3OPDA

Crystal structure of the n-terminal domain of an hsp90 from trypanosoma brucei, tb10.26.1080 in the presence of a benzamide derivative
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
208
Chain Sequence
b'GMTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQSVLGDEPHLRIRVIPDRVNKTLTVEDSGIGMTKADLVNNLGTIARSGTKSFMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVVSKNNEDDAYTWESSAGGTFTVTSTPDLKRGTRIVLHLKEDQQEYLEERRLKDLIKKHSEFIGYDIELMVEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein 83
publication title Exploring the Trypanosoma brucei Hsp83 potential as a target for structure guided drug design.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Chaperone
total genus 67
structure length 208
sequence length 210
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3opdA00
4P7AA 2BT0A 4EM7A 3EKRA 4B7PA 2CCUA 2C2AA 2YI6A 1JM6A 1THNA 4XITA 3K99A 4NH9A 4YKWA 3B28A 1B62A 3ZXOA 4H85A 2YEIA 2BU8A 2HKJA 3EHFA 2CGFA 4B6CA 1AJ6A 4GEEA 1I59A 4KSHA 4LPBA 3K60A 1UYMA 2AKPA 1AMWA 1H7SA 2ZKJA 4W7TA 3CGYA 4BAEA 4FCRA 2XHXA 1B63A 4JAUA 4JASA 3MNRP 4LWFA 2ZBKB 4YKTA 4LP0A 4CWNA 2YE5A 3R4PA 1Z5CA 3CRLA 4EGHA 2YEEA 2QFOA 1NHJA 1U2OA 2EXLA 2XABA 3RLPA 3Q5LA 4L91A 2XHTA 1YC3A 4MOTA 4DZYA 2XDUA 2QG0A 3Q5KA 3B27A 4HZ5A 4FCPA 5F5RA 4I3HA 1UYEA 3D2RA 4BXIA 1H7UA 2VCIA 1ZXNA 4DUHA 1Y8PA 1TILA 2QF6A 4LWGA 4GQTA 2CG9A 5L3JA 1ZWHA 3FV5A 2YI7A 4KSGA 2XX5A 2YI5A 1UYKA 1BGQA 2IOQA 4HY1A 4X9LA 4AWQA 3T0ZA 4WUBA 1MU5A 4CWQA 1YESA 4NH7A 3R91A 2WERA 3T10A 4BIZA 3TZ4A 4I5SA 2YE8A 1S16A 2IWUA 5GGZA 3HEKA 5M4NA 3QTFA 3B25A 3G7BA 5IN9A 2YEFA 1I5DA 4O09A 4CWRA 4H81A 4HZ0A 1Y8OA 4KFGA 3VHAA 4E01A 3H4LA 2YE2A 4JQLA 3U67A 3R4OA 4XC0A 3C11A 1UY7A 1YETA 2Q8GA 5CTYA 4U7OA 2CCSA 5FWKA 1UYGA 5M4MA 2WEPA 1ID0A 4AS9A 1I58A 4XTJA 1YT0A 2YE4A 1L0OA 4V25A 1UYIA 3EHJA 4YKXA 4GCZA 2YGEA 3HZ5A 4L94A 3RKZA 1YS3A 4XCJA 4QPKA 4LWIA 3T1KA 3HYZA 1EA6A 1AH6A 2YECA 4YKZA 2Q8HA 1YSZA 1UY9A 2Q8FA 4XIQA 2YKBA 2BRCA 2IORA 4ASAA 2VCJA 1AH8A 3C0EA 4XCLA 3OWDA 3HZ1A 2Q8IA 4BQJA 4XKOA 1I5AA 2HG1A 3T0HA 1Y4SA 3GIGA 3TTZA 2BU6A 1Z59A 2XX4A 2YJXA 3EKOA 1I5CA 2YEGA 4ASFA 2IOPA 1PVGA 3ZKBA 4HYMA 2FWZA 3U2KA 2ZDXA 3BMYA 2YE3A 4XKKA 1OSFA 3O2FA 4XD8A 1YC4A 5CTUA 2YGFA 4JAVA 1TBWA 1TC0A 2XDLA 3ZKDA 5M4EA 3O0IA 4H7QA 4WUCA 3K98A 3OW6A 4R1FA 3Q5JA 2YEAA 4EMVA 2VW5A 3HHUA 2YEHA 4XE2A 3EHHA 2XDSA 1AM1A 2XJJA 3FT8A 4HXZA 2YK9A 4V26A 4YKQA 3RLRA 2ZDYA 1BYQA 2BREA 2XK2A 4EGKA 4O04A 4EEHA 3A0YA 3VHDA 2XD6A 2WI3A 2YE9A 4CWSA 3U2DA 3T2SA 4KQVA 1UYLA 4O05A 3INWA 2XJGA 3QDDA 3HYYA 3ZXQA 1QYEA 2YJWA 3GIEA 2CCTA 5D6QA 4CE2A 1R62A 5BOCA 2PNRA 2YEBA 5M4PA 1QZRA 2YI0A 3PEHA 3IEDA 1GJVA 4CE3A 2WI4A 4ZVIA 3G75A 3OPDA 3A0WA 1UYFA 2YK2A 3B24A 3R92A 4KP4A 2JKIA 5M4KA 4NH8A 4CWFA 4KTNA 2BSMA 1UYHA 4GGLA 4FPPA 1BKNA 4MPCA 3CRKA 2H55A 2YKIA 5C93A 1QY8A 3JZ3A 4CWPA 2BTZA 2K5BA 4E02A 4URMA 3G7EA 3TZ0A 1S14A 2YKJA 1YT2A 1GKZA 1NHHA 4PRVA 2YE7A 4FMTA 2Q2EB 3H80A 4GFNA 2QG2A 3FT5A 3A0XA 3GIFA 2FWYA 4QPJA 2UWDA 1US7A 4Q20A 4MP2A 1UYCA 3CWVA 4R3MA 2XX2A 2XCMA 2O1WA 2WEQA 4ZKIA 1KIJA 1YSRA 2FXSA 4PU9A 2XDKA 3D36A 3OWBA 5IDMA 5CTWA 4L8ZA 4CWTA 2BYHA 1EI1A 3SL2A 2XDXA 4MPNA 2BU7A 4L90A 5FNCA 2BU5A 5M4HA 2YKEA 1YT1A 2XJXA 4YKYA 1NHIA 3PEJA 3KE6A 1Y4UA 2YEJA 4XIRA 4WUDA 4MPEA 4GT8A 1YERA 5FNDA 4AWOA 4E00A 1TH8A 1TIDA 3OMUA 4EGIA 2FYPA 2YEDA 3BM9A 4MP7A 4XIPA 5J71A 1A4HA 2O1UA 1Y8NA 2O1VA 5CPHA 4ASGA 2YGAA 4LWEA 5IDJA 1GKXA 4R3AA 4CE1A 4MB9A 3ZM7A 1UY6A 4MBCA 4CWOA 3EHGA 2GFDA 4U7NA 3INXA 4YKRA 2WI1A 2WI5A 3K97A 1Z5BA 2WI2A 1BXDA 3A0ZA 4K4OA 4UROA 1KZNA 4XKAA 3R4NA 2GQPA 2BZ5A 5F3KA 3WQ9A 4URNA 5CTXA 3VADA 2ESAA 4BIUA 2WI6A 1ZXMA 3B26A 2IWXA 5D7RA 1Z5AA 4HXWA 2XHRA 4YKUA 4EFTA 2IWSA 3A0TA 4HY6A 4AWPA 3TZ5A 4O07A 3NMQA 5D6PA 1UYDA 3CGZA 2VWCA 4EFUA 1I5BA 1TC6A 4P8OA 5CF0A 1B3QA 2HCHA 2CH4A 3VHCA 1YC1A 2YKCA 3TUHA 3O6OA 3D0BA 3DGEA 5BODA 4PRXA 1MX0A 5J6AA 5D7CA 3TZ2A 1ZW9A 4XDMA 2BU2A 1U0ZA 4PL9A 2WI7A 4BQGA 4ASBA 5FNFA 4HYPA 2E0AA 2BYIA 2YE6A 1UY8A 3RLQA 3R4MA 3LPSA 3GIGB 4LWHA 3WHAA 5D7DA 4U93A 4URLA 4O0BA 4FCQA 2H8MA 3A0RA 4L93A 3LNUA 2JJCA
chains in the Genus database with same CATH superfamily
4P7AA 2BT0A 4EM7A 3EKRA 4B7PA 2CCUA 2C2AA 2YI6A 1JM6A 1THNA 4XITA 3K99A 4NH9A 4YKWA 3B28A 1B62A 3ZXOA 4H85A 2YEIA 2BU8A 2HKJA 3EHFA 2CGFA 4B6CA 1AJ6A 4GEEA 1I59A 4KSHA 4LPBA 3K60A 1UYMA 2AKPA 1AMWA 1H7SA 2ZKJA 4W7TA 3CGYA 4BAEA 4FCRA 2XHXA 1B63A 4JAUA 4JASA 3MNRP 4LWFA 2ZBKB 4YKTA 4LP0A 4CWNA 2YE5A 3R4PA 1Z5CA 3CRLA 1F51A 4EGHA 2YEEA 2QFOA 1NHJA 1U2OA 2EXLA 2XABA 3RLPA 2FTKA 3Q5LA 4L91A 2XHTA 1YC3A 4MOTA 4DZYA 2XDUA 2QG0A 3Q5KA 3B27A 4HZ5A 3LMMA 4FCPA 5F5RA 4I3HA 1UYEA 3D2RA 4BXIA 1H7UA 2VCIA 1ZXNA 4DUHA 1Y8PA 1TILA 2QF6A 4LWGA 4GQTA 2CG9A 5L3JA 1ZWHA 3FV5A 2YI7A 4KSGA 2XX5A 2YI5A 1UYKA 1BGQA 2IOQA 4HY1A 4X9LA 4AWQA 3T0ZA 4WUBA 1MU5A 4CWQA 1YESA 4NH7A 3R91A 2WERA 3T10A 4BIZA 3TZ4A 4I5SA 2YE8A 1S16A 2IWUA 5GGZA 3HEKA 5M4NA 3QTFA 3B25A 3G7BA 5IN9A 2YEFA 1I5DA 4O09A 1IXMA 2HHIA 4CWRA 4H81A 4HZ0A 1Y8OA 4KFGA 3VHAA 4E01A 3H4LA 2YE2A 4JQLA 3U67A 3R4OA 4XC0A 3C11A 1UY7A 1YETA 2Q8GA 5CTYA 4U7OA 2CCSA 5FWKA 1UYGA 5M4MA 2WEPA 1ID0A 4AS9A 1I58A 4XTJA 1YT0A 2YE4A 1L0OA 4V25A 1UYIA 3EHJA 4YKXA 4GCZA 2YGEA 3HZ5A 4L94A 3RKZA 1YS3A 4XCJA 4QPKA 4LWIA 3T1KA 3HYZA 1EA6A 1AH6A 4E72A 2YECA 4YKZA 2Q8HA 1YSZA 1UY9A 2Q8FA 4XIQA 2YKBA 2BRCA 2IORA 4ASAA 2VCJA 1AH8A 3C0EA 3S5TA 4XCLA 3OWDA 3HZ1A 2Q8IA 4BQJA 4XKOA 1I5AA 2HG1A 3T0HA 1Y4SA 3GIGA 3TTZA 2BU6A 1Z59A 2XX4A 2YJXA 3EKOA 1I5CA 2YEGA 4ASFA 2IOPA 1PVGA 3ZKBA 4HYMA 2FWZA 3U2KA 2ZDXA 3BMYA 2YE3A 4XKKA 1OSFA 3O2FA 4XD8A 1YC4A 5CTUA 2YGFA 4JAVA 1TBWA 1TC0A 2XDLA 3ZKDA 5M4EA 3O0IA 4H7QA 4WUCA 3K98A 3OW6A 4R1FA 3Q5JA 2YEAA 4EMVA 2VW5A 3HHUA 2YEHA 4XE2A 3EHHA 2XDSA 1AM1A 2XJJA 3FT8A 4HXZA 2YK9A 4V26A 4YKQA 3RLRA 2ZDYA 1BYQA 2BREA 2XK2A 4EGKA 4O04A 4EEHA 3A0YA 3VHDA 2XD6A 2WI3A 2YE9A 4CWSA 3U2DA 3T2SA 4KQVA 1UYLA 4O05A 3INWA 2XJGA 3QDDA 3HYYA 3ZXQA 1QYEA 2YJWA 3GIEA 2CCTA 5D6QA 4CE2A 1R62A 5BOCA 2PNRA 2YEBA 5M4PA 1QZRA 2YI0A 3PEHA 3IEDA 1GJVA 4CE3A 2WI4A 4ZVIA 3G75A 3OPDA 3A0WA 1UYFA 2YK2A 3B24A 3R92A 4KP4A 2JKIA 5M4KA 4NH8A 4CWFA 4KTNA 2BSMA 1UYHA 4GGLA 4FPPA 1BKNA 4MPCA 3CRKA 3CYGA 2H55A 2YKIA 5C93A 1QY8A 3JZ3A 4CWPA 2BTZA 2K5BA 4E02A 4URMA 3G7EA 3TZ0A 1S14A 2YKJA 1YT2A 1GKZA 1NHHA 2C1IA 4PRVA 2YE7A 4FMTA 2Q2EB 3H80A 2QG2A 3FT5A 4GFNA 3A0XA 3GIFA 2FWYA 4QPJA 2UWDA 1US7A 4Q20A 4MP2A 1UYCA 3CWVA 4R3MA 2XX2A 2XCMA 2O1WA 2WEQA 4ZKIA 1KIJA 1YSRA 2FXSA 4PU9A 2XDKA 3D36A 3OWBA 5IDMA 5CTWA 4L8ZA 4CWTA 2BYHA 1EI1A 3SL2A 2XDXA 4MPNA 2BU7A 4L90A 5FNCA 2BU5A 5M4HA 2YKEA 1YT1A 2XJXA 4YKYA 1NHIA 2C1GA 3PEJA 3KE6A 1Y4UA 2YEJA 4XIRA 4WUDA 4MPEA 4GT8A 1YERA 5FNDA 4AWOA 4E00A 1TH8A 1TIDA 3OMUA 4EGIA 2FYPA 2YEDA 3BM9A 4MP7A 4XIPA 5J71A 1A4HA 2O1UA 1Y8NA 2O1VA 5CPHA 4ASGA 2YGAA 4LWEA 5IDJA 1GKXA 4R3AA 4CE1A 4MB9A 3ZM7A 1UY6A 4MBCA 4CWOA 3EHGA 2GFDA 4U7NA 3INXA 4YKRA 2WI1A 2WI5A 3K97A 1Z5BA 2WI2A 1BXDA 3A0ZA 4K4OA 4UROA 1KZNA 4XKAA 3R4NA 2GQPA 2BZ5A 5F3KA 3WQ9A 4URNA 5CTXA 3VADA 2ESAA 4BIUA 2WI6A 1ZXMA 3B26A 2IWXA 5D7RA 1Z5AA 4HXWA 2XHRA 4YKUA 4EFTA 2IWSA 3A0TA 4HY6A 4AWPA 3TZ5A 4O07A 3NMQA 5D6PA 1UYDA 3CGZA 2VWCA 4EFUA 1I5BA 1TC6A 4P8OA 5CF0A 1B3QA 2HCHA 2CH4A 3VHCA 1YC1A 2YKCA 3TUHA 3O6OA 3D0BA 3DGEA 5BODA 4PRXA 1MX0A 5J6AA 5JENA 5D7CA 3TZ2A 1ZW9A 4XDMA 2BU2A 1U0ZA 4PL9A 2WI7A 4BQGA 4ASBA 5FNFA 4HYPA 2E0AA 2BYIA 2YE6A 1UY8A 3RLQA 3R4MA 3LPSA 3GIGB 4LWHA 3WHAA 5D7DA 4U93A 4URLA 4O0BA 4FCQA 2H8MA 3A0RA 4L93A 3LNUA 2JJCA
chains in the Genus database with same CATH topology
4P7AA 2BT0A 4EM7A 3EKRA 4B7PA 2CCUA 2C2AA 2YI6A 1JM6A 1THNA 4XITA 3K99A 4NH9A 4YKWA 3B28A 1B62A 3ZXOA 4H85A 2YEIA 2BU8A 2HKJA 3EHFA 2CGFA 4B6CA 1AJ6A 4GEEA 1I59A 4KSHA 4LPBA 3K60A 1UYMA 2AKPA 1AMWA 1H7SA 2ZKJA 4W7TA 3CGYA 4BAEA 4FCRA 2XHXA 1B63A 4JAUA 4JASA 3MNRP 4LWFA 2ZBKB 4YKTA 4LP0A 4CWNA 2YE5A 3R4PA 1Z5CA 3CRLA 4EGHA 2YEEA 2QFOA 1NHJA 1U2OA 2EXLA 2XABA 3RLPA 3Q5LA 4L91A 2XHTA 1YC3A 4MOTA 4DZYA 2XDUA 2QG0A 3Q5KA 3B27A 4HZ5A 4FCPA 5F5RA 4I3HA 1UYEA 3D2RA 4BXIA 1H7UA 2VCIA 1ZXNA 4DUHA 1Y8PA 1TILA 2QF6A 4LWGA 4GQTA 2CG9A 5L3JA 1ZWHA 3FV5A 2YI7A 4KSGA 2XX5A 2YI5A 1UYKA 1BGQA 2IOQA 4HY1A 4X9LA 4AWQA 3T0ZA 4WUBA 1MU5A 4CWQA 1YESA 4NH7A 3R91A 2WERA 3T10A 4BIZA 3TZ4A 4I5SA 2YE8A 1S16A 2IWUA 5GGZA 3HEKA 5M4NA 3QTFA 3B25A 3G7BA 5IN9A 2YEFA 1I5DA 4O09A 4CWRA 4H81A 4HZ0A 1Y8OA 4KFGA 3VHAA 4E01A 3H4LA 2YE2A 4JQLA 3U67A 3R4OA 4XC0A 3C11A 1UY7A 1YETA 2Q8GA 5CTYA 4U7OA 2CCSA 5FWKA 1UYGA 5M4MA 2WEPA 1ID0A 4AS9A 1I58A 4XTJA 1YT0A 2YE4A 1L0OA 4V25A 1UYIA 3EHJA 4YKXA 4GCZA 2YGEA 3HZ5A 4L94A 3RKZA 1YS3A 4XCJA 4QPKA 4LWIA 3T1KA 3HYZA 1EA6A 1AH6A 2YECA 4YKZA 2Q8HA 1YSZA 1UY9A 2Q8FA 4XIQA 2YKBA 2BRCA 2IORA 4ASAA 2VCJA 1AH8A 3C0EA 4XCLA 3OWDA 3HZ1A 2Q8IA 4BQJA 4XKOA 1I5AA 2HG1A 3T0HA 1Y4SA 3GIGA 3TTZA 2BU6A 1Z59A 2XX4A 2YJXA 3EKOA 1I5CA 2YEGA 4ASFA 2IOPA 1PVGA 3ZKBA 4HYMA 2FWZA 3U2KA 2ZDXA 3BMYA 2YE3A 4XKKA 1OSFA 3O2FA 4XD8A 1YC4A 5CTUA 2YGFA 4JAVA 1TBWA 1TC0A 2XDLA 3ZKDA 5M4EA 3O0IA 4H7QA 4WUCA 3K98A 3OW6A 4R1FA 3Q5JA 2YEAA 4EMVA 2VW5A 3HHUA 2YEHA 4XE2A 3EHHA 2XDSA 1AM1A 2XJJA 3FT8A 4HXZA 2YK9A 4V26A 4YKQA 3RLRA 2ZDYA 1BYQA 2BREA 2XK2A 4EGKA 4O04A 4EEHA 3A0YA 3VHDA 2XD6A 2WI3A 2YE9A 4CWSA 3U2DA 3T2SA 4KQVA 1UYLA 4O05A 3INWA 2XJGA 3QDDA 3HYYA 3ZXQA 1QYEA 2YJWA 3GIEA 2CCTA 5D6QA 4CE2A 1R62A 5BOCA 2PNRA 2YEBA 5M4PA 1QZRA 2YI0A 3PEHA 3IEDA 1GJVA 4CE3A 2WI4A 4ZVIA 3G75A 3OPDA 3A0WA 1UYFA 2YK2A 3B24A 3R92A 4KP4A 2JKIA 5M4KA 4NH8A 4CWFA 4KTNA 2BSMA 1UYHA 4GGLA 4FPPA 1BKNA 4MPCA 3CRKA 2H55A 2YKIA 5C93A 1QY8A 3JZ3A 4CWPA 2BTZA 2K5BA 4E02A 4URMA 3G7EA 3TZ0A 1S14A 2YKJA 1YT2A 1GKZA 1NHHA 4PRVA 2YE7A 4FMTA 2Q2EB 3H80A 4GFNA 2QG2A 3FT5A 3A0XA 3GIFA 2FWYA 4QPJA 2UWDA 1US7A 4Q20A 4MP2A 1UYCA 3CWVA 4R3MA 2XX2A 2XCMA 2O1WA 2WEQA 4ZKIA 1KIJA 1YSRA 2FXSA 4PU9A 2XDKA 3D36A 3OWBA 5IDMA 5CTWA 4L8ZA 4CWTA 2BYHA 1EI1A 3SL2A 2XDXA 4MPNA 2BU7A 4L90A 5FNCA 2BU5A 5M4HA 2YKEA 1YT1A 2XJXA 4YKYA 1NHIA 3PEJA 3KE6A 1Y4UA 2YEJA 4XIRA 4WUDA 4MPEA 4GT8A 1YERA 5FNDA 4AWOA 4E00A 1TH8A 1TIDA 3OMUA 4EGIA 2FYPA 2YEDA 3BM9A 4MP7A 4XIPA 5J71A 1A4HA 2O1UA 1Y8NA 2O1VA 5CPHA 4ASGA 2YGAA 4LWEA 5IDJA 1GKXA 4R3AA 4CE1A 4MB9A 3ZM7A 1UY6A 4MBCA 4CWOA 3EHGA 2GFDA 4U7NA 3INXA 4YKRA 2WI1A 2WI5A 3K97A 1Z5BA 2WI2A 1BXDA 3A0ZA 4K4OA 4UROA 1KZNA 4XKAA 3R4NA 2GQPA 2BZ5A 5F3KA 3WQ9A 4URNA 5CTXA 3VADA 2ESAA 4BIUA 2WI6A 1ZXMA 3B26A 2IWXA 5D7RA 1Z5AA 4HXWA 2XHRA 4YKUA 4EFTA 2IWSA 3A0TA 4HY6A 4AWPA 3TZ5A 4O07A 3NMQA 5D6PA 1UYDA 3CGZA 2VWCA 4EFUA 1I5BA 1TC6A 4P8OA 5CF0A 1B3QA 2HCHA 2CH4A 3VHCA 1YC1A 2YKCA 3TUHA 3O6OA 3D0BA 3DGEA 5BODA 4PRXA 1MX0A 5J6AA 5D7CA 3TZ2A 1ZW9A 4XDMA 2BU2A 1U0ZA 4PL9A 2WI7A 4BQGA 4ASBA 5FNFA 4HYPA 2E0AA 2BYIA 2YE6A 1UY8A 3RLQA 3R4MA 3LPSA 3GIGB 4LWHA 3WHAA 5D7DA 4U93A 4URLA 4O0BA 4FCQA 2H8MA 3A0RA 4L93A 3LNUA 2JJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P7A A;  2BT0 A;  4EM7 A;  3EKR A;  4B7P A;  2CCU A;  2C2A A;  2YI6 A;  1JM6 A;  1THN A;  4XIT A;  3K99 A;  4NH9 A;  4YKW A;  3B28 A;  1B62 A;  3ZXO A;  4H85 A;  2YEI A;  2BU8 A;  2HKJ A;  3EHF A;  2CGF A;  4B6C A;  1AJ6 A;  4GEE A;  1I59 A;  4KSH A;  4LPB A;  3K60 A;  1UYM A;  2AKP A;  1AMW A;  1H7S A;  2ZKJ A;  4W7T A;  3CGY A;  4BAE A;  4FCR A;  2XHX A;  1B63 A;  4JAU A;  4JAS A;  3MNR P;  4LWF A;  2ZBK B;  4YKT A;  4LP0 A;  4CWN A;  2YE5 A;  3R4P A;  1Z5C A;  3CRL A;  4EGH A;  2YEE A;  2QFO A;  1NHJ A;  1U2O A;  2EXL A;  2XAB A;  3RLP A;  3Q5L A;  4L91 A;  2XHT A;  1YC3 A;  4MOT A;  4DZY A;  2XDU A;  2QG0 A;  3Q5K A;  3B27 A;  4HZ5 A;  4FCP A;  5F5R A;  4I3H A;  1UYE A;  3D2R A;  4BXI A;  1H7U A;  2VCI A;  1ZXN A;  4DUH A;  1Y8P A;  1TIL A;  2QF6 A;  4LWG A;  4GQT A;  2CG9 A;  5L3J A;  1ZWH A;  3FV5 A;  2YI7 A;  4KSG A;  2XX5 A;  2YI5 A;  1UYK A;  1BGQ A;  2IOQ A;  4HY1 A;  4X9L A;  4AWQ A;  3T0Z A;  4WUB A;  1MU5 A;  4CWQ A;  1YES A;  4NH7 A;  3R91 A;  2WER A;  3T10 A;  4BIZ A;  3TZ4 A;  4I5S A;  2YE8 A;  1S16 A;  2IWU A;  5GGZ A;  3HEK A;  5M4N A;  3QTF A;  3B25 A;  3G7B A;  5IN9 A;  2YEF A;  1I5D A;  4O09 A;  4CWR A;  4H81 A;  4HZ0 A;  1Y8O A;  4KFG A;  3VHA A;  4E01 A;  3H4L A;  2YE2 A;  4JQL A;  3U67 A;  3R4O A;  4XC0 A;  3C11 A;  1UY7 A;  1YET A;  2Q8G A;  5CTY A;  4U7O A;  2CCS A;  5FWK A;  1UYG A;  5M4M A;  2WEP A;  1ID0 A;  4AS9 A;  1I58 A;  4XTJ A;  1YT0 A;  2YE4 A;  1L0O A;  4V25 A;  1UYI A;  3EHJ A;  4YKX A;  4GCZ A;  2YGE A;  3HZ5 A;  4L94 A;  3RKZ A;  1YS3 A;  4XCJ A;  4QPK A;  4LWI A;  3T1K A;  3HYZ A;  1EA6 A;  1AH6 A;  2YEC A;  4YKZ A;  2Q8H A;  1YSZ A;  1UY9 A;  2Q8F A;  4XIQ A;  2YKB A;  2BRC A;  2IOR A;  4ASA A;  2VCJ A;  1AH8 A;  3C0E A;  4XCL A;  3OWD A;  3HZ1 A;  2Q8I A;  4BQJ A;  4XKO A;  1I5A A;  2HG1 A;  3T0H A;  1Y4S A;  3GIG A;  3TTZ A;  2BU6 A;  1Z59 A;  2XX4 A;  2YJX A;  3EKO A;  1I5C A;  2YEG A;  4ASF A;  2IOP A;  1PVG A;  3ZKB A;  4HYM A;  2FWZ A;  3U2K A;  2ZDX A;  3BMY A;  2YE3 A;  4XKK A;  1OSF A;  3O2F A;  4XD8 A;  1YC4 A;  5CTU A;  2YGF A;  4JAV A;  1TBW A;  1TC0 A;  2XDL A;  3ZKD A;  5M4E A;  3O0I A;  4H7Q A;  4WUC A;  3K98 A;  3OW6 A;  4R1F A;  3Q5J A;  2YEA A;  4EMV A;  2VW5 A;  3HHU A;  2YEH A;  4XE2 A;  3EHH A;  2XDS A;  1AM1 A;  2XJJ A;  3FT8 A;  4HXZ A;  2YK9 A;  4V26 A;  4YKQ A;  3RLR A;  2ZDY A;  1BYQ A;  2BRE A;  2XK2 A;  4EGK A;  4O04 A;  4EEH A;  3A0Y A;  3VHD A;  2XD6 A;  2WI3 A;  2YE9 A;  4CWS A;  3U2D A;  3T2S A;  4KQV A;  1UYL A;  4O05 A;  3INW A;  2XJG A;  3QDD A;  3HYY A;  3ZXQ A;  1QYE A;  2YJW A;  3GIE A;  2CCT A;  5D6Q A;  4CE2 A;  1R62 A;  5BOC A;  2PNR A;  2YEB A;  5M4P A;  1QZR A;  2YI0 A;  3PEH A;  3IED A;  1GJV A;  4CE3 A;  2WI4 A;  4ZVI A;  3G75 A;  3OPD A;  3A0W A;  1UYF A;  2YK2 A;  3B24 A;  3R92 A;  4KP4 A;  2JKI A;  5M4K A;  4NH8 A;  4CWF A;  4KTN A;  2BSM A;  1UYH A;  4GGL A;  4FPP A;  1BKN A;  4MPC A;  3CRK A;  2H55 A;  2YKI A;  5C93 A;  1QY8 A;  3JZ3 A;  4CWP A;  2BTZ A;  2K5B A;  4E02 A;  4URM A;  3G7E A;  3TZ0 A;  1S14 A;  2YKJ A;  1YT2 A;  1GKZ A;  1NHH A;  4PRV A;  2YE7 A;  4FMT A;  2Q2E B;  3H80 A;  4GFN A;  2QG2 A;  3FT5 A;  3A0X A;  3GIF A;  2FWY A;  4QPJ A;  2UWD A;  1US7 A;  4Q20 A;  4MP2 A;  1UYC A;  3CWV A;  4R3M A;  2XX2 A;  2XCM A;  2O1W A;  2WEQ A;  4ZKI A;  1KIJ A;  1YSR A;  2FXS A;  4PU9 A;  2XDK A;  3D36 A;  3OWB A;  5IDM A;  5CTW A;  4L8Z A;  4CWT A;  2BYH A;  1EI1 A;  3SL2 A;  2XDX A;  4MPN A;  2BU7 A;  4L90 A;  5FNC A;  2BU5 A;  5M4H A;  2YKE A;  1YT1 A;  2XJX A;  4YKY A;  1NHI A;  3PEJ A;  3KE6 A;  1Y4U A;  2YEJ A;  4XIR A;  4WUD A;  4MPE A;  4GT8 A;  1YER A;  5FND A;  4AWO A;  4E00 A;  1TH8 A;  1TID A;  3OMU A;  4EGI A;  2FYP A;  2YED A;  3BM9 A;  4MP7 A;  4XIP A;  5J71 A;  1A4H A;  2O1U A;  1Y8N A;  2O1V A;  5CPH A;  4ASG A;  2YGA A;  4LWE A;  5IDJ A;  1GKX A;  4R3A A;  4CE1 A;  4MB9 A;  3ZM7 A;  1UY6 A;  4MBC A;  4CWO A;  3EHG A;  2GFD A;  4U7N A;  3INX A;  4YKR A;  2WI1 A;  2WI5 A;  3K97 A;  1Z5B A;  2WI2 A;  1BXD A;  3A0Z A;  4K4O A;  4URO A;  1KZN A;  4XKA A;  3R4N A;  2GQP A;  2BZ5 A;  5F3K A;  3WQ9 A;  4URN A;  5CTX A;  3VAD A;  2ESA A;  4BIU A;  2WI6 A;  1ZXM A;  3B26 A;  2IWX A;  5D7R A;  1Z5A A;  4HXW A;  2XHR A;  4YKU A;  4EFT A;  2IWS A;  3A0T A;  4HY6 A;  4AWP A;  3TZ5 A;  4O07 A;  3NMQ A;  5D6P A;  1UYD A;  3CGZ A;  2VWC A;  4EFU A;  1I5B A;  1TC6 A;  4P8O A;  5CF0 A;  1B3Q A;  2HCH A;  2CH4 A;  3VHC A;  1YC1 A;  2YKC A;  3TUH A;  3O6O A;  3D0B A;  3DGE A;  5BOD A;  4PRX A;  1MX0 A;  5J6A A;  5D7C A;  3TZ2 A;  1ZW9 A;  4XDM A;  2BU2 A;  1U0Z A;  4PL9 A;  2WI7 A;  4BQG A;  4ASB A;  5FNF A;  4HYP A;  2E0A A;  2BYI A;  2YE6 A;  1UY8 A;  3RLQ A;  3R4M A;  3LPS A;  3GIG B;  4LWH A;  3WHA A;  5D7D A;  4U93 A;  4URL A;  4O0B A;  4FCQ A;  2H8M A;  3A0R A;  4L93 A;  3LNU A;  2JJC A; 
#chains in the Genus database with same CATH topology
 4P7A A;  2BT0 A;  4EM7 A;  3EKR A;  4B7P A;  2CCU A;  2C2A A;  2YI6 A;  1JM6 A;  1THN A;  4XIT A;  3K99 A;  4NH9 A;  4YKW A;  3B28 A;  1B62 A;  3ZXO A;  4H85 A;  2YEI A;  2BU8 A;  2HKJ A;  3EHF A;  2CGF A;  4B6C A;  1AJ6 A;  4GEE A;  1I59 A;  4KSH A;  4LPB A;  3K60 A;  1UYM A;  2AKP A;  1AMW A;  1H7S A;  2ZKJ A;  4W7T A;  3CGY A;  4BAE A;  4FCR A;  2XHX A;  1B63 A;  4JAU A;  4JAS A;  3MNR P;  4LWF A;  2ZBK B;  4YKT A;  4LP0 A;  4CWN A;  2YE5 A;  3R4P A;  1Z5C A;  3CRL A;  1F51 A;  4EGH A;  2YEE A;  2QFO A;  1NHJ A;  1U2O A;  2EXL A;  2XAB A;  3RLP A;  2FTK A;  3Q5L A;  4L91 A;  2XHT A;  1YC3 A;  4MOT A;  4DZY A;  2XDU A;  2QG0 A;  3Q5K A;  3B27 A;  4HZ5 A;  3LMM A;  4FCP A;  5F5R A;  4I3H A;  1UYE A;  3D2R A;  4BXI A;  1H7U A;  2VCI A;  1ZXN A;  4DUH A;  1Y8P A;  1TIL A;  2QF6 A;  4LWG A;  4GQT A;  2CG9 A;  5L3J A;  1ZWH A;  3FV5 A;  2YI7 A;  4KSG A;  2XX5 A;  2YI5 A;  1UYK A;  1BGQ A;  2IOQ A;  4HY1 A;  4X9L A;  4AWQ A;  3T0Z A;  4WUB A;  1MU5 A;  4CWQ A;  1YES A;  4NH7 A;  3R91 A;  2WER A;  3T10 A;  4BIZ A;  3TZ4 A;  4I5S A;  2YE8 A;  1S16 A;  2IWU A;  5GGZ A;  3HEK A;  5M4N A;  3QTF A;  3B25 A;  3G7B A;  5IN9 A;  2YEF A;  1I5D A;  4O09 A;  1IXM A;  2HHI A;  4CWR A;  4H81 A;  4HZ0 A;  1Y8O A;  4KFG A;  3VHA A;  4E01 A;  3H4L A;  2YE2 A;  4JQL A;  3U67 A;  3R4O A;  4XC0 A;  3C11 A;  1UY7 A;  1YET A;  2Q8G A;  5CTY A;  4U7O A;  2CCS A;  5FWK A;  1UYG A;  5M4M A;  2WEP A;  1ID0 A;  4AS9 A;  1I58 A;  4XTJ A;  1YT0 A;  2YE4 A;  1L0O A;  4V25 A;  1UYI A;  3EHJ A;  4YKX A;  4GCZ A;  2YGE A;  3HZ5 A;  4L94 A;  3RKZ A;  1YS3 A;  4XCJ A;  4QPK A;  4LWI A;  3T1K A;  3HYZ A;  1EA6 A;  1AH6 A;  4E72 A;  2YEC A;  4YKZ A;  2Q8H A;  1YSZ A;  1UY9 A;  2Q8F A;  4XIQ A;  2YKB A;  2BRC A;  2IOR A;  4ASA A;  2VCJ A;  1AH8 A;  3C0E A;  3S5T A;  4XCL A;  3OWD A;  3HZ1 A;  2Q8I A;  4BQJ A;  4XKO A;  1I5A A;  2HG1 A;  3T0H A;  1Y4S A;  3GIG A;  3TTZ A;  2BU6 A;  1Z59 A;  2XX4 A;  2YJX A;  3EKO A;  1I5C A;  2YEG A;  4ASF A;  2IOP A;  1PVG A;  3ZKB A;  4HYM A;  2FWZ A;  3U2K A;  2ZDX A;  3BMY A;  2YE3 A;  4XKK A;  1OSF A;  3O2F A;  4XD8 A;  1YC4 A;  5CTU A;  2YGF A;  4JAV A;  1TBW A;  1TC0 A;  2XDL A;  3ZKD A;  5M4E A;  3O0I A;  4H7Q A;  4WUC A;  3K98 A;  3OW6 A;  4R1F A;  3Q5J A;  2YEA A;  4EMV A;  2VW5 A;  3HHU A;  2YEH A;  4XE2 A;  3EHH A;  2XDS A;  1AM1 A;  2XJJ A;  3FT8 A;  4HXZ A;  2YK9 A;  4V26 A;  4YKQ A;  3RLR A;  2ZDY A;  1BYQ A;  2BRE A;  2XK2 A;  4EGK A;  4O04 A;  4EEH A;  3A0Y A;  3VHD A;  2XD6 A;  2WI3 A;  2YE9 A;  4CWS A;  3U2D A;  3T2S A;  4KQV A;  1UYL A;  4O05 A;  3INW A;  2XJG A;  3QDD A;  3HYY A;  3ZXQ A;  1QYE A;  2YJW A;  3GIE A;  2CCT A;  5D6Q A;  4CE2 A;  1R62 A;  5BOC A;  2PNR A;  2YEB A;  5M4P A;  1QZR A;  2YI0 A;  3PEH A;  3IED A;  1GJV A;  4CE3 A;  2WI4 A;  4ZVI A;  3G75 A;  3OPD A;  3A0W A;  1UYF A;  2YK2 A;  3B24 A;  3R92 A;  4KP4 A;  2JKI A;  5M4K A;  4NH8 A;  4CWF A;  4KTN A;  2BSM A;  1UYH A;  4GGL A;  4FPP A;  1BKN A;  4MPC A;  3CRK A;  3CYG A;  2H55 A;  2YKI A;  5C93 A;  1QY8 A;  3JZ3 A;  4CWP A;  2BTZ A;  2K5B A;  4E02 A;  4URM A;  3G7E A;  3TZ0 A;  1S14 A;  2YKJ A;  1YT2 A;  1GKZ A;  1NHH A;  2C1I A;  4PRV A;  2YE7 A;  4FMT A;  2Q2E B;  3H80 A;  2QG2 A;  3FT5 A;  4GFN A;  3A0X A;  3GIF A;  2FWY A;  4QPJ A;  2UWD A;  1US7 A;  4Q20 A;  4MP2 A;  1UYC A;  3CWV A;  4R3M A;  2XX2 A;  2XCM A;  2O1W A;  2WEQ A;  4ZKI A;  1KIJ A;  1YSR A;  2FXS A;  4PU9 A;  2XDK A;  3D36 A;  3OWB A;  5IDM A;  5CTW A;  4L8Z A;  4CWT A;  2BYH A;  1EI1 A;  3SL2 A;  2XDX A;  4MPN A;  2BU7 A;  4L90 A;  5FNC A;  2BU5 A;  5M4H A;  2YKE A;  1YT1 A;  2XJX A;  4YKY A;  1NHI A;  2C1G A;  3PEJ A;  3KE6 A;  1Y4U A;  2YEJ A;  4XIR A;  4WUD A;  4MPE A;  4GT8 A;  1YER A;  5FND A;  4AWO A;  4E00 A;  1TH8 A;  1TID A;  3OMU A;  4EGI A;  2FYP A;  2YED A;  3BM9 A;  4MP7 A;  4XIP A;  5J71 A;  1A4H A;  2O1U A;  1Y8N A;  2O1V A;  5CPH A;  4ASG A;  2YGA A;  4LWE A;  5IDJ A;  1GKX A;  4R3A A;  4CE1 A;  4MB9 A;  3ZM7 A;  1UY6 A;  4MBC A;  4CWO A;  3EHG A;  2GFD A;  4U7N A;  3INX A;  4YKR A;  2WI1 A;  2WI5 A;  3K97 A;  1Z5B A;  2WI2 A;  1BXD A;  3A0Z A;  4K4O A;  4URO A;  1KZN A;  4XKA A;  3R4N A;  2GQP A;  2BZ5 A;  5F3K A;  3WQ9 A;  4URN A;  5CTX A;  3VAD A;  2ESA A;  4BIU A;  2WI6 A;  1ZXM A;  3B26 A;  2IWX A;  5D7R A;  1Z5A A;  4HXW A;  2XHR A;  4YKU A;  4EFT A;  2IWS A;  3A0T A;  4HY6 A;  4AWP A;  3TZ5 A;  4O07 A;  3NMQ A;  5D6P A;  1UYD A;  3CGZ A;  2VWC A;  4EFU A;  1I5B A;  1TC6 A;  4P8O A;  5CF0 A;  1B3Q A;  2HCH A;  2CH4 A;  3VHC A;  1YC1 A;  2YKC A;  3TUH A;  3O6O A;  3D0B A;  3DGE A;  5BOD A;  4PRX A;  1MX0 A;  5J6A A;  5JEN A;  5D7C A;  3TZ2 A;  1ZW9 A;  4XDM A;  2BU2 A;  1U0Z A;  4PL9 A;  2WI7 A;  4BQG A;  4ASB A;  5FNF A;  4HYP A;  2E0A A;  2BYI A;  2YE6 A;  1UY8 A;  3RLQ A;  3R4M A;  3LPS A;  3GIG B;  4LWH A;  3WHA A;  5D7D A;  4U93 A;  4URL A;  4O0B A;  4FCQ A;  2H8M A;  3A0R A;  4L93 A;  3LNU A;  2JJC A; 
#chains in the Genus database with same CATH homology
 4P7A A;  2BT0 A;  4EM7 A;  3EKR A;  4B7P A;  2CCU A;  2C2A A;  2YI6 A;  1JM6 A;  1THN A;  4XIT A;  3K99 A;  4NH9 A;  4YKW A;  3B28 A;  1B62 A;  3ZXO A;  4H85 A;  2YEI A;  2BU8 A;  2HKJ A;  3EHF A;  2CGF A;  4B6C A;  1AJ6 A;  4GEE A;  1I59 A;  4KSH A;  4LPB A;  3K60 A;  1UYM A;  2AKP A;  1AMW A;  1H7S A;  2ZKJ A;  4W7T A;  3CGY A;  4BAE A;  4FCR A;  2XHX A;  1B63 A;  4JAU A;  4JAS A;  3MNR P;  4LWF A;  2ZBK B;  4YKT A;  4LP0 A;  4CWN A;  2YE5 A;  3R4P A;  1Z5C A;  3CRL A;  4EGH A;  2YEE A;  2QFO A;  1NHJ A;  1U2O A;  2EXL A;  2XAB A;  3RLP A;  3Q5L A;  4L91 A;  2XHT A;  1YC3 A;  4MOT A;  4DZY A;  2XDU A;  2QG0 A;  3Q5K A;  3B27 A;  4HZ5 A;  4FCP A;  5F5R A;  4I3H A;  1UYE A;  3D2R A;  4BXI A;  1H7U A;  2VCI A;  1ZXN A;  4DUH A;  1Y8P A;  1TIL A;  2QF6 A;  4LWG A;  4GQT A;  2CG9 A;  5L3J A;  1ZWH A;  3FV5 A;  2YI7 A;  4KSG A;  2XX5 A;  2YI5 A;  1UYK A;  1BGQ A;  2IOQ A;  4HY1 A;  4X9L A;  4AWQ A;  3T0Z A;  4WUB A;  1MU5 A;  4CWQ A;  1YES A;  4NH7 A;  3R91 A;  2WER A;  3T10 A;  4BIZ A;  3TZ4 A;  4I5S A;  2YE8 A;  1S16 A;  2IWU A;  5GGZ A;  3HEK A;  5M4N A;  3QTF A;  3B25 A;  3G7B A;  5IN9 A;  2YEF A;  1I5D A;  4O09 A;  4CWR A;  4H81 A;  4HZ0 A;  1Y8O A;  4KFG A;  3VHA A;  4E01 A;  3H4L A;  2YE2 A;  4JQL A;  3U67 A;  3R4O A;  4XC0 A;  3C11 A;  1UY7 A;  1YET A;  2Q8G A;  5CTY A;  4U7O A;  2CCS A;  5FWK A;  1UYG A;  5M4M A;  2WEP A;  1ID0 A;  4AS9 A;  1I58 A;  4XTJ A;  1YT0 A;  2YE4 A;  1L0O A;  4V25 A;  1UYI A;  3EHJ A;  4YKX A;  4GCZ A;  2YGE A;  3HZ5 A;  4L94 A;  3RKZ A;  1YS3 A;  4XCJ A;  4QPK A;  4LWI A;  3T1K A;  3HYZ A;  1EA6 A;  1AH6 A;  2YEC A;  4YKZ A;  2Q8H A;  1YSZ A;  1UY9 A;  2Q8F A;  4XIQ A;  2YKB A;  2BRC A;  2IOR A;  4ASA A;  2VCJ A;  1AH8 A;  3C0E A;  4XCL A;  3OWD A;  3HZ1 A;  2Q8I A;  4BQJ A;  4XKO A;  1I5A A;  2HG1 A;  3T0H A;  1Y4S A;  3GIG A;  3TTZ A;  2BU6 A;  1Z59 A;  2XX4 A;  2YJX A;  3EKO A;  1I5C A;  2YEG A;  4ASF A;  2IOP A;  1PVG A;  3ZKB A;  4HYM A;  2FWZ A;  3U2K A;  2ZDX A;  3BMY A;  2YE3 A;  4XKK A;  1OSF A;  3O2F A;  4XD8 A;  1YC4 A;  5CTU A;  2YGF A;  4JAV A;  1TBW A;  1TC0 A;  2XDL A;  3ZKD A;  5M4E A;  3O0I A;  4H7Q A;  4WUC A;  3K98 A;  3OW6 A;  4R1F A;  3Q5J A;  2YEA A;  4EMV A;  2VW5 A;  3HHU A;  2YEH A;  4XE2 A;  3EHH A;  2XDS A;  1AM1 A;  2XJJ A;  3FT8 A;  4HXZ A;  2YK9 A;  4V26 A;  4YKQ A;  3RLR A;  2ZDY A;  1BYQ A;  2BRE A;  2XK2 A;  4EGK A;  4O04 A;  4EEH A;  3A0Y A;  3VHD A;  2XD6 A;  2WI3 A;  2YE9 A;  4CWS A;  3U2D A;  3T2S A;  4KQV A;  1UYL A;  4O05 A;  3INW A;  2XJG A;  3QDD A;  3HYY A;  3ZXQ A;  1QYE A;  2YJW A;  3GIE A;  2CCT A;  5D6Q A;  4CE2 A;  1R62 A;  5BOC A;  2PNR A;  2YEB A;  5M4P A;  1QZR A;  2YI0 A;  3PEH A;  3IED A;  1GJV A;  4CE3 A;  2WI4 A;  4ZVI A;  3G75 A;  3OPD A;  3A0W A;  1UYF A;  2YK2 A;  3B24 A;  3R92 A;  4KP4 A;  2JKI A;  5M4K A;  4NH8 A;  4CWF A;  4KTN A;  2BSM A;  1UYH A;  4GGL A;  4FPP A;  1BKN A;  4MPC A;  3CRK A;  2H55 A;  2YKI A;  5C93 A;  1QY8 A;  3JZ3 A;  4CWP A;  2BTZ A;  2K5B A;  4E02 A;  4URM A;  3G7E A;  3TZ0 A;  1S14 A;  2YKJ A;  1YT2 A;  1GKZ A;  1NHH A;  4PRV A;  2YE7 A;  4FMT A;  2Q2E B;  3H80 A;  4GFN A;  2QG2 A;  3FT5 A;  3A0X A;  3GIF A;  2FWY A;  4QPJ A;  2UWD A;  1US7 A;  4Q20 A;  4MP2 A;  1UYC A;  3CWV A;  4R3M A;  2XX2 A;  2XCM A;  2O1W A;  2WEQ A;  4ZKI A;  1KIJ A;  1YSR A;  2FXS A;  4PU9 A;  2XDK A;  3D36 A;  3OWB A;  5IDM A;  5CTW A;  4L8Z A;  4CWT A;  2BYH A;  1EI1 A;  3SL2 A;  2XDX A;  4MPN A;  2BU7 A;  4L90 A;  5FNC A;  2BU5 A;  5M4H A;  2YKE A;  1YT1 A;  2XJX A;  4YKY A;  1NHI A;  3PEJ A;  3KE6 A;  1Y4U A;  2YEJ A;  4XIR A;  4WUD A;  4MPE A;  4GT8 A;  1YER A;  5FND A;  4AWO A;  4E00 A;  1TH8 A;  1TID A;  3OMU A;  4EGI A;  2FYP A;  2YED A;  3BM9 A;  4MP7 A;  4XIP A;  5J71 A;  1A4H A;  2O1U A;  1Y8N A;  2O1V A;  5CPH A;  4ASG A;  2YGA A;  4LWE A;  5IDJ A;  1GKX A;  4R3A A;  4CE1 A;  4MB9 A;  3ZM7 A;  1UY6 A;  4MBC A;  4CWO A;  3EHG A;  2GFD A;  4U7N A;  3INX A;  4YKR A;  2WI1 A;  2WI5 A;  3K97 A;  1Z5B A;  2WI2 A;  1BXD A;  3A0Z A;  4K4O A;  4URO A;  1KZN A;  4XKA A;  3R4N A;  2GQP A;  2BZ5 A;  5F3K A;  3WQ9 A;  4URN A;  5CTX A;  3VAD A;  2ESA A;  4BIU A;  2WI6 A;  1ZXM A;  3B26 A;  2IWX A;  5D7R A;  1Z5A A;  4HXW A;  2XHR A;  4YKU A;  4EFT A;  2IWS A;  3A0T A;  4HY6 A;  4AWP A;  3TZ5 A;  4O07 A;  3NMQ A;  5D6P A;  1UYD A;  3CGZ A;  2VWC A;  4EFU A;  1I5B A;  1TC6 A;  4P8O A;  5CF0 A;  1B3Q A;  2HCH A;  2CH4 A;  3VHC A;  1YC1 A;  2YKC A;  3TUH A;  3O6O A;  3D0B A;  3DGE A;  5BOD A;  4PRX A;  1MX0 A;  5J6A A;  5D7C A;  3TZ2 A;  1ZW9 A;  4XDM A;  2BU2 A;  1U0Z A;  4PL9 A;  2WI7 A;  4BQG A;  4ASB A;  5FNF A;  4HYP A;  2E0A A;  2BYI A;  2YE6 A;  1UY8 A;  3RLQ A;  3R4M A;  3LPS A;  3GIG B;  4LWH A;  3WHA A;  5D7D A;  4U93 A;  4URL A;  4O0B A;  4FCQ A;  2H8M A;  3A0R A;  4L93 A;  3LNU A;  2JJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...