4U7OA

Active histidine kinase bound with atp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
239
structure length
234
Chain Sequence
VTEQQKIDNDRKQFVSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRVDKQGGTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine protein kinase sensor protein
publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Transferase
total genus 79
structure length 234
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4u7oA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4u7oA02
2C2AA 4HXWA 4K4OA 4YKXA 1L0OA 2LFSA 3TZ5A 3H4LA 4R1FA 2ESAA 4GT1A 1H7SA 4XIPA 3QTFA 1U2OA 5M4HA 2CCTA 2GQPA 3O2FA 4YKTA 2YEEA 2CCUA 3G7BA 4YKQA 5M4PA 4AWOA 4V26A 4KTNA 1Y8PA 4MPEA 5J71A 2YGAA 3EKRA 4JQLA 1KIJA 1YC3A 4LWGA 2XDKA 4GQTA 3R4PA 4E01A 3WQ9A 1YSRA 5F3KA 4LWEA 1ZWHA 1Z5AA 2BYIA 2YEHA 4HY1A 2CCSA 4XKAA 2YI5A 4L94A 4CE1A 4BIUA 3R91A 3HZ1A 1Y4UA 4E02A 2YEIA 4ZKIA 4MP2A 2YJXA 3K60A 4MPNA 4O0BA 1UY8A 1ZXNA 2YK2A 5FNCA 2YKCA 1UYEA 2XHXA 4PU9A 4ASAA 5CTXA 1PVGA 3A0TA 1I5AA 4DUHA 4U7NA 4MOTA 3HHUA 4WUCA 4URNA 2WI3A 2O1VA 4EM7A 2IWXA 3O6OA 2XDXA 3MNRP 1NHIA 3CGZA 1THNA 3A0RA 2YI7A 1I5DA 4E00A 3T10A 4XCJA 4NH7A 3HZ5A 4H81A 4P7AA 4GT8A 1ID0A 4MPCA 1TBWA 2O1WA 2IOQA 5GGZA 1YS3A 2BRCA 3DGEA 4ASFA 1BYQA 2QF6A 1UYCA 2XCMA 2JJCA 2ZKJA 1Z59A 2HKJA 4JYCA 4GFNA 4HYPA 3VHCA 3VHAA 2YKEA 1KZNA 2VW5A 2WI6A 4XIQA 2WI7A 4MBCA 4KQVA 1UY7A 2FTKA 2H8MA 1QY8A 4CWFA 3WHAA 3FV5A 4XD8A 3OPDA 1ZW9A 4CWPA 1YC4A 5B1NA 3P32A 2YE2A 4MP7A 2WI4A 2YGEA 1TIDA 4CWQA 1B62A 3O0IA 3OWBA 4O05A 4LWHA 5FNFA 4XDMA 4AWQA 1YT2A 1JOYA 2BZ5A 5D7CA 2Q8GA 3TTZA 1GKZA 4YKWA 3EHFA 3ZRVA 1OSFA 1YETA 3BM9A 1Y8NA 2YKIA 4LWFA 3K98A 2IWUA 1BGQA 1NHHA 4EFTA 4GCZA 3CRKA 2QFOA 4PL9A 4KP4A 2WEPA 5D7RA 3A0XA 2BU2A 3EHHA 1NHJA 2BU7A 3A0YA 4YKYA 2WI5A 3CWVA 5D6QA 2Q8IA 5CTWA 3Q5KA 2XX4A 2QG2A 1QZRA 2YECA 4R3AA 2H55A 1AJ6A 2XX5A 3D2RA 2CGFA 4WUDA 5IDMA 2YGFA 2WERA 3C0EA 2LFRA 2YE5A 3B28A 4BAEA 2HCHA 1IXMA 3T2SA 2YEAA 4CWTA 1YSZA 4FMTA 2YE4A 3U2DA 1I5BA 1Y4SA 2VCJA 3T0HA 5FWKA 3IEDA 4P8OA 2ZBKB 1R62A 4XITA 1Z5CA 4R3MA 3RKZA 2YEGA 3OMUA 1AH6A 4ZVIA 2QG0A 2FYPA 2YI0A 3OWDA 2WI1A 3GIEA 5D6PA 2K5BA 3TK1A 3TZ4A 4PRXA 1TC6A 2XHTA 2BU6A 2YI6A 3LPSA 5M4MA 5BODA 2YEJA 3SL2A 2BYHA 1F51A 4JYBA 3VADA 5CF0A 2XK2A 1YESA 4LWIA 1TILA 1QYEA 2XDUA 3ZXQA 3MD0A 1YT1A 4GEEA 1EI1A 4BQJA 2YE6A 2XDLA 3K97A 4WUBA 3R4NA 4MT8A 2QM7A 1BXDA 3B25A 5BOCA 3T1KA 3VHDA 4EGIA 4XE2A 4W7TA 2BU5A 1EA6A 1AMWA 3PEJA 4YKUA 5IN9A 1S14A 1UYGA 2YEDA 5F5RA 1A4HA 3FT8A 2CH4A 1MU5A 4CE2A 2IORA 3ZKBA 4EFUA 3Q5JA 3R4MA 2YE3A 3BMYA 2YK9A 3RLRA 4QPJA 1UYKA 4LP0A 1I5CA 3NMQA 4EMVA 1YC1A 3HEKA 4BXIA 2YKJA 2YKBA 3D0BA 4KSHA 4AWPA 4MTXA 3TZ0A 4DZYA 1MX0A 3R4OA 3D36A 2FXSA 4PRVA 3ZRWB 3EKOA 2XJJA 4XC0A 1UYDA 4CWNA 1Z5BA 4CWSA 2EXLA 2JKIA 3RLQA 4QPKA 2O1UA 2BTZA 4X9LA 3B26A 3EHJA 3HYYA 3B24A 3ZCCA 5CTYA 4FCPA 2BU8A 1Y8OA 4XIRA 1YERA 3INXA 3U2KA 4HZ5A 3K99A 2GFDA 3GIFA 2XDSA 3G7EA 1UYIA 4V25A 1AM1A 4XCLA 2CG9A 2AKPA 4I5SA 3C11A 4FCRA 4HXZA 2YJWA 3KE6A 4HY6A 2BREA 1UY9A 2QM8A 4LC1A 1I58A 4EEHA 2YE9A 4FPPA 2Q2EB 2E0AA 3ZXOA 3G75A 4URMA 4B6CA 4U93A 1TC0A 1UYLA 3A0ZA 4FCQA 3ZM7A 5IDJA 4HYMA 5CTUA 2IWSA 1GJVA 4L93A 3EHGA 1US7A 4UROA 4XKKA 4NH9A 4O04A 5B1OA 4L90A 4HZ0A 2IOPA 4NH8A 2HG1A 1AH8A 4URLA 3RLPA 1UYFA 5M4EA 2VWCA 3B27A 4ASGA 4XKOA 4BIZA 4Q20A 4H7QA 4EGHA 4BQGA 3CGYA 3HYZA 2BSMA 3PEHA 4LPBA 2Q8FA 3CRLA 4YKRA 3H80A 1B63A 2XABA 2WI2A 1GKXA 1JM6A 1UY6A 4L91A 3JZ3A 4I3HA 4KFGA 5D7DA 5M4NA 4ASBA 5L3JA 2Q8HA 3U67A 3R92A 2BT0A 5CPHA 3ZKDA 4B7PA 4XTJA 4EGKA 2FWZA 4YKZA 1YT0A 2VCIA 4JAVA 4AS9A 2YE8A 3TUHA 1U0ZA 1UYMA 2WWWA 2ZDYA 2XJXA 3ZRXA 1S16A 4U7OA 5J6AA 1I59A 1BKNA 2XHRA 2UWDA 2ZDXA 1H7UA 5M4KA 2FWYA 3INWA 4JASA 4CWOA 3GIGB 3OW6A 1TH8A 2YEFA 2YEBA 2YE7A 3T0ZA 4L8ZA 5C93A 5FNDA 2PNRA 2XD6A 3TZ2A 4GGLA 1UYHA 2P67A 1B3QA 3FT5A 3Q5LA 4MB9A 4KSGA 4H85A 3A0WA 1ZXMA 3GIGA 2XX2A 3LNUA 3NXSA 4CWRA 3ZRWA 4JAUA 3QDDA 4CE3A 2XJGA 4O09A 2WEQA 4O07A
chains in the Genus database with same CATH superfamily
2CGOA 4O4JA 5LMUO 4HXWA 3OEEG 4K4OA 3ZHRA 1YJ9V 1V54B 3TZ5A 3L70H 2ESAA 2DYSB 1EM1A 3CCEV 1U2OA 3K06A 5GW7A 1OCZC 3G7BA 5M4PA 1OZ0A 1WP7A 4CS2A 4WFHA 4KTNA 4F6RB 3SYOA 1FXHA 4NXMO 4MPEA 5FPRA 5J71A 2ITCC 1OJHA 2VQEB 4LF7B 1AJQA 2QM4A 3OT7A 3AG1C 4JF3A 4RO2A 1SQVH 3BA8A 2ZDIC 1MMMA 2BYIA 1F4MA 1QNMA 1IVSA 3E8GA 1MZEA 1HR0O 1I94O 5JH7B 4JI1B 1XMOB 2XASA 3RYHB 1FJGO 4FVMA 1Y4UA 4BW9A 2YEIA 4ZKIA 4AQYB 2N05A 4MP2A 4F6RA 3K60A 1YCIA 2PYJA 3J7AU 2Z0AA 4Z1MG 1ZXNA 1PM9A 1R1BA 1THZA 1MSWD 3BEHA 3EXAA 3S3WA 1PNLA 1PVGA 1GN6A 2Q67A 1I5AA 2W6IG 3AG7A 2WA4A 4NTYA 2M7WA 3OUSA 4PI2A 2CTPA 2A06H 2WI3A 4EM7A 1H38A 4MVOA 4JI8O 3O6OA 3RYHA 5LP6B 3MNRP 5IWAO 2O57A 1THNA 5IYZB 4IYHA 2YI7A 1Q6UA 5EC2C 1NVPB 4QE9A 1H2MA 1I5DA 5EBLC 3E83A 2ZIMA 5GTIZ 3CMEV 4H81A 1ID0A 2QR4A 4LH7A 3RVYA 3GB7C 4Q6GA 5LL6Y 1AI6A 2F95B 1KKCA 4K0KB 3QVNA 2ZKJA 1SQPH 4UCOA 4JYCA 2ZR3A 5LP6A 4DUYO 4JI0B 5IJ9B 1UFIA 1OCOC 2Q73A 5FL7G 3L71H 4WFAV 5B1BC 4WCEV 4B3MO 1QLNA 1VQ9V 2H8MA 1IBKB 3ZHQA 4CWFA 3WHAA 1K34A 1XOUA 1GN2A 3FV5A 1NR7A 1MOFA 3OPDA 3HPLC 4RAIA 1YC4A 2A7WA 2YIBD 5B1NA 1ZAUA 1AB3A 2WI4A 5CA3A 4DK1A 1TIDA 1XMQO 3HR0A 5IJ9A 1B62A 2KKWA 3O0IA 1VQ6V 2M6YA 4CS4A 3X2QC 2BZ5A 2UXXA 4YKWA 1H2NA 2RJZA 3ZRVA 5KX5B 1DGSA 4PA3A 2EIJB 1BGYH 4JAAA 3CD6V 4LWFA 5CA1B 2IWUA 3CRQA 4EFTA 2A79B 2P5OA 4GKJO 4PL9A 4KP4A 4UVBA 5C8YB 5A9GA 3L73H 1NHJA 2IJIA 1WNSA 3O65A 2OTLV 1M9NA 2WI5A 4RUEA 4DR1B 3FAVB 4DW1A 1QVFU 2WLIB 3K0DA 1OCCC 2ZCEA 5KX5A 1O9GA 3CS5A 3LNMB 1AJ6A 2XX5A 2D2CB 4WUDA 4CH6A 4EKWA 4LF5B 2L35A 2YGFA 2WERA 2LFRA 4GX2A 5CA1A 1EFRG 4YY3O 1K4DC 4JTAB 1YSZA 5C8YA 1Y4SA 3T0HA 5FWKA 4JV5O 1EN6A 1FXKC 1G4YB 2ZBKB 1MZFA 3FAVA 2WLIA 1SA0B 2DE0X 3KKYA 1P49A 4LBEC 5KA5A 1YSCA 1G8MA 5CB4B 3RGBA 3GIEA 3ABUA 4IT5A 3VQYA 4I50B 3OW2U 4QNHB 1TC6A 4UCTA 4X1YB 1PL4A 2Q68A 1DF4A 2YEJA 2NNUA 3SL2A 2GUZB 4TV8B 1OCRB 1DLBA 2XK2A 2XAQA 2FKXA 2OIGA 5CB4A 4RWUA 1FS0G 5LMNB 3H1HH 3R4NA 4MT8A 4W4LA 1M5IA 1N0JA 1BXDA 4I50A 2WLHA 5GONB 1XILA 2BU5A 1N32B 2NLJC 1KYOF 2GUZA 4TV8A 3WB0A 2YXHA 1QR9A 2N04A 3WU2Z 2JJ1G 3BCCH 1ZL8B 1A4HA 3FT8A 4CE2A 1W0KG 1U97A 1FXVA 4Z1VA 5GTHZ 5DECA 3I5DA 2ZINA 3BAAA 4QPJA 2Y0PA 4JYAO 1DK1A 4JTCB 4BWAA 1UYKA 5GONA 1SZXA 2A3QA 3CP1A 2XUMA 3N2GB 3F5WC 3L72H 4L8JA 5KAIZ 3CRMA 1R3JC 3JSLA 4LWSA 4AWPA 1ZL8A 1MX0A 3UKMA 2FXSA 1BHAA 3EKOA 1HNXO 2R70A 4R8CA 4DV7B 4PDVA 5BR8B 4CWNA 1K7DA 3N2GA 1Y4MA 2QKAA 4GKKO 2JKIA 4DR7B 1YTFD 1OHHG 4QPKA 1E1RG 2ZM6O 1N34O 3W7WA 3DTUB 4B3RB 2UXBB 3B24A 5DEDA 5CTYA 2E5LB 2E3CA 4FCPA 3T1YB 2BU8A 5LXTB 1Y8OA 1K9MW 4XDJA 1GMGA 1YERA 1ZWIC 3CMAV 3INXA 2FL4A 3DC5A 4Z2WA 4HZ5A 3KG2A 3K99A 1TA8A 4DR4O 2R9IA 4LFAO 3RT3C 1KC8W 3SPCA 4FCRA 5BXZA 3A8TA 2YJWA 1I5XA 4HY6A 2R9RB 4HBNA 4NYKA 5LXTA 1UY9A 2QM8A 3AK3A 4HAMA 3UO3A 2Q2EB 3H9VA 2UU9O 1CPYA 3B8NA 1NVPD 4B6CA 3U0ZA 4U93A 1KB9F 4FM0A 3OTOB 3OMNB 3G71V 2F4VO 4FCQA 1MSDA 2EJRA 4A5UB 3W7XA 2IW5A 5EK0A 3EHGA 2F23A 3AG3B 4O4HB 4XKKA 4NH9A 4MVSA 5B1OA 4X20A 1K33A 4I7ZB 1BQ0A 4JGSA 2PUSA 1F7YA 1N8RW 3E8FA 4YJ3B 4X66B 3RLPA 3ABKB 1UYFA 1NTMH 3B27A 1BS3A 3T1HB 4BIZA 4Q20A 4H7QA 4EGHA 1V9PA 4BQGA 3PEHA 1K8AW 4LPBA 2Q8FA 2UXDO 4H0LB 3UO2A 4X65B 1WJZA 1N36B 2WI2A 4LFBO 1JR9A 1HNZO 2LW7A 3AG2C 4MSWC 4WFFA 5D7DA 4YJ2B 5DM6V 5M4NA 2XAFA 4JI5B 3WG7B 1QVGU 2Q8HA 3U67A 4YJ3A 5BMVB 4OPHA 4D6TH 1K5QA 5TISZ 1V54C 4PA4A 4EGKA 4GZRB 2DYSC 1VQ7V 3OFNG 4CH5A 1Q7YW 1H2KA 2Y4UA 2VWJA 4JAVA 2HG5C 2YE8A 2RCVA 5EBMC 3TUHA 1U0ZA 2PF4E 5CA0B 1UYMA 2ZDYA 3ZRXA 4YJ2A 1S16A 1R6KA 3QNEA 5J6AA 2F43G 5BMVA 2UWDA 1RSOB 1ZX3A 1H7UA 4X9QA 1PNMA 4CWOA 4PHZA 3S5TA 2YEBA 1P4RA 1GRJA 4DV3O 3K3WA 5KHHA 4X64O 3T0ZA 1F23A 4L8ZA 4DW0A 5FLXN 3ASOB 5CA0A 2LW1A 2BTQA 3ZMZA 4J10A 1UYHA 1TVKB 2P67A 2QWPB 3ABLB 3JATB 3FT5A 3Q5LA 4MB9A 4KSGA 4NR1A 2Q9LA 1RSOA 4I4TA 3CC7V 1XL6A 1PD3A 2DN9A 3NXSA 5LP6C 3JAWB 1YDXA 2UUCO 2KG7A 4JI7O 3G80A 5LYJB 1NT2B 2UXNA 4X89A 1XNQB 2PGGA 4HNAB 4IL6Z 3RFRA 3ETQA 2LFSA 4J9ZB 3JATA 2JGUA 4NVPA 3APOA 4ZBMA 3EKRA 1KIJA 4ZHQB 2ZE7A 3OGIB 4JI4B 4GQTA 5LYJA 3WQ9A 5CN0A 2W6JG 2YIDA 5F3KA 2WLLB 2CTWA 1ZWHA 2CTRA 2JRIA 1JVMA 3SPHA 2YEHA 2PI5A 2CCSA 4XKAA 3IFXA 2EIKB 3OGCC 4BIUA 4CE1A 1M57B 3CXHF 2WA3A 2FMLA 3PN1A 3SYAA 4E02A 1VF7A 3FD9A 3SYPA 4ABMA 4MPNA 2QEXV 1S76D 2ZKOA 4K3AA 3AEIA 2YK2A 1QR8A 5FNCA 2YKCA 2XHXA 3ZRSA 1S72V 2WLLA 3D3QA 4DV5B 2YS8A 1AI5A 4U7NA 4NXMB 1NH2B 1LUWA 3ZN1A 4O4IB 4KFMA 2JEUA 2O1VA 4IGGA 1FKAO 2IWXA 5A2QN 4XBFA 1Z2GA 2Y4TA 1N33B 4DV1O 3A0RA 4NTWA 4LF8B 2EIJC 4E00A 4XCJA 4MTOA 2CK3G 2Q4PA 3OR6C 1HR0B 1I94B 4J9YB 4GT8A 1FFTB 1FJGB 1GO3F 4PA6A 4MPCA 1XHXA 2IOQA 5GGZA 5K1PA 1YS3A 3DGEA 3CJHB 3CRRA 1R3LC 3ZHVA 2PI4A 3R65A 5BZBA 2QF6A 2XCMA 2HKJA 2ODMA 4HYPA 1KBHA 2ZIOA 4NB5A 4ZOLB 4FFBB 3ZS8C 2WI6A 2Q7EA 1UJWB 3STLC 4XIQA 3CB2A 5IWAB 2DMXA 2FTKA 2RMKB 3LDEA 2BSKB 4XD8A 1JQ0A 4KL1A 4CWQA 4ZOLA 4FFBA 4LWHA 4KUMA 2IH3C 1Q43A 4O4LB 3VOUA 1NJIW 4XDMA 1OV9A 2LJ2A 1JOYA 2WSSG 2YI8A 3LMMA 1R73A 1VF6A 5D7CA 2Q8GA 1XBLA 5EC1C 2BSKA 2YICA 2QTSA 2VQFO 4B3MB 4FLYA 1KP3A 4BAYA 4CH3A 3BM9A 3SDLA 2CE4A 3K98A 2ZD9A 4FLTA 1BGQA 1OCRC 1FFXB 1XNRO 1GM9A 2DWEC 3CRKA 2QFOA 1R6NA 3A0XA 1XMQB 1WPBA 4YKYA 2Y0IA 2CTQA 5CTWA 3Q5KA 2JK5C 4UB6Z 2E74B 2H55A 5KA6A 5KUKA 4BAEA 1P7BA 1FFXA 2HEPA 2NN4A 3CEIA 5L3DA 2ARHA 3U2DA 5IYCO 1W0JG 1I5BA 2ATKC 4F4LA 4FM2A 1YZBA 3G4SV 2QSAA 3FB6C 3NR7A 1BL8A 1VQ8V 3R66A 4XITA 4GKJB 4YIOA 3JARB 1MNGA 1R3IC 2IJKA 3OR7C 1VARA 3CRCA 3E89A 3Q4HB 4LFCO 2V4DA 4P30A 1QQCA 3SYCA 3UT5B 3JCUZ 2YC0A 2QG0A 5J2UB 2FYPA 4IYIA 3OWDA 3WFVA 2WI1A 2UUBB 2Q7GA 5JH7A 2K5BA 3W7SA 4K8ZA 5J2TB 3TK1A 1AROP 2V1DA 2OYQA 3T4DA 2XHTA 1AI7A 2HHHB 2YI6A 5M4MA 5DN6G 1H2GA 2B1GA 3JARA 1F51A 4JYBA 3T4ZA 2N74A 4BIOA 3VADA 3Q4HA 5D5QA 3ZMSA 1QYEA 3ZXQA 2HR3A 1JA8A 3MD0A 3UT5A 2RNBA 1M56B 1EI1A 2BOCC 3K97A 4MW3A 3FB7C 5J2TA 4EGIA 4DR3O 4DV2B 4B3TO 5IYZA 4XE2A 1A32A 4U3JB 1UPGA 4YKUA 2PZSA 5IN9A 1UYGA 5F5RA 4EFBA 2B5UA 3FX7A 4PV1B 2EZOA 2X7RB 1MU5A 3AG4B 4EFUA 4DRXB 3Q5JA 2YE3A 2YK9A 4N21A 3CCJV 1S3JA 4EFEA 3B4SA 3LNNA 4LP0A 2QTOA 4UV8A 1YJNV 1DF5A 4EMVA 1I0HA 1NTKH 3E22B 4WFBV 3P3PA 1IDSA 4U3JA 3D0BA 1VQOV 1VQ5V 4KSHA 2A0LA 1I08A 1Q6IA 3TZ0A 1SQXH 2X0LA 3FKSG 1ZSPA 4BR6A 1RFYA 3R4OA 5IJ0B 1IBMB 1NU1H 4RQFA 3ZRWB 4GX5A 1IBLB 3AG3C 2XJJA 4XC0A 1UYDA 1FD9A 4IIJB 3LSSA 4PDLA 3E22A 1PPJH 3RLQA 3G67A 3JAMN 2O1UA 2BTZA 1VP7A 3OD4A 4JYAB 4X9LA 5CBGA 3EHJA 2HLDG 3ZCCA 1BZKA 5FPOA 4EB6B 1GH6A 5IJ0A 4XIRA 3SYQA 1FAFA 5F2VO 2DOSA 4X1KB 1HNWO 5FNVB 5LHHA 4IIJA 1Q86W 2ZXWB 4AQYO 2GFDA 3GIFA 3WG7C 4E4EA 1KECA 4DR5B 2XDSA 1HNXB 4V25A 1AM1A 4XCLA 4H44B 4I5SA 1NH2D 3CPWU 4UVCA 3KE6A 4EB6A 3FFQA 3CWBH 1HP8A 4QGPA 1I58A 4EEHA 1WN7A 2ZM6B 2YE9A 1Q90D 2XAJA 4EEQA 4X1KA 3H1JH 2C1IA 4FPPA 1GN4A 5FNVA 2IM9A 2QWQB 4GYCB 1VQNV 2EINB 1TC0A 3STZC 3BHPA 3SJBC 3ZBHA 1IURA 3ZIAG 4HYMA 5CTUA 1NZ6A 2HFEC 2LGQA 4KHPB 4TT3G 4L90A 4P9PA 4DUZO 3RYIB 3MAQA 3ASOC 1SA0A 4LFAB 3J80N 1L1FA 3EFFK 4K0KO 1BSMA 3B77A 4FM1A 1SZTA 1AH8A 4JI0O 5M4EA 2VWCA 4ASGA 3ABLC 4FFKA 2Q69A 3RYFB 3HYZA 2BSMA 4YKRA 2ILMA 4XDLA 3UM7A 2KSDA 1IBKO 1GKXA 2HVJC 4J7KA 4X1YA 1Y76B 3ETEA 5IE9A 3APQA 5IY5B 2F4VB 1UY6A 4L91A 4I3HA 5L3EA 2P90A 3RYIA 2OCHA 3K9SA 5L3JA 1W59A 3ABMB 2OCCB 4DR2O 1SKVA 5CPHA 2AZ0A 1ORQC 1OCZB 1Q81W 1EN4A 3RYFA 4O2BB 4NKGB 4DV6O 2OIEA 1P84F 1YHQV 2EILB 3F7YC 4O2AB 1Y76A 2CH7B 2YEVB 1YXBA 5IYBO 2EX3A 3ASNB 4OGQB 1I59A 2W0XA 1BKNA 1HNZB 2ZDXA 2WLKA 2FWYA 3INWA 3GIGB 4TWKA 1M57C 4O2BA 2YEFA 4IHJB 2YE7A 3BA9A 3G6BA 4X1IB 1M4UA 4O2AA 2XD6A 2B9ZA 1DTOA 2CH7A 2YEVA 4DR1O 4MVRA 1YVWA 4MW8A 4ZI7B 4LF5O 3A0WA 4JI2O 1ZXMA 4JI6B 3ZJZA 1VQLV 3GIGA 1PP9H 3K5OA 4JAUA 5L3CA 4IHJA 2XJGA 1BCCH 2GV9A 4O09A 4X1IA 2WEQA 4YKXA 1V55B 4JI3B 2XTAA 3H4LA 4R1FA 1H7SA 4XIPA 1Z5WA 1WPXA 3QTFA 4ZI7A 2WLMA 4YKTA 5M4HA 5H6RA 1K92A 1SETA 4AWOA 1M90W 1MABG 1SS3A 4QIWF 4J80A 4CZZA 1YC3A 5H2FZ 4W4KA 2XDKA 2ETNA 3EVKA 3BY6A 1Y66A 3R4PA 4X62O 1IXBA 1YSRA 4LWEA 4UV9A 1X59A 5JWPA 1NTZH 4PELA 3UCSC 4GLXA 2YI5A 2UUCB 1VF6C 1MG1A 4AHCA 1SF9A 3J81N 4CC6A 5CBFA 3CCMV 1G1XB 2XAGA 2QWNB 4JPRA 1UYEA 4PU9A 3SJQC 4ASAA 4L87A 5CTXA 1I5YA 4DUHA 4J11A 3CCSV 4DO2A 4MOTA 3OMIB 1AJNA 5KUMA 4OXSA 1HWYA 3K79A 4JTDB 4TQDA 4D7SA 1PV0A 4O4HA 3CCQV 5BY1A 1XL4A 3T10A 3B40A 3JCZA 5B3SB 1D2DA 2C1GA 1GTOA 3E2EA 4NH7A 4U3FH 3HZ5A 1AJPA 4P7AA 2O1WA 1LNQA 3I56V 4I55B 4ASFA 1BYQA 1N0NA 2F93B 2H94A 2GHYA 1UYCA 2JJCA 2XHBA 2ZT9B 1Z59A 4MVZA 3VHCA 3VHAA 2Q6AA 5B66Z 1KZNA 4ICGA 4TUYB 4X8AA 2VW5A 4PDRA 2X6BA 2LP7A 4UCVA 2WI7A 2UUAO 4LR3A 4KQVA 4UFZA 1UY7A 4G2KA 3QO5A 4ASUG 5BR8O 3JD2A 1H8EG 4DV1B 4I55A 4UB8Z 4DR7O 1ZW9A 2JJ2G 3F5TA 3P32A 4B3RO 2YGEA 1QU7A 2UXBO 1R3KC 4LNUB 1U96A 2HP8A 2E5LO 2VS0A 1XQ8A 4TUYA 3FB5C 3O9OA 2QWRB 4AWQA 2JS3A 2JIZG 1YIJV 3TXQA 3L75H 3KCYA 4FZ1A 4B3SB 3TTZA 1GKZA 3CC2V 4I0XB 2FYUH 2F1MA 1I7FA 1Y8NA 2YKIA 2AHZA 3M99B 3C90A 4LNUA 2KB1A 2P7TC 4BW5A 3K03A 4DXWA 1NHHA 1JMKC 1WB7A 3HKDB 1TVKA 3K0GA 3ZMVA 5D7RA 2HJDA 2XNDG 1J5EB 3B8MA 1M56C 3BFRA 3CWVA 4LF6O 5D6QA 2Q8IA 5LHIA 3HKCB 2XX4A 2GTSA 4I0XA 5LHGA 2YIAA 3CC4V 4R3AA 3JAWA 5IDMA 2V7QG 3C0EA 2YE5A 3B28A 3OEHG 1K97A 4H33A 5LGNA 3T2SA 4HNAA 4CWTA 3HKDA 4UCSA 1US6A 2AGAA 3K5MA 4FMTA 3TGUH 3T1CA 1JCHA 4X66O 5LMUB 3HKCA 1X4TA 1NKDA 3BVOA 4R3MA 3RKZA 3I55V 1SC5B 4ZHQA 1XREA 2RDCA 1TUEB 3ZX6A 4PA9A 2WAMA 5EIBD 4ZVIA 2GTAA 3SR2C 2EJ7A 5LGUA 5CMUA 4LF4O 2K9PA 5B1AB 2YI0A 4FJCC 2ZNJA 2P4KA 2YXLA 1COWG 3BABA 1XUQA 4OPAA 4PRXA 4DR6O 3LPSA 4J7JA 4CC5A 4HZ3A 5BODA 3CCVV 4LP8A 3T2MA 3LDDA 4DV4O 1TILA 1SQGA 2XDUA 4YHHO 2PY5A 3JALB 1AP6A 1H2SB 4TSFG 1YT1A 4GEEA 4BQJA 2YE6A 1KP2A 4O4IA 3ZMTA 4WUBA 3SPGA 4LFCB 1CEZA 2QM7A 3CXCU 3QG5A 3B25A 4WBNB 3L9DA 2YUAA 1LR1A 1JJOA 4F6EA 1EA6A 3JSNA 4LCUC 3RWRD 3CX5F 3PEJA 4JI8B 4NXNO 1K3EA 1IX9A 5H6QA 3K5LA 3JALA 2IORA 1WAZA 3ZKBA 3CJHA 3R4MA 1AR1B 3HKBB 3RLRA 1M1KW 4PDMA 4WBNA 3NMQA 1D5AA 1YC1A 3HEKA 1XHZA 3OUFA 2EIMB 1KMIZ 2JGDB 1LUVA 2RQ6A 2EINC 2YKBA 2YKJA 4DR3B 4FK5C 4AILC 2R9AA 4DUYB 4OX9O 4E72A 3AK1A 4DZYA 3D36A 3K5NA 1JJ2U 1NR1A 1AP5A 2AZ2A 2QGNA 2WLNA 1Q3EA 4DV0O 3BRCA 3ZEDA 4O4LA 5JENA 2ADQB 2JGDA 3H1IH 3B26A 3ETDA 3HYYA 1YITV 2VWKA 3UQ8A 4G27B 2FB5A 5HFMA 1KKDA 4WFGA 1S5JA 1QCEA 1XDCA 3TJTA 3JD0A 3U2KA 5EIBC 4UXNA 5JJJB 3G7EA 3ABMC 1E79G 3LSUA 2OCCC 4UCUA 2H3OA 3B09A 2XOKG 4B7EA 3P3NA 2CDYA 2P22C 2Y48A 3CCLV 4LF9O 4DV5O 2BREA 4LC1A 3ZMUA 4X88A 1PL0A 4K35A 3ABTA 2EILC 1JPXA 1YTFB 2E0AA 3ZXOA 3S3XA 1Q6HA 4MS2A 1M93A 5HFLA 4URMA 1N33O 3E35A 4J7ZA 1UYLA 2HKOA 3ASNC 1VIBA 4LF8O 3OMAB 1HNWB 2ZE6A 3LUTB 4P9OA 4I9QA 1GJVA 3F7VC 1B06A 4UROA 4YY3B 4O04A 3MDSA 2JEXA 2W0FC 5EYPB 4FLXA 4NH8A 4JV5B 5E1AC 1RM1B 1B04A 3W7UA 3CGYA 5J2UA 5H5NA 2UXCO 5JCOA 2D3OW 1GK9A 4PD4F 1JM6A 3TETA 3JZ3A 4KFGA 2ADPA 5EYPA 3K08A 2GDSA 3R92A 3JASB 3A0BZ 2BT0A 1PNKA 1V55C 4XTJA 2EULA 3C3SA 5IT9N 3FYIB 3OAAG 1VQ4V 1CP9A 4DUZB 2E75B 3OM3B 4CBCA 1W2BU 4YKZA 2KQXA 4DK0A 1ROPA 3SPIA 1YT0A 4AS9A 2Q0AA 2P6JA 5E79Z 2XJXA 3QO7A 3GVMA 4U7OA 3VQVA 3ML0A 3JASA 5KLVH 1VEWA 5L3BA 4JASA 4DRXA 5JJNB 4GX1A 1TH8A 3HKEB 4DR2B 5FNDA 2PNRA 3E8HA 2Y69B 2YI9A 4UVAA 1XI1A 3TZ2A 4GGLA 5K1XA 4DV6B 1GAXA 2NR5A 5H9CA 4MVMA 1L0NH 3ABKC 1IZ3A 2VQEO 1Y67A 1WA8B 4LF7O 1SRYA 2WPDG 1VQMV 1VQKV 4WF9V 3LNUA 1AR4A 2DWDC 3G6EV 1J95A 3ZRWA 3HKEA 4CE3A 2YSUB 3DXRB 4JI1O 1XMOO 1F4NA 4O07A 2C2AA 2CUGA 5B3SC 2QKSA 1L0OA 2GSMB 1SESA 5KMGB 4GT1A 3D8CA 1KQSU 1WA8A 3CSXA 2CCTA 2GQPA 3O2FA 2YEEA 2CCUA 4YKQA 4GKKB 1QLEB 3H1KH 4V26A 4N23A 4MTFA 4FIPC 1Y8PA 1N34B 3FYEB 2YGAA 4JQLA 4LWGA 3ZHTA 2UUBO 3DXRA 4E01A 4JI2B 2Z3YA 2DYRB 2HHHO 1Z5AA 1JFFB 3QF7A 4HY1A 2ZQMA 5KMGA 1EN5A 4L94A 3C3TA 3R91A 3HZ1A 1ZTEA 2Q0OC 5L3GA 1VF5B 2ZE8A 2YJXA 3B2EE 4O0BA 1UY8A 3M8AA 4DR4B 3IGAC 1BE3H 3A2FA 4DV2O 3A0TA 2PTMA 3HHUA 5AG2A 3CYGA 4WUCA 3ZHSA 5B5EZ 2K1EA 1JFFA 2DQ3A 4URNA 4X62B 2UU9B 2XDXA 3OTFA 1NHIA 3CGZA 2CAZC 4MTGA 3K59A 4I9WA 4FZ0A 1AVMA 3N27A 1R6TA 3RW0A 4JZGA 1TBWA 1D5NA 5KAFZ 1Z5VA 2BRCA 2Q7HA 3WB1A 4YIPA 2H8PC 4CS3A 1Q82W 4GFNA 5EZYB 2YKEA 2OT5A 1RPOA 3EHBB 1IBMO 3AG1B 2UXDB 4MBCA 1IBLO 4LWSB 4CH4A 3L74H 4E2LA 4LFBB 1QY8A 2DW4A 3ZHUA 5CBHA 2EIKC 4CWPA 3JD3A 2YE2A 4MP7A 5EZYA 4K8XA 3OWBA 4O05A 2F66C 1YI2V 1KU9A 5FNFA 1YJWV 2ZDIA 1EZVH 1ZUQA 3WB2A 1YT2A 3MHSC 1GN3A 4GX0A 5B1AC 3K57A 2UUAB 4J41A 1AILA 1GM8A 4DR5O 3E8BA 3EHFA 1OSFA 1YETA 4RQEA 2MK3A 1RPRA 3RBZA 1KUQA 1CXZB 4KXRA 3P30A 1BMFG 4GCZA 1Y6XA 1AI4A 4DYLA 4NTXA 1Y74B 2WEPA 4DV3B 4X64B 2IJJA 5LGTA 2BU2A 3EHHA 2BU7A 3A0YA 3KZIZ 1S0VA 2YXYA 5JQGB 1TUBB 4J42A 2YDEA 5LBQA 2QG2A 2AXTZ 1QZRA 2YECA 2DQ0A 1OCOB 3D2RA 3PJSK 2CGFA 5B1BB 2JVDA 4MVUA 5EBWC 4QJFB 4KHPO 2DJVA 5KHIA 1IXMA 2HCHA 2YEAA 1NQTA 3RVZA 1KD1W 1Y74A 2YE4A 2VCJA 4JI7B 3IEDA 3SJCC 2X6AA 5D5PA 5KHKA 4P8OA 3D36C 5JQGA 1TUBA 1R62A 1BT8A 5LMNO 1Z5CA 4X20B 2JS5A 3CE2A 4FLVA 2YEGA 1RP3B 3OMUA 1AR5A 1AH6A 1HW7A 4LF6B 3X2QB 2EIMC 4AI8A 2IU0A 1N32O 5D6PA 3E86A 2XAHA 3TZ4A 2G38A 1BHBA 2BU6A 2GBOA 1EZJA 3ICXA 2BYHA 1JX9A 1TAEA 4R6ZA 5CF0A 2AW9A 1YESA 4LWIA 1S5LZ 3AK2A 3MHHC 2IU3A 2XDLA 1OCCB 5BOCA 3T1KA 1B6QA 2WLJA 3VHDA 2MW2B 2QKCA 4W7TA 2QDOA 2HHIA 4LF4B 4YXWG 3D3IA 1AMWA 4G28B 3JD4A 1S14A 2YEDA 4DV7O 4DR6B 3CCRV 2Q8VA 3VBBA 2CH4A 3BMYA 1FXKB 3GWOA 4P2ZA 2CGNA 3U11A 4DV4B 4PI0A 3CHXA 4QE7A 3CRAA 4YHHB 2BOBC 1I5CA 2BTOA 3LDCA 1PKXA 3T1YO 2BTQB 4JI6O 1E1QG 4B7KA 2BCCH 4HYOA 4JYYA 5LA6B 4BXIA 4MTXA 3K58A 2EBOA 2E76B 2BE3A 4UUJC 3CYOA 3IC7A 4I4TB 2OTJV 1HDJA 1FXKA 2HJFC 4PJ0Z 4PRVA 2Q5ZA 5JCOC 1FPOA 1ZLZA 1WP8A 4NXNB 3H01A 2KG7B 4JI3O 3IC9A 5KHJA 1FYJA 1L0LH 1Z5BA 4CWSA 3RYCB 2EXLA 1RM1C 4LH6A 5LA6A 2QWOB 3U10A 1Q8IA 4WFEA 5J9PC 4H13B 1WLEA 4JZ2A 2IJHA 3OTOO 2LO1A 2LGWA 5IYDO 3GWKC 3K9AA 1T5EA 3DSQA 5KHGA 2R72A 4OX9B 1ENVA 3RYCA 3QO8A 2VQFB 1UYIA 4PA7A 2CG9A 2AKPA 3C11A 2IBZH 4C7UA 3AG4C 4GUNA 4R50A 4HXZA 2YIBA 3FB8C 3SPJA 4DV0B 2XT9A 1BQZA 2ZNIA 2B1IA 1XNRB 3T1HO 2QE7G 2HVKC 2X6CA 2VRZA 2RN9A 3G75A 4X65O 2Z5UA 1N36O 3VQWA 3BPZA 1K4CC 2ZR2A 2A9HA 4TV9B 3A0ZA 3ZM7A 5IDJA 1EBOA 4JI5O 4MVQA 2IWSA 4L93A 1H8HG 1US7A 1S5HC 4XDKA 3IAYA 3ZN0A 2EZPA 2QA4V 4HZ0A 2IOPA 2Y69C 1SQBH 4TOIA 2HG1A 3N2KB 1MA1A 4LF9B 4URLA 4ZIBA 4XKOA 3IJ4A 2PYLA 3M7MX 4TV9A 3CRLA 1GKFA 1N4CA 3H80A 1B63A 2XABA 2LQTA 2L6LA 3TXSA 3DC6A 3SJAC 3KCXA 3OE7G 4ASBA 2ZXWC 3JAKB 2ZE5A 3CCUV 3N2KA 3K04A 3ZKDA 1VMGA 4B7PA 5ITZB 3RN4A 1TGOA 2P4VA 5JVDB 2ITDC 2FWZA 1XEQA 4D7TA 3JYCA 1QLEC 3QTCA 1URFA 2VCIA 4FLUA 1NBMG 2WWWA 3ETGA 1K73W 4B08A 4B3SO 3LSQA 2UXCB 2OWOA 3JAKA 3TCUA 1P7GA 4FLZA 4B3TB 2DYRC 1SQQH 2XHRA 1Q5OA 5ITZA 5M4KA 5JJEB 2QJ1A 3VQXA 2IH1C 4R7CA 5JVDA 1XNQO 3HKBA 1NS1A 3OW6A 1G6UA 3THOA 5LOVB 3A0HZ 1O9HA 5C93A 1J5EO 4RUFA 1SQFA 4TQFA 4H37A 4O4JB 2P06A 1K5SA 1H2LA 3SGIA 1NI8A 1B3QA 1QBZA 1S77D 3JD1A 2JDIG 4JI4O 4H85A 1QHTA 1L8DA 3HB3B 1YEWA 1YF2A 5L3FA 3H1LH 2XX2A 4CWRA 3AG2B 4UCRA 1VQPV 2AHYA 1WB8A 3QDDA 3W7TA 5LOVA 1GM7A 1SERA 4FLWA 5IY5C
chains in the Genus database with same CATH topology
4HXWA 3OEEG 4K4OA 1YJ9V 1V54B 3TZ5A 2ESAA 2DYSB 3CCEV 1U2OA 3K06A 5GW7A 1OCZC 3G7BA 5M4PA 1OZ0A 4WFHA 4KTNA 3SYOA 1FXHA 4MPEA 5J71A 2ITCC 1AJQA 3AG1C 4JF3A 4RO2A 2ZDIC 2BYIA 1F4MA 3E8GA 2XASA 1Y4UA 2YEIA 4ZKIA 4MP2A 3K60A 4Z1MG 1ZXNA 1THZA 1MSWD 3BEHA 1PNLA 1PVGA 2Q67A 1I5AA 2W6IG 2M7WA 3OUSA 2WI3A 4EM7A 1H38A 4MVOA 3O6OA 3MNRP 1THNA 2YI7A 1NVPB 5EC2C 1I5DA 4QE9A 5EBLC 3E83A 3CMEV 4H81A 1ID0A 3RVYA 3GB7C 1AI6A 2ZKJA 4JYCA 2ZR3A 1OCOC 5FL7G 4WFAV 5B1BC 4WCEV 1QLNA 1VQ9V 2H8MA 4CWFA 3WHAA 1K34A 3FV5A 1NR7A 1MOFA 3OPDA 3HPLC 4RAIA 1YC4A 5B1NA 2WI4A 5CA3A 1TIDA 1B62A 3O0IA 1VQ6V 3X2QC 2BZ5A 2UXXA 4YKWA 3ZRVA 4PA3A 2EIJB 3CD6V 4LWFA 2IWUA 4EFTA 2A79B 4PL9A 4KP4A 4UVBA 1NHJA 2IJIA 2OTLV 2WI5A 1M9NA 4RUEA 1QVFU 2WLIB 3K0DA 1OCCC 1AJ6A 3LNMB 2XX5A 4WUDA 4EKWA 2YGFA 2WERA 2LFRA 4GX2A 1EFRG 1K4DC 4JTAB 1YSZA 1Y4SA 3T0HA 5FWKA 1FXKC 1G4YB 2ZBKB 2WLIA 4LBEC 5KA5A 1YSCA 1G8MA 3GIEA 3ABUA 3OW2U 4QNHB 1TC6A 2Q68A 1DF4A 2YEJA 2NNUA 3SL2A 1OCRB 1DLBA 2XK2A 2XAQA 1FS0G 3R4NA 4MT8A 1BXDA 2WLHA 2BU5A 2NLJC 1QR9A 2JJ1G 1A4HA 3FT8A 4CE2A 1W0KG 1FXVA 4QPJA 4JTCB 1UYKA 3CP1A 3F5WC 1R3JC 4AWPA 1MX0A 3UKMA 2FXSA 1BHAA 3EKOA 4R8CA 4PDVA 4CWNA 1K7DA 1Y4MA 2JKIA 1YTFD 1OHHG 4QPKA 1E1RG 3W7WA 3DTUB 3B24A 5CTYA 4FCPA 2BU8A 1Y8OA 1K9MW 4XDJA 1GMGA 1YERA 1ZWIC 3CMAV 3INXA 4HZ5A 3KG2A 3K99A 2R9IA 1KC8W 3SPCA 4FCRA 2YJWA 1I5XA 4HY6A 2R9RB 1UY9A 2QM8A 4HAMA 2Q2EB 1CPYA 3B8NA 1NVPD 4B6CA 4U93A 3OMNB 3G71V 4FCQA 2EJRA 3W7XA 2IW5A 5EK0A 3EHGA 3AG3B 4XKKA 4NH9A 4MVSA 5B1OA 1K33A 4JGSA 1N8RW 3E8FA 3RLPA 3ABKB 1UYFA 3B27A 4BIZA 4Q20A 4H7QA 4EGHA 4BQGA 3PEHA 1K8AW 4LPBA 2Q8FA 2WI2A 3AG2C 4MSWC 4WFFA 5D7DA 5DM6V 5M4NA 2XAFA 3WG7B 1QVGU 2Q8HA 3U67A 1K5QA 1V54C 4PA4A 4EGKA 2DYSC 1VQ7V 3OFNG 1Q7YW 4JAVA 2HG5C 2YE8A 5EBMC 3TUHA 1U0ZA 1UYMA 2ZDYA 3ZRXA 1S16A 1R6KA 3QNEA 5J6AA 2F43G 2UWDA 1H7UA 1PNMA 4CWOA 2YEBA 1P4RA 3K3WA 3T0ZA 1F23A 4L8ZA 3ASOB 3ZMZA 1UYHA 2P67A 3ABLB 3FT5A 3Q5LA 4MB9A 4KSGA 3CC7V 1XL6A 1PD3A 3NXSA 2UXNA 4X89A 2LFSA 4J9ZB 4ZBMA 3EKRA 1KIJA 4GQTA 3WQ9A 5CN0A 2W6JG 5F3KA 2WLLB 1ZWHA 1JVMA 3SPHA 2YEHA 2PI5A 2CCSA 4XKAA 3IFXA 2EIKB 3OGCC 4BIUA 4CE1A 1M57B 3SYAA 4E02A 3SYPA 4MPNA 2QEXV 1S76D 3AEIA 2YK2A 1QR8A 5FNCA 2YKCA 2XHXA 3ZRSA 1S72V 2WLLA 1AI5A 4U7NA 1NH2B 3ZN1A 4KFMA 2JEUA 2O1VA 2IWXA 4XBFA 3A0RA 2EIJC 4E00A 4XCJA 4MTOA 2CK3G 3OR6C 4J9YB 4GT8A 1FFTB 1GO3F 4PA6A 4MPCA 2IOQA 5GGZA 1YS3A 3DGEA 1R3LC 2PI4A 3R65A 5BZBA 2QF6A 2XCMA 2HKJA 4HYPA 2WI6A 1UJWB 3STLC 4XIQA 2FTKA 3LDEA 4XD8A 1JQ0A 4CWQA 4LWHA 4KUMA 2IH3C 3VOUA 1NJIW 4XDMA 1JOYA 2WSSG 1R73A 5D7CA 2Q8GA 5EC1C 1KP3A 4BAYA 3BM9A 3K98A 2ZD9A 1BGQA 1OCRC 1GM9A 2DWEC 3CRKA 2QFOA 1R6NA 3A0XA 4YKYA 5CTWA 3Q5KA 2JK5C 2H55A 5KA6A 5KUKA 4BAEA 1P7BA 5L3DA 3U2DA 5IYCO 1W0JG 1I5BA 2ATKC 4F4LA 3G4SV 3FB6C 1BL8A 1VQ8V 4XITA 1R3IC 2IJKA 3OR7C 3E89A 4P30A 3SYCA 2QG0A 2FYPA 3OWDA 3WFVA 2WI1A 2K5BA 3W7SA 3TK1A 1AROP 2V1DA 3T4DA 2XHTA 1AI7A 2YI6A 5M4MA 5DN6G 1H2GA 2B1GA 1F51A 4JYBA 3T4ZA 3VADA 3ZMSA 1QYEA 3ZXQA 2HR3A 3MD0A 1M56B 1EI1A 2BOCC 3K97A 4MW3A 3FB7C 4EGIA 4XE2A 4YKUA 5IN9A 1UYGA 5F5RA 2B5UA 2EZOA 2X7RB 1MU5A 3AG4B 4EFUA 3Q5JA 2YE3A 2YK9A 4N21A 3CCJV 1S3JA 4LP0A 2QTOA 4UV8A 1YJNV 1DF5A 4EMVA 4WFBV 3D0BA 1VQOV 1VQ5V 4KSHA 2A0LA 3TZ0A 2X0LA 3FKSG 3R4OA 4RQFA 3ZRWB 4GX5A 3AG3C 2XJJA 4XC0A 1UYDA 3LSSA 4PDLA 3RLQA 2O1UA 2BTZA 4X9LA 5CBGA 3EHJA 2HLDG 3ZCCA 4XIRA 3SYQA 5LHHA 1Q86W 2ZXWB 2GFDA 3GIFA 3WG7C 1KECA 2XDSA 4V25A 1AM1A 4XCLA 4I5SA 1NH2D 3CPWU 4UVCA 3KE6A 1I58A 4EEHA 2YE9A 2XAJA 4FPPA 1VQNV 2EINB 1TC0A 3STZC 3ZIAG 4HYMA 5CTUA 2HFEC 4TT3G 4L90A 4P9PA 3ASOC 1L1FA 3EFFK 3B77A 1SZTA 1AH8A 5M4EA 2VWCA 4ASGA 3ABLC 2Q69A 3HYZA 2BSMA 4YKRA 4XDLA 3UM7A 1GKXA 2HVJC 1UY6A 4L91A 3ETEA 5IY5B 4I3HA 5L3EA 2P90A 5L3JA 3ABMB 2OCCB 5CPHA 1ORQC 1OCZB 1Q81W 1YHQV 2EILB 3F7YC 2YEVB 5IYBO 3ASNB 1I59A 1BKNA 2ZDXA 2WLKA 2FWYA 3INWA 3GIGB 4TWKA 1M57C 2YEFA 2YE7A 2XD6A 1DTOA 2YEVA 4MVRA 4MW8A 3A0WA 1ZXMA 3ZJZA 1VQLV 3GIGA 4JAUA 5L3CA 2XJGA 4O09A 2WEQA 4YKXA 1V55B 3H4LA 4R1FA 1H7SA 4XIPA 1WPXA 3QTFA 2WLMA 5M4HA 4YKTA 5H6RA 1K92A 1SETA 4AWOA 1M90W 1MABG 4QIWF 4CZZA 1YC3A 2XDKA 3BY6A 1Y66A 3R4PA 1YSRA 4LWEA 4UV9A 4PELA 2YI5A 1MG1A 5CBFA 3CCMV 2XAGA 4JPRA 1UYEA 4PU9A 3SJQC 4ASAA 4L87A 5CTXA 1I5YA 4DUHA 3CCSV 4DO2A 4MOTA 3OMIB 1AJNA 5KUMA 4OXSA 1HWYA 3K79A 4JTDB 3CCQV 1XL4A 3T10A 3JCZA 5B3SB 1GTOA 3E2EA 4NH7A 3HZ5A 1AJPA 4P7AA 2O1WA 1LNQA 3I56V 4ASFA 1BYQA 2H94A 2GHYA 1UYCA 2JJCA 1Z59A 4MVZA 3VHCA 3VHAA 2Q6AA 1KZNA 4X8AA 2VW5A 4PDRA 2X6BA 2LP7A 2WI7A 4KQVA 1UY7A 4G2KA 3QO5A 4ASUG 3JD2A 1H8EG 1ZW9A 2JJ2G 3P32A 2YGEA 1R3KC 3FB5C 4AWQA 2JIZG 1YIJV 3TTZA 1GKZA 3CC2V 1Y8NA 2YKIA 2AHZA 3M99B 2KB1A 2P7TC 4BW5A 3K03A 4DXWA 1NHHA 3ZMVA 3K0GA 5D7RA 2XNDG 3B8MA 1M56C 3CWVA 5D6QA 2Q8IA 5LHIA 2XX4A 5LHGA 4R3AA 3CC4V 5IDMA 2V7QG 3C0EA 2YE5A 3B28A 3OEHG 1K97A 4H33A 5LGNA 3T2SA 4CWTA 4FMTA 3T1CA 1JCHA 1NKDA 4R3MA 3RKZA 3I55V 1TUEB 4PA9A 2WAMA 4ZVIA 5LGUA 5CMUA 5B1AB 2YI0A 4FJCC 1COWG 4PRXA 3LPSA 4HZ3A 5BODA 3CCVV 4LP8A 3T2MA 3LDDA 1TILA 2XDUA 4GEEA 4TSFG 1YT1A 4BQJA 2YE6A 1KP2A 3ZMTA 4WUBA 3SPGA 1CEZA 2QM7A 3CXCU 3B25A 1EA6A 4LCUC 3PEJA 1K3EA 5H6QA 2IORA 3ZKBA 3R4MA 1AR1B 3RLRA 1M1KW 4PDMA 3NMQA 1YC1A 3HEKA 3OUFA 2EIMB 2YKJA 2EINC 2YKBA 4FK5C 4DZYA 3D36A 1JJ2U 1NR1A 2WLNA 3B26A 3ETDA 3HYYA 1YITV 4G27B 5HFMA 1KKDA 4WFGA 1QCEA 3JD0A 3U2KA 4UXNA 3G7EA 3ABMC 1E79G 2OCCC 2XOKG 2Y48A 3CCLV 2BREA 4LC1A 3ZMUA 4X88A 1PL0A 3ABTA 2EILC 1JPXA 1YTFB 2E0AA 3ZXOA 4MS2A 5HFLA 4URMA 3E35A 1UYLA 2HKOA 3ASNC 3OMAB 3LUTB 4P9OA 1GJVA 3F7VC 4UROA 4O04A 2JEXA 2W0FC 4NH8A 5E1AC 1RM1B 3W7UA 3CGYA 2D3OW 1GK9A 1JM6A 3TETA 3JZ3A 4KFGA 3K08A 3R92A 2BT0A 1PNKA 1V55C 4XTJA 3FYIB 3OAAG 1VQ4V 1CP9A 3OM3B 4CBCA 1W2BU 4YKZA 1YT0A 1ROPA 3SPIA 4AS9A 2P6JA 2XJXA 3QO7A 4U7OA 3ML0A 5L3BA 4JASA 4GX1A 1TH8A 5FNDA 2PNRA 3E8HA 2Y69B 4UVAA 3TZ2A 4GGLA 5H9CA 4MVMA 3ABKC 1SRYA 2WPDG 1VQMV 1VQKV 4WF9V 3LNUA 2DWDC 3G6EV 1J95A 3ZRWA 4CE3A 2YSUB 1F4NA 4O07A 2C2AA 5B3SC 2QKSA 1L0OA 2GSMB 1SESA 4GT1A 1KQSU 2CCTA 2GQPA 3O2FA 2YEEA 2CCUA 4YKQA 1QLEB 4V26A 4N23A 4MTFA 4FIPC 1Y8PA 3FYEB 2YGAA 4JQLA 4LWGA 4E01A 2Z3YA 2DYRB 1Z5AA 4HY1A 2ZQMA 4L94A 3R91A 3HZ1A 5L3GA 2YJXA 4O0BA 1UY8A 3IGAC 3A0TA 3HHUA 4WUCA 2K1EA 2DQ3A 4URNA 2XDXA 1NHIA 3CGZA 4MTGA 4I9WA 3RW0A 1TBWA 2BRCA 2H8PC 1Q82W 4GFNA 2YKEA 2OT5A 1RPOA 3EHBB 3AG1B 4MBCA 4E2LA 1QY8A 2DW4A 5CBHA 2EIKC 4CWPA 3JD3A 2YE2A 4MP7A 3OWBA 4O05A 1YI2V 5FNFA 1YJWV 2ZDIA 1YT2A 3MHSC 4GX0A 5B1AC 1GM8A 3EHFA 3E8BA 1OSFA 1YETA 4RQEA 2MK3A 1RPRA 3RBZA 3P30A 1BMFG 4GCZA 1AI4A 2WEPA 2IJJA 5LGTA 2BU2A 3EHHA 2BU7A 3A0YA 1S0VA 5LBQA 2QG2A 1QZRA 2YECA 2DQ0A 1OCOB 3D2RA 3PJSK 2CGFA 5B1BB 4MVUA 5EBWC 4QJFB 2HCHA 1IXMA 2YEAA 1NQTA 3RVZA 1KD1W 2YE4A 2VCJA 3IEDA 2X6AA 4P8OA 1R62A 1Z5CA 2YEGA 3OMUA 1AH6A 3X2QB 2EIMC 2IU0A 5D6PA 3E86A 2XAHA 3TZ4A 1BHBA 2BU6A 1EZJA 2BYHA 1JX9A 4R6ZA 5CF0A 1YESA 4LWIA 3MHHC 2IU3A 2XDLA 1OCCB 5BOCA 3T1KA 1B6QA 2WLJA 3VHDA 4W7TA 4YXWG 3D3IA 1AMWA 4G28B 3JD4A 1S14A 2YEDA 3CCRV 3VBBA 2CH4A 3BMYA 1FXKB 3GWOA 4P2ZA 4QE7A 2BOBC 1I5CA 3LDCA 1PKXA 1E1QG 4HYOA 4BXIA 4MTXA 2EBOA 4UUJC 3CYOA 3IC7A 2OTJV 1FXKA 2HJFC 4PRVA 3H01A 1Z5BA 4CWSA 2EXLA 1RM1C 4WFEA 5J9PC 1WLEA 2IJHA 5IYDO 3K9AA 1ENVA 3QO8A 1UYIA 4PA7A 2CG9A 2AKPA 3C11A 3AG4C 4R50A 4HXZA 3FB8C 3SPJA 2B1IA 2QE7G 2HVKC 2X6CA 3G75A 2Z5UA 1K4CC 2ZR2A 2A9HA 3A0ZA 3ZM7A 5IDJA 1EBOA 4MVQA 2IWSA 4L93A 1H8HG 1US7A 1S5HC 4XDKA 3ZN0A 2EZPA 2QA4V 4HZ0A 2IOPA 2Y69C 2HG1A 4URLA 4XKOA 3CRLA 1GKFA 3H80A 1B63A 2XABA 3OE7G 4ASBA 2ZXWC 3CCUV 3K04A 3ZKDA 4B7PA 2ITDC 2FWZA 3JYCA 1QLEC 2VCIA 1NBMG 2WWWA 3ETGA 1K73W 3LSQA 3TCUA 2XHRA 2DYRC 5M4KA 2IH1C 4R7CA 3OW6A 5C93A 4RUFA 4H37A 1K5SA 1B3QA 1QBZA 1S77D 3JD1A 2JDIG 4H85A 3HB3B 5L3FA 2XX2A 4CWRA 3AG2B 1VQPV 3QDDA 2AHYA 3W7TA 1GM7A 1SERA 5IY5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2A A;  4HXW A;  4K4O A;  4YKX A;  1L0O A;  2LFS A;  3TZ5 A;  3H4L A;  4R1F A;  2ESA A;  4GT1 A;  1H7S A;  4XIP A;  3QTF A;  1U2O A;  5M4H A;  2CCT A;  2GQP A;  3O2F A;  4YKT A;  2YEE A;  2CCU A;  3G7B A;  4YKQ A;  5M4P A;  4AWO A;  4V26 A;  4KTN A;  1Y8P A;  4MPE A;  5J71 A;  2YGA A;  3EKR A;  4JQL A;  1KIJ A;  1YC3 A;  4LWG A;  2XDK A;  4GQT A;  3R4P A;  4E01 A;  3WQ9 A;  1YSR A;  5F3K A;  4LWE A;  1ZWH A;  1Z5A A;  2BYI A;  2YEH A;  4HY1 A;  2CCS A;  4XKA A;  2YI5 A;  4L94 A;  4CE1 A;  4BIU A;  3R91 A;  3HZ1 A;  1Y4U A;  4E02 A;  2YEI A;  4ZKI A;  4MP2 A;  2YJX A;  3K60 A;  4MPN A;  4O0B A;  1UY8 A;  1ZXN A;  2YK2 A;  5FNC A;  2YKC A;  1UYE A;  2XHX A;  4PU9 A;  4ASA A;  5CTX A;  1PVG A;  3A0T A;  1I5A A;  4DUH A;  4U7N A;  4MOT A;  3HHU A;  4WUC A;  4URN A;  2WI3 A;  2O1V A;  4EM7 A;  2IWX A;  3O6O A;  2XDX A;  3MNR P;  1NHI A;  3CGZ A;  1THN A;  3A0R A;  2YI7 A;  1I5D A;  4E00 A;  3T10 A;  4XCJ A;  4NH7 A;  3HZ5 A;  4H81 A;  4P7A A;  4GT8 A;  1ID0 A;  4MPC A;  1TBW A;  2O1W A;  2IOQ A;  5GGZ A;  1YS3 A;  2BRC A;  3DGE A;  4ASF A;  1BYQ A;  2QF6 A;  1UYC A;  2XCM A;  2JJC A;  2ZKJ A;  1Z59 A;  2HKJ A;  4JYC A;  4GFN A;  4HYP A;  3VHC A;  3VHA A;  2YKE A;  1KZN A;  2VW5 A;  2WI6 A;  4XIQ A;  2WI7 A;  4MBC A;  4KQV A;  1UY7 A;  2FTK A;  2H8M A;  1QY8 A;  4CWF A;  3WHA A;  3FV5 A;  4XD8 A;  3OPD A;  1ZW9 A;  4CWP A;  1YC4 A;  5B1N A;  3P32 A;  2YE2 A;  4MP7 A;  2WI4 A;  2YGE A;  1TID A;  4CWQ A;  1B62 A;  3O0I A;  3OWB A;  4O05 A;  4LWH A;  5FNF A;  4XDM A;  4AWQ A;  1YT2 A;  1JOY A;  2BZ5 A;  5D7C A;  2Q8G A;  3TTZ A;  1GKZ A;  4YKW A;  3EHF A;  3ZRV A;  1OSF A;  1YET A;  3BM9 A;  1Y8N A;  2YKI A;  4LWF A;  3K98 A;  2IWU A;  1BGQ A;  1NHH A;  4EFT A;  4GCZ A;  3CRK A;  2QFO A;  4PL9 A;  4KP4 A;  2WEP A;  5D7R A;  3A0X A;  2BU2 A;  3EHH A;  1NHJ A;  2BU7 A;  3A0Y A;  4YKY A;  2WI5 A;  3CWV A;  5D6Q A;  2Q8I A;  5CTW A;  3Q5K A;  2XX4 A;  2QG2 A;  1QZR A;  2YEC A;  4R3A A;  2H55 A;  1AJ6 A;  2XX5 A;  3D2R A;  2CGF A;  4WUD A;  5IDM A;  2YGF A;  2WER A;  3C0E A;  2LFR A;  2YE5 A;  3B28 A;  4BAE A;  2HCH A;  1IXM A;  3T2S A;  2YEA A;  4CWT A;  1YSZ A;  4FMT A;  2YE4 A;  3U2D A;  1I5B A;  1Y4S A;  2VCJ A;  3T0H A;  5FWK A;  3IED A;  4P8O A;  2ZBK B;  1R62 A;  4XIT A;  1Z5C A;  4R3M A;  3RKZ A;  2YEG A;  3OMU A;  1AH6 A;  4ZVI A;  2QG0 A;  2FYP A;  2YI0 A;  3OWD A;  2WI1 A;  3GIE A;  5D6P A;  2K5B A;  3TK1 A;  3TZ4 A;  4PRX A;  1TC6 A;  2XHT A;  2BU6 A;  2YI6 A;  3LPS A;  5M4M A;  5BOD A;  2YEJ A;  3SL2 A;  2BYH A;  1F51 A;  4JYB A;  3VAD A;  5CF0 A;  2XK2 A;  1YES A;  4LWI A;  1TIL A;  1QYE A;  2XDU A;  3ZXQ A;  3MD0 A;  1YT1 A;  4GEE A;  1EI1 A;  4BQJ A;  2YE6 A;  2XDL A;  3K97 A;  4WUB A;  3R4N A;  4MT8 A;  2QM7 A;  1BXD A;  3B25 A;  5BOC A;  3T1K A;  3VHD A;  4EGI A;  4XE2 A;  4W7T A;  2BU5 A;  1EA6 A;  1AMW A;  3PEJ A;  4YKU A;  5IN9 A;  1S14 A;  1UYG A;  2YED A;  5F5R A;  1A4H A;  3FT8 A;  2CH4 A;  1MU5 A;  4CE2 A;  2IOR A;  3ZKB A;  4EFU A;  3Q5J A;  3R4M A;  2YE3 A;  3BMY A;  2YK9 A;  3RLR A;  4QPJ A;  1UYK A;  4LP0 A;  1I5C A;  3NMQ A;  4EMV A;  1YC1 A;  3HEK A;  4BXI A;  2YKJ A;  2YKB A;  3D0B A;  4KSH A;  4AWP A;  4MTX A;  3TZ0 A;  4DZY A;  1MX0 A;  3R4O A;  3D36 A;  2FXS A;  4PRV A;  3ZRW B;  3EKO A;  2XJJ A;  4XC0 A;  1UYD A;  4CWN A;  1Z5B A;  4CWS A;  2EXL A;  2JKI A;  3RLQ A;  4QPK A;  2O1U A;  2BTZ A;  4X9L A;  3B26 A;  3EHJ A;  3HYY A;  3B24 A;  3ZCC A;  5CTY A;  4FCP A;  2BU8 A;  1Y8O A;  4XIR A;  1YER A;  3INX A;  3U2K A;  4HZ5 A;  3K99 A;  2GFD A;  3GIF A;  2XDS A;  3G7E A;  1UYI A;  4V25 A;  1AM1 A;  4XCL A;  2CG9 A;  2AKP A;  4I5S A;  3C11 A;  4FCR A;  4HXZ A;  2YJW A;  3KE6 A;  4HY6 A;  2BRE A;  1UY9 A;  2QM8 A;  4LC1 A;  1I58 A;  4EEH A;  2YE9 A;  4FPP A;  2Q2E B;  2E0A A;  3ZXO A;  3G75 A;  4URM A;  4B6C A;  4U93 A;  1TC0 A;  1UYL A;  3A0Z A;  4FCQ A;  3ZM7 A;  5IDJ A;  4HYM A;  5CTU A;  2IWS A;  1GJV A;  4L93 A;  3EHG A;  1US7 A;  4URO A;  4XKK A;  4NH9 A;  4O04 A;  5B1O A;  4L90 A;  4HZ0 A;  2IOP A;  4NH8 A;  2HG1 A;  1AH8 A;  4URL A;  3RLP A;  1UYF A;  5M4E A;  2VWC A;  3B27 A;  4ASG A;  4XKO A;  4BIZ A;  4Q20 A;  4H7Q A;  4EGH A;  4BQG A;  3CGY A;  3HYZ A;  2BSM A;  3PEH A;  4LPB A;  2Q8F A;  3CRL A;  4YKR A;  3H80 A;  1B63 A;  2XAB A;  2WI2 A;  1GKX A;  1JM6 A;  1UY6 A;  4L91 A;  3JZ3 A;  4I3H A;  4KFG A;  5D7D A;  5M4N A;  4ASB A;  5L3J A;  2Q8H A;  3U67 A;  3R92 A;  2BT0 A;  5CPH A;  3ZKD A;  4B7P A;  4XTJ A;  4EGK A;  2FWZ A;  4YKZ A;  1YT0 A;  2VCI A;  4JAV A;  4AS9 A;  2YE8 A;  3TUH A;  1U0Z A;  1UYM A;  2WWW A;  2ZDY A;  2XJX A;  3ZRX A;  1S16 A;  4U7O A;  5J6A A;  1I59 A;  1BKN A;  2XHR A;  2UWD A;  2ZDX A;  1H7U A;  5M4K A;  2FWY A;  3INW A;  4JAS A;  4CWO A;  3GIG B;  3OW6 A;  1TH8 A;  2YEF A;  2YEB A;  2YE7 A;  3T0Z A;  4L8Z A;  5C93 A;  5FND A;  2PNR A;  2XD6 A;  3TZ2 A;  4GGL A;  1UYH A;  2P67 A;  1B3Q A;  3FT5 A;  3Q5L A;  4MB9 A;  4KSG A;  4H85 A;  3A0W A;  1ZXM A;  3GIG A;  2XX2 A;  3LNU A;  3NXS A;  4CWR A;  3ZRW A;  4JAU A;  3QDD A;  4CE3 A;  2XJG A;  4O09 A;  2WEQ A;  4O07 A; 
#chains in the Genus database with same CATH topology
 2CGO A;  4O4J A;  5LMU O;  4HXW A;  3OEE G;  4K4O A;  3ZHR A;  1YJ9 V;  1V54 B;  3TZ5 A;  3L70 H;  2ESA A;  2DYS B;  1EM1 A;  3CCE V;  1U2O A;  3K06 A;  5GW7 A;  1OCZ C;  3G7B A;  5M4P A;  1OZ0 A;  1WP7 A;  4CS2 A;  4WFH A;  4KTN A;  4F6R B;  3SYO A;  1FXH A;  4NXM O;  4MPE A;  5FPR A;  5J71 A;  2ITC C;  1OJH A;  2VQE B;  4LF7 B;  1AJQ A;  2QM4 A;  3OT7 A;  3AG1 C;  4JF3 A;  4RO2 A;  1SQV H;  3BA8 A;  2ZDI C;  1MMM A;  2BYI A;  1F4M A;  1QNM A;  1IVS A;  3E8G A;  1MZE A;  1HR0 O;  1I94 O;  5JH7 B;  4JI1 B;  1XMO B;  2XAS A;  3RYH B;  1FJG O;  4FVM A;  1Y4U A;  4BW9 A;  2YEI A;  4ZKI A;  4AQY B;  2N05 A;  4MP2 A;  4F6R A;  3K60 A;  1YCI A;  2PYJ A;  3J7A U;  2Z0A A;  4Z1M G;  1ZXN A;  1PM9 A;  1R1B A;  1THZ A;  1MSW D;  3BEH A;  3EXA A;  3S3W A;  1PNL A;  1PVG A;  1GN6 A;  2Q67 A;  1I5A A;  2W6I G;  3AG7 A;  2WA4 A;  4NTY A;  2M7W A;  3OUS A;  4PI2 A;  2CTP A;  2A06 H;  2WI3 A;  4EM7 A;  1H38 A;  4MVO A;  4JI8 O;  3O6O A;  3RYH A;  5LP6 B;  3MNR P;  5IWA O;  2O57 A;  1THN A;  5IYZ B;  4IYH A;  2YI7 A;  1Q6U A;  5EC2 C;  1NVP B;  4QE9 A;  1H2M A;  1I5D A;  5EBL C;  3E83 A;  2ZIM A;  5GTI Z;  3CME V;  4H81 A;  1ID0 A;  2QR4 A;  4LH7 A;  3RVY A;  3GB7 C;  4Q6G A;  5LL6 Y;  1AI6 A;  2F95 B;  1KKC A;  4K0K B;  3QVN A;  2ZKJ A;  1SQP H;  4UCO A;  4JYC A;  2ZR3 A;  5LP6 A;  4DUY O;  4JI0 B;  5IJ9 B;  1UFI A;  1OCO C;  2Q73 A;  5FL7 G;  3L71 H;  4WFA V;  5B1B C;  4WCE V;  4B3M O;  1QLN A;  1VQ9 V;  2H8M A;  1IBK B;  3ZHQ A;  4CWF A;  3WHA A;  1K34 A;  1XOU A;  1GN2 A;  3FV5 A;  1NR7 A;  1MOF A;  3OPD A;  3HPL C;  4RAI A;  1YC4 A;  2A7W A;  2YIB D;  5B1N A;  1ZAU A;  1AB3 A;  2WI4 A;  5CA3 A;  4DK1 A;  1TID A;  1XMQ O;  3HR0 A;  5IJ9 A;  1B62 A;  2KKW A;  3O0I A;  1VQ6 V;  2M6Y A;  4CS4 A;  3X2Q C;  2BZ5 A;  2UXX A;  4YKW A;  1H2N A;  2RJZ A;  3ZRV A;  5KX5 B;  1DGS A;  4PA3 A;  2EIJ B;  1BGY H;  4JAA A;  3CD6 V;  4LWF A;  5CA1 B;  2IWU A;  3CRQ A;  4EFT A;  2A79 B;  2P5O A;  4GKJ O;  4PL9 A;  4KP4 A;  4UVB A;  5C8Y B;  5A9G A;  3L73 H;  1NHJ A;  2IJI A;  1WNS A;  3O65 A;  2OTL V;  1M9N A;  2WI5 A;  4RUE A;  4DR1 B;  3FAV B;  4DW1 A;  1QVF U;  2WLI B;  3K0D A;  1OCC C;  2ZCE A;  5KX5 A;  1O9G A;  3CS5 A;  3LNM B;  1AJ6 A;  2XX5 A;  2D2C B;  4WUD A;  4CH6 A;  4EKW A;  4LF5 B;  2L35 A;  2YGF A;  2WER A;  2LFR A;  4GX2 A;  5CA1 A;  1EFR G;  4YY3 O;  1K4D C;  4JTA B;  1YSZ A;  5C8Y A;  1Y4S A;  3T0H A;  5FWK A;  4JV5 O;  1EN6 A;  1FXK C;  1G4Y B;  2ZBK B;  1MZF A;  3FAV A;  2WLI A;  1SA0 B;  2DE0 X;  3KKY A;  1P49 A;  4LBE C;  5KA5 A;  1YSC A;  1G8M A;  5CB4 B;  3RGB A;  3GIE A;  3ABU A;  4IT5 A;  3VQY A;  4I50 B;  3OW2 U;  4QNH B;  1TC6 A;  4UCT A;  4X1Y B;  1PL4 A;  2Q68 A;  1DF4 A;  2YEJ A;  2NNU A;  3SL2 A;  2GUZ B;  4TV8 B;  1OCR B;  1DLB A;  2XK2 A;  2XAQ A;  2FKX A;  2OIG A;  5CB4 A;  4RWU A;  1FS0 G;  5LMN B;  3H1H H;  3R4N A;  4MT8 A;  4W4L A;  1M5I A;  1N0J A;  1BXD A;  4I50 A;  2WLH A;  5GON B;  1XIL A;  2BU5 A;  1N32 B;  2NLJ C;  1KYO F;  2GUZ A;  4TV8 A;  3WB0 A;  2YXH A;  1QR9 A;  2N04 A;  3WU2 Z;  2JJ1 G;  3BCC H;  1ZL8 B;  1A4H A;  3FT8 A;  4CE2 A;  1W0K G;  1U97 A;  1FXV A;  4Z1V A;  5GTH Z;  5DEC A;  3I5D A;  2ZIN A;  3BAA A;  4QPJ A;  2Y0P A;  4JYA O;  1DK1 A;  4JTC B;  4BWA A;  1UYK A;  5GON A;  1SZX A;  2A3Q A;  3CP1 A;  2XUM A;  3N2G B;  3F5W C;  3L72 H;  4L8J A;  5KAI Z;  3CRM A;  1R3J C;  3JSL A;  4LWS A;  4AWP A;  1ZL8 A;  1MX0 A;  3UKM A;  2FXS A;  1BHA A;  3EKO A;  1HNX O;  2R70 A;  4R8C A;  4DV7 B;  4PDV A;  5BR8 B;  4CWN A;  1K7D A;  3N2G A;  1Y4M A;  2QKA A;  4GKK O;  2JKI A;  4DR7 B;  1YTF D;  1OHH G;  4QPK A;  1E1R G;  2ZM6 O;  1N34 O;  3W7W A;  3DTU B;  4B3R B;  2UXB B;  3B24 A;  5DED A;  5CTY A;  2E5L B;  2E3C A;  4FCP A;  3T1Y B;  2BU8 A;  5LXT B;  1Y8O A;  1K9M W;  4XDJ A;  1GMG A;  1YER A;  1ZWI C;  3CMA V;  3INX A;  2FL4 A;  3DC5 A;  4Z2W A;  4HZ5 A;  3KG2 A;  3K99 A;  1TA8 A;  4DR4 O;  2R9I A;  4LFA O;  3RT3 C;  1KC8 W;  3SPC A;  4FCR A;  5BXZ A;  3A8T A;  2YJW A;  1I5X A;  4HY6 A;  2R9R B;  4HBN A;  4NYK A;  5LXT A;  1UY9 A;  2QM8 A;  3AK3 A;  4HAM A;  3UO3 A;  2Q2E B;  3H9V A;  2UU9 O;  1CPY A;  3B8N A;  1NVP D;  4B6C A;  3U0Z A;  4U93 A;  1KB9 F;  4FM0 A;  3OTO B;  3OMN B;  3G71 V;  2F4V O;  4FCQ A;  1MSD A;  2EJR A;  4A5U B;  3W7X A;  2IW5 A;  5EK0 A;  3EHG A;  2F23 A;  3AG3 B;  4O4H B;  4XKK A;  4NH9 A;  4MVS A;  5B1O A;  4X20 A;  1K33 A;  4I7Z B;  1BQ0 A;  4JGS A;  2PUS A;  1F7Y A;  1N8R W;  3E8F A;  4YJ3 B;  4X66 B;  3RLP A;  3ABK B;  1UYF A;  1NTM H;  3B27 A;  1BS3 A;  3T1H B;  4BIZ A;  4Q20 A;  4H7Q A;  4EGH A;  1V9P A;  4BQG A;  3PEH A;  1K8A W;  4LPB A;  2Q8F A;  2UXD O;  4H0L B;  3UO2 A;  4X65 B;  1WJZ A;  1N36 B;  2WI2 A;  4LFB O;  1JR9 A;  1HNZ O;  2LW7 A;  3AG2 C;  4MSW C;  4WFF A;  5D7D A;  4YJ2 B;  5DM6 V;  5M4N A;  2XAF A;  4JI5 B;  3WG7 B;  1QVG U;  2Q8H A;  3U67 A;  4YJ3 A;  5BMV B;  4OPH A;  4D6T H;  1K5Q A;  5TIS Z;  1V54 C;  4PA4 A;  4EGK A;  4GZR B;  2DYS C;  1VQ7 V;  3OFN G;  4CH5 A;  1Q7Y W;  1H2K A;  2Y4U A;  2VWJ A;  4JAV A;  2HG5 C;  2YE8 A;  2RCV A;  5EBM C;  3TUH A;  1U0Z A;  2PF4 E;  5CA0 B;  1UYM A;  2ZDY A;  3ZRX A;  4YJ2 A;  1S16 A;  1R6K A;  3QNE A;  5J6A A;  2F43 G;  5BMV A;  2UWD A;  1RSO B;  1ZX3 A;  1H7U A;  4X9Q A;  1PNM A;  4CWO A;  4PHZ A;  3S5T A;  2YEB A;  1P4R A;  1GRJ A;  4DV3 O;  3K3W A;  5KHH A;  4X64 O;  3T0Z A;  1F23 A;  4L8Z A;  4DW0 A;  5FLX N;  3ASO B;  5CA0 A;  2LW1 A;  2BTQ A;  3ZMZ A;  4J10 A;  1UYH A;  1TVK B;  2P67 A;  2QWP B;  3ABL B;  3JAT B;  3FT5 A;  3Q5L A;  4MB9 A;  4KSG A;  4NR1 A;  2Q9L A;  1RSO A;  4I4T A;  3CC7 V;  1XL6 A;  1PD3 A;  2DN9 A;  3NXS A;  5LP6 C;  3JAW B;  1YDX A;  2UUC O;  2KG7 A;  4JI7 O;  3G80 A;  5LYJ B;  1NT2 B;  2UXN A;  4X89 A;  1XNQ B;  2PGG A;  4HNA B;  4IL6 Z;  3RFR A;  3ETQ A;  2LFS A;  4J9Z B;  3JAT A;  2JGU A;  4NVP A;  3APO A;  4ZBM A;  3EKR A;  1KIJ A;  4ZHQ B;  2ZE7 A;  3OGI B;  4JI4 B;  4GQT A;  5LYJ A;  3WQ9 A;  5CN0 A;  2W6J G;  2YID A;  5F3K A;  2WLL B;  2CTW A;  1ZWH A;  2CTR A;  2JRI A;  1JVM A;  3SPH A;  2YEH A;  2PI5 A;  2CCS A;  4XKA A;  3IFX A;  2EIK B;  3OGC C;  4BIU A;  4CE1 A;  1M57 B;  3CXH F;  2WA3 A;  2FML A;  3PN1 A;  3SYA A;  4E02 A;  1VF7 A;  3FD9 A;  3SYP A;  4ABM A;  4MPN A;  2QEX V;  1S76 D;  2ZKO A;  4K3A A;  3AEI A;  2YK2 A;  1QR8 A;  5FNC A;  2YKC A;  2XHX A;  3ZRS A;  1S72 V;  2WLL A;  3D3Q A;  4DV5 B;  2YS8 A;  1AI5 A;  4U7N A;  4NXM B;  1NH2 B;  1LUW A;  3ZN1 A;  4O4I B;  4KFM A;  2JEU A;  2O1V A;  4IGG A;  1FKA O;  2IWX A;  5A2Q N;  4XBF A;  1Z2G A;  2Y4T A;  1N33 B;  4DV1 O;  3A0R A;  4NTW A;  4LF8 B;  2EIJ C;  4E00 A;  4XCJ A;  4MTO A;  2CK3 G;  2Q4P A;  3OR6 C;  1HR0 B;  1I94 B;  4J9Y B;  4GT8 A;  1FFT B;  1FJG B;  1GO3 F;  4PA6 A;  4MPC A;  1XHX A;  2IOQ A;  5GGZ A;  5K1P A;  1YS3 A;  3DGE A;  3CJH B;  3CRR A;  1R3L C;  3ZHV A;  2PI4 A;  3R65 A;  5BZB A;  2QF6 A;  2XCM A;  2HKJ A;  2ODM A;  4HYP A;  1KBH A;  2ZIO A;  4NB5 A;  4ZOL B;  4FFB B;  3ZS8 C;  2WI6 A;  2Q7E A;  1UJW B;  3STL C;  4XIQ A;  3CB2 A;  5IWA B;  2DMX A;  2FTK A;  2RMK B;  3LDE A;  2BSK B;  4XD8 A;  1JQ0 A;  4KL1 A;  4CWQ A;  4ZOL A;  4FFB A;  4LWH A;  4KUM A;  2IH3 C;  1Q43 A;  4O4L B;  3VOU A;  1NJI W;  4XDM A;  1OV9 A;  2LJ2 A;  1JOY A;  2WSS G;  2YI8 A;  3LMM A;  1R73 A;  1VF6 A;  5D7C A;  2Q8G A;  1XBL A;  5EC1 C;  2BSK A;  2YIC A;  2QTS A;  2VQF O;  4B3M B;  4FLY A;  1KP3 A;  4BAY A;  4CH3 A;  3BM9 A;  3SDL A;  2CE4 A;  3K98 A;  2ZD9 A;  4FLT A;  1BGQ A;  1OCR C;  1FFX B;  1XNR O;  1GM9 A;  2DWE C;  3CRK A;  2QFO A;  1R6N A;  3A0X A;  1XMQ B;  1WPB A;  4YKY A;  2Y0I A;  2CTQ A;  5CTW A;  3Q5K A;  2JK5 C;  4UB6 Z;  2E74 B;  2H55 A;  5KA6 A;  5KUK A;  4BAE A;  1P7B A;  1FFX A;  2HEP A;  2NN4 A;  3CEI A;  5L3D A;  2ARH A;  3U2D A;  5IYC O;  1W0J G;  1I5B A;  2ATK C;  4F4L A;  4FM2 A;  1YZB A;  3G4S V;  2QSA A;  3FB6 C;  3NR7 A;  1BL8 A;  1VQ8 V;  3R66 A;  4XIT A;  4GKJ B;  4YIO A;  3JAR B;  1MNG A;  1R3I C;  2IJK A;  3OR7 C;  1VAR A;  3CRC A;  3E89 A;  3Q4H B;  4LFC O;  2V4D A;  4P30 A;  1QQC A;  3SYC A;  3UT5 B;  3JCU Z;  2YC0 A;  2QG0 A;  5J2U B;  2FYP A;  4IYI A;  3OWD A;  3WFV A;  2WI1 A;  2UUB B;  2Q7G A;  5JH7 A;  2K5B A;  3W7S A;  4K8Z A;  5J2T B;  3TK1 A;  1ARO P;  2V1D A;  2OYQ A;  3T4D A;  2XHT A;  1AI7 A;  2HHH B;  2YI6 A;  5M4M A;  5DN6 G;  1H2G A;  2B1G A;  3JAR A;  1F51 A;  4JYB A;  3T4Z A;  2N74 A;  4BIO A;  3VAD A;  3Q4H A;  5D5Q A;  3ZMS A;  1QYE A;  3ZXQ A;  2HR3 A;  1JA8 A;  3MD0 A;  3UT5 A;  2RNB A;  1M56 B;  1EI1 A;  2BOC C;  3K97 A;  4MW3 A;  3FB7 C;  5J2T A;  4EGI A;  4DR3 O;  4DV2 B;  4B3T O;  5IYZ A;  4XE2 A;  1A32 A;  4U3J B;  1UPG A;  4YKU A;  2PZS A;  5IN9 A;  1UYG A;  5F5R A;  4EFB A;  2B5U A;  3FX7 A;  4PV1 B;  2EZO A;  2X7R B;  1MU5 A;  3AG4 B;  4EFU A;  4DRX B;  3Q5J A;  2YE3 A;  2YK9 A;  4N21 A;  3CCJ V;  1S3J A;  4EFE A;  3B4S A;  3LNN A;  4LP0 A;  2QTO A;  4UV8 A;  1YJN V;  1DF5 A;  4EMV A;  1I0H A;  1NTK H;  3E22 B;  4WFB V;  3P3P A;  1IDS A;  4U3J A;  3D0B A;  1VQO V;  1VQ5 V;  4KSH A;  2A0L A;  1I08 A;  1Q6I A;  3TZ0 A;  1SQX H;  2X0L A;  3FKS G;  1ZSP A;  4BR6 A;  1RFY A;  3R4O A;  5IJ0 B;  1IBM B;  1NU1 H;  4RQF A;  3ZRW B;  4GX5 A;  1IBL B;  3AG3 C;  2XJJ A;  4XC0 A;  1UYD A;  1FD9 A;  4IIJ B;  3LSS A;  4PDL A;  3E22 A;  1PPJ H;  3RLQ A;  3G67 A;  3JAM N;  2O1U A;  2BTZ A;  1VP7 A;  3OD4 A;  4JYA B;  4X9L A;  5CBG A;  3EHJ A;  2HLD G;  3ZCC A;  1BZK A;  5FPO A;  4EB6 B;  1GH6 A;  5IJ0 A;  4XIR A;  3SYQ A;  1FAF A;  5F2V O;  2DOS A;  4X1K B;  1HNW O;  5FNV B;  5LHH A;  4IIJ A;  1Q86 W;  2ZXW B;  4AQY O;  2GFD A;  3GIF A;  3WG7 C;  4E4E A;  1KEC A;  4DR5 B;  2XDS A;  1HNX B;  4V25 A;  1AM1 A;  4XCL A;  4H44 B;  4I5S A;  1NH2 D;  3CPW U;  4UVC A;  3KE6 A;  4EB6 A;  3FFQ A;  3CWB H;  1HP8 A;  4QGP A;  1I58 A;  4EEH A;  1WN7 A;  2ZM6 B;  2YE9 A;  1Q90 D;  2XAJ A;  4EEQ A;  4X1K A;  3H1J H;  2C1I A;  4FPP A;  1GN4 A;  5FNV A;  2IM9 A;  2QWQ B;  4GYC B;  1VQN V;  2EIN B;  1TC0 A;  3STZ C;  3BHP A;  3SJB C;  3ZBH A;  1IUR A;  3ZIA G;  4HYM A;  5CTU A;  1NZ6 A;  2HFE C;  2LGQ A;  4KHP B;  4TT3 G;  4L90 A;  4P9P A;  4DUZ O;  3RYI B;  3MAQ A;  3ASO C;  1SA0 A;  4LFA B;  3J80 N;  1L1F A;  3EFF K;  4K0K O;  1BSM A;  3B77 A;  4FM1 A;  1SZT A;  1AH8 A;  4JI0 O;  5M4E A;  2VWC A;  4ASG A;  3ABL C;  4FFK A;  2Q69 A;  3RYF B;  3HYZ A;  2BSM A;  4YKR A;  2ILM A;  4XDL A;  3UM7 A;  2KSD A;  1IBK O;  1GKX A;  2HVJ C;  4J7K A;  4X1Y A;  1Y76 B;  3ETE A;  5IE9 A;  3APQ A;  5IY5 B;  2F4V B;  1UY6 A;  4L91 A;  4I3H A;  5L3E A;  2P90 A;  3RYI A;  2OCH A;  3K9S A;  5L3J A;  1W59 A;  3ABM B;  2OCC B;  4DR2 O;  1SKV A;  5CPH A;  2AZ0 A;  1ORQ C;  1OCZ B;  1Q81 W;  1EN4 A;  3RYF A;  4O2B B;  4NKG B;  4DV6 O;  2OIE A;  1P84 F;  1YHQ V;  2EIL B;  3F7Y C;  4O2A B;  1Y76 A;  2CH7 B;  2YEV B;  1YXB A;  5IYB O;  2EX3 A;  3ASN B;  4OGQ B;  1I59 A;  2W0X A;  1BKN A;  1HNZ B;  2ZDX A;  2WLK A;  2FWY A;  3INW A;  3GIG B;  4TWK A;  1M57 C;  4O2B A;  2YEF A;  4IHJ B;  2YE7 A;  3BA9 A;  3G6B A;  4X1I B;  1M4U A;  4O2A A;  2XD6 A;  2B9Z A;  1DTO A;  2CH7 A;  2YEV A;  4DR1 O;  4MVR A;  1YVW A;  4MW8 A;  4ZI7 B;  4LF5 O;  3A0W A;  4JI2 O;  1ZXM A;  4JI6 B;  3ZJZ A;  1VQL V;  3GIG A;  1PP9 H;  3K5O A;  4JAU A;  5L3C A;  4IHJ A;  2XJG A;  1BCC H;  2GV9 A;  4O09 A;  4X1I A;  2WEQ A;  4YKX A;  1V55 B;  4JI3 B;  2XTA A;  3H4L A;  4R1F A;  1H7S A;  4XIP A;  1Z5W A;  1WPX A;  3QTF A;  4ZI7 A;  2WLM A;  4YKT A;  5M4H A;  5H6R A;  1K92 A;  1SET A;  4AWO A;  1M90 W;  1MAB G;  1SS3 A;  4QIW F;  4J80 A;  4CZZ A;  1YC3 A;  5H2F Z;  4W4K A;  2XDK A;  2ETN A;  3EVK A;  3BY6 A;  1Y66 A;  3R4P A;  4X62 O;  1IXB A;  1YSR A;  4LWE A;  4UV9 A;  1X59 A;  5JWP A;  1NTZ H;  4PEL A;  3UCS C;  4GLX A;  2YI5 A;  2UUC B;  1VF6 C;  1MG1 A;  4AHC A;  1SF9 A;  3J81 N;  4CC6 A;  5CBF A;  3CCM V;  1G1X B;  2XAG A;  2QWN B;  4JPR A;  1UYE A;  4PU9 A;  3SJQ C;  4ASA A;  4L87 A;  5CTX A;  1I5Y A;  4DUH A;  4J11 A;  3CCS V;  4DO2 A;  4MOT A;  3OMI B;  1AJN A;  5KUM A;  4OXS A;  1HWY A;  3K79 A;  4JTD B;  4TQD A;  4D7S A;  1PV0 A;  4O4H A;  3CCQ V;  5BY1 A;  1XL4 A;  3T10 A;  3B40 A;  3JCZ A;  5B3S B;  1D2D A;  2C1G A;  1GTO A;  3E2E A;  4NH7 A;  4U3F H;  3HZ5 A;  1AJP A;  4P7A A;  2O1W A;  1LNQ A;  3I56 V;  4I55 B;  4ASF A;  1BYQ A;  1N0N A;  2F93 B;  2H94 A;  2GHY A;  1UYC A;  2JJC A;  2XHB A;  2ZT9 B;  1Z59 A;  4MVZ A;  3VHC A;  3VHA A;  2Q6A A;  5B66 Z;  1KZN A;  4ICG A;  4TUY B;  4X8A A;  2VW5 A;  4PDR A;  2X6B A;  2LP7 A;  4UCV A;  2WI7 A;  2UUA O;  4LR3 A;  4KQV A;  4UFZ A;  1UY7 A;  4G2K A;  3QO5 A;  4ASU G;  5BR8 O;  3JD2 A;  1H8E G;  4DV1 B;  4I55 A;  4UB8 Z;  4DR7 O;  1ZW9 A;  2JJ2 G;  3F5T A;  3P32 A;  4B3R O;  2YGE A;  1QU7 A;  2UXB O;  1R3K C;  4LNU B;  1U96 A;  2HP8 A;  2E5L O;  2VS0 A;  1XQ8 A;  4TUY A;  3FB5 C;  3O9O A;  2QWR B;  4AWQ A;  2JS3 A;  2JIZ G;  1YIJ V;  3TXQ A;  3L75 H;  3KCY A;  4FZ1 A;  4B3S B;  3TTZ A;  1GKZ A;  3CC2 V;  4I0X B;  2FYU H;  2F1M A;  1I7F A;  1Y8N A;  2YKI A;  2AHZ A;  3M99 B;  3C90 A;  4LNU A;  2KB1 A;  2P7T C;  4BW5 A;  3K03 A;  4DXW A;  1NHH A;  1JMK C;  1WB7 A;  3HKD B;  1TVK A;  3K0G A;  3ZMV A;  5D7R A;  2HJD A;  2XND G;  1J5E B;  3B8M A;  1M56 C;  3BFR A;  3CWV A;  4LF6 O;  5D6Q A;  2Q8I A;  5LHI A;  3HKC B;  2XX4 A;  2GTS A;  4I0X A;  5LHG A;  2YIA A;  3CC4 V;  4R3A A;  3JAW A;  5IDM A;  2V7Q G;  3C0E A;  2YE5 A;  3B28 A;  3OEH G;  1K97 A;  4H33 A;  5LGN A;  3T2S A;  4HNA A;  4CWT A;  3HKD A;  4UCS A;  1US6 A;  2AGA A;  3K5M A;  4FMT A;  3TGU H;  3T1C A;  1JCH A;  4X66 O;  5LMU B;  3HKC A;  1X4T A;  1NKD A;  3BVO A;  4R3M A;  3RKZ A;  3I55 V;  1SC5 B;  4ZHQ A;  1XRE A;  2RDC A;  1TUE B;  3ZX6 A;  4PA9 A;  2WAM A;  5EIB D;  4ZVI A;  2GTA A;  3SR2 C;  2EJ7 A;  5LGU A;  5CMU A;  4LF4 O;  2K9P A;  5B1A B;  2YI0 A;  4FJC C;  2ZNJ A;  2P4K A;  2YXL A;  1COW G;  3BAB A;  1XUQ A;  4OPA A;  4PRX A;  4DR6 O;  3LPS A;  4J7J A;  4CC5 A;  4HZ3 A;  5BOD A;  3CCV V;  4LP8 A;  3T2M A;  3LDD A;  4DV4 O;  1TIL A;  1SQG A;  2XDU A;  4YHH O;  2PY5 A;  3JAL B;  1AP6 A;  1H2S B;  4TSF G;  1YT1 A;  4GEE A;  4BQJ A;  2YE6 A;  1KP2 A;  4O4I A;  3ZMT A;  4WUB A;  3SPG A;  4LFC B;  1CEZ A;  2QM7 A;  3CXC U;  3QG5 A;  3B25 A;  4WBN B;  3L9D A;  2YUA A;  1LR1 A;  1JJO A;  4F6E A;  1EA6 A;  3JSN A;  4LCU C;  3RWR D;  3CX5 F;  3PEJ A;  4JI8 B;  4NXN O;  1K3E A;  1IX9 A;  5H6Q A;  3K5L A;  3JAL A;  2IOR A;  1WAZ A;  3ZKB A;  3CJH A;  3R4M A;  1AR1 B;  3HKB B;  3RLR A;  1M1K W;  4PDM A;  4WBN A;  3NMQ A;  1D5A A;  1YC1 A;  3HEK A;  1XHZ A;  3OUF A;  2EIM B;  1KMI Z;  2JGD B;  1LUV A;  2RQ6 A;  2EIN C;  2YKB A;  2YKJ A;  4DR3 B;  4FK5 C;  4AIL C;  2R9A A;  4DUY B;  4OX9 O;  4E72 A;  3AK1 A;  4DZY A;  3D36 A;  3K5N A;  1JJ2 U;  1NR1 A;  1AP5 A;  2AZ2 A;  2QGN A;  2WLN A;  1Q3E A;  4DV0 O;  3BRC A;  3ZED A;  4O4L A;  5JEN A;  2ADQ B;  2JGD A;  3H1I H;  3B26 A;  3ETD A;  3HYY A;  1YIT V;  2VWK A;  3UQ8 A;  4G27 B;  2FB5 A;  5HFM A;  1KKD A;  4WFG A;  1S5J A;  1QCE A;  1XDC A;  3TJT A;  3JD0 A;  3U2K A;  5EIB C;  4UXN A;  5JJJ B;  3G7E A;  3ABM C;  1E79 G;  3LSU A;  2OCC C;  4UCU A;  2H3O A;  3B09 A;  2XOK G;  4B7E A;  3P3N A;  2CDY A;  2P22 C;  2Y48 A;  3CCL V;  4LF9 O;  4DV5 O;  2BRE A;  4LC1 A;  3ZMU A;  4X88 A;  1PL0 A;  4K35 A;  3ABT A;  2EIL C;  1JPX A;  1YTF B;  2E0A A;  3ZXO A;  3S3X A;  1Q6H A;  4MS2 A;  1M93 A;  5HFL A;  4URM A;  1N33 O;  3E35 A;  4J7Z A;  1UYL A;  2HKO A;  3ASN C;  1VIB A;  4LF8 O;  3OMA B;  1HNW B;  2ZE6 A;  3LUT B;  4P9O A;  4I9Q A;  1GJV A;  3F7V C;  1B06 A;  4URO A;  4YY3 B;  4O04 A;  3MDS A;  2JEX A;  2W0F C;  5EYP B;  4FLX A;  4NH8 A;  4JV5 B;  5E1A C;  1RM1 B;  1B04 A;  3W7U A;  3CGY A;  5J2U A;  5H5N A;  2UXC O;  5JCO A;  2D3O W;  1GK9 A;  4PD4 F;  1JM6 A;  3TET A;  3JZ3 A;  4KFG A;  2ADP A;  5EYP A;  3K08 A;  2GDS A;  3R92 A;  3JAS B;  3A0B Z;  2BT0 A;  1PNK A;  1V55 C;  4XTJ A;  2EUL A;  3C3S A;  5IT9 N;  3FYI B;  3OAA G;  1VQ4 V;  1CP9 A;  4DUZ B;  2E75 B;  3OM3 B;  4CBC A;  1W2B U;  4YKZ A;  2KQX A;  4DK0 A;  1ROP A;  3SPI A;  1YT0 A;  4AS9 A;  2Q0A A;  2P6J A;  5E79 Z;  2XJX A;  3QO7 A;  3GVM A;  4U7O A;  3VQV A;  3ML0 A;  3JAS A;  5KLV H;  1VEW A;  5L3B A;  4JAS A;  4DRX A;  5JJN B;  4GX1 A;  1TH8 A;  3HKE B;  4DR2 B;  5FND A;  2PNR A;  3E8H A;  2Y69 B;  2YI9 A;  4UVA A;  1XI1 A;  3TZ2 A;  4GGL A;  5K1X A;  4DV6 B;  1GAX A;  2NR5 A;  5H9C A;  4MVM A;  1L0N H;  3ABK C;  1IZ3 A;  2VQE O;  1Y67 A;  1WA8 B;  4LF7 O;  1SRY A;  2WPD G;  1VQM V;  1VQK V;  4WF9 V;  3LNU A;  1AR4 A;  2DWD C;  3G6E V;  1J95 A;  3ZRW A;  3HKE A;  4CE3 A;  2YSU B;  3DXR B;  4JI1 O;  1XMO O;  1F4N A;  4O07 A;  2C2A A;  2CUG A;  5B3S C;  2QKS A;  1L0O A;  2GSM B;  1SES A;  5KMG B;  4GT1 A;  3D8C A;  1KQS U;  1WA8 A;  3CSX A;  2CCT A;  2GQP A;  3O2F A;  2YEE A;  2CCU A;  4YKQ A;  4GKK B;  1QLE B;  3H1K H;  4V26 A;  4N23 A;  4MTF A;  4FIP C;  1Y8P A;  1N34 B;  3FYE B;  2YGA A;  4JQL A;  4LWG A;  3ZHT A;  2UUB O;  3DXR A;  4E01 A;  4JI2 B;  2Z3Y A;  2DYR B;  2HHH O;  1Z5A A;  1JFF B;  3QF7 A;  4HY1 A;  2ZQM A;  5KMG A;  1EN5 A;  4L94 A;  3C3T A;  3R91 A;  3HZ1 A;  1ZTE A;  2Q0O C;  5L3G A;  1VF5 B;  2ZE8 A;  2YJX A;  3B2E E;  4O0B A;  1UY8 A;  3M8A A;  4DR4 B;  3IGA C;  1BE3 H;  3A2F A;  4DV2 O;  3A0T A;  2PTM A;  3HHU A;  5AG2 A;  3CYG A;  4WUC A;  3ZHS A;  5B5E Z;  2K1E A;  1JFF A;  2DQ3 A;  4URN A;  4X62 B;  2UU9 B;  2XDX A;  3OTF A;  1NHI A;  3CGZ A;  2CAZ C;  4MTG A;  3K59 A;  4I9W A;  4FZ0 A;  1AVM A;  3N27 A;  1R6T A;  3RW0 A;  4JZG A;  1TBW A;  1D5N A;  5KAF Z;  1Z5V A;  2BRC A;  2Q7H A;  3WB1 A;  4YIP A;  2H8P C;  4CS3 A;  1Q82 W;  4GFN A;  5EZY B;  2YKE A;  2OT5 A;  1RPO A;  3EHB B;  1IBM O;  3AG1 B;  2UXD B;  4MBC A;  1IBL O;  4LWS B;  4CH4 A;  3L74 H;  4E2L A;  4LFB B;  1QY8 A;  2DW4 A;  3ZHU A;  5CBH A;  2EIK C;  4CWP A;  3JD3 A;  2YE2 A;  4MP7 A;  5EZY A;  4K8X A;  3OWB A;  4O05 A;  2F66 C;  1YI2 V;  1KU9 A;  5FNF A;  1YJW V;  2ZDI A;  1EZV H;  1ZUQ A;  3WB2 A;  1YT2 A;  3MHS C;  1GN3 A;  4GX0 A;  5B1A C;  3K57 A;  2UUA B;  4J41 A;  1AIL A;  1GM8 A;  4DR5 O;  3E8B A;  3EHF A;  1OSF A;  1YET A;  4RQE A;  2MK3 A;  1RPR A;  3RBZ A;  1KUQ A;  1CXZ B;  4KXR A;  3P30 A;  1BMF G;  4GCZ A;  1Y6X A;  1AI4 A;  4DYL A;  4NTX A;  1Y74 B;  2WEP A;  4DV3 B;  4X64 B;  2IJJ A;  5LGT A;  2BU2 A;  3EHH A;  2BU7 A;  3A0Y A;  3KZI Z;  1S0V A;  2YXY A;  5JQG B;  1TUB B;  4J42 A;  2YDE A;  5LBQ A;  2QG2 A;  2AXT Z;  1QZR A;  2YEC A;  2DQ0 A;  1OCO B;  3D2R A;  3PJS K;  2CGF A;  5B1B B;  2JVD A;  4MVU A;  5EBW C;  4QJF B;  4KHP O;  2DJV A;  5KHI A;  1IXM A;  2HCH A;  2YEA A;  1NQT A;  3RVZ A;  1KD1 W;  1Y74 A;  2YE4 A;  2VCJ A;  4JI7 B;  3IED A;  3SJC C;  2X6A A;  5D5P A;  5KHK A;  4P8O A;  3D36 C;  5JQG A;  1TUB A;  1R62 A;  1BT8 A;  5LMN O;  1Z5C A;  4X20 B;  2JS5 A;  3CE2 A;  4FLV A;  2YEG A;  1RP3 B;  3OMU A;  1AR5 A;  1AH6 A;  1HW7 A;  4LF6 B;  3X2Q B;  2EIM C;  4AI8 A;  2IU0 A;  1N32 O;  5D6P A;  3E86 A;  2XAH A;  3TZ4 A;  2G38 A;  1BHB A;  2BU6 A;  2GBO A;  1EZJ A;  3ICX A;  2BYH A;  1JX9 A;  1TAE A;  4R6Z A;  5CF0 A;  2AW9 A;  1YES A;  4LWI A;  1S5L Z;  3AK2 A;  3MHH C;  2IU3 A;  2XDL A;  1OCC B;  5BOC A;  3T1K A;  1B6Q A;  2WLJ A;  3VHD A;  2MW2 B;  2QKC A;  4W7T A;  2QDO A;  2HHI A;  4LF4 B;  4YXW G;  3D3I A;  1AMW A;  4G28 B;  3JD4 A;  1S14 A;  2YED A;  4DV7 O;  4DR6 B;  3CCR V;  2Q8V A;  3VBB A;  2CH4 A;  3BMY A;  1FXK B;  3GWO A;  4P2Z A;  2CGN A;  3U11 A;  4DV4 B;  4PI0 A;  3CHX A;  4QE7 A;  3CRA A;  4YHH B;  2BOB C;  1I5C A;  2BTO A;  3LDC A;  1PKX A;  3T1Y O;  2BTQ B;  4JI6 O;  1E1Q G;  4B7K A;  2BCC H;  4HYO A;  4JYY A;  5LA6 B;  4BXI A;  4MTX A;  3K58 A;  2EBO A;  2E76 B;  2BE3 A;  4UUJ C;  3CYO A;  3IC7 A;  4I4T B;  2OTJ V;  1HDJ A;  1FXK A;  2HJF C;  4PJ0 Z;  4PRV A;  2Q5Z A;  5JCO C;  1FPO A;  1ZLZ A;  1WP8 A;  4NXN B;  3H01 A;  2KG7 B;  4JI3 O;  3IC9 A;  5KHJ A;  1FYJ A;  1L0L H;  1Z5B A;  4CWS A;  3RYC B;  2EXL A;  1RM1 C;  4LH6 A;  5LA6 A;  2QWO B;  3U10 A;  1Q8I A;  4WFE A;  5J9P C;  4H13 B;  1WLE A;  4JZ2 A;  2IJH A;  3OTO O;  2LO1 A;  2LGW A;  5IYD O;  3GWK C;  3K9A A;  1T5E A;  3DSQ A;  5KHG A;  2R72 A;  4OX9 B;  1ENV A;  3RYC A;  3QO8 A;  2VQF B;  1UYI A;  4PA7 A;  2CG9 A;  2AKP A;  3C11 A;  2IBZ H;  4C7U A;  3AG4 C;  4GUN A;  4R50 A;  4HXZ A;  2YIB A;  3FB8 C;  3SPJ A;  4DV0 B;  2XT9 A;  1BQZ A;  2ZNI A;  2B1I A;  1XNR B;  3T1H O;  2QE7 G;  2HVK C;  2X6C A;  2VRZ A;  2RN9 A;  3G75 A;  4X65 O;  2Z5U A;  1N36 O;  3VQW A;  3BPZ A;  1K4C C;  2ZR2 A;  2A9H A;  4TV9 B;  3A0Z A;  3ZM7 A;  5IDJ A;  1EBO A;  4JI5 O;  4MVQ A;  2IWS A;  4L93 A;  1H8H G;  1US7 A;  1S5H C;  4XDK A;  3IAY A;  3ZN0 A;  2EZP A;  2QA4 V;  4HZ0 A;  2IOP A;  2Y69 C;  1SQB H;  4TOI A;  2HG1 A;  3N2K B;  1MA1 A;  4LF9 B;  4URL A;  4ZIB A;  4XKO A;  3IJ4 A;  2PYL A;  3M7M X;  4TV9 A;  3CRL A;  1GKF A;  1N4C A;  3H80 A;  1B63 A;  2XAB A;  2LQT A;  2L6L A;  3TXS A;  3DC6 A;  3SJA C;  3KCX A;  3OE7 G;  4ASB A;  2ZXW C;  3JAK B;  2ZE5 A;  3CCU V;  3N2K A;  3K04 A;  3ZKD A;  1VMG A;  4B7P A;  5ITZ B;  3RN4 A;  1TGO A;  2P4V A;  5JVD B;  2ITD C;  2FWZ A;  1XEQ A;  4D7T A;  3JYC A;  1QLE C;  3QTC A;  1URF A;  2VCI A;  4FLU A;  1NBM G;  2WWW A;  3ETG A;  1K73 W;  4B08 A;  4B3S O;  3LSQ A;  2UXC B;  2OWO A;  3JAK A;  3TCU A;  1P7G A;  4FLZ A;  4B3T B;  2DYR C;  1SQQ H;  2XHR A;  1Q5O A;  5ITZ A;  5M4K A;  5JJE B;  2QJ1 A;  3VQX A;  2IH1 C;  4R7C A;  5JVD A;  1XNQ O;  3HKB A;  1NS1 A;  3OW6 A;  1G6U A;  3THO A;  5LOV B;  3A0H Z;  1O9H A;  5C93 A;  1J5E O;  4RUF A;  1SQF A;  4TQF A;  4H37 A;  4O4J B;  2P06 A;  1K5S A;  1H2L A;  3SGI A;  1NI8 A;  1B3Q A;  1QBZ A;  1S77 D;  3JD1 A;  2JDI G;  4JI4 O;  4H85 A;  1QHT A;  1L8D A;  3HB3 B;  1YEW A;  1YF2 A;  5L3F A;  3H1L H;  2XX2 A;  4CWR A;  3AG2 B;  4UCR A;  1VQP V;  2AHY A;  1WB8 A;  3QDD A;  3W7T A;  5LOV A;  1GM7 A;  1SER A;  4FLW A;  5IY5 C; 
#chains in the Genus database with same CATH homology
 4HXW A;  3OEE G;  4K4O A;  1YJ9 V;  1V54 B;  3TZ5 A;  2ESA A;  2DYS B;  3CCE V;  1U2O A;  3K06 A;  5GW7 A;  1OCZ C;  3G7B A;  5M4P A;  1OZ0 A;  4WFH A;  4KTN A;  3SYO A;  1FXH A;  4MPE A;  5J71 A;  2ITC C;  1AJQ A;  3AG1 C;  4JF3 A;  4RO2 A;  2ZDI C;  2BYI A;  1F4M A;  3E8G A;  2XAS A;  1Y4U A;  2YEI A;  4ZKI A;  4MP2 A;  3K60 A;  4Z1M G;  1ZXN A;  1THZ A;  1MSW D;  3BEH A;  1PNL A;  1PVG A;  2Q67 A;  1I5A A;  2W6I G;  2M7W A;  3OUS A;  2WI3 A;  4EM7 A;  1H38 A;  4MVO A;  3O6O A;  3MNR P;  1THN A;  2YI7 A;  1NVP B;  5EC2 C;  1I5D A;  4QE9 A;  5EBL C;  3E83 A;  3CME V;  4H81 A;  1ID0 A;  3RVY A;  3GB7 C;  1AI6 A;  2ZKJ A;  4JYC A;  2ZR3 A;  1OCO C;  5FL7 G;  4WFA V;  5B1B C;  4WCE V;  1QLN A;  1VQ9 V;  2H8M A;  4CWF A;  3WHA A;  1K34 A;  3FV5 A;  1NR7 A;  1MOF A;  3OPD A;  3HPL C;  4RAI A;  1YC4 A;  5B1N A;  2WI4 A;  5CA3 A;  1TID A;  1B62 A;  3O0I A;  1VQ6 V;  3X2Q C;  2BZ5 A;  2UXX A;  4YKW A;  3ZRV A;  4PA3 A;  2EIJ B;  3CD6 V;  4LWF A;  2IWU A;  4EFT A;  2A79 B;  4PL9 A;  4KP4 A;  4UVB A;  1NHJ A;  2IJI A;  2OTL V;  2WI5 A;  1M9N A;  4RUE A;  1QVF U;  2WLI B;  3K0D A;  1OCC C;  1AJ6 A;  3LNM B;  2XX5 A;  4WUD A;  4EKW A;  2YGF A;  2WER A;  2LFR A;  4GX2 A;  1EFR G;  1K4D C;  4JTA B;  1YSZ A;  1Y4S A;  3T0H A;  5FWK A;  1FXK C;  1G4Y B;  2ZBK B;  2WLI A;  4LBE C;  5KA5 A;  1YSC A;  1G8M A;  3GIE A;  3ABU A;  3OW2 U;  4QNH B;  1TC6 A;  2Q68 A;  1DF4 A;  2YEJ A;  2NNU A;  3SL2 A;  1OCR B;  1DLB A;  2XK2 A;  2XAQ A;  1FS0 G;  3R4N A;  4MT8 A;  1BXD A;  2WLH A;  2BU5 A;  2NLJ C;  1QR9 A;  2JJ1 G;  1A4H A;  3FT8 A;  4CE2 A;  1W0K G;  1FXV A;  4QPJ A;  4JTC B;  1UYK A;  3CP1 A;  3F5W C;  1R3J C;  4AWP A;  1MX0 A;  3UKM A;  2FXS A;  1BHA A;  3EKO A;  4R8C A;  4PDV A;  4CWN A;  1K7D A;  1Y4M A;  2JKI A;  1YTF D;  1OHH G;  4QPK A;  1E1R G;  3W7W A;  3DTU B;  3B24 A;  5CTY A;  4FCP A;  2BU8 A;  1Y8O A;  1K9M W;  4XDJ A;  1GMG A;  1YER A;  1ZWI C;  3CMA V;  3INX A;  4HZ5 A;  3KG2 A;  3K99 A;  2R9I A;  1KC8 W;  3SPC A;  4FCR A;  2YJW A;  1I5X A;  4HY6 A;  2R9R B;  1UY9 A;  2QM8 A;  4HAM A;  2Q2E B;  1CPY A;  3B8N A;  1NVP D;  4B6C A;  4U93 A;  3OMN B;  3G71 V;  4FCQ A;  2EJR A;  3W7X A;  2IW5 A;  5EK0 A;  3EHG A;  3AG3 B;  4XKK A;  4NH9 A;  4MVS A;  5B1O A;  1K33 A;  4JGS A;  1N8R W;  3E8F A;  3RLP A;  3ABK B;  1UYF A;  3B27 A;  4BIZ A;  4Q20 A;  4H7Q A;  4EGH A;  4BQG A;  3PEH A;  1K8A W;  4LPB A;  2Q8F A;  2WI2 A;  3AG2 C;  4MSW C;  4WFF A;  5D7D A;  5DM6 V;  5M4N A;  2XAF A;  3WG7 B;  1QVG U;  2Q8H A;  3U67 A;  1K5Q A;  1V54 C;  4PA4 A;  4EGK A;  2DYS C;  1VQ7 V;  3OFN G;  1Q7Y W;  4JAV A;  2HG5 C;  2YE8 A;  5EBM C;  3TUH A;  1U0Z A;  1UYM A;  2ZDY A;  3ZRX A;  1S16 A;  1R6K A;  3QNE A;  5J6A A;  2F43 G;  2UWD A;  1H7U A;  1PNM A;  4CWO A;  2YEB A;  1P4R A;  3K3W A;  3T0Z A;  1F23 A;  4L8Z A;  3ASO B;  3ZMZ A;  1UYH A;  2P67 A;  3ABL B;  3FT5 A;  3Q5L A;  4MB9 A;  4KSG A;  3CC7 V;  1XL6 A;  1PD3 A;  3NXS A;  2UXN A;  4X89 A;  2LFS A;  4J9Z B;  4ZBM A;  3EKR A;  1KIJ A;  4GQT A;  3WQ9 A;  5CN0 A;  2W6J G;  5F3K A;  2WLL B;  1ZWH A;  1JVM A;  3SPH A;  2YEH A;  2PI5 A;  2CCS A;  4XKA A;  3IFX A;  2EIK B;  3OGC C;  4BIU A;  4CE1 A;  1M57 B;  3SYA A;  4E02 A;  3SYP A;  4MPN A;  2QEX V;  1S76 D;  3AEI A;  2YK2 A;  1QR8 A;  5FNC A;  2YKC A;  2XHX A;  3ZRS A;  1S72 V;  2WLL A;  1AI5 A;  4U7N A;  1NH2 B;  3ZN1 A;  4KFM A;  2JEU A;  2O1V A;  2IWX A;  4XBF A;  3A0R A;  2EIJ C;  4E00 A;  4XCJ A;  4MTO A;  2CK3 G;  3OR6 C;  4J9Y B;  4GT8 A;  1FFT B;  1GO3 F;  4PA6 A;  4MPC A;  2IOQ A;  5GGZ A;  1YS3 A;  3DGE A;  1R3L C;  2PI4 A;  3R65 A;  5BZB A;  2QF6 A;  2XCM A;  2HKJ A;  4HYP A;  2WI6 A;  1UJW B;  3STL C;  4XIQ A;  2FTK A;  3LDE A;  4XD8 A;  1JQ0 A;  4CWQ A;  4LWH A;  4KUM A;  2IH3 C;  3VOU A;  1NJI W;  4XDM A;  1JOY A;  2WSS G;  1R73 A;  5D7C A;  2Q8G A;  5EC1 C;  1KP3 A;  4BAY A;  3BM9 A;  3K98 A;  2ZD9 A;  1BGQ A;  1OCR C;  1GM9 A;  2DWE C;  3CRK A;  2QFO A;  1R6N A;  3A0X A;  4YKY A;  5CTW A;  3Q5K A;  2JK5 C;  2H55 A;  5KA6 A;  5KUK A;  4BAE A;  1P7B A;  5L3D A;  3U2D A;  5IYC O;  1W0J G;  1I5B A;  2ATK C;  4F4L A;  3G4S V;  3FB6 C;  1BL8 A;  1VQ8 V;  4XIT A;  1R3I C;  2IJK A;  3OR7 C;  3E89 A;  4P30 A;  3SYC A;  2QG0 A;  2FYP A;  3OWD A;  3WFV A;  2WI1 A;  2K5B A;  3W7S A;  3TK1 A;  1ARO P;  2V1D A;  3T4D A;  2XHT A;  1AI7 A;  2YI6 A;  5M4M A;  5DN6 G;  1H2G A;  2B1G A;  1F51 A;  4JYB A;  3T4Z A;  3VAD A;  3ZMS A;  1QYE A;  3ZXQ A;  2HR3 A;  3MD0 A;  1M56 B;  1EI1 A;  2BOC C;  3K97 A;  4MW3 A;  3FB7 C;  4EGI A;  4XE2 A;  4YKU A;  5IN9 A;  1UYG A;  5F5R A;  2B5U A;  2EZO A;  2X7R B;  1MU5 A;  3AG4 B;  4EFU A;  3Q5J A;  2YE3 A;  2YK9 A;  4N21 A;  3CCJ V;  1S3J A;  4LP0 A;  2QTO A;  4UV8 A;  1YJN V;  1DF5 A;  4EMV A;  4WFB V;  3D0B A;  1VQO V;  1VQ5 V;  4KSH A;  2A0L A;  3TZ0 A;  2X0L A;  3FKS G;  3R4O A;  4RQF A;  3ZRW B;  4GX5 A;  3AG3 C;  2XJJ A;  4XC0 A;  1UYD A;  3LSS A;  4PDL A;  3RLQ A;  2O1U A;  2BTZ A;  4X9L A;  5CBG A;  3EHJ A;  2HLD G;  3ZCC A;  4XIR A;  3SYQ A;  5LHH A;  1Q86 W;  2ZXW B;  2GFD A;  3GIF A;  3WG7 C;  1KEC A;  2XDS A;  4V25 A;  1AM1 A;  4XCL A;  4I5S A;  1NH2 D;  3CPW U;  4UVC A;  3KE6 A;  1I58 A;  4EEH A;  2YE9 A;  2XAJ A;  4FPP A;  1VQN V;  2EIN B;  1TC0 A;  3STZ C;  3ZIA G;  4HYM A;  5CTU A;  2HFE C;  4TT3 G;  4L90 A;  4P9P A;  3ASO C;  1L1F A;  3EFF K;  3B77 A;  1SZT A;  1AH8 A;  5M4E A;  2VWC A;  4ASG A;  3ABL C;  2Q69 A;  3HYZ A;  2BSM A;  4YKR A;  4XDL A;  3UM7 A;  1GKX A;  2HVJ C;  1UY6 A;  4L91 A;  3ETE A;  5IY5 B;  4I3H A;  5L3E A;  2P90 A;  5L3J A;  3ABM B;  2OCC B;  5CPH A;  1ORQ C;  1OCZ B;  1Q81 W;  1YHQ V;  2EIL B;  3F7Y C;  2YEV B;  5IYB O;  3ASN B;  1I59 A;  1BKN A;  2ZDX A;  2WLK A;  2FWY A;  3INW A;  3GIG B;  4TWK A;  1M57 C;  2YEF A;  2YE7 A;  2XD6 A;  1DTO A;  2YEV A;  4MVR A;  4MW8 A;  3A0W A;  1ZXM A;  3ZJZ A;  1VQL V;  3GIG A;  4JAU A;  5L3C A;  2XJG A;  4O09 A;  2WEQ A;  4YKX A;  1V55 B;  3H4L A;  4R1F A;  1H7S A;  4XIP A;  1WPX A;  3QTF A;  2WLM A;  5M4H A;  4YKT A;  5H6R A;  1K92 A;  1SET A;  4AWO A;  1M90 W;  1MAB G;  4QIW F;  4CZZ A;  1YC3 A;  2XDK A;  3BY6 A;  1Y66 A;  3R4P A;  1YSR A;  4LWE A;  4UV9 A;  4PEL A;  2YI5 A;  1MG1 A;  5CBF A;  3CCM V;  2XAG A;  4JPR A;  1UYE A;  4PU9 A;  3SJQ C;  4ASA A;  4L87 A;  5CTX A;  1I5Y A;  4DUH A;  3CCS V;  4DO2 A;  4MOT A;  3OMI B;  1AJN A;  5KUM A;  4OXS A;  1HWY A;  3K79 A;  4JTD B;  3CCQ V;  1XL4 A;  3T10 A;  3JCZ A;  5B3S B;  1GTO A;  3E2E A;  4NH7 A;  3HZ5 A;  1AJP A;  4P7A A;  2O1W A;  1LNQ A;  3I56 V;  4ASF A;  1BYQ A;  2H94 A;  2GHY A;  1UYC A;  2JJC A;  1Z59 A;  4MVZ A;  3VHC A;  3VHA A;  2Q6A A;  1KZN A;  4X8A A;  2VW5 A;  4PDR A;  2X6B A;  2LP7 A;  2WI7 A;  4KQV A;  1UY7 A;  4G2K A;  3QO5 A;  4ASU G;  3JD2 A;  1H8E G;  1ZW9 A;  2JJ2 G;  3P32 A;  2YGE A;  1R3K C;  3FB5 C;  4AWQ A;  2JIZ G;  1YIJ V;  3TTZ A;  1GKZ A;  3CC2 V;  1Y8N A;  2YKI A;  2AHZ A;  3M99 B;  2KB1 A;  2P7T C;  4BW5 A;  3K03 A;  4DXW A;  1NHH A;  3ZMV A;  3K0G A;  5D7R A;  2XND G;  3B8M A;  1M56 C;  3CWV A;  5D6Q A;  2Q8I A;  5LHI A;  2XX4 A;  5LHG A;  4R3A A;  3CC4 V;  5IDM A;  2V7Q G;  3C0E A;  2YE5 A;  3B28 A;  3OEH G;  1K97 A;  4H33 A;  5LGN A;  3T2S A;  4CWT A;  4FMT A;  3T1C A;  1JCH A;  1NKD A;  4R3M A;  3RKZ A;  3I55 V;  1TUE B;  4PA9 A;  2WAM A;  4ZVI A;  5LGU A;  5CMU A;  5B1A B;  2YI0 A;  4FJC C;  1COW G;  4PRX A;  3LPS A;  4HZ3 A;  5BOD A;  3CCV V;  4LP8 A;  3T2M A;  3LDD A;  1TIL A;  2XDU A;  4GEE A;  4TSF G;  1YT1 A;  4BQJ A;  2YE6 A;  1KP2 A;  3ZMT A;  4WUB A;  3SPG A;  1CEZ A;  2QM7 A;  3CXC U;  3B25 A;  1EA6 A;  4LCU C;  3PEJ A;  1K3E A;  5H6Q A;  2IOR A;  3ZKB A;  3R4M A;  1AR1 B;  3RLR A;  1M1K W;  4PDM A;  3NMQ A;  1YC1 A;  3HEK A;  3OUF A;  2EIM B;  2YKJ A;  2EIN C;  2YKB A;  4FK5 C;  4DZY A;  3D36 A;  1JJ2 U;  1NR1 A;  2WLN A;  3B26 A;  3ETD A;  3HYY A;  1YIT V;  4G27 B;  5HFM A;  1KKD A;  4WFG A;  1QCE A;  3JD0 A;  3U2K A;  4UXN A;  3G7E A;  3ABM C;  1E79 G;  2OCC C;  2XOK G;  2Y48 A;  3CCL V;  2BRE A;  4LC1 A;  3ZMU A;  4X88 A;  1PL0 A;  3ABT A;  2EIL C;  1JPX A;  1YTF B;  2E0A A;  3ZXO A;  4MS2 A;  5HFL A;  4URM A;  3E35 A;  1UYL A;  2HKO A;  3ASN C;  3OMA B;  3LUT B;  4P9O A;  1GJV A;  3F7V C;  4URO A;  4O04 A;  2JEX A;  2W0F C;  4NH8 A;  5E1A C;  1RM1 B;  3W7U A;  3CGY A;  2D3O W;  1GK9 A;  1JM6 A;  3TET A;  3JZ3 A;  4KFG A;  3K08 A;  3R92 A;  2BT0 A;  1PNK A;  1V55 C;  4XTJ A;  3FYI B;  3OAA G;  1VQ4 V;  1CP9 A;  3OM3 B;  4CBC A;  1W2B U;  4YKZ A;  1YT0 A;  1ROP A;  3SPI A;  4AS9 A;  2P6J A;  2XJX A;  3QO7 A;  4U7O A;  3ML0 A;  5L3B A;  4JAS A;  4GX1 A;  1TH8 A;  5FND A;  2PNR A;  3E8H A;  2Y69 B;  4UVA A;  3TZ2 A;  4GGL A;  5H9C A;  4MVM A;  3ABK C;  1SRY A;  2WPD G;  1VQM V;  1VQK V;  4WF9 V;  3LNU A;  2DWD C;  3G6E V;  1J95 A;  3ZRW A;  4CE3 A;  2YSU B;  1F4N A;  4O07 A;  2C2A A;  5B3S C;  2QKS A;  1L0O A;  2GSM B;  1SES A;  4GT1 A;  1KQS U;  2CCT A;  2GQP A;  3O2F A;  2YEE A;  2CCU A;  4YKQ A;  1QLE B;  4V26 A;  4N23 A;  4MTF A;  4FIP C;  1Y8P A;  3FYE B;  2YGA A;  4JQL A;  4LWG A;  4E01 A;  2Z3Y A;  2DYR B;  1Z5A A;  4HY1 A;  2ZQM A;  4L94 A;  3R91 A;  3HZ1 A;  5L3G A;  2YJX A;  4O0B A;  1UY8 A;  3IGA C;  3A0T A;  3HHU A;  4WUC A;  2K1E A;  2DQ3 A;  4URN A;  2XDX A;  1NHI A;  3CGZ A;  4MTG A;  4I9W A;  3RW0 A;  1TBW A;  2BRC A;  2H8P C;  1Q82 W;  4GFN A;  2YKE A;  2OT5 A;  1RPO A;  3EHB B;  3AG1 B;  4MBC A;  4E2L A;  1QY8 A;  2DW4 A;  5CBH A;  2EIK C;  4CWP A;  3JD3 A;  2YE2 A;  4MP7 A;  3OWB A;  4O05 A;  1YI2 V;  5FNF A;  1YJW V;  2ZDI A;  1YT2 A;  3MHS C;  4GX0 A;  5B1A C;  1GM8 A;  3EHF A;  3E8B A;  1OSF A;  1YET A;  4RQE A;  2MK3 A;  1RPR A;  3RBZ A;  3P30 A;  1BMF G;  4GCZ A;  1AI4 A;  2WEP A;  2IJJ A;  5LGT A;  2BU2 A;  3EHH A;  2BU7 A;  3A0Y A;  1S0V A;  5LBQ A;  2QG2 A;  1QZR A;  2YEC A;  2DQ0 A;  1OCO B;  3D2R A;  3PJS K;  2CGF A;  5B1B B;  4MVU A;  5EBW C;  4QJF B;  2HCH A;  1IXM A;  2YEA A;  1NQT A;  3RVZ A;  1KD1 W;  2YE4 A;  2VCJ A;  3IED A;  2X6A A;  4P8O A;  1R62 A;  1Z5C A;  2YEG A;  3OMU A;  1AH6 A;  3X2Q B;  2EIM C;  2IU0 A;  5D6P A;  3E86 A;  2XAH A;  3TZ4 A;  1BHB A;  2BU6 A;  1EZJ A;  2BYH A;  1JX9 A;  4R6Z A;  5CF0 A;  1YES A;  4LWI A;  3MHH C;  2IU3 A;  2XDL A;  1OCC B;  5BOC A;  3T1K A;  1B6Q A;  2WLJ A;  3VHD A;  4W7T A;  4YXW G;  3D3I A;  1AMW A;  4G28 B;  3JD4 A;  1S14 A;  2YED A;  3CCR V;  3VBB A;  2CH4 A;  3BMY A;  1FXK B;  3GWO A;  4P2Z A;  4QE7 A;  2BOB C;  1I5C A;  3LDC A;  1PKX A;  1E1Q G;  4HYO A;  4BXI A;  4MTX A;  2EBO A;  4UUJ C;  3CYO A;  3IC7 A;  2OTJ V;  1FXK A;  2HJF C;  4PRV A;  3H01 A;  1Z5B A;  4CWS A;  2EXL A;  1RM1 C;  4WFE A;  5J9P C;  1WLE A;  2IJH A;  5IYD O;  3K9A A;  1ENV A;  3QO8 A;  1UYI A;  4PA7 A;  2CG9 A;  2AKP A;  3C11 A;  3AG4 C;  4R50 A;  4HXZ A;  3FB8 C;  3SPJ A;  2B1I A;  2QE7 G;  2HVK C;  2X6C A;  3G75 A;  2Z5U A;  1K4C C;  2ZR2 A;  2A9H A;  3A0Z A;  3ZM7 A;  5IDJ A;  1EBO A;  4MVQ A;  2IWS A;  4L93 A;  1H8H G;  1US7 A;  1S5H C;  4XDK A;  3ZN0 A;  2EZP A;  2QA4 V;  4HZ0 A;  2IOP A;  2Y69 C;  2HG1 A;  4URL A;  4XKO A;  3CRL A;  1GKF A;  3H80 A;  1B63 A;  2XAB A;  3OE7 G;  4ASB A;  2ZXW C;  3CCU V;  3K04 A;  3ZKD A;  4B7P A;  2ITD C;  2FWZ A;  3JYC A;  1QLE C;  2VCI A;  1NBM G;  2WWW A;  3ETG A;  1K73 W;  3LSQ A;  3TCU A;  2XHR A;  2DYR C;  5M4K A;  2IH1 C;  4R7C A;  3OW6 A;  5C93 A;  4RUF A;  4H37 A;  1K5S A;  1B3Q A;  1QBZ A;  1S77 D;  3JD1 A;  2JDI G;  4H85 A;  3HB3 B;  5L3F A;  2XX2 A;  4CWR A;  3AG2 B;  1VQP V;  3QDD A;  2AHY A;  3W7T A;  1GM7 A;  1SER A;  5IY5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...