4U7OA

Active histidine kinase bound with atp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
239
structure length
234
Chain Sequence
VTEQQKIDNDRKQFVSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRVDKQGGTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine protein kinase sensor protein
publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Transferase
total genus 79
structure length 234
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4u7oA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4u7oA02
4NH7A 3ZKDA 4MP7A 1YC1A 2BRCA 1YERA 1H7SA 3CWVA 3OWBA 4W7TA 2YEIA 2YE9A 3BMYA 4UROA 4JQLA 2YI7A 4MOTA 4E01A 1ZW9A 2XD6A 3O0IA 3A0ZA 4GCZA 1TH8A 4L91A 2YK9A 2O1UA 1TBWA 4O0BA 2WI3A 4EFUA 1OSFA 3GIEA 3SL2A 2VWCA 4X9LA 1F51A 4H81A 2ZKJA 4KP4A 2JJCA 4KFGA 3ZRVA 3VHAA 3H4LA 3HYZA 5CTUA 2WEPA 2O1WA 5F5RA 2BSMA 3A0TA 3FV5A 3EKOA 5B1OA 1YESA 4L90A 4YKRA 3TTZA 3B26A 5CPHA 5BODA 3Q5LA 3TZ0A 3FT5A 4HY1A 5CF0A 1NHHA 3G7BA 4HZ0A 2YI5A 2QG2A 2H8MA 3WHAA 3K97A 1AH8A 4MPNA 2Q8GA 5M4MA 4YKZA 4NH8A 2GQPA 4R3AA 3H80A 2YE7A 4XCLA 2GFDA 2LFRA 3CGZA 4YKXA 2QFOA 5M4NA 1I58A 4EGHA 4YKQA 2WEQA 2FTKA 1JM6A 1AMWA 3LNUA 3T10A 2Q8FA 1TILA 2CGFA 2CG9A 5M4HA 1YT0A 3PEHA 4XC0A 1Y8PA 2XK2A 4CWNA 3ZRWB 1YS3A 1Z5BA 4XE2A 1UY6A 2UWDA 5D7DA 1GKZA 4KTNA 3R4PA 2Q2EB 1Y8NA 1ZXNA 2YK2A 3U67A 4FPPA 2WERA 5BOCA 2BU7A 2XDSA 5IDMA 4PL9A 4BIZA 1BXDA 1A4HA 1UYFA 1NHJA 1ZWHA 3EHHA 2YEFA 3KE6A 4ZVIA 4EEHA 3EHJA 3EKRA 2QM8A 3B28A 2HCHA 5FNFA 4BQJA 2YGEA 4BQGA 4P8OA 2YE8A 3RLQA 2AKPA 4YKTA 4E00A 2ESAA 3TZ4A 5M4EA 1BGQA 4WUDA 1I5AA 3GIGA 1UYEA 3HEKA 4XCJA 4GQTA 3EHGA 4XIPA 1UYCA 3B24A 3LPSA 4HXZA 3R91A 3VHCA 3G7EA 2XHRA 4O09A 3ZCCA 1Z5CA 2YJXA 3HHUA 2BREA 2CH4A 3OWDA 1U0ZA 2P67A 2IORA 1EI1A 2BU8A 4JYCA 5IDJA 4JASA 1UYHA 3C11A 1YSZA 2XDLA 4MPEA 3RLRA 1I5CA 2BTZA 1UY8A 5L3JA 3R4MA 3INXA 5J6AA 2XHXA 4R1FA 4R3MA 5M4KA 4MP2A 2BZ5A 4B7PA 4BXIA 4CE3A 1B63A 3INWA 3K60A 3K99A 1PVGA 2LFSA 3A0YA 2E0AA 3TZ5A 2WI2A 1Z59A 4LWHA 1BKNA 3PEJA 4XTJA 4ASBA 2YEAA 2CCUA 1Z5AA 2XJJA 4B6CA 4XIQA 4FCQA 2YKBA 1ZXMA 2WI6A 1R62A 2ZBKB 4LWFA 4LC1A 2YE2A 3WQ9A 4O05A 4JAVA 4GEEA 2IOPA 3QDDA 3D36A 1YT2A 5FWKA 5D6PA 4PRVA 4KSHA 2FYPA 2YE5A 4I5SA 2QM7A 2QF6A 4L93A 3NMQA 1H7UA 5B1NA 4CE2A 3MD0A 4CWRA 3R92A 2BU6A 1YC4A 2WI1A 2BU5A 4V26A 1QZRA 2H55A 3RLPA 1MX0A 3GIFA 4CWFA 3RKZA 4FCPA 4CWPA 2YKCA 2XX5A 4O04A 5CTXA 4URLA 2QG0A 3Q5JA 4MTXA 3OPDA 2WWWA 4XKKA 4ASGA 3T1KA 4YKWA 4HYMA 3ZXOA 3NXSA 4YKUA 3O2FA 1US7A 4LP0A 3U2KA 4CE1A 4XIRA 2YEGA 2YECA 2Q8IA 3U2DA 1I59A 3CRKA 4URNA 2CCSA 2XDUA 3HZ1A 2XDKA 4NH9A 5D7CA 5FNCA 1KIJA 4XDMA 2YE3A 4FMTA 4HZ5A 2HKJA 3A0XA 2YKJA 1B62A 4KSGA 3C0EA 3B25A 3GIGB 3A0WA 2K5BA 4Q20A 1YT1A 4AS9A 2FWYA 1UYIA 4AWPA 2BU2A 2IWXA 2VCJA 2C2AA 4CWTA 1NHIA 4XD8A 3T0HA 1QY8A 3TZ2A 2YEJA 4LWGA 1YC3A 4MT8A 4K4OA 2YKEA 1TC0A 2BYIA 2XDXA 4FCRA 1IXMA 4HXWA 4L8ZA 3R4NA 1UY7A 2YI0A 4DZYA 4MPCA 1I5DA 1GKXA 1S16A 4CWSA 4U7NA 3O6OA 1UYMA 3HZ5A 4CWOA 1AM1A 2YKIA 1U2OA 3Q5KA 3D2RA 1AJ6A 1YETA 3VADA 3CRLA 2EXLA 1UYKA 2IOQA 3OW6A 4PU9A 2XJXA 3FT8A 4EMVA 4H85A 1I5BA 1S14A 1UYDA 2YEEA 4HYPA 3CGYA 5CTYA 4URMA 3DGEA 1QYEA 2YGAA 5F3KA 4I3HA 3T0ZA 4WUBA 4CWQA 4EGIA 5IN9A 3TK1A 2XX4A 4U7OA 2YEBA 3ZM7A 5GGZA 4XKOA 2YEDA 1Y8OA 4MBCA 4EM7A 4LWEA 4MB9A 2ZDYA 3QTFA 3B27A 3OMUA 4QPJA 1UYGA 5FNDA 1Y4UA 4ASAA 2BT0A 2YI6A 4AWOA 1TIDA 2XABA 4YKYA 4XKAA 4LPBA 4PRXA 4KQVA 2XCMA 1AH6A 3ZXQA 2YE6A 4JYBA 1THNA 1KZNA 2JKIA 2XJGA 4BIUA 3TUHA 3IEDA 4BAEA 1TC6A 2Q8HA 3A0RA 1B3QA 1ID0A 1L0OA 3D0BA 3MNRP 4QPKA 3R4OA 2YJWA 2XHTA 3G75A 5J71A 5M4PA 4HY6A 3VHDA 3ZRXA 4V25A 1UYLA 5D7RA 4WUCA 3ZRWA 4GGLA 1GJVA 2ZDXA 4EFTA 2VW5A 4E02A 4H7QA 3EHFA 2PNRA 3P32A 2FXSA 4LWIA 3HYYA 2FWZA 4XITA 1BYQA 4AWQA 4U93A 2WI4A 2YE4A 3BM9A 4JAUA 1JOYA 2CCTA 2VCIA 2YEHA 2O1VA 3JZ3A 1MU5A 4L94A 4ZKIA 4GT8A 4EGKA 2IWSA 1UY9A 4DUHA 1Y4SA 2IWUA 4P7AA 4GFNA 5D6QA 4ASFA 2BYHA 2XX2A 4O07A 1EA6A 1YSRA 2WI5A 3T2SA 5CTWA 2HG1A 3ZKBA 3K98A 2YGFA 5C93A 4GT1A 2WI7A
chains in the Genus database with same CATH superfamily
1EN6A 4UB8Z 2VWJA 4LF7O 2BRCA 1YERA 1H7SA 5CBGA 2ATKC 4DW1A 4DUYO 1N34B 2YEIA 2A79B 1KMIZ 4MOTA 2YI7A 1H2SB 2F4VB 1H2GA 5JENA 2XD6A 3BA9A 3O0IA 4I9WA 2YK9A 4O0BA 5LA6A 3L74H 3JYCA 3Q4HB 3SL2A 2ZR3A 3RYHA 4LF4B 2O57A 2DJVA 3ZHUA 3ZRVA 3A0HZ 4QJFB 5CTUA 1ZSPA 2WEPA 1WAZA 1FXVA 4LF9B 4ZOLA 1WN7A 2XUMA 2ZDIC 1IURA 1YESA 4K8ZA 4K8XA 4L90A 4YKRA 2HG5C 2LGWA 3IC7A 3B26A 5BODA 3Q5LA 1WA8B 2YI8A 3JSLA 5CF0A 5D5PA 3G7BA 2Q7GA 5LMNB 2QG2A 1JJ2U 2H8MA 1AH8A 2PI4A 4MPNA 1SZXA 4JI7O 2Q8GA 5M4MA 1GN6A 2QA4V 4NH8A 4DRXB 1PP9H 3BRCA 4WBNA 3LUTB 2QFOA 2QWRB 1VQ4V 4YKQA 4FM1A 1M56C 2HP8A 4AQYB 3T10A 2CGFA 1YCIA 5M4HA 2YEVB 3OTOO 1YT0A 4L8JA 4LWSB 5LP6B 3PEHA 3VQYA 2H3OA 1Y8PA 3SJBC 2NNUA 2VWKA 5IYCO 4JF3A 3T4ZA 3D8CA 4KTNA 1U96A 1H2MA 1SQGA 1BT8A 1PNLA 3CRAA 3P3NA 4JI1O 4WFHA 4BWAA 2WERA 3CC2V 4XBFA 2W0FC 1P49A 2WLNA 1O9HA 2ADQB 3M7MX 1QLEC 1A4HA 4X1KA 1UYFA 5IYZA 3ASNB 1GMGA 3T2MA 1W59A 3FD9A 3JAWB 3AG1C 1NVPB 5FNFA 4BQJA 5EYPB 4BQGA 1EBOA 4RWUA 3OAAG 2YE8A 3RYCA 2W6IG 4YKTA 3WB2A 3JD0A 3TZ4A 1IXBA 4N21A 1BGQA 3H1LH 1UYEA 1Q6HA 3RWRD 2ZE8A 1AB3A 2F93B 1M90W 3B24A 2E76B 3O9OA 3VHCA 4DR7B 1WJZA 4DUZO 4D7SA 3ZCCA 3ZHSA 2W6JG 3ETDA 1P4RA 2IORA 3RYIB 1EI1A 1YJWV 2PF4E 4WFAV 2HLDG 4R7CA 4FFBA 3OEEG 5L3EA 3INXA 1AI5A 5IJ9A 3AG4B 5J6AA 2Q68A 3HKEA 5M4KA 5EC1C 4LF8B 4CE3A 2BZ5A 1WNSA 1FKAO 4OPHA 3E83A 3ZHRA 3K60A 1R3KC 1TVKA 1YDXA 3AG1B 5J2UB 2JGDB 4B3TB 2DE0X 1Q8IA 2Q4PA 2ZE5A 1VF6C 2IM9A 1IVSA 2GV9A 1Z5AA 2OCCB 5BMVA 4B6CA 4O2BA 1SQFA 4DUYB 1ZXMA 4JTCB 2HVJC 1ZLZA 5KUKA 5EZYA 1S72V 4OX9B 1YHQV 3G67A 1GH6A 5KMGA 2YE2A 3WQ9A 4O05A 4JAVA 1BQZA 2P22C 3D36A 1DF5A 5CA1B 3OM3B 2E5LO 4X1YB 4KSHA 2Q8VA 2AXTZ 2XAHA 4J7JA 2Q6AA 2QM7A 3H9VA 3CRQA 4L93A 1VQMV 3FAVA 1IX9A 5C8YA 2EILC 1GN2A 1DK1A 2UXDB 3L9DA 1BL8A 1KD1W 3OR7C 2UXCB 3JAMN 1YTFB 3B77A 4UCRA 4X8AA 3K79A 1MX0A 3GIFA 3OGCC 3RKZA 4CWFA 2JVDA 1XNQB 4O04A 5CTXA 5LL6Y 3CCJV 1FXKA 4DR6O 4IHJA 4J42A 4XKKA 4H13B 1YEWA 3B8MA 3SPHA 4WFBV 1ENVA 3NXSA 5GTIZ 1S76D 4WFGA 1R3JC 4JTAB 2IJJA 1US7A 3U2KA 4XIRA 2W0XA 1XDCA 4NR1A 3K5LA 4JI7B 1I59A 5H9CA 1LR1A 2EIJB 2YUAA 4J10A 4IYHA 4X62O 4TUYA 2YXHA 4GX0A 2ZM6O 4NH9A 5D7CA 3UKMA 5FNCA 1KIJA 1IBKO 1SZTA 5KHJA 4FMTA 4LF6B 4RO2A 2KSDA 4O2AA 1V54B 2WA3A 2R9IA 2JRIA 3OTOB 1LUVA 3O65A 4GKKO 2K5BA 4O4HB 4H37A 4TQDA 4J80A 3ZMSA 1YT1A 2WLKA 3OMAB 2Z5UA 4RQEA 2FWYA 1EZJA 3WFVA 1UYIA 1FFXA 4XD8A 2Q5ZA 4N23A 2V1DA 3TZ2A 3GWOA 4LWGA 4Z1VA 3X2QB 3JALB 3ZHTA 1SETA 1KB9F 1QCEA 3QO8A 1FPOA 1TC0A 3CCUV 2XDXA 4YY3O 2WLMA 1YSCA 2K1EA 3JATA 1AR4A 4UFZA 1N0JA 2CH7A 4DZYA 3ABMC 1GO3F 1S16A 4ICGA 1F4NA 5B1BC 2DWDC 2QE7G 4TV8A 4NXNO 3E8GA 1UYMA 5EBMC 3CXCU 3K5MA 3STLC 4DR1B 1AJ6A 3D2RA 1VQ6V 1CEZA 1VEWA 1WP7A 2WLJA 1QBZA 1N0NA 3D3IA 3OW6A 4DV0B 2JDIG 4EMVA 1I5BA 1RM1C 1S14A 2OIEA 4DR2O 1US6A 2XTAA 2YEEA 5ITZA 3CGYA 3AG2C 1QYEA 2YGAA 1Q7YW 4CWQA 3RT3C 5IJ0B 2XX4A 3JSNA 1GN4A 2DMXA 3E35A 2YEDA 3LSUA 1G8MA 4JI8O 1OJHA 1HR0O 3G80A 3N2KA 3CC7V 4YIOA 5FNDA 1Y76B 1NTKH 4PDRA 3BPZA 4JI4B 5B1BB 5CMUA 2XABA 4YKYA 4CC5A 1Q43A 1R1BA 1M57C 1KUQA 2HHIA 4GKJO 1NKDA 1K33A 3G6EV 2ARHA 4CC6A 3KKYA 2WAMA 1OCOC 1L0OA 5JCOA 1VQ8V 5J71A 4W4KA 2GTAA 5FNVB 2FL4A 3CE2A 3J81N 4LFBB 5JJEB 1GM8A 3RN4A 2ZDXA 4H7QA 3EHFA 4GUNA 3HB3B 2FXSA 1QLNA 1LUWA 2DWEC 2FWZA 4XITA 3CCEV 1ZL8B 2A3QA 3W7XA 2EBOA 5JQGB 4UCUA 2XASA 3EHBB 4O4JB 3BM9A 1FD9A 2Y48A 4UV9A 1MU5A 1T5EA 2XAGA 4EGKA 4GT8A 3ZBHA 2BTQB 3UM7A 1UY9A 1TA8A 1QVFU 2OCHA 4GFNA 2OTLV 5D6QA 2BOBC 4D7TA 1IBMO 2YC0A 4DV3B 4XDKA 1YSRA 2BYHA 3QVNA 3DXRB 3ZKBA 5JWPA 5C93A 2QGNA 2HHHB 3CYOA 4MTFA 1OCOB 4DR4B 4NH7A 4NTYA 2IH3C 4K0KB 3ZKDA 3HKDB 5KUMA 4RUFA 3AK3A 2OWOA 3OWBA 4W7TA 4IIJB 1GTOA 1THZA 3BMYA 4LFCO 2MK3A 3B40A 2M7WA 2EIMB 2YXYA 4BAYA 4FLUA 1X59A 5HFMA 4L91A 1H38A 4X64O 4HBNA 1EN5A 4FLTA 3QNEA 1TBWA 3L75H 3BCCH 4EFUA 3WU2Z 2ZE6A 1CP9A 1XHZA 4GKKB 1G1XB 1XL6A 4UVAA 4X9LA 4LNUA 1F51A 4F6RB 5CBFA 2ZKJA 2N04A 3HYZA 2ZNIA 3SJAC 4GZRB 1YIJV 2ADPA 5F5RA 1BGYH 4FLWA 5J2TA 5KX5B 1ZAUA 4LFAO 2VS0A 4IL6Z 1X4TA 3EKOA 4RUEA 2GUZA 2Y69C 2E74B 5B3SB 1OCCC 4FVMA 2HKOA 2CTQA 4DW0A 2JK5C 2FMLA 4B3RO 3GWKC 3FT5A 1M5IA 3UO3A 4X1IA 2F1MA 1Z2GA 3ABLC 1D2DA 4I4TA 1Q5OA 1S5HC 3RVZA 3ZJZA 1VQ7V 4FK5C 1P7GA 3K9SA 3ZN0A 4YKZA 1XNRO 2BCCH 1S5LZ 4G27B 3H80A 3UO2A 1SRYA 3CGZA 2HFEC 5IT9N 3JARA 1I58A 5CA0B 3VBBA 3JD2A 4I50A 3JASA 1JM6A 3LNUA 3SPGA 1NR1A 1AJNA 1GM9A 2CG9A 1AR5A 2F43G 3IC9A 2QJ1A 1HNXB 4RAIA 4I55A 4XC0A 2XK2A 4U3JA 5H5NA 2Q9LA 3ZRWB 3CD6V 2D2CB 4XE2A 1UY6A 2UWDA 5D7DA 2Y69B 3ABKC 2KKWA 3R4PA 1OCCB 4CH6A 2Q2EB 4PA6A 1Y8NA 1HWYA 2V4DA 2ZNJA 3CX5F 1FYJA 4MVQA 3BAAA 3QTCA 4FPPA 3ABLB 2XDSA 4DV7O 3ASOB 2CTPA 4BIZA 1BXDA 4TSFG 1NHJA 4TT3G 1W0JG 4ZI7A 5J9PC 1AILA 3ETGA 3RVYA 2VQFB 4UCSA 1IBLB 3RLQA 3K59A 4E00A 4PJ0Z 5KHGA 2XNDG 1MOFA 1W2BU 3C3SA 4HZ3A 3CWBH 3K57A 3GIGA 3C3TA 4XCJA 1VQ9V 4GQTA 1K4CC 1NBMG 1UYCA 3QG5A 1OV9A 3R91A 3G7EA 1NI8A 4ZBMA 2YJXA 4FLYA 3HHUA 2BREA 1GK9A 2Y4TA 3ABKB 1J5EO 2BU8A 4JYCA 2AHYA 5IDJA 4PDVA 2IBZH 2RNBA 5LA6B 1UYHA 2XHBA 1I5CA 4OXSA 2NLJC 1UY8A 3RYHB 2PTMA 3R4MA 4JYAO 3HKBA 3FB8C 4J7ZA 4R1FA 5KHKA 1FJGO 4MP2A 4B7PA 4BR6A 2E75B 3UT5A 1M1KW 1NH2B 4WF9V 1PVGA 5IY5C 3TETA 4KHPB 4ZOLB 1XMOO 2LFSA 3SPCA 3T4DA 2JJ2G 3SYAA 1K34A 4DXWA 1K3EA 2WI2A 4LWHA 2GDSA 2H8PC 4DV4O 4XTJA 2YEAA 4ASBA 3P3PA 1SA0A 4AHCA 4GX2A 1DGSA 2WPDG 4W4LA 4XIQA 4FCQA 1XMQO 3LSQA 2WI6A 4PHZA 1NJIW 5IWAB 1SESA 1QR9A 1N8RW 2IOPA 1GAXA 2RN9A 5F2VO 2YIDA 4WBNB 1MSWD 2ITDC 1IZ3A 1SQPH 3RFRA 4IT5A 1NZ6A 2WLHA 4I5SA 2QF6A 1H7UA 4FLXA 5BY1A 5JH7A 3OW2U 1H2KA 4CWRA 2BU6A 1XHXA 1Q90D 3DTUB 2BU5A 3BEHA 4QIWF 1Z5WA 5LHGA 3CCRV 3RLPA 5IY5B 3D3QA 3PN1A 1B06A 4LFAB 4FCPA 4CWPA 1F23A 2BSKA 4JZ2A 2XX5A 3JAKA 4MS2A 3U10A 1RSOA 2EZOA 4URLA 4X65O 2QG0A 4MTXA 1VIBA 3OPDA 4F6EA 2ZE7A 2IW5A 4L87A 2QR4A 4B3RB 1KYOF 3FB5C 5EBWC 1N36O 1BSMA 3O2FA 3VQXA 4LP0A 1GRJA 3JCZA 2YEGA 3B2EE 3SYQA 3U2DA 4X1KB 1WB7A 3OD4A 5IYZB 2K9PA 4DR3O 1XUQA 2BTOA 3T1HO 2N05A 5DN6G 3L71H 4CS2A 4FFKA 5CBHA 3CHXA 3RYCB 3EFFK 1M56B 1Z5VA 1JQ0A 5KHIA 5GTHZ 2YKJA 3CP1A 1B62A 3C0EA 1TGOA 4DV6B 2JS5A 4FZ0A 4BIOA 3A0WA 1Y74A 3S3XA 3FKSG 4PA7A 4X89A 4CH4A 4XDJA 3AG7A 1K92A 2BU2A 2IWXA 3T0HA 4WFEA 1D5NA 3D36C 1QY8A 1KECA 4E2LA 1HDJA 2FKXA 4YJ2A 2DN9A 1Y6XA 5BZBA 3U0ZA 4FFBB 1K7DA 3F5TA 4YJ3A 2JEUA 1YITV 5EK0A 4K4OA 2YKEA 3N2GA 3HKEB 3BY6A 2BYIA 2A06H 1TAEA 1UPGA 4C7UA 3A2FA 4L8ZA 1QLEB 3AG3C 4R6ZA 1UY7A 3TXSA 4G28B 1GKXA 4FZ1A 5FL7G 1MSDA 4LR3A 4X88A 1TVKB 4CWSA 4U7NA 2DOSA 3O6OA 3HZ5A 1FXKC 2DYRC 1I7FA 2PYJA 3AEIA 4NXMO 3VADA 2EXLA 1UYKA 2IOQA 4LP8A 5BMVB 4LF7B 4JPRA 1OHHG 4O2BB 5LXTA 2PI5A 5EZYB 1Q81W 1VQKV 4HYPA 1SS3A 4NYKA 5KMGB 5CTYA 3KZIZ 4HNAA 4K35A 2C1GA 2QM4A 5D5QA 2JIZG 5IN9A 3TK1A 5B1AC 2YEBA 2B1IA 5GGZA 1OCZC 1Y8OA 4JYAB 3FAVB 5C8YB 4GX5A 4MB9A 1XILA 1MZFA 4EFBA 4X66O 2ZDYA 3B27A 3OMUA 3U11A 3CRCA 2F66C 2ZD9A 2UXBO 1I5XA 1TIDA 1S0VA 3CSXA 2P06A 1CPYA 3WB1A 4LPBA 2P7TC 3OE7G 1SQQH 5L3GA 1FXKB 4PRXA 2XCMA 2YE6A 3PJSK 4IHJB 1I5YA 4JYBA 2Y0IA 1THNA 1TUBA 1SF9A 2QKSA 4BIUA 4TV9A 1TC6A 2Q8HA 3D0BA 3L73H 4O4IA 3MNRP 3E8FA 3R4OA 2XAJA 3G75A 4EB6A 5M4PA 3VHDA 1G6UA 4V25A 1DLBA 4WUCA 4TUYB 4EFTA 4E02A 4QGPA 4HAMA 4XDLA 5LOVB 4JI5O 4LWIA 3HYYA 1OCZB 1L1FA 1MABG 1K9MW 4AWQA 4O2AB 2WI4A 3MDSA 1YZBA 2EILB 2P4KA 3B8NA 5KAFZ 4DV5O 3SDLA 4DV1O 4JAUA 2CCTA 2P5OA 2O1VA 4Q6GA 3JZ3A 2IWSA 3RW0A 1FFXB 3J7AU 4ASFA 5BR8O 2XX2A 2WSSG 1UFIA 1ZTEA 2OYQA 2HG1A 1PKXA 4F4LA 3MHSC 4JI1B 2WI7A 5LHIA 1YJ9V 4PA4A 2F23A 1Q6UA 4O4LA 4E4EA 1NQTA 3CWVA 3JATB 3ZMTA 2CH7B 2FYUH 2R72A 4DR3B 1H8EG 4JV5O 2YE9A 3T1HB 4E01A 4TV8B 1ZW9A 4WFFA 1AI7A 3WB0A 2F95B 3A0ZA 4GCZA 1TH8A 2YICA 2WI3A 4EKWA 1DF4A 4JI6O 3B09A 5CA3A 2VWCA 5JCOC 1VQPV 2LJ2A 3I55V 1O9GA 1WLEA 1YVWA 3OMNB 5ITZB 4I0XA 4TOIA 3ZIAG 4KP4A 5KLVH 4KFGA 1ZWIC 2RCVA 4B08A 2O1WA 4DUZB 3ZX6A 4CBCA 1N32O 3FV5A 1MA1A 1K97A 1PV0A 1JR9A 1SQVH 3RYFA 4CH3A 2EINC 5CPHA 4UVCA 3STZC 2IH1C 3SYPA 2YS8A 5JJNB 1JFFA 3N2KB 4DV2O 4NTWA 4JI2O 4HZ0A 2E3CA 3H1HH 4DK1A 2YI5A 4UXNA 5CB4A 3K97A 3ABMB 4JI3O 5EBLC 4WCEV 3ZRSA 3G71V 5E79Z 4PD4F 1N4CA 2GQPA 4R3AA 3IJ4A 3SR2C 2ETNA 5M4NA 4NXMB 3CCMV 2WEQA 4JAAA 2FTKA 1S3JA 1I94O 3ETEA 1H2NA 1RM1B 3K58A 2X0LA 4YHHO 4B3SO 1Y76A 3ZHQA 2X6BA 3AG2B 1KKCA 2Z3YA 2B1GA 1YS3A 1Z5BA 3ABUA 1R3IC 4UV8A 4JTDB 1VMGA 4H44B 1VQLV 2CK3G 1GKZA 2E5LB 5CN0A 1HNWO 1AI6A 2YSUB 3L72H 1PL4A 2EINB 1ZXNA 2YK2A 1R3LC 2RDCA 3U67A 1DTOA 2BU7A 5IDMA 3HKCA 4G2KA 4PL9A 1S77D 2ZINA 2F4VO 2Q73A 2KQXA 1BMFG 1M57B 3F7YC 4EEHA 3K04A 3EHJA 3EKRA 3THOA 4DR6B 3B28A 2HCHA 2YGEA 1NT2B 1ORQC 2B5UA 2YDEA 4P8OA 1AJPA 1K5QA 1MNGA 2AKPA 5LGTA 4LF4O 5M4EA 1K73W 1RPRA 1U97A 3HEKA 3EHGA 1YF2A 4P9OA 3LPSA 4HXZA 3K3WA 3E8BA 3APQA 3ZMUA 4X62B 4LF9O 2WLLA 2ZM6B 2P67A 2DYSC 2L35A 4EFEA 1H8HG 3E22A 1IBKB 4MPEA 2EJ7A 3SJCC 2OTJV 3RLRA 2BTZA 2QKAA 5H2FZ 4IYIA 1WP8A 4LNUB 5JVDA 1QQCA 1CXZB 3G4SV 4BXIA 1Y4MA 5LMNO 1B63A 3HPLC 3INWA 3K99A 4QE7A 4PA9A 5J2TB 2PGGA 3CC4V 2WA4A 3A0YA 1Y66A 3SJQC 3CMEV 2GUZB 4LH6A 2E0AA 2YIAA 3TZ5A 3K9AA 4ZHQA 3TGUH 1Z59A 3E89A 1MMMA 1BKNA 3WG7C 3ML0A 4AQYO 4LCUC 4KXRA 4X1IB 3VOUA 4YY3B 4I4TB 4JV5B 3OUFA 1R62A 2ZBKB 1WB8A 4QNHB 5DEDA 2ZIMA 4GEEA 3QDDA 1M93A 4NXNB 3APOA 2DYSB 1BZKA 3H1KH 1YT2A 3JARB 3DC6A 4PRVA 2FYPA 4I50B 2YE5A 4NTXA 3JASB 3TJTA 2B9ZA 1QU7A 2JGUA 2KG7A 4CE2A 5DM6V 3R92A 2WI1A 2XOKG 4DR2B 2Q0OC 4V26A 4I55B 1FAFA 5GONA 4MVRA 4U3JB 2QWPB 5L3BA 3OUSA 1N32B 2IJHA 3Q5JA 3ICXA 4FLZA 3K5NA 2WWWA 5LYJA 3WG7B 2X7RB 4JI8B 3T1KA 1HR0B 4FIPC 4I7ZB 4HYMA 2N74A 4KFMA 1XREA 2A0LA 5EIBD 4AILC 2CTWA 4X20A 3ZMVA 4FM2A 4EEQA 2CCSA 4DR7O 4ZI7B 2WLIA 5A2QN 4CS4A 4GKJB 2XDUA 2XDKA 2CGNA 4Z2WA 2HR3A 4HZ5A 2AZ0A 5IYBO 4KSGA 1JA8A 1AI4A 5H6RA 3B25A 3GIGB 3LNNA 4B3SB 2EZPA 3T1YO 3KCYA 2Q7HA 3QO5A 2AGAA 1AP5A 2YI9A 3A8TA 4B3MO 5JJJB 4AS9A 2RJZA 1NVPD 2QTOA 2VCJA 2C2AA 1NHIA 3AK2A 3LDDA 3BHPA 3ABTA 1VQNV 2GSMB 3FB7C 3CJHA 3HKBB 2IJIA 3CS5A 1XQ8A 4OPAA 4NVPA 1QNMA 1IXMA 4HXWA 1PM9A 1SQXH 1K8AW 3CXHF 3UT5B 3GVMA 2Q0AA 5LHHA 3R4NA 4H33A 5EC2C 4OX9O 4MPCA 4HYOA 1IBMB 3R66A 2NR5A 2YKIA 4LH7A 5B5EZ 1YETA 3SYCA 3SPIA 1SA0B 3CRLA 4GYCB 3Q4HA 2X6AA 4PU9A 2XJXA 2UXDO 1UYDA 1B04A 5LP6C 5EIBC 4LFCB 2UXCO 4P9PA 1GM7A 4J7KA 3DGEA 3ZS8C 2R9AA 1GKFA 5F3KA 4I3HA 3T0ZA 1XNQO 1WPXA 3EXAA 4UVBA 1QHTA 1AVMA 4U7OA 4H0LB 4X64B 4MTGA 4E72A 4EM7A 4B7EA 5JH7B 4LWEA 1URFA 2GTSA 1WA8A 1UYGA 3JD3A 4ASAA 3BABA 4R8CA 1Q3EA 5KA6A 1V55C 2BSKB 3ASNC 4XKAA 5L3CA 3JAKB 1RSOB 4PI0A 3B4SA 4YXWG 4KQVA 4DRXA 4ABMA 1GN3A 3QF7A 5DECA 1KZNA 2JKIA 2XJGA 1YXBA 1JMKC 3TUHA 3IEDA 2HEPA 4BAEA 4LF6O 3A0RA 1ID0A 3W7SA 1MZEA 4MVOA 4QPKA 2YIBD 1SERA 1YTFD 2PYLA 2XHTA 3FYIB 1RFYA 2X6CA 2YEVA 4LWSA 5LP6A 4BW9A 2FB5A 1UYLA 5D7RA 1XNRB 2GHYA 2JEXA 2CDYA 3IGAC 4GGLA 2VW5A 2ZDIA 3IFXA 2P6JA 3OT7A 3CCSV 2PNRA 1VF5B 3AK1A 4ZIBA 1LNQA 2CAZC 4NKGB 4U93A 1XI1A 2UU9O 1PNMA 3AG4C 1JOYA 2VCIA 2Q67A 1ZUQA 1Y74B 4L94A 4ZKIA 4DUHA 3IAYA 1V55B 4P7AA 2QDOA 3ZMZA 5FLXN 1EA6A 3M99B 4YJ2B 2CUGA 3JAWA 2YXLA 2UUCO 1FXHA 4DR1O 3K98A 2YGFA 1EM1A 5EYPA 2P90A 3R65A 2QWQB 4YJ3B 3N2GB 5FPRA 1Q82W 4MP7A 1B6QA 5IJ9B 4DV0O 1YC1A 2OCCC 1N33O 4DV7B 3H1JH 5LGNA 2BE3A 1NR7A 1HP8A 4TWKA 4UROA 1L0LH 4JQLA 4U3FH 1Y67A 1V9PA 3KCXA 3NR7A 3RBZA 1R6KA 3BFRA 3E8HA 5KHHA 3RYIA 4MSWC 2O1UA 1VARA 2LO1A 4MVZA 1AJQA 4FJCC 1OSFA 3GIEA 2ODMA 1XOUA 5LXTB 3EVKA 3T1YB 4H81A 2R9RB 2JJCA 1OZ0A 4B3MB 3VHAA 3H4LA 4JI4O 2AZ2A 4HNAB 1PNKA 2BSMA 3A0TA 3I56V 1J5EB 1SKVA 5L3DA 1AP6A 5J2UA 1EZVH 2JGDA 5LMUO 5B1OA 3OEHG 1E1RG 1P7BA 2QWOB 3W7TA 4X9QA 1M9NA 3TTZA 2JJ1G 3S5TA 4NB5A 3TZ0A 1BQ0A 4HY1A 3LDCA 4JYYA 2LGQA 1JX9A 4BW5A 1FJGB 1NHHA 1HNZO 2QTSA 3AG3B 3TCUA 1RPOA 1BCCH 2ITCC 3WHAA 4LFBO 1G4YB 4KL1A 2EIJC 3G6BA 1XMOB 1H2LA 1XEQA 2DYRB 1NTMH 1VQ5V 2XT9A 2YE7A 2A9HA 2GFDA 2LFRA 1TUBB 5CA1A 4XCLA 4YKXA 3LSSA 4EGHA 4X1YA 4TV9B 3CRMA 4DV4B 1AMWA 1TUEB 4O4IB 1COWG 2ZIOA 3UQ8A 3FX7A 1V54C 2Q8FA 1TILA 1XMQB 4EB6B 2CE4A 1KU9A 2YIBA 4CWNA 4J11A 4RQFA 1JVMA 3CYGA 4DV3O 1RP3B 5B1AB 1ZX3A 5BXZA 3C90A 3T1CA 4J41A 3X2QC 4J9YB 1VF6A 2HHHO 1F7YA 4DR4O 1FFTB 2ZT9B 4K0KO 5BOCA 2UXNA 2C1IA 1HW7A 2HJDA 3CB2A 3CMAV 2PUSA 3I5DA 4LF5O 4JGSA 1ZWHA 3EHHA 2GBOA 3ZHVA 1R6TA 5GW7A 2YEFA 3KE6A 5IYDO 4ZVIA 4UCTA 2JS3A 1BHAA 1R6NA 2QM8A 4X65B 4OGQB 5LOVA 2ZXWC 2CTRA 2A7WA 1KQSU 2RQ6A 2QKCA 4O4LB 1N36B 2ESAA 4WUDA 2VQEO 1I5AA 5TISZ 5L3FA 4XIPA 4O4HA 1A32A 2UUAO 1JCHA 3H01A 2XHRA 4O09A 3JCUZ 1Z5CA 2CH4A 4MW3A 3OWDA 1U0ZA 4JASA 2IU3A 3FB6C 3C11A 1YSZA 2XDLA 2UU9B 3K5OA 2PY5A 5L3JA 3JALA 3RGBA 4LBEC 3K03A 2RMKB 4IGGA 3F7VC 2XHXA 4I0XB 4R3MA 3MAQA 3ZN1A 5K1XA 1YI2V 1YJNV 3K08A 2L6LA 2DQ0A 2Y4UA 4UB6Z 2IJKA 4TQFA 2ZKOA 1NU1H 1ROPA 2UUCB 3E86A 2ZXWB 1PL0A 2VRZA 2UUBO 1KKDA 2DQ3A 3RYFB 1VF7A 3PEJA 3OFNG 4J9ZB 4P30A 1JFFB 2CCUA 3S3WA 4FLVA 1N33B 2XJJA 3E2EA 5B66Z 1FS0G 1HNXO 2YKBA 2QWNB 1L0NH 5CB4B 4D6TH 4LWFA 4LC1A 2P4VA 2Z0AA 3CCQV 3CCLV 2G38A 2XAFA 1PD3A 2R70A 5IE9A 1KP2A 3L70H 1OCRC 5FWKA 5D6PA 2QSAA 1EN4A 5IJ0A 2DW4A 3QO7A 4FM0A 4JZGA 3NMQA 5FPOA 4DR5O 2OIGA 5B1NA 4JI0O 3MD0A 1YC4A 3BA8A 1QZRA 2H55A 1Q86W 3K06A 5KAIZ 4DK0A 1BE3H 1VP7A 2D3OW 1NTZH 4K3AA 2YKCA 2QEXV 1KP3A 5LMUB 1K4DC 2VQFO 4MVSA 1MG1A 1E1QG 1IBLO 4ASGA 1K5SA 4YKWA 3ZXOA 1I08A 4YKUA 3CCVV 4X66B 1HNZB 3W7UA 4CE1A 3HKCB 3CPWU 2YECA 4A5UB 2Q8IA 2UXXA 4UCOA 3ETQA 2UXBB 1N34O 3CRKA 5FNVA 4URNA 4KUMA 1QVGU 3OGIB 1OCRB 2EIMC 2OT5A 3HZ1A 4MVMA 4ASUG 4XDMA 2YE3A 3H1IH 2HKJA 3A0XA 1ZL8A 3CEIA 4B7KA 5JQGA 4MVUA 1SQBH 1J95A 2EJRA 4O4JA 3K0DA 1F4MA 4Q20A 4AI8A 4R50A 5HFLA 1W0KG 4DO2A 4CS3A 2Q7EA 2BTQA 2WLLB 4AWPA 4UUJC 4KHPO 4CWTA 3A0BZ 3DSQA 2EIKC 4Z1MG 1KC8W 3E22B 4JI5B 3VQVA 3SGIA 3DXRA 2YEJA 4I9QA 1YC3A 3OMIB 5B3SC 4UCVA 4MT8A 1P84F 1EFRG 3MHHC 4DV5B 5LGUA 4DV1B 5JVDB 3HKDA 1IDSA 2EULA 4FCRA 2LW7A 1BS3A 4IIJA 4LF5B 2YI0A 5IWAO 1I5DA 2HVKC 2H94A 5BR8B 4CWOA 1AM1A 1AR1B 1U2OA 1Q6IA 4ZHQB 4CZZA 3Q5KA 2PZSA 1VQOV 2NN4A 2LW1A 5H6QA 2VQEB 3FT8A 4H85A 4PV1B 3TXQA 5KA5A 3F5WC 3SPJA 1NH2D 1PPJH 1KBHA 2EX3A 2UUAB 1D5AA 4F6RA 3LNMB 4GLXA 2BOCC 4PI2A 4URMA 2EIKB 2KB1A 4WUBA 4EGIA 3OR6C 5KX5A 2XAQA 1JPXA 1R73A 3ZM7A 2ILMA 4XKOA 2V7QG 4PA3A 4JI6B 4MBCA 2KG7B 5K1PA 3QTFA 2AW9A 3LDEA 1WPBA 3ASOC 4QPJA 4MW8A 5GONB 2IU0A 1Y4UA 2BT0A 2HJFC 4PDMA 2YI6A 4PDLA 4AWOA 1UJWB 3ZEDA 1AROP 5E1AC 3ZXQA 3OTFA 1AH6A 2UUBB 1L8DA 3CRRA 1SC5B 1XL4A 3M8AA 5LYJB 3FFQA 2LQTA 2ZQMA 2ZR2A 5CA0A 2AHZA 3W7WA 4MTOA 5LBQA 1B3QA 3SYOA 2Q69A 4DV2B 4PELA 3J80N 4JI2B 1I0HA 1JJOA 3KG2A 4DV6O 2YJWA 4GX1A 4YIPA 5A9GA 4X20B 4HY6A 4JI3B 3ZRXA 2WLIB 3ZRWA 1GJVA 1XBLA 3FYEB 3P30A 3LMMA 2Y0PA 4CH5A 1NS1A 3P32A 3BVOA 3N27A 3HR0A 2ZCEA 1BYQA 2M6YA 3JD4A 5AG2A 4DR5B 4JI0B 4P2ZA 1I94B 4DYLA 3DC5A 2YE4A 3UCSC 4YHHB 2YEHA 1BHBA 2CGOA 4LF8O 1Y4SA 1M4UA 2IWUA 4QE9A 2LP7A 1QR8A 3VQWA 4O07A 2WI5A 3T2SA 5CTWA 1HNWB 3K0GA 1E79G 4B3TO 2MW2B 3GB7C 1S5JA 3CJHB 3JD1A 4GT1A
chains in the Genus database with same CATH topology
2BRCA 1YERA 1H7SA 5CBGA 2ATKC 2YEIA 2A79B 4MOTA 2YI7A 1H2GA 2XD6A 3O0IA 4I9WA 2YK9A 4O0BA 3JYCA 3SL2A 2ZR3A 3ZRVA 4QJFB 5CTUA 2WEPA 1FXVA 2ZDIC 1YESA 4L90A 4YKRA 2HG5C 3IC7A 3B26A 5BODA 3Q5LA 5CF0A 3G7BA 2QG2A 1JJ2U 2H8MA 1AH8A 2PI4A 4MPNA 2Q8GA 5M4MA 2QA4V 4NH8A 3LUTB 2QFOA 1VQ4V 4YKQA 1M56C 3T10A 2CGFA 5M4HA 2YEVB 1YT0A 3PEHA 1Y8PA 2NNUA 5IYCO 4JF3A 3T4ZA 4KTNA 1PNLA 4WFHA 2WERA 3CC2V 4XBFA 2W0FC 2WLNA 1QLEC 1A4HA 1UYFA 3ASNB 1GMGA 3T2MA 3AG1C 1NVPB 5FNFA 4BQJA 4BQGA 1EBOA 3OAAG 2YE8A 2W6IG 4YKTA 3JD0A 3TZ4A 4N21A 1BGQA 1UYEA 1M90W 3B24A 3VHCA 3ZCCA 2W6JG 3ETDA 1P4RA 2IORA 1EI1A 1YJWV 4WFAV 2HLDG 4R7CA 3OEEG 5L3EA 3INXA 1AI5A 3AG4B 5J6AA 2Q68A 5M4KA 5EC1C 4CE3A 2BZ5A 3E83A 3K60A 1R3KC 3AG1B 1Z5AA 2OCCB 4B6CA 1ZXMA 4JTCB 2HVJC 5KUKA 1S72V 1YHQV 2YE2A 3WQ9A 4O05A 4JAVA 3D36A 1DF5A 3OM3B 4KSHA 2XAHA 2Q6AA 2QM7A 4L93A 1VQMV 2EILC 1BL8A 1KD1W 3OR7C 1YTFB 3B77A 4X8AA 3K79A 1MX0A 3GIFA 3OGCC 3RKZA 4CWFA 4O04A 5CTXA 3CCJV 1FXKA 4XKKA 3B8MA 3SPHA 4WFBV 1ENVA 3NXSA 1S76D 4WFGA 1R3JC 4JTAB 2IJJA 1US7A 3U2KA 4XIRA 1I59A 5H9CA 2EIJB 4GX0A 4NH9A 5D7CA 3UKMA 5FNCA 1KIJA 1SZTA 4FMTA 4RO2A 1V54B 2R9IA 2K5BA 4H37A 3ZMSA 1YT1A 2WLKA 3OMAB 2Z5UA 4RQEA 2FWYA 1EZJA 3WFVA 1UYIA 4XD8A 4N23A 2V1DA 3TZ2A 3GWOA 4LWGA 3X2QB 1SETA 1QCEA 3QO8A 1TC0A 3CCUV 2XDXA 2WLMA 1YSCA 2K1EA 4DZYA 3ABMC 1GO3F 1S16A 1F4NA 5B1BC 2DWDC 2QE7G 3E8GA 1UYMA 5EBMC 3CXCU 3STLC 3D2RA 1AJ6A 1VQ6V 1CEZA 2WLJA 1QBZA 3OW6A 3D3IA 2JDIG 4EMVA 1I5BA 1RM1C 1S14A 2YEEA 3CGYA 3AG2C 1QYEA 2YGAA 1Q7YW 4CWQA 2XX4A 3E35A 2YEDA 1G8MA 3CC7V 5FNDA 4PDRA 5B1BB 5CMUA 2XABA 4YKYA 1M57C 1NKDA 1K33A 3G6EV 2WAMA 1OCOC 1L0OA 1VQ8V 5J71A 1GM8A 2ZDXA 4H7QA 3EHFA 3HB3B 2FXSA 1QLNA 2DWEC 2FWZA 4XITA 3CCEV 3W7XA 2EBOA 2XASA 3EHBB 3BM9A 2Y48A 4UV9A 1MU5A 2XAGA 4EGKA 4GT8A 3UM7A 1UY9A 1QVFU 4GFNA 2OTLV 5D6QA 2BOBC 2BYHA 4XDKA 1YSRA 3ZKBA 5C93A 3CYOA 4MTFA 1OCOB 4NH7A 2IH3C 3ZKDA 5KUMA 4RUFA 3OWBA 4W7TA 1GTOA 1THZA 3BMYA 2MK3A 2M7WA 2EIMB 4BAYA 5HFMA 4L91A 1H38A 1TBWA 3QNEA 4EFUA 1CP9A 1XL6A 4UVAA 4X9LA 1F51A 5CBFA 2ZKJA 3HYZA 1YIJV 5F5RA 3EKOA 4RUEA 2Y69C 5B3SB 1OCCC 2HKOA 2JK5C 3FT5A 3ABLC 1S5HC 3RVZA 3ZJZA 1VQ7V 4FK5C 3ZN0A 4YKZA 4G27B 3H80A 1SRYA 3CGZA 2HFEC 1I58A 3VBBA 3JD2A 1JM6A 3LNUA 3SPGA 1NR1A 1AJNA 1GM9A 2CG9A 2F43G 4RAIA 4XC0A 2XK2A 3ZRWB 3CD6V 4XE2A 1UY6A 2UWDA 5D7DA 2Y69B 3ABKC 3R4PA 1OCCB 2Q2EB 4PA6A 1Y8NA 1HWYA 4MVQA 4FPPA 3ABLB 2XDSA 3ASOB 4BIZA 1BXDA 4TSFG 1NHJA 4TT3G 1W0JG 5J9PC 3ETGA 3RVYA 3RLQA 4E00A 2XNDG 1MOFA 1W2BU 4HZ3A 3GIGA 4XCJA 1VQ9V 4GQTA 1K4CC 1NBMG 1UYCA 3R91A 3G7EA 4ZBMA 2YJXA 3HHUA 2BREA 1GK9A 3ABKB 2BU8A 4JYCA 2AHYA 5IDJA 4PDVA 1UYHA 1I5CA 4OXSA 2NLJC 1UY8A 3R4MA 3FB8C 4R1FA 4MP2A 4B7PA 1M1KW 1NH2B 4WF9V 1PVGA 5IY5C 3TETA 2LFSA 3SPCA 3T4DA 2JJ2G 3SYAA 1K34A 4DXWA 1K3EA 2WI2A 4LWHA 2H8PC 4XTJA 4ASBA 2YEAA 4GX2A 2WPDG 4XIQA 4FCQA 3LSQA 2WI6A 1NJIW 1SESA 1QR9A 1N8RW 2IOPA 1MSWD 2ITDC 2WLHA 4I5SA 2QF6A 1H7UA 3OW2U 4CWRA 2BU6A 3DTUB 2BU5A 3BEHA 4QIWF 5LHGA 3CCRV 3RLPA 5IY5B 4FCPA 4CWPA 1F23A 2XX5A 4MS2A 2EZOA 4URLA 2QG0A 4MTXA 3OPDA 2IW5A 4L87A 3FB5C 5EBWC 3O2FA 4LP0A 3JCZA 2YEGA 3SYQA 3U2DA 5DN6G 5CBHA 3EFFK 1M56B 1JQ0A 2YKJA 3CP1A 1B62A 3C0EA 3A0WA 3FKSG 4PA7A 4X89A 4XDJA 1K92A 2BU2A 2IWXA 3T0HA 4WFEA 1QY8A 1KECA 4E2LA 5BZBA 1K7DA 2JEUA 1YITV 5EK0A 4K4OA 2YKEA 3BY6A 2BYIA 4L8ZA 1QLEB 3AG3C 4R6ZA 1UY7A 4G28B 1GKXA 5FL7G 4X88A 4CWSA 4U7NA 3O6OA 3HZ5A 1FXKC 2DYRC 3AEIA 3VADA 2EXLA 1UYKA 2IOQA 4LP8A 4JPRA 1OHHG 2PI5A 1Q81W 1VQKV 4HYPA 5CTYA 2JIZG 5IN9A 3TK1A 5B1AC 2YEBA 2B1IA 5GGZA 1OCZC 1Y8OA 4GX5A 4MB9A 2ZDYA 3B27A 3OMUA 2ZD9A 1I5XA 1TIDA 1S0VA 1CPYA 4LPBA 2P7TC 3OE7G 5L3GA 1FXKB 4PRXA 2XCMA 2YE6A 3PJSK 1I5YA 4JYBA 1THNA 2QKSA 4BIUA 1TC6A 2Q8HA 3D0BA 3MNRP 3E8FA 3R4OA 2XAJA 3G75A 5M4PA 3VHDA 4V25A 1DLBA 4WUCA 4EFTA 4E02A 4HAMA 4XDLA 4LWIA 3HYYA 1OCZB 1L1FA 1MABG 1K9MW 4AWQA 2WI4A 2EILB 3B8NA 4JAUA 2CCTA 2O1VA 3JZ3A 2IWSA 3RW0A 4ASFA 2XX2A 2WSSG 2HG1A 1PKXA 4F4LA 3MHSC 2WI7A 1YJ9V 5LHIA 4PA4A 1NQTA 3CWVA 3ZMTA 1H8EG 2YE9A 4E01A 1ZW9A 4WFFA 1AI7A 3A0ZA 4GCZA 1TH8A 2WI3A 4EKWA 1DF4A 5CA3A 2VWCA 1VQPV 3I55V 1WLEA 3OMNB 3ZIAG 4KP4A 4KFGA 1ZWIC 2O1WA 4CBCA 3FV5A 1K97A 2EINC 5CPHA 4UVCA 3STZC 2IH1C 3SYPA 4HZ0A 2YI5A 4UXNA 3K97A 3ABMB 5EBLC 4WCEV 3ZRSA 3G71V 2GQPA 4R3AA 5M4NA 3CCMV 2WEQA 2FTKA 1S3JA 3ETEA 1RM1B 2X0LA 2X6BA 3AG2B 2Z3YA 2B1GA 1YS3A 1Z5BA 3ABUA 1R3IC 4UV8A 4JTDB 1VQLV 2CK3G 1GKZA 5CN0A 1AI6A 2YSUB 2EINB 1ZXNA 2YK2A 1R3LC 3U67A 1DTOA 2BU7A 5IDMA 4G2KA 4PL9A 1S77D 1BMFG 1M57B 3F7YC 4EEHA 3K04A 3EHJA 3EKRA 3B28A 2HCHA 2YGEA 1ORQC 2B5UA 4P8OA 1AJPA 1K5QA 2AKPA 5LGTA 5M4EA 1K73W 1RPRA 3HEKA 3EHGA 4P9OA 3LPSA 4HXZA 3K3WA 3E8BA 3ZMUA 2WLLA 2P67A 2DYSC 1H8HG 4MPEA 2OTJV 3RLRA 2BTZA 4BXIA 3G4SV 1Y4MA 1B63A 3HPLC 3INWA 3K99A 4QE7A 4PA9A 3CC4V 3A0YA 1Y66A 3SJQC 3CMEV 2E0AA 3TZ5A 3K9AA 1Z59A 3E89A 1BKNA 3WG7C 3ML0A 4LCUC 3VOUA 3OUFA 1R62A 2ZBKB 4QNHB 4GEEA 3QDDA 2DYSB 1YT2A 4PRVA 2FYPA 2YE5A 4CE2A 5DM6V 3R92A 2WI1A 2XOKG 4V26A 4MVRA 5L3BA 3OUSA 2IJHA 3Q5JA 2WWWA 3WG7B 2X7RB 3T1KA 4FIPC 4HYMA 4KFMA 2A0LA 3ZMVA 2CCSA 2WLIA 2XDUA 2XDKA 2HR3A 4HZ5A 5IYBO 4KSGA 1AI4A 5H6RA 3B25A 3GIGB 2EZPA 3QO5A 4AS9A 1NVPD 2QTOA 2VCJA 2C2AA 1NHIA 3LDDA 3ABTA 1VQNV 2GSMB 3FB7C 2IJIA 1IXMA 4HXWA 1K8AW 3R4NA 5LHHA 4H33A 5EC2C 4MPCA 4HYOA 2YKIA 1YETA 3SYCA 3SPIA 3CRLA 2X6AA 4PU9A 2XJXA 1UYDA 4P9PA 1GM7A 3DGEA 1GKFA 5F3KA 4I3HA 3T0ZA 1WPXA 4UVBA 4U7OA 4MTGA 4EM7A 4LWEA 1UYGA 3JD3A 4ASAA 4R8CA 5KA6A 1V55C 3ASNC 4XKAA 5L3CA 4YXWG 4KQVA 1KZNA 2JKIA 2XJGA 3TUHA 3IEDA 4BAEA 3A0RA 1ID0A 3W7SA 4MVOA 4QPKA 1SERA 1YTFD 2XHTA 3FYIB 2X6CA 2YEVA 1UYLA 5D7RA 2GHYA 2JEXA 3IGAC 4GGLA 2VW5A 2ZDIA 3IFXA 2P6JA 3CCSV 2PNRA 1LNQA 4U93A 1PNMA 3AG4C 1JOYA 2VCIA 2Q67A 4L94A 4ZKIA 4DUHA 1V55B 4P7AA 3ZMZA 1EA6A 3M99B 1FXHA 3K98A 2YGFA 2P90A 3R65A 1Q82W 4MP7A 1B6QA 1YC1A 2OCCC 5LGNA 1NR7A 4TWKA 4UROA 4JQLA 3RBZA 1R6KA 3E8HA 4MSWC 2O1UA 4MVZA 1AJQA 4FJCC 1OSFA 3GIEA 4H81A 2R9RB 2JJCA 1OZ0A 3VHAA 3H4LA 1PNKA 2BSMA 3A0TA 3I56V 5L3DA 5B1OA 3OEHG 1E1RG 1P7BA 3W7TA 3TTZA 1M9NA 2JJ1G 3TZ0A 4HY1A 3LDCA 4BW5A 1JX9A 1NHHA 3AG3B 3TCUA 1RPOA 2ITCC 3WHAA 1G4YB 2EIJC 2DYRB 2YE7A 1VQ5V 4XCLA 2A9HA 2GFDA 2LFRA 4YKXA 3LSSA 4EGHA 1AMWA 1TUEB 1COWG 1V54C 2Q8FA 1TILA 4CWNA 4RQFA 1JVMA 5B1AB 3T1CA 3X2QC 4J9YB 1FFTB 5BOCA 2UXNA 3CMAV 4JGSA 1ZWHA 3EHHA 3KE6A 5GW7A 2YEFA 5IYDO 4ZVIA 1BHAA 1R6NA 2QM8A 2ZXWC 1KQSU 2ESAA 4WUDA 1I5AA 5L3FA 4XIPA 1JCHA 3H01A 2XHRA 4O09A 1Z5CA 2CH4A 4MW3A 3OWDA 1U0ZA 4JASA 2IU3A 3FB6C 3C11A 1YSZA 2XDLA 5L3JA 4LBEC 3K03A 3F7VC 2XHXA 4R3MA 3ZN1A 1YI2V 1YJNV 3K08A 2DQ0A 2IJKA 1ROPA 1KKDA 3E86A 2ZXWB 1PL0A 2DQ3A 3PEJA 3OFNG 4J9ZB 4P30A 2CCUA 2XJJA 3E2EA 1FS0G 2YKBA 4LWFA 4LC1A 3CCQV 3CCLV 2XAFA 1PD3A 1KP2A 1OCRC 5FWKA 5D6PA 2DW4A 3QO7A 3NMQA 5B1NA 3MD0A 1YC4A 1QZRA 2H55A 1Q86W 3K06A 2D3OW 2YKCA 2QEXV 1KP3A 1K4DC 4MVSA 1MG1A 1E1QG 4ASGA 1K5SA 4YKWA 3ZXOA 4YKUA 3CCVV 3W7UA 4CE1A 3CPWU 2YECA 2Q8IA 2UXXA 3CRKA 4URNA 4KUMA 1QVGU 1OCRB 2EIMC 2OT5A 3HZ1A 4MVMA 4ASUG 4XDMA 2YE3A 2HKJA 3A0XA 4MVUA 1J95A 2EJRA 3K0DA 1F4MA 4Q20A 4R50A 1W0KG 5HFLA 4DO2A 2WLLB 4AWPA 4UUJC 4CWTA 2EIKC 4Z1MG 1KC8W 2YEJA 1YC3A 3OMIB 5B3SC 4MT8A 1EFRG 3MHHC 5LGUA 4FCRA 2YI0A 1I5DA 2HVKC 2H94A 4CWOA 1AM1A 1AR1B 1U2OA 4CZZA 3Q5KA 1VQOV 5H6QA 3FT8A 4H85A 5KA5A 3F5WC 3SPJA 1NH2D 3LNMB 2BOCC 4URMA 2EIKB 2KB1A 4WUBA 4EGIA 3OR6C 2XAQA 1JPXA 1R73A 3ZM7A 4XKOA 2V7QG 4PA3A 4MBCA 3QTFA 3LDEA 4QPJA 2IU0A 3ASOC 4MW8A 1Y4UA 2BT0A 2HJFC 4PDMA 2YI6A 4PDLA 4AWOA 1UJWB 1AROP 5E1AC 3ZXQA 1AH6A 1XL4A 2ZQMA 2ZR2A 2AHZA 3W7WA 4MTOA 5LBQA 3SYOA 1B3QA 2Q69A 4PELA 3KG2A 2YJWA 4GX1A 4HY6A 3ZRXA 2WLIB 3ZRWA 1GJVA 3P30A 3FYEB 3P32A 1BYQA 3JD4A 4P2ZA 2YE4A 2YEHA 1BHBA 1Y4SA 2IWUA 4QE9A 2LP7A 1QR8A 4O07A 2WI5A 3T2SA 5CTWA 3K0GA 1E79G 3GB7C 3JD1A 4GT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NH7 A;  3ZKD A;  4MP7 A;  1YC1 A;  2BRC A;  1YER A;  1H7S A;  3CWV A;  3OWB A;  4W7T A;  2YEI A;  2YE9 A;  3BMY A;  4URO A;  4JQL A;  2YI7 A;  4MOT A;  4E01 A;  1ZW9 A;  2XD6 A;  3O0I A;  3A0Z A;  4GCZ A;  1TH8 A;  4L91 A;  2YK9 A;  2O1U A;  1TBW A;  4O0B A;  2WI3 A;  4EFU A;  1OSF A;  3GIE A;  3SL2 A;  2VWC A;  4X9L A;  1F51 A;  4H81 A;  2ZKJ A;  4KP4 A;  2JJC A;  4KFG A;  3ZRV A;  3VHA A;  3H4L A;  3HYZ A;  5CTU A;  2WEP A;  2O1W A;  5F5R A;  2BSM A;  3A0T A;  3FV5 A;  3EKO A;  5B1O A;  1YES A;  4L90 A;  4YKR A;  3TTZ A;  3B26 A;  5CPH A;  5BOD A;  3Q5L A;  3TZ0 A;  3FT5 A;  4HY1 A;  5CF0 A;  1NHH A;  3G7B A;  4HZ0 A;  2YI5 A;  2QG2 A;  2H8M A;  3WHA A;  3K97 A;  1AH8 A;  4MPN A;  2Q8G A;  5M4M A;  4YKZ A;  4NH8 A;  2GQP A;  4R3A A;  3H80 A;  2YE7 A;  4XCL A;  2GFD A;  2LFR A;  3CGZ A;  4YKX A;  2QFO A;  5M4N A;  1I58 A;  4EGH A;  4YKQ A;  2WEQ A;  2FTK A;  1JM6 A;  1AMW A;  3LNU A;  3T10 A;  2Q8F A;  1TIL A;  2CGF A;  2CG9 A;  5M4H A;  1YT0 A;  3PEH A;  4XC0 A;  1Y8P A;  2XK2 A;  4CWN A;  3ZRW B;  1YS3 A;  1Z5B A;  4XE2 A;  1UY6 A;  2UWD A;  5D7D A;  1GKZ A;  4KTN A;  3R4P A;  2Q2E B;  1Y8N A;  1ZXN A;  2YK2 A;  3U67 A;  4FPP A;  2WER A;  5BOC A;  2BU7 A;  2XDS A;  5IDM A;  4PL9 A;  4BIZ A;  1BXD A;  1A4H A;  1UYF A;  1NHJ A;  1ZWH A;  3EHH A;  2YEF A;  3KE6 A;  4ZVI A;  4EEH A;  3EHJ A;  3EKR A;  2QM8 A;  3B28 A;  2HCH A;  5FNF A;  4BQJ A;  2YGE A;  4BQG A;  4P8O A;  2YE8 A;  3RLQ A;  2AKP A;  4YKT A;  4E00 A;  2ESA A;  3TZ4 A;  5M4E A;  1BGQ A;  4WUD A;  1I5A A;  3GIG A;  1UYE A;  3HEK A;  4XCJ A;  4GQT A;  3EHG A;  4XIP A;  1UYC A;  3B24 A;  3LPS A;  4HXZ A;  3R91 A;  3VHC A;  3G7E A;  2XHR A;  4O09 A;  3ZCC A;  1Z5C A;  2YJX A;  3HHU A;  2BRE A;  2CH4 A;  3OWD A;  1U0Z A;  2P67 A;  2IOR A;  1EI1 A;  2BU8 A;  4JYC A;  5IDJ A;  4JAS A;  1UYH A;  3C11 A;  1YSZ A;  2XDL A;  4MPE A;  3RLR A;  1I5C A;  2BTZ A;  1UY8 A;  5L3J A;  3R4M A;  3INX A;  5J6A A;  2XHX A;  4R1F A;  4R3M A;  5M4K A;  4MP2 A;  2BZ5 A;  4B7P A;  4BXI A;  4CE3 A;  1B63 A;  3INW A;  3K60 A;  3K99 A;  1PVG A;  2LFS A;  3A0Y A;  2E0A A;  3TZ5 A;  2WI2 A;  1Z59 A;  4LWH A;  1BKN A;  3PEJ A;  4XTJ A;  4ASB A;  2YEA A;  2CCU A;  1Z5A A;  2XJJ A;  4B6C A;  4XIQ A;  4FCQ A;  2YKB A;  1ZXM A;  2WI6 A;  1R62 A;  2ZBK B;  4LWF A;  4LC1 A;  2YE2 A;  3WQ9 A;  4O05 A;  4JAV A;  4GEE A;  2IOP A;  3QDD A;  3D36 A;  1YT2 A;  5FWK A;  5D6P A;  4PRV A;  4KSH A;  2FYP A;  2YE5 A;  4I5S A;  2QM7 A;  2QF6 A;  4L93 A;  3NMQ A;  1H7U A;  5B1N A;  4CE2 A;  3MD0 A;  4CWR A;  3R92 A;  2BU6 A;  1YC4 A;  2WI1 A;  2BU5 A;  4V26 A;  1QZR A;  2H55 A;  3RLP A;  1MX0 A;  3GIF A;  4CWF A;  3RKZ A;  4FCP A;  4CWP A;  2YKC A;  2XX5 A;  4O04 A;  5CTX A;  4URL A;  2QG0 A;  3Q5J A;  4MTX A;  3OPD A;  2WWW A;  4XKK A;  4ASG A;  3T1K A;  4YKW A;  4HYM A;  3ZXO A;  3NXS A;  4YKU A;  3O2F A;  1US7 A;  4LP0 A;  3U2K A;  4CE1 A;  4XIR A;  2YEG A;  2YEC A;  2Q8I A;  3U2D A;  1I59 A;  3CRK A;  4URN A;  2CCS A;  2XDU A;  3HZ1 A;  2XDK A;  4NH9 A;  5D7C A;  5FNC A;  1KIJ A;  4XDM A;  2YE3 A;  4FMT A;  4HZ5 A;  2HKJ A;  3A0X A;  2YKJ A;  1B62 A;  4KSG A;  3C0E A;  3B25 A;  3GIG B;  3A0W A;  2K5B A;  4Q20 A;  1YT1 A;  4AS9 A;  2FWY A;  1UYI A;  4AWP A;  2BU2 A;  2IWX A;  2VCJ A;  2C2A A;  4CWT A;  1NHI A;  4XD8 A;  3T0H A;  1QY8 A;  3TZ2 A;  2YEJ A;  4LWG A;  1YC3 A;  4MT8 A;  4K4O A;  2YKE A;  1TC0 A;  2BYI A;  2XDX A;  4FCR A;  1IXM A;  4HXW A;  4L8Z A;  3R4N A;  1UY7 A;  2YI0 A;  4DZY A;  4MPC A;  1I5D A;  1GKX A;  1S16 A;  4CWS A;  4U7N A;  3O6O A;  1UYM A;  3HZ5 A;  4CWO A;  1AM1 A;  2YKI A;  1U2O A;  3Q5K A;  3D2R A;  1AJ6 A;  1YET A;  3VAD A;  3CRL A;  2EXL A;  1UYK A;  2IOQ A;  3OW6 A;  4PU9 A;  2XJX A;  3FT8 A;  4EMV A;  4H85 A;  1I5B A;  1S14 A;  1UYD A;  2YEE A;  4HYP A;  3CGY A;  5CTY A;  4URM A;  3DGE A;  1QYE A;  2YGA A;  5F3K A;  4I3H A;  3T0Z A;  4WUB A;  4CWQ A;  4EGI A;  5IN9 A;  3TK1 A;  2XX4 A;  4U7O A;  2YEB A;  3ZM7 A;  5GGZ A;  4XKO A;  2YED A;  1Y8O A;  4MBC A;  4EM7 A;  4LWE A;  4MB9 A;  2ZDY A;  3QTF A;  3B27 A;  3OMU A;  4QPJ A;  1UYG A;  5FND A;  1Y4U A;  4ASA A;  2BT0 A;  2YI6 A;  4AWO A;  1TID A;  2XAB A;  4YKY A;  4XKA A;  4LPB A;  4PRX A;  4KQV A;  2XCM A;  1AH6 A;  3ZXQ A;  2YE6 A;  4JYB A;  1THN A;  1KZN A;  2JKI A;  2XJG A;  4BIU A;  3TUH A;  3IED A;  4BAE A;  1TC6 A;  2Q8H A;  3A0R A;  1B3Q A;  1ID0 A;  1L0O A;  3D0B A;  3MNR P;  4QPK A;  3R4O A;  2YJW A;  2XHT A;  3G75 A;  5J71 A;  5M4P A;  4HY6 A;  3VHD A;  3ZRX A;  4V25 A;  1UYL A;  5D7R A;  4WUC A;  3ZRW A;  4GGL A;  1GJV A;  2ZDX A;  4EFT A;  2VW5 A;  4E02 A;  4H7Q A;  3EHF A;  2PNR A;  3P32 A;  2FXS A;  4LWI A;  3HYY A;  2FWZ A;  4XIT A;  1BYQ A;  4AWQ A;  4U93 A;  2WI4 A;  2YE4 A;  3BM9 A;  4JAU A;  1JOY A;  2CCT A;  2VCI A;  2YEH A;  2O1V A;  3JZ3 A;  1MU5 A;  4L94 A;  4ZKI A;  4GT8 A;  4EGK A;  2IWS A;  1UY9 A;  4DUH A;  1Y4S A;  2IWU A;  4P7A A;  4GFN A;  5D6Q A;  4ASF A;  2BYH A;  2XX2 A;  4O07 A;  1EA6 A;  1YSR A;  2WI5 A;  3T2S A;  5CTW A;  2HG1 A;  3ZKB A;  3K98 A;  2YGF A;  5C93 A;  4GT1 A;  2WI7 A; 
#chains in the Genus database with same CATH topology
 1EN6 A;  4UB8 Z;  2VWJ A;  4LF7 O;  2BRC A;  1YER A;  1H7S A;  5CBG A;  2ATK C;  4DW1 A;  4DUY O;  1N34 B;  2YEI A;  2A79 B;  1KMI Z;  4MOT A;  2YI7 A;  1H2S B;  2F4V B;  1H2G A;  5JEN A;  2XD6 A;  3BA9 A;  3O0I A;  4I9W A;  2YK9 A;  4O0B A;  5LA6 A;  3L74 H;  3JYC A;  3Q4H B;  3SL2 A;  2ZR3 A;  3RYH A;  4LF4 B;  2O57 A;  2DJV A;  3ZHU A;  3ZRV A;  3A0H Z;  4QJF B;  5CTU A;  1ZSP A;  2WEP A;  1WAZ A;  1FXV A;  4LF9 B;  4ZOL A;  1WN7 A;  2XUM A;  2ZDI C;  1IUR A;  1YES A;  4K8Z A;  4K8X A;  4L90 A;  4YKR A;  2HG5 C;  2LGW A;  3IC7 A;  3B26 A;  5BOD A;  3Q5L A;  1WA8 B;  2YI8 A;  3JSL A;  5CF0 A;  5D5P A;  3G7B A;  2Q7G A;  5LMN B;  2QG2 A;  1JJ2 U;  2H8M A;  1AH8 A;  2PI4 A;  4MPN A;  1SZX A;  4JI7 O;  2Q8G A;  5M4M A;  1GN6 A;  2QA4 V;  4NH8 A;  4DRX B;  1PP9 H;  3BRC A;  4WBN A;  3LUT B;  2QFO A;  2QWR B;  1VQ4 V;  4YKQ A;  4FM1 A;  1M56 C;  2HP8 A;  4AQY B;  3T10 A;  2CGF A;  1YCI A;  5M4H A;  2YEV B;  3OTO O;  1YT0 A;  4L8J A;  4LWS B;  5LP6 B;  3PEH A;  3VQY A;  2H3O A;  1Y8P A;  3SJB C;  2NNU A;  2VWK A;  5IYC O;  4JF3 A;  3T4Z A;  3D8C A;  4KTN A;  1U96 A;  1H2M A;  1SQG A;  1BT8 A;  1PNL A;  3CRA A;  3P3N A;  4JI1 O;  4WFH A;  4BWA A;  2WER A;  3CC2 V;  4XBF A;  2W0F C;  1P49 A;  2WLN A;  1O9H A;  2ADQ B;  3M7M X;  1QLE C;  1A4H A;  4X1K A;  1UYF A;  5IYZ A;  3ASN B;  1GMG A;  3T2M A;  1W59 A;  3FD9 A;  3JAW B;  3AG1 C;  1NVP B;  5FNF A;  4BQJ A;  5EYP B;  4BQG A;  1EBO A;  4RWU A;  3OAA G;  2YE8 A;  3RYC A;  2W6I G;  4YKT A;  3WB2 A;  3JD0 A;  3TZ4 A;  1IXB A;  4N21 A;  1BGQ A;  3H1L H;  1UYE A;  1Q6H A;  3RWR D;  2ZE8 A;  1AB3 A;  2F93 B;  1M90 W;  3B24 A;  2E76 B;  3O9O A;  3VHC A;  4DR7 B;  1WJZ A;  4DUZ O;  4D7S A;  3ZCC A;  3ZHS A;  2W6J G;  3ETD A;  1P4R A;  2IOR A;  3RYI B;  1EI1 A;  1YJW V;  2PF4 E;  4WFA V;  2HLD G;  4R7C A;  4FFB A;  3OEE G;  5L3E A;  3INX A;  1AI5 A;  5IJ9 A;  3AG4 B;  5J6A A;  2Q68 A;  3HKE A;  5M4K A;  5EC1 C;  4LF8 B;  4CE3 A;  2BZ5 A;  1WNS A;  1FKA O;  4OPH A;  3E83 A;  3ZHR A;  3K60 A;  1R3K C;  1TVK A;  1YDX A;  3AG1 B;  5J2U B;  2JGD B;  4B3T B;  2DE0 X;  1Q8I A;  2Q4P A;  2ZE5 A;  1VF6 C;  2IM9 A;  1IVS A;  2GV9 A;  1Z5A A;  2OCC B;  5BMV A;  4B6C A;  4O2B A;  1SQF A;  4DUY B;  1ZXM A;  4JTC B;  2HVJ C;  1ZLZ A;  5KUK A;  5EZY A;  1S72 V;  4OX9 B;  1YHQ V;  3G67 A;  1GH6 A;  5KMG A;  2YE2 A;  3WQ9 A;  4O05 A;  4JAV A;  1BQZ A;  2P22 C;  3D36 A;  1DF5 A;  5CA1 B;  3OM3 B;  2E5L O;  4X1Y B;  4KSH A;  2Q8V A;  2AXT Z;  2XAH A;  4J7J A;  2Q6A A;  2QM7 A;  3H9V A;  3CRQ A;  4L93 A;  1VQM V;  3FAV A;  1IX9 A;  5C8Y A;  2EIL C;  1GN2 A;  1DK1 A;  2UXD B;  3L9D A;  1BL8 A;  1KD1 W;  3OR7 C;  2UXC B;  3JAM N;  1YTF B;  3B77 A;  4UCR A;  4X8A A;  3K79 A;  1MX0 A;  3GIF A;  3OGC C;  3RKZ A;  4CWF A;  2JVD A;  1XNQ B;  4O04 A;  5CTX A;  5LL6 Y;  3CCJ V;  1FXK A;  4DR6 O;  4IHJ A;  4J42 A;  4XKK A;  4H13 B;  1YEW A;  3B8M A;  3SPH A;  4WFB V;  1ENV A;  3NXS A;  5GTI Z;  1S76 D;  4WFG A;  1R3J C;  4JTA B;  2IJJ A;  1US7 A;  3U2K A;  4XIR A;  2W0X A;  1XDC A;  4NR1 A;  3K5L A;  4JI7 B;  1I59 A;  5H9C A;  1LR1 A;  2EIJ B;  2YUA A;  4J10 A;  4IYH A;  4X62 O;  4TUY A;  2YXH A;  4GX0 A;  2ZM6 O;  4NH9 A;  5D7C A;  3UKM A;  5FNC A;  1KIJ A;  1IBK O;  1SZT A;  5KHJ A;  4FMT A;  4LF6 B;  4RO2 A;  2KSD A;  4O2A A;  1V54 B;  2WA3 A;  2R9I A;  2JRI A;  3OTO B;  1LUV A;  3O65 A;  4GKK O;  2K5B A;  4O4H B;  4H37 A;  4TQD A;  4J80 A;  3ZMS A;  1YT1 A;  2WLK A;  3OMA B;  2Z5U A;  4RQE A;  2FWY A;  1EZJ A;  3WFV A;  1UYI A;  1FFX A;  4XD8 A;  2Q5Z A;  4N23 A;  2V1D A;  3TZ2 A;  3GWO A;  4LWG A;  4Z1V A;  3X2Q B;  3JAL B;  3ZHT A;  1SET A;  1KB9 F;  1QCE A;  3QO8 A;  1FPO A;  1TC0 A;  3CCU V;  2XDX A;  4YY3 O;  2WLM A;  1YSC A;  2K1E A;  3JAT A;  1AR4 A;  4UFZ A;  1N0J A;  2CH7 A;  4DZY A;  3ABM C;  1GO3 F;  1S16 A;  4ICG A;  1F4N A;  5B1B C;  2DWD C;  2QE7 G;  4TV8 A;  4NXN O;  3E8G A;  1UYM A;  5EBM C;  3CXC U;  3K5M A;  3STL C;  4DR1 B;  1AJ6 A;  3D2R A;  1VQ6 V;  1CEZ A;  1VEW A;  1WP7 A;  2WLJ A;  1QBZ A;  1N0N A;  3D3I A;  3OW6 A;  4DV0 B;  2JDI G;  4EMV A;  1I5B A;  1RM1 C;  1S14 A;  2OIE A;  4DR2 O;  1US6 A;  2XTA A;  2YEE A;  5ITZ A;  3CGY A;  3AG2 C;  1QYE A;  2YGA A;  1Q7Y W;  4CWQ A;  3RT3 C;  5IJ0 B;  2XX4 A;  3JSN A;  1GN4 A;  2DMX A;  3E35 A;  2YED A;  3LSU A;  1G8M A;  4JI8 O;  1OJH A;  1HR0 O;  3G80 A;  3N2K A;  3CC7 V;  4YIO A;  5FND A;  1Y76 B;  1NTK H;  4PDR A;  3BPZ A;  4JI4 B;  5B1B B;  5CMU A;  2XAB A;  4YKY A;  4CC5 A;  1Q43 A;  1R1B A;  1M57 C;  1KUQ A;  2HHI A;  4GKJ O;  1NKD A;  1K33 A;  3G6E V;  2ARH A;  4CC6 A;  3KKY A;  2WAM A;  1OCO C;  1L0O A;  5JCO A;  1VQ8 V;  5J71 A;  4W4K A;  2GTA A;  5FNV B;  2FL4 A;  3CE2 A;  3J81 N;  4LFB B;  5JJE B;  1GM8 A;  3RN4 A;  2ZDX A;  4H7Q A;  3EHF A;  4GUN A;  3HB3 B;  2FXS A;  1QLN A;  1LUW A;  2DWE C;  2FWZ A;  4XIT A;  3CCE V;  1ZL8 B;  2A3Q A;  3W7X A;  2EBO A;  5JQG B;  4UCU A;  2XAS A;  3EHB B;  4O4J B;  3BM9 A;  1FD9 A;  2Y48 A;  4UV9 A;  1MU5 A;  1T5E A;  2XAG A;  4EGK A;  4GT8 A;  3ZBH A;  2BTQ B;  3UM7 A;  1UY9 A;  1TA8 A;  1QVF U;  2OCH A;  4GFN A;  2OTL V;  5D6Q A;  2BOB C;  4D7T A;  1IBM O;  2YC0 A;  4DV3 B;  4XDK A;  1YSR A;  2BYH A;  3QVN A;  3DXR B;  3ZKB A;  5JWP A;  5C93 A;  2QGN A;  2HHH B;  3CYO A;  4MTF A;  1OCO B;  4DR4 B;  4NH7 A;  4NTY A;  2IH3 C;  4K0K B;  3ZKD A;  3HKD B;  5KUM A;  4RUF A;  3AK3 A;  2OWO A;  3OWB A;  4W7T A;  4IIJ B;  1GTO A;  1THZ A;  3BMY A;  4LFC O;  2MK3 A;  3B40 A;  2M7W A;  2EIM B;  2YXY A;  4BAY A;  4FLU A;  1X59 A;  5HFM A;  4L91 A;  1H38 A;  4X64 O;  4HBN A;  1EN5 A;  4FLT A;  3QNE A;  1TBW A;  3L75 H;  3BCC H;  4EFU A;  3WU2 Z;  2ZE6 A;  1CP9 A;  1XHZ A;  4GKK B;  1G1X B;  1XL6 A;  4UVA A;  4X9L A;  4LNU A;  1F51 A;  4F6R B;  5CBF A;  2ZKJ A;  2N04 A;  3HYZ A;  2ZNI A;  3SJA C;  4GZR B;  1YIJ V;  2ADP A;  5F5R A;  1BGY H;  4FLW A;  5J2T A;  5KX5 B;  1ZAU A;  4LFA O;  2VS0 A;  4IL6 Z;  1X4T A;  3EKO A;  4RUE A;  2GUZ A;  2Y69 C;  2E74 B;  5B3S B;  1OCC C;  4FVM A;  2HKO A;  2CTQ A;  4DW0 A;  2JK5 C;  2FML A;  4B3R O;  3GWK C;  3FT5 A;  1M5I A;  3UO3 A;  4X1I A;  2F1M A;  1Z2G A;  3ABL C;  1D2D A;  4I4T A;  1Q5O A;  1S5H C;  3RVZ A;  3ZJZ A;  1VQ7 V;  4FK5 C;  1P7G A;  3K9S A;  3ZN0 A;  4YKZ A;  1XNR O;  2BCC H;  1S5L Z;  4G27 B;  3H80 A;  3UO2 A;  1SRY A;  3CGZ A;  2HFE C;  5IT9 N;  3JAR A;  1I58 A;  5CA0 B;  3VBB A;  3JD2 A;  4I50 A;  3JAS A;  1JM6 A;  3LNU A;  3SPG A;  1NR1 A;  1AJN A;  1GM9 A;  2CG9 A;  1AR5 A;  2F43 G;  3IC9 A;  2QJ1 A;  1HNX B;  4RAI A;  4I55 A;  4XC0 A;  2XK2 A;  4U3J A;  5H5N A;  2Q9L A;  3ZRW B;  3CD6 V;  2D2C B;  4XE2 A;  1UY6 A;  2UWD A;  5D7D A;  2Y69 B;  3ABK C;  2KKW A;  3R4P A;  1OCC B;  4CH6 A;  2Q2E B;  4PA6 A;  1Y8N A;  1HWY A;  2V4D A;  2ZNJ A;  3CX5 F;  1FYJ A;  4MVQ A;  3BAA A;  3QTC A;  4FPP A;  3ABL B;  2XDS A;  4DV7 O;  3ASO B;  2CTP A;  4BIZ A;  1BXD A;  4TSF G;  1NHJ A;  4TT3 G;  1W0J G;  4ZI7 A;  5J9P C;  1AIL A;  3ETG A;  3RVY A;  2VQF B;  4UCS A;  1IBL B;  3RLQ A;  3K59 A;  4E00 A;  4PJ0 Z;  5KHG A;  2XND G;  1MOF A;  1W2B U;  3C3S A;  4HZ3 A;  3CWB H;  3K57 A;  3GIG A;  3C3T A;  4XCJ A;  1VQ9 V;  4GQT A;  1K4C C;  1NBM G;  1UYC A;  3QG5 A;  1OV9 A;  3R91 A;  3G7E A;  1NI8 A;  4ZBM A;  2YJX A;  4FLY A;  3HHU A;  2BRE A;  1GK9 A;  2Y4T A;  3ABK B;  1J5E O;  2BU8 A;  4JYC A;  2AHY A;  5IDJ A;  4PDV A;  2IBZ H;  2RNB A;  5LA6 B;  1UYH A;  2XHB A;  1I5C A;  4OXS A;  2NLJ C;  1UY8 A;  3RYH B;  2PTM A;  3R4M A;  4JYA O;  3HKB A;  3FB8 C;  4J7Z A;  4R1F A;  5KHK A;  1FJG O;  4MP2 A;  4B7P A;  4BR6 A;  2E75 B;  3UT5 A;  1M1K W;  1NH2 B;  4WF9 V;  1PVG A;  5IY5 C;  3TET A;  4KHP B;  4ZOL B;  1XMO O;  2LFS A;  3SPC A;  3T4D A;  2JJ2 G;  3SYA A;  1K34 A;  4DXW A;  1K3E A;  2WI2 A;  4LWH A;  2GDS A;  2H8P C;  4DV4 O;  4XTJ A;  2YEA A;  4ASB A;  3P3P A;  1SA0 A;  4AHC A;  4GX2 A;  1DGS A;  2WPD G;  4W4L A;  4XIQ A;  4FCQ A;  1XMQ O;  3LSQ A;  2WI6 A;  4PHZ A;  1NJI W;  5IWA B;  1SES A;  1QR9 A;  1N8R W;  2IOP A;  1GAX A;  2RN9 A;  5F2V O;  2YID A;  4WBN B;  1MSW D;  2ITD C;  1IZ3 A;  1SQP H;  3RFR A;  4IT5 A;  1NZ6 A;  2WLH A;  4I5S A;  2QF6 A;  1H7U A;  4FLX A;  5BY1 A;  5JH7 A;  3OW2 U;  1H2K A;  4CWR A;  2BU6 A;  1XHX A;  1Q90 D;  3DTU B;  2BU5 A;  3BEH A;  4QIW F;  1Z5W A;  5LHG A;  3CCR V;  3RLP A;  5IY5 B;  3D3Q A;  3PN1 A;  1B06 A;  4LFA B;  4FCP A;  4CWP A;  1F23 A;  2BSK A;  4JZ2 A;  2XX5 A;  3JAK A;  4MS2 A;  3U10 A;  1RSO A;  2EZO A;  4URL A;  4X65 O;  2QG0 A;  4MTX A;  1VIB A;  3OPD A;  4F6E A;  2ZE7 A;  2IW5 A;  4L87 A;  2QR4 A;  4B3R B;  1KYO F;  3FB5 C;  5EBW C;  1N36 O;  1BSM A;  3O2F A;  3VQX A;  4LP0 A;  1GRJ A;  3JCZ A;  2YEG A;  3B2E E;  3SYQ A;  3U2D A;  4X1K B;  1WB7 A;  3OD4 A;  5IYZ B;  2K9P A;  4DR3 O;  1XUQ A;  2BTO A;  3T1H O;  2N05 A;  5DN6 G;  3L71 H;  4CS2 A;  4FFK A;  5CBH A;  3CHX A;  3RYC B;  3EFF K;  1M56 B;  1Z5V A;  1JQ0 A;  5KHI A;  5GTH Z;  2YKJ A;  3CP1 A;  1B62 A;  3C0E A;  1TGO A;  4DV6 B;  2JS5 A;  4FZ0 A;  4BIO A;  3A0W A;  1Y74 A;  3S3X A;  3FKS G;  4PA7 A;  4X89 A;  4CH4 A;  4XDJ A;  3AG7 A;  1K92 A;  2BU2 A;  2IWX A;  3T0H A;  4WFE A;  1D5N A;  3D36 C;  1QY8 A;  1KEC A;  4E2L A;  1HDJ A;  2FKX A;  4YJ2 A;  2DN9 A;  1Y6X A;  5BZB A;  3U0Z A;  4FFB B;  1K7D A;  3F5T A;  4YJ3 A;  2JEU A;  1YIT V;  5EK0 A;  4K4O A;  2YKE A;  3N2G A;  3HKE B;  3BY6 A;  2BYI A;  2A06 H;  1TAE A;  1UPG A;  4C7U A;  3A2F A;  4L8Z A;  1QLE B;  3AG3 C;  4R6Z A;  1UY7 A;  3TXS A;  4G28 B;  1GKX A;  4FZ1 A;  5FL7 G;  1MSD A;  4LR3 A;  4X88 A;  1TVK B;  4CWS A;  4U7N A;  2DOS A;  3O6O A;  3HZ5 A;  1FXK C;  2DYR C;  1I7F A;  2PYJ A;  3AEI A;  4NXM O;  3VAD A;  2EXL A;  1UYK A;  2IOQ A;  4LP8 A;  5BMV B;  4LF7 B;  4JPR A;  1OHH G;  4O2B B;  5LXT A;  2PI5 A;  5EZY B;  1Q81 W;  1VQK V;  4HYP A;  1SS3 A;  4NYK A;  5KMG B;  5CTY A;  3KZI Z;  4HNA A;  4K35 A;  2C1G A;  2QM4 A;  5D5Q A;  2JIZ G;  5IN9 A;  3TK1 A;  5B1A C;  2YEB A;  2B1I A;  5GGZ A;  1OCZ C;  1Y8O A;  4JYA B;  3FAV B;  5C8Y B;  4GX5 A;  4MB9 A;  1XIL A;  1MZF A;  4EFB A;  4X66 O;  2ZDY A;  3B27 A;  3OMU A;  3U11 A;  3CRC A;  2F66 C;  2ZD9 A;  2UXB O;  1I5X A;  1TID A;  1S0V A;  3CSX A;  2P06 A;  1CPY A;  3WB1 A;  4LPB A;  2P7T C;  3OE7 G;  1SQQ H;  5L3G A;  1FXK B;  4PRX A;  2XCM A;  2YE6 A;  3PJS K;  4IHJ B;  1I5Y A;  4JYB A;  2Y0I A;  1THN A;  1TUB A;  1SF9 A;  2QKS A;  4BIU A;  4TV9 A;  1TC6 A;  2Q8H A;  3D0B A;  3L73 H;  4O4I A;  3MNR P;  3E8F A;  3R4O A;  2XAJ A;  3G75 A;  4EB6 A;  5M4P A;  3VHD A;  1G6U A;  4V25 A;  1DLB A;  4WUC A;  4TUY B;  4EFT A;  4E02 A;  4QGP A;  4HAM A;  4XDL A;  5LOV B;  4JI5 O;  4LWI A;  3HYY A;  1OCZ B;  1L1F A;  1MAB G;  1K9M W;  4AWQ A;  4O2A B;  2WI4 A;  3MDS A;  1YZB A;  2EIL B;  2P4K A;  3B8N A;  5KAF Z;  4DV5 O;  3SDL A;  4DV1 O;  4JAU A;  2CCT A;  2P5O A;  2O1V A;  4Q6G A;  3JZ3 A;  2IWS A;  3RW0 A;  1FFX B;  3J7A U;  4ASF A;  5BR8 O;  2XX2 A;  2WSS G;  1UFI A;  1ZTE A;  2OYQ A;  2HG1 A;  1PKX A;  4F4L A;  3MHS C;  4JI1 B;  2WI7 A;  5LHI A;  1YJ9 V;  4PA4 A;  2F23 A;  1Q6U A;  4O4L A;  4E4E A;  1NQT A;  3CWV A;  3JAT B;  3ZMT A;  2CH7 B;  2FYU H;  2R72 A;  4DR3 B;  1H8E G;  4JV5 O;  2YE9 A;  3T1H B;  4E01 A;  4TV8 B;  1ZW9 A;  4WFF A;  1AI7 A;  3WB0 A;  2F95 B;  3A0Z A;  4GCZ A;  1TH8 A;  2YIC A;  2WI3 A;  4EKW A;  1DF4 A;  4JI6 O;  3B09 A;  5CA3 A;  2VWC A;  5JCO C;  1VQP V;  2LJ2 A;  3I55 V;  1O9G A;  1WLE A;  1YVW A;  3OMN B;  5ITZ B;  4I0X A;  4TOI A;  3ZIA G;  4KP4 A;  5KLV H;  4KFG A;  1ZWI C;  2RCV A;  4B08 A;  2O1W A;  4DUZ B;  3ZX6 A;  4CBC A;  1N32 O;  3FV5 A;  1MA1 A;  1K97 A;  1PV0 A;  1JR9 A;  1SQV H;  3RYF A;  4CH3 A;  2EIN C;  5CPH A;  4UVC A;  3STZ C;  2IH1 C;  3SYP A;  2YS8 A;  5JJN B;  1JFF A;  3N2K B;  4DV2 O;  4NTW A;  4JI2 O;  4HZ0 A;  2E3C A;  3H1H H;  4DK1 A;  2YI5 A;  4UXN A;  5CB4 A;  3K97 A;  3ABM B;  4JI3 O;  5EBL C;  4WCE V;  3ZRS A;  3G71 V;  5E79 Z;  4PD4 F;  1N4C A;  2GQP A;  4R3A A;  3IJ4 A;  3SR2 C;  2ETN A;  5M4N A;  4NXM B;  3CCM V;  2WEQ A;  4JAA A;  2FTK A;  1S3J A;  1I94 O;  3ETE A;  1H2N A;  1RM1 B;  3K58 A;  2X0L A;  4YHH O;  4B3S O;  1Y76 A;  3ZHQ A;  2X6B A;  3AG2 B;  1KKC A;  2Z3Y A;  2B1G A;  1YS3 A;  1Z5B A;  3ABU A;  1R3I C;  4UV8 A;  4JTD B;  1VMG A;  4H44 B;  1VQL V;  2CK3 G;  1GKZ A;  2E5L B;  5CN0 A;  1HNW O;  1AI6 A;  2YSU B;  3L72 H;  1PL4 A;  2EIN B;  1ZXN A;  2YK2 A;  1R3L C;  2RDC A;  3U67 A;  1DTO A;  2BU7 A;  5IDM A;  3HKC A;  4G2K A;  4PL9 A;  1S77 D;  2ZIN A;  2F4V O;  2Q73 A;  2KQX A;  1BMF G;  1M57 B;  3F7Y C;  4EEH A;  3K04 A;  3EHJ A;  3EKR A;  3THO A;  4DR6 B;  3B28 A;  2HCH A;  2YGE A;  1NT2 B;  1ORQ C;  2B5U A;  2YDE A;  4P8O A;  1AJP A;  1K5Q A;  1MNG A;  2AKP A;  5LGT A;  4LF4 O;  5M4E A;  1K73 W;  1RPR A;  1U97 A;  3HEK A;  3EHG A;  1YF2 A;  4P9O A;  3LPS A;  4HXZ A;  3K3W A;  3E8B A;  3APQ A;  3ZMU A;  4X62 B;  4LF9 O;  2WLL A;  2ZM6 B;  2P67 A;  2DYS C;  2L35 A;  4EFE A;  1H8H G;  3E22 A;  1IBK B;  4MPE A;  2EJ7 A;  3SJC C;  2OTJ V;  3RLR A;  2BTZ A;  2QKA A;  5H2F Z;  4IYI A;  1WP8 A;  4LNU B;  5JVD A;  1QQC A;  1CXZ B;  3G4S V;  4BXI A;  1Y4M A;  5LMN O;  1B63 A;  3HPL C;  3INW A;  3K99 A;  4QE7 A;  4PA9 A;  5J2T B;  2PGG A;  3CC4 V;  2WA4 A;  3A0Y A;  1Y66 A;  3SJQ C;  3CME V;  2GUZ B;  4LH6 A;  2E0A A;  2YIA A;  3TZ5 A;  3K9A A;  4ZHQ A;  3TGU H;  1Z59 A;  3E89 A;  1MMM A;  1BKN A;  3WG7 C;  3ML0 A;  4AQY O;  4LCU C;  4KXR A;  4X1I B;  3VOU A;  4YY3 B;  4I4T B;  4JV5 B;  3OUF A;  1R62 A;  2ZBK B;  1WB8 A;  4QNH B;  5DED A;  2ZIM A;  4GEE A;  3QDD A;  1M93 A;  4NXN B;  3APO A;  2DYS B;  1BZK A;  3H1K H;  1YT2 A;  3JAR B;  3DC6 A;  4PRV A;  2FYP A;  4I50 B;  2YE5 A;  4NTX A;  3JAS B;  3TJT A;  2B9Z A;  1QU7 A;  2JGU A;  2KG7 A;  4CE2 A;  5DM6 V;  3R92 A;  2WI1 A;  2XOK G;  4DR2 B;  2Q0O C;  4V26 A;  4I55 B;  1FAF A;  5GON A;  4MVR A;  4U3J B;  2QWP B;  5L3B A;  3OUS A;  1N32 B;  2IJH A;  3Q5J A;  3ICX A;  4FLZ A;  3K5N A;  2WWW A;  5LYJ A;  3WG7 B;  2X7R B;  4JI8 B;  3T1K A;  1HR0 B;  4FIP C;  4I7Z B;  4HYM A;  2N74 A;  4KFM A;  1XRE A;  2A0L A;  5EIB D;  4AIL C;  2CTW A;  4X20 A;  3ZMV A;  4FM2 A;  4EEQ A;  2CCS A;  4DR7 O;  4ZI7 B;  2WLI A;  5A2Q N;  4CS4 A;  4GKJ B;  2XDU A;  2XDK A;  2CGN A;  4Z2W A;  2HR3 A;  4HZ5 A;  2AZ0 A;  5IYB O;  4KSG A;  1JA8 A;  1AI4 A;  5H6R A;  3B25 A;  3GIG B;  3LNN A;  4B3S B;  2EZP A;  3T1Y O;  3KCY A;  2Q7H A;  3QO5 A;  2AGA A;  1AP5 A;  2YI9 A;  3A8T A;  4B3M O;  5JJJ B;  4AS9 A;  2RJZ A;  1NVP D;  2QTO A;  2VCJ A;  2C2A A;  1NHI A;  3AK2 A;  3LDD A;  3BHP A;  3ABT A;  1VQN V;  2GSM B;  3FB7 C;  3CJH A;  3HKB B;  2IJI A;  3CS5 A;  1XQ8 A;  4OPA A;  4NVP A;  1QNM A;  1IXM A;  4HXW A;  1PM9 A;  1SQX H;  1K8A W;  3CXH F;  3UT5 B;  3GVM A;  2Q0A A;  5LHH A;  3R4N A;  4H33 A;  5EC2 C;  4OX9 O;  4MPC A;  4HYO A;  1IBM B;  3R66 A;  2NR5 A;  2YKI A;  4LH7 A;  5B5E Z;  1YET A;  3SYC A;  3SPI A;  1SA0 B;  3CRL A;  4GYC B;  3Q4H A;  2X6A A;  4PU9 A;  2XJX A;  2UXD O;  1UYD A;  1B04 A;  5LP6 C;  5EIB C;  4LFC B;  2UXC O;  4P9P A;  1GM7 A;  4J7K A;  3DGE A;  3ZS8 C;  2R9A A;  1GKF A;  5F3K A;  4I3H A;  3T0Z A;  1XNQ O;  1WPX A;  3EXA A;  4UVB A;  1QHT A;  1AVM A;  4U7O A;  4H0L B;  4X64 B;  4MTG A;  4E72 A;  4EM7 A;  4B7E A;  5JH7 B;  4LWE A;  1URF A;  2GTS A;  1WA8 A;  1UYG A;  3JD3 A;  4ASA A;  3BAB A;  4R8C A;  1Q3E A;  5KA6 A;  1V55 C;  2BSK B;  3ASN C;  4XKA A;  5L3C A;  3JAK B;  1RSO B;  4PI0 A;  3B4S A;  4YXW G;  4KQV A;  4DRX A;  4ABM A;  1GN3 A;  3QF7 A;  5DEC A;  1KZN A;  2JKI A;  2XJG A;  1YXB A;  1JMK C;  3TUH A;  3IED A;  2HEP A;  4BAE A;  4LF6 O;  3A0R A;  1ID0 A;  3W7S A;  1MZE A;  4MVO A;  4QPK A;  2YIB D;  1SER A;  1YTF D;  2PYL A;  2XHT A;  3FYI B;  1RFY A;  2X6C A;  2YEV A;  4LWS A;  5LP6 A;  4BW9 A;  2FB5 A;  1UYL A;  5D7R A;  1XNR B;  2GHY A;  2JEX A;  2CDY A;  3IGA C;  4GGL A;  2VW5 A;  2ZDI A;  3IFX A;  2P6J A;  3OT7 A;  3CCS V;  2PNR A;  1VF5 B;  3AK1 A;  4ZIB A;  1LNQ A;  2CAZ C;  4NKG B;  4U93 A;  1XI1 A;  2UU9 O;  1PNM A;  3AG4 C;  1JOY A;  2VCI A;  2Q67 A;  1ZUQ A;  1Y74 B;  4L94 A;  4ZKI A;  4DUH A;  3IAY A;  1V55 B;  4P7A A;  2QDO A;  3ZMZ A;  5FLX N;  1EA6 A;  3M99 B;  4YJ2 B;  2CUG A;  3JAW A;  2YXL A;  2UUC O;  1FXH A;  4DR1 O;  3K98 A;  2YGF A;  1EM1 A;  5EYP A;  2P90 A;  3R65 A;  2QWQ B;  4YJ3 B;  3N2G B;  5FPR A;  1Q82 W;  4MP7 A;  1B6Q A;  5IJ9 B;  4DV0 O;  1YC1 A;  2OCC C;  1N33 O;  4DV7 B;  3H1J H;  5LGN A;  2BE3 A;  1NR7 A;  1HP8 A;  4TWK A;  4URO A;  1L0L H;  4JQL A;  4U3F H;  1Y67 A;  1V9P A;  3KCX A;  3NR7 A;  3RBZ A;  1R6K A;  3BFR A;  3E8H A;  5KHH A;  3RYI A;  4MSW C;  2O1U A;  1VAR A;  2LO1 A;  4MVZ A;  1AJQ A;  4FJC C;  1OSF A;  3GIE A;  2ODM A;  1XOU A;  5LXT B;  3EVK A;  3T1Y B;  4H81 A;  2R9R B;  2JJC A;  1OZ0 A;  4B3M B;  3VHA A;  3H4L A;  4JI4 O;  2AZ2 A;  4HNA B;  1PNK A;  2BSM A;  3A0T A;  3I56 V;  1J5E B;  1SKV A;  5L3D A;  1AP6 A;  5J2U A;  1EZV H;  2JGD A;  5LMU O;  5B1O A;  3OEH G;  1E1R G;  1P7B A;  2QWO B;  3W7T A;  4X9Q A;  1M9N A;  3TTZ A;  2JJ1 G;  3S5T A;  4NB5 A;  3TZ0 A;  1BQ0 A;  4HY1 A;  3LDC A;  4JYY A;  2LGQ A;  1JX9 A;  4BW5 A;  1FJG B;  1NHH A;  1HNZ O;  2QTS A;  3AG3 B;  3TCU A;  1RPO A;  1BCC H;  2ITC C;  3WHA A;  4LFB O;  1G4Y B;  4KL1 A;  2EIJ C;  3G6B A;  1XMO B;  1H2L A;  1XEQ A;  2DYR B;  1NTM H;  1VQ5 V;  2XT9 A;  2YE7 A;  2A9H A;  2GFD A;  2LFR A;  1TUB B;  5CA1 A;  4XCL A;  4YKX A;  3LSS A;  4EGH A;  4X1Y A;  4TV9 B;  3CRM A;  4DV4 B;  1AMW A;  1TUE B;  4O4I B;  1COW G;  2ZIO A;  3UQ8 A;  3FX7 A;  1V54 C;  2Q8F A;  1TIL A;  1XMQ B;  4EB6 B;  2CE4 A;  1KU9 A;  2YIB A;  4CWN A;  4J11 A;  4RQF A;  1JVM A;  3CYG A;  4DV3 O;  1RP3 B;  5B1A B;  1ZX3 A;  5BXZ A;  3C90 A;  3T1C A;  4J41 A;  3X2Q C;  4J9Y B;  1VF6 A;  2HHH O;  1F7Y A;  4DR4 O;  1FFT B;  2ZT9 B;  4K0K O;  5BOC A;  2UXN A;  2C1I A;  1HW7 A;  2HJD A;  3CB2 A;  3CMA V;  2PUS A;  3I5D A;  4LF5 O;  4JGS A;  1ZWH A;  3EHH A;  2GBO A;  3ZHV A;  1R6T A;  5GW7 A;  2YEF A;  3KE6 A;  5IYD O;  4ZVI A;  4UCT A;  2JS3 A;  1BHA A;  1R6N A;  2QM8 A;  4X65 B;  4OGQ B;  5LOV A;  2ZXW C;  2CTR A;  2A7W A;  1KQS U;  2RQ6 A;  2QKC A;  4O4L B;  1N36 B;  2ESA A;  4WUD A;  2VQE O;  1I5A A;  5TIS Z;  5L3F A;  4XIP A;  4O4H A;  1A32 A;  2UUA O;  1JCH A;  3H01 A;  2XHR A;  4O09 A;  3JCU Z;  1Z5C A;  2CH4 A;  4MW3 A;  3OWD A;  1U0Z A;  4JAS A;  2IU3 A;  3FB6 C;  3C11 A;  1YSZ A;  2XDL A;  2UU9 B;  3K5O A;  2PY5 A;  5L3J A;  3JAL A;  3RGB A;  4LBE C;  3K03 A;  2RMK B;  4IGG A;  3F7V C;  2XHX A;  4I0X B;  4R3M A;  3MAQ A;  3ZN1 A;  5K1X A;  1YI2 V;  1YJN V;  3K08 A;  2L6L A;  2DQ0 A;  2Y4U A;  4UB6 Z;  2IJK A;  4TQF A;  2ZKO A;  1NU1 H;  1ROP A;  2UUC B;  3E86 A;  2ZXW B;  1PL0 A;  2VRZ A;  2UUB O;  1KKD A;  2DQ3 A;  3RYF B;  1VF7 A;  3PEJ A;  3OFN G;  4J9Z B;  4P30 A;  1JFF B;  2CCU A;  3S3W A;  4FLV A;  1N33 B;  2XJJ A;  3E2E A;  5B66 Z;  1FS0 G;  1HNX O;  2YKB A;  2QWN B;  1L0N H;  5CB4 B;  4D6T H;  4LWF A;  4LC1 A;  2P4V A;  2Z0A A;  3CCQ V;  3CCL V;  2G38 A;  2XAF A;  1PD3 A;  2R70 A;  5IE9 A;  1KP2 A;  3L70 H;  1OCR C;  5FWK A;  5D6P A;  2QSA A;  1EN4 A;  5IJ0 A;  2DW4 A;  3QO7 A;  4FM0 A;  4JZG A;  3NMQ A;  5FPO A;  4DR5 O;  2OIG A;  5B1N A;  4JI0 O;  3MD0 A;  1YC4 A;  3BA8 A;  1QZR A;  2H55 A;  1Q86 W;  3K06 A;  5KAI Z;  4DK0 A;  1BE3 H;  1VP7 A;  2D3O W;  1NTZ H;  4K3A A;  2YKC A;  2QEX V;  1KP3 A;  5LMU B;  1K4D C;  2VQF O;  4MVS A;  1MG1 A;  1E1Q G;  1IBL O;  4ASG A;  1K5S A;  4YKW A;  3ZXO A;  1I08 A;  4YKU A;  3CCV V;  4X66 B;  1HNZ B;  3W7U A;  4CE1 A;  3HKC B;  3CPW U;  2YEC A;  4A5U B;  2Q8I A;  2UXX A;  4UCO A;  3ETQ A;  2UXB B;  1N34 O;  3CRK A;  5FNV A;  4URN A;  4KUM A;  1QVG U;  3OGI B;  1OCR B;  2EIM C;  2OT5 A;  3HZ1 A;  4MVM A;  4ASU G;  4XDM A;  2YE3 A;  3H1I H;  2HKJ A;  3A0X A;  1ZL8 A;  3CEI A;  4B7K A;  5JQG A;  4MVU A;  1SQB H;  1J95 A;  2EJR A;  4O4J A;  3K0D A;  1F4M A;  4Q20 A;  4AI8 A;  4R50 A;  5HFL A;  1W0K G;  4DO2 A;  4CS3 A;  2Q7E A;  2BTQ A;  2WLL B;  4AWP A;  4UUJ C;  4KHP O;  4CWT A;  3A0B Z;  3DSQ A;  2EIK C;  4Z1M G;  1KC8 W;  3E22 B;  4JI5 B;  3VQV A;  3SGI A;  3DXR A;  2YEJ A;  4I9Q A;  1YC3 A;  3OMI B;  5B3S C;  4UCV A;  4MT8 A;  1P84 F;  1EFR G;  3MHH C;  4DV5 B;  5LGU A;  4DV1 B;  5JVD B;  3HKD A;  1IDS A;  2EUL A;  4FCR A;  2LW7 A;  1BS3 A;  4IIJ A;  4LF5 B;  2YI0 A;  5IWA O;  1I5D A;  2HVK C;  2H94 A;  5BR8 B;  4CWO A;  1AM1 A;  1AR1 B;  1U2O A;  1Q6I A;  4ZHQ B;  4CZZ A;  3Q5K A;  2PZS A;  1VQO V;  2NN4 A;  2LW1 A;  5H6Q A;  2VQE B;  3FT8 A;  4H85 A;  4PV1 B;  3TXQ A;  5KA5 A;  3F5W C;  3SPJ A;  1NH2 D;  1PPJ H;  1KBH A;  2EX3 A;  2UUA B;  1D5A A;  4F6R A;  3LNM B;  4GLX A;  2BOC C;  4PI2 A;  4URM A;  2EIK B;  2KB1 A;  4WUB A;  4EGI A;  3OR6 C;  5KX5 A;  2XAQ A;  1JPX A;  1R73 A;  3ZM7 A;  2ILM A;  4XKO A;  2V7Q G;  4PA3 A;  4JI6 B;  4MBC A;  2KG7 B;  5K1P A;  3QTF A;  2AW9 A;  3LDE A;  1WPB A;  3ASO C;  4QPJ A;  4MW8 A;  5GON B;  2IU0 A;  1Y4U A;  2BT0 A;  2HJF C;  4PDM A;  2YI6 A;  4PDL A;  4AWO A;  1UJW B;  3ZED A;  1ARO P;  5E1A C;  3ZXQ A;  3OTF A;  1AH6 A;  2UUB B;  1L8D A;  3CRR A;  1SC5 B;  1XL4 A;  3M8A A;  5LYJ B;  3FFQ A;  2LQT A;  2ZQM A;  2ZR2 A;  5CA0 A;  2AHZ A;  3W7W A;  4MTO A;  5LBQ A;  1B3Q A;  3SYO A;  2Q69 A;  4DV2 B;  4PEL A;  3J80 N;  4JI2 B;  1I0H A;  1JJO A;  3KG2 A;  4DV6 O;  2YJW A;  4GX1 A;  4YIP A;  5A9G A;  4X20 B;  4HY6 A;  4JI3 B;  3ZRX A;  2WLI B;  3ZRW A;  1GJV A;  1XBL A;  3FYE B;  3P30 A;  3LMM A;  2Y0P A;  4CH5 A;  1NS1 A;  3P32 A;  3BVO A;  3N27 A;  3HR0 A;  2ZCE A;  1BYQ A;  2M6Y A;  3JD4 A;  5AG2 A;  4DR5 B;  4JI0 B;  4P2Z A;  1I94 B;  4DYL A;  3DC5 A;  2YE4 A;  3UCS C;  4YHH B;  2YEH A;  1BHB A;  2CGO A;  4LF8 O;  1Y4S A;  1M4U A;  2IWU A;  4QE9 A;  2LP7 A;  1QR8 A;  3VQW A;  4O07 A;  2WI5 A;  3T2S A;  5CTW A;  1HNW B;  3K0G A;  1E79 G;  4B3T O;  2MW2 B;  3GB7 C;  1S5J A;  3CJH B;  3JD1 A;  4GT1 A; 
#chains in the Genus database with same CATH homology
 2BRC A;  1YER A;  1H7S A;  5CBG A;  2ATK C;  2YEI A;  2A79 B;  4MOT A;  2YI7 A;  1H2G A;  2XD6 A;  3O0I A;  4I9W A;  2YK9 A;  4O0B A;  3JYC A;  3SL2 A;  2ZR3 A;  3ZRV A;  4QJF B;  5CTU A;  2WEP A;  1FXV A;  2ZDI C;  1YES A;  4L90 A;  4YKR A;  2HG5 C;  3IC7 A;  3B26 A;  5BOD A;  3Q5L A;  5CF0 A;  3G7B A;  2QG2 A;  1JJ2 U;  2H8M A;  1AH8 A;  2PI4 A;  4MPN A;  2Q8G A;  5M4M A;  2QA4 V;  4NH8 A;  3LUT B;  2QFO A;  1VQ4 V;  4YKQ A;  1M56 C;  3T10 A;  2CGF A;  5M4H A;  2YEV B;  1YT0 A;  3PEH A;  1Y8P A;  2NNU A;  5IYC O;  4JF3 A;  3T4Z A;  4KTN A;  1PNL A;  4WFH A;  2WER A;  3CC2 V;  4XBF A;  2W0F C;  2WLN A;  1QLE C;  1A4H A;  1UYF A;  3ASN B;  1GMG A;  3T2M A;  3AG1 C;  1NVP B;  5FNF A;  4BQJ A;  4BQG A;  1EBO A;  3OAA G;  2YE8 A;  2W6I G;  4YKT A;  3JD0 A;  3TZ4 A;  4N21 A;  1BGQ A;  1UYE A;  1M90 W;  3B24 A;  3VHC A;  3ZCC A;  2W6J G;  3ETD A;  1P4R A;  2IOR A;  1EI1 A;  1YJW V;  4WFA V;  2HLD G;  4R7C A;  3OEE G;  5L3E A;  3INX A;  1AI5 A;  3AG4 B;  5J6A A;  2Q68 A;  5M4K A;  5EC1 C;  4CE3 A;  2BZ5 A;  3E83 A;  3K60 A;  1R3K C;  3AG1 B;  1Z5A A;  2OCC B;  4B6C A;  1ZXM A;  4JTC B;  2HVJ C;  5KUK A;  1S72 V;  1YHQ V;  2YE2 A;  3WQ9 A;  4O05 A;  4JAV A;  3D36 A;  1DF5 A;  3OM3 B;  4KSH A;  2XAH A;  2Q6A A;  2QM7 A;  4L93 A;  1VQM V;  2EIL C;  1BL8 A;  1KD1 W;  3OR7 C;  1YTF B;  3B77 A;  4X8A A;  3K79 A;  1MX0 A;  3GIF A;  3OGC C;  3RKZ A;  4CWF A;  4O04 A;  5CTX A;  3CCJ V;  1FXK A;  4XKK A;  3B8M A;  3SPH A;  4WFB V;  1ENV A;  3NXS A;  1S76 D;  4WFG A;  1R3J C;  4JTA B;  2IJJ A;  1US7 A;  3U2K A;  4XIR A;  1I59 A;  5H9C A;  2EIJ B;  4GX0 A;  4NH9 A;  5D7C A;  3UKM A;  5FNC A;  1KIJ A;  1SZT A;  4FMT A;  4RO2 A;  1V54 B;  2R9I A;  2K5B A;  4H37 A;  3ZMS A;  1YT1 A;  2WLK A;  3OMA B;  2Z5U A;  4RQE A;  2FWY A;  1EZJ A;  3WFV A;  1UYI A;  4XD8 A;  4N23 A;  2V1D A;  3TZ2 A;  3GWO A;  4LWG A;  3X2Q B;  1SET A;  1QCE A;  3QO8 A;  1TC0 A;  3CCU V;  2XDX A;  2WLM A;  1YSC A;  2K1E A;  4DZY A;  3ABM C;  1GO3 F;  1S16 A;  1F4N A;  5B1B C;  2DWD C;  2QE7 G;  3E8G A;  1UYM A;  5EBM C;  3CXC U;  3STL C;  3D2R A;  1AJ6 A;  1VQ6 V;  1CEZ A;  2WLJ A;  1QBZ A;  3OW6 A;  3D3I A;  2JDI G;  4EMV A;  1I5B A;  1RM1 C;  1S14 A;  2YEE A;  3CGY A;  3AG2 C;  1QYE A;  2YGA A;  1Q7Y W;  4CWQ A;  2XX4 A;  3E35 A;  2YED A;  1G8M A;  3CC7 V;  5FND A;  4PDR A;  5B1B B;  5CMU A;  2XAB A;  4YKY A;  1M57 C;  1NKD A;  1K33 A;  3G6E V;  2WAM A;  1OCO C;  1L0O A;  1VQ8 V;  5J71 A;  1GM8 A;  2ZDX A;  4H7Q A;  3EHF A;  3HB3 B;  2FXS A;  1QLN A;  2DWE C;  2FWZ A;  4XIT A;  3CCE V;  3W7X A;  2EBO A;  2XAS A;  3EHB B;  3BM9 A;  2Y48 A;  4UV9 A;  1MU5 A;  2XAG A;  4EGK A;  4GT8 A;  3UM7 A;  1UY9 A;  1QVF U;  4GFN A;  2OTL V;  5D6Q A;  2BOB C;  2BYH A;  4XDK A;  1YSR A;  3ZKB A;  5C93 A;  3CYO A;  4MTF A;  1OCO B;  4NH7 A;  2IH3 C;  3ZKD A;  5KUM A;  4RUF A;  3OWB A;  4W7T A;  1GTO A;  1THZ A;  3BMY A;  2MK3 A;  2M7W A;  2EIM B;  4BAY A;  5HFM A;  4L91 A;  1H38 A;  1TBW A;  3QNE A;  4EFU A;  1CP9 A;  1XL6 A;  4UVA A;  4X9L A;  1F51 A;  5CBF A;  2ZKJ A;  3HYZ A;  1YIJ V;  5F5R A;  3EKO A;  4RUE A;  2Y69 C;  5B3S B;  1OCC C;  2HKO A;  2JK5 C;  3FT5 A;  3ABL C;  1S5H C;  3RVZ A;  3ZJZ A;  1VQ7 V;  4FK5 C;  3ZN0 A;  4YKZ A;  4G27 B;  3H80 A;  1SRY A;  3CGZ A;  2HFE C;  1I58 A;  3VBB A;  3JD2 A;  1JM6 A;  3LNU A;  3SPG A;  1NR1 A;  1AJN A;  1GM9 A;  2CG9 A;  2F43 G;  4RAI A;  4XC0 A;  2XK2 A;  3ZRW B;  3CD6 V;  4XE2 A;  1UY6 A;  2UWD A;  5D7D A;  2Y69 B;  3ABK C;  3R4P A;  1OCC B;  2Q2E B;  4PA6 A;  1Y8N A;  1HWY A;  4MVQ A;  4FPP A;  3ABL B;  2XDS A;  3ASO B;  4BIZ A;  1BXD A;  4TSF G;  1NHJ A;  4TT3 G;  1W0J G;  5J9P C;  3ETG A;  3RVY A;  3RLQ A;  4E00 A;  2XND G;  1MOF A;  1W2B U;  4HZ3 A;  3GIG A;  4XCJ A;  1VQ9 V;  4GQT A;  1K4C C;  1NBM G;  1UYC A;  3R91 A;  3G7E A;  4ZBM A;  2YJX A;  3HHU A;  2BRE A;  1GK9 A;  3ABK B;  2BU8 A;  4JYC A;  2AHY A;  5IDJ A;  4PDV A;  1UYH A;  1I5C A;  4OXS A;  2NLJ C;  1UY8 A;  3R4M A;  3FB8 C;  4R1F A;  4MP2 A;  4B7P A;  1M1K W;  1NH2 B;  4WF9 V;  1PVG A;  5IY5 C;  3TET A;  2LFS A;  3SPC A;  3T4D A;  2JJ2 G;  3SYA A;  1K34 A;  4DXW A;  1K3E A;  2WI2 A;  4LWH A;  2H8P C;  4XTJ A;  4ASB A;  2YEA A;  4GX2 A;  2WPD G;  4XIQ A;  4FCQ A;  3LSQ A;  2WI6 A;  1NJI W;  1SES A;  1QR9 A;  1N8R W;  2IOP A;  1MSW D;  2ITD C;  2WLH A;  4I5S A;  2QF6 A;  1H7U A;  3OW2 U;  4CWR A;  2BU6 A;  3DTU B;  2BU5 A;  3BEH A;  4QIW F;  5LHG A;  3CCR V;  3RLP A;  5IY5 B;  4FCP A;  4CWP A;  1F23 A;  2XX5 A;  4MS2 A;  2EZO A;  4URL A;  2QG0 A;  4MTX A;  3OPD A;  2IW5 A;  4L87 A;  3FB5 C;  5EBW C;  3O2F A;  4LP0 A;  3JCZ A;  2YEG A;  3SYQ A;  3U2D A;  5DN6 G;  5CBH A;  3EFF K;  1M56 B;  1JQ0 A;  2YKJ A;  3CP1 A;  1B62 A;  3C0E A;  3A0W A;  3FKS G;  4PA7 A;  4X89 A;  4XDJ A;  1K92 A;  2BU2 A;  2IWX A;  3T0H A;  4WFE A;  1QY8 A;  1KEC A;  4E2L A;  5BZB A;  1K7D A;  2JEU A;  1YIT V;  5EK0 A;  4K4O A;  2YKE A;  3BY6 A;  2BYI A;  4L8Z A;  1QLE B;  3AG3 C;  4R6Z A;  1UY7 A;  4G28 B;  1GKX A;  5FL7 G;  4X88 A;  4CWS A;  4U7N A;  3O6O A;  3HZ5 A;  1FXK C;  2DYR C;  3AEI A;  3VAD A;  2EXL A;  1UYK A;  2IOQ A;  4LP8 A;  4JPR A;  1OHH G;  2PI5 A;  1Q81 W;  1VQK V;  4HYP A;  5CTY A;  2JIZ G;  5IN9 A;  3TK1 A;  5B1A C;  2YEB A;  2B1I A;  5GGZ A;  1OCZ C;  1Y8O A;  4GX5 A;  4MB9 A;  2ZDY A;  3B27 A;  3OMU A;  2ZD9 A;  1I5X A;  1TID A;  1S0V A;  1CPY A;  4LPB A;  2P7T C;  3OE7 G;  5L3G A;  1FXK B;  4PRX A;  2XCM A;  2YE6 A;  3PJS K;  1I5Y A;  4JYB A;  1THN A;  2QKS A;  4BIU A;  1TC6 A;  2Q8H A;  3D0B A;  3MNR P;  3E8F A;  3R4O A;  2XAJ A;  3G75 A;  5M4P A;  3VHD A;  4V25 A;  1DLB A;  4WUC A;  4EFT A;  4E02 A;  4HAM A;  4XDL A;  4LWI A;  3HYY A;  1OCZ B;  1L1F A;  1MAB G;  1K9M W;  4AWQ A;  2WI4 A;  2EIL B;  3B8N A;  4JAU A;  2CCT A;  2O1V A;  3JZ3 A;  2IWS A;  3RW0 A;  4ASF A;  2XX2 A;  2WSS G;  2HG1 A;  1PKX A;  4F4L A;  3MHS C;  2WI7 A;  1YJ9 V;  5LHI A;  4PA4 A;  1NQT A;  3CWV A;  3ZMT A;  1H8E G;  2YE9 A;  4E01 A;  1ZW9 A;  4WFF A;  1AI7 A;  3A0Z A;  4GCZ A;  1TH8 A;  2WI3 A;  4EKW A;  1DF4 A;  5CA3 A;  2VWC A;  1VQP V;  3I55 V;  1WLE A;  3OMN B;  3ZIA G;  4KP4 A;  4KFG A;  1ZWI C;  2O1W A;  4CBC A;  3FV5 A;  1K97 A;  2EIN C;  5CPH A;  4UVC A;  3STZ C;  2IH1 C;  3SYP A;  4HZ0 A;  2YI5 A;  4UXN A;  3K97 A;  3ABM B;  5EBL C;  4WCE V;  3ZRS A;  3G71 V;  2GQP A;  4R3A A;  5M4N A;  3CCM V;  2WEQ A;  2FTK A;  1S3J A;  3ETE A;  1RM1 B;  2X0L A;  2X6B A;  3AG2 B;  2Z3Y A;  2B1G A;  1YS3 A;  1Z5B A;  3ABU A;  1R3I C;  4UV8 A;  4JTD B;  1VQL V;  2CK3 G;  1GKZ A;  5CN0 A;  1AI6 A;  2YSU B;  2EIN B;  1ZXN A;  2YK2 A;  1R3L C;  3U67 A;  1DTO A;  2BU7 A;  5IDM A;  4G2K A;  4PL9 A;  1S77 D;  1BMF G;  1M57 B;  3F7Y C;  4EEH A;  3K04 A;  3EHJ A;  3EKR A;  3B28 A;  2HCH A;  2YGE A;  1ORQ C;  2B5U A;  4P8O A;  1AJP A;  1K5Q A;  2AKP A;  5LGT A;  5M4E A;  1K73 W;  1RPR A;  3HEK A;  3EHG A;  4P9O A;  3LPS A;  4HXZ A;  3K3W A;  3E8B A;  3ZMU A;  2WLL A;  2P67 A;  2DYS C;  1H8H G;  4MPE A;  2OTJ V;  3RLR A;  2BTZ A;  4BXI A;  3G4S V;  1Y4M A;  1B63 A;  3HPL C;  3INW A;  3K99 A;  4QE7 A;  4PA9 A;  3CC4 V;  3A0Y A;  1Y66 A;  3SJQ C;  3CME V;  2E0A A;  3TZ5 A;  3K9A A;  1Z59 A;  3E89 A;  1BKN A;  3WG7 C;  3ML0 A;  4LCU C;  3VOU A;  3OUF A;  1R62 A;  2ZBK B;  4QNH B;  4GEE A;  3QDD A;  2DYS B;  1YT2 A;  4PRV A;  2FYP A;  2YE5 A;  4CE2 A;  5DM6 V;  3R92 A;  2WI1 A;  2XOK G;  4V26 A;  4MVR A;  5L3B A;  3OUS A;  2IJH A;  3Q5J A;  2WWW A;  3WG7 B;  2X7R B;  3T1K A;  4FIP C;  4HYM A;  4KFM A;  2A0L A;  3ZMV A;  2CCS A;  2WLI A;  2XDU A;  2XDK A;  2HR3 A;  4HZ5 A;  5IYB O;  4KSG A;  1AI4 A;  5H6R A;  3B25 A;  3GIG B;  2EZP A;  3QO5 A;  4AS9 A;  1NVP D;  2QTO A;  2VCJ A;  2C2A A;  1NHI A;  3LDD A;  3ABT A;  1VQN V;  2GSM B;  3FB7 C;  2IJI A;  1IXM A;  4HXW A;  1K8A W;  3R4N A;  5LHH A;  4H33 A;  5EC2 C;  4MPC A;  4HYO A;  2YKI A;  1YET A;  3SYC A;  3SPI A;  3CRL A;  2X6A A;  4PU9 A;  2XJX A;  1UYD A;  4P9P A;  1GM7 A;  3DGE A;  1GKF A;  5F3K A;  4I3H A;  3T0Z A;  1WPX A;  4UVB A;  4U7O A;  4MTG A;  4EM7 A;  4LWE A;  1UYG A;  3JD3 A;  4ASA A;  4R8C A;  5KA6 A;  1V55 C;  3ASN C;  4XKA A;  5L3C A;  4YXW G;  4KQV A;  1KZN A;  2JKI A;  2XJG A;  3TUH A;  3IED A;  4BAE A;  3A0R A;  1ID0 A;  3W7S A;  4MVO A;  4QPK A;  1SER A;  1YTF D;  2XHT A;  3FYI B;  2X6C A;  2YEV A;  1UYL A;  5D7R A;  2GHY A;  2JEX A;  3IGA C;  4GGL A;  2VW5 A;  2ZDI A;  3IFX A;  2P6J A;  3CCS V;  2PNR A;  1LNQ A;  4U93 A;  1PNM A;  3AG4 C;  1JOY A;  2VCI A;  2Q67 A;  4L94 A;  4ZKI A;  4DUH A;  1V55 B;  4P7A A;  3ZMZ A;  1EA6 A;  3M99 B;  1FXH A;  3K98 A;  2YGF A;  2P90 A;  3R65 A;  1Q82 W;  4MP7 A;  1B6Q A;  1YC1 A;  2OCC C;  5LGN A;  1NR7 A;  4TWK A;  4URO A;  4JQL A;  3RBZ A;  1R6K A;  3E8H A;  4MSW C;  2O1U A;  4MVZ A;  1AJQ A;  4FJC C;  1OSF A;  3GIE A;  4H81 A;  2R9R B;  2JJC A;  1OZ0 A;  3VHA A;  3H4L A;  1PNK A;  2BSM A;  3A0T A;  3I56 V;  5L3D A;  5B1O A;  3OEH G;  1E1R G;  1P7B A;  3W7T A;  3TTZ A;  1M9N A;  2JJ1 G;  3TZ0 A;  4HY1 A;  3LDC A;  4BW5 A;  1JX9 A;  1NHH A;  3AG3 B;  3TCU A;  1RPO A;  2ITC C;  3WHA A;  1G4Y B;  2EIJ C;  2DYR B;  2YE7 A;  1VQ5 V;  4XCL A;  2A9H A;  2GFD A;  2LFR A;  4YKX A;  3LSS A;  4EGH A;  1AMW A;  1TUE B;  1COW G;  1V54 C;  2Q8F A;  1TIL A;  4CWN A;  4RQF A;  1JVM A;  5B1A B;  3T1C A;  3X2Q C;  4J9Y B;  1FFT B;  5BOC A;  2UXN A;  3CMA V;  4JGS A;  1ZWH A;  3EHH A;  3KE6 A;  5GW7 A;  2YEF A;  5IYD O;  4ZVI A;  1BHA A;  1R6N A;  2QM8 A;  2ZXW C;  1KQS U;  2ESA A;  4WUD A;  1I5A A;  5L3F A;  4XIP A;  1JCH A;  3H01 A;  2XHR A;  4O09 A;  1Z5C A;  2CH4 A;  4MW3 A;  3OWD A;  1U0Z A;  4JAS A;  2IU3 A;  3FB6 C;  3C11 A;  1YSZ A;  2XDL A;  5L3J A;  4LBE C;  3K03 A;  3F7V C;  2XHX A;  4R3M A;  3ZN1 A;  1YI2 V;  1YJN V;  3K08 A;  2DQ0 A;  2IJK A;  1ROP A;  1KKD A;  3E86 A;  2ZXW B;  1PL0 A;  2DQ3 A;  3PEJ A;  3OFN G;  4J9Z B;  4P30 A;  2CCU A;  2XJJ A;  3E2E A;  1FS0 G;  2YKB A;  4LWF A;  4LC1 A;  3CCQ V;  3CCL V;  2XAF A;  1PD3 A;  1KP2 A;  1OCR C;  5FWK A;  5D6P A;  2DW4 A;  3QO7 A;  3NMQ A;  5B1N A;  3MD0 A;  1YC4 A;  1QZR A;  2H55 A;  1Q86 W;  3K06 A;  2D3O W;  2YKC A;  2QEX V;  1KP3 A;  1K4D C;  4MVS A;  1MG1 A;  1E1Q G;  4ASG A;  1K5S A;  4YKW A;  3ZXO A;  4YKU A;  3CCV V;  3W7U A;  4CE1 A;  3CPW U;  2YEC A;  2Q8I A;  2UXX A;  3CRK A;  4URN A;  4KUM A;  1QVG U;  1OCR B;  2EIM C;  2OT5 A;  3HZ1 A;  4MVM A;  4ASU G;  4XDM A;  2YE3 A;  2HKJ A;  3A0X A;  4MVU A;  1J95 A;  2EJR A;  3K0D A;  1F4M A;  4Q20 A;  4R50 A;  1W0K G;  5HFL A;  4DO2 A;  2WLL B;  4AWP A;  4UUJ C;  4CWT A;  2EIK C;  4Z1M G;  1KC8 W;  2YEJ A;  1YC3 A;  3OMI B;  5B3S C;  4MT8 A;  1EFR G;  3MHH C;  5LGU A;  4FCR A;  2YI0 A;  1I5D A;  2HVK C;  2H94 A;  4CWO A;  1AM1 A;  1AR1 B;  1U2O A;  4CZZ A;  3Q5K A;  1VQO V;  5H6Q A;  3FT8 A;  4H85 A;  5KA5 A;  3F5W C;  3SPJ A;  1NH2 D;  3LNM B;  2BOC C;  4URM A;  2EIK B;  2KB1 A;  4WUB A;  4EGI A;  3OR6 C;  2XAQ A;  1JPX A;  1R73 A;  3ZM7 A;  4XKO A;  2V7Q G;  4PA3 A;  4MBC A;  3QTF A;  3LDE A;  4QPJ A;  2IU0 A;  3ASO C;  4MW8 A;  1Y4U A;  2BT0 A;  2HJF C;  4PDM A;  2YI6 A;  4PDL A;  4AWO A;  1UJW B;  1ARO P;  5E1A C;  3ZXQ A;  1AH6 A;  1XL4 A;  2ZQM A;  2ZR2 A;  2AHZ A;  3W7W A;  4MTO A;  5LBQ A;  3SYO A;  1B3Q A;  2Q69 A;  4PEL A;  3KG2 A;  2YJW A;  4GX1 A;  4HY6 A;  3ZRX A;  2WLI B;  3ZRW A;  1GJV A;  3P30 A;  3FYE B;  3P32 A;  1BYQ A;  3JD4 A;  4P2Z A;  2YE4 A;  2YEH A;  1BHB A;  1Y4S A;  2IWU A;  4QE9 A;  2LP7 A;  1QR8 A;  4O07 A;  2WI5 A;  3T2S A;  5CTW A;  3K0G A;  1E79 G;  3GB7 C;  3JD1 A;  4GT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...