4JASA

Structural basis of a rationally rewired protein-protein interface (hk853mutant a268v, a271g, t275m, v294t and d297e and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
237
structure length
237
Chain Sequence
LKRIDRMKTEFIANISHELRTPLTVIKGYAEMIYNSLGELDLSTLKEFLETIIEQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine kinase
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
total genus 68
structure length 237
sequence length 237
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jasA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4jasA02
2XDUA 2H55A 4NH8A 2O1WA 1NHHA 5FNCA 4FCRA 1UYLA 2YK2A 3QDDA 1QYEA 2VW5A 1OSFA 4H81A 3K98A 5CTYA 4CWSA 1YC4A 2BREA 1B3QA 4MP2A 1UYCA 2VCIA 2IWSA 3HYZA 3TZ5A 4MPCA 2XHXA 1Y4SA 2XHRA 3RKZA 3B25A 3D2RA 2YEJA 4O04A 3R4OA 2WI3A 5M4MA 2CCUA 3INWA 1I59A 5BODA 1I5AA 4XTJA 3GIGB 4V25A 2CGFA 2XD6A 2YKCA 3K99A 1YSZA 1UYFA 2YKJA 3B24A 4PRXA 1YC3A 2JJCA 2WI6A 3OWDA 4XKKA 1US7A 2LFSA 2CG9A 4ASFA 4PL9A 2AKPA 1UYKA 2XABA 1NHJA 3FV5A 4E02A 4CWTA 3HZ5A 5FWKA 1H7SA 1EA6A 1QZRA 4X9LA 4R3MA 1YS3A 4XIPA 5CTWA 1JOYA 1NHIA 1Z5CA 2YEDA 2BU2A 2YEGA 1UYMA 2BYIA 2WI4A 3R4MA 2PNRA 3O0IA 4CE1A 4AWPA 2YE9A 3INXA 4ZKIA 2FTKA 4EGKA 4QPKA 2BU5A 4LPBA 3P32A 1I58A 3T0HA 1Z59A 4K4OA 4EFTA 1YERA 2XHTA 5F5RA 1U0ZA 4GT1A 4XE2A 1GJVA 4LWFA 5CF0A 1I5DA 4XDMA 4BQJA 3EHFA 2IORA 2HCHA 3EHHA 3ZKDA 4U7OA 1I5BA 2WI2A 4CWNA 1KIJA 4NH9A 4XCLA 4YKXA 4O09A 1THNA 3DGEA 2ZDYA 4GFNA 1TBWA 4MB9A 4HZ0A 1UYGA 3Q5KA 2BZ5A 2YGFA 4URMA 1AH6A 1R62A 2XCMA 2YE7A 3QTFA 1GKZA 2ESAA 4FCQA 2FWZA 3A0TA 1TH8A 2WERA 2QF6A 4XKAA 3A0RA 1Y8NA 4R1FA 4KTNA 3WHAA 1YETA 4P7AA 4YKTA 1AM1A 2QFOA 2Q8FA 1UY6A 4MPEA 1UY8A 4LP0A 3ZRVA 1TILA 3K60A 1TC0A 2YKIA 5D7RA 3EKRA 2XDKA 4R3AA 2BU6A 3H80A 2YK9A 1UY9A 3VHCA 4AS9A 4HYMA 5M4PA 2YKEA 3RLRA 4L91A 5FNFA 3CRKA 4YKZA 2ZDXA 3NXSA 2XDSA 4O07A 2YJWA 4BQGA 1B63A 1Y8OA 2CCSA 1KZNA 1U2OA 2BYHA 1BKNA 4MOTA 4P8OA 4ZVIA 4YKWA 4HZ5A 1AH8A 2WI5A 1BGQA 3A0ZA 3NMQA 4XKOA 2WWWA 4XC0A 5BOCA 1JM6A 1UY7A 5M4EA 1BXDA 3LPSA 4E01A 3PEHA 2YEBA 1UYDA 2YGEA 5D6PA 4EFUA 3R4NA 4EM7A 2QG2A 1AJ6A 3O6OA 4W7TA 5IN9A 3U67A 1ZXNA 4XD8A 4U7NA 5C93A 2YI6A 2XX4A 3T0ZA 3ZKBA 2CH4A 4ASBA 2LFRA 5B1OA 1QY8A 1ZW9A 3H4LA 4JQLA 3ZRWB 3ZRXA 2YEIA 2BSMA 3GIGA 3BM9A 3OMUA 4CE3A 4DZYA 4JYBA 2QM7A 4XITA 4CWQA 4LWGA 4CWFA 4U93A 4CWRA 2HKJA 5J71A 2YECA 1L0OA 2BU7A 3LNUA 2ZBKB 4JYCA 4LWEA 2UWDA 2GFDA 4EGHA 3JZ3A 3FT8A 1S16A 1F51A 5D7DA 3T1KA 4MTXA 2H8MA 3K97A 4BAEA 4FPPA 3B26A 1UYHA 4LWIA 2HG1A 3T10A 4JAUA 5M4NA 2IOQA 4DUHA 3MD0A 1YC1A 2QM8A 3TTZA 2O1VA 1H7UA 4CE2A 4CWOA 2FYPA 4KP4A 3VADA 2YKBA 3OWBA 1YT2A 5F3KA 2YE8A 2YEEA 4UROA 5CTUA 4MBCA 3SL2A 1GKXA 3CGZA 4XCJA 4V26A 2YEAA 3U2KA 3HHUA 3VHDA 2XX5A 3OPDA 1MX0A 3CRLA 4JAVA 3G75A 3Q5JA 3R92A 1TC6A 2Q8HA 2YE6A 3O2FA 4L90A 2K5BA 1YT0A 4O05A 4BIUA 2IOPA 2WI7A 3ZM7A 2EXLA 1IXMA 2XDXA 4QPJA 1I5CA 1Y8PA 1YESA 4ASGA 3HZ1A 2WEQA 4FMTA 3MNRP 4KSHA 2YGAA 2XJXA 2YE3A 3Q5LA 2WI1A 4E00A 4L93A 4HXZA 3CWVA 2BU8A 2GQPA 2FXSA 3GIFA 3OW6A 5FNDA 4LC1A 2XDLA 1B62A 4EGIA 2FWYA 3KE6A 4GGLA 3ZXOA 4AWQA 3CGYA 4HYPA 4YKUA 1EI1A 3RLPA 3R91A 3RLQA 4B6CA 3TZ2A 4HXWA 3TZ4A 2Q8GA 1UYEA 4MT8A 3FT5A 4EMVA 4MP7A 5J6AA 4YKRA 3TUHA 4WUCA 4GCZA 2Q8IA 2YI5A 2YI0A 5CTXA 2IWXA 5L3JA 4PU9A 5D6QA 4GQTA 3HEKA 3BMYA 2XX2A 4WUDA 4I3HA 3R4PA 4XIRA 4BXIA 4XIQA 3GIEA 3ZRWA 1ZXMA 4MPNA 2IWUA 3A0YA 1PVGA 4URLA 3G7EA 1YSRA 2XJGA 3C11A 2YEFA 3EKOA 3U2DA 3TK1A 2BT0A 3TZ0A 4Q20A 2JKIA 3D36A 4CWPA 4O0BA 2YI7A 2ZKJA 3B27A 2XK2A 3EHJA 3B28A 1UYIA 3C0EA 4H85A 3EHGA 2QG0A 2O1UA 4I5SA 1AMWA 2CCTA 1YT1A 1Z5AA 4GT8A 2XJJA 4URNA 3PEJA 2YE2A 4GEEA 4PRVA 1TIDA 3D0BA 1A4HA 3HYYA 2BRCA 5CPHA 5M4HA 3G7BA 2VCJA 5GGZA 5B1NA 2E0AA 4BIZA 4YKYA 4JASA 5M4KA 2YJXA 5IDMA 2WEPA 2BTZA 4KSGA 2YE4A 2C2AA 3T2SA 1BYQA 1S14A 4HY1A 4AWOA 1MU5A 4H7QA 4FCPA 2YE5A 1ZWHA 5IDJA 2Q2EB 4L8ZA 4KFGA 5D7CA 4KQVA 3ZXQA 3A0XA 4ASAA 3VHAA 4HY6A 3ZCCA 1Z5BA 3A0WA 3IEDA 4L94A 4B7PA 2P67A 4YKQA 2VWCA 1ID0A 1Y4UA 3WQ9A 4EEHA 2YEHA 4NH7A 4WUBA 4LWHA
chains in the Genus database with same CATH superfamily
3CCUV 2XDUA 1AJQA 4WFFA 2F4VO 1Z2GA 3CYGA 3QDDA 1QYEA 1HDJA 4WBNB 2W0XA 5JJJB 3K98A 1V55B 1VF6A 2BREA 2G38A 1UYCA 2IWSA 3HYZA 3OUFA 4MPCA 1V55C 1Y4SA 4O2BB 3BAAA 3E89A 4TQDA 1PPJH 3RKZA 5BZBA 3DXRB 4JZGA 4DV0B 1W2BU 4K3AA 1Q8IA 4DV7B 3G6BA 4X1YB 3INWA 2PYJA 3CHXA 3OMAB 3RBZA 2ZR2A 1AJNA 1QR8A 2CK3G 4UV9A 1YC3A 2YKJA 2Z5UA 1HP8A 3ETDA 2UUAB 2LFSA 4IL6Z 1R73A 2ZE8A 3CRAA 5J9PC 5LYJB 2XABA 4CZZA 3ZHUA 4LFCB 1NHJA 3FV5A 2WA4A 5GONA 3RVZA 3BEHA 5FWKA 5FNVA 1OCRB 3SJBC 2UUCO 1F4NA 1EA6A 2Q4PA 4X9LA 5A2QN 1OCRC 1Y74A 1YS3A 1BQZA 1FFXB 1JOYA 3HPLC 1N0NA 3BFRA 2K1EA 3SPCA 2JK5C 4E2LA 3RYFB 1Z5CA 1EFRG 1GN3A 3R4MA 4CE1A 2P06A 3K04A 2KG7A 2CDYA 4ZKIA 1PNKA 4LFAO 3KCXA 3W7TA 2FKXA 2FTKA 3AEIA 2E5LO 4EGKA 4NVPA 3ICXA 1O9GA 4TV8A 3OAAG 2QWNB 2CTQA 4EFTA 2CTPA 2QKAA 1GJVA 4LWFA 5CF0A 4JV5B 1YJWV 2E76B 3ZKDA 1I5BA 1KIJA 2HHHB 3E86A 3DGEA 5GTHZ 3QO8A 4MB9A 1SRYA 2BZ5A 2ZDIC 5DEDA 4URMA 4ZI7A 2CUGA 2FMLA 2OWOA 3WU2Z 5JENA 4PA6A 2RN9A 1TH8A 5KAFZ 3CRRA 3L74H 3A0RA 1M90W 1Y8NA 5EK0A 1G8MA 4OXSA 1YETA 2VWKA 3HR0A 2QWRB 2QFOA 4B08A 3CPWU 5BXZA 4UV8A 4X64O 2CH7A 2YK9A 1UY9A 5IY5B 3VHCA 4R50A 1WJZA 3RLRA 4MSWC 1RPRA 4LH6A 5FNFA 5LA6B 2VQEB 1N8RW 5IY5C 3NXSA 4FM0A 1GAXA 1XL4A 3BA8A 3OEHG 5JWPA 3ZHRA 1ZTEA 1KZNA 2HVKC 4GYCB 1ENVA 2BYHA 3T2MA 5LMUB 1U97A 1Q6HA 5E1AC 4DR5B 1IX9A 4JI1B 4ZIBA 3AG7A 2HG5C 1IDSA 4GKKO 4JI6O 3HKDB 1ZL8B 5L3BA 2WWWA 2YC0A 3LMMA 5LHGA 4GKJB 4P9PA 1JM6A 4J11A 5KHKA 2QKCA 1WAZA 5M4EA 1BXDA 3CCVV 1IZ3A 3SR2C 3OM3B 1TVKB 3ZIAG 2YEBA 2LGQA 1K3EA 1R3JC 4XD8A 2XX4A 3ZKBA 1Y4MA 4XBFA 1YIJV 4MTGA 3ZRWB 1CXZB 3T4DA 3Q4HB 2IJHA 3OMUA 1B6QA 4NXNO 5LGUA 1KBHA 2DN9A 3CWBH 2QE7G 5CBFA 4NXMO 5K1PA 4CWQA 1GN4A 4LWGA 2YEVA 4CWRA 1PM9A 1S76D 1K73W 2YECA 1L0OA 4GX0A 4QJFB 5AG2A 2GFDA 4FLZA 1F51A 3ZMSA 4MTXA 1K33A 3GWOA 2BSKB 1H2SB 3B26A 2P22C 3CC4V 2WLIA 4LF8O 1ZUQA 4TQFA 1GH6A 1DTOA 4B3RO 2QM8A 1BHAA 5EBLC 1EN5A 5B5EZ 2FYPA 3R66A 3E22A 3G67A 2ARHA 2F66C 4MVRA 2NN4A 4IHJB 4KL1A 4PDVA 5F3KA 2Q73A 4H44B 4JZ2A 4CC6A 3OUSA 3CD6V 5EZYA 3MDSA 4UROA 5IE9A 4MBCA 1GKXA 4YJ2A 3H1KH 2HKOA 4TT3G 2YEAA 2YIBD 1XNQB 1P4RA 1N34O 3VHDA 3OPDA 5J2UB 1PP9H 4J7KA 5L3EA 1NH2D 2WLJA 2ZCEA 3G75A 2DMXA 2Q8HA 2YE6A 4BIUA 2WI7A 4X65B 5JQGB 3A2FA 2JJ2G 2AZ0A 3RN4A 1BMFG 1I5CA 4XDKA 4I9WA 3JAWB 3IFXA 3MNRP 3RYHB 4KSHA 1NKDA 5BY1A 2AZ2A 1Y76B 1XNRO 5C8YB 2H3OA 4A5UB 4E00A 3UM7A 4B3TO 4LCUC 4H13B 4UB8Z 3SYCA 2GQPA 1PD3A 3HB3B 3STZC 4CS2A 2FWYA 4X9QA 3KE6A 4JI5B 2PI5A 5KHIA 1Z5WA 4X66O 3E8FA 3OTFA 4OPHA 3A0BZ 4B6CA 3TZ2A 5LOVB 2PGGA 4QE7A 3ZHTA 1R3IC 1BHBA 3K59A 1XHZA 3O9OA 1GN6A 5D5PA 2QWOB 3FX7A 2WPDG 3TUHA 1Q82W 4WUCA 2Q5ZA 4K35A 3W7WA 5L3JA 4PU9A 2HJFC 5JCOC 3G4SV 5KAIZ 4GQTA 4FLVA 2VQFB 2R9AA 3HEKA 1NR1A 4XDJA 3E8BA 2Q0OC 2HHIA 1M1KW 4XIQA 5B1BB 2R9RB 4MPNA 2IWUA 1Y6XA 1ROPA 5B1BC 3A0YA 3G7EA 5CB4A 3OTOB 1VQ9V 4FFBA 1EZJA 4I0XA 3W7XA 3JATB 3M8AA 3C11A 4PA4A 1W0KG 2X6BA 2YEFA 3EKOA 4LBEC 1XMOB 3JALB 2BT0A 3TZ0A 3D36A 2HVJC 3HKBA 4QE9A 4O0BA 4CC5A 1JR9A 2ZKJA 1DK1A 1N33B 2XK2A 3T1YB 3BVOA 1IVSA 2O1UA 2E74B 4I5SA 4DR7B 2CCTA 4FLUA 1K8AW 5B3SB 3BABA 1JVMA 5B3SC 4UCVA 3HYYA 3JARA 4QIWF 3P3NA 4IIJA 1M4UA 4X1IB 5KMGB 1GM9A 2JVDA 1NI8A 5GGZA 4JYAB 2E0AA 4BIZA 1MNGA 5M4KA 2YJXA 2Y0PA 3APOA 5IDMA 2WEPA 2DYRB 4DR6O 4O2AA 1JJ2U 1BYQA 2DYRC 1ZSPA 4HY1A 4AWOA 3VQYA 1YXBA 3U11A 4H7QA 4MVQA 3AG3B 2QKSA 5J2TA 1FXKA 4IGGA 2UXNA 4PDLA 2OCHA 4KHPB 3AG3C 5D7CA 4YIPA 2X7RB 4ASAA 5A9GA 2ZE7A 4TUYB 1YVWA 3WB1A 5JJEB 1QQCA 4PD4F 4WUBA 4B7KA 1S5LZ 3HKCA 1BL8A 4DO2A 2P90A 3T4ZA 1YJNV 4RUFA 1IBKO 3FB8C 3STLC 3HKEA 5CTYA 3K06A 4LF5O 1FJGB 2DOSA 1B3QA 2DJVA 2IJJA 5FLXN 4DV2B 1R6NA 3T1HO 2XHRA 2FYUH 2W6IG 3D2RA 4DV6O 3K0GA 2UXDO 1RSOA 2AXTZ 3JD1A 3R4OA 3IC9A 3OMIB 4R6ZA 3CC2V 3J7AU 5M4MA 2CCUA 2E75B 1I59A 1BQ0A 1I5AA 3GIGB 4V25A 3K99A 4PRXA 2JJCA 4UCRA 1XEQA 3OWDA 4F6RB 4JI2O 2P4VA 4BIOA 2UU9O 2JGDB 2QA4V 3OEEG 4P30A 2BTOA 4H0LB 2D3OW 1N32O 2F4VB 5IYDO 1H7SA 1I94O 1JFFB 4KXRA 3B4SA 2M6YA 5LGNA 4XIPA 1AI4A 1I0HA 3QVNA 2YEGA 2BYIA 2PNRA 1N4CA 3O0IA 4AWPA 1TUBA 2ETNA 3LSSA 1JX9A 1N0JA 1WN7A 1WLEA 3CXHF 1Q6UA 1CPYA 2V7QG 2ZQMA 2ZR3A 2GBOA 3FKSG 3WFVA 2CGNA 4ZHQB 5BMVB 1Z59A 1I08A 1YEWA 5F5RA 5K1XA 4NR1A 3BHPA 3EHFA 2B5UA 2JS3A 1NU1H 3AG1B 4O09A 2D2CB 3TGUH 1THNA 1ZLZA 1GRJA 1TBWA 3AG1C 2EIKB 2UUCB 1YDXA 2UXCO 1M9NA 3B77A 2EIKC 2YXHA 3CJHB 3KZIZ 1R62A 2YE7A 3QTFA 3N2GB 4FCQA 3A8TA 5CA1B 3OGIB 4X20B 4N21A 4R7CA 1I5YA 1KC8W 4KTNA 4YKTA 4LFAB 5JVDB 4RQFA 1AM1A 2Q8FA 1UY6A 4MPEA 2E5LB 1UY8A 4O4JB 3ZRVA 1TILA 4UCUA 4I4TA 4Q6GA 1WB8A 3K60A 3N2KB 4J42A 5EIBD 2LGWA 5KUKA 2XDKA 3EKRA 2BU6A 1NS1A 3K9SA 4X62O 4R8CA 1IBMO 3SPHA 1VQ6V 4AS9A 4IT5A 5M4PA 2H8PC 2IH3C 2ZKOA 2LW7A 2Z0AA 2ZDXA 2CTWA 4X88A 2C1IA 4KFMA 4L87A 1B63A 1URFA 2KB1A 2CCSA 2Y4UA 1XREA 5KA6A 1S5JA 1LR1A 3H01A 4OX9O 3BRCA 4MOTA 1B06A 5EIBC 3JAMN 2WI5A 1K4CC 1W59A 3A0ZA 3B8MA 1G1XB 1ZAUA 1VF6C 3P30A 1FD9A 4XC0A 3ZHSA 3X2QB 4AQYO 1UY7A 1XMQO 3LPSA 2N74A 3X2QC 4UVAA 2YGEA 1UYDA 5D6PA 4EM7A 3R4NA 4B7EA 4W7TA 4X64B 4AHCA 2YI6A 1OJHA 3OGCC 4O2BA 1QY8A 5CA0A 3DXRA 4LF7O 3H4LA 3W7SA 3BY6A 3ZRXA 3JAKB 4X1YA 3ZMUA 2BSMA 2YEIA 2EULA 4PI2A 1SESA 1GTOA 1DLBA 4DV1B 1K7DA 4CE3A 4DZYA 4DUZO 4HYOA 2ADQB 1Y74B 4CWFA 5LYJA 3WB2A 5EBMC 1RPOA 1FS0G 2P5OA 1MZEA 2ZE6A 2BU7A 4GKKB 2F43G 2L35A 2BE3A 4JI6B 2LW1A 3JZ3A 3FT8A 2KG7B 2UUBO 3DTUB 1S16A 3T1KA 2BTQA 1AR5A 3ZJZA 4LF9O 3K79A 3S5TA 3KG2A 1L0NH 4TV8B 1FFXA 4DR3B 1VQ5V 1NTMH 3SJQC 4LWIA 2HG1A 3RYFA 4JAUA 3RVYA 4I55B 4O4LB 5L3DA 1HR0O 1K4DC 3MD0A 1YC1A 3LDCA 1SQVH 2KSDA 4DK1A 1VQNV 5LL6Y 2XNDG 2YKBA 5IT9N 1WPXA 4YHHO 1YTFD 4PI0A 2CTRA 4NXNB 5FPRA 4NXMB 3IC7A 3B40A 1EN6A 1F4MA 2VWJA 3QNEA 3CGZA 1S0VA 4LP8A 3FAVB 1S72V 4FJCC 1Z5VA 4JAVA 1VQ8V 1YTFB 3Q5JA 3U10A 1I5XA 2K5BA 4YJ3B 2M7WA 3ZM7A 1YI2V 1IXMA 2WSSG 4BAYA 2XDXA 2CH7B 3LUTB 4LF8B 4CS3A 4BR6A 1Y8PA 4ASGA 4B3RB 2GUZB 2RDCA 2WEQA 5H9CA 2GTSA 1Q7YW 2QGNA 2IJIA 4JI4O 3KCYA 3H9VA 2A7WA 4FLXA 2X6AA 4UCSA 4FIPC 4HXZA 3K5LA 3GIFA 3OW6A 4EGIA 5LA6A 4B3MO 1FYJA 2DWDC 4GGLA 2IW5A 4AWQA 1SZTA 4GX2A 4E72A 4HYPA 5GTIZ 5KUMA 2JS5A 1N34B 3FYIB 3RLPA 3OR6C 4RO2A 4HXWA 1R1BA 1VEWA 3FB7C 2LP7A 2Q8GA 1UYEA 1EM1A 3RYIB 3IJ4A 5LP6B 2JEUA 4DRXB 2ZIMA 4MP7A 1NT2B 3R65A 1SA0B 4DUYB 3CRQA 5H6RA 2YSUB 5LP6C 3HKDA 1AILA 1ZL8A 2EILB 1UPGA 4L8JA 4GZRB 4FZ1A 3CCRV 2EILC 3AK3A 3LNMB 2QR4A 1H2LA 4DXWA 3G80A 3J80N 5CTXA 4X1KA 1SZXA 1VQKV 1MSWD 5D6QA 1XNRB 1QU7A 3ZRSA 4I9QA 1BZKA 2JIZG 2AW9A 4B3TB 1W0JG 1K5QA 4WFHA 1QLEB 4O4IB 3UT5B 3ZRWA 3FYEB 4YY3O 2DYSB 3Q4HA 1PVGA 1QLEC 1JCHA 1VMGA 4UVCA 4X66B 4DR1B 1MMMA 1BCCH 2HR3A 2C1GA 4GLXA 4Q20A 1AI6A 4CWPA 5CBHA 1TAEA 1Q5OA 1D2DA 2OCCB 3B27A 4GUNA 4J41A 3B28A 1SS3A 4P2ZA 2OCCC 4G28B 1NTKH 3C3SA 1YT1A 1Z5AA 1XHXA 4D7TA 2N04A 4GT8A 3WB0A 2XHBA 4URNA 2LQTA 2YE2A 1TIDA 4HZ3A 3CC7V 4TOIA 5M4HA 1PV0A 4J7JA 4DV3O 2GHYA 4NTYA 2VCJA 1HNZB 2YXLA 1KYOF 2Q69A 3JD4A 4JASA 4IHJA 2OIGA 2Y4TA 2UXBB 4KSGA 4JYYA 2QSAA 4DR5O 2QM4A 4UCOA 4JI3O 1RP3B 5H2FZ 3RFRA 1MU5A 2XAQA 3N27A 2FB5A 3B8NA 1ZWHA 1LUWA 4MVUA 5IDJA 4KFGA 4KQVA 3H1LH 1NH2B 3A0XA 3ETEA 3H1IH 4EB6B 3CMAV 5KHJA 3A0WA 4L94A 1E79G 2X6CA 4PELA 3L71H 2P67A 1X4TA 2LO1A 4UFZA 4CH6A 1ID0A 2YEHA 3JAWA 1AP5A 3RYHA 1VARA 1NHHA 3SPGA 1Y76A 5LHHA 4DV5O 5FNCA 2F23A 1UYLA 2NR5A 2BOCC 5EYPA 5IWAO 4DR6B 4H81A 3E83A 4CWSA 3B09A 1YC4A 4W4KA 4MP2A 1WA8B 3P3PA 1WNSA 2PF4E 3B25A 3KKYA 2ZIOA 2Y48A 2IBZH 5LOVA 1P84F 3OMNB 5BODA 4PDRA 4JTAB 4XTJA 1IBLO 2CGFA 1Y67A 1UYFA 3B24A 4K8ZA 2WI6A 3BCCH 3SPJA 3L9DA 2GTAA 4XKKA 2ITDC 4J7ZA 4ASFA 1JQ0A 4PL9A 2AKPA 5EC2C 4E02A 4K8XA 1L8DA 1AB3A 4CWTA 1THZA 5JCOA 1XBLA 2QTSA 3ABTA 3K57A 2WLNA 2RMKB 4I0XB 1HNXO 1P49A 1IBKB 5EBWC 4R3MA 3SYQA 1WPBA 4X89A 4IYHA 2YIDA 4LF5B 3TCUA 1NHIA 2BU2A 4PV1B 2IM9A 1UYMA 2WI4A 3T1HB 2YE9A 2WLLB 1AROP 4DV6B 3K0DA 3QTCA 3VQXA 3SJCC 4QPKA 3I55V 4LPBA 1GK9A 2MW2B 3JALA 3OT7A 4K4OA 4NKGB 2XHTA 2F93B 1U0ZA 4GT1A 4XE2A 1R6KA 4LNUB 1I5DA 1NBMG 4BQJA 4IIJB 4JI2B 2UU9B 2F1MA 4J9ZB 2X0LA 4NH9A 1SKVA 2FL4A 4YKXA 2OIEA 4AILC 2ZDYA 4GFNA 1N32B 4HZ0A 4K0KB 1BT8A 2ADPA 2P4KA 3CE2A 1I94B 1UYGA 5LGTA 2Z3YA 2Q7HA 1KP2A 1AH6A 1OCZB 4O2AB 3JD0A 3BPZA 1SQQH 1AJPA 2ESAA 1SF9A 4TV9B 4X1IA 4ZOLB 2WERA 1OCZC 2V1DA 3PN1A 5KX5B 3ZS8C 1SQFA 3WHAA 3K5OA 5J2TB 3ZBHA 4JPRA 2F95B 4RAIA 3K5MA 4AI8A 5ITZB 1TC0A 3TETA 5D7RA 1Q43A 5JH7B 4PA9A 4WF9V 1R6TA 4PA3A 1VQ7V 4LWSA 4DV4O 3SPIA 2YKEA 3JD3A 4L91A 3CRKA 4BQGA 4O07A 4KUMA 2YJWA 1EN4A 4FLWA 3OE7G 3HKCB 3L72H 1GO3F 5E79Z 1U96A 1AI5A 3A0HZ 2DQ3A 4MTFA 1K97A 5LMNB 2UXCB 1FXVA 4QNHB 3GWKC 4HZ5A 2ODMA 4EKWA 1AH8A 1BGQA 2OTJV 3NMQA 1PNMA 5B66Z 4JI8O 1WP7A 4LF6O 3K5NA 3K58A 5BOCA 4P9OA 1HNWO 3QG5A 4O4HB 5EC1C 2NNUA 3JASA 5IJ0B 2YI9A 2B1IA 1HW7A 1KP3A 1XILA 4EFUA 2QG2A 1AJ6A 3O6OA 5IN9A 1ZXNA 4X62B 5C93A 3E35A 5TISZ 3RYCA 4F4LA 1IBMB 2CH4A 1F23A 5B1OA 3T0ZA 2JGUA 2PUSA 2OT5A 2ZE5A 4U3JB 4JF3A 4LFBO 3QO5A 2B1GA 3ZEDA 2VS0A 3GIGA 2KQXA 3BM9A 4B3SO 3K08A 2ILMA 4JYBA 2YDEA 3LDEA 1PL4A 4OX9B 4F6RA 4U93A 3EVKA 2JGDA 1A32A 2XOKG 4I50A 2CGOA 2ZBKB 4JYCA 3CS5A 3LNUA 3OW2U 1VIBA 4LWEA 1TUBB 4HBNA 2K9PA 4E4EA 1JFFA 2VRZA 2Q7EA 5D7DA 4AQYB 2R72A 2XASA 1XMQB 1BS3A 2LJ2A 3C3TA 1MABG 2ZNJA 5LHIA 1GN2A 4FPPA 1UYHA 4BAEA 1QNMA 4RWUA 3G6EV 3U0ZA 4CH5A 1KECA 3BA9A 2YIAA 3F5TA 5DM6V 4DUHA 2Y69B 3T1CA 4DR2O 5LXTB 2O1VA 1H7UA 4LF7B 1B04A 2Y69C 2XAGA 4NTXA 4CE2A 4CWOA 4HNAB 4KP4A 3VADA 3OWBA 1MZFA 1YT2A 4LF4O 4ZHQA 5DECA 2YEEA 4DUZB 4MVMA 2L6LA 4FM1A 1AP6A 5CTUA 2IJKA 3DC5A 4JTDB 3J81N 1FPOA 2Q0AA 1JJOA 3U2KA 4JI0O 1ORQC 3GB7C 3GVMA 2O57A 2XX5A 5IYZB 2UUBB 3TJTA 3CRLA 4RUEA 3H1JH 1TC6A 3CSXA 4LH7A 2A0LA 3O2FA 3ETGA 2EX3A 3N2GA 1PNLA 2ZINA 2Q7GA 5CA1A 4O05A 4X20A 1OZ0A 3ZHQA 2QTOA 1HR0B 1D5AA 3HZ1A 2QEXV 3SDLA 2ITCC 1XDCA 5JVDA 1PKXA 4FMTA 4UB6Z 4G2KA 1FFTB 2XJXA 4QGPA 3VQWA 2YE3A 3O65A 3I56V 4FLYA 1UJWB 4YHHB 3Q5LA 3ZX6A 4D6TH 5IJ9A 2RNBA 1COWG 4YXWG 2W0FC 2XAHA 2BU8A 3VQVA 3JD2A 5F2VO 2DW4A 3CRCA 2HJDA 1N36O 5FNDA 1QLNA 3F7VC 4EFEA 2A9HA 3ZXOA 1NZ6A 3CGYA 5HFMA 1RFYA 2EIMB 4YKUA 4IYIA 1EI1A 4WBNA 3R91A 3RLQA 2EIMC 3ABKB 1J5EO 2Y0IA 3W7UA 3ABKC 4MW3A 4EMVA 4MVSA 3FD9A 1BE3H 2DWEC 3VBBA 5J6AA 1KB9F 1DF5A 3D8CA 2XAJA 5CA0B 2KKWA 3MHHC 3JSNA 5GONB 2YI5A 5FNVB 4JI4B 5H5NA 1Q3EA 3ETQA 2V4DA 2AHYA 2XX2A 1G4YB 5FL7G 1YCIA 4BXIA 1SERA 1V54B 4OGQB 2XUMA 4PHZA 1S5HC 4B3MB 1V54C 3JAKA 3CB2A 4EFBA 3CCLV 1US6A 1FAFA 2Q9LA 4CBCA 1S77D 2HLDG 2BTQB 4NTWA 1NTZH 1QHTA 4UUJC 1Q86W 3E8HA 2YI7A 3UKMA 4JI7O 1D5NA 5BR8O 3MAQA 3EHJA 3C0EA 1ZX3A 4DR4O 3SGIA 3EHGA 3JSLA 1H38A 3H1HH 1AMWA 3CRMA 1CEZA 4LR3A 4I55A 3D0BA 1X59A 4O4LA 4ZI7B 3G7BA 1DGSA 2ZM6O 3S3WA 4RQEA 3D3QA 4YY3B 3ZN0A 5B1NA 1GKFA 2JDIG 4YKYA 2JEXA 2ZDIA 1JA8A 3SYPA 2OTLV 2C2AA 3T2SA 1VF5B 1S14A 2N05A 4BW5A 1XUQA 4DV0O 1UFIA 3FAVA 2Q2EB 4DV7O 1Q90D 3ZXQA 2JJ1G 3VHAA 4YJ3A 4EEQA 1K92A 3EXAA 5LBQA 1WB7A 1P7GA 2EBOA 3AK2A 2UUAO 4CH4A 1Y4UA 3WQ9A 4EEHA 4LFCO 2YXYA 1IURA 2GUZA 4DV3B 4MTOA 1DF4A 3UO3A 2H55A 4NH8A 2O1WA 2QWQB 1G6UA 4DV1O 4FCRA 2YK2A 1VQPV 2VW5A 5D5QA 1OSFA 2AGAA 2WLKA 3CXCU 4FLTA 4H37A 4JI3B 3CCQV 4XDLA 2VCIA 3TZ5A 3EFFK 2XHXA 2EIJB 3FB5C 2OYQA 2YEJA 4O04A 2EIJC 2Q8VA 3DSQA 4N23A 2WI3A 4C7UA 2ZNIA 1Q6IA 1TVKA 2Q67A 4X1KB 4DR3O 2XD6A 2YKCA 1M93A 3RYIA 1YSZA 1KU9A 5LP6A 4DRXA 1SA0A 4GX5A 1S3JA 1US7A 2CG9A 4JV5O 1XQ8A 2YEVB 3UQ8A 1NQTA 1XL6A 1UYKA 3K9AA 2YI8A 3F5WC 2PYLA 2HHHO 2YS8A 3HZ5A 1GM7A 1OCCB 2DYSC 4BWAA 4DV5B 4I7ZB 2IU0A 1QZRA 1K9MW 1P7BA 1WP8A 1VF7A 1OCCC 4J9YB 5IWAB 3RWRD 3LDDA 2EINB 3UCSC 5CTWA 2IH1C 4UCTA 4Z1VA 1H8EG 2EINC 2WLIB 4O4IA 2YEDA 3UT5A 3INXA 3LSUA 3L75H 4DYLA 3FFQA 2WLMA 3D3IA 2BU5A 2BSKA 1H2GA 4NYKA 3P32A 1OCOB 3E22B 4H33A 1I58A 1YZBA 1IBLB 3T0HA 3TXSA 1OCOC 1YERA 2HP8A 5HFLA 2QDOA 5EZYB 4XDMA 2IORA 2HCHA 3EHHA 2VQEO 4U7OA 2WI2A 4CWNA 4YJ2B 2PZSA 4XCLA 3LSQA 1T5EA 3PJSK 3ZMZA 1AVMA 3JYCA 1OV9A 3Q5KA 2JRIA 4JGSA 4ZBMA 1HNXB 5LMUO 1KUQA 2YGFA 2XCMA 1LUVA 1NVPD 4JI1O 1GKZA 1O9HA 1YITV 2FWZA 3A0TA 3NR7A 2QF6A 1QBZA 3ML0A 4XKAA 1VQ4V 2AHZA 4D7SA 4R1FA 2PY5A 4GKJO 5J2UA 4P7AA 2A79B 4LP0A 1NR7A 1AR1B 1HWYA 2ZT9B 1H2NA 3M99B 2YKIA 1MA1A 4ABMA 4ASUG 4R3AA 4PDMA 1NVPB 5JQGA 3H80A 2EZPA 4DUYO 4HYMA 2YIBA 3JCZA 4J10A 1I7FA 4YKZA 3THOA 2XDSA 2YICA 1Y8OA 3ABLB 1K5SA 4MVOA 1QVFU 4EB6A 5C8YA 4TWKA 4FFKA 3ABLC 1KQSU 1U2OA 5EYPB 1BKNA 4P8OA 4ZVIA 4YKWA 1Q81W 2W6JG 1E1RG 2PTMA 4XKOA 3RW0A 4DW1A 1YF2A 1TGOA 4JAAA 4DR1O 4FK5C 1K34A 1FXHA 1KKCA 1SQGA 2ZD9A 2PI4A 3CEIA 4E01A 3PEHA 1LNQA 2WAMA 3RT3C 3U67A 1WA8A 4U7NA 1YHQV 1H2KA 1BSMA 5JJNB 2LFRA 1XI1A 1ZW9A 4ASBA 4DV4B 2P6JA 4JQLA 3E2EA 5CB4B 4FFBB 4JTCB 2E3CA 2QM7A 1H2MA 4PJ0Z 2ZXWB 4XITA 2WA3A 5L3FA 4DW0A 2ZXWC 2HKJA 5J71A 3HKBB 5KA5A 1HNZO 2R9IA 3VOUA 3D36C 1XNQO 4UVBA 2UWDA 2EJ7A 1L0LH 4JI8B 4LF6B 4EGHA 3RGBA 2UXDB 1HNWB 4WCEV 1J95A 2GSMB 3JATA 5IYBO 1Y66A 2UXBO 2NLJC 2H8MA 4UXNA 3K97A 3OR7C 4CS4A 1NJIW 4X65O 3T10A 3F7YC 4DK0A 3JARB 4FZ0A 2BOBC 5M4NA 1AI7A 1JPXA 2IOQA 1JMKC 2WLLA 3IGAC 3K3WA 3TTZA 3QF7A 1TUEB 1KMIZ 2UXXA 4LFBB 4G27B 4B3SB 2YE8A 5CMUA 4MVZA 4LNUA 5KMGA 4WFGA 4Z1MG 3SL2A 4JI5O 4XCJA 4V26A 2XAFA 1E1QG 2WLHA 4U3FH 4YIOA 5H6QA 1H8HG 3HHUA 1M56B 1EZVH 1FXKB 1MX0A 1SQBH 4F6EA 1M56C 3R92A 1FXKC 2YUAA 3QO7A 4L90A 1F7YA 4TV9A 1YT0A 4ZOLA 4WFAV 2IOPA 2EXLA 4QPJA 5KX5A 3CCEV 2DQ0A 4DR2B 4LWSB 1L1FA 3K03A 4J80A 1KD1W 1YESA 4WFEA 3ZMVA 4ICGA 2HEPA 1BGYH 1VQMV 2YGAA 4BW9A 5ITZA 1V9PA 1SC5B 2WI1A 4LF4B 4TUYA 2HFEC 5JH7A 5L3CA 2VQFO 2QJ1A 1SQPH 5DN6G 5KHHA 4L93A 3CWVA 3HKEB 5B1AB 3IAYA 2FXSA 4LC1A 1KKDA 1B62A 5CBGA 2XDLA 5B1AC 5CA3A 3ZN1A 3MHSC 3CYOA 4PA7A 1SQXH 3L73H 3OTOO 4JI0B 1GMGA 1RSOB 3G71V 4CH3A 2IU3A 3JASB 2GDSA 1CP9A 1RM1B 3CMEV 3TZ4A 1XMOO 4MT8A 3FT5A 3SYAA 4Z2WA 1TA8A 1RM1C 1MG1A 4FVMA 1EBOA 2R70A 4YKRA 1IXBA 3OD4A 3RYCB 4MW8A 1N33O 3L70H 1ZWIC 3T1YO 1QR9A 2H94A 4O4HA 3CCJV 4GCZA 2Q8IA 3ASNB 4DR7O 5IJ0A 2YI0A 1FKAO 2IWXA 3WG7B 4W4LA 1PL0A 3ASNC 3WG7C 2MK3A 3LNNA 3BMYA 4WUDA 4I3HA 3R4PA 4WFBV 1QCEA 4XIRA 3EHBB 1N36B 2EZOA 3GIEA 4U3JA 3M7MX 4JYAO 1ZXMA 3ABUA 4I50B 1R3KC 4MS2A 4OPAA 4URLA 1M5IA 4K0KO 1YSRA 2XJGA 3C90A 3FB6C 1J5EB 3U2DA 5GW7A 3TK1A 2RJZA 2JKIA 1YJ9V 5KHGA 2RQ6A 1VQLV 3ASOB 2B9ZA 1GM8A 5KLVH 3ZMTA 2QWPB 3ASOC 3AK1A 2CE4A 3B2EE 3OFNG 3DC6A 1VP7A 3ABMB 1UYIA 4H85A 4KHPO 2XTAA 1MOFA 2QG0A 3UO2A 3ABMC 3CCMV 4HAMA 3SYOA 5BMVA 5CN0A 2Q6AA 2XJJA 3PEJA 4GEEA 4PRVA 2P7TC 1A4HA 3I5DA 2BRCA 5CPHA 4NB5A 1XOUA 1VQOV 2A06H 5LXTA 1QVGU 3CCSV 3JCUZ 4HNAA 2EJRA 3AG2B 3CP1A 3CX5F 1R3LC 3SJAC 2CAZC 2DE0X 2BTZA 4LF9B 5LMNO 3AG2C 3CJHA 4I4TB 2A3QA 2YE4A 4X8AA 3AG4B 1FJGO 4DV2O 3AG4C 5L3GA 1MSDA 2Q68A 4FCPA 4JI7B 3ZHVA 2YE5A 5FPOA 5BR8B 1YSCA 5IYZA 4L8ZA 2ATKC 4DR4B 4O4JA 4FM2A 4TSFG 1M57B 1OHHG 4HY6A 3N2KA 2GV9A 3TXQA 3ZCCA 1Z5BA 2XT9A 5IYCO 1M57C 3IEDA 2RCVA 5IJ9B 3APQA 2BCCH 4B7PA 3S3XA 1SETA 4GX1A 2VWCA 4YKQA 3E8GA 4NH7A 1AR4A 2ZM6B 4LWHA
chains in the Genus database with same CATH topology
3CCUV 2XDUA 1AJQA 4WFFA 3QDDA 1QYEA 3K98A 1V55B 2BREA 1UYCA 2IWSA 3HYZA 3OUFA 4MPCA 1V55C 1Y4SA 3E89A 3RKZA 5BZBA 1W2BU 3INWA 3OMAB 3RBZA 2ZR2A 1AJNA 1QR8A 2CK3G 4UV9A 1YC3A 2YKJA 2Z5UA 3ETDA 2LFSA 1R73A 5J9PC 2XABA 4CZZA 1NHJA 3FV5A 3RVZA 3BEHA 5FWKA 1OCRB 1F4NA 1EA6A 4X9LA 1OCRC 1YS3A 1JOYA 3HPLC 3SPCA 2K1EA 1Z5CA 2JK5C 4E2LA 1EFRG 3R4MA 4CE1A 3K04A 4ZKIA 1PNKA 3W7TA 3AEIA 2FTKA 4EGKA 3OAAG 4EFTA 1GJVA 4LWFA 5CF0A 1YJWV 3ZKDA 1I5BA 1KIJA 3E86A 3DGEA 3QO8A 4MB9A 1SRYA 2BZ5A 2ZDIC 4URMA 4PA6A 1TH8A 3A0RA 1M90W 1Y8NA 5EK0A 1G8MA 4OXSA 1YETA 2QFOA 3CPWU 4UV8A 2YK9A 1UY9A 5IY5B 3VHCA 4R50A 3RLRA 4MSWC 1RPRA 5FNFA 1N8RW 5IY5C 3NXSA 1XL4A 3OEHG 1KZNA 2HVKC 1ENVA 2BYHA 3T2MA 5E1AC 2HG5C 5L3BA 2WWWA 5LHGA 4P9PA 1JM6A 5M4EA 1BXDA 3CCVV 3OM3B 3ZIAG 2YEBA 1K3EA 1R3JC 4XD8A 2XX4A 3ZKBA 1Y4MA 4XBFA 1YIJV 4MTGA 3ZRWB 3T4DA 2IJHA 3OMUA 1B6QA 5LGUA 2QE7G 5CBFA 4CWQA 4LWGA 2YEVA 4CWRA 1S76D 1K73W 2YECA 1L0OA 4GX0A 4QJFB 2GFDA 1F51A 3ZMSA 4MTXA 1K33A 3GWOA 3B26A 3CC4V 2WLIA 1DTOA 2QM8A 1BHAA 5EBLC 2FYPA 4MVRA 4PDVA 5F3KA 3OUSA 3CD6V 4UROA 4MBCA 1GKXA 4TT3G 2HKOA 2YEAA 1P4RA 3VHDA 3OPDA 1NH2D 5L3EA 2WLJA 3G75A 2Q8HA 2YE6A 4BIUA 2WI7A 2JJ2G 1BMFG 1I5CA 4XDKA 4I9WA 3IFXA 3MNRP 4KSHA 1NKDA 4E00A 3UM7A 4LCUC 2GQPA 3SYCA 1PD3A 3HB3B 3STZC 2FWYA 3KE6A 2PI5A 3E8FA 4B6CA 3TZ2A 4QE7A 1R3IC 1BHBA 2WPDG 3TUHA 1Q82W 4WUCA 3W7WA 5L3JA 4PU9A 2HJFC 3G4SV 4GQTA 3HEKA 1NR1A 4XDJA 3E8BA 1M1KW 4XIQA 5B1BB 2R9RB 4MPNA 2IWUA 1ROPA 5B1BC 3A0YA 3G7EA 1VQ9V 1EZJA 3W7XA 3C11A 4PA4A 1W0KG 2X6BA 2YEFA 3EKOA 4LBEC 2BT0A 3TZ0A 3D36A 2HVJC 4QE9A 4O0BA 2ZKJA 2XK2A 2O1UA 4I5SA 2CCTA 1K8AW 5B3SB 1JVMA 5B3SC 3HYYA 4QIWF 1GM9A 5GGZA 2E0AA 4BIZA 5M4KA 2YJXA 5IDMA 2WEPA 2DYRB 1JJ2U 1BYQA 2DYRC 4HY1A 4AWOA 4H7QA 4MVQA 3AG3B 2QKSA 1FXKA 2UXNA 4PDLA 3AG3C 5D7CA 2X7RB 4ASAA 4WUBA 1BL8A 4DO2A 2P90A 3T4ZA 1YJNV 4RUFA 3FB8C 3STLC 5CTYA 3K06A 1B3QA 2IJJA 1R6NA 2XHRA 2W6IG 3D2RA 3K0GA 3JD1A 3R4OA 3OMIB 4R6ZA 3CC2V 5M4MA 2CCUA 1I59A 1I5AA 3GIGB 4V25A 3K99A 4PRXA 2JJCA 3OWDA 2QA4V 3OEEG 4P30A 2D3OW 5IYDO 1H7SA 5LGNA 4XIPA 1AI4A 2YEGA 2BYIA 2PNRA 3O0IA 4AWPA 3LSSA 1JX9A 1WLEA 1CPYA 2V7QG 2ZQMA 2ZR3A 3FKSG 3WFVA 1Z59A 5F5RA 3EHFA 2B5UA 3AG1B 4O09A 1THNA 1TBWA 3AG1C 2EIKB 1M9NA 3B77A 2EIKC 1R62A 2YE7A 3QTFA 4FCQA 4N21A 4R7CA 1I5YA 1KC8W 4KTNA 4YKTA 1AM1A 4RQFA 2Q8FA 1UY6A 4MPEA 1UY8A 3ZRVA 1TILA 3K60A 5KUKA 2XDKA 3EKRA 2BU6A 4R8CA 3SPHA 1VQ6V 4AS9A 5M4PA 2H8PC 2IH3C 2ZDXA 4X88A 4KFMA 4L87A 1B63A 2KB1A 2CCSA 5KA6A 3H01A 4MOTA 2WI5A 1K4CC 3A0ZA 3B8MA 3P30A 4XC0A 3X2QB 1UY7A 3LPSA 3X2QC 4UVAA 2YGEA 1UYDA 5D6PA 4EM7A 3R4NA 4W7TA 2YI6A 3OGCC 1QY8A 3H4LA 3W7SA 3BY6A 3ZRXA 3ZMUA 2YEIA 2BSMA 1SESA 1GTOA 1DLBA 1K7DA 4CE3A 4DZYA 4HYOA 4CWFA 5EBMC 1RPOA 1FS0G 2BU7A 2F43G 3JZ3A 3FT8A 1S16A 3DTUB 3T1KA 3ZJZA 3K79A 3KG2A 1VQ5V 3SJQC 4LWIA 2HG1A 4JAUA 3RVYA 5L3DA 1K4DC 3MD0A 1YC1A 3LDCA 1VQNV 2XNDG 2YKBA 1WPXA 1YTFD 3IC7A 1F4MA 3QNEA 3CGZA 1S0VA 4LP8A 1S72V 4FJCC 4JAVA 1VQ8V 1YTFB 3Q5JA 1I5XA 2K5BA 2M7WA 3ZM7A 1YI2V 1IXMA 2WSSG 4BAYA 2XDXA 3LUTB 1Y8PA 4ASGA 2WEQA 5H9CA 1Q7YW 2IJIA 2X6AA 4FIPC 4HXZA 3GIFA 3OW6A 4EGIA 2DWDC 4GGLA 2IW5A 4AWQA 1SZTA 4GX2A 4HYPA 5KUMA 3FYIB 3RLPA 3OR6C 4RO2A 4HXWA 3FB7C 2LP7A 2Q8GA 1UYEA 2JEUA 4MP7A 3R65A 2YSUB 5H6RA 2EILB 3CCRV 2EILC 3LNMB 4DXWA 5CTXA 1VQKV 1MSWD 5D6QA 3ZRSA 2JIZG 1W0JG 1K5QA 4WFHA 1QLEB 3ZRWA 3FYEB 2DYSB 1PVGA 1QLEC 1JCHA 4UVCA 2HR3A 4Q20A 1AI6A 4CWPA 5CBHA 2OCCB 3B27A 3B28A 4P2ZA 2OCCC 4G28B 1YT1A 1Z5AA 4GT8A 4URNA 2YE2A 1TIDA 4HZ3A 3CC7V 5M4HA 2GHYA 2VCJA 2Q69A 3JD4A 4JASA 4KSGA 1MU5A 2XAQA 3B8NA 1ZWHA 4MVUA 5IDJA 4KFGA 4KQVA 1NH2B 3A0XA 3ETEA 3CMAV 3A0WA 4L94A 1E79G 2X6CA 4PELA 2P67A 1ID0A 2YEHA 1NHHA 3SPGA 5LHHA 5FNCA 1UYLA 2BOCC 4H81A 3E83A 4CWSA 1YC4A 4MP2A 3B25A 2Y48A 3OMNB 5BODA 4PDRA 4JTAB 4XTJA 2CGFA 1UYFA 3B24A 2WI6A 3SPJA 4XKKA 2ITDC 4ASFA 1JQ0A 4PL9A 2AKPA 5EC2C 4E02A 4CWTA 1THZA 3ABTA 2WLNA 5EBWC 4R3MA 3SYQA 4X89A 3TCUA 1NHIA 2BU2A 1UYMA 2WI4A 2YE9A 2WLLB 1AROP 3K0DA 4QPKA 3I55V 4LPBA 1GK9A 4K4OA 2XHTA 1U0ZA 4GT1A 4XE2A 1R6KA 1I5DA 1NBMG 4BQJA 4J9ZB 2X0LA 4NH9A 4YKXA 2ZDYA 4GFNA 4HZ0A 1UYGA 5LGTA 2Z3YA 1KP2A 1AH6A 1OCZB 3JD0A 1AJPA 2ESAA 2WERA 1OCZC 2V1DA 3WHAA 4JPRA 4RAIA 1TC0A 3TETA 5D7RA 4PA9A 4WF9V 4PA3A 1VQ7V 3SPIA 2YKEA 3JD3A 4L91A 3CRKA 4BQGA 4O07A 4KUMA 2YJWA 3OE7G 1GO3F 1AI5A 2DQ3A 4MTFA 1K97A 1FXVA 4QNHB 4HZ5A 4EKWA 1AH8A 1BGQA 2OTJV 3NMQA 1PNMA 5BOCA 4P9OA 5EC1C 2NNUA 2B1IA 1KP3A 4EFUA 2QG2A 1AJ6A 3O6OA 5IN9A 1ZXNA 5C93A 3E35A 3T0ZA 4F4LA 2CH4A 1F23A 5B1OA 2OT5A 4JF3A 3QO5A 2B1GA 3GIGA 3BM9A 3K08A 4JYBA 3LDEA 4U93A 2XOKG 3LNUA 2ZBKB 4JYCA 3OW2U 4LWEA 5D7DA 2XASA 5LHIA 4BAEA 1MABG 4FPPA 1UYHA 3G6EV 1KECA 5DM6V 4DUHA 2Y69B 3T1CA 2O1VA 1H7UA 2Y69C 2XAGA 4CE2A 4CWOA 4KP4A 3VADA 3OWBA 1YT2A 2YEEA 4MVMA 5CTUA 2IJKA 4JTDB 3U2KA 1ORQC 3GB7C 2XX5A 3CRLA 4RUEA 1TC6A 2A0LA 3O2FA 3ETGA 1PNLA 4O05A 1OZ0A 2QTOA 3HZ1A 2QEXV 2ITCC 1PKXA 4FMTA 4G2KA 1FFTB 2XJXA 2YE3A 3I56V 1UJWB 3Q5LA 1COWG 4YXWG 2W0FC 2XAHA 2BU8A 3JD2A 2DW4A 5FNDA 1QLNA 3F7VC 2A9HA 3ZXOA 3CGYA 5HFMA 2EIMB 4YKUA 1EI1A 3R91A 3RLQA 2EIMC 3ABKB 3W7UA 3ABKC 4MW3A 4EMVA 4MVSA 2DWEC 3VBBA 5J6AA 1DF5A 2XAJA 3MHHC 2YI5A 2AHYA 2XX2A 1G4YB 5FL7G 4BXIA 1SERA 1V54B 1S5HC 1V54C 3CCLV 4CBCA 1S77D 2HLDG 4UUJC 1Q86W 3E8HA 2YI7A 3UKMA 3EHJA 3C0EA 3EHGA 1H38A 1AMWA 1CEZA 3D0BA 3G7BA 4RQEA 3ZN0A 5B1NA 1GKFA 2JDIG 4YKYA 2JEXA 2ZDIA 3SYPA 2OTLV 2C2AA 3T2SA 1S14A 4BW5A 2Q2EB 3ZXQA 2JJ1G 3VHAA 1K92A 5LBQA 2EBOA 1Y4UA 3WQ9A 4EEHA 4MTOA 1DF4A 2H55A 4NH8A 2O1WA 4FCRA 2YK2A 1VQPV 2VW5A 1OSFA 2WLKA 3CXCU 4H37A 3CCQV 4XDLA 2VCIA 3TZ5A 3EFFK 2XHXA 2EIJB 3FB5C 2YEJA 4O04A 2EIJC 4N23A 2WI3A 2Q67A 2XD6A 2YKCA 1YSZA 4GX5A 1S3JA 1US7A 2CG9A 2YEVB 1NQTA 1XL6A 1UYKA 3K9AA 3F5WC 3HZ5A 1GM7A 1OCCB 2DYSC 2IU0A 1QZRA 1K9MW 1P7BA 1OCCC 4J9YB 3LDDA 2EINB 5CTWA 2IH1C 1H8EG 2EINC 2WLIB 2YEDA 3INXA 2WLMA 3D3IA 2BU5A 1H2GA 3P32A 1OCOB 4H33A 1I58A 3T0HA 1OCOC 1YERA 5HFLA 4XDMA 2IORA 2HCHA 3EHHA 4U7OA 2WI2A 4CWNA 4XCLA 3LSQA 3PJSK 3ZMZA 3JYCA 3Q5KA 4JGSA 4ZBMA 2YGFA 2XCMA 1NVPD 1GKZA 1YITV 2FWZA 3A0TA 2QF6A 1QBZA 3ML0A 4XKAA 1VQ4V 2AHZA 4R1FA 4P7AA 2A79B 4LP0A 1NR7A 1AR1B 1HWYA 3M99B 2YKIA 4R3AA 4ASUG 4PDMA 1NVPB 3H80A 2EZPA 4HYMA 3JCZA 4YKZA 2XDSA 1Y8OA 3ABLB 1K5SA 4MVOA 1QVFU 4TWKA 3ABLC 1KQSU 1U2OA 1BKNA 4P8OA 4ZVIA 4YKWA 1Q81W 2W6JG 1E1RG 4XKOA 3RW0A 4FK5C 1K34A 1FXHA 2PI4A 2ZD9A 4E01A 3PEHA 1LNQA 2WAMA 3U67A 4U7NA 1YHQV 4ASBA 2LFRA 1ZW9A 2P6JA 4JQLA 3E2EA 4JTCB 2QM7A 2ZXWB 4XITA 5L3FA 2ZXWC 2HKJA 5J71A 5KA5A 2R9IA 3VOUA 4UVBA 2UWDA 4EGHA 4WCEV 1J95A 2GSMB 5IYBO 1Y66A 2NLJC 2H8MA 4UXNA 3K97A 3OR7C 1NJIW 3T10A 3F7YC 5M4NA 2BOBC 1AI7A 1JPXA 2IOQA 2WLLA 3IGAC 3K3WA 3TTZA 1TUEB 2UXXA 4G27B 2YE8A 5CMUA 4MVZA 4WFGA 4Z1MG 3SL2A 4XCJA 4V26A 2XAFA 1E1QG 2WLHA 5H6QA 1H8HG 3HHUA 1M56B 1FXKB 1MX0A 1M56C 3R92A 1FXKC 3QO7A 4L90A 1YT0A 4WFAV 2IOPA 2EXLA 4QPJA 3CCEV 2DQ0A 1KD1W 1YESA 1L1FA 3K03A 4WFEA 3ZMVA 1VQMV 2YGAA 2WI1A 2HFEC 5L3CA 5DN6G 4L93A 3CWVA 5B1AB 2FXSA 4LC1A 1KKDA 1B62A 5CBGA 2XDLA 5B1AC 5CA3A 3ZN1A 3MHSC 3CYOA 4PA7A 1GMGA 3G71V 2IU3A 1CP9A 1RM1B 3CMEV 3TZ4A 4MT8A 3FT5A 3SYAA 1RM1C 1MG1A 1EBOA 4YKRA 4MW8A 1ZWIC 1QR9A 2H94A 3CCJV 4GCZA 2Q8IA 3ASNB 2YI0A 2IWXA 3WG7B 1PL0A 3ASNC 3WG7C 2MK3A 3BMYA 4WUDA 4I3HA 3R4PA 4WFBV 1QCEA 4XIRA 3EHBB 2EZOA 3GIEA 1ZXMA 3ABUA 1R3KC 4MS2A 4URLA 1YSRA 2XJGA 3FB6C 3U2DA 5GW7A 3TK1A 2JKIA 1YJ9V 1VQLV 3ASOB 1GM8A 3ZMTA 3ASOC 3OFNG 3ABMB 1UYIA 4H85A 2QG0A 1MOFA 3ABMC 3CCMV 4HAMA 3SYOA 5CN0A 2Q6AA 2XJJA 3PEJA 4GEEA 4PRVA 2P7TC 1A4HA 2BRCA 5CPHA 1VQOV 1QVGU 3CCSV 2EJRA 3AG2B 3CP1A 1R3LC 2BTZA 3AG2C 2YE4A 4X8AA 3AG4B 3AG4C 5L3GA 2Q68A 4FCPA 2YE5A 1YSCA 4L8ZA 2ATKC 4TSFG 1M57B 1OHHG 4HY6A 3ZCCA 1Z5BA 5IYCO 1M57C 3IEDA 4B7PA 1SETA 4GX1A 2VWCA 4YKQA 3E8GA 4NH7A 4LWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDU A;  2H55 A;  4NH8 A;  2O1W A;  1NHH A;  5FNC A;  4FCR A;  1UYL A;  2YK2 A;  3QDD A;  1QYE A;  2VW5 A;  1OSF A;  4H81 A;  3K98 A;  5CTY A;  4CWS A;  1YC4 A;  2BRE A;  1B3Q A;  4MP2 A;  1UYC A;  2VCI A;  2IWS A;  3HYZ A;  3TZ5 A;  4MPC A;  2XHX A;  1Y4S A;  2XHR A;  3RKZ A;  3B25 A;  3D2R A;  2YEJ A;  4O04 A;  3R4O A;  2WI3 A;  5M4M A;  2CCU A;  3INW A;  1I59 A;  5BOD A;  1I5A A;  4XTJ A;  3GIG B;  4V25 A;  2CGF A;  2XD6 A;  2YKC A;  3K99 A;  1YSZ A;  1UYF A;  2YKJ A;  3B24 A;  4PRX A;  1YC3 A;  2JJC A;  2WI6 A;  3OWD A;  4XKK A;  1US7 A;  2LFS A;  2CG9 A;  4ASF A;  4PL9 A;  2AKP A;  1UYK A;  2XAB A;  1NHJ A;  3FV5 A;  4E02 A;  4CWT A;  3HZ5 A;  5FWK A;  1H7S A;  1EA6 A;  1QZR A;  4X9L A;  4R3M A;  1YS3 A;  4XIP A;  5CTW A;  1JOY A;  1NHI A;  1Z5C A;  2YED A;  2BU2 A;  2YEG A;  1UYM A;  2BYI A;  2WI4 A;  3R4M A;  2PNR A;  3O0I A;  4CE1 A;  4AWP A;  2YE9 A;  3INX A;  4ZKI A;  2FTK A;  4EGK A;  4QPK A;  2BU5 A;  4LPB A;  3P32 A;  1I58 A;  3T0H A;  1Z59 A;  4K4O A;  4EFT A;  1YER A;  2XHT A;  5F5R A;  1U0Z A;  4GT1 A;  4XE2 A;  1GJV A;  4LWF A;  5CF0 A;  1I5D A;  4XDM A;  4BQJ A;  3EHF A;  2IOR A;  2HCH A;  3EHH A;  3ZKD A;  4U7O A;  1I5B A;  2WI2 A;  4CWN A;  1KIJ A;  4NH9 A;  4XCL A;  4YKX A;  4O09 A;  1THN A;  3DGE A;  2ZDY A;  4GFN A;  1TBW A;  4MB9 A;  4HZ0 A;  1UYG A;  3Q5K A;  2BZ5 A;  2YGF A;  4URM A;  1AH6 A;  1R62 A;  2XCM A;  2YE7 A;  3QTF A;  1GKZ A;  2ESA A;  4FCQ A;  2FWZ A;  3A0T A;  1TH8 A;  2WER A;  2QF6 A;  4XKA A;  3A0R A;  1Y8N A;  4R1F A;  4KTN A;  3WHA A;  1YET A;  4P7A A;  4YKT A;  1AM1 A;  2QFO A;  2Q8F A;  1UY6 A;  4MPE A;  1UY8 A;  4LP0 A;  3ZRV A;  1TIL A;  3K60 A;  1TC0 A;  2YKI A;  5D7R A;  3EKR A;  2XDK A;  4R3A A;  2BU6 A;  3H80 A;  2YK9 A;  1UY9 A;  3VHC A;  4AS9 A;  4HYM A;  5M4P A;  2YKE A;  3RLR A;  4L91 A;  5FNF A;  3CRK A;  4YKZ A;  2ZDX A;  3NXS A;  2XDS A;  4O07 A;  2YJW A;  4BQG A;  1B63 A;  1Y8O A;  2CCS A;  1KZN A;  1U2O A;  2BYH A;  1BKN A;  4MOT A;  4P8O A;  4ZVI A;  4YKW A;  4HZ5 A;  1AH8 A;  2WI5 A;  1BGQ A;  3A0Z A;  3NMQ A;  4XKO A;  2WWW A;  4XC0 A;  5BOC A;  1JM6 A;  1UY7 A;  5M4E A;  1BXD A;  3LPS A;  4E01 A;  3PEH A;  2YEB A;  1UYD A;  2YGE A;  5D6P A;  4EFU A;  3R4N A;  4EM7 A;  2QG2 A;  1AJ6 A;  3O6O A;  4W7T A;  5IN9 A;  3U67 A;  1ZXN A;  4XD8 A;  4U7N A;  5C93 A;  2YI6 A;  2XX4 A;  3T0Z A;  3ZKB A;  2CH4 A;  4ASB A;  2LFR A;  5B1O A;  1QY8 A;  1ZW9 A;  3H4L A;  4JQL A;  3ZRW B;  3ZRX A;  2YEI A;  2BSM A;  3GIG A;  3BM9 A;  3OMU A;  4CE3 A;  4DZY A;  4JYB A;  2QM7 A;  4XIT A;  4CWQ A;  4LWG A;  4CWF A;  4U93 A;  4CWR A;  2HKJ A;  5J71 A;  2YEC A;  1L0O A;  2BU7 A;  3LNU A;  2ZBK B;  4JYC A;  4LWE A;  2UWD A;  2GFD A;  4EGH A;  3JZ3 A;  3FT8 A;  1S16 A;  1F51 A;  5D7D A;  3T1K A;  4MTX A;  2H8M A;  3K97 A;  4BAE A;  4FPP A;  3B26 A;  1UYH A;  4LWI A;  2HG1 A;  3T10 A;  4JAU A;  5M4N A;  2IOQ A;  4DUH A;  3MD0 A;  1YC1 A;  2QM8 A;  3TTZ A;  2O1V A;  1H7U A;  4CE2 A;  4CWO A;  2FYP A;  4KP4 A;  3VAD A;  2YKB A;  3OWB A;  1YT2 A;  5F3K A;  2YE8 A;  2YEE A;  4URO A;  5CTU A;  4MBC A;  3SL2 A;  1GKX A;  3CGZ A;  4XCJ A;  4V26 A;  2YEA A;  3U2K A;  3HHU A;  3VHD A;  2XX5 A;  3OPD A;  1MX0 A;  3CRL A;  4JAV A;  3G75 A;  3Q5J A;  3R92 A;  1TC6 A;  2Q8H A;  2YE6 A;  3O2F A;  4L90 A;  2K5B A;  1YT0 A;  4O05 A;  4BIU A;  2IOP A;  2WI7 A;  3ZM7 A;  2EXL A;  1IXM A;  2XDX A;  4QPJ A;  1I5C A;  1Y8P A;  1YES A;  4ASG A;  3HZ1 A;  2WEQ A;  4FMT A;  3MNR P;  4KSH A;  2YGA A;  2XJX A;  2YE3 A;  3Q5L A;  2WI1 A;  4E00 A;  4L93 A;  4HXZ A;  3CWV A;  2BU8 A;  2GQP A;  2FXS A;  3GIF A;  3OW6 A;  5FND A;  4LC1 A;  2XDL A;  1B62 A;  4EGI A;  2FWY A;  3KE6 A;  4GGL A;  3ZXO A;  4AWQ A;  3CGY A;  4HYP A;  4YKU A;  1EI1 A;  3RLP A;  3R91 A;  3RLQ A;  4B6C A;  3TZ2 A;  4HXW A;  3TZ4 A;  2Q8G A;  1UYE A;  4MT8 A;  3FT5 A;  4EMV A;  4MP7 A;  5J6A A;  4YKR A;  3TUH A;  4WUC A;  4GCZ A;  2Q8I A;  2YI5 A;  2YI0 A;  5CTX A;  2IWX A;  5L3J A;  4PU9 A;  5D6Q A;  4GQT A;  3HEK A;  3BMY A;  2XX2 A;  4WUD A;  4I3H A;  3R4P A;  4XIR A;  4BXI A;  4XIQ A;  3GIE A;  3ZRW A;  1ZXM A;  4MPN A;  2IWU A;  3A0Y A;  1PVG A;  4URL A;  3G7E A;  1YSR A;  2XJG A;  3C11 A;  2YEF A;  3EKO A;  3U2D A;  3TK1 A;  2BT0 A;  3TZ0 A;  4Q20 A;  2JKI A;  3D36 A;  4CWP A;  4O0B A;  2YI7 A;  2ZKJ A;  3B27 A;  2XK2 A;  3EHJ A;  3B28 A;  1UYI A;  3C0E A;  4H85 A;  3EHG A;  2QG0 A;  2O1U A;  4I5S A;  1AMW A;  2CCT A;  1YT1 A;  1Z5A A;  4GT8 A;  2XJJ A;  4URN A;  3PEJ A;  2YE2 A;  4GEE A;  4PRV A;  1TID A;  3D0B A;  1A4H A;  3HYY A;  2BRC A;  5CPH A;  5M4H A;  3G7B A;  2VCJ A;  5GGZ A;  5B1N A;  2E0A A;  4BIZ A;  4YKY A;  4JAS A;  5M4K A;  2YJX A;  5IDM A;  2WEP A;  2BTZ A;  4KSG A;  2YE4 A;  2C2A A;  3T2S A;  1BYQ A;  1S14 A;  4HY1 A;  4AWO A;  1MU5 A;  4H7Q A;  4FCP A;  2YE5 A;  1ZWH A;  5IDJ A;  2Q2E B;  4L8Z A;  4KFG A;  5D7C A;  4KQV A;  3ZXQ A;  3A0X A;  4ASA A;  3VHA A;  4HY6 A;  3ZCC A;  1Z5B A;  3A0W A;  3IED A;  4L94 A;  4B7P A;  2P67 A;  4YKQ A;  2VWC A;  1ID0 A;  1Y4U A;  3WQ9 A;  4EEH A;  2YEH A;  4NH7 A;  4WUB A;  4LWH A; 
#chains in the Genus database with same CATH topology
 3CCU V;  2XDU A;  1AJQ A;  4WFF A;  2F4V O;  1Z2G A;  3CYG A;  3QDD A;  1QYE A;  1HDJ A;  4WBN B;  2W0X A;  5JJJ B;  3K98 A;  1V55 B;  1VF6 A;  2BRE A;  2G38 A;  1UYC A;  2IWS A;  3HYZ A;  3OUF A;  4MPC A;  1V55 C;  1Y4S A;  4O2B B;  3BAA A;  3E89 A;  4TQD A;  1PPJ H;  3RKZ A;  5BZB A;  3DXR B;  4JZG A;  4DV0 B;  1W2B U;  4K3A A;  1Q8I A;  4DV7 B;  3G6B A;  4X1Y B;  3INW A;  2PYJ A;  3CHX A;  3OMA B;  3RBZ A;  2ZR2 A;  1AJN A;  1QR8 A;  2CK3 G;  4UV9 A;  1YC3 A;  2YKJ A;  2Z5U A;  1HP8 A;  3ETD A;  2UUA B;  2LFS A;  4IL6 Z;  1R73 A;  2ZE8 A;  3CRA A;  5J9P C;  5LYJ B;  2XAB A;  4CZZ A;  3ZHU A;  4LFC B;  1NHJ A;  3FV5 A;  2WA4 A;  5GON A;  3RVZ A;  3BEH A;  5FWK A;  5FNV A;  1OCR B;  3SJB C;  2UUC O;  1F4N A;  1EA6 A;  2Q4P A;  4X9L A;  5A2Q N;  1OCR C;  1Y74 A;  1YS3 A;  1BQZ A;  1FFX B;  1JOY A;  3HPL C;  1N0N A;  3BFR A;  2K1E A;  3SPC A;  2JK5 C;  4E2L A;  3RYF B;  1Z5C A;  1EFR G;  1GN3 A;  3R4M A;  4CE1 A;  2P06 A;  3K04 A;  2KG7 A;  2CDY A;  4ZKI A;  1PNK A;  4LFA O;  3KCX A;  3W7T A;  2FKX A;  2FTK A;  3AEI A;  2E5L O;  4EGK A;  4NVP A;  3ICX A;  1O9G A;  4TV8 A;  3OAA G;  2QWN B;  2CTQ A;  4EFT A;  2CTP A;  2QKA A;  1GJV A;  4LWF A;  5CF0 A;  4JV5 B;  1YJW V;  2E76 B;  3ZKD A;  1I5B A;  1KIJ A;  2HHH B;  3E86 A;  3DGE A;  5GTH Z;  3QO8 A;  4MB9 A;  1SRY A;  2BZ5 A;  2ZDI C;  5DED A;  4URM A;  4ZI7 A;  2CUG A;  2FML A;  2OWO A;  3WU2 Z;  5JEN A;  4PA6 A;  2RN9 A;  1TH8 A;  5KAF Z;  3CRR A;  3L74 H;  3A0R A;  1M90 W;  1Y8N A;  5EK0 A;  1G8M A;  4OXS A;  1YET A;  2VWK A;  3HR0 A;  2QWR B;  2QFO A;  4B08 A;  3CPW U;  5BXZ A;  4UV8 A;  4X64 O;  2CH7 A;  2YK9 A;  1UY9 A;  5IY5 B;  3VHC A;  4R50 A;  1WJZ A;  3RLR A;  4MSW C;  1RPR A;  4LH6 A;  5FNF A;  5LA6 B;  2VQE B;  1N8R W;  5IY5 C;  3NXS A;  4FM0 A;  1GAX A;  1XL4 A;  3BA8 A;  3OEH G;  5JWP A;  3ZHR A;  1ZTE A;  1KZN A;  2HVK C;  4GYC B;  1ENV A;  2BYH A;  3T2M A;  5LMU B;  1U97 A;  1Q6H A;  5E1A C;  4DR5 B;  1IX9 A;  4JI1 B;  4ZIB A;  3AG7 A;  2HG5 C;  1IDS A;  4GKK O;  4JI6 O;  3HKD B;  1ZL8 B;  5L3B A;  2WWW A;  2YC0 A;  3LMM A;  5LHG A;  4GKJ B;  4P9P A;  1JM6 A;  4J11 A;  5KHK A;  2QKC A;  1WAZ A;  5M4E A;  1BXD A;  3CCV V;  1IZ3 A;  3SR2 C;  3OM3 B;  1TVK B;  3ZIA G;  2YEB A;  2LGQ A;  1K3E A;  1R3J C;  4XD8 A;  2XX4 A;  3ZKB A;  1Y4M A;  4XBF A;  1YIJ V;  4MTG A;  3ZRW B;  1CXZ B;  3T4D A;  3Q4H B;  2IJH A;  3OMU A;  1B6Q A;  4NXN O;  5LGU A;  1KBH A;  2DN9 A;  3CWB H;  2QE7 G;  5CBF A;  4NXM O;  5K1P A;  4CWQ A;  1GN4 A;  4LWG A;  2YEV A;  4CWR A;  1PM9 A;  1S76 D;  1K73 W;  2YEC A;  1L0O A;  4GX0 A;  4QJF B;  5AG2 A;  2GFD A;  4FLZ A;  1F51 A;  3ZMS A;  4MTX A;  1K33 A;  3GWO A;  2BSK B;  1H2S B;  3B26 A;  2P22 C;  3CC4 V;  2WLI A;  4LF8 O;  1ZUQ A;  4TQF A;  1GH6 A;  1DTO A;  4B3R O;  2QM8 A;  1BHA A;  5EBL C;  1EN5 A;  5B5E Z;  2FYP A;  3R66 A;  3E22 A;  3G67 A;  2ARH A;  2F66 C;  4MVR A;  2NN4 A;  4IHJ B;  4KL1 A;  4PDV A;  5F3K A;  2Q73 A;  4H44 B;  4JZ2 A;  4CC6 A;  3OUS A;  3CD6 V;  5EZY A;  3MDS A;  4URO A;  5IE9 A;  4MBC A;  1GKX A;  4YJ2 A;  3H1K H;  2HKO A;  4TT3 G;  2YEA A;  2YIB D;  1XNQ B;  1P4R A;  1N34 O;  3VHD A;  3OPD A;  5J2U B;  1PP9 H;  4J7K A;  5L3E A;  1NH2 D;  2WLJ A;  2ZCE A;  3G75 A;  2DMX A;  2Q8H A;  2YE6 A;  4BIU A;  2WI7 A;  4X65 B;  5JQG B;  3A2F A;  2JJ2 G;  2AZ0 A;  3RN4 A;  1BMF G;  1I5C A;  4XDK A;  4I9W A;  3JAW B;  3IFX A;  3MNR P;  3RYH B;  4KSH A;  1NKD A;  5BY1 A;  2AZ2 A;  1Y76 B;  1XNR O;  5C8Y B;  2H3O A;  4A5U B;  4E00 A;  3UM7 A;  4B3T O;  4LCU C;  4H13 B;  4UB8 Z;  3SYC A;  2GQP A;  1PD3 A;  3HB3 B;  3STZ C;  4CS2 A;  2FWY A;  4X9Q A;  3KE6 A;  4JI5 B;  2PI5 A;  5KHI A;  1Z5W A;  4X66 O;  3E8F A;  3OTF A;  4OPH A;  3A0B Z;  4B6C A;  3TZ2 A;  5LOV B;  2PGG A;  4QE7 A;  3ZHT A;  1R3I C;  1BHB A;  3K59 A;  1XHZ A;  3O9O A;  1GN6 A;  5D5P A;  2QWO B;  3FX7 A;  2WPD G;  3TUH A;  1Q82 W;  4WUC A;  2Q5Z A;  4K35 A;  3W7W A;  5L3J A;  4PU9 A;  2HJF C;  5JCO C;  3G4S V;  5KAI Z;  4GQT A;  4FLV A;  2VQF B;  2R9A A;  3HEK A;  1NR1 A;  4XDJ A;  3E8B A;  2Q0O C;  2HHI A;  1M1K W;  4XIQ A;  5B1B B;  2R9R B;  4MPN A;  2IWU A;  1Y6X A;  1ROP A;  5B1B C;  3A0Y A;  3G7E A;  5CB4 A;  3OTO B;  1VQ9 V;  4FFB A;  1EZJ A;  4I0X A;  3W7X A;  3JAT B;  3M8A A;  3C11 A;  4PA4 A;  1W0K G;  2X6B A;  2YEF A;  3EKO A;  4LBE C;  1XMO B;  3JAL B;  2BT0 A;  3TZ0 A;  3D36 A;  2HVJ C;  3HKB A;  4QE9 A;  4O0B A;  4CC5 A;  1JR9 A;  2ZKJ A;  1DK1 A;  1N33 B;  2XK2 A;  3T1Y B;  3BVO A;  1IVS A;  2O1U A;  2E74 B;  4I5S A;  4DR7 B;  2CCT A;  4FLU A;  1K8A W;  5B3S B;  3BAB A;  1JVM A;  5B3S C;  4UCV A;  3HYY A;  3JAR A;  4QIW F;  3P3N A;  4IIJ A;  1M4U A;  4X1I B;  5KMG B;  1GM9 A;  2JVD A;  1NI8 A;  5GGZ A;  4JYA B;  2E0A A;  4BIZ A;  1MNG A;  5M4K A;  2YJX A;  2Y0P A;  3APO A;  5IDM A;  2WEP A;  2DYR B;  4DR6 O;  4O2A A;  1JJ2 U;  1BYQ A;  2DYR C;  1ZSP A;  4HY1 A;  4AWO A;  3VQY A;  1YXB A;  3U11 A;  4H7Q A;  4MVQ A;  3AG3 B;  2QKS A;  5J2T A;  1FXK A;  4IGG A;  2UXN A;  4PDL A;  2OCH A;  4KHP B;  3AG3 C;  5D7C A;  4YIP A;  2X7R B;  4ASA A;  5A9G A;  2ZE7 A;  4TUY B;  1YVW A;  3WB1 A;  5JJE B;  1QQC A;  4PD4 F;  4WUB A;  4B7K A;  1S5L Z;  3HKC A;  1BL8 A;  4DO2 A;  2P90 A;  3T4Z A;  1YJN V;  4RUF A;  1IBK O;  3FB8 C;  3STL C;  3HKE A;  5CTY A;  3K06 A;  4LF5 O;  1FJG B;  2DOS A;  1B3Q A;  2DJV A;  2IJJ A;  5FLX N;  4DV2 B;  1R6N A;  3T1H O;  2XHR A;  2FYU H;  2W6I G;  3D2R A;  4DV6 O;  3K0G A;  2UXD O;  1RSO A;  2AXT Z;  3JD1 A;  3R4O A;  3IC9 A;  3OMI B;  4R6Z A;  3CC2 V;  3J7A U;  5M4M A;  2CCU A;  2E75 B;  1I59 A;  1BQ0 A;  1I5A A;  3GIG B;  4V25 A;  3K99 A;  4PRX A;  2JJC A;  4UCR A;  1XEQ A;  3OWD A;  4F6R B;  4JI2 O;  2P4V A;  4BIO A;  2UU9 O;  2JGD B;  2QA4 V;  3OEE G;  4P30 A;  2BTO A;  4H0L B;  2D3O W;  1N32 O;  2F4V B;  5IYD O;  1H7S A;  1I94 O;  1JFF B;  4KXR A;  3B4S A;  2M6Y A;  5LGN A;  4XIP A;  1AI4 A;  1I0H A;  3QVN A;  2YEG A;  2BYI A;  2PNR A;  1N4C A;  3O0I A;  4AWP A;  1TUB A;  2ETN A;  3LSS A;  1JX9 A;  1N0J A;  1WN7 A;  1WLE A;  3CXH F;  1Q6U A;  1CPY A;  2V7Q G;  2ZQM A;  2ZR3 A;  2GBO A;  3FKS G;  3WFV A;  2CGN A;  4ZHQ B;  5BMV B;  1Z59 A;  1I08 A;  1YEW A;  5F5R A;  5K1X A;  4NR1 A;  3BHP A;  3EHF A;  2B5U A;  2JS3 A;  1NU1 H;  3AG1 B;  4O09 A;  2D2C B;  3TGU H;  1THN A;  1ZLZ A;  1GRJ A;  1TBW A;  3AG1 C;  2EIK B;  2UUC B;  1YDX A;  2UXC O;  1M9N A;  3B77 A;  2EIK C;  2YXH A;  3CJH B;  3KZI Z;  1R62 A;  2YE7 A;  3QTF A;  3N2G B;  4FCQ A;  3A8T A;  5CA1 B;  3OGI B;  4X20 B;  4N21 A;  4R7C A;  1I5Y A;  1KC8 W;  4KTN A;  4YKT A;  4LFA B;  5JVD B;  4RQF A;  1AM1 A;  2Q8F A;  1UY6 A;  4MPE A;  2E5L B;  1UY8 A;  4O4J B;  3ZRV A;  1TIL A;  4UCU A;  4I4T A;  4Q6G A;  1WB8 A;  3K60 A;  3N2K B;  4J42 A;  5EIB D;  2LGW A;  5KUK A;  2XDK A;  3EKR A;  2BU6 A;  1NS1 A;  3K9S A;  4X62 O;  4R8C A;  1IBM O;  3SPH A;  1VQ6 V;  4AS9 A;  4IT5 A;  5M4P A;  2H8P C;  2IH3 C;  2ZKO A;  2LW7 A;  2Z0A A;  2ZDX A;  2CTW A;  4X88 A;  2C1I A;  4KFM A;  4L87 A;  1B63 A;  1URF A;  2KB1 A;  2CCS A;  2Y4U A;  1XRE A;  5KA6 A;  1S5J A;  1LR1 A;  3H01 A;  4OX9 O;  3BRC A;  4MOT A;  1B06 A;  5EIB C;  3JAM N;  2WI5 A;  1K4C C;  1W59 A;  3A0Z A;  3B8M A;  1G1X B;  1ZAU A;  1VF6 C;  3P30 A;  1FD9 A;  4XC0 A;  3ZHS A;  3X2Q B;  4AQY O;  1UY7 A;  1XMQ O;  3LPS A;  2N74 A;  3X2Q C;  4UVA A;  2YGE A;  1UYD A;  5D6P A;  4EM7 A;  3R4N A;  4B7E A;  4W7T A;  4X64 B;  4AHC A;  2YI6 A;  1OJH A;  3OGC C;  4O2B A;  1QY8 A;  5CA0 A;  3DXR A;  4LF7 O;  3H4L A;  3W7S A;  3BY6 A;  3ZRX A;  3JAK B;  4X1Y A;  3ZMU A;  2BSM A;  2YEI A;  2EUL A;  4PI2 A;  1SES A;  1GTO A;  1DLB A;  4DV1 B;  1K7D A;  4CE3 A;  4DZY A;  4DUZ O;  4HYO A;  2ADQ B;  1Y74 B;  4CWF A;  5LYJ A;  3WB2 A;  5EBM C;  1RPO A;  1FS0 G;  2P5O A;  1MZE A;  2ZE6 A;  2BU7 A;  4GKK B;  2F43 G;  2L35 A;  2BE3 A;  4JI6 B;  2LW1 A;  3JZ3 A;  3FT8 A;  2KG7 B;  2UUB O;  3DTU B;  1S16 A;  3T1K A;  2BTQ A;  1AR5 A;  3ZJZ A;  4LF9 O;  3K79 A;  3S5T A;  3KG2 A;  1L0N H;  4TV8 B;  1FFX A;  4DR3 B;  1VQ5 V;  1NTM H;  3SJQ C;  4LWI A;  2HG1 A;  3RYF A;  4JAU A;  3RVY A;  4I55 B;  4O4L B;  5L3D A;  1HR0 O;  1K4D C;  3MD0 A;  1YC1 A;  3LDC A;  1SQV H;  2KSD A;  4DK1 A;  1VQN V;  5LL6 Y;  2XND G;  2YKB A;  5IT9 N;  1WPX A;  4YHH O;  1YTF D;  4PI0 A;  2CTR A;  4NXN B;  5FPR A;  4NXM B;  3IC7 A;  3B40 A;  1EN6 A;  1F4M A;  2VWJ A;  3QNE A;  3CGZ A;  1S0V A;  4LP8 A;  3FAV B;  1S72 V;  4FJC C;  1Z5V A;  4JAV A;  1VQ8 V;  1YTF B;  3Q5J A;  3U10 A;  1I5X A;  2K5B A;  4YJ3 B;  2M7W A;  3ZM7 A;  1YI2 V;  1IXM A;  2WSS G;  4BAY A;  2XDX A;  2CH7 B;  3LUT B;  4LF8 B;  4CS3 A;  4BR6 A;  1Y8P A;  4ASG A;  4B3R B;  2GUZ B;  2RDC A;  2WEQ A;  5H9C A;  2GTS A;  1Q7Y W;  2QGN A;  2IJI A;  4JI4 O;  3KCY A;  3H9V A;  2A7W A;  4FLX A;  2X6A A;  4UCS A;  4FIP C;  4HXZ A;  3K5L A;  3GIF A;  3OW6 A;  4EGI A;  5LA6 A;  4B3M O;  1FYJ A;  2DWD C;  4GGL A;  2IW5 A;  4AWQ A;  1SZT A;  4GX2 A;  4E72 A;  4HYP A;  5GTI Z;  5KUM A;  2JS5 A;  1N34 B;  3FYI B;  3RLP A;  3OR6 C;  4RO2 A;  4HXW A;  1R1B A;  1VEW A;  3FB7 C;  2LP7 A;  2Q8G A;  1UYE A;  1EM1 A;  3RYI B;  3IJ4 A;  5LP6 B;  2JEU A;  4DRX B;  2ZIM A;  4MP7 A;  1NT2 B;  3R65 A;  1SA0 B;  4DUY B;  3CRQ A;  5H6R A;  2YSU B;  5LP6 C;  3HKD A;  1AIL A;  1ZL8 A;  2EIL B;  1UPG A;  4L8J A;  4GZR B;  4FZ1 A;  3CCR V;  2EIL C;  3AK3 A;  3LNM B;  2QR4 A;  1H2L A;  4DXW A;  3G80 A;  3J80 N;  5CTX A;  4X1K A;  1SZX A;  1VQK V;  1MSW D;  5D6Q A;  1XNR B;  1QU7 A;  3ZRS A;  4I9Q A;  1BZK A;  2JIZ G;  2AW9 A;  4B3T B;  1W0J G;  1K5Q A;  4WFH A;  1QLE B;  4O4I B;  3UT5 B;  3ZRW A;  3FYE B;  4YY3 O;  2DYS B;  3Q4H A;  1PVG A;  1QLE C;  1JCH A;  1VMG A;  4UVC A;  4X66 B;  4DR1 B;  1MMM A;  1BCC H;  2HR3 A;  2C1G A;  4GLX A;  4Q20 A;  1AI6 A;  4CWP A;  5CBH A;  1TAE A;  1Q5O A;  1D2D A;  2OCC B;  3B27 A;  4GUN A;  4J41 A;  3B28 A;  1SS3 A;  4P2Z A;  2OCC C;  4G28 B;  1NTK H;  3C3S A;  1YT1 A;  1Z5A A;  1XHX A;  4D7T A;  2N04 A;  4GT8 A;  3WB0 A;  2XHB A;  4URN A;  2LQT A;  2YE2 A;  1TID A;  4HZ3 A;  3CC7 V;  4TOI A;  5M4H A;  1PV0 A;  4J7J A;  4DV3 O;  2GHY A;  4NTY A;  2VCJ A;  1HNZ B;  2YXL A;  1KYO F;  2Q69 A;  3JD4 A;  4JAS A;  4IHJ A;  2OIG A;  2Y4T A;  2UXB B;  4KSG A;  4JYY A;  2QSA A;  4DR5 O;  2QM4 A;  4UCO A;  4JI3 O;  1RP3 B;  5H2F Z;  3RFR A;  1MU5 A;  2XAQ A;  3N27 A;  2FB5 A;  3B8N A;  1ZWH A;  1LUW A;  4MVU A;  5IDJ A;  4KFG A;  4KQV A;  3H1L H;  1NH2 B;  3A0X A;  3ETE A;  3H1I H;  4EB6 B;  3CMA V;  5KHJ A;  3A0W A;  4L94 A;  1E79 G;  2X6C A;  4PEL A;  3L71 H;  2P67 A;  1X4T A;  2LO1 A;  4UFZ A;  4CH6 A;  1ID0 A;  2YEH A;  3JAW A;  1AP5 A;  3RYH A;  1VAR A;  1NHH A;  3SPG A;  1Y76 A;  5LHH A;  4DV5 O;  5FNC A;  2F23 A;  1UYL A;  2NR5 A;  2BOC C;  5EYP A;  5IWA O;  4DR6 B;  4H81 A;  3E83 A;  4CWS A;  3B09 A;  1YC4 A;  4W4K A;  4MP2 A;  1WA8 B;  3P3P A;  1WNS A;  2PF4 E;  3B25 A;  3KKY A;  2ZIO A;  2Y48 A;  2IBZ H;  5LOV A;  1P84 F;  3OMN B;  5BOD A;  4PDR A;  4JTA B;  4XTJ A;  1IBL O;  2CGF A;  1Y67 A;  1UYF A;  3B24 A;  4K8Z A;  2WI6 A;  3BCC H;  3SPJ A;  3L9D A;  2GTA A;  4XKK A;  2ITD C;  4J7Z A;  4ASF A;  1JQ0 A;  4PL9 A;  2AKP A;  5EC2 C;  4E02 A;  4K8X A;  1L8D A;  1AB3 A;  4CWT A;  1THZ A;  5JCO A;  1XBL A;  2QTS A;  3ABT A;  3K57 A;  2WLN A;  2RMK B;  4I0X B;  1HNX O;  1P49 A;  1IBK B;  5EBW C;  4R3M A;  3SYQ A;  1WPB A;  4X89 A;  4IYH A;  2YID A;  4LF5 B;  3TCU A;  1NHI A;  2BU2 A;  4PV1 B;  2IM9 A;  1UYM A;  2WI4 A;  3T1H B;  2YE9 A;  2WLL B;  1ARO P;  4DV6 B;  3K0D A;  3QTC A;  3VQX A;  3SJC C;  4QPK A;  3I55 V;  4LPB A;  1GK9 A;  2MW2 B;  3JAL A;  3OT7 A;  4K4O A;  4NKG B;  2XHT A;  2F93 B;  1U0Z A;  4GT1 A;  4XE2 A;  1R6K A;  4LNU B;  1I5D A;  1NBM G;  4BQJ A;  4IIJ B;  4JI2 B;  2UU9 B;  2F1M A;  4J9Z B;  2X0L A;  4NH9 A;  1SKV A;  2FL4 A;  4YKX A;  2OIE A;  4AIL C;  2ZDY A;  4GFN A;  1N32 B;  4HZ0 A;  4K0K B;  1BT8 A;  2ADP A;  2P4K A;  3CE2 A;  1I94 B;  1UYG A;  5LGT A;  2Z3Y A;  2Q7H A;  1KP2 A;  1AH6 A;  1OCZ B;  4O2A B;  3JD0 A;  3BPZ A;  1SQQ H;  1AJP A;  2ESA A;  1SF9 A;  4TV9 B;  4X1I A;  4ZOL B;  2WER A;  1OCZ C;  2V1D A;  3PN1 A;  5KX5 B;  3ZS8 C;  1SQF A;  3WHA A;  3K5O A;  5J2T B;  3ZBH A;  4JPR A;  2F95 B;  4RAI A;  3K5M A;  4AI8 A;  5ITZ B;  1TC0 A;  3TET A;  5D7R A;  1Q43 A;  5JH7 B;  4PA9 A;  4WF9 V;  1R6T A;  4PA3 A;  1VQ7 V;  4LWS A;  4DV4 O;  3SPI A;  2YKE A;  3JD3 A;  4L91 A;  3CRK A;  4BQG A;  4O07 A;  4KUM A;  2YJW A;  1EN4 A;  4FLW A;  3OE7 G;  3HKC B;  3L72 H;  1GO3 F;  5E79 Z;  1U96 A;  1AI5 A;  3A0H Z;  2DQ3 A;  4MTF A;  1K97 A;  5LMN B;  2UXC B;  1FXV A;  4QNH B;  3GWK C;  4HZ5 A;  2ODM A;  4EKW A;  1AH8 A;  1BGQ A;  2OTJ V;  3NMQ A;  1PNM A;  5B66 Z;  4JI8 O;  1WP7 A;  4LF6 O;  3K5N A;  3K58 A;  5BOC A;  4P9O A;  1HNW O;  3QG5 A;  4O4H B;  5EC1 C;  2NNU A;  3JAS A;  5IJ0 B;  2YI9 A;  2B1I A;  1HW7 A;  1KP3 A;  1XIL A;  4EFU A;  2QG2 A;  1AJ6 A;  3O6O A;  5IN9 A;  1ZXN A;  4X62 B;  5C93 A;  3E35 A;  5TIS Z;  3RYC A;  4F4L A;  1IBM B;  2CH4 A;  1F23 A;  5B1O A;  3T0Z A;  2JGU A;  2PUS A;  2OT5 A;  2ZE5 A;  4U3J B;  4JF3 A;  4LFB O;  3QO5 A;  2B1G A;  3ZED A;  2VS0 A;  3GIG A;  2KQX A;  3BM9 A;  4B3S O;  3K08 A;  2ILM A;  4JYB A;  2YDE A;  3LDE A;  1PL4 A;  4OX9 B;  4F6R A;  4U93 A;  3EVK A;  2JGD A;  1A32 A;  2XOK G;  4I50 A;  2CGO A;  2ZBK B;  4JYC A;  3CS5 A;  3LNU A;  3OW2 U;  1VIB A;  4LWE A;  1TUB B;  4HBN A;  2K9P A;  4E4E A;  1JFF A;  2VRZ A;  2Q7E A;  5D7D A;  4AQY B;  2R72 A;  2XAS A;  1XMQ B;  1BS3 A;  2LJ2 A;  3C3T A;  1MAB G;  2ZNJ A;  5LHI A;  1GN2 A;  4FPP A;  1UYH A;  4BAE A;  1QNM A;  4RWU A;  3G6E V;  3U0Z A;  4CH5 A;  1KEC A;  3BA9 A;  2YIA A;  3F5T A;  5DM6 V;  4DUH A;  2Y69 B;  3T1C A;  4DR2 O;  5LXT B;  2O1V A;  1H7U A;  4LF7 B;  1B04 A;  2Y69 C;  2XAG A;  4NTX A;  4CE2 A;  4CWO A;  4HNA B;  4KP4 A;  3VAD A;  3OWB A;  1MZF A;  1YT2 A;  4LF4 O;  4ZHQ A;  5DEC A;  2YEE A;  4DUZ B;  4MVM A;  2L6L A;  4FM1 A;  1AP6 A;  5CTU A;  2IJK A;  3DC5 A;  4JTD B;  3J81 N;  1FPO A;  2Q0A A;  1JJO A;  3U2K A;  4JI0 O;  1ORQ C;  3GB7 C;  3GVM A;  2O57 A;  2XX5 A;  5IYZ B;  2UUB B;  3TJT A;  3CRL A;  4RUE A;  3H1J H;  1TC6 A;  3CSX A;  4LH7 A;  2A0L A;  3O2F A;  3ETG A;  2EX3 A;  3N2G A;  1PNL A;  2ZIN A;  2Q7G A;  5CA1 A;  4O05 A;  4X20 A;  1OZ0 A;  3ZHQ A;  2QTO A;  1HR0 B;  1D5A A;  3HZ1 A;  2QEX V;  3SDL A;  2ITC C;  1XDC A;  5JVD A;  1PKX A;  4FMT A;  4UB6 Z;  4G2K A;  1FFT B;  2XJX A;  4QGP A;  3VQW A;  2YE3 A;  3O65 A;  3I56 V;  4FLY A;  1UJW B;  4YHH B;  3Q5L A;  3ZX6 A;  4D6T H;  5IJ9 A;  2RNB A;  1COW G;  4YXW G;  2W0F C;  2XAH A;  2BU8 A;  3VQV A;  3JD2 A;  5F2V O;  2DW4 A;  3CRC A;  2HJD A;  1N36 O;  5FND A;  1QLN A;  3F7V C;  4EFE A;  2A9H A;  3ZXO A;  1NZ6 A;  3CGY A;  5HFM A;  1RFY A;  2EIM B;  4YKU A;  4IYI A;  1EI1 A;  4WBN A;  3R91 A;  3RLQ A;  2EIM C;  3ABK B;  1J5E O;  2Y0I A;  3W7U A;  3ABK C;  4MW3 A;  4EMV A;  4MVS A;  3FD9 A;  1BE3 H;  2DWE C;  3VBB A;  5J6A A;  1KB9 F;  1DF5 A;  3D8C A;  2XAJ A;  5CA0 B;  2KKW A;  3MHH C;  3JSN A;  5GON B;  2YI5 A;  5FNV B;  4JI4 B;  5H5N A;  1Q3E A;  3ETQ A;  2V4D A;  2AHY A;  2XX2 A;  1G4Y B;  5FL7 G;  1YCI A;  4BXI A;  1SER A;  1V54 B;  4OGQ B;  2XUM A;  4PHZ A;  1S5H C;  4B3M B;  1V54 C;  3JAK A;  3CB2 A;  4EFB A;  3CCL V;  1US6 A;  1FAF A;  2Q9L A;  4CBC A;  1S77 D;  2HLD G;  2BTQ B;  4NTW A;  1NTZ H;  1QHT A;  4UUJ C;  1Q86 W;  3E8H A;  2YI7 A;  3UKM A;  4JI7 O;  1D5N A;  5BR8 O;  3MAQ A;  3EHJ A;  3C0E A;  1ZX3 A;  4DR4 O;  3SGI A;  3EHG A;  3JSL A;  1H38 A;  3H1H H;  1AMW A;  3CRM A;  1CEZ A;  4LR3 A;  4I55 A;  3D0B A;  1X59 A;  4O4L A;  4ZI7 B;  3G7B A;  1DGS A;  2ZM6 O;  3S3W A;  4RQE A;  3D3Q A;  4YY3 B;  3ZN0 A;  5B1N A;  1GKF A;  2JDI G;  4YKY A;  2JEX A;  2ZDI A;  1JA8 A;  3SYP A;  2OTL V;  2C2A A;  3T2S A;  1VF5 B;  1S14 A;  2N05 A;  4BW5 A;  1XUQ A;  4DV0 O;  1UFI A;  3FAV A;  2Q2E B;  4DV7 O;  1Q90 D;  3ZXQ A;  2JJ1 G;  3VHA A;  4YJ3 A;  4EEQ A;  1K92 A;  3EXA A;  5LBQ A;  1WB7 A;  1P7G A;  2EBO A;  3AK2 A;  2UUA O;  4CH4 A;  1Y4U A;  3WQ9 A;  4EEH A;  4LFC O;  2YXY A;  1IUR A;  2GUZ A;  4DV3 B;  4MTO A;  1DF4 A;  3UO3 A;  2H55 A;  4NH8 A;  2O1W A;  2QWQ B;  1G6U A;  4DV1 O;  4FCR A;  2YK2 A;  1VQP V;  2VW5 A;  5D5Q A;  1OSF A;  2AGA A;  2WLK A;  3CXC U;  4FLT A;  4H37 A;  4JI3 B;  3CCQ V;  4XDL A;  2VCI A;  3TZ5 A;  3EFF K;  2XHX A;  2EIJ B;  3FB5 C;  2OYQ A;  2YEJ A;  4O04 A;  2EIJ C;  2Q8V A;  3DSQ A;  4N23 A;  2WI3 A;  4C7U A;  2ZNI A;  1Q6I A;  1TVK A;  2Q67 A;  4X1K B;  4DR3 O;  2XD6 A;  2YKC A;  1M93 A;  3RYI A;  1YSZ A;  1KU9 A;  5LP6 A;  4DRX A;  1SA0 A;  4GX5 A;  1S3J A;  1US7 A;  2CG9 A;  4JV5 O;  1XQ8 A;  2YEV B;  3UQ8 A;  1NQT A;  1XL6 A;  1UYK A;  3K9A A;  2YI8 A;  3F5W C;  2PYL A;  2HHH O;  2YS8 A;  3HZ5 A;  1GM7 A;  1OCC B;  2DYS C;  4BWA A;  4DV5 B;  4I7Z B;  2IU0 A;  1QZR A;  1K9M W;  1P7B A;  1WP8 A;  1VF7 A;  1OCC C;  4J9Y B;  5IWA B;  3RWR D;  3LDD A;  2EIN B;  3UCS C;  5CTW A;  2IH1 C;  4UCT A;  4Z1V A;  1H8E G;  2EIN C;  2WLI B;  4O4I A;  2YED A;  3UT5 A;  3INX A;  3LSU A;  3L75 H;  4DYL A;  3FFQ A;  2WLM A;  3D3I A;  2BU5 A;  2BSK A;  1H2G A;  4NYK A;  3P32 A;  1OCO B;  3E22 B;  4H33 A;  1I58 A;  1YZB A;  1IBL B;  3T0H A;  3TXS A;  1OCO C;  1YER A;  2HP8 A;  5HFL A;  2QDO A;  5EZY B;  4XDM A;  2IOR A;  2HCH A;  3EHH A;  2VQE O;  4U7O A;  2WI2 A;  4CWN A;  4YJ2 B;  2PZS A;  4XCL A;  3LSQ A;  1T5E A;  3PJS K;  3ZMZ A;  1AVM A;  3JYC A;  1OV9 A;  3Q5K A;  2JRI A;  4JGS A;  4ZBM A;  1HNX B;  5LMU O;  1KUQ A;  2YGF A;  2XCM A;  1LUV A;  1NVP D;  4JI1 O;  1GKZ A;  1O9H A;  1YIT V;  2FWZ A;  3A0T A;  3NR7 A;  2QF6 A;  1QBZ A;  3ML0 A;  4XKA A;  1VQ4 V;  2AHZ A;  4D7S A;  4R1F A;  2PY5 A;  4GKJ O;  5J2U A;  4P7A A;  2A79 B;  4LP0 A;  1NR7 A;  1AR1 B;  1HWY A;  2ZT9 B;  1H2N A;  3M99 B;  2YKI A;  1MA1 A;  4ABM A;  4ASU G;  4R3A A;  4PDM A;  1NVP B;  5JQG A;  3H80 A;  2EZP A;  4DUY O;  4HYM A;  2YIB A;  3JCZ A;  4J10 A;  1I7F A;  4YKZ A;  3THO A;  2XDS A;  2YIC A;  1Y8O A;  3ABL B;  1K5S A;  4MVO A;  1QVF U;  4EB6 A;  5C8Y A;  4TWK A;  4FFK A;  3ABL C;  1KQS U;  1U2O A;  5EYP B;  1BKN A;  4P8O A;  4ZVI A;  4YKW A;  1Q81 W;  2W6J G;  1E1R G;  2PTM A;  4XKO A;  3RW0 A;  4DW1 A;  1YF2 A;  1TGO A;  4JAA A;  4DR1 O;  4FK5 C;  1K34 A;  1FXH A;  1KKC A;  1SQG A;  2ZD9 A;  2PI4 A;  3CEI A;  4E01 A;  3PEH A;  1LNQ A;  2WAM A;  3RT3 C;  3U67 A;  1WA8 A;  4U7N A;  1YHQ V;  1H2K A;  1BSM A;  5JJN B;  2LFR A;  1XI1 A;  1ZW9 A;  4ASB A;  4DV4 B;  2P6J A;  4JQL A;  3E2E A;  5CB4 B;  4FFB B;  4JTC B;  2E3C A;  2QM7 A;  1H2M A;  4PJ0 Z;  2ZXW B;  4XIT A;  2WA3 A;  5L3F A;  4DW0 A;  2ZXW C;  2HKJ A;  5J71 A;  3HKB B;  5KA5 A;  1HNZ O;  2R9I A;  3VOU A;  3D36 C;  1XNQ O;  4UVB A;  2UWD A;  2EJ7 A;  1L0L H;  4JI8 B;  4LF6 B;  4EGH A;  3RGB A;  2UXD B;  1HNW B;  4WCE V;  1J95 A;  2GSM B;  3JAT A;  5IYB O;  1Y66 A;  2UXB O;  2NLJ C;  2H8M A;  4UXN A;  3K97 A;  3OR7 C;  4CS4 A;  1NJI W;  4X65 O;  3T10 A;  3F7Y C;  4DK0 A;  3JAR B;  4FZ0 A;  2BOB C;  5M4N A;  1AI7 A;  1JPX A;  2IOQ A;  1JMK C;  2WLL A;  3IGA C;  3K3W A;  3TTZ A;  3QF7 A;  1TUE B;  1KMI Z;  2UXX A;  4LFB B;  4G27 B;  4B3S B;  2YE8 A;  5CMU A;  4MVZ A;  4LNU A;  5KMG A;  4WFG A;  4Z1M G;  3SL2 A;  4JI5 O;  4XCJ A;  4V26 A;  2XAF A;  1E1Q G;  2WLH A;  4U3F H;  4YIO A;  5H6Q A;  1H8H G;  3HHU A;  1M56 B;  1EZV H;  1FXK B;  1MX0 A;  1SQB H;  4F6E A;  1M56 C;  3R92 A;  1FXK C;  2YUA A;  3QO7 A;  4L90 A;  1F7Y A;  4TV9 A;  1YT0 A;  4ZOL A;  4WFA V;  2IOP A;  2EXL A;  4QPJ A;  5KX5 A;  3CCE V;  2DQ0 A;  4DR2 B;  4LWS B;  1L1F A;  3K03 A;  4J80 A;  1KD1 W;  1YES A;  4WFE A;  3ZMV A;  4ICG A;  2HEP A;  1BGY H;  1VQM V;  2YGA A;  4BW9 A;  5ITZ A;  1V9P A;  1SC5 B;  2WI1 A;  4LF4 B;  4TUY A;  2HFE C;  5JH7 A;  5L3C A;  2VQF O;  2QJ1 A;  1SQP H;  5DN6 G;  5KHH A;  4L93 A;  3CWV A;  3HKE B;  5B1A B;  3IAY A;  2FXS A;  4LC1 A;  1KKD A;  1B62 A;  5CBG A;  2XDL A;  5B1A C;  5CA3 A;  3ZN1 A;  3MHS C;  3CYO A;  4PA7 A;  1SQX H;  3L73 H;  3OTO O;  4JI0 B;  1GMG A;  1RSO B;  3G71 V;  4CH3 A;  2IU3 A;  3JAS B;  2GDS A;  1CP9 A;  1RM1 B;  3CME V;  3TZ4 A;  1XMO O;  4MT8 A;  3FT5 A;  3SYA A;  4Z2W A;  1TA8 A;  1RM1 C;  1MG1 A;  4FVM A;  1EBO A;  2R70 A;  4YKR A;  1IXB A;  3OD4 A;  3RYC B;  4MW8 A;  1N33 O;  3L70 H;  1ZWI C;  3T1Y O;  1QR9 A;  2H94 A;  4O4H A;  3CCJ V;  4GCZ A;  2Q8I A;  3ASN B;  4DR7 O;  5IJ0 A;  2YI0 A;  1FKA O;  2IWX A;  3WG7 B;  4W4L A;  1PL0 A;  3ASN C;  3WG7 C;  2MK3 A;  3LNN A;  3BMY A;  4WUD A;  4I3H A;  3R4P A;  4WFB V;  1QCE A;  4XIR A;  3EHB B;  1N36 B;  2EZO A;  3GIE A;  4U3J A;  3M7M X;  4JYA O;  1ZXM A;  3ABU A;  4I50 B;  1R3K C;  4MS2 A;  4OPA A;  4URL A;  1M5I A;  4K0K O;  1YSR A;  2XJG A;  3C90 A;  3FB6 C;  1J5E B;  3U2D A;  5GW7 A;  3TK1 A;  2RJZ A;  2JKI A;  1YJ9 V;  5KHG A;  2RQ6 A;  1VQL V;  3ASO B;  2B9Z A;  1GM8 A;  5KLV H;  3ZMT A;  2QWP B;  3ASO C;  3AK1 A;  2CE4 A;  3B2E E;  3OFN G;  3DC6 A;  1VP7 A;  3ABM B;  1UYI A;  4H85 A;  4KHP O;  2XTA A;  1MOF A;  2QG0 A;  3UO2 A;  3ABM C;  3CCM V;  4HAM A;  3SYO A;  5BMV A;  5CN0 A;  2Q6A A;  2XJJ A;  3PEJ A;  4GEE A;  4PRV A;  2P7T C;  1A4H A;  3I5D A;  2BRC A;  5CPH A;  4NB5 A;  1XOU A;  1VQO V;  2A06 H;  5LXT A;  1QVG U;  3CCS V;  3JCU Z;  4HNA A;  2EJR A;  3AG2 B;  3CP1 A;  3CX5 F;  1R3L C;  3SJA C;  2CAZ C;  2DE0 X;  2BTZ A;  4LF9 B;  5LMN O;  3AG2 C;  3CJH A;  4I4T B;  2A3Q A;  2YE4 A;  4X8A A;  3AG4 B;  1FJG O;  4DV2 O;  3AG4 C;  5L3G A;  1MSD A;  2Q68 A;  4FCP A;  4JI7 B;  3ZHV A;  2YE5 A;  5FPO A;  5BR8 B;  1YSC A;  5IYZ A;  4L8Z A;  2ATK C;  4DR4 B;  4O4J A;  4FM2 A;  4TSF G;  1M57 B;  1OHH G;  4HY6 A;  3N2K A;  2GV9 A;  3TXQ A;  3ZCC A;  1Z5B A;  2XT9 A;  5IYC O;  1M57 C;  3IED A;  2RCV A;  5IJ9 B;  3APQ A;  2BCC H;  4B7P A;  3S3X A;  1SET A;  4GX1 A;  2VWC A;  4YKQ A;  3E8G A;  4NH7 A;  1AR4 A;  2ZM6 B;  4LWH A; 
#chains in the Genus database with same CATH homology
 3CCU V;  2XDU A;  1AJQ A;  4WFF A;  3QDD A;  1QYE A;  3K98 A;  1V55 B;  2BRE A;  1UYC A;  2IWS A;  3HYZ A;  3OUF A;  4MPC A;  1V55 C;  1Y4S A;  3E89 A;  3RKZ A;  5BZB A;  1W2B U;  3INW A;  3OMA B;  3RBZ A;  2ZR2 A;  1AJN A;  1QR8 A;  2CK3 G;  4UV9 A;  1YC3 A;  2YKJ A;  2Z5U A;  3ETD A;  2LFS A;  1R73 A;  5J9P C;  2XAB A;  4CZZ A;  1NHJ A;  3FV5 A;  3RVZ A;  3BEH A;  5FWK A;  1OCR B;  1F4N A;  1EA6 A;  4X9L A;  1OCR C;  1YS3 A;  1JOY A;  3HPL C;  3SPC A;  2K1E A;  1Z5C A;  2JK5 C;  4E2L A;  1EFR G;  3R4M A;  4CE1 A;  3K04 A;  4ZKI A;  1PNK A;  3W7T A;  3AEI A;  2FTK A;  4EGK A;  3OAA G;  4EFT A;  1GJV A;  4LWF A;  5CF0 A;  1YJW V;  3ZKD A;  1I5B A;  1KIJ A;  3E86 A;  3DGE A;  3QO8 A;  4MB9 A;  1SRY A;  2BZ5 A;  2ZDI C;  4URM A;  4PA6 A;  1TH8 A;  3A0R A;  1M90 W;  1Y8N A;  5EK0 A;  1G8M A;  4OXS A;  1YET A;  2QFO A;  3CPW U;  4UV8 A;  2YK9 A;  1UY9 A;  5IY5 B;  3VHC A;  4R50 A;  3RLR A;  4MSW C;  1RPR A;  5FNF A;  1N8R W;  5IY5 C;  3NXS A;  1XL4 A;  3OEH G;  1KZN A;  2HVK C;  1ENV A;  2BYH A;  3T2M A;  5E1A C;  2HG5 C;  5L3B A;  2WWW A;  5LHG A;  4P9P A;  1JM6 A;  5M4E A;  1BXD A;  3CCV V;  3OM3 B;  3ZIA G;  2YEB A;  1K3E A;  1R3J C;  4XD8 A;  2XX4 A;  3ZKB A;  1Y4M A;  4XBF A;  1YIJ V;  4MTG A;  3ZRW B;  3T4D A;  2IJH A;  3OMU A;  1B6Q A;  5LGU A;  2QE7 G;  5CBF A;  4CWQ A;  4LWG A;  2YEV A;  4CWR A;  1S76 D;  1K73 W;  2YEC A;  1L0O A;  4GX0 A;  4QJF B;  2GFD A;  1F51 A;  3ZMS A;  4MTX A;  1K33 A;  3GWO A;  3B26 A;  3CC4 V;  2WLI A;  1DTO A;  2QM8 A;  1BHA A;  5EBL C;  2FYP A;  4MVR A;  4PDV A;  5F3K A;  3OUS A;  3CD6 V;  4URO A;  4MBC A;  1GKX A;  4TT3 G;  2HKO A;  2YEA A;  1P4R A;  3VHD A;  3OPD A;  1NH2 D;  5L3E A;  2WLJ A;  3G75 A;  2Q8H A;  2YE6 A;  4BIU A;  2WI7 A;  2JJ2 G;  1BMF G;  1I5C A;  4XDK A;  4I9W A;  3IFX A;  3MNR P;  4KSH A;  1NKD A;  4E00 A;  3UM7 A;  4LCU C;  2GQP A;  3SYC A;  1PD3 A;  3HB3 B;  3STZ C;  2FWY A;  3KE6 A;  2PI5 A;  3E8F A;  4B6C A;  3TZ2 A;  4QE7 A;  1R3I C;  1BHB A;  2WPD G;  3TUH A;  1Q82 W;  4WUC A;  3W7W A;  5L3J A;  4PU9 A;  2HJF C;  3G4S V;  4GQT A;  3HEK A;  1NR1 A;  4XDJ A;  3E8B A;  1M1K W;  4XIQ A;  5B1B B;  2R9R B;  4MPN A;  2IWU A;  1ROP A;  5B1B C;  3A0Y A;  3G7E A;  1VQ9 V;  1EZJ A;  3W7X A;  3C11 A;  4PA4 A;  1W0K G;  2X6B A;  2YEF A;  3EKO A;  4LBE C;  2BT0 A;  3TZ0 A;  3D36 A;  2HVJ C;  4QE9 A;  4O0B A;  2ZKJ A;  2XK2 A;  2O1U A;  4I5S A;  2CCT A;  1K8A W;  5B3S B;  1JVM A;  5B3S C;  3HYY A;  4QIW F;  1GM9 A;  5GGZ A;  2E0A A;  4BIZ A;  5M4K A;  2YJX A;  5IDM A;  2WEP A;  2DYR B;  1JJ2 U;  1BYQ A;  2DYR C;  4HY1 A;  4AWO A;  4H7Q A;  4MVQ A;  3AG3 B;  2QKS A;  1FXK A;  2UXN A;  4PDL A;  3AG3 C;  5D7C A;  2X7R B;  4ASA A;  4WUB A;  1BL8 A;  4DO2 A;  2P90 A;  3T4Z A;  1YJN V;  4RUF A;  3FB8 C;  3STL C;  5CTY A;  3K06 A;  1B3Q A;  2IJJ A;  1R6N A;  2XHR A;  2W6I G;  3D2R A;  3K0G A;  3JD1 A;  3R4O A;  3OMI B;  4R6Z A;  3CC2 V;  5M4M A;  2CCU A;  1I59 A;  1I5A A;  3GIG B;  4V25 A;  3K99 A;  4PRX A;  2JJC A;  3OWD A;  2QA4 V;  3OEE G;  4P30 A;  2D3O W;  5IYD O;  1H7S A;  5LGN A;  4XIP A;  1AI4 A;  2YEG A;  2BYI A;  2PNR A;  3O0I A;  4AWP A;  3LSS A;  1JX9 A;  1WLE A;  1CPY A;  2V7Q G;  2ZQM A;  2ZR3 A;  3FKS G;  3WFV A;  1Z59 A;  5F5R A;  3EHF A;  2B5U A;  3AG1 B;  4O09 A;  1THN A;  1TBW A;  3AG1 C;  2EIK B;  1M9N A;  3B77 A;  2EIK C;  1R62 A;  2YE7 A;  3QTF A;  4FCQ A;  4N21 A;  4R7C A;  1I5Y A;  1KC8 W;  4KTN A;  4YKT A;  1AM1 A;  4RQF A;  2Q8F A;  1UY6 A;  4MPE A;  1UY8 A;  3ZRV A;  1TIL A;  3K60 A;  5KUK A;  2XDK A;  3EKR A;  2BU6 A;  4R8C A;  3SPH A;  1VQ6 V;  4AS9 A;  5M4P A;  2H8P C;  2IH3 C;  2ZDX A;  4X88 A;  4KFM A;  4L87 A;  1B63 A;  2KB1 A;  2CCS A;  5KA6 A;  3H01 A;  4MOT A;  2WI5 A;  1K4C C;  3A0Z A;  3B8M A;  3P30 A;  4XC0 A;  3X2Q B;  1UY7 A;  3LPS A;  3X2Q C;  4UVA A;  2YGE A;  1UYD A;  5D6P A;  4EM7 A;  3R4N A;  4W7T A;  2YI6 A;  3OGC C;  1QY8 A;  3H4L A;  3W7S A;  3BY6 A;  3ZRX A;  3ZMU A;  2YEI A;  2BSM A;  1SES A;  1GTO A;  1DLB A;  1K7D A;  4CE3 A;  4DZY A;  4HYO A;  4CWF A;  5EBM C;  1RPO A;  1FS0 G;  2BU7 A;  2F43 G;  3JZ3 A;  3FT8 A;  1S16 A;  3DTU B;  3T1K A;  3ZJZ A;  3K79 A;  3KG2 A;  1VQ5 V;  3SJQ C;  4LWI A;  2HG1 A;  4JAU A;  3RVY A;  5L3D A;  1K4D C;  3MD0 A;  1YC1 A;  3LDC A;  1VQN V;  2XND G;  2YKB A;  1WPX A;  1YTF D;  3IC7 A;  1F4M A;  3QNE A;  3CGZ A;  1S0V A;  4LP8 A;  1S72 V;  4FJC C;  4JAV A;  1VQ8 V;  1YTF B;  3Q5J A;  1I5X A;  2K5B A;  2M7W A;  3ZM7 A;  1YI2 V;  1IXM A;  2WSS G;  4BAY A;  2XDX A;  3LUT B;  1Y8P A;  4ASG A;  2WEQ A;  5H9C A;  1Q7Y W;  2IJI A;  2X6A A;  4FIP C;  4HXZ A;  3GIF A;  3OW6 A;  4EGI A;  2DWD C;  4GGL A;  2IW5 A;  4AWQ A;  1SZT A;  4GX2 A;  4HYP A;  5KUM A;  3FYI B;  3RLP A;  3OR6 C;  4RO2 A;  4HXW A;  3FB7 C;  2LP7 A;  2Q8G A;  1UYE A;  2JEU A;  4MP7 A;  3R65 A;  2YSU B;  5H6R A;  2EIL B;  3CCR V;  2EIL C;  3LNM B;  4DXW A;  5CTX A;  1VQK V;  1MSW D;  5D6Q A;  3ZRS A;  2JIZ G;  1W0J G;  1K5Q A;  4WFH A;  1QLE B;  3ZRW A;  3FYE B;  2DYS B;  1PVG A;  1QLE C;  1JCH A;  4UVC A;  2HR3 A;  4Q20 A;  1AI6 A;  4CWP A;  5CBH A;  2OCC B;  3B27 A;  3B28 A;  4P2Z A;  2OCC C;  4G28 B;  1YT1 A;  1Z5A A;  4GT8 A;  4URN A;  2YE2 A;  1TID A;  4HZ3 A;  3CC7 V;  5M4H A;  2GHY A;  2VCJ A;  2Q69 A;  3JD4 A;  4JAS A;  4KSG A;  1MU5 A;  2XAQ A;  3B8N A;  1ZWH A;  4MVU A;  5IDJ A;  4KFG A;  4KQV A;  1NH2 B;  3A0X A;  3ETE A;  3CMA V;  3A0W A;  4L94 A;  1E79 G;  2X6C A;  4PEL A;  2P67 A;  1ID0 A;  2YEH A;  1NHH A;  3SPG A;  5LHH A;  5FNC A;  1UYL A;  2BOC C;  4H81 A;  3E83 A;  4CWS A;  1YC4 A;  4MP2 A;  3B25 A;  2Y48 A;  3OMN B;  5BOD A;  4PDR A;  4JTA B;  4XTJ A;  2CGF A;  1UYF A;  3B24 A;  2WI6 A;  3SPJ A;  4XKK A;  2ITD C;  4ASF A;  1JQ0 A;  4PL9 A;  2AKP A;  5EC2 C;  4E02 A;  4CWT A;  1THZ A;  3ABT A;  2WLN A;  5EBW C;  4R3M A;  3SYQ A;  4X89 A;  3TCU A;  1NHI A;  2BU2 A;  1UYM A;  2WI4 A;  2YE9 A;  2WLL B;  1ARO P;  3K0D A;  4QPK A;  3I55 V;  4LPB A;  1GK9 A;  4K4O A;  2XHT A;  1U0Z A;  4GT1 A;  4XE2 A;  1R6K A;  1I5D A;  1NBM G;  4BQJ A;  4J9Z B;  2X0L A;  4NH9 A;  4YKX A;  2ZDY A;  4GFN A;  4HZ0 A;  1UYG A;  5LGT A;  2Z3Y A;  1KP2 A;  1AH6 A;  1OCZ B;  3JD0 A;  1AJP A;  2ESA A;  2WER A;  1OCZ C;  2V1D A;  3WHA A;  4JPR A;  4RAI A;  1TC0 A;  3TET A;  5D7R A;  4PA9 A;  4WF9 V;  4PA3 A;  1VQ7 V;  3SPI A;  2YKE A;  3JD3 A;  4L91 A;  3CRK A;  4BQG A;  4O07 A;  4KUM A;  2YJW A;  3OE7 G;  1GO3 F;  1AI5 A;  2DQ3 A;  4MTF A;  1K97 A;  1FXV A;  4QNH B;  4HZ5 A;  4EKW A;  1AH8 A;  1BGQ A;  2OTJ V;  3NMQ A;  1PNM A;  5BOC A;  4P9O A;  5EC1 C;  2NNU A;  2B1I A;  1KP3 A;  4EFU A;  2QG2 A;  1AJ6 A;  3O6O A;  5IN9 A;  1ZXN A;  5C93 A;  3E35 A;  3T0Z A;  4F4L A;  2CH4 A;  1F23 A;  5B1O A;  2OT5 A;  4JF3 A;  3QO5 A;  2B1G A;  3GIG A;  3BM9 A;  3K08 A;  4JYB A;  3LDE A;  4U93 A;  2XOK G;  3LNU A;  2ZBK B;  4JYC A;  3OW2 U;  4LWE A;  5D7D A;  2XAS A;  5LHI A;  4BAE A;  1MAB G;  4FPP A;  1UYH A;  3G6E V;  1KEC A;  5DM6 V;  4DUH A;  2Y69 B;  3T1C A;  2O1V A;  1H7U A;  2Y69 C;  2XAG A;  4CE2 A;  4CWO A;  4KP4 A;  3VAD A;  3OWB A;  1YT2 A;  2YEE A;  4MVM A;  5CTU A;  2IJK A;  4JTD B;  3U2K A;  1ORQ C;  3GB7 C;  2XX5 A;  3CRL A;  4RUE A;  1TC6 A;  2A0L A;  3O2F A;  3ETG A;  1PNL A;  4O05 A;  1OZ0 A;  2QTO A;  3HZ1 A;  2QEX V;  2ITC C;  1PKX A;  4FMT A;  4G2K A;  1FFT B;  2XJX A;  2YE3 A;  3I56 V;  1UJW B;  3Q5L A;  1COW G;  4YXW G;  2W0F C;  2XAH A;  2BU8 A;  3JD2 A;  2DW4 A;  5FND A;  1QLN A;  3F7V C;  2A9H A;  3ZXO A;  3CGY A;  5HFM A;  2EIM B;  4YKU A;  1EI1 A;  3R91 A;  3RLQ A;  2EIM C;  3ABK B;  3W7U A;  3ABK C;  4MW3 A;  4EMV A;  4MVS A;  2DWE C;  3VBB A;  5J6A A;  1DF5 A;  2XAJ A;  3MHH C;  2YI5 A;  2AHY A;  2XX2 A;  1G4Y B;  5FL7 G;  4BXI A;  1SER A;  1V54 B;  1S5H C;  1V54 C;  3CCL V;  4CBC A;  1S77 D;  2HLD G;  4UUJ C;  1Q86 W;  3E8H A;  2YI7 A;  3UKM A;  3EHJ A;  3C0E A;  3EHG A;  1H38 A;  1AMW A;  1CEZ A;  3D0B A;  3G7B A;  4RQE A;  3ZN0 A;  5B1N A;  1GKF A;  2JDI G;  4YKY A;  2JEX A;  2ZDI A;  3SYP A;  2OTL V;  2C2A A;  3T2S A;  1S14 A;  4BW5 A;  2Q2E B;  3ZXQ A;  2JJ1 G;  3VHA A;  1K92 A;  5LBQ A;  2EBO A;  1Y4U A;  3WQ9 A;  4EEH A;  4MTO A;  1DF4 A;  2H55 A;  4NH8 A;  2O1W A;  4FCR A;  2YK2 A;  1VQP V;  2VW5 A;  1OSF A;  2WLK A;  3CXC U;  4H37 A;  3CCQ V;  4XDL A;  2VCI A;  3TZ5 A;  3EFF K;  2XHX A;  2EIJ B;  3FB5 C;  2YEJ A;  4O04 A;  2EIJ C;  4N23 A;  2WI3 A;  2Q67 A;  2XD6 A;  2YKC A;  1YSZ A;  4GX5 A;  1S3J A;  1US7 A;  2CG9 A;  2YEV B;  1NQT A;  1XL6 A;  1UYK A;  3K9A A;  3F5W C;  3HZ5 A;  1GM7 A;  1OCC B;  2DYS C;  2IU0 A;  1QZR A;  1K9M W;  1P7B A;  1OCC C;  4J9Y B;  3LDD A;  2EIN B;  5CTW A;  2IH1 C;  1H8E G;  2EIN C;  2WLI B;  2YED A;  3INX A;  2WLM A;  3D3I A;  2BU5 A;  1H2G A;  3P32 A;  1OCO B;  4H33 A;  1I58 A;  3T0H A;  1OCO C;  1YER A;  5HFL A;  4XDM A;  2IOR A;  2HCH A;  3EHH A;  4U7O A;  2WI2 A;  4CWN A;  4XCL A;  3LSQ A;  3PJS K;  3ZMZ A;  3JYC A;  3Q5K A;  4JGS A;  4ZBM A;  2YGF A;  2XCM A;  1NVP D;  1GKZ A;  1YIT V;  2FWZ A;  3A0T A;  2QF6 A;  1QBZ A;  3ML0 A;  4XKA A;  1VQ4 V;  2AHZ A;  4R1F A;  4P7A A;  2A79 B;  4LP0 A;  1NR7 A;  1AR1 B;  1HWY A;  3M99 B;  2YKI A;  4R3A A;  4ASU G;  4PDM A;  1NVP B;  3H80 A;  2EZP A;  4HYM A;  3JCZ A;  4YKZ A;  2XDS A;  1Y8O A;  3ABL B;  1K5S A;  4MVO A;  1QVF U;  4TWK A;  3ABL C;  1KQS U;  1U2O A;  1BKN A;  4P8O A;  4ZVI A;  4YKW A;  1Q81 W;  2W6J G;  1E1R G;  4XKO A;  3RW0 A;  4FK5 C;  1K34 A;  1FXH A;  2PI4 A;  2ZD9 A;  4E01 A;  3PEH A;  1LNQ A;  2WAM A;  3U67 A;  4U7N A;  1YHQ V;  4ASB A;  2LFR A;  1ZW9 A;  2P6J A;  4JQL A;  3E2E A;  4JTC B;  2QM7 A;  2ZXW B;  4XIT A;  5L3F A;  2ZXW C;  2HKJ A;  5J71 A;  5KA5 A;  2R9I A;  3VOU A;  4UVB A;  2UWD A;  4EGH A;  4WCE V;  1J95 A;  2GSM B;  5IYB O;  1Y66 A;  2NLJ C;  2H8M A;  4UXN A;  3K97 A;  3OR7 C;  1NJI W;  3T10 A;  3F7Y C;  5M4N A;  2BOB C;  1AI7 A;  1JPX A;  2IOQ A;  2WLL A;  3IGA C;  3K3W A;  3TTZ A;  1TUE B;  2UXX A;  4G27 B;  2YE8 A;  5CMU A;  4MVZ A;  4WFG A;  4Z1M G;  3SL2 A;  4XCJ A;  4V26 A;  2XAF A;  1E1Q G;  2WLH A;  5H6Q A;  1H8H G;  3HHU A;  1M56 B;  1FXK B;  1MX0 A;  1M56 C;  3R92 A;  1FXK C;  3QO7 A;  4L90 A;  1YT0 A;  4WFA V;  2IOP A;  2EXL A;  4QPJ A;  3CCE V;  2DQ0 A;  1KD1 W;  1YES A;  1L1F A;  3K03 A;  4WFE A;  3ZMV A;  1VQM V;  2YGA A;  2WI1 A;  2HFE C;  5L3C A;  5DN6 G;  4L93 A;  3CWV A;  5B1A B;  2FXS A;  4LC1 A;  1KKD A;  1B62 A;  5CBG A;  2XDL A;  5B1A C;  5CA3 A;  3ZN1 A;  3MHS C;  3CYO A;  4PA7 A;  1GMG A;  3G71 V;  2IU3 A;  1CP9 A;  1RM1 B;  3CME V;  3TZ4 A;  4MT8 A;  3FT5 A;  3SYA A;  1RM1 C;  1MG1 A;  1EBO A;  4YKR A;  4MW8 A;  1ZWI C;  1QR9 A;  2H94 A;  3CCJ V;  4GCZ A;  2Q8I A;  3ASN B;  2YI0 A;  2IWX A;  3WG7 B;  1PL0 A;  3ASN C;  3WG7 C;  2MK3 A;  3BMY A;  4WUD A;  4I3H A;  3R4P A;  4WFB V;  1QCE A;  4XIR A;  3EHB B;  2EZO A;  3GIE A;  1ZXM A;  3ABU A;  1R3K C;  4MS2 A;  4URL A;  1YSR A;  2XJG A;  3FB6 C;  3U2D A;  5GW7 A;  3TK1 A;  2JKI A;  1YJ9 V;  1VQL V;  3ASO B;  1GM8 A;  3ZMT A;  3ASO C;  3OFN G;  3ABM B;  1UYI A;  4H85 A;  2QG0 A;  1MOF A;  3ABM C;  3CCM V;  4HAM A;  3SYO A;  5CN0 A;  2Q6A A;  2XJJ A;  3PEJ A;  4GEE A;  4PRV A;  2P7T C;  1A4H A;  2BRC A;  5CPH A;  1VQO V;  1QVG U;  3CCS V;  2EJR A;  3AG2 B;  3CP1 A;  1R3L C;  2BTZ A;  3AG2 C;  2YE4 A;  4X8A A;  3AG4 B;  3AG4 C;  5L3G A;  2Q68 A;  4FCP A;  2YE5 A;  1YSC A;  4L8Z A;  2ATK C;  4TSF G;  1M57 B;  1OHH G;  4HY6 A;  3ZCC A;  1Z5B A;  5IYC O;  1M57 C;  3IED A;  4B7P A;  1SET A;  4GX1 A;  2VWC A;  4YKQ A;  3E8G A;  4NH7 A;  4LWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...