4JASA

Structural basis of a rationally rewired protein-protein interface (hk853mutant a268v, a271g, t275m, v294t and d297e and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
237
structure length
237
Chain Sequence
LKRIDRMKTEFIANISHELRTPLTVIKGYAEMIYNSLGELDLSTLKEFLETIIEQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/signaling protein
molecule keywords Histidine kinase
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
total genus 68
structure length 237
sequence length 237
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jasA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4jasA02
3ZKBA 3VHCA 4W7TA 4CWSA 3P32A 2H8MA 4B7PA 3HZ1A 2XX2A 4YKQA 2VCJA 3C11A 2CCUA 5B1OA 3SL2A 4L90A 2QF6A 2ESAA 3RLRA 4CWTA 3C0EA 3MD0A 2XD6A 4XIQA 3CGYA 2YGAA 1Z5AA 4LWEA 4E01A 3NXSA 3ZCCA 4EFTA 1UYFA 4QPJA 4ZKIA 4V26A 4HY6A 4YKRA 3HHUA 3ZKDA 1UYIA 2H55A 1H7UA 2K5BA 2YE4A 4R1FA 3D36A 5C93A 1UY9A 3WQ9A 4YKXA 3OPDA 2YJXA 4EMVA 1Z5BA 1TBWA 3U67A 1KZNA 2GFDA 2CGFA 2XDLA 2WI4A 2BU8A 1AH6A 4U7NA 3RLQA 4U93A 4MPCA 2YE7A 4H85A 3GIFA 4XCJA 2BU2A 3TK1A 2YGFA 5D6PA 2YE8A 3CRLA 3GIEA 3MNRP 4GFNA 1S16A 2YECA 3ZM7A 5CTUA 1A4HA 3BMYA 5M4KA 3TZ0A 5CF0A 3HYYA 5IDJA 4CE1A 3K60A 4HZ0A 1UY8A 3D0BA 3INXA 5CTWA 5IDMA 2JKIA 2IOQA 1MU5A 2C2AA 2ZDYA 1TC0A 3GIGA 5CTXA 4DZYA 4KQVA 1YT0A 2YE9A 4URMA 3R4PA 4HZ5A 1NHJA 1ZXMA 3QDDA 1YESA 4CWPA 2YJWA 4NH8A 2WEQA 5J71A 3QTFA 4FMTA 1AJ6A 5F5RA 4JASA 1U0ZA 2QM8A 2CCTA 2BU5A 3O6OA 2HG1A 2ZDXA 4L91A 4LWIA 3B26A 3CGZA 4XKAA 4EGHA 4KP4A 4X9LA 3BM9A 1I5BA 1Y4SA 1YT1A 1Y8OA 2WI5A 3RKZA 4HXZA 3U2DA 2VCIA 2AKPA 2YI6A 1PVGA 2BTZA 1GKZA 1Y4UA 1TILA 3TUHA 2WEPA 4GEEA 4O04A 1THNA 2XHXA 4AS9A 5FNFA 2CCSA 4O07A 1OSFA 4WUCA 2XCMA 2FXSA 4CWNA 5GGZA 2GQPA 4GCZA 5BOCA 3EHGA 3IEDA 3VHAA 4XKKA 5CPHA 3CRKA 3GIGB 4XTJA 4GT1A 2BYIA 2HKJA 1QZRA 5FNDA 4XD8A 1I5DA 3ZXOA 3OW6A 1GJVA 2XHRA 4CWQA 1UY6A 1YC4A 2WI3A 3TZ4A 4P8OA 1Y8PA 2IWSA 2XDKA 4FCQA 2YEJA 3K97A 4E02A 3FV5A 4KTNA 3WHAA 4CWFA 3TTZA 2YKEA 3A0TA 1YC1A 2YKCA 3H80A 4XDMA 1UY7A 1QYEA 4XKOA 4BXIA 1GKXA 5M4PA 2WI2A 4BQJA 4AWQA 1S14A 4YKYA 4I3HA 1YERA 3HZ5A 3CWVA 4H7QA 4K4OA 4L93A 2YE5A 2YKJA 3PEJA 5D7DA 2O1WA 4YKZA 3Q5KA 4L8ZA 5CTYA 2JJCA 1UYMA 1YSZA 4GGLA 4ASGA 2XDUA 3DGEA 2VW5A 2YEDA 2XHTA 3R4MA 4E00A 2YEAA 1YT2A 1AH8A 2QM7A 4MPNA 4GT8A 4PU9A 3T10A 4JYCA 1TIDA 3R92A 1UYCA 3B28A 2IWUA 2FWYA 3A0ZA 5FNCA 4NH7A 3T0HA 1JOYA 3A0RA 4URLA 5D7CA 4JQLA 2WI1A 3B27A 3JZ3A 4XIRA 3TZ2A 2BT0A 3R4NA 3A0XA 3RLPA 1BKNA 2YI5A 2YEBA 3PEHA 4P7AA 4FPPA 5D7RA 1I5CA 1EA6A 3INWA 4JAUA 3VADA 2UWDA 1Z59A 3K99A 3ZRXA 4H81A 4MTXA 4HY1A 1UYHA 1U2OA 4BAEA 4DUHA 2EXLA 2LFSA 3A0YA 4KFGA 2YEFA 4YKWA 2BZ5A 2YEGA 2Q8IA 2XABA 2CH4A 4CE2A 3T1KA 3LPSA 3Q5LA 2CG9A 4WUBA 2WWWA 3R91A 2O1VA 4CE3A 3A0WA 2ZKJA 4XIPA 4AWOA 4MPEA 2QG0A 1H7SA 4V25A 1QY8A 1ZWHA 4YKUA 3KE6A 2XDSA 2YEIA 4XITA 4ASFA 3ZRWB 3LNUA 5M4MA 2BYHA 4CWOA 3G75A 4HYPA 1YS3A 4MP2A 2BU6A 2YI7A 2ZBKB 4L94A 1F51A 4LWHA 4YKTA 2FWZA 3HEKA 2YE6A 3G7BA 4O09A 2XJJA 4UROA 2WI7A 3B25A 1I59A 4O0BA 1UYKA 2YE2A 1YETA 2XX4A 2XJGA 1L0OA 2YKBA 3OWDA 1ID0A 4PRVA 2YGEA 4LC1A 4I5SA 2HCHA 2YE3A 3EHJA 3FT5A 4LWGA 3O0IA 4URNA 5M4NA 4MOTA 3G7EA 5BODA 4XE2A 4PL9A 4KSHA 2O1UA 3EHHA 4R3AA 4NH9A 2YEHA 2E0AA 2XDXA 4FCPA 4MBCA 2P67A 4AWPA 1BXDA 1EI1A 2VWCA 5M4HA 2Q8HA 5L3JA 2YKIA 1UYDA 4MT8A 1ZW9A 1NHHA 4HXWA 4BIZA 2WI6A 3FT8A 4ASAA 3K98A 3U2KA 3EKRA 4KSGA 3ZRVA 3TZ5A 4CWRA 2FTKA 1KIJA 2IORA 1YC3A 3ZRWA 4ZVIA 4O05A 4EM7A 4LWFA 4EFUA 5D6QA 3EHFA 2IOPA 2YK9A 2IWXA 4EEHA 1Z5CA 1B62A 1TH8A 3NMQA 2XX5A 4MB9A 4LP0A 2PNRA 3B24A 3OMUA 1BYQA 1TC6A 1B3QA 4FCRA 1US7A 2YI0A 4HYMA 3R4OA 4MP7A 1YSRA 1NHIA 4BIUA 4ASBA 4XC0A 2XJXA 4U7OA 2Q8GA 4PRXA 2YEEA 4B6CA 5M4EA 2BSMA 5F3KA 1UYGA 3D2RA 3HYZA 1B63A 2Q2EB 2LFRA 3O2FA 3VHDA 4BQGA 4EGKA 1I58A 4LPBA 4QPKA 2QFOA 3ZXQA 2FYPA 1Y8NA 4EGIA 5J6AA 4R3MA 4WUDA 2BU7A 4Q20A 2QG2A 3OWBA 3Q5JA 1UYEA 2XK2A 2BREA 3H4LA 2Q8FA 3T0ZA 1AMWA 5FWKA 1AM1A 1JM6A 1I5AA 1MX0A 2YK2A 4JYBA 1UYLA 2WERA 2BRCA 1ZXNA 1BGQA 4GQTA 4XCLA 5B1NA 3T2SA 4JAVA 1R62A 1IXMA 5IN9A 3EKOA
chains in the Genus database with same CATH superfamily
4FJCC 2B1GA 4W7TA 4CWSA 5IJ9A 3G71V 3T1YB 1AP6A 4B7PA 1YDXA 2VCJA 5B1OA 2EIMC 2DYRC 4R50A 1U97A 1G1XB 4CWTA 3VQWA 1E79G 1AVMA 4RQFA 1SRYA 3K5MA 4XBFA 1Q43A 4WFAV 4Z1MG 1XNRO 4QPJA 1S72V 3E8BA 1BHBA 4DV1B 1QVGU 5LGTA 3H1KH 2PYLA 2Y0IA 2XOKG 1UYIA 2H55A 1Y76B 2YE4A 5C93A 1NH2D 1UY9A 1H2GA 3SPJA 2L6LA 4GX1A 4R7CA 4J41A 1NBMG 3T1CA 4O4HB 4ABMA 5IYZA 1Q86W 4KXRA 4EMVA 5FNVA 3DXRB 4NVPA 1Z5BA 2XDLA 3CPWU 5DECA 2VQFO 1PPJH 4O2AB 2BU2A 2QWPB 3CE2A 2WLHA 4FFBA 3MNRP 1WNSA 5JENA 3JARA 1S16A 3ZM7A 3U0ZA 3K3WA 1A4HA 3BMYA 2Q68A 5EBLC 4G2KA 1M4UA 5IDJA 3I56V 4DV0B 3K60A 4HZ0A 1UY8A 3JATA 3JCZA 1BMFG 1JFFA 1QLEC 2CAZC 4I0XA 2ZDYA 1TC0A 3QG5A 4DZYA 4I9WA 3TXQA 3OMIB 3AG3B 1HP8A 4KQVA 5BMVB 1PL0A 4J7JA 1WLEA 4X66O 1Z5WA 3OUFA 4LH6A 2DWDC 2KQXA 1NHJA 4H0LB 3CS5A 3IJ4A 4LBEC 4RWUA 4X62B 1WB8A 2ZXWB 2IH3C 2YJWA 3LDEA 2DW4A 1JJ2U 4FMTA 1MA1A 5KMGB 5F5RA 1U0ZA 1S5JA 1DGSA 1GO3F 2QM8A 2JJ1G 3ETEA 1D5AA 3R65A 1Q81W 4B3MB 2HG1A 2ZDXA 1WPBA 1M5IA 3DC6A 2YC0A 3B26A 2YXYA 4HZ3A 4B3RO 3CGZA 1FXKC 2Q7EA 4KP4A 4X9LA 3OE7G 3RW0A 3STZC 2RJZA 4KL1A 3U2DA 5L3BA 2YI6A 4J10A 5GONB 5E79Z 1Y4UA 4MVRA 4GEEA 4DR3B 2JGUA 2PGGA 4R6ZA 3G80A 1NI8A 4ZIBA 2XCMA 5GGZA 2GQPA 1H2KA 3APOA 2EINC 5KUKA 5BOCA 2V4DA 3TETA 2OTLV 3D36C 1KP3A 4RQEA 4XKKA 1P49A 4NR1A 3LSQA 4WBNB 1OCRB 2QKSA 4LFBB 1XHZA 3E22B 2GUZA 3BA8A 3VOUA 5FNDA 1PP9H 3MHSC 2XHRA 2ZCEA 2CUGA 4ZHQB 4X1KB 3BCCH 4P8OA 4E4EA 2IWSA 4FCQA 2E5LO 4LF5O 3FV5A 4KTNA 4CWFA 3SYAA 2EIJC 5LHHA 4B3TO 3A0TA 3H80A 1VQKV 4XKOA 4UCVA 2P6JA 4BXIA 2XNDG 5M4PA 2YICA 3ZX6A 1S14A 3SPCA 4H7QA 2YEVA 2YE5A 3PEJA 5L3CA 4CH6A 5BR8B 3Q4HB 4L8ZA 1FD9A 3OR7C 3CYGA 3L72H 3JSNA 4JI3O 1ZUQA 4PA4A 1IXBA 2HEPA 4YXWG 1O9HA 4MTFA 1Y4MA 1YJ9V 2XHTA 3FAVB 2DYSB 1N8RW 4IHJA 4PU9A 3OEEG 2ZE5A 4JYCA 4JYAO 4TQFA 3T10A 2RN9A 3R92A 1UYCA 4DV4B 2IWUA 5KUMA 1WA8B 2ZDIC 2FWYA 3A0ZA 5FNCA 2JIZG 4NH7A 2M7WA 1QBZA 1Q8IA 1E1QG 2F95B 4CS2A 5D7CA 2Y69C 4JQLA 3RYHA 5IYDO 3TZ2A 3ZN1A 3R4NA 4DR7B 4PDVA 5HFLA 3EXAA 3M99B 3AG2B 5B1AC 1MZEA 2W6JG 4P7AA 4FPPA 1BQ0A 4UVAA 3VADA 2MW2B 2Q69A 1YITV 2ZDIA 3W7SA 1Z59A 3B40A 1EFRG 2QR4A 1Q82W 5LP6A 3LSUA 3K99A 2LGWA 4GKKO 2LO1A 4HY1A 1J95A 2H94A 1U2OA 3CCVV 4BAEA 2EXLA 4RO2A 3N27A 3RT3C 3TCUA 2UXDB 5FLXN 2RMKB 4LFCO 4E2LA 3D8CA 1H8HG 2E75B 3ABKC 3K06A 3UT5B 3W7WA 2UUBO 4UVBA 2P06A 4IYIA 2CG9A 1AR1B 3R91A 2O1VA 4CE3A 1QHTA 4NTXA 4UXNA 2BTQA 1SA0A 1QQCA 5EBMC 2XDSA 4C7UA 3JAWB 4B7EA 5CA0A 3ZRWB 1FKAO 3LNUA 3K9SA 5M4MA 5C8YA 2BYHA 4CWOA 3G75A 2YI7A 2Q7HA 2ZBKB 4L94A 5IY5B 4LWHA 2F23A 1FXVA 2L35A 3P3NA 1MG1A 3G7BA 5IWAB 4O09A 4UROA 1Y67A 2RQ6A 2YIDA 2WI7A 2LP7A 4FZ0A 2Q73A 1DLBA 4TV9B 3SJBC 2YE2A 2XX4A 2XJGA 1L0OA 3A2FA 5J2UA 3RYFB 1WP7A 4I50B 1K7DA 4DR5O 3ASNB 3EHJA 1XL6A 4LWGA 2DWEC 3CCEV 3E35A 4F6EA 4LF4B 1KU9A 4I4TB 4XE2A 3JD1A 4KSHA 1OCZC 2O1UA 2D3OW 4L87A 1N36O 1YVWA 1NS1A 4FCPA 2OYQA 1MSDA 3B2EE 3KG2A 4DV2O 1ZAUA 4MBCA 1YXBA 3HKEB 1BXDA 1GN2A 3A0HZ 4B3SB 2CGNA 1R3IC 1EI1A 1L0NH 5LXTB 2E76B 3M8AA 2KB1A 5L3JA 1AP5A 3JAMN 1UYDA 2JS3A 2A9HA 1NJIW 2ZNIA 3K98A 3EKRA 4JI1B 3JALA 3H1JH 3C90A 4CWRA 2DQ0A 2FTKA 3LNNA 4OX9O 3FYEB 1V55B 4UV9A 2CK3G 4MVMA 3CC4V 2LQTA 5KHJA 1XILA 2IWXA 2YK9A 4EEHA 1N4CA 4FIPC 1BL8A 5FPOA 5IE9A 4LP0A 3SYPA 1ORQC 1KUQA 2K9PA 3SPGA 3T1HO 4LR3A 1TC6A 3CRAA 1QNMA 4JGSA 1H38A 1US7A 2EULA 4I7ZB 1US6A 4QGPA 4FM2A 2G38A 4JI2O 2XJXA 4U7OA 4JI7B 3K79A 4PRXA 3FB5C 4B6CA 5M4EA 2BSMA 1UYGA 2A79B 1B63A 1I5YA 1BCCH 3RYCA 3O2FA 5KX5B 4N21A 3SPHA 5B3SC 1K4DC 3B09A 2YI9A 4B7KA 4QPKA 4X20B 1SQPH 3BFRA 4EGIA 4LNUB 4R3MA 1MNGA 4WUDA 3ZHRA 4Q20A 2QG2A 1IBLB 4PHZA 3Q5JA 3KCYA 1VQ4V 4CZZA 4JPRA 1GH6A 4FK5C 2XT9A 1UYEA 3E8FA 3DXRA 1FFXA 4DUYB 2Q8FA 5FWKA 1RSOB 1I5AA 2Q5ZA 5LMNB 2Y4UA 2YK2A 1S5LZ 1DK1A 4O2AA 3QO7A 4QIWF 1I94B 3L9DA 3L71H 4EB6B 3ABLC 4OPAA 2OTJV 3T2SA 1R62A 4YJ3B 5IN9A 4UCTA 2H8MA 1N32B 2XX2A 2IH1C 3K57A 1IBMB 3E2EA 1LUWA 4JTCB 1LNQA 2WLNA 2CCUA 2GTAA 4K35A 3MAQA 3AEIA 3ZHUA 4JV5B 2P5OA 3RLRA 1Q5OA 2YI8A 3RVYA 1VARA 4JI6O 1B6QA 2YGAA 1Z5AA 5BMVA 3SGIA 3H1LH 2EILB 2P90A 3NXSA 3ZCCA 4NXMB 3M7MX 2N74A 2BCCH 2ZM6B 1HR0O 2R70A 4JI4B 4JTDB 2BOBC 3ABMB 2X6CA 1BQZA 4UB8Z 4BAYA 1XMQO 3ZKDA 2CTWA 2WLIB 5KMGA 3BAAA 4ZI7A 4RAIA 1QU7A 4AQYO 1WN7A 1K33A 4UUJC 3EHBB 2YE7A 4H85A 2OWOA 2QWQB 1AJNA 3TK1A 1M57B 2QDOA 3ETGA 5GONA 5CTUA 1ZL8B 5H6RA 4NXNB 4LF7B 2ZNJA 3CCSV 4CE1A 4AILC 3ZN0A 3QO8A 2IOQA 4D6TH 1SZXA 5DN6G 4LWSA 3FX7A 5CTXA 4WBNA 1QR9A 1XL4A 5LMUO 2Q67A 3E22A 3T4DA 1I08A 1M56C 2YE9A 1I0HA 4AI8A 1OHHG 3R4PA 1XMOB 1HDJA 2O57A 3QDDA 2JEUA 5H6QA 4CWPA 5CA3A 4IL6Z 3SYQA 4P9PA 2P4KA 3QTFA 1AJQA 3LUTB 4X1YB 4JASA 3ZHQA 1S5HC 5F2VO 3J81N 4PDMA 4MVOA 4LWIA 5K1PA 2DQ3A 5A2QN 4JTAB 3AG1C 3BM9A 1Y4SA 4UCRA 4JI0B 3OT7A 1N34B 3S3XA 3R66A 1IURA 1Y8OA 2ZR3A 3E83A 2VS0A 3RKZA 3K0GA 4DV1O 1VF7A 4CS3A 4Z2WA 2GHYA 1K97A 2XHBA 3KKYA 1PVGA 2UXCO 1V54C 3FD9A 1GKZA 4FFKA 3K58A 1TILA 2WEPA 1Q6IA 4YHHB 2H8PC 1THNA 1FPOA 4AS9A 1WAZA 1NT2B 3FAVA 4O07A 1OSFA 4WUCA 1K5SA 1HNZO 1K8AW 5JJJB 3N2GB 4DR4B 1VQ8V 5J9PC 4DV5B 5CPHA 4O4JB 2ZIMA 1RM1C 2IJIA 4JZ2A 2YXHA 1Y74A 5CMUA 1I5DA 3ZXOA 2HG5C 4D7TA 4J80A 1SC5B 5LYJB 1D5NA 4DV0O 1JCHA 1GJVA 3ZHSA 2Q0OC 1X4TA 2GV9A 3FB6C 3F5TA 3SJCC 2XDKA 3OGIB 1F7YA 4K0KO 2N05A 4XDLA 1M90W 2EX3A 2YKEA 2ZQMA 2WLMA 3JD4A 4XDMA 2JEXA 2WLLA 4JI8B 5L3FA 2Y4TA 4TUYB 4BQJA 5J2TB 2IU3A 1YERA 3CWVA 4L93A 2YKJA 4KFMA 2A7WA 2YIBD 1SQXH 5D7DA 1H2NA 2X6AA 3CJHA 5BZBA 4YKZA 4PDLA 3Q5KA 1F4MA 4BR6A 2MK3A 4FLTA 1NR7A 2OCCB 1SESA 3OMAB 3K04A 2XDUA 4B3MO 3DGEA 4GLXA 2VW5A 5JWPA 1COWG 1NKDA 3QVNA 3WB1A 1DTOA 1RFYA 4LH7A 3T0HA 1JOYA 5KA5A 1YSCA 4TV9A 1XNRB 3FB8C 1VF6C 5E1AC 5B66Z 4URLA 2ETNA 2XAFA 3RBZA 1SQQH 3B27A 2CTQA 5H2FZ 1NR1A 3RYFA 3JZ3A 4O4IB 4BIOA 5LGNA 3J7AU 3OTOO 1ENVA 2YEBA 1AR5A 4KHPO 5D7RA 1I5CA 1EA6A 4JAUA 4WFHA 1ZWIC 1Q90D 3OAAG 2UUAO 4H81A 1VF6A 5EZYB 1MOFA 1IX9A 1UYHA 3HKEA 2Z3YA 1AR4A 1KYOF 5JQGB 2RCVA 2LFSA 1S3JA 2VQFB 5LXTA 3W7TA 3A0YA 2BZ5A 1W0KG 2YEGA 2M6YA 2XABA 2Q8IA 1JJOA 3AG4C 2CH4A 3KZIZ 3Q5LA 3N2KB 1AROP 5B1BC 3BEHA 1BE3H 1NTKH 3A0WA 4MPEA 2QG0A 5KAFZ 2YEIA 3KE6A 5CB4B 3VQYA 2ZE6A 5BXZA 2WLJA 4TQDA 2EJ7A 1NZ6A 4YJ2B 1HNWB 1W59A 5TISZ 3ABUA 3FB7C 4H33A 2FWZA 2P22C 2CDYA 2YE6A 3O65A 2QTOA 3HEKA 2EIKB 2BE3A 3BABA 2JVDA 4X66B 1XUQA 3B25A 3U10A 1J5EO 4O0BA 3OWDA 1U96A 3ASOB 1TUEB 3CCQV 5EC1C 3G4SV 1ZTEA 3CC7V 1R3KC 3FT5A 2OCHA 4MOTA 3CWBH 4PL9A 4F6RB 4R3AA 4HBNA 3IAYA 3P3PA 1TAEA 3OM3B 4JI5B 5KX5A 2XDXA 4B3RB 1XDCA 3I5DA 4UV8A 4W4KA 2BSKB 2D2CB 4GKJO 4X20A 1Q3EA 3ETDA 2GSMB 2K1EA 1SQBH 1OCOC 4UB6Z 3RYIB 3CRQA 3OEHG 4D7SA 5LL6Y 2LGQA 4LF6O 1ZSPA 5CBFA 3JD3A 4MS2A 4LFAO 1YC3A 4P2ZA 1RSOA 1VQMV 3X2QC 4U3FH 3ZHVA 4EFUA 3WB2A 3EHFA 2IOPA 1SF9A 2ZT9B 1Z5CA 2NR5A 3ICXA 4Q6GA 4EB6A 1TH8A 1HNXO 2HFEC 2PNRA 3B24A 1NVPB 5LP6C 3OMUA 1LUVA 4WFEA 2HP8A 2IW5A 4RUEA 2GBOA 4P9OA 5HFMA 4FCRA 2ILMA 4FLZA 2CTRA 3R4OA 1A32A 2Q6AA 5IJ9B 2P4VA 3CCMV 1DF5A 2HHIA 4BIUA 4LF5B 2Q8VA 4XC0A 3K5NA 3K08A 4B3TB 5F3KA 1VQPV 3HYZA 2CGOA 4YIPA 2YS8A 2X7RB 4NTWA 5EIBD 2F66C 2OIGA 2WA3A 4EFEA 4BQGA 4EGKA 4CC6A 2QKAA 2HVJC 1D2DA 1XNQO 2PF4E 2EIMB 3ZMTA 2QJ1A 4DK0A 2DYRB 2P7TC 4LF4O 2XK2A 1P84F 3F7VC 3DTUB 2QWOB 4GUNA 4MW3A 4XDKA 5IYZB 3T0ZA 1AMWA 1AM1A 1JM6A 5FNVB 2PYJA 2A06H 1XQ8A 1Q7YW 2F4VO 4JYAB 1MX0A 1PNMA 4JYBA 3W7UA 3T2MA 1FYJA 1R3LC 3CD6V 2XAJA 4GQTA 4XCLA 3HKDB 4ASUG 3JAKB 5B1NA 4JAVA 1ZL8A 1IXMA 2HHHO 3EKOA 2ZINA 2N04A 3CSXA 3JARB 4DV7O 3ZKBA 1H8EG 4JI1O 4X9QA 3GWKC 1FAFA 3SPIA 3BVOA 4DRXB 4YKQA 3EVKA 3J80N 1IVSA 3ML0A 4PDRA 3SL2A 1M1KW 2EZPA 4KUMA 2QF6A 4DW1A 4BW5A 1IBKB 3MD0A 4GKKB 2XD6A 2Z0AA 4JYYA 3JASB 2JDIG 4EFTA 3CP1A 4K8XA 4ZKIA 1EBOA 4PJ0Z 4LFCB 2OT5A 3D3IA 2UUBB 1YTFB 3CMAV 2IJHA 1H7UA 1QLEB 2K5BA 1V9PA 2ADPA 4K8ZA 3S5TA 3ZRSA 4B08A 4YKXA 5GTHZ 3DSQA 1TA8A 2PY5A 1JX9A 5AG2A 3CCLV 3CRRA 2JGDB 3CHXA 2RDCA 4UCSA 1KC8W 1KZNA 1TBWA 3U67A 2VQEB 3RLQA 4MPCA 3GIFA 4XCJA 4DR2O 2YGFA 2YE8A 5EYPA 4WFBV 1FFTB 3CXCU 3GIEA 5CA1A 3E8HA 4GFNA 2YECA 1KKDA 3C3SA 5M4KA 2Q9LA 4DUZO 3TZ0A 1KD1W 3HYYA 2UUCO 2V7QG 4DR5B 4J7ZA 4NYKA 3K59A 5ITZB 1R6TA 5CTWA 2W0FC 4DUYO 5IDMA 2JKIA 1FXKB 4ZBMA 2WSSG 3N2GA 3CRMA 1MU5A 3L73H 1KP2A 2C2AA 4CH5A 4X65B 4PI2A 1N36B 4PA3A 2WPDG 5GW7A 2R9AA 5CBGA 3SJAC 5LYJA 1HWYA 4OXSA 2QEXV 4UCOA 2QWRB 4LF8B 4WFFA 1HW7A 1XI1A 4X64O 2FB5A 3G6BA 3BRCA 4X89A 2EZOA 1G8MA 1Y76A 3FKSG 5J71A 4DV3O 4X8AA 1TGOA 3AK2A 1Y6XA 1SS3A 4OX9B 4JV5O 1WB7A 1SKVA 3EFFK 4O4HA 4IIJB 3ZHTA 1KBHA 2CCTA 1IZ3A 1YEWA 2R9IA 1W2BU 2BU5A 3O6OA 4HNAB 4L91A 1VP7A 4TUYA 3CC2V 4XKAA 3H9VA 3BHPA 1LR1A 5J2TA 1I5BA 4YY3B 1YT1A 3OW2U 2WI5A 3OUSA 1GN3A 3T1HB 2PI4A 2ADQB 2W0XA 3AG3C 4PA7A 4HXZA 3C3TA 2VCIA 3STLC 2AKPA 2F43G 1IDSA 2EIJB 2IM9A 1P4RA 2UXNA 3TUHA 4UCUA 2YDEA 3O9OA 2XHXA 1FXHA 3ABTA 1AB3A 2B5UA 5JVDB 2ITDC 2UU9B 2CCSA 3QO5A 4LF9O 4JI2B 2ZXWC 3E89A 2FXSA 1K73W 2WA4A 4X88A 4BWAA 1RP3B 2ZR2A 3K0DA 3DC5A 4IHJB 4GCZA 2PUSA 2AHZA 3ZS8C 2UXBO 3CRKA 3GIGB 4GZRB 5LA6B 4DV6O 4DR6O 2HKJA 1QZRA 1AI7A 4XD8A 1FJGO 1K4CC 1R3JC 4RUFA 3RGBA 4MTOA 3OW6A 3B77A 4CWQA 3TGUH 3RWRD 1YC4A 2R9RB 1VQ9V 3TZ4A 2QE7G 2VRZA 3K97A 4E02A 4GYCB 3WHAA 2NNUA 1EN5A 1F4NA 1YJWV 1RPOA 3G67A 2YKCA 1N33O 5JQGA 3UKMA 2Y69B 2XAQA 1YF2A 4FLYA 1UY7A 1S76D 5CBHA 1I7FA 5JJNB 1ZLZA 1XMOO 4A5UB 3IC7A 4O4LB 4BW9A 3HZ5A 4GX5A 3N2KA 1TUBB 1M93A 2AXTZ 5DM6V 1GN6A 1OCRC 4U3JB 3ETQA 2QGNA 2BTQB 1VQ7V 5CTYA 5CB4A 1EZJA 1S0VA 2JJCA 1UYMA 4MVUA 4ASGA 5L3EA 2YEDA 3R4MA 4E00A 2YEAA 1PD3A 2QM7A 1AH8A 4MPNA 1SETA 1TIDA 1GKFA 2ARHA 3APQA 3UQ8A 2QKCA 4HYOA 4O2BB 3L74H 5DEDA 3L70H 3A0RA 1HR0B 1GM8A 1VQ5V 2CE4A 4XIRA 2YIBA 2BT0A 5JH7B 1JA8A 5J2UB 1CPYA 4YHHO 3T1YO 1XMQB 4ZHQA 4X1KA 1BKNA 1BZKA 2YI5A 3PEHA 1MZFA 3INWA 2UWDA 4F6RA 3JD0A 5CN0A 3ZRXA 1B06A 1G4YB 3F5WC 4TT3G 1FS0G 4DUHA 1OJHA 2BSKA 2Q4PA 2DYSC 4KFGA 3RYIA 4PA9A 4J9ZB 1MABG 4DR1B 3LPSA 5LOVB 4WFGA 4YIOA 1XOUA 4WF9V 2WWWA 3Q4HA 3QTCA 5LHGA 4XIPA 1SQFA 1H7SA 4V25A 1OCZB 1QY8A 4YKUA 4XITA 1NTZH 1RPRA 4EEQA 3AG2C 2CH7B 5EC2C 2CTPA 1WP8A 1Y66A 1YS3A 4IT5A 2YSUB 3HB3B 4JAAA 2HKOA 1F51A 2KKWA 3ZMZA 4YKTA 5LMUB 1WA8A 2LJ2A 2ZE7A 2XTAA 2DMXA 1BSMA 1I59A 4ZOLB 1YJNV 1UYKA 2YKBA 4OGQB 3VQXA 4PRVA 2YGEA 2UXXA 4I5SA 2LW1A 3VBBA 2YE3A 1XREA 5GTIZ 3O0IA 1AI6A 2JS5A 4URNA 2FMLA 3B8MA 2PZSA 1KB9F 1URFA 2YEHA 2E0AA 3FFQA 3RYCB 3A8TA 4FM0A 5KHHA 5M4HA 5IY5C 3BY6A 1OCCB 4NB5A 1Q6UA 3NR7A 3UT5A 2WAMA 4PV1B 1ZW9A 1EN4A 3VQVA 1NHHA 4BIZA 4HXWA 4X62O 2UXCB 3U2KA 4KSGA 3IGAC 3ZRVA 3L75H 1K3EA 2R72A 3TZ5A 3JAWA 1WJZA 2IORA 3CEIA 3ZRWA 4MTGA 1HNZB 4ZVIA 4O05A 1FFXB 5KAIZ 4EM7A 3ASNC 3UO3A 1TVKB 5B3SB 4I55B 3SR2C 1CXZB 4FLWA 1O9GA 1B62A 3HKDA 3JAKA 4MB9A 1YIJV 2JRIA 4GX2A 3UCSC 5IJ0B 2YUAA 1B3QA 1KMIZ 3ZJZA 4J9YB 2XUMA 4DRXA 1YSRA 4MVZA 4I50A 1DF4A 1EZVH 1YI2V 1NHIA 4DR3O 1XEQA 5FPRA 1T5EA 4ASBA 1HNWO 4K0KB 2IJKA 4I4TA 2Q8GA 4W4LA 3GB7C 1L8DA 4G28B 3ABLB 3D2RA 3JASA 2Q2EB 2LFRA 1QCEA 1V55C 4LFBO 5EBWC 1NVPD 2Y0PA 1WPXA 4HAMA 5EIBC 3IC9A 3SJQC 3ZXQA 2FYPA 1KQSU 3SYOA 1MMMA 3RFRA 5J6AA 2BU7A 3OWBA 1I5XA 3HKBB 5LBQA 3CB2A 4ZI7B 4TOIA 3LDCA 1ZX3A 2JGDA 3U11A 3H4LA 1R1BA 4JI5O 1AILA 2QWNB 4J7KA 1UYLA 1AJPA 2WERA 3P30A 2ZD9A 3F7YC 3BPZA 3MHHC 2QSAA 3ZBHA 1X59A 3S3WA 5KHKA 1AI5A 4ICGA 2NN4A 2DOSA 3HKCB 4IGGA 3VHCA 5BR8O 3LDDA 3P32A 3HZ1A 3OTOB 5ITZA 1BS3A 5H5NA 1NH2B 4KHPB 1FXKA 3C11A 1NTMH 1G6UA 4L90A 1UPGA 3ZIAG 2ESAA 1JR9A 3AK1A 3C0EA 2UUAB 3RVZA 4LWSB 4XIQA 2ZIOA 3CGYA 4WCEV 4LWEA 2RNBA 4DV4O 4E01A 5LHIA 2IU0A 1UYFA 2NLJC 4H44B 4V26A 4HY6A 2ZKOA 4TV8B 4E72A 1BT8A 4YKRA 3HHUA 2VWJA 4DR7O 5KHIA 4PD4F 3WG7B 4LNUA 2DN9A 4R1FA 3D36A 2H3OA 1YZBA 3OD4A 1KKCA 5H9CA 1EN6A 3WQ9A 1GK9A 4IIJA 1Z5VA 3G6EV 4HNAA 4PI0A 1M56B 5L3DA 2W6IG 5IYBO 3OPDA 2YJXA 2AZ2A 3D3QA 2KG7B 4X1IB 1VF5B 3B8NA 4Z1VA 2GFDA 2WLKA 2CGFA 2BOCC 2WI4A 2BU8A 3CCUV 1AH6A 4U7NA 1QLNA 4JF3A 1VQ6V 2FYUH 4U93A 1SQVH 2UXDO 1ROPA 4EKWA 1CEZA 3QF7A 3B4SA 5D6PA 3H1IH 3CRLA 4YJ3A 1J5EB 3AK3A 4IYHA 1GM7A 2EILC 1YTFD 5D5PA 3WU2Z 5CF0A 4MSWC 4L8JA 5JVDA 2XASA 3D0BA 3INXA 3ABMC 5EK0A 3AG1B 4FLUA 2E5LB 4MVSA 3LSSA 3GIGA 3SYCA 4FLVA 5LA6A 1VQNV 1YT0A 5IWAO 4URMA 3FYIB 1R73A 5KLVH 1V54B 5L3GA 4HZ5A 1Y74B 4GKJB 3GVMA 3OMNB 2F93B 1ZXMA 4PELA 4FZ1A 1YESA 3SDLA 1M57C 4NH8A 2WEQA 4LF6B 2WLIA 1W0JG 1AJ6A 1P7BA 3LMMA 1IBKO 4JI3B 4LFAB 1F23A 1RM1B 4MW8A 1H2LA 4K3AA 1PKXA 2WLLB 3CYOA 2E3CA 4EGHA 1BHAA 3THOA 1HNXB 4O4LA 2QA4V 4B3SO 1TUBA 2AHYA 4DK1A 2AZ0A 4U3JA 3H01A 2PTMA 4FFBB 1R6NA 3CJHB 1GRJA 4R8CA 3A0BZ 4UFZA 2BTZA 3ZMSA 4DXWA 4F4LA 3CCRV 4MVQA 2C1IA 1K5QA 5D5QA 1M9NA 2Y48A 4O04A 3WFVA 5FNFA 1NQTA 4CWNA 3JATB 2LW7A 3HR0A 3K5OA 2YXLA 2VQEO 1JFFB 4I0XB 3EHGA 4O2BA 3IEDA 3VHAA 1PNKA 4XTJA 1L0LH 4GT1A 2BYIA 2FL4A 4OPHA 1AI4A 5JH7A 1XNQB 1PV0A 1Z2GA 1UY6A 2V1DA 2BTOA 2WI3A 1B04A 3K5LA 1Y8PA 1N0JA 2YEJA 1PM9A 4XDJA 3H1HH 4X1YA 3OTFA 4JI7O 2ITCC 1EM1A 3TTZA 4X65O 2QTSA 4LCUC 3OFNG 1YC1A 2F4VB 2A3QA 3ZMVA 1QYEA 1GKXA 2WI2A 4AWQA 4DO2A 3CXHF 2A0LA 4LF8O 4YKYA 5LOVA 4I3HA 4K4OA 1K92A 2HHHB 2B1IA 4DV7B 2O1WA 1QVFU 2F1MA 1IBLO 4UVCA 5FL7G 1VQLV 1YSZA 2AGAA 4GGLA 2CH7A 5KHGA 4GX0A 1YT2A 4GT8A 5B5EZ 4PA6A 5LMNO 3JD2A 3AG4B 1XBLA 4QE9A 4YY3O 3B28A 1I94O 4O4JA 2B9ZA 1SZTA 4DV2B 4ZOLA 5B1BB 1K34A 2WI1A 4JZGA 2GUZB 4I9QA 4NKGB 1OCCC 5A9GA 3A0XA 3RLPA 3OGCC 5K1XA 1N32O 2ZE8A 2UU9O 2X6BA 1IBMO 1JMKC 4CBCA 2XAHA 2EINB 2AW9A 3K03A 4CS4A 3PJSK 4QE7A 1VQOV 4MTXA 3UO2A 2OCCC 5IT9N 1NU1H 3E86A 3KCXA 2HR3A 4NXMO 1GMGA 4DR2B 2YEFA 2ZM6O 4YKWA 4DW0A 4JI4O 4CE2A 3T1KA 4QJFB 1H2MA 4CC5A 2YEVB 4WUBA 4DUZB 3JYCA 2UUCB 2ZKJA 4AWOA 4ASFA 3AG7A 1ZWHA 1GAXA 1VMGA 2VWKA 3CCJV 1THZA 1TVKA 1Q6HA 4I55A 4HYPA 2X0LA 4MP2A 2BU6A 5IYCO 3ZEDA 1P7GA 2Q0AA 2FKXA 3CMEV 3PN1A 2Q7GA 5IJ0A 1OCOB 2XJJA 1GN4A 2OIEA 3HPLC 3LNMB 1YETA 1OZ0A 2Z5UA 1YCIA 3TJTA 3RYHB 1ID0A 3K9AA 4O4IA 3JCUZ 4NXNO 4LC1A 4X64B 4LF7O 3X2QB 2HCHA 2HLDG 2ODMA 2HVKC 4DV3B 3IFXA 3MDSA 2IBZH 3WB0A 5M4NA 3G7EA 5BODA 3EHHA 1N0NA 4NH9A 1OV9A 5EZYA 5LP6B 1GTOA 1SERA 5KA6A 2P67A 4AWPA 1VIBA 4J11A 2VWCA 4CH3A 1R6KA 3CRCA 2Q8HA 3W7XA 1CP9A 1QR8A 5B1AB 2YKIA 4MT8A 3UM7A 3T4ZA 1MSWD 2WI6A 4NTYA 1L1FA 2EIKC 3FT8A 4ASAA 2GDSA 3HKBA 2JJ2G 1JVMA 3ASOC 3OR6C 1SA0B 2JK5C 1KECA 1KIJA 4LF9B 2EJRA 5CA0B 4YJ2A 4LWFA 4J42A 5JCOC 1PNLA 5C8YB 5D6QA 3E8GA 4N23A 2E74B 2UXBB 2DE0X 4JI6B 2XX5A 4JI0O 1JQ0A 3ABKB 1N34O 3NMQA 4DV6B 4P30A 4DR6B 4DR1O 4AHCA 3HKCA 1JPXA 1S77D 1BYQA 3ZMUA 1FJGB 2EBOA 4FM1A 3CX5F 1SQGA 1K9MW 3TXSA 4H13B 3JSLA 2YI0A 4EFBA 4HYMA 4MP7A 4CH4A 5JCOA 1GM9A 3WG7C 4G27B 2YEEA 4DYLA 4AQYB 1N33B 2QM4A 1UJWB 4DR4O 4DV5O 2C1GA 2XAGA 4TWKA 3VHDA 1UFIA 4TV8A 4QNHB 5BY1A 1I58A 4LPBA 1PL4A 2ATKC 3BA9A 1YHQV 2QFOA 2HJDA 3QNEA 1Y8NA 3GWOA 4LP8A 1VEWA 2GTSA 1E1RG 2HJFC 1H2SB 2IJJA 3JALB 2BREA 4TSFG 5LGUA 2PI5A 2KG7A 4H37A 4X1IA 2KSDA 2YIAA 4FLXA 4FVMA 4JI8O 1XHXA 3RN4A 2DJVA 2BRCA 1ZXNA 1BGQA 5JJEB 3I55V 1BGYH 5EYPB 5CA1B
chains in the Genus database with same CATH topology
4FJCC 2B1GA 4W7TA 4CWSA 4B7PA 3G71V 2VCJA 5B1OA 2EIMC 2DYRC 4R50A 4CWTA 1E79G 4RQFA 1SRYA 4XBFA 4WFAV 4Z1MG 4QPJA 1S72V 3E8BA 1BHBA 1QVGU 5LGTA 2XOKG 1UYIA 2H55A 2YE4A 5C93A 1NH2D 1UY9A 1H2GA 3SPJA 4GX1A 4R7CA 1NBMG 3T1CA 1Q86W 4EMVA 1Z5BA 2XDLA 3CPWU 2BU2A 2WLHA 3MNRP 1S16A 3ZM7A 3K3WA 1A4HA 3BMYA 2Q68A 5EBLC 4G2KA 5IDJA 3I56V 3K60A 4HZ0A 1UY8A 3JCZA 1BMFG 1QLEC 2ZDYA 1TC0A 4DZYA 4I9WA 3OMIB 3AG3B 4KQVA 1PL0A 1WLEA 3OUFA 2DWDC 1NHJA 4LBEC 2ZXWB 2IH3C 2YJWA 3LDEA 2DW4A 1JJ2U 4FMTA 5F5RA 1U0ZA 2QM8A 1GO3F 2JJ1G 3ETEA 3R65A 1Q81W 2HG1A 2ZDXA 3B26A 4HZ3A 3CGZA 1FXKC 4KP4A 4X9LA 3OE7G 3RW0A 3STZC 3U2DA 5L3BA 2YI6A 1Y4UA 4MVRA 4GEEA 4R6ZA 2XCMA 5GGZA 2GQPA 2EINC 5KUKA 5BOCA 3TETA 2OTLV 4RQEA 1KP3A 4XKKA 3LSQA 1OCRB 2QKSA 3VOUA 5FNDA 3MHSC 2XHRA 4P8OA 2IWSA 4FCQA 3FV5A 4KTNA 4CWFA 3SYAA 2EIJC 5LHHA 3A0TA 3H80A 1VQKV 4XKOA 2P6JA 4BXIA 2XNDG 5M4PA 1S14A 3SPCA 4H7QA 2YEVA 2YE5A 3PEJA 5L3CA 4L8ZA 3OR7C 4PA4A 4YXWG 4MTFA 1Y4MA 1YJ9V 2XHTA 2DYSB 1N8RW 4PU9A 3OEEG 4JYCA 3T10A 3R92A 1UYCA 2IWUA 5KUMA 2ZDIC 2FWYA 3A0ZA 5FNCA 2JIZG 4NH7A 2M7WA 1QBZA 1E1QG 5D7CA 2Y69C 4JQLA 5IYDO 3TZ2A 3ZN1A 3R4NA 4PDVA 5HFLA 3M99B 3AG2B 5B1AC 2W6JG 4P7AA 4FPPA 4UVAA 3VADA 2Q69A 1YITV 2ZDIA 3W7SA 1Z59A 1EFRG 1Q82W 3K99A 4HY1A 1J95A 2H94A 1U2OA 3CCVV 4BAEA 2EXLA 4RO2A 3TCUA 4E2LA 1H8HG 3ABKC 3K06A 3W7WA 4UVBA 2CG9A 1AR1B 3R91A 2O1VA 4CE3A 4UXNA 5EBMC 2XDSA 3ZRWB 3LNUA 5M4MA 2BYHA 4CWOA 3G75A 2YI7A 2ZBKB 4L94A 5IY5B 4LWHA 1FXVA 1MG1A 3G7BA 4O09A 4UROA 2WI7A 2LP7A 1DLBA 2YE2A 2XX4A 2XJGA 1L0OA 1K7DA 3ASNB 3EHJA 1XL6A 4LWGA 2DWEC 3CCEV 3E35A 4XE2A 3JD1A 4KSHA 1OCZC 2O1UA 2D3OW 4L87A 4FCPA 3KG2A 4MBCA 1BXDA 1R3IC 1EI1A 2KB1A 5L3JA 1UYDA 2A9HA 1NJIW 3K98A 3EKRA 4CWRA 2DQ0A 2FTKA 3FYEB 1V55B 4UV9A 2CK3G 4MVMA 3CC4V 2YK9A 2IWXA 4EEHA 4FIPC 1BL8A 4LP0A 3SYPA 1ORQC 3SPGA 1TC6A 4JGSA 1H38A 1US7A 2XJXA 4U7OA 3K79A 4PRXA 3FB5C 4B6CA 5M4EA 2BSMA 1UYGA 2A79B 1B63A 1I5YA 3O2FA 4N21A 3SPHA 5B3SC 1K4DC 4QPKA 4EGIA 4R3MA 4WUDA 4Q20A 2QG2A 3Q5JA 1VQ4V 4CZZA 4JPRA 4FK5C 1UYEA 3E8FA 2Q8FA 5FWKA 1I5AA 2YK2A 4QIWF 3QO7A 3ABLC 2OTJV 3T2SA 1R62A 5IN9A 2H8MA 2XX2A 2IH1C 3E2EA 4JTCB 1LNQA 2WLNA 2CCUA 3AEIA 3RLRA 3RVYA 1B6QA 2YGAA 1Z5AA 2EILB 2P90A 3NXSA 3ZCCA 4JTDB 2BOBC 3ABMB 2X6CA 4BAYA 3ZKDA 2WLIB 4RAIA 1K33A 4UUJC 3EHBB 2YE7A 4H85A 1AJNA 3TK1A 1M57B 3ETGA 5CTUA 5H6RA 3CCSV 4CE1A 3ZN0A 3QO8A 2IOQA 5DN6G 5CTXA 1QR9A 1XL4A 2Q67A 3T4DA 2YE9A 1M56C 1OHHG 3R4PA 3QDDA 2JEUA 5H6QA 4CWPA 5CA3A 3SYQA 4P9PA 3QTFA 1AJQA 3LUTB 4JASA 1S5HC 4PDMA 4MVOA 4LWIA 2DQ3A 4JTAB 3AG1C 3BM9A 1Y4SA 1Y8OA 2ZR3A 3E83A 3RKZA 3K0GA 2GHYA 1K97A 1PVGA 1V54C 1GKZA 1TILA 2WEPA 2H8PC 1THNA 4AS9A 4O07A 1OSFA 4WUCA 1K5SA 1K8AW 1VQ8V 5J9PC 5CPHA 1RM1C 2IJIA 5CMUA 1I5DA 3ZXOA 2HG5C 1JCHA 1GJVA 3FB6C 2XDKA 4XDLA 1M90W 2YKEA 2ZQMA 2WLMA 3JD4A 4XDMA 2JEXA 2WLLA 5L3FA 4BQJA 2IU3A 1YERA 3CWVA 4L93A 2YKJA 4KFMA 5D7DA 2X6AA 5BZBA 4YKZA 4PDLA 3Q5KA 1F4MA 2MK3A 1NR7A 2OCCB 1SESA 3OMAB 3K04A 2XDUA 3DGEA 2VW5A 1COWG 1NKDA 1DTOA 3T0HA 1JOYA 5KA5A 1YSCA 3FB8C 5E1AC 4URLA 2XAFA 3RBZA 3B27A 3JZ3A 1NR1A 5LGNA 1ENVA 2YEBA 5D7RA 1I5CA 1EA6A 4JAUA 4WFHA 1ZWIC 3OAAG 4H81A 1MOFA 1UYHA 2Z3YA 2LFSA 1S3JA 3W7TA 3A0YA 2BZ5A 1W0KG 2YEGA 2Q8IA 2XABA 3AG4C 2CH4A 3Q5LA 1AROP 5B1BC 3BEHA 3A0WA 4MPEA 2QG0A 3KE6A 2YEIA 2WLJA 3ABUA 3FB7C 4H33A 2FWZA 3HEKA 2YE6A 2QTOA 2EIKB 3B25A 4O0BA 3OWDA 3ASOB 1TUEB 3CCQV 5EC1C 3G4SV 3CC7V 1R3KC 3FT5A 4MOTA 4PL9A 4R3AA 2XDXA 3OM3B 4UV8A 3ETDA 2GSMB 2K1EA 1OCOC 3OEHG 5CBFA 3JD3A 4MS2A 1YC3A 4P2ZA 1VQMV 3X2QC 4EFUA 3EHFA 2IOPA 1Z5CA 1TH8A 2HFEC 2PNRA 3B24A 1NVPB 3OMUA 4WFEA 4RUEA 2IW5A 4P9OA 5HFMA 4FCRA 3R4OA 2Q6AA 3CCMV 1DF5A 4BIUA 4XC0A 3K08A 5F3KA 1VQPV 3HYZA 2X7RB 4BQGA 4EGKA 2HVJC 2EIMB 3ZMTA 2DYRB 2P7TC 2XK2A 3F7VC 3DTUB 4MW3A 4XDKA 3T0ZA 1AMWA 1AM1A 1JM6A 1MX0A 1Q7YW 1PNMA 4JYBA 3W7UA 3T2MA 1R3LC 3CD6V 2XAJA 4GQTA 4XCLA 4ASUG 5B1NA 4JAVA 1IXMA 3EKOA 3ZKBA 1H8EG 3SPIA 4YKQA 3ML0A 4PDRA 3SL2A 1M1KW 2EZPA 4KUMA 2QF6A 4BW5A 3MD0A 2XD6A 2JDIG 4EFTA 3CP1A 4ZKIA 1EBOA 2OT5A 3D3IA 1YTFB 3CMAV 2IJHA 1H7UA 1QLEB 2K5BA 3ZRSA 4YKXA 1JX9A 3CCLV 1KC8W 1TBWA 3U67A 1KZNA 3RLQA 4MPCA 3GIFA 4XCJA 2YGFA 2YE8A 4WFBV 1FFTB 3CXCU 3GIEA 3E8HA 4GFNA 2YECA 1KKDA 5M4KA 3TZ0A 1KD1W 3HYYA 2V7QG 5CTWA 2W0FC 5IDMA 2JKIA 1FXKB 4ZBMA 2WSSG 1MU5A 1KP2A 2C2AA 4PA3A 2WPDG 5GW7A 5CBGA 1HWYA 4OXSA 2QEXV 4WFFA 4X89A 2EZOA 1G8MA 3FKSG 5J71A 4X8AA 3EFFK 2CCTA 2BU5A 1W2BU 2R9IA 3O6OA 4L91A 3CC2V 4XKAA 1I5BA 1YT1A 3OW2U 2WI5A 3OUSA 2PI4A 3AG3C 4PA7A 4HXZA 2VCIA 3STLC 2AKPA 2F43G 2EIJB 1P4RA 2UXNA 3TUHA 2XHXA 1FXHA 3ABTA 2B5UA 2ITDC 2CCSA 3QO5A 2ZXWC 3E89A 2FXSA 1K73W 4X88A 2ZR2A 3K0DA 4GCZA 2AHZA 3CRKA 3GIGB 2HKJA 1QZRA 1AI7A 4XD8A 1K4CC 1R3JC 4RUFA 4MTOA 3OW6A 3B77A 4CWQA 1YC4A 2R9RB 1VQ9V 3TZ4A 2QE7G 3K97A 4E02A 3WHAA 2NNUA 1F4NA 1YJWV 1RPOA 2YKCA 3UKMA 2Y69B 2XAQA 1UY7A 1S76D 5CBHA 3IC7A 3HZ5A 4GX5A 5DM6V 1OCRC 1VQ7V 5CTYA 1EZJA 1S0VA 2JJCA 1UYMA 4MVUA 4ASGA 5L3EA 2YEDA 3R4MA 4E00A 2YEAA 1PD3A 2QM7A 1AH8A 4MPNA 1SETA 1TIDA 1GKFA 4HYOA 3A0RA 1GM8A 1VQ5V 4XIRA 2BT0A 1CPYA 1BKNA 2YI5A 3PEHA 3INWA 2UWDA 3JD0A 5CN0A 3ZRXA 1G4YB 3F5WC 4TT3G 1FS0G 4DUHA 2DYSC 4KFGA 4PA9A 4J9ZB 1MABG 3LPSA 4WFGA 4WF9V 2WWWA 5LHGA 4XIPA 1H7SA 4V25A 1OCZB 1QY8A 4YKUA 4XITA 1RPRA 3AG2C 5EC2C 1Y66A 1YS3A 2YSUB 3HB3B 2HKOA 1F51A 3ZMZA 4YKTA 1I59A 1YJNV 1UYKA 2YKBA 4PRVA 2YGEA 2UXXA 4I5SA 3VBBA 2YE3A 3O0IA 1AI6A 4URNA 3B8MA 2YEHA 2E0AA 5M4HA 5IY5C 3BY6A 1OCCB 2WAMA 1ZW9A 1NHHA 4HXWA 4BIZA 3U2KA 4KSGA 3IGAC 3ZRVA 1K3EA 3TZ5A 2IORA 3ZRWA 4MTGA 4ZVIA 4O05A 4EM7A 3ASNC 5B3SB 1B62A 4MB9A 1YIJV 4GX2A 1B3QA 3ZJZA 4J9YB 1YSRA 4MVZA 1DF4A 1YI2V 1NHIA 4ASBA 2IJKA 2Q8GA 3GB7C 4G28B 3ABLB 3D2RA 2Q2EB 2LFRA 1QCEA 1V55C 5EBWC 1NVPD 1WPXA 4HAMA 3SJQC 3ZXQA 2FYPA 1KQSU 3SYOA 5J6AA 2BU7A 3OWBA 1I5XA 5LBQA 3LDCA 3H4LA 1UYLA 1AJPA 2WERA 3P30A 2ZD9A 3F7YC 3MHHC 1AI5A 3VHCA 3LDDA 3P32A 3HZ1A 1NH2B 1FXKA 3C11A 4L90A 3ZIAG 2ESAA 3C0EA 3RVZA 4XIQA 3CGYA 4WCEV 4LWEA 4E01A 5LHIA 2IU0A 1UYFA 2NLJC 4V26A 4HY6A 4YKRA 3HHUA 3WG7B 4R1FA 3D36A 5H9CA 3WQ9A 1GK9A 3G6EV 1M56B 5L3DA 2W6IG 5IYBO 3OPDA 2YJXA 3B8NA 2GFDA 2WLKA 2CGFA 2BOCC 2WI4A 2BU8A 3CCUV 1AH6A 4U7NA 1QLNA 4JF3A 1VQ6V 4U93A 1ROPA 4EKWA 1CEZA 5D6PA 3CRLA 1GM7A 2EILC 1YTFD 5CF0A 4MSWC 2XASA 3D0BA 3INXA 3ABMC 5EK0A 3AG1B 4MVSA 3LSSA 3GIGA 3SYCA 1VQNV 1YT0A 4URMA 3FYIB 1R73A 1V54B 5L3GA 4HZ5A 3OMNB 1ZXMA 4PELA 1YESA 1M57C 4NH8A 2WEQA 2WLIA 1W0JG 1AJ6A 1P7BA 1F23A 1RM1B 4MW8A 1PKXA 2WLLB 3CYOA 4EGHA 1BHAA 2QA4V 2AHYA 3H01A 1R6NA 4R8CA 2BTZA 3ZMSA 4DXWA 4F4LA 3CCRV 4MVQA 1K5QA 1M9NA 2Y48A 4O04A 3WFVA 5FNFA 1NQTA 4CWNA 3EHGA 3IEDA 3VHAA 1PNKA 4XTJA 4GT1A 2BYIA 1AI4A 1UY6A 2V1DA 2WI3A 1Y8PA 2YEJA 4XDJA 2ITCC 3TTZA 4LCUC 3OFNG 1YC1A 3ZMVA 1QYEA 1GKXA 2WI2A 4AWQA 4DO2A 2A0LA 4YKYA 4I3HA 4K4OA 1K92A 2B1IA 2O1WA 1QVFU 4UVCA 5FL7G 1VQLV 1YSZA 4GGLA 4GX0A 1YT2A 4GT8A 4PA6A 3JD2A 3AG4B 4QE9A 3B28A 1SZTA 5B1BB 1K34A 2WI1A 1OCCC 3A0XA 3RLPA 3OGCC 2X6BA 4CBCA 2XAHA 2EINB 3K03A 3PJSK 4QE7A 1VQOV 4MTXA 2OCCC 3E86A 2HR3A 1GMGA 2YEFA 4YKWA 4CE2A 3T1KA 4QJFB 2YEVB 4WUBA 3JYCA 2ZKJA 4AWOA 4ASFA 1ZWHA 3CCJV 1THZA 4HYPA 2X0LA 4MP2A 2BU6A 5IYCO 3CMEV 1OCOB 2XJJA 3HPLC 3LNMB 1YETA 1OZ0A 2Z5UA 1ID0A 3K9AA 4LC1A 3X2QB 2HCHA 2HLDG 2HVKC 3IFXA 5M4NA 3G7EA 5BODA 3EHHA 4NH9A 1GTOA 1SERA 5KA6A 2P67A 4AWPA 2VWCA 1R6KA 2Q8HA 3W7XA 1CP9A 1QR8A 5B1AB 2YKIA 4MT8A 3UM7A 3T4ZA 1MSWD 2WI6A 1L1FA 2EIKC 3FT8A 4ASAA 2JJ2G 1JVMA 3ASOC 3OR6C 2JK5C 1KECA 1KIJA 2EJRA 4LWFA 1PNLA 5D6QA 3E8GA 4N23A 3NMQA 2XX5A 1JQ0A 3ABKB 4P30A 1JPXA 1S77D 1BYQA 3ZMUA 2EBOA 1K9MW 2YI0A 4HYMA 4MP7A 1GM9A 3WG7C 4G27B 2YEEA 1UJWB 2XAGA 4TWKA 3VHDA 4QNHB 1I58A 4LPBA 2ATKC 2QFOA 1YHQV 3QNEA 1Y8NA 3GWOA 4LP8A 1E1RG 2HJFC 2IJJA 2BREA 4TSFG 5LGUA 2PI5A 4H37A 2BRCA 1ZXNA 1BGQA 3I55V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZKB A;  3VHC A;  4W7T A;  4CWS A;  3P32 A;  2H8M A;  4B7P A;  3HZ1 A;  2XX2 A;  4YKQ A;  2VCJ A;  3C11 A;  2CCU A;  5B1O A;  3SL2 A;  4L90 A;  2QF6 A;  2ESA A;  3RLR A;  4CWT A;  3C0E A;  3MD0 A;  2XD6 A;  4XIQ A;  3CGY A;  2YGA A;  1Z5A A;  4LWE A;  4E01 A;  3NXS A;  3ZCC A;  4EFT A;  1UYF A;  4QPJ A;  4ZKI A;  4V26 A;  4HY6 A;  4YKR A;  3HHU A;  3ZKD A;  1UYI A;  2H55 A;  1H7U A;  2K5B A;  2YE4 A;  4R1F A;  3D36 A;  5C93 A;  1UY9 A;  3WQ9 A;  4YKX A;  3OPD A;  2YJX A;  4EMV A;  1Z5B A;  1TBW A;  3U67 A;  1KZN A;  2GFD A;  2CGF A;  2XDL A;  2WI4 A;  2BU8 A;  1AH6 A;  4U7N A;  3RLQ A;  4U93 A;  4MPC A;  2YE7 A;  4H85 A;  3GIF A;  4XCJ A;  2BU2 A;  3TK1 A;  2YGF A;  5D6P A;  2YE8 A;  3CRL A;  3GIE A;  3MNR P;  4GFN A;  1S16 A;  2YEC A;  3ZM7 A;  5CTU A;  1A4H A;  3BMY A;  5M4K A;  3TZ0 A;  5CF0 A;  3HYY A;  5IDJ A;  4CE1 A;  3K60 A;  4HZ0 A;  1UY8 A;  3D0B A;  3INX A;  5CTW A;  5IDM A;  2JKI A;  2IOQ A;  1MU5 A;  2C2A A;  2ZDY A;  1TC0 A;  3GIG A;  5CTX A;  4DZY A;  4KQV A;  1YT0 A;  2YE9 A;  4URM A;  3R4P A;  4HZ5 A;  1NHJ A;  1ZXM A;  3QDD A;  1YES A;  4CWP A;  2YJW A;  4NH8 A;  2WEQ A;  5J71 A;  3QTF A;  4FMT A;  1AJ6 A;  5F5R A;  4JAS A;  1U0Z A;  2QM8 A;  2CCT A;  2BU5 A;  3O6O A;  2HG1 A;  2ZDX A;  4L91 A;  4LWI A;  3B26 A;  3CGZ A;  4XKA A;  4EGH A;  4KP4 A;  4X9L A;  3BM9 A;  1I5B A;  1Y4S A;  1YT1 A;  1Y8O A;  2WI5 A;  3RKZ A;  4HXZ A;  3U2D A;  2VCI A;  2AKP A;  2YI6 A;  1PVG A;  2BTZ A;  1GKZ A;  1Y4U A;  1TIL A;  3TUH A;  2WEP A;  4GEE A;  4O04 A;  1THN A;  2XHX A;  4AS9 A;  5FNF A;  2CCS A;  4O07 A;  1OSF A;  4WUC A;  2XCM A;  2FXS A;  4CWN A;  5GGZ A;  2GQP A;  4GCZ A;  5BOC A;  3EHG A;  3IED A;  3VHA A;  4XKK A;  5CPH A;  3CRK A;  3GIG B;  4XTJ A;  4GT1 A;  2BYI A;  2HKJ A;  1QZR A;  5FND A;  4XD8 A;  1I5D A;  3ZXO A;  3OW6 A;  1GJV A;  2XHR A;  4CWQ A;  1UY6 A;  1YC4 A;  2WI3 A;  3TZ4 A;  4P8O A;  1Y8P A;  2IWS A;  2XDK A;  4FCQ A;  2YEJ A;  3K97 A;  4E02 A;  3FV5 A;  4KTN A;  3WHA A;  4CWF A;  3TTZ A;  2YKE A;  3A0T A;  1YC1 A;  2YKC A;  3H80 A;  4XDM A;  1UY7 A;  1QYE A;  4XKO A;  4BXI A;  1GKX A;  5M4P A;  2WI2 A;  4BQJ A;  4AWQ A;  1S14 A;  4YKY A;  4I3H A;  1YER A;  3HZ5 A;  3CWV A;  4H7Q A;  4K4O A;  4L93 A;  2YE5 A;  2YKJ A;  3PEJ A;  5D7D A;  2O1W A;  4YKZ A;  3Q5K A;  4L8Z A;  5CTY A;  2JJC A;  1UYM A;  1YSZ A;  4GGL A;  4ASG A;  2XDU A;  3DGE A;  2VW5 A;  2YED A;  2XHT A;  3R4M A;  4E00 A;  2YEA A;  1YT2 A;  1AH8 A;  2QM7 A;  4MPN A;  4GT8 A;  4PU9 A;  3T10 A;  4JYC A;  1TID A;  3R92 A;  1UYC A;  3B28 A;  2IWU A;  2FWY A;  3A0Z A;  5FNC A;  4NH7 A;  3T0H A;  1JOY A;  3A0R A;  4URL A;  5D7C A;  4JQL A;  2WI1 A;  3B27 A;  3JZ3 A;  4XIR A;  3TZ2 A;  2BT0 A;  3R4N A;  3A0X A;  3RLP A;  1BKN A;  2YI5 A;  2YEB A;  3PEH A;  4P7A A;  4FPP A;  5D7R A;  1I5C A;  1EA6 A;  3INW A;  4JAU A;  3VAD A;  2UWD A;  1Z59 A;  3K99 A;  3ZRX A;  4H81 A;  4MTX A;  4HY1 A;  1UYH A;  1U2O A;  4BAE A;  4DUH A;  2EXL A;  2LFS A;  3A0Y A;  4KFG A;  2YEF A;  4YKW A;  2BZ5 A;  2YEG A;  2Q8I A;  2XAB A;  2CH4 A;  4CE2 A;  3T1K A;  3LPS A;  3Q5L A;  2CG9 A;  4WUB A;  2WWW A;  3R91 A;  2O1V A;  4CE3 A;  3A0W A;  2ZKJ A;  4XIP A;  4AWO A;  4MPE A;  2QG0 A;  1H7S A;  4V25 A;  1QY8 A;  1ZWH A;  4YKU A;  3KE6 A;  2XDS A;  2YEI A;  4XIT A;  4ASF A;  3ZRW B;  3LNU A;  5M4M A;  2BYH A;  4CWO A;  3G75 A;  4HYP A;  1YS3 A;  4MP2 A;  2BU6 A;  2YI7 A;  2ZBK B;  4L94 A;  1F51 A;  4LWH A;  4YKT A;  2FWZ A;  3HEK A;  2YE6 A;  3G7B A;  4O09 A;  2XJJ A;  4URO A;  2WI7 A;  3B25 A;  1I59 A;  4O0B A;  1UYK A;  2YE2 A;  1YET A;  2XX4 A;  2XJG A;  1L0O A;  2YKB A;  3OWD A;  1ID0 A;  4PRV A;  2YGE A;  4LC1 A;  4I5S A;  2HCH A;  2YE3 A;  3EHJ A;  3FT5 A;  4LWG A;  3O0I A;  4URN A;  5M4N A;  4MOT A;  3G7E A;  5BOD A;  4XE2 A;  4PL9 A;  4KSH A;  2O1U A;  3EHH A;  4R3A A;  4NH9 A;  2YEH A;  2E0A A;  2XDX A;  4FCP A;  4MBC A;  2P67 A;  4AWP A;  1BXD A;  1EI1 A;  2VWC A;  5M4H A;  2Q8H A;  5L3J A;  2YKI A;  1UYD A;  4MT8 A;  1ZW9 A;  1NHH A;  4HXW A;  4BIZ A;  2WI6 A;  3FT8 A;  4ASA A;  3K98 A;  3U2K A;  3EKR A;  4KSG A;  3ZRV A;  3TZ5 A;  4CWR A;  2FTK A;  1KIJ A;  2IOR A;  1YC3 A;  3ZRW A;  4ZVI A;  4O05 A;  4EM7 A;  4LWF A;  4EFU A;  5D6Q A;  3EHF A;  2IOP A;  2YK9 A;  2IWX A;  4EEH A;  1Z5C A;  1B62 A;  1TH8 A;  3NMQ A;  2XX5 A;  4MB9 A;  4LP0 A;  2PNR A;  3B24 A;  3OMU A;  1BYQ A;  1TC6 A;  1B3Q A;  4FCR A;  1US7 A;  2YI0 A;  4HYM A;  3R4O A;  4MP7 A;  1YSR A;  1NHI A;  4BIU A;  4ASB A;  4XC0 A;  2XJX A;  4U7O A;  2Q8G A;  4PRX A;  2YEE A;  4B6C A;  5M4E A;  2BSM A;  5F3K A;  1UYG A;  3D2R A;  3HYZ A;  1B63 A;  2Q2E B;  2LFR A;  3O2F A;  3VHD A;  4BQG A;  4EGK A;  1I58 A;  4LPB A;  4QPK A;  2QFO A;  3ZXQ A;  2FYP A;  1Y8N A;  4EGI A;  5J6A A;  4R3M A;  4WUD A;  2BU7 A;  4Q20 A;  2QG2 A;  3OWB A;  3Q5J A;  1UYE A;  2XK2 A;  2BRE A;  3H4L A;  2Q8F A;  3T0Z A;  1AMW A;  5FWK A;  1AM1 A;  1JM6 A;  1I5A A;  1MX0 A;  2YK2 A;  4JYB A;  1UYL A;  2WER A;  2BRC A;  1ZXN A;  1BGQ A;  4GQT A;  4XCL A;  5B1N A;  3T2S A;  4JAV A;  1R62 A;  1IXM A;  5IN9 A;  3EKO A; 
#chains in the Genus database with same CATH topology
 4FJC C;  2B1G A;  4W7T A;  4CWS A;  5IJ9 A;  3G71 V;  3T1Y B;  1AP6 A;  4B7P A;  1YDX A;  2VCJ A;  5B1O A;  2EIM C;  2DYR C;  4R50 A;  1U97 A;  1G1X B;  4CWT A;  3VQW A;  1E79 G;  1AVM A;  4RQF A;  1SRY A;  3K5M A;  4XBF A;  1Q43 A;  4WFA V;  4Z1M G;  1XNR O;  4QPJ A;  1S72 V;  3E8B A;  1BHB A;  4DV1 B;  1QVG U;  5LGT A;  3H1K H;  2PYL A;  2Y0I A;  2XOK G;  1UYI A;  2H55 A;  1Y76 B;  2YE4 A;  5C93 A;  1NH2 D;  1UY9 A;  1H2G A;  3SPJ A;  2L6L A;  4GX1 A;  4R7C A;  4J41 A;  1NBM G;  3T1C A;  4O4H B;  4ABM A;  5IYZ A;  1Q86 W;  4KXR A;  4EMV A;  5FNV A;  3DXR B;  4NVP A;  1Z5B A;  2XDL A;  3CPW U;  5DEC A;  2VQF O;  1PPJ H;  4O2A B;  2BU2 A;  2QWP B;  3CE2 A;  2WLH A;  4FFB A;  3MNR P;  1WNS A;  5JEN A;  3JAR A;  1S16 A;  3ZM7 A;  3U0Z A;  3K3W A;  1A4H A;  3BMY A;  2Q68 A;  5EBL C;  4G2K A;  1M4U A;  5IDJ A;  3I56 V;  4DV0 B;  3K60 A;  4HZ0 A;  1UY8 A;  3JAT A;  3JCZ A;  1BMF G;  1JFF A;  1QLE C;  2CAZ C;  4I0X A;  2ZDY A;  1TC0 A;  3QG5 A;  4DZY A;  4I9W A;  3TXQ A;  3OMI B;  3AG3 B;  1HP8 A;  4KQV A;  5BMV B;  1PL0 A;  4J7J A;  1WLE A;  4X66 O;  1Z5W A;  3OUF A;  4LH6 A;  2DWD C;  2KQX A;  1NHJ A;  4H0L B;  3CS5 A;  3IJ4 A;  4LBE C;  4RWU A;  4X62 B;  1WB8 A;  2ZXW B;  2IH3 C;  2YJW A;  3LDE A;  2DW4 A;  1JJ2 U;  4FMT A;  1MA1 A;  5KMG B;  5F5R A;  1U0Z A;  1S5J A;  1DGS A;  1GO3 F;  2QM8 A;  2JJ1 G;  3ETE A;  1D5A A;  3R65 A;  1Q81 W;  4B3M B;  2HG1 A;  2ZDX A;  1WPB A;  1M5I A;  3DC6 A;  2YC0 A;  3B26 A;  2YXY A;  4HZ3 A;  4B3R O;  3CGZ A;  1FXK C;  2Q7E A;  4KP4 A;  4X9L A;  3OE7 G;  3RW0 A;  3STZ C;  2RJZ A;  4KL1 A;  3U2D A;  5L3B A;  2YI6 A;  4J10 A;  5GON B;  5E79 Z;  1Y4U A;  4MVR A;  4GEE A;  4DR3 B;  2JGU A;  2PGG A;  4R6Z A;  3G80 A;  1NI8 A;  4ZIB A;  2XCM A;  5GGZ A;  2GQP A;  1H2K A;  3APO A;  2EIN C;  5KUK A;  5BOC A;  2V4D A;  3TET A;  2OTL V;  3D36 C;  1KP3 A;  4RQE A;  4XKK A;  1P49 A;  4NR1 A;  3LSQ A;  4WBN B;  1OCR B;  2QKS A;  4LFB B;  1XHZ A;  3E22 B;  2GUZ A;  3BA8 A;  3VOU A;  5FND A;  1PP9 H;  3MHS C;  2XHR A;  2ZCE A;  2CUG A;  4ZHQ B;  4X1K B;  3BCC H;  4P8O A;  4E4E A;  2IWS A;  4FCQ A;  2E5L O;  4LF5 O;  3FV5 A;  4KTN A;  4CWF A;  3SYA A;  2EIJ C;  5LHH A;  4B3T O;  3A0T A;  3H80 A;  1VQK V;  4XKO A;  4UCV A;  2P6J A;  4BXI A;  2XND G;  5M4P A;  2YIC A;  3ZX6 A;  1S14 A;  3SPC A;  4H7Q A;  2YEV A;  2YE5 A;  3PEJ A;  5L3C A;  4CH6 A;  5BR8 B;  3Q4H B;  4L8Z A;  1FD9 A;  3OR7 C;  3CYG A;  3L72 H;  3JSN A;  4JI3 O;  1ZUQ A;  4PA4 A;  1IXB A;  2HEP A;  4YXW G;  1O9H A;  4MTF A;  1Y4M A;  1YJ9 V;  2XHT A;  3FAV B;  2DYS B;  1N8R W;  4IHJ A;  4PU9 A;  3OEE G;  2ZE5 A;  4JYC A;  4JYA O;  4TQF A;  3T10 A;  2RN9 A;  3R92 A;  1UYC A;  4DV4 B;  2IWU A;  5KUM A;  1WA8 B;  2ZDI C;  2FWY A;  3A0Z A;  5FNC A;  2JIZ G;  4NH7 A;  2M7W A;  1QBZ A;  1Q8I A;  1E1Q G;  2F95 B;  4CS2 A;  5D7C A;  2Y69 C;  4JQL A;  3RYH A;  5IYD O;  3TZ2 A;  3ZN1 A;  3R4N A;  4DR7 B;  4PDV A;  5HFL A;  3EXA A;  3M99 B;  3AG2 B;  5B1A C;  1MZE A;  2W6J G;  4P7A A;  4FPP A;  1BQ0 A;  4UVA A;  3VAD A;  2MW2 B;  2Q69 A;  1YIT V;  2ZDI A;  3W7S A;  1Z59 A;  3B40 A;  1EFR G;  2QR4 A;  1Q82 W;  5LP6 A;  3LSU A;  3K99 A;  2LGW A;  4GKK O;  2LO1 A;  4HY1 A;  1J95 A;  2H94 A;  1U2O A;  3CCV V;  4BAE A;  2EXL A;  4RO2 A;  3N27 A;  3RT3 C;  3TCU A;  2UXD B;  5FLX N;  2RMK B;  4LFC O;  4E2L A;  3D8C A;  1H8H G;  2E75 B;  3ABK C;  3K06 A;  3UT5 B;  3W7W A;  2UUB O;  4UVB A;  2P06 A;  4IYI A;  2CG9 A;  1AR1 B;  3R91 A;  2O1V A;  4CE3 A;  1QHT A;  4NTX A;  4UXN A;  2BTQ A;  1SA0 A;  1QQC A;  5EBM C;  2XDS A;  4C7U A;  3JAW B;  4B7E A;  5CA0 A;  3ZRW B;  1FKA O;  3LNU A;  3K9S A;  5M4M A;  5C8Y A;  2BYH A;  4CWO A;  3G75 A;  2YI7 A;  2Q7H A;  2ZBK B;  4L94 A;  5IY5 B;  4LWH A;  2F23 A;  1FXV A;  2L35 A;  3P3N A;  1MG1 A;  3G7B A;  5IWA B;  4O09 A;  4URO A;  1Y67 A;  2RQ6 A;  2YID A;  2WI7 A;  2LP7 A;  4FZ0 A;  2Q73 A;  1DLB A;  4TV9 B;  3SJB C;  2YE2 A;  2XX4 A;  2XJG A;  1L0O A;  3A2F A;  5J2U A;  3RYF B;  1WP7 A;  4I50 B;  1K7D A;  4DR5 O;  3ASN B;  3EHJ A;  1XL6 A;  4LWG A;  2DWE C;  3CCE V;  3E35 A;  4F6E A;  4LF4 B;  1KU9 A;  4I4T B;  4XE2 A;  3JD1 A;  4KSH A;  1OCZ C;  2O1U A;  2D3O W;  4L87 A;  1N36 O;  1YVW A;  1NS1 A;  4FCP A;  2OYQ A;  1MSD A;  3B2E E;  3KG2 A;  4DV2 O;  1ZAU A;  4MBC A;  1YXB A;  3HKE B;  1BXD A;  1GN2 A;  3A0H Z;  4B3S B;  2CGN A;  1R3I C;  1EI1 A;  1L0N H;  5LXT B;  2E76 B;  3M8A A;  2KB1 A;  5L3J A;  1AP5 A;  3JAM N;  1UYD A;  2JS3 A;  2A9H A;  1NJI W;  2ZNI A;  3K98 A;  3EKR A;  4JI1 B;  3JAL A;  3H1J H;  3C90 A;  4CWR A;  2DQ0 A;  2FTK A;  3LNN A;  4OX9 O;  3FYE B;  1V55 B;  4UV9 A;  2CK3 G;  4MVM A;  3CC4 V;  2LQT A;  5KHJ A;  1XIL A;  2IWX A;  2YK9 A;  4EEH A;  1N4C A;  4FIP C;  1BL8 A;  5FPO A;  5IE9 A;  4LP0 A;  3SYP A;  1ORQ C;  1KUQ A;  2K9P A;  3SPG A;  3T1H O;  4LR3 A;  1TC6 A;  3CRA A;  1QNM A;  4JGS A;  1H38 A;  1US7 A;  2EUL A;  4I7Z B;  1US6 A;  4QGP A;  4FM2 A;  2G38 A;  4JI2 O;  2XJX A;  4U7O A;  4JI7 B;  3K79 A;  4PRX A;  3FB5 C;  4B6C A;  5M4E A;  2BSM A;  1UYG A;  2A79 B;  1B63 A;  1I5Y A;  1BCC H;  3RYC A;  3O2F A;  5KX5 B;  4N21 A;  3SPH A;  5B3S C;  1K4D C;  3B09 A;  2YI9 A;  4B7K A;  4QPK A;  4X20 B;  1SQP H;  3BFR A;  4EGI A;  4LNU B;  4R3M A;  1MNG A;  4WUD A;  3ZHR A;  4Q20 A;  2QG2 A;  1IBL B;  4PHZ A;  3Q5J A;  3KCY A;  1VQ4 V;  4CZZ A;  4JPR A;  1GH6 A;  4FK5 C;  2XT9 A;  1UYE A;  3E8F A;  3DXR A;  1FFX A;  4DUY B;  2Q8F A;  5FWK A;  1RSO B;  1I5A A;  2Q5Z A;  5LMN B;  2Y4U A;  2YK2 A;  1S5L Z;  1DK1 A;  4O2A A;  3QO7 A;  4QIW F;  1I94 B;  3L9D A;  3L71 H;  4EB6 B;  3ABL C;  4OPA A;  2OTJ V;  3T2S A;  1R62 A;  4YJ3 B;  5IN9 A;  4UCT A;  2H8M A;  1N32 B;  2XX2 A;  2IH1 C;  3K57 A;  1IBM B;  3E2E A;  1LUW A;  4JTC B;  1LNQ A;  2WLN A;  2CCU A;  2GTA A;  4K35 A;  3MAQ A;  3AEI A;  3ZHU A;  4JV5 B;  2P5O A;  3RLR A;  1Q5O A;  2YI8 A;  3RVY A;  1VAR A;  4JI6 O;  1B6Q A;  2YGA A;  1Z5A A;  5BMV A;  3SGI A;  3H1L H;  2EIL B;  2P90 A;  3NXS A;  3ZCC A;  4NXM B;  3M7M X;  2N74 A;  2BCC H;  2ZM6 B;  1HR0 O;  2R70 A;  4JI4 B;  4JTD B;  2BOB C;  3ABM B;  2X6C A;  1BQZ A;  4UB8 Z;  4BAY A;  1XMQ O;  3ZKD A;  2CTW A;  2WLI B;  5KMG A;  3BAA A;  4ZI7 A;  4RAI A;  1QU7 A;  4AQY O;  1WN7 A;  1K33 A;  4UUJ C;  3EHB B;  2YE7 A;  4H85 A;  2OWO A;  2QWQ B;  1AJN A;  3TK1 A;  1M57 B;  2QDO A;  3ETG A;  5GON A;  5CTU A;  1ZL8 B;  5H6R A;  4NXN B;  4LF7 B;  2ZNJ A;  3CCS V;  4CE1 A;  4AIL C;  3ZN0 A;  3QO8 A;  2IOQ A;  4D6T H;  1SZX A;  5DN6 G;  4LWS A;  3FX7 A;  5CTX A;  4WBN A;  1QR9 A;  1XL4 A;  5LMU O;  2Q67 A;  3E22 A;  3T4D A;  1I08 A;  1M56 C;  2YE9 A;  1I0H A;  4AI8 A;  1OHH G;  3R4P A;  1XMO B;  1HDJ A;  2O57 A;  3QDD A;  2JEU A;  5H6Q A;  4CWP A;  5CA3 A;  4IL6 Z;  3SYQ A;  4P9P A;  2P4K A;  3QTF A;  1AJQ A;  3LUT B;  4X1Y B;  4JAS A;  3ZHQ A;  1S5H C;  5F2V O;  3J81 N;  4PDM A;  4MVO A;  4LWI A;  5K1P A;  2DQ3 A;  5A2Q N;  4JTA B;  3AG1 C;  3BM9 A;  1Y4S A;  4UCR A;  4JI0 B;  3OT7 A;  1N34 B;  3S3X A;  3R66 A;  1IUR A;  1Y8O A;  2ZR3 A;  3E83 A;  2VS0 A;  3RKZ A;  3K0G A;  4DV1 O;  1VF7 A;  4CS3 A;  4Z2W A;  2GHY A;  1K97 A;  2XHB A;  3KKY A;  1PVG A;  2UXC O;  1V54 C;  3FD9 A;  1GKZ A;  4FFK A;  3K58 A;  1TIL A;  2WEP A;  1Q6I A;  4YHH B;  2H8P C;  1THN A;  1FPO A;  4AS9 A;  1WAZ A;  1NT2 B;  3FAV A;  4O07 A;  1OSF A;  4WUC A;  1K5S A;  1HNZ O;  1K8A W;  5JJJ B;  3N2G B;  4DR4 B;  1VQ8 V;  5J9P C;  4DV5 B;  5CPH A;  4O4J B;  2ZIM A;  1RM1 C;  2IJI A;  4JZ2 A;  2YXH A;  1Y74 A;  5CMU A;  1I5D A;  3ZXO A;  2HG5 C;  4D7T A;  4J80 A;  1SC5 B;  5LYJ B;  1D5N A;  4DV0 O;  1JCH A;  1GJV A;  3ZHS A;  2Q0O C;  1X4T A;  2GV9 A;  3FB6 C;  3F5T A;  3SJC C;  2XDK A;  3OGI B;  1F7Y A;  4K0K O;  2N05 A;  4XDL A;  1M90 W;  2EX3 A;  2YKE A;  2ZQM A;  2WLM A;  3JD4 A;  4XDM A;  2JEX A;  2WLL A;  4JI8 B;  5L3F A;  2Y4T A;  4TUY B;  4BQJ A;  5J2T B;  2IU3 A;  1YER A;  3CWV A;  4L93 A;  2YKJ A;  4KFM A;  2A7W A;  2YIB D;  1SQX H;  5D7D A;  1H2N A;  2X6A A;  3CJH A;  5BZB A;  4YKZ A;  4PDL A;  3Q5K A;  1F4M A;  4BR6 A;  2MK3 A;  4FLT A;  1NR7 A;  2OCC B;  1SES A;  3OMA B;  3K04 A;  2XDU A;  4B3M O;  3DGE A;  4GLX A;  2VW5 A;  5JWP A;  1COW G;  1NKD A;  3QVN A;  3WB1 A;  1DTO A;  1RFY A;  4LH7 A;  3T0H A;  1JOY A;  5KA5 A;  1YSC A;  4TV9 A;  1XNR B;  3FB8 C;  1VF6 C;  5E1A C;  5B66 Z;  4URL A;  2ETN A;  2XAF A;  3RBZ A;  1SQQ H;  3B27 A;  2CTQ A;  5H2F Z;  1NR1 A;  3RYF A;  3JZ3 A;  4O4I B;  4BIO A;  5LGN A;  3J7A U;  3OTO O;  1ENV A;  2YEB A;  1AR5 A;  4KHP O;  5D7R A;  1I5C A;  1EA6 A;  4JAU A;  4WFH A;  1ZWI C;  1Q90 D;  3OAA G;  2UUA O;  4H81 A;  1VF6 A;  5EZY B;  1MOF A;  1IX9 A;  1UYH A;  3HKE A;  2Z3Y A;  1AR4 A;  1KYO F;  5JQG B;  2RCV A;  2LFS A;  1S3J A;  2VQF B;  5LXT A;  3W7T A;  3A0Y A;  2BZ5 A;  1W0K G;  2YEG A;  2M6Y A;  2XAB A;  2Q8I A;  1JJO A;  3AG4 C;  2CH4 A;  3KZI Z;  3Q5L A;  3N2K B;  1ARO P;  5B1B C;  3BEH A;  1BE3 H;  1NTK H;  3A0W A;  4MPE A;  2QG0 A;  5KAF Z;  2YEI A;  3KE6 A;  5CB4 B;  3VQY A;  2ZE6 A;  5BXZ A;  2WLJ A;  4TQD A;  2EJ7 A;  1NZ6 A;  4YJ2 B;  1HNW B;  1W59 A;  5TIS Z;  3ABU A;  3FB7 C;  4H33 A;  2FWZ A;  2P22 C;  2CDY A;  2YE6 A;  3O65 A;  2QTO A;  3HEK A;  2EIK B;  2BE3 A;  3BAB A;  2JVD A;  4X66 B;  1XUQ A;  3B25 A;  3U10 A;  1J5E O;  4O0B A;  3OWD A;  1U96 A;  3ASO B;  1TUE B;  3CCQ V;  5EC1 C;  3G4S V;  1ZTE A;  3CC7 V;  1R3K C;  3FT5 A;  2OCH A;  4MOT A;  3CWB H;  4PL9 A;  4F6R B;  4R3A A;  4HBN A;  3IAY A;  3P3P A;  1TAE A;  3OM3 B;  4JI5 B;  5KX5 A;  2XDX A;  4B3R B;  1XDC A;  3I5D A;  4UV8 A;  4W4K A;  2BSK B;  2D2C B;  4GKJ O;  4X20 A;  1Q3E A;  3ETD A;  2GSM B;  2K1E A;  1SQB H;  1OCO C;  4UB6 Z;  3RYI B;  3CRQ A;  3OEH G;  4D7S A;  5LL6 Y;  2LGQ A;  4LF6 O;  1ZSP A;  5CBF A;  3JD3 A;  4MS2 A;  4LFA O;  1YC3 A;  4P2Z A;  1RSO A;  1VQM V;  3X2Q C;  4U3F H;  3ZHV A;  4EFU A;  3WB2 A;  3EHF A;  2IOP A;  1SF9 A;  2ZT9 B;  1Z5C A;  2NR5 A;  3ICX A;  4Q6G A;  4EB6 A;  1TH8 A;  1HNX O;  2HFE C;  2PNR A;  3B24 A;  1NVP B;  5LP6 C;  3OMU A;  1LUV A;  4WFE A;  2HP8 A;  2IW5 A;  4RUE A;  2GBO A;  4P9O A;  5HFM A;  4FCR A;  2ILM A;  4FLZ A;  2CTR A;  3R4O A;  1A32 A;  2Q6A A;  5IJ9 B;  2P4V A;  3CCM V;  1DF5 A;  2HHI A;  4BIU A;  4LF5 B;  2Q8V A;  4XC0 A;  3K5N A;  3K08 A;  4B3T B;  5F3K A;  1VQP V;  3HYZ A;  2CGO A;  4YIP A;  2YS8 A;  2X7R B;  4NTW A;  5EIB D;  2F66 C;  2OIG A;  2WA3 A;  4EFE A;  4BQG A;  4EGK A;  4CC6 A;  2QKA A;  2HVJ C;  1D2D A;  1XNQ O;  2PF4 E;  2EIM B;  3ZMT A;  2QJ1 A;  4DK0 A;  2DYR B;  2P7T C;  4LF4 O;  2XK2 A;  1P84 F;  3F7V C;  3DTU B;  2QWO B;  4GUN A;  4MW3 A;  4XDK A;  5IYZ B;  3T0Z A;  1AMW A;  1AM1 A;  1JM6 A;  5FNV B;  2PYJ A;  2A06 H;  1XQ8 A;  1Q7Y W;  2F4V O;  4JYA B;  1MX0 A;  1PNM A;  4JYB A;  3W7U A;  3T2M A;  1FYJ A;  1R3L C;  3CD6 V;  2XAJ A;  4GQT A;  4XCL A;  3HKD B;  4ASU G;  3JAK B;  5B1N A;  4JAV A;  1ZL8 A;  1IXM A;  2HHH O;  3EKO A;  2ZIN A;  2N04 A;  3CSX A;  3JAR B;  4DV7 O;  3ZKB A;  1H8E G;  4JI1 O;  4X9Q A;  3GWK C;  1FAF A;  3SPI A;  3BVO A;  4DRX B;  4YKQ A;  3EVK A;  3J80 N;  1IVS A;  3ML0 A;  4PDR A;  3SL2 A;  1M1K W;  2EZP A;  4KUM A;  2QF6 A;  4DW1 A;  4BW5 A;  1IBK B;  3MD0 A;  4GKK B;  2XD6 A;  2Z0A A;  4JYY A;  3JAS B;  2JDI G;  4EFT A;  3CP1 A;  4K8X A;  4ZKI A;  1EBO A;  4PJ0 Z;  4LFC B;  2OT5 A;  3D3I A;  2UUB B;  1YTF B;  3CMA V;  2IJH A;  1H7U A;  1QLE B;  2K5B A;  1V9P A;  2ADP A;  4K8Z A;  3S5T A;  3ZRS A;  4B08 A;  4YKX A;  5GTH Z;  3DSQ A;  1TA8 A;  2PY5 A;  1JX9 A;  5AG2 A;  3CCL V;  3CRR A;  2JGD B;  3CHX A;  2RDC A;  4UCS A;  1KC8 W;  1KZN A;  1TBW A;  3U67 A;  2VQE B;  3RLQ A;  4MPC A;  3GIF A;  4XCJ A;  4DR2 O;  2YGF A;  2YE8 A;  5EYP A;  4WFB V;  1FFT B;  3CXC U;  3GIE A;  5CA1 A;  3E8H A;  4GFN A;  2YEC A;  1KKD A;  3C3S A;  5M4K A;  2Q9L A;  4DUZ O;  3TZ0 A;  1KD1 W;  3HYY A;  2UUC O;  2V7Q G;  4DR5 B;  4J7Z A;  4NYK A;  3K59 A;  5ITZ B;  1R6T A;  5CTW A;  2W0F C;  4DUY O;  5IDM A;  2JKI A;  1FXK B;  4ZBM A;  2WSS G;  3N2G A;  3CRM A;  1MU5 A;  3L73 H;  1KP2 A;  2C2A A;  4CH5 A;  4X65 B;  4PI2 A;  1N36 B;  4PA3 A;  2WPD G;  5GW7 A;  2R9A A;  5CBG A;  3SJA C;  5LYJ A;  1HWY A;  4OXS A;  2QEX V;  4UCO A;  2QWR B;  4LF8 B;  4WFF A;  1HW7 A;  1XI1 A;  4X64 O;  2FB5 A;  3G6B A;  3BRC A;  4X89 A;  2EZO A;  1G8M A;  1Y76 A;  3FKS G;  5J71 A;  4DV3 O;  4X8A A;  1TGO A;  3AK2 A;  1Y6X A;  1SS3 A;  4OX9 B;  4JV5 O;  1WB7 A;  1SKV A;  3EFF K;  4O4H A;  4IIJ B;  3ZHT A;  1KBH A;  2CCT A;  1IZ3 A;  1YEW A;  2R9I A;  1W2B U;  2BU5 A;  3O6O A;  4HNA B;  4L91 A;  1VP7 A;  4TUY A;  3CC2 V;  4XKA A;  3H9V A;  3BHP A;  1LR1 A;  5J2T A;  1I5B A;  4YY3 B;  1YT1 A;  3OW2 U;  2WI5 A;  3OUS A;  1GN3 A;  3T1H B;  2PI4 A;  2ADQ B;  2W0X A;  3AG3 C;  4PA7 A;  4HXZ A;  3C3T A;  2VCI A;  3STL C;  2AKP A;  2F43 G;  1IDS A;  2EIJ B;  2IM9 A;  1P4R A;  2UXN A;  3TUH A;  4UCU A;  2YDE A;  3O9O A;  2XHX A;  1FXH A;  3ABT A;  1AB3 A;  2B5U A;  5JVD B;  2ITD C;  2UU9 B;  2CCS A;  3QO5 A;  4LF9 O;  4JI2 B;  2ZXW C;  3E89 A;  2FXS A;  1K73 W;  2WA4 A;  4X88 A;  4BWA A;  1RP3 B;  2ZR2 A;  3K0D A;  3DC5 A;  4IHJ B;  4GCZ A;  2PUS A;  2AHZ A;  3ZS8 C;  2UXB O;  3CRK A;  3GIG B;  4GZR B;  5LA6 B;  4DV6 O;  4DR6 O;  2HKJ A;  1QZR A;  1AI7 A;  4XD8 A;  1FJG O;  1K4C C;  1R3J C;  4RUF A;  3RGB A;  4MTO A;  3OW6 A;  3B77 A;  4CWQ A;  3TGU H;  3RWR D;  1YC4 A;  2R9R B;  1VQ9 V;  3TZ4 A;  2QE7 G;  2VRZ A;  3K97 A;  4E02 A;  4GYC B;  3WHA A;  2NNU A;  1EN5 A;  1F4N A;  1YJW V;  1RPO A;  3G67 A;  2YKC A;  1N33 O;  5JQG A;  3UKM A;  2Y69 B;  2XAQ A;  1YF2 A;  4FLY A;  1UY7 A;  1S76 D;  5CBH A;  1I7F A;  5JJN B;  1ZLZ A;  1XMO O;  4A5U B;  3IC7 A;  4O4L B;  4BW9 A;  3HZ5 A;  4GX5 A;  3N2K A;  1TUB B;  1M93 A;  2AXT Z;  5DM6 V;  1GN6 A;  1OCR C;  4U3J B;  3ETQ A;  2QGN A;  2BTQ B;  1VQ7 V;  5CTY A;  5CB4 A;  1EZJ A;  1S0V A;  2JJC A;  1UYM A;  4MVU A;  4ASG A;  5L3E A;  2YED A;  3R4M A;  4E00 A;  2YEA A;  1PD3 A;  2QM7 A;  1AH8 A;  4MPN A;  1SET A;  1TID A;  1GKF A;  2ARH A;  3APQ A;  3UQ8 A;  2QKC A;  4HYO A;  4O2B B;  3L74 H;  5DED A;  3L70 H;  3A0R A;  1HR0 B;  1GM8 A;  1VQ5 V;  2CE4 A;  4XIR A;  2YIB A;  2BT0 A;  5JH7 B;  1JA8 A;  5J2U B;  1CPY A;  4YHH O;  3T1Y O;  1XMQ B;  4ZHQ A;  4X1K A;  1BKN A;  1BZK A;  2YI5 A;  3PEH A;  1MZF A;  3INW A;  2UWD A;  4F6R A;  3JD0 A;  5CN0 A;  3ZRX A;  1B06 A;  1G4Y B;  3F5W C;  4TT3 G;  1FS0 G;  4DUH A;  1OJH A;  2BSK A;  2Q4P A;  2DYS C;  4KFG A;  3RYI A;  4PA9 A;  4J9Z B;  1MAB G;  4DR1 B;  3LPS A;  5LOV B;  4WFG A;  4YIO A;  1XOU A;  4WF9 V;  2WWW A;  3Q4H A;  3QTC A;  5LHG A;  4XIP A;  1SQF A;  1H7S A;  4V25 A;  1OCZ B;  1QY8 A;  4YKU A;  4XIT A;  1NTZ H;  1RPR A;  4EEQ A;  3AG2 C;  2CH7 B;  5EC2 C;  2CTP A;  1WP8 A;  1Y66 A;  1YS3 A;  4IT5 A;  2YSU B;  3HB3 B;  4JAA A;  2HKO A;  1F51 A;  2KKW A;  3ZMZ A;  4YKT A;  5LMU B;  1WA8 A;  2LJ2 A;  2ZE7 A;  2XTA A;  2DMX A;  1BSM A;  1I59 A;  4ZOL B;  1YJN V;  1UYK A;  2YKB A;  4OGQ B;  3VQX A;  4PRV A;  2YGE A;  2UXX A;  4I5S A;  2LW1 A;  3VBB A;  2YE3 A;  1XRE A;  5GTI Z;  3O0I A;  1AI6 A;  2JS5 A;  4URN A;  2FML A;  3B8M A;  2PZS A;  1KB9 F;  1URF A;  2YEH A;  2E0A A;  3FFQ A;  3RYC B;  3A8T A;  4FM0 A;  5KHH A;  5M4H A;  5IY5 C;  3BY6 A;  1OCC B;  4NB5 A;  1Q6U A;  3NR7 A;  3UT5 A;  2WAM A;  4PV1 B;  1ZW9 A;  1EN4 A;  3VQV A;  1NHH A;  4BIZ A;  4HXW A;  4X62 O;  2UXC B;  3U2K A;  4KSG A;  3IGA C;  3ZRV A;  3L75 H;  1K3E A;  2R72 A;  3TZ5 A;  3JAW A;  1WJZ A;  2IOR A;  3CEI A;  3ZRW A;  4MTG A;  1HNZ B;  4ZVI A;  4O05 A;  1FFX B;  5KAI Z;  4EM7 A;  3ASN C;  3UO3 A;  1TVK B;  5B3S B;  4I55 B;  3SR2 C;  1CXZ B;  4FLW A;  1O9G A;  1B62 A;  3HKD A;  3JAK A;  4MB9 A;  1YIJ V;  2JRI A;  4GX2 A;  3UCS C;  5IJ0 B;  2YUA A;  1B3Q A;  1KMI Z;  3ZJZ A;  4J9Y B;  2XUM A;  4DRX A;  1YSR A;  4MVZ A;  4I50 A;  1DF4 A;  1EZV H;  1YI2 V;  1NHI A;  4DR3 O;  1XEQ A;  5FPR A;  1T5E A;  4ASB A;  1HNW O;  4K0K B;  2IJK A;  4I4T A;  2Q8G A;  4W4L A;  3GB7 C;  1L8D A;  4G28 B;  3ABL B;  3D2R A;  3JAS A;  2Q2E B;  2LFR A;  1QCE A;  1V55 C;  4LFB O;  5EBW C;  1NVP D;  2Y0P A;  1WPX A;  4HAM A;  5EIB C;  3IC9 A;  3SJQ C;  3ZXQ A;  2FYP A;  1KQS U;  3SYO A;  1MMM A;  3RFR A;  5J6A A;  2BU7 A;  3OWB A;  1I5X A;  3HKB B;  5LBQ A;  3CB2 A;  4ZI7 B;  4TOI A;  3LDC A;  1ZX3 A;  2JGD A;  3U11 A;  3H4L A;  1R1B A;  4JI5 O;  1AIL A;  2QWN B;  4J7K A;  1UYL A;  1AJP A;  2WER A;  3P30 A;  2ZD9 A;  3F7Y C;  3BPZ A;  3MHH C;  2QSA A;  3ZBH A;  1X59 A;  3S3W A;  5KHK A;  1AI5 A;  4ICG A;  2NN4 A;  2DOS A;  3HKC B;  4IGG A;  3VHC A;  5BR8 O;  3LDD A;  3P32 A;  3HZ1 A;  3OTO B;  5ITZ A;  1BS3 A;  5H5N A;  1NH2 B;  4KHP B;  1FXK A;  3C11 A;  1NTM H;  1G6U A;  4L90 A;  1UPG A;  3ZIA G;  2ESA A;  1JR9 A;  3AK1 A;  3C0E A;  2UUA B;  3RVZ A;  4LWS B;  4XIQ A;  2ZIO A;  3CGY A;  4WCE V;  4LWE A;  2RNB A;  4DV4 O;  4E01 A;  5LHI A;  2IU0 A;  1UYF A;  2NLJ C;  4H44 B;  4V26 A;  4HY6 A;  2ZKO A;  4TV8 B;  4E72 A;  1BT8 A;  4YKR A;  3HHU A;  2VWJ A;  4DR7 O;  5KHI A;  4PD4 F;  3WG7 B;  4LNU A;  2DN9 A;  4R1F A;  3D36 A;  2H3O A;  1YZB A;  3OD4 A;  1KKC A;  5H9C A;  1EN6 A;  3WQ9 A;  1GK9 A;  4IIJ A;  1Z5V A;  3G6E V;  4HNA A;  4PI0 A;  1M56 B;  5L3D A;  2W6I G;  5IYB O;  3OPD A;  2YJX A;  2AZ2 A;  3D3Q A;  2KG7 B;  4X1I B;  1VF5 B;  3B8N A;  4Z1V A;  2GFD A;  2WLK A;  2CGF A;  2BOC C;  2WI4 A;  2BU8 A;  3CCU V;  1AH6 A;  4U7N A;  1QLN A;  4JF3 A;  1VQ6 V;  2FYU H;  4U93 A;  1SQV H;  2UXD O;  1ROP A;  4EKW A;  1CEZ A;  3QF7 A;  3B4S A;  5D6P A;  3H1I H;  3CRL A;  4YJ3 A;  1J5E B;  3AK3 A;  4IYH A;  1GM7 A;  2EIL C;  1YTF D;  5D5P A;  3WU2 Z;  5CF0 A;  4MSW C;  4L8J A;  5JVD A;  2XAS A;  3D0B A;  3INX A;  3ABM C;  5EK0 A;  3AG1 B;  4FLU A;  2E5L B;  4MVS A;  3LSS A;  3GIG A;  3SYC A;  4FLV A;  5LA6 A;  1VQN V;  1YT0 A;  5IWA O;  4URM A;  3FYI B;  1R73 A;  5KLV H;  1V54 B;  5L3G A;  4HZ5 A;  1Y74 B;  4GKJ B;  3GVM A;  3OMN B;  2F93 B;  1ZXM A;  4PEL A;  4FZ1 A;  1YES A;  3SDL A;  1M57 C;  4NH8 A;  2WEQ A;  4LF6 B;  2WLI A;  1W0J G;  1AJ6 A;  1P7B A;  3LMM A;  1IBK O;  4JI3 B;  4LFA B;  1F23 A;  1RM1 B;  4MW8 A;  1H2L A;  4K3A A;  1PKX A;  2WLL B;  3CYO A;  2E3C A;  4EGH A;  1BHA A;  3THO A;  1HNX B;  4O4L A;  2QA4 V;  4B3S O;  1TUB A;  2AHY A;  4DK1 A;  2AZ0 A;  4U3J A;  3H01 A;  2PTM A;  4FFB B;  1R6N A;  3CJH B;  1GRJ A;  4R8C A;  3A0B Z;  4UFZ A;  2BTZ A;  3ZMS A;  4DXW A;  4F4L A;  3CCR V;  4MVQ A;  2C1I A;  1K5Q A;  5D5Q A;  1M9N A;  2Y48 A;  4O04 A;  3WFV A;  5FNF A;  1NQT A;  4CWN A;  3JAT B;  2LW7 A;  3HR0 A;  3K5O A;  2YXL A;  2VQE O;  1JFF B;  4I0X B;  3EHG A;  4O2B A;  3IED A;  3VHA A;  1PNK A;  4XTJ A;  1L0L H;  4GT1 A;  2BYI A;  2FL4 A;  4OPH A;  1AI4 A;  5JH7 A;  1XNQ B;  1PV0 A;  1Z2G A;  1UY6 A;  2V1D A;  2BTO A;  2WI3 A;  1B04 A;  3K5L A;  1Y8P A;  1N0J A;  2YEJ A;  1PM9 A;  4XDJ A;  3H1H H;  4X1Y A;  3OTF A;  4JI7 O;  2ITC C;  1EM1 A;  3TTZ A;  4X65 O;  2QTS A;  4LCU C;  3OFN G;  1YC1 A;  2F4V B;  2A3Q A;  3ZMV A;  1QYE A;  1GKX A;  2WI2 A;  4AWQ A;  4DO2 A;  3CXH F;  2A0L A;  4LF8 O;  4YKY A;  5LOV A;  4I3H A;  4K4O A;  1K92 A;  2HHH B;  2B1I A;  4DV7 B;  2O1W A;  1QVF U;  2F1M A;  1IBL O;  4UVC A;  5FL7 G;  1VQL V;  1YSZ A;  2AGA A;  4GGL A;  2CH7 A;  5KHG A;  4GX0 A;  1YT2 A;  4GT8 A;  5B5E Z;  4PA6 A;  5LMN O;  3JD2 A;  3AG4 B;  1XBL A;  4QE9 A;  4YY3 O;  3B28 A;  1I94 O;  4O4J A;  2B9Z A;  1SZT A;  4DV2 B;  4ZOL A;  5B1B B;  1K34 A;  2WI1 A;  4JZG A;  2GUZ B;  4I9Q A;  4NKG B;  1OCC C;  5A9G A;  3A0X A;  3RLP A;  3OGC C;  5K1X A;  1N32 O;  2ZE8 A;  2UU9 O;  2X6B A;  1IBM O;  1JMK C;  4CBC A;  2XAH A;  2EIN B;  2AW9 A;  3K03 A;  4CS4 A;  3PJS K;  4QE7 A;  1VQO V;  4MTX A;  3UO2 A;  2OCC C;  5IT9 N;  1NU1 H;  3E86 A;  3KCX A;  2HR3 A;  4NXM O;  1GMG A;  4DR2 B;  2YEF A;  2ZM6 O;  4YKW A;  4DW0 A;  4JI4 O;  4CE2 A;  3T1K A;  4QJF B;  1H2M A;  4CC5 A;  2YEV B;  4WUB A;  4DUZ B;  3JYC A;  2UUC B;  2ZKJ A;  4AWO A;  4ASF A;  3AG7 A;  1ZWH A;  1GAX A;  1VMG A;  2VWK A;  3CCJ V;  1THZ A;  1TVK A;  1Q6H A;  4I55 A;  4HYP A;  2X0L A;  4MP2 A;  2BU6 A;  5IYC O;  3ZED A;  1P7G A;  2Q0A A;  2FKX A;  3CME V;  3PN1 A;  2Q7G A;  5IJ0 A;  1OCO B;  2XJJ A;  1GN4 A;  2OIE A;  3HPL C;  3LNM B;  1YET A;  1OZ0 A;  2Z5U A;  1YCI A;  3TJT A;  3RYH B;  1ID0 A;  3K9A A;  4O4I A;  3JCU Z;  4NXN O;  4LC1 A;  4X64 B;  4LF7 O;  3X2Q B;  2HCH A;  2HLD G;  2ODM A;  2HVK C;  4DV3 B;  3IFX A;  3MDS A;  2IBZ H;  3WB0 A;  5M4N A;  3G7E A;  5BOD A;  3EHH A;  1N0N A;  4NH9 A;  1OV9 A;  5EZY A;  5LP6 B;  1GTO A;  1SER A;  5KA6 A;  2P67 A;  4AWP A;  1VIB A;  4J11 A;  2VWC A;  4CH3 A;  1R6K A;  3CRC A;  2Q8H A;  3W7X A;  1CP9 A;  1QR8 A;  5B1A B;  2YKI A;  4MT8 A;  3UM7 A;  3T4Z A;  1MSW D;  2WI6 A;  4NTY A;  1L1F A;  2EIK C;  3FT8 A;  4ASA A;  2GDS A;  3HKB A;  2JJ2 G;  1JVM A;  3ASO C;  3OR6 C;  1SA0 B;  2JK5 C;  1KEC A;  1KIJ A;  4LF9 B;  2EJR A;  5CA0 B;  4YJ2 A;  4LWF A;  4J42 A;  5JCO C;  1PNL A;  5C8Y B;  5D6Q A;  3E8G A;  4N23 A;  2E74 B;  2UXB B;  2DE0 X;  4JI6 B;  2XX5 A;  4JI0 O;  1JQ0 A;  3ABK B;  1N34 O;  3NMQ A;  4DV6 B;  4P30 A;  4DR6 B;  4DR1 O;  4AHC A;  3HKC A;  1JPX A;  1S77 D;  1BYQ A;  3ZMU A;  1FJG B;  2EBO A;  4FM1 A;  3CX5 F;  1SQG A;  1K9M W;  3TXS A;  4H13 B;  3JSL A;  2YI0 A;  4EFB A;  4HYM A;  4MP7 A;  4CH4 A;  5JCO A;  1GM9 A;  3WG7 C;  4G27 B;  2YEE A;  4DYL A;  4AQY B;  1N33 B;  2QM4 A;  1UJW B;  4DR4 O;  4DV5 O;  2C1G A;  2XAG A;  4TWK A;  3VHD A;  1UFI A;  4TV8 A;  4QNH B;  5BY1 A;  1I58 A;  4LPB A;  1PL4 A;  2ATK C;  3BA9 A;  1YHQ V;  2QFO A;  2HJD A;  3QNE A;  1Y8N A;  3GWO A;  4LP8 A;  1VEW A;  2GTS A;  1E1R G;  2HJF C;  1H2S B;  2IJJ A;  3JAL B;  2BRE A;  4TSF G;  5LGU A;  2PI5 A;  2KG7 A;  4H37 A;  4X1I A;  2KSD A;  2YIA A;  4FLX A;  4FVM A;  4JI8 O;  1XHX A;  3RN4 A;  2DJV A;  2BRC A;  1ZXN A;  1BGQ A;  5JJE B;  3I55 V;  1BGY H;  5EYP B;  5CA1 B; 
#chains in the Genus database with same CATH homology
 4FJC C;  2B1G A;  4W7T A;  4CWS A;  4B7P A;  3G71 V;  2VCJ A;  5B1O A;  2EIM C;  2DYR C;  4R50 A;  4CWT A;  1E79 G;  4RQF A;  1SRY A;  4XBF A;  4WFA V;  4Z1M G;  4QPJ A;  1S72 V;  3E8B A;  1BHB A;  1QVG U;  5LGT A;  2XOK G;  1UYI A;  2H55 A;  2YE4 A;  5C93 A;  1NH2 D;  1UY9 A;  1H2G A;  3SPJ A;  4GX1 A;  4R7C A;  1NBM G;  3T1C A;  1Q86 W;  4EMV A;  1Z5B A;  2XDL A;  3CPW U;  2BU2 A;  2WLH A;  3MNR P;  1S16 A;  3ZM7 A;  3K3W A;  1A4H A;  3BMY A;  2Q68 A;  5EBL C;  4G2K A;  5IDJ A;  3I56 V;  3K60 A;  4HZ0 A;  1UY8 A;  3JCZ A;  1BMF G;  1QLE C;  2ZDY A;  1TC0 A;  4DZY A;  4I9W A;  3OMI B;  3AG3 B;  4KQV A;  1PL0 A;  1WLE A;  3OUF A;  2DWD C;  1NHJ A;  4LBE C;  2ZXW B;  2IH3 C;  2YJW A;  3LDE A;  2DW4 A;  1JJ2 U;  4FMT A;  5F5R A;  1U0Z A;  2QM8 A;  1GO3 F;  2JJ1 G;  3ETE A;  3R65 A;  1Q81 W;  2HG1 A;  2ZDX A;  3B26 A;  4HZ3 A;  3CGZ A;  1FXK C;  4KP4 A;  4X9L A;  3OE7 G;  3RW0 A;  3STZ C;  3U2D A;  5L3B A;  2YI6 A;  1Y4U A;  4MVR A;  4GEE A;  4R6Z A;  2XCM A;  5GGZ A;  2GQP A;  2EIN C;  5KUK A;  5BOC A;  3TET A;  2OTL V;  4RQE A;  1KP3 A;  4XKK A;  3LSQ A;  1OCR B;  2QKS A;  3VOU A;  5FND A;  3MHS C;  2XHR A;  4P8O A;  2IWS A;  4FCQ A;  3FV5 A;  4KTN A;  4CWF A;  3SYA A;  2EIJ C;  5LHH A;  3A0T A;  3H80 A;  1VQK V;  4XKO A;  2P6J A;  4BXI A;  2XND G;  5M4P A;  1S14 A;  3SPC A;  4H7Q A;  2YEV A;  2YE5 A;  3PEJ A;  5L3C A;  4L8Z A;  3OR7 C;  4PA4 A;  4YXW G;  4MTF A;  1Y4M A;  1YJ9 V;  2XHT A;  2DYS B;  1N8R W;  4PU9 A;  3OEE G;  4JYC A;  3T10 A;  3R92 A;  1UYC A;  2IWU A;  5KUM A;  2ZDI C;  2FWY A;  3A0Z A;  5FNC A;  2JIZ G;  4NH7 A;  2M7W A;  1QBZ A;  1E1Q G;  5D7C A;  2Y69 C;  4JQL A;  5IYD O;  3TZ2 A;  3ZN1 A;  3R4N A;  4PDV A;  5HFL A;  3M99 B;  3AG2 B;  5B1A C;  2W6J G;  4P7A A;  4FPP A;  4UVA A;  3VAD A;  2Q69 A;  1YIT V;  2ZDI A;  3W7S A;  1Z59 A;  1EFR G;  1Q82 W;  3K99 A;  4HY1 A;  1J95 A;  2H94 A;  1U2O A;  3CCV V;  4BAE A;  2EXL A;  4RO2 A;  3TCU A;  4E2L A;  1H8H G;  3ABK C;  3K06 A;  3W7W A;  4UVB A;  2CG9 A;  1AR1 B;  3R91 A;  2O1V A;  4CE3 A;  4UXN A;  5EBM C;  2XDS A;  3ZRW B;  3LNU A;  5M4M A;  2BYH A;  4CWO A;  3G75 A;  2YI7 A;  2ZBK B;  4L94 A;  5IY5 B;  4LWH A;  1FXV A;  1MG1 A;  3G7B A;  4O09 A;  4URO A;  2WI7 A;  2LP7 A;  1DLB A;  2YE2 A;  2XX4 A;  2XJG A;  1L0O A;  1K7D A;  3ASN B;  3EHJ A;  1XL6 A;  4LWG A;  2DWE C;  3CCE V;  3E35 A;  4XE2 A;  3JD1 A;  4KSH A;  1OCZ C;  2O1U A;  2D3O W;  4L87 A;  4FCP A;  3KG2 A;  4MBC A;  1BXD A;  1R3I C;  1EI1 A;  2KB1 A;  5L3J A;  1UYD A;  2A9H A;  1NJI W;  3K98 A;  3EKR A;  4CWR A;  2DQ0 A;  2FTK A;  3FYE B;  1V55 B;  4UV9 A;  2CK3 G;  4MVM A;  3CC4 V;  2YK9 A;  2IWX A;  4EEH A;  4FIP C;  1BL8 A;  4LP0 A;  3SYP A;  1ORQ C;  3SPG A;  1TC6 A;  4JGS A;  1H38 A;  1US7 A;  2XJX A;  4U7O A;  3K79 A;  4PRX A;  3FB5 C;  4B6C A;  5M4E A;  2BSM A;  1UYG A;  2A79 B;  1B63 A;  1I5Y A;  3O2F A;  4N21 A;  3SPH A;  5B3S C;  1K4D C;  4QPK A;  4EGI A;  4R3M A;  4WUD A;  4Q20 A;  2QG2 A;  3Q5J A;  1VQ4 V;  4CZZ A;  4JPR A;  4FK5 C;  1UYE A;  3E8F A;  2Q8F A;  5FWK A;  1I5A A;  2YK2 A;  4QIW F;  3QO7 A;  3ABL C;  2OTJ V;  3T2S A;  1R62 A;  5IN9 A;  2H8M A;  2XX2 A;  2IH1 C;  3E2E A;  4JTC B;  1LNQ A;  2WLN A;  2CCU A;  3AEI A;  3RLR A;  3RVY A;  1B6Q A;  2YGA A;  1Z5A A;  2EIL B;  2P90 A;  3NXS A;  3ZCC A;  4JTD B;  2BOB C;  3ABM B;  2X6C A;  4BAY A;  3ZKD A;  2WLI B;  4RAI A;  1K33 A;  4UUJ C;  3EHB B;  2YE7 A;  4H85 A;  1AJN A;  3TK1 A;  1M57 B;  3ETG A;  5CTU A;  5H6R A;  3CCS V;  4CE1 A;  3ZN0 A;  3QO8 A;  2IOQ A;  5DN6 G;  5CTX A;  1QR9 A;  1XL4 A;  2Q67 A;  3T4D A;  2YE9 A;  1M56 C;  1OHH G;  3R4P A;  3QDD A;  2JEU A;  5H6Q A;  4CWP A;  5CA3 A;  3SYQ A;  4P9P A;  3QTF A;  1AJQ A;  3LUT B;  4JAS A;  1S5H C;  4PDM A;  4MVO A;  4LWI A;  2DQ3 A;  4JTA B;  3AG1 C;  3BM9 A;  1Y4S A;  1Y8O A;  2ZR3 A;  3E83 A;  3RKZ A;  3K0G A;  2GHY A;  1K97 A;  1PVG A;  1V54 C;  1GKZ A;  1TIL A;  2WEP A;  2H8P C;  1THN A;  4AS9 A;  4O07 A;  1OSF A;  4WUC A;  1K5S A;  1K8A W;  1VQ8 V;  5J9P C;  5CPH A;  1RM1 C;  2IJI A;  5CMU A;  1I5D A;  3ZXO A;  2HG5 C;  1JCH A;  1GJV A;  3FB6 C;  2XDK A;  4XDL A;  1M90 W;  2YKE A;  2ZQM A;  2WLM A;  3JD4 A;  4XDM A;  2JEX A;  2WLL A;  5L3F A;  4BQJ A;  2IU3 A;  1YER A;  3CWV A;  4L93 A;  2YKJ A;  4KFM A;  5D7D A;  2X6A A;  5BZB A;  4YKZ A;  4PDL A;  3Q5K A;  1F4M A;  2MK3 A;  1NR7 A;  2OCC B;  1SES A;  3OMA B;  3K04 A;  2XDU A;  3DGE A;  2VW5 A;  1COW G;  1NKD A;  1DTO A;  3T0H A;  1JOY A;  5KA5 A;  1YSC A;  3FB8 C;  5E1A C;  4URL A;  2XAF A;  3RBZ A;  3B27 A;  3JZ3 A;  1NR1 A;  5LGN A;  1ENV A;  2YEB A;  5D7R A;  1I5C A;  1EA6 A;  4JAU A;  4WFH A;  1ZWI C;  3OAA G;  4H81 A;  1MOF A;  1UYH A;  2Z3Y A;  2LFS A;  1S3J A;  3W7T A;  3A0Y A;  2BZ5 A;  1W0K G;  2YEG A;  2Q8I A;  2XAB A;  3AG4 C;  2CH4 A;  3Q5L A;  1ARO P;  5B1B C;  3BEH A;  3A0W A;  4MPE A;  2QG0 A;  3KE6 A;  2YEI A;  2WLJ A;  3ABU A;  3FB7 C;  4H33 A;  2FWZ A;  3HEK A;  2YE6 A;  2QTO A;  2EIK B;  3B25 A;  4O0B A;  3OWD A;  3ASO B;  1TUE B;  3CCQ V;  5EC1 C;  3G4S V;  3CC7 V;  1R3K C;  3FT5 A;  4MOT A;  4PL9 A;  4R3A A;  2XDX A;  3OM3 B;  4UV8 A;  3ETD A;  2GSM B;  2K1E A;  1OCO C;  3OEH G;  5CBF A;  3JD3 A;  4MS2 A;  1YC3 A;  4P2Z A;  1VQM V;  3X2Q C;  4EFU A;  3EHF A;  2IOP A;  1Z5C A;  1TH8 A;  2HFE C;  2PNR A;  3B24 A;  1NVP B;  3OMU A;  4WFE A;  4RUE A;  2IW5 A;  4P9O A;  5HFM A;  4FCR A;  3R4O A;  2Q6A A;  3CCM V;  1DF5 A;  4BIU A;  4XC0 A;  3K08 A;  5F3K A;  1VQP V;  3HYZ A;  2X7R B;  4BQG A;  4EGK A;  2HVJ C;  2EIM B;  3ZMT A;  2DYR B;  2P7T C;  2XK2 A;  3F7V C;  3DTU B;  4MW3 A;  4XDK A;  3T0Z A;  1AMW A;  1AM1 A;  1JM6 A;  1MX0 A;  1Q7Y W;  1PNM A;  4JYB A;  3W7U A;  3T2M A;  1R3L C;  3CD6 V;  2XAJ A;  4GQT A;  4XCL A;  4ASU G;  5B1N A;  4JAV A;  1IXM A;  3EKO A;  3ZKB A;  1H8E G;  3SPI A;  4YKQ A;  3ML0 A;  4PDR A;  3SL2 A;  1M1K W;  2EZP A;  4KUM A;  2QF6 A;  4BW5 A;  3MD0 A;  2XD6 A;  2JDI G;  4EFT A;  3CP1 A;  4ZKI A;  1EBO A;  2OT5 A;  3D3I A;  1YTF B;  3CMA V;  2IJH A;  1H7U A;  1QLE B;  2K5B A;  3ZRS A;  4YKX A;  1JX9 A;  3CCL V;  1KC8 W;  1TBW A;  3U67 A;  1KZN A;  3RLQ A;  4MPC A;  3GIF A;  4XCJ A;  2YGF A;  2YE8 A;  4WFB V;  1FFT B;  3CXC U;  3GIE A;  3E8H A;  4GFN A;  2YEC A;  1KKD A;  5M4K A;  3TZ0 A;  1KD1 W;  3HYY A;  2V7Q G;  5CTW A;  2W0F C;  5IDM A;  2JKI A;  1FXK B;  4ZBM A;  2WSS G;  1MU5 A;  1KP2 A;  2C2A A;  4PA3 A;  2WPD G;  5GW7 A;  5CBG A;  1HWY A;  4OXS A;  2QEX V;  4WFF A;  4X89 A;  2EZO A;  1G8M A;  3FKS G;  5J71 A;  4X8A A;  3EFF K;  2CCT A;  2BU5 A;  1W2B U;  2R9I A;  3O6O A;  4L91 A;  3CC2 V;  4XKA A;  1I5B A;  1YT1 A;  3OW2 U;  2WI5 A;  3OUS A;  2PI4 A;  3AG3 C;  4PA7 A;  4HXZ A;  2VCI A;  3STL C;  2AKP A;  2F43 G;  2EIJ B;  1P4R A;  2UXN A;  3TUH A;  2XHX A;  1FXH A;  3ABT A;  2B5U A;  2ITD C;  2CCS A;  3QO5 A;  2ZXW C;  3E89 A;  2FXS A;  1K73 W;  4X88 A;  2ZR2 A;  3K0D A;  4GCZ A;  2AHZ A;  3CRK A;  3GIG B;  2HKJ A;  1QZR A;  1AI7 A;  4XD8 A;  1K4C C;  1R3J C;  4RUF A;  4MTO A;  3OW6 A;  3B77 A;  4CWQ A;  1YC4 A;  2R9R B;  1VQ9 V;  3TZ4 A;  2QE7 G;  3K97 A;  4E02 A;  3WHA A;  2NNU A;  1F4N A;  1YJW V;  1RPO A;  2YKC A;  3UKM A;  2Y69 B;  2XAQ A;  1UY7 A;  1S76 D;  5CBH A;  3IC7 A;  3HZ5 A;  4GX5 A;  5DM6 V;  1OCR C;  1VQ7 V;  5CTY A;  1EZJ A;  1S0V A;  2JJC A;  1UYM A;  4MVU A;  4ASG A;  5L3E A;  2YED A;  3R4M A;  4E00 A;  2YEA A;  1PD3 A;  2QM7 A;  1AH8 A;  4MPN A;  1SET A;  1TID A;  1GKF A;  4HYO A;  3A0R A;  1GM8 A;  1VQ5 V;  4XIR A;  2BT0 A;  1CPY A;  1BKN A;  2YI5 A;  3PEH A;  3INW A;  2UWD A;  3JD0 A;  5CN0 A;  3ZRX A;  1G4Y B;  3F5W C;  4TT3 G;  1FS0 G;  4DUH A;  2DYS C;  4KFG A;  4PA9 A;  4J9Z B;  1MAB G;  3LPS A;  4WFG A;  4WF9 V;  2WWW A;  5LHG A;  4XIP A;  1H7S A;  4V25 A;  1OCZ B;  1QY8 A;  4YKU A;  4XIT A;  1RPR A;  3AG2 C;  5EC2 C;  1Y66 A;  1YS3 A;  2YSU B;  3HB3 B;  2HKO A;  1F51 A;  3ZMZ A;  4YKT A;  1I59 A;  1YJN V;  1UYK A;  2YKB A;  4PRV A;  2YGE A;  2UXX A;  4I5S A;  3VBB A;  2YE3 A;  3O0I A;  1AI6 A;  4URN A;  3B8M A;  2YEH A;  2E0A A;  5M4H A;  5IY5 C;  3BY6 A;  1OCC B;  2WAM A;  1ZW9 A;  1NHH A;  4HXW A;  4BIZ A;  3U2K A;  4KSG A;  3IGA C;  3ZRV A;  1K3E A;  3TZ5 A;  2IOR A;  3ZRW A;  4MTG A;  4ZVI A;  4O05 A;  4EM7 A;  3ASN C;  5B3S B;  1B62 A;  4MB9 A;  1YIJ V;  4GX2 A;  1B3Q A;  3ZJZ A;  4J9Y B;  1YSR A;  4MVZ A;  1DF4 A;  1YI2 V;  1NHI A;  4ASB A;  2IJK A;  2Q8G A;  3GB7 C;  4G28 B;  3ABL B;  3D2R A;  2Q2E B;  2LFR A;  1QCE A;  1V55 C;  5EBW C;  1NVP D;  1WPX A;  4HAM A;  3SJQ C;  3ZXQ A;  2FYP A;  1KQS U;  3SYO A;  5J6A A;  2BU7 A;  3OWB A;  1I5X A;  5LBQ A;  3LDC A;  3H4L A;  1UYL A;  1AJP A;  2WER A;  3P30 A;  2ZD9 A;  3F7Y C;  3MHH C;  1AI5 A;  3VHC A;  3LDD A;  3P32 A;  3HZ1 A;  1NH2 B;  1FXK A;  3C11 A;  4L90 A;  3ZIA G;  2ESA A;  3C0E A;  3RVZ A;  4XIQ A;  3CGY A;  4WCE V;  4LWE A;  4E01 A;  5LHI A;  2IU0 A;  1UYF A;  2NLJ C;  4V26 A;  4HY6 A;  4YKR A;  3HHU A;  3WG7 B;  4R1F A;  3D36 A;  5H9C A;  3WQ9 A;  1GK9 A;  3G6E V;  1M56 B;  5L3D A;  2W6I G;  5IYB O;  3OPD A;  2YJX A;  3B8N A;  2GFD A;  2WLK A;  2CGF A;  2BOC C;  2WI4 A;  2BU8 A;  3CCU V;  1AH6 A;  4U7N A;  1QLN A;  4JF3 A;  1VQ6 V;  4U93 A;  1ROP A;  4EKW A;  1CEZ A;  5D6P A;  3CRL A;  1GM7 A;  2EIL C;  1YTF D;  5CF0 A;  4MSW C;  2XAS A;  3D0B A;  3INX A;  3ABM C;  5EK0 A;  3AG1 B;  4MVS A;  3LSS A;  3GIG A;  3SYC A;  1VQN V;  1YT0 A;  4URM A;  3FYI B;  1R73 A;  1V54 B;  5L3G A;  4HZ5 A;  3OMN B;  1ZXM A;  4PEL A;  1YES A;  1M57 C;  4NH8 A;  2WEQ A;  2WLI A;  1W0J G;  1AJ6 A;  1P7B A;  1F23 A;  1RM1 B;  4MW8 A;  1PKX A;  2WLL B;  3CYO A;  4EGH A;  1BHA A;  2QA4 V;  2AHY A;  3H01 A;  1R6N A;  4R8C A;  2BTZ A;  3ZMS A;  4DXW A;  4F4L A;  3CCR V;  4MVQ A;  1K5Q A;  1M9N A;  2Y48 A;  4O04 A;  3WFV A;  5FNF A;  1NQT A;  4CWN A;  3EHG A;  3IED A;  3VHA A;  1PNK A;  4XTJ A;  4GT1 A;  2BYI A;  1AI4 A;  1UY6 A;  2V1D A;  2WI3 A;  1Y8P A;  2YEJ A;  4XDJ A;  2ITC C;  3TTZ A;  4LCU C;  3OFN G;  1YC1 A;  3ZMV A;  1QYE A;  1GKX A;  2WI2 A;  4AWQ A;  4DO2 A;  2A0L A;  4YKY A;  4I3H A;  4K4O A;  1K92 A;  2B1I A;  2O1W A;  1QVF U;  4UVC A;  5FL7 G;  1VQL V;  1YSZ A;  4GGL A;  4GX0 A;  1YT2 A;  4GT8 A;  4PA6 A;  3JD2 A;  3AG4 B;  4QE9 A;  3B28 A;  1SZT A;  5B1B B;  1K34 A;  2WI1 A;  1OCC C;  3A0X A;  3RLP A;  3OGC C;  2X6B A;  4CBC A;  2XAH A;  2EIN B;  3K03 A;  3PJS K;  4QE7 A;  1VQO V;  4MTX A;  2OCC C;  3E86 A;  2HR3 A;  1GMG A;  2YEF A;  4YKW A;  4CE2 A;  3T1K A;  4QJF B;  2YEV B;  4WUB A;  3JYC A;  2ZKJ A;  4AWO A;  4ASF A;  1ZWH A;  3CCJ V;  1THZ A;  4HYP A;  2X0L A;  4MP2 A;  2BU6 A;  5IYC O;  3CME V;  1OCO B;  2XJJ A;  3HPL C;  3LNM B;  1YET A;  1OZ0 A;  2Z5U A;  1ID0 A;  3K9A A;  4LC1 A;  3X2Q B;  2HCH A;  2HLD G;  2HVK C;  3IFX A;  5M4N A;  3G7E A;  5BOD A;  3EHH A;  4NH9 A;  1GTO A;  1SER A;  5KA6 A;  2P67 A;  4AWP A;  2VWC A;  1R6K A;  2Q8H A;  3W7X A;  1CP9 A;  1QR8 A;  5B1A B;  2YKI A;  4MT8 A;  3UM7 A;  3T4Z A;  1MSW D;  2WI6 A;  1L1F A;  2EIK C;  3FT8 A;  4ASA A;  2JJ2 G;  1JVM A;  3ASO C;  3OR6 C;  2JK5 C;  1KEC A;  1KIJ A;  2EJR A;  4LWF A;  1PNL A;  5D6Q A;  3E8G A;  4N23 A;  3NMQ A;  2XX5 A;  1JQ0 A;  3ABK B;  4P30 A;  1JPX A;  1S77 D;  1BYQ A;  3ZMU A;  2EBO A;  1K9M W;  2YI0 A;  4HYM A;  4MP7 A;  1GM9 A;  3WG7 C;  4G27 B;  2YEE A;  1UJW B;  2XAG A;  4TWK A;  3VHD A;  4QNH B;  1I58 A;  4LPB A;  2ATK C;  2QFO A;  1YHQ V;  3QNE A;  1Y8N A;  3GWO A;  4LP8 A;  1E1R G;  2HJF C;  2IJJ A;  2BRE A;  4TSF G;  5LGU A;  2PI5 A;  4H37 A;  2BRC A;  1ZXN A;  1BGQ A;  3I55 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...