4JASA

Structural basis of a rationally rewired protein-protein interface (hk853mutant a268v, a271g, t275m, v294t and d297e and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
237
structure length
237
Chain Sequence
LKRIDRMKTEFIANISHELRTPLTVIKGYAEMIYNSLGELDLSTLKEFLETIIEQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine kinase
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
total genus 68
structure length 237
sequence length 237
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jasA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4jasA02
4CWRA 2WI7A 3BM9A 1KIJA 2CCUA 1TIDA 4E02A 3GIEA 3G7BA 1H7UA 4EGHA 4XD8A 5CF0A 4LWEA 4H81A 1Z5CA 3ZRVA 1EI1A 2XDSA 3EKOA 4XKKA 4GT8A 3CRKA 3T10A 1UYHA 1TC6A 3EHHA 2YEHA 2VW5A 5BODA 2YGEA 1QZRA 3ZXQA 3K97A 3EHJA 3GIGA 3OW6A 1TBWA 2QFOA 1YSRA 5FNFA 4LC1A 3R4PA 2C2AA 1JOYA 2BT0A 3ZCCA 2WWWA 3D0BA 4AWQA 3Q5KA 2YGAA 4FCPA 3Q5LA 4KFGA 4NH7A 2BYIA 2WI1A 2BRCA 4U93A 5M4MA 1GKXA 4CWOA 1ZWHA 4EFTA 2BU2A 1ZXNA 4CWQA 1YESA 1Z59A 2ESAA 3CWVA 2YI0A 2O1VA 4GCZA 4L90A 2Q2EB 2FXSA 4U7OA 2WI3A 2WEPA 1S14A 2LFSA 1L0OA 4MP7A 5IDMA 4V25A 4EMVA 3A0XA 3FT5A 1I5BA 5M4HA 4JAUA 4EGIA 5L3JA 2XDUA 3H4LA 2Q8HA 5CTWA 4X9LA 4XCJA 3LPSA 3ZKBA 1QYEA 1YC4A 1YC3A 1NHIA 3P32A 4ASGA 5CTUA 2XJXA 3QDDA 4AS9A 2Q8FA 4XTJA 4ASFA 4CWNA 3MNRP 4H7QA 4HY6A 4WUDA 5D7RA 4EFUA 2IWSA 2JJCA 4EM7A 1AM1A 2BU6A 3B27A 2XX2A 4JASA 4L8ZA 1Z5AA 2YJWA 4CWFA 2HKJA 5GGZA 2BTZA 5F3KA 1Y8OA 3OMUA 1YT0A 2WI5A 4BXIA 3OWDA 4BQGA 4QPKA 4LWIA 4LWGA 4GGLA 3RLQA 4R1FA 5D6QA 2P67A 4FPPA 2YI7A 2ZBKB 4B6CA 2O1UA 1UY7A 5CPHA 4PRXA 5CTXA 4YKWA 3TZ5A 4JQLA 1KZNA 1EA6A 4MPNA 1US7A 4XKOA 3T1KA 2YE5A 3R4OA 1I5DA 3R4MA 3KE6A 2GFDA 3D36A 4XIQA 1UY9A 2HG1A 2WERA 2YE6A 5J6AA 3DGEA 3RKZA 4BQJA 1YC1A 2ZDXA 2QM8A 2XHXA 1JM6A 3NMQA 3GIFA 1B62A 2VCIA 4WUCA 2Q8GA 3VADA 3RLPA 2XDXA 2UWDA 4I3HA 4YKRA 2XHRA 2YEBA 1UYEA 1UYMA 2QG0A 3Q5JA 5FNDA 4GFNA 1ZW9A 3PEHA 2YI6A 3EKRA 3K99A 1TC0A 3VHAA 4BAEA 5IN9A 1MU5A 2FYPA 4HY1A 4ZVIA 3RLRA 5J71A 4O07A 4R3MA 1UYKA 4XKAA 2PNRA 4MOTA 4FMTA 4XC0A 2QF6A 4KP4A 4URLA 4P8OA 3R4NA 3T0HA 1QY8A 5FWKA 2XJJA 3HEKA 3TZ4A 3ZRWA 1YETA 4HXWA 2AKPA 4YKTA 4Q20A 4KTNA 3CRLA 3U67A 4L94A 4MBCA 2YEGA 1UYDA 2YEJA 1UYFA 2YKIA 3ZXOA 2CG9A 3CGZA 3G75A 4CE3A 2YGFA 2BU7A 1Y4SA 3B28A 3A0YA 4LP0A 1YT2A 3TZ2A 5M4PA 5IDJA 1R62A 2YE3A 4MP2A 2GQPA 4KSGA 2HCHA 2IWUA 3MD0A 5M4NA 3U2DA 4EGKA 4KQVA 3T0ZA 3B24A 3O0IA 4CWSA 2YKCA 2YECA 5F5RA 2BSMA 4ZKIA 2YKBA 2E0AA 1TILA 3TTZA 3FV5A 4HZ0A 4YKUA 3VHDA 5FNCA 4L91A 4H85A 4WUBA 2IWXA 3PEJA 2ZKJA 2FWYA 2YI5A 1Y8NA 4YKQA 1UY8A 2BZ5A 1Z5BA 4XITA 4NH9A 2YK2A 1THNA 5BOCA 2Q8IA 3O2FA 1BGQA 1UYGA 4MPCA 3ZM7A 4XIPA 4CWTA 2YKJA 2YEDA 3HHUA 2CCTA 3SL2A 2JKIA 3A0WA 3INXA 1GKZA 2O1WA 2YE2A 2K5BA 1YSZA 4R3AA 3ZRXA 4FCQA 4BIUA 2XDKA 2YE7A 4MPEA 4HZ5A 5M4EA 1AJ6A 4QPJA 1TH8A 3A0RA 1U0ZA 4U7NA 1YS3A 2YK9A 1NHHA 4NH8A 1B3QA 2XX5A 5B1OA 1NHJA 2YEAA 4ASAA 3D2RA 3R91A 3JZ3A 3FT8A 4XE2A 4K4OA 4JYCA 3A0TA 4PU9A 4YKZA 1UYLA 5D7CA 3WHAA 1BKNA 4V26A 4XCLA 5D7DA 2BYHA 2YEFA 4LWHA 3C0EA 1Y4UA 4GEEA 2XDLA 2WI6A 4P7AA 2QM7A 1YERA 3INWA 2CCSA 2IORA 4YKYA 4CWPA 3WQ9A 2XJGA 4O04A 3HYYA 1B63A 4JYBA 1UYIA 4W7TA 1F51A 4DZYA 4EEHA 3K98A 2IOPA 2WI4A 2YE4A 4MB9A 1BXDA 3O6OA 1ZXMA 4URMA 2CGFA 4GT1A 3HZ5A 1AMWA 4LWFA 2BREA 2WI2A 3T2SA 1I58A 4UROA 3C11A 1U2OA 4MT8A 2BU5A 3VHCA 4O09A 2CH4A 4YKXA 4O0BA 3TK1A 3OWBA 2LFRA 1Y8PA 2WEQA 4B7PA 3BMYA 4HXZA 2ZDYA 3K60A 4AWPA 3LNUA 2IOQA 3OPDA 2XCMA 2VCJA 3HYZA 3B26A 4FCRA 4GQTA 1MX0A 1A4HA 4E00A 1UYCA 4XIRA 4DUHA 3U2KA 5CTYA 1I5AA 4O05A 1AH8A 1I59A 2FWZA 1PVGA 2QG2A 1ID0A 1AH6A 4KSHA 2YEEA 1S16A 4CE2A 4HYPA 4AWOA 1UY6A 3EHFA 4LPBA 4PRVA 4PL9A 3ZKDA 3GIGB 5D6PA 5M4KA 3R92A 2XHTA 4URNA 2H55A 1I5CA 5B1NA 1YT1A 4HYMA 3H80A 4XDMA 2XD6A 1H7SA 3G7EA 2BU8A 3NXSA 2XABA 2EXLA 3QTFA 4ASBA 3IEDA 3CGYA 2YJXA 2YE8A 4JAVA 1IXMA 4E01A 2VWCA 3HZ1A 4I5SA 3TZ0A 2YKEA 4BIZA 3EHGA 3TUHA 1OSFA 1BYQA 2H8MA 3B25A 2YE9A 5C93A 2XK2A 4MTXA 3ZRWB 4CE1A 1GJVA 2FTKA 2YEIA 3A0ZA 4L93A 2XX4A
chains in the Genus database with same CATH superfamily
2XHBA 3LMMA 4ZHQA 4LH6A 1ZTEA 3GWKC 5J9PC 1TIDA 4GX2A 2WLNA 1H7UA 5CBGA 4EGHA 5CF0A 1OCZB 4LWEA 3FFQA 3BFRA 5JVDB 1IXBA 1Z5CA 2NNUA 1EI1A 4UVBA 3H01A 3EKOA 1NTZH 3IAYA 2EIJB 1OCCC 5BODA 5HFMA 3IFXA 3X2QB 1QZRA 3ZXQA 4J41A 3K97A 1AVMA 5KUMA 1QVGU 4YJ2B 4W4LA 1YSRA 5FNFA 4NXNO 4CH3A 4MVRA 1Q5OA 4LF6B 5JQGA 1N32B 3FYIB 1UFIA 4A5UB 1DLBA 1VQ4V 4BWAA 3EVKA 3OMAB 5L3FA 2OWOA 2DYSC 1RPOA 1XMOB 2IM9A 1VQ7V 2IU3A 3SPCA 3UCSC 3F7YC 4E2LA 2JK5C 3S3WA 4F6EA 1XQ8A 4ZI7B 4LNUB 1Z59A 2ESAA 5IY5C 3ABLB 2YI0A 2Z3YA 2YIDA 4TOIA 2Q2EB 3ZN0A 2FXSA 4U7OA 1GN6A 4CS4A 5JH7A 4PD4F 2VRZA 2Z0AA 4UCRA 1SETA 3KZIZ 1Y74B 1GH6A 1S14A 2EINB 2ZKOA 4MP7A 2BE3A 4I55A 2AHZA 2WLKA 3AG1C 1V54B 1GAXA 1I5BA 4JAUA 5L3JA 1RSOB 2ZIOA 1KP2A 4JZGA 3ZKBA 5ITZB 4NXMO 2AW9A 1NHIA 3ASOB 5B1AB 3ZMVA 4X1YB 3QDDA 1MG1A 3CE2A 5CBFA 1N0NA 2IU0A 4IHJB 5D7RA 4R6ZA 3JD4A 1W0JG 2ZE7A 5D5QA 3STLC 4J10A 2YIBD 2P4KA 1R3LC 2JGDB 5HFLA 5KHKA 2WLMA 2PF4E 3JALA 4JI3B 2YC0A 5F3KA 3NR7A 2CGOA 1YT0A 2BSKB 3WFVA 3H1HH 1WPBA 4B08A 5GONB 4XDKA 2P67A 4FPPA 4B3MB 4FJCC 4B6CA 4X66O 2O1UA 3T1HO 3OMIB 1L0NH 1XUQA 1KYOF 4TV9B 3K5NA 4MPNA 3FKSG 4Z1VA 2Q4PA 4O4JA 4J42A 3ABMB 2RNBA 2HG5C 4O4HB 1AI7A 1JFFB 4K0KB 1UY9A 2OCHA 3E83A 5J6AA 3DGEA 3TETA 1XL4A 1Z2GA 2Y69B 5H6QA 3ZX6A 2QM8A 1FS0G 1JR9A 3C3TA 3NMQA 4FLWA 4EB6B 4Q6GA 5BZBA 5KHGA 2A3QA 4JI1O 3W7TA 4LF7O 5GTHZ 3RLPA 1RM1C 4IT5A 1UYEA 5A9GA 5KMGA 2ZM6B 4G27B 3PEHA 4TV8B 3EKRA 3K99A 1SZXA 1AR1B 5B1BB 1S5JA 1MZEA 4BAEA 4CH5A 1MU5A 4ZVIA 4OPAA 3FAVA 2IJIA 4WBNB 4MTFA 4LFCO 4R3MA 1WAZA 2YXHA 4XKAA 2PNRA 3BCCH 2YDEA 2IW5A 2LQTA 2BSKA 4DUYO 4P8OA 3VQWA 3CYGA 3G71V 4NYKA 1K9MW 3T0HA 3AEIA 4WFBV 4QNHB 2UUAO 4DR3B 2XJJA 3IGAC 4O4IB 3TZ4A 4NXNB 1YETA 3IC9A 4Q20A 2OTLV 1NKDA 3WU2Z 1V9PA 2YEJA 1UYFA 2BOBC 1JFFA 3ZMTA 4DR2O 1NR1A 2QM4A 1XMQO 2JJ2G 2BU7A 2Q0AA 1Y4SA 3B28A 2P6JA 3P3NA 2R72A 1GM8A 5LXTB 4MTOA 3TZ2A 4I0XA 4R50A 3DC5A 3VQYA 4JI4O 4MP2A 5KAFZ 4DV1O 1VQ8V 1NTMH 2P22C 4X8AA 1K34A 3JATA 2X6AA 2GV9A 3MD0A 1CXZB 3BRCA 2ILMA 3HKEB 4G2KA 3T0ZA 3LSSA 3B24A 1EM1A 1Q3EA 4RO2A 5EBWC 5JWPA 2E3CA 3G6EV 4OX9O 2YKCA 4PA3A 1F4MA 2E0AA 3BY6A 4K35A 3T4DA 3VHDA 1G6UA 2QWNB 4H44B 3CMAV 4L91A 3OMNB 4NTWA 4DV6B 3CRCA 3RN4A 4DV5B 2WLIB 3K9SA 3ZJZA 5CA0B 5K1XA 4FLVA 2W0XA 1Z5BA 4NXMB 4FLTA 2YK2A 4E72A 1GM7A 2Q8IA 1M56C 4NKGB 1VQNV 3ZM7A 4O4IA 1LUWA 1E1QG 5J2TB 4CWTA 4X89A 4I4TA 1NZ6A 4I50A 2Q69A 2F66C 5C8YB 5CB4B 1VQOV 2YE2A 3JASA 3ZRXA 3CS5A 1FPOA 1HDJA 4BIUA 1UJWB 2XDKA 4FCQA 4HZ5A 1AJ6A 3QNEA 2QE7G 1JQ0A 3AG3B 4LBEC 2BTOA 1TH8A 2NN4A 5EYPA 1GN3A 4J7JA 4O2BA 4MTGA 3D8CA 2ZE6A 1BGYH 1YS3A 2IBZH 2L35A 3K5LA 1U97A 4NH8A 1MZFA 1M1KW 2EIKC 1VEWA 3D2RA 2MK3A 1YDXA 2DQ3A 3CXCU 2N74A 4JYCA 4PU9A 4KFMA 1UYLA 1JVMA 4O4LB 2UXNA 1NVPB 4XDJA 3C0EA 3UM7A 1Y4UA 4GEEA 3D36C 2ZDIC 2XDLA 4Z2WA 4HNAB 4WFFA 3INWA 4DV0O 2ZXWC 4W7TA 2YICA 4UUJC 2QEXV 1NU1H 2IOPA 2RCVA 4PJ0Z 5LA6A 4LF7B 2CH7A 4UCTA 5CA1B 3K03A 1AMWA 1YJ9V 3L70H 1I0HA 5E79Z 1JA8A 1I58A 2AGAA 2DJVA 4MVUA 3UT5A 5CB4A 2XAQA 1KKDA 1G4YB 2L6LA 2OT5A 1VQ6V 3ZMZA 1P49A 4O0BA 1E79G 4UCVA 4LFCB 4MVSA 1BCCH 3K60A 2LJ2A 5LP6C 5IJ9B 4DUYB 2N04A 3N2GA 3BPZA 1VMGA 1M4UA 1A4HA 4JI6O 3CRRA 4DUHA 3U2KA 1WLEA 1OZ0A 1YJWV 2LGQA 4CH4A 1AH8A 1A32A 2WLLB 3MDSA 1I59A 4PA7A 1PM9A 4UXNA 3QO7A 3CEIA 4CC5A 5BMVB 4DV4B 4FIPC 4AWOA 4HNAA 1UY6A 3E35A 3ZKDA 2ADPA 1YI2V 1XMQB 2Q7GA 1ZAUA 3CC4V 5E1AC 5H6RA 3S3XA 1BE3H 1YT1A 3K06A 3OGCC 3H80A 1WP8A 3RVZA 4DV1B 4PA6A 2BU8A 4GX1A 1SQVH 5IT9N 3QF7A 3QTFA 1FD9A 3AG2B 1R6NA 3AK3A 3B8NA 1G8MA 1XHXA 2YJXA 1CP9A 4JAAA 1PD3A 4IL6Z 4OX9B 4YJ3A 4JAVA 4E01A 1H2MA 2YKEA 2UUCO 3FB7C 3EHGA 4JV5O 1OSFA 3IJ4A 4FK5C 3G80A 4EFBA 1L0LH 3B25A 2Q7EA 2KG7A 1HNXB 1XNQB 2YE9A 2XK2A 1YITV 3ZRWB 5JJJB 4CE1A 2FTKA 3CRQA 3BVOA 4J80A 2ZD9A 2XX4A 1YJNV 3HKBB 2OCCC 2ZR3A 2YS8A 2W6IG 3KG2A 2HP8A 4E02A 1IX9A 1AJQA 3G7BA 3HKDB 1WA8B 3HKCB 3ZRVA 1AR5A 1XI1A 5IWAB 4PI0A 1OCRC 3A2FA 2BCCH 3T1CA 2MW2B 2VW5A 3K57A 1MSDA 2P7TC 1T5EA 2A79B 3EHJA 3B2EE 4TUYB 2QFOA 4X1KB 3SYAA 4LC1A 4F4LA 5BR8O 4YIPA 3JCUZ 3R4PA 3K0GA 1XILA 3L73H 1ZX3A 2B1IA 3ZCCA 2WWWA 4AWQA 1YEWA 1PNLA 3ETGA 4FCPA 3D3IA 4CBCA 2LP7A 2UXBO 4AQYB 3SYQA 1NI8A 2BRCA 1I5XA 4U93A 1GN2A 2B1GA 4MW8A 1XBLA 1I08A 3CCLV 1GKXA 4FFBA 4DV0B 3AK1A 2CUGA 1ZXNA 1YESA 3CWVA 2FB5A 4JPRA 1FXKC 1S0VA 1X4TA 2YUAA 2WEPA 2HFEC 4JTCB 4FLUA 2LFSA 3H9VA 1SA0A 1U96A 1QLNA 3APOA 1OCCB 3A8TA 1WA8A 2ODMA 3E89A 2XDUA 2UXXA 2EIMC 1S76D 2BTQB 4XCJA 3LPSA 1QYEA 3TCUA 4X64O 4JI7O 3P32A 4JI0O 1EN6A 4GUNA 3CCRV 3IC7A 1H2GA 5EZYA 4B3SB 1ENVA 2XASA 4XTJA 4GKJO 4ZOLB 4X65O 1TUBB 3MNRP 3OFNG 2OIEA 2QTSA 4H7QA 4HY6A 2DYSB 2P06A 4EFUA 4JI5O 1Q43A 3ABKC 4JI6B 1YTFD 1EZVH 2BU6A 2XX2A 3G6BA 3ETDA 1IURA 4L8ZA 1Z5AA 2YJWA 1HW7A 1PPJH 3OEEG 1N36O 5GGZA 3QG5A 1Y8OA 5K1PA 3SJAC 3OMUA 5LBQA 2HVJC 1Q81W 2A7WA 5IY5B 4LWIA 3MAQA 4LF4O 4LWGA 4R1FA 2JRIA 4FM2A 2YI7A 2OYQA 1YHQV 4J9ZB 5CTXA 1TAEA 1KZNA 5IYDO 5FPRA 1EA6A 4XKOA 4ICGA 3CCEV 3AG1B 2CTWA 3R4OA 2GDSA 1M57C 2JDIG 4LFAB 2HG1A 4X20A 4YHHO 4JI2B 3RKZA 3CJHB 3M7MX 4BQJA 2ZDXA 1MA1A 2DYRB 1NBMG 2UUCB 3FB6C 2VCIA 5JENA 4U3FH 2Q8GA 5J2UB 4B7KA 3VADA 3BA8A 2XDXA 4H37A 1LUVA 2UWDA 4I3HA 1HR0B 1BSMA 2XHRA 3EFFK 2R9RB 4PA4A 4FM0A 1ZW9A 2N05A 4QJFB 4HYOA 2JEUA 4PHZA 1BZKA 3HB3B 3R66A 5IN9A 2XAHA 4X1IA 3RLRA 1VF6A 2LW7A 2F93B 1QLEC 1JCHA 3SYOA 1N34O 2Q73A 2K1EA 3CB2A 4MOTA 4FMTA 2QKCA 1D5NA 2KKWA 4MSWC 3R4NA 1TGOA 2RDCA 3FD9A 1V55C 5FWKA 2HHIA 5L3DA 3OTFA 3HEKA 4HXWA 3OD4A 2AKPA 1Q90D 2AXTZ 2HHHO 5A2QN 1QVFU 4LF8O 4KTNA 4UCUA 2E5LO 3CRLA 5JCOA 1QR9A 3A0BZ 3CMEV 2YEGA 2YKIA 3UKMA 3ZXOA 1GM9A 5H2FZ 3SPIA 3CGZA 2UXBB 4OPHA 4CE3A 5JVDA 3H1LH 1N0JA 3LDCA 3PN1A 2XTAA 2ZE8A 2JEXA 1RM1B 1Z5VA 2PI5A 3K5OA 4LP0A 4I9WA 1R62A 4RWUA 3CYOA 4P9OA 2GQPA 4KSGA 2CTQA 4BIOA 1LR1A 1VP7A 3RBZA 4UV8A 4H0LB 4YJ2A 2ZE5A 5LMUB 2YIAA 4EGKA 1HNWO 3BHPA 1N33O 1SERA 1PL0A 2X0LA 2YKBA 2JVDA 3B4SA 3U11A 4HZ0A 3FB8C 1IBKO 4YKUA 3CHXA 4NTYA 2YI8A 4K8ZA 4H85A 1MNGA 2ZCEA 3I55V 1I7FA 4FLYA 1W59A 2GHYA 5LYJB 1BL8A 3K9AA 1N4CA 4FVMA 2E75B 3B77A 2Q5ZA 4JI7B 4NH9A 4ZI7A 2R9AA 2F1MA 1THNA 2AZ0A 4LNUA 2NR5A 4DR5B 3I5DA 2YKJA 2YEDA 3J7AU 2CCTA 1H2KA 4GKJB 4X65B 3SL2A 3A0WA 3LSQA 1SESA 1YSZA 5LOVB 1Y74A 2ZT9B 4JI5B 1BQZA 3B40A 4MPEA 2ZINA 3WG7C 1N36B 3Q4HB 5KA5A 3EHBB 3C3SA 1RSOA 2JIZG 2H3OA 4ABMA 2QGNA 1U0ZA 2C1IA 1X59A 2ZR2A 4LF4B 3R65A 4YY3B 3CCVV 5ITZA 1NHJA 4LP8A 3MHHC 5B66Z 1D5AA 4AHCA 2HJDA 3R91A 1Y67A 4X1YA 3JD0A 4DR1O 2RMKB 5D7CA 2EX3A 4JTAB 4IHJA 2YEFA 3JCZA 3KCYA 4DYLA 4F6RB 3E8FA 4JYAO 2JGDA 2IORA 4CWPA 4L87A 3WQ9A 2DW4A 2F43G 2XJGA 1SKVA 1B63A 4DW0A 1F51A 4HAMA 4DZYA 1M56B 2Q0OC 3E22B 3D3QA 3E2EA 1FJGO 5GONA 3O6OA 2VQEO 1ZXMA 4URMA 2CGFA 3HZ5A 2ITDC 3E8BA 2WI2A 3T2SA 2Q68A 4BW5A 1IBMO 4D7TA 5IYCO 4TV9A 3SPHA 5LOVA 3SJQC 1XHZA 2F4VO 4O09A 4IIJB 4MW3A 4O4HA 4YKXA 3TK1A 5CN0A 2LFRA 1SQBH 1VARA 4J7ZA 3CX5F 2WEQA 1N34B 4HXZA 1KKCA 2EIKB 2UXDO 4EFEA 4PDLA 3K79A 4EB6A 3CRAA 2IOQA 3OPDA 3B26A 1H2LA 5B5EZ 3JARB 3BEHA 4O2AB 1MX0A 2YXLA 1UYCA 4DW1A 4R7CA 2Q67A 3RYHB 3OTOO 1I5AA 2VWJA 4TV8A 4LF8B 3ABMC 2E5LB 1PVGA 5CBHA 4TQDA 1VQPV 3O9OA 2DN9A 2Z5UA 2ZXWB 5DM6V 2PI4A 1PL4A 4HYPA 4E4EA 1DTOA 2Y69C 4WBNA 4PRVA 2HVKC 3GIGB 1R6KA 1O9GA 2XHTA 5BXZA 4URNA 4L8JA 3P3PA 2R70A 4FLXA 1KUQA 1M90W 2FMLA 4LFBO 4LWSB 4DR7O 3LDEA 4DV2O 1D2DA 4ASBA 4FM1A 4EEQA 3STZC 4BR6A 1AROP 1PP9H 5B1BC 4DUZO 1N33B 4D7SA 3GWOA 3JD1A 2CDYA 4B3RO 1F23A 3HR0A 1UPGA 1PNMA 3HZ1A 4I5SA 3TZ0A 4RUEA 4BIZA 1JJ2U 5LP6B 3H1JH 1IBKB 2WA3A 5BY1A 2H8MA 2DE0X 5C93A 4MTXA 1GJVA 2UXCO 2YEIA 2RQ6A 5LXTA 4DR4O 4OGQB 1YF2A 2ZIMA 4CWRA 4X66B 3T1HB 2QWRB 1KIJA 1IDSA 3CCUV 4D6TH 4XD8A 1J95A 3HKEA 3DXRB 4JI8O 4H81A 2EJRA 4R8CA 3ETEA 5EIBD 1NH2D 2UUBO 2XDSA 4XKKA 4GT8A 3FYEB 3CRKA 3T10A 3CD6V 3KCXA 4DV3O 2AZ2A 3ABUA 3EHHA 2YEHA 1SC5B 2LGWA 4EKWA 3UQ8A 3GIGA 1THZA 1TBWA 1B6QA 3ZIAG 1G1XB 4PV1B 1FFXB 1Y4MA 2WLIA 5CA0A 2P90A 5D5PA 1JOYA 3VQXA 4JI1B 3JYCA 3ZBHA 5J2TA 3D0BA 1HNZO 4DR1B 3Q5KA 2WLHA 3Q5LA 5C8YA 2D2CB 1N8RW 4NH7A 2BYIA 2WI1A 2GTSA 2G38A 4HZ3A 1R73A 3RW0A 4IGGA 4JYAB 1XNRO 2BU2A 1B06A 4CWQA 2OCCB 3CWBH 1SS3A 4L90A 3UO3A 2PTMA 3K0DA 1BS3A 2WI3A 1EN4A 2VQEB 2UUAB 2Q6AA 5IDMA 2FKXA 4EMVA 2ADQB 3A0XA 3FT5A 1OCRB 2AHYA 3OAAG 3OUFA 4O4LA 5DEDA 2WAMA 5M4HA 1JX9A 3H4LA 3AK2A 5CTWA 5GTIZ 4X9LA 3AG3C 1F4NA 1H2SB 4DR2B 5CMUA 5LHGA 1M5IA 5CTUA 1AILA 2XJXA 4NR1A 3L75H 4AS9A 4C7UA 3AG4C 2PYJA 4ASFA 2EULA 4JI4B 1AI4A 2F23A 3LNMB 3JAMN 5L3CA 4PDRA 2IWSA 3RFRA 5CA1A 2XAFA 3SGIA 1K4DC 1AM1A 2BOCC 3AG7A 3OTOB 5EBMC 4NTXA 4KXRA 4CWFA 1GTOA 2BTZA 1QR8A 4NVPA 2PYLA 3RYIB 1SZTA 2IJKA 2WI5A 1DK1A 2UU9O 1GK9A 4QPKA 1F7YA 3RLQA 3VOUA 3CP1A 2XT9A 4PDMA 1FXKB 2Y4TA 1L1FA 5CPHA 2CAZC 4YKWA 5IJ9A 4JQLA 1IVSA 1CEZA 2CTRA 5LGNA 3T1KA 4DR7B 1I5DA 4DV2B 1ORQC 3ML0A 3KE6A 2GFDA 4XIQA 1Y76B 2WERA 2DQ0A 2FYUH 2GTAA 2WLLA 1AI5A 2V4DA 3ASNC 4B3RB 1VQ5V 1MMMA 3L74H 2A06H 1JM6A 4G28B 5BMVA 1B62A 2Q7HA 1I94O 4TT3G 4WUCA 3DTUB 1OCOC 4LF6O 3LUTB 5CA3A 1B04A 1XEQA 2UXCB 3TXQA 2YSUB 1UYMA 2YEVB 4DR4B 2YI6A 4UVAA 2W0FC 2HEPA 1H2NA 2CK3G 3VHAA 3H1IH 4BAYA 4HY1A 3CC7V 4JI8B 3MHSC 1GN4A 1UYKA 1EFRG 5FNVB 4XC0A 4B7EA 1TVKB 4KP4A 5EIBC 2QF6A 4URLA 1EZJA 4DV3B 1NS1A 1QY8A 1ZL8B 1GO3F 1S72V 5LL6Y 1WJZA 3SYPA 3ZRWA 4X62O 5AG2A 2EILC 5LHIA 5KX5B 3CPWU 4DK0A 3JAWB 3C90A 1K5QA 3CCQV 4HBNA 3HKBA 3WB2A 2V7QG 2IJHA 4UB8Z 4FZ0A 4RUFA 5DN6G 3FX7A 5KLVH 4KHPO 3AG2C 1EBOA 3W7WA 4L94A 2CG9A 3HKDA 1Y76A 4TQFA 3HKCA 2YGFA 2WLJA 1HP8A 4LF5O 3A0YA 1US6A 4DV7O 3N2KB 4GKKO 5M4PA 4ZHQB 5H9CA 3BAAA 2IWUA 4TUYA 4X1KA 5M4NA 3U2DA 1WP7A 2HLDG 4KQVA 1RP3B 3O0IA 5EK0A 1YXBA 2X6CA 4CWSA 2YECA 5F5RA 4ZKIA 5IYBO 3TTZA 4CH6A 3FV5A 1DF5A 4YXWG 4B3MO 1V55B 5EC1C 3U10A 2ZKJA 1VIBA 2DWDC 3M8AA 1Y8NA 4UCOA 4YKQA 4P9PA 2P4VA 2BZ5A 3TGUH 4XITA 2XAGA 5JQGB 5BOCA 3RT3C 3SDLA 4MVMA 1K97A 2JGUA 4XIPA 1FAFA 4WFGA 3OUSA 5L3EA 2JKIA 1SQXH 3F5TA 3INXA 5B3SC 1KU9A 3B8MA 5KA6A 3JSLA 1PV0A 2YE7A 1KMIZ 4BW9A 4QPJA 1CPYA 3ZHSA 4DRXB 4GX5A 2PGGA 2LO1A 1KBHA 3W7UA 3SJCC 3SJBC 1XL6A 1QQCA 3T2MA 3WB1A 2BTQA 4U7NA 3FB5C 5JH7B 1VF7A 4XBFA 4WCEV 4JV5B 1NHHA 2YK9A 1VF5B 2YEAA 4ASAA 2XUMA 3JZ3A 5FL7G 4XE2A 4I55B 2E76B 2QKSA 4K4OA 1TA8A 3A0TA 2PY5A 4ZOLA 1TUBA 3WHAA 1BKNA 4V26A 5D7DA 3E86A 2BYHA 3VBBA 1AI6A 2QM7A 1VQ9V 2W6JG 1ZLZA 4LF9O 2CCSA 2QWQB 2E74B 3HYYA 2LW1A 1UYIA 4DR3O 1Q6IA 1GMGA 5DECA 3TJTA 1FFTB 4ASUG 2WI4A 1Y6XA 2YE4A 2EZPA 4TWKA 1I94B 4H13B 4MB9A 1BXDA 3O65A 4GT1A 1MSWD 2BREA 1XDCA 4UROA 5JJEB 5BR8B 3C11A 1R3IC 3JALB 3ETQA 1U2OA 5KUKA 5LGTA 3WG7B 1YTFB 4CS2A 1VF6C 1AJNA 2YI9A 1AR4A 2BU5A 3JD3A 3W7XA 1R1BA 3ZHQA 1P7BA 1Y8PA 3ZRSA 3BMYA 4DRXA 3CJHA 4AILC 4AWPA 3OGIB 2ZQMA 5J2UA 4O4JB 1OHHG 5EBLC 2KSDA 4E00A 3SYCA 2ITCC 2DOSA 2CGNA 3M99B 4X62B 3HPLC 4O05A 3DC6A 5JCOC 4KHPB 3RGBA 4DV6O 4KSHA 2YEEA 1JJOA 1OCZC 2GUZB 4DV5O 2Y4UA 4DXWA 1R3KC 3JAKB 5M4KA 2DYRC 3OEHG 1OV9A 2EIJC 4LF5B 2H55A 5IJ0B 4DV7B 1I5CA 5KMGB 5B1NA 3X2QC 4GKKB 4HYMA 1Q6UA 2CTPA 1OJHA 4X64B 2C1GA 2HJFC 4JI0B 1MABG 1FKAO 3G7EA 2QJ1A 4KL1A 3NXSA 3T1YO 3L71H 1Q8IA 2A0LA 1QBZA 1NR7A 3FAVB 3B09A 4CZZA 2QDOA 2FL4A 2YE8A 2DWEC 1XOUA 1BYQA 4WFHA 3VQVA 2F95B 3J80N 4OXSA 1MOFA 1NQTA 2ATKC 3A0ZA 2H94A 1PNKA 2IH3C 3ABLC 4WFEA 4MVZA 2WI7A 3CCJV 3GB7C 3BM9A 2ETNA 2CCUA 3GIEA 1IZ3A 3ZMSA 3JD2A 2EINC 1J5EO 1H8EG 1P4RA 3QO8A 1V54C 1UYHA 2GUZA 4QGPA 4I0XB 1TC6A 4YHHB 1K7DA 4J9YB 2YGEA 3JAKA 1JMKC 4GYCB 3RYCB 3JATB 3OW6A 3OT7A 2A9HA 5H5NA 1K33A 2EZOA 5LYJA 5IJ0A 4P30A 3H1KH 3ASOC 2C2AA 5B1AC 1Y66A 3A0HZ 2BT0A 1SF9A 4X9QA 2YGAA 1KECA 5L3GA 3E8HA 1DF4A 4KFGA 2K9PA 5M4MA 2PZSA 1K92A 4CWOA 2ARHA 4QE9A 1ZWHA 4LF9B 1PKXA 4EFTA 3LNNA 3Q4HA 1W2BU 1AP5A 4CS3A 4Z1MG 2Q8VA 2O1VA 4GCZA 1H38A 2VQFO 4I4TB 3TXSA 4I50B 1WB8A 3BA9A 1AJPA 5JJNB 1FXHA 4CC6A 4N23A 2XNDG 3JASB 1S77D 1NVPD 1ZUQA 1L0OA 4WF9V 4DV4O 4V25A 2X7RB 3ICXA 2HHHB 4DR6O 2OIGA 4EGIA 5EYPB 4O2BB 3SPGA 2WSSG 3KKYA 5KHIA 3CSXA 2Q8HA 3K08A 3OW2U 4PDVA 1R3JC 4F6RA 1YC4A 1YC3A 4ASGA 4ZIBA 4UVCA 2WPDG 4NB5A 2M7WA 3RYCA 1H8HG 3E22A 2Q8FA 4CWNA 4WUDA 4UV9A 2ZNIA 2JJCA 5F2VO 1K5SA 4EM7A 3B27A 4JASA 1HNWB 2RN9A 1WNSA 2HKJA 2WA4A 3K3WA 1SQQH 3ZEDA 1SQGA 4MVOA 4AI8A 1HNXO 1VQMV 1XNQO 4BXIA 2YIBA 3OWDA 4BQGA 4IIJA 2D3OW 4GGLA 5LA6B 3T4ZA 2CH7B 5D6QA 3CRMA 2ZBKB 3QO5A 1UY7A 3CCSV 4PRXA 3TZ5A 3UT5B 5EC2C 1US7A 2B9ZA 5KHJA 1IBLO 3JARA 4XDLA 4O2AA 2YE5A 2XAJA 3T1YB 3OE7G 3R4MA 5IWAO 2H8PC 4ZBMA 3D36A 1QCEA 2ZDIA 3RYHA 2R9IA 2YE6A 2JS3A 4TSFG 1YC1A 4LCUC 2XHXA 3GIFA 4YIOA 1YSCA 3ABTA 4JTDB 2GBOA 2OTJV 3N2GB 4PI2A 3P30A 3AG4B 4YKRA 3THOA 2YEBA 2QG0A 3Q5JA 5FNDA 4GFNA 4MS2A 2Y48A 3ZHUA 1K3EA 1TC0A 4AQYO 4LWSA 2B5UA 1YVWA 2IJJA 1K73W 2FYPA 1WN7A 5FPOA 1YZBA 3E8GA 5J71A 3ZN1A 4O07A 1L8DA 3L9DA 1J5EB 1COWG 1QHTA 1LNQA 4QE7A 4UB6Z 4B3TO 1BQ0A 3K5MA 1W0KG 1P7GA 5LP6A 1KQSU 3OR7C 5TISZ 1NJIW 4PELA 1FJGB 3ZMUA 4YKTA 2HR3A 1YCIA 4YJ3B 3SR2C 3ASNB 3U67A 1WB7A 3QVNA 4MBCA 1UYDA 1IBMB 4U3JB 1RFYA 1TUEB 3DXRA 3G75A 2KG7B 1Q82W 2QSAA 1URFA 4IYIA 1OCOB 2F4VB 1KC8W 3JSNA 1SQFA 5IYZB 3L72H 1YIJV 4B3SO 1YT2A 2KB1A 2V1DA 3GVMA 5IDJA 1BHBA 2YE3A 3ZHRA 4WFAV 4DO2A 3RYFB 2UXDB 2HCHA 3F5WC 2VQFB 1FFXA 4FZ1A 3F7VC 4RQEA 5LMNO 4KUMA 5LGUA 1O9HA 4JZ2A 3OM3B 2BSMA 4J7KA 1Z5WA 1TILA 2QA4V 3G4SV 1FYJA 1NH2B 4DR6B 5FNCA 3W7SA 4WUBA 2IWXA 3PEJA 5KAIZ 5LHHA 2FWYA 4I9QA 2YI5A 1E1RG 1UY8A 2EBOA 3CCMV 4LH7A 4L93A 2EILB 1M93A 3O2FA 1S5LZ 1UYGA 2P5OA 4MPCA 1GKFA 3HHUA 2Y0PA 3LDDA 4LFAO 2VS0A 1GKZA 4LFBB 1JPXA 2O1WA 2K5BA 4JI2O 3ZHVA 4R3AA 2X6BA 2QTOA 3I56V 2NLJC 5M4EA 2EIMB 4FFBB 4DUZB 4U3JA 1NTKH 4JYYA 4GX0A 4FFKA 3A0RA 1HR0O 3UO2A 5IYZA 3CXHF 2M6YA 1B3QA 4MVQA 2XX5A 5B1OA 1R6TA 1VQLV 4GZRB 1N32O 3RYFA 1SRYA 1Q86W 3FT8A 1S5HC 3S5TA 1SA0B 3ABKB 4PA9A 1FXVA 4YKZA 3ZS8C 5IE9A 4XCLA 2O57A 1IBLB 3EXAA 4LWHA 1KD1W 1XMOO 1BHAA 2CE4A 1RPRA 1Q6HA 2WI6A 3SPJA 4P7AA 1KB9F 1KP3A 1YERA 4UFZA 4YKYA 3U0ZA 4O04A 2UUBB 3RVYA 4JYBA 3RYIA 5EZYB 4EEHA 1GRJA 3K98A 2QKAA 4RAIA 5L3BA 3APQA 4LR3A 1M9NA 3DSQA 1VQKV 1AP6A 1K4CC 2IH1C 1FXKA 4LWFA 3QTCA 5B3SB 4X88A 1HWYA 4H33A 1EN5A 1M57B 1QU7A 1XREA 2RJZA 3J81N 4QIWF 4MT8A 1QNMA 3G67A 5KHHA 3OR6C 3VHCA 3LSUA 3RWRD 1HNZB 2CH4A 4GLXA 3OWBA 4JF3A 4RQFA 4J11A 4FLZA 4B7PA 3K59A 4B3TB 1WPXA 2ZDYA 1Q7YW 2QWOB 3LNUA 5LMUO 5FLXN 1XNRB 2XCMA 2VCJA 3HYZA 2Y0IA 4FCRA 4GQTA 1S3JA 1BT8A 3PJSK 1SQPH 2EJ7A 4XIRA 2QWPB 5CTYA 2YEVA 1ZWIC 4X20B 4DK1A 2FWZA 4JI3O 5GW7A 2QG2A 2PUSA 1ID0A 4K3AA 1AH6A 1QLEB 4N21A 1S16A 4CE2A 2JS5A 2VWKA 3K58A 3EHFA 4LPBA 4K8XA 3K04A 4PL9A 5D6PA 1I5YA 3R92A 5FNVA 3ZHTA 1BMFG 4DR5O 1TVKA 1P84F 4IYHA 2YXYA 4I7ZB 2KQXA 1ZL8A 4XDMA 2QR4A 2XD6A 1H7SA 1DGSA 2JJ1G 2XABA 4X1IB 2EXLA 2DMXA 2ZNJA 3IEDA 3CGYA 5LMNB 4K0KO 5KX5A 3JAWA 3CC2V 1ROPA 1IXMA 2VWCA 1NT2B 1K8AW 2HKOA 3N27A 1ZSPA 3TUHA 3BABA 4YY3O 2Q9LA 4UCSA 2XOKG 2GSMB 2UU9B 4P2ZA 4JGSA 3WB0A 2ZM6O 3N2KA 1AB3A 4W4KA 1BGQA
chains in the Genus database with same CATH topology
5J9PC 1TIDA 4GX2A 2WLNA 1H7UA 5CBGA 4EGHA 5CF0A 1OCZB 4LWEA 1Z5CA 2NNUA 1EI1A 4UVBA 3H01A 3EKOA 2EIJB 1OCCC 5BODA 5HFMA 3IFXA 3X2QB 1QZRA 3ZXQA 3K97A 5KUMA 1QVGU 1YSRA 5FNFA 4MVRA 3FYIB 1DLBA 1VQ4V 3OMAB 5L3FA 2DYSC 1RPOA 1VQ7V 2IU3A 3SPCA 3F7YC 4E2LA 2JK5C 1Z59A 2ESAA 5IY5C 3ABLB 2YI0A 2Z3YA 2Q2EB 3ZN0A 2FXSA 4U7OA 1SETA 1S14A 2EINB 4MP7A 2AHZA 2WLKA 3AG1C 1V54B 1I5BA 4JAUA 5L3JA 1KP2A 3ZKBA 1NHIA 3ASOB 5B1AB 3ZMVA 3QDDA 1MG1A 5CBFA 2IU0A 5D7RA 4R6ZA 3JD4A 1W0JG 3STLC 1R3LC 5HFLA 2WLMA 5F3KA 1YT0A 3WFVA 4XDKA 2P67A 4FPPA 4FJCC 4B6CA 2O1UA 3OMIB 4MPNA 3FKSG 3ABMB 2HG5C 1AI7A 1UY9A 3E83A 5J6AA 3DGEA 3TETA 1XL4A 2Y69B 5H6QA 2QM8A 1FS0G 3NMQA 5BZBA 3W7TA 3RLPA 1RM1C 1UYEA 4G27B 3PEHA 3EKRA 3K99A 1AR1B 5B1BB 4BAEA 1MU5A 4ZVIA 2IJIA 4MTFA 4R3MA 4XKAA 2PNRA 2IW5A 4P8OA 3G71V 1K9MW 3T0HA 3AEIA 4WFBV 4QNHB 2XJJA 3IGAC 3TZ4A 1YETA 4Q20A 2OTLV 1NKDA 2YEJA 1UYFA 2BOBC 3ZMTA 1NR1A 2JJ2G 2BU7A 1Y4SA 3B28A 2P6JA 1GM8A 3TZ2A 4MTOA 4R50A 4MP2A 1VQ8V 4X8AA 1K34A 2X6AA 3MD0A 4G2KA 3T0ZA 3LSSA 3B24A 4RO2A 5EBWC 3G6EV 2YKCA 4PA3A 1F4MA 2E0AA 3BY6A 3T4DA 3VHDA 3CMAV 4L91A 3OMNB 2WLIB 3ZJZA 1Z5BA 2YK2A 1GM7A 2Q8IA 1M56C 1VQNV 3ZM7A 4CWTA 1E1QG 4X89A 2Q69A 1VQOV 2YE2A 3ZRXA 4FCQA 4BIUA 1UJWB 2XDKA 4HZ5A 1AJ6A 3QNEA 2QE7G 1JQ0A 3AG3B 4LBEC 1TH8A 4MTGA 1YS3A 4NH8A 1M1KW 2EIKC 3D2RA 2MK3A 2DQ3A 3CXCU 4JYCA 4PU9A 4KFMA 1UYLA 1JVMA 2UXNA 1NVPB 4XDJA 3C0EA 3UM7A 1Y4UA 4GEEA 2ZDIC 2XDLA 4WFFA 3INWA 2ZXWC 4W7TA 4UUJC 2QEXV 2IOPA 3K03A 1AMWA 1YJ9V 1I58A 4MVUA 2XAQA 1KKDA 1G4YB 2OT5A 1VQ6V 3ZMZA 4O0BA 1E79G 4MVSA 3K60A 1A4HA 4DUHA 3U2KA 1WLEA 1OZ0A 1YJWV 1AH8A 2WLLB 1I59A 4PA7A 4UXNA 3QO7A 4FIPC 4AWOA 1UY6A 3E35A 3ZKDA 1YI2V 3CC4V 5E1AC 5H6RA 1YT1A 3K06A 3OGCC 3H80A 3RVZA 4PA6A 2BU8A 4GX1A 3QTFA 3AG2B 1R6NA 3B8NA 1G8MA 2YJXA 1CP9A 1PD3A 4JAVA 4E01A 2YKEA 3FB7C 3EHGA 1OSFA 4FK5C 3B25A 2YE9A 2XK2A 1YITV 3ZRWB 4CE1A 2FTKA 2ZD9A 2XX4A 1YJNV 2OCCC 2ZR3A 2W6IG 3KG2A 4E02A 1AJQA 3G7BA 3ZRVA 1OCRC 3T1CA 2VW5A 2P7TC 2A79B 3EHJA 2QFOA 3SYAA 4LC1A 4F4LA 3R4PA 3K0GA 2B1IA 3ZCCA 2WWWA 4AWQA 1PNLA 3ETGA 4FCPA 3D3IA 4CBCA 2LP7A 3SYQA 2BRCA 1I5XA 4U93A 2B1GA 4MW8A 3CCLV 1GKXA 1ZXNA 1YESA 3CWVA 4JPRA 1FXKC 1S0VA 2WEPA 2HFEC 4JTCB 2LFSA 1QLNA 1OCCB 3E89A 2XDUA 2UXXA 2EIMC 1S76D 4XCJA 3LPSA 1QYEA 3TCUA 3P32A 3CCRV 3IC7A 1H2GA 1ENVA 2XASA 4XTJA 3MNRP 3OFNG 4H7QA 4HY6A 2DYSB 4EFUA 3ABKC 1YTFD 2BU6A 2XX2A 3ETDA 4L8ZA 1Z5AA 2YJWA 3OEEG 5GGZA 1Y8OA 3OMUA 5LBQA 2HVJC 1Q81W 5IY5B 4LWIA 4LWGA 4R1FA 2YI7A 1YHQV 4J9ZB 5CTXA 1KZNA 5IYDO 1EA6A 4XKOA 3CCEV 3AG1B 3R4OA 1M57C 2JDIG 2HG1A 3RKZA 4BQJA 2ZDXA 2DYRB 1NBMG 3FB6C 2VCIA 2Q8GA 3VADA 2XDXA 4H37A 2UWDA 4I3HA 2XHRA 3EFFK 2R9RB 4PA4A 1ZW9A 4QJFB 4HYOA 2JEUA 3HB3B 5IN9A 2XAHA 3RLRA 1QLEC 1JCHA 3SYOA 2K1EA 4MOTA 4FMTA 4MSWC 3R4NA 1V55C 5FWKA 5L3DA 3HEKA 4HXWA 2AKPA 1QVFU 4KTNA 3CRLA 1QR9A 3CMEV 2YEGA 2YKIA 3UKMA 3ZXOA 1GM9A 3SPIA 3CGZA 4CE3A 3LDCA 2JEXA 1RM1B 2PI5A 4LP0A 4I9WA 1R62A 3CYOA 4P9OA 2GQPA 4KSGA 3RBZA 4UV8A 4EGKA 1SERA 1PL0A 2X0LA 2YKBA 4HZ0A 3FB8C 4YKUA 4H85A 3I55V 2GHYA 1BL8A 3K9AA 3B77A 4NH9A 1THNA 2YKJA 2YEDA 2CCTA 3SL2A 3A0WA 3LSQA 1SESA 1YSZA 4MPEA 3WG7C 5KA5A 3EHBB 2JIZG 1U0ZA 2ZR2A 3R65A 3CCVV 1NHJA 4LP8A 3MHHC 3R91A 3JD0A 5D7CA 4JTAB 2YEFA 3JCZA 3E8FA 2IORA 4CWPA 4L87A 3WQ9A 2DW4A 2F43G 2XJGA 1B63A 1F51A 4HAMA 4DZYA 1M56B 3E2EA 3O6OA 1ZXMA 4URMA 2CGFA 3HZ5A 2ITDC 3E8BA 2WI2A 3T2SA 2Q68A 4BW5A 5IYCO 3SPHA 3SJQC 4O09A 4MW3A 4YKXA 3TK1A 5CN0A 2LFRA 2WEQA 4HXZA 2EIKB 4PDLA 3K79A 2IOQA 3OPDA 3B26A 3BEHA 1MX0A 1UYCA 4R7CA 2Q67A 1I5AA 3ABMC 1PVGA 5CBHA 1VQPV 2Z5UA 2ZXWB 5DM6V 2PI4A 4HYPA 1DTOA 2Y69C 4PRVA 2HVKC 3GIGB 1R6KA 2XHTA 4URNA 1M90W 3LDEA 4ASBA 3STZC 1AROP 5B1BC 3GWOA 3JD1A 1F23A 1PNMA 3HZ1A 4I5SA 3TZ0A 4RUEA 4BIZA 1JJ2U 2H8MA 5C93A 4MTXA 1GJVA 2YEIA 4CWRA 1KIJA 3CCUV 4XD8A 1J95A 4H81A 2EJRA 4R8CA 3ETEA 1NH2D 2XDSA 4XKKA 4GT8A 3FYEB 3CRKA 3T10A 3CD6V 3ABUA 3EHHA 2YEHA 4EKWA 3GIGA 1THZA 1TBWA 1B6QA 3ZIAG 1Y4MA 2WLIA 2P90A 1JOYA 3JYCA 3D0BA 3Q5KA 2WLHA 3Q5LA 1N8RW 4NH7A 2BYIA 2WI1A 4HZ3A 1R73A 3RW0A 2BU2A 4CWQA 2OCCB 4L90A 3K0DA 2WI3A 2Q6AA 5IDMA 4EMVA 3A0XA 3FT5A 1OCRB 2AHYA 3OAAG 3OUFA 5M4HA 2WAMA 1JX9A 3H4LA 5CTWA 4X9LA 3AG3C 1F4NA 5CMUA 5LHGA 5CTUA 2XJXA 4AS9A 3AG4C 4ASFA 1AI4A 3LNMB 5L3CA 4PDRA 2IWSA 2XAFA 1K4DC 1AM1A 2BOCC 5EBMC 4CWFA 1GTOA 2BTZA 1QR8A 1SZTA 2IJKA 2WI5A 1GK9A 4QPKA 3RLQA 3VOUA 3CP1A 4PDMA 1FXKB 1L1FA 5CPHA 4YKWA 4JQLA 1CEZA 5LGNA 3T1KA 1I5DA 1ORQC 3ML0A 3KE6A 2GFDA 4XIQA 2WERA 2DQ0A 2WLLA 1AI5A 3ASNC 1VQ5V 1JM6A 4G28B 1B62A 4TT3G 4WUCA 3DTUB 1OCOC 3LUTB 5CA3A 2YSUB 1UYMA 2YEVB 2YI6A 4UVAA 2W0FC 2CK3G 3VHAA 4BAYA 4HY1A 3CC7V 3MHSC 1UYKA 1EFRG 4XC0A 2QF6A 4KP4A 4URLA 1EZJA 1QY8A 1GO3F 1S72V 3SYPA 3ZRWA 2EILC 5LHIA 3CPWU 1K5QA 3CCQV 5DN6G 2V7QG 2IJHA 4RUFA 3AG2C 1EBOA 3W7WA 4L94A 2CG9A 2YGFA 2WLJA 3A0YA 5M4PA 5H9CA 2IWUA 5M4NA 3U2DA 2HLDG 4KQVA 3O0IA 5EK0A 2X6CA 4CWSA 2YECA 5F5RA 4ZKIA 5IYBO 3TTZA 3FV5A 1DF5A 4YXWG 1V55B 5EC1C 2ZKJA 2DWDC 1Y8NA 4YKQA 4P9PA 2BZ5A 4XITA 2XAGA 5BOCA 4MVMA 1K97A 4XIPA 4WFGA 3OUSA 5L3EA 2JKIA 3INXA 5B3SC 3B8MA 5KA6A 2YE7A 4QPJA 1CPYA 4GX5A 3W7UA 1XL6A 3T2MA 4U7NA 3FB5C 4XBFA 1NHHA 4WCEV 2YK9A 2YEAA 4ASAA 3JZ3A 5FL7G 4XE2A 2QKSA 4K4OA 3A0TA 3WHAA 1BKNA 4V26A 5D7DA 3E86A 2BYHA 3VBBA 1AI6A 2QM7A 1VQ9V 2W6JG 2CCSA 3HYYA 1UYIA 1GMGA 1FFTB 4ASUG 2WI4A 2YE4A 2EZPA 4TWKA 4MB9A 1BXDA 4GT1A 1MSWD 2BREA 4UROA 3C11A 1R3IC 1U2OA 5KUKA 5LGTA 3WG7B 1YTFB 1AJNA 2BU5A 3JD3A 3W7XA 1P7BA 1Y8PA 3ZRSA 3BMYA 4AWPA 2ZQMA 1OHHG 5EBLC 4E00A 3SYCA 2ITCC 3M99B 3HPLC 4O05A 4KSHA 2YEEA 1OCZC 4DXWA 1R3KC 5M4KA 2DYRC 3OEHG 2EIJC 2H55A 1I5CA 5B1NA 3X2QC 4HYMA 2HJFC 1MABG 3G7EA 3NXSA 2A0LA 1QBZA 1NR7A 4CZZA 2YE8A 2DWEC 1BYQA 4WFHA 4OXSA 1MOFA 1NQTA 2ATKC 3A0ZA 2H94A 1PNKA 2IH3C 3ABLC 4WFEA 4MVZA 2WI7A 3CCJV 3GB7C 3BM9A 2CCUA 3GIEA 3ZMSA 3JD2A 2EINC 1H8EG 1P4RA 3QO8A 1V54C 1UYHA 1TC6A 1K7DA 4J9YB 2YGEA 3OW6A 2A9HA 1K33A 2EZOA 4P30A 3ASOC 2C2AA 5B1AC 1Y66A 2BT0A 2YGAA 1KECA 5L3GA 3E8HA 1DF4A 4KFGA 5M4MA 1K92A 4CWOA 1ZWHA 4QE9A 1PKXA 4EFTA 1W2BU 4Z1MG 2O1VA 4GCZA 1H38A 1AJPA 1FXHA 4N23A 2XNDG 1S77D 1NVPD 1L0OA 4WF9V 4V25A 2X7RB 4EGIA 3SPGA 2WSSG 2Q8HA 3K08A 3OW2U 4PDVA 1R3JC 1YC4A 1YC3A 4ASGA 4UVCA 2WPDG 2M7WA 1H8HG 2Q8FA 4CWNA 4WUDA 4UV9A 2JJCA 1K5SA 4EM7A 3B27A 4JASA 2HKJA 3K3WA 4MVOA 1VQMV 4BXIA 3OWDA 4BQGA 2D3OW 4GGLA 3T4ZA 5D6QA 2ZBKB 3QO5A 1UY7A 3CCSV 4PRXA 3TZ5A 5EC2C 1US7A 4XDLA 2YE5A 2XAJA 3OE7G 3R4MA 2H8PC 4ZBMA 3D36A 1QCEA 2ZDIA 2R9IA 2YE6A 4TSFG 1YC1A 4LCUC 2XHXA 3GIFA 1YSCA 3ABTA 4JTDB 2OTJV 3P30A 3AG4B 4YKRA 2YEBA 3Q5JA 2QG0A 5FNDA 4GFNA 4MS2A 2Y48A 1K3EA 1TC0A 2B5UA 2IJJA 1K73W 2FYPA 3E8GA 5J71A 3ZN1A 4O07A 1COWG 1LNQA 4QE7A 1W0KG 1KQSU 3OR7C 1NJIW 4PELA 3ZMUA 4YKTA 2HR3A 3ASNB 3U67A 4MBCA 1UYDA 1TUEB 3G75A 1Q82W 1OCOB 1KC8W 1YIJV 1YT2A 2KB1A 2V1DA 5IDJA 1BHBA 2YE3A 4WFAV 4DO2A 2HCHA 3F5WC 3F7VC 4RQEA 4KUMA 5LGUA 3OM3B 2BSMA 1TILA 2QA4V 3G4SV 1NH2B 5FNCA 3W7SA 4WUBA 2IWXA 3PEJA 5LHHA 2FWYA 2YI5A 1E1RG 1UY8A 2EBOA 3CCMV 2EILB 3O2FA 1UYGA 4MPCA 1GKFA 3HHUA 3LDDA 1GKZA 1JPXA 2O1WA 2K5BA 4R3AA 2X6BA 2QTOA 3I56V 2NLJC 5M4EA 2EIMB 4GX0A 3A0RA 4MVQA 1B3QA 2XX5A 5B1OA 1VQLV 1SRYA 1Q86W 3FT8A 1S5HC 3ABKB 4PA9A 1FXVA 4YKZA 4XCLA 4LWHA 1KD1W 1BHAA 1RPRA 2WI6A 3SPJA 4P7AA 1KP3A 1YERA 4YKYA 4O04A 3RVYA 4JYBA 4EEHA 3K98A 4RAIA 5L3BA 1M9NA 1VQKV 1K4CC 2IH1C 1FXKA 4LWFA 5B3SB 4X88A 1HWYA 4H33A 1M57B 4QIWF 4MT8A 3OR6C 3VHCA 2CH4A 3OWBA 4JF3A 4RQFA 4B7PA 1WPXA 2ZDYA 1Q7YW 3LNUA 2XCMA 2VCJA 3HYZA 4FCRA 4GQTA 1S3JA 3PJSK 4XIRA 5CTYA 2YEVA 1ZWIC 2FWZA 5GW7A 2QG2A 1ID0A 1AH6A 1QLEB 4N21A 1S16A 4CE2A 3EHFA 4LPBA 3K04A 4PL9A 5D6PA 1I5YA 3R92A 1BMFG 4XDMA 2XD6A 1H7SA 2JJ1G 2XABA 2EXLA 3IEDA 3CGYA 3CC2V 1ROPA 1IXMA 2VWCA 1K8AW 2HKOA 3TUHA 2XOKG 2GSMB 4P2ZA 4JGSA 4L93A 1BGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CWR A;  2WI7 A;  3BM9 A;  1KIJ A;  2CCU A;  1TID A;  4E02 A;  3GIE A;  3G7B A;  1H7U A;  4EGH A;  4XD8 A;  5CF0 A;  4LWE A;  4H81 A;  1Z5C A;  3ZRV A;  1EI1 A;  2XDS A;  3EKO A;  4XKK A;  4GT8 A;  3CRK A;  3T10 A;  1UYH A;  1TC6 A;  3EHH A;  2YEH A;  2VW5 A;  5BOD A;  2YGE A;  1QZR A;  3ZXQ A;  3K97 A;  3EHJ A;  3GIG A;  3OW6 A;  1TBW A;  2QFO A;  1YSR A;  5FNF A;  4LC1 A;  3R4P A;  2C2A A;  1JOY A;  2BT0 A;  3ZCC A;  2WWW A;  3D0B A;  4AWQ A;  3Q5K A;  2YGA A;  4FCP A;  3Q5L A;  4KFG A;  4NH7 A;  2BYI A;  2WI1 A;  2BRC A;  4U93 A;  5M4M A;  1GKX A;  4CWO A;  1ZWH A;  4EFT A;  2BU2 A;  1ZXN A;  4CWQ A;  1YES A;  1Z59 A;  2ESA A;  3CWV A;  2YI0 A;  2O1V A;  4GCZ A;  4L90 A;  2Q2E B;  2FXS A;  4U7O A;  2WI3 A;  2WEP A;  1S14 A;  2LFS A;  1L0O A;  4MP7 A;  5IDM A;  4V25 A;  4EMV A;  3A0X A;  3FT5 A;  1I5B A;  5M4H A;  4JAU A;  4EGI A;  5L3J A;  2XDU A;  3H4L A;  2Q8H A;  5CTW A;  4X9L A;  4XCJ A;  3LPS A;  3ZKB A;  1QYE A;  1YC4 A;  1YC3 A;  1NHI A;  3P32 A;  4ASG A;  5CTU A;  2XJX A;  3QDD A;  4AS9 A;  2Q8F A;  4XTJ A;  4ASF A;  4CWN A;  3MNR P;  4H7Q A;  4HY6 A;  4WUD A;  5D7R A;  4EFU A;  2IWS A;  2JJC A;  4EM7 A;  1AM1 A;  2BU6 A;  3B27 A;  2XX2 A;  4JAS A;  4L8Z A;  1Z5A A;  2YJW A;  4CWF A;  2HKJ A;  5GGZ A;  2BTZ A;  5F3K A;  1Y8O A;  3OMU A;  1YT0 A;  2WI5 A;  4BXI A;  3OWD A;  4BQG A;  4QPK A;  4LWI A;  4LWG A;  4GGL A;  3RLQ A;  4R1F A;  5D6Q A;  2P67 A;  4FPP A;  2YI7 A;  2ZBK B;  4B6C A;  2O1U A;  1UY7 A;  5CPH A;  4PRX A;  5CTX A;  4YKW A;  3TZ5 A;  4JQL A;  1KZN A;  1EA6 A;  4MPN A;  1US7 A;  4XKO A;  3T1K A;  2YE5 A;  3R4O A;  1I5D A;  3R4M A;  3KE6 A;  2GFD A;  3D36 A;  4XIQ A;  1UY9 A;  2HG1 A;  2WER A;  2YE6 A;  5J6A A;  3DGE A;  3RKZ A;  4BQJ A;  1YC1 A;  2ZDX A;  2QM8 A;  2XHX A;  1JM6 A;  3NMQ A;  3GIF A;  1B62 A;  2VCI A;  4WUC A;  2Q8G A;  3VAD A;  3RLP A;  2XDX A;  2UWD A;  4I3H A;  4YKR A;  2XHR A;  2YEB A;  1UYE A;  1UYM A;  2QG0 A;  3Q5J A;  5FND A;  4GFN A;  1ZW9 A;  3PEH A;  2YI6 A;  3EKR A;  3K99 A;  1TC0 A;  3VHA A;  4BAE A;  5IN9 A;  1MU5 A;  2FYP A;  4HY1 A;  4ZVI A;  3RLR A;  5J71 A;  4O07 A;  4R3M A;  1UYK A;  4XKA A;  2PNR A;  4MOT A;  4FMT A;  4XC0 A;  2QF6 A;  4KP4 A;  4URL A;  4P8O A;  3R4N A;  3T0H A;  1QY8 A;  5FWK A;  2XJJ A;  3HEK A;  3TZ4 A;  3ZRW A;  1YET A;  4HXW A;  2AKP A;  4YKT A;  4Q20 A;  4KTN A;  3CRL A;  3U67 A;  4L94 A;  4MBC A;  2YEG A;  1UYD A;  2YEJ A;  1UYF A;  2YKI A;  3ZXO A;  2CG9 A;  3CGZ A;  3G75 A;  4CE3 A;  2YGF A;  2BU7 A;  1Y4S A;  3B28 A;  3A0Y A;  4LP0 A;  1YT2 A;  3TZ2 A;  5M4P A;  5IDJ A;  1R62 A;  2YE3 A;  4MP2 A;  2GQP A;  4KSG A;  2HCH A;  2IWU A;  3MD0 A;  5M4N A;  3U2D A;  4EGK A;  4KQV A;  3T0Z A;  3B24 A;  3O0I A;  4CWS A;  2YKC A;  2YEC A;  5F5R A;  2BSM A;  4ZKI A;  2YKB A;  2E0A A;  1TIL A;  3TTZ A;  3FV5 A;  4HZ0 A;  4YKU A;  3VHD A;  5FNC A;  4L91 A;  4H85 A;  4WUB A;  2IWX A;  3PEJ A;  2ZKJ A;  2FWY A;  2YI5 A;  1Y8N A;  4YKQ A;  1UY8 A;  2BZ5 A;  1Z5B A;  4XIT A;  4NH9 A;  2YK2 A;  1THN A;  5BOC A;  2Q8I A;  3O2F A;  1BGQ A;  1UYG A;  4MPC A;  3ZM7 A;  4XIP A;  4CWT A;  2YKJ A;  2YED A;  3HHU A;  2CCT A;  3SL2 A;  2JKI A;  3A0W A;  3INX A;  1GKZ A;  2O1W A;  2YE2 A;  2K5B A;  1YSZ A;  4R3A A;  3ZRX A;  4FCQ A;  4BIU A;  2XDK A;  2YE7 A;  4MPE A;  4HZ5 A;  5M4E A;  1AJ6 A;  4QPJ A;  1TH8 A;  3A0R A;  1U0Z A;  4U7N A;  1YS3 A;  2YK9 A;  1NHH A;  4NH8 A;  1B3Q A;  2XX5 A;  5B1O A;  1NHJ A;  2YEA A;  4ASA A;  3D2R A;  3R91 A;  3JZ3 A;  3FT8 A;  4XE2 A;  4K4O A;  4JYC A;  3A0T A;  4PU9 A;  4YKZ A;  1UYL A;  5D7C A;  3WHA A;  1BKN A;  4V26 A;  4XCL A;  5D7D A;  2BYH A;  2YEF A;  4LWH A;  3C0E A;  1Y4U A;  4GEE A;  2XDL A;  2WI6 A;  4P7A A;  2QM7 A;  1YER A;  3INW A;  2CCS A;  2IOR A;  4YKY A;  4CWP A;  3WQ9 A;  2XJG A;  4O04 A;  3HYY A;  1B63 A;  4JYB A;  1UYI A;  4W7T A;  1F51 A;  4DZY A;  4EEH A;  3K98 A;  2IOP A;  2WI4 A;  2YE4 A;  4MB9 A;  1BXD A;  3O6O A;  1ZXM A;  4URM A;  2CGF A;  4GT1 A;  3HZ5 A;  1AMW A;  4LWF A;  2BRE A;  2WI2 A;  3T2S A;  1I58 A;  4URO A;  3C11 A;  1U2O A;  4MT8 A;  2BU5 A;  3VHC A;  4O09 A;  2CH4 A;  4YKX A;  4O0B A;  3TK1 A;  3OWB A;  2LFR A;  1Y8P A;  2WEQ A;  4B7P A;  3BMY A;  4HXZ A;  2ZDY A;  3K60 A;  4AWP A;  3LNU A;  2IOQ A;  3OPD A;  2XCM A;  2VCJ A;  3HYZ A;  3B26 A;  4FCR A;  4GQT A;  1MX0 A;  1A4H A;  4E00 A;  1UYC A;  4XIR A;  4DUH A;  3U2K A;  5CTY A;  1I5A A;  4O05 A;  1AH8 A;  1I59 A;  2FWZ A;  1PVG A;  2QG2 A;  1ID0 A;  1AH6 A;  4KSH A;  2YEE A;  1S16 A;  4CE2 A;  4HYP A;  4AWO A;  1UY6 A;  3EHF A;  4LPB A;  4PRV A;  4PL9 A;  3ZKD A;  3GIG B;  5D6P A;  5M4K A;  3R92 A;  2XHT A;  4URN A;  2H55 A;  1I5C A;  5B1N A;  1YT1 A;  4HYM A;  3H80 A;  4XDM A;  2XD6 A;  1H7S A;  3G7E A;  2BU8 A;  3NXS A;  2XAB A;  2EXL A;  3QTF A;  4ASB A;  3IED A;  3CGY A;  2YJX A;  2YE8 A;  4JAV A;  1IXM A;  4E01 A;  2VWC A;  3HZ1 A;  4I5S A;  3TZ0 A;  2YKE A;  4BIZ A;  3EHG A;  3TUH A;  1OSF A;  1BYQ A;  2H8M A;  3B25 A;  2YE9 A;  5C93 A;  2XK2 A;  4MTX A;  3ZRW B;  4CE1 A;  1GJV A;  2FTK A;  2YEI A;  3A0Z A;  4L93 A;  2XX4 A; 
#chains in the Genus database with same CATH topology
 2XHB A;  3LMM A;  4ZHQ A;  4LH6 A;  1ZTE A;  3GWK C;  5J9P C;  1TID A;  4GX2 A;  2WLN A;  1H7U A;  5CBG A;  4EGH A;  5CF0 A;  1OCZ B;  4LWE A;  3FFQ A;  3BFR A;  5JVD B;  1IXB A;  1Z5C A;  2NNU A;  1EI1 A;  4UVB A;  3H01 A;  3EKO A;  1NTZ H;  3IAY A;  2EIJ B;  1OCC C;  5BOD A;  5HFM A;  3IFX A;  3X2Q B;  1QZR A;  3ZXQ A;  4J41 A;  3K97 A;  1AVM A;  5KUM A;  1QVG U;  4YJ2 B;  4W4L A;  1YSR A;  5FNF A;  4NXN O;  4CH3 A;  4MVR A;  1Q5O A;  4LF6 B;  5JQG A;  1N32 B;  3FYI B;  1UFI A;  4A5U B;  1DLB A;  1VQ4 V;  4BWA A;  3EVK A;  3OMA B;  5L3F A;  2OWO A;  2DYS C;  1RPO A;  1XMO B;  2IM9 A;  1VQ7 V;  2IU3 A;  3SPC A;  3UCS C;  3F7Y C;  4E2L A;  2JK5 C;  3S3W A;  4F6E A;  1XQ8 A;  4ZI7 B;  4LNU B;  1Z59 A;  2ESA A;  5IY5 C;  3ABL B;  2YI0 A;  2Z3Y A;  2YID A;  4TOI A;  2Q2E B;  3ZN0 A;  2FXS A;  4U7O A;  1GN6 A;  4CS4 A;  5JH7 A;  4PD4 F;  2VRZ A;  2Z0A A;  4UCR A;  1SET A;  3KZI Z;  1Y74 B;  1GH6 A;  1S14 A;  2EIN B;  2ZKO A;  4MP7 A;  2BE3 A;  4I55 A;  2AHZ A;  2WLK A;  3AG1 C;  1V54 B;  1GAX A;  1I5B A;  4JAU A;  5L3J A;  1RSO B;  2ZIO A;  1KP2 A;  4JZG A;  3ZKB A;  5ITZ B;  4NXM O;  2AW9 A;  1NHI A;  3ASO B;  5B1A B;  3ZMV A;  4X1Y B;  3QDD A;  1MG1 A;  3CE2 A;  5CBF A;  1N0N A;  2IU0 A;  4IHJ B;  5D7R A;  4R6Z A;  3JD4 A;  1W0J G;  2ZE7 A;  5D5Q A;  3STL C;  4J10 A;  2YIB D;  2P4K A;  1R3L C;  2JGD B;  5HFL A;  5KHK A;  2WLM A;  2PF4 E;  3JAL A;  4JI3 B;  2YC0 A;  5F3K A;  3NR7 A;  2CGO A;  1YT0 A;  2BSK B;  3WFV A;  3H1H H;  1WPB A;  4B08 A;  5GON B;  4XDK A;  2P67 A;  4FPP A;  4B3M B;  4FJC C;  4B6C A;  4X66 O;  2O1U A;  3T1H O;  3OMI B;  1L0N H;  1XUQ A;  1KYO F;  4TV9 B;  3K5N A;  4MPN A;  3FKS G;  4Z1V A;  2Q4P A;  4O4J A;  4J42 A;  3ABM B;  2RNB A;  2HG5 C;  4O4H B;  1AI7 A;  1JFF B;  4K0K B;  1UY9 A;  2OCH A;  3E83 A;  5J6A A;  3DGE A;  3TET A;  1XL4 A;  1Z2G A;  2Y69 B;  5H6Q A;  3ZX6 A;  2QM8 A;  1FS0 G;  1JR9 A;  3C3T A;  3NMQ A;  4FLW A;  4EB6 B;  4Q6G A;  5BZB A;  5KHG A;  2A3Q A;  4JI1 O;  3W7T A;  4LF7 O;  5GTH Z;  3RLP A;  1RM1 C;  4IT5 A;  1UYE A;  5A9G A;  5KMG A;  2ZM6 B;  4G27 B;  3PEH A;  4TV8 B;  3EKR A;  3K99 A;  1SZX A;  1AR1 B;  5B1B B;  1S5J A;  1MZE A;  4BAE A;  4CH5 A;  1MU5 A;  4ZVI A;  4OPA A;  3FAV A;  2IJI A;  4WBN B;  4MTF A;  4LFC O;  4R3M A;  1WAZ A;  2YXH A;  4XKA A;  2PNR A;  3BCC H;  2YDE A;  2IW5 A;  2LQT A;  2BSK A;  4DUY O;  4P8O A;  3VQW A;  3CYG A;  3G71 V;  4NYK A;  1K9M W;  3T0H A;  3AEI A;  4WFB V;  4QNH B;  2UUA O;  4DR3 B;  2XJJ A;  3IGA C;  4O4I B;  3TZ4 A;  4NXN B;  1YET A;  3IC9 A;  4Q20 A;  2OTL V;  1NKD A;  3WU2 Z;  1V9P A;  2YEJ A;  1UYF A;  2BOB C;  1JFF A;  3ZMT A;  4DR2 O;  1NR1 A;  2QM4 A;  1XMQ O;  2JJ2 G;  2BU7 A;  2Q0A A;  1Y4S A;  3B28 A;  2P6J A;  3P3N A;  2R72 A;  1GM8 A;  5LXT B;  4MTO A;  3TZ2 A;  4I0X A;  4R50 A;  3DC5 A;  3VQY A;  4JI4 O;  4MP2 A;  5KAF Z;  4DV1 O;  1VQ8 V;  1NTM H;  2P22 C;  4X8A A;  1K34 A;  3JAT A;  2X6A A;  2GV9 A;  3MD0 A;  1CXZ B;  3BRC A;  2ILM A;  3HKE B;  4G2K A;  3T0Z A;  3LSS A;  3B24 A;  1EM1 A;  1Q3E A;  4RO2 A;  5EBW C;  5JWP A;  2E3C A;  3G6E V;  4OX9 O;  2YKC A;  4PA3 A;  1F4M A;  2E0A A;  3BY6 A;  4K35 A;  3T4D A;  3VHD A;  1G6U A;  2QWN B;  4H44 B;  3CMA V;  4L91 A;  3OMN B;  4NTW A;  4DV6 B;  3CRC A;  3RN4 A;  4DV5 B;  2WLI B;  3K9S A;  3ZJZ A;  5CA0 B;  5K1X A;  4FLV A;  2W0X A;  1Z5B A;  4NXM B;  4FLT A;  2YK2 A;  4E72 A;  1GM7 A;  2Q8I A;  1M56 C;  4NKG B;  1VQN V;  3ZM7 A;  4O4I A;  1LUW A;  1E1Q G;  5J2T B;  4CWT A;  4X89 A;  4I4T A;  1NZ6 A;  4I50 A;  2Q69 A;  2F66 C;  5C8Y B;  5CB4 B;  1VQO V;  2YE2 A;  3JAS A;  3ZRX A;  3CS5 A;  1FPO A;  1HDJ A;  4BIU A;  1UJW B;  2XDK A;  4FCQ A;  4HZ5 A;  1AJ6 A;  3QNE A;  2QE7 G;  1JQ0 A;  3AG3 B;  4LBE C;  2BTO A;  1TH8 A;  2NN4 A;  5EYP A;  1GN3 A;  4J7J A;  4O2B A;  4MTG A;  3D8C A;  2ZE6 A;  1BGY H;  1YS3 A;  2IBZ H;  2L35 A;  3K5L A;  1U97 A;  4NH8 A;  1MZF A;  1M1K W;  2EIK C;  1VEW A;  3D2R A;  2MK3 A;  1YDX A;  2DQ3 A;  3CXC U;  2N74 A;  4JYC A;  4PU9 A;  4KFM A;  1UYL A;  1JVM A;  4O4L B;  2UXN A;  1NVP B;  4XDJ A;  3C0E A;  3UM7 A;  1Y4U A;  4GEE A;  3D36 C;  2ZDI C;  2XDL A;  4Z2W A;  4HNA B;  4WFF A;  3INW A;  4DV0 O;  2ZXW C;  4W7T A;  2YIC A;  4UUJ C;  2QEX V;  1NU1 H;  2IOP A;  2RCV A;  4PJ0 Z;  5LA6 A;  4LF7 B;  2CH7 A;  4UCT A;  5CA1 B;  3K03 A;  1AMW A;  1YJ9 V;  3L70 H;  1I0H A;  5E79 Z;  1JA8 A;  1I58 A;  2AGA A;  2DJV A;  4MVU A;  3UT5 A;  5CB4 A;  2XAQ A;  1KKD A;  1G4Y B;  2L6L A;  2OT5 A;  1VQ6 V;  3ZMZ A;  1P49 A;  4O0B A;  1E79 G;  4UCV A;  4LFC B;  4MVS A;  1BCC H;  3K60 A;  2LJ2 A;  5LP6 C;  5IJ9 B;  4DUY B;  2N04 A;  3N2G A;  3BPZ A;  1VMG A;  1M4U A;  1A4H A;  4JI6 O;  3CRR A;  4DUH A;  3U2K A;  1WLE A;  1OZ0 A;  1YJW V;  2LGQ A;  4CH4 A;  1AH8 A;  1A32 A;  2WLL B;  3MDS A;  1I59 A;  4PA7 A;  1PM9 A;  4UXN A;  3QO7 A;  3CEI A;  4CC5 A;  5BMV B;  4DV4 B;  4FIP C;  4AWO A;  4HNA A;  1UY6 A;  3E35 A;  3ZKD A;  2ADP A;  1YI2 V;  1XMQ B;  2Q7G A;  1ZAU A;  3CC4 V;  5E1A C;  5H6R A;  3S3X A;  1BE3 H;  1YT1 A;  3K06 A;  3OGC C;  3H80 A;  1WP8 A;  3RVZ A;  4DV1 B;  4PA6 A;  2BU8 A;  4GX1 A;  1SQV H;  5IT9 N;  3QF7 A;  3QTF A;  1FD9 A;  3AG2 B;  1R6N A;  3AK3 A;  3B8N A;  1G8M A;  1XHX A;  2YJX A;  1CP9 A;  4JAA A;  1PD3 A;  4IL6 Z;  4OX9 B;  4YJ3 A;  4JAV A;  4E01 A;  1H2M A;  2YKE A;  2UUC O;  3FB7 C;  3EHG A;  4JV5 O;  1OSF A;  3IJ4 A;  4FK5 C;  3G80 A;  4EFB A;  1L0L H;  3B25 A;  2Q7E A;  2KG7 A;  1HNX B;  1XNQ B;  2YE9 A;  2XK2 A;  1YIT V;  3ZRW B;  5JJJ B;  4CE1 A;  2FTK A;  3CRQ A;  3BVO A;  4J80 A;  2ZD9 A;  2XX4 A;  1YJN V;  3HKB B;  2OCC C;  2ZR3 A;  2YS8 A;  2W6I G;  3KG2 A;  2HP8 A;  4E02 A;  1IX9 A;  1AJQ A;  3G7B A;  3HKD B;  1WA8 B;  3HKC B;  3ZRV A;  1AR5 A;  1XI1 A;  5IWA B;  4PI0 A;  1OCR C;  3A2F A;  2BCC H;  3T1C A;  2MW2 B;  2VW5 A;  3K57 A;  1MSD A;  2P7T C;  1T5E A;  2A79 B;  3EHJ A;  3B2E E;  4TUY B;  2QFO A;  4X1K B;  3SYA A;  4LC1 A;  4F4L A;  5BR8 O;  4YIP A;  3JCU Z;  3R4P A;  3K0G A;  1XIL A;  3L73 H;  1ZX3 A;  2B1I A;  3ZCC A;  2WWW A;  4AWQ A;  1YEW A;  1PNL A;  3ETG A;  4FCP A;  3D3I A;  4CBC A;  2LP7 A;  2UXB O;  4AQY B;  3SYQ A;  1NI8 A;  2BRC A;  1I5X A;  4U93 A;  1GN2 A;  2B1G A;  4MW8 A;  1XBL A;  1I08 A;  3CCL V;  1GKX A;  4FFB A;  4DV0 B;  3AK1 A;  2CUG A;  1ZXN A;  1YES A;  3CWV A;  2FB5 A;  4JPR A;  1FXK C;  1S0V A;  1X4T A;  2YUA A;  2WEP A;  2HFE C;  4JTC B;  4FLU A;  2LFS A;  3H9V A;  1SA0 A;  1U96 A;  1QLN A;  3APO A;  1OCC B;  3A8T A;  1WA8 A;  2ODM A;  3E89 A;  2XDU A;  2UXX A;  2EIM C;  1S76 D;  2BTQ B;  4XCJ A;  3LPS A;  1QYE A;  3TCU A;  4X64 O;  4JI7 O;  3P32 A;  4JI0 O;  1EN6 A;  4GUN A;  3CCR V;  3IC7 A;  1H2G A;  5EZY A;  4B3S B;  1ENV A;  2XAS A;  4XTJ A;  4GKJ O;  4ZOL B;  4X65 O;  1TUB B;  3MNR P;  3OFN G;  2OIE A;  2QTS A;  4H7Q A;  4HY6 A;  2DYS B;  2P06 A;  4EFU A;  4JI5 O;  1Q43 A;  3ABK C;  4JI6 B;  1YTF D;  1EZV H;  2BU6 A;  2XX2 A;  3G6B A;  3ETD A;  1IUR A;  4L8Z A;  1Z5A A;  2YJW A;  1HW7 A;  1PPJ H;  3OEE G;  1N36 O;  5GGZ A;  3QG5 A;  1Y8O A;  5K1P A;  3SJA C;  3OMU A;  5LBQ A;  2HVJ C;  1Q81 W;  2A7W A;  5IY5 B;  4LWI A;  3MAQ A;  4LF4 O;  4LWG A;  4R1F A;  2JRI A;  4FM2 A;  2YI7 A;  2OYQ A;  1YHQ V;  4J9Z B;  5CTX A;  1TAE A;  1KZN A;  5IYD O;  5FPR A;  1EA6 A;  4XKO A;  4ICG A;  3CCE V;  3AG1 B;  2CTW A;  3R4O A;  2GDS A;  1M57 C;  2JDI G;  4LFA B;  2HG1 A;  4X20 A;  4YHH O;  4JI2 B;  3RKZ A;  3CJH B;  3M7M X;  4BQJ A;  2ZDX A;  1MA1 A;  2DYR B;  1NBM G;  2UUC B;  3FB6 C;  2VCI A;  5JEN A;  4U3F H;  2Q8G A;  5J2U B;  4B7K A;  3VAD A;  3BA8 A;  2XDX A;  4H37 A;  1LUV A;  2UWD A;  4I3H A;  1HR0 B;  1BSM A;  2XHR A;  3EFF K;  2R9R B;  4PA4 A;  4FM0 A;  1ZW9 A;  2N05 A;  4QJF B;  4HYO A;  2JEU A;  4PHZ A;  1BZK A;  3HB3 B;  3R66 A;  5IN9 A;  2XAH A;  4X1I A;  3RLR A;  1VF6 A;  2LW7 A;  2F93 B;  1QLE C;  1JCH A;  3SYO A;  1N34 O;  2Q73 A;  2K1E A;  3CB2 A;  4MOT A;  4FMT A;  2QKC A;  1D5N A;  2KKW A;  4MSW C;  3R4N A;  1TGO A;  2RDC A;  3FD9 A;  1V55 C;  5FWK A;  2HHI A;  5L3D A;  3OTF A;  3HEK A;  4HXW A;  3OD4 A;  2AKP A;  1Q90 D;  2AXT Z;  2HHH O;  5A2Q N;  1QVF U;  4LF8 O;  4KTN A;  4UCU A;  2E5L O;  3CRL A;  5JCO A;  1QR9 A;  3A0B Z;  3CME V;  2YEG A;  2YKI A;  3UKM A;  3ZXO A;  1GM9 A;  5H2F Z;  3SPI A;  3CGZ A;  2UXB B;  4OPH A;  4CE3 A;  5JVD A;  3H1L H;  1N0J A;  3LDC A;  3PN1 A;  2XTA A;  2ZE8 A;  2JEX A;  1RM1 B;  1Z5V A;  2PI5 A;  3K5O A;  4LP0 A;  4I9W A;  1R62 A;  4RWU A;  3CYO A;  4P9O A;  2GQP A;  4KSG A;  2CTQ A;  4BIO A;  1LR1 A;  1VP7 A;  3RBZ A;  4UV8 A;  4H0L B;  4YJ2 A;  2ZE5 A;  5LMU B;  2YIA A;  4EGK A;  1HNW O;  3BHP A;  1N33 O;  1SER A;  1PL0 A;  2X0L A;  2YKB A;  2JVD A;  3B4S A;  3U11 A;  4HZ0 A;  3FB8 C;  1IBK O;  4YKU A;  3CHX A;  4NTY A;  2YI8 A;  4K8Z A;  4H85 A;  1MNG A;  2ZCE A;  3I55 V;  1I7F A;  4FLY A;  1W59 A;  2GHY A;  5LYJ B;  1BL8 A;  3K9A A;  1N4C A;  4FVM A;  2E75 B;  3B77 A;  2Q5Z A;  4JI7 B;  4NH9 A;  4ZI7 A;  2R9A A;  2F1M A;  1THN A;  2AZ0 A;  4LNU A;  2NR5 A;  4DR5 B;  3I5D A;  2YKJ A;  2YED A;  3J7A U;  2CCT A;  1H2K A;  4GKJ B;  4X65 B;  3SL2 A;  3A0W A;  3LSQ A;  1SES A;  1YSZ A;  5LOV B;  1Y74 A;  2ZT9 B;  4JI5 B;  1BQZ A;  3B40 A;  4MPE A;  2ZIN A;  3WG7 C;  1N36 B;  3Q4H B;  5KA5 A;  3EHB B;  3C3S A;  1RSO A;  2JIZ G;  2H3O A;  4ABM A;  2QGN A;  1U0Z A;  2C1I A;  1X59 A;  2ZR2 A;  4LF4 B;  3R65 A;  4YY3 B;  3CCV V;  5ITZ A;  1NHJ A;  4LP8 A;  3MHH C;  5B66 Z;  1D5A A;  4AHC A;  2HJD A;  3R91 A;  1Y67 A;  4X1Y A;  3JD0 A;  4DR1 O;  2RMK B;  5D7C A;  2EX3 A;  4JTA B;  4IHJ A;  2YEF A;  3JCZ A;  3KCY A;  4DYL A;  4F6R B;  3E8F A;  4JYA O;  2JGD A;  2IOR A;  4CWP A;  4L87 A;  3WQ9 A;  2DW4 A;  2F43 G;  2XJG A;  1SKV A;  1B63 A;  4DW0 A;  1F51 A;  4HAM A;  4DZY A;  1M56 B;  2Q0O C;  3E22 B;  3D3Q A;  3E2E A;  1FJG O;  5GON A;  3O6O A;  2VQE O;  1ZXM A;  4URM A;  2CGF A;  3HZ5 A;  2ITD C;  3E8B A;  2WI2 A;  3T2S A;  2Q68 A;  4BW5 A;  1IBM O;  4D7T A;  5IYC O;  4TV9 A;  3SPH A;  5LOV A;  3SJQ C;  1XHZ A;  2F4V O;  4O09 A;  4IIJ B;  4MW3 A;  4O4H A;  4YKX A;  3TK1 A;  5CN0 A;  2LFR A;  1SQB H;  1VAR A;  4J7Z A;  3CX5 F;  2WEQ A;  1N34 B;  4HXZ A;  1KKC A;  2EIK B;  2UXD O;  4EFE A;  4PDL A;  3K79 A;  4EB6 A;  3CRA A;  2IOQ A;  3OPD A;  3B26 A;  1H2L A;  5B5E Z;  3JAR B;  3BEH A;  4O2A B;  1MX0 A;  2YXL A;  1UYC A;  4DW1 A;  4R7C A;  2Q67 A;  3RYH B;  3OTO O;  1I5A A;  2VWJ A;  4TV8 A;  4LF8 B;  3ABM C;  2E5L B;  1PVG A;  5CBH A;  4TQD A;  1VQP V;  3O9O A;  2DN9 A;  2Z5U A;  2ZXW B;  5DM6 V;  2PI4 A;  1PL4 A;  4HYP A;  4E4E A;  1DTO A;  2Y69 C;  4WBN A;  4PRV A;  2HVK C;  3GIG B;  1R6K A;  1O9G A;  2XHT A;  5BXZ A;  4URN A;  4L8J A;  3P3P A;  2R70 A;  4FLX A;  1KUQ A;  1M90 W;  2FML A;  4LFB O;  4LWS B;  4DR7 O;  3LDE A;  4DV2 O;  1D2D A;  4ASB A;  4FM1 A;  4EEQ A;  3STZ C;  4BR6 A;  1ARO P;  1PP9 H;  5B1B C;  4DUZ O;  1N33 B;  4D7S A;  3GWO A;  3JD1 A;  2CDY A;  4B3R O;  1F23 A;  3HR0 A;  1UPG A;  1PNM A;  3HZ1 A;  4I5S A;  3TZ0 A;  4RUE A;  4BIZ A;  1JJ2 U;  5LP6 B;  3H1J H;  1IBK B;  2WA3 A;  5BY1 A;  2H8M A;  2DE0 X;  5C93 A;  4MTX A;  1GJV A;  2UXC O;  2YEI A;  2RQ6 A;  5LXT A;  4DR4 O;  4OGQ B;  1YF2 A;  2ZIM A;  4CWR A;  4X66 B;  3T1H B;  2QWR B;  1KIJ A;  1IDS A;  3CCU V;  4D6T H;  4XD8 A;  1J95 A;  3HKE A;  3DXR B;  4JI8 O;  4H81 A;  2EJR A;  4R8C A;  3ETE A;  5EIB D;  1NH2 D;  2UUB O;  2XDS A;  4XKK A;  4GT8 A;  3FYE B;  3CRK A;  3T10 A;  3CD6 V;  3KCX A;  4DV3 O;  2AZ2 A;  3ABU A;  3EHH A;  2YEH A;  1SC5 B;  2LGW A;  4EKW A;  3UQ8 A;  3GIG A;  1THZ A;  1TBW A;  1B6Q A;  3ZIA G;  1G1X B;  4PV1 B;  1FFX B;  1Y4M A;  2WLI A;  5CA0 A;  2P90 A;  5D5P A;  1JOY A;  3VQX A;  4JI1 B;  3JYC A;  3ZBH A;  5J2T A;  3D0B A;  1HNZ O;  4DR1 B;  3Q5K A;  2WLH A;  3Q5L A;  5C8Y A;  2D2C B;  1N8R W;  4NH7 A;  2BYI A;  2WI1 A;  2GTS A;  2G38 A;  4HZ3 A;  1R73 A;  3RW0 A;  4IGG A;  4JYA B;  1XNR O;  2BU2 A;  1B06 A;  4CWQ A;  2OCC B;  3CWB H;  1SS3 A;  4L90 A;  3UO3 A;  2PTM A;  3K0D A;  1BS3 A;  2WI3 A;  1EN4 A;  2VQE B;  2UUA B;  2Q6A A;  5IDM A;  2FKX A;  4EMV A;  2ADQ B;  3A0X A;  3FT5 A;  1OCR B;  2AHY A;  3OAA G;  3OUF A;  4O4L A;  5DED A;  2WAM A;  5M4H A;  1JX9 A;  3H4L A;  3AK2 A;  5CTW A;  5GTI Z;  4X9L A;  3AG3 C;  1F4N A;  1H2S B;  4DR2 B;  5CMU A;  5LHG A;  1M5I A;  5CTU A;  1AIL A;  2XJX A;  4NR1 A;  3L75 H;  4AS9 A;  4C7U A;  3AG4 C;  2PYJ A;  4ASF A;  2EUL A;  4JI4 B;  1AI4 A;  2F23 A;  3LNM B;  3JAM N;  5L3C A;  4PDR A;  2IWS A;  3RFR A;  5CA1 A;  2XAF A;  3SGI A;  1K4D C;  1AM1 A;  2BOC C;  3AG7 A;  3OTO B;  5EBM C;  4NTX A;  4KXR A;  4CWF A;  1GTO A;  2BTZ A;  1QR8 A;  4NVP A;  2PYL A;  3RYI B;  1SZT A;  2IJK A;  2WI5 A;  1DK1 A;  2UU9 O;  1GK9 A;  4QPK A;  1F7Y A;  3RLQ A;  3VOU A;  3CP1 A;  2XT9 A;  4PDM A;  1FXK B;  2Y4T A;  1L1F A;  5CPH A;  2CAZ C;  4YKW A;  5IJ9 A;  4JQL A;  1IVS A;  1CEZ A;  2CTR A;  5LGN A;  3T1K A;  4DR7 B;  1I5D A;  4DV2 B;  1ORQ C;  3ML0 A;  3KE6 A;  2GFD A;  4XIQ A;  1Y76 B;  2WER A;  2DQ0 A;  2FYU H;  2GTA A;  2WLL A;  1AI5 A;  2V4D A;  3ASN C;  4B3R B;  1VQ5 V;  1MMM A;  3L74 H;  2A06 H;  1JM6 A;  4G28 B;  5BMV A;  1B62 A;  2Q7H A;  1I94 O;  4TT3 G;  4WUC A;  3DTU B;  1OCO C;  4LF6 O;  3LUT B;  5CA3 A;  1B04 A;  1XEQ A;  2UXC B;  3TXQ A;  2YSU B;  1UYM A;  2YEV B;  4DR4 B;  2YI6 A;  4UVA A;  2W0F C;  2HEP A;  1H2N A;  2CK3 G;  3VHA A;  3H1I H;  4BAY A;  4HY1 A;  3CC7 V;  4JI8 B;  3MHS C;  1GN4 A;  1UYK A;  1EFR G;  5FNV B;  4XC0 A;  4B7E A;  1TVK B;  4KP4 A;  5EIB C;  2QF6 A;  4URL A;  1EZJ A;  4DV3 B;  1NS1 A;  1QY8 A;  1ZL8 B;  1GO3 F;  1S72 V;  5LL6 Y;  1WJZ A;  3SYP A;  3ZRW A;  4X62 O;  5AG2 A;  2EIL C;  5LHI A;  5KX5 B;  3CPW U;  4DK0 A;  3JAW B;  3C90 A;  1K5Q A;  3CCQ V;  4HBN A;  3HKB A;  3WB2 A;  2V7Q G;  2IJH A;  4UB8 Z;  4FZ0 A;  4RUF A;  5DN6 G;  3FX7 A;  5KLV H;  4KHP O;  3AG2 C;  1EBO A;  3W7W A;  4L94 A;  2CG9 A;  3HKD A;  1Y76 A;  4TQF A;  3HKC A;  2YGF A;  2WLJ A;  1HP8 A;  4LF5 O;  3A0Y A;  1US6 A;  4DV7 O;  3N2K B;  4GKK O;  5M4P A;  4ZHQ B;  5H9C A;  3BAA A;  2IWU A;  4TUY A;  4X1K A;  5M4N A;  3U2D A;  1WP7 A;  2HLD G;  4KQV A;  1RP3 B;  3O0I A;  5EK0 A;  1YXB A;  2X6C A;  4CWS A;  2YEC A;  5F5R A;  4ZKI A;  5IYB O;  3TTZ A;  4CH6 A;  3FV5 A;  1DF5 A;  4YXW G;  4B3M O;  1V55 B;  5EC1 C;  3U10 A;  2ZKJ A;  1VIB A;  2DWD C;  3M8A A;  1Y8N A;  4UCO A;  4YKQ A;  4P9P A;  2P4V A;  2BZ5 A;  3TGU H;  4XIT A;  2XAG A;  5JQG B;  5BOC A;  3RT3 C;  3SDL A;  4MVM A;  1K97 A;  2JGU A;  4XIP A;  1FAF A;  4WFG A;  3OUS A;  5L3E A;  2JKI A;  1SQX H;  3F5T A;  3INX A;  5B3S C;  1KU9 A;  3B8M A;  5KA6 A;  3JSL A;  1PV0 A;  2YE7 A;  1KMI Z;  4BW9 A;  4QPJ A;  1CPY A;  3ZHS A;  4DRX B;  4GX5 A;  2PGG A;  2LO1 A;  1KBH A;  3W7U A;  3SJC C;  3SJB C;  1XL6 A;  1QQC A;  3T2M A;  3WB1 A;  2BTQ A;  4U7N A;  3FB5 C;  5JH7 B;  1VF7 A;  4XBF A;  4WCE V;  4JV5 B;  1NHH A;  2YK9 A;  1VF5 B;  2YEA A;  4ASA A;  2XUM A;  3JZ3 A;  5FL7 G;  4XE2 A;  4I55 B;  2E76 B;  2QKS A;  4K4O A;  1TA8 A;  3A0T A;  2PY5 A;  4ZOL A;  1TUB A;  3WHA A;  1BKN A;  4V26 A;  5D7D A;  3E86 A;  2BYH A;  3VBB A;  1AI6 A;  2QM7 A;  1VQ9 V;  2W6J G;  1ZLZ A;  4LF9 O;  2CCS A;  2QWQ B;  2E74 B;  3HYY A;  2LW1 A;  1UYI A;  4DR3 O;  1Q6I A;  1GMG A;  5DEC A;  3TJT A;  1FFT B;  4ASU G;  2WI4 A;  1Y6X A;  2YE4 A;  2EZP A;  4TWK A;  1I94 B;  4H13 B;  4MB9 A;  1BXD A;  3O65 A;  4GT1 A;  1MSW D;  2BRE A;  1XDC A;  4URO A;  5JJE B;  5BR8 B;  3C11 A;  1R3I C;  3JAL B;  3ETQ A;  1U2O A;  5KUK A;  5LGT A;  3WG7 B;  1YTF B;  4CS2 A;  1VF6 C;  1AJN A;  2YI9 A;  1AR4 A;  2BU5 A;  3JD3 A;  3W7X A;  1R1B A;  3ZHQ A;  1P7B A;  1Y8P A;  3ZRS A;  3BMY A;  4DRX A;  3CJH A;  4AIL C;  4AWP A;  3OGI B;  2ZQM A;  5J2U A;  4O4J B;  1OHH G;  5EBL C;  2KSD A;  4E00 A;  3SYC A;  2ITC C;  2DOS A;  2CGN A;  3M99 B;  4X62 B;  3HPL C;  4O05 A;  3DC6 A;  5JCO C;  4KHP B;  3RGB A;  4DV6 O;  4KSH A;  2YEE A;  1JJO A;  1OCZ C;  2GUZ B;  4DV5 O;  2Y4U A;  4DXW A;  1R3K C;  3JAK B;  5M4K A;  2DYR C;  3OEH G;  1OV9 A;  2EIJ C;  4LF5 B;  2H55 A;  5IJ0 B;  4DV7 B;  1I5C A;  5KMG B;  5B1N A;  3X2Q C;  4GKK B;  4HYM A;  1Q6U A;  2CTP A;  1OJH A;  4X64 B;  2C1G A;  2HJF C;  4JI0 B;  1MAB G;  1FKA O;  3G7E A;  2QJ1 A;  4KL1 A;  3NXS A;  3T1Y O;  3L71 H;  1Q8I A;  2A0L A;  1QBZ A;  1NR7 A;  3FAV B;  3B09 A;  4CZZ A;  2QDO A;  2FL4 A;  2YE8 A;  2DWE C;  1XOU A;  1BYQ A;  4WFH A;  3VQV A;  2F95 B;  3J80 N;  4OXS A;  1MOF A;  1NQT A;  2ATK C;  3A0Z A;  2H94 A;  1PNK A;  2IH3 C;  3ABL C;  4WFE A;  4MVZ A;  2WI7 A;  3CCJ V;  3GB7 C;  3BM9 A;  2ETN A;  2CCU A;  3GIE A;  1IZ3 A;  3ZMS A;  3JD2 A;  2EIN C;  1J5E O;  1H8E G;  1P4R A;  3QO8 A;  1V54 C;  1UYH A;  2GUZ A;  4QGP A;  4I0X B;  1TC6 A;  4YHH B;  1K7D A;  4J9Y B;  2YGE A;  3JAK A;  1JMK C;  4GYC B;  3RYC B;  3JAT B;  3OW6 A;  3OT7 A;  2A9H A;  5H5N A;  1K33 A;  2EZO A;  5LYJ A;  5IJ0 A;  4P30 A;  3H1K H;  3ASO C;  2C2A A;  5B1A C;  1Y66 A;  3A0H Z;  2BT0 A;  1SF9 A;  4X9Q A;  2YGA A;  1KEC A;  5L3G A;  3E8H A;  1DF4 A;  4KFG A;  2K9P A;  5M4M A;  2PZS A;  1K92 A;  4CWO A;  2ARH A;  4QE9 A;  1ZWH A;  4LF9 B;  1PKX A;  4EFT A;  3LNN A;  3Q4H A;  1W2B U;  1AP5 A;  4CS3 A;  4Z1M G;  2Q8V A;  2O1V A;  4GCZ A;  1H38 A;  2VQF O;  4I4T B;  3TXS A;  4I50 B;  1WB8 A;  3BA9 A;  1AJP A;  5JJN B;  1FXH A;  4CC6 A;  4N23 A;  2XND G;  3JAS B;  1S77 D;  1NVP D;  1ZUQ A;  1L0O A;  4WF9 V;  4DV4 O;  4V25 A;  2X7R B;  3ICX A;  2HHH B;  4DR6 O;  2OIG A;  4EGI A;  5EYP B;  4O2B B;  3SPG A;  2WSS G;  3KKY A;  5KHI A;  3CSX A;  2Q8H A;  3K08 A;  3OW2 U;  4PDV A;  1R3J C;  4F6R A;  1YC4 A;  1YC3 A;  4ASG A;  4ZIB A;  4UVC A;  2WPD G;  4NB5 A;  2M7W A;  3RYC A;  1H8H G;  3E22 A;  2Q8F A;  4CWN A;  4WUD A;  4UV9 A;  2ZNI A;  2JJC A;  5F2V O;  1K5S A;  4EM7 A;  3B27 A;  4JAS A;  1HNW B;  2RN9 A;  1WNS A;  2HKJ A;  2WA4 A;  3K3W A;  1SQQ H;  3ZED A;  1SQG A;  4MVO A;  4AI8 A;  1HNX O;  1VQM V;  1XNQ O;  4BXI A;  2YIB A;  3OWD A;  4BQG A;  4IIJ A;  2D3O W;  4GGL A;  5LA6 B;  3T4Z A;  2CH7 B;  5D6Q A;  3CRM A;  2ZBK B;  3QO5 A;  1UY7 A;  3CCS V;  4PRX A;  3TZ5 A;  3UT5 B;  5EC2 C;  1US7 A;  2B9Z A;  5KHJ A;  1IBL O;  3JAR A;  4XDL A;  4O2A A;  2YE5 A;  2XAJ A;  3T1Y B;  3OE7 G;  3R4M A;  5IWA O;  2H8P C;  4ZBM A;  3D36 A;  1QCE A;  2ZDI A;  3RYH A;  2R9I A;  2YE6 A;  2JS3 A;  4TSF G;  1YC1 A;  4LCU C;  2XHX A;  3GIF A;  4YIO A;  1YSC A;  3ABT A;  4JTD B;  2GBO A;  2OTJ V;  3N2G B;  4PI2 A;  3P30 A;  3AG4 B;  4YKR A;  3THO A;  2YEB A;  2QG0 A;  3Q5J A;  5FND A;  4GFN A;  4MS2 A;  2Y48 A;  3ZHU A;  1K3E A;  1TC0 A;  4AQY O;  4LWS A;  2B5U A;  1YVW A;  2IJJ A;  1K73 W;  2FYP A;  1WN7 A;  5FPO A;  1YZB A;  3E8G A;  5J71 A;  3ZN1 A;  4O07 A;  1L8D A;  3L9D A;  1J5E B;  1COW G;  1QHT A;  1LNQ A;  4QE7 A;  4UB6 Z;  4B3T O;  1BQ0 A;  3K5M A;  1W0K G;  1P7G A;  5LP6 A;  1KQS U;  3OR7 C;  5TIS Z;  1NJI W;  4PEL A;  1FJG B;  3ZMU A;  4YKT A;  2HR3 A;  1YCI A;  4YJ3 B;  3SR2 C;  3ASN B;  3U67 A;  1WB7 A;  3QVN A;  4MBC A;  1UYD A;  1IBM B;  4U3J B;  1RFY A;  1TUE B;  3DXR A;  3G75 A;  2KG7 B;  1Q82 W;  2QSA A;  1URF A;  4IYI A;  1OCO B;  2F4V B;  1KC8 W;  3JSN A;  1SQF A;  5IYZ B;  3L72 H;  1YIJ V;  4B3S O;  1YT2 A;  2KB1 A;  2V1D A;  3GVM A;  5IDJ A;  1BHB A;  2YE3 A;  3ZHR A;  4WFA V;  4DO2 A;  3RYF B;  2UXD B;  2HCH A;  3F5W C;  2VQF B;  1FFX A;  4FZ1 A;  3F7V C;  4RQE A;  5LMN O;  4KUM A;  5LGU A;  1O9H A;  4JZ2 A;  3OM3 B;  2BSM A;  4J7K A;  1Z5W A;  1TIL A;  2QA4 V;  3G4S V;  1FYJ A;  1NH2 B;  4DR6 B;  5FNC A;  3W7S A;  4WUB A;  2IWX A;  3PEJ A;  5KAI Z;  5LHH A;  2FWY A;  4I9Q A;  2YI5 A;  1E1R G;  1UY8 A;  2EBO A;  3CCM V;  4LH7 A;  4L93 A;  2EIL B;  1M93 A;  3O2F A;  1S5L Z;  1UYG A;  2P5O A;  4MPC A;  1GKF A;  3HHU A;  2Y0P A;  3LDD A;  4LFA O;  2VS0 A;  1GKZ A;  4LFB B;  1JPX A;  2O1W A;  2K5B A;  4JI2 O;  3ZHV A;  4R3A A;  2X6B A;  2QTO A;  3I56 V;  2NLJ C;  5M4E A;  2EIM B;  4FFB B;  4DUZ B;  4U3J A;  1NTK H;  4JYY A;  4GX0 A;  4FFK A;  3A0R A;  1HR0 O;  3UO2 A;  5IYZ A;  3CXH F;  2M6Y A;  1B3Q A;  4MVQ A;  2XX5 A;  5B1O A;  1R6T A;  1VQL V;  4GZR B;  1N32 O;  3RYF A;  1SRY A;  1Q86 W;  3FT8 A;  1S5H C;  3S5T A;  1SA0 B;  3ABK B;  4PA9 A;  1FXV A;  4YKZ A;  3ZS8 C;  5IE9 A;  4XCL A;  2O57 A;  1IBL B;  3EXA A;  4LWH A;  1KD1 W;  1XMO O;  1BHA A;  2CE4 A;  1RPR A;  1Q6H A;  2WI6 A;  3SPJ A;  4P7A A;  1KB9 F;  1KP3 A;  1YER A;  4UFZ A;  4YKY A;  3U0Z A;  4O04 A;  2UUB B;  3RVY A;  4JYB A;  3RYI A;  5EZY B;  4EEH A;  1GRJ A;  3K98 A;  2QKA A;  4RAI A;  5L3B A;  3APQ A;  4LR3 A;  1M9N A;  3DSQ A;  1VQK V;  1AP6 A;  1K4C C;  2IH1 C;  1FXK A;  4LWF A;  3QTC A;  5B3S B;  4X88 A;  1HWY A;  4H33 A;  1EN5 A;  1M57 B;  1QU7 A;  1XRE A;  2RJZ A;  3J81 N;  4QIW F;  4MT8 A;  1QNM A;  3G67 A;  5KHH A;  3OR6 C;  3VHC A;  3LSU A;  3RWR D;  1HNZ B;  2CH4 A;  4GLX A;  3OWB A;  4JF3 A;  4RQF A;  4J11 A;  4FLZ A;  4B7P A;  3K59 A;  4B3T B;  1WPX A;  2ZDY A;  1Q7Y W;  2QWO B;  3LNU A;  5LMU O;  5FLX N;  1XNR B;  2XCM A;  2VCJ A;  3HYZ A;  2Y0I A;  4FCR A;  4GQT A;  1S3J A;  1BT8 A;  3PJS K;  1SQP H;  2EJ7 A;  4XIR A;  2QWP B;  5CTY A;  2YEV A;  1ZWI C;  4X20 B;  4DK1 A;  2FWZ A;  4JI3 O;  5GW7 A;  2QG2 A;  2PUS A;  1ID0 A;  4K3A A;  1AH6 A;  1QLE B;  4N21 A;  1S16 A;  4CE2 A;  2JS5 A;  2VWK A;  3K58 A;  3EHF A;  4LPB A;  4K8X A;  3K04 A;  4PL9 A;  5D6P A;  1I5Y A;  3R92 A;  5FNV A;  3ZHT A;  1BMF G;  4DR5 O;  1TVK A;  1P84 F;  4IYH A;  2YXY A;  4I7Z B;  2KQX A;  1ZL8 A;  4XDM A;  2QR4 A;  2XD6 A;  1H7S A;  1DGS A;  2JJ1 G;  2XAB A;  4X1I B;  2EXL A;  2DMX A;  2ZNJ A;  3IED A;  3CGY A;  5LMN B;  4K0K O;  5KX5 A;  3JAW A;  3CC2 V;  1ROP A;  1IXM A;  2VWC A;  1NT2 B;  1K8A W;  2HKO A;  3N27 A;  1ZSP A;  3TUH A;  3BAB A;  4YY3 O;  2Q9L A;  4UCS A;  2XOK G;  2GSM B;  2UU9 B;  4P2Z A;  4JGS A;  3WB0 A;  2ZM6 O;  3N2K A;  1AB3 A;  4W4K A;  1BGQ A; 
#chains in the Genus database with same CATH homology
 5J9P C;  1TID A;  4GX2 A;  2WLN A;  1H7U A;  5CBG A;  4EGH A;  5CF0 A;  1OCZ B;  4LWE A;  1Z5C A;  2NNU A;  1EI1 A;  4UVB A;  3H01 A;  3EKO A;  2EIJ B;  1OCC C;  5BOD A;  5HFM A;  3IFX A;  3X2Q B;  1QZR A;  3ZXQ A;  3K97 A;  5KUM A;  1QVG U;  1YSR A;  5FNF A;  4MVR A;  3FYI B;  1DLB A;  1VQ4 V;  3OMA B;  5L3F A;  2DYS C;  1RPO A;  1VQ7 V;  2IU3 A;  3SPC A;  3F7Y C;  4E2L A;  2JK5 C;  1Z59 A;  2ESA A;  5IY5 C;  3ABL B;  2YI0 A;  2Z3Y A;  2Q2E B;  3ZN0 A;  2FXS A;  4U7O A;  1SET A;  1S14 A;  2EIN B;  4MP7 A;  2AHZ A;  2WLK A;  3AG1 C;  1V54 B;  1I5B A;  4JAU A;  5L3J A;  1KP2 A;  3ZKB A;  1NHI A;  3ASO B;  5B1A B;  3ZMV A;  3QDD A;  1MG1 A;  5CBF A;  2IU0 A;  5D7R A;  4R6Z A;  3JD4 A;  1W0J G;  3STL C;  1R3L C;  5HFL A;  2WLM A;  5F3K A;  1YT0 A;  3WFV A;  4XDK A;  2P67 A;  4FPP A;  4FJC C;  4B6C A;  2O1U A;  3OMI B;  4MPN A;  3FKS G;  3ABM B;  2HG5 C;  1AI7 A;  1UY9 A;  3E83 A;  5J6A A;  3DGE A;  3TET A;  1XL4 A;  2Y69 B;  5H6Q A;  2QM8 A;  1FS0 G;  3NMQ A;  5BZB A;  3W7T A;  3RLP A;  1RM1 C;  1UYE A;  4G27 B;  3PEH A;  3EKR A;  3K99 A;  1AR1 B;  5B1B B;  4BAE A;  1MU5 A;  4ZVI A;  2IJI A;  4MTF A;  4R3M A;  4XKA A;  2PNR A;  2IW5 A;  4P8O A;  3G71 V;  1K9M W;  3T0H A;  3AEI A;  4WFB V;  4QNH B;  2XJJ A;  3IGA C;  3TZ4 A;  1YET A;  4Q20 A;  2OTL V;  1NKD A;  2YEJ A;  1UYF A;  2BOB C;  3ZMT A;  1NR1 A;  2JJ2 G;  2BU7 A;  1Y4S A;  3B28 A;  2P6J A;  1GM8 A;  3TZ2 A;  4MTO A;  4R50 A;  4MP2 A;  1VQ8 V;  4X8A A;  1K34 A;  2X6A A;  3MD0 A;  4G2K A;  3T0Z A;  3LSS A;  3B24 A;  4RO2 A;  5EBW C;  3G6E V;  2YKC A;  4PA3 A;  1F4M A;  2E0A A;  3BY6 A;  3T4D A;  3VHD A;  3CMA V;  4L91 A;  3OMN B;  2WLI B;  3ZJZ A;  1Z5B A;  2YK2 A;  1GM7 A;  2Q8I A;  1M56 C;  1VQN V;  3ZM7 A;  4CWT A;  1E1Q G;  4X89 A;  2Q69 A;  1VQO V;  2YE2 A;  3ZRX A;  4FCQ A;  4BIU A;  1UJW B;  2XDK A;  4HZ5 A;  1AJ6 A;  3QNE A;  2QE7 G;  1JQ0 A;  3AG3 B;  4LBE C;  1TH8 A;  4MTG A;  1YS3 A;  4NH8 A;  1M1K W;  2EIK C;  3D2R A;  2MK3 A;  2DQ3 A;  3CXC U;  4JYC A;  4PU9 A;  4KFM A;  1UYL A;  1JVM A;  2UXN A;  1NVP B;  4XDJ A;  3C0E A;  3UM7 A;  1Y4U A;  4GEE A;  2ZDI C;  2XDL A;  4WFF A;  3INW A;  2ZXW C;  4W7T A;  4UUJ C;  2QEX V;  2IOP A;  3K03 A;  1AMW A;  1YJ9 V;  1I58 A;  4MVU A;  2XAQ A;  1KKD A;  1G4Y B;  2OT5 A;  1VQ6 V;  3ZMZ A;  4O0B A;  1E79 G;  4MVS A;  3K60 A;  1A4H A;  4DUH A;  3U2K A;  1WLE A;  1OZ0 A;  1YJW V;  1AH8 A;  2WLL B;  1I59 A;  4PA7 A;  4UXN A;  3QO7 A;  4FIP C;  4AWO A;  1UY6 A;  3E35 A;  3ZKD A;  1YI2 V;  3CC4 V;  5E1A C;  5H6R A;  1YT1 A;  3K06 A;  3OGC C;  3H80 A;  3RVZ A;  4PA6 A;  2BU8 A;  4GX1 A;  3QTF A;  3AG2 B;  1R6N A;  3B8N A;  1G8M A;  2YJX A;  1CP9 A;  1PD3 A;  4JAV A;  4E01 A;  2YKE A;  3FB7 C;  3EHG A;  1OSF A;  4FK5 C;  3B25 A;  2YE9 A;  2XK2 A;  1YIT V;  3ZRW B;  4CE1 A;  2FTK A;  2ZD9 A;  2XX4 A;  1YJN V;  2OCC C;  2ZR3 A;  2W6I G;  3KG2 A;  4E02 A;  1AJQ A;  3G7B A;  3ZRV A;  1OCR C;  3T1C A;  2VW5 A;  2P7T C;  2A79 B;  3EHJ A;  2QFO A;  3SYA A;  4LC1 A;  4F4L A;  3R4P A;  3K0G A;  2B1I A;  3ZCC A;  2WWW A;  4AWQ A;  1PNL A;  3ETG A;  4FCP A;  3D3I A;  4CBC A;  2LP7 A;  3SYQ A;  2BRC A;  1I5X A;  4U93 A;  2B1G A;  4MW8 A;  3CCL V;  1GKX A;  1ZXN A;  1YES A;  3CWV A;  4JPR A;  1FXK C;  1S0V A;  2WEP A;  2HFE C;  4JTC B;  2LFS A;  1QLN A;  1OCC B;  3E89 A;  2XDU A;  2UXX A;  2EIM C;  1S76 D;  4XCJ A;  3LPS A;  1QYE A;  3TCU A;  3P32 A;  3CCR V;  3IC7 A;  1H2G A;  1ENV A;  2XAS A;  4XTJ A;  3MNR P;  3OFN G;  4H7Q A;  4HY6 A;  2DYS B;  4EFU A;  3ABK C;  1YTF D;  2BU6 A;  2XX2 A;  3ETD A;  4L8Z A;  1Z5A A;  2YJW A;  3OEE G;  5GGZ A;  1Y8O A;  3OMU A;  5LBQ A;  2HVJ C;  1Q81 W;  5IY5 B;  4LWI A;  4LWG A;  4R1F A;  2YI7 A;  1YHQ V;  4J9Z B;  5CTX A;  1KZN A;  5IYD O;  1EA6 A;  4XKO A;  3CCE V;  3AG1 B;  3R4O A;  1M57 C;  2JDI G;  2HG1 A;  3RKZ A;  4BQJ A;  2ZDX A;  2DYR B;  1NBM G;  3FB6 C;  2VCI A;  2Q8G A;  3VAD A;  2XDX A;  4H37 A;  2UWD A;  4I3H A;  2XHR A;  3EFF K;  2R9R B;  4PA4 A;  1ZW9 A;  4QJF B;  4HYO A;  2JEU A;  3HB3 B;  5IN9 A;  2XAH A;  3RLR A;  1QLE C;  1JCH A;  3SYO A;  2K1E A;  4MOT A;  4FMT A;  4MSW C;  3R4N A;  1V55 C;  5FWK A;  5L3D A;  3HEK A;  4HXW A;  2AKP A;  1QVF U;  4KTN A;  3CRL A;  1QR9 A;  3CME V;  2YEG A;  2YKI A;  3UKM A;  3ZXO A;  1GM9 A;  3SPI A;  3CGZ A;  4CE3 A;  3LDC A;  2JEX A;  1RM1 B;  2PI5 A;  4LP0 A;  4I9W A;  1R62 A;  3CYO A;  4P9O A;  2GQP A;  4KSG A;  3RBZ A;  4UV8 A;  4EGK A;  1SER A;  1PL0 A;  2X0L A;  2YKB A;  4HZ0 A;  3FB8 C;  4YKU A;  4H85 A;  3I55 V;  2GHY A;  1BL8 A;  3K9A A;  3B77 A;  4NH9 A;  1THN A;  2YKJ A;  2YED A;  2CCT A;  3SL2 A;  3A0W A;  3LSQ A;  1SES A;  1YSZ A;  4MPE A;  3WG7 C;  5KA5 A;  3EHB B;  2JIZ G;  1U0Z A;  2ZR2 A;  3R65 A;  3CCV V;  1NHJ A;  4LP8 A;  3MHH C;  3R91 A;  3JD0 A;  5D7C A;  4JTA B;  2YEF A;  3JCZ A;  3E8F A;  2IOR A;  4CWP A;  4L87 A;  3WQ9 A;  2DW4 A;  2F43 G;  2XJG A;  1B63 A;  1F51 A;  4HAM A;  4DZY A;  1M56 B;  3E2E A;  3O6O A;  1ZXM A;  4URM A;  2CGF A;  3HZ5 A;  2ITD C;  3E8B A;  2WI2 A;  3T2S A;  2Q68 A;  4BW5 A;  5IYC O;  3SPH A;  3SJQ C;  4O09 A;  4MW3 A;  4YKX A;  3TK1 A;  5CN0 A;  2LFR A;  2WEQ A;  4HXZ A;  2EIK B;  4PDL A;  3K79 A;  2IOQ A;  3OPD A;  3B26 A;  3BEH A;  1MX0 A;  1UYC A;  4R7C A;  2Q67 A;  1I5A A;  3ABM C;  1PVG A;  5CBH A;  1VQP V;  2Z5U A;  2ZXW B;  5DM6 V;  2PI4 A;  4HYP A;  1DTO A;  2Y69 C;  4PRV A;  2HVK C;  3GIG B;  1R6K A;  2XHT A;  4URN A;  1M90 W;  3LDE A;  4ASB A;  3STZ C;  1ARO P;  5B1B C;  3GWO A;  3JD1 A;  1F23 A;  1PNM A;  3HZ1 A;  4I5S A;  3TZ0 A;  4RUE A;  4BIZ A;  1JJ2 U;  2H8M A;  5C93 A;  4MTX A;  1GJV A;  2YEI A;  4CWR A;  1KIJ A;  3CCU V;  4XD8 A;  1J95 A;  4H81 A;  2EJR A;  4R8C A;  3ETE A;  1NH2 D;  2XDS A;  4XKK A;  4GT8 A;  3FYE B;  3CRK A;  3T10 A;  3CD6 V;  3ABU A;  3EHH A;  2YEH A;  4EKW A;  3GIG A;  1THZ A;  1TBW A;  1B6Q A;  3ZIA G;  1Y4M A;  2WLI A;  2P90 A;  1JOY A;  3JYC A;  3D0B A;  3Q5K A;  2WLH A;  3Q5L A;  1N8R W;  4NH7 A;  2BYI A;  2WI1 A;  4HZ3 A;  1R73 A;  3RW0 A;  2BU2 A;  4CWQ A;  2OCC B;  4L90 A;  3K0D A;  2WI3 A;  2Q6A A;  5IDM A;  4EMV A;  3A0X A;  3FT5 A;  1OCR B;  2AHY A;  3OAA G;  3OUF A;  5M4H A;  2WAM A;  1JX9 A;  3H4L A;  5CTW A;  4X9L A;  3AG3 C;  1F4N A;  5CMU A;  5LHG A;  5CTU A;  2XJX A;  4AS9 A;  3AG4 C;  4ASF A;  1AI4 A;  3LNM B;  5L3C A;  4PDR A;  2IWS A;  2XAF A;  1K4D C;  1AM1 A;  2BOC C;  5EBM C;  4CWF A;  1GTO A;  2BTZ A;  1QR8 A;  1SZT A;  2IJK A;  2WI5 A;  1GK9 A;  4QPK A;  3RLQ A;  3VOU A;  3CP1 A;  4PDM A;  1FXK B;  1L1F A;  5CPH A;  4YKW A;  4JQL A;  1CEZ A;  5LGN A;  3T1K A;  1I5D A;  1ORQ C;  3ML0 A;  3KE6 A;  2GFD A;  4XIQ A;  2WER A;  2DQ0 A;  2WLL A;  1AI5 A;  3ASN C;  1VQ5 V;  1JM6 A;  4G28 B;  1B62 A;  4TT3 G;  4WUC A;  3DTU B;  1OCO C;  3LUT B;  5CA3 A;  2YSU B;  1UYM A;  2YEV B;  2YI6 A;  4UVA A;  2W0F C;  2CK3 G;  3VHA A;  4BAY A;  4HY1 A;  3CC7 V;  3MHS C;  1UYK A;  1EFR G;  4XC0 A;  2QF6 A;  4KP4 A;  4URL A;  1EZJ A;  1QY8 A;  1GO3 F;  1S72 V;  3SYP A;  3ZRW A;  2EIL C;  5LHI A;  3CPW U;  1K5Q A;  3CCQ V;  5DN6 G;  2V7Q G;  2IJH A;  4RUF A;  3AG2 C;  1EBO A;  3W7W A;  4L94 A;  2CG9 A;  2YGF A;  2WLJ A;  3A0Y A;  5M4P A;  5H9C A;  2IWU A;  5M4N A;  3U2D A;  2HLD G;  4KQV A;  3O0I A;  5EK0 A;  2X6C A;  4CWS A;  2YEC A;  5F5R A;  4ZKI A;  5IYB O;  3TTZ A;  3FV5 A;  1DF5 A;  4YXW G;  1V55 B;  5EC1 C;  2ZKJ A;  2DWD C;  1Y8N A;  4YKQ A;  4P9P A;  2BZ5 A;  4XIT A;  2XAG A;  5BOC A;  4MVM A;  1K97 A;  4XIP A;  4WFG A;  3OUS A;  5L3E A;  2JKI A;  3INX A;  5B3S C;  3B8M A;  5KA6 A;  2YE7 A;  4QPJ A;  1CPY A;  4GX5 A;  3W7U A;  1XL6 A;  3T2M A;  4U7N A;  3FB5 C;  4XBF A;  1NHH A;  4WCE V;  2YK9 A;  2YEA A;  4ASA A;  3JZ3 A;  5FL7 G;  4XE2 A;  2QKS A;  4K4O A;  3A0T A;  3WHA A;  1BKN A;  4V26 A;  5D7D A;  3E86 A;  2BYH A;  3VBB A;  1AI6 A;  2QM7 A;  1VQ9 V;  2W6J G;  2CCS A;  3HYY A;  1UYI A;  1GMG A;  1FFT B;  4ASU G;  2WI4 A;  2YE4 A;  2EZP A;  4TWK A;  4MB9 A;  1BXD A;  4GT1 A;  1MSW D;  2BRE A;  4URO A;  3C11 A;  1R3I C;  1U2O A;  5KUK A;  5LGT A;  3WG7 B;  1YTF B;  1AJN A;  2BU5 A;  3JD3 A;  3W7X A;  1P7B A;  1Y8P A;  3ZRS A;  3BMY A;  4AWP A;  2ZQM A;  1OHH G;  5EBL C;  4E00 A;  3SYC A;  2ITC C;  3M99 B;  3HPL C;  4O05 A;  4KSH A;  2YEE A;  1OCZ C;  4DXW A;  1R3K C;  5M4K A;  2DYR C;  3OEH G;  2EIJ C;  2H55 A;  1I5C A;  5B1N A;  3X2Q C;  4HYM A;  2HJF C;  1MAB G;  3G7E A;  3NXS A;  2A0L A;  1QBZ A;  1NR7 A;  4CZZ A;  2YE8 A;  2DWE C;  1BYQ A;  4WFH A;  4OXS A;  1MOF A;  1NQT A;  2ATK C;  3A0Z A;  2H94 A;  1PNK A;  2IH3 C;  3ABL C;  4WFE A;  4MVZ A;  2WI7 A;  3CCJ V;  3GB7 C;  3BM9 A;  2CCU A;  3GIE A;  3ZMS A;  3JD2 A;  2EIN C;  1H8E G;  1P4R A;  3QO8 A;  1V54 C;  1UYH A;  1TC6 A;  1K7D A;  4J9Y B;  2YGE A;  3OW6 A;  2A9H A;  1K33 A;  2EZO A;  4P30 A;  3ASO C;  2C2A A;  5B1A C;  1Y66 A;  2BT0 A;  2YGA A;  1KEC A;  5L3G A;  3E8H A;  1DF4 A;  4KFG A;  5M4M A;  1K92 A;  4CWO A;  1ZWH A;  4QE9 A;  1PKX A;  4EFT A;  1W2B U;  4Z1M G;  2O1V A;  4GCZ A;  1H38 A;  1AJP A;  1FXH A;  4N23 A;  2XND G;  1S77 D;  1NVP D;  1L0O A;  4WF9 V;  4V25 A;  2X7R B;  4EGI A;  3SPG A;  2WSS G;  2Q8H A;  3K08 A;  3OW2 U;  4PDV A;  1R3J C;  1YC4 A;  1YC3 A;  4ASG A;  4UVC A;  2WPD G;  2M7W A;  1H8H G;  2Q8F A;  4CWN A;  4WUD A;  4UV9 A;  2JJC A;  1K5S A;  4EM7 A;  3B27 A;  4JAS A;  2HKJ A;  3K3W A;  4MVO A;  1VQM V;  4BXI A;  3OWD A;  4BQG A;  2D3O W;  4GGL A;  3T4Z A;  5D6Q A;  2ZBK B;  3QO5 A;  1UY7 A;  3CCS V;  4PRX A;  3TZ5 A;  5EC2 C;  1US7 A;  4XDL A;  2YE5 A;  2XAJ A;  3OE7 G;  3R4M A;  2H8P C;  4ZBM A;  3D36 A;  1QCE A;  2ZDI A;  2R9I A;  2YE6 A;  4TSF G;  1YC1 A;  4LCU C;  2XHX A;  3GIF A;  1YSC A;  3ABT A;  4JTD B;  2OTJ V;  3P30 A;  3AG4 B;  4YKR A;  2YEB A;  3Q5J A;  2QG0 A;  5FND A;  4GFN A;  4MS2 A;  2Y48 A;  1K3E A;  1TC0 A;  2B5U A;  2IJJ A;  1K73 W;  2FYP A;  3E8G A;  5J71 A;  3ZN1 A;  4O07 A;  1COW G;  1LNQ A;  4QE7 A;  1W0K G;  1KQS U;  3OR7 C;  1NJI W;  4PEL A;  3ZMU A;  4YKT A;  2HR3 A;  3ASN B;  3U67 A;  4MBC A;  1UYD A;  1TUE B;  3G75 A;  1Q82 W;  1OCO B;  1KC8 W;  1YIJ V;  1YT2 A;  2KB1 A;  2V1D A;  5IDJ A;  1BHB A;  2YE3 A;  4WFA V;  4DO2 A;  2HCH A;  3F5W C;  3F7V C;  4RQE A;  4KUM A;  5LGU A;  3OM3 B;  2BSM A;  1TIL A;  2QA4 V;  3G4S V;  1NH2 B;  5FNC A;  3W7S A;  4WUB A;  2IWX A;  3PEJ A;  5LHH A;  2FWY A;  2YI5 A;  1E1R G;  1UY8 A;  2EBO A;  3CCM V;  2EIL B;  3O2F A;  1UYG A;  4MPC A;  1GKF A;  3HHU A;  3LDD A;  1GKZ A;  1JPX A;  2O1W A;  2K5B A;  4R3A A;  2X6B A;  2QTO A;  3I56 V;  2NLJ C;  5M4E A;  2EIM B;  4GX0 A;  3A0R A;  4MVQ A;  1B3Q A;  2XX5 A;  5B1O A;  1VQL V;  1SRY A;  1Q86 W;  3FT8 A;  1S5H C;  3ABK B;  4PA9 A;  1FXV A;  4YKZ A;  4XCL A;  4LWH A;  1KD1 W;  1BHA A;  1RPR A;  2WI6 A;  3SPJ A;  4P7A A;  1KP3 A;  1YER A;  4YKY A;  4O04 A;  3RVY A;  4JYB A;  4EEH A;  3K98 A;  4RAI A;  5L3B A;  1M9N A;  1VQK V;  1K4C C;  2IH1 C;  1FXK A;  4LWF A;  5B3S B;  4X88 A;  1HWY A;  4H33 A;  1M57 B;  4QIW F;  4MT8 A;  3OR6 C;  3VHC A;  2CH4 A;  3OWB A;  4JF3 A;  4RQF A;  4B7P A;  1WPX A;  2ZDY A;  1Q7Y W;  3LNU A;  2XCM A;  2VCJ A;  3HYZ A;  4FCR A;  4GQT A;  1S3J A;  3PJS K;  4XIR A;  5CTY A;  2YEV A;  1ZWI C;  2FWZ A;  5GW7 A;  2QG2 A;  1ID0 A;  1AH6 A;  1QLE B;  4N21 A;  1S16 A;  4CE2 A;  3EHF A;  4LPB A;  3K04 A;  4PL9 A;  5D6P A;  1I5Y A;  3R92 A;  1BMF G;  4XDM A;  2XD6 A;  1H7S A;  2JJ1 G;  2XAB A;  2EXL A;  3IED A;  3CGY A;  3CC2 V;  1ROP A;  1IXM A;  2VWC A;  1K8A W;  2HKO A;  3TUH A;  2XOK G;  2GSM B;  4P2Z A;  4JGS A;  4L93 A;  1BGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...