UYG A;  4K3A A;  3ETG A;  4LFC B;  1CXZ B;  3A0W A;  4I50 B;  4JI2 B;  2WI3 A;  4CH6 A;  5H2F Z;  3N27 A;  2JDI G;  1N36 O;  4E00 A;  1VQK V;  1AI5 A;  1SA0 A;  2Q69 A;  1K97 A;  4X62 O;  1NT2 B;  4NTY A;  4CWF A;  3TCU A;  2XHR A;  2F23 A;  5LHH A;  2X7R B;  4TUY B;  3OMU A;  4E72 A;  2ZQM A;  4WF9 V;  3T0H A;  1AR1 B;  1AVM A;  1BE3 H;  1YJW V;  1IUR A;  2XJJ A;  1QLE B;  1FXK C;  5J2T B;  2ITC C;  3TXS A;  1I5A A;  3R65 A;  2DYS C;  2A0L A;  3BFR A;  4DR7 B;  1WNS A;  4FPP A;  1GN4 A;  3KKY A;  3Q5L A;  1EFR G;  4BIU A;  2Q5Z A;  4KHP O;  4FLZ A;  3JSL A;  3W7U A;  1P49 A;  2UXD O;  4YXW G;  5HFL A;  2CCT A;  5CN0 A;  2V7Q G;  2YKC A;  4O2A B;  3T1H B;  4AWO A;  2CG9 A;  1PNM A;  2X6B A;  4GZR B;  1S0V A;  3AG2 C;  4MB9 A;  1YIT V;  3E2E A;  2ZNJ A;  4HY6 A;  4PRX A;  3OMI B;  1AI7 A;  4CWQ A;  1FD9 A;  2Q8G A;  3B8N A;  1PKX A;  4J7J A;  2YC0 A;  2H3O A;  1AR5 A;  3HKC A;  2YEC A;  3TET A;  1VMG A;  4DV4 B;  5BOC A;  1QR8 A;  4JYA O;  2B5U A;  4GT1 A;  4J11 A;  4NB5 A;  5CA1 A;  4I50 A;  2Y4U A;  4J7Z A;  5GGZ A;  3T10 A;  1YS3 A;  2A79 B;  1JQ0 A;  2WI7 A;  4L8J A;  5IJ0 B;  1B04 A;  2W6J G;  4QNH B;  4EM7 A;  3DTU B;  3ASO C;  3Q4H A;  4DUY B;  1H8H G;  5JH7 B;  3M7M X;  3K0G A;  1N4C A;  2B9Z A;  1A4H A;  3LMM A;  1S72 V;  3JAM N;  2HHI A;  1HNX B;  2QFO A;  2HHH B;  1ZXM A;  2GBO A;  3RWR D;  1WN7 A;  5JCO A;  2XAG A;  3HR0 A;  4XDL A;  1DK1 A;  4LFA B;  2E74 B;  2KSD A;  3I5D A;  4DV7 B;  1UYF A;  1MG1 A;  4D6T H;  4KXR A;  4EFT A;  1XMQ B;  5M4E A;  2BSK B;  4LWE A;  1CEZ A;  2N74 A;  3GIE A;  1WP8 A;  4X64 O;  2HJF C;  4B3S O;  2O1U A;  1JX9 A;  2YEA A;  4FLT A;  1SQV H;  4CH3 A;  1BZK A;  4NH7 A;  5JQG A;  3SYC A;  3OWD A;  4WCE V;  4GKK B;  3NMQ A;  1B3Q A;  2G38 A;  5BR8 B;  2KG7 A;  2M7W A;  2RMK B;  3O9O A;  4MS2 A;  4K8X A;  1UYE A;  2LJ2 A;  3UM7 A;  4WFH A;  2Q6A A;  3SGI A;  1KC8 W;  4DR6 B;  4DV6 O;  2HG5 C;  2A7W A;  3CC4 V;  4WFB V;  5B1B B;  1F4M A;  5H5N A;  4NXM B;  3QTC A;  3K5O A;  5IYC O;  3SL2 A;  1FJG B;  3OFN G;  1RP3 B;  2BTZ A;  1A32 A;  2HFE C;  2GTA A;  4PDM A;  2FL4 A;  1IDS A;  1I08 A;  2P22 C;  4L8Z A;  4PEL A;  3E8G A;  2JS3 A;  1SQQ H;  3CGY A;  3ETE A;  3VHD A;  3FB6 C;  3JAK A;  3ZKB A;  2WPD G;  5KHJ A;  3CXC U;  3D36 C;  2HLD G;  4NH8 A;  2XAF A;  3WB1 A;  3INW A;  4MTO A;  3OUF A;  4JV5 B;  4YY3 B;  3H4L A;  2A06 H;  2VWK A;  1X59 A;  3OTF A;  2M6Y A;  3DSQ A;  4X65 B;  3B77 A;  4ZOL B;  1AP6 A;  4IHJ B;  5BZB A;  3EHH A;  3MHH C;  2HKJ A;  4J41 A;  4EKW A;  1GM7 A;  3T2M A;  4P9P A;  3AG7 A;  2H94 A;  1Y74 B;  3GIF A;  2WWW A;  2VCJ A;  5J2U A;  1S5L Z;  1T5E A;  3BCC H;  4D7T A;  3F5T A;  4H81 A;  3ETD A;  1KYO F;  4JYY A;  4KFM A;  5IN9 A;  1PPJ H;  3ABK B;  1MSD A;  4KP4 A;  2YJW A;  3J81 N;  3T2S A;  4LF9 B;  3SYO A;  4LF5 O;  5KHK A;  3BY6 A;  4YIP A;  4RQE A;  4UV8 A;  5FLX N;  1I94 B;  2IJK A;  3HZ5 A;  2EJR A;  2IOR A;  2Z3Y A;  3ZED A;  5CBG A;  1IBM O;  1JA8 A;  2YE6 A;  5D5Q A;  4QPJ A;  4EFE A;  3OM3 B;  2OTJ V;  1M93 A;  4JI0 B;  4HAM A;  4JAA A;  1XQ8 A;  4I55 B;  4GX5 A;  3S3X A;  3CRR A;  1BQ0 A;  4TSF G;  2JGU A;  2D2C B;  1NTZ H;  1TAE A;  5B1A B;  4FM1 A;  3TGU H;  5EIB C;  2XT9 A;  3QF7 A;  1K34 A;  1QVG U;  3IGA C;  3K3W A;  1MNG A;  4X89 A;  2YIB A;  4EFB A;  4X8A A;  2YE7 A;  2OCC B;  3SR2 C;  1UYD A;  4JI3 B;  3RN4 A;  1E79 G;  1TVK A;  2XAQ A;  1B6Q A;  4DW1 A;  1Y76 B;  2YE4 A;  2UU9 B;  3CRQ A;  4RAI A;  1GK9 A;  5CBF A;  4ZVI A;  5KLV H;  4BXI A;  2XTA A;  2UUA B;  3CCR V;  2YED A;  2BCC H;  1HNZ O;  2CAZ C;  3X2Q C;  2JS5 A;  3F7V C;  2XAB A;  4UCV A;  4YKR A;  4FLW A;  3SJQ C;  4ZI7 B;  4WUB A;  1YC3 A;  5LOV A;  4ASB A;  3O2F A;  5HFM A;  5H9C A;  2OIG A;  1JFF A;  1WA8 B;  4CWO A;  1U2O A;  5JJJ B;  4DV3 B;  1WB7 A;  3OEE G;  2R9A A;  3RGB A;  1J5E O;  4IT5 A;  2H8M A;  4UCT A;  4DV2 O;  3QTF A;  2UXB B;  3K57 A;  3Q5J A;  4RUE A;  4QJF B;  4JI7 O;  4DZY A;  4HYP A;  2Q8H A;  1Q90 D;  4J9Z B;  4JI6 B;  1KIJ A;  1S76 D;  2QKC A;  4LP0 A;  1KP2 A;  2XHB A;  2CTP A;  1Z5A A;  4DR3 B;  4O04 A;  2BRC A;  2YGF A;  4PL9 A;  1AB3 A;  4MVR A;  4ZHQ A;  4FLV A;  2Y4T A;  3QVN A;  2YEV B;  2YE2 A;  5C8Y A;  2PY5 A;  4P2Z A;  5TIS Z;  2OYQ A;  2RDC A;  5L3B A;  1N8R W;  2WEP A;  4G27 B;  4CZZ A;  1SET A;  1ZL8 B;  2ZKJ A;  3PEH A;  1L8D A;  4QPK A;  2YXY A;  1XRE A;  3GIG B;  3ZM7 A;  2YEI A;  1Y76 A;  4V26 A;  2E5L O;  2YI8 A;  4FMT A;  2GHY A;  3RVY A;  1UYM A;  2QWP B;  4LC1 A;  1Z59 A;  4DW0 A;  4K0K O;  2BU8 A;  4ZKI A;  5EBW C;  1K7D A;  4PD4 F;  2XAJ A;  1SQB H;  2Y0I A;  1OCC C;  4FVM A;  2ARH A;  2JKI A;  2GSM B;  3R4N A;  4RO2 A;  4B3T B;  1J95 A;  1XL6 A;  3G4S V;  1OCR C;  1WA8 A;  1K5Q A;  1YC4 A;  3D0B A;  4FCR A;  4MVQ A;  3AG4 C;  2QA4 V;  4C7U A;  4Z1V A;  4Z1M G;  4B3R O;  3L73 H;  4W7T A;  4WFF A;  2JEX A;  2PGG A;  3ETQ A;  4W4K A;  4YHH O;  2EZP A;  4LWG A;  3FAV B;  5D7R A;  1Q86 W;  5LYJ B;  3CGZ A;  2GQP A;  3N2K A;  1U97 A;  4U3J B;  5LMU B;  2WLN A;  1DTO A;  4I4T B;  1Z5W A;  1S5J A;  1NH2 D;  4J10 A;  2AW9 A;  3OMA B;  3G6B A;  2VQE O;  1B62 A;  3P3P A;  1YHQ V;  5IJ9 B;  1PV0 A;  3W7X A;  2LO1 A;  2EIM C;  4NTW A;  4H7Q A;  2WI6 A;  2YS8 A;  2KKW A;  3DXR A;  5IWA O;  1ZL8 A;  5D6P A;  2EZO A;  1Y4M A;  5LP6 B;  4FFB B;  5EYP A;  1PL4 A;  4X20 A;  4BR6 A;  2Q2E B;  3RYI B;  2F4V O;  5L3J A;  3KG2 A;  1R6T A;  4GGL A;  5EK0 A;  2HR3 A;  1Y8O A;  3JZ3 A;  4XIT A;  2RJZ A;  1K9M W;  2ODM A;  5LXT B;  3FT8 A;  4B6C A;  4KSH A;  3EHF A;  2F93 B;  5AG2 A;  1MA1 A;  2DN9 A;  3AG1 C;  3B40 A;  3STZ C;  2IBZ H;  4GX1 A;  1Y66 A;  3ZMU A;  4XDM A;  4XIQ A;  4N21 A;  2BOB C;  3CCS V;  2WLI A;  4DYL A;  1WPB A;  2W0X A;  3T0Z A;  2LGQ A;  3RKZ A;  1W0K G;  3ZS8 C;  1N34 O;  2ZE5 A;  3BPZ A;  1FYJ A;  4EGI A;  4HYO A;  1CPY A;  4B08 A;  4MP2 A;  4U7N A;  5ITZ B;  2ZR2 A;  3FAV A;  1GN3 A;  1WPX A;  4AWP A;  3H01 A;  2YIA A;  5LYJ A;  3B2E E;  2BZ5 A;  4MPE A;  4U3J A;  1K33 A;  1VQ4 V;  4JI2 O;  1Z2G A;  4DR5 B;  2EIK B;  4IYH A;  3UT5 B;  3LSQ A;  3BHP A;  2QKS A;  5J71 A;  4RQF A;  3CRK A;  1GKZ A;  1D5N A;  1YF2 A;  5IYB O;  2XX4 A;  3ZBH A;  5IJ9 A;  1PNL A;  3ZHT A;  1UY7 A;  4PDL A;  1GKF A;  4MTG A;  3JYC A;  5LP6 A;  1Y6X A;  2O57 A;  4FFB A;  5KX5 B;  4BIZ A;  3CPW U;  5J6A A;  1K5S A;  1YSR A;  4IIJ B;  1AJQ A;  4FLX A;  4DR7 O;  1EN5 A;  4MW8 A;  1VQ7 V;  1IBL B;  4BW5 A;  1VF7 A;  4X9Q A;  4MTF A;  3APO A;  1I5X A;  3HKE A;  5CF0 A;  4KTN A;  2Q67 A;  2YKJ A;  4F6R A;  3JAS A;  3K98 A;  1M9N A;  1GM9 A;  3T1H O;  2YIC A;  4UV9 A;  4IGG A;  3VQX A;  1EM1 A;  3CSX A;  2WLL A;  1DF5 A;  5FL7 G;  2R72 A;  1D2D A;  1R6K A;  4P30 A;  5LGU A;  1R3K C;  5F2V O;  1FXK B;  3CRA A;  1PP9 H;  1FFX B;  4HY1 A;  3R4O A;  3CJH B;  1YT1 A;  2DYS B;  5D7C A;  3SPI A;  1RM1 C;  1H8E G;  4O4L A;  2JGD A;  2EUL A;  1LNQ A;  3DGE A;  2F1M A;  2CH4 A;  4ASU G;  2IWU A;  5KA5 A;  2P90 A;  5EBL C;  4F4L A;  4MW3 A;  2HCH A;  1Q8I A;  3HPL C;  4FIP C;  4O07 A;  3R92 A;  5EIB D;  1H2K A;  3FFQ A;  2IJH A;  4I0X A;  4GX2 A;  4DUY O;  3HKB A;  3CYO A;  1YDX A;  5DEC A;  3I56 V;  4EB6 B;  1AI6 A;  2JJ2 G;  1HNX O;  1JMK C;  2AGA A;  2HHH O;  4Q6G A;  1I5C A;  3ASN C;  4URL A;  1HWY A;  3E8F A;  5KX5 A;  1MU5 A;  1KKC A;  2R9I A;  4LFA O;  1EI1 A;  2ZE6 A;  1AH6 A;  4DV7 O;  2YI5 A;  4O2B B;  2Z0A A;  1XMQ O;  1Q81 W;  4K8Z A;  3U2K A;  2EXL A;  3ASO B;  3E86 A;  4LF7 B;  2EBO A;  1P7B A;  2PYL A;  3L71 H;  4FM0 A;  4CWS A;  5H6Q A;  2QWR B;  4LNU A;  1YEW A;  4O4H B;  2IWX A;  5EC1 C;  4JGS A;  4GKJ B;  1NH2 B;  1NTK H;  4YKW A;  4UCR A;  2ZIN A;  1KU9 A;  4GKK O;  4FCP A;  4AS9 A;  5BR8 O;  1DGS A;  3B4S A;  2P6J A;  3E8B A;  3FX7 A;  2LW1 A;  1LUV A;  3K5M A;  1UYL A;  1YET A;  3CCU V;  3JAL B;  1KBH A;  4O05 A;  3N2G A;  4UFZ A;  4DR6 O;  1SQG A;  1XDC A;  2YEH A;  2Q7E A;  3FKS G;  3ZN0 A;  1NHH A;  4LWH A;  4FZ0 A;  1D5A A;  4CH4 A;  1TUB B;  3AK2 A;  4NXM O;  4R3A A;  1FJG O;  4CWP A;  2LW7 A;  1OJH A;  1PD3 A;  3ZMV A;  2E75 B;  4PJ0 Z;  1EZJ A;  3ABM C;  1IZ3 A;  1XNQ B;  1S14 A;  3HKD A;  3U11 A;  1OSF A;  2ZE8 A;  3OWB A;  4TV9 A;  4KQV A;  1I5B A;  3ZMT A;  3OR6 C;  4DV5 B;  3ZRW B;  3U67 A;  2BOC C;  2C2A A;  2CTQ A;  2YUA A;  4JV5 O;  4YY3 O;  1XHZ A;  1OCO C;  1Q82 W;  1L0O A;  2XCM A;  4X65 O;  3UQ8 A;  3G71 V;  2FWZ A;  1QHT A;  3KCX A;  3CCE V;  1VQ8 V;  3IC7 A;  2CTR A;  1THZ A;  2PTM A;  4L93 A;  1S16 A;  3A0H Z;  2BTQ B;  1M4U A;  2OTL V;  4I3H A;  4UCS A;  4X66 B;  5IDM A;  4E01 A;  4Q20 A;  1FKA O;  1R3J C;  1JCH A;  5B1N A;  4G2K A;  1XHX A;  4UUJ C;  2ADP A;  3I55 V;  3ABU A;  3PEJ A;  3A0B Z;  5B5E Z;  5IYZ B;  3W7T A;  4LF9 O;  4HYM A;  1Y4U A;  4TUY A;  4XDJ A;  3AG3 B;  2WLH A;  1I94 O;  1FAF A;  2QTS A;  4I5S A;  5J2T A;  4XKK A;  2Q73 A;  1PM9 A;  4EMV A;  4DUH A;  1VF6 A;  5M4M A;  2Y69 C;  3K60 A;  3LNU A;  4R8C A;  2ZT9 B;  4JI0 O;  3T1Y B;  1GH6 A;  1QNM A;  4JZ2 A;  4LF6 B;  1SRY A;  5BMV B;  2JEU A;  5KAI Z;  5LMN B;  2ZM6 B;  2DYR B;  2FYU H;  5FWK A;  5EBM C;  4CS2 A;  4O2A A;  2CH7 B;  1H7U A;  1Q6I A;  2YEF A;  2V1D A;  2L6L A;  3KZI Z;  3K58 A;  3WB2 A;  2XDX A;  4PV1 B;  5CTX A;  3AK1 A;  3OE7 G;  5JJE B;  3HHU A;  4FJC C;  4UCO A;  4JI3 O;  4CC6 A;  1THN A;  2PNR A;  5JCO C;  4DR1 B;  2HG1 A;  3FB8 C;  4KFG A;  1HW7 A;  1TUE B;  5JEN A;  4K4O A;  4OX9 B;  2BTQ A;  1VQO V;  3R4P A;  2FTK A;  3F7Y C;  2QEX V;  5IJ0 A;  3UCS C;  1FPO A;  1WP7 A;  4NXN O;  4KSG A;  5JH7 A;  3BM9 A;  3SDL A;  4MP7 A;  3STL C;  1N0N A;  4FM2 A;  5IT9 N;  1ZW9 A;  1SC5 B;  3A0T A;  1ZLZ A;  3FT5 A;  1JJO A;  4DV3 O;  2LFS A;  4H37 A;  5A9G A;  3ZHV A;  1QYE A;  1TH8 A;  4XE2 A;  3OAA G;  2UXB O;  2MW2 B;  1VAR A;  1MMM A;  4PA7 A;  1ENV A;  2IJJ A;  3HYY A;  4QIW F;  4JI6 O;  5FPO A;  3HYZ A;  2X6C A;  1GN2 A;  5IY5 C;  4DR3 O;  1UPG A;  3QO5 A;  1M90 W;  2BSK A;  3B09 A;  2R9R B;  4JI8 B;  3J80 N;  2CH7 A;  3OGI B;  2YK9 A;  2DWD C;  2KB1 A;  2ZXW C;  1WJZ A;  4HNA B;  1M56 C;  4TV8 B;  1UJW B;  1DLB A;  3JAT B;  1K4D C;  5GW7 A;  2L35 A;  4GFN A;  5D6Q A;  3ZRX A;  5LHI A;  3TJT A;  4UB8 Z;  1PL0 A;  2CE4 A;  1QR9 A;  3MAQ A;  3BA8 A;  1Q43 A;  4X1I B;  4E02 A;  1L1F A;  3E22 B;  3CRL A;  4PDR A;  1B06 A;  1VEW A;  4LF8 B;  1YTF D;  1XUQ A;  2NR5 A;  4CS4 A;  2CCS A;  3GB7 C;  4B3T O;  2WA4 A;  3CC7 V;  2PUS A;  3OEH G;  3TZ4 A;  3OUS A;  2Q8V A;  4MPC A;  4DRX B;  2JVD A;  1US6 A;  2XHT A;  3GWK C;  3WQ9 A;  1Q5O A;  1QU7 A;  3B27 A;  3K04 A;  1F4N A;  2JJ1 G;  3C11 A;  2VCI A;  4L91 A;  1K4C C;  4CWN A;  3SPG A;  2CGO A;  2PI4 A;  2MK3 A;  3ZMS A;  2XK2 A;  4ZOL A;  4IHJ A;  5LMU O;  3EVK A;  3JAR B;  1OZ0 A;  2GDS A;  3BRC A;  4EFU A;  2PF4 E;  4YIO A;  5DM6 V;  1NKD A;  5L3D A;  3ABT A;  1OCC B;  2WLK A;  1BHB A;  4JAS A;  1ZXN A;  1Y74 A;  3SPC A;  3TTZ A;  1OCR B;  3ZHR A;  2QKA A;  3H9V A;  4ICG A;  4UVC A;  4O4J B;  4TV8 A;  3AG4 B;  1NJI W;  3BEH A;  3JAT A;  4B7P A;  4WUD A;  2ZDI A;  2WI1 A;  2BTO A;  2DWE C;  4AWQ A;  2YID A;  1ARO P;  2ZE7 A;  2R70 A;  3VBB A;  1JVM A;  3JCZ A;  4GT8 A;  2UUC B;  3NR7 A;  3RFR A;  1KEC A;  3CX5 F;  5E79 Z;  2UXC B;  2YDE A;  4X1I A;  4LFB B;  2CGF A;  3W7W A;  2FB5 A;  3G80 A;  3K9A A;  4X1Y B;  2EX3 A;  4BAY A;  3TXQ A;  2EIL C;  2YEG A;  1ZTE A;  4I55 A;  1AR4 A;  2DMX A;  2OCH A;  2EIM B;  1TGO A;  4PI2 A;  5M4H A;  1TID A;  3FV5 A;  4DRX A;  3O0I A;  1ZSP A;  5CB4 B;  2YE5 A;  1Z5B A;  2GUZ B;  4OPH A;  5LA6 B;  3RT3 C;  4DV0 B;  4PA3 A;  4XC0 A;  2YKB A;  2YGA A;  3MDS A;  4LP8 A;  2YI6 A;  2BU7 A;  5E1A C;  4DR5 O;  3RYF B;  1YI2 V;  3S3W A;  3B8M A;  5M4N A;  1RSO B;  5EC2 C;  1BGQ A;  1OHH G;  4YKY A;  5GTH Z;  3AG1 B;  2FYP A;  5B3S C;  3VQV A;  1UYC A;  3IAY A;  1SQX H;  1YSZ A;  1ID0 A;  3RYH B;  3LNN A;  4QGP A;  1QQC A;  4JI4 B;  3L9D A;  1P7G A;  2LQT A;  5JWP A;  4DR2 B;  4AHC A;  4MVM A;  1QVF U;  1KB9 F;  2YEE A;  2JJC A;  3EHG A;  4ZI7 A;  4W4L A;  3WU2 Z;  2CCU A;  4YJ2 B;  4YJ3 B;  3B28 A;  2F43 G;  2YEJ A;  1IBL O;  1IXB A;  2E76 B;  2UUB B;  1GAX A;  2OCC C;  1VP7 A;  2JK5 C;  1VQN V;  3QO8 A;  1EBO A;  2F95 B;  3VHA A;  5DN6 G;  3E8H A;  3ZHQ A;  4X1Y A;  4EGH A;  2XOK G;  2ZDY A;  2IM9 A;  4URM A;  2P67 A;  4EEH A;  3H1K H;  2HP8 A;  2P5O A;  1JJ2 U;  3ABL C;  3R66 A;  2V4D A;  2K9P A;  3R91 A;  2GUZ A;  1FS0 G;  2YEV A;  2QM8 A;  5LA6 A;  3JCU Z;  2IWS A;  1UYH A;  1F23 A;  3B25 A;  3OPD A;  4R3M A;  1K73 W;  2QE7 G;  3FB5 C;  2VWC A;  5CTU A;  2PYJ A;  1KP3 A;  1NBM G;  2WEQ A;  3JSN A;  1V54 C;  3GIG A;  1XEQ A;  1H2S B;  1RSO A;  1PVG A;  1UY9 A;  1R73 A;  4P9O A;  4LF4 B;  1Q3E A;  3G67 A;  5JVD B;  3UKM A;  2DQ3 A;  2VWJ A;  1VQ6 V;  1LR1 A;  5KMG B;  1M57 C;  4FZ1 A;  2XD6 A;  3B26 A;  4YKU A;  4DK1 A;  3RW0 A;  3RYC B;  3D3I A;  4KL1 A;  3TZ2 A;  1X4T A;  4JI1 B;  4JAV A;  1MZE A;  4UCU A;  4EGK A;  2VS0 A;  1RM1 B;  1YTF B;  2EIN C;  3LUT B;  3G75 A;  1NS1 A;  1RFY A;  4UVB A;  3S5T A;  1IXM A;  2XND G;  2XX5 A;  1BSM A;  1V55 C;  3SPH A;  3SYQ A;  4O4I B;  1DF4 A;  1I0H A;  2PI5 A;  2DJV A;  5KHI A;  2Y0P A;  4LFC O;  4LF7 O;  4A5U B;  5C93 A;  1NU1 H;  2ZNI A;  2QWN B;  5L3G A;  4I4T A;  3R4M A;  3K08 A;  2P06 A;  4ZIB A;  4GKJ O;  3P32 A;  3CME V;  2XAS A;  2B1I A;  3ASN B;  3HZ1 A;  2W6I G;  1R3I C;  3RLQ A;  4G28 B;  3ZHS A;  4JAU A;  2WA3 A;  4UVA A;  2Y48 A;  1VQM V;  1JR9 A;  3JD4 A;  1BXD A;  2YK2 A;  3VHC A;  1UY6 A;  1QLN A;  3ZCC A;  3AEI A;  1GMG A;  4V25 A;  1WLE A;  1UFI A;  3RYI A;  1N33 B;  1F51 A;  3T4Z A;  2JRI A;  2ZD9 A;  4IL6 Z;  3BAA A;  4UXN A;  5KUM A;  4LCU C;  5J9P C;  4X1K B;  4CWR A;  1XL4 A;  4HZ3 A;  1EZV H;  2YEB A;  5KMG A;  3OTO B;  4DR4 B;  1G4Y B;  5LXT A;  2OIE A;  4DV5 O;  3IFX A;  2A3Q A;  2WI5 A;  3SYA A;  2IU0 A;  4BQG A;  2ZCE A;  1Y8P A;  4PHZ A;  1BCC H;  1XNR B;  3FYE B;  2WAM A;  1KKD A;  5KUK A;  1IBK B;  2AHZ A;  1Q6U A;  2CDY A;  5LP6 C;  4DV4 O;  5IDJ A;  2BU6 A;  4O4I A;  1EN4 A;  3ABM B;  5ITZ A;  2X0L A;  4IYI A;  2P4K A;  3EFF K;  1AMW A;  1GN6 A;  2QM4 A;  4AQY B;  3L75 H;  4X66 O;  2XHX A;  4FFK A;  4YKT A;  3UT5 A;  1QCE A;  4R1F A;  1AJN A;  5DED A;  1SA0 B;  1ZUQ A;  1YT0 A;  3QG5 A;  1OCZ C;  1R6N A;  1ROP A;  3AG2 B;  3MD0 A;  2YKI A;  1SZX A;  4NVP A;  2RNB A;  1YIJ V;  2IOP A;  1YER A;  1OCO B;  2YE8 A;  2N04 A;  3EKO A;  4L87 A;  1JPX A;  3BA9 A;  4DXW A;  3DC5 A;  1YES A;  1N0J A;  2H8P C;  5IE9 A;  3G7E A;  2N05 A;  5KAF Z;  4IIJ A;  2O1V A;  5CTW A;  3T1Y O;  3JD1 A;  3G7B A;  4LF6 O;  1H38 A;  2GFD A;  2BYH A;  1MZF A;  3PJS K;  5LMN O;  1KMI Z;  4PU9 A;  2ZM6 O;  3RLP A;  2XDK A;  1KQS U;  1GM8 A;  1VQ9 V;  1MAB G;  4MVU A;  1MSW D;  2YIB D;  4GUN A;  1UYK A;  3LDE A;  4DV1 B;  1FXK A;  1OV9 A;  1FFX A;  1YVW A;  3LSU A;  5D5P A;  2GTS A;  3VQY A;  3CJH A;  5LHG A;  4DR1 O;  1N32 B;  1TC0 A;  4N23 A;  4LBE C;  4LH6 A;  4OX9 O;  5CA1 B;  1ZWH A;  1AH8 A;  1I5Y A;  4RWU A;  2XDU A;  4MVZ A;  4NKG B;  5EZY B;  4PA9 A;  4ASA A;  1JOY A;  1YXB A;  5FNV B;  2QWQ B;  4BAE A;  2HVK C;  3Q4H B;  3ZN1 A;  4WFA V;  3ZRV A;  1XI1 A;  2D3O W;  3FB7 C;  4EB6 A;  1HR0 B;  4H44 B;  5FNF A;  3CHX A;  3K06 A;  4FLY A;  2EIJ C;  1TC6 A;  3IED A;  2QF6 A;  2YJX A;  5F5R A;  2BU2 A;  1G1X B;  4JYC A;  1YC1 A;  5LL6 Y;  3B24 A;  3SJA C;  1XBL A;  1G8M A;  1TBW A;  3BAB A;  4O0B A;  3CC2 V;  4O2B A;  4JTC B;  1O9G A;  3D3Q A;  3H1I H;  2QDO A;  1R62 A;  4KUM A;  4CC5 A;  3K03 A;  4NR1 A;  4OXS A;  3WG7 C;  3CMA V;  1GTO A;  3J7A U;  4JI8 O;  1NVP D;  1YZB A;  1ZAU A;  5F3K A;  1S77 D; 
#chains in the Genus database with same CATH homology
 3RVZ A;  3FYI B;  3KE6 A;  1AM1 A;  5BOD A;  4XBF A;  3ZXQ A;  3LSS A;  3E83 A;  1YJN V;  2BRE A;  2YI7 A;  3T4D A;  1EA6 A;  4LPB A;  5B1O A;  4LWF A;  5FND A;  5IY5 B;  1S5H C;  3O6O A;  3WFV A;  5CBH A;  2XX2 A;  3M99 B;  3W7S A;  4YKQ A;  4XIR A;  5H6R A;  3ZMZ A;  2ZXW B;  4H33 A;  2BSM A;  1M56 B;  2QTO A;  4X88 A;  4GEE A;  4CWT A;  4GCZ A;  3ZRW A;  2DQ0 A;  1BMF G;  1K3E A;  2QM7 A;  3CD6 V;  4XCJ A;  1FXV A;  4URN A;  1TIL A;  1QLE C;  1YJ9 V;  1KD1 W;  4JQL A;  4MPN A;  3CCJ V;  2ZBK B;  4MBC A;  3ZKD A;  1JM6 A;  3EKR A;  2IJI A;  4XDK A;  5IYD O;  4XTJ A;  1BHA A;  3D36 A;  5FNC A;  4XIP A;  2W0F C;  3CCM V;  2DW4 A;  1BL8 A;  1I5D A;  3C0E A;  1E1R G;  4TT3 G;  2IU3 A;  1BYQ A;  1MX0 A;  4P8O A;  3JD2 A;  4BQJ A;  4PA4 A;  2OT5 A;  1UYI A;  2ESA A;  1I58 A;  1SES A;  3QNE A;  3X2Q B;  1UY8 A;  4R6Z A;  2FWY A;  3T1K A;  2ITD C;  3ZIA G;  5LGN A;  2P7T C;  1H7S A;  4L94 A;  3AG3 C;  2Q8F A;  4MVS A;  3CCQ V;  4URO A;  3QDD A;  1S3J A;  2NNU A;  2EIL B;  1US7 A;  1YSC A;  4U93 A;  3RBZ A;  4CE1 A;  3D2R A;  2DYR C;  1Y8N A;  1GO3 F;  3T1C A;  1P4R A;  3HEK A;  3TK1 A;  4NH9 A;  3F5W C;  2FXS A;  2ATK C;  4TWK A;  4QE9 A;  4I9W A;  1NHI A;  2WER A;  2H55 A;  5B3S B;  5B1B C;  2Z5U A;  3ML0 A;  3ZXO A;  4JPR A;  3BMY A;  2WLJ A;  3OW2 U;  2BU5 A;  1SER A;  2A9H A;  1NVP B;  2IH1 C;  3K99 A;  3CCV V;  1KZN A;  4DO2 A;  1VQ5 V;  3OMN B;  2B1G A;  1Y4S A;  1B63 A;  1YT2 A;  3RLR A;  2BYI A;  3WHA A;  2IOQ A;  1AI4 A;  5M4P A;  4YKX A;  4ASG A;  4MVO A;  1Z5C A;  1FXH A;  4XD8 A;  3CWV A;  3ABL B;  2WI4 A;  1COW G;  1RPR A;  4GX0 A;  2UXN A;  3H80 A;  1NHJ A;  3VOU A;  4PDV A;  1V54 B;  3ABK C;  4CE3 A;  2X6A A;  2ZDI C;  4MOT A;  2K1E A;  1GKX A;  4CE2 A;  2YSU B;  2YE3 A;  3OGC C;  1RPO A;  1M57 B;  3TUH A;  3OW6 A;  1QBZ A;  3JD0 A;  1K8A W;  2XAH A;  3CCL V;  4HXZ A;  1FFT B;  5L3E A;  2EIN B;  2WI2 A;  5B1A C;  2WSS G;  2XDL A;  2NLJ C;  3E89 A;  3QO7 A;  1V55 B;  4XKA A;  3MHS C;  3TZ0 A;  2YI0 A;  4MSW C;  1Q7Y W;  4XKO A;  2E0A A;  1VQP V;  3K97 A;  4JTA B;  3GWO A;  2XJG A;  2Q8I A;  3K0D A;  2AKP A;  4CBC A;  1QZR A;  2WLI B;  5L3C A;  5CPH A;  2LFR A;  5LGT A;  4RUF A;  1AJP A;  2UWD A;  2WLM A;  4JYB A;  3JD3 A;  4O09 A;  2O1W A;  4P7A A;  5CTY A;  4GQT A;  4ASF A;  4MT8 A;  3NXS A;  3SPJ A;  3LDD A;  4MTX A;  1W2B U;  2K5B A;  5M4K A;  1W0J G;  4R50 A;  2VW5 A;  1E1Q G;  4U7O A;  2QG0 A;  4X9L A;  1ORQ C;  3K79 A;  3Q5K A;  1R3L C;  1BKN A;  1H2G A;  2IH3 C;  1M1K W;  1PNK A;  5KA6 A;  4YKZ A;  5LBQ A;  1OCZ B;  3EHJ A;  4WUC A;  2QG2 A;  2WLL B;  1I59 A;  5CA3 A;  2YE9 A;  1GJV A;  3A0X A;  1NR1 A;  4WFE A;  3OR7 C;  5D7D A;  2Q68 A;  3ZJZ A;  3CP1 A;  5CMU A;  3P30 A;  1VQL V;  1NR7 A;  1ZWI C;  2ZR3 A;  4H85 A;  2ZDX A;  3A0R A;  4J9Y B;  3A0Z A;  4HZ5 A;  1AJ6 A;  2BT0 A;  4HXW A;  4L90 A;  3LDC A;  1MOF A;  1QY8 A;  2XJX A;  1NQT A;  4QE7 A;  2HVJ C;  4PA6 A;  3TZ5 A;  2AHY A;  4PRV A;  4E2L A;  1K92 A;  3HB3 B;  4R7C A;  3G6E V;  2LP7 A;  4JF3 A;  3E35 A;  2IW5 A;  2YGE A;  2XDS A;  3LNM B;  2EIJ B;  5L3F A;  3U2D A;  3VAD A;  3INX A;  2CK3 G;  2YKE A;  4LWI A;  2HKO A;  3A0Y A;  1SZT A;  4XCL A;  4HZ0 A;  3SYP A;  4FCQ A;  4JTD B;  3WG7 B;  3MNR P;  1CP9 A;  4ZBM A;  2JIZ G;  4FK5 C;  2EIK C;  3LPS A;  2UXX A;  3ZRS A;  1U0Z A;  4WFG A;  3EHB B;  2Y69 B;  1UYG A;  3ETG A;  3A0W A;  2WI3 A;  2JDI G;  4E00 A;  1VQK V;  1AI5 A;  2Q69 A;  1K97 A;  4CWF A;  3TCU A;  2XHR A;  5LHH A;  2X7R B;  3OMU A;  2ZQM A;  4WF9 V;  3T0H A;  1AR1 B;  1YJW V;  2XJJ A;  1QLE B;  1FXK C;  2ITC C;  1I5A A;  3R65 A;  2DYS C;  2A0L A;  4FPP A;  3Q5L A;  1EFR G;  4BIU A;  3W7U A;  4YXW G;  5HFL A;  2CCT A;  5CN0 A;  2V7Q G;  2YKC A;  4AWO A;  2CG9 A;  1PNM A;  2X6B A;  1S0V A;  3AG2 C;  4MB9 A;  1YIT V;  3E2E A;  4HY6 A;  4PRX A;  3OMI B;  1AI7 A;  4CWQ A;  2Q8G A;  3B8N A;  1PKX A;  2YEC A;  3TET A;  5BOC A;  1QR8 A;  2B5U A;  4GT1 A;  5GGZ A;  3T10 A;  1YS3 A;  2A79 B;  1JQ0 A;  2WI7 A;  2W6J G;  4QNH B;  4EM7 A;  3DTU B;  3ASO C;  1H8H G;  3K0G A;  1A4H A;  1S72 V;  2QFO A;  1ZXM A;  2XAG A;  4XDL A;  1UYF A;  1MG1 A;  4EFT A;  5M4E A;  4LWE A;  1CEZ A;  3GIE A;  2HJF C;  2O1U A;  1JX9 A;  2YEA A;  4NH7 A;  3SYC A;  3OWD A;  4WCE V;  3NMQ A;  1B3Q A;  2M7W A;  4MS2 A;  1UYE A;  3UM7 A;  4WFH A;  2Q6A A;  1KC8 W;  2HG5 C;  3CC4 V;  4WFB V;  5B1B B;  1F4M A;  5IYC O;  3SL2 A;  3OFN G;  2BTZ A;  2HFE C;  4PDM A;  4L8Z A;  4PEL A;  3E8G A;  3CGY A;  3ETE A;  3VHD A;  3FB6 C;  3ZKB A;  2WPD G;  3CXC U;  2HLD G;  4NH8 A;  2XAF A;  3INW A;  4MTO A;  3OUF A;  3H4L A;  3B77 A;  5BZB A;  3EHH A;  3MHH C;  2HKJ A;  4EKW A;  1GM7 A;  3T2M A;  4P9P A;  2H94 A;  3GIF A;  2WWW A;  2VCJ A;  4H81 A;  3ETD A;  4KFM A;  5IN9 A;  3ABK B;  4KP4 A;  2YJW A;  3T2S A;  3SYO A;  3BY6 A;  4RQE A;  4UV8 A;  2IJK A;  3HZ5 A;  2EJR A;  2IOR A;  2Z3Y A;  5CBG A;  2YE6 A;  4QPJ A;  3OM3 B;  2OTJ V;  4HAM A;  4GX5 A;  4TSF G;  5B1A B;  1K34 A;  1QVG U;  3IGA C;  3K3W A;  4X89 A;  4X8A A;  2YE7 A;  2OCC B;  1UYD A;  1E79 G;  2XAQ A;  1B6Q A;  2YE4 A;  4RAI A;  1GK9 A;  5CBF A;  4ZVI A;  4BXI A;  3CCR V;  2YED A;  3X2Q C;  3F7V C;  2XAB A;  4YKR A;  3SJQ C;  4WUB A;  1YC3 A;  4ASB A;  3O2F A;  5HFM A;  5H9C A;  4CWO A;  1U2O A;  3OEE G;  2H8M A;  3QTF A;  3Q5J A;  4RUE A;  4QJF B;  4DZY A;  4HYP A;  2Q8H A;  4J9Z B;  1KIJ A;  1S76 D;  4LP0 A;  1KP2 A;  1Z5A A;  4O04 A;  2BRC A;  2YGF A;  4PL9 A;  4MVR A;  2YEV B;  2YE2 A;  4P2Z A;  5L3B A;  1N8R W;  2WEP A;  4G27 B;  4CZZ A;  1SET A;  3PEH A;  2ZKJ A;  4QPK A;  3GIG B;  3ZM7 A;  2YEI A;  4V26 A;  4FMT A;  2GHY A;  3RVY A;  1UYM A;  4LC1 A;  1Z59 A;  2BU8 A;  4ZKI A;  5EBW C;  1K7D A;  2XAJ A;  1OCC C;  2JKI A;  2GSM B;  3R4N A;  4RO2 A;  1J95 A;  1XL6 A;  3G4S V;  1OCR C;  1K5Q A;  1YC4 A;  3D0B A;  4FCR A;  4MVQ A;  3AG4 C;  2QA4 V;  4Z1M G;  4W7T A;  4WFF A;  2JEX A;  2EZP A;  4LWG A;  5D7R A;  1Q86 W;  3CGZ A;  2GQP A;  2WLN A;  1DTO A;  1NH2 D;  3OMA B;  1B62 A;  1YHQ V;  3W7X A;  2EIM C;  4H7Q A;  2WI6 A;  5D6P A;  2EZO A;  1Y4M A;  2Q2E B;  5L3J A;  3KG2 A;  4GGL A;  5EK0 A;  2HR3 A;  1Y8O A;  3JZ3 A;  4XIT A;  1K9M W;  3FT8 A;  4B6C A;  4KSH A;  3EHF A;  3AG1 C;  3STZ C;  4GX1 A;  1Y66 A;  3ZMU A;  4XDM A;  4XIQ A;  4N21 A;  2BOB C;  3CCS V;  2WLI A;  3T0Z A;  3RKZ A;  1W0K G;  4EGI A;  4HYO A;  1CPY A;  4MP2 A;  4U7N A;  2ZR2 A;  1WPX A;  4AWP A;  3H01 A;  2BZ5 A;  4MPE A;  1K33 A;  1VQ4 V;  2EIK B;  3LSQ A;  2QKS A;  5J71 A;  4RQF A;  3CRK A;  1GKZ A;  5IYB O;  2XX4 A;  1PNL A;  1UY7 A;  4PDL A;  1GKF A;  4MTG A;  3JYC A;  4BIZ A;  3CPW U;  5J6A A;  1K5S A;  1YSR A;  1AJQ A;  4MW8 A;  1VQ7 V;  4BW5 A;  4MTF A;  1I5X A;  5CF0 A;  4KTN A;  2Q67 A;  2YKJ A;  3K98 A;  1M9N A;  1GM9 A;  4UV9 A;  2WLL A;  1DF5 A;  5FL7 G;  1R6K A;  4P30 A;  5LGU A;  1R3K C;  1FXK B;  4HY1 A;  3R4O A;  1YT1 A;  2DYS B;  5D7C A;  3SPI A;  1RM1 C;  1H8E G;  1LNQ A;  3DGE A;  2CH4 A;  4ASU G;  2IWU A;  5KA5 A;  2P90 A;  5EBL C;  4F4L A;  4MW3 A;  2HCH A;  4FIP C;  3HPL C;  4O07 A;  3R92 A;  2IJH A;  4GX2 A;  3CYO A;  3I56 V;  1AI6 A;  2JJ2 G;  1I5C A;  3ASN C;  4URL A;  1HWY A;  3E8F A;  1MU5 A;  2R9I A;  1EI1 A;  1AH6 A;  2YI5 A;  1Q81 W;  3U2K A;  2EXL A;  3ASO B;  3E86 A;  2EBO A;  1P7B A;  4CWS A;  5H6Q A;  2IWX A;  5EC1 C;  4JGS A;  1NH2 B;  4YKW A;  4FCP A;  4AS9 A;  2P6J A;  3E8B A;  1UYL A;  1YET A;  3CCU V;  4O05 A;  2YEH A;  3FKS G;  3ZN0 A;  1NHH A;  4LWH A;  4R3A A;  4CWP A;  3ZMV A;  1PD3 A;  1EZJ A;  3ABM C;  1S14 A;  1OSF A;  3OWB A;  4KQV A;  1I5B A;  3ZMT A;  3OR6 C;  3ZRW B;  3U67 A;  2BOC C;  2C2A A;  1OCO C;  1Q82 W;  1L0O A;  2XCM A;  3G71 V;  2FWZ A;  3CCE V;  1VQ8 V;  3IC7 A;  1THZ A;  4L93 A;  1S16 A;  2OTL V;  4I3H A;  5IDM A;  4E01 A;  4Q20 A;  1R3J C;  1JCH A;  5B1N A;  4G2K A;  4UUJ C;  3I55 V;  3ABU A;  3PEJ A;  3W7T A;  4HYM A;  1Y4U A;  4XDJ A;  3AG3 B;  2WLH A;  4I5S A;  4XKK A;  4EMV A;  4DUH A;  5M4M A;  2Y69 C;  3K60 A;  3LNU A;  4R8C A;  1SRY A;  2JEU A;  2DYR B;  5FWK A;  5EBM C;  1H7U A;  2YEF A;  2V1D A;  2XDX A;  5CTX A;  3OE7 G;  3HHU A;  4FJC C;  1THN A;  2PNR A;  2HG1 A;  3FB8 C;  4KFG A;  1TUE B;  4K4O A;  1VQO V;  3R4P A;  2FTK A;  3F7Y C;  2QEX V;  4KSG A;  3BM9 A;  4MP7 A;  3STL C;  1ZW9 A;  3A0T A;  3FT5 A;  2LFS A;  4H37 A;  1QYE A;  1TH8 A;  4XE2 A;  3OAA G;  4PA7 A;  1ENV A;  2IJJ A;  3HYY A;  4QIW F;  3HYZ A;  2X6C A;  5IY5 C;  3QO5 A;  1M90 W;  2R9R B;  2YK9 A;  2DWD C;  2KB1 A;  2ZXW C;  1M56 C;  1UJW B;  1DLB A;  1K4D C;  5GW7 A;  4GFN A;  5D6Q A;  3ZRX A;  5LHI A;  1PL0 A;  1QR9 A;  4E02 A;  1L1F A;  3CRL A;  4PDR A;  1YTF D;  2CCS A;  3GB7 C;  3CC7 V;  3TZ4 A;  3OEH G;  3OUS A;  4MPC A;  2XHT A;  3WQ9 A;  3B27 A;  3K04 A;  1F4N A;  2JJ1 G;  3C11 A;  2VCI A;  4L91 A;  1K4C C;  4CWN A;  3SPG A;  2PI4 A;  2MK3 A;  3ZMS A;  2XK2 A;  1OZ0 A;  4EFU A;  5DM6 V;  1NKD A;  5L3D A;  3ABT A;  1OCC B;  2WLK A;  1BHB A;  4JAS A;  1ZXN A;  3SPC A;  3TTZ A;  1OCR B;  4UVC A;  3AG4 B;  1NJI W;  3BEH A;  4B7P A;  4WUD A;  2ZDI A;  2WI1 A;  2DWE C;  4AWQ A;  1ARO P;  3VBB A;  1JVM A;  3JCZ A;  4GT8 A;  1KEC A;  2CGF A;  3W7W A;  3K9A A;  4BAY A;  2EIL C;  2YEG A;  2EIM B;  5M4H A;  1TID A;  3FV5 A;  3O0I A;  2YE5 A;  1Z5B A;  4XC0 A;  4PA3 A;  2YKB A;  2YGA A;  4LP8 A;  2YI6 A;  2BU7 A;  5E1A C;  1YI2 V;  3B8M A;  5M4N A;  5EC2 C;  1BGQ A;  1OHH G;  4YKY A;  3AG1 B;  2FYP A;  5B3S C;  1UYC A;  1YSZ A;  1ID0 A;  1QVF U;  4MVM A;  2YEE A;  2JJC A;  3EHG A;  2CCU A;  3B28 A;  2F43 G;  2YEJ A;  2OCC C;  2JK5 C;  1VQN V;  3QO8 A;  1EBO A;  3VHA A;  5DN6 G;  3E8H A;  4EGH A;  2XOK G;  2ZDY A;  4URM A;  2P67 A;  4EEH A;  1JJ2 U;  3ABL C;  3R91 A;  1FS0 G;  2YEV A;  2QM8 A;  2IWS A;  1UYH A;  1F23 A;  3B25 A;  3OPD A;  4R3M A;  1K73 W;  2QE7 G;  3FB5 C;  2VWC A;  5CTU A;  2WEQ A;  1KP3 A;  1NBM G;  1V54 C;  3GIG A;  1PVG A;  1UY9 A;  1R73 A;  4P9O A;  3UKM A;  2DQ3 A;  1VQ6 V;  1M57 C;  2XD6 A;  3B26 A;  4YKU A;  3RW0 A;  3D3I A;  3TZ2 A;  4JAV A;  4EGK A;  1RM1 B;  1YTF B;  2EIN C;  3LUT B;  3G75 A;  4UVB A;  1IXM A;  2XND G;  2XX5 A;  1V55 C;  3SPH A;  3SYQ A;  1DF4 A;  2PI5 A;  5C93 A;  5L3G A;  3R4M A;  3K08 A;  3P32 A;  3CME V;  2XAS A;  2B1I A;  3ASN B;  3HZ1 A;  2W6I G;  1R3I C;  3RLQ A;  4G28 B;  4JAU A;  2Y48 A;  4UVA A;  1VQM V;  3JD4 A;  1BXD A;  2YK2 A;  3VHC A;  1UY6 A;  1QLN A;  3ZCC A;  3AEI A;  1GMG A;  4V25 A;  1F51 A;  3T4Z A;  2ZD9 A;  4UXN A;  5KUM A;  4LCU C;  5J9P C;  4CWR A;  1XL4 A;  4HZ3 A;  2YEB A;  1G4Y B;  3IFX A;  2WI5 A;  3SYA A;  2IU0 A;  4BQG A;  1Y8P A;  3FYE B;  2WAM A;  1KKD A;  5KUK A;  2AHZ A;  5IDJ A;  2BU6 A;  3ABM B;  2X0L A;  3EFF K;  1AMW A;  2XHX A;  4YKT A;  1QCE A;  4R1F A;  1AJN A;  1YT0 A;  1OCZ C;  1R6N A;  1ROP A;  3AG2 B;  3MD0 A;  2YKI A;  1YIJ V;  2IOP A;  1YER A;  1OCO B;  2YE8 A;  3EKO A;  4L87 A;  1JPX A;  4DXW A;  1YES A;  2H8P C;  3G7E A;  2O1V A;  5CTW A;  3JD1 A;  3G7B A;  1H38 A;  2GFD A;  2BYH A;  3PJS K;  4PU9 A;  3RLP A;  2XDK A;  1KQS U;  1GM8 A;  1VQ9 V;  1MAB G;  4MVU A;  1MSW D;  1UYK A;  3LDE A;  1FXK A;  5LHG A;  1TC0 A;  4N23 A;  4LBE C;  1ZWH A;  1AH8 A;  1I5Y A;  2XDU A;  4MVZ A;  4PA9 A;  4ASA A;  1JOY A;  4BAE A;  2HVK C;  3ZN1 A;  4WFA V;  3ZRV A;  2D3O W;  3FB7 C;  5FNF A;  3K06 A;  2EIJ C;  1TC6 A;  3IED A;  2QF6 A;  5F5R A;  2YJX A;  2BU2 A;  4JYC A;  1YC1 A;  3B24 A;  1G8M A;  1TBW A;  4O0B A;  3CC2 V;  4JTC B;  1R62 A;  4KUM A;  3K03 A;  4OXS A;  3WG7 C;  3CMA V;  1GTO A;  1NVP D;  1WLE A;  5F3K A;  1S77 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...