4JASA

Structural basis of a rationally rewired protein-protein interface (hk853mutant a268v, a271g, t275m, v294t and d297e and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
237
structure length
237
Chain Sequence
b'LKRIDRMKTEFIANISHELRTPLTVIKGYAEMIYNSLGELDLSTLKEFLETIIEQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine kinase
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
total genus 68
structure length 237
sequence length 237
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jasA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4jasA02
2O1VA 1I5CA 4LWEA 1US7A 5J6AA 2H8MA 4E00A 4KSHA 4E01A 1NHJA 5B1OA 4ASFA 4PL9A 3TZ5A 3HEKA 2FWYA 2PNRA 3VHDA 3GIEA 4BIZA 4HYPA 4O04A 1YS3A 2ZBKB 2BRCA 2Q8GA 1THNA 1BXDA 2FWZA 4MTXA 3TK1A 3CRLA 4GFNA 2YEJA 1UYLA 1ZW9A 5M4PA 3IEDA 1YSZA 3Q5LA 4V26A 1JOYA 2IORA 4MT8A 3ZRVA 2YGAA 3RLPA 4FPPA 3QTFA 3A0RA 3GIGA 1AJ6A 2BU7A 2XDLA 2IOQA 3HZ5A 4MPNA 4O09A 3G7BA 2CGFA 2ESAA 4V25A 1UYFA 4NH7A 1AH6A 1UY6A 4GQTA 2VCIA 1UYDA 4EGHA 2YE8A 1H7UA 1OSFA 4XDMA 5CF0A 3OPDA 4L93A 3LPSA 3C11A 3RLQA 3MD0A 5D7DA 2P67A 1TC0A 4CWQA 2QM7A 1TIDA 3HYYA 5CTXA 4L8ZA 3VHAA 4FCRA 1YC3A 4R3AA 2YI6A 3LNUA 2YE7A 5CTWA 4EEHA 1R62A 2BT0A 2YK9A 4KFGA 4BIUA 1TILA 2YI0A 3OWBA 4LPBA 5L3JA 1Y8PA 3O0IA 2WI4A 4KSGA 2BU5A 3O6OA 3INWA 5BODA 3K98A 4EFUA 4XKAA 1F51A 4K4OA 4Q20A 2YKJA 4XKKA 4LC1A 1PVGA 3EHHA 4O0BA 4GT1A 2VWCA 3BMYA 3R92A 4H81A 5M4MA 5D7CA 4JYBA 3INXA 1I59A 3A0XA 4NH8A 2ZDXA 2BYHA 4JQLA 2XK2A 4X9LA 4XE2A 2BU8A 4GCZA 3ZM7A 4CE2A 1IXMA 4XCLA 3WHAA 4KTNA 4XD8A 4YKUA 3T1KA 4P8OA 2HKJA 4CWOA 3TZ4A 2IOPA 3NMQA 4U7NA 4LP0A 4DUHA 3T2SA 5M4KA 3D0BA 3NXSA 5IDJA 3A0ZA 2AKPA 5M4NA 1UYHA 4O07A 3QDDA 2IWSA 1GKXA 3EKRA 4MBCA 2YEHA 2LFRA 2UWDA 1Z5AA 2C2AA 3ZXOA 3TUHA 4FCPA 2XX4A 4ASGA 1Z5BA 2JJCA 4CWNA 1YERA 2Q2EB 4XTJA 5F3KA 2O1UA 3PEHA 5D7RA 5GGZA 2CCSA 4EGKA 4ZKIA 4PRVA 5D6QA 2YEIA 2JKIA 1UYKA 4L94A 2BREA 2YI5A 1B63A 2BTZA 2XX2A 3SL2A 1KIJA 3P32A 3T0HA 2XJXA 3ZKBA 2CCTA 1AMWA 3MNRP 2YE3A 2CCUA 3CGZA 2HCHA 2HG1A 4EM7A 1UY7A 3HHUA 4CWPA 1Y8OA 4WUCA 3RLRA 2YI7A 4BQGA 5B1NA 2BU2A 4GT8A 3H80A 2EXLA 2XDUA 1I5BA 1EA6A 4BXIA 1JM6A 4GEEA 3R4NA 1B62A 3ZRXA 3ZXQA 2YJXA 5IDMA 3FT5A 4URNA 2XD6A 1TBWA 2QG0A 3VADA 1ZXMA 3Q5JA 5J71A 1YSRA 3R4OA 3U2DA 2IWUA 3D2RA 2XDSA 1ID0A 4BAEA 4I3HA 4HY6A 1NHHA 4WUBA 2QM8A 1ZXNA 2Q8FA 3A0WA 2YE4A 1YESA 3HZ1A 3K60A 4EGIA 4URLA 2QF6A 2WI5A 3B27A 1Z5CA 4YKQA 3A0TA 2BSMA 4QPJA 3ZRWB 2YGEA 4CE3A 1UY9A 1KZNA 3OW6A 5FNDA 2XDXA 2E0AA 1Y4SA 3EHJA 4JYCA 2YKCA 4O05A 1YT0A 4LWHA 1QZRA 3C0EA 3EKOA 4YKWA 3OMUA 3K99A 3Q5KA 3U2KA 3CGYA 2WEPA 4L91A 1ZWHA 3TZ0A 4AWOA 3B24A 2WWWA 3DGEA 4FCQA 2O1WA 1H7SA 3KE6A 1BGQA 2YECA 4I5SA 4NH9A 2YEAA 4HZ5A 3CRKA 4EMVA 2QFOA 3R91A 1U0ZA 4MPCA 2WI7A 2K5BA 4ZVIA 3PEJA 5FNCA 4XC0A 4EFTA 5CTYA 2XDKA 4URMA 2FTKA 4MOTA 4YKZA 4HXWA 4MB9A 5CPHA 1UY8A 2FXSA 4BQJA 3ZRWA 1UYMA 4AWQA 4YKRA 1YT2A 4JASA 1S16A 2YE2A 1MX0A 4FMTA 1YC4A 4LWFA 3TTZA 4MP2A 3H4LA 2QG2A 4E02A 3BM9A 4H7QA 4L90A 4W7TA 4UROA 2YKBA 1I58A 4DZYA 2XJJA 4WUDA 2ZKJA 3ZKDA 1BKNA 1L0OA 1A4HA 3D36A 1QY8A 1U2OA 5M4HA 4R3MA 4MP7A 3B25A 4HXZA 2ZDYA 1TH8A 4LWGA 3GIFA 3R4MA 2H55A 2Q8IA 4KP4A 2XCMA 1MU5A 3VHCA 2YJWA 1I5AA 4XIPA 3K97A 5M4EA 4ASBA 4JAVA 3B28A 2YEEA 1EI1A 3T10A 4AWPA 4B6CA 1Z59A 1I5DA 2BYIA 4HY1A 3A0YA 3ZCCA 5FNFA 1B3QA 5CTUA 1YETA 2WI6A 3CWVA 2WERA 3G7EA 2XABA 4GGLA 2YEBA 2YKIA 4R1FA 3T0ZA 5IN9A 4QPKA 2FYPA 1GKZA 2XHRA 4XCJA 3WQ9A 4YKTA 2YEDA 4HYMA 5BOCA 2WEQA 4YKXA 4U7OA 2CH4A 2WI2A 2GFDA 1UYEA 2XJGA 2IWXA 5D6PA 1YT1A 4JAUA 1UYCA 3B26A 1AH8A 5C93A 1Y8NA 2YEGA 3R4PA 5F5RA 1YC1A 2YE9A 4XKOA 2YE6A 2GQPA 3RKZA 2YGFA 1TC6A 2BZ5A 4H85A 4MPEA 4XIRA 2LFSA 3HYZA 1BYQA 3EHGA 2YEFA 2YKEA 4XIQA 1NHIA 4CWSA 4LWIA 4P7AA 3OWDA 4CWRA 4HZ0A 4CWFA 1UYIA 3G75A 4B7PA 3U67A 3FT8A 3TZ2A 2YK2A 4CE1A 2XHTA 3JZ3A 4YKYA 2VW5A 1S14A 2VCJA 4XITA 4CWTA 5FWKA 4U93A 4AS9A 2BU6A 2WI3A 3O2FA 2WI1A 3FV5A 4ASAA 4KQVA 3GIGB 1QYEA 3EHFA 2YE5A 2XX5A 2CG9A 2Q8HA 1GJVA 1UYGA 4PRXA 1AM1A 1Y4UA 4PU9A 2XHXA
chains in the Genus database with same CATH superfamily
1GH6A 1SQPH 1FS0G 1XUQA 5H6QA 3P3NA 2H8MA 4E01A 2UUCB 4BWAA 4IIJB 1XNRB 4PL9A 4MVUA 3HEKA 1HR0B 2Q9LA 5IYZA 2B1IA 2EJ7A 4BIZA 2IW5A 1PNKA 1THNA 1N33B 3TGUH 1SA0A 1BXDA 3L9DA 3QG5A 2G38A 1HNZB 1S5LZ 4JTAB 4X1IB 2HR3A 4PA4A 5M4PA 3IEDA 1YSZA 3Q5LA 2WLLB 3G6BA 3Q4HA 1N0JA 3A0BZ 1Q6IA 2CGNA 1NQTA 3A0RA 4FZ0A 2XDLA 1NVPD 3ABMC 2YDEA 1VARA 4I0XB 1UYFA 1UY6A 4GQTA 4UFZA 2YXYA 5JJNB 2YE8A 1H7UA 1OSFA 5LP6C 4YIOA 3A0HZ 4W4LA 3C11A 2QTSA 1QU7A 3T1CA 3CYOA 3HYYA 5CTXA 4K35A 3JYCA 1B06A 2ATKC 4DR5O 2F93B 4X62O 4LNUB 4O4LB 4FCRA 1NH2D 4R3AA 1K92A 1AI4A 5AG2A 1BS3A 3I56V 2YE7A 5CTWA 5EIBC 1I5XA 1BHBA 1DK1A 2H3OA 5JCOA 2YI0A 4GZRB 3F5WC 4FM0A 4WFFA 2UXBB 3M7MX 2DYSB 5L3JA 4MTFA 2MW2B 2WA3A 3VQXA 1YJNV 4WCEV 3G80A 2UUAB 3EFFK 4H33A 4N21A 4XKAA 1H2LA 2GUZA 4Q20A 1SQGA 1PVGA 3F5TA 1LUVA 3EHHA 5JQGA 4O0BA 1XQ8A 3P30A 4DR2B 2AHYA 1NT2B 4N23A 5J9PC 4NH8A 3UCSC 2ZDXA 2BYHA 3JAKB 4A5UB 2JRIA 5J2UA 4X9LA 4YJ2B 3ZM7A 1XNQB 4XCLA 1PP9H 4KTNA 3AK2A 4JI8B 4PA9A 2IH3C 5GTHZ 2HKJA 3C90A 3JD0A 4DYLA 3ZJZA 3NMQA 1AJQA 5C8YB 4LP0A 3HKBB 3UQ8A 2BSKA 3T2SA 4JI1B 4B3TO 4UV8A 2AKPA 3K08A 3FYEB 2ZT9B 4UV9A 1CXZB 3CX5F 3DXRA 4LWSB 4MBCA 3CC7V 1JCHA 2HJFC 2EULA 1Z5AA 4FCPA 4JZ2A 3JALA 4Z1MG 1FXKA 2Q67A 3FB5C 1Z5BA 4CWNA 2YI8A 2CCSA 4ZKIA 1YJWV 4MS2A 1N8RW 3OTOB 2YEIA 4O2AA 2JKIA 2BREA 1ZX3A 3E8GA 2PGGA 3E8HA 1D5NA 3JSNA 2GDSA 2AZ2A 1HNWB 3CSXA 1KIJA 2MK3A 1N36O 1SESA 4DR3B 2YE3A 3OFNG 2RJZA 2UUBO 3CGZA 2D2CB 4UCSA 2UXDB 3HHUA 1EBOA 4CWPA 1Y8OA 3APOA 2P6JA 4ZI7B 3RBZA 4UB6Z 1F7YA 4NTYA 5H9CA 4I7ZB 2E74B 2JJ1G 3WB0A 3ASOC 1R6TA 2YEVB 1WA8A 1JM6A 2HJDA 3R4NA 4B3SB 2X0LA 2FB5A 1HP8A 4NTXA 3CC2V 4URNA 1IZ3A 3FAVB 1TUBA 4LBEC 3KKYA 1NI8A 1YEWA 3CS5A 2QG0A 2ZCEA 3K0DA 3Q5JA 2CE4A 1YSRA 5JJJB 1T5EA 4LF5B 1EN4A 2GBOA 1K73W 2E3CA 3K79A 1VQPV 2XDSA 4DV5B 2OIGA 1RM1C 1NKDA 2EINC 2QM8A 1TAEA 1WAZA 3FYIB 2IJJA 4HZ3A 2Q8FA 3IC7A 2JDIG 4X1IA 2JVDA 1YESA 3K60A 4ASUG 2CGOA 2WI5A 4URLA 4DR1O 2D3OW 4KHPB 3DTUB 2WLLA 1YVWA 5B1AC 1GN6A 4WBNB 4K0KB 4CE3A 1N4CA 3OW6A 4NB5A 1Q43A 2DMXA 2CTWA 3K3WA 4GKKB 2LW7A 3JD2A 4RUFA 4O05A 2W6JG 3OD4A 4LWHA 1THZA 5KUMA 4UCUA 3C0EA 1H2SB 3N27A 3OMUA 3DC5A 4LP8A 2QSAA 1GM7A 3CWBH 4L8JA 4L91A 1ZWHA 2R72A 3TZ0A 3RYCA 5KHIA 4HNAB 4RUEA 4FCQA 4JI5O 4O4LA 2KB1A 1U96A 4TV8B 3K59A 1NR7A 3W7XA 4EMVA 1DLBA 5CMUA 1H8EG 1U0ZA 3JASB 2YSUB 3ASNC 4ZVIA 3SPJA 2LJ2A 4EFTA 2XDKA 2FTKA 3VQWA 1RSOB 3H1JH 2ZDIA 4B3RO 4HXWA 1NS1A 5B3SB 4EFBA 1RP3B 2OCCC 3ABKC 3E22B 2VQFO 1K8AW 5LMNB 1YT2A 4LFBB 1S16A 3ZHVA 2W6IG 1OCRB 3K5OA 2Y0IA 2VS0A 1BCCH 1Y66A 4LWFA 3AG1C 3RYIB 5KLVH 3ETEA 3JAKA 4X64O 5LBQA 2Y4TA 3B40A 3BM9A 4H7QA 2E5LO 4YJ2A 1EZVH 4NTWA 4UROA 4O4IA 2QR4A 2YKBA 4DO2A 4WUDA 3JD3A 2QM4A 3RYHB 1A4HA 3D36A 1QY8A 1IBLO 5C8YA 5M4HA 4R3MA 3HKBA 2ARHA 4HXZA 2N04A 5LOVA 3LNNA 1SZTA 1EM1A 2H55A 4O4HA 4G2KA 2Q8IA 4GX5A 2XCMA 5JWPA 1OCCB 3VHCA 1I5AA 4R6ZA 2CAZC 5IWAB 2F43G 3B28A 4LFAO 3T1YO 1EI1A 3T10A 4AWPA 1FJGO 1I5DA 2L6LA 3ZCCA 4BW9A 4YHHO 3H1IH 3OGCC 4GYCB 3CMEV 3ABUA 4J7KA 3G7EA 1VF7A 2XABA 1DF5A 1FFXB 4JI3O 2QWPB 4X62B 2FYPA 1D5AA 3AK3A 3J81N 1WP8A 5BY1A 4Z2WA 4I50B 4YKTA 1NBMG 1UFIA 2A7WA 2YEDA 4HYMA 4ZI7A 5IJ0A 4NVPA 4X20A 5BOCA 2WEQA 4YKXA 1SS3A 1M9NA 2R9RB 4U7OA 2CH4A 1LUWA 1UYCA 3B26A 1XMOB 1YZBA 4DV0O 5LGUA 1Y8NA 4AQYB 2YEGA 1YC1A 3R4PA 5F5RA 2GQPA 2FL4A 5KA5A 2YGFA 1TC6A 2BZ5A 1OV9A 1DF4A 3JAWA 2GV9A 2IJHA 2YKEA 3LDCA 4O4JA 4DV3O 2EILB 5EBMC 1IBMO 4P7AA 5LMUO 3ZMUA 2DE0X 2EIKC 4FLZA 4HZ0A 3G75A 2RMKB 3QF7A 4BW5A 2YK2A 2ZR2A 2CDYA 2XHTA 1SC5B 1R6KA 1S5HC 4DR7O 4XITA 4JI4O 1SERA 4UVBA 4U93A 2BU6A 3O2FA 3ZBHA 3Q4HB 3E89A 1Q81W 4ASAA 4WBNA 4KQVA 2B9ZA 2ODMA 2YE5A 1F4NA 4YJ3A 5IY5B 3HR0A 3K58A 4JI6B 5LXTA 2F4VO 2CG9A 2Q8HA 4RQEA 3TJTA 1K97A 1AM1A 4MTGA 4PU9A 4AI8A 1YXBA 3ZHRA 4EEQA 4PHZA 3JAMN 4U3JA 3O9OA 4J10A 1OZ0A 4X65B 2P7TC 4KSHA 1K4DC 2IH1C 2WLKA 4JV5O 4HNAA 1XOUA 1MABG 3TZ5A 3RW0A 3JD1A 2FWYA 4TV8A 3VHDA 1SRYA 4HYPA 2Q7EA 2E76B 1YS3A 2ZBKB 4DV2O 2Q8GA 3B2EE 2PF4E 2QWQB 4LF7O 2QKAA 4GLXA 4FLUA 2UUBB 3CRLA 1I7FA 4O2BB 1ZW9A 1Q7YW 4QGPA 4MVQA 3T1HO 1FD9A 1MG1A 4NXMB 2IORA 3ZRVA 2GUZB 4JPRA 4CH6A 3HZ5A 4NR1A 4MPNA 2Z5UA 3E22A 1OJHA 4V25A 3FKSG 1UYDA 4DUYO 1KKDA 3TETA 4EGHA 4XDMA 1G1XB 2HVKC 2UXNA 3SJAC 1E1RG 3RYIA 5D7DA 3K04A 3EVKA 3ICXA 3H01A 2EIMC 3QVNA 2QM7A 1VQ8V 4F6RA 3CP1A 4PV1B 3ZMSA 1KC8W 1CEZA 4PDMA 1UJWB 4XDKA 2BSKB 2C1GA 2X6BA 2BT0A 4KFGA 1TILA 1VQ4V 2W0XA 2DQ3A 4PI2A 1QLEC 4WFGA 4DW0A 1U97A 4FLVA 1GN2A 1KMIZ 2JEUA 2OT5A 1GM9A 3DXRB 1Y8PA 1M57B 4DR1B 3OR6C 2WI4A 5KHGA 2ZINA 2M7WA 2QEXV 3O6OA 4JAAA 1V55C 5BODA 2XOKG 3JALB 3UKMA 1WNSA 1JA8A 2VWCA 5M4MA 2P06A 4O2AB 5BXZA 5D7CA 1TGOA 1SQXH 3A0XA 3SJCC 2F23A 2Y69C 5IJ9A 2OYQA 4XE2A 1ORQC 2CK3G 2YI9A 3WHAA 3VQYA 4NXNO 3BEHA 4YKUA 3WB2A 2ZKOA 4CWOA 2IOPA 3L71H 3UO3A 4U7NA 3CC4V 5L3DA 1WA8B 1Z5WA 3NXSA 3B8MA 3A0ZA 5M4NA 1KP2A 1UYHA 4O07A 3X2QC 5LYJB 2IWSA 1GKXA 1HNXO 2HFEC 3CE2A 3UO2A 1VF6A 1TUBB 5KHJA 1LR1A 4OXSA 3L73H 5L3FA 3JSLA 1QVGU 5DECA 2VWJA 2C2AA 3TUHA 5CA1B 3ZX6A 2Q73A 3L75H 4XTJA 2O1UA 3PEHA 1MA1A 3BA9A 1SETA 3QO5A 2WLJA 3CRQA 2QWRB 4RO2A 2WSSG 4L94A 2YI5A 4RAIA 2BTZA 3SL2A 1BT8A 4MVZA 4X64B 1K9MW 2CCTA 1AMWA 2ZXWC 1S0VA 5A2QN 3ZMVA 4QE9A 4IGGA 1MZFA 4BR6A 2HCHA 1CP9A 2DOSA 5LL6Y 2XASA 3H9VA 1VQLV 4EM7A 3KG2A 1UY7A 2ZNIA 1FXKC 2YI7A 4BQGA 1IBLB 1URFA 2A79B 4OPAA 4CH4A 2EXLA 2OWOA 1EA6A 3CRMA 3IGAC 5CB4A 1H2KA 1QVFU 4GEEA 3ZXQA 2OIEA 3GWOA 2LGQA 3FT5A 2DWDC 3RYCB 2XD6A 2H94A 1TBWA 1PV0A 4DV6O 1FJGB 3RWRD 5J71A 3R4OA 3WG7B 4FM1A 5DM6V 3D2RA 1FXHA 1YHQV 2WLMA 4DW1A 4WUBA 3U11A 3FB6C 1TA8A 3KZIZ 1QNMA 2GHYA 4I55B 1IBKO 4JI3B 1FAFA 2YE4A 4PDVA 3CCRV 3JATA 4O2BA 2RQ6A 2ZM6B 2QF6A 4UVCA 1Z5CA 4CBCA 4JI2B 4YKQA 5IE9A 3CD6V 3SPIA 1KZNA 5FNDA 4X89A 1M1KW 1Y4SA 1Y67A 1NZ6A 2W0FC 3WFVA 2P22C 1YT0A 3GWKC 3EKOA 4DV0B 5L3GA 1F23A 1XI1A 3IAYA 2WEPA 4DV1O 4L87A 4OX9O 1L1FA 2WWWA 4O4IB 5D5QA 4WF9V 1I94O 3KE6A 3SPHA 4DV3B 1US6A 4I5SA 4MW8A 4HZ5A 5LMUB 1JQ0A 4K8ZA 1M5IA 1BQZA 2KQXA 1M56B 2AXTZ 2ZE6A 5LOVB 2QFOA 4X66O 4UCVA 3LSUA 4O4HB 3PEJA 5JH7A 2ETNA 1AP5A 4DR7B 4URMA 4MOTA 4JI4B 4FZ1A 2HG5C 4YKZA 2UXCO 1WN7A 4IL6Z 4H44B 4MB9A 3BY6A 1UY8A 4TSFG 4BQJA 1YJ9V 2XT9A 3OMNB 4UVAA 4KUMA 3SDLA 4JASA 3SR2C 3ZHTA 3OEHG 4FMTA 4DR6B 1YC4A 1Y76B 1KECA 4LR3A 4MP2A 3H4LA 5FL7G 4E02A 2X6AA 2DYSC 3LUTB 4JV5B 2ZDIC 5FLXN 2JS5A 4E72A 5LHGA 5KX5A 2K1EA 1BSMA 1X59A 5IJ0B 2Q7HA 1K5QA 3AG3B 3WB1A 1BKNA 1L0OA 1XEQA 4X20B 4GUNA 1IX9A 1L0NH 3SJBC 1U2OA 4BIOA 1W0KG 4LF7B 4LWGA 3GIFA 2QA4V 3R4MA 1JVMA 1Q90D 5LYJA 2YIDA 1NJIW 2H8PC 3T1HB 1ZAUA 2YJWA 4XIPA 1NTKH 5M4EA 1I0HA 2LGWA 1EZJA 2YEEA 5CA1A 3JAWB 3LMMA 5GTIZ 1Z59A 2JIZG 4HY1A 3D36C 3A0YA 3OUSA 4IYIA 4O4JB 4PA3A 5FNFA 4JGSA 1JR9A 4DK1A 3M8AA 3AG4B 5CTUA 2BCCH 3SJQC 1XL4A 3LSSA 3CWVA 1VEWA 1TVKB 5LHIA 4R1FA 4TWKA 1P49A 3T0ZA 1S77D 1PNMA 5IN9A 1E79G 4C7UA 1GKZA 4WFHA 4XCJA 2AW9A 4ZIBA 1AILA 1K7DA 3E8FA 4FK5C 1XBLA 4YJ3B 2AGAA 1PD3A 5LXTB 2Q0OC 2QTOA 4P9PA 1P84F 3CCLV 4FJCC 4DUZO 2IWXA 1YT1A 4LF6O 4MVMA 4JTCB 4U3JB 5LGNA 4DRXB 1O9GA 2BTQA 2YE6A 4FLYA 4HYOA 4XDJA 5J2TA 1XMQB 4H85A 1A32A 3U10A 2IM9A 3HYZA 1NTMH 4HAMA 2ITCC 1WB7A 3EHGA 1BGYH 2XAQA 4LWIA 2RNBA 3SYQA 2EX3A 1UYIA 4PA6A 1OCZB 2Q8VA 3U67A 5CBFA 4JI0B 4I55A 3TCUA 4NXNB 3JZ3A 2VW5A 1S14A 4R8CA 2BOCC 2GTSA 4AS9A 4JYAO 1AI6A 3RT3C 2WLIA 3FV5A 2OTJV 3JCUZ 1COWG 1QYEA 3SYAA 2PI4A 4DV7B 3K9SA 3J7AU 4J7ZA 1R6NA 1M90W 5EK0A 4PRXA 2NLJC 1HNXB 2UU9O 1VQ6V 5BR8O 3SPGA 2RN9A 1R3IC 3KCYA 4CH3A 2CH7A 4LWEA 2YUAA 2HP8A 1NHJA 5B1OA 2E75B 4F6RB 4ASFA 3GVMA 4YY3O 2PNRA 1FKAO 4MTOA 3GIEA 4O04A 2PTMA 2BRCA 1AR5A 2FWZA 2DW4A 1H2NA 2IU3A 4QNHB 5LHHA 1HNZO 4GFNA 2YEJA 5LGTA 3FB7C 4JF3A 2N05A 1AR1B 4E4EA 2XAHA 5FPOA 3RYFA 1N32O 2YGAA 3GIGA 1AJ6A 2BU7A 2IOQA 4O09A 3RN4A 3G7BA 1O9HA 2Y48A 1PL0A 2CGFA 2ESAA 1N0NA 5B1BB 1FYJA 2VCIA 2Y4UA 5CF0A 3OPDA 1WJZA 5IJ9B 1QLNA 4L93A 1Y76A 3MD0A 4PDRA 5EZYA 2LQTA 4DR5B 4QIWF 3B4SA 1N34O 2P90A 5B3SC 3VHAA 1Q6HA 2YI6A 3CRRA 1AI5A 1IVSA 4EEHA 2Q69A 2B1GA 4PA7A 3G71V 1XL6A 1IBKB 4BIUA 3ZHUA 1OCRC 2VQEO 4DR4O 2WPDG 3AG2B 1G4YB 2UXBO 3PN1A 3O0IA 3ZEDA 2GTAA 1GN3A 2YXHA 4KSGA 3BABA 1M93A 1QQCA 2UUAO 2Z0AA 1F51A 1S76D 1SQVH 2YKJA 4XKKA 3BMYA 3R92A 3U0ZA 3AEIA 3QO7A 4JYBA 3INXA 4DR2O 3G67A 1NR1A 1VQMV 2X7RB 4DV1B 4JQLA 1XHZA 2BOBC 1Z2GA 2LP7A 2BU8A 1TVKA 3K06A 1OCCC 1I94B 3ZN1A 2QWNB 4F6EA 5L3BA 3L70H 3BRCA 4JI8O 2OCHA 5H6RA 4P8OA 4XDLA 3C3SA 3E2EA 4G27B 3L72H 1B04A 5KA6A 2YIBA 4B3TB 1V54B 5EYPB 3KCXA 4X66B 5M4KA 3D0BA 1Y74A 5CB4B 1TUEB 3JARA 5IDJA 3QDDA 2WAMA 3CCJV 1K34A 3EKRA 3UT5B 2YEHA 2LFRA 4DRXA 3ZXOA 2DYRB 2WLHA 2PYLA 4ASGA 3RVYA 1WP7A 1KBHA 1YERA 5F3KA 2KG7A 1WLEA 3EXAA 5D7RA 2F1MA 4EGKA 4P9OA 1M4UA 5KAFZ 1KB9F 4AILC 5CA0A 3N2KA 5D6QA 3HKEB 1N36B 3P32A 3T0HA 3WU2Z 3W7UA 3MNRP 1SQBH 3JATB 1OCOB 4FFBB 3SYPA 2CTRA 3A8TA 3ABLB 1Q86W 4MVOA 1EN6A 5B1NA 2XNDG 3BPZA 2YS8A 3H80A 2K9PA 2XDUA 1I5BA 2GSMB 2EILC 5ITZA 1GRJA 1E1QG 5EBLC 3ZRXA 2YJXA 4B3SO 3K5MA 3K9AA 5E1AC 1ZXMA 2PZSA 3SYOA 5H2FZ 3U2DA 5LA6A 3J80N 1H8HG 3N2GA 1Y6XA 2ITDC 3F7YC 4BAEA 1ROPA 2EIJB 5IY5C 4HY6A 5KHKA 3S5TA 1YSCA 1AJNA 3PJSK 5JH7B 2HHIA 2ADPA 1DTOA 3HZ1A 4EGIA 1QR9A 2LO1A 2ZE7A 3H1KH 5GW7A 1ZLZA 4KHPO 4ZBMA 5JVDA 3L74H 4QPJA 2BSMA 1UY9A 1R3LC 3MHHC 1XDCA 3MAQA 2XDXA 4PJ0Z 1EFRG 3HPLC 3EHJA 4JYCA 4EFEA 2YICA 3CMAV 2EZOA 1K5SA 2YKCA 3CB2A 1VMGA 5JCOC 1DGSA 4YKWA 4YIPA 2Q5ZA 3GB7C 2VWKA 3IFXA 4IYHA 1GKFA 2XUMA 1R3KC 3DGEA 4FLXA 4JI5B 3S3XA 3DC6A 1P7GA 5KX5B 3JD4A 3LNMB 3ZRSA 2DJVA 3CPWU 1KD1W 2O1WA 1H7SA 2JK5C 3ABMB 5KHHA 2HKOA 5H5NA 1QCEA 1Q6UA 2Z3YA 3CRKA 4TOIA 2JJ2G 5LP6B 5CBHA 3R91A 3I55V 4MPCA 2EBOA 2KSDA 3K5NA 5FNCA 4EKWA 4B3RB 2F95B 3IJ4A 2WLNA 4HBNA 4JYAB 3CEIA 5CPHA 2FXSA 2B5UA 4X88A 3ZRWA 2VQFB 1UYMA 5HFLA 5EC2C 3HKCB 1KP3A 4YKRA 2UU9B 4J80A 5LMNO 4WFEA 1VQ5V 5IYDO 2N74A 3TTZA 4NYKA 2QG2A 2E5LB 4BAYA 1AP6A 1M57C 1R1BA 4W4KA 4W7TA 3VBBA 2PI5A 3LSQA 4YY3B 4LF9O 5KUKA 3JCZA 2XJJA 3D8CA 5DN6G 4LFCO 2ZKJA 4LF8O 4K3AA 4EB6B 3CRAA 5EYPA 4J42A 3B25A 4R7CA 4TUYA 1TH8A 2ZDYA 3STZC 2JGUA 1R73A 5F2VO 2BTQB 3OM3B 3OMIB 2A0LA 3UT5A 3K97A 1KUQA 4LFAB 1N32B 4P30A 3T1YB 5J2TB 1J5EO 5IWAO 3CRCA 1F4MA 1FXVA 2ZR3A 2BYIA 4YHHB 2HHHO 2QWOB 5L3CA 1G6UA 3FFQA 3CCEV 1JMKC 3CCVV 1NVPB 1SKVA 2ZIMA 3HKDB 1EN5A 3BCCH 4PI0A 1W0JG 2WERA 3HKEA 3AK1A 5D5PA 4ABMA 1GAXA 2YEBA 4UCRA 1N34B 2QKSA 1K33A 2XTAA 4QPKA 4FFBA 1QBZA 2XHRA 3CJHB 2WLIB 3FD9A 1YTFD 3WQ9A 2YXLA 2FMLA 3G4SV 2C1IA 3LDDA 5TISZ 1NH2B 1YTFB 2L35A 1WPXA 4FLTA 1KYOF 1KU9A 2VQEB 4DR4B 2XJGA 4Z1VA 3R65A 4JAUA 1VP7A 1S72V 1G8MA 2QDOA 4X1KA 4X1YA 2CH7B 2YE9A 4XKOA 1XMOO 3CXCU 2XAJA 4AQYO 3RKZA 3K57A 3HB3B 4WFAV 3VQVA 4MPEA 4XIRA 2LFSA 2A3QA 5JENA 1ZL8B 1AJPA 4I4TB 4LF4O 4D7TA 1LNQA 3H1LH 3T2MA 3ASOB 4IT5A 3W7SA 1IBMB 4XIQA 4UXNA 1NHIA 4CWSA 3OWDA 3K5LA 4B7PA 3FT8A 3TZ2A 1MSWD 1W59A 4CE1A 3QO8A 1VQKV 1NU1H 3OE7G 4YKYA 1BQ0A 2FYUH 2ZIOA 2A9HA 3RYFB 2WI1A 1SQQH 1H2GA 5KAIZ 3GIGB 2ZE8A 4E2LA 2F4VB 3EHFA 3WG7C 2XX5A 4MW3A 1RM1B 1I5YA 3M99B 2YC0A 2Y0PA 1UYGA 4JI6O 2EINB 2XHXA 2IJKA 5IYCO 2PUSA 3E83A 4WFBV 2O1VA 2DQ0A 3K0GA 4JYYA 1I5CA 4ZOLA 1YITV 5EZYB 2R9AA 3CHXA 5DEDA 4TQFA 5FNVB 1US7A 1VQ7V 5J6AA 4E00A 5B1AB 4X65O 1VQNV 4OPHA 3BVOA 3AG7A 3BFRA 3MDSA 3E8BA 1XREA 1B6QA 4J11A 3BHPA 2R9IA 1IURA 4DV2B 3A2FA 2Q6AA 1HW7A 5LP6A 4FIPC 4MTXA 3TK1A 1UYLA 4JI7O 2JGDA 4V26A 3QTCA 1JOYA 4MT8A 1ZTEA 4NXMO 3RLPA 4FPPA 3QTFA 5KMGB 3C3TA 4FM2A 2NN4A 4P2ZA 5EC1C 4GKJO 3HKCA 4DUYB 4NH7A 2RDCA 1AH6A 2QE7G 4MVSA 3W7WA 4GX0A 1M56C 2VRZA 3ASNB 4UCTA 4B3MO 4RQFA 2WA4A 3CCQV 3LPSA 5IYBO 3RLQA 2P67A 1TC0A 1AROP 4CWQA 1TIDA 3CCUV 2M6YA 1Q5OA 4L8ZA 4JZGA 2OCCB 3ABKB 4IIJA 5CN0A 2PY5A 2LW1A 2YIBD 2CTQA 1YC3A 2XAGA 1AI7A 3LNUA 2QGNA 1I08A 1Y74B 4EB6A 1BHAA 1R62A 2YK9A 3JARB 2V4DA 3AG1B 3OWBA 4LPBA 5B66Z 1MMMA 1PM9A 2BU5A 3INWA 3R66A 3K98A 4EFUA 1JJOA 4K4OA 3QNEA 3B8NA 4LC1A 2KG7B 5E79Z 3AG3C 4GT1A 2IU0A 2ILMA 3W7TA 4H81A 3ZHQA 5CA0B 4I0XA 3N2KB 4GX2A 2Q68A 3HKDA 1I59A 1QR8A 2XK2A 1AR4A 4GCZA 4CE2A 1X4TA 1IXMA 1JFFB 1FPOA 4XD8A 4DV4O 4U3FH 3RFRA 4KFMA 3T1KA 4PDLA 3CJHA 1YDXA 4LNUA 1V9PA 3TZ4A 4TQDA 4J7JA 4DUHA 4H13B 3OAAG 5ITZB 3NR7A 2HEPA 3D3QA 3AG4C 3OUFA 2V1DA 1GM8A 2UWDA 2ZD9A 2IBZH 4LH6A 4ZHQB 3OMAB 1IDSA 2YIAA 3K03A 4JTDB 2RCVA 5K1XA 3ZMZA 2P4KA 4F4LA 3OTFA 3ABTA 2XX4A 1SQFA 5LA6B 4Q6GA 2UUCO 1XNRO 1Q8IA 1D2DA 2JJCA 2Q2EB 1ZL8A 3N2GB 5GGZA 1OHHG 4I4TA 1HR0O 3BAAA 4PRVA 1UYKA 1YI2V 1B63A 2XX2A 2EZPA 1N33O 3F7VC 4I9QA 4KXRA 2XJXA 3ZKBA 2A06H 3DSQA 4LF9B 2CCUA 4J41A 3H1HH 4LFCB 2HG1A 2CUGA 5JVDB 4TV9B 3T4ZA 1IXBA 4B7KA 4WUCA 4LF8B 3RLRA 5IT9N 4D6TH 1GMGA 2HVJC 2BU2A 4GT8A 1GN4A 2JEXA 2EIKB 4BXIA 3S3WA 1B62A 1H38A 3CYGA 3ZS8C 5IDMA 3ETGA 1K3EA 1OCZC 2Q0AA 3TXQA 3VOUA 5CA3A 3P3PA 1YF2A 4LWSA 1BE3H 4DV6B 1J5EB 2ZE5A 2BTOA 3VADA 5FNVA 2P5OA 1PPJH 1WPBA 3ZIAG 1VIBA 1KKCA 2X6CA 1RFYA 2HHHB 1FFTB 2IWUA 1JPXA 5GONB 4RWUA 2JS3A 3FB8C 1ID0A 4I3HA 5HFMA 4CS2A 4UUJC 1VQ9V 1NHHA 2ADQB 1L8DA 4B08A 4QE7A 1Q82W 3MHSC 1VQOV 3APQA 2KKWA 1HWYA 1ZXNA 1MZEA 3A0WA 2Q7GA 1PKXA 1ENVA 3UM7A 3B27A 2ZM6O 1L0LH 3A0TA 1RPRA 2YGEA 3ZRWB 4JI2O 4D7SA 2AZ0A 1VF5B 3E35A 2E0AA 4IHJB 5KMGA 2XHBA 1SF9A 3CXHF 3D3IA 2YEVA 5BMVB 1QZRA 1RPOA 4NKGB 3K99A 3Q5KA 3U2KA 4OX9B 3CGYA 4H37A 3FAVA 1Q3EA 4AWOA 3B24A 4J9YB 1KQSU 1XNQO 4X9QA 2PYJA 3E86A 4LF4B 4H0LB 1PNLA 2V7QG 3STLC 1BGQA 2YECA 4NH9A 5IYZB 2YEAA 1P7BA 3O65A 1SA0B 3G6EV 5B1BC 4TUYB 4JI1O 1CPYA 2WI7A 2K5BA 2P4VA 3LDEA 1BL8A 4XC0A 4MSWC 5CTYA 2BE3A 2EIMB 2UXCB 4AHCA 4CZZA 3ETQA 4I9WA 1W2BU 2Q4PA 4K8XA 4AWQA 4DK0A 4PD4F 2ZQMA 1UPGA 3TXSA 1QLEB 1ZWIC 3ZN0A 2YE2A 3OTOO 1MX0A 3RVZA 1NTZH 4XBFA 1R3JC 1ZUQA 4DR6O 4MVRA 1Z5VA 4TT3G 1HNWO 1GO3F 1K4CC 3AG2C 4CS4A 1VF6C 3B77A 1V55B 4FVMA 4L90A 3THOA 4DR3O 1JFFA 1I58A 4DZYA 4LCUC 2UXDO 3OT7A 5L3EA 1JX9A 1HDJA 3ZKDA 5A9GA 3RGBA 3OEEG 1YCIA 4MP7A 4KL1A 2Y69B 1MOFA 2UXXA 3JASA 4X1KB 4JI7B 4X1YB 4KP4A 3CCSV 4B7EA 1QHTA 2XAFA 1MU5A 1RSOA 4CH5A 4ASBA 2CTPA 4ZHQA 3CCMV 4JAVA 1S3JA 3I5DA 5JQGB 4GKJB 4B6CA 2IJIA 4CC5A 4LF5O 5B5EZ 3SGIA 5EBWC 4B3MB 4CC6A 1B3QA 1V54C 1MSDA 3SPCA 2DWEC 3ZMTA 3X2QB 4DV5O 2F66C 1YETA 2WI6A 5J2UB 3B09A 4GGLA 2EJRA 4OGQB 2YKIA 5FPRA 1YIJV 1Y4MA 1H2MA 4YXWG 3EHBB 2DYRC 1GK9A 2DN9A 4TV9A 1J95A 3RYHA 5BZBA 4DXWA 4K0KO 4FFKA 4QJFB 4DUZB 1P4RA 4GX1A 1ZSPA 4LF6B 2GFDA 1UYEA 2WI2A 5D6PA 4GKKO 1AB3A 4UCOA 1S5JA 1MNGA 2ZNJA 2ZXWB 4ZOLB 1AH8A 5C93A 1OCOC 4LH7A 1WB8A 3OGIB 1FXKB 3ML0A 1JJ2U 4ICGA 1XMQO 2QJ1A 1BYQA 4FLWA 3ABLC 1XILA 2YEFA 3ZHSA 4G28B 5GONA 3OR7C 1AVMA 2OTLV 1XHXA 4CWRA 4CWFA 1BZKA 1GTOA 5K1PA 4J9ZB 2FKXA 4X8AA 2AHZA 5JJEB 4R50A 1FFXA 3BA8A 4JI0O 3IC9A 2JGDB 4DV4B 1PL4A 3OW2U 2VCJA 4CWTA 5FWKA 1SZXA 4CS3A 2QKCA 1BMFG 2WI3A 5CBGA 5EIBD 3ETDA 4I50A 3FX7A 2NR5A 2R70A 2NNUA 4IHJA 2O57A 3SYCA 1GJVA 2HLDG 4UB8Z 4DV7O 2EIJC 4PELA 5BR8B 1Y4UA 4LFBO 3T4DA 5BMVA
chains in the Genus database with same CATH topology
1FS0G 5H6QA 2H8MA 4E01A 4PL9A 4MVUA 3HEKA 2B1IA 4BIZA 2IW5A 1PNKA 1THNA 1BXDA 4JTAB 2HR3A 4PA4A 5M4PA 3IEDA 1YSZA 3Q5LA 2WLLB 1NQTA 3A0RA 2XDLA 1NVPD 3ABMC 1UYFA 1UY6A 4GQTA 2YE8A 1H7UA 1OSFA 3C11A 3T1CA 3CYOA 3HYYA 5CTXA 3JYCA 2ATKC 4FCRA 1NH2D 4R3AA 1K92A 1AI4A 3I56V 2YE7A 5CTWA 1I5XA 1BHBA 2YI0A 3F5WC 4WFFA 2DYSB 5L3JA 4MTFA 1YJNV 4WCEV 3EFFK 4H33A 4N21A 4XKAA 4Q20A 1PVGA 3EHHA 4O0BA 3P30A 2AHYA 4N23A 5J9PC 4NH8A 2ZDXA 2BYHA 4X9LA 3ZM7A 4XCLA 4KTNA 4PA9A 2IH3C 2HKJA 3JD0A 3ZJZA 3NMQA 1AJQA 4LP0A 3T2SA 4UV8A 2AKPA 3K08A 3FYEB 4UV9A 4MBCA 3CC7V 1JCHA 2HJFC 1Z5AA 4FCPA 4Z1MG 1FXKA 2Q67A 3FB5C 1Z5BA 4CWNA 2CCSA 4ZKIA 1YJWV 4MS2A 1N8RW 2YEIA 2JKIA 2BREA 3E8GA 3E8HA 1KIJA 2MK3A 1SESA 2YE3A 3OFNG 3CGZA 3HHUA 1EBOA 4CWPA 1Y8OA 2P6JA 3RBZA 5H9CA 2JJ1G 3ASOC 2YEVB 1JM6A 3R4NA 2X0LA 3CC2V 4URNA 4LBEC 2QG0A 3K0DA 3Q5JA 1YSRA 1K73W 3K79A 1VQPV 2XDSA 1RM1C 1NKDA 2EINC 2QM8A 3FYIB 2IJJA 4HZ3A 2Q8FA 3IC7A 2JDIG 1YESA 3K60A 4ASUG 4URLA 2WI5A 2D3OW 3DTUB 2WLLA 5B1AC 4CE3A 3OW6A 3K3WA 3JD2A 4RUFA 4O05A 2W6JG 4LWHA 1THZA 5KUMA 3C0EA 3OMUA 4LP8A 1GM7A 4L91A 1ZWHA 3TZ0A 4RUEA 4FCQA 2KB1A 1NR7A 3W7XA 4EMVA 1DLBA 5CMUA 1H8EG 1U0ZA 2YSUB 3ASNC 4ZVIA 3SPJA 4EFTA 2XDKA 2FTKA 2ZDIA 4HXWA 5B3SB 2OCCC 3ABKC 1K8AW 1YT2A 1S16A 2W6IG 1OCRB 1Y66A 4LWFA 3AG1C 3ETEA 5LBQA 3BM9A 4H7QA 4UROA 2YKBA 4DO2A 4WUDA 3JD3A 1A4HA 3D36A 1QY8A 5M4HA 4R3MA 4HXZA 1SZTA 2H55A 2Q8IA 4G2KA 4GX5A 2XCMA 1OCCB 3VHCA 1I5AA 4R6ZA 2F43G 3B28A 1EI1A 3T10A 4AWPA 1I5DA 3ZCCA 3OGCC 3CMEV 3ABUA 3G7EA 2XABA 1DF5A 2FYPA 4YKTA 1NBMG 2YEDA 4HYMA 5BOCA 2WEQA 4YKXA 1M9NA 2R9RB 4U7OA 2CH4A 1UYCA 3B26A 5LGUA 1Y8NA 2YEGA 3R4PA 1YC1A 5F5RA 2GQPA 5KA5A 2YGFA 1TC6A 2BZ5A 1DF4A 2IJHA 2YKEA 3LDCA 2EILB 5EBMC 4P7AA 3ZMUA 2EIKC 4HZ0A 3G75A 4BW5A 2YK2A 2ZR2A 2XHTA 1R6KA 1S5HC 4XITA 4U93A 1SERA 4UVBA 2BU6A 3O2FA 3E89A 1Q81W 4ASAA 4KQVA 2YE5A 1F4NA 5IY5B 2CG9A 2Q8HA 4RQEA 1K97A 1AM1A 4MTGA 4PU9A 1OZ0A 2P7TC 4KSHA 1K4DC 2IH1C 2WLKA 1MABG 3TZ5A 3RW0A 3JD1A 2FWYA 3VHDA 1SRYA 4HYPA 1YS3A 2ZBKB 2Q8GA 3CRLA 1ZW9A 1Q7YW 4MVQA 1MG1A 2IORA 3ZRVA 4JPRA 3HZ5A 4MPNA 2Z5UA 4V25A 3FKSG 1UYDA 1KKDA 4EGHA 3TETA 4XDMA 2HVKC 2UXNA 1E1RG 5D7DA 3K04A 3H01A 2EIMC 2QM7A 1VQ8V 3CP1A 3ZMSA 1KC8W 1CEZA 4PDMA 1UJWB 4XDKA 2X6BA 2BT0A 4KFGA 1TILA 1VQ4V 2DQ3A 1QLEC 4WFGA 2OT5A 2JEUA 1GM9A 1Y8PA 1M57B 3OR6C 2WI4A 2M7WA 2QEXV 3O6OA 1V55C 5BODA 2XOKG 3UKMA 2VWCA 5M4MA 5D7CA 3A0XA 2Y69C 4XE2A 1ORQC 2CK3G 3WHAA 3BEHA 4YKUA 4CWOA 2IOPA 4U7NA 3CC4V 5L3DA 3NXSA 3B8MA 3A0ZA 5M4NA 1KP2A 1UYHA 4O07A 3X2QC 2IWSA 1GKXA 2HFEC 5L3FA 4OXSA 1QVGU 2C2AA 3TUHA 4XTJA 2O1UA 3PEHA 1SETA 3QO5A 2WLJA 4RO2A 2WSSG 4L94A 2YI5A 4RAIA 2BTZA 3SL2A 4MVZA 1K9MW 2CCTA 1AMWA 2ZXWC 1S0VA 3ZMVA 4QE9A 2HCHA 1CP9A 2XASA 1VQLV 4EM7A 3KG2A 1UY7A 1FXKC 2YI7A 4BQGA 2A79B 2EXLA 1EA6A 3IGAC 1QVFU 4GEEA 3ZXQA 3GWOA 3FT5A 2DWDC 2XD6A 2H94A 1TBWA 5J71A 3R4OA 3WG7B 5DM6V 3D2RA 1FXHA 1YHQV 2WLMA 4WUBA 3FB6C 2GHYA 2YE4A 4PDVA 3CCRV 2QF6A 4UVCA 1Z5CA 4CBCA 4YKQA 3CD6V 3SPIA 1KZNA 5FNDA 4X89A 1M1KW 1Y4SA 2W0FC 3WFVA 1YT0A 3EKOA 5L3GA 1F23A 2WEPA 4L87A 1L1FA 2WWWA 4WF9V 3KE6A 3SPHA 4I5SA 4MW8A 4HZ5A 1JQ0A 1M56B 2QFOA 3PEJA 4URMA 4MOTA 4YKZA 2HG5C 4MB9A 3BY6A 1UY8A 4TSFG 4BQJA 1YJ9V 3OMNB 4UVAA 4KUMA 4JASA 3OEHG 4FMTA 1YC4A 1KECA 4MP2A 3H4LA 5FL7G 4E02A 2X6AA 2DYSC 3LUTB 2ZDIC 5LHGA 2K1EA 3AG3B 1K5QA 1BKNA 1L0OA 1U2OA 1W0KG 4LWGA 3GIFA 2QA4V 3R4MA 1JVMA 1NJIW 2H8PC 2YJWA 4XIPA 5M4EA 1EZJA 2YEEA 1Z59A 2JIZG 4HY1A 3A0YA 3OUSA 4PA3A 5FNFA 4JGSA 3AG4B 5CTUA 3SJQC 1XL4A 3LSSA 3CWVA 5LHIA 4R1FA 4TWKA 3T0ZA 1S77D 1PNMA 5IN9A 1E79G 1GKZA 4WFHA 4XCJA 1K7DA 3E8FA 4FK5C 1PD3A 2QTOA 4P9PA 3CCLV 4FJCC 2IWXA 1YT1A 4MVMA 4JTCB 5LGNA 2YE6A 4HYOA 4XDJA 4H85A 3HYZA 4HAMA 2ITCC 3EHGA 2XAQA 4LWIA 3SYQA 1UYIA 4PA6A 1OCZB 3U67A 5CBFA 3TCUA 3JZ3A 2VW5A 1S14A 4R8CA 2BOCC 4AS9A 1AI6A 2WLIA 3FV5A 2OTJV 1COWG 1QYEA 3SYAA 2PI4A 4PRXA 1R6NA 1M90W 5EK0A 2NLJC 1VQ6V 3SPGA 1R3IC 4LWEA 1NHJA 5B1OA 4ASFA 2PNRA 4MTOA 3GIEA 4O04A 2BRCA 2FWZA 2DW4A 2IU3A 4QNHB 5LHHA 4GFNA 2YEJA 5LGTA 3FB7C 4JF3A 1AR1B 2XAHA 2YGAA 3GIGA 1AJ6A 2BU7A 2IOQA 4O09A 3G7BA 2Y48A 1PL0A 2CGFA 2ESAA 5B1BB 2VCIA 5CF0A 3OPDA 1QLNA 4L93A 3MD0A 4PDRA 4QIWF 2P90A 5B3SC 3VHAA 2YI6A 1AI5A 4EEHA 2Q69A 2B1GA 4PA7A 3G71V 1XL6A 4BIUA 1OCRC 2WPDG 3AG2B 1G4YB 3O0IA 4KSGA 1F51A 1S76D 2YKJA 4XKKA 3BMYA 3R92A 3AEIA 3QO7A 4JYBA 3INXA 1NR1A 1VQMV 2X7RB 4JQLA 2BOBC 2LP7A 2BU8A 3K06A 1OCCC 3ZN1A 5L3BA 4P8OA 5H6RA 4XDLA 3E2EA 4G27B 5KA6A 1V54B 5M4KA 3D0BA 1TUEB 5IDJA 3QDDA 2WAMA 3CCJV 1K34A 3EKRA 2YEHA 2LFRA 3ZXOA 2DYRB 2WLHA 4ASGA 3RVYA 1YERA 5F3KA 1WLEA 5D7RA 4EGKA 4P9OA 5D6QA 3P32A 3T0HA 3W7UA 3MNRP 1OCOB 3SYPA 3ABLB 1Q86W 4MVOA 5B1NA 2XNDG 3H80A 2XDUA 1I5BA 2GSMB 2EILC 1E1QG 5EBLC 3ZRXA 2YJXA 3K9AA 5E1AC 1ZXMA 3SYOA 3U2DA 1H8HG 2ITDC 3F7YC 4BAEA 1ROPA 2EIJB 5IY5C 4HY6A 1YSCA 1AJNA 3PJSK 1DTOA 3HZ1A 4EGIA 1QR9A 5GW7A 4ZBMA 2BSMA 4QPJA 1UY9A 1R3LC 3MHHC 2XDXA 1EFRG 3HPLC 3EHJA 4JYCA 2YKCA 3CMAV 2EZOA 1K5SA 4YKWA 3GB7C 3IFXA 1GKFA 1R3KC 3DGEA 3JD4A 3LNMB 3ZRSA 3CPWU 1KD1W 2O1WA 1H7SA 2JK5C 3ABMB 2HKOA 1QCEA 2Z3YA 3CRKA 2JJ2G 5CBHA 3R91A 3I55V 4MPCA 2EBOA 5FNCA 4EKWA 2WLNA 5CPHA 2FXSA 2B5UA 4X88A 3ZRWA 1UYMA 5HFLA 5EC2C 1KP3A 4YKRA 1VQ5V 4WFEA 5IYDO 3TTZA 2QG2A 4BAYA 1M57C 4W7TA 3VBBA 2PI5A 3LSQA 5KUKA 3JCZA 2XJJA 5DN6G 2ZKJA 3B25A 4R7CA 1TH8A 2ZDYA 3STZC 1R73A 3OM3B 3OMIB 2A0LA 3K97A 4P30A 1F4MA 1FXVA 2ZR3A 2BYIA 5L3CA 3CCVV 3CCEV 1NVPB 1W0JG 2WERA 2YEBA 2QKSA 1K33A 4QPKA 1QBZA 2XHRA 2WLIB 1YTFD 3WQ9A 3G4SV 3LDDA 1NH2B 1YTFB 1WPXA 2XJGA 3R65A 4JAUA 1S72V 1G8MA 2YE9A 4XKOA 3CXCU 2XAJA 3RKZA 3HB3B 4WFAV 4MPEA 4XIRA 2LFSA 1AJPA 1LNQA 3T2MA 3ASOB 3W7SA 4XIQA 4UXNA 1NHIA 4CWSA 3OWDA 4B7PA 3FT8A 3TZ2A 1MSWD 4CE1A 3QO8A 1VQKV 3OE7G 4YKYA 2A9HA 2WI1A 1H2GA 3GIGB 4E2LA 3EHFA 3WG7C 2XX5A 4MW3A 1RM1B 1I5YA 3M99B 1UYGA 2EINB 2XHXA 5IYCO 2IJKA 3E83A 4WFBV 2O1VA 2DQ0A 3K0GA 1I5CA 1YITV 1US7A 5J6AA 1VQ7V 4E00A 5B1AB 1VQNV 3E8BA 1B6QA 2R9IA 2Q6AA 4FIPC 4MTXA 3TK1A 1UYLA 4V26A 1JOYA 4MT8A 3RLPA 4FPPA 3QTFA 4P2ZA 5EC1C 4NH7A 1AH6A 2QE7G 4MVSA 3W7WA 4GX0A 1M56C 3ASNB 4RQFA 3CCQV 3LPSA 5IYBO 3RLQA 2P67A 1TC0A 1AROP 4CWQA 1TIDA 3CCUV 4L8ZA 2OCCB 3ABKB 5CN0A 1YC3A 2XAGA 1AI7A 3LNUA 1R62A 1BHAA 2YK9A 3AG1B 3OWBA 4LPBA 2BU5A 3INWA 3K98A 4EFUA 4K4OA 3QNEA 3B8NA 4LC1A 3AG3C 4GT1A 2IU0A 3W7TA 4H81A 4GX2A 2Q68A 1I59A 1QR8A 2XK2A 4GCZA 4CE2A 1IXMA 4XD8A 4KFMA 3T1KA 4PDLA 3TZ4A 4DUHA 3OAAG 3AG4C 3OUFA 2V1DA 1GM8A 2UWDA 2ZD9A 3OMAB 3K03A 4JTDB 3ZMZA 4F4LA 3ABTA 2XX4A 2JJCA 2Q2EB 5GGZA 1OHHG 4PRVA 1UYKA 1YI2V 1B63A 2XX2A 2EZPA 3F7VC 2XJXA 3ZKBA 2CCUA 2HG1A 3T4ZA 4WUCA 3RLRA 1GMGA 2HVJC 2BU2A 4GT8A 2JEXA 2EIKB 4BXIA 1B62A 1H38A 5IDMA 3ETGA 1K3EA 1OCZC 3VOUA 5CA3A 3VADA 3ZIAG 2X6CA 1FFTB 2IWUA 1JPXA 3FB8C 1ID0A 4I3HA 5HFMA 4UUJC 1VQ9V 1NHHA 4QE7A 1Q82W 3MHSC 1VQOV 1HWYA 1ZXNA 3A0WA 1PKXA 1ENVA 3UM7A 3B27A 3A0TA 1RPRA 2YGEA 3ZRWB 3E35A 2E0AA 3D3IA 2YEVA 1QZRA 1RPOA 3K99A 3Q5KA 3U2KA 3CGYA 4H37A 4AWOA 3B24A 4J9YB 1KQSU 3E86A 1PNLA 2V7QG 3STLC 1BGQA 2YECA 4NH9A 2YEAA 1P7BA 3G6EV 5B1BC 1CPYA 2WI7A 2K5BA 3LDEA 1BL8A 4XC0A 4MSWC 5CTYA 2EIMB 4CZZA 4I9WA 1W2BU 4AWQA 2ZQMA 1QLEB 1ZWIC 3ZN0A 2YE2A 1MX0A 3RVZA 4XBFA 1R3JC 4MVRA 4TT3G 1GO3F 1K4CC 3AG2C 3B77A 1V55B 4L90A 1I58A 4DZYA 4LCUC 5L3EA 1JX9A 3ZKDA 3OEEG 4MP7A 2Y69B 1MOFA 2UXXA 4KP4A 3CCSV 2XAFA 1MU5A 4ASBA 3CCMV 4JAVA 1S3JA 4B6CA 2IJIA 5EBWC 1B3QA 1V54C 3SPCA 2DWEC 3ZMTA 3X2QB 1YETA 2WI6A 4GGLA 2EJRA 2YKIA 1YIJV 1Y4MA 4YXWG 3EHBB 2DYRC 1GK9A 1J95A 5BZBA 4DXWA 4QJFB 1P4RA 4GX1A 2WI2A 2GFDA 1UYEA 5D6PA 2ZXWB 1AH8A 5C93A 1OCOC 1FXKB 3ML0A 1JJ2U 1BYQA 3ABLC 2YEFA 4G28B 3OR7C 2OTLV 4CWRA 4CWFA 1GTOA 4J9ZB 4X8AA 2AHZA 4R50A 3OW2U 2VCJA 4CWTA 5FWKA 1BMFG 2WI3A 5CBGA 3ETDA 2NNUA 1GJVA 3SYCA 2HLDG 2EIJC 4PELA 1Y4UA 3T4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O1V A;  1I5C A;  4LWE A;  1US7 A;  5J6A A;  2H8M A;  4E00 A;  4KSH A;  4E01 A;  1NHJ A;  5B1O A;  4ASF A;  4PL9 A;  3TZ5 A;  3HEK A;  2FWY A;  2PNR A;  3VHD A;  3GIE A;  4BIZ A;  4HYP A;  4O04 A;  1YS3 A;  2ZBK B;  2BRC A;  2Q8G A;  1THN A;  1BXD A;  2FWZ A;  4MTX A;  3TK1 A;  3CRL A;  4GFN A;  2YEJ A;  1UYL A;  1ZW9 A;  5M4P A;  3IED A;  1YSZ A;  3Q5L A;  4V26 A;  1JOY A;  2IOR A;  4MT8 A;  3ZRV A;  2YGA A;  3RLP A;  4FPP A;  3QTF A;  3A0R A;  3GIG A;  1AJ6 A;  2BU7 A;  2XDL A;  2IOQ A;  3HZ5 A;  4MPN A;  4O09 A;  3G7B A;  2CGF A;  2ESA A;  4V25 A;  1UYF A;  4NH7 A;  1AH6 A;  1UY6 A;  4GQT A;  2VCI A;  1UYD A;  4EGH A;  2YE8 A;  1H7U A;  1OSF A;  4XDM A;  5CF0 A;  3OPD A;  4L93 A;  3LPS A;  3C11 A;  3RLQ A;  3MD0 A;  5D7D A;  2P67 A;  1TC0 A;  4CWQ A;  2QM7 A;  1TID A;  3HYY A;  5CTX A;  4L8Z A;  3VHA A;  4FCR A;  1YC3 A;  4R3A A;  2YI6 A;  3LNU A;  2YE7 A;  5CTW A;  4EEH A;  1R62 A;  2BT0 A;  2YK9 A;  4KFG A;  4BIU A;  1TIL A;  2YI0 A;  3OWB A;  4LPB A;  5L3J A;  1Y8P A;  3O0I A;  2WI4 A;  4KSG A;  2BU5 A;  3O6O A;  3INW A;  5BOD A;  3K98 A;  4EFU A;  4XKA A;  1F51 A;  4K4O A;  4Q20 A;  2YKJ A;  4XKK A;  4LC1 A;  1PVG A;  3EHH A;  4O0B A;  4GT1 A;  2VWC A;  3BMY A;  3R92 A;  4H81 A;  5M4M A;  5D7C A;  4JYB A;  3INX A;  1I59 A;  3A0X A;  4NH8 A;  2ZDX A;  2BYH A;  4JQL A;  2XK2 A;  4X9L A;  4XE2 A;  2BU8 A;  4GCZ A;  3ZM7 A;  4CE2 A;  1IXM A;  4XCL A;  3WHA A;  4KTN A;  4XD8 A;  4YKU A;  3T1K A;  4P8O A;  2HKJ A;  4CWO A;  3TZ4 A;  2IOP A;  3NMQ A;  4U7N A;  4LP0 A;  4DUH A;  3T2S A;  5M4K A;  3D0B A;  3NXS A;  5IDJ A;  3A0Z A;  2AKP A;  5M4N A;  1UYH A;  4O07 A;  3QDD A;  2IWS A;  1GKX A;  3EKR A;  4MBC A;  2YEH A;  2LFR A;  2UWD A;  1Z5A A;  2C2A A;  3ZXO A;  3TUH A;  4FCP A;  2XX4 A;  4ASG A;  1Z5B A;  2JJC A;  4CWN A;  1YER A;  2Q2E B;  4XTJ A;  5F3K A;  2O1U A;  3PEH A;  5D7R A;  5GGZ A;  2CCS A;  4EGK A;  4ZKI A;  4PRV A;  5D6Q A;  2YEI A;  2JKI A;  1UYK A;  4L94 A;  2BRE A;  2YI5 A;  1B63 A;  2BTZ A;  2XX2 A;  3SL2 A;  1KIJ A;  3P32 A;  3T0H A;  2XJX A;  3ZKB A;  2CCT A;  1AMW A;  3MNR P;  2YE3 A;  2CCU A;  3CGZ A;  2HCH A;  2HG1 A;  4EM7 A;  1UY7 A;  3HHU A;  4CWP A;  1Y8O A;  4WUC A;  3RLR A;  2YI7 A;  4BQG A;  5B1N A;  2BU2 A;  4GT8 A;  3H80 A;  2EXL A;  2XDU A;  1I5B A;  1EA6 A;  4BXI A;  1JM6 A;  4GEE A;  3R4N A;  1B62 A;  3ZRX A;  3ZXQ A;  2YJX A;  5IDM A;  3FT5 A;  4URN A;  2XD6 A;  1TBW A;  2QG0 A;  3VAD A;  1ZXM A;  3Q5J A;  5J71 A;  1YSR A;  3R4O A;  3U2D A;  2IWU A;  3D2R A;  2XDS A;  1ID0 A;  4BAE A;  4I3H A;  4HY6 A;  1NHH A;  4WUB A;  2QM8 A;  1ZXN A;  2Q8F A;  3A0W A;  2YE4 A;  1YES A;  3HZ1 A;  3K60 A;  4EGI A;  4URL A;  2QF6 A;  2WI5 A;  3B27 A;  1Z5C A;  4YKQ A;  3A0T A;  2BSM A;  4QPJ A;  3ZRW B;  2YGE A;  4CE3 A;  1UY9 A;  1KZN A;  3OW6 A;  5FND A;  2XDX A;  2E0A A;  1Y4S A;  3EHJ A;  4JYC A;  2YKC A;  4O05 A;  1YT0 A;  4LWH A;  1QZR A;  3C0E A;  3EKO A;  4YKW A;  3OMU A;  3K99 A;  3Q5K A;  3U2K A;  3CGY A;  2WEP A;  4L91 A;  1ZWH A;  3TZ0 A;  4AWO A;  3B24 A;  2WWW A;  3DGE A;  4FCQ A;  2O1W A;  1H7S A;  3KE6 A;  1BGQ A;  2YEC A;  4I5S A;  4NH9 A;  2YEA A;  4HZ5 A;  3CRK A;  4EMV A;  2QFO A;  3R91 A;  1U0Z A;  4MPC A;  2WI7 A;  2K5B A;  4ZVI A;  3PEJ A;  5FNC A;  4XC0 A;  4EFT A;  5CTY A;  2XDK A;  4URM A;  2FTK A;  4MOT A;  4YKZ A;  4HXW A;  4MB9 A;  5CPH A;  1UY8 A;  2FXS A;  4BQJ A;  3ZRW A;  1UYM A;  4AWQ A;  4YKR A;  1YT2 A;  4JAS A;  1S16 A;  2YE2 A;  1MX0 A;  4FMT A;  1YC4 A;  4LWF A;  3TTZ A;  4MP2 A;  3H4L A;  2QG2 A;  4E02 A;  3BM9 A;  4H7Q A;  4L90 A;  4W7T A;  4URO A;  2YKB A;  1I58 A;  4DZY A;  2XJJ A;  4WUD A;  2ZKJ A;  3ZKD A;  1BKN A;  1L0O A;  1A4H A;  3D36 A;  1QY8 A;  1U2O A;  5M4H A;  4R3M A;  4MP7 A;  3B25 A;  4HXZ A;  2ZDY A;  1TH8 A;  4LWG A;  3GIF A;  3R4M A;  2H55 A;  2Q8I A;  4KP4 A;  2XCM A;  1MU5 A;  3VHC A;  2YJW A;  1I5A A;  4XIP A;  3K97 A;  5M4E A;  4ASB A;  4JAV A;  3B28 A;  2YEE A;  1EI1 A;  3T10 A;  4AWP A;  4B6C A;  1Z59 A;  1I5D A;  2BYI A;  4HY1 A;  3A0Y A;  3ZCC A;  5FNF A;  1B3Q A;  5CTU A;  1YET A;  2WI6 A;  3CWV A;  2WER A;  3G7E A;  2XAB A;  4GGL A;  2YEB A;  2YKI A;  4R1F A;  3T0Z A;  5IN9 A;  4QPK A;  2FYP A;  1GKZ A;  2XHR A;  4XCJ A;  3WQ9 A;  4YKT A;  2YED A;  4HYM A;  5BOC A;  2WEQ A;  4YKX A;  4U7O A;  2CH4 A;  2WI2 A;  2GFD A;  1UYE A;  2XJG A;  2IWX A;  5D6P A;  1YT1 A;  4JAU A;  1UYC A;  3B26 A;  1AH8 A;  5C93 A;  1Y8N A;  2YEG A;  3R4P A;  5F5R A;  1YC1 A;  2YE9 A;  4XKO A;  2YE6 A;  2GQP A;  3RKZ A;  2YGF A;  1TC6 A;  2BZ5 A;  4H85 A;  4MPE A;  4XIR A;  2LFS A;  3HYZ A;  1BYQ A;  3EHG A;  2YEF A;  2YKE A;  4XIQ A;  1NHI A;  4CWS A;  4LWI A;  4P7A A;  3OWD A;  4CWR A;  4HZ0 A;  4CWF A;  1UYI A;  3G75 A;  4B7P A;  3U67 A;  3FT8 A;  3TZ2 A;  2YK2 A;  4CE1 A;  2XHT A;  3JZ3 A;  4YKY A;  2VW5 A;  1S14 A;  2VCJ A;  4XIT A;  4CWT A;  5FWK A;  4U93 A;  4AS9 A;  2BU6 A;  2WI3 A;  3O2F A;  2WI1 A;  3FV5 A;  4ASA A;  4KQV A;  3GIG B;  1QYE A;  3EHF A;  2YE5 A;  2XX5 A;  2CG9 A;  2Q8H A;  1GJV A;  1UYG A;  4PRX A;  1AM1 A;  1Y4U A;  4PU9 A;  2XHX A; 
#chains in the Genus database with same CATH topology
 1GH6 A;  1SQP H;  1FS0 G;  1XUQ A;  5H6Q A;  3P3N A;  2H8M A;  4E01 A;  2UUC B;  4BWA A;  4IIJ B;  1XNR B;  4PL9 A;  4MVU A;  3HEK A;  1HR0 B;  2Q9L A;  5IYZ A;  2B1I A;  2EJ7 A;  4BIZ A;  2IW5 A;  1PNK A;  1THN A;  1N33 B;  3TGU H;  1SA0 A;  1BXD A;  3L9D A;  3QG5 A;  2G38 A;  1HNZ B;  1S5L Z;  4JTA B;  4X1I B;  2HR3 A;  4PA4 A;  5M4P A;  3IED A;  1YSZ A;  3Q5L A;  2WLL B;  3G6B A;  3Q4H A;  1N0J A;  3A0B Z;  1Q6I A;  2CGN A;  1NQT A;  3A0R A;  4FZ0 A;  2XDL A;  1NVP D;  3ABM C;  2YDE A;  1VAR A;  4I0X B;  1UYF A;  1UY6 A;  4GQT A;  4UFZ A;  2YXY A;  5JJN B;  2YE8 A;  1H7U A;  1OSF A;  5LP6 C;  4YIO A;  3A0H Z;  4W4L A;  3C11 A;  2QTS A;  1QU7 A;  3T1C A;  3CYO A;  3HYY A;  5CTX A;  4K35 A;  3JYC A;  1B06 A;  2ATK C;  4DR5 O;  2F93 B;  4X62 O;  4LNU B;  4O4L B;  4FCR A;  1NH2 D;  4R3A A;  1K92 A;  1AI4 A;  5AG2 A;  1BS3 A;  3I56 V;  2YE7 A;  5CTW A;  5EIB C;  1I5X A;  1BHB A;  1DK1 A;  2H3O A;  5JCO A;  2YI0 A;  4GZR B;  3F5W C;  4FM0 A;  4WFF A;  2UXB B;  3M7M X;  2DYS B;  5L3J A;  4MTF A;  2MW2 B;  2WA3 A;  3VQX A;  1YJN V;  4WCE V;  3G80 A;  2UUA B;  3EFF K;  4H33 A;  4N21 A;  4XKA A;  1H2L A;  2GUZ A;  4Q20 A;  1SQG A;  1PVG A;  3F5T A;  1LUV A;  3EHH A;  5JQG A;  4O0B A;  1XQ8 A;  3P30 A;  4DR2 B;  2AHY A;  1NT2 B;  4N23 A;  5J9P C;  4NH8 A;  3UCS C;  2ZDX A;  2BYH A;  3JAK B;  4A5U B;  2JRI A;  5J2U A;  4X9L A;  4YJ2 B;  3ZM7 A;  1XNQ B;  4XCL A;  1PP9 H;  4KTN A;  3AK2 A;  4JI8 B;  4PA9 A;  2IH3 C;  5GTH Z;  2HKJ A;  3C90 A;  3JD0 A;  4DYL A;  3ZJZ A;  3NMQ A;  1AJQ A;  5C8Y B;  4LP0 A;  3HKB B;  3UQ8 A;  2BSK A;  3T2S A;  4JI1 B;  4B3T O;  4UV8 A;  2AKP A;  3K08 A;  3FYE B;  2ZT9 B;  4UV9 A;  1CXZ B;  3CX5 F;  3DXR A;  4LWS B;  4MBC A;  3CC7 V;  1JCH A;  2HJF C;  2EUL A;  1Z5A A;  4FCP A;  4JZ2 A;  3JAL A;  4Z1M G;  1FXK A;  2Q67 A;  3FB5 C;  1Z5B A;  4CWN A;  2YI8 A;  2CCS A;  4ZKI A;  1YJW V;  4MS2 A;  1N8R W;  3OTO B;  2YEI A;  4O2A A;  2JKI A;  2BRE A;  1ZX3 A;  3E8G A;  2PGG A;  3E8H A;  1D5N A;  3JSN A;  2GDS A;  2AZ2 A;  1HNW B;  3CSX A;  1KIJ A;  2MK3 A;  1N36 O;  1SES A;  4DR3 B;  2YE3 A;  3OFN G;  2RJZ A;  2UUB O;  3CGZ A;  2D2C B;  4UCS A;  2UXD B;  3HHU A;  1EBO A;  4CWP A;  1Y8O A;  3APO A;  2P6J A;  4ZI7 B;  3RBZ A;  4UB6 Z;  1F7Y A;  4NTY A;  5H9C A;  4I7Z B;  2E74 B;  2JJ1 G;  3WB0 A;  3ASO C;  1R6T A;  2YEV B;  1WA8 A;  1JM6 A;  2HJD A;  3R4N A;  4B3S B;  2X0L A;  2FB5 A;  1HP8 A;  4NTX A;  3CC2 V;  4URN A;  1IZ3 A;  3FAV B;  1TUB A;  4LBE C;  3KKY A;  1NI8 A;  1YEW A;  3CS5 A;  2QG0 A;  2ZCE A;  3K0D A;  3Q5J A;  2CE4 A;  1YSR A;  5JJJ B;  1T5E A;  4LF5 B;  1EN4 A;  2GBO A;  1K73 W;  2E3C A;  3K79 A;  1VQP V;  2XDS A;  4DV5 B;  2OIG A;  1RM1 C;  1NKD A;  2EIN C;  2QM8 A;  1TAE A;  1WAZ A;  3FYI B;  2IJJ A;  4HZ3 A;  2Q8F A;  3IC7 A;  2JDI G;  4X1I A;  2JVD A;  1YES A;  3K60 A;  4ASU G;  2CGO A;  2WI5 A;  4URL A;  4DR1 O;  2D3O W;  4KHP B;  3DTU B;  2WLL A;  1YVW A;  5B1A C;  1GN6 A;  4WBN B;  4K0K B;  4CE3 A;  1N4C A;  3OW6 A;  4NB5 A;  1Q43 A;  2DMX A;  2CTW A;  3K3W A;  4GKK B;  2LW7 A;  3JD2 A;  4RUF A;  4O05 A;  2W6J G;  3OD4 A;  4LWH A;  1THZ A;  5KUM A;  4UCU A;  3C0E A;  1H2S B;  3N27 A;  3OMU A;  3DC5 A;  4LP8 A;  2QSA A;  1GM7 A;  3CWB H;  4L8J A;  4L91 A;  1ZWH A;  2R72 A;  3TZ0 A;  3RYC A;  5KHI A;  4HNA B;  4RUE A;  4FCQ A;  4JI5 O;  4O4L A;  2KB1 A;  1U96 A;  4TV8 B;  3K59 A;  1NR7 A;  3W7X A;  4EMV A;  1DLB A;  5CMU A;  1H8E G;  1U0Z A;  3JAS B;  2YSU B;  3ASN C;  4ZVI A;  3SPJ A;  2LJ2 A;  4EFT A;  2XDK A;  2FTK A;  3VQW A;  1RSO B;  3H1J H;  2ZDI A;  4B3R O;  4HXW A;  1NS1 A;  5B3S B;  4EFB A;  1RP3 B;  2OCC C;  3ABK C;  3E22 B;  2VQF O;  1K8A W;  5LMN B;  1YT2 A;  4LFB B;  1S16 A;  3ZHV A;  2W6I G;  1OCR B;  3K5O A;  2Y0I A;  2VS0 A;  1BCC H;  1Y66 A;  4LWF A;  3AG1 C;  3RYI B;  5KLV H;  3ETE A;  3JAK A;  4X64 O;  5LBQ A;  2Y4T A;  3B40 A;  3BM9 A;  4H7Q A;  2E5L O;  4YJ2 A;  1EZV H;  4NTW A;  4URO A;  4O4I A;  2QR4 A;  2YKB A;  4DO2 A;  4WUD A;  3JD3 A;  2QM4 A;  3RYH B;  1A4H A;  3D36 A;  1QY8 A;  1IBL O;  5C8Y A;  5M4H A;  4R3M A;  3HKB A;  2ARH A;  4HXZ A;  2N04 A;  5LOV A;  3LNN A;  1SZT A;  1EM1 A;  2H55 A;  4O4H A;  4G2K A;  2Q8I A;  4GX5 A;  2XCM A;  5JWP A;  1OCC B;  3VHC A;  1I5A A;  4R6Z A;  2CAZ C;  5IWA B;  2F43 G;  3B28 A;  4LFA O;  3T1Y O;  1EI1 A;  3T10 A;  4AWP A;  1FJG O;  1I5D A;  2L6L A;  3ZCC A;  4BW9 A;  4YHH O;  3H1I H;  3OGC C;  4GYC B;  3CME V;  3ABU A;  4J7K A;  3G7E A;  1VF7 A;  2XAB A;  1DF5 A;  1FFX B;  4JI3 O;  2QWP B;  4X62 B;  2FYP A;  1D5A A;  3AK3 A;  3J81 N;  1WP8 A;  5BY1 A;  4Z2W A;  4I50 B;  4YKT A;  1NBM G;  1UFI A;  2A7W A;  2YED A;  4HYM A;  4ZI7 A;  5IJ0 A;  4NVP A;  4X20 A;  5BOC A;  2WEQ A;  4YKX A;  1SS3 A;  1M9N A;  2R9R B;  4U7O A;  2CH4 A;  1LUW A;  1UYC A;  3B26 A;  1XMO B;  1YZB A;  4DV0 O;  5LGU A;  1Y8N A;  4AQY B;  2YEG A;  1YC1 A;  3R4P A;  5F5R A;  2GQP A;  2FL4 A;  5KA5 A;  2YGF A;  1TC6 A;  2BZ5 A;  1OV9 A;  1DF4 A;  3JAW A;  2GV9 A;  2IJH A;  2YKE A;  3LDC A;  4O4J A;  4DV3 O;  2EIL B;  5EBM C;  1IBM O;  4P7A A;  5LMU O;  3ZMU A;  2DE0 X;  2EIK C;  4FLZ A;  4HZ0 A;  3G75 A;  2RMK B;  3QF7 A;  4BW5 A;  2YK2 A;  2ZR2 A;  2CDY A;  2XHT A;  1SC5 B;  1R6K A;  1S5H C;  4DR7 O;  4XIT A;  4JI4 O;  1SER A;  4UVB A;  4U93 A;  2BU6 A;  3O2F A;  3ZBH A;  3Q4H B;  3E89 A;  1Q81 W;  4ASA A;  4WBN A;  4KQV A;  2B9Z A;  2ODM A;  2YE5 A;  1F4N A;  4YJ3 A;  5IY5 B;  3HR0 A;  3K58 A;  4JI6 B;  5LXT A;  2F4V O;  2CG9 A;  2Q8H A;  4RQE A;  3TJT A;  1K97 A;  1AM1 A;  4MTG A;  4PU9 A;  4AI8 A;  1YXB A;  3ZHR A;  4EEQ A;  4PHZ A;  3JAM N;  4U3J A;  3O9O A;  4J10 A;  1OZ0 A;  4X65 B;  2P7T C;  4KSH A;  1K4D C;  2IH1 C;  2WLK A;  4JV5 O;  4HNA A;  1XOU A;  1MAB G;  3TZ5 A;  3RW0 A;  3JD1 A;  2FWY A;  4TV8 A;  3VHD A;  1SRY A;  4HYP A;  2Q7E A;  2E76 B;  1YS3 A;  2ZBK B;  4DV2 O;  2Q8G A;  3B2E E;  2PF4 E;  2QWQ B;  4LF7 O;  2QKA A;  4GLX A;  4FLU A;  2UUB B;  3CRL A;  1I7F A;  4O2B B;  1ZW9 A;  1Q7Y W;  4QGP A;  4MVQ A;  3T1H O;  1FD9 A;  1MG1 A;  4NXM B;  2IOR A;  3ZRV A;  2GUZ B;  4JPR A;  4CH6 A;  3HZ5 A;  4NR1 A;  4MPN A;  2Z5U A;  3E22 A;  1OJH A;  4V25 A;  3FKS G;  1UYD A;  4DUY O;  1KKD A;  3TET A;  4EGH A;  4XDM A;  1G1X B;  2HVK C;  2UXN A;  3SJA C;  1E1R G;  3RYI A;  5D7D A;  3K04 A;  3EVK A;  3ICX A;  3H01 A;  2EIM C;  3QVN A;  2QM7 A;  1VQ8 V;  4F6R A;  3CP1 A;  4PV1 B;  3ZMS A;  1KC8 W;  1CEZ A;  4PDM A;  1UJW B;  4XDK A;  2BSK B;  2C1G A;  2X6B A;  2BT0 A;  4KFG A;  1TIL A;  1VQ4 V;  2W0X A;  2DQ3 A;  4PI2 A;  1QLE C;  4WFG A;  4DW0 A;  1U97 A;  4FLV A;  1GN2 A;  1KMI Z;  2JEU A;  2OT5 A;  1GM9 A;  3DXR B;  1Y8P A;  1M57 B;  4DR1 B;  3OR6 C;  2WI4 A;  5KHG A;  2ZIN A;  2M7W A;  2QEX V;  3O6O A;  4JAA A;  1V55 C;  5BOD A;  2XOK G;  3JAL B;  3UKM A;  1WNS A;  1JA8 A;  2VWC A;  5M4M A;  2P06 A;  4O2A B;  5BXZ A;  5D7C A;  1TGO A;  1SQX H;  3A0X A;  3SJC C;  2F23 A;  2Y69 C;  5IJ9 A;  2OYQ A;  4XE2 A;  1ORQ C;  2CK3 G;  2YI9 A;  3WHA A;  3VQY A;  4NXN O;  3BEH A;  4YKU A;  3WB2 A;  2ZKO A;  4CWO A;  2IOP A;  3L71 H;  3UO3 A;  4U7N A;  3CC4 V;  5L3D A;  1WA8 B;  1Z5W A;  3NXS A;  3B8M A;  3A0Z A;  5M4N A;  1KP2 A;  1UYH A;  4O07 A;  3X2Q C;  5LYJ B;  2IWS A;  1GKX A;  1HNX O;  2HFE C;  3CE2 A;  3UO2 A;  1VF6 A;  1TUB B;  5KHJ A;  1LR1 A;  4OXS A;  3L73 H;  5L3F A;  3JSL A;  1QVG U;  5DEC A;  2VWJ A;  2C2A A;  3TUH A;  5CA1 B;  3ZX6 A;  2Q73 A;  3L75 H;  4XTJ A;  2O1U A;  3PEH A;  1MA1 A;  3BA9 A;  1SET A;  3QO5 A;  2WLJ A;  3CRQ A;  2QWR B;  4RO2 A;  2WSS G;  4L94 A;  2YI5 A;  4RAI A;  2BTZ A;  3SL2 A;  1BT8 A;  4MVZ A;  4X64 B;  1K9M W;  2CCT A;  1AMW A;  2ZXW C;  1S0V A;  5A2Q N;  3ZMV A;  4QE9 A;  4IGG A;  1MZF A;  4BR6 A;  2HCH A;  1CP9 A;  2DOS A;  5LL6 Y;  2XAS A;  3H9V A;  1VQL V;  4EM7 A;  3KG2 A;  1UY7 A;  2ZNI A;  1FXK C;  2YI7 A;  4BQG A;  1IBL B;  1URF A;  2A79 B;  4OPA A;  4CH4 A;  2EXL A;  2OWO A;  1EA6 A;  3CRM A;  3IGA C;  5CB4 A;  1H2K A;  1QVF U;  4GEE A;  3ZXQ A;  2OIE A;  3GWO A;  2LGQ A;  3FT5 A;  2DWD C;  3RYC B;  2XD6 A;  2H94 A;  1TBW A;  1PV0 A;  4DV6 O;  1FJG B;  3RWR D;  5J71 A;  3R4O A;  3WG7 B;  4FM1 A;  5DM6 V;  3D2R A;  1FXH A;  1YHQ V;  2WLM A;  4DW1 A;  4WUB A;  3U11 A;  3FB6 C;  1TA8 A;  3KZI Z;  1QNM A;  2GHY A;  4I55 B;  1IBK O;  4JI3 B;  1FAF A;  2YE4 A;  4PDV A;  3CCR V;  3JAT A;  4O2B A;  2RQ6 A;  2ZM6 B;  2QF6 A;  4UVC A;  1Z5C A;  4CBC A;  4JI2 B;  4YKQ A;  5IE9 A;  3CD6 V;  3SPI A;  1KZN A;  5FND A;  4X89 A;  1M1K W;  1Y4S A;  1Y67 A;  1NZ6 A;  2W0F C;  3WFV A;  2P22 C;  1YT0 A;  3GWK C;  3EKO A;  4DV0 B;  5L3G A;  1F23 A;  1XI1 A;  3IAY A;  2WEP A;  4DV1 O;  4L87 A;  4OX9 O;  1L1F A;  2WWW A;  4O4I B;  5D5Q A;  4WF9 V;  1I94 O;  3KE6 A;  3SPH A;  4DV3 B;  1US6 A;  4I5S A;  4MW8 A;  4HZ5 A;  5LMU B;  1JQ0 A;  4K8Z A;  1M5I A;  1BQZ A;  2KQX A;  1M56 B;  2AXT Z;  2ZE6 A;  5LOV B;  2QFO A;  4X66 O;  4UCV A;  3LSU A;  4O4H B;  3PEJ A;  5JH7 A;  2ETN A;  1AP5 A;  4DR7 B;  4URM A;  4MOT A;  4JI4 B;  4FZ1 A;  2HG5 C;  4YKZ A;  2UXC O;  1WN7 A;  4IL6 Z;  4H44 B;  4MB9 A;  3BY6 A;  1UY8 A;  4TSF G;  4BQJ A;  1YJ9 V;  2XT9 A;  3OMN B;  4UVA A;  4KUM A;  3SDL A;  4JAS A;  3SR2 C;  3ZHT A;  3OEH G;  4FMT A;  4DR6 B;  1YC4 A;  1Y76 B;  1KEC A;  4LR3 A;  4MP2 A;  3H4L A;  5FL7 G;  4E02 A;  2X6A A;  2DYS C;  3LUT B;  4JV5 B;  2ZDI C;  5FLX N;  2JS5 A;  4E72 A;  5LHG A;  5KX5 A;  2K1E A;  1BSM A;  1X59 A;  5IJ0 B;  2Q7H A;  1K5Q A;  3AG3 B;  3WB1 A;  1BKN A;  1L0O A;  1XEQ A;  4X20 B;  4GUN A;  1IX9 A;  1L0N H;  3SJB C;  1U2O A;  4BIO A;  1W0K G;  4LF7 B;  4LWG A;  3GIF A;  2QA4 V;  3R4M A;  1JVM A;  1Q90 D;  5LYJ A;  2YID A;  1NJI W;  2H8P C;  3T1H B;  1ZAU A;  2YJW A;  4XIP A;  1NTK H;  5M4E A;  1I0H A;  2LGW A;  1EZJ A;  2YEE A;  5CA1 A;  3JAW B;  3LMM A;  5GTI Z;  1Z59 A;  2JIZ G;  4HY1 A;  3D36 C;  3A0Y A;  3OUS A;  4IYI A;  4O4J B;  4PA3 A;  5FNF A;  4JGS A;  1JR9 A;  4DK1 A;  3M8A A;  3AG4 B;  5CTU A;  2BCC H;  3SJQ C;  1XL4 A;  3LSS A;  3CWV A;  1VEW A;  1TVK B;  5LHI A;  4R1F A;  4TWK A;  1P49 A;  3T0Z A;  1S77 D;  1PNM A;  5IN9 A;  1E79 G;  4C7U A;  1GKZ A;  4WFH A;  4XCJ A;  2AW9 A;  4ZIB A;  1AIL A;  1K7D A;  3E8F A;  4FK5 C;  1XBL A;  4YJ3 B;  2AGA A;  1PD3 A;  5LXT B;  2Q0O C;  2QTO A;  4P9P A;  1P84 F;  3CCL V;  4FJC C;  4DUZ O;  2IWX A;  1YT1 A;  4LF6 O;  4MVM A;  4JTC B;  4U3J B;  5LGN A;  4DRX B;  1O9G A;  2BTQ A;  2YE6 A;  4FLY A;  4HYO A;  4XDJ A;  5J2T A;  1XMQ B;  4H85 A;  1A32 A;  3U10 A;  2IM9 A;  3HYZ A;  1NTM H;  4HAM A;  2ITC C;  1WB7 A;  3EHG A;  1BGY H;  2XAQ A;  4LWI A;  2RNB A;  3SYQ A;  2EX3 A;  1UYI A;  4PA6 A;  1OCZ B;  2Q8V A;  3U67 A;  5CBF A;  4JI0 B;  4I55 A;  3TCU A;  4NXN B;  3JZ3 A;  2VW5 A;  1S14 A;  4R8C A;  2BOC C;  2GTS A;  4AS9 A;  4JYA O;  1AI6 A;  3RT3 C;  2WLI A;  3FV5 A;  2OTJ V;  3JCU Z;  1COW G;  1QYE A;  3SYA A;  2PI4 A;  4DV7 B;  3K9S A;  3J7A U;  4J7Z A;  1R6N A;  1M90 W;  5EK0 A;  4PRX A;  2NLJ C;  1HNX B;  2UU9 O;  1VQ6 V;  5BR8 O;  3SPG A;  2RN9 A;  1R3I C;  3KCY A;  4CH3 A;  2CH7 A;  4LWE A;  2YUA A;  2HP8 A;  1NHJ A;  5B1O A;  2E75 B;  4F6R B;  4ASF A;  3GVM A;  4YY3 O;  2PNR A;  1FKA O;  4MTO A;  3GIE A;  4O04 A;  2PTM A;  2BRC A;  1AR5 A;  2FWZ A;  2DW4 A;  1H2N A;  2IU3 A;  4QNH B;  5LHH A;  1HNZ O;  4GFN A;  2YEJ A;  5LGT A;  3FB7 C;  4JF3 A;  2N05 A;  1AR1 B;  4E4E A;  2XAH A;  5FPO A;  3RYF A;  1N32 O;  2YGA A;  3GIG A;  1AJ6 A;  2BU7 A;  2IOQ A;  4O09 A;  3RN4 A;  3G7B A;  1O9H A;  2Y48 A;  1PL0 A;  2CGF A;  2ESA A;  1N0N A;  5B1B B;  1FYJ A;  2VCI A;  2Y4U A;  5CF0 A;  3OPD A;  1WJZ A;  5IJ9 B;  1QLN A;  4L93 A;  1Y76 A;  3MD0 A;  4PDR A;  5EZY A;  2LQT A;  4DR5 B;  4QIW F;  3B4S A;  1N34 O;  2P90 A;  5B3S C;  3VHA A;  1Q6H A;  2YI6 A;  3CRR A;  1AI5 A;  1IVS A;  4EEH A;  2Q69 A;  2B1G A;  4PA7 A;  3G71 V;  1XL6 A;  1IBK B;  4BIU A;  3ZHU A;  1OCR C;  2VQE O;  4DR4 O;  2WPD G;  3AG2 B;  1G4Y B;  2UXB O;  3PN1 A;  3O0I A;  3ZED A;  2GTA A;  1GN3 A;  2YXH A;  4KSG A;  3BAB A;  1M93 A;  1QQC A;  2UUA O;  2Z0A A;  1F51 A;  1S76 D;  1SQV H;  2YKJ A;  4XKK A;  3BMY A;  3R92 A;  3U0Z A;  3AEI A;  3QO7 A;  4JYB A;  3INX A;  4DR2 O;  3G67 A;  1NR1 A;  1VQM V;  2X7R B;  4DV1 B;  4JQL A;  1XHZ A;  2BOB C;  1Z2G A;  2LP7 A;  2BU8 A;  1TVK A;  3K06 A;  1OCC C;  1I94 B;  3ZN1 A;  2QWN B;  4F6E A;  5L3B A;  3L70 H;  3BRC A;  4JI8 O;  2OCH A;  5H6R A;  4P8O A;  4XDL A;  3C3S A;  3E2E A;  4G27 B;  3L72 H;  1B04 A;  5KA6 A;  2YIB A;  4B3T B;  1V54 B;  5EYP B;  3KCX A;  4X66 B;  5M4K A;  3D0B A;  1Y74 A;  5CB4 B;  1TUE B;  3JAR A;  5IDJ A;  3QDD A;  2WAM A;  3CCJ V;  1K34 A;  3EKR A;  3UT5 B;  2YEH A;  2LFR A;  4DRX A;  3ZXO A;  2DYR B;  2WLH A;  2PYL A;  4ASG A;  3RVY A;  1WP7 A;  1KBH A;  1YER A;  5F3K A;  2KG7 A;  1WLE A;  3EXA A;  5D7R A;  2F1M A;  4EGK A;  4P9O A;  1M4U A;  5KAF Z;  1KB9 F;  4AIL C;  5CA0 A;  3N2K A;  5D6Q A;  3HKE B;  1N36 B;  3P32 A;  3T0H A;  3WU2 Z;  3W7U A;  3MNR P;  1SQB H;  3JAT B;  1OCO B;  4FFB B;  3SYP A;  2CTR A;  3A8T A;  3ABL B;  1Q86 W;  4MVO A;  1EN6 A;  5B1N A;  2XND G;  3BPZ A;  2YS8 A;  3H80 A;  2K9P A;  2XDU A;  1I5B A;  2GSM B;  2EIL C;  5ITZ A;  1GRJ A;  1E1Q G;  5EBL C;  3ZRX A;  2YJX A;  4B3S O;  3K5M A;  3K9A A;  5E1A C;  1ZXM A;  2PZS A;  3SYO A;  5H2F Z;  3U2D A;  5LA6 A;  3J80 N;  1H8H G;  3N2G A;  1Y6X A;  2ITD C;  3F7Y C;  4BAE A;  1ROP A;  2EIJ B;  5IY5 C;  4HY6 A;  5KHK A;  3S5T A;  1YSC A;  1AJN A;  3PJS K;  5JH7 B;  2HHI A;  2ADP A;  1DTO A;  3HZ1 A;  4EGI A;  1QR9 A;  2LO1 A;  2ZE7 A;  3H1K H;  5GW7 A;  1ZLZ A;  4KHP O;  4ZBM A;  5JVD A;  3L74 H;  4QPJ A;  2BSM A;  1UY9 A;  1R3L C;  3MHH C;  1XDC A;  3MAQ A;  2XDX A;  4PJ0 Z;  1EFR G;  3HPL C;  3EHJ A;  4JYC A;  4EFE A;  2YIC A;  3CMA V;  2EZO A;  1K5S A;  2YKC A;  3CB2 A;  1VMG A;  5JCO C;  1DGS A;  4YKW A;  4YIP A;  2Q5Z A;  3GB7 C;  2VWK A;  3IFX A;  4IYH A;  1GKF A;  2XUM A;  1R3K C;  3DGE A;  4FLX A;  4JI5 B;  3S3X A;  3DC6 A;  1P7G A;  5KX5 B;  3JD4 A;  3LNM B;  3ZRS A;  2DJV A;  3CPW U;  1KD1 W;  2O1W A;  1H7S A;  2JK5 C;  3ABM B;  5KHH A;  2HKO A;  5H5N A;  1QCE A;  1Q6U A;  2Z3Y A;  3CRK A;  4TOI A;  2JJ2 G;  5LP6 B;  5CBH A;  3R91 A;  3I55 V;  4MPC A;  2EBO A;  2KSD A;  3K5N A;  5FNC A;  4EKW A;  4B3R B;  2F95 B;  3IJ4 A;  2WLN A;  4HBN A;  4JYA B;  3CEI A;  5CPH A;  2FXS A;  2B5U A;  4X88 A;  3ZRW A;  2VQF B;  1UYM A;  5HFL A;  5EC2 C;  3HKC B;  1KP3 A;  4YKR A;  2UU9 B;  4J80 A;  5LMN O;  4WFE A;  1VQ5 V;  5IYD O;  2N74 A;  3TTZ A;  4NYK A;  2QG2 A;  2E5L B;  4BAY A;  1AP6 A;  1M57 C;  1R1B A;  4W4K A;  4W7T A;  3VBB A;  2PI5 A;  3LSQ A;  4YY3 B;  4LF9 O;  5KUK A;  3JCZ A;  2XJJ A;  3D8C A;  5DN6 G;  4LFC O;  2ZKJ A;  4LF8 O;  4K3A A;  4EB6 B;  3CRA A;  5EYP A;  4J42 A;  3B25 A;  4R7C A;  4TUY A;  1TH8 A;  2ZDY A;  3STZ C;  2JGU A;  1R73 A;  5F2V O;  2BTQ B;  3OM3 B;  3OMI B;  2A0L A;  3UT5 A;  3K97 A;  1KUQ A;  4LFA B;  1N32 B;  4P30 A;  3T1Y B;  5J2T B;  1J5E O;  5IWA O;  3CRC A;  1F4M A;  1FXV A;  2ZR3 A;  2BYI A;  4YHH B;  2HHH O;  2QWO B;  5L3C A;  1G6U A;  3FFQ A;  3CCE V;  1JMK C;  3CCV V;  1NVP B;  1SKV A;  2ZIM A;  3HKD B;  1EN5 A;  3BCC H;  4PI0 A;  1W0J G;  2WER A;  3HKE A;  3AK1 A;  5D5P A;  4ABM A;  1GAX A;  2YEB A;  4UCR A;  1N34 B;  2QKS A;  1K33 A;  2XTA A;  4QPK A;  4FFB A;  1QBZ A;  2XHR A;  3CJH B;  2WLI B;  3FD9 A;  1YTF D;  3WQ9 A;  2YXL A;  2FML A;  3G4S V;  2C1I A;  3LDD A;  5TIS Z;  1NH2 B;  1YTF B;  2L35 A;  1WPX A;  4FLT A;  1KYO F;  1KU9 A;  2VQE B;  4DR4 B;  2XJG A;  4Z1V A;  3R65 A;  4JAU A;  1VP7 A;  1S72 V;  1G8M A;  2QDO A;  4X1K A;  4X1Y A;  2CH7 B;  2YE9 A;  4XKO A;  1XMO O;  3CXC U;  2XAJ A;  4AQY O;  3RKZ A;  3K57 A;  3HB3 B;  4WFA V;  3VQV A;  4MPE A;  4XIR A;  2LFS A;  2A3Q A;  5JEN A;  1ZL8 B;  1AJP A;  4I4T B;  4LF4 O;  4D7T A;  1LNQ A;  3H1L H;  3T2M A;  3ASO B;  4IT5 A;  3W7S A;  1IBM B;  4XIQ A;  4UXN A;  1NHI A;  4CWS A;  3OWD A;  3K5L A;  4B7P A;  3FT8 A;  3TZ2 A;  1MSW D;  1W59 A;  4CE1 A;  3QO8 A;  1VQK V;  1NU1 H;  3OE7 G;  4YKY A;  1BQ0 A;  2FYU H;  2ZIO A;  2A9H A;  3RYF B;  2WI1 A;  1SQQ H;  1H2G A;  5KAI Z;  3GIG B;  2ZE8 A;  4E2L A;  2F4V B;  3EHF A;  3WG7 C;  2XX5 A;  4MW3 A;  1RM1 B;  1I5Y A;  3M99 B;  2YC0 A;  2Y0P A;  1UYG A;  4JI6 O;  2EIN B;  2XHX A;  2IJK A;  5IYC O;  2PUS A;  3E83 A;  4WFB V;  2O1V A;  2DQ0 A;  3K0G A;  4JYY A;  1I5C A;  4ZOL A;  1YIT V;  5EZY B;  2R9A A;  3CHX A;  5DED A;  4TQF A;  5FNV B;  1US7 A;  1VQ7 V;  5J6A A;  4E00 A;  5B1A B;  4X65 O;  1VQN V;  4OPH A;  3BVO A;  3AG7 A;  3BFR A;  3MDS A;  3E8B A;  1XRE A;  1B6Q A;  4J11 A;  3BHP A;  2R9I A;  1IUR A;  4DV2 B;  3A2F A;  2Q6A A;  1HW7 A;  5LP6 A;  4FIP C;  4MTX A;  3TK1 A;  1UYL A;  4JI7 O;  2JGD A;  4V26 A;  3QTC A;  1JOY A;  4MT8 A;  1ZTE A;  4NXM O;  3RLP A;  4FPP A;  3QTF A;  5KMG B;  3C3T A;  4FM2 A;  2NN4 A;  4P2Z A;  5EC1 C;  4GKJ O;  3HKC A;  4DUY B;  4NH7 A;  2RDC A;  1AH6 A;  2QE7 G;  4MVS A;  3W7W A;  4GX0 A;  1M56 C;  2VRZ A;  3ASN B;  4UCT A;  4B3M O;  4RQF A;  2WA4 A;  3CCQ V;  3LPS A;  5IYB O;  3RLQ A;  2P67 A;  1TC0 A;  1ARO P;  4CWQ A;  1TID A;  3CCU V;  2M6Y A;  1Q5O A;  4L8Z A;  4JZG A;  2OCC B;  3ABK B;  4IIJ A;  5CN0 A;  2PY5 A;  2LW1 A;  2YIB D;  2CTQ A;  1YC3 A;  2XAG A;  1AI7 A;  3LNU A;  2QGN A;  1I08 A;  1Y74 B;  4EB6 A;  1BHA A;  1R62 A;  2YK9 A;  3JAR B;  2V4D A;  3AG1 B;  3OWB A;  4LPB A;  5B66 Z;  1MMM A;  1PM9 A;  2BU5 A;  3INW A;  3R66 A;  3K98 A;  4EFU A;  1JJO A;  4K4O A;  3QNE A;  3B8N A;  4LC1 A;  2KG7 B;  5E79 Z;  3AG3 C;  4GT1 A;  2IU0 A;  2ILM A;  3W7T A;  4H81 A;  3ZHQ A;  5CA0 B;  4I0X A;  3N2K B;  4GX2 A;  2Q68 A;  3HKD A;  1I59 A;  1QR8 A;  2XK2 A;  1AR4 A;  4GCZ A;  4CE2 A;  1X4T A;  1IXM A;  1JFF B;  1FPO A;  4XD8 A;  4DV4 O;  4U3F H;  3RFR A;  4KFM A;  3T1K A;  4PDL A;  3CJH A;  1YDX A;  4LNU A;  1V9P A;  3TZ4 A;  4TQD A;  4J7J A;  4DUH A;  4H13 B;  3OAA G;  5ITZ B;  3NR7 A;  2HEP A;  3D3Q A;  3AG4 C;  3OUF A;  2V1D A;  1GM8 A;  2UWD A;  2ZD9 A;  2IBZ H;  4LH6 A;  4ZHQ B;  3OMA B;  1IDS A;  2YIA A;  3K03 A;  4JTD B;  2RCV A;  5K1X A;  3ZMZ A;  2P4K A;  4F4L A;  3OTF A;  3ABT A;  2XX4 A;  1SQF A;  5LA6 B;  4Q6G A;  2UUC O;  1XNR O;  1Q8I A;  1D2D A;  2JJC A;  2Q2E B;  1ZL8 A;  3N2G B;  5GGZ A;  1OHH G;  4I4T A;  1HR0 O;  3BAA A;  4PRV A;  1UYK A;  1YI2 V;  1B63 A;  2XX2 A;  2EZP A;  1N33 O;  3F7V C;  4I9Q A;  4KXR A;  2XJX A;  3ZKB A;  2A06 H;  3DSQ A;  4LF9 B;  2CCU A;  4J41 A;  3H1H H;  4LFC B;  2HG1 A;  2CUG A;  5JVD B;  4TV9 B;  3T4Z A;  1IXB A;  4B7K A;  4WUC A;  4LF8 B;  3RLR A;  5IT9 N;  4D6T H;  1GMG A;  2HVJ C;  2BU2 A;  4GT8 A;  1GN4 A;  2JEX A;  2EIK B;  4BXI A;  3S3W A;  1B62 A;  1H38 A;  3CYG A;  3ZS8 C;  5IDM A;  3ETG A;  1K3E A;  1OCZ C;  2Q0A A;  3TXQ A;  3VOU A;  5CA3 A;  3P3P A;  1YF2 A;  4LWS A;  1BE3 H;  4DV6 B;  1J5E B;  2ZE5 A;  2BTO A;  3VAD A;  5FNV A;  2P5O A;  1PPJ H;  1WPB A;  3ZIA G;  1VIB A;  1KKC A;  2X6C A;  1RFY A;  2HHH B;  1FFT B;  2IWU A;  1JPX A;  5GON B;  4RWU A;  2JS3 A;  3FB8 C;  1ID0 A;  4I3H A;  5HFM A;  4CS2 A;  4UUJ C;  1VQ9 V;  1NHH A;  2ADQ B;  1L8D A;  4B08 A;  4QE7 A;  1Q82 W;  3MHS C;  1VQO V;  3APQ A;  2KKW A;  1HWY A;  1ZXN A;  1MZE A;  3A0W A;  2Q7G A;  1PKX A;  1ENV A;  3UM7 A;  3B27 A;  2ZM6 O;  1L0L H;  3A0T A;  1RPR A;  2YGE A;  3ZRW B;  4JI2 O;  4D7S A;  2AZ0 A;  1VF5 B;  3E35 A;  2E0A A;  4IHJ B;  5KMG A;  2XHB A;  1SF9 A;  3CXH F;  3D3I A;  2YEV A;  5BMV B;  1QZR A;  1RPO A;  4NKG B;  3K99 A;  3Q5K A;  3U2K A;  4OX9 B;  3CGY A;  4H37 A;  3FAV A;  1Q3E A;  4AWO A;  3B24 A;  4J9Y B;  1KQS U;  1XNQ O;  4X9Q A;  2PYJ A;  3E86 A;  4LF4 B;  4H0L B;  1PNL A;  2V7Q G;  3STL C;  1BGQ A;  2YEC A;  4NH9 A;  5IYZ B;  2YEA A;  1P7B A;  3O65 A;  1SA0 B;  3G6E V;  5B1B C;  4TUY B;  4JI1 O;  1CPY A;  2WI7 A;  2K5B A;  2P4V A;  3LDE A;  1BL8 A;  4XC0 A;  4MSW C;  5CTY A;  2BE3 A;  2EIM B;  2UXC B;  4AHC A;  4CZZ A;  3ETQ A;  4I9W A;  1W2B U;  2Q4P A;  4K8X A;  4AWQ A;  4DK0 A;  4PD4 F;  2ZQM A;  1UPG A;  3TXS A;  1QLE B;  1ZWI C;  3ZN0 A;  2YE2 A;  3OTO O;  1MX0 A;  3RVZ A;  1NTZ H;  4XBF A;  1R3J C;  1ZUQ A;  4DR6 O;  4MVR A;  1Z5V A;  4TT3 G;  1HNW O;  1GO3 F;  1K4C C;  3AG2 C;  4CS4 A;  1VF6 C;  3B77 A;  1V55 B;  4FVM A;  4L90 A;  3THO A;  4DR3 O;  1JFF A;  1I58 A;  4DZY A;  4LCU C;  2UXD O;  3OT7 A;  5L3E A;  1JX9 A;  1HDJ A;  3ZKD A;  5A9G A;  3RGB A;  3OEE G;  1YCI A;  4MP7 A;  4KL1 A;  2Y69 B;  1MOF A;  2UXX A;  3JAS A;  4X1K B;  4JI7 B;  4X1Y B;  4KP4 A;  3CCS V;  4B7E A;  1QHT A;  2XAF A;  1MU5 A;  1RSO A;  4CH5 A;  4ASB A;  2CTP A;  4ZHQ A;  3CCM V;  4JAV A;  1S3J A;  3I5D A;  5JQG B;  4GKJ B;  4B6C A;  2IJI A;  4CC5 A;  4LF5 O;  5B5E Z;  3SGI A;  5EBW C;  4B3M B;  4CC6 A;  1B3Q A;  1V54 C;  1MSD A;  3SPC A;  2DWE C;  3ZMT A;  3X2Q B;  4DV5 O;  2F66 C;  1YET A;  2WI6 A;  5J2U B;  3B09 A;  4GGL A;  2EJR A;  4OGQ B;  2YKI A;  5FPR A;  1YIJ V;  1Y4M A;  1H2M A;  4YXW G;  3EHB B;  2DYR C;  1GK9 A;  2DN9 A;  4TV9 A;  1J95 A;  3RYH A;  5BZB A;  4DXW A;  4K0K O;  4FFK A;  4QJF B;  4DUZ B;  1P4R A;  4GX1 A;  1ZSP A;  4LF6 B;  2GFD A;  1UYE A;  2WI2 A;  5D6P A;  4GKK O;  1AB3 A;  4UCO A;  1S5J A;  1MNG A;  2ZNJ A;  2ZXW B;  4ZOL B;  1AH8 A;  5C93 A;  1OCO C;  4LH7 A;  1WB8 A;  3OGI B;  1FXK B;  3ML0 A;  1JJ2 U;  4ICG A;  1XMQ O;  2QJ1 A;  1BYQ A;  4FLW A;  3ABL C;  1XIL A;  2YEF A;  3ZHS A;  4G28 B;  5GON A;  3OR7 C;  1AVM A;  2OTL V;  1XHX A;  4CWR A;  4CWF A;  1BZK A;  1GTO A;  5K1P A;  4J9Z B;  2FKX A;  4X8A A;  2AHZ A;  5JJE B;  4R50 A;  1FFX A;  3BA8 A;  4JI0 O;  3IC9 A;  2JGD B;  4DV4 B;  1PL4 A;  3OW2 U;  2VCJ A;  4CWT A;  5FWK A;  1SZX A;  4CS3 A;  2QKC A;  1BMF G;  2WI3 A;  5CBG A;  5EIB D;  3ETD A;  4I50 A;  3FX7 A;  2NR5 A;  2R70 A;  2NNU A;  4IHJ A;  2O57 A;  3SYC A;  1GJV A;  2HLD G;  4UB8 Z;  4DV7 O;  2EIJ C;  4PEL A;  5BR8 B;  1Y4U A;  4LFB O;  3T4D A;  5BMV A; 
#chains in the Genus database with same CATH homology
 1FS0 G;  5H6Q A;  2H8M A;  4E01 A;  4PL9 A;  4MVU A;  3HEK A;  2B1I A;  4BIZ A;  2IW5 A;  1PNK A;  1THN A;  1BXD A;  4JTA B;  2HR3 A;  4PA4 A;  5M4P A;  3IED A;  1YSZ A;  3Q5L A;  2WLL B;  1NQT A;  3A0R A;  2XDL A;  1NVP D;  3ABM C;  1UYF A;  1UY6 A;  4GQT A;  2YE8 A;  1H7U A;  1OSF A;  3C11 A;  3T1C A;  3CYO A;  3HYY A;  5CTX A;  3JYC A;  2ATK C;  4FCR A;  1NH2 D;  4R3A A;  1K92 A;  1AI4 A;  3I56 V;  2YE7 A;  5CTW A;  1I5X A;  1BHB A;  2YI0 A;  3F5W C;  4WFF A;  2DYS B;  5L3J A;  4MTF A;  1YJN V;  4WCE V;  3EFF K;  4H33 A;  4N21 A;  4XKA A;  4Q20 A;  1PVG A;  3EHH A;  4O0B A;  3P30 A;  2AHY A;  4N23 A;  5J9P C;  4NH8 A;  2ZDX A;  2BYH A;  4X9L A;  3ZM7 A;  4XCL A;  4KTN A;  4PA9 A;  2IH3 C;  2HKJ A;  3JD0 A;  3ZJZ A;  3NMQ A;  1AJQ A;  4LP0 A;  3T2S A;  4UV8 A;  2AKP A;  3K08 A;  3FYE B;  4UV9 A;  4MBC A;  3CC7 V;  1JCH A;  2HJF C;  1Z5A A;  4FCP A;  4Z1M G;  1FXK A;  2Q67 A;  3FB5 C;  1Z5B A;  4CWN A;  2CCS A;  4ZKI A;  1YJW V;  4MS2 A;  1N8R W;  2YEI A;  2JKI A;  2BRE A;  3E8G A;  3E8H A;  1KIJ A;  2MK3 A;  1SES A;  2YE3 A;  3OFN G;  3CGZ A;  3HHU A;  1EBO A;  4CWP A;  1Y8O A;  2P6J A;  3RBZ A;  5H9C A;  2JJ1 G;  3ASO C;  2YEV B;  1JM6 A;  3R4N A;  2X0L A;  3CC2 V;  4URN A;  4LBE C;  2QG0 A;  3K0D A;  3Q5J A;  1YSR A;  1K73 W;  3K79 A;  1VQP V;  2XDS A;  1RM1 C;  1NKD A;  2EIN C;  2QM8 A;  3FYI B;  2IJJ A;  4HZ3 A;  2Q8F A;  3IC7 A;  2JDI G;  1YES A;  3K60 A;  4ASU G;  4URL A;  2WI5 A;  2D3O W;  3DTU B;  2WLL A;  5B1A C;  4CE3 A;  3OW6 A;  3K3W A;  3JD2 A;  4RUF A;  4O05 A;  2W6J G;  4LWH A;  1THZ A;  5KUM A;  3C0E A;  3OMU A;  4LP8 A;  1GM7 A;  4L91 A;  1ZWH A;  3TZ0 A;  4RUE A;  4FCQ A;  2KB1 A;  1NR7 A;  3W7X A;  4EMV A;  1DLB A;  5CMU A;  1H8E G;  1U0Z A;  2YSU B;  3ASN C;  4ZVI A;  3SPJ A;  4EFT A;  2XDK A;  2FTK A;  2ZDI A;  4HXW A;  5B3S B;  2OCC C;  3ABK C;  1K8A W;  1YT2 A;  1S16 A;  2W6I G;  1OCR B;  1Y66 A;  4LWF A;  3AG1 C;  3ETE A;  5LBQ A;  3BM9 A;  4H7Q A;  4URO A;  2YKB A;  4DO2 A;  4WUD A;  3JD3 A;  1A4H A;  3D36 A;  1QY8 A;  5M4H A;  4R3M A;  4HXZ A;  1SZT A;  2H55 A;  2Q8I A;  4G2K A;  4GX5 A;  2XCM A;  1OCC B;  3VHC A;  1I5A A;  4R6Z A;  2F43 G;  3B28 A;  1EI1 A;  3T10 A;  4AWP A;  1I5D A;  3ZCC A;  3OGC C;  3CME V;  3ABU A;  3G7E A;  2XAB A;  1DF5 A;  2FYP A;  4YKT A;  1NBM G;  2YED A;  4HYM A;  5BOC A;  2WEQ A;  4YKX A;  1M9N A;  2R9R B;  4U7O A;  2CH4 A;  1UYC A;  3B26 A;  5LGU A;  1Y8N A;  2YEG A;  3R4P A;  1YC1 A;  5F5R A;  2GQP A;  5KA5 A;  2YGF A;  1TC6 A;  2BZ5 A;  1DF4 A;  2IJH A;  2YKE A;  3LDC A;  2EIL B;  5EBM C;  4P7A A;  3ZMU A;  2EIK C;  4HZ0 A;  3G75 A;  4BW5 A;  2YK2 A;  2ZR2 A;  2XHT A;  1R6K A;  1S5H C;  4XIT A;  4U93 A;  1SER A;  4UVB A;  2BU6 A;  3O2F A;  3E89 A;  1Q81 W;  4ASA A;  4KQV A;  2YE5 A;  1F4N A;  5IY5 B;  2CG9 A;  2Q8H A;  4RQE A;  1K97 A;  1AM1 A;  4MTG A;  4PU9 A;  1OZ0 A;  2P7T C;  4KSH A;  1K4D C;  2IH1 C;  2WLK A;  1MAB G;  3TZ5 A;  3RW0 A;  3JD1 A;  2FWY A;  3VHD A;  1SRY A;  4HYP A;  1YS3 A;  2ZBK B;  2Q8G A;  3CRL A;  1ZW9 A;  1Q7Y W;  4MVQ A;  1MG1 A;  2IOR A;  3ZRV A;  4JPR A;  3HZ5 A;  4MPN A;  2Z5U A;  4V25 A;  3FKS G;  1UYD A;  1KKD A;  4EGH A;  3TET A;  4XDM A;  2HVK C;  2UXN A;  1E1R G;  5D7D A;  3K04 A;  3H01 A;  2EIM C;  2QM7 A;  1VQ8 V;  3CP1 A;  3ZMS A;  1KC8 W;  1CEZ A;  4PDM A;  1UJW B;  4XDK A;  2X6B A;  2BT0 A;  4KFG A;  1TIL A;  1VQ4 V;  2DQ3 A;  1QLE C;  4WFG A;  2OT5 A;  2JEU A;  1GM9 A;  1Y8P A;  1M57 B;  3OR6 C;  2WI4 A;  2M7W A;  2QEX V;  3O6O A;  1V55 C;  5BOD A;  2XOK G;  3UKM A;  2VWC A;  5M4M A;  5D7C A;  3A0X A;  2Y69 C;  4XE2 A;  1ORQ C;  2CK3 G;  3WHA A;  3BEH A;  4YKU A;  4CWO A;  2IOP A;  4U7N A;  3CC4 V;  5L3D A;  3NXS A;  3B8M A;  3A0Z A;  5M4N A;  1KP2 A;  1UYH A;  4O07 A;  3X2Q C;  2IWS A;  1GKX A;  2HFE C;  5L3F A;  4OXS A;  1QVG U;  2C2A A;  3TUH A;  4XTJ A;  2O1U A;  3PEH A;  1SET A;  3QO5 A;  2WLJ A;  4RO2 A;  2WSS G;  4L94 A;  2YI5 A;  4RAI A;  2BTZ A;  3SL2 A;  4MVZ A;  1K9M W;  2CCT A;  1AMW A;  2ZXW C;  1S0V A;  3ZMV A;  4QE9 A;  2HCH A;  1CP9 A;  2XAS A;  1VQL V;  4EM7 A;  3KG2 A;  1UY7 A;  1FXK C;  2YI7 A;  4BQG A;  2A79 B;  2EXL A;  1EA6 A;  3IGA C;  1QVF U;  4GEE A;  3ZXQ A;  3GWO A;  3FT5 A;  2DWD C;  2XD6 A;  2H94 A;  1TBW A;  5J71 A;  3R4O A;  3WG7 B;  5DM6 V;  3D2R A;  1FXH A;  1YHQ V;  2WLM A;  4WUB A;  3FB6 C;  2GHY A;  2YE4 A;  4PDV A;  3CCR V;  2QF6 A;  4UVC A;  1Z5C A;  4CBC A;  4YKQ A;  3CD6 V;  3SPI A;  1KZN A;  5FND A;  4X89 A;  1M1K W;  1Y4S A;  2W0F C;  3WFV A;  1YT0 A;  3EKO A;  5L3G A;  1F23 A;  2WEP A;  4L87 A;  1L1F A;  2WWW A;  4WF9 V;  3KE6 A;  3SPH A;  4I5S A;  4MW8 A;  4HZ5 A;  1JQ0 A;  1M56 B;  2QFO A;  3PEJ A;  4URM A;  4MOT A;  4YKZ A;  2HG5 C;  4MB9 A;  3BY6 A;  1UY8 A;  4TSF G;  4BQJ A;  1YJ9 V;  3OMN B;  4UVA A;  4KUM A;  4JAS A;  3OEH G;  4FMT A;  1YC4 A;  1KEC A;  4MP2 A;  3H4L A;  5FL7 G;  4E02 A;  2X6A A;  2DYS C;  3LUT B;  2ZDI C;  5LHG A;  2K1E A;  3AG3 B;  1K5Q A;  1BKN A;  1L0O A;  1U2O A;  1W0K G;  4LWG A;  3GIF A;  2QA4 V;  3R4M A;  1JVM A;  1NJI W;  2H8P C;  2YJW A;  4XIP A;  5M4E A;  1EZJ A;  2YEE A;  1Z59 A;  2JIZ G;  4HY1 A;  3A0Y A;  3OUS A;  4PA3 A;  5FNF A;  4JGS A;  3AG4 B;  5CTU A;  3SJQ C;  1XL4 A;  3LSS A;  3CWV A;  5LHI A;  4R1F A;  4TWK A;  3T0Z A;  1S77 D;  1PNM A;  5IN9 A;  1E79 G;  1GKZ A;  4WFH A;  4XCJ A;  1K7D A;  3E8F A;  4FK5 C;  1PD3 A;  2QTO A;  4P9P A;  3CCL V;  4FJC C;  2IWX A;  1YT1 A;  4MVM A;  4JTC B;  5LGN A;  2YE6 A;  4HYO A;  4XDJ A;  4H85 A;  3HYZ A;  4HAM A;  2ITC C;  3EHG A;  2XAQ A;  4LWI A;  3SYQ A;  1UYI A;  4PA6 A;  1OCZ B;  3U67 A;  5CBF A;  3TCU A;  3JZ3 A;  2VW5 A;  1S14 A;  4R8C A;  2BOC C;  4AS9 A;  1AI6 A;  2WLI A;  3FV5 A;  2OTJ V;  1COW G;  1QYE A;  3SYA A;  2PI4 A;  4PRX A;  1R6N A;  1M90 W;  5EK0 A;  2NLJ C;  1VQ6 V;  3SPG A;  1R3I C;  4LWE A;  1NHJ A;  5B1O A;  4ASF A;  2PNR A;  4MTO A;  3GIE A;  4O04 A;  2BRC A;  2FWZ A;  2DW4 A;  2IU3 A;  4QNH B;  5LHH A;  4GFN A;  2YEJ A;  5LGT A;  3FB7 C;  4JF3 A;  1AR1 B;  2XAH A;  2YGA A;  3GIG A;  1AJ6 A;  2BU7 A;  2IOQ A;  4O09 A;  3G7B A;  2Y48 A;  1PL0 A;  2CGF A;  2ESA A;  5B1B B;  2VCI A;  5CF0 A;  3OPD A;  1QLN A;  4L93 A;  3MD0 A;  4PDR A;  4QIW F;  2P90 A;  5B3S C;  3VHA A;  2YI6 A;  1AI5 A;  4EEH A;  2Q69 A;  2B1G A;  4PA7 A;  3G71 V;  1XL6 A;  4BIU A;  1OCR C;  2WPD G;  3AG2 B;  1G4Y B;  3O0I A;  4KSG A;  1F51 A;  1S76 D;  2YKJ A;  4XKK A;  3BMY A;  3R92 A;  3AEI A;  3QO7 A;  4JYB A;  3INX A;  1NR1 A;  1VQM V;  2X7R B;  4JQL A;  2BOB C;  2LP7 A;  2BU8 A;  3K06 A;  1OCC C;  3ZN1 A;  5L3B A;  4P8O A;  5H6R A;  4XDL A;  3E2E A;  4G27 B;  5KA6 A;  1V54 B;  5M4K A;  3D0B A;  1TUE B;  5IDJ A;  3QDD A;  2WAM A;  3CCJ V;  1K34 A;  3EKR A;  2YEH A;  2LFR A;  3ZXO A;  2DYR B;  2WLH A;  4ASG A;  3RVY A;  1YER A;  5F3K A;  1WLE A;  5D7R A;  4EGK A;  4P9O A;  5D6Q A;  3P32 A;  3T0H A;  3W7U A;  3MNR P;  1OCO B;  3SYP A;  3ABL B;  1Q86 W;  4MVO A;  5B1N A;  2XND G;  3H80 A;  2XDU A;  1I5B A;  2GSM B;  2EIL C;  1E1Q G;  5EBL C;  3ZRX A;  2YJX A;  3K9A A;  5E1A C;  1ZXM A;  3SYO A;  3U2D A;  1H8H G;  2ITD C;  3F7Y C;  4BAE A;  1ROP A;  2EIJ B;  5IY5 C;  4HY6 A;  1YSC A;  1AJN A;  3PJS K;  1DTO A;  3HZ1 A;  4EGI A;  1QR9 A;  5GW7 A;  4ZBM A;  2BSM A;  4QPJ A;  1UY9 A;  1R3L C;  3MHH C;  2XDX A;  1EFR G;  3HPL C;  3EHJ A;  4JYC A;  2YKC A;  3CMA V;  2EZO A;  1K5S A;  4YKW A;  3GB7 C;  3IFX A;  1GKF A;  1R3K C;  3DGE A;  3JD4 A;  3LNM B;  3ZRS A;  3CPW U;  1KD1 W;  2O1W A;  1H7S A;  2JK5 C;  3ABM B;  2HKO A;  1QCE A;  2Z3Y A;  3CRK A;  2JJ2 G;  5CBH A;  3R91 A;  3I55 V;  4MPC A;  2EBO A;  5FNC A;  4EKW A;  2WLN A;  5CPH A;  2FXS A;  2B5U A;  4X88 A;  3ZRW A;  1UYM A;  5HFL A;  5EC2 C;  1KP3 A;  4YKR A;  1VQ5 V;  4WFE A;  5IYD O;  3TTZ A;  2QG2 A;  4BAY A;  1M57 C;  4W7T A;  3VBB A;  2PI5 A;  3LSQ A;  5KUK A;  3JCZ A;  2XJJ A;  5DN6 G;  2ZKJ A;  3B25 A;  4R7C A;  1TH8 A;  2ZDY A;  3STZ C;  1R73 A;  3OM3 B;  3OMI B;  2A0L A;  3K97 A;  4P30 A;  1F4M A;  1FXV A;  2ZR3 A;  2BYI A;  5L3C A;  3CCV V;  3CCE V;  1NVP B;  1W0J G;  2WER A;  2YEB A;  2QKS A;  1K33 A;  4QPK A;  1QBZ A;  2XHR A;  2WLI B;  1YTF D;  3WQ9 A;  3G4S V;  3LDD A;  1NH2 B;  1YTF B;  1WPX A;  2XJG A;  3R65 A;  4JAU A;  1S72 V;  1G8M A;  2YE9 A;  4XKO A;  3CXC U;  2XAJ A;  3RKZ A;  3HB3 B;  4WFA V;  4MPE A;  4XIR A;  2LFS A;  1AJP A;  1LNQ A;  3T2M A;  3ASO B;  3W7S A;  4XIQ A;  4UXN A;  1NHI A;  4CWS A;  3OWD A;  4B7P A;  3FT8 A;  3TZ2 A;  1MSW D;  4CE1 A;  3QO8 A;  1VQK V;  3OE7 G;  4YKY A;  2A9H A;  2WI1 A;  1H2G A;  3GIG B;  4E2L A;  3EHF A;  3WG7 C;  2XX5 A;  4MW3 A;  1RM1 B;  1I5Y A;  3M99 B;  1UYG A;  2EIN B;  2XHX A;  5IYC O;  2IJK A;  3E83 A;  4WFB V;  2O1V A;  2DQ0 A;  3K0G A;  1I5C A;  1YIT V;  1US7 A;  5J6A A;  1VQ7 V;  4E00 A;  5B1A B;  1VQN V;  3E8B A;  1B6Q A;  2R9I A;  2Q6A A;  4FIP C;  4MTX A;  3TK1 A;  1UYL A;  4V26 A;  1JOY A;  4MT8 A;  3RLP A;  4FPP A;  3QTF A;  4P2Z A;  5EC1 C;  4NH7 A;  1AH6 A;  2QE7 G;  4MVS A;  3W7W A;  4GX0 A;  1M56 C;  3ASN B;  4RQF A;  3CCQ V;  3LPS A;  5IYB O;  3RLQ A;  2P67 A;  1TC0 A;  1ARO P;  4CWQ A;  1TID A;  3CCU V;  4L8Z A;  2OCC B;  3ABK B;  5CN0 A;  1YC3 A;  2XAG A;  1AI7 A;  3LNU A;  1R62 A;  1BHA A;  2YK9 A;  3AG1 B;  3OWB A;  4LPB A;  2BU5 A;  3INW A;  3K98 A;  4EFU A;  4K4O A;  3QNE A;  3B8N A;  4LC1 A;  3AG3 C;  4GT1 A;  2IU0 A;  3W7T A;  4H81 A;  4GX2 A;  2Q68 A;  1I59 A;  1QR8 A;  2XK2 A;  4GCZ A;  4CE2 A;  1IXM A;  4XD8 A;  4KFM A;  3T1K A;  4PDL A;  3TZ4 A;  4DUH A;  3OAA G;  3AG4 C;  3OUF A;  2V1D A;  1GM8 A;  2UWD A;  2ZD9 A;  3OMA B;  3K03 A;  4JTD B;  3ZMZ A;  4F4L A;  3ABT A;  2XX4 A;  2JJC A;  2Q2E B;  5GGZ A;  1OHH G;  4PRV A;  1UYK A;  1YI2 V;  1B63 A;  2XX2 A;  2EZP A;  3F7V C;  2XJX A;  3ZKB A;  2CCU A;  2HG1 A;  3T4Z A;  4WUC A;  3RLR A;  1GMG A;  2HVJ C;  2BU2 A;  4GT8 A;  2JEX A;  2EIK B;  4BXI A;  1B62 A;  1H38 A;  5IDM A;  3ETG A;  1K3E A;  1OCZ C;  3VOU A;  5CA3 A;  3VAD A;  3ZIA G;  2X6C A;  1FFT B;  2IWU A;  1JPX A;  3FB8 C;  1ID0 A;  4I3H A;  5HFM A;  4UUJ C;  1VQ9 V;  1NHH A;  4QE7 A;  1Q82 W;  3MHS C;  1VQO V;  1HWY A;  1ZXN A;  3A0W A;  1PKX A;  1ENV A;  3UM7 A;  3B27 A;  3A0T A;  1RPR A;  2YGE A;  3ZRW B;  3E35 A;  2E0A A;  3D3I A;  2YEV A;  1QZR A;  1RPO A;  3K99 A;  3Q5K A;  3U2K A;  3CGY A;  4H37 A;  4AWO A;  3B24 A;  4J9Y B;  1KQS U;  3E86 A;  1PNL A;  2V7Q G;  3STL C;  1BGQ A;  2YEC A;  4NH9 A;  2YEA A;  1P7B A;  3G6E V;  5B1B C;  1CPY A;  2WI7 A;  2K5B A;  3LDE A;  1BL8 A;  4XC0 A;  4MSW C;  5CTY A;  2EIM B;  4CZZ A;  4I9W A;  1W2B U;  4AWQ A;  2ZQM A;  1QLE B;  1ZWI C;  3ZN0 A;  2YE2 A;  1MX0 A;  3RVZ A;  4XBF A;  1R3J C;  4MVR A;  4TT3 G;  1GO3 F;  1K4C C;  3AG2 C;  3B77 A;  1V55 B;  4L90 A;  1I58 A;  4DZY A;  4LCU C;  5L3E A;  1JX9 A;  3ZKD A;  3OEE G;  4MP7 A;  2Y69 B;  1MOF A;  2UXX A;  4KP4 A;  3CCS V;  2XAF A;  1MU5 A;  4ASB A;  3CCM V;  4JAV A;  1S3J A;  4B6C A;  2IJI A;  5EBW C;  1B3Q A;  1V54 C;  3SPC A;  2DWE C;  3ZMT A;  3X2Q B;  1YET A;  2WI6 A;  4GGL A;  2EJR A;  2YKI A;  1YIJ V;  1Y4M A;  4YXW G;  3EHB B;  2DYR C;  1GK9 A;  1J95 A;  5BZB A;  4DXW A;  4QJF B;  1P4R A;  4GX1 A;  2WI2 A;  2GFD A;  1UYE A;  5D6P A;  2ZXW B;  1AH8 A;  5C93 A;  1OCO C;  1FXK B;  3ML0 A;  1JJ2 U;  1BYQ A;  3ABL C;  2YEF A;  4G28 B;  3OR7 C;  2OTL V;  4CWR A;  4CWF A;  1GTO A;  4J9Z B;  4X8A A;  2AHZ A;  4R50 A;  3OW2 U;  2VCJ A;  4CWT A;  5FWK A;  1BMF G;  2WI3 A;  5CBG A;  3ETD A;  2NNU A;  1GJV A;  3SYC A;  2HLD G;  2EIJ C;  4PEL A;  1Y4U A;  3T4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...