4JASA

Structural basis of a rationally rewired protein-protein interface (hk853mutant a268v, a271g, t275m, v294t and d297e and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
237
structure length
237
Chain Sequence
LKRIDRMKTEFIANISHELRTPLTVIKGYAEMIYNSLGELDLSTLKEFLETIIEQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
molecule keywords Histidine kinase
total genus 68
structure length 237
sequence length 237
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jasA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4jasA02
5FWKA 2BZ5A 1UYIA 2GFDA 4CWSA 4YKZA 5M4KA 1TBWA 1ZW9A 3O2FA 3FV5A 2WI4A 3OWDA 3FT8A 4P7AA 3C11A 2WI3A 2BREA 4FMTA 4YKWA 3NMQA 2XHRA 4ASFA 3U67A 3ZKBA 1EI1A 5B1NA 4GCZA 3D36A 4JYBA 2YECA 4QPJA 4L93A 4Q20A 3R4NA 5IDJA 2ZDXA 2O1VA 3FT5A 4X9LA 4XC0A 4YKUA 2BSMA 1B62A 5M4HA 2YKEA 3ZCCA 2YKJA 4LC1A 1JM6A 2BU7A 1I5AA 1BGQA 4MB9A 2CG9A 2CH4A 2XDSA 3B28A 1UY9A 2H8MA 2XX5A 3G7BA 3PEJA 3R92A 4AWOA 4WUDA 2YE8A 5M4MA 1Z59A 1AJ6A 4KP4A 4EGKA 4HYPA 2WERA 2XJXA 2YK9A 4GT1A 4R3AA 4YKYA 2VWCA 1UYLA 5D6PA 2Q8FA 4FCPA 2FTKA 4ASGA 3U2KA 4BAEA 1AH8A 4CWFA 4URLA 3DGEA 1UYKA 2YE2A 4K4OA 1S14A 4FCRA 3ZXOA 4CE2A 4XTJA 3ZRXA 2LFRA 4BIZA 3R4MA 2IORA 3RLRA 1YC4A 3A0ZA 3EKOA 3LPSA 3Q5JA 2CGFA 4MPEA 1PVGA 1UYMA 3T2SA 2YI7A 1Z5CA 4BXIA 2XJJA 4MTXA 2YEDA 4I3HA 4MT8A 5IN9A 2YGFA 5F5RA 2YEHA 1QY8A 3G7EA 4O0BA 4LP0A 1THNA 1UYCA 3A0TA 1BKNA 3IEDA 3CGYA 4ASAA 3B27A 1U0ZA 3G75A 2XDKA 2YE4A 4KFGA 2HCHA 2IWSA 4O04A 2HKJA 1AMWA 3TUHA 1AM1A 1GJVA 2BU6A 4XKAA 2CCTA 4EGHA 2XDXA 4MPCA 2BU8A 4URNA 2PNRA 5FNDA 1Y8PA 4V26A 2YJWA 4CWTA 1F51A 4L90A 4NH8A 1JOYA 2BYHA 2Q8HA 3ZKDA 1YC3A 5B1OA 3K98A 3O0IA 3T1KA 1Y4SA 3TZ5A 4H85A 1GKZA 2WI5A 2YK2A 1H7UA 1Z5BA 2YJXA 4HZ5A 3TZ0A 3CRLA 4EFTA 4EGIA 4MP7A 2IOPA 2Q8IA 4EMVA 1Y4UA 2WI7A 2JJCA 3CWVA 2WWWA 4ZKIA 2GQPA 4YKRA 5M4PA 4LWGA 4EFUA 1KZNA 4GGLA 3P32A 5GGZA 1ZXNA 4PRXA 1YSZA 4HY6A 5CTXA 5J71A 4BQGA 3EHFA 4L94A 5C93A 4MP2A 5F3KA 4B7PA 4FPPA 1TH8A 1YSRA 3JZ3A 1UYEA 2CCSA 4HZ0A 2YEGA 1QYEA 2YEJA 1I5DA 2XDLA 2IWUA 2XDUA 4KSHA 4XIQA 4GFNA 3OPDA 4R1FA 5FNFA 5BODA 2QFOA 3TZ4A 3INXA 1YT1A 2FXSA 3TZ2A 4DZYA 2YEIA 2EXLA 4YKTA 2YGEA 2ESAA 3VHAA 5CPHA 3HYYA 4HYMA 4E02A 2XK2A 1NHHA 3ZRVA 4XIPA 1ZXMA 2K5BA 2YE7A 1BXDA 5D7DA 5D7RA 3EHHA 3A0YA 1I59A 1UYFA 4GEEA 1S16A 4O09A 1MX0A 2VCJA 1QZRA 3OMUA 2WEQA 1UY7A 3OW6A 1AH6A 1B3QA 4GT8A 4MBCA 4B6CA 5M4EA 2YI6A 4CWPA 4JYCA 2YEAA 3VADA 1KIJA 2E0AA 5M4NA 3VHDA 3K60A 3D0BA 2VCIA 4YKXA 2QF6A 2YKIA 3K99A 2AKPA 3INWA 3B24A 1YC1A 4LWHA 2YE5A 2WI6A 3EKRA 2Q2EB 4HY1A 3BM9A 4P8OA 4V25A 4E00A 2BYIA 2ZKJA 4UROA 3KE6A 3H4LA 3A0XA 3H80A 3GIFA 2UWDA 2Q8GA 4XCLA 4CE1A 5BOCA 3SL2A 4E01A 1Y8OA 2YEEA 2BT0A 1UYHA 3U2DA 1NHJA 1UYDA 4URMA 2XJGA 4AS9A 3HZ1A 5CTWA 4BQJA 3EHJA 1ID0A 2BU2A 3HYZA 3MD0A 2WI1A 2P67A 1YS3A 4EEHA 1OSFA 4XKKA 4O07A 1YT2A 1TC6A 4QPKA 3A0WA 4AWQA 1YERA 2FWZA 4BIUA 4L91A 3HHUA 5J6AA 3Q5KA 4XKOA 4CWRA 3D2RA 2ZBKB 3TK1A 2IOQA 4U93A 4DUHA 3T0ZA 2WI2A 1US7A 4JQLA 2C2AA 3PEHA 2YEFA 3ZRWB 3ZM7A 1TC0A 2H55A 3GIGA 4PU9A 2YI5A 4XDMA 3R4PA 4NH9A 2IWXA 1I5CA 2XD6A 2BU5A 4CE3A 4HXZA 1Y8NA 1UY6A 2LFSA 4MPNA 1BYQA 2XABA 2QM8A 4HXWA 4O05A 4LWEA 2BRCA 3K97A 2O1UA 4YKQA 4KSGA 4FCQA 4XITA 3T0HA 4LPBA 4JASA 2JKIA 5CTYA 4LWFA 4CWQA 2BTZA 4U7NA 5CTUA 4ZVIA 4JAUA 1TIDA 2VW5A 2HG1A 3BMYA 4GQTA 1GKXA 3VHCA 2FWYA 5CF0A 3TTZA 4I5SA 3RKZA 4L8ZA 4XE2A 3GIGB 3HZ5A 3B25A 3RLQA 3O6OA 2CCUA 1A4HA 3A0RA 1YETA 4ASBA 3NXSA 1R62A 1U2OA 2YGAA 5FNCA 3R4OA 2QG0A 3ZXQA 4PRVA 4XD8A 5L3JA 3T10A 3C0EA 1IXMA 3QTFA 1B63A 2XCMA 3QDDA 1YT0A 2XHXA 4H81A 3ZRWA 3R91A 1Z5AA 1L0OA 1I58A 1EA6A 3CRKA 4W7TA 1NHIA 4WUBA 4H7QA 2O1WA 3Q5LA 2XX2A 5D6QA 3LNUA 2YE9A 3CGZA 4CWNA 4XCJA 3WQ9A 4MOTA 5D7CA 2WEPA 2YE3A 3RLPA 4CWOA 2QG2A 1UY8A 3OWBA 4JAVA 1YESA 1ZWHA 3WHAA 4LWIA 1I5BA 2YE6A 3MNRP 1UYGA 3EHGA 2XHTA 1TILA 3GIEA 1H7SA 3HEKA 1MU5A 4XIRA 4KQVA 4NH7A 2YEBA 4U7OA 2ZDYA 2YI0A 3B26A 2XX4A 4PL9A 4R3MA 4KTNA 5IDMA 2FYPA 4WUCA 2YKCA 2YKBA 4AWPA 2QM7A 4EM7A
chains in the Genus database with same CATH superfamily
2BSKA 5FWKA 1M56C 4DV5O 4UB6Z 4DR7B 1RSOA 4YKZA 4EB6A 1ZW9A 4J7JA 2WLHA 2LGWA 2F4VB 2WI4A 1K4CC 2BREA 4PDLA 3K5LA 1FXVA 1D2DA 3NMQA 4JI8B 4RUEA 2VQFO 4H0LB 4CH3A 4K35A 2XUMA 4GCZA 4DV7O 4QPJA 3BEHA 4LWSB 4L93A 5JVDA 1YEWA 2GSMB 4PA3A 1N36O 4IL6Z 1N4CA 2JEUA 3ZMUA 3LNMB 3ICXA 3ETEA 5IJ0A 3ZCCA 2HLDG 4LC1A 2ZXWB 1BGQA 4MB9A 4I4TA 5KMGA 5HFMA 2WSSG 3G7BA 3OM3B 2XX5A 3PEJA 3R92A 3CWBH 2UUBO 4AWOA 3E8HA 5B1BC 5D5QA 3UO3A 3VOUA 1Z59A 4UVAA 3GWKC 5B5EZ 1N34B 3LSQA 1Y6XA 3LMMA 4K8ZA 4HBNA 1M9NA 5D6PA 5IWAO 4FCPA 4AQYB 3SPCA 4UCSA 1VQ5V 5B3SB 4QE7A 1DGSA 2GV9A 3DGEA 4F6RA 4QNHB 1GM8A 1MSDA 5H5NA 2YE2A 4UVBA 1AILA 4X88A 4GKJB 3ZXOA 4XTJA 3ZRXA 4TV8B 4DO2A 1IXBA 5H6RA 4BIZA 4CC5A 1I7FA 4RUFA 4B7KA 3JSNA 5CA1B 3OR7C 3SR2C 1UYMA 2IU3A 2YICA 1Z5CA 5BMVA 4JAAA 2ETNA 2IJHA 1QY8A 1XHXA 4IHJA 3VQVA 2DJVA 2Q7EA 1THNA 4PA9A 1CP9A 4U3JA 3CCEV 4IT5A 1UYCA 2FMLA 2H3OA 4YIOA 2M6YA 4F6RB 2YE4A 3OEEG 2P5OA 4H37A 2E5LO 3H1HH 2HKJA 1HNXB 1GJVA 2ITCC 1QLEC 4D7TA 3U11A 2V1DA 3DTUB 2OIGA 4KL1A 1F51A 2CK3G 3D3IA 1JOYA 5B1AB 4DUZB 2ZE8A 3IGAC 3K98A 1IBMB 2Q9LA 3CXCU 1Z5VA 1Y4SA 3KKYA 5B3SC 4CS4A 3WG7B 2CTWA 3TJTA 4WFFA 1M57C 5LOVB 3S3XA 4ZHQA 1AVMA 2F95B 2UXCO 2JJCA 4JI5B 4YKRA 1HNWO 5M4PA 4LWGA 1HNZO 1SETA 4NTXA 4DW1A 1KZNA 5KX5A 2EX3A 3P32A 5GGZA 5CA0A 1WA8A 3EHBB 5J2UB 3F7VC 2YIBD 5LGTA 3CE2A 2LJ2A 1IURA 1EN4A 3CEIA 5C93A 5JCOA 5F3KA 4DUYB 4B7PA 1OJHA 3K04A 3WB2A 3JD1A 4NXMO 1YSRA 3D36C 4PI0A 1UYEA 1K8AW 5J2TA 2CCSA 3G71V 4HZ0A 5A2QN 1TA8A 4UVCA 3AG3B 4XIQA 5CA1A 1HR0B 3E8BA 3OPDA 1GN4A 1R6TA 4JI3O 4R1FA 1P49A 3RN4A 2Y4UA 5LXTA 4RWUA 3AK1A 3TZ4A 1M90W 4KHPO 3IJ4A 4Z1MG 3TZ2A 3ZMZA 2YEIA 2GTAA 4MTOA 4FLXA 1EM1A 3Q4HB 1QU7A 1VQMV 2HG5C 1IDSA 3OAAG 2D3OW 4HYMA 5EC2C 2XK2A 2WLIA 3ZRVA 3HB3B 3T4ZA 4XIPA 1BS3A 3E8FA 2AXTZ 1HDJA 3EHHA 1FXKC 4LF5O 1UYFA 4X1YB 4FLTA 2VCJA 1VQ8V 2CTRA 2WEQA 1VMGA 3R65A 4GT8A 2JS3A 5FL7G 3CX5F 5M4EA 4KXRA 4HAMA 4X1IA 1XBLA 1EN5A 3BY6A 2DMXA 5B1AC 5L3FA 2QR4A 4B3MB 3JCZA 1Q81W 1K97A 2HFEC 2VRZA 3K59A 3R66A 3K60A 3D0BA 4YKXA 2Q69A 4PDMA 3K99A 5ITZA 1G6UA 2AKPA 3B24A 3WB0A 4JTAB 2YE5A 3K3WA 3EKRA 4YY3O 3IC7A 2Q2EB 4HY1A 4UROA 5FLXN 1OCCC 1ORQC 4ASUG 1WAZA 2HP8A 4DV5B 3SL2A 2YEEA 4B7EA 3CCJV 2WLNA 4JTDB 2L35A 2ZR3A 1NHJA 1VARA 5EBWC 4URMA 4Z1VA 1MZEA 1WN7A 1VQNV 1JX9A 4AS9A 2EZOA 3HZ1A 3EHJA 1Y4MA 5KHKA 3FYIB 1BMFG 1Q6UA 4B3TO 3C90A 4J9YB 2NN4A 1YCIA 2Y0IA 3ETGA 4CH6A 1OSFA 2EBOA 1WPBA 2PZSA 2QKSA 5KHIA 1NH2D 2BOBC 1VQ7V 2YIAA 4FLUA 4MVUA 2V7QG 3X2QC 1BHAA 3ZHTA 1IBKO 2FWZA 5J6AA 3E8GA 1X59A 4CWRA 2ZE5A 1R1BA 4GX2A 2DQ0A 2F1MA 2AZ2A 4DUHA 2UUBB 3T0ZA 2PYLA 1WP8A 1Q8IA 1XREA 2DN9A 1XL4A 1P84F 2RNBA 1RM1B 1SESA 3ZRWB 5BMVB 1PNMA 3O9OA 2YI5A 3L71H 1PD3A 3RVYA 3E86A 3N2KA 3FFQA 4N21A 1M56B 2UUCO 2XD6A 4CE3A 1Y8NA 1UY6A 5LMUB 2XTAA 3ZRSA 2QWNB 3K0GA 4G27B 3OUSA 2YDEA 2BRCA 1PV0A 1DLBA 4TUYA 5H9CA 2QKAA 3LNNA 3ABLB 1FD9A 5EBLC 2WLLB 1I0HA 4U3FH 5KUMA 3RWRD 4DR3B 4FM2A 4LPBA 4XITA 4LWFA 1AI6A 1AJNA 4CWQA 4R6ZA 3RBZA 4ZVIA 3CXHF 4JAUA 2VW5A 1US6A 2B9ZA 1H8EG 3NR7A 5IJ9A 3RKZA 5L3GA 1YTFD 5IY5C 3MHHC 3A0RA 3JAWA 1YETA 4ASBA 2YUAA 1U2OA 2B5UA 1FS0G 5BR8B 1I94B 4JI2B 1FJGB 3L70H 1XL6A 1IBLO 4PJ0Z 4UCOA 3RT3C 1S77D 5L3JA 1MNGA 2RQ6A 3N2GA 1IXMA 1B63A 3TXSA 1THZA 4CH5A 1YT0A 3T1YB 3R91A 3FKSG 1L0OA 4L87A 1N32B 4WUBA 4UV9A 4H7QA 2O1WA 3Q5LA 5LGNA 1CPYA 4LF7O 2XX2A 1ZUQA 5D6QA 1JCHA 1DTOA 2YE9A 1YTFB 5LL6Y 4MOTA 3T4DA 1ZL8B 3ASNB 1CXZB 1K3EA 4CWOA 2QG2A 4YJ3B 3OWBA 1G8MA 1ZWHA 2GUZA 3T2MA 5CB4A 2Y0PA 5LP6A 3F5WC 4GUNA 5JJJB 1H7SA 4P30A 4PA6A 3P3PA 2WLJA 4NH7A 2A0LA 1NI8A 3IFXA 1N0NA 4J11A 5LYJA 1FXHA 1GMGA 1FFXA 4W4LA 1KQSU 4TV8A 2EINC 4DUYO 4J9ZB 2N05A 3RVZA 4DV0B 2YKCA 4OX9O 4AWPA 2HR3A 4X8AA 4X65O 4B3TB 2GFDA 3HKCB 4CWSA 1SZXA 1YXBA 3E35A 5M4KA 3ABMC 2QGNA 3CSXA 4WFAV 3CC4V 3RYIB 3OWDA 5KHHA 3FT8A 5J9PC 1KP3A 2X6CA 4FFBA 4TV9A 4P7AA 4NTYA 4O4LB 4UCUA 4YKWA 2HVJC 4IHJB 2XHRA 3SDLA 1HP8A 3ZKBA 2IJJA 1EI1A 5B1NA 4AILC 2DYSB 4UCTA 2PGGA 4MVOA 1DF5A 4JYBA 3SJAC 1J95A 3OMNB 3OGIB 5C8YA 1L8DA 5IY5B 1JFFB 2ZDXA 4I50A 2O1VA 3FT5A 4I0XB 4YKUA 3HKCA 4OPAA 2BSMA 5JQGA 3AK2A 5M4HA 1QQCA 3N27A 5EBMC 1JPXA 1SF9A 3KCXA 2CG9A 2CH4A 2XDSA 4YHHB 3B28A 1UY9A 2H8MA 1JMKC 1ZLZA 3K5NA 1O9GA 4WUDA 2P4KA 5M4MA 1R3IC 1AJ6A 4KP4A 5AG2A 5LMUO 4EGKA 4DYLA 3BHPA 5E79Z 3CRQA 3OEHG 2YK9A 3ETDA 4GT1A 4R3AA 2VWCA 3VBBA 3F7YC 2N74A 1UYLA 2FTKA 4E4EA 1SZTA 1N0JA 4YXWG 1AH8A 1UYKA 1OCRB 1S72V 2PY5A 1S14A 4I50B 4GLXA 2LQTA 4CE2A 4YJ2B 1LR1A 1NVPB 1Y74B 1YIJV 1Q82W 4MVMA 2IORA 1YC4A 1QNMA 5EYPA 1Q7YW 2Q68A 1TUEB 1PM9A 2W6JG 4I3HA 4MT8A 2YGFA 5F5RA 2RJZA 4O0BA 2E74B 3A0TA 4WFBV 1NH2B 2JJ1G 4DK0A 5EK0A 2IWSA 4DXWA 3DXRA 2E75B 2PUSA 2B1IA 3T1HB 1AMWA 4P9OA 2CCTA 4EGHA 2BU8A 4X62O 4JI1O 4LH6A 5FNDA 4V26A 2Q8HA 4MW3A 1V9PA 3ZKDA 2OCCC 2ZE6A 5B1OA 4LFCO 3O0IA 2WLLA 4JI8O 2X0LA 1XUQA 2Z3YA 2WI5A 2BCCH 5EC1C 4FZ1A 2YJXA 3TZ0A 4EFTA 3B40A 3OTOO 4GYCB 3SYAA 2UXNA 3DSQA 2A7WA 2Q8IA 4EMVA 1Y4UA 2WI7A 4DR3O 3CMEV 1P4RA 2GQPA 4GKKO 3DXRB 2A06H 2CH7A 4B3SB 1Y66A 2R9IA 1Q6HA 1TVKA 5K1PA 4JV5O 1YSCA 4DV0O 1S0VA 2HHHO 2DWDC 3M7MX 1VEWA 4DR4B 4NB5A 3SYPA 1JQ0A 3AEIA 2JRIA 3ZMTA 1H8HG 2ZR2A 3CRRA 4QGPA 2HKOA 3J80N 3EHFA 4QIWF 1ENVA 1TH8A 3N2GB 2JS5A 3JZ3A 1J5EO 5L3EA 5BR8O 1I94O 4JI2O 4J80A 2LP7A 3A8TA 1QLNA 1QYEA 2YEJA 1I5DA 1TVKB 2Y69C 2XDLA 2QA4V 4J42A 1KC8W 4GFNA 2UUCB 3OMAB 3ZJZA 5FPRA 5BODA 5KHGA 2QFOA 1FPOA 3INXA 4R7CA 1YT1A 4EFEA 2UUAB 4LF6O 1Y76A 2NNUA 4UV8A 1ZSPA 3ZEDA 1R3KC 4WBNB 1K73W 1WPXA 4PA4A 5IYBO 2XOKG 4YKTA 4MVRA 2ESAA 2Z5UA 3FB8C 4AHCA 4DV1O 2YI8A 1SQQH 5LP6B 3K06A 3JATB 4CH4A 3S3WA 1TUBB 1XHZA 1BXDA 3GWOA 1OHHG 4LFAB 4JZ2A 1RPOA 2UXXA 1N33O 1EZVH 2C1GA 3OMUA 1UY7A 1R6NA 5LHHA 2BOCC 4J7KA 1AH6A 3EXAA 4LF7B 4I4TB 5KMGB 3L73H 4DR7O 4BWAA 3K08A 1XNRB 4CWPA 4MVSA 4NTWA 3E2EA 3S5TA 3CCQV 5LA6A 3FYEB 3VADA 2LO1A 1XQ8A 2E0AA 2RCVA 3AG4B 1TUBA 4KUMA 3A2FA 4MTGA 2UXDO 3T1YO 3VHDA 3D8CA 4NXNO 1Y74A 2KSDA 3FAVB 3H1KH 1S5HC 4LR3A 2YKIA 1VQ4V 4DV7B 2BTQB 3LUTB 3INWA 1UFIA 2QWRB 5CBFA 1QR9A 5BXZA 4LWHA 4I55B 2WI6A 3ASNC 4JI7O 5LHGA 4E00A 2YXYA 4N23A 1V54C 1QLEB 3H4LA 3A0XA 3H80A 3GIFA 2UWDA 4CE1A 3BA8A 2P4VA 2QE7G 3SPHA 1UYHA 1WB7A 4ZOLB 5CB4B 4FLWA 1ZX3A 4BQJA 1ID0A 3HKEB 3BVOA 4DR6B 1NR1A 2P67A 1WP7A 2CTPA 4WFGA 1YT2A 4O07A 4LFBB 4B3RB 2ZKOA 1KP2A 3A0WA 3FB5C 3OW2U 4AWQA 1HR0O 4L91A 2ZBKB 2BE3A 2LW7A 4C7UA 3J7AU 3TK1A 1TGOA 4FLVA 5EIBC 2WI2A 4IIJB 1A32A 1N8RW 5LP6C 1XOUA 4JQLA 4TOIA 2YEFA 5HFLA 4X66B 4JI0B 2EULA 2EJRA 2WLMA 3AG2B 4O4IA 4XDLA 5BY1A 1F4MA 3JAMN 4NH9A 1YI2V 4NVPA 1R6KA 2CE4A 4HXZA 2XAHA 1QVGU 4MPNA 2P6JA 1BYQA 2QM8A 5CBHA 4O05A 3B4SA 2YIBA 3O65A 4X1KB 3K97A 2YXLA 1OCOC 4CBCA 4YKQA 4KSGA 3C3TA 2VS0A 4LF4B 5E1AC 2F23A 4JASA 4PI2A 2GUZB 5J2UA 3MDSA 3CS5A 4U7NA 1TIDA 2HG1A 1I5YA 1GKXA 1EBOA 1AJQA 4MVQA 4I9QA 2K9PA 4X64O 1SQVH 3WG7C 4XE2A 3GIGB 2JGUA 1ZAUA 3O6OA 1SERA 3AG1B 1YDXA 3W7SA 3NXSA 1R62A 1HNXO 4FLZA 3VQYA 4JZGA 1L0NH 5FNCA 1H2MA 2OYQA 3ZXQA 4PRVA 4K0KB 3K5OA 2JDIG 4MVZA 3C0EA 2RDCA 2ZDIC 3OR6C 2VQEB 3TGUH 2XHXA 3DC5A 1HW7A 2X6BA 4A5UB 1G1XB 3HR0A 1KB9F 3UCSC 4B3SO 3AK3A 1Z5AA 1BHBA 1XNRO 2V4DA 3WFVA 3CCSV 1N36B 2EIMB 3CRKA 2JIZG 2A79B 3ZMVA 3ZHQA 4LF9B 3CGZA 4MTFA 2P06A 4CWNA 5KAFZ 2EIKB 3BAAA 4L8JA 1YESA 3WHAA 1N34O 3RYCB 2PI4A 3I55V 5K1XA 4X62B 4DR1B 2IJIA 3EHGA 3OFNG 1AROP 4JI1B 3HEKA 4XIRA 3CCLV 4O4HB 5KA6A 2ZDIA 4U7OA 4PDRA 2YI0A 3LDEA 5H2FZ 3B26A 2XX4A 4R3MA 1M1KW 2PF4E 2QKCA 5GONA 4FZ0A 1K9MW 4LF6B 4UB8Z 4DV2B 5CTUA 3B77A 2RN9A 4EM7A 5FPOA 2OWOA 2ZIMA 1SQPH 1NBMG 2IJKA 3ABUA 4RQFA 3O2FA 4FJCC 4EEQA 4LNUB 1EZJA 3BRCA 3CJHB 4JV5B 3JD3A 3C11A 2WI3A 4FMTA 3LSSA 3U67A 3P30A 1W2BU 1QR8A 4LH7A 1COWG 3D36A 3K9AA 3PN1A 3R4NA 5LA6B 5IDJA 1VP7A 4X9LA 3ZHRA 3CPWU 1B06A 4DV1B 1B62A 3HKBA 4JI4O 1AB3A 4OXSA 2YKJA 2A3QA 4LNUA 1JM6A 2BU7A 5IYZA 1WLEA 2Q7HA 4AI8A 4BAYA 1BQZA 2F66C 1N33B 3JASB 5IJ9B 1RM1C 4HYPA 2WERA 1H2SB 4LP8A 3B8NA 3OGCC 1ZWIC 1D5NA 1IBMO 1NTKH 1FKAO 3U2KA 4LF4O 4H33A 1BCCH 3THOA 1KKDA 4IYHA 1M57B 2UU9B 5CA3A 4K4OA 1GH6A 1NR7A 2UXCB 4NXNB 3C3SA 4TV9B 1VF5B 4X20B 1XDCA 5LXTB 3ABKB 1NT2B 3RLRA 3W7TA 4U3JB 1OCZC 1XNQB 3EKOA 3LPSA 2JEXA 5EYPB 3Q5JA 2OCHA 1IBKB 2CGFA 5C8YB 1KBHA 4WCEV 2DYRC 2JJ2G 1YF2A 3CCVV 4DR6O 4JYAB 4I0XA 2R9AA 4G28B 4MTXA 2XJJA 2YEDA 1F4NA 1SA0A 2Q8VA 3APOA 5IN9A 3HPLC 2YEHA 5DN6G 3AG2C 4QJFB 2P22C 5DECA 2DE0X 2AW9A 2VQEO 3IEDA 2UXDB 3CGYA 2HJFC 1QCEA 3B27A 1U0ZA 4JYYA 4ASAA 2HCHA 2XAJA 2DQ3A 3B8MA 3H01A 4O04A 4OGQB 1FXKB 4HZ3A 1V55C 1AM1A 4X20A 1BSMA 4DR2B 4XKAA 4MPCA 1GN3A 4URNA 4QE9A 3E22B 1MA1A 2ITDC 1Y76B 3D3QA 3KCYA 3STLC 2BTOA 4PD4F 3ABLC 5JCOC 4PHZA 3TETA 3CC7V 3T1KA 2XNDG 3L72H 1Z2GA 3TZ5A 1YJWV 2DYRB 1F7YA 1GKZA 3OUFA 4PDVA 1TAEA 1Z5BA 5ITZB 4HZ5A 3CCRV 1KU9A 4R8CA 1UJWB 2CUGA 3JATA 1PP9H 2Q7GA 4FM0A 1FFXB 3L75H 3SJQC 2IOPA 1MG1A 1MOFA 4X66O 2IW5A 1K33A 1VQLV 1AI7A 2R9RB 1OZ0A 2YC0A 1WNSA 1RPRA 1ZXNA 4PRXA 1YSZA 5J71A 1IBLB 4BQGA 4B3MO 3KG2A 4MP2A 4L94A 2MK3A 1NVPD 1KUQA 1DF4A 3JARB 3SJCC 3QG5A 2YEGA 1VQPV 4FLYA 3EVKA 1I5XA 2ADQB 1H2GA 1OCRC 3E83A 2XDUA 5KAIZ 3ABKC 1FFTB 1P7GA 5FNFA 5GTHZ 4WFHA 2KG7B 1U96A 2FXSA 5JWPA 1S76D 3AG1C 4DZYA 3JALA 1K5SA 2EXLA 4TWKA 4I9WA 1R73A 2E76B 2YSUB 5FNVA 2Q4PA 5JJNB 2UXBO 3RYCA 2Q0AA 4HNAA 4O4JB 3CP1A 3BCCH 4HYOA 1ZXMA 2K5BA 1JJOA 2XASA 3N2KB 3A0YA 3OD4A 1AR4A 4DV4B 1NS1A 1I59A 1S16A 4O09A 2EILB 4O2AA 3CMAV 4FVMA 2UU9O 1MX0A 4XDJA 1VF7A 3X2QB 1W59A 1XMQO 4K8XA 5KUKA 4IIJA 1Q86W 2FB5A 4MBCA 1SQXH 4CS3A 5CBGA 2YI6A 3K0DA 3ZHVA 1GM9A 2W0XA 1MMMA 3UKMA 4K3AA 4DV2O 1YJNV 2F93B 5L3CA 5IWAB 5M4NA 2ZNJA 1L0LH 5F2VO 1VF6C 3L9DA 3U0ZA 1BT8A 2VCIA 5LHIA 5KA5A 1URFA 3P3NA 2CGOA 1EFRG 2ILMA 2R72A 2YS8A 1BE3H 3CYOA 3JYCA 1H2NA 1V54B 3JAWB 5L3BA 4YJ2A 2DW4A 4V25A 1WJZA 1M4UA 3K9SA 1AR1B 1YHQV 1VQ6V 2H8PC 2Q8GA 4XCLA 4X1KA 4E01A 2HHHB 1Y8OA 2P7TC 2BT0A 4DR4O 1BL8A 4LF8B 1JA8A 4ZOLA 1Q6IA 5EZYA 1UYDA 4WFEA 3UQ8A 1SQFA 3OT7A 5CTWA 2BU2A 1PNLA 2E3CA 3HYZA 1SC5B 2WI1A 3BFRA 1YS3A 4EEHA 4BIOA 2KG7A 3G6EV 2P90A 1TC6A 1ZL8A 1NQTA 1YERA 1FJGO 3HHUA 1AR5A 3Q5KA 1SQBH 4Q6GA 3M8AA 4LBEC 2IOQA 3CJHA 4U93A 5B1BB 3CRCA 2O57A 4LWSA 2C2AA 3PEHA 1RSOB 1K4DC 4F6EA 3ZM7A 1M5IA 3FD9A 1XNQO 3R4PA 2E5LB 2ZM6O 3FB7C 1V55B 2IWXA 3SPJA 2QTOA 1CEZA 1JR9A 2ZT9B 2LFSA 1YZBA 2XABA 2YEVB 1D5AA 3HKDB 4HXWA 1K34A 4LWEA 4XDKA 5LMNB 3T0HA 1OCOB 2ZNIA 1Q5OA 2EIJC 4O2BA 4E72A 3E22A 3BMYA 2Y69B 3G80A 4I7ZB 4RQEA 1JFFA 2ARHA 3IAYA 4L8ZA 4JI5O 4FFKA 1HNZB 3ML0A 4ICGA 2Q5ZA 3RLQA 5DEDA 1A4HA 3M99B 1NJIW 3ZIAG 2YGAA 1KYOF 2FL4A 3FAVA 1K7DA 1E1QG 3I5DA 3R4OA 3H1JH 1VIBA 5B66Z 2AHZA 3G67A 2AZ0A 4PELA 4O4IB 2WPDG 2ATKC 3SPGA 4WF9V 3QDDA 4UFZA 4JF3A 2YXHA 4X9QA 1IVSA 3RGBA 1FAFA 4J10A 4MS2A 3FB6C 1SS3A 2IU0A 3H1IH 4DR5O 4W7TA 2ADPA 1NHIA 1BGYH 3CCMV 2VWJA 4LF5B 3PJSK 3SJBC 1LNQA 3WQ9A 2FYUH 5D7CA 1XILA 3ASOB 2YE3A 3RLPA 4B3RO 1H2LA 1UPGA 2WLKA 3ZHSA 4EFBA 4DV3B 1OV9A 2ZE7A 1I5BA 5KHJA 4F4LA 1G4YB 4DRXB 4H44B 4J41A 2EZPA 4XBFA 2EJ7A 2EIJB 1MZFA 3GVMA 4YJ3A 2C1IA 4IYIA 1AP6A 4IGGA 4WUCA 3B2EE 2YKBA 3UT5A 2BTQA 2IH1C 2Z0AA 4PV1B 4D6TH 2PTMA 2PYJA 2BZ5A 1UYIA 4YY3B 1TBWA 3FV5A 4Z2WA 1SKVA 1U97A 1SA0B 4TT3G 1NZ6A 2XHBA 4ASFA 1QBZA 4DV4O 2ZCEA 3J81N 4LCUC 4JPRA 1GN2A 2YECA 1EN6A 4Q20A 2WA4A 3ZBHA 3ZN1A 1XEQA 1WA8B 3AG7A 3ZN0A 4XC0A 3IC9A 4X1YA 2YKEA 2ZINA 3GB7C 5KLVH 1NTMH 1O9HA 1KKCA 1I5AA 1BZKA 3T1CA 3CB2A 4O4HA 2YE8A 2D2CB 5D5PA 3CYGA 1AI5A 2XJXA 4JI6B 1B04A 4YKYA 3K79A 5GONB 4FFBB 2PI5A 4LFCB 1BQ0A 2Q8FA 5LMNO 4ASGA 1GRJA 1SRYA 1P7BA 3MAQA 4UXNA 2UXBB 4BAEA 4GX1A 1Q3EA 4CWFA 1MSWD 4URLA 2EIMC 2ZD9A 2B1GA 4FCRA 1PPJH 2A9HA 2HEPA 5IYCO 4EB6B 3TXQA 4X65B 3RYHA 4KHPB 1ZTEA 2LFRA 3R4MA 3G6BA 4O2AB 4LF9O 3A0ZA 1R3LC 2Q73A 5JH7A 1NU1H 3E89A 4MPEA 3CCUV 3LDDA 1PVGA 3T2SA 1VQOV 1AP5A 2IM9A 5A9GA 3QF7A 5L3DA 2YI7A 3OMIB 4BXIA 1QVFU 3JARA 5KX5B 4DR1O 5LBQA 3G7EA 1LUVA 3ABTA 2RMKB 3FX7A 2EINB 5CA0B 4LP0A 4LF8O 4NYKA 1BKNA 3G75A 2XDKA 4KFGA 2DOSA 1GKFA 3K03A 3WU2Z 1IZ3A 2X6AA 2IH3C 4B08A 3ZHUA 3QO7A 3RFRA 3ZX6A 3TUHA 1DK1A 2BU6A 3L74H 2XDXA 2KKWA 3RYFA 4FM1A 2KQXA 1HWYA 2Y48A 3QVNA 2PNRA 2YEVA 4GX5A 1Y8PA 2YJWA 4CWTA 4HNAB 4L90A 4NH8A 3W7WA 2DYSC 3JALB 4GX0A 2BYHA 1NKDA 1YC3A 5CN0A 4DV3O 4H85A 4CC6A 2YK2A 4EKWA 1H7UA 3CRLA 4E2LA 2OTJV 1R3JC 4CS2A 4EGIA 4MP7A 1X4TA 1RP3B 4P9PA 3LDCA 4ZBMA 5H6QA 1AJPA 3CWVA 2WWWA 5GTIZ 4ZKIA 5LGUA 1I08A 2OTLV 4EFUA 1QHTA 2QDOA 5BZBA 2F4VO 4DK1A 1OCCB 4GGLA 3ZS8C 3K57A 4WBNA 1Q90D 5DM6V 2ZIOA 2XAFA 2QEXV 4HY6A 5CTXA 2HHIA 2X7RB 3H1LH 1XMOO 1F23A 5EIBD 2OIEA 3JD0A 4FPPA 1Z5WA 1N32O 1WB8A 4X1IB 2HJDA 4BW9A 4X64B 3UO2A 2WA3A 1PL4A 2MW2B 2XAQA 2IWUA 1Y67A 5IYDO 4KSHA 2ZM6B 3K58A 5JH7B 4D7SA 3T1HO 3AG3C 2ODMA 3QO8A 2CGNA 4FIPC 1GK9A 3QTCA 2JVDA 3ZMSA 3OTFA 3JASA 2W0FC 3ETQA 4DW0A 4AQYO 2YGEA 4ZI7B 3VQXA 3VHAA 1S5JA 5CPHA 5JENA 2OCCB 1IX9A 4JYAO 3HYYA 2IBZH 4E02A 1W0KG 4G2KA 3K5MA 4O2BB 1NHHA 4TSFG 4OX9B 2QWPB 1H38A 3OTOB 2K1EA 2YE7A 1KECA 5D7DA 5D7RA 2YIDA 2VWKA 3W7XA 4DV6O 2CAZC 1Q43A 4LFBO 4GEEA 2QSAA 3JD2A 4GKKB 5GW7A 2NLJC 1QZRA 3OW6A 1B3QA 4B6CA 1W0JG 3A0BZ 1GM7A 2NR5A 2KB1A 4JYCA 2YEAA 4KFMA 1KIJA 3BABA 1FXKA 1RFYA 2Y4TA 1KMIZ 4GKJO 5J2TB 2HVKC 3MHSC 3RYHB 2W6IG 2QTSA 4TQDA 2QF6A 4BW5A 1ROPA 1J5EB 3CRMA 1JJ2U 2CDYA 1KD1W 1VQKV 4DR5B 1YC1A 4R50A 2WAMA 2JGDB 2Q0OC 2CH7B 5CMUA 4JI4B 1GAXA 3BM9A 4P8OA 3ASOC 4GZRB 2BYIA 4X89A 2ZKJA 1LUWA 3KE6A 2R70A 3HKEA 5BOCA 3OE7G 2FKXA 5IE9A 2GTSA 3I56V 3JSLA 3U2DA 3VQWA 2CTQA 2XJGA 2WLIB 3SYOA 5TISZ 2N04A 4TUYB 3RW0A 5LOVA 3UM7A 1JVMA 2F43G 1K5QA 2JGDA 3APQA 3AG4C 3MD0A 5JJEB 4LFAO 4XKKA 5IT9N 2QJ1A 3LSUA 4UCRA 1E79G 4QPKA 3BA9A 2AHYA 4MW8A 5LYJB 4BIUA 4CZZA 2VQFB 4XKOA 2Q6AA 4ZI7A 4DUZO 3D2RA 3B09A 4K0KO 1H2KA 3A0HZ 2LGQA 1OCZB 2QM4A 1S5LZ 3DC6A 1YITV 1MABG 2GHYA 1US7A 1NTZH 3SGIA 1TC0A 5JQGB 1XMOB 4YIPA 2H55A 3GIGA 4PU9A 4XDMA 3F5TA 2H94A 3CRAA 4O4LA 1B6QA 3JAKA 1I5CA 2BU5A 2AGAA 3CD6V 2QWQB 3ABMB 1YJ9V 2LW1A 3JCUZ 4O4JA 2EILC 1PKXA 4JI7B 2DWEC 3EFFK 2O1UA 1XMQB 2GDSA 4FCQA 2QWOB 3G4SV 4NXMB 2JKIA 1HNWB 5CTYA 2JK5C 3CHXA 3RYFB 4JI6O 2BTZA 1VF6A 1PL0A 5FNVB 1GO3F 4GQTA 3VHCA 3UT5B 2FWYA 5CF0A 3TTZA 4I5SA 4UUJC 4P2ZA 3WB1A 2EIKC 2XT9A 4YHHO 1K92A 3W7UA 3HZ5A 3B25A 3BPZA 2CCUA 3JAKB 5IYZB 1GN6A 4I55A 4J7ZA 4BR6A 3QO5A 3H9VA 1T5EA 2YI9A 2ZXWC 4DV6B 1YVWA 4DR2O 5IJ0B 2UUAO 2QG0A 4FK5C 4XD8A 2OT5A 4ZIBA 3T10A 3QNEA 1VQ9V 2GBOA 3QTFA 4JI3B 3STZC 2XCMA 4H81A 4MSWC 1FYJA 3ZRWA 4W4KA 3RYIA 3TCUA 4JTCB 2G38A 3HKDA 3KZIZ 4JI0O 1I58A 1EA6A 3U10A 3SYCA 4NKGB 4NR1A 1L1FA 2L6LA 2BSKB 3LNUA 1AI4A 4RAIA 4XCJA 1SQGA 1M93A 2WEPA 3Q4HA 4PA7A 4ZHQB 1UY8A 4JAVA 4LWIA 4H13B 4RO2A 4TQFA 3JD4A 1GTOA 2YE6A 3MNRP 1UYGA 4ABMA 4DRXA 1XI1A 4OPHA 2XHTA 1E1RG 3CC2V 1TILA 3GIEA 4UCVA 1MU5A 4KQVA 4JGSA 1PNKA 1S3JA 3SPIA 5JVDB 2YEBA 2ZDYA 2ZQMA 3SYQA 5EZYB 2Q67A 4PL9A 3HKBB 4KTNA 2XAGA 2M7WA 5IDMA 2FYPA 2QM7A
chains in the Genus database with same CATH topology
2HR3A 5FWKA 1M56C 4X8AA 2BZ5A 1UYIA 2GFDA 4CWSA 1NBMG 3E35A 2IJKA 3ABUA 4RQFA 1TBWA 1ZW9A 3ABMC 3O2FA 4YKZA 4FJCC 2WLHA 4WFAV 2WI4A 3CC4V 3FV5A 1EZJA 3OWDA 1K4CC 3FT8A 4TT3G 1KP3A 2X6CA 5J9PC 3JD3A 3C11A 4P7AA 2WI3A 2BREA 4FMTA 4PDLA 4YKWA 1FXVA 2HVJC 3NMQA 3LSSA 2XHRA 4RUEA 4ASFA 3U67A 3ZKBA 3P30A 2IJJA 1QBZA 1W2BU 1EI1A 5B1NA 2DYSB 1QR8A 4MVOA 4GCZA 1COWG 4LCUC 1DF5A 3D36A 4JYBA 4JPRA 2YECA 1J95A 3OMNB 4QPJA 3BEHA 3K9AA 4L93A 4Q20A 3ZN1A 3R4NA 5IDJA 2GSMB 4PA3A 5IY5B 2O1VA 2ZDXA 3FT5A 4X9LA 3ZN0A 4XC0A 4YKUA 3ZMUA 2JEUA 2BSMA 3CPWU 1B62A 3LNMB 5M4HA 3ETEA 2YKEA 4OXSA 3GB7C 3ZCCA 2YKJA 2HLDG 1JPXA 4LC1A 5EBMC 2ZXWB 1JM6A 1I5AA 2BU7A 1BGQA 4MB9A 2CG9A 2CH4A 2XDSA 5HFMA 1WLEA 2WSSG 3B28A 1UY9A 2H8MA 3OM3B 2XX5A 3T1CA 3G7BA 3PEJA 4BAYA 3R92A 4AWOA 3E8HA 5B1BC 4WUDA 2YE8A 3VOUA 5M4MA 1Z59A 1R3IC 4UVAA 4KP4A 1RM1C 1AJ6A 1AI5A 4HYPA 4EGKA 5M4KA 2QM7A 2WERA 2XJXA 4LP8A 3B8NA 3LSQA 3OEHG 3OGCC 2YK9A 3ETDA 4GT1A 3K79A 4R3AA 2VWCA 4YKYA 1ZWIC 2PI5A 3VBBA 3F7YC 1M9NA 1UYLA 5D6PA 2Q8FA 4FCPA 2FTKA 4ASGA 3SPCA 1SRYA 1P7BA 3U2KA 1SZTA 4UXNA 1VQ5V 4H33A 4YXWG 5B3SB 1AH8A 4GX1A 4QE7A 4BAEA 1MSWD 4CWFA 1KKDA 3DGEA 4URLA 4QNHB 1UYKA 1M57B 1GM8A 1OCRB 2YE2A 4UVBA 5CA3A 4K4OA 3ZKDA 1S72V 1NR7A 1S14A 2EIMC 2ZD9A 2B1GA 4X88A 4FCRA 3ZXOA 4CE2A 4XTJA 3ZRXA 4DO2A 2A9HA 1NVPB 5IYCO 1YIJV 1Q82W 4MVMA 5H6RA 3ABKB 2LFRA 4BIZA 3R4MA 2IORA 3RLRA 4RUFA 3W7TA 1YC4A 3A0ZA 1OCZC 3EKOA 1R3LC 3LPSA 2JEXA 3Q5JA 2CGFA 3E89A 4MPEA 1Q7YW 3OR7C 3CCUV 4YKXA 3LDDA 4WCEV 1PVGA 1UYMA 2Q68A 1VQOV 3T2SA 2DYRC 2IU3A 2JJ2G 1TUEB 5L3DA 3CCVV 1Z5CA 3OMIB 2YI7A 4BXIA 4G28B 4MTXA 2W6JG 2XJJA 2YEDA 4I3HA 1F4NA 4MT8A 1QVFU 5IN9A 3HPLC 2YGFA 5F5RA 5LBQA 2YEHA 5DN6G 2IJHA 1QY8A 3AG2C 3G7EA 4O0BA 3ABTA 2EINB 4LP0A 4QJFB 4PA9A 1CP9A 1THNA 3CCEV 1UYCA 3A0TA 4WFBV 1NH2B 1BKNA 3CGYA 3IEDA 2HJFC 1QCEA 3B27A 1U0ZA 3G75A 4ASAA 2XDKA 2JJ1G 2YE4A 4KFGA 2HCHA 3OEEG 2XAJA 1GKFA 2IWSA 5EK0A 2DQ3A 3K03A 4DXWA 3B8MA 3H01A 4H37A 2X6AA 2IH3C 4O04A 3QO7A 2B1IA 2HKJA 1AMWA 1FXKB 4HZ3A 1V55C 1AM1A 3TUHA 1GJVA 2BU6A 4P9OA 4XKAA 2CCTA 4EGHA 2ITCC 2XDXA 1QLEC 1HWYA 4MPCA 2BU8A 2V1DA 2Y48A 4URNA 3DTUB 2PNRA 2YEVA 4QE9A 4GX5A 5FNDA 2ITDC 1Y8PA 2YJWA 4V26A 1F51A 4CWTA 4L90A 2CK3G 3D3IA 4NH8A 3W7WA 2DYSC 4GX0A 1JOYA 3STLC 2BYHA 2Q8HA 3ABLC 4MW3A 5B1AB 4V25A 3TETA 1NKDA 2OCCC 3IGAC 5CN0A 5B1OA 3CC7V 3CXCU 2WLLA 1YC3A 2XNDG 1Y4SA 2X0LA 3O0IA 3T1KA 3TZ5A 2Z3YA 5B3SC 1YJWV 2DYRB 4H85A 1GKZA 3OUFA 4PDVA 2WI5A 5EC1C 3WG7B 2YK2A 4EKWA 1H7UA 1Z5BA 2YJXA 4WFFA 3CRLA 1M57C 4E2LA 3CCRV 4HZ5A 2OTJV 3SYAA 2UXNA 4R8CA 1R3JC 1UJWB 4EGIA 4MP7A 2IOPA 3SJQC 2Q8IA 4P9PA 4EMVA 1MG1A 1MOFA 3LDCA 1Y4UA 4ZBMA 2IW5A 1AJPA 5H6QA 2JJCA 3CMEV 2WI7A 2WWWA 3CWVA 1P4RA 4ZKIA 5LGUA 2GQPA 4YKRA 5M4PA 2OTLV 4LWGA 1K33A 4EFUA 1Y66A 2R9IA 1AI7A 1SETA 5BZBA 1VQLV 1OCCB 2R9RB 1OZ0A 1KZNA 4GGLA 1YSCA 1S0VA 2DWDC 3P32A 5GGZA 1RPRA 1ZXNA 4PRXA 5DM6V 1YSZA 3EHBB 2XAFA 3F7VC 2QEXV 4HY6A 5CTXA 5LGTA 3SYPA 5J71A 1JQ0A 3AEIA 4BQGA 3ZMTA 1H8HG 2X7RB 3KG2A 2ZR2A 1F23A 2HKOA 3EHFA 4QIWF 5C93A 4L94A 4MP2A 5F3KA 4B7PA 1ENVA 2MK3A 3K04A 3JD0A 3JD1A 4FPPA 1NVPD 1TH8A 1YSRA 3JZ3A 1DF4A 1UYEA 1K8AW 5L3EA 2CCSA 4UROA 3G71V 4HZ0A 2LP7A 2YEGA 4UVCA 1VQPV 1QLNA 1QYEA 2YEJA 1I5DA 1I5XA 2Y69C 1H2GA 1OCRC 2XAQA 3E83A 3AG3B 5IYDO 2QA4V 3ABKC 2IWUA 2XDLA 1FFTB 2XDUA 4KSHA 1KC8W 4GFNA 4XIQA 3E8BA 3OPDA 4R1FA 3OMAB 3ZJZA 4KQVA 3AG3C 5FNFA 5BODA 2QFOA 4WFHA 3TZ4A 3INXA 4R7CA 1YT1A 1M90W 3QO8A 4FIPC 2FXSA 4Z1MG 1S76D 2NNUA 3AG1C 3ZMZA 1GK9A 4UV8A 2YEIA 3TZ2A 4MTOA 1K5SA 4DZYA 2EXLA 1R3KC 4TWKA 4I9WA 1K73W 1R73A 3ZMSA 1WPXA 4PA4A 2YSUB 2XOKG 5IYBO 2W0FC 4YKTA 2YGEA 1VQMV 4MVRA 2HG5C 2ESAA 3VHAA 5CPHA 2Z5UA 2OCCB 3FB8C 3HYYA 3OAAG 2D3OW 4HYMA 4E02A 1W0KG 5EC2C 4G2KA 2WLIA 3CP1A 3K06A 2XK2A 1NHHA 3ZRVA 3HB3B 4HYOA 4TSFG 3T4ZA 1ZXMA 4XIPA 3E8FA 2K5BA 1H38A 2K1EA 2XASA 1KECA 3GWOA 2YE7A 5D7RA 1OHHG 3W7XA 5D7DA 1BXDA 3EHHA 3A0YA 1FXKC 2UXXA 1RPOA 1I59A 1UYFA 4GEEA 1S16A 3JD2A 4O09A 2EILB 5GW7A 3CMAV 1MX0A 2NLJC 2VCJA 4XDJA 1VQ8V 1QZRA 3OMUA 3X2QB 2WEQA 1UY7A 1R6NA 3OW6A 5LHHA 2BOCC 1AH6A 3R65A 1B3QA 4GT8A 5FL7G 5KUKA 1Q86W 4MBCA 4B6CA 5M4EA 3K08A 4HAMA 1W0JG 1GM7A 3BY6A 5B1AC 5CBGA 5L3FA 2YI6A 3K0DA 4CWPA 2KB1A 3JCZA 4JYCA 4MVSA 3E2EA 1GM9A 3CCQV 1Q81W 2YEAA 4KFMA 3UKMA 3FYEB 3VADA 1KIJA 1YJNV 1FXKA 5L3CA 1K97A 2HFEC 3AG4B 2E0AA 5M4NA 4KUMA 4MTGA 3VHDA 3K60A 2HVKC 3MHSC 2VCIA 3D0BA 2W6IG 1S5HC 2QF6A 2Q69A 4PDMA 5LHIA 5KA5A 4BW5A 1ROPA 1VQ4V 2YKIA 3K99A 3LUTB 2AKPA 1EFRG 1JJ2U 1KD1W 3INWA 1VQKV 3B24A 3CYOA 5CBFA 1QR9A 1YC1A 4R50A 3JYCA 2WAMA 4LWHA 4JTAB 2YE5A 1V54B 3K3WA 5L3BA 5CMUA 2WI6A 3EKRA 2DW4A 3IC7A 2Q2EB 3BM9A 3ASNC 3ASOC 4HY1A 5LHGA 4P8OA 1AR1B 4E00A 4N23A 4X89A 1V54C 2BYIA 1QLEB 1YHQV 2ZKJA 3A0XA 1VQ6V 3GIFA 3H4LA 1OCCC 1ORQC 2H8PC 4ASUG 2UWDA 3H80A 2Q8GA 4XCLA 4CE1A 5BOCA 3SL2A 4E01A 1Y8OA 2YEEA 2P7TC 2QE7G 3OE7G 2BT0A 3KE6A 3SPHA 3CCJV 2WLNA 1BL8A 4JTDB 3I56V 1UYHA 3U2DA 2ZR3A 3K98A 1NHJA 5EBWC 1UYDA 4URMA 2XJGA 2WLIB 3SYOA 3RW0A 4WFEA 1VQNV 3UM7A 1JX9A 1JVMA 4AS9A 2EZOA 2F43G 3HZ1A 5CTWA 4BQJA 1K5QA 1Y4MA 3EHJA 1ID0A 3FYIB 1BMFG 2BU2A 1PNLA 4J9YB 1NR1A 3HYZA 3AG4C 3MD0A 3ETGA 2P67A 2WI1A 1YS3A 4EEHA 1OSFA 2EBOA 4XKKA 3G6EV 4WFGA 1YT2A 4O07A 2QKSA 2P90A 1NH2D 1TC6A 1E79G 4QPKA 1KP2A 3A0WA 2BOBC 1VQ7V 3FB5C 3OW2U 2AHYA 4MW8A 4MVUA 2V7QG 3X2QC 1BHAA 1NQTA 1YERA 4AWQA 2FWZA 4BIUA 4L91A 3HHUA 4CZZA 5J6AA 3E8GA 3Q5KA 4XKOA 2Q6AA 4CWRA 3D2RA 2ZBKB 1OCZB 4GX2A 2DQ0A 3TK1A 4LBEC 1YITV 2IOQA 1MABG 4U93A 4DUHA 3T0ZA 2GHYA 2WI2A 5B1BB 1N8RW 1US7A 1XL4A 4JQLA 2C2AA 1RM1B 3PEHA 1SESA 2YEFA 1K4DC 5HFLA 3ZRWB 3ZM7A 1PNMA 2EJRA 1TC0A 2WLMA 3AG2B 2H55A 3GIGA 4PU9A 2YI5A 4XDLA 3R4PA 2H94A 4XDMA 1F4MA 1PD3A 3RVYA 3E86A 1YI2V 4NH9A 4EFTA 4N21A 1B6QA 1M56B 3FB7C 1V55B 2IWXA 1I5CA 2BU5A 1R6KA 3SPJA 2XD6A 2QTOA 4CE3A 1CEZA 4HXZA 2XAHA 1Y8NA 1UY6A 1QVGU 2LFSA 3CD6V 2P6JA 4MPNA 1BYQA 2XABA 2YEVB 2QM8A 3ABMB 4HXWA 3ZRSA 1YJ9V 3K0GA 5CBHA 4O05A 1K34A 2EILC 1PKXA 3OUSA 4G27B 4XDKA 2BRCA 4LWEA 2DWEC 3EFFK 1DLBA 5H9CA 3K97A 2O1UA 1OCOC 4CBCA 4YKQA 4KSGA 3ABLB 5EBLC 2WLLB 4FCQA 5KUMA 4XITA 4LPBA 5E1AC 3G4SV 3T0HA 4JASA 2JKIA 5CTYA 4LWFA 1AI6A 1OCOB 2JK5C 1AJNA 4CWQA 2BTZA 4R6ZA 3RBZA 4U7NA 1PL0A 5CTUA 2EIJC 4ZVIA 4JAUA 1TIDA 2VW5A 2HG1A 1GO3F 3BMYA 4GQTA 1I5YA 2Y69B 1GKXA 1H8EG 3VHCA 1EBOA 4RQEA 1AJQA 4MVQA 2FWYA 5CF0A 3TTZA 4I5SA 3RKZA 4UUJC 4P2ZA 5L3GA 4L8ZA 2EIKC 3WG7C 1YTFD 4XE2A 5IY5C 1K92A 3W7UA 3MHHC 3ML0A 3B25A 3GIGB 3HZ5A 3O6OA 3RLQA 2CCUA 1SERA 3AG1B 1A4HA 3W7SA 3A0RA 3M99B 1YETA 4ASBA 3NXSA 1R62A 1U2OA 2B5UA 3QO5A 1FS0G 1NJIW 3ZIAG 2YGAA 2ZXWC 5FNCA 1K7DA 1E1QG 3R4OA 1XL6A 2QG0A 4FK5C 3ZXQA 4PRVA 2AHZA 4XD8A 2OT5A 1S77D 3TZ0A 5L3JA 4PELA 2JDIG 4MVZA 3C0EA 3QNEA 3T10A 2WPDG 1IXMA 2ZDIC 1VQ9V 3OR6C 2ATKC 3SPGA 1THZA 3STZC 4WF9V 1B63A 1YT0A 4JF3A 2XCMA 2XHXA 3QDDA 4H81A 2X6BA 4MSWC 3ZRWA 4MS2A 1Z5AA 3FKSG 3R91A 1BHBA 3TCUA 3FB6C 4JTCB 2IU0A 1L0OA 3WFVA 1I58A 4L87A 3CCSV 1EA6A 2EIMB 3CRKA 2JIZG 3SYCA 2A79B 4W7TA 1NHIA 1L1FA 3CCMV 4UV9A 4H7QA 4WUBA 2O1WA 3Q5LA 5LGNA 1CPYA 2XX2A 3PJSK 3ZMVA 5D6QA 3LNUA 1AI4A 1JCHA 1DTOA 2YE9A 1YTFB 3CGZA 4MTFA 4CWNA 4RAIA 1LNQA 4XCJA 3WQ9A 4MOTA 5D7CA 3T4DA 3ASNB 3ASOB 1K3EA 2EIKB 2WEPA 4PA7A 2YE3A 3RLPA 4CWOA 2QG2A 1UY8A 3OWBA 4JAVA 1YESA 1G8MA 2WLKA 1ZWHA 3WHAA 4LWIA 4RO2A 3JD4A 3T2MA 2PI4A 1GTOA 3I55V 1I5BA 2YE6A 3MNRP 1UYGA 2IJIA 4F4LA 3OFNG 1G4YB 2XHTA 3EHGA 1AROP 1E1RG 3F5WC 3CC2V 1H7SA 1TILA 1MU5A 4P30A 4PA6A 3CCLV 3GIEA 2EZPA 3HEKA 4JGSA 4XBFA 2WLJA 1PNKA 2EIJB 2A0LA 4NH7A 3IFXA 3QTFA 1S3JA 3SPIA 2ZDIA 4U7OA 5KA6A 4PDRA 2YEBA 3LDEA 1FXHA 2ZQMA 3SYQA 2YI0A 1GMGA 2ZDYA 3B26A 2Q67A 1KQSU 2XX4A 4PL9A 2EINC 4R3MA 4J9ZB 4XIRA 1M1KW 4KTNA 2XAGA 3RVZA 2M7WA 1K9MW 5IDMA 2FYPA 4WUCA 2YKCA 2YKBA 2IH1C 4AWPA 3B77A 4EM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FWK A;  2BZ5 A;  1UYI A;  2GFD A;  4CWS A;  4YKZ A;  5M4K A;  1TBW A;  1ZW9 A;  3O2F A;  3FV5 A;  2WI4 A;  3OWD A;  3FT8 A;  4P7A A;  3C11 A;  2WI3 A;  2BRE A;  4FMT A;  4YKW A;  3NMQ A;  2XHR A;  4ASF A;  3U67 A;  3ZKB A;  1EI1 A;  5B1N A;  4GCZ A;  3D36 A;  4JYB A;  2YEC A;  4QPJ A;  4L93 A;  4Q20 A;  3R4N A;  5IDJ A;  2ZDX A;  2O1V A;  3FT5 A;  4X9L A;  4XC0 A;  4YKU A;  2BSM A;  1B62 A;  5M4H A;  2YKE A;  3ZCC A;  2YKJ A;  4LC1 A;  1JM6 A;  2BU7 A;  1I5A A;  1BGQ A;  4MB9 A;  2CG9 A;  2CH4 A;  2XDS A;  3B28 A;  1UY9 A;  2H8M A;  2XX5 A;  3G7B A;  3PEJ A;  3R92 A;  4AWO A;  4WUD A;  2YE8 A;  5M4M A;  1Z59 A;  1AJ6 A;  4KP4 A;  4EGK A;  4HYP A;  2WER A;  2XJX A;  2YK9 A;  4GT1 A;  4R3A A;  4YKY A;  2VWC A;  1UYL A;  5D6P A;  2Q8F A;  4FCP A;  2FTK A;  4ASG A;  3U2K A;  4BAE A;  1AH8 A;  4CWF A;  4URL A;  3DGE A;  1UYK A;  2YE2 A;  4K4O A;  1S14 A;  4FCR A;  3ZXO A;  4CE2 A;  4XTJ A;  3ZRX A;  2LFR A;  4BIZ A;  3R4M A;  2IOR A;  3RLR A;  1YC4 A;  3A0Z A;  3EKO A;  3LPS A;  3Q5J A;  2CGF A;  4MPE A;  1PVG A;  1UYM A;  3T2S A;  2YI7 A;  1Z5C A;  4BXI A;  2XJJ A;  4MTX A;  2YED A;  4I3H A;  4MT8 A;  5IN9 A;  2YGF A;  5F5R A;  2YEH A;  1QY8 A;  3G7E A;  4O0B A;  4LP0 A;  1THN A;  1UYC A;  3A0T A;  1BKN A;  3IED A;  3CGY A;  4ASA A;  3B27 A;  1U0Z A;  3G75 A;  2XDK A;  2YE4 A;  4KFG A;  2HCH A;  2IWS A;  4O04 A;  2HKJ A;  1AMW A;  3TUH A;  1AM1 A;  1GJV A;  2BU6 A;  4XKA A;  2CCT A;  4EGH A;  2XDX A;  4MPC A;  2BU8 A;  4URN A;  2PNR A;  5FND A;  1Y8P A;  4V26 A;  2YJW A;  4CWT A;  1F51 A;  4L90 A;  4NH8 A;  1JOY A;  2BYH A;  2Q8H A;  3ZKD A;  1YC3 A;  5B1O A;  3K98 A;  3O0I A;  3T1K A;  1Y4S A;  3TZ5 A;  4H85 A;  1GKZ A;  2WI5 A;  2YK2 A;  1H7U A;  1Z5B A;  2YJX A;  4HZ5 A;  3TZ0 A;  3CRL A;  4EFT A;  4EGI A;  4MP7 A;  2IOP A;  2Q8I A;  4EMV A;  1Y4U A;  2WI7 A;  2JJC A;  3CWV A;  2WWW A;  4ZKI A;  2GQP A;  4YKR A;  5M4P A;  4LWG A;  4EFU A;  1KZN A;  4GGL A;  3P32 A;  5GGZ A;  1ZXN A;  4PRX A;  1YSZ A;  4HY6 A;  5CTX A;  5J71 A;  4BQG A;  3EHF A;  4L94 A;  5C93 A;  4MP2 A;  5F3K A;  4B7P A;  4FPP A;  1TH8 A;  1YSR A;  3JZ3 A;  1UYE A;  2CCS A;  4HZ0 A;  2YEG A;  1QYE A;  2YEJ A;  1I5D A;  2XDL A;  2IWU A;  2XDU A;  4KSH A;  4XIQ A;  4GFN A;  3OPD A;  4R1F A;  5FNF A;  5BOD A;  2QFO A;  3TZ4 A;  3INX A;  1YT1 A;  2FXS A;  3TZ2 A;  4DZY A;  2YEI A;  2EXL A;  4YKT A;  2YGE A;  2ESA A;  3VHA A;  5CPH A;  3HYY A;  4HYM A;  4E02 A;  2XK2 A;  1NHH A;  3ZRV A;  4XIP A;  1ZXM A;  2K5B A;  2YE7 A;  1BXD A;  5D7D A;  5D7R A;  3EHH A;  3A0Y A;  1I59 A;  1UYF A;  4GEE A;  1S16 A;  4O09 A;  1MX0 A;  2VCJ A;  1QZR A;  3OMU A;  2WEQ A;  1UY7 A;  3OW6 A;  1AH6 A;  1B3Q A;  4GT8 A;  4MBC A;  4B6C A;  5M4E A;  2YI6 A;  4CWP A;  4JYC A;  2YEA A;  3VAD A;  1KIJ A;  2E0A A;  5M4N A;  3VHD A;  3K60 A;  3D0B A;  2VCI A;  4YKX A;  2QF6 A;  2YKI A;  3K99 A;  2AKP A;  3INW A;  3B24 A;  1YC1 A;  4LWH A;  2YE5 A;  2WI6 A;  3EKR A;  2Q2E B;  4HY1 A;  3BM9 A;  4P8O A;  4V25 A;  4E00 A;  2BYI A;  2ZKJ A;  4URO A;  3KE6 A;  3H4L A;  3A0X A;  3H80 A;  3GIF A;  2UWD A;  2Q8G A;  4XCL A;  4CE1 A;  5BOC A;  3SL2 A;  4E01 A;  1Y8O A;  2YEE A;  2BT0 A;  1UYH A;  3U2D A;  1NHJ A;  1UYD A;  4URM A;  2XJG A;  4AS9 A;  3HZ1 A;  5CTW A;  4BQJ A;  3EHJ A;  1ID0 A;  2BU2 A;  3HYZ A;  3MD0 A;  2WI1 A;  2P67 A;  1YS3 A;  4EEH A;  1OSF A;  4XKK A;  4O07 A;  1YT2 A;  1TC6 A;  4QPK A;  3A0W A;  4AWQ A;  1YER A;  2FWZ A;  4BIU A;  4L91 A;  3HHU A;  5J6A A;  3Q5K A;  4XKO A;  4CWR A;  3D2R A;  2ZBK B;  3TK1 A;  2IOQ A;  4U93 A;  4DUH A;  3T0Z A;  2WI2 A;  1US7 A;  4JQL A;  2C2A A;  3PEH A;  2YEF A;  3ZRW B;  3ZM7 A;  1TC0 A;  2H55 A;  3GIG A;  4PU9 A;  2YI5 A;  4XDM A;  3R4P A;  4NH9 A;  2IWX A;  1I5C A;  2XD6 A;  2BU5 A;  4CE3 A;  4HXZ A;  1Y8N A;  1UY6 A;  2LFS A;  4MPN A;  1BYQ A;  2XAB A;  2QM8 A;  4HXW A;  4O05 A;  4LWE A;  2BRC A;  3K97 A;  2O1U A;  4YKQ A;  4KSG A;  4FCQ A;  4XIT A;  3T0H A;  4LPB A;  4JAS A;  2JKI A;  5CTY A;  4LWF A;  4CWQ A;  2BTZ A;  4U7N A;  5CTU A;  4ZVI A;  4JAU A;  1TID A;  2VW5 A;  2HG1 A;  3BMY A;  4GQT A;  1GKX A;  3VHC A;  2FWY A;  5CF0 A;  3TTZ A;  4I5S A;  3RKZ A;  4L8Z A;  4XE2 A;  3GIG B;  3HZ5 A;  3B25 A;  3RLQ A;  3O6O A;  2CCU A;  1A4H A;  3A0R A;  1YET A;  4ASB A;  3NXS A;  1R62 A;  1U2O A;  2YGA A;  5FNC A;  3R4O A;  2QG0 A;  3ZXQ A;  4PRV A;  4XD8 A;  5L3J A;  3T10 A;  3C0E A;  1IXM A;  3QTF A;  1B63 A;  2XCM A;  3QDD A;  1YT0 A;  2XHX A;  4H81 A;  3ZRW A;  3R91 A;  1Z5A A;  1L0O A;  1I58 A;  1EA6 A;  3CRK A;  4W7T A;  1NHI A;  4WUB A;  4H7Q A;  2O1W A;  3Q5L A;  2XX2 A;  5D6Q A;  3LNU A;  2YE9 A;  3CGZ A;  4CWN A;  4XCJ A;  3WQ9 A;  4MOT A;  5D7C A;  2WEP A;  2YE3 A;  3RLP A;  4CWO A;  2QG2 A;  1UY8 A;  3OWB A;  4JAV A;  1YES A;  1ZWH A;  3WHA A;  4LWI A;  1I5B A;  2YE6 A;  3MNR P;  1UYG A;  3EHG A;  2XHT A;  1TIL A;  3GIE A;  1H7S A;  3HEK A;  1MU5 A;  4XIR A;  4KQV A;  4NH7 A;  2YEB A;  4U7O A;  2ZDY A;  2YI0 A;  3B26 A;  2XX4 A;  4PL9 A;  4R3M A;  4KTN A;  5IDM A;  2FYP A;  4WUC A;  2YKC A;  2YKB A;  4AWP A;  2QM7 A;  4EM7 A; 
#chains in the Genus database with same CATH topology
 2BSK A;  5FWK A;  1M56 C;  4DV5 O;  4UB6 Z;  4DR7 B;  1RSO A;  4YKZ A;  4EB6 A;  1ZW9 A;  4J7J A;  2WLH A;  2LGW A;  2F4V B;  2WI4 A;  1K4C C;  2BRE A;  4PDL A;  3K5L A;  1FXV A;  1D2D A;  3NMQ A;  4JI8 B;  4RUE A;  2VQF O;  4H0L B;  4CH3 A;  4K35 A;  2XUM A;  4GCZ A;  4DV7 O;  4QPJ A;  3BEH A;  4LWS B;  4L93 A;  5JVD A;  1YEW A;  2GSM B;  4PA3 A;  1N36 O;  4IL6 Z;  1N4C A;  2JEU A;  3ZMU A;  3LNM B;  3ICX A;  3ETE A;  5IJ0 A;  3ZCC A;  2HLD G;  4LC1 A;  2ZXW B;  1BGQ A;  4MB9 A;  4I4T A;  5KMG A;  5HFM A;  2WSS G;  3G7B A;  3OM3 B;  2XX5 A;  3PEJ A;  3R92 A;  3CWB H;  2UUB O;  4AWO A;  3E8H A;  5B1B C;  5D5Q A;  3UO3 A;  3VOU A;  1Z59 A;  4UVA A;  3GWK C;  5B5E Z;  1N34 B;  3LSQ A;  1Y6X A;  3LMM A;  4K8Z A;  4HBN A;  1M9N A;  5D6P A;  5IWA O;  4FCP A;  4AQY B;  3SPC A;  4UCS A;  1VQ5 V;  5B3S B;  4QE7 A;  1DGS A;  2GV9 A;  3DGE A;  4F6R A;  4QNH B;  1GM8 A;  1MSD A;  5H5N A;  2YE2 A;  4UVB A;  1AIL A;  4X88 A;  4GKJ B;  3ZXO A;  4XTJ A;  3ZRX A;  4TV8 B;  4DO2 A;  1IXB A;  5H6R A;  4BIZ A;  4CC5 A;  1I7F A;  4RUF A;  4B7K A;  3JSN A;  5CA1 B;  3OR7 C;  3SR2 C;  1UYM A;  2IU3 A;  2YIC A;  1Z5C A;  5BMV A;  4JAA A;  2ETN A;  2IJH A;  1QY8 A;  1XHX A;  4IHJ A;  3VQV A;  2DJV A;  2Q7E A;  1THN A;  4PA9 A;  1CP9 A;  4U3J A;  3CCE V;  4IT5 A;  1UYC A;  2FML A;  2H3O A;  4YIO A;  2M6Y A;  4F6R B;  2YE4 A;  3OEE G;  2P5O A;  4H37 A;  2E5L O;  3H1H H;  2HKJ A;  1HNX B;  1GJV A;  2ITC C;  1QLE C;  4D7T A;  3U11 A;  2V1D A;  3DTU B;  2OIG A;  4KL1 A;  1F51 A;  2CK3 G;  3D3I A;  1JOY A;  5B1A B;  4DUZ B;  2ZE8 A;  3IGA C;  3K98 A;  1IBM B;  2Q9L A;  3CXC U;  1Z5V A;  1Y4S A;  3KKY A;  5B3S C;  4CS4 A;  3WG7 B;  2CTW A;  3TJT A;  4WFF A;  1M57 C;  5LOV B;  3S3X A;  4ZHQ A;  1AVM A;  2F95 B;  2UXC O;  2JJC A;  4JI5 B;  4YKR A;  1HNW O;  5M4P A;  4LWG A;  1HNZ O;  1SET A;  4NTX A;  4DW1 A;  1KZN A;  5KX5 A;  2EX3 A;  3P32 A;  5GGZ A;  5CA0 A;  1WA8 A;  3EHB B;  5J2U B;  3F7V C;  2YIB D;  5LGT A;  3CE2 A;  2LJ2 A;  1IUR A;  1EN4 A;  3CEI A;  5C93 A;  5JCO A;  5F3K A;  4DUY B;  4B7P A;  1OJH A;  3K04 A;  3WB2 A;  3JD1 A;  4NXM O;  1YSR A;  3D36 C;  4PI0 A;  1UYE A;  1K8A W;  5J2T A;  2CCS A;  3G71 V;  4HZ0 A;  5A2Q N;  1TA8 A;  4UVC A;  3AG3 B;  4XIQ A;  5CA1 A;  1HR0 B;  3E8B A;  3OPD A;  1GN4 A;  1R6T A;  4JI3 O;  4R1F A;  1P49 A;  3RN4 A;  2Y4U A;  5LXT A;  4RWU A;  3AK1 A;  3TZ4 A;  1M90 W;  4KHP O;  3IJ4 A;  4Z1M G;  3TZ2 A;  3ZMZ A;  2YEI A;  2GTA A;  4MTO A;  4FLX A;  1EM1 A;  3Q4H B;  1QU7 A;  1VQM V;  2HG5 C;  1IDS A;  3OAA G;  2D3O W;  4HYM A;  5EC2 C;  2XK2 A;  2WLI A;  3ZRV A;  3HB3 B;  3T4Z A;  4XIP A;  1BS3 A;  3E8F A;  2AXT Z;  1HDJ A;  3EHH A;  1FXK C;  4LF5 O;  1UYF A;  4X1Y B;  4FLT A;  2VCJ A;  1VQ8 V;  2CTR A;  2WEQ A;  1VMG A;  3R65 A;  4GT8 A;  2JS3 A;  5FL7 G;  3CX5 F;  5M4E A;  4KXR A;  4HAM A;  4X1I A;  1XBL A;  1EN5 A;  3BY6 A;  2DMX A;  5B1A C;  5L3F A;  2QR4 A;  4B3M B;  3JCZ A;  1Q81 W;  1K97 A;  2HFE C;  2VRZ A;  3K59 A;  3R66 A;  3K60 A;  3D0B A;  4YKX A;  2Q69 A;  4PDM A;  3K99 A;  5ITZ A;  1G6U A;  2AKP A;  3B24 A;  3WB0 A;  4JTA B;  2YE5 A;  3K3W A;  3EKR A;  4YY3 O;  3IC7 A;  2Q2E B;  4HY1 A;  4URO A;  5FLX N;  1OCC C;  1ORQ C;  4ASU G;  1WAZ A;  2HP8 A;  4DV5 B;  3SL2 A;  2YEE A;  4B7E A;  3CCJ V;  2WLN A;  4JTD B;  2L35 A;  2ZR3 A;  1NHJ A;  1VAR A;  5EBW C;  4URM A;  4Z1V A;  1MZE A;  1WN7 A;  1VQN V;  1JX9 A;  4AS9 A;  2EZO A;  3HZ1 A;  3EHJ A;  1Y4M A;  5KHK A;  3FYI B;  1BMF G;  1Q6U A;  4B3T O;  3C90 A;  4J9Y B;  2NN4 A;  1YCI A;  2Y0I A;  3ETG A;  4CH6 A;  1OSF A;  2EBO A;  1WPB A;  2PZS A;  2QKS A;  5KHI A;  1NH2 D;  2BOB C;  1VQ7 V;  2YIA A;  4FLU A;  4MVU A;  2V7Q G;  3X2Q C;  1BHA A;  3ZHT A;  1IBK O;  2FWZ A;  5J6A A;  3E8G A;  1X59 A;  4CWR A;  2ZE5 A;  1R1B A;  4GX2 A;  2DQ0 A;  2F1M A;  2AZ2 A;  4DUH A;  2UUB B;  3T0Z A;  2PYL A;  1WP8 A;  1Q8I A;  1XRE A;  2DN9 A;  1XL4 A;  1P84 F;  2RNB A;  1RM1 B;  1SES A;  3ZRW B;  5BMV B;  1PNM A;  3O9O A;  2YI5 A;  3L71 H;  1PD3 A;  3RVY A;  3E86 A;  3N2K A;  3FFQ A;  4N21 A;  1M56 B;  2UUC O;  2XD6 A;  4CE3 A;  1Y8N A;  1UY6 A;  5LMU B;  2XTA A;  3ZRS A;  2QWN B;  3K0G A;  4G27 B;  3OUS A;  2YDE A;  2BRC A;  1PV0 A;  1DLB A;  4TUY A;  5H9C A;  2QKA A;  3LNN A;  3ABL B;  1FD9 A;  5EBL C;  2WLL B;  1I0H A;  4U3F H;  5KUM A;  3RWR D;  4DR3 B;  4FM2 A;  4LPB A;  4XIT A;  4LWF A;  1AI6 A;  1AJN A;  4CWQ A;  4R6Z A;  3RBZ A;  4ZVI A;  3CXH F;  4JAU A;  2VW5 A;  1US6 A;  2B9Z A;  1H8E G;  3NR7 A;  5IJ9 A;  3RKZ A;  5L3G A;  1YTF D;  5IY5 C;  3MHH C;  3A0R A;  3JAW A;  1YET A;  4ASB A;  2YUA A;  1U2O A;  2B5U A;  1FS0 G;  5BR8 B;  1I94 B;  4JI2 B;  1FJG B;  3L70 H;  1XL6 A;  1IBL O;  4PJ0 Z;  4UCO A;  3RT3 C;  1S77 D;  5L3J A;  1MNG A;  2RQ6 A;  3N2G A;  1IXM A;  1B63 A;  3TXS A;  1THZ A;  4CH5 A;  1YT0 A;  3T1Y B;  3R91 A;  3FKS G;  1L0O A;  4L87 A;  1N32 B;  4WUB A;  4UV9 A;  4H7Q A;  2O1W A;  3Q5L A;  5LGN A;  1CPY A;  4LF7 O;  2XX2 A;  1ZUQ A;  5D6Q A;  1JCH A;  1DTO A;  2YE9 A;  1YTF B;  5LL6 Y;  4MOT A;  3T4D A;  1ZL8 B;  3ASN B;  1CXZ B;  1K3E A;  4CWO A;  2QG2 A;  4YJ3 B;  3OWB A;  1G8M A;  1ZWH A;  2GUZ A;  3T2M A;  5CB4 A;  2Y0P A;  5LP6 A;  3F5W C;  4GUN A;  5JJJ B;  1H7S A;  4P30 A;  4PA6 A;  3P3P A;  2WLJ A;  4NH7 A;  2A0L A;  1NI8 A;  3IFX A;  1N0N A;  4J11 A;  5LYJ A;  1FXH A;  1GMG A;  1FFX A;  4W4L A;  1KQS U;  4TV8 A;  2EIN C;  4DUY O;  4J9Z B;  2N05 A;  3RVZ A;  4DV0 B;  2YKC A;  4OX9 O;  4AWP A;  2HR3 A;  4X8A A;  4X65 O;  4B3T B;  2GFD A;  3HKC B;  4CWS A;  1SZX A;  1YXB A;  3E35 A;  5M4K A;  3ABM C;  2QGN A;  3CSX A;  4WFA V;  3CC4 V;  3RYI B;  3OWD A;  5KHH A;  3FT8 A;  5J9P C;  1KP3 A;  2X6C A;  4FFB A;  4TV9 A;  4P7A A;  4NTY A;  4O4L B;  4UCU A;  4YKW A;  2HVJ C;  4IHJ B;  2XHR A;  3SDL A;  1HP8 A;  3ZKB A;  2IJJ A;  1EI1 A;  5B1N A;  4AIL C;  2DYS B;  4UCT A;  2PGG A;  4MVO A;  1DF5 A;  4JYB A;  3SJA C;  1J95 A;  3OMN B;  3OGI B;  5C8Y A;  1L8D A;  5IY5 B;  1JFF B;  2ZDX A;  4I50 A;  2O1V A;  3FT5 A;  4I0X B;  4YKU A;  3HKC A;  4OPA A;  2BSM A;  5JQG A;  3AK2 A;  5M4H A;  1QQC A;  3N27 A;  5EBM C;  1JPX A;  1SF9 A;  3KCX A;  2CG9 A;  2CH4 A;  2XDS A;  4YHH B;  3B28 A;  1UY9 A;  2H8M A;  1JMK C;  1ZLZ A;  3K5N A;  1O9G A;  4WUD A;  2P4K A;  5M4M A;  1R3I C;  1AJ6 A;  4KP4 A;  5AG2 A;  5LMU O;  4EGK A;  4DYL A;  3BHP A;  5E79 Z;  3CRQ A;  3OEH G;  2YK9 A;  3ETD A;  4GT1 A;  4R3A A;  2VWC A;  3VBB A;  3F7Y C;  2N74 A;  1UYL A;  2FTK A;  4E4E A;  1SZT A;  1N0J A;  4YXW G;  1AH8 A;  1UYK A;  1OCR B;  1S72 V;  2PY5 A;  1S14 A;  4I50 B;  4GLX A;  2LQT A;  4CE2 A;  4YJ2 B;  1LR1 A;  1NVP B;  1Y74 B;  1YIJ V;  1Q82 W;  4MVM A;  2IOR A;  1YC4 A;  1QNM A;  5EYP A;  1Q7Y W;  2Q68 A;  1TUE B;  1PM9 A;  2W6J G;  4I3H A;  4MT8 A;  2YGF A;  5F5R A;  2RJZ A;  4O0B A;  2E74 B;  3A0T A;  4WFB V;  1NH2 B;  2JJ1 G;  4DK0 A;  5EK0 A;  2IWS A;  4DXW A;  3DXR A;  2E75 B;  2PUS A;  2B1I A;  3T1H B;  1AMW A;  4P9O A;  2CCT A;  4EGH A;  2BU8 A;  4X62 O;  4JI1 O;  4LH6 A;  5FND A;  4V26 A;  2Q8H A;  4MW3 A;  1V9P A;  3ZKD A;  2OCC C;  2ZE6 A;  5B1O A;  4LFC O;  3O0I A;  2WLL A;  4JI8 O;  2X0L A;  1XUQ A;  2Z3Y A;  2WI5 A;  2BCC H;  5EC1 C;  4FZ1 A;  2YJX A;  3TZ0 A;  4EFT A;  3B40 A;  3OTO O;  4GYC B;  3SYA A;  2UXN A;  3DSQ A;  2A7W A;  2Q8I A;  4EMV A;  1Y4U A;  2WI7 A;  4DR3 O;  3CME V;  1P4R A;  2GQP A;  4GKK O;  3DXR B;  2A06 H;  2CH7 A;  4B3S B;  1Y66 A;  2R9I A;  1Q6H A;  1TVK A;  5K1P A;  4JV5 O;  1YSC A;  4DV0 O;  1S0V A;  2HHH O;  2DWD C;  3M7M X;  1VEW A;  4DR4 B;  4NB5 A;  3SYP A;  1JQ0 A;  3AEI A;  2JRI A;  3ZMT A;  1H8H G;  2ZR2 A;  3CRR A;  4QGP A;  2HKO A;  3J80 N;  3EHF A;  4QIW F;  1ENV A;  1TH8 A;  3N2G B;  2JS5 A;  3JZ3 A;  1J5E O;  5L3E A;  5BR8 O;  1I94 O;  4JI2 O;  4J80 A;  2LP7 A;  3A8T A;  1QLN A;  1QYE A;  2YEJ A;  1I5D A;  1TVK B;  2Y69 C;  2XDL A;  2QA4 V;  4J42 A;  1KC8 W;  4GFN A;  2UUC B;  3OMA B;  3ZJZ A;  5FPR A;  5BOD A;  5KHG A;  2QFO A;  1FPO A;  3INX A;  4R7C A;  1YT1 A;  4EFE A;  2UUA B;  4LF6 O;  1Y76 A;  2NNU A;  4UV8 A;  1ZSP A;  3ZED A;  1R3K C;  4WBN B;  1K73 W;  1WPX A;  4PA4 A;  5IYB O;  2XOK G;  4YKT A;  4MVR A;  2ESA A;  2Z5U A;  3FB8 C;  4AHC A;  4DV1 O;  2YI8 A;  1SQQ H;  5LP6 B;  3K06 A;  3JAT B;  4CH4 A;  3S3W A;  1TUB B;  1XHZ A;  1BXD A;  3GWO A;  1OHH G;  4LFA B;  4JZ2 A;  1RPO A;  2UXX A;  1N33 O;  1EZV H;  2C1G A;  3OMU A;  1UY7 A;  1R6N A;  5LHH A;  2BOC C;  4J7K A;  1AH6 A;  3EXA A;  4LF7 B;  4I4T B;  5KMG B;  3L73 H;  4DR7 O;  4BWA A;  3K08 A;  1XNR B;  4CWP A;  4MVS A;  4NTW A;  3E2E A;  3S5T A;  3CCQ V;  5LA6 A;  3FYE B;  3VAD A;  2LO1 A;  1XQ8 A;  2E0A A;  2RCV A;  3AG4 B;  1TUB A;  4KUM A;  3A2F A;  4MTG A;  2UXD O;  3T1Y O;  3VHD A;  3D8C A;  4NXN O;  1Y74 A;  2KSD A;  3FAV B;  3H1K H;  1S5H C;  4LR3 A;  2YKI A;  1VQ4 V;  4DV7 B;  2BTQ B;  3LUT B;  3INW A;  1UFI A;  2QWR B;  5CBF A;  1QR9 A;  5BXZ A;  4LWH A;  4I55 B;  2WI6 A;  3ASN C;  4JI7 O;  5LHG A;  4E00 A;  2YXY A;  4N23 A;  1V54 C;  1QLE B;  3H4L A;  3A0X A;  3H80 A;  3GIF A;  2UWD A;  4CE1 A;  3BA8 A;  2P4V A;  2QE7 G;  3SPH A;  1UYH A;  1WB7 A;  4ZOL B;  5CB4 B;  4FLW A;  1ZX3 A;  4BQJ A;  1ID0 A;  3HKE B;  3BVO A;  4DR6 B;  1NR1 A;  2P67 A;  1WP7 A;  2CTP A;  4WFG A;  1YT2 A;  4O07 A;  4LFB B;  4B3R B;  2ZKO A;  1KP2 A;  3A0W A;  3FB5 C;  3OW2 U;  4AWQ A;  1HR0 O;  4L91 A;  2ZBK B;  2BE3 A;  2LW7 A;  4C7U A;  3J7A U;  3TK1 A;  1TGO A;  4FLV A;  5EIB C;  2WI2 A;  4IIJ B;  1A32 A;  1N8R W;  5LP6 C;  1XOU A;  4JQL A;  4TOI A;  2YEF A;  5HFL A;  4X66 B;  4JI0 B;  2EUL A;  2EJR A;  2WLM A;  3AG2 B;  4O4I A;  4XDL A;  5BY1 A;  1F4M A;  3JAM N;  4NH9 A;  1YI2 V;  4NVP A;  1R6K A;  2CE4 A;  4HXZ A;  2XAH A;  1QVG U;  4MPN A;  2P6J A;  1BYQ A;  2QM8 A;  5CBH A;  4O05 A;  3B4S A;  2YIB A;  3O65 A;  4X1K B;  3K97 A;  2YXL A;  1OCO C;  4CBC A;  4YKQ A;  4KSG A;  3C3T A;  2VS0 A;  4LF4 B;  5E1A C;  2F23 A;  4JAS A;  4PI2 A;  2GUZ B;  5J2U A;  3MDS A;  3CS5 A;  4U7N A;  1TID A;  2HG1 A;  1I5Y A;  1GKX A;  1EBO A;  1AJQ A;  4MVQ A;  4I9Q A;  2K9P A;  4X64 O;  1SQV H;  3WG7 C;  4XE2 A;  3GIG B;  2JGU A;  1ZAU A;  3O6O A;  1SER A;  3AG1 B;  1YDX A;  3W7S A;  3NXS A;  1R62 A;  1HNX O;  4FLZ A;  3VQY A;  4JZG A;  1L0N H;  5FNC A;  1H2M A;  2OYQ A;  3ZXQ A;  4PRV A;  4K0K B;  3K5O A;  2JDI G;  4MVZ A;  3C0E A;  2RDC A;  2ZDI C;  3OR6 C;  2VQE B;  3TGU H;  2XHX A;  3DC5 A;  1HW7 A;  2X6B A;  4A5U B;  1G1X B;  3HR0 A;  1KB9 F;  3UCS C;  4B3S O;  3AK3 A;  1Z5A A;  1BHB A;  1XNR O;  2V4D A;  3WFV A;  3CCS V;  1N36 B;  2EIM B;  3CRK A;  2JIZ G;  2A79 B;  3ZMV A;  3ZHQ A;  4LF9 B;  3CGZ A;  4MTF A;  2P06 A;  4CWN A;  5KAF Z;  2EIK B;  3BAA A;  4L8J A;  1YES A;  3WHA A;  1N34 O;  3RYC B;  2PI4 A;  3I55 V;  5K1X A;  4X62 B;  4DR1 B;  2IJI A;  3EHG A;  3OFN G;  1ARO P;  4JI1 B;  3HEK A;  4XIR A;  3CCL V;  4O4H B;  5KA6 A;  2ZDI A;  4U7O A;  4PDR A;  2YI0 A;  3LDE A;  5H2F Z;  3B26 A;  2XX4 A;  4R3M A;  1M1K W;  2PF4 E;  2QKC A;  5GON A;  4FZ0 A;  1K9M W;  4LF6 B;  4UB8 Z;  4DV2 B;  5CTU A;  3B77 A;  2RN9 A;  4EM7 A;  5FPO A;  2OWO A;  2ZIM A;  1SQP H;  1NBM G;  2IJK A;  3ABU A;  4RQF A;  3O2F A;  4FJC C;  4EEQ A;  4LNU B;  1EZJ A;  3BRC A;  3CJH B;  4JV5 B;  3JD3 A;  3C11 A;  2WI3 A;  4FMT A;  3LSS A;  3U67 A;  3P30 A;  1W2B U;  1QR8 A;  4LH7 A;  1COW G;  3D36 A;  3K9A A;  3PN1 A;  3R4N A;  5LA6 B;  5IDJ A;  1VP7 A;  4X9L A;  3ZHR A;  3CPW U;  1B06 A;  4DV1 B;  1B62 A;  3HKB A;  4JI4 O;  1AB3 A;  4OXS A;  2YKJ A;  2A3Q A;  4LNU A;  1JM6 A;  2BU7 A;  5IYZ A;  1WLE A;  2Q7H A;  4AI8 A;  4BAY A;  1BQZ A;  2F66 C;  1N33 B;  3JAS B;  5IJ9 B;  1RM1 C;  4HYP A;  2WER A;  1H2S B;  4LP8 A;  3B8N A;  3OGC C;  1ZWI C;  1D5N A;  1IBM O;  1NTK H;  1FKA O;  3U2K A;  4LF4 O;  4H33 A;  1BCC H;  3THO A;  1KKD A;  4IYH A;  1M57 B;  2UU9 B;  5CA3 A;  4K4O A;  1GH6 A;  1NR7 A;  2UXC B;  4NXN B;  3C3S A;  4TV9 B;  1VF5 B;  4X20 B;  1XDC A;  5LXT B;  3ABK B;  1NT2 B;  3RLR A;  3W7T A;  4U3J B;  1OCZ C;  1XNQ B;  3EKO A;  3LPS A;  2JEX A;  5EYP B;  3Q5J A;  2OCH A;  1IBK B;  2CGF A;  5C8Y B;  1KBH A;  4WCE V;  2DYR C;  2JJ2 G;  1YF2 A;  3CCV V;  4DR6 O;  4JYA B;  4I0X A;  2R9A A;  4G28 B;  4MTX A;  2XJJ A;  2YED A;  1F4N A;  1SA0 A;  2Q8V A;  3APO A;  5IN9 A;  3HPL C;  2YEH A;  5DN6 G;  3AG2 C;  4QJF B;  2P22 C;  5DEC A;  2DE0 X;  2AW9 A;  2VQE O;  3IED A;  2UXD B;  3CGY A;  2HJF C;  1QCE A;  3B27 A;  1U0Z A;  4JYY A;  4ASA A;  2HCH A;  2XAJ A;  2DQ3 A;  3B8M A;  3H01 A;  4O04 A;  4OGQ B;  1FXK B;  4HZ3 A;  1V55 C;  1AM1 A;  4X20 A;  1BSM A;  4DR2 B;  4XKA A;  4MPC A;  1GN3 A;  4URN A;  4QE9 A;  3E22 B;  1MA1 A;  2ITD C;  1Y76 B;  3D3Q A;  3KCY A;  3STL C;  2BTO A;  4PD4 F;  3ABL C;  5JCO C;  4PHZ A;  3TET A;  3CC7 V;  3T1K A;  2XND G;  3L72 H;  1Z2G A;  3TZ5 A;  1YJW V;  2DYR B;  1F7Y A;  1GKZ A;  3OUF A;  4PDV A;  1TAE A;  1Z5B A;  5ITZ B;  4HZ5 A;  3CCR V;  1KU9 A;  4R8C A;  1UJW B;  2CUG A;  3JAT A;  1PP9 H;  2Q7G A;  4FM0 A;  1FFX B;  3L75 H;  3SJQ C;  2IOP A;  1MG1 A;  1MOF A;  4X66 O;  2IW5 A;  1K33 A;  1VQL V;  1AI7 A;  2R9R B;  1OZ0 A;  2YC0 A;  1WNS A;  1RPR A;  1ZXN A;  4PRX A;  1YSZ A;  5J71 A;  1IBL B;  4BQG A;  4B3M O;  3KG2 A;  4MP2 A;  4L94 A;  2MK3 A;  1NVP D;  1KUQ A;  1DF4 A;  3JAR B;  3SJC C;  3QG5 A;  2YEG A;  1VQP V;  4FLY A;  3EVK A;  1I5X A;  2ADQ B;  1H2G A;  1OCR C;  3E83 A;  2XDU A;  5KAI Z;  3ABK C;  1FFT B;  1P7G A;  5FNF A;  5GTH Z;  4WFH A;  2KG7 B;  1U96 A;  2FXS A;  5JWP A;  1S76 D;  3AG1 C;  4DZY A;  3JAL A;  1K5S A;  2EXL A;  4TWK A;  4I9W A;  1R73 A;  2E76 B;  2YSU B;  5FNV A;  2Q4P A;  5JJN B;  2UXB O;  3RYC A;  2Q0A A;  4HNA A;  4O4J B;  3CP1 A;  3BCC H;  4HYO A;  1ZXM A;  2K5B A;  1JJO A;  2XAS A;  3N2K B;  3A0Y A;  3OD4 A;  1AR4 A;  4DV4 B;  1NS1 A;  1I59 A;  1S16 A;  4O09 A;  2EIL B;  4O2A A;  3CMA V;  4FVM A;  2UU9 O;  1MX0 A;  4XDJ A;  1VF7 A;  3X2Q B;  1W59 A;  1XMQ O;  4K8X A;  5KUK A;  4IIJ A;  1Q86 W;  2FB5 A;  4MBC A;  1SQX H;  4CS3 A;  5CBG A;  2YI6 A;  3K0D A;  3ZHV A;  1GM9 A;  2W0X A;  1MMM A;  3UKM A;  4K3A A;  4DV2 O;  1YJN V;  2F93 B;  5L3C A;  5IWA B;  5M4N A;  2ZNJ A;  1L0L H;  5F2V O;  1VF6 C;  3L9D A;  3U0Z A;  1BT8 A;  2VCI A;  5LHI A;  5KA5 A;  1URF A;  3P3N A;  2CGO A;  1EFR G;  2ILM A;  2R72 A;  2YS8 A;  1BE3 H;  3CYO A;  3JYC A;  1H2N A;  1V54 B;  3JAW B;  5L3B A;  4YJ2 A;  2DW4 A;  4V25 A;  1WJZ A;  1M4U A;  3K9S A;  1AR1 B;  1YHQ V;  1VQ6 V;  2H8P C;  2Q8G A;  4XCL A;  4X1K A;  4E01 A;  2HHH B;  1Y8O A;  2P7T C;  2BT0 A;  4DR4 O;  1BL8 A;  4LF8 B;  1JA8 A;  4ZOL A;  1Q6I A;  5EZY A;  1UYD A;  4WFE A;  3UQ8 A;  1SQF A;  3OT7 A;  5CTW A;  2BU2 A;  1PNL A;  2E3C A;  3HYZ A;  1SC5 B;  2WI1 A;  3BFR A;  1YS3 A;  4EEH A;  4BIO A;  2KG7 A;  3G6E V;  2P90 A;  1TC6 A;  1ZL8 A;  1NQT A;  1YER A;  1FJG O;  3HHU A;  1AR5 A;  3Q5K A;  1SQB H;  4Q6G A;  3M8A A;  4LBE C;  2IOQ A;  3CJH A;  4U93 A;  5B1B B;  3CRC A;  2O57 A;  4LWS A;  2C2A A;  3PEH A;  1RSO B;  1K4D C;  4F6E A;  3ZM7 A;  1M5I A;  3FD9 A;  1XNQ O;  3R4P A;  2E5L B;  2ZM6 O;  3FB7 C;  1V55 B;  2IWX A;  3SPJ A;  2QTO A;  1CEZ A;  1JR9 A;  2ZT9 B;  2LFS A;  1YZB A;  2XAB A;  2YEV B;  1D5A A;  3HKD B;  4HXW A;  1K34 A;  4LWE A;  4XDK A;  5LMN B;  3T0H A;  1OCO B;  2ZNI A;  1Q5O A;  2EIJ C;  4O2B A;  4E72 A;  3E22 A;  3BMY A;  2Y69 B;  3G80 A;  4I7Z B;  4RQE A;  1JFF A;  2ARH A;  3IAY A;  4L8Z A;  4JI5 O;  4FFK A;  1HNZ B;  3ML0 A;  4ICG A;  2Q5Z A;  3RLQ A;  5DED A;  1A4H A;  3M99 B;  1NJI W;  3ZIA G;  2YGA A;  1KYO F;  2FL4 A;  3FAV A;  1K7D A;  1E1Q G;  3I5D A;  3R4O A;  3H1J H;  1VIB A;  5B66 Z;  2AHZ A;  3G67 A;  2AZ0 A;  4PEL A;  4O4I B;  2WPD G;  2ATK C;  3SPG A;  4WF9 V;  3QDD A;  4UFZ A;  4JF3 A;  2YXH A;  4X9Q A;  1IVS A;  3RGB A;  1FAF A;  4J10 A;  4MS2 A;  3FB6 C;  1SS3 A;  2IU0 A;  3H1I H;  4DR5 O;  4W7T A;  2ADP A;  1NHI A;  1BGY H;  3CCM V;  2VWJ A;  4LF5 B;  3PJS K;  3SJB C;  1LNQ A;  3WQ9 A;  2FYU H;  5D7C A;  1XIL A;  3ASO B;  2YE3 A;  3RLP A;  4B3R O;  1H2L A;  1UPG A;  2WLK A;  3ZHS A;  4EFB A;  4DV3 B;  1OV9 A;  2ZE7 A;  1I5B A;  5KHJ A;  4F4L A;  1G4Y B;  4DRX B;  4H44 B;  4J41 A;  2EZP A;  4XBF A;  2EJ7 A;  2EIJ B;  1MZF A;  3GVM A;  4YJ3 A;  2C1I A;  4IYI A;  1AP6 A;  4IGG A;  4WUC A;  3B2E E;  2YKB A;  3UT5 A;  2BTQ A;  2IH1 C;  2Z0A A;  4PV1 B;  4D6T H;  2PTM A;  2PYJ A;  2BZ5 A;  1UYI A;  4YY3 B;  1TBW A;  3FV5 A;  4Z2W A;  1SKV A;  1U97 A;  1SA0 B;  4TT3 G;  1NZ6 A;  2XHB A;  4ASF A;  1QBZ A;  4DV4 O;  2ZCE A;  3J81 N;  4LCU C;  4JPR A;  1GN2 A;  2YEC A;  1EN6 A;  4Q20 A;  2WA4 A;  3ZBH A;  3ZN1 A;  1XEQ A;  1WA8 B;  3AG7 A;  3ZN0 A;  4XC0 A;  3IC9 A;  4X1Y A;  2YKE A;  2ZIN A;  3GB7 C;  5KLV H;  1NTM H;  1O9H A;  1KKC A;  1I5A A;  1BZK A;  3T1C A;  3CB2 A;  4O4H A;  2YE8 A;  2D2C B;  5D5P A;  3CYG A;  1AI5 A;  2XJX A;  4JI6 B;  1B04 A;  4YKY A;  3K79 A;  5GON B;  4FFB B;  2PI5 A;  4LFC B;  1BQ0 A;  2Q8F A;  5LMN O;  4ASG A;  1GRJ A;  1SRY A;  1P7B A;  3MAQ A;  4UXN A;  2UXB B;  4BAE A;  4GX1 A;  1Q3E A;  4CWF A;  1MSW D;  4URL A;  2EIM C;  2ZD9 A;  2B1G A;  4FCR A;  1PPJ H;  2A9H A;  2HEP A;  5IYC O;  4EB6 B;  3TXQ A;  4X65 B;  3RYH A;  4KHP B;  1ZTE A;  2LFR A;  3R4M A;  3G6B A;  4O2A B;  4LF9 O;  3A0Z A;  1R3L C;  2Q73 A;  5JH7 A;  1NU1 H;  3E89 A;  4MPE A;  3CCU V;  3LDD A;  1PVG A;  3T2S A;  1VQO V;  1AP5 A;  2IM9 A;  5A9G A;  3QF7 A;  5L3D A;  2YI7 A;  3OMI B;  4BXI A;  1QVF U;  3JAR A;  5KX5 B;  4DR1 O;  5LBQ A;  3G7E A;  1LUV A;  3ABT A;  2RMK B;  3FX7 A;  2EIN B;  5CA0 B;  4LP0 A;  4LF8 O;  4NYK A;  1BKN A;  3G75 A;  2XDK A;  4KFG A;  2DOS A;  1GKF A;  3K03 A;  3WU2 Z;  1IZ3 A;  2X6A A;  2IH3 C;  4B08 A;  3ZHU A;  3QO7 A;  3RFR A;  3ZX6 A;  3TUH A;  1DK1 A;  2BU6 A;  3L74 H;  2XDX A;  2KKW A;  3RYF A;  4FM1 A;  2KQX A;  1HWY A;  2Y48 A;  3QVN A;  2PNR A;  2YEV A;  4GX5 A;  1Y8P A;  2YJW A;  4CWT A;  4HNA B;  4L90 A;  4NH8 A;  3W7W A;  2DYS C;  3JAL B;  4GX0 A;  2BYH A;  1NKD A;  1YC3 A;  5CN0 A;  4DV3 O;  4H85 A;  4CC6 A;  2YK2 A;  4EKW A;  1H7U A;  3CRL A;  4E2L A;  2OTJ V;  1R3J C;  4CS2 A;  4EGI A;  4MP7 A;  1X4T A;  1RP3 B;  4P9P A;  3LDC A;  4ZBM A;  5H6Q A;  1AJP A;  3CWV A;  2WWW A;  5GTI Z;  4ZKI A;  5LGU A;  1I08 A;  2OTL V;  4EFU A;  1QHT A;  2QDO A;  5BZB A;  2F4V O;  4DK1 A;  1OCC B;  4GGL A;  3ZS8 C;  3K57 A;  4WBN A;  1Q90 D;  5DM6 V;  2ZIO A;  2XAF A;  2QEX V;  4HY6 A;  5CTX A;  2HHI A;  2X7R B;  3H1L H;  1XMO O;  1F23 A;  5EIB D;  2OIE A;  3JD0 A;  4FPP A;  1Z5W A;  1N32 O;  1WB8 A;  4X1I B;  2HJD A;  4BW9 A;  4X64 B;  3UO2 A;  2WA3 A;  1PL4 A;  2MW2 B;  2XAQ A;  2IWU A;  1Y67 A;  5IYD O;  4KSH A;  2ZM6 B;  3K58 A;  5JH7 B;  4D7S A;  3T1H O;  3AG3 C;  2ODM A;  3QO8 A;  2CGN A;  4FIP C;  1GK9 A;  3QTC A;  2JVD A;  3ZMS A;  3OTF A;  3JAS A;  2W0F C;  3ETQ A;  4DW0 A;  4AQY O;  2YGE A;  4ZI7 B;  3VQX A;  3VHA A;  1S5J A;  5CPH A;  5JEN A;  2OCC B;  1IX9 A;  4JYA O;  3HYY A;  2IBZ H;  4E02 A;  1W0K G;  4G2K A;  3K5M A;  4O2B B;  1NHH A;  4TSF G;  4OX9 B;  2QWP B;  1H38 A;  3OTO B;  2K1E A;  2YE7 A;  1KEC A;  5D7D A;  5D7R A;  2YID A;  2VWK A;  3W7X A;  4DV6 O;  2CAZ C;  1Q43 A;  4LFB O;  4GEE A;  2QSA A;  3JD2 A;  4GKK B;  5GW7 A;  2NLJ C;  1QZR A;  3OW6 A;  1B3Q A;  4B6C A;  1W0J G;  3A0B Z;  1GM7 A;  2NR5 A;  2KB1 A;  4JYC A;  2YEA A;  4KFM A;  1KIJ A;  3BAB A;  1FXK A;  1RFY A;  2Y4T A;  1KMI Z;  4GKJ O;  5J2T B;  2HVK C;  3MHS C;  3RYH B;  2W6I G;  2QTS A;  4TQD A;  2QF6 A;  4BW5 A;  1ROP A;  1J5E B;  3CRM A;  1JJ2 U;  2CDY A;  1KD1 W;  1VQK V;  4DR5 B;  1YC1 A;  4R50 A;  2WAM A;  2JGD B;  2Q0O C;  2CH7 B;  5CMU A;  4JI4 B;  1GAX A;  3BM9 A;  4P8O A;  3ASO C;  4GZR B;  2BYI A;  4X89 A;  2ZKJ A;  1LUW A;  3KE6 A;  2R70 A;  3HKE A;  5BOC A;  3OE7 G;  2FKX A;  5IE9 A;  2GTS A;  3I56 V;  3JSL A;  3U2D A;  3VQW A;  2CTQ A;  2XJG A;  2WLI B;  3SYO A;  5TIS Z;  2N04 A;  4TUY B;  3RW0 A;  5LOV A;  3UM7 A;  1JVM A;  2F43 G;  1K5Q A;  2JGD A;  3APQ A;  3AG4 C;  3MD0 A;  5JJE B;  4LFA O;  4XKK A;  5IT9 N;  2QJ1 A;  3LSU A;  4UCR A;  1E79 G;  4QPK A;  3BA9 A;  2AHY A;  4MW8 A;  5LYJ B;  4BIU A;  4CZZ A;  2VQF B;  4XKO A;  2Q6A A;  4ZI7 A;  4DUZ O;  3D2R A;  3B09 A;  4K0K O;  1H2K A;  3A0H Z;  2LGQ A;  1OCZ B;  2QM4 A;  1S5L Z;  3DC6 A;  1YIT V;  1MAB G;  2GHY A;  1US7 A;  1NTZ H;  3SGI A;  1TC0 A;  5JQG B;  1XMO B;  4YIP A;  2H55 A;  3GIG A;  4PU9 A;  4XDM A;  3F5T A;  2H94 A;  3CRA A;  4O4L A;  1B6Q A;  3JAK A;  1I5C A;  2BU5 A;  2AGA A;  3CD6 V;  2QWQ B;  3ABM B;  1YJ9 V;  2LW1 A;  3JCU Z;  4O4J A;  2EIL C;  1PKX A;  4JI7 B;  2DWE C;  3EFF K;  2O1U A;  1XMQ B;  2GDS A;  4FCQ A;  2QWO B;  3G4S V;  4NXM B;  2JKI A;  1HNW B;  5CTY A;  2JK5 C;  3CHX A;  3RYF B;  4JI6 O;  2BTZ A;  1VF6 A;  1PL0 A;  5FNV B;  1GO3 F;  4GQT A;  3VHC A;  3UT5 B;  2FWY A;  5CF0 A;  3TTZ A;  4I5S A;  4UUJ C;  4P2Z A;  3WB1 A;  2EIK C;  2XT9 A;  4YHH O;  1K92 A;  3W7U A;  3HZ5 A;  3B25 A;  3BPZ A;  2CCU A;  3JAK B;  5IYZ B;  1GN6 A;  4I55 A;  4J7Z A;  4BR6 A;  3QO5 A;  3H9V A;  1T5E A;  2YI9 A;  2ZXW C;  4DV6 B;  1YVW A;  4DR2 O;  5IJ0 B;  2UUA O;  2QG0 A;  4FK5 C;  4XD8 A;  2OT5 A;  4ZIB A;  3T10 A;  3QNE A;  1VQ9 V;  2GBO A;  3QTF A;  4JI3 B;  3STZ C;  2XCM A;  4H81 A;  4MSW C;  1FYJ A;  3ZRW A;  4W4K A;  3RYI A;  3TCU A;  4JTC B;  2G38 A;  3HKD A;  3KZI Z;  4JI0 O;  1I58 A;  1EA6 A;  3U10 A;  3SYC A;  4NKG B;  4NR1 A;  1L1F A;  2L6L A;  2BSK B;  3LNU A;  1AI4 A;  4RAI A;  4XCJ A;  1SQG A;  1M93 A;  2WEP A;  3Q4H A;  4PA7 A;  4ZHQ B;  1UY8 A;  4JAV A;  4LWI A;  4H13 B;  4RO2 A;  4TQF A;  3JD4 A;  1GTO A;  2YE6 A;  3MNR P;  1UYG A;  4ABM A;  4DRX A;  1XI1 A;  4OPH A;  2XHT A;  1E1R G;  3CC2 V;  1TIL A;  3GIE A;  4UCV A;  1MU5 A;  4KQV A;  4JGS A;  1PNK A;  1S3J A;  3SPI A;  5JVD B;  2YEB A;  2ZDY A;  2ZQM A;  3SYQ A;  5EZY B;  2Q67 A;  4PL9 A;  3HKB B;  4KTN A;  2XAG A;  2M7W A;  5IDM A;  2FYP A;  2QM7 A; 
#chains in the Genus database with same CATH homology
 2HR3 A;  5FWK A;  1M56 C;  4X8A A;  2BZ5 A;  1UYI A;  2GFD A;  4CWS A;  1NBM G;  3E35 A;  2IJK A;  3ABU A;  4RQF A;  1TBW A;  1ZW9 A;  3ABM C;  3O2F A;  4YKZ A;  4FJC C;  2WLH A;  4WFA V;  2WI4 A;  3CC4 V;  3FV5 A;  1EZJ A;  3OWD A;  1K4C C;  3FT8 A;  4TT3 G;  1KP3 A;  2X6C A;  5J9P C;  3JD3 A;  3C11 A;  4P7A A;  2WI3 A;  2BRE A;  4FMT A;  4PDL A;  4YKW A;  1FXV A;  2HVJ C;  3NMQ A;  3LSS A;  2XHR A;  4RUE A;  4ASF A;  3U67 A;  3ZKB A;  3P30 A;  2IJJ A;  1QBZ A;  1W2B U;  1EI1 A;  5B1N A;  2DYS B;  1QR8 A;  4MVO A;  4GCZ A;  1COW G;  4LCU C;  1DF5 A;  3D36 A;  4JYB A;  4JPR A;  2YEC A;  1J95 A;  3OMN B;  4QPJ A;  3BEH A;  3K9A A;  4L93 A;  4Q20 A;  3ZN1 A;  3R4N A;  5IDJ A;  2GSM B;  4PA3 A;  5IY5 B;  2O1V A;  2ZDX A;  3FT5 A;  4X9L A;  3ZN0 A;  4XC0 A;  4YKU A;  3ZMU A;  2JEU A;  2BSM A;  3CPW U;  1B62 A;  3LNM B;  5M4H A;  3ETE A;  2YKE A;  4OXS A;  3GB7 C;  3ZCC A;  2YKJ A;  2HLD G;  1JPX A;  4LC1 A;  5EBM C;  2ZXW B;  1JM6 A;  1I5A A;  2BU7 A;  1BGQ A;  4MB9 A;  2CG9 A;  2CH4 A;  2XDS A;  5HFM A;  1WLE A;  2WSS G;  3B28 A;  1UY9 A;  2H8M A;  3OM3 B;  2XX5 A;  3T1C A;  3G7B A;  3PEJ A;  4BAY A;  3R92 A;  4AWO A;  3E8H A;  5B1B C;  4WUD A;  2YE8 A;  3VOU A;  5M4M A;  1Z59 A;  1R3I C;  4UVA A;  4KP4 A;  1RM1 C;  1AJ6 A;  1AI5 A;  4HYP A;  4EGK A;  5M4K A;  2QM7 A;  2WER A;  2XJX A;  4LP8 A;  3B8N A;  3LSQ A;  3OEH G;  3OGC C;  2YK9 A;  3ETD A;  4GT1 A;  3K79 A;  4R3A A;  2VWC A;  4YKY A;  1ZWI C;  2PI5 A;  3VBB A;  3F7Y C;  1M9N A;  1UYL A;  5D6P A;  2Q8F A;  4FCP A;  2FTK A;  4ASG A;  3SPC A;  1SRY A;  1P7B A;  3U2K A;  1SZT A;  4UXN A;  1VQ5 V;  4H33 A;  4YXW G;  5B3S B;  1AH8 A;  4GX1 A;  4QE7 A;  4BAE A;  1MSW D;  4CWF A;  1KKD A;  3DGE A;  4URL A;  4QNH B;  1UYK A;  1M57 B;  1GM8 A;  1OCR B;  2YE2 A;  4UVB A;  5CA3 A;  4K4O A;  3ZKD A;  1S72 V;  1NR7 A;  1S14 A;  2EIM C;  2ZD9 A;  2B1G A;  4X88 A;  4FCR A;  3ZXO A;  4CE2 A;  4XTJ A;  3ZRX A;  4DO2 A;  2A9H A;  1NVP B;  5IYC O;  1YIJ V;  1Q82 W;  4MVM A;  5H6R A;  3ABK B;  2LFR A;  4BIZ A;  3R4M A;  2IOR A;  3RLR A;  4RUF A;  3W7T A;  1YC4 A;  3A0Z A;  1OCZ C;  3EKO A;  1R3L C;  3LPS A;  2JEX A;  3Q5J A;  2CGF A;  3E89 A;  4MPE A;  1Q7Y W;  3OR7 C;  3CCU V;  4YKX A;  3LDD A;  4WCE V;  1PVG A;  1UYM A;  2Q68 A;  1VQO V;  3T2S A;  2DYR C;  2IU3 A;  2JJ2 G;  1TUE B;  5L3D A;  3CCV V;  1Z5C A;  3OMI B;  2YI7 A;  4BXI A;  4G28 B;  4MTX A;  2W6J G;  2XJJ A;  2YED A;  4I3H A;  1F4N A;  4MT8 A;  1QVF U;  5IN9 A;  3HPL C;  2YGF A;  5F5R A;  5LBQ A;  2YEH A;  5DN6 G;  2IJH A;  1QY8 A;  3AG2 C;  3G7E A;  4O0B A;  3ABT A;  2EIN B;  4LP0 A;  4QJF B;  4PA9 A;  1CP9 A;  1THN A;  3CCE V;  1UYC A;  3A0T A;  4WFB V;  1NH2 B;  1BKN A;  3CGY A;  3IED A;  2HJF C;  1QCE A;  3B27 A;  1U0Z A;  3G75 A;  4ASA A;  2XDK A;  2JJ1 G;  2YE4 A;  4KFG A;  2HCH A;  3OEE G;  2XAJ A;  1GKF A;  2IWS A;  5EK0 A;  2DQ3 A;  3K03 A;  4DXW A;  3B8M A;  3H01 A;  4H37 A;  2X6A A;  2IH3 C;  4O04 A;  3QO7 A;  2B1I A;  2HKJ A;  1AMW A;  1FXK B;  4HZ3 A;  1V55 C;  1AM1 A;  3TUH A;  1GJV A;  2BU6 A;  4P9O A;  4XKA A;  2CCT A;  4EGH A;  2ITC C;  2XDX A;  1QLE C;  1HWY A;  4MPC A;  2BU8 A;  2V1D A;  2Y48 A;  4URN A;  3DTU B;  2PNR A;  2YEV A;  4QE9 A;  4GX5 A;  5FND A;  2ITD C;  1Y8P A;  2YJW A;  4V26 A;  1F51 A;  4CWT A;  4L90 A;  2CK3 G;  3D3I A;  4NH8 A;  3W7W A;  2DYS C;  4GX0 A;  1JOY A;  3STL C;  2BYH A;  2Q8H A;  3ABL C;  4MW3 A;  5B1A B;  4V25 A;  3TET A;  1NKD A;  2OCC C;  3IGA C;  5CN0 A;  5B1O A;  3CC7 V;  3CXC U;  2WLL A;  1YC3 A;  2XND G;  1Y4S A;  2X0L A;  3O0I A;  3T1K A;  3TZ5 A;  2Z3Y A;  5B3S C;  1YJW V;  2DYR B;  4H85 A;  1GKZ A;  3OUF A;  4PDV A;  2WI5 A;  5EC1 C;  3WG7 B;  2YK2 A;  4EKW A;  1H7U A;  1Z5B A;  2YJX A;  4WFF A;  3CRL A;  1M57 C;  4E2L A;  3CCR V;  4HZ5 A;  2OTJ V;  3SYA A;  2UXN A;  4R8C A;  1R3J C;  1UJW B;  4EGI A;  4MP7 A;  2IOP A;  3SJQ C;  2Q8I A;  4P9P A;  4EMV A;  1MG1 A;  1MOF A;  3LDC A;  1Y4U A;  4ZBM A;  2IW5 A;  1AJP A;  5H6Q A;  2JJC A;  3CME V;  2WI7 A;  2WWW A;  3CWV A;  1P4R A;  4ZKI A;  5LGU A;  2GQP A;  4YKR A;  5M4P A;  2OTL V;  4LWG A;  1K33 A;  4EFU A;  1Y66 A;  2R9I A;  1AI7 A;  1SET A;  5BZB A;  1VQL V;  1OCC B;  2R9R B;  1OZ0 A;  1KZN A;  4GGL A;  1YSC A;  1S0V A;  2DWD C;  3P32 A;  5GGZ A;  1RPR A;  1ZXN A;  4PRX A;  5DM6 V;  1YSZ A;  3EHB B;  2XAF A;  3F7V C;  2QEX V;  4HY6 A;  5CTX A;  5LGT A;  3SYP A;  5J71 A;  1JQ0 A;  3AEI A;  4BQG A;  3ZMT A;  1H8H G;  2X7R B;  3KG2 A;  2ZR2 A;  1F23 A;  2HKO A;  3EHF A;  4QIW F;  5C93 A;  4L94 A;  4MP2 A;  5F3K A;  4B7P A;  1ENV A;  2MK3 A;  3K04 A;  3JD0 A;  3JD1 A;  4FPP A;  1NVP D;  1TH8 A;  1YSR A;  3JZ3 A;  1DF4 A;  1UYE A;  1K8A W;  5L3E A;  2CCS A;  4URO A;  3G71 V;  4HZ0 A;  2LP7 A;  2YEG A;  4UVC A;  1VQP V;  1QLN A;  1QYE A;  2YEJ A;  1I5D A;  1I5X A;  2Y69 C;  1H2G A;  1OCR C;  2XAQ A;  3E83 A;  3AG3 B;  5IYD O;  2QA4 V;  3ABK C;  2IWU A;  2XDL A;  1FFT B;  2XDU A;  4KSH A;  1KC8 W;  4GFN A;  4XIQ A;  3E8B A;  3OPD A;  4R1F A;  3OMA B;  3ZJZ A;  4KQV A;  3AG3 C;  5FNF A;  5BOD A;  2QFO A;  4WFH A;  3TZ4 A;  3INX A;  4R7C A;  1YT1 A;  1M90 W;  3QO8 A;  4FIP C;  2FXS A;  4Z1M G;  1S76 D;  2NNU A;  3AG1 C;  3ZMZ A;  1GK9 A;  4UV8 A;  2YEI A;  3TZ2 A;  4MTO A;  1K5S A;  4DZY A;  2EXL A;  1R3K C;  4TWK A;  4I9W A;  1K73 W;  1R73 A;  3ZMS A;  1WPX A;  4PA4 A;  2YSU B;  2XOK G;  5IYB O;  2W0F C;  4YKT A;  2YGE A;  1VQM V;  4MVR A;  2HG5 C;  2ESA A;  3VHA A;  5CPH A;  2Z5U A;  2OCC B;  3FB8 C;  3HYY A;  3OAA G;  2D3O W;  4HYM A;  4E02 A;  1W0K G;  5EC2 C;  4G2K A;  2WLI A;  3CP1 A;  3K06 A;  2XK2 A;  1NHH A;  3ZRV A;  3HB3 B;  4HYO A;  4TSF G;  3T4Z A;  1ZXM A;  4XIP A;  3E8F A;  2K5B A;  1H38 A;  2K1E A;  2XAS A;  1KEC A;  3GWO A;  2YE7 A;  5D7R A;  1OHH G;  3W7X A;  5D7D A;  1BXD A;  3EHH A;  3A0Y A;  1FXK C;  2UXX A;  1RPO A;  1I59 A;  1UYF A;  4GEE A;  1S16 A;  3JD2 A;  4O09 A;  2EIL B;  5GW7 A;  3CMA V;  1MX0 A;  2NLJ C;  2VCJ A;  4XDJ A;  1VQ8 V;  1QZR A;  3OMU A;  3X2Q B;  2WEQ A;  1UY7 A;  1R6N A;  3OW6 A;  5LHH A;  2BOC C;  1AH6 A;  3R65 A;  1B3Q A;  4GT8 A;  5FL7 G;  5KUK A;  1Q86 W;  4MBC A;  4B6C A;  5M4E A;  3K08 A;  4HAM A;  1W0J G;  1GM7 A;  3BY6 A;  5B1A C;  5CBG A;  5L3F A;  2YI6 A;  3K0D A;  4CWP A;  2KB1 A;  3JCZ A;  4JYC A;  4MVS A;  3E2E A;  1GM9 A;  3CCQ V;  1Q81 W;  2YEA A;  4KFM A;  3UKM A;  3FYE B;  3VAD A;  1KIJ A;  1YJN V;  1FXK A;  5L3C A;  1K97 A;  2HFE C;  3AG4 B;  2E0A A;  5M4N A;  4KUM A;  4MTG A;  3VHD A;  3K60 A;  2HVK C;  3MHS C;  2VCI A;  3D0B A;  2W6I G;  1S5H C;  2QF6 A;  2Q69 A;  4PDM A;  5LHI A;  5KA5 A;  4BW5 A;  1ROP A;  1VQ4 V;  2YKI A;  3K99 A;  3LUT B;  2AKP A;  1EFR G;  1JJ2 U;  1KD1 W;  3INW A;  1VQK V;  3B24 A;  3CYO A;  5CBF A;  1QR9 A;  1YC1 A;  4R50 A;  3JYC A;  2WAM A;  4LWH A;  4JTA B;  2YE5 A;  1V54 B;  3K3W A;  5L3B A;  5CMU A;  2WI6 A;  3EKR A;  2DW4 A;  3IC7 A;  2Q2E B;  3BM9 A;  3ASN C;  3ASO C;  4HY1 A;  5LHG A;  4P8O A;  1AR1 B;  4E00 A;  4N23 A;  4X89 A;  1V54 C;  2BYI A;  1QLE B;  1YHQ V;  2ZKJ A;  3A0X A;  1VQ6 V;  3GIF A;  3H4L A;  1OCC C;  1ORQ C;  2H8P C;  4ASU G;  2UWD A;  3H80 A;  2Q8G A;  4XCL A;  4CE1 A;  5BOC A;  3SL2 A;  4E01 A;  1Y8O A;  2YEE A;  2P7T C;  2QE7 G;  3OE7 G;  2BT0 A;  3KE6 A;  3SPH A;  3CCJ V;  2WLN A;  1BL8 A;  4JTD B;  3I56 V;  1UYH A;  3U2D A;  2ZR3 A;  3K98 A;  1NHJ A;  5EBW C;  1UYD A;  4URM A;  2XJG A;  2WLI B;  3SYO A;  3RW0 A;  4WFE A;  1VQN V;  3UM7 A;  1JX9 A;  1JVM A;  4AS9 A;  2EZO A;  2F43 G;  3HZ1 A;  5CTW A;  4BQJ A;  1K5Q A;  1Y4M A;  3EHJ A;  1ID0 A;  3FYI B;  1BMF G;  2BU2 A;  1PNL A;  4J9Y B;  1NR1 A;  3HYZ A;  3AG4 C;  3MD0 A;  3ETG A;  2P67 A;  2WI1 A;  1YS3 A;  4EEH A;  1OSF A;  2EBO A;  4XKK A;  3G6E V;  4WFG A;  1YT2 A;  4O07 A;  2QKS A;  2P90 A;  1NH2 D;  1TC6 A;  1E79 G;  4QPK A;  1KP2 A;  3A0W A;  2BOB C;  1VQ7 V;  3FB5 C;  3OW2 U;  2AHY A;  4MW8 A;  4MVU A;  2V7Q G;  3X2Q C;  1BHA A;  1NQT A;  1YER A;  4AWQ A;  2FWZ A;  4BIU A;  4L91 A;  3HHU A;  4CZZ A;  5J6A A;  3E8G A;  3Q5K A;  4XKO A;  2Q6A A;  4CWR A;  3D2R A;  2ZBK B;  1OCZ B;  4GX2 A;  2DQ0 A;  3TK1 A;  4LBE C;  1YIT V;  2IOQ A;  1MAB G;  4U93 A;  4DUH A;  3T0Z A;  2GHY A;  2WI2 A;  5B1B B;  1N8R W;  1US7 A;  1XL4 A;  4JQL A;  2C2A A;  1RM1 B;  3PEH A;  1SES A;  2YEF A;  1K4D C;  5HFL A;  3ZRW B;  3ZM7 A;  1PNM A;  2EJR A;  1TC0 A;  2WLM A;  3AG2 B;  2H55 A;  3GIG A;  4PU9 A;  2YI5 A;  4XDL A;  3R4P A;  2H94 A;  4XDM A;  1F4M A;  1PD3 A;  3RVY A;  3E86 A;  1YI2 V;  4NH9 A;  4EFT A;  4N21 A;  1B6Q A;  1M56 B;  3FB7 C;  1V55 B;  2IWX A;  1I5C A;  2BU5 A;  1R6K A;  3SPJ A;  2XD6 A;  2QTO A;  4CE3 A;  1CEZ A;  4HXZ A;  2XAH A;  1Y8N A;  1UY6 A;  1QVG U;  2LFS A;  3CD6 V;  2P6J A;  4MPN A;  1BYQ A;  2XAB A;  2YEV B;  2QM8 A;  3ABM B;  4HXW A;  3ZRS A;  1YJ9 V;  3K0G A;  5CBH A;  4O05 A;  1K34 A;  2EIL C;  1PKX A;  3OUS A;  4G27 B;  4XDK A;  2BRC A;  4LWE A;  2DWE C;  3EFF K;  1DLB A;  5H9C A;  3K97 A;  2O1U A;  1OCO C;  4CBC A;  4YKQ A;  4KSG A;  3ABL B;  5EBL C;  2WLL B;  4FCQ A;  5KUM A;  4XIT A;  4LPB A;  5E1A C;  3G4S V;  3T0H A;  4JAS A;  2JKI A;  5CTY A;  4LWF A;  1AI6 A;  1OCO B;  2JK5 C;  1AJN A;  4CWQ A;  2BTZ A;  4R6Z A;  3RBZ A;  4U7N A;  1PL0 A;  5CTU A;  2EIJ C;  4ZVI A;  4JAU A;  1TID A;  2VW5 A;  2HG1 A;  1GO3 F;  3BMY A;  4GQT A;  1I5Y A;  2Y69 B;  1GKX A;  1H8E G;  3VHC A;  1EBO A;  4RQE A;  1AJQ A;  4MVQ A;  2FWY A;  5CF0 A;  3TTZ A;  4I5S A;  3RKZ A;  4UUJ C;  4P2Z A;  5L3G A;  4L8Z A;  2EIK C;  3WG7 C;  1YTF D;  4XE2 A;  5IY5 C;  1K92 A;  3W7U A;  3MHH C;  3ML0 A;  3B25 A;  3GIG B;  3HZ5 A;  3O6O A;  3RLQ A;  2CCU A;  1SER A;  3AG1 B;  1A4H A;  3W7S A;  3A0R A;  3M99 B;  1YET A;  4ASB A;  3NXS A;  1R62 A;  1U2O A;  2B5U A;  3QO5 A;  1FS0 G;  1NJI W;  3ZIA G;  2YGA A;  2ZXW C;  5FNC A;  1K7D A;  1E1Q G;  3R4O A;  1XL6 A;  2QG0 A;  4FK5 C;  3ZXQ A;  4PRV A;  2AHZ A;  4XD8 A;  2OT5 A;  1S77 D;  3TZ0 A;  5L3J A;  4PEL A;  2JDI G;  4MVZ A;  3C0E A;  3QNE A;  3T10 A;  2WPD G;  1IXM A;  2ZDI C;  1VQ9 V;  3OR6 C;  2ATK C;  3SPG A;  1THZ A;  3STZ C;  4WF9 V;  1B63 A;  1YT0 A;  4JF3 A;  2XCM A;  2XHX A;  3QDD A;  4H81 A;  2X6B A;  4MSW C;  3ZRW A;  4MS2 A;  1Z5A A;  3FKS G;  3R91 A;  1BHB A;  3TCU A;  3FB6 C;  4JTC B;  2IU0 A;  1L0O A;  3WFV A;  1I58 A;  4L87 A;  3CCS V;  1EA6 A;  2EIM B;  3CRK A;  2JIZ G;  3SYC A;  2A79 B;  4W7T A;  1NHI A;  1L1F A;  3CCM V;  4UV9 A;  4H7Q A;  4WUB A;  2O1W A;  3Q5L A;  5LGN A;  1CPY A;  2XX2 A;  3PJS K;  3ZMV A;  5D6Q A;  3LNU A;  1AI4 A;  1JCH A;  1DTO A;  2YE9 A;  1YTF B;  3CGZ A;  4MTF A;  4CWN A;  4RAI A;  1LNQ A;  4XCJ A;  3WQ9 A;  4MOT A;  5D7C A;  3T4D A;  3ASN B;  3ASO B;  1K3E A;  2EIK B;  2WEP A;  4PA7 A;  2YE3 A;  3RLP A;  4CWO A;  2QG2 A;  1UY8 A;  3OWB A;  4JAV A;  1YES A;  1G8M A;  2WLK A;  1ZWH A;  3WHA A;  4LWI A;  4RO2 A;  3JD4 A;  3T2M A;  2PI4 A;  1GTO A;  3I55 V;  1I5B A;  2YE6 A;  3MNR P;  1UYG A;  2IJI A;  4F4L A;  3OFN G;  1G4Y B;  2XHT A;  3EHG A;  1ARO P;  1E1R G;  3F5W C;  3CC2 V;  1H7S A;  1TIL A;  1MU5 A;  4P30 A;  4PA6 A;  3CCL V;  3GIE A;  2EZP A;  3HEK A;  4JGS A;  4XBF A;  2WLJ A;  1PNK A;  2EIJ B;  2A0L A;  4NH7 A;  3IFX A;  3QTF A;  1S3J A;  3SPI A;  2ZDI A;  4U7O A;  5KA6 A;  4PDR A;  2YEB A;  3LDE A;  1FXH A;  2ZQM A;  3SYQ A;  2YI0 A;  1GMG A;  2ZDY A;  3B26 A;  2Q67 A;  1KQS U;  2XX4 A;  4PL9 A;  2EIN C;  4R3M A;  4J9Z B;  4XIR A;  1M1K W;  4KTN A;  2XAG A;  3RVZ A;  2M7W A;  1K9M W;  5IDM A;  2FYP A;  4WUC A;  2YKC A;  2YKB A;  2IH1 C;  4AWP A;  3B77 A;  4EM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...