3CGYA

Crystal structure of salmonella sensor kinase phoq catalytic domain in complex with radicicol
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
155
structure length
133
Chain Sequence
SVLLSRELHPVAPLLDNLISALNKVYQRKGVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDDHLHIFVEDDGPGIPVGLAVAREITEQYAGQIIASDSLLGGARMEVVFGRQHPTQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Virulence sensor histidine kinase phoQ
publication title The Hsp90 inhibitor radicicol interacts with the ATP-binding pocket of bacterial sensor kinase PhoQ.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 33
structure length 133
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3cgyA00
4GEEA 5BODA 2IOQA 4FMTA 1EA6A 4FCPA 4CWRA 3ZXQA 1NHHA 4QPKA 3Q5LA 3C0EA 4XCLA 2VWCA 1TH8A 4HZ0A 5IN9A 1ZXNA 1H7SA 1YS3A 4NH7A 2VCIA 4U93A 4MBCA 4AWPA 4P8OA 4U7NA 4YKYA 2YE5A 3JZ3A 5M4NA 3IEDA 4XCJA 4KP4A 1B3QA 3OPDA 1UYEA 4O05A 1Y8PA 3ZKBA 1UYDA 1UYMA 2YE2A 1Y8OA 1UYKA 4BIZA 2BU7A 3G75A 4B7PA 5D7RA 2XABA 4GCZA 3K98A 2WI5A 2YEBA 2YEIA 2WI2A 3A0ZA 2QG0A 3K97A 4X9LA 2XJXA 2YEFA 3LNUA 2XX4A 4EEHA 2CG9A 3U67A 2E0AA 2XDLA 4O09A 4QPJA 4YKRA 3K99A 3BMYA 4O0BA 1US7A 2YI5A 2XHXA 2YI6A 4V25A 2YEGA 1MX0A 1YSZA 1UY6A 3A0RA 4K4OA 4L94A 4YKZA 1AJ6A 2QF6A 1Z5BA 4ASBA 3TTZA 4LP0A 2XX5A 2YECA 4XC0A 4YKWA 4XDMA 4H81A 4MPCA 3VADA 4EGIA 4O04A 1QZRA 2YJWA 2JJCA 1R62A 2YI0A 4XD8A 4LWEA 4YKTA 4EFUA 2VCJA 4PRVA 4XIPA 4WUCA 2YKEA 1I5BA 2YI7A 4KFGA 3B24A 4I3HA 3T0ZA 5IDJA 3TZ4A 3ZM7A 2Q8GA 3K60A 4XKKA 4CWOA 2ZBKB 3WQ9A 2CH4A 5C93A 4AS9A 2GQPA 1YT1A 1UYLA 1KIJA 2YK9A 2QG2A 4JASA 3A0XA 2EXLA 5D6QA 3SL2A 3O2FA 1NHJA 1B63A 1BKNA 1YC3A 3D0BA 1UY8A 4JAUA 2XD6A 3KE6A 5J6AA 3OWDA 3TZ2A 4YKXA 1ZWHA 3GIGB 3VHAA 5D7DA 5CTYA 1YERA 3RLPA 1YSRA 2FWYA 4MB9A 3R4NA 3HEKA 4URMA 1UYFA 3O6OA 3MNRP 4V26A 4HXWA 2YEHA 5D6PA 1I5AA 4KSHA 1Z59A 4P7AA 4PRXA 1ZW9A 2YGFA 3CGZA 1U2OA 2YKBA 1GJVA 5M4PA 1AH6A 3TZ5A 3B28A 1UY9A 4HY6A 1QY8A 3G7BA 3EHFA 1TBWA 4E00A 4MP7A 1L0OA 1JM6A 2CGFA 2CCTA 2XX2A 4NH9A 1THNA 1U0ZA 3R4PA 2YE8A 4HY1A 1BXDA 2YEAA 1Z5AA 4H85A 2CCSA 4XIRA 2ZDYA 2YKCA 4R3AA 3OWBA 4HXZA 4ZKIA 1YT0A 4EM7A 1Z5CA 3QDDA 1Y4UA 5D7CA 3TZ0A 4XITA 2IWUA 3LPSA 3PEJA 3EKOA 5M4KA 1Y8NA 2K5BA 3B27A 4GGLA 2BT0A 2WI6A 2YE6A 2BTZA 2QFOA 2ZDXA 3HYZA 4ZVIA 4E02A 5M4EA 2XHTA 2YKJA 2Q8HA 1UYCA 4W7TA 4B6CA 5CPHA 1YC1A 2WI7A 1TIDA 1PVGA 1OSFA 3DGEA 3ZKDA 4YKQA 4KTNA 4DZYA 1BGQA 2IORA 5FNCA 1I58A 2FXSA 1UY7A 5CTXA 1H7UA 4L93A 3H80A 3NMQA 2IOPA 3FT5A 3FV5A 2XDXA 2BYIA 3INXA 3T10A 1I59A 4I5SA 1A4HA 4FCRA 4JQLA 3G7EA 4LWGA 1NHIA 4NH8A 4HYPA 2YE4A 4XKAA 1ZXMA 1UYIA 2YE7A 3EHJA 4KSGA 4LPBA 5M4MA 1MU5A 2YEDA 3C11A 3D36A 2YE3A 4XIQA 4U7OA 3B25A 4CE1A 3A0TA 2YEEA 4GT8A 4BQJA 3HZ5A 3BM9A 2BU6A 3OMUA 2YE9A 3VHDA 3T0HA 3HZ1A 1AMWA 2FYPA 4BAEA 1I5DA 4AWOA 3Q5JA 4LWHA 3A0WA 1Y4SA 3PEHA 4MPNA 4H7QA 4WUBA 2XHRA 2H55A 4CWTA 2BYHA 4GFNA 2YK2A 4Q20A 4URLA 1GKXA 4MP2A 2JKIA 3U2DA 4LWIA 2BREA 3EHHA 4FCQA 2FWZA 5FWKA 3A0YA 4FPPA 2IWXA 2UWDA 2YEJA 2Q8FA 3RLQA 2XJJA 2WEQA 4HZ5A 4JAVA 4CWSA 1B62A 1TILA 4L90A 3T1KA 2XCMA 5CTUA 3CWVA 3INWA 2WEPA 2IWSA 2XDKA 2YKIA 2HG1A 5BOCA 2HCHA 3H4LA 4L8ZA 4BXIA 4ASGA 2WERA 4MOTA 2O1WA 1ID0A 2WI1A 3O0IA 4E01A 4WUDA 2PNRA 4EGHA 2BZ5A 3FT8A 2XK2A 3HHUA 3T2SA 4EFTA 3ZXOA 2YJXA 3RLRA 2ESAA 1YT2A 4R3MA 1YC4A 5CF0A 3GIGA 4DUHA 3CRKA 1QYEA 4CWNA 1UYGA 2VW5A 4XTJA 2HKJA 4BQGA 1AH8A 5GGZA 4O07A 2BSMA 2WI4A 4GQTA 4ASAA 1BYQA 4XE2A 3D2RA 2BU8A 5M4HA 5FNDA 4CWQA 4KQVA 3EHGA 2XDUA 1AM1A 5FNFA 4BIUA 4HYMA 4PU9A 5CTWA 3GIEA 2GFDA 3EKRA 2C2AA 2BU5A 3Q5KA 2YGEA 3QTFA 4PL9A 4YKUA 4EMVA 3R92A 1TC0A 1GKZA 2ZKJA 4LWFA 4CWFA 3GIFA 3R4MA 4AWQA 2BU2A 2AKPA 3VHCA 3R91A 3U2KA 4CE2A 4MPEA 4EGKA 3WHAA 2O1UA 1YESA 2H8MA 3CGYA 2XJGA 5L3JA 1EI1A 3B26A 4URNA 1TC6A 1KZNA 2Q2EB 5IDMA 5F3KA 2Q8IA 2CCUA 2O1VA 5J71A 1YETA 4XKOA 4CE3A 2XDSA 4CWPA 4R1FA 5F5RA 2BRCA 2WI3A 3HYYA 2YGAA 3OW6A 1S16A 3RKZA 1UYHA 4L91A 1S14A 4ASFA 1I5CA 3CRLA 3R4OA 4UROA 3TUHA
chains in the Genus database with same CATH superfamily
4GEEA 5BODA 2IOQA 4FMTA 1EA6A 4FCPA 4CWRA 3ZXQA 1NHHA 4QPKA 3Q5LA 3C0EA 4XCLA 2VWCA 1TH8A 4HZ0A 5IN9A 1ZXNA 1H7SA 1YS3A 4NH7A 2VCIA 4U93A 4MBCA 4AWPA 4P8OA 4U7NA 4YKYA 2YE5A 3JZ3A 5M4NA 3IEDA 4XCJA 4KP4A 1B3QA 3OPDA 1UYEA 4O05A 1Y8PA 3ZKBA 1UYDA 1UYMA 2YE2A 1Y8OA 1UYKA 4BIZA 2BU7A 3G75A 4B7PA 5D7RA 2XABA 4GCZA 3K98A 2WI5A 2YEBA 2YEIA 2WI2A 3A0ZA 2QG0A 3K97A 4X9LA 2XJXA 2YEFA 3LNUA 2XX4A 4EEHA 2CG9A 3U67A 2E0AA 2XDLA 4O09A 4QPJA 4YKRA 3K99A 3BMYA 4O0BA 1US7A 2YI5A 2XHXA 2YI6A 4V25A 2YEGA 1MX0A 1YSZA 1UY6A 3A0RA 4K4OA 4L94A 4YKZA 1AJ6A 2QF6A 1Z5BA 4ASBA 3TTZA 4LP0A 2XX5A 2YECA 4XC0A 4YKWA 4XDMA 4H81A 4MPCA 3VADA 4EGIA 4O04A 1QZRA 2YJWA 2JJCA 1R62A 2YI0A 4XD8A 4LWEA 4YKTA 4EFUA 2VCJA 4PRVA 4XIPA 4WUCA 2YKEA 1I5BA 2YI7A 4KFGA 3B24A 4I3HA 3T0ZA 5IDJA 3TZ4A 3ZM7A 2Q8GA 3K60A 4XKKA 4CWOA 2ZBKB 3WQ9A 2CH4A 5C93A 4AS9A 2GQPA 1YT1A 1UYLA 1KIJA 2YK9A 2QG2A 2HHIA 4JASA 3A0XA 2EXLA 5D6QA 3SL2A 3O2FA 1NHJA 1B63A 1BKNA 1YC3A 3D0BA 1UY8A 4JAUA 2XD6A 3KE6A 5J6AA 3OWDA 3TZ2A 4YKXA 1ZWHA 3GIGB 3VHAA 5D7DA 5CTYA 1YERA 3RLPA 1YSRA 2FWYA 4MB9A 1F51A 3R4NA 3HEKA 4URMA 1UYFA 3O6OA 3MNRP 4V26A 4HXWA 2YEHA 5D6PA 1I5AA 4KSHA 1Z59A 4P7AA 4PRXA 1ZW9A 2YGFA 3CGZA 1U2OA 2YKBA 1GJVA 5M4PA 1AH6A 3TZ5A 3B28A 1UY9A 4HY6A 1QY8A 3G7BA 3EHFA 1TBWA 4E00A 4MP7A 1L0OA 1JM6A 2CGFA 2CCTA 2XX2A 4NH9A 1THNA 1U0ZA 3R4PA 2YE8A 4HY1A 1BXDA 2YEAA 1Z5AA 4H85A 2CCSA 4XIRA 2ZDYA 2YKCA 4R3AA 3OWBA 4HXZA 4ZKIA 1YT0A 4EM7A 1Z5CA 3QDDA 1Y4UA 5D7CA 3TZ0A 4XITA 2IWUA 3LPSA 3PEJA 3EKOA 5JENA 5M4KA 1Y8NA 2K5BA 3B27A 4GGLA 2BT0A 2WI6A 2YE6A 2BTZA 2QFOA 2ZDXA 3HYZA 4ZVIA 4E02A 5M4EA 2XHTA 2YKJA 2Q8HA 1UYCA 4W7TA 4B6CA 5CPHA 1YC1A 3S5TA 2WI7A 1TIDA 1PVGA 1OSFA 3DGEA 3ZKDA 4YKQA 4KTNA 4DZYA 1BGQA 2IORA 5FNCA 1I58A 2FXSA 1UY7A 2FTKA 5CTXA 1H7UA 4L93A 3H80A 3NMQA 2IOPA 3FT5A 3FV5A 2XDXA 2BYIA 3INXA 3T10A 1I59A 4I5SA 1A4HA 4FCRA 4JQLA 3G7EA 4LWGA 1NHIA 4NH8A 4HYPA 2YE4A 4XKAA 1ZXMA 1UYIA 2YE7A 3EHJA 4KSGA 4LPBA 5M4MA 1MU5A 2YEDA 3C11A 3D36A 2YE3A 4XIQA 4U7OA 2C1IA 3B25A 4CE1A 3A0TA 2YEEA 4GT8A 4BQJA 3HZ5A 3BM9A 2BU6A 3OMUA 2YE9A 3VHDA 3T0HA 3HZ1A 1AMWA 2FYPA 4BAEA 1I5DA 4AWOA 3Q5JA 4LWHA 3A0WA 1Y4SA 3PEHA 4MPNA 4H7QA 4WUBA 2XHRA 2H55A 4CWTA 2BYHA 4GFNA 2YK2A 4Q20A 4URLA 1GKXA 4MP2A 2JKIA 3U2DA 4LWIA 2BREA 3EHHA 4FCQA 2FWZA 5FWKA 3A0YA 4FPPA 2IWXA 2UWDA 2YEJA 2Q8FA 3RLQA 2XJJA 2WEQA 4HZ5A 4JAVA 4CWSA 1B62A 1TILA 4L90A 3T1KA 2XCMA 5CTUA 3CWVA 3INWA 2WEPA 2IWSA 2XDKA 2YKIA 2HG1A 5BOCA 2HCHA 3H4LA 4L8ZA 4BXIA 4ASGA 3LMMA 1IXMA 2WERA 4MOTA 2O1WA 1ID0A 2WI1A 3O0IA 4E01A 4WUDA 2PNRA 4EGHA 2BZ5A 3FT8A 2XK2A 3HHUA 3T2SA 4EFTA 3ZXOA 2YJXA 3RLRA 2ESAA 1YT2A 4R3MA 1YC4A 5CF0A 3GIGA 4DUHA 3CRKA 1QYEA 4CWNA 1UYGA 2VW5A 4XTJA 2HKJA 4BQGA 1AH8A 5GGZA 4O07A 2BSMA 2WI4A 4GQTA 4ASAA 1BYQA 4XE2A 3D2RA 2BU8A 5M4HA 5FNDA 4CWQA 2C1GA 4KQVA 3EHGA 2XDUA 1AM1A 5FNFA 4BIUA 4HYMA 4PU9A 5CTWA 3GIEA 2GFDA 3EKRA 2C2AA 2BU5A 3Q5KA 2YGEA 3QTFA 4PL9A 4YKUA 4EMVA 3R92A 1TC0A 1GKZA 2ZKJA 4LWFA 4CWFA 3CYGA 3GIFA 3R4MA 4AWQA 2BU2A 2AKPA 3VHCA 3R91A 3U2KA 4CE2A 4MPEA 4EGKA 3WHAA 2O1UA 1YESA 2H8MA 3CGYA 2XJGA 5L3JA 1EI1A 3B26A 4URNA 1TC6A 1KZNA 2Q2EB 5IDMA 5F3KA 2Q8IA 2CCUA 2O1VA 5J71A 1YETA 4XKOA 4CE3A 2XDSA 4CWPA 4R1FA 5F5RA 2BRCA 2WI3A 3HYYA 4E72A 2YGAA 3OW6A 1S16A 3RKZA 1UYHA 4L91A 1S14A 4ASFA 1I5CA 3CRLA 3R4OA 4UROA 3TUHA
chains in the Genus database with same CATH topology
4GEEA 5BODA 2IOQA 4FMTA 1EA6A 4FCPA 4CWRA 3ZXQA 1NHHA 4QPKA 3Q5LA 3C0EA 4XCLA 2VWCA 1TH8A 4HZ0A 5IN9A 1ZXNA 1H7SA 1YS3A 4NH7A 2VCIA 4U93A 4MBCA 4AWPA 4P8OA 4U7NA 4YKYA 2YE5A 3JZ3A 5M4NA 3IEDA 4XCJA 4KP4A 1B3QA 3OPDA 1UYEA 4O05A 1Y8PA 3ZKBA 1UYDA 1UYMA 2YE2A 1Y8OA 1UYKA 4BIZA 2BU7A 3G75A 4B7PA 5D7RA 2XABA 4GCZA 3K98A 2WI5A 2YEBA 2YEIA 2WI2A 3A0ZA 2QG0A 3K97A 4X9LA 2XJXA 2YEFA 3LNUA 2XX4A 4EEHA 2CG9A 3U67A 2E0AA 2XDLA 4O09A 4QPJA 4YKRA 3K99A 3BMYA 4O0BA 1US7A 2YI5A 2XHXA 2YI6A 4V25A 2YEGA 1MX0A 1YSZA 1UY6A 3A0RA 4K4OA 4L94A 4YKZA 1AJ6A 2QF6A 1Z5BA 4ASBA 3TTZA 4LP0A 2XX5A 2YECA 4XC0A 4YKWA 4XDMA 4H81A 4MPCA 3VADA 4EGIA 4O04A 1QZRA 2YJWA 2JJCA 1R62A 2YI0A 4XD8A 4LWEA 4YKTA 4EFUA 2VCJA 4PRVA 4XIPA 4WUCA 2YKEA 1I5BA 2YI7A 4KFGA 3B24A 4I3HA 3T0ZA 5IDJA 3TZ4A 3ZM7A 2Q8GA 3K60A 4XKKA 4CWOA 2ZBKB 3WQ9A 2CH4A 5C93A 4AS9A 2GQPA 1YT1A 1UYLA 1KIJA 2YK9A 2QG2A 4JASA 3A0XA 2EXLA 5D6QA 3SL2A 3O2FA 1NHJA 1B63A 1BKNA 1YC3A 3D0BA 1UY8A 4JAUA 2XD6A 3KE6A 5J6AA 3OWDA 3TZ2A 4YKXA 1ZWHA 3GIGB 3VHAA 5D7DA 5CTYA 1YERA 3RLPA 1YSRA 2FWYA 4MB9A 3R4NA 3HEKA 4URMA 1UYFA 3O6OA 3MNRP 4V26A 4HXWA 2YEHA 5D6PA 1I5AA 4KSHA 1Z59A 4P7AA 4PRXA 1ZW9A 2YGFA 3CGZA 1U2OA 2YKBA 1GJVA 5M4PA 1AH6A 3TZ5A 3B28A 1UY9A 4HY6A 1QY8A 3G7BA 3EHFA 1TBWA 4E00A 4MP7A 1L0OA 1JM6A 2CGFA 2CCTA 2XX2A 4NH9A 1THNA 1U0ZA 3R4PA 2YE8A 4HY1A 1BXDA 2YEAA 1Z5AA 4H85A 2CCSA 4XIRA 2ZDYA 2YKCA 4R3AA 3OWBA 4HXZA 4ZKIA 1YT0A 4EM7A 1Z5CA 3QDDA 1Y4UA 5D7CA 3TZ0A 4XITA 2IWUA 3LPSA 3PEJA 3EKOA 5M4KA 1Y8NA 2K5BA 3B27A 4GGLA 2BT0A 2WI6A 2YE6A 2BTZA 2QFOA 2ZDXA 3HYZA 4ZVIA 4E02A 5M4EA 2XHTA 2YKJA 2Q8HA 1UYCA 4W7TA 4B6CA 5CPHA 1YC1A 2WI7A 1TIDA 1PVGA 1OSFA 3DGEA 3ZKDA 4YKQA 4KTNA 4DZYA 1BGQA 2IORA 5FNCA 1I58A 2FXSA 1UY7A 5CTXA 1H7UA 4L93A 3H80A 3NMQA 2IOPA 3FT5A 3FV5A 2XDXA 2BYIA 3INXA 3T10A 1I59A 4I5SA 1A4HA 4FCRA 4JQLA 3G7EA 4LWGA 1NHIA 4NH8A 4HYPA 2YE4A 4XKAA 1ZXMA 1UYIA 2YE7A 3EHJA 4KSGA 4LPBA 5M4MA 1MU5A 2YEDA 3C11A 3D36A 2YE3A 4XIQA 4U7OA 3B25A 4CE1A 3A0TA 2YEEA 4GT8A 4BQJA 3HZ5A 3BM9A 2BU6A 3OMUA 2YE9A 3VHDA 3T0HA 3HZ1A 1AMWA 2FYPA 4BAEA 1I5DA 4AWOA 3Q5JA 4LWHA 3A0WA 1Y4SA 3PEHA 4MPNA 4H7QA 4WUBA 2XHRA 2H55A 4CWTA 2BYHA 4GFNA 2YK2A 4Q20A 4URLA 1GKXA 4MP2A 2JKIA 3U2DA 4LWIA 2BREA 3EHHA 4FCQA 2FWZA 5FWKA 3A0YA 4FPPA 2IWXA 2UWDA 2YEJA 2Q8FA 3RLQA 2XJJA 2WEQA 4HZ5A 4JAVA 4CWSA 1B62A 1TILA 4L90A 3T1KA 2XCMA 5CTUA 3CWVA 3INWA 2WEPA 2IWSA 2XDKA 2YKIA 2HG1A 5BOCA 2HCHA 3H4LA 4L8ZA 4BXIA 4ASGA 2WERA 4MOTA 2O1WA 1ID0A 2WI1A 3O0IA 4E01A 4WUDA 2PNRA 4EGHA 2BZ5A 3FT8A 2XK2A 3HHUA 3T2SA 4EFTA 3ZXOA 2YJXA 3RLRA 2ESAA 1YT2A 4R3MA 1YC4A 5CF0A 3GIGA 4DUHA 3CRKA 1QYEA 4CWNA 1UYGA 2VW5A 4XTJA 2HKJA 4BQGA 1AH8A 5GGZA 4O07A 2BSMA 2WI4A 4GQTA 4ASAA 1BYQA 4XE2A 3D2RA 2BU8A 5M4HA 5FNDA 4CWQA 4KQVA 3EHGA 2XDUA 1AM1A 5FNFA 4BIUA 4HYMA 4PU9A 5CTWA 3GIEA 2GFDA 3EKRA 2C2AA 2BU5A 3Q5KA 2YGEA 3QTFA 4PL9A 4YKUA 4EMVA 3R92A 1TC0A 1GKZA 2ZKJA 4LWFA 4CWFA 3GIFA 3R4MA 4AWQA 2BU2A 2AKPA 3VHCA 3R91A 3U2KA 4CE2A 4MPEA 4EGKA 3WHAA 2O1UA 1YESA 2H8MA 3CGYA 2XJGA 5L3JA 1EI1A 3B26A 4URNA 1TC6A 1KZNA 2Q2EB 5IDMA 5F3KA 2Q8IA 2CCUA 2O1VA 5J71A 1YETA 4XKOA 4CE3A 2XDSA 4CWPA 4R1FA 5F5RA 2BRCA 2WI3A 3HYYA 2YGAA 3OW6A 1S16A 3RKZA 1UYHA 4L91A 1S14A 4ASFA 1I5CA 3CRLA 3R4OA 4UROA 3TUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GEE A;  5BOD A;  2IOQ A;  4FMT A;  1EA6 A;  4FCP A;  4CWR A;  3ZXQ A;  1NHH A;  4QPK A;  3Q5L A;  3C0E A;  4XCL A;  2VWC A;  1TH8 A;  4HZ0 A;  5IN9 A;  1ZXN A;  1H7S A;  1YS3 A;  4NH7 A;  2VCI A;  4U93 A;  4MBC A;  4AWP A;  4P8O A;  4U7N A;  4YKY A;  2YE5 A;  3JZ3 A;  5M4N A;  3IED A;  4XCJ A;  4KP4 A;  1B3Q A;  3OPD A;  1UYE A;  4O05 A;  1Y8P A;  3ZKB A;  1UYD A;  1UYM A;  2YE2 A;  1Y8O A;  1UYK A;  4BIZ A;  2BU7 A;  3G75 A;  4B7P A;  5D7R A;  2XAB A;  4GCZ A;  3K98 A;  2WI5 A;  2YEB A;  2YEI A;  2WI2 A;  3A0Z A;  2QG0 A;  3K97 A;  4X9L A;  2XJX A;  2YEF A;  3LNU A;  2XX4 A;  4EEH A;  2CG9 A;  3U67 A;  2E0A A;  2XDL A;  4O09 A;  4QPJ A;  4YKR A;  3K99 A;  3BMY A;  4O0B A;  1US7 A;  2YI5 A;  2XHX A;  2YI6 A;  4V25 A;  2YEG A;  1MX0 A;  1YSZ A;  1UY6 A;  3A0R A;  4K4O A;  4L94 A;  4YKZ A;  1AJ6 A;  2QF6 A;  1Z5B A;  4ASB A;  3TTZ A;  4LP0 A;  2XX5 A;  2YEC A;  4XC0 A;  4YKW A;  4XDM A;  4H81 A;  4MPC A;  3VAD A;  4EGI A;  4O04 A;  1QZR A;  2YJW A;  2JJC A;  1R62 A;  2YI0 A;  4XD8 A;  4LWE A;  4YKT A;  4EFU A;  2VCJ A;  4PRV A;  4XIP A;  4WUC A;  2YKE A;  1I5B A;  2YI7 A;  4KFG A;  3B24 A;  4I3H A;  3T0Z A;  5IDJ A;  3TZ4 A;  3ZM7 A;  2Q8G A;  3K60 A;  4XKK A;  4CWO A;  2ZBK B;  3WQ9 A;  2CH4 A;  5C93 A;  4AS9 A;  2GQP A;  1YT1 A;  1UYL A;  1KIJ A;  2YK9 A;  2QG2 A;  4JAS A;  3A0X A;  2EXL A;  5D6Q A;  3SL2 A;  3O2F A;  1NHJ A;  1B63 A;  1BKN A;  1YC3 A;  3D0B A;  1UY8 A;  4JAU A;  2XD6 A;  3KE6 A;  5J6A A;  3OWD A;  3TZ2 A;  4YKX A;  1ZWH A;  3GIG B;  3VHA A;  5D7D A;  5CTY A;  1YER A;  3RLP A;  1YSR A;  2FWY A;  4MB9 A;  3R4N A;  3HEK A;  4URM A;  1UYF A;  3O6O A;  3MNR P;  4V26 A;  4HXW A;  2YEH A;  5D6P A;  1I5A A;  4KSH A;  1Z59 A;  4P7A A;  4PRX A;  1ZW9 A;  2YGF A;  3CGZ A;  1U2O A;  2YKB A;  1GJV A;  5M4P A;  1AH6 A;  3TZ5 A;  3B28 A;  1UY9 A;  4HY6 A;  1QY8 A;  3G7B A;  3EHF A;  1TBW A;  4E00 A;  4MP7 A;  1L0O A;  1JM6 A;  2CGF A;  2CCT A;  2XX2 A;  4NH9 A;  1THN A;  1U0Z A;  3R4P A;  2YE8 A;  4HY1 A;  1BXD A;  2YEA A;  1Z5A A;  4H85 A;  2CCS A;  4XIR A;  2ZDY A;  2YKC A;  4R3A A;  3OWB A;  4HXZ A;  4ZKI A;  1YT0 A;  4EM7 A;  1Z5C A;  3QDD A;  1Y4U A;  5D7C A;  3TZ0 A;  4XIT A;  2IWU A;  3LPS A;  3PEJ A;  3EKO A;  5M4K A;  1Y8N A;  2K5B A;  3B27 A;  4GGL A;  2BT0 A;  2WI6 A;  2YE6 A;  2BTZ A;  2QFO A;  2ZDX A;  3HYZ A;  4ZVI A;  4E02 A;  5M4E A;  2XHT A;  2YKJ A;  2Q8H A;  1UYC A;  4W7T A;  4B6C A;  5CPH A;  1YC1 A;  2WI7 A;  1TID A;  1PVG A;  1OSF A;  3DGE A;  3ZKD A;  4YKQ A;  4KTN A;  4DZY A;  1BGQ A;  2IOR A;  5FNC A;  1I58 A;  2FXS A;  1UY7 A;  5CTX A;  1H7U A;  4L93 A;  3H80 A;  3NMQ A;  2IOP A;  3FT5 A;  3FV5 A;  2XDX A;  2BYI A;  3INX A;  3T10 A;  1I59 A;  4I5S A;  1A4H A;  4FCR A;  4JQL A;  3G7E A;  4LWG A;  1NHI A;  4NH8 A;  4HYP A;  2YE4 A;  4XKA A;  1ZXM A;  1UYI A;  2YE7 A;  3EHJ A;  4KSG A;  4LPB A;  5M4M A;  1MU5 A;  2YED A;  3C11 A;  3D36 A;  2YE3 A;  4XIQ A;  4U7O A;  3B25 A;  4CE1 A;  3A0T A;  2YEE A;  4GT8 A;  4BQJ A;  3HZ5 A;  3BM9 A;  2BU6 A;  3OMU A;  2YE9 A;  3VHD A;  3T0H A;  3HZ1 A;  1AMW A;  2FYP A;  4BAE A;  1I5D A;  4AWO A;  3Q5J A;  4LWH A;  3A0W A;  1Y4S A;  3PEH A;  4MPN A;  4H7Q A;  4WUB A;  2XHR A;  2H55 A;  4CWT A;  2BYH A;  4GFN A;  2YK2 A;  4Q20 A;  4URL A;  1GKX A;  4MP2 A;  2JKI A;  3U2D A;  4LWI A;  2BRE A;  3EHH A;  4FCQ A;  2FWZ A;  5FWK A;  3A0Y A;  4FPP A;  2IWX A;  2UWD A;  2YEJ A;  2Q8F A;  3RLQ A;  2XJJ A;  2WEQ A;  4HZ5 A;  4JAV A;  4CWS A;  1B62 A;  1TIL A;  4L90 A;  3T1K A;  2XCM A;  5CTU A;  3CWV A;  3INW A;  2WEP A;  2IWS A;  2XDK A;  2YKI A;  2HG1 A;  5BOC A;  2HCH A;  3H4L A;  4L8Z A;  4BXI A;  4ASG A;  2WER A;  4MOT A;  2O1W A;  1ID0 A;  2WI1 A;  3O0I A;  4E01 A;  4WUD A;  2PNR A;  4EGH A;  2BZ5 A;  3FT8 A;  2XK2 A;  3HHU A;  3T2S A;  4EFT A;  3ZXO A;  2YJX A;  3RLR A;  2ESA A;  1YT2 A;  4R3M A;  1YC4 A;  5CF0 A;  3GIG A;  4DUH A;  3CRK A;  1QYE A;  4CWN A;  1UYG A;  2VW5 A;  4XTJ A;  2HKJ A;  4BQG A;  1AH8 A;  5GGZ A;  4O07 A;  2BSM A;  2WI4 A;  4GQT A;  4ASA A;  1BYQ A;  4XE2 A;  3D2R A;  2BU8 A;  5M4H A;  5FND A;  4CWQ A;  4KQV A;  3EHG A;  2XDU A;  1AM1 A;  5FNF A;  4BIU A;  4HYM A;  4PU9 A;  5CTW A;  3GIE A;  2GFD A;  3EKR A;  2C2A A;  2BU5 A;  3Q5K A;  2YGE A;  3QTF A;  4PL9 A;  4YKU A;  4EMV A;  3R92 A;  1TC0 A;  1GKZ A;  2ZKJ A;  4LWF A;  4CWF A;  3GIF A;  3R4M A;  4AWQ A;  2BU2 A;  2AKP A;  3VHC A;  3R91 A;  3U2K A;  4CE2 A;  4MPE A;  4EGK A;  3WHA A;  2O1U A;  1YES A;  2H8M A;  3CGY A;  2XJG A;  5L3J A;  1EI1 A;  3B26 A;  4URN A;  1TC6 A;  1KZN A;  2Q2E B;  5IDM A;  5F3K A;  2Q8I A;  2CCU A;  2O1V A;  5J71 A;  1YET A;  4XKO A;  4CE3 A;  2XDS A;  4CWP A;  4R1F A;  5F5R A;  2BRC A;  2WI3 A;  3HYY A;  2YGA A;  3OW6 A;  1S16 A;  3RKZ A;  1UYH A;  4L91 A;  1S14 A;  4ASF A;  1I5C A;  3CRL A;  3R4O A;  4URO A;  3TUH A; 
#chains in the Genus database with same CATH topology
 4GEE A;  5BOD A;  2IOQ A;  4FMT A;  1EA6 A;  4FCP A;  4CWR A;  3ZXQ A;  1NHH A;  4QPK A;  3Q5L A;  3C0E A;  4XCL A;  2VWC A;  1TH8 A;  4HZ0 A;  5IN9 A;  1ZXN A;  1H7S A;  1YS3 A;  4NH7 A;  2VCI A;  4U93 A;  4MBC A;  4AWP A;  4P8O A;  4U7N A;  4YKY A;  2YE5 A;  3JZ3 A;  5M4N A;  3IED A;  4XCJ A;  4KP4 A;  1B3Q A;  3OPD A;  1UYE A;  4O05 A;  1Y8P A;  3ZKB A;  1UYD A;  1UYM A;  2YE2 A;  1Y8O A;  1UYK A;  4BIZ A;  2BU7 A;  3G75 A;  4B7P A;  5D7R A;  2XAB A;  4GCZ A;  3K98 A;  2WI5 A;  2YEB A;  2YEI A;  2WI2 A;  3A0Z A;  2QG0 A;  3K97 A;  4X9L A;  2XJX A;  2YEF A;  3LNU A;  2XX4 A;  4EEH A;  2CG9 A;  3U67 A;  2E0A A;  2XDL A;  4O09 A;  4QPJ A;  4YKR A;  3K99 A;  3BMY A;  4O0B A;  1US7 A;  2YI5 A;  2XHX A;  2YI6 A;  4V25 A;  2YEG A;  1MX0 A;  1YSZ A;  1UY6 A;  3A0R A;  4K4O A;  4L94 A;  4YKZ A;  1AJ6 A;  2QF6 A;  1Z5B A;  4ASB A;  3TTZ A;  4LP0 A;  2XX5 A;  2YEC A;  4XC0 A;  4YKW A;  4XDM A;  4H81 A;  4MPC A;  3VAD A;  4EGI A;  4O04 A;  1QZR A;  2YJW A;  2JJC A;  1R62 A;  2YI0 A;  4XD8 A;  4LWE A;  4YKT A;  4EFU A;  2VCJ A;  4PRV A;  4XIP A;  4WUC A;  2YKE A;  1I5B A;  2YI7 A;  4KFG A;  3B24 A;  4I3H A;  3T0Z A;  5IDJ A;  3TZ4 A;  3ZM7 A;  2Q8G A;  3K60 A;  4XKK A;  4CWO A;  2ZBK B;  3WQ9 A;  2CH4 A;  5C93 A;  4AS9 A;  2GQP A;  1YT1 A;  1UYL A;  1KIJ A;  2YK9 A;  2QG2 A;  2HHI A;  4JAS A;  3A0X A;  2EXL A;  5D6Q A;  3SL2 A;  3O2F A;  1NHJ A;  1B63 A;  1BKN A;  1YC3 A;  3D0B A;  1UY8 A;  4JAU A;  2XD6 A;  3KE6 A;  5J6A A;  3OWD A;  3TZ2 A;  4YKX A;  1ZWH A;  3GIG B;  3VHA A;  5D7D A;  5CTY A;  1YER A;  3RLP A;  1YSR A;  2FWY A;  4MB9 A;  1F51 A;  3R4N A;  3HEK A;  4URM A;  1UYF A;  3O6O A;  3MNR P;  4V26 A;  4HXW A;  2YEH A;  5D6P A;  1I5A A;  4KSH A;  1Z59 A;  4P7A A;  4PRX A;  1ZW9 A;  2YGF A;  3CGZ A;  1U2O A;  2YKB A;  1GJV A;  5M4P A;  1AH6 A;  3TZ5 A;  3B28 A;  1UY9 A;  4HY6 A;  1QY8 A;  3G7B A;  3EHF A;  1TBW A;  4E00 A;  4MP7 A;  1L0O A;  1JM6 A;  2CGF A;  2CCT A;  2XX2 A;  4NH9 A;  1THN A;  1U0Z A;  3R4P A;  2YE8 A;  4HY1 A;  1BXD A;  2YEA A;  1Z5A A;  4H85 A;  2CCS A;  4XIR A;  2ZDY A;  2YKC A;  4R3A A;  3OWB A;  4HXZ A;  4ZKI A;  1YT0 A;  4EM7 A;  1Z5C A;  3QDD A;  1Y4U A;  5D7C A;  3TZ0 A;  4XIT A;  2IWU A;  3LPS A;  3PEJ A;  3EKO A;  5JEN A;  5M4K A;  1Y8N A;  2K5B A;  3B27 A;  4GGL A;  2BT0 A;  2WI6 A;  2YE6 A;  2BTZ A;  2QFO A;  2ZDX A;  3HYZ A;  4ZVI A;  4E02 A;  5M4E A;  2XHT A;  2YKJ A;  2Q8H A;  1UYC A;  4W7T A;  4B6C A;  5CPH A;  1YC1 A;  3S5T A;  2WI7 A;  1TID A;  1PVG A;  1OSF A;  3DGE A;  3ZKD A;  4YKQ A;  4KTN A;  4DZY A;  1BGQ A;  2IOR A;  5FNC A;  1I58 A;  2FXS A;  1UY7 A;  2FTK A;  5CTX A;  1H7U A;  4L93 A;  3H80 A;  3NMQ A;  2IOP A;  3FT5 A;  3FV5 A;  2XDX A;  2BYI A;  3INX A;  3T10 A;  1I59 A;  4I5S A;  1A4H A;  4FCR A;  4JQL A;  3G7E A;  4LWG A;  1NHI A;  4NH8 A;  4HYP A;  2YE4 A;  4XKA A;  1ZXM A;  1UYI A;  2YE7 A;  3EHJ A;  4KSG A;  4LPB A;  5M4M A;  1MU5 A;  2YED A;  3C11 A;  3D36 A;  2YE3 A;  4XIQ A;  4U7O A;  2C1I A;  3B25 A;  4CE1 A;  3A0T A;  2YEE A;  4GT8 A;  4BQJ A;  3HZ5 A;  3BM9 A;  2BU6 A;  3OMU A;  2YE9 A;  3VHD A;  3T0H A;  3HZ1 A;  1AMW A;  2FYP A;  4BAE A;  1I5D A;  4AWO A;  3Q5J A;  4LWH A;  3A0W A;  1Y4S A;  3PEH A;  4MPN A;  4H7Q A;  4WUB A;  2XHR A;  2H55 A;  4CWT A;  2BYH A;  4GFN A;  2YK2 A;  4Q20 A;  4URL A;  1GKX A;  4MP2 A;  2JKI A;  3U2D A;  4LWI A;  2BRE A;  3EHH A;  4FCQ A;  2FWZ A;  5FWK A;  3A0Y A;  4FPP A;  2IWX A;  2UWD A;  2YEJ A;  2Q8F A;  3RLQ A;  2XJJ A;  2WEQ A;  4HZ5 A;  4JAV A;  4CWS A;  1B62 A;  1TIL A;  4L90 A;  3T1K A;  2XCM A;  5CTU A;  3CWV A;  3INW A;  2WEP A;  2IWS A;  2XDK A;  2YKI A;  2HG1 A;  5BOC A;  2HCH A;  3H4L A;  4L8Z A;  4BXI A;  4ASG A;  3LMM A;  1IXM A;  2WER A;  4MOT A;  2O1W A;  1ID0 A;  2WI1 A;  3O0I A;  4E01 A;  4WUD A;  2PNR A;  4EGH A;  2BZ5 A;  3FT8 A;  2XK2 A;  3HHU A;  3T2S A;  4EFT A;  3ZXO A;  2YJX A;  3RLR A;  2ESA A;  1YT2 A;  4R3M A;  1YC4 A;  5CF0 A;  3GIG A;  4DUH A;  3CRK A;  1QYE A;  4CWN A;  1UYG A;  2VW5 A;  4XTJ A;  2HKJ A;  4BQG A;  1AH8 A;  5GGZ A;  4O07 A;  2BSM A;  2WI4 A;  4GQT A;  4ASA A;  1BYQ A;  4XE2 A;  3D2R A;  2BU8 A;  5M4H A;  5FND A;  4CWQ A;  2C1G A;  4KQV A;  3EHG A;  2XDU A;  1AM1 A;  5FNF A;  4BIU A;  4HYM A;  4PU9 A;  5CTW A;  3GIE A;  2GFD A;  3EKR A;  2C2A A;  2BU5 A;  3Q5K A;  2YGE A;  3QTF A;  4PL9 A;  4YKU A;  4EMV A;  3R92 A;  1TC0 A;  1GKZ A;  2ZKJ A;  4LWF A;  4CWF A;  3CYG A;  3GIF A;  3R4M A;  4AWQ A;  2BU2 A;  2AKP A;  3VHC A;  3R91 A;  3U2K A;  4CE2 A;  4MPE A;  4EGK A;  3WHA A;  2O1U A;  1YES A;  2H8M A;  3CGY A;  2XJG A;  5L3J A;  1EI1 A;  3B26 A;  4URN A;  1TC6 A;  1KZN A;  2Q2E B;  5IDM A;  5F3K A;  2Q8I A;  2CCU A;  2O1V A;  5J71 A;  1YET A;  4XKO A;  4CE3 A;  2XDS A;  4CWP A;  4R1F A;  5F5R A;  2BRC A;  2WI3 A;  3HYY A;  4E72 A;  2YGA A;  3OW6 A;  1S16 A;  3RKZ A;  1UYH A;  4L91 A;  1S14 A;  4ASF A;  1I5C A;  3CRL A;  3R4O A;  4URO A;  3TUH A; 
#chains in the Genus database with same CATH homology
 4GEE A;  5BOD A;  2IOQ A;  4FMT A;  1EA6 A;  4FCP A;  4CWR A;  3ZXQ A;  1NHH A;  4QPK A;  3Q5L A;  3C0E A;  4XCL A;  2VWC A;  1TH8 A;  4HZ0 A;  5IN9 A;  1ZXN A;  1H7S A;  1YS3 A;  4NH7 A;  2VCI A;  4U93 A;  4MBC A;  4AWP A;  4P8O A;  4U7N A;  4YKY A;  2YE5 A;  3JZ3 A;  5M4N A;  3IED A;  4XCJ A;  4KP4 A;  1B3Q A;  3OPD A;  1UYE A;  4O05 A;  1Y8P A;  3ZKB A;  1UYD A;  1UYM A;  2YE2 A;  1Y8O A;  1UYK A;  4BIZ A;  2BU7 A;  3G75 A;  4B7P A;  5D7R A;  2XAB A;  4GCZ A;  3K98 A;  2WI5 A;  2YEB A;  2YEI A;  2WI2 A;  3A0Z A;  2QG0 A;  3K97 A;  4X9L A;  2XJX A;  2YEF A;  3LNU A;  2XX4 A;  4EEH A;  2CG9 A;  3U67 A;  2E0A A;  2XDL A;  4O09 A;  4QPJ A;  4YKR A;  3K99 A;  3BMY A;  4O0B A;  1US7 A;  2YI5 A;  2XHX A;  2YI6 A;  4V25 A;  2YEG A;  1MX0 A;  1YSZ A;  1UY6 A;  3A0R A;  4K4O A;  4L94 A;  4YKZ A;  1AJ6 A;  2QF6 A;  1Z5B A;  4ASB A;  3TTZ A;  4LP0 A;  2XX5 A;  2YEC A;  4XC0 A;  4YKW A;  4XDM A;  4H81 A;  4MPC A;  3VAD A;  4EGI A;  4O04 A;  1QZR A;  2YJW A;  2JJC A;  1R62 A;  2YI0 A;  4XD8 A;  4LWE A;  4YKT A;  4EFU A;  2VCJ A;  4PRV A;  4XIP A;  4WUC A;  2YKE A;  1I5B A;  2YI7 A;  4KFG A;  3B24 A;  4I3H A;  3T0Z A;  5IDJ A;  3TZ4 A;  3ZM7 A;  2Q8G A;  3K60 A;  4XKK A;  4CWO A;  2ZBK B;  3WQ9 A;  2CH4 A;  5C93 A;  4AS9 A;  2GQP A;  1YT1 A;  1UYL A;  1KIJ A;  2YK9 A;  2QG2 A;  4JAS A;  3A0X A;  2EXL A;  5D6Q A;  3SL2 A;  3O2F A;  1NHJ A;  1B63 A;  1BKN A;  1YC3 A;  3D0B A;  1UY8 A;  4JAU A;  2XD6 A;  3KE6 A;  5J6A A;  3OWD A;  3TZ2 A;  4YKX A;  1ZWH A;  3GIG B;  3VHA A;  5D7D A;  5CTY A;  1YER A;  3RLP A;  1YSR A;  2FWY A;  4MB9 A;  3R4N A;  3HEK A;  4URM A;  1UYF A;  3O6O A;  3MNR P;  4V26 A;  4HXW A;  2YEH A;  5D6P A;  1I5A A;  4KSH A;  1Z59 A;  4P7A A;  4PRX A;  1ZW9 A;  2YGF A;  3CGZ A;  1U2O A;  2YKB A;  1GJV A;  5M4P A;  1AH6 A;  3TZ5 A;  3B28 A;  1UY9 A;  4HY6 A;  1QY8 A;  3G7B A;  3EHF A;  1TBW A;  4E00 A;  4MP7 A;  1L0O A;  1JM6 A;  2CGF A;  2CCT A;  2XX2 A;  4NH9 A;  1THN A;  1U0Z A;  3R4P A;  2YE8 A;  4HY1 A;  1BXD A;  2YEA A;  1Z5A A;  4H85 A;  2CCS A;  4XIR A;  2ZDY A;  2YKC A;  4R3A A;  3OWB A;  4HXZ A;  4ZKI A;  1YT0 A;  4EM7 A;  1Z5C A;  3QDD A;  1Y4U A;  5D7C A;  3TZ0 A;  4XIT A;  2IWU A;  3LPS A;  3PEJ A;  3EKO A;  5M4K A;  1Y8N A;  2K5B A;  3B27 A;  4GGL A;  2BT0 A;  2WI6 A;  2YE6 A;  2BTZ A;  2QFO A;  2ZDX A;  3HYZ A;  4ZVI A;  4E02 A;  5M4E A;  2XHT A;  2YKJ A;  2Q8H A;  1UYC A;  4W7T A;  4B6C A;  5CPH A;  1YC1 A;  2WI7 A;  1TID A;  1PVG A;  1OSF A;  3DGE A;  3ZKD A;  4YKQ A;  4KTN A;  4DZY A;  1BGQ A;  2IOR A;  5FNC A;  1I58 A;  2FXS A;  1UY7 A;  5CTX A;  1H7U A;  4L93 A;  3H80 A;  3NMQ A;  2IOP A;  3FT5 A;  3FV5 A;  2XDX A;  2BYI A;  3INX A;  3T10 A;  1I59 A;  4I5S A;  1A4H A;  4FCR A;  4JQL A;  3G7E A;  4LWG A;  1NHI A;  4NH8 A;  4HYP A;  2YE4 A;  4XKA A;  1ZXM A;  1UYI A;  2YE7 A;  3EHJ A;  4KSG A;  4LPB A;  5M4M A;  1MU5 A;  2YED A;  3C11 A;  3D36 A;  2YE3 A;  4XIQ A;  4U7O A;  3B25 A;  4CE1 A;  3A0T A;  2YEE A;  4GT8 A;  4BQJ A;  3HZ5 A;  3BM9 A;  2BU6 A;  3OMU A;  2YE9 A;  3VHD A;  3T0H A;  3HZ1 A;  1AMW A;  2FYP A;  4BAE A;  1I5D A;  4AWO A;  3Q5J A;  4LWH A;  3A0W A;  1Y4S A;  3PEH A;  4MPN A;  4H7Q A;  4WUB A;  2XHR A;  2H55 A;  4CWT A;  2BYH A;  4GFN A;  2YK2 A;  4Q20 A;  4URL A;  1GKX A;  4MP2 A;  2JKI A;  3U2D A;  4LWI A;  2BRE A;  3EHH A;  4FCQ A;  2FWZ A;  5FWK A;  3A0Y A;  4FPP A;  2IWX A;  2UWD A;  2YEJ A;  2Q8F A;  3RLQ A;  2XJJ A;  2WEQ A;  4HZ5 A;  4JAV A;  4CWS A;  1B62 A;  1TIL A;  4L90 A;  3T1K A;  2XCM A;  5CTU A;  3CWV A;  3INW A;  2WEP A;  2IWS A;  2XDK A;  2YKI A;  2HG1 A;  5BOC A;  2HCH A;  3H4L A;  4L8Z A;  4BXI A;  4ASG A;  2WER A;  4MOT A;  2O1W A;  1ID0 A;  2WI1 A;  3O0I A;  4E01 A;  4WUD A;  2PNR A;  4EGH A;  2BZ5 A;  3FT8 A;  2XK2 A;  3HHU A;  3T2S A;  4EFT A;  3ZXO A;  2YJX A;  3RLR A;  2ESA A;  1YT2 A;  4R3M A;  1YC4 A;  5CF0 A;  3GIG A;  4DUH A;  3CRK A;  1QYE A;  4CWN A;  1UYG A;  2VW5 A;  4XTJ A;  2HKJ A;  4BQG A;  1AH8 A;  5GGZ A;  4O07 A;  2BSM A;  2WI4 A;  4GQT A;  4ASA A;  1BYQ A;  4XE2 A;  3D2R A;  2BU8 A;  5M4H A;  5FND A;  4CWQ A;  4KQV A;  3EHG A;  2XDU A;  1AM1 A;  5FNF A;  4BIU A;  4HYM A;  4PU9 A;  5CTW A;  3GIE A;  2GFD A;  3EKR A;  2C2A A;  2BU5 A;  3Q5K A;  2YGE A;  3QTF A;  4PL9 A;  4YKU A;  4EMV A;  3R92 A;  1TC0 A;  1GKZ A;  2ZKJ A;  4LWF A;  4CWF A;  3GIF A;  3R4M A;  4AWQ A;  2BU2 A;  2AKP A;  3VHC A;  3R91 A;  3U2K A;  4CE2 A;  4MPE A;  4EGK A;  3WHA A;  2O1U A;  1YES A;  2H8M A;  3CGY A;  2XJG A;  5L3J A;  1EI1 A;  3B26 A;  4URN A;  1TC6 A;  1KZN A;  2Q2E B;  5IDM A;  5F3K A;  2Q8I A;  2CCU A;  2O1V A;  5J71 A;  1YET A;  4XKO A;  4CE3 A;  2XDS A;  4CWP A;  4R1F A;  5F5R A;  2BRC A;  2WI3 A;  3HYY A;  2YGA A;  3OW6 A;  1S16 A;  3RKZ A;  1UYH A;  4L91 A;  1S14 A;  4ASF A;  1I5C A;  3CRL A;  3R4O A;  4URO A;  3TUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...