4JASA

Structural basis of a rationally rewired protein-protein interface (hk853mutant a268v, a271g, t275m, v294t and d297e and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
237
structure length
237
Chain Sequence
LKRIDRMKTEFIANISHELRTPLTVIKGYAEMIYNSLGELDLSTLKEFLETIIEQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
molecule keywords Histidine kinase
total genus 68
structure length 237
sequence length 237
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jasA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4jasA02
1I58A 1OSFA 2YGAA 3T0HA 2XX2A 3B24A 3EKRA 3VHAA 4EFTA 3HZ5A 3A0WA 4KSHA 1YT2A 3SL2A 4XC0A 3CRLA 1Y4UA 2LFSA 4B7PA 4CWTA 2BYHA 2YEAA 2FWYA 2CGFA 4XITA 2XDXA 2YI7A 2BZ5A 4MP2A 2XDSA 4KP4A 4AWQA 4LWFA 3HYZA 3OW6A 4LWHA 3P32A 4HYMA 1TC0A 4BAEA 2YE8A 4CWRA 1U2OA 1IXMA 5CTXA 2BSMA 2YE3A 5CF0A 2YE9A 2H55A 2YECA 1KIJA 3K60A 1F51A 5M4HA 5F3KA 1Y8NA 1YERA 1YSRA 2FWZA 4MBCA 4I3HA 2IORA 3CRKA 3CGYA 5B1OA 2QM8A 4EGKA 3QDDA 1AH6A 2YE2A 2YGFA 1L0OA 1UYHA 4H81A 4HY6A 4X9LA 1JOYA 3G75A 4GT1A 1I5DA 1UYKA 4HYPA 4CE3A 4ASBA 5CTYA 3R92A 3HZ1A 3ZRWB 1Z5CA 3TUHA 2VWCA 4GQTA 1A4HA 3PEJA 3GIFA 4PRVA 3OMUA 3PEHA 2FTKA 3H4LA 1Z5BA 1NHIA 2WERA 2WI2A 3ZM7A 4H85A 3ZRWA 2H8MA 3A0RA 3FT8A 1UYLA 4EGIA 1U0ZA 2XHRA 2LFRA 4JYCA 2XJGA 4JYBA 4GFNA 4PRXA 3C11A 4XKKA 4MPEA 3TZ2A 4ASGA 2O1UA 3GIEA 1ZWHA 4ZKIA 3NXSA 1I59A 5D7CA 4YKYA 4I5SA 3A0TA 4MT8A 2WI4A 2YE5A 4XE2A 4B6CA 2CH4A 3EKOA 5L3JA 4R1FA 2VCIA 2YEGA 3HHUA 2YEDA 4E01A 2WI1A 5BOCA 4JAUA 4UROA 2GFDA 4EGHA 3VHDA 3D2RA 2XD6A 2QFOA 2WI7A 1EI1A 4ZVIA 4AWPA 4XIPA 3U2DA 1YC3A 4WUCA 2WEQA 1KZNA 1UYMA 2XX5A 4MOTA 1YT0A 1S14A 2BYIA 1AH8A 5CTUA 5IDMA 3T10A 3GIGA 3OWBA 5M4NA 2YEJA 3ZXOA 2HCHA 3TK1A 1BGQA 2GQPA 2XHTA 3FV5A 3O2FA 4BXIA 5M4MA 3HYYA 1YS3A 4MTXA 4EMVA 5IDJA 1I5AA 5J6AA 5D7RA 2WI3A 4NH7A 4EM7A 3QTFA 2FYPA 4O07A 2BTZA 4FCRA 1GJVA 3TZ5A 4EFUA 4URLA 1EA6A 1UYEA 4MPCA 4P7AA 4XKOA 1AJ6A 1UYFA 2CCSA 4CE2A 2BT0A 5FNFA 4XIRA 4L90A 2IWSA 4DUHA 1YSZA 3EHHA 4O04A 4EEHA 3K97A 2O1WA 1UYGA 3U2KA 3TZ0A 1B62A 4MB9A 3EHGA 3G7EA 4XDMA 4R3MA 1ZXNA 2WI5A 3EHFA 4YKXA 2VCJA 2O1VA 4XTJA 1YC1A 2BU6A 5FNCA 2QF6A 4XCJA 1Z5AA 2XHXA 4L8ZA 4WUDA 2BU8A 1TH8A 1ZXMA 4BQGA 4HZ0A 1BYQA 4LC1A 2YI6A 2JJCA 2WWWA 3WQ9A 2HG1A 2YEFA 2JKIA 1US7A 1UY9A 1Y4SA 2QG2A 4PU9A 3VADA 4FPPA 2YE6A 1I5CA 3ZRVA 2Q8IA 4CWOA 2ZDXA 1UYIA 2YI5A 3A0ZA 1AM1A 4KTNA 3K99A 4XKAA 1NHHA 2YEIA 2K5BA 3BM9A 3RLQA 2BRCA 1UY6A 4U93A 2BU2A 1R62A 2IWUA 3D0BA 3D36A 1YT1A 2QG0A 4O05A 1H7SA 2FXSA 1BXDA 2XK2A 5D7DA 3NMQA 1Y8OA 5C93A 1QY8A 2YEHA 2ZKJA 4P8OA 4L93A 4YKUA 1Z59A 5M4PA 1TC6A 3R4MA 4Q20A 1THNA 5M4KA 4FCPA 4YKTA 3O6OA 1I5BA 4L91A 2E0AA 1UYDA 1PVGA 1QYEA 4JAVA 3MNRP 4KSGA 1JM6A 2YE7A 2Q2EB 3BMYA 4NH9A 2BREA 4KFGA 1B3QA 2YK2A 5CTWA 3A0XA 1AMWA 3TTZA 5FNDA 2YKBA 3ZRXA 2IOPA 4JQLA 4YKWA 4ASFA 3GIGB 3LNUA 1TILA 3G7BA 3OPDA 3T0ZA 1MU5A 1YESA 2P67A 4AWOA 4E00A 4W7TA 2Q8GA 2ZDYA 3TZ4A 3T1KA 2XDLA 2YKJA 4CWNA 4PL9A 1BKNA 2HKJA 2C2AA 4QPKA 4XD8A 4XIQA 3INXA 4HY1A 4WUBA 3DGEA 3RLRA 1ID0A 3B27A 4HZ5A 1QZRA 2XDUA 3A0YA 2BU5A 3FT5A 4CWFA 3B26A 4XCLA 2YE4A 4O09A 4QPJA 2QM7A 4KQVA 2VW5A 3WHAA 2YEBA 3VHCA 1Y8PA 5F5RA 1GKZA 3LPSA 2WI6A 4U7OA 1TIDA 4V26A 4BQJA 4LWIA 3R91A 4CE1A 4CWQA 3ZXQA 3T2SA 3IEDA 2YKCA 3MD0A 2CG9A 3H80A 3O0IA 4R3AA 1S16A 4URNA 2WEPA 2YK9A 2YJXA 2BU7A 4MPNA 3RKZA 5M4EA 3Q5LA 4DZYA 2Q8FA 3HEKA 4BIZA 5BODA 3RLPA 1ZW9A 2UWDA 4CWPA 3EHJA 3K98A 3R4PA 4CWSA 1NHJA 4LWEA 5D6QA 4NH8A 4HXZA 3B25A 4YKZA 4V25A 1MX0A 4GGLA 2YGEA 2ESAA 2XDKA 4FCQA 5B1NA 2Q8HA 1TBWA 3INWA 1GKXA 4L94A 2PNRA 1YC4A 2CCTA 5IN9A 3OWDA 5GGZA 2YKIA 4BIUA 3ZCCA 3R4NA 3U67A 4JASA 3ZKBA 1YETA 2XCMA 4HXWA 3CGZA 3ZKDA 4U7NA 3KE6A 4H7QA 4MP7A 3Q5KA 2AKPA 3B28A 2YI0A 2YEEA 3R4OA 2XJXA 2YKEA 4LWGA 3CWVA 4LP0A 3C0EA 4GEEA 4URMA 4AS9A 3JZ3A 4GCZA 1UY7A 5J71A 2YJWA 1H7UA 2XJJA 1UY8A 1B63A 2CCUA 2XABA 4ASAA 4YKRA 4E02A 5FWKA 1UYCA 2XX4A 2ZBKB 5CPHA 2IOQA 2EXLA 5D6PA 4YKQA 4FMTA 3Q5JA 4GT8A 4K4OA 4O0BA 2IWXA 4LPBA
chains in the Genus database with same CATH superfamily
1YJNV 4P2ZA 4IYHA 1I58A 1NS1A 3BPZA 1XMOB 1SRYA 2YGAA 3B24A 3EKRA 3T0HA 4FVMA 3F5TA 4UV9A 2E3CA 3A0WA 4O4IA 2P6JA 2UXCO 1TUEB 1XNQO 3SL2A 4XC0A 1KKDA 1Y4UA 4B7PA 2HLDG 2FWYA 2RNBA 2YI7A 5EK0A 4PDRA 3OW6A 5LXTB 4DUYB 4LFBO 1ZX3A 4Q6GA 5KX5A 2H55A 2ODMA 3K60A 2YI9A 5M4HA 1PKXA 1YERA 5LBQA 4JI3B 4MBCA 2D2CB 4DR4O 4DV6O 3QDDA 2AXTZ 4O4HB 4CS3A 1V9PA 1VF6A 4JI4B 2ADPA 1Q5OA 1Q6UA 5D5QA 2PI5A 1BL8A 4X9LA 2Q8VA 1M90W 4GT1A 3FFQA 1I5DA 1HNZB 2PGGA 4HZ3A 3SPHA 4UCUA 3TCUA 2VQEO 1UYKA 3S3WA 1PM9A 4LBEC 1R1BA 3E22B 3RVYA 3AK2A 5CTYA 1VIBA 5D5PA 4ASBA 2HVKC 3HZ1A 3CEIA 3L71H 5KMGA 3E86A 2EIJC 3E35A 1NTZH 3ZN0A 3ZRWB 3OR7C 1RSOB 2LP7A 5LHGA 2VWCA 4O4JA 5J2UB 1OJHA 3RYFB 4P9PA 1A4HA 3GIFA 2P4KA 2QWPB 4B7KA 3ASOB 1JQ0A 5LMNO 3PEHA 3K0GA 2FTKA 5H2FZ 5H5NA 2WSSG 1NHIA 3ZM7A 5KHIA 1V55B 3Q4HA 2JRIA 1U0ZA 1JCHA 2Q5ZA 1H8HG 4MVRA 4XKKA 4NXMB 3CCRV 4WFEA 4GX0A 5LMUB 5KHKA 2D3OW 2GSMB 1F4MA 3A0TA 4X1IB 2DWEC 4JV5O 2WI4A 3J7AU 4PA6A 4NTWA 1QLNA 2VCIA 2HP8A 2YEGA 5IYBO 3I56V 2XAGA 3RYIB 5FPOA 4DV7O 4E01A 4DUYO 2EBOA 5BOCA 1M9NA 1BE3H 3LNNA 1M56B 3OTOB 3VHDA 2XD6A 4PI0A 4LF5O 1R3IC 2VS0A 1EI1A 4OGQB 1RFYA 3JATA 5EZYA 2XAQA 3AG4C 1B06A 1YC3A 2WEQA 2M6YA 4FLUA 1S76D 1YT0A 2BYIA 3HPLC 1YXBA 1AH8A 1OCOB 3ICXA 1HNZO 3ZRSA 5M4NA 3OT7A 2EILC 3FV5A 1BGQA 4YHHO 3HYYA 4MTXA 1EN4A 3H01A 5IDJA 1Q6IA 2CH7B 3K06A 3AG1B 1Y74A 3WB2A 2YIBD 2BTQB 1Z5WA 2E74B 4DR5B 2YDEA 3ABKC 2PI4A 1GJVA 2YUAA 2WLLA 1F23A 3CJHA 4EFUA 4URLA 5JVDB 3ZHQA 2X7RB 3CC4V 2BOBC 4DUZO 1COWG 4H13B 4OX9B 4NKGB 4K8ZA 4U3FH 4GKKO 1UYFA 1US6A 2XOKG 2IW5A 1Y76A 5FNFA 2IWSA 2ZR3A 3A2FA 4HBNA 1BQ0A 3OM3B 3TXQA 1VARA 4DXWA 4D6TH 4O04A 1Q86W 2HG5C 1I08A 4P30A 1YHQV 3IC9A 1H2LA 2QTOA 4XDMA 4LH7A 4PV1B 1KB9F 1QU7A 4LFAB 2QGNA 3EHFA 1SQVH 1GM8A 2C1GA 1YC1A 2ZE7A 3K5MA 2BU6A 5FNCA 1Z5AA 2Q0AA 1IBKO 1ZXMA 5L3FA 5L3DA 4LC1A 4CBCA 2IJHA 2WWWA 2N04A 2HG1A 1UY9A 3E8HA 4FPPA 3SYCA 2CDYA 3IFXA 1YTFB 1WN7A 2UU9B 3CCVV 1AM1A 2KG7A 1B04A 2YEIA 1V54B 4ZHQB 5CBFA 2BRCA 2VWKA 4U93A 2YEVB 1R62A 3OFNG 1JA8A 1O9GA 1VQPV 2WLIA 4LF9B 2XK2A 3NR7A 2YEHA 4UB6Z 1GN2A 2ZKJA 4L93A 2V1DA 4P8OA 1XMQB 3CE2A 1XQ8A 5M4PA 1MZEA 4LF8B 5M4KA 5BMVA 1Y67A 5L3BA 1S0VA 3O6OA 1EM1A 1UYDA 1IDSA 2HEPA 2WAMA 4JAVA 2CAZC 3MNRP 4CC5A 4DR2O 4BW9A 2UXNA 4R6ZA 3BCCH 2Q2EB 3BMYA 1CXZB 1M1KW 4NH9A 4N23A 3N2KA 2HHHB 2BREA 3K9AA 4RUEA 3SPJA 4YY3B 3AEIA 1B3QA 1O9HA 5CTWA 1G4YB 4J9YB 1K92A 1Q8IA 2LQTA 5FNDA 1BGYH 1AI7A 1Q82W 1FJGO 3JD0A 1MU5A 3OGIB 2P67A 3BRCA 3G71V 3FB6C 3OR6C 5K1XA 2HKJA 4LF4O 4R7CA 4WBNB 4HY1A 1JR9A 2QWRB 2ZINA 3M7MX 4B08A 2E5LO 1WJZA 4WUBA 4O4JB 1ID0A 3B27A 2IJIA 4HZ5A 1B6QA 3ML0A 2ZDIC 5KAFZ 4JI1B 4UUJC 3QVNA 4NXNO 2YE4A 1A32A 4KQVA 2YEBA 3VHCA 3UT5A 5JH7B 1Y8PA 2BTOA 3LPSA 4HNAA 3JAMN 2F93B 1L0LH 3OMNB 1SC5B 2QJ1A 5ITZB 4V26A 1FXKC 5IT9N 1PP9H 2JJ2G 4CE1A 4NTXA 2OTLV 1IBLB 4CWQA 3ZXQA 1WNSA 1EZVH 1YVWA 3AG3C 1S16A 2QKSA 4URNA 1YI2V 2WEPA 2YK9A 4JI0O 3CS5A 1K3EA 4JGSA 2G38A 1WPBA 4XDKA 4DZYA 1QVFU 4DW1A 2AGAA 3HKDB 3MHHC 4NYKA 4UCOA 2PF4E 3CRRA 2UXDB 1MABG 1SA0B 3EHJA 1BHBA 4WCEV 3R4PA 2EJRA 1NHJA 5D6QA 2JGDB 4B3MB 2DYSB 1Q6HA 5JJNB 2P22C 1K33A 1WA8A 4LCUC 1KD1W 2Q8HA 5B1NA 5LA6B 1VQ7V 2YICA 4FZ1A 3BAAA 5GGZA 3L9DA 5LGUA 4WBNA 3FB5C 3OEEG 2ZNIA 3APQA 3IAYA 2X6BA 4HXWA 3SJCC 1HNXO 1G8MA 3Q5KA 3B28A 4N21A 1NQTA 4PDMA 3ZS8C 4PA4A 1AILA 4YJ2A 3ABTA 4DV4B 2L6LA 1XNQB 4H44B 3T1HO 1IBLO 2YKEA 1K8AW 4LP0A 3L72H 2QKCA 3JZ3A 3DXRB 5B3SB 3JD2A 4BW5A 1BHAA 1KBHA 5J2UA 4EKWA 1UY8A 1QR8A 2HR3A 1H38A 2N74A 1URFA 5FWKA 5H9CA 1S72V 5JWPA 1YITV 1T5EA 1YJ9V 1PL0A 4CH3A 1BCCH 5IYZA 1M93A 1AR1B 3Q5JA 4QE9A 2R72A 4K35A 3TXSA 5LL6Y 4LFBB 4LPBA 1WB7A 3JSLA 2F1MA 4B3MO 1YCIA 2XX2A 3JD4A 3AG2B 2P06A 3CCLV 1AROP 2YXHA 4EFTA 3HZ5A 3E89A 3E83A 3RYFA 4JTDB 1Z5VA 4R8CA 1GO3F 5B1BB 1H8EG 4B3TO 2MK3A 4FK5C 3CRLA 4CWTA 4NTYA 2BYHA 4CH4A 1G6UA 4G28B 3U11A 3WB0A 3UM7A 3ETGA 4DRXB 2HJFC 3O65A 1GKFA 5L3EA 3CHXA 1VQNV 3QO8A 1QCEA 4BAYA 4HYMA 1TC0A 4ZHQA 3JAWB 1GK9A 1M5IA 5CF0A 3JYCA 1KIJA 3AK1A 3ABMC 4JI8O 5F3KA 3JALA 3IC7A 5J2TB 3JCUZ 5IYDO 1N34B 1YSRA 3ABLC 3MAQA 4I55B 4I3HA 3CRKA 5B1OA 2ZNJA 4EGKA 3RT3C 2PZSA 4MTOA 3WU2Z 1L0OA 1UYHA 4YJ3A 2LO1A 4KXRA 2PYJA 5LYJB 1JOYA 4FJCC 2OT5A 5DEDA 4ASUG 5H6RA 1VQMV 3L75H 5AG2A 2BSKA 3CXCU 3K03A 1FXHA 1I94O 1Z5CA 3SGIA 1N4CA 4GQTA 1XNRB 2HHHO 4LNUA 2ITCC 4F4LA 3UO2A 3TJTA 5LGNA 5IJ9A 2CH7A 5L3GA 3E22A 1YF2A 2K1EA 5B66Z 3S3XA 5BR8B 4LF5B 1AI5A 1G1XB 4EGIA 2R9RB 2C1IA 4JYCA 1DTOA 4UXNA 4ABMA 5A9GA 3CMEV 3ZIAG 4MPEA 4ASGA 4G27B 2O1UA 4JYAB 4LP8A 4ZKIA 2Q69A 3NXSA 5KHGA 2DOSA 2QEXV 1I59A 1R73A 4E2LA 3B77A 4I5SA 4YKYA 2CE4A 4IIJA 4XE2A 4B6CA 1RM1B 2A0LA 2CH4A 1RP3B 2IU0A 5B5EZ 2E76B 5KA5A 1S5LZ 3I5DA 4H0LB 4UVCA 2IU3A 1BT8A 1FS0G 1J5EB 1VQOV 2QFOA 5IYCO 2WI7A 2XUMA 5LXTA 4FFBA 3N2KB 5LYJA 2F66C 5GONB 3AK3A 1KZNA 1UYMA 1XREA 1S14A 3H1LH 1HNWO 3AG7A 3SPCA 1YEWA 2R9AA 2YEJA 3ZXOA 2HKOA 2HCHA 3TK1A 1S77D 4JV5B 2LW7A 2GQPA 3O2FA 2RN9A 3CRMA 3HR0A 4JI2B 1YS3A 1I5AA 5J6AA 1GH6A 4F6EA 1NKDA 2BCCH 3OMAB 4FLXA 4I50B 3CCMV 5B3SC 4DR2B 3THOA 2Z5UA 2WLKA 3K5NA 3ZHSA 1L0NH 2Q7EA 4FCRA 1JFFB 1QLEB 5KUMA 5FNVB 4DV3B 4X89A 2W0FC 1PPJH 4MW8A 3EHBB 3ZJZA 3K57A 4CZZA 3ASNC 4DW0A 4WFFA 1F4NA 3K5LA 4PA9A 1AJ6A 3JAKB 2WA4A 5ITZA 4CE2A 2BT0A 4XIRA 3MHSC 4Z1MG 1YSZA 1SS3A 1OHHG 2Q4PA 3B8NA 3K97A 4GKJO 1UYGA 4DV0B 3TGUH 2UU9O 3BY6A 4PJ0Z 3U2KA 4AI8A 1JJ2U 3CC7V 1B62A 4YJ2B 4P9OA 3AG4B 4YKXA 2VCJA 3RFRA 4DR5O 4YXWG 4WUDA 2BU8A 4BQGA 1HNWB 2YI6A 3LMMA 1BZKA 1I0HA 2JJCA 1XDCA 2YEFA 1QBZA 2IJJA 4J42A 1Y4SA 4TQDA 4JZGA 4MVSA 2QWNB 1N0JA 3CX5F 2XT9A 4K3AA 2YE6A 3ZX6A 1RSOA 2GTAA 3LSSA 3ZRVA 1Y66A 3E8FA 2ZDXA 1UYIA 1ZLZA 3VBBA 4JI0B 1GAXA 2Y69B 1XI1A 2Q9LA 2VRZA 3B2EE 2Q7GA 2K5BA 2DWDC 4LF6O 1HW7A 3MDSA 2IWUA 5CB4A 4WF9V 1YT1A 1K5QA 3D0BA 5CBGA 1H7SA 2FXSA 2JS3A 1SQXH 4LWSB 5C93A 1VF5B 3VQWA 2JGUA 4U3JB 4B3TB 3BA8A 1DK1A 3R4MA 3ZMTA 4TV8B 4YKTA 4TWKA 4L91A 3CB2A 3GB7C 3SPGA 1KMIZ 1FFXB 2W0XA 2YC0A 4PD4F 5K1PA 1PVGA 1QYEA 1MOFA 2YXYA 4X8AA 1QHTA 1X59A 3F7VC 2VWJA 1OCOC 3RWRD 1NH2D 4J80A 4X64B 1Y6XA 4JI5B 1D2DA 3EVKA 4I55A 3SPIA 3A0XA 4LR3A 3UQ8A 1XMQO 2ARHA 2WLLB 4DV4O 2L35A 3AG1C 4FZ0A 2IOPA 4JQLA 4KHPB 4ASFA 1TILA 3G7BA 4I7ZB 5HFMA 4JPRA 4J10A 2Q7HA 2JGDA 3STZC 1K34A 4E00A 4ZI7A 4W7TA 5CN0A 3T1KA 2XDLA 2YKJA 4PL9A 2GDSA 4XD8A 3CCQV 1UFIA 2E75B 3KZIZ 4KFMA 1K9MW 1GN6A 4DO2A 1OZ0A 3WFVA 5GTHZ 1QZRA 1AP5A 2BU5A 3FT5A 4F6RA 1PL4A 2JIZG 4O09A 2H3OA 3WHAA 5F5RA 2EJ7A 1UJWB 2O57A 1NH2B 2WI6A 4BQJA 1AJPA 4LWIA 1ENVA 3R91A 3CC2V 2IH1C 5BR8O 3OE7G 2MW2B 5TISZ 4DR7O 5EYPB 4DR1O 2PY5A 2CG9A 4B7EA 4R3AA 5LP6C 2PTMA 3JARA 2YJXA 2E5LB 4X66B 3EFFK 2PYLA 2JDIG 4D7TA 2JEXA 4ZBMA 5LA6A 1ZW9A 2Y0IA 3PJSK 4JI7B 1K4CC 3K98A 2ZT9B 4CWSA 4LWEA 1THZA 1OCZC 5EBWC 1OCRB 1MSWD 2F23A 1I5YA 4JI6O 4GGLA 3UCSC 2Y4UA 1L8DA 1R3KC 2QSAA 3KCYA 2XTAA 1GKXA 1GM7A 4L94A 4CS4A 2CTRA 2PNRA 2FKXA 3SJAC 2CCTA 4YJ3B 3OWDA 3GWOA 2AHZA 3DC6A 5LOVA 1IBMO 1SERA 4UCVA 2DQ3A 2CGNA 1IURA 3ASOC 3ZKBA 2ZQMA 1Q43A 4MVMA 4JZ2A 3CGZA 2HJDA 3ZKDA 1CPYA 1AVMA 3KE6A 5LGTA 4H7QA 4MP7A 1ZUQA 2ZXWC 2UXXA 4RQFA 1Z2GA 4TQFA 3ZMUA 5JJJB 3RYHA 4E4EA 1PNKA 3H1JH 4KL1A 2IH3C 1UY7A 4DV1O 3W7TA 2RDCA 2K9PA 3FD9A 3O9OA 5A2QN 1H7UA 4O2AB 2GUZA 2XJJA 2R9IA 5EIBC 1ZL8A 3B40A 2CCUA 2XABA 4YKRA 4E02A 5B1AB 2FYUH 2HHIA 5LP6A 3DXRA 2IOQA 2YI8A 5D6PA 1EN6A 1J95A 2KG7B 2DYSC 2IWXA 4O0BA 1XMOO 1KUQA 4ZIBA 3OUFA 2Q68A 5IWAB 1OSFA 2UXCB 4DK1A 3K5OA 1SZXA 5J9PC 1H2KA 3ETEA 2OTJV 4TV9A 3HKDA 4X1YA 4ZOLB 4I9QA 1BQZA 1BMFG 1NTMH 2LFSA 4UCSA 2ZE5A 1N8RW 2CGFA 4XITA 1DF5A 2XDXA 1KKCA 1JPXA 2BZ5A 4MP2A 2XDSA 1BS3A 3X2QC 4LWFA 2RCVA 3JALB 4UVBA 4DR6O 3HYZA 1I94B 1SESA 1Q90D 3P32A 3RN4A 2GTSA 1U97A 2UUBO 4R50A 3CCSV 2YE8A 5CTXA 2BSMA 5JQGA 1K7DA 2YECA 3AG3B 4O2BB 1Y8NA 3C90A 3OAAG 4B3SB 3UO3A 4I0XB 5CA1B 2EINB 3VQXA 2YGFA 2JEUA 4H81A 3ZHUA 1KP2A 3R66A 5J2TA 1TVKA 4UV8A 2Z0AA 5KAIZ 1HR0O 2EZOA 4YIPA 3SYAA 1KU9A 5IJ9B 1TUBA 1NT2B 4X88A 2GV9A 1H2SB 4CE3A 1HR0B 2ADQB 3TUHA 4IL6Z 1N0NA 1M57B 4AQYB 4EB6B 3PEJA 3KG2A 3QF7A 4PRVA 3JSNA 4TV9B 5JCOC 1VQ4V 1S5JA 1VEWA 2PUSA 3K08A 1Z5BA 4O4LB 1DGSA 2EIMC 2XJGA 2ILMA 1JFFA 1NR1A 3TZ2A 3JAWA 1FAFA 1P7GA 1LR1A 4TT3G 3UKMA 4BIOA 5CA0B 1DF4A 5D7CA 3T1YB 2NLJC 4TSFG 2KSDA 4MT8A 5JENA 2YE5A 2UUAB 2FMLA 2EX3A 5L3JA 4R1FA 3CCUV 2OWOA 4DV5O 2KQXA 2Q0OC 4DV3O 4MTFA 4JAUA 4WFGA 2JVDA 3TETA 2HFEC 2Q73A 3RYHB 4CC6A 1AJNA 5IJ0B 2DN9A 4EGHA 2B5UA 1GN3A 4OPAA 4AWPA 4XIPA 3U2DA 5EYPA 2P7TC 4WUCA 3HKCB 4GZRB 3FYEB 4DR1B 4XDJA 4FLVA 4YHHB 5CTUA 5IDMA 3T10A 4FLZA 4B3RO 3JASB 5C8YB 4BXIA 1P49A 4I4TB 4IT5A 5M4MA 4PA7A 3K9SA 4EMVA 3FAVB 5FLXN 1TAEA 1P84F 5KA6A 5KLVH 4QE7A 3CD6V 3KKYA 4DR3B 4AQYO 4X65O 2NN4A 1EZJA 2WI3A 4NH7A 4EM7A 2XAFA 1H2MA 4O07A 2DMXA 3CRCA 4FLTA 4AHCA 1ZTEA 4Z2WA 1YSCA 2AW9A 2ZM6B 2P5OA 3TZ5A 4DUZB 1MA1A 1W2BU 2EILB 2DJVA 3RGBA 2QWQB 4MW3A 2LGWA 4MVOA 4XKOA 4LNUB 2CCSA 4MS2A 3PN1A 4YIOA 2OYQA 4DUHA 1I5XA 4FLYA 3D36C 4WFAV 1IX9A 3GWKC 2KB1A 2O1WA 3ETDA 4O2BA 4FFBB 3TZ0A 1HWYA 5GW7A 1U96A 4MB9A 1K4DC 3G7EA 3N2GA 2EULA 1FFXA 4R3MA 1Q7YW 2LGQA 3E2EA 2RQ6A 4DV5B 3RVZA 3QTCA 4O4HA 2QF6A 2YS8A 3K04A 1XHZA 2VQFB 4CH5A 2CUGA 4HZ0A 1BYQA 2XAHA 2B1GA 4MVQA 4XDLA 1LNQA 1WP7A 3OD4A 3G4SV 2WLJA 4JYAO 2QG2A 2HVJC 3VADA 2QWOB 2X6CA 4EEQA 3KCXA 2Q8IA 4X9QA 4J9ZB 5KMGB 3A0ZA 3BA9A 1Q81W 1PNLA 1FFTB 4KTNA 3K99A 4XKAA 4LF4B 3W7XA 4NXNB 1JX9A 2Q6AA 3U10A 3RLQA 1NU1H 2BU2A 3AG2C 3D36A 1QNMA 2ZM6O 5FPRA 2QG0A 4O05A 3ASNB 1NVPB 1XBLA 2ZR2A 1K97A 1N34O 5D7DA 5JCOA 4X64O 3NMQA 3W7SA 5EIBD 1Y8OA 1RM1C 1AI6A 4I50A 4YKUA 4IYIA 1Z59A 1VQ6V 4F6RB 3OW2U 3OUSA 1W59A 5CB4B 3FYIB 4Q20A 1THNA 2H94A 2UUCO 4FCPA 5B1BC 1SQQH 5EBLC 4UVAA 4LH6A 2ZD9A 1WB8A 5FNVA 2EIJB 3P3PA 2H8PC 4UCRA 2YE7A 3VQYA 2A7WA 2ZIOA 4H33A 4KFGA 2YK2A 3G6EV 1EN5A 5CA3A 5DM6V 1AMWA 4HYOA 1VP7A 3ABMB 2Q67A 3ZRXA 4FM0A 1GMGA 2XHBA 2YIDA 3JASA 1K73W 3T0ZA 1AB3A 1YESA 2Y69C 4AWOA 3TZ4A 3T1CA 2VQEB 4QPKA 4XIQA 3INXA 1VQ5V 5EBMC 3DGEA 3RLRA 2KKWA 3APOA 3L70H 3SYOA 1SF9A 3T1HB 2IM9A 4ZI7B 3A0YA 3L73H 1XILA 4O2AA 2AHYA 3IGAC 3LSQA 4D7SA 5KUKA 3B26A 4XCLA 1OCCB 3P30A 4AILC 4K0KO 1AI4A 4K8XA 1GKZA 1IBMB 5BMVB 3SR2C 2F4VB 5GONA 4EFBA 3T2SA 3IEDA 2YKCA 3MD0A 2RMKB 1WPXA 3VQVA 1GM9A 3H80A 1AP6A 2QE7G 4Z1VA 3ZBHA 3RW0A 5BY1A 5F2VO 3T1YO 2BU7A 3H9VA 4MPNA 3HKBB 3RKZA 5M4EA 3Q5LA 1UPGA 2Q8FA 3LDEA 3HEKA 2UXBO 4NR1A 3RLPA 2UWDA 3G67A 1D5AA 2ETNA 1XNRO 3ZMVA 3JARB 2QA4V 3RYCA 3T4DA 3CMAV 3F5WC 5LHIA 3FX7A 3OTOO 4HXZA 2UXDO 4YKZA 1MX0A 1VQ9V 2CTQA 3HKCA 2YGEA 2ESAA 3WB1A 4FCQA 3OTFA 3INWA 1NBMG 1KC8W 4W4LA 2YKIA 1ORQC 1SETA 4BR6A 1YIJV 4TV8A 4X66O 3R4NA 5BZBA 5CBHA 3D8CA 3WG7B 4JASA 3A0HZ 1ZSPA 2DE0X 4QNHB 1YETA 4I0XA 4JTCB 2AZ0A 2JK5C 2YEVA 4IIJB 5CA0A 4U7NA 3CPWU 4JYYA 2YI0A 1HNXB 1R6KA 4L8JA 5H6QA 2YEEA 1R6TA 5IWAO 3R4OA 2ATKC 3CWVA 2F4VO 4URMA 5L3CA 4AS9A 3JD1A 4GLXA 4GCZA 1QVGU 2YJWA 1HP8A 1JJOA 2UUCB 1L1FA 4PDLA 4XBFA 1B63A 2UUBB 4ASAA 2QM4A 5IY5C 2A06H 1VMGA 1N36B 2XX4A 2ZBKB 5CPHA 2EXLA 4YKQA 4MSWC 3ZMZA 1RPOA 3C3SA 1TVKB 4GT8A 4K4OA 2FL4A 4LF6B 3ZHRA 2A79B 1YTFD 3ABUA 2EIMB 3I55V 4DV6B 1GTOA 4J7ZA 4DYLA 1YJWV 1E1RG 3VHAA 4IGGA 4X1IA 1GRJA 4E72A 3VOUA 2ZDIA 3ZMSA 4KSHA 3CP1A 1YT2A 2YSUB 3RYIA 3SYQA 2YEAA 2Z3YA 2NR5A 5JVDA 2ZKOA 4AWQA 1R3LC 3N27A 4KP4A 3JAKA 4DV1B 4DV2B 4X1KA 1CEZA 3GVMA 4OXSA 1JVMA 1ROPA 4LWHA 4RAIA 1QLEC 3J80N 2DW4A 4BAEA 1I7FA 4CWRA 1FPOA 1U2OA 1IXMA 5LMNB 3H1KH 4NVPA 2YE3A 2YE9A 2ZE6A 5DECA 3UT5B 5JH7A 1PV0A 1F51A 2JJ1G 4IHJB 4K0KB 4I4TA 2QR4A 4WFHA 2FWZA 1YDXA 2IORA 3CGYA 1AR4A 1XL6A 2QM8A 4NXMO 3N2GB 4CS2A 1AH6A 5JQGB 4X20B 2YE2A 2NNUA 4UB8Z 2BOCC 1M4UA 4HY6A 4OX9O 3G75A 4MTGA 4DR6B 2OCCB 2JS5A 1N36O 3LNMB 3CYOA 1OCZB 5IYZB 1WAZA 4L87A 3IJ4A 5LMUO 3LDCA 4HYPA 3ZHTA 4QJFB 1JMKC 4JI2O 4H37A 1PNMA 3R92A 1AJQA 1OV9A 2AZ2A 3CRQA 2UUAO 3RYCB 2ZCEA 3R65A 2GUZB 1RPRA 4X1YB 2OIEA 3OMUA 2Y0PA 3FAVA 1K5SA 4TOIA 3BVOA 4DR4B 1SQFA 4LFAO 1SQGA 4GUNA 3H4LA 4TUYB 2WERA 4MVUA 2DYRC 2WI2A 3ZEDA 4H85A 5FL7G 3ZRWA 1N32B 3A0RA 2H8MA 3FT8A 1UYLA 1NI8A 1Y4MA 4LWSA 1FJGB 2EIKC 2XHRA 2LFRA 4HAMA 2WLIB 1HDJA 4JYBA 4GFNA 4PRXA 3C11A 3S5TA 1F7YA 1ZWIC 3CCJV 3GIEA 1ZWHA 1XOUA 4LF7B 2A3QA 2GBOA 3BHPA 4LFCO 3Q4HB 4B3RB 3STLC 4X62O 3EKOA 2FB5A 4ICGA 2CTPA 3HHUA 2YEDA 4JAAA 4MVZA 1KECA 4DR3O 3CYGA 3OMIB 2WI1A 1EBOA 2EINC 5GTIZ 4UROA 2EZPA 2B1IA 4RUFA 2GFDA 4RWUA 3D2RA 3ZN1A 2WLHA 4ZVIA 1DLBA 2CK3G 4GKKB 2ITDC 4FIPC 3BFRA 4G2KA 2XX5A 4MOTA 5LP6B 1PD3A 1D5NA 1Y74B 1MZFA 3GIGA 3OWBA 2XHTA 3BEHA 1WP8A 4EB6A 1X4TA 5CA1A 5E79Z 5D7RA 1SKVA 1E1QG 3QTFA 3F7YC 2FYPA 1XHXA 2BTZA 1OCRC 4QGPA 1IBKB 3C3TA 3L74H 3H1IH 1TA8A 2QTSA 5DN6G 3K58A 1N33B 1IVSA 1EA6A 3T2MA 3E8GA 1UYEA 3EXAA 4MPCA 1IXBA 4KUMA 1LUVA 4P7AA 1FYJA 3DSQA 1NVPD 3G6BA 4LF7O 1SQPH 3ETQA 4U3JA 4L90A 2W6JG 5KX5B 2BE3A 4J7JA 3EHHA 4EEHA 2ZXWB 1Q3EA 4J11A 1VQ8V 2A9HA 4JI5O 4PELA 2XASA 3U0ZA 4LFCB 3FB7C 1VQLV 3CXHF 4GKJB 3EHGA 4OPHA 2WLMA 3E8BA 1ZXNA 2WI5A 2CGOA 2XNDG 2O1VA 2B9ZA 4XTJA 4HNAB 5EC1C 4XCJA 1P4RA 2XHXA 4FLWA 4L8ZA 3FB8C 3T4ZA 1W0JG 1KP3A 1TH8A 4O4IB 1M57C 3WQ9A 2JKIA 1US7A 3H1HH 2P4VA 1M56C 1S3JA 1WA8B 2YIBA 4PU9A 4WFBV 1MSDA 5LOVB 3M99B 1MG1A 1I5CA 3LUTB 2BSKB 4CWOA 3LSUA 3CRAA 1OCCC 2ZE8A 2YI5A 3JATB 5EZYB 3SYPA 1S5HC 3W7UA 3RBZA 1FKAO 3FKSG 1NHHA 2WA3A 3CJHB 4QIWF 3BM9A 1UY6A 4O4LA 4TUYA 4PDVA 4A5UB 1BXDA 4JI3O 2VQFO 4JTAB 1Y76B 1QY8A 1SQBH 4J41A 3ABLB 4PA3A 1TC6A 1FXVA 2DQ0A 1N33O 3A8TA 3X2QB 3W7WA 1NZ6A 1EFRG 1SA0A 4X1KB 3B4SA 1I5BA 3P3NA 2E0AA 5C8YA 2QDOA 1FD9A 3SJBC 1W0KG 3G80A 3K59A 3B09A 3JD3A 2DYRB 4KSGA 1XL4A 1FXKA 4GX2A 1JM6A 3D3IA 5KHJA 2EIKB 1CP9A 5IJ0A 3ZHVA 2Y4TA 1VF6C 4FM1A 4GYCB 2OCHA 4LF9O 1BSMA 1E79G 1J5EO 3HKBA 2YIAA 3TTZA 1QR9A 4RQEA 3WG7C 2YKBA 5B1AC 4BWAA 4PHZA 2OIGA 3K79A 2WLNA 4YKWA 3GIGB 3LNUA 2XAJA 4I9WA 3OPDA 1QQCA 4KHPO 4GX1A 3QO7A 4LF8O 2Q8GA 2ZDYA 4CWNA 2BTQA 2UXBB 1BKNA 4NB5A 2YXLA 2C2AA 4C7UA 4UFZA 3QNEA 2QKAA 4DV7B 2XDUA 2P90A 4FM2A 3DTUB 4CWFA 3DC5A 4QPJA 2QM7A 2VW5A 4JF3A 3A0BZ 2F95B 2LJ2A 4U7OA 1TIDA 1SZTA 5IY5B 1V54C 3HKEA 3BABA 3J81N 1N32O 2V7QG 1P7BA 3JCZA 3SDLA 3O0IA 1XUQA 4PI2A 2IBZH 1VF7A 4X20A 5IE9A 4DK0A 4DV2O 1ZL8B 1R3JC 4X62B 5CMUA 1V55C 4JI1O 4X65B 1TUBB 4BIZA 2N05A 5EC2C 5BODA 3QG5A 2GHYA 3HB3B 1XEQA 4CWPA 4IHJA 2ZIMA 4NH8A 4DRXA 3B25A 1GN4A 4V25A 1TGOA 4W4KA 1NR7A 2X0LA 2XDKA 1VQKV 1TBWA 1KQSU 2WPDG 3B8MA 1KYOF 4JI6B 1YC4A 5IN9A 4BIUA 2V4DA 2Y48A 5E1AC 3ZCCA 1NJIW 3U67A 5BXZA 4ZOLA 5HFLA 3LDDA 1AR5A 2XCMA 2CTWA 3K0DA 1H2GA 3CWBH 4FFKA 2IJKA 1WLEA 2AKPA 4YY3O 5JJEB 2R70A 2X6AA 2M7WA 3HKEB 2LW1A 3M8AA 1YZBA 4JI4O 2OCCC 2RJZA 3SJQC 2XJXA 1MMMA 4LWGA 4B3SO 4DR7B 4EFEA 3C0EA 4GEEA 1MNGA 5J71A 3OGCC 4GX5A 1LUWA 3CSXA 5LHHA 1H2NA 3D3QA 3QO5A 4UCTA 4RO2A 3ABKB 4CH6A 3OEHG 1FXKB 3K3WA 5KHHA 3CCEV 1UYCA 2W6IG 4JI8B 4FMTA 4DV0O 1ZAUA 1NTKH 1R6NA 4J7KA 4JI7O 1IZ3A 2F43G
chains in the Genus database with same CATH topology
1YJNV 4P2ZA 1I58A 1GTOA 1OSFA 2YGAA 3T0HA 1SRYA 2XX2A 3B24A 3EKRA 3JD4A 3AG2B 1YJWV 1E1RG 3CCLV 4UV9A 3VHAA 1AROP 5J9PC 4EFTA 3HZ5A 3ETEA 3E89A 2OTJV 3A0WA 2P6JA 1TUEB 3VOUA 3E83A 2ZDIA 3ZMSA 4JTDB 4R8CA 4KSHA 3CP1A 1GO3F 5B1BB 1H8EG 2YSUB 1YT2A 3SL2A 2MK3A 4FK5C 3CRLA 4XC0A 1BMFG 1KKDA 1Y4UA 2LFSA 4B7PA 4CWTA 3SYQA 2HLDG 2BYHA 1N8RW 2FWYA 4G28B 2CGFA 2YEAA 4XITA 2Z3YA 1DF5A 2XDXA 1JPXA 2YI7A 2BZ5A 3OW6A 5EK0A 4PDRA 1R3LC 4KP4A 3X2QC 2XDSA 3UM7A 3ETGA 4LWFA 4MP2A 4AWQA 2HJFC 4UVBA 1GKFA 4OXSA 5L3EA 1CEZA 3HYZA 1JVMA 1ROPA 1SESA 3QO8A 4RAIA 1VQNV 1QLEC 4LWHA 1QCEA 2DW4A 3P32A 4BAYA 4HYMA 1TC0A 4BAEA 4R50A 3CCSV 2YE8A 4CWRA 1U2OA 1IXMA 5CTXA 4O05A 2BSMA 1GK9A 2YE3A 5CF0A 2YE9A 3JYCA 1K7DA 2H55A 2YECA 1KIJA 3AG3B 3K60A 1F51A 2JJ1G 3ABMC 5F3KA 5M4HA 1Y8NA 3IC7A 5IYDO 1PKXA 3OAAG 5LBQA 1YERA 1YSRA 3ABLC 4WFHA 2FWZA 4MBCA 4I3HA 2IORA 3CRKA 3CGYA 5B1OA 1XL6A 2QM8A 4EGKA 3QDDA 1AH6A 2EINB 2YE2A 2NNUA 2YGFA 2JEUA 4MTOA 2PI5A 1L0OA 1UYHA 2BOCC 4H81A 1BL8A 4HY6A 1KP2A 4X9LA 1JOYA 3G75A 4FJCC 4MTGA 1M90W 2OCCB 4GT1A 2OT5A 3LNMB 1I5DA 4UV8A 4ASUG 5H6RA 4HZ3A 3SPHA 1VQMV 3CYOA 1OCZB 3TCUA 2EZOA 4L87A 1UYKA 3SYAA 3LDCA 4HYPA 4QJFB 4X88A 4LBEC 4H37A 3RVYA 2WI6A 1PNMA 5CTYA 3R92A 4ASBA 2HVKC 1AJQA 3HZ1A 3CXCU 3K03A 1FXHA 3E86A 2EIJC 3E35A 3ZRWB 3ZN0A 1Z5CA 3OR7C 2LP7A 2VWCA 5LHGA 4GQTA 3R65A 1M57B 1RPRA 4P9PA 1A4HA 3PEJA 3GIFA 2ITCC 3KG2A 4PRVA 3ASOB 4F4LA 1JQ0A 1K5SA 3OMUA 3PEHA 3K0GA 5LGNA 2FTKA 1VQ4V 5L3GA 3H4LA 2WSSG 3K08A 1Z5BA 1NHIA 2WERA 2K1EA 2DYRC 4MVUA 2WI2A 3ZM7A 4H85A 1V55B 5FL7G 3ZRWA 3A0RA 2H8MA 3FT8A 1UYLA 1Y4MA 1AI5A 1U0ZA 2EIKC 2R9RB 2LFRA 2XHRA 4HAMA 4JYCA 2EIMC 1DTOA 2WLIB 1JCHA 2XJGA 1H8HG 4JYBA 4MVRA 4GFNA 4PRXA 3C11A 1NR1A 4UXNA 4XKKA 3CCRV 4WFEA 3ZIAG 4GX0A 3CMEV 2D3OW 4G27B 2O1UA 1ZWIC 3CCJV 3GIEA 3TZ2A 4TT3G 1ZWHA 4LP8A 3UKMA 2Q69A 3NXSA 4ZKIA 2GSMB 1I59A 2QEXV 1DF4A 1F4MA 5D7CA 4CE3A 1R73A 4E2LA 3B77A 4I5SA 3A0TA 2NLJC 4TSFG 4YKYA 2DWEC 4MT8A 2WI4A 3STLC 2YE5A 4XE2A 4B6CA 4PA6A 1RM1B 2A0LA 2CH4A 1QLNA 3EKOA 5L3JA 4R1FA 2VCIA 3CCUV 2IU0A 2YEGA 5KA5A 5IYBO 3HHUA 3I56V 2XAGA 2YEDA 4MVZA 1KECA 4UVCA 2IU3A 4E01A 3OMIB 4MTFA 2WI1A 2EBOA 1EBOA 2EINC 4JAUA 4WFGA 5BOCA 3TETA 2EZPA 4UROA 2HFEC 1M9NA 2B1IA 1FS0G 1AJNA 4RUFA 1VQOV 2GFDA 1M56B 4EGHA 2B5UA 3D2RA 2XD6A 3ZN1A 2QFOA 3VHDA 1R3IC 5IYCO 2WI7A 1EI1A 2WLHA 4ZVIA 1DLBA 4AWPA 2CK3G 3TUHA 2ITDC 4XIPA 3U2DA 2XAQA 3AG4C 1YC3A 4FIPC 2P7TC 4WUCA 4G2KA 2WEQA 3FYEB 1KZNA 1UYMA 2XX5A 4MOTA 1YT0A 1S76D 1S14A 4XDJA 3HPLC 1PD3A 2BYIA 1AH8A 1OCOB 3SPCA 5CTUA 5IDMA 3ZRSA 3T10A 3GIGA 3OWBA 5M4NA 2YEJA 3ZXOA 2EILC 2HKOA 2HCHA 3TK1A 1S77D 3BEHA 1BGQA 2GQPA 2XHTA 3FV5A 3O2FA 4BXIA 5M4MA 4PA7A 3HYYA 1YS3A 4MTXA 3H01A 4EMVA 5IDJA 1I5AA 5J6AA 1NKDA 5KA6A 3OMAB 4QE7A 3K06A 4EGIA 3CCMV 3AG1B 5B3SC 3CD6V 5D7RA 1E1QG 1EZJA 2WI3A 4NH7A 4EM7A 2Z5UA 3QTFA 3F7YC 2FYPA 2WLKA 2XAFA 4O07A 2BTZA 1OCRC 4FCRA 3ABKC 2PI4A 1YSCA 1GJVA 1QLEB 3TZ5A 5KUMA 2WLLA 5DN6G 1F23A 4X89A 4EFUA 4URLA 1EA6A 1W2BU 2EILB 2W0FC 4MW8A 3T2MA 2X7RB 3EHBB 3E8GA 3ZJZA 3CC4V 1UYEA 2BOBC 4MPCA 1COWG 4CZZA 3ASNC 4WFFA 4KUMA 4YKZA 1F4NA 4P7AA 4MW3A 4MVOA 4PA9A 1AJ6A 4XKOA 1NVPD 1UYFA 4MS2A 2CCSA 2XOKG 4CE2A 2IW5A 2BT0A 5FNFA 4XIRA 4L90A 2IWSA 3MHSC 4Z1MG 2W6JG 2ZR3A 4DUHA 1I5XA 3OM3B 1YSZA 3EHHA 4DXWA 1OHHG 4O04A 1Q86W 4EEHA 4WFAV 3B8NA 2ZXWB 2HG5C 3K97A 2KB1A 1VQ8V 2O1WA 2A9HA 3ETDA 1UYGA 4P30A 4PELA 3BY6A 1YHQV 3U2KA 2XASA 1JJ2U 1HWYA 3TZ0A 3CC7V 3FB7C 5GW7A 1YTFD 1B62A 1VQLV 4MB9A 1K4DC 3EHGA 2QTOA 2WLMA 3G7EA 4XDMA 4P9OA 3AG4B 4R3MA 3E8BA 1Q7YW 1ZXNA 2WI5A 3EHFA 3E2EA 4YKXA 2VCJA 1GM8A 2XNDG 2O1VA 3RVZA 1YC1A 2BU6A 4XTJA 5EC1C 5FNCA 2QF6A 4XCJA 1Z5AA 1P4RA 3K04A 2XHXA 4L8ZA 4YXWG 3FB8C 3T4ZA 1W0JG 1KP3A 4WUDA 2BU8A 1TH8A 1ZXMA 5L3FA 4BQGA 5L3DA 4HZ0A 1BYQA 4LC1A 2YI6A 2XAHA 2B1GA 4MVQA 4CBCA 4XDLA 1LNQA 1M57C 2IJHA 2WWWA 2JJCA 3WQ9A 2HG1A 3G4SV 2YEFA 1QBZA 2IJJA 2WLJA 1US7A 2JKIA 1UY9A 3E8HA 1Y4SA 2HVJC 2QG2A 4MVSA 4PU9A 1M56C 1S3JA 3VADA 4FPPA 3SYCA 4WFBV 3IFXA 2YE6A 2X6CA 3M99B 1MG1A 1YTFB 3LSSA 1I5CA 3LUTB 3ZRVA 2Q8IA 4CWOA 1Y66A 3E8FA 4J9ZB 1UYIA 1OCCC 2YI5A 2ZDXA 3VBBA 3A0ZA 3SYPA 3W7UA 1S5HC 3CCVV 1Q81W 1PNLA 1FFTB 2Y69B 3RBZA 1AM1A 4KTNA 3K99A 3FKSG 4XKAA 1NHHA 3W7XA 2YEIA 1V54B 4QIWF 2K5BA 1JX9A 2Q6AA 5CBFA 3BM9A 3RLQA 2DWDC 2BRCA 1UY6A 4BQJA 4U93A 2YEVB 1R62A 2BU2A 3OFNG 2IWUA 4WF9V 3AG2C 3D36A 1K5QA 1YT1A 3D0BA 4PDVA 5CBGA 1H7SA 2FXSA 3ASNB 1VQPV 1NVPB 2QG0A 2ZR2A 1K97A 2WLIA 1BXDA 2XK2A 5D7DA 4JTAB 3NMQA 3W7SA 1Y8OA 5C93A 1RM1C 1AI6A 1QY8A 2YEHA 2ZKJA 4L93A 3ABLB 2V1DA 4P8OA 4YKUA 4PA3A 1Z59A 1VQ6V 3OW2U 5M4PA 3OUSA 1TC6A 1FXVA 2DQ0A 3FYIB 3X2QB 3R4MA 3W7WA 4Q20A 1THNA 2H94A 3ZMTA 5M4KA 4FCPA 5B1BC 5L3BA 1EFRG 1S0VA 5EBLC 1I5BA 3O6OA 4UVAA 4TWKA 4YKTA 2ZD9A 4L91A 2E0AA 1UYDA 3GB7C 1PVGA 3SPGA 1QYEA 1W0KG 2WAMA 2EIJB 3JD3A 2DYRB 4JAVA 3MNRP 4KSGA 1MOFA 1XL4A 1FXKA 2H8PC 4GX2A 2UXNA 3D3IA 1JM6A 4X8AA 2EIKB 1CP9A 4R6ZA 2YE7A 3F7VC 2Q2EB 3BMYA 1OCOC 1M1KW 4NH9A 4N23A 2BREA 3K9AA 1NH2D 4H33A 4RUEA 3SPJA 4KFGA 3AEIA 1E79G 1B3QA 2YK2A 3G6EV 5CTWA 1G4YB 4J9YB 3SPIA 5CA3A 3A0XA 1K92A 5DM6V 4CWFA 1AMWA 3TTZA 1QR9A 4HYOA 5FNDA 4RQEA 3ABMB 3WG7C 2WLLB 2Q67A 2YKBA 1AI7A 5B1AC 3AG1C 3ZRXA 3K79A 2IOPA 4JQLA 2WLNA 1Q82W 4YKWA 4ASFA 3JD0A 3GIGB 3LNUA 2XAJA 1TILA 3G7BA 4I9WA 1GMGA 5HFMA 1K73W 3OPDA 1MU5A 3T0ZA 4JPRA 1YESA 3STZC 2Y69C 4GX1A 2P67A 4AWOA 1K34A 3QO7A 4E00A 3G71V 4W7TA 2ZDYA 3T1CA 2Q8GA 5CN0A 3TZ4A 3FB6C 3T1KA 2XDLA 2YKJA 4CWNA 3OR6C 1BKNA 4PL9A 2HKJA 2C2AA 4QPKA 4R7CA 4XD8A 4XIQA 3CCQV 3INXA 1VQ5V 4HY1A 4WUBA 5EBMC 3DGEA 3RLRA 4KFMA 1ID0A 3QNEA 1K9MW 3B27A 2IJIA 1OZ0A 3SYOA 3WFVA 1B6QA 3ML0A 2ZDIC 4DO2A 1QZRA 2XDUA 4HZ5A 2P90A 3A0YA 4UUJC 3DTUB 2BU5A 3FT5A 2JIZG 2AHYA 3IGAC 3LSQA 5KUKA 3B26A 4XCLA 2YE4A 4O09A 1OCCB 4QPJA 2QM7A 3P30A 2VW5A 4JF3A 4KQVA 2YEBA 1AI4A 1Y8PA 5F5RA 3VHCA 3WHAA 1GKZA 3LPSA 3OMNB 1UJWB 4U7OA 1NH2B 1SZTA 1AJPA 1FXKC 1V54C 5IY5B 1TIDA 2JJ2G 1ENVA 4LWIA 4V26A 3CC2V 3R91A 2IH1C 2OTLV 4CE1A 3OE7G 4CWQA 2V7QG 3ZXQA 1P7BA 3JCZA 3T2SA 3IEDA 2YKCA 3MD0A 2CG9A 1WPXA 1GM9A 3H80A 3O0IA 3AG3C 4R3AA 2QE7G 1S16A 2QKSA 3RW0A 4URNA 1YI2V 2WEPA 2YK9A 2YJXA 2BU7A 1K3EA 4MPNA 3EFFK 4MPEA 1R3JC 3RKZA 4ASGA 5CMUA 3Q5LA 4JGSA 5M4EA 4XDKA 1V55C 1QVFU 4DZYA 2Q8FA 2JDIG 3LDEA 3MHHC 3HEKA 4BIZA 2JEXA 5EC2C 4ZBMA 3RLPA 5BODA 1ZW9A 2UWDA 2GHYA 3HB3B 4CWPA 3PJSK 1MABG 3ZMVA 3EHJA 1K4CC 3K98A 2QA4V 1BHBA 4WCEV 3R4PA 3T4DA 3CMAV 3F5WC 2EJRA 5LHIA 1NHJA 4CWSA 4LWEA 5D6QA 1THZA 4NH8A 4HXZA 3B25A 1OCZC 5EBWC 1OCRB 1MSWD 2DYSB 3I55V 4V25A 1MX0A 1I5YA 1VQ9V 4GGLA 1NR7A 4LCUC 1K33A 2X0LA 1KD1W 2ESAA 1VQKV 2XDKA 2YGEA 5B1NA 4FCQA 1TBWA 1R3KC 1KQSU 3INWA 2Q8HA 1NBMG 2WPDG 1VQ7V 1GKXA 1GM7A 4L94A 3B8MA 2PNRA 1YC4A 2CCTA 1KC8W 3OWDA 5IN9A 3GWOA 2AHZA 5GGZA 5LGUA 1ORQC 1SETA 4BIUA 1SERA 2YKIA 1YIJV 2Y48A 2DQ3A 5E1AC 3ZCCA 3R4NA 1NJIW 5BZBA 3FB5C 3OEEG 3U67A 5CBHA 3WG7B 4JASA 3ASOC 5HFLA 3ZKBA 3LDDA 4QNHB 1YETA 2XCMA 2ZQMA 3K0DA 4JTCB 4MVMA 1H2GA 2X6BA 4HXWA 2JK5C 1G8MA 2YEVA 3CGZA 2IJKA 3ZKDA 1CPYA 1WLEA 4U7NA 3KE6A 5LGTA 3CPWU 4H7QA 4MP7A 2ZXWC 2AKPA 3Q5KA 3B28A 4N21A 2YI0A 1NQTA 2UXXA 4RQFA 4PDMA 4PA4A 1R6KA 2X6AA 2M7WA 5H6QA 3ZMUA 2YEEA 3ABTA 2OCCC 3SJQC 2ATKC 3R4OA 2XJXA 2YKEA 4LWGA 1K8AW 3CWVA 4LP0A 1PNKA 3C0EA 4GEEA 5L3CA 4URMA 4AS9A 3JZ3A 3JD1A 5B3SB 2IH3C 4GCZA 1UY7A 3JD2A 4BW5A 1QVGU 5J71A 3W7TA 2YJWA 3OGCC 1BHAA 1H7UA 4GX5A 5LHHA 2XJJA 4EKWA 2R9IA 1L1FA 1QR8A 1UY8A 4PDLA 2HR3A 4XBFA 1H38A 1B63A 2CCUA 2XABA 3QO5A 4RO2A 3ABKB 4YKRA 4ASAA 4E02A 3OEHG 1FXKB 5IY5C 5FWKA 5B1AB 5H9CA 1S72V 3K3WA 3CCEV 1UYCA 2XX4A 2ZBKB 1YITV 5CPHA 2IOQA 1YJ9V 2EXLA 5D6PA 4YKQA 1PL0A 4MSWC 3ZMZA 2W6IG 4FMTA 1J95A 1R6NA 1RPOA 1AR1B 3Q5JA 4QE9A 4GT8A 4K4OA 2DYSC 2IWXA 4O0BA 4LPBA 2A79B 3ABUA 2EIMB 3OUFA 2F43G 2Q68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I58 A;  1OSF A;  2YGA A;  3T0H A;  2XX2 A;  3B24 A;  3EKR A;  3VHA A;  4EFT A;  3HZ5 A;  3A0W A;  4KSH A;  1YT2 A;  3SL2 A;  4XC0 A;  3CRL A;  1Y4U A;  2LFS A;  4B7P A;  4CWT A;  2BYH A;  2YEA A;  2FWY A;  2CGF A;  4XIT A;  2XDX A;  2YI7 A;  2BZ5 A;  4MP2 A;  2XDS A;  4KP4 A;  4AWQ A;  4LWF A;  3HYZ A;  3OW6 A;  4LWH A;  3P32 A;  4HYM A;  1TC0 A;  4BAE A;  2YE8 A;  4CWR A;  1U2O A;  1IXM A;  5CTX A;  2BSM A;  2YE3 A;  5CF0 A;  2YE9 A;  2H55 A;  2YEC A;  1KIJ A;  3K60 A;  1F51 A;  5M4H A;  5F3K A;  1Y8N A;  1YER A;  1YSR A;  2FWZ A;  4MBC A;  4I3H A;  2IOR A;  3CRK A;  3CGY A;  5B1O A;  2QM8 A;  4EGK A;  3QDD A;  1AH6 A;  2YE2 A;  2YGF A;  1L0O A;  1UYH A;  4H81 A;  4HY6 A;  4X9L A;  1JOY A;  3G75 A;  4GT1 A;  1I5D A;  1UYK A;  4HYP A;  4CE3 A;  4ASB A;  5CTY A;  3R92 A;  3HZ1 A;  3ZRW B;  1Z5C A;  3TUH A;  2VWC A;  4GQT A;  1A4H A;  3PEJ A;  3GIF A;  4PRV A;  3OMU A;  3PEH A;  2FTK A;  3H4L A;  1Z5B A;  1NHI A;  2WER A;  2WI2 A;  3ZM7 A;  4H85 A;  3ZRW A;  2H8M A;  3A0R A;  3FT8 A;  1UYL A;  4EGI A;  1U0Z A;  2XHR A;  2LFR A;  4JYC A;  2XJG A;  4JYB A;  4GFN A;  4PRX A;  3C11 A;  4XKK A;  4MPE A;  3TZ2 A;  4ASG A;  2O1U A;  3GIE A;  1ZWH A;  4ZKI A;  3NXS A;  1I59 A;  5D7C A;  4YKY A;  4I5S A;  3A0T A;  4MT8 A;  2WI4 A;  2YE5 A;  4XE2 A;  4B6C A;  2CH4 A;  3EKO A;  5L3J A;  4R1F A;  2VCI A;  2YEG A;  3HHU A;  2YED A;  4E01 A;  2WI1 A;  5BOC A;  4JAU A;  4URO A;  2GFD A;  4EGH A;  3VHD A;  3D2R A;  2XD6 A;  2QFO A;  2WI7 A;  1EI1 A;  4ZVI A;  4AWP A;  4XIP A;  3U2D A;  1YC3 A;  4WUC A;  2WEQ A;  1KZN A;  1UYM A;  2XX5 A;  4MOT A;  1YT0 A;  1S14 A;  2BYI A;  1AH8 A;  5CTU A;  5IDM A;  3T10 A;  3GIG A;  3OWB A;  5M4N A;  2YEJ A;  3ZXO A;  2HCH A;  3TK1 A;  1BGQ A;  2GQP A;  2XHT A;  3FV5 A;  3O2F A;  4BXI A;  5M4M A;  3HYY A;  1YS3 A;  4MTX A;  4EMV A;  5IDJ A;  1I5A A;  5J6A A;  5D7R A;  2WI3 A;  4NH7 A;  4EM7 A;  3QTF A;  2FYP A;  4O07 A;  2BTZ A;  4FCR A;  1GJV A;  3TZ5 A;  4EFU A;  4URL A;  1EA6 A;  1UYE A;  4MPC A;  4P7A A;  4XKO A;  1AJ6 A;  1UYF A;  2CCS A;  4CE2 A;  2BT0 A;  5FNF A;  4XIR A;  4L90 A;  2IWS A;  4DUH A;  1YSZ A;  3EHH A;  4O04 A;  4EEH A;  3K97 A;  2O1W A;  1UYG A;  3U2K A;  3TZ0 A;  1B62 A;  4MB9 A;  3EHG A;  3G7E A;  4XDM A;  4R3M A;  1ZXN A;  2WI5 A;  3EHF A;  4YKX A;  2VCJ A;  2O1V A;  4XTJ A;  1YC1 A;  2BU6 A;  5FNC A;  2QF6 A;  4XCJ A;  1Z5A A;  2XHX A;  4L8Z A;  4WUD A;  2BU8 A;  1TH8 A;  1ZXM A;  4BQG A;  4HZ0 A;  1BYQ A;  4LC1 A;  2YI6 A;  2JJC A;  2WWW A;  3WQ9 A;  2HG1 A;  2YEF A;  2JKI A;  1US7 A;  1UY9 A;  1Y4S A;  2QG2 A;  4PU9 A;  3VAD A;  4FPP A;  2YE6 A;  1I5C A;  3ZRV A;  2Q8I A;  4CWO A;  2ZDX A;  1UYI A;  2YI5 A;  3A0Z A;  1AM1 A;  4KTN A;  3K99 A;  4XKA A;  1NHH A;  2YEI A;  2K5B A;  3BM9 A;  3RLQ A;  2BRC A;  1UY6 A;  4U93 A;  2BU2 A;  1R62 A;  2IWU A;  3D0B A;  3D36 A;  1YT1 A;  2QG0 A;  4O05 A;  1H7S A;  2FXS A;  1BXD A;  2XK2 A;  5D7D A;  3NMQ A;  1Y8O A;  5C93 A;  1QY8 A;  2YEH A;  2ZKJ A;  4P8O A;  4L93 A;  4YKU A;  1Z59 A;  5M4P A;  1TC6 A;  3R4M A;  4Q20 A;  1THN A;  5M4K A;  4FCP A;  4YKT A;  3O6O A;  1I5B A;  4L91 A;  2E0A A;  1UYD A;  1PVG A;  1QYE A;  4JAV A;  3MNR P;  4KSG A;  1JM6 A;  2YE7 A;  2Q2E B;  3BMY A;  4NH9 A;  2BRE A;  4KFG A;  1B3Q A;  2YK2 A;  5CTW A;  3A0X A;  1AMW A;  3TTZ A;  5FND A;  2YKB A;  3ZRX A;  2IOP A;  4JQL A;  4YKW A;  4ASF A;  3GIG B;  3LNU A;  1TIL A;  3G7B A;  3OPD A;  3T0Z A;  1MU5 A;  1YES A;  2P67 A;  4AWO A;  4E00 A;  4W7T A;  2Q8G A;  2ZDY A;  3TZ4 A;  3T1K A;  2XDL A;  2YKJ A;  4CWN A;  4PL9 A;  1BKN A;  2HKJ A;  2C2A A;  4QPK A;  4XD8 A;  4XIQ A;  3INX A;  4HY1 A;  4WUB A;  3DGE A;  3RLR A;  1ID0 A;  3B27 A;  4HZ5 A;  1QZR A;  2XDU A;  3A0Y A;  2BU5 A;  3FT5 A;  4CWF A;  3B26 A;  4XCL A;  2YE4 A;  4O09 A;  4QPJ A;  2QM7 A;  4KQV A;  2VW5 A;  3WHA A;  2YEB A;  3VHC A;  1Y8P A;  5F5R A;  1GKZ A;  3LPS A;  2WI6 A;  4U7O A;  1TID A;  4V26 A;  4BQJ A;  4LWI A;  3R91 A;  4CE1 A;  4CWQ A;  3ZXQ A;  3T2S A;  3IED A;  2YKC A;  3MD0 A;  2CG9 A;  3H80 A;  3O0I A;  4R3A A;  1S16 A;  4URN A;  2WEP A;  2YK9 A;  2YJX A;  2BU7 A;  4MPN A;  3RKZ A;  5M4E A;  3Q5L A;  4DZY A;  2Q8F A;  3HEK A;  4BIZ A;  5BOD A;  3RLP A;  1ZW9 A;  2UWD A;  4CWP A;  3EHJ A;  3K98 A;  3R4P A;  4CWS A;  1NHJ A;  4LWE A;  5D6Q A;  4NH8 A;  4HXZ A;  3B25 A;  4YKZ A;  4V25 A;  1MX0 A;  4GGL A;  2YGE A;  2ESA A;  2XDK A;  4FCQ A;  5B1N A;  2Q8H A;  1TBW A;  3INW A;  1GKX A;  4L94 A;  2PNR A;  1YC4 A;  2CCT A;  5IN9 A;  3OWD A;  5GGZ A;  2YKI A;  4BIU A;  3ZCC A;  3R4N A;  3U67 A;  4JAS A;  3ZKB A;  1YET A;  2XCM A;  4HXW A;  3CGZ A;  3ZKD A;  4U7N A;  3KE6 A;  4H7Q A;  4MP7 A;  3Q5K A;  2AKP A;  3B28 A;  2YI0 A;  2YEE A;  3R4O A;  2XJX A;  2YKE A;  4LWG A;  3CWV A;  4LP0 A;  3C0E A;  4GEE A;  4URM A;  4AS9 A;  3JZ3 A;  4GCZ A;  1UY7 A;  5J71 A;  2YJW A;  1H7U A;  2XJJ A;  1UY8 A;  1B63 A;  2CCU A;  2XAB A;  4ASA A;  4YKR A;  4E02 A;  5FWK A;  1UYC A;  2XX4 A;  2ZBK B;  5CPH A;  2IOQ A;  2EXL A;  5D6P A;  4YKQ A;  4FMT A;  3Q5J A;  4GT8 A;  4K4O A;  4O0B A;  2IWX A;  4LPB A; 
#chains in the Genus database with same CATH topology
 1YJN V;  4P2Z A;  4IYH A;  1I58 A;  1NS1 A;  3BPZ A;  1XMO B;  1SRY A;  2YGA A;  3B24 A;  3EKR A;  3T0H A;  4FVM A;  3F5T A;  4UV9 A;  2E3C A;  3A0W A;  4O4I A;  2P6J A;  2UXC O;  1TUE B;  1XNQ O;  3SL2 A;  4XC0 A;  1KKD A;  1Y4U A;  4B7P A;  2HLD G;  2FWY A;  2RNB A;  2YI7 A;  5EK0 A;  4PDR A;  3OW6 A;  5LXT B;  4DUY B;  4LFB O;  1ZX3 A;  4Q6G A;  5KX5 A;  2H55 A;  2ODM A;  3K60 A;  2YI9 A;  5M4H A;  1PKX A;  1YER A;  5LBQ A;  4JI3 B;  4MBC A;  2D2C B;  4DR4 O;  4DV6 O;  3QDD A;  2AXT Z;  4O4H B;  4CS3 A;  1V9P A;  1VF6 A;  4JI4 B;  2ADP A;  1Q5O A;  1Q6U A;  5D5Q A;  2PI5 A;  1BL8 A;  4X9L A;  2Q8V A;  1M90 W;  4GT1 A;  3FFQ A;  1I5D A;  1HNZ B;  2PGG A;  4HZ3 A;  3SPH A;  4UCU A;  3TCU A;  2VQE O;  1UYK A;  3S3W A;  1PM9 A;  4LBE C;  1R1B A;  3E22 B;  3RVY A;  3AK2 A;  5CTY A;  1VIB A;  5D5P A;  4ASB A;  2HVK C;  3HZ1 A;  3CEI A;  3L71 H;  5KMG A;  3E86 A;  2EIJ C;  3E35 A;  1NTZ H;  3ZN0 A;  3ZRW B;  3OR7 C;  1RSO B;  2LP7 A;  5LHG A;  2VWC A;  4O4J A;  5J2U B;  1OJH A;  3RYF B;  4P9P A;  1A4H A;  3GIF A;  2P4K A;  2QWP B;  4B7K A;  3ASO B;  1JQ0 A;  5LMN O;  3PEH A;  3K0G A;  2FTK A;  5H2F Z;  5H5N A;  2WSS G;  1NHI A;  3ZM7 A;  5KHI A;  1V55 B;  3Q4H A;  2JRI A;  1U0Z A;  1JCH A;  2Q5Z A;  1H8H G;  4MVR A;  4XKK A;  4NXM B;  3CCR V;  4WFE A;  4GX0 A;  5LMU B;  5KHK A;  2D3O W;  2GSM B;  1F4M A;  3A0T A;  4X1I B;  2DWE C;  4JV5 O;  2WI4 A;  3J7A U;  4PA6 A;  4NTW A;  1QLN A;  2VCI A;  2HP8 A;  2YEG A;  5IYB O;  3I56 V;  2XAG A;  3RYI B;  5FPO A;  4DV7 O;  4E01 A;  4DUY O;  2EBO A;  5BOC A;  1M9N A;  1BE3 H;  3LNN A;  1M56 B;  3OTO B;  3VHD A;  2XD6 A;  4PI0 A;  4LF5 O;  1R3I C;  2VS0 A;  1EI1 A;  4OGQ B;  1RFY A;  3JAT A;  5EZY A;  2XAQ A;  3AG4 C;  1B06 A;  1YC3 A;  2WEQ A;  2M6Y A;  4FLU A;  1S76 D;  1YT0 A;  2BYI A;  3HPL C;  1YXB A;  1AH8 A;  1OCO B;  3ICX A;  1HNZ O;  3ZRS A;  5M4N A;  3OT7 A;  2EIL C;  3FV5 A;  1BGQ A;  4YHH O;  3HYY A;  4MTX A;  1EN4 A;  3H01 A;  5IDJ A;  1Q6I A;  2CH7 B;  3K06 A;  3AG1 B;  1Y74 A;  3WB2 A;  2YIB D;  2BTQ B;  1Z5W A;  2E74 B;  4DR5 B;  2YDE A;  3ABK C;  2PI4 A;  1GJV A;  2YUA A;  2WLL A;  1F23 A;  3CJH A;  4EFU A;  4URL A;  5JVD B;  3ZHQ A;  2X7R B;  3CC4 V;  2BOB C;  4DUZ O;  1COW G;  4H13 B;  4OX9 B;  4NKG B;  4K8Z A;  4U3F H;  4GKK O;  1UYF A;  1US6 A;  2XOK G;  2IW5 A;  1Y76 A;  5FNF A;  2IWS A;  2ZR3 A;  3A2F A;  4HBN A;  1BQ0 A;  3OM3 B;  3TXQ A;  1VAR A;  4DXW A;  4D6T H;  4O04 A;  1Q86 W;  2HG5 C;  1I08 A;  4P30 A;  1YHQ V;  3IC9 A;  1H2L A;  2QTO A;  4XDM A;  4LH7 A;  4PV1 B;  1KB9 F;  1QU7 A;  4LFA B;  2QGN A;  3EHF A;  1SQV H;  1GM8 A;  2C1G A;  1YC1 A;  2ZE7 A;  3K5M A;  2BU6 A;  5FNC A;  1Z5A A;  2Q0A A;  1IBK O;  1ZXM A;  5L3F A;  5L3D A;  4LC1 A;  4CBC A;  2IJH A;  2WWW A;  2N04 A;  2HG1 A;  1UY9 A;  3E8H A;  4FPP A;  3SYC A;  2CDY A;  3IFX A;  1YTF B;  1WN7 A;  2UU9 B;  3CCV V;  1AM1 A;  2KG7 A;  1B04 A;  2YEI A;  1V54 B;  4ZHQ B;  5CBF A;  2BRC A;  2VWK A;  4U93 A;  2YEV B;  1R62 A;  3OFN G;  1JA8 A;  1O9G A;  1VQP V;  2WLI A;  4LF9 B;  2XK2 A;  3NR7 A;  2YEH A;  4UB6 Z;  1GN2 A;  2ZKJ A;  4L93 A;  2V1D A;  4P8O A;  1XMQ B;  3CE2 A;  1XQ8 A;  5M4P A;  1MZE A;  4LF8 B;  5M4K A;  5BMV A;  1Y67 A;  5L3B A;  1S0V A;  3O6O A;  1EM1 A;  1UYD A;  1IDS A;  2HEP A;  2WAM A;  4JAV A;  2CAZ C;  3MNR P;  4CC5 A;  4DR2 O;  4BW9 A;  2UXN A;  4R6Z A;  3BCC H;  2Q2E B;  3BMY A;  1CXZ B;  1M1K W;  4NH9 A;  4N23 A;  3N2K A;  2HHH B;  2BRE A;  3K9A A;  4RUE A;  3SPJ A;  4YY3 B;  3AEI A;  1B3Q A;  1O9H A;  5CTW A;  1G4Y B;  4J9Y B;  1K92 A;  1Q8I A;  2LQT A;  5FND A;  1BGY H;  1AI7 A;  1Q82 W;  1FJG O;  3JD0 A;  1MU5 A;  3OGI B;  2P67 A;  3BRC A;  3G71 V;  3FB6 C;  3OR6 C;  5K1X A;  2HKJ A;  4LF4 O;  4R7C A;  4WBN B;  4HY1 A;  1JR9 A;  2QWR B;  2ZIN A;  3M7M X;  4B08 A;  2E5L O;  1WJZ A;  4WUB A;  4O4J B;  1ID0 A;  3B27 A;  2IJI A;  4HZ5 A;  1B6Q A;  3ML0 A;  2ZDI C;  5KAF Z;  4JI1 B;  4UUJ C;  3QVN A;  4NXN O;  2YE4 A;  1A32 A;  4KQV A;  2YEB A;  3VHC A;  3UT5 A;  5JH7 B;  1Y8P A;  2BTO A;  3LPS A;  4HNA A;  3JAM N;  2F93 B;  1L0L H;  3OMN B;  1SC5 B;  2QJ1 A;  5ITZ B;  4V26 A;  1FXK C;  5IT9 N;  1PP9 H;  2JJ2 G;  4CE1 A;  4NTX A;  2OTL V;  1IBL B;  4CWQ A;  3ZXQ A;  1WNS A;  1EZV H;  1YVW A;  3AG3 C;  1S16 A;  2QKS A;  4URN A;  1YI2 V;  2WEP A;  2YK9 A;  4JI0 O;  3CS5 A;  1K3E A;  4JGS A;  2G38 A;  1WPB A;  4XDK A;  4DZY A;  1QVF U;  4DW1 A;  2AGA A;  3HKD B;  3MHH C;  4NYK A;  4UCO A;  2PF4 E;  3CRR A;  2UXD B;  1MAB G;  1SA0 B;  3EHJ A;  1BHB A;  4WCE V;  3R4P A;  2EJR A;  1NHJ A;  5D6Q A;  2JGD B;  4B3M B;  2DYS B;  1Q6H A;  5JJN B;  2P22 C;  1K33 A;  1WA8 A;  4LCU C;  1KD1 W;  2Q8H A;  5B1N A;  5LA6 B;  1VQ7 V;  2YIC A;  4FZ1 A;  3BAA A;  5GGZ A;  3L9D A;  5LGU A;  4WBN A;  3FB5 C;  3OEE G;  2ZNI A;  3APQ A;  3IAY A;  2X6B A;  4HXW A;  3SJC C;  1HNX O;  1G8M A;  3Q5K A;  3B28 A;  4N21 A;  1NQT A;  4PDM A;  3ZS8 C;  4PA4 A;  1AIL A;  4YJ2 A;  3ABT A;  4DV4 B;  2L6L A;  1XNQ B;  4H44 B;  3T1H O;  1IBL O;  2YKE A;  1K8A W;  4LP0 A;  3L72 H;  2QKC A;  3JZ3 A;  3DXR B;  5B3S B;  3JD2 A;  4BW5 A;  1BHA A;  1KBH A;  5J2U A;  4EKW A;  1UY8 A;  1QR8 A;  2HR3 A;  1H38 A;  2N74 A;  1URF A;  5FWK A;  5H9C A;  1S72 V;  5JWP A;  1YIT V;  1T5E A;  1YJ9 V;  1PL0 A;  4CH3 A;  1BCC H;  5IYZ A;  1M93 A;  1AR1 B;  3Q5J A;  4QE9 A;  2R72 A;  4K35 A;  3TXS A;  5LL6 Y;  4LFB B;  4LPB A;  1WB7 A;  3JSL A;  2F1M A;  4B3M O;  1YCI A;  2XX2 A;  3JD4 A;  3AG2 B;  2P06 A;  3CCL V;  1ARO P;  2YXH A;  4EFT A;  3HZ5 A;  3E89 A;  3E83 A;  3RYF A;  4JTD B;  1Z5V A;  4R8C A;  1GO3 F;  5B1B B;  1H8E G;  4B3T O;  2MK3 A;  4FK5 C;  3CRL A;  4CWT A;  4NTY A;  2BYH A;  4CH4 A;  1G6U A;  4G28 B;  3U11 A;  3WB0 A;  3UM7 A;  3ETG A;  4DRX B;  2HJF C;  3O65 A;  1GKF A;  5L3E A;  3CHX A;  1VQN V;  3QO8 A;  1QCE A;  4BAY A;  4HYM A;  1TC0 A;  4ZHQ A;  3JAW B;  1GK9 A;  1M5I A;  5CF0 A;  3JYC A;  1KIJ A;  3AK1 A;  3ABM C;  4JI8 O;  5F3K A;  3JAL A;  3IC7 A;  5J2T B;  3JCU Z;  5IYD O;  1N34 B;  1YSR A;  3ABL C;  3MAQ A;  4I55 B;  4I3H A;  3CRK A;  5B1O A;  2ZNJ A;  4EGK A;  3RT3 C;  2PZS A;  4MTO A;  3WU2 Z;  1L0O A;  1UYH A;  4YJ3 A;  2LO1 A;  4KXR A;  2PYJ A;  5LYJ B;  1JOY A;  4FJC C;  2OT5 A;  5DED A;  4ASU G;  5H6R A;  1VQM V;  3L75 H;  5AG2 A;  2BSK A;  3CXC U;  3K03 A;  1FXH A;  1I94 O;  1Z5C A;  3SGI A;  1N4C A;  4GQT A;  1XNR B;  2HHH O;  4LNU A;  2ITC C;  4F4L A;  3UO2 A;  3TJT A;  5LGN A;  5IJ9 A;  2CH7 A;  5L3G A;  3E22 A;  1YF2 A;  2K1E A;  5B66 Z;  3S3X A;  5BR8 B;  4LF5 B;  1AI5 A;  1G1X B;  4EGI A;  2R9R B;  2C1I A;  4JYC A;  1DTO A;  4UXN A;  4ABM A;  5A9G A;  3CME V;  3ZIA G;  4MPE A;  4ASG A;  4G27 B;  2O1U A;  4JYA B;  4LP8 A;  4ZKI A;  2Q69 A;  3NXS A;  5KHG A;  2DOS A;  2QEX V;  1I59 A;  1R73 A;  4E2L A;  3B77 A;  4I5S A;  4YKY A;  2CE4 A;  4IIJ A;  4XE2 A;  4B6C A;  1RM1 B;  2A0L A;  2CH4 A;  1RP3 B;  2IU0 A;  5B5E Z;  2E76 B;  5KA5 A;  1S5L Z;  3I5D A;  4H0L B;  4UVC A;  2IU3 A;  1BT8 A;  1FS0 G;  1J5E B;  1VQO V;  2QFO A;  5IYC O;  2WI7 A;  2XUM A;  5LXT A;  4FFB A;  3N2K B;  5LYJ A;  2F66 C;  5GON B;  3AK3 A;  1KZN A;  1UYM A;  1XRE A;  1S14 A;  3H1L H;  1HNW O;  3AG7 A;  3SPC A;  1YEW A;  2R9A A;  2YEJ A;  3ZXO A;  2HKO A;  2HCH A;  3TK1 A;  1S77 D;  4JV5 B;  2LW7 A;  2GQP A;  3O2F A;  2RN9 A;  3CRM A;  3HR0 A;  4JI2 B;  1YS3 A;  1I5A A;  5J6A A;  1GH6 A;  4F6E A;  1NKD A;  2BCC H;  3OMA B;  4FLX A;  4I50 B;  3CCM V;  5B3S C;  4DR2 B;  3THO A;  2Z5U A;  2WLK A;  3K5N A;  3ZHS A;  1L0N H;  2Q7E A;  4FCR A;  1JFF B;  1QLE B;  5KUM A;  5FNV B;  4DV3 B;  4X89 A;  2W0F C;  1PPJ H;  4MW8 A;  3EHB B;  3ZJZ A;  3K57 A;  4CZZ A;  3ASN C;  4DW0 A;  4WFF A;  1F4N A;  3K5L A;  4PA9 A;  1AJ6 A;  3JAK B;  2WA4 A;  5ITZ A;  4CE2 A;  2BT0 A;  4XIR A;  3MHS C;  4Z1M G;  1YSZ A;  1SS3 A;  1OHH G;  2Q4P A;  3B8N A;  3K97 A;  4GKJ O;  1UYG A;  4DV0 B;  3TGU H;  2UU9 O;  3BY6 A;  4PJ0 Z;  3U2K A;  4AI8 A;  1JJ2 U;  3CC7 V;  1B62 A;  4YJ2 B;  4P9O A;  3AG4 B;  4YKX A;  2VCJ A;  3RFR A;  4DR5 O;  4YXW G;  4WUD A;  2BU8 A;  4BQG A;  1HNW B;  2YI6 A;  3LMM A;  1BZK A;  1I0H A;  2JJC A;  1XDC A;  2YEF A;  1QBZ A;  2IJJ A;  4J42 A;  1Y4S A;  4TQD A;  4JZG A;  4MVS A;  2QWN B;  1N0J A;  3CX5 F;  2XT9 A;  4K3A A;  2YE6 A;  3ZX6 A;  1RSO A;  2GTA A;  3LSS A;  3ZRV A;  1Y66 A;  3E8F A;  2ZDX A;  1UYI A;  1ZLZ A;  3VBB A;  4JI0 B;  1GAX A;  2Y69 B;  1XI1 A;  2Q9L A;  2VRZ A;  3B2E E;  2Q7G A;  2K5B A;  2DWD C;  4LF6 O;  1HW7 A;  3MDS A;  2IWU A;  5CB4 A;  4WF9 V;  1YT1 A;  1K5Q A;  3D0B A;  5CBG A;  1H7S A;  2FXS A;  2JS3 A;  1SQX H;  4LWS B;  5C93 A;  1VF5 B;  3VQW A;  2JGU A;  4U3J B;  4B3T B;  3BA8 A;  1DK1 A;  3R4M A;  3ZMT A;  4TV8 B;  4YKT A;  4TWK A;  4L91 A;  3CB2 A;  3GB7 C;  3SPG A;  1KMI Z;  1FFX B;  2W0X A;  2YC0 A;  4PD4 F;  5K1P A;  1PVG A;  1QYE A;  1MOF A;  2YXY A;  4X8A A;  1QHT A;  1X59 A;  3F7V C;  2VWJ A;  1OCO C;  3RWR D;  1NH2 D;  4J80 A;  4X64 B;  1Y6X A;  4JI5 B;  1D2D A;  3EVK A;  4I55 A;  3SPI A;  3A0X A;  4LR3 A;  3UQ8 A;  1XMQ O;  2ARH A;  2WLL B;  4DV4 O;  2L35 A;  3AG1 C;  4FZ0 A;  2IOP A;  4JQL A;  4KHP B;  4ASF A;  1TIL A;  3G7B A;  4I7Z B;  5HFM A;  4JPR A;  4J10 A;  2Q7H A;  2JGD A;  3STZ C;  1K34 A;  4E00 A;  4ZI7 A;  4W7T A;  5CN0 A;  3T1K A;  2XDL A;  2YKJ A;  4PL9 A;  2GDS A;  4XD8 A;  3CCQ V;  1UFI A;  2E75 B;  3KZI Z;  4KFM A;  1K9M W;  1GN6 A;  4DO2 A;  1OZ0 A;  3WFV A;  5GTH Z;  1QZR A;  1AP5 A;  2BU5 A;  3FT5 A;  4F6R A;  1PL4 A;  2JIZ G;  4O09 A;  2H3O A;  3WHA A;  5F5R A;  2EJ7 A;  1UJW B;  2O57 A;  1NH2 B;  2WI6 A;  4BQJ A;  1AJP A;  4LWI A;  1ENV A;  3R91 A;  3CC2 V;  2IH1 C;  5BR8 O;  3OE7 G;  2MW2 B;  5TIS Z;  4DR7 O;  5EYP B;  4DR1 O;  2PY5 A;  2CG9 A;  4B7E A;  4R3A A;  5LP6 C;  2PTM A;  3JAR A;  2YJX A;  2E5L B;  4X66 B;  3EFF K;  2PYL A;  2JDI G;  4D7T A;  2JEX A;  4ZBM A;  5LA6 A;  1ZW9 A;  2Y0I A;  3PJS K;  4JI7 B;  1K4C C;  3K98 A;  2ZT9 B;  4CWS A;  4LWE A;  1THZ A;  1OCZ C;  5EBW C;  1OCR B;  1MSW D;  2F23 A;  1I5Y A;  4JI6 O;  4GGL A;  3UCS C;  2Y4U A;  1L8D A;  1R3K C;  2QSA A;  3KCY A;  2XTA A;  1GKX A;  1GM7 A;  4L94 A;  4CS4 A;  2CTR A;  2PNR A;  2FKX A;  3SJA C;  2CCT A;  4YJ3 B;  3OWD A;  3GWO A;  2AHZ A;  3DC6 A;  5LOV A;  1IBM O;  1SER A;  4UCV A;  2DQ3 A;  2CGN A;  1IUR A;  3ASO C;  3ZKB A;  2ZQM A;  1Q43 A;  4MVM A;  4JZ2 A;  3CGZ A;  2HJD A;  3ZKD A;  1CPY A;  1AVM A;  3KE6 A;  5LGT A;  4H7Q A;  4MP7 A;  1ZUQ A;  2ZXW C;  2UXX A;  4RQF A;  1Z2G A;  4TQF A;  3ZMU A;  5JJJ B;  3RYH A;  4E4E A;  1PNK A;  3H1J H;  4KL1 A;  2IH3 C;  1UY7 A;  4DV1 O;  3W7T A;  2RDC A;  2K9P A;  3FD9 A;  3O9O A;  5A2Q N;  1H7U A;  4O2A B;  2GUZ A;  2XJJ A;  2R9I A;  5EIB C;  1ZL8 A;  3B40 A;  2CCU A;  2XAB A;  4YKR A;  4E02 A;  5B1A B;  2FYU H;  2HHI A;  5LP6 A;  3DXR A;  2IOQ A;  2YI8 A;  5D6P A;  1EN6 A;  1J95 A;  2KG7 B;  2DYS C;  2IWX A;  4O0B A;  1XMO O;  1KUQ A;  4ZIB A;  3OUF A;  2Q68 A;  5IWA B;  1OSF A;  2UXC B;  4DK1 A;  3K5O A;  1SZX A;  5J9P C;  1H2K A;  3ETE A;  2OTJ V;  4TV9 A;  3HKD A;  4X1Y A;  4ZOL B;  4I9Q A;  1BQZ A;  1BMF G;  1NTM H;  2LFS A;  4UCS A;  2ZE5 A;  1N8R W;  2CGF A;  4XIT A;  1DF5 A;  2XDX A;  1KKC A;  1JPX A;  2BZ5 A;  4MP2 A;  2XDS A;  1BS3 A;  3X2Q C;  4LWF A;  2RCV A;  3JAL B;  4UVB A;  4DR6 O;  3HYZ A;  1I94 B;  1SES A;  1Q90 D;  3P32 A;  3RN4 A;  2GTS A;  1U97 A;  2UUB O;  4R50 A;  3CCS V;  2YE8 A;  5CTX A;  2BSM A;  5JQG A;  1K7D A;  2YEC A;  3AG3 B;  4O2B B;  1Y8N A;  3C90 A;  3OAA G;  4B3S B;  3UO3 A;  4I0X B;  5CA1 B;  2EIN B;  3VQX A;  2YGF A;  2JEU A;  4H81 A;  3ZHU A;  1KP2 A;  3R66 A;  5J2T A;  1TVK A;  4UV8 A;  2Z0A A;  5KAI Z;  1HR0 O;  2EZO A;  4YIP A;  3SYA A;  1KU9 A;  5IJ9 B;  1TUB A;  1NT2 B;  4X88 A;  2GV9 A;  1H2S B;  4CE3 A;  1HR0 B;  2ADQ B;  3TUH A;  4IL6 Z;  1N0N A;  1M57 B;  4AQY B;  4EB6 B;  3PEJ A;  3KG2 A;  3QF7 A;  4PRV A;  3JSN A;  4TV9 B;  5JCO C;  1VQ4 V;  1S5J A;  1VEW A;  2PUS A;  3K08 A;  1Z5B A;  4O4L B;  1DGS A;  2EIM C;  2XJG A;  2ILM A;  1JFF A;  1NR1 A;  3TZ2 A;  3JAW A;  1FAF A;  1P7G A;  1LR1 A;  4TT3 G;  3UKM A;  4BIO A;  5CA0 B;  1DF4 A;  5D7C A;  3T1Y B;  2NLJ C;  4TSF G;  2KSD A;  4MT8 A;  5JEN A;  2YE5 A;  2UUA B;  2FML A;  2EX3 A;  5L3J A;  4R1F A;  3CCU V;  2OWO A;  4DV5 O;  2KQX A;  2Q0O C;  4DV3 O;  4MTF A;  4JAU A;  4WFG A;  2JVD A;  3TET A;  2HFE C;  2Q73 A;  3RYH B;  4CC6 A;  1AJN A;  5IJ0 B;  2DN9 A;  4EGH A;  2B5U A;  1GN3 A;  4OPA A;  4AWP A;  4XIP A;  3U2D A;  5EYP A;  2P7T C;  4WUC A;  3HKC B;  4GZR B;  3FYE B;  4DR1 B;  4XDJ A;  4FLV A;  4YHH B;  5CTU A;  5IDM A;  3T10 A;  4FLZ A;  4B3R O;  3JAS B;  5C8Y B;  4BXI A;  1P49 A;  4I4T B;  4IT5 A;  5M4M A;  4PA7 A;  3K9S A;  4EMV A;  3FAV B;  5FLX N;  1TAE A;  1P84 F;  5KA6 A;  5KLV H;  4QE7 A;  3CD6 V;  3KKY A;  4DR3 B;  4AQY O;  4X65 O;  2NN4 A;  1EZJ A;  2WI3 A;  4NH7 A;  4EM7 A;  2XAF A;  1H2M A;  4O07 A;  2DMX A;  3CRC A;  4FLT A;  4AHC A;  1ZTE A;  4Z2W A;  1YSC A;  2AW9 A;  2ZM6 B;  2P5O A;  3TZ5 A;  4DUZ B;  1MA1 A;  1W2B U;  2EIL B;  2DJV A;  3RGB A;  2QWQ B;  4MW3 A;  2LGW A;  4MVO A;  4XKO A;  4LNU B;  2CCS A;  4MS2 A;  3PN1 A;  4YIO A;  2OYQ A;  4DUH A;  1I5X A;  4FLY A;  3D36 C;  4WFA V;  1IX9 A;  3GWK C;  2KB1 A;  2O1W A;  3ETD A;  4O2B A;  4FFB B;  3TZ0 A;  1HWY A;  5GW7 A;  1U96 A;  4MB9 A;  1K4D C;  3G7E A;  3N2G A;  2EUL A;  1FFX A;  4R3M A;  1Q7Y W;  2LGQ A;  3E2E A;  2RQ6 A;  4DV5 B;  3RVZ A;  3QTC A;  4O4H A;  2QF6 A;  2YS8 A;  3K04 A;  1XHZ A;  2VQF B;  4CH5 A;  2CUG A;  4HZ0 A;  1BYQ A;  2XAH A;  2B1G A;  4MVQ A;  4XDL A;  1LNQ A;  1WP7 A;  3OD4 A;  3G4S V;  2WLJ A;  4JYA O;  2QG2 A;  2HVJ C;  3VAD A;  2QWO B;  2X6C A;  4EEQ A;  3KCX A;  2Q8I A;  4X9Q A;  4J9Z B;  5KMG B;  3A0Z A;  3BA9 A;  1Q81 W;  1PNL A;  1FFT B;  4KTN A;  3K99 A;  4XKA A;  4LF4 B;  3W7X A;  4NXN B;  1JX9 A;  2Q6A A;  3U10 A;  3RLQ A;  1NU1 H;  2BU2 A;  3AG2 C;  3D36 A;  1QNM A;  2ZM6 O;  5FPR A;  2QG0 A;  4O05 A;  3ASN B;  1NVP B;  1XBL A;  2ZR2 A;  1K97 A;  1N34 O;  5D7D A;  5JCO A;  4X64 O;  3NMQ A;  3W7S A;  5EIB D;  1Y8O A;  1RM1 C;  1AI6 A;  4I50 A;  4YKU A;  4IYI A;  1Z59 A;  1VQ6 V;  4F6R B;  3OW2 U;  3OUS A;  1W59 A;  5CB4 B;  3FYI B;  4Q20 A;  1THN A;  2H94 A;  2UUC O;  4FCP A;  5B1B C;  1SQQ H;  5EBL C;  4UVA A;  4LH6 A;  2ZD9 A;  1WB8 A;  5FNV A;  2EIJ B;  3P3P A;  2H8P C;  4UCR A;  2YE7 A;  3VQY A;  2A7W A;  2ZIO A;  4H33 A;  4KFG A;  2YK2 A;  3G6E V;  1EN5 A;  5CA3 A;  5DM6 V;  1AMW A;  4HYO A;  1VP7 A;  3ABM B;  2Q67 A;  3ZRX A;  4FM0 A;  1GMG A;  2XHB A;  2YID A;  3JAS A;  1K73 W;  3T0Z A;  1AB3 A;  1YES A;  2Y69 C;  4AWO A;  3TZ4 A;  3T1C A;  2VQE B;  4QPK A;  4XIQ A;  3INX A;  1VQ5 V;  5EBM C;  3DGE A;  3RLR A;  2KKW A;  3APO A;  3L70 H;  3SYO A;  1SF9 A;  3T1H B;  2IM9 A;  4ZI7 B;  3A0Y A;  3L73 H;  1XIL A;  4O2A A;  2AHY A;  3IGA C;  3LSQ A;  4D7S A;  5KUK A;  3B26 A;  4XCL A;  1OCC B;  3P30 A;  4AIL C;  4K0K O;  1AI4 A;  4K8X A;  1GKZ A;  1IBM B;  5BMV B;  3SR2 C;  2F4V B;  5GON A;  4EFB A;  3T2S A;  3IED A;  2YKC A;  3MD0 A;  2RMK B;  1WPX A;  3VQV A;  1GM9 A;  3H80 A;  1AP6 A;  2QE7 G;  4Z1V A;  3ZBH A;  3RW0 A;  5BY1 A;  5F2V O;  3T1Y O;  2BU7 A;  3H9V A;  4MPN A;  3HKB B;  3RKZ A;  5M4E A;  3Q5L A;  1UPG A;  2Q8F A;  3LDE A;  3HEK A;  2UXB O;  4NR1 A;  3RLP A;  2UWD A;  3G67 A;  1D5A A;  2ETN A;  1XNR O;  3ZMV A;  3JAR B;  2QA4 V;  3RYC A;  3T4D A;  3CMA V;  3F5W C;  5LHI A;  3FX7 A;  3OTO O;  4HXZ A;  2UXD O;  4YKZ A;  1MX0 A;  1VQ9 V;  2CTQ A;  3HKC A;  2YGE A;  2ESA A;  3WB1 A;  4FCQ A;  3OTF A;  3INW A;  1NBM G;  1KC8 W;  4W4L A;  2YKI A;  1ORQ C;  1SET A;  4BR6 A;  1YIJ V;  4TV8 A;  4X66 O;  3R4N A;  5BZB A;  5CBH A;  3D8C A;  3WG7 B;  4JAS A;  3A0H Z;  1ZSP A;  2DE0 X;  4QNH B;  1YET A;  4I0X A;  4JTC B;  2AZ0 A;  2JK5 C;  2YEV A;  4IIJ B;  5CA0 A;  4U7N A;  3CPW U;  4JYY A;  2YI0 A;  1HNX B;  1R6K A;  4L8J A;  5H6Q A;  2YEE A;  1R6T A;  5IWA O;  3R4O A;  2ATK C;  3CWV A;  2F4V O;  4URM A;  5L3C A;  4AS9 A;  3JD1 A;  4GLX A;  4GCZ A;  1QVG U;  2YJW A;  1HP8 A;  1JJO A;  2UUC B;  1L1F A;  4PDL A;  4XBF A;  1B63 A;  2UUB B;  4ASA A;  2QM4 A;  5IY5 C;  2A06 H;  1VMG A;  1N36 B;  2XX4 A;  2ZBK B;  5CPH A;  2EXL A;  4YKQ A;  4MSW C;  3ZMZ A;  1RPO A;  3C3S A;  1TVK B;  4GT8 A;  4K4O A;  2FL4 A;  4LF6 B;  3ZHR A;  2A79 B;  1YTF D;  3ABU A;  2EIM B;  3I55 V;  4DV6 B;  1GTO A;  4J7Z A;  4DYL A;  1YJW V;  1E1R G;  3VHA A;  4IGG A;  4X1I A;  1GRJ A;  4E72 A;  3VOU A;  2ZDI A;  3ZMS A;  4KSH A;  3CP1 A;  1YT2 A;  2YSU B;  3RYI A;  3SYQ A;  2YEA A;  2Z3Y A;  2NR5 A;  5JVD A;  2ZKO A;  4AWQ A;  1R3L C;  3N27 A;  4KP4 A;  3JAK A;  4DV1 B;  4DV2 B;  4X1K A;  1CEZ A;  3GVM A;  4OXS A;  1JVM A;  1ROP A;  4LWH A;  4RAI A;  1QLE C;  3J80 N;  2DW4 A;  4BAE A;  1I7F A;  4CWR A;  1FPO A;  1U2O A;  1IXM A;  5LMN B;  3H1K H;  4NVP A;  2YE3 A;  2YE9 A;  2ZE6 A;  5DEC A;  3UT5 B;  5JH7 A;  1PV0 A;  1F51 A;  2JJ1 G;  4IHJ B;  4K0K B;  4I4T A;  2QR4 A;  4WFH A;  2FWZ A;  1YDX A;  2IOR A;  3CGY A;  1AR4 A;  1XL6 A;  2QM8 A;  4NXM O;  3N2G B;  4CS2 A;  1AH6 A;  5JQG B;  4X20 B;  2YE2 A;  2NNU A;  4UB8 Z;  2BOC C;  1M4U A;  4HY6 A;  4OX9 O;  3G75 A;  4MTG A;  4DR6 B;  2OCC B;  2JS5 A;  1N36 O;  3LNM B;  3CYO A;  1OCZ B;  5IYZ B;  1WAZ A;  4L87 A;  3IJ4 A;  5LMU O;  3LDC A;  4HYP A;  3ZHT A;  4QJF B;  1JMK C;  4JI2 O;  4H37 A;  1PNM A;  3R92 A;  1AJQ A;  1OV9 A;  2AZ2 A;  3CRQ A;  2UUA O;  3RYC B;  2ZCE A;  3R65 A;  2GUZ B;  1RPR A;  4X1Y B;  2OIE A;  3OMU A;  2Y0P A;  3FAV A;  1K5S A;  4TOI A;  3BVO A;  4DR4 B;  1SQF A;  4LFA O;  1SQG A;  4GUN A;  3H4L A;  4TUY B;  2WER A;  4MVU A;  2DYR C;  2WI2 A;  3ZED A;  4H85 A;  5FL7 G;  3ZRW A;  1N32 B;  3A0R A;  2H8M A;  3FT8 A;  1UYL A;  1NI8 A;  1Y4M A;  4LWS A;  1FJG B;  2EIK C;  2XHR A;  2LFR A;  4HAM A;  2WLI B;  1HDJ A;  4JYB A;  4GFN A;  4PRX A;  3C11 A;  3S5T A;  1F7Y A;  1ZWI C;  3CCJ V;  3GIE A;  1ZWH A;  1XOU A;  4LF7 B;  2A3Q A;  2GBO A;  3BHP A;  4LFC O;  3Q4H B;  4B3R B;  3STL C;  4X62 O;  3EKO A;  2FB5 A;  4ICG A;  2CTP A;  3HHU A;  2YED A;  4JAA A;  4MVZ A;  1KEC A;  4DR3 O;  3CYG A;  3OMI B;  2WI1 A;  1EBO A;  2EIN C;  5GTI Z;  4URO A;  2EZP A;  2B1I A;  4RUF A;  2GFD A;  4RWU A;  3D2R A;  3ZN1 A;  2WLH A;  4ZVI A;  1DLB A;  2CK3 G;  4GKK B;  2ITD C;  4FIP C;  3BFR A;  4G2K A;  2XX5 A;  4MOT A;  5LP6 B;  1PD3 A;  1D5N A;  1Y74 B;  1MZF A;  3GIG A;  3OWB A;  2XHT A;  3BEH A;  1WP8 A;  4EB6 A;  1X4T A;  5CA1 A;  5E79 Z;  5D7R A;  1SKV A;  1E1Q G;  3QTF A;  3F7Y C;  2FYP A;  1XHX A;  2BTZ A;  1OCR C;  4QGP A;  1IBK B;  3C3T A;  3L74 H;  3H1I H;  1TA8 A;  2QTS A;  5DN6 G;  3K58 A;  1N33 B;  1IVS A;  1EA6 A;  3T2M A;  3E8G A;  1UYE A;  3EXA A;  4MPC A;  1IXB A;  4KUM A;  1LUV A;  4P7A A;  1FYJ A;  3DSQ A;  1NVP D;  3G6B A;  4LF7 O;  1SQP H;  3ETQ A;  4U3J A;  4L90 A;  2W6J G;  5KX5 B;  2BE3 A;  4J7J A;  3EHH A;  4EEH A;  2ZXW B;  1Q3E A;  4J11 A;  1VQ8 V;  2A9H A;  4JI5 O;  4PEL A;  2XAS A;  3U0Z A;  4LFC B;  3FB7 C;  1VQL V;  3CXH F;  4GKJ B;  3EHG A;  4OPH A;  2WLM A;  3E8B A;  1ZXN A;  2WI5 A;  2CGO A;  2XND G;  2O1V A;  2B9Z A;  4XTJ A;  4HNA B;  5EC1 C;  4XCJ A;  1P4R A;  2XHX A;  4FLW A;  4L8Z A;  3FB8 C;  3T4Z A;  1W0J G;  1KP3 A;  1TH8 A;  4O4I B;  1M57 C;  3WQ9 A;  2JKI A;  1US7 A;  3H1H H;  2P4V A;  1M56 C;  1S3J A;  1WA8 B;  2YIB A;  4PU9 A;  4WFB V;  1MSD A;  5LOV B;  3M99 B;  1MG1 A;  1I5C A;  3LUT B;  2BSK B;  4CWO A;  3LSU A;  3CRA A;  1OCC C;  2ZE8 A;  2YI5 A;  3JAT B;  5EZY B;  3SYP A;  1S5H C;  3W7U A;  3RBZ A;  1FKA O;  3FKS G;  1NHH A;  2WA3 A;  3CJH B;  4QIW F;  3BM9 A;  1UY6 A;  4O4L A;  4TUY A;  4PDV A;  4A5U B;  1BXD A;  4JI3 O;  2VQF O;  4JTA B;  1Y76 B;  1QY8 A;  1SQB H;  4J41 A;  3ABL B;  4PA3 A;  1TC6 A;  1FXV A;  2DQ0 A;  1N33 O;  3A8T A;  3X2Q B;  3W7W A;  1NZ6 A;  1EFR G;  1SA0 A;  4X1K B;  3B4S A;  1I5B A;  3P3N A;  2E0A A;  5C8Y A;  2QDO A;  1FD9 A;  3SJB C;  1W0K G;  3G80 A;  3K59 A;  3B09 A;  3JD3 A;  2DYR B;  4KSG A;  1XL4 A;  1FXK A;  4GX2 A;  1JM6 A;  3D3I A;  5KHJ A;  2EIK B;  1CP9 A;  5IJ0 A;  3ZHV A;  2Y4T A;  1VF6 C;  4FM1 A;  4GYC B;  2OCH A;  4LF9 O;  1BSM A;  1E79 G;  1J5E O;  3HKB A;  2YIA A;  3TTZ A;  1QR9 A;  4RQE A;  3WG7 C;  2YKB A;  5B1A C;  4BWA A;  4PHZ A;  2OIG A;  3K79 A;  2WLN A;  4YKW A;  3GIG B;  3LNU A;  2XAJ A;  4I9W A;  3OPD A;  1QQC A;  4KHP O;  4GX1 A;  3QO7 A;  4LF8 O;  2Q8G A;  2ZDY A;  4CWN A;  2BTQ A;  2UXB B;  1BKN A;  4NB5 A;  2YXL A;  2C2A A;  4C7U A;  4UFZ A;  3QNE A;  2QKA A;  4DV7 B;  2XDU A;  2P90 A;  4FM2 A;  3DTU B;  4CWF A;  3DC5 A;  4QPJ A;  2QM7 A;  2VW5 A;  4JF3 A;  3A0B Z;  2F95 B;  2LJ2 A;  4U7O A;  1TID A;  1SZT A;  5IY5 B;  1V54 C;  3HKE A;  3BAB A;  3J81 N;  1N32 O;  2V7Q G;  1P7B A;  3JCZ A;  3SDL A;  3O0I A;  1XUQ A;  4PI2 A;  2IBZ H;  1VF7 A;  4X20 A;  5IE9 A;  4DK0 A;  4DV2 O;  1ZL8 B;  1R3J C;  4X62 B;  5CMU A;  1V55 C;  4JI1 O;  4X65 B;  1TUB B;  4BIZ A;  2N05 A;  5EC2 C;  5BOD A;  3QG5 A;  2GHY A;  3HB3 B;  1XEQ A;  4CWP A;  4IHJ A;  2ZIM A;  4NH8 A;  4DRX A;  3B25 A;  1GN4 A;  4V25 A;  1TGO A;  4W4K A;  1NR7 A;  2X0L A;  2XDK A;  1VQK V;  1TBW A;  1KQS U;  2WPD G;  3B8M A;  1KYO F;  4JI6 B;  1YC4 A;  5IN9 A;  4BIU A;  2V4D A;  2Y48 A;  5E1A C;  3ZCC A;  1NJI W;  3U67 A;  5BXZ A;  4ZOL A;  5HFL A;  3LDD A;  1AR5 A;  2XCM A;  2CTW A;  3K0D A;  1H2G A;  3CWB H;  4FFK A;  2IJK A;  1WLE A;  2AKP A;  4YY3 O;  5JJE B;  2R70 A;  2X6A A;  2M7W A;  3HKE B;  2LW1 A;  3M8A A;  1YZB A;  4JI4 O;  2OCC C;  2RJZ A;  3SJQ C;  2XJX A;  1MMM A;  4LWG A;  4B3S O;  4DR7 B;  4EFE A;  3C0E A;  4GEE A;  1MNG A;  5J71 A;  3OGC C;  4GX5 A;  1LUW A;  3CSX A;  5LHH A;  1H2N A;  3D3Q A;  3QO5 A;  4UCT A;  4RO2 A;  3ABK B;  4CH6 A;  3OEH G;  1FXK B;  3K3W A;  5KHH A;  3CCE V;  1UYC A;  2W6I G;  4JI8 B;  4FMT A;  4DV0 O;  1ZAU A;  1NTK H;  1R6N A;  4J7K A;  4JI7 O;  1IZ3 A;  2F43 G; 
#chains in the Genus database with same CATH homology
 1YJN V;  4P2Z A;  1I58 A;  1GTO A;  1OSF A;  2YGA A;  3T0H A;  1SRY A;  2XX2 A;  3B24 A;  3EKR A;  3JD4 A;  3AG2 B;  1YJW V;  1E1R G;  3CCL V;  4UV9 A;  3VHA A;  1ARO P;  5J9P C;  4EFT A;  3HZ5 A;  3ETE A;  3E89 A;  2OTJ V;  3A0W A;  2P6J A;  1TUE B;  3VOU A;  3E83 A;  2ZDI A;  3ZMS A;  4JTD B;  4R8C A;  4KSH A;  3CP1 A;  1GO3 F;  5B1B B;  1H8E G;  2YSU B;  1YT2 A;  3SL2 A;  2MK3 A;  4FK5 C;  3CRL A;  4XC0 A;  1BMF G;  1KKD A;  1Y4U A;  2LFS A;  4B7P A;  4CWT A;  3SYQ A;  2HLD G;  2BYH A;  1N8R W;  2FWY A;  4G28 B;  2CGF A;  2YEA A;  4XIT A;  2Z3Y A;  1DF5 A;  2XDX A;  1JPX A;  2YI7 A;  2BZ5 A;  3OW6 A;  5EK0 A;  4PDR A;  1R3L C;  4KP4 A;  3X2Q C;  2XDS A;  3UM7 A;  3ETG A;  4LWF A;  4MP2 A;  4AWQ A;  2HJF C;  4UVB A;  1GKF A;  4OXS A;  5L3E A;  1CEZ A;  3HYZ A;  1JVM A;  1ROP A;  1SES A;  3QO8 A;  4RAI A;  1VQN V;  1QLE C;  4LWH A;  1QCE A;  2DW4 A;  3P32 A;  4BAY A;  4HYM A;  1TC0 A;  4BAE A;  4R50 A;  3CCS V;  2YE8 A;  4CWR A;  1U2O A;  1IXM A;  5CTX A;  4O05 A;  2BSM A;  1GK9 A;  2YE3 A;  5CF0 A;  2YE9 A;  3JYC A;  1K7D A;  2H55 A;  2YEC A;  1KIJ A;  3AG3 B;  3K60 A;  1F51 A;  2JJ1 G;  3ABM C;  5F3K A;  5M4H A;  1Y8N A;  3IC7 A;  5IYD O;  1PKX A;  3OAA G;  5LBQ A;  1YER A;  1YSR A;  3ABL C;  4WFH A;  2FWZ A;  4MBC A;  4I3H A;  2IOR A;  3CRK A;  3CGY A;  5B1O A;  1XL6 A;  2QM8 A;  4EGK A;  3QDD A;  1AH6 A;  2EIN B;  2YE2 A;  2NNU A;  2YGF A;  2JEU A;  4MTO A;  2PI5 A;  1L0O A;  1UYH A;  2BOC C;  4H81 A;  1BL8 A;  4HY6 A;  1KP2 A;  4X9L A;  1JOY A;  3G75 A;  4FJC C;  4MTG A;  1M90 W;  2OCC B;  4GT1 A;  2OT5 A;  3LNM B;  1I5D A;  4UV8 A;  4ASU G;  5H6R A;  4HZ3 A;  3SPH A;  1VQM V;  3CYO A;  1OCZ B;  3TCU A;  2EZO A;  4L87 A;  1UYK A;  3SYA A;  3LDC A;  4HYP A;  4QJF B;  4X88 A;  4LBE C;  4H37 A;  3RVY A;  2WI6 A;  1PNM A;  5CTY A;  3R92 A;  4ASB A;  2HVK C;  1AJQ A;  3HZ1 A;  3CXC U;  3K03 A;  1FXH A;  3E86 A;  2EIJ C;  3E35 A;  3ZRW B;  3ZN0 A;  1Z5C A;  3OR7 C;  2LP7 A;  2VWC A;  5LHG A;  4GQT A;  3R65 A;  1M57 B;  1RPR A;  4P9P A;  1A4H A;  3PEJ A;  3GIF A;  2ITC C;  3KG2 A;  4PRV A;  3ASO B;  4F4L A;  1JQ0 A;  1K5S A;  3OMU A;  3PEH A;  3K0G A;  5LGN A;  2FTK A;  1VQ4 V;  5L3G A;  3H4L A;  2WSS G;  3K08 A;  1Z5B A;  1NHI A;  2WER A;  2K1E A;  2DYR C;  4MVU A;  2WI2 A;  3ZM7 A;  4H85 A;  1V55 B;  5FL7 G;  3ZRW A;  3A0R A;  2H8M A;  3FT8 A;  1UYL A;  1Y4M A;  1AI5 A;  1U0Z A;  2EIK C;  2R9R B;  2LFR A;  2XHR A;  4HAM A;  4JYC A;  2EIM C;  1DTO A;  2WLI B;  1JCH A;  2XJG A;  1H8H G;  4JYB A;  4MVR A;  4GFN A;  4PRX A;  3C11 A;  1NR1 A;  4UXN A;  4XKK A;  3CCR V;  4WFE A;  3ZIA G;  4GX0 A;  3CME V;  2D3O W;  4G27 B;  2O1U A;  1ZWI C;  3CCJ V;  3GIE A;  3TZ2 A;  4TT3 G;  1ZWH A;  4LP8 A;  3UKM A;  2Q69 A;  3NXS A;  4ZKI A;  2GSM B;  1I59 A;  2QEX V;  1DF4 A;  1F4M A;  5D7C A;  4CE3 A;  1R73 A;  4E2L A;  3B77 A;  4I5S A;  3A0T A;  2NLJ C;  4TSF G;  4YKY A;  2DWE C;  4MT8 A;  2WI4 A;  3STL C;  2YE5 A;  4XE2 A;  4B6C A;  4PA6 A;  1RM1 B;  2A0L A;  2CH4 A;  1QLN A;  3EKO A;  5L3J A;  4R1F A;  2VCI A;  3CCU V;  2IU0 A;  2YEG A;  5KA5 A;  5IYB O;  3HHU A;  3I56 V;  2XAG A;  2YED A;  4MVZ A;  1KEC A;  4UVC A;  2IU3 A;  4E01 A;  3OMI B;  4MTF A;  2WI1 A;  2EBO A;  1EBO A;  2EIN C;  4JAU A;  4WFG A;  5BOC A;  3TET A;  2EZP A;  4URO A;  2HFE C;  1M9N A;  2B1I A;  1FS0 G;  1AJN A;  4RUF A;  1VQO V;  2GFD A;  1M56 B;  4EGH A;  2B5U A;  3D2R A;  2XD6 A;  3ZN1 A;  2QFO A;  3VHD A;  1R3I C;  5IYC O;  2WI7 A;  1EI1 A;  2WLH A;  4ZVI A;  1DLB A;  4AWP A;  2CK3 G;  3TUH A;  2ITD C;  4XIP A;  3U2D A;  2XAQ A;  3AG4 C;  1YC3 A;  4FIP C;  2P7T C;  4WUC A;  4G2K A;  2WEQ A;  3FYE B;  1KZN A;  1UYM A;  2XX5 A;  4MOT A;  1YT0 A;  1S76 D;  1S14 A;  4XDJ A;  3HPL C;  1PD3 A;  2BYI A;  1AH8 A;  1OCO B;  3SPC A;  5CTU A;  5IDM A;  3ZRS A;  3T10 A;  3GIG A;  3OWB A;  5M4N A;  2YEJ A;  3ZXO A;  2EIL C;  2HKO A;  2HCH A;  3TK1 A;  1S77 D;  3BEH A;  1BGQ A;  2GQP A;  2XHT A;  3FV5 A;  3O2F A;  4BXI A;  5M4M A;  4PA7 A;  3HYY A;  1YS3 A;  4MTX A;  3H01 A;  4EMV A;  5IDJ A;  1I5A A;  5J6A A;  1NKD A;  5KA6 A;  3OMA B;  4QE7 A;  3K06 A;  4EGI A;  3CCM V;  3AG1 B;  5B3S C;  3CD6 V;  5D7R A;  1E1Q G;  1EZJ A;  2WI3 A;  4NH7 A;  4EM7 A;  2Z5U A;  3QTF A;  3F7Y C;  2FYP A;  2WLK A;  2XAF A;  4O07 A;  2BTZ A;  1OCR C;  4FCR A;  3ABK C;  2PI4 A;  1YSC A;  1GJV A;  1QLE B;  3TZ5 A;  5KUM A;  2WLL A;  5DN6 G;  1F23 A;  4X89 A;  4EFU A;  4URL A;  1EA6 A;  1W2B U;  2EIL B;  2W0F C;  4MW8 A;  3T2M A;  2X7R B;  3EHB B;  3E8G A;  3ZJZ A;  3CC4 V;  1UYE A;  2BOB C;  4MPC A;  1COW G;  4CZZ A;  3ASN C;  4WFF A;  4KUM A;  4YKZ A;  1F4N A;  4P7A A;  4MW3 A;  4MVO A;  4PA9 A;  1AJ6 A;  4XKO A;  1NVP D;  1UYF A;  4MS2 A;  2CCS A;  2XOK G;  4CE2 A;  2IW5 A;  2BT0 A;  5FNF A;  4XIR A;  4L90 A;  2IWS A;  3MHS C;  4Z1M G;  2W6J G;  2ZR3 A;  4DUH A;  1I5X A;  3OM3 B;  1YSZ A;  3EHH A;  4DXW A;  1OHH G;  4O04 A;  1Q86 W;  4EEH A;  4WFA V;  3B8N A;  2ZXW B;  2HG5 C;  3K97 A;  2KB1 A;  1VQ8 V;  2O1W A;  2A9H A;  3ETD A;  1UYG A;  4P30 A;  4PEL A;  3BY6 A;  1YHQ V;  3U2K A;  2XAS A;  1JJ2 U;  1HWY A;  3TZ0 A;  3CC7 V;  3FB7 C;  5GW7 A;  1YTF D;  1B62 A;  1VQL V;  4MB9 A;  1K4D C;  3EHG A;  2QTO A;  2WLM A;  3G7E A;  4XDM A;  4P9O A;  3AG4 B;  4R3M A;  3E8B A;  1Q7Y W;  1ZXN A;  2WI5 A;  3EHF A;  3E2E A;  4YKX A;  2VCJ A;  1GM8 A;  2XND G;  2O1V A;  3RVZ A;  1YC1 A;  2BU6 A;  4XTJ A;  5EC1 C;  5FNC A;  2QF6 A;  4XCJ A;  1Z5A A;  1P4R A;  3K04 A;  2XHX A;  4L8Z A;  4YXW G;  3FB8 C;  3T4Z A;  1W0J G;  1KP3 A;  4WUD A;  2BU8 A;  1TH8 A;  1ZXM A;  5L3F A;  4BQG A;  5L3D A;  4HZ0 A;  1BYQ A;  4LC1 A;  2YI6 A;  2XAH A;  2B1G A;  4MVQ A;  4CBC A;  4XDL A;  1LNQ A;  1M57 C;  2IJH A;  2WWW A;  2JJC A;  3WQ9 A;  2HG1 A;  3G4S V;  2YEF A;  1QBZ A;  2IJJ A;  2WLJ A;  1US7 A;  2JKI A;  1UY9 A;  3E8H A;  1Y4S A;  2HVJ C;  2QG2 A;  4MVS A;  4PU9 A;  1M56 C;  1S3J A;  3VAD A;  4FPP A;  3SYC A;  4WFB V;  3IFX A;  2YE6 A;  2X6C A;  3M99 B;  1MG1 A;  1YTF B;  3LSS A;  1I5C A;  3LUT B;  3ZRV A;  2Q8I A;  4CWO A;  1Y66 A;  3E8F A;  4J9Z B;  1UYI A;  1OCC C;  2YI5 A;  2ZDX A;  3VBB A;  3A0Z A;  3SYP A;  3W7U A;  1S5H C;  3CCV V;  1Q81 W;  1PNL A;  1FFT B;  2Y69 B;  3RBZ A;  1AM1 A;  4KTN A;  3K99 A;  3FKS G;  4XKA A;  1NHH A;  3W7X A;  2YEI A;  1V54 B;  4QIW F;  2K5B A;  1JX9 A;  2Q6A A;  5CBF A;  3BM9 A;  3RLQ A;  2DWD C;  2BRC A;  1UY6 A;  4BQJ A;  4U93 A;  2YEV B;  1R62 A;  2BU2 A;  3OFN G;  2IWU A;  4WF9 V;  3AG2 C;  3D36 A;  1K5Q A;  1YT1 A;  3D0B A;  4PDV A;  5CBG A;  1H7S A;  2FXS A;  3ASN B;  1VQP V;  1NVP B;  2QG0 A;  2ZR2 A;  1K97 A;  2WLI A;  1BXD A;  2XK2 A;  5D7D A;  4JTA B;  3NMQ A;  3W7S A;  1Y8O A;  5C93 A;  1RM1 C;  1AI6 A;  1QY8 A;  2YEH A;  2ZKJ A;  4L93 A;  3ABL B;  2V1D A;  4P8O A;  4YKU A;  4PA3 A;  1Z59 A;  1VQ6 V;  3OW2 U;  5M4P A;  3OUS A;  1TC6 A;  1FXV A;  2DQ0 A;  3FYI B;  3X2Q B;  3R4M A;  3W7W A;  4Q20 A;  1THN A;  2H94 A;  3ZMT A;  5M4K A;  4FCP A;  5B1B C;  5L3B A;  1EFR G;  1S0V A;  5EBL C;  1I5B A;  3O6O A;  4UVA A;  4TWK A;  4YKT A;  2ZD9 A;  4L91 A;  2E0A A;  1UYD A;  3GB7 C;  1PVG A;  3SPG A;  1QYE A;  1W0K G;  2WAM A;  2EIJ B;  3JD3 A;  2DYR B;  4JAV A;  3MNR P;  4KSG A;  1MOF A;  1XL4 A;  1FXK A;  2H8P C;  4GX2 A;  2UXN A;  3D3I A;  1JM6 A;  4X8A A;  2EIK B;  1CP9 A;  4R6Z A;  2YE7 A;  3F7V C;  2Q2E B;  3BMY A;  1OCO C;  1M1K W;  4NH9 A;  4N23 A;  2BRE A;  3K9A A;  1NH2 D;  4H33 A;  4RUE A;  3SPJ A;  4KFG A;  3AEI A;  1E79 G;  1B3Q A;  2YK2 A;  3G6E V;  5CTW A;  1G4Y B;  4J9Y B;  3SPI A;  5CA3 A;  3A0X A;  1K92 A;  5DM6 V;  4CWF A;  1AMW A;  3TTZ A;  1QR9 A;  4HYO A;  5FND A;  4RQE A;  3ABM B;  3WG7 C;  2WLL B;  2Q67 A;  2YKB A;  1AI7 A;  5B1A C;  3AG1 C;  3ZRX A;  3K79 A;  2IOP A;  4JQL A;  2WLN A;  1Q82 W;  4YKW A;  4ASF A;  3JD0 A;  3GIG B;  3LNU A;  2XAJ A;  1TIL A;  3G7B A;  4I9W A;  1GMG A;  5HFM A;  1K73 W;  3OPD A;  1MU5 A;  3T0Z A;  4JPR A;  1YES A;  3STZ C;  2Y69 C;  4GX1 A;  2P67 A;  4AWO A;  1K34 A;  3QO7 A;  4E00 A;  3G71 V;  4W7T A;  2ZDY A;  3T1C A;  2Q8G A;  5CN0 A;  3TZ4 A;  3FB6 C;  3T1K A;  2XDL A;  2YKJ A;  4CWN A;  3OR6 C;  1BKN A;  4PL9 A;  2HKJ A;  2C2A A;  4QPK A;  4R7C A;  4XD8 A;  4XIQ A;  3CCQ V;  3INX A;  1VQ5 V;  4HY1 A;  4WUB A;  5EBM C;  3DGE A;  3RLR A;  4KFM A;  1ID0 A;  3QNE A;  1K9M W;  3B27 A;  2IJI A;  1OZ0 A;  3SYO A;  3WFV A;  1B6Q A;  3ML0 A;  2ZDI C;  4DO2 A;  1QZR A;  2XDU A;  4HZ5 A;  2P90 A;  3A0Y A;  4UUJ C;  3DTU B;  2BU5 A;  3FT5 A;  2JIZ G;  2AHY A;  3IGA C;  3LSQ A;  5KUK A;  3B26 A;  4XCL A;  2YE4 A;  4O09 A;  1OCC B;  4QPJ A;  2QM7 A;  3P30 A;  2VW5 A;  4JF3 A;  4KQV A;  2YEB A;  1AI4 A;  1Y8P A;  5F5R A;  3VHC A;  3WHA A;  1GKZ A;  3LPS A;  3OMN B;  1UJW B;  4U7O A;  1NH2 B;  1SZT A;  1AJP A;  1FXK C;  1V54 C;  5IY5 B;  1TID A;  2JJ2 G;  1ENV A;  4LWI A;  4V26 A;  3CC2 V;  3R91 A;  2IH1 C;  2OTL V;  4CE1 A;  3OE7 G;  4CWQ A;  2V7Q G;  3ZXQ A;  1P7B A;  3JCZ A;  3T2S A;  3IED A;  2YKC A;  3MD0 A;  2CG9 A;  1WPX A;  1GM9 A;  3H80 A;  3O0I A;  3AG3 C;  4R3A A;  2QE7 G;  1S16 A;  2QKS A;  3RW0 A;  4URN A;  1YI2 V;  2WEP A;  2YK9 A;  2YJX A;  2BU7 A;  1K3E A;  4MPN A;  3EFF K;  4MPE A;  1R3J C;  3RKZ A;  4ASG A;  5CMU A;  3Q5L A;  4JGS A;  5M4E A;  4XDK A;  1V55 C;  1QVF U;  4DZY A;  2Q8F A;  2JDI G;  3LDE A;  3MHH C;  3HEK A;  4BIZ A;  2JEX A;  5EC2 C;  4ZBM A;  3RLP A;  5BOD A;  1ZW9 A;  2UWD A;  2GHY A;  3HB3 B;  4CWP A;  3PJS K;  1MAB G;  3ZMV A;  3EHJ A;  1K4C C;  3K98 A;  2QA4 V;  1BHB A;  4WCE V;  3R4P A;  3T4D A;  3CMA V;  3F5W C;  2EJR A;  5LHI A;  1NHJ A;  4CWS A;  4LWE A;  5D6Q A;  1THZ A;  4NH8 A;  4HXZ A;  3B25 A;  1OCZ C;  5EBW C;  1OCR B;  1MSW D;  2DYS B;  3I55 V;  4V25 A;  1MX0 A;  1I5Y A;  1VQ9 V;  4GGL A;  1NR7 A;  4LCU C;  1K33 A;  2X0L A;  1KD1 W;  2ESA A;  1VQK V;  2XDK A;  2YGE A;  5B1N A;  4FCQ A;  1TBW A;  1R3K C;  1KQS U;  3INW A;  2Q8H A;  1NBM G;  2WPD G;  1VQ7 V;  1GKX A;  1GM7 A;  4L94 A;  3B8M A;  2PNR A;  1YC4 A;  2CCT A;  1KC8 W;  3OWD A;  5IN9 A;  3GWO A;  2AHZ A;  5GGZ A;  5LGU A;  1ORQ C;  1SET A;  4BIU A;  1SER A;  2YKI A;  1YIJ V;  2Y48 A;  2DQ3 A;  5E1A C;  3ZCC A;  3R4N A;  1NJI W;  5BZB A;  3FB5 C;  3OEE G;  3U67 A;  5CBH A;  3WG7 B;  4JAS A;  3ASO C;  5HFL A;  3ZKB A;  3LDD A;  4QNH B;  1YET A;  2XCM A;  2ZQM A;  3K0D A;  4JTC B;  4MVM A;  1H2G A;  2X6B A;  4HXW A;  2JK5 C;  1G8M A;  2YEV A;  3CGZ A;  2IJK A;  3ZKD A;  1CPY A;  1WLE A;  4U7N A;  3KE6 A;  5LGT A;  3CPW U;  4H7Q A;  4MP7 A;  2ZXW C;  2AKP A;  3Q5K A;  3B28 A;  4N21 A;  2YI0 A;  1NQT A;  2UXX A;  4RQF A;  4PDM A;  4PA4 A;  1R6K A;  2X6A A;  2M7W A;  5H6Q A;  3ZMU A;  2YEE A;  3ABT A;  2OCC C;  3SJQ C;  2ATK C;  3R4O A;  2XJX A;  2YKE A;  4LWG A;  1K8A W;  3CWV A;  4LP0 A;  1PNK A;  3C0E A;  4GEE A;  5L3C A;  4URM A;  4AS9 A;  3JZ3 A;  3JD1 A;  5B3S B;  2IH3 C;  4GCZ A;  1UY7 A;  3JD2 A;  4BW5 A;  1QVG U;  5J71 A;  3W7T A;  2YJW A;  3OGC C;  1BHA A;  1H7U A;  4GX5 A;  5LHH A;  2XJJ A;  4EKW A;  2R9I A;  1L1F A;  1QR8 A;  1UY8 A;  4PDL A;  2HR3 A;  4XBF A;  1H38 A;  1B63 A;  2CCU A;  2XAB A;  3QO5 A;  4RO2 A;  3ABK B;  4YKR A;  4ASA A;  4E02 A;  3OEH G;  1FXK B;  5IY5 C;  5FWK A;  5B1A B;  5H9C A;  1S72 V;  3K3W A;  3CCE V;  1UYC A;  2XX4 A;  2ZBK B;  1YIT V;  5CPH A;  2IOQ A;  1YJ9 V;  2EXL A;  5D6P A;  4YKQ A;  1PL0 A;  4MSW C;  3ZMZ A;  2W6I G;  4FMT A;  1J95 A;  1R6N A;  1RPO A;  1AR1 B;  3Q5J A;  4QE9 A;  4GT8 A;  4K4O A;  2DYS C;  2IWX A;  4O0B A;  4LPB A;  2A79 B;  3ABU A;  2EIM B;  3OUF A;  2F43 G;  2Q68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...