3OPDA

Crystal structure of the n-terminal domain of an hsp90 from trypanosoma brucei, tb10.26.1080 in the presence of a benzamide derivative
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
208
Chain Sequence
GMTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQSVLGDEPHLRIRVIPDRVNKTLTVEDSGIGMTKADLVNNLGTIARSGTKSFMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVVSKNNEDDAYTWESSAGGTFTVTSTPDLKRGTRIVLHLKEDQQEYLEERRLKDLIKKHSEFIGYDIELMVEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein 83
publication title Exploring the Trypanosoma brucei Hsp83 potential as a target for structure guided drug design.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Chaperone
total genus 67
structure length 208
sequence length 210
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3opdA00
4YKRA 1AJ6A 3T2SA 1Z59A 2YGAA 1TH8A 2IWUA 4EGIA 3Q5LA 3TZ4A 2BRCA 2GFDA 4LWEA 2HCHA 1AH8A 1Y8OA 4URMA 4EMVA 1YC1A 2ESAA 4CWFA 2Q8FA 3OMUA 1KIJA 1NHIA 3C0EA 2H8MA 3KE6A 2XCMA 4QPKA 1Y8NA 3O0IA 4LWIA 1YETA 2AKPA 2YEIA 3FT5A 3A0YA 3T1KA 4EFUA 5L3JA 3EKRA 4CWOA 5M4HA 1UY9A 2YE3A 4XCJA 2HKJA 4L94A 4NH9A 5J71A 2FWZA 4XIPA 2IWSA 4MPEA 5D6PA 3EKOA 2YEDA 3O2FA 2FWYA 3A0ZA 4GT8A 1L0OA 3TZ0A 4P7AA 4X9LA 5M4EA 2IOPA 4PRXA 4ASBA 4P8OA 1JM6A 1EA6A 4MBCA 4HZ5A 4KP4A 4U7NA 1YESA 1R62A 2C2AA 4JAVA 4XTJA 5D7RA 4NH7A 4H7QA 2Q8HA 2Q8GA 3B25A 2XJXA 4MPNA 1YC3A 4GGLA 4XITA 4HZ0A 4KTNA 3A0TA 3R4OA 1H7UA 4URNA 2FXSA 3CRLA 4L93A 1BXDA 4ZVIA 4LP0A 2BSMA 4YKUA 3TTZA 5FWKA 3EHHA 4MOTA 4Q20A 2YI5A 5BODA 2QG2A 4YKTA 3T10A 3Q5KA 2WI7A 2XHRA 2XDLA 2XDSA 4WUCA 4BIUA 2WEPA 3O6OA 1NHJA 1UYEA 4FMTA 2BZ5A 3HZ1A 1TC6A 4XKAA 3GIEA 5IDMA 3HYZA 3INWA 2WI2A 4GEEA 2BYIA 1UYHA 4KSHA 3ZXQA 2CCSA 3WHAA 4O0BA 3Q5JA 4O05A 5J6AA 4LPBA 2HG1A 2YKJA 4JASA 4BQGA 1YT1A 2JKIA 1I59A 3D0BA 3FV5A 1UY8A 4U7OA 3U67A 2WI3A 4CWQA 5CTXA 4W7TA 4MP2A 1U0ZA 4CE1A 2WEQA 1I5DA 4LWGA 4R3MA 5IDJA 3OWBA 2XABA 4CWTA 3ZM7A 4JQLA 5GGZA 2YEAA 5FNFA 1ZXMA 3R4PA 4UROA 3EHFA 3RLRA 2BT0A 3H80A 3MNRP 2YI7A 4XIQA 4E01A 2XD6A 1TC0A 4CE2A 4DZYA 4L90A 2Q2EB 2YKIA 4HY6A 4AWPA 1BGQA 1GKXA 2CH4A 3A0WA 1I5CA 3K60A 2XDUA 2XHTA 2CG9A 3VADA 4KQVA 4O09A 2WI6A 1UYGA 1YT2A 3SL2A 3HZ5A 3CGYA 2XHXA 4CWNA 3DGEA 5D7CA 4NH8A 2ZDXA 1EI1A 5F5RA 1Y4UA 3G7EA 4H85A 2XX5A 3OWDA 4H81A 4LWHA 1QYEA 5CTYA 3QDDA 2BU6A 4BXIA 1NHHA 3BMYA 2YEBA 3GIGB 1UYKA 1UYMA 1S16A 4YKZA 1AM1A 4AWOA 4FCQA 5CPHA 3TZ5A 4HYMA 2O1UA 3CRKA 3U2KA 3ZKBA 2IORA 2O1VA 4YKYA 4I3HA 3G7BA 1S14A 1UYLA 1I58A 2YE8A 3VHDA 3PEHA 4V26A 2YK9A 1QY8A 4ASAA 2VCIA 4YKXA 2VCJA 1UY7A 5FNCA 1TIDA 2Q8IA 3ZXOA 3D36A 4YKWA 1ZW9A 2YE5A 2BREA 3RLPA 2WERA 4XIRA 5M4PA 3D2RA 4QPJA 2YE7A 3ZKDA 2ZDYA 5FNDA 3NMQA 3R92A 1ZWHA 3TZ2A 3RLQA 1I5BA 1A4HA 2QFOA 2K5BA 4CWPA 2IOQA 4CWRA 3VHCA 3T0HA 4LWFA 3R4NA 4I5SA 4PL9A 1THNA 3C11A 1AMWA 4E02A 2BU2A 3INXA 2WI5A 5BOCA 2CGFA 2YE6A 2VWCA 2YI0A 1Y4SA 3R4MA 3EHGA 3HHUA 1MU5A 2PNRA 3QTFA 4HXWA 3A0XA 3FT8A 4AS9A 2BU5A 1QZRA 3OW6A 4HYPA 1GJVA 1YC4A 1U2OA 1YSZA 3LNUA 4GFNA 3CWVA 1UY6A 4EFTA 2XJJA 5CTUA 3OPDA 4O04A 2YEEA 4CE3A 2YGEA 3HYYA 1I5AA 1BKNA 2YKEA 4B6CA 3WQ9A 1B3QA 2YGFA 2GQPA 4ASGA 2YEJA 4ZKIA 4E00A 2YE2A 2VW5A 2YEHA 4R3AA 2CCUA 2H55A 2IWXA 2YE4A 3B24A 3CGZA 4YKQA 5M4NA 2E0AA 2YKBA 1AH6A 3TUHA 4K4OA 2XX2A 4GQTA 2BU8A 4MP7A 3T0ZA 2O1WA 1TILA 2UWDA 1ZXNA 1Z5AA 1US7A 1UYDA 3B26A 4KSGA 4FCPA 4EM7A 4WUDA 3PEJA 1MX0A 2XDKA 2XK2A 5M4KA 5CTWA 3U2DA 4EEHA 3VHAA 4BIZA 2BYHA 4BAEA 4FCRA 2QG0A 5M4MA 2ZKJA 4XDMA 4FPPA 3HEKA 1ID0A 3GIGA 3A0RA 1YSRA 4AWQA 1YT0A 2EXLA 2YECA 1Z5BA 4CWSA 4DUHA 1Z5CA 3R91A 4EGHA 2YJXA 1GKZA 2CCTA 4MB9A 4URLA 2QF6A 5F3KA 3BM9A 2XDXA 4XD8A 5CF0A 2YEGA 3JZ3A 4WUBA 2YE9A 1YS3A 4KFGA 3GIFA 4XC0A 1UYCA 3H4LA 4ASFA 1TBWA 4XKKA 4L91A 4U93A 1H7SA 2WI4A 4MPCA 2YKCA 3K99A 4XE2A 1Y8PA 5C93A 1OSFA 2XJGA 2WI1A 4JAUA 4XCLA 4BQJA 1UYIA 1BYQA 3RKZA 3EHJA 1B62A 2YI6A 3B28A 4PRVA 4GCZA 2ZBKB 4HY1A 4R1FA 4L8ZA 5D6QA 2YK2A 2YEFA 2BTZA 1KZNA 3K98A 2YJWA 3B27A 2XX4A 5D7DA 1UYFA 1YERA 4O07A 2FYPA 4EGKA 3G75A 2BU7A 4V25A 3IEDA 4PU9A 4B7PA 2JJCA 5IN9A 1PVGA 3K97A 1B63A 4HXZA 4XKOA 3LPSA
chains in the Genus database with same CATH superfamily
4YKRA 1AJ6A 3T2SA 1Z59A 2YGAA 1TH8A 2IWUA 4EGIA 3Q5LA 3TZ4A 2BRCA 2GFDA 4LWEA 2HCHA 1Y8OA 1AH8A 4URMA 4EMVA 1YC1A 2ESAA 4CWFA 2Q8FA 3OMUA 1KIJA 1NHIA 3C0EA 2H8MA 3KE6A 2XCMA 4QPKA 1Y8NA 3O0IA 4LWIA 1YETA 2AKPA 2YEIA 3FT5A 3A0YA 3T1KA 4EFUA 5L3JA 3EKRA 4CWOA 5M4HA 1UY9A 2YE3A 4XCJA 2HKJA 4L94A 4NH9A 3S5TA 5J71A 2FWZA 4XIPA 2IWSA 4MPEA 5D6PA 3EKOA 2YEDA 3O2FA 3CYGA 2FWYA 3A0ZA 4GT8A 1L0OA 3TZ0A 4P7AA 4X9LA 5M4EA 2IOPA 4PRXA 4ASBA 4P8OA 1JM6A 1EA6A 4MBCA 4HZ5A 4KP4A 4U7NA 1YESA 1R62A 2C2AA 4JAVA 4XTJA 5D7RA 4NH7A 4H7QA 2Q8HA 2Q8GA 3B25A 2XJXA 4MPNA 1YC3A 4GGLA 4XITA 4HZ0A 4KTNA 3A0TA 3R4OA 1H7UA 4URNA 2FXSA 3CRLA 4L93A 1BXDA 4ZVIA 4LP0A 2BSMA 4YKUA 3TTZA 5FWKA 3EHHA 4MOTA 4Q20A 2YI5A 5BODA 2QG2A 4YKTA 3T10A 3Q5KA 2WI7A 2XHRA 2XDLA 2XDSA 4WUCA 4BIUA 2WEPA 3O6OA 1NHJA 1UYEA 4FMTA 2BZ5A 3HZ1A 1TC6A 4XKAA 3GIEA 5IDMA 3HYZA 3INWA 2WI2A 4GEEA 2BYIA 1UYHA 4KSHA 3ZXQA 2CCSA 3WHAA 4O0BA 3Q5JA 4O05A 5J6AA 4LPBA 2HG1A 2YKJA 4JASA 4BQGA 1YT1A 2JKIA 1I59A 3D0BA 3FV5A 1UY8A 5JENA 4U7OA 3U67A 2WI3A 4CWQA 5CTXA 4W7TA 4MP2A 1U0ZA 4CE1A 2WEQA 1I5DA 4LWGA 4R3MA 5IDJA 3OWBA 2XABA 4CWTA 3ZM7A 4JQLA 5GGZA 2HHIA 2YEAA 5FNFA 1ZXMA 3R4PA 4UROA 3EHFA 3RLRA 2BT0A 3H80A 3MNRP 2YI7A 4XIQA 4E01A 2XD6A 1TC0A 4CE2A 4DZYA 4L90A 2Q2EB 2YKIA 4HY6A 2FTKA 4AWPA 1BGQA 1GKXA 2CH4A 3A0WA 1I5CA 3K60A 2XDUA 2XHTA 2CG9A 3VADA 4KQVA 4O09A 2WI6A 1UYGA 1YT2A 3SL2A 3HZ5A 3CGYA 2XHXA 4CWNA 3DGEA 5D7CA 4NH8A 2ZDXA 1EI1A 5F5RA 1Y4UA 3G7EA 4H85A 2XX5A 3OWDA 4H81A 4LWHA 1QYEA 5CTYA 3QDDA 2BU6A 4BXIA 1NHHA 3BMYA 2YEBA 3GIGB 1UYKA 1UYMA 1S16A 4YKZA 2C1GA 1AM1A 4AWOA 4FCQA 5CPHA 3TZ5A 4HYMA 2O1UA 3CRKA 3U2KA 3ZKBA 2IORA 1F51A 2O1VA 4YKYA 4I3HA 3G7BA 1S14A 1UYLA 1I58A 2YE8A 3VHDA 3PEHA 4V26A 2YK9A 1QY8A 4ASAA 2VCIA 4YKXA 2VCJA 1UY7A 5FNCA 1TIDA 2Q8IA 3ZXOA 3D36A 4YKWA 1ZW9A 2YE5A 2BREA 3RLPA 2WERA 4XIRA 5M4PA 3D2RA 4QPJA 2YE7A 3ZKDA 2ZDYA 5FNDA 3NMQA 3R92A 1ZWHA 3TZ2A 3RLQA 1I5BA 1A4HA 2QFOA 2K5BA 4CWPA 2IOQA 4CWRA 3VHCA 3T0HA 4LWFA 3R4NA 4I5SA 4PL9A 1THNA 3C11A 1AMWA 4E02A 2BU2A 3INXA 2WI5A 5BOCA 2CGFA 2YE6A 2VWCA 2YI0A 1Y4SA 3R4MA 3EHGA 3HHUA 1MU5A 2PNRA 3QTFA 4HXWA 3A0XA 3FT8A 4AS9A 2BU5A 1QZRA 3LMMA 3OW6A 4HYPA 1GJVA 1YC4A 1U2OA 1YSZA 3LNUA 4GFNA 3CWVA 1UY6A 4EFTA 2XJJA 5CTUA 3OPDA 4O04A 2YEEA 4CE3A 2YGEA 3HYYA 1I5AA 1BKNA 2YKEA 4B6CA 3WQ9A 1B3QA 2YGFA 2GQPA 4ASGA 2YEJA 4ZKIA 4E00A 2YE2A 2VW5A 2YEHA 4R3AA 2CCUA 2H55A 2IWXA 2YE4A 3B24A 3CGZA 4YKQA 5M4NA 2E0AA 2YKBA 1AH6A 3TUHA 4K4OA 2XX2A 4GQTA 2BU8A 4MP7A 3T0ZA 2O1WA 1TILA 2UWDA 1ZXNA 1Z5AA 1US7A 1UYDA 1IXMA 3B26A 4KSGA 4FCPA 4EM7A 4WUDA 3PEJA 1MX0A 2XDKA 2XK2A 5M4KA 5CTWA 3U2DA 4EEHA 3VHAA 4BIZA 2BYHA 4BAEA 4FCRA 2QG0A 5M4MA 2ZKJA 4XDMA 4FPPA 3HEKA 1ID0A 3GIGA 3A0RA 1YSRA 4AWQA 1YT0A 2EXLA 2YECA 1Z5BA 4CWSA 4DUHA 1Z5CA 3R91A 4EGHA 2YJXA 1GKZA 2CCTA 4MB9A 4URLA 2QF6A 5F3KA 3BM9A 2XDXA 4XD8A 5CF0A 2YEGA 3JZ3A 4WUBA 2YE9A 1YS3A 4KFGA 3GIFA 4XC0A 1UYCA 3H4LA 4ASFA 1TBWA 4XKKA 4L91A 4U93A 1H7SA 2WI4A 4MPCA 2YKCA 3K99A 4XE2A 1Y8PA 5C93A 1OSFA 2XJGA 2WI1A 4JAUA 4XCLA 4BQJA 1UYIA 1BYQA 3RKZA 3EHJA 1B62A 2YI6A 3B28A 4PRVA 4GCZA 2ZBKB 4HY1A 4R1FA 4L8ZA 5D6QA 2YK2A 2YEFA 2BTZA 1KZNA 3K98A 2YJWA 3B27A 4E72A 2XX4A 5D7DA 1UYFA 1YERA 4O07A 2FYPA 4EGKA 3G75A 2C1IA 2BU7A 4V25A 3IEDA 4PU9A 4B7PA 2JJCA 5IN9A 1PVGA 3K97A 1B63A 4HXZA 4XKOA 3LPSA
chains in the Genus database with same CATH topology
4YKRA 1AJ6A 3T2SA 1Z59A 2YGAA 1TH8A 2IWUA 4EGIA 3Q5LA 3TZ4A 2BRCA 2GFDA 4LWEA 2HCHA 1AH8A 1Y8OA 4URMA 4EMVA 1YC1A 2ESAA 4CWFA 2Q8FA 3OMUA 1KIJA 1NHIA 3C0EA 2H8MA 3KE6A 2XCMA 4QPKA 1Y8NA 3O0IA 4LWIA 1YETA 2AKPA 2YEIA 3FT5A 3A0YA 3T1KA 4EFUA 5L3JA 3EKRA 4CWOA 5M4HA 1UY9A 2YE3A 4XCJA 2HKJA 4L94A 4NH9A 5J71A 2FWZA 4XIPA 2IWSA 4MPEA 5D6PA 3EKOA 2YEDA 3O2FA 2FWYA 3A0ZA 4GT8A 1L0OA 3TZ0A 4P7AA 4X9LA 5M4EA 2IOPA 4PRXA 4ASBA 4P8OA 1JM6A 1EA6A 4MBCA 4HZ5A 4KP4A 4U7NA 1YESA 1R62A 2C2AA 4JAVA 4XTJA 5D7RA 4NH7A 4H7QA 2Q8HA 2Q8GA 3B25A 2XJXA 4MPNA 1YC3A 4GGLA 4XITA 4HZ0A 4KTNA 3A0TA 3R4OA 1H7UA 4URNA 2FXSA 3CRLA 4L93A 1BXDA 4ZVIA 4LP0A 2BSMA 4YKUA 3TTZA 5FWKA 3EHHA 4MOTA 4Q20A 2YI5A 5BODA 2QG2A 4YKTA 3T10A 3Q5KA 2WI7A 2XHRA 2XDLA 2XDSA 4WUCA 4BIUA 2WEPA 3O6OA 1NHJA 1UYEA 4FMTA 2BZ5A 3HZ1A 1TC6A 4XKAA 3GIEA 5IDMA 3HYZA 3INWA 2WI2A 4GEEA 2BYIA 1UYHA 4KSHA 3ZXQA 2CCSA 3WHAA 4O0BA 3Q5JA 4O05A 5J6AA 4LPBA 2HG1A 2YKJA 4JASA 4BQGA 1YT1A 2JKIA 1I59A 3D0BA 3FV5A 1UY8A 4U7OA 3U67A 2WI3A 4CWQA 5CTXA 4W7TA 4MP2A 1U0ZA 4CE1A 2WEQA 1I5DA 4LWGA 4R3MA 5IDJA 3OWBA 2XABA 4CWTA 3ZM7A 4JQLA 5GGZA 2YEAA 5FNFA 1ZXMA 3R4PA 4UROA 3EHFA 3RLRA 2BT0A 3H80A 3MNRP 2YI7A 4XIQA 4E01A 2XD6A 1TC0A 4CE2A 4DZYA 4L90A 2Q2EB 2YKIA 4HY6A 4AWPA 1BGQA 1GKXA 2CH4A 3A0WA 1I5CA 3K60A 2XDUA 2XHTA 2CG9A 3VADA 4KQVA 4O09A 2WI6A 1UYGA 1YT2A 3SL2A 3HZ5A 3CGYA 2XHXA 4CWNA 3DGEA 5D7CA 4NH8A 2ZDXA 1EI1A 5F5RA 1Y4UA 3G7EA 4H85A 2XX5A 3OWDA 4H81A 4LWHA 1QYEA 5CTYA 3QDDA 2BU6A 4BXIA 1NHHA 3BMYA 2YEBA 3GIGB 1UYKA 1UYMA 1S16A 4YKZA 1AM1A 4AWOA 4FCQA 5CPHA 3TZ5A 4HYMA 2O1UA 3CRKA 3U2KA 3ZKBA 2IORA 2O1VA 4YKYA 4I3HA 3G7BA 1S14A 1UYLA 1I58A 2YE8A 3VHDA 3PEHA 4V26A 2YK9A 1QY8A 4ASAA 2VCIA 4YKXA 2VCJA 1UY7A 5FNCA 1TIDA 2Q8IA 3ZXOA 3D36A 4YKWA 1ZW9A 2YE5A 2BREA 3RLPA 2WERA 4XIRA 5M4PA 3D2RA 4QPJA 2YE7A 3ZKDA 2ZDYA 5FNDA 3NMQA 3R92A 1ZWHA 3TZ2A 3RLQA 1I5BA 1A4HA 2QFOA 2K5BA 4CWPA 2IOQA 4CWRA 3VHCA 3T0HA 4LWFA 3R4NA 4I5SA 4PL9A 1THNA 3C11A 1AMWA 4E02A 2BU2A 3INXA 2WI5A 5BOCA 2CGFA 2YE6A 2VWCA 2YI0A 1Y4SA 3R4MA 3EHGA 3HHUA 1MU5A 2PNRA 3QTFA 4HXWA 3A0XA 3FT8A 4AS9A 2BU5A 1QZRA 3OW6A 4HYPA 1GJVA 1YC4A 1U2OA 1YSZA 3LNUA 4GFNA 3CWVA 1UY6A 4EFTA 2XJJA 5CTUA 3OPDA 4O04A 2YEEA 4CE3A 2YGEA 3HYYA 1I5AA 1BKNA 2YKEA 4B6CA 3WQ9A 1B3QA 2YGFA 2GQPA 4ASGA 2YEJA 4ZKIA 4E00A 2YE2A 2VW5A 2YEHA 4R3AA 2CCUA 2H55A 2IWXA 2YE4A 3B24A 3CGZA 4YKQA 5M4NA 2E0AA 2YKBA 1AH6A 3TUHA 4K4OA 2XX2A 4GQTA 2BU8A 4MP7A 3T0ZA 2O1WA 1TILA 2UWDA 1ZXNA 1Z5AA 1US7A 1UYDA 3B26A 4KSGA 4FCPA 4EM7A 4WUDA 3PEJA 1MX0A 2XDKA 2XK2A 5M4KA 5CTWA 3U2DA 4EEHA 3VHAA 4BIZA 2BYHA 4BAEA 4FCRA 2QG0A 5M4MA 2ZKJA 4XDMA 4FPPA 3HEKA 1ID0A 3GIGA 3A0RA 1YSRA 4AWQA 1YT0A 2EXLA 2YECA 1Z5BA 4CWSA 4DUHA 1Z5CA 3R91A 4EGHA 2YJXA 1GKZA 2CCTA 4MB9A 4URLA 2QF6A 5F3KA 3BM9A 2XDXA 4XD8A 5CF0A 2YEGA 3JZ3A 4WUBA 2YE9A 1YS3A 4KFGA 3GIFA 4XC0A 1UYCA 3H4LA 4ASFA 1TBWA 4XKKA 4L91A 4U93A 1H7SA 2WI4A 4MPCA 2YKCA 3K99A 4XE2A 1Y8PA 5C93A 1OSFA 2XJGA 2WI1A 4JAUA 4XCLA 4BQJA 1UYIA 1BYQA 3RKZA 3EHJA 1B62A 2YI6A 3B28A 4PRVA 4GCZA 2ZBKB 4HY1A 4R1FA 4L8ZA 5D6QA 2YK2A 2YEFA 2BTZA 1KZNA 3K98A 2YJWA 3B27A 2XX4A 5D7DA 1UYFA 1YERA 4O07A 2FYPA 4EGKA 3G75A 2BU7A 4V25A 3IEDA 4PU9A 4B7PA 2JJCA 5IN9A 1PVGA 3K97A 1B63A 4HXZA 4XKOA 3LPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YKR A;  1AJ6 A;  3T2S A;  1Z59 A;  2YGA A;  1TH8 A;  2IWU A;  4EGI A;  3Q5L A;  3TZ4 A;  2BRC A;  2GFD A;  4LWE A;  2HCH A;  1AH8 A;  1Y8O A;  4URM A;  4EMV A;  1YC1 A;  2ESA A;  4CWF A;  2Q8F A;  3OMU A;  1KIJ A;  1NHI A;  3C0E A;  2H8M A;  3KE6 A;  2XCM A;  4QPK A;  1Y8N A;  3O0I A;  4LWI A;  1YET A;  2AKP A;  2YEI A;  3FT5 A;  3A0Y A;  3T1K A;  4EFU A;  5L3J A;  3EKR A;  4CWO A;  5M4H A;  1UY9 A;  2YE3 A;  4XCJ A;  2HKJ A;  4L94 A;  4NH9 A;  5J71 A;  2FWZ A;  4XIP A;  2IWS A;  4MPE A;  5D6P A;  3EKO A;  2YED A;  3O2F A;  2FWY A;  3A0Z A;  4GT8 A;  1L0O A;  3TZ0 A;  4P7A A;  4X9L A;  5M4E A;  2IOP A;  4PRX A;  4ASB A;  4P8O A;  1JM6 A;  1EA6 A;  4MBC A;  4HZ5 A;  4KP4 A;  4U7N A;  1YES A;  1R62 A;  2C2A A;  4JAV A;  4XTJ A;  5D7R A;  4NH7 A;  4H7Q A;  2Q8H A;  2Q8G A;  3B25 A;  2XJX A;  4MPN A;  1YC3 A;  4GGL A;  4XIT A;  4HZ0 A;  4KTN A;  3A0T A;  3R4O A;  1H7U A;  4URN A;  2FXS A;  3CRL A;  4L93 A;  1BXD A;  4ZVI A;  4LP0 A;  2BSM A;  4YKU A;  3TTZ A;  5FWK A;  3EHH A;  4MOT A;  4Q20 A;  2YI5 A;  5BOD A;  2QG2 A;  4YKT A;  3T10 A;  3Q5K A;  2WI7 A;  2XHR A;  2XDL A;  2XDS A;  4WUC A;  4BIU A;  2WEP A;  3O6O A;  1NHJ A;  1UYE A;  4FMT A;  2BZ5 A;  3HZ1 A;  1TC6 A;  4XKA A;  3GIE A;  5IDM A;  3HYZ A;  3INW A;  2WI2 A;  4GEE A;  2BYI A;  1UYH A;  4KSH A;  3ZXQ A;  2CCS A;  3WHA A;  4O0B A;  3Q5J A;  4O05 A;  5J6A A;  4LPB A;  2HG1 A;  2YKJ A;  4JAS A;  4BQG A;  1YT1 A;  2JKI A;  1I59 A;  3D0B A;  3FV5 A;  1UY8 A;  4U7O A;  3U67 A;  2WI3 A;  4CWQ A;  5CTX A;  4W7T A;  4MP2 A;  1U0Z A;  4CE1 A;  2WEQ A;  1I5D A;  4LWG A;  4R3M A;  5IDJ A;  3OWB A;  2XAB A;  4CWT A;  3ZM7 A;  4JQL A;  5GGZ A;  2YEA A;  5FNF A;  1ZXM A;  3R4P A;  4URO A;  3EHF A;  3RLR A;  2BT0 A;  3H80 A;  3MNR P;  2YI7 A;  4XIQ A;  4E01 A;  2XD6 A;  1TC0 A;  4CE2 A;  4DZY A;  4L90 A;  2Q2E B;  2YKI A;  4HY6 A;  4AWP A;  1BGQ A;  1GKX A;  2CH4 A;  3A0W A;  1I5C A;  3K60 A;  2XDU A;  2XHT A;  2CG9 A;  3VAD A;  4KQV A;  4O09 A;  2WI6 A;  1UYG A;  1YT2 A;  3SL2 A;  3HZ5 A;  3CGY A;  2XHX A;  4CWN A;  3DGE A;  5D7C A;  4NH8 A;  2ZDX A;  1EI1 A;  5F5R A;  1Y4U A;  3G7E A;  4H85 A;  2XX5 A;  3OWD A;  4H81 A;  4LWH A;  1QYE A;  5CTY A;  3QDD A;  2BU6 A;  4BXI A;  1NHH A;  3BMY A;  2YEB A;  3GIG B;  1UYK A;  1UYM A;  1S16 A;  4YKZ A;  1AM1 A;  4AWO A;  4FCQ A;  5CPH A;  3TZ5 A;  4HYM A;  2O1U A;  3CRK A;  3U2K A;  3ZKB A;  2IOR A;  2O1V A;  4YKY A;  4I3H A;  3G7B A;  1S14 A;  1UYL A;  1I58 A;  2YE8 A;  3VHD A;  3PEH A;  4V26 A;  2YK9 A;  1QY8 A;  4ASA A;  2VCI A;  4YKX A;  2VCJ A;  1UY7 A;  5FNC A;  1TID A;  2Q8I A;  3ZXO A;  3D36 A;  4YKW A;  1ZW9 A;  2YE5 A;  2BRE A;  3RLP A;  2WER A;  4XIR A;  5M4P A;  3D2R A;  4QPJ A;  2YE7 A;  3ZKD A;  2ZDY A;  5FND A;  3NMQ A;  3R92 A;  1ZWH A;  3TZ2 A;  3RLQ A;  1I5B A;  1A4H A;  2QFO A;  2K5B A;  4CWP A;  2IOQ A;  4CWR A;  3VHC A;  3T0H A;  4LWF A;  3R4N A;  4I5S A;  4PL9 A;  1THN A;  3C11 A;  1AMW A;  4E02 A;  2BU2 A;  3INX A;  2WI5 A;  5BOC A;  2CGF A;  2YE6 A;  2VWC A;  2YI0 A;  1Y4S A;  3R4M A;  3EHG A;  3HHU A;  1MU5 A;  2PNR A;  3QTF A;  4HXW A;  3A0X A;  3FT8 A;  4AS9 A;  2BU5 A;  1QZR A;  3OW6 A;  4HYP A;  1GJV A;  1YC4 A;  1U2O A;  1YSZ A;  3LNU A;  4GFN A;  3CWV A;  1UY6 A;  4EFT A;  2XJJ A;  5CTU A;  3OPD A;  4O04 A;  2YEE A;  4CE3 A;  2YGE A;  3HYY A;  1I5A A;  1BKN A;  2YKE A;  4B6C A;  3WQ9 A;  1B3Q A;  2YGF A;  2GQP A;  4ASG A;  2YEJ A;  4ZKI A;  4E00 A;  2YE2 A;  2VW5 A;  2YEH A;  4R3A A;  2CCU A;  2H55 A;  2IWX A;  2YE4 A;  3B24 A;  3CGZ A;  4YKQ A;  5M4N A;  2E0A A;  2YKB A;  1AH6 A;  3TUH A;  4K4O A;  2XX2 A;  4GQT A;  2BU8 A;  4MP7 A;  3T0Z A;  2O1W A;  1TIL A;  2UWD A;  1ZXN A;  1Z5A A;  1US7 A;  1UYD A;  3B26 A;  4KSG A;  4FCP A;  4EM7 A;  4WUD A;  3PEJ A;  1MX0 A;  2XDK A;  2XK2 A;  5M4K A;  5CTW A;  3U2D A;  4EEH A;  3VHA A;  4BIZ A;  2BYH A;  4BAE A;  4FCR A;  2QG0 A;  5M4M A;  2ZKJ A;  4XDM A;  4FPP A;  3HEK A;  1ID0 A;  3GIG A;  3A0R A;  1YSR A;  4AWQ A;  1YT0 A;  2EXL A;  2YEC A;  1Z5B A;  4CWS A;  4DUH A;  1Z5C A;  3R91 A;  4EGH A;  2YJX A;  1GKZ A;  2CCT A;  4MB9 A;  4URL A;  2QF6 A;  5F3K A;  3BM9 A;  2XDX A;  4XD8 A;  5CF0 A;  2YEG A;  3JZ3 A;  4WUB A;  2YE9 A;  1YS3 A;  4KFG A;  3GIF A;  4XC0 A;  1UYC A;  3H4L A;  4ASF A;  1TBW A;  4XKK A;  4L91 A;  4U93 A;  1H7S A;  2WI4 A;  4MPC A;  2YKC A;  3K99 A;  4XE2 A;  1Y8P A;  5C93 A;  1OSF A;  2XJG A;  2WI1 A;  4JAU A;  4XCL A;  4BQJ A;  1UYI A;  1BYQ A;  3RKZ A;  3EHJ A;  1B62 A;  2YI6 A;  3B28 A;  4PRV A;  4GCZ A;  2ZBK B;  4HY1 A;  4R1F A;  4L8Z A;  5D6Q A;  2YK2 A;  2YEF A;  2BTZ A;  1KZN A;  3K98 A;  2YJW A;  3B27 A;  2XX4 A;  5D7D A;  1UYF A;  1YER A;  4O07 A;  2FYP A;  4EGK A;  3G75 A;  2BU7 A;  4V25 A;  3IED A;  4PU9 A;  4B7P A;  2JJC A;  5IN9 A;  1PVG A;  3K97 A;  1B63 A;  4HXZ A;  4XKO A;  3LPS A; 
#chains in the Genus database with same CATH topology
 4YKR A;  1AJ6 A;  3T2S A;  1Z59 A;  2YGA A;  1TH8 A;  2IWU A;  4EGI A;  3Q5L A;  3TZ4 A;  2BRC A;  2GFD A;  4LWE A;  2HCH A;  1Y8O A;  1AH8 A;  4URM A;  4EMV A;  1YC1 A;  2ESA A;  4CWF A;  2Q8F A;  3OMU A;  1KIJ A;  1NHI A;  3C0E A;  2H8M A;  3KE6 A;  2XCM A;  4QPK A;  1Y8N A;  3O0I A;  4LWI A;  1YET A;  2AKP A;  2YEI A;  3FT5 A;  3A0Y A;  3T1K A;  4EFU A;  5L3J A;  3EKR A;  4CWO A;  5M4H A;  1UY9 A;  2YE3 A;  4XCJ A;  2HKJ A;  4L94 A;  4NH9 A;  3S5T A;  5J71 A;  2FWZ A;  4XIP A;  2IWS A;  4MPE A;  5D6P A;  3EKO A;  2YED A;  3O2F A;  3CYG A;  2FWY A;  3A0Z A;  4GT8 A;  1L0O A;  3TZ0 A;  4P7A A;  4X9L A;  5M4E A;  2IOP A;  4PRX A;  4ASB A;  4P8O A;  1JM6 A;  1EA6 A;  4MBC A;  4HZ5 A;  4KP4 A;  4U7N A;  1YES A;  1R62 A;  2C2A A;  4JAV A;  4XTJ A;  5D7R A;  4NH7 A;  4H7Q A;  2Q8H A;  2Q8G A;  3B25 A;  2XJX A;  4MPN A;  1YC3 A;  4GGL A;  4XIT A;  4HZ0 A;  4KTN A;  3A0T A;  3R4O A;  1H7U A;  4URN A;  2FXS A;  3CRL A;  4L93 A;  1BXD A;  4ZVI A;  4LP0 A;  2BSM A;  4YKU A;  3TTZ A;  5FWK A;  3EHH A;  4MOT A;  4Q20 A;  2YI5 A;  5BOD A;  2QG2 A;  4YKT A;  3T10 A;  3Q5K A;  2WI7 A;  2XHR A;  2XDL A;  2XDS A;  4WUC A;  4BIU A;  2WEP A;  3O6O A;  1NHJ A;  1UYE A;  4FMT A;  2BZ5 A;  3HZ1 A;  1TC6 A;  4XKA A;  3GIE A;  5IDM A;  3HYZ A;  3INW A;  2WI2 A;  4GEE A;  2BYI A;  1UYH A;  4KSH A;  3ZXQ A;  2CCS A;  3WHA A;  4O0B A;  3Q5J A;  4O05 A;  5J6A A;  4LPB A;  2HG1 A;  2YKJ A;  4JAS A;  4BQG A;  1YT1 A;  2JKI A;  1I59 A;  3D0B A;  3FV5 A;  1UY8 A;  5JEN A;  4U7O A;  3U67 A;  2WI3 A;  4CWQ A;  5CTX A;  4W7T A;  4MP2 A;  1U0Z A;  4CE1 A;  2WEQ A;  1I5D A;  4LWG A;  4R3M A;  5IDJ A;  3OWB A;  2XAB A;  4CWT A;  3ZM7 A;  4JQL A;  5GGZ A;  2HHI A;  2YEA A;  5FNF A;  1ZXM A;  3R4P A;  4URO A;  3EHF A;  3RLR A;  2BT0 A;  3H80 A;  3MNR P;  2YI7 A;  4XIQ A;  4E01 A;  2XD6 A;  1TC0 A;  4CE2 A;  4DZY A;  4L90 A;  2Q2E B;  2YKI A;  4HY6 A;  2FTK A;  4AWP A;  1BGQ A;  1GKX A;  2CH4 A;  3A0W A;  1I5C A;  3K60 A;  2XDU A;  2XHT A;  2CG9 A;  3VAD A;  4KQV A;  4O09 A;  2WI6 A;  1UYG A;  1YT2 A;  3SL2 A;  3HZ5 A;  3CGY A;  2XHX A;  4CWN A;  3DGE A;  5D7C A;  4NH8 A;  2ZDX A;  1EI1 A;  5F5R A;  1Y4U A;  3G7E A;  4H85 A;  2XX5 A;  3OWD A;  4H81 A;  4LWH A;  1QYE A;  5CTY A;  3QDD A;  2BU6 A;  4BXI A;  1NHH A;  3BMY A;  2YEB A;  3GIG B;  1UYK A;  1UYM A;  1S16 A;  4YKZ A;  2C1G A;  1AM1 A;  4AWO A;  4FCQ A;  5CPH A;  3TZ5 A;  4HYM A;  2O1U A;  3CRK A;  3U2K A;  3ZKB A;  2IOR A;  1F51 A;  2O1V A;  4YKY A;  4I3H A;  3G7B A;  1S14 A;  1UYL A;  1I58 A;  2YE8 A;  3VHD A;  3PEH A;  4V26 A;  2YK9 A;  1QY8 A;  4ASA A;  2VCI A;  4YKX A;  2VCJ A;  1UY7 A;  5FNC A;  1TID A;  2Q8I A;  3ZXO A;  3D36 A;  4YKW A;  1ZW9 A;  2YE5 A;  2BRE A;  3RLP A;  2WER A;  4XIR A;  5M4P A;  3D2R A;  4QPJ A;  2YE7 A;  3ZKD A;  2ZDY A;  5FND A;  3NMQ A;  3R92 A;  1ZWH A;  3TZ2 A;  3RLQ A;  1I5B A;  1A4H A;  2QFO A;  2K5B A;  4CWP A;  2IOQ A;  4CWR A;  3VHC A;  3T0H A;  4LWF A;  3R4N A;  4I5S A;  4PL9 A;  1THN A;  3C11 A;  1AMW A;  4E02 A;  2BU2 A;  3INX A;  2WI5 A;  5BOC A;  2CGF A;  2YE6 A;  2VWC A;  2YI0 A;  1Y4S A;  3R4M A;  3EHG A;  3HHU A;  1MU5 A;  2PNR A;  3QTF A;  4HXW A;  3A0X A;  3FT8 A;  4AS9 A;  2BU5 A;  1QZR A;  3LMM A;  3OW6 A;  4HYP A;  1GJV A;  1YC4 A;  1U2O A;  1YSZ A;  3LNU A;  4GFN A;  3CWV A;  1UY6 A;  4EFT A;  2XJJ A;  5CTU A;  3OPD A;  4O04 A;  2YEE A;  4CE3 A;  2YGE A;  3HYY A;  1I5A A;  1BKN A;  2YKE A;  4B6C A;  3WQ9 A;  1B3Q A;  2YGF A;  2GQP A;  4ASG A;  2YEJ A;  4ZKI A;  4E00 A;  2YE2 A;  2VW5 A;  2YEH A;  4R3A A;  2CCU A;  2H55 A;  2IWX A;  2YE4 A;  3B24 A;  3CGZ A;  4YKQ A;  5M4N A;  2E0A A;  2YKB A;  1AH6 A;  3TUH A;  4K4O A;  2XX2 A;  4GQT A;  2BU8 A;  4MP7 A;  3T0Z A;  2O1W A;  1TIL A;  2UWD A;  1ZXN A;  1Z5A A;  1US7 A;  1UYD A;  1IXM A;  3B26 A;  4KSG A;  4FCP A;  4EM7 A;  4WUD A;  3PEJ A;  1MX0 A;  2XDK A;  2XK2 A;  5M4K A;  5CTW A;  3U2D A;  4EEH A;  3VHA A;  4BIZ A;  2BYH A;  4BAE A;  4FCR A;  2QG0 A;  5M4M A;  2ZKJ A;  4XDM A;  4FPP A;  3HEK A;  1ID0 A;  3GIG A;  3A0R A;  1YSR A;  4AWQ A;  1YT0 A;  2EXL A;  2YEC A;  1Z5B A;  4CWS A;  4DUH A;  1Z5C A;  3R91 A;  4EGH A;  2YJX A;  1GKZ A;  2CCT A;  4MB9 A;  4URL A;  2QF6 A;  5F3K A;  3BM9 A;  2XDX A;  4XD8 A;  5CF0 A;  2YEG A;  3JZ3 A;  4WUB A;  2YE9 A;  1YS3 A;  4KFG A;  3GIF A;  4XC0 A;  1UYC A;  3H4L A;  4ASF A;  1TBW A;  4XKK A;  4L91 A;  4U93 A;  1H7S A;  2WI4 A;  4MPC A;  2YKC A;  3K99 A;  4XE2 A;  1Y8P A;  5C93 A;  1OSF A;  2XJG A;  2WI1 A;  4JAU A;  4XCL A;  4BQJ A;  1UYI A;  1BYQ A;  3RKZ A;  3EHJ A;  1B62 A;  2YI6 A;  3B28 A;  4PRV A;  4GCZ A;  2ZBK B;  4HY1 A;  4R1F A;  4L8Z A;  5D6Q A;  2YK2 A;  2YEF A;  2BTZ A;  1KZN A;  3K98 A;  2YJW A;  3B27 A;  4E72 A;  2XX4 A;  5D7D A;  1UYF A;  1YER A;  4O07 A;  2FYP A;  4EGK A;  3G75 A;  2C1I A;  2BU7 A;  4V25 A;  3IED A;  4PU9 A;  4B7P A;  2JJC A;  5IN9 A;  1PVG A;  3K97 A;  1B63 A;  4HXZ A;  4XKO A;  3LPS A; 
#chains in the Genus database with same CATH homology
 4YKR A;  1AJ6 A;  3T2S A;  1Z59 A;  2YGA A;  1TH8 A;  2IWU A;  4EGI A;  3Q5L A;  3TZ4 A;  2BRC A;  2GFD A;  4LWE A;  2HCH A;  1AH8 A;  1Y8O A;  4URM A;  4EMV A;  1YC1 A;  2ESA A;  4CWF A;  2Q8F A;  3OMU A;  1KIJ A;  1NHI A;  3C0E A;  2H8M A;  3KE6 A;  2XCM A;  4QPK A;  1Y8N A;  3O0I A;  4LWI A;  1YET A;  2AKP A;  2YEI A;  3FT5 A;  3A0Y A;  3T1K A;  4EFU A;  5L3J A;  3EKR A;  4CWO A;  5M4H A;  1UY9 A;  2YE3 A;  4XCJ A;  2HKJ A;  4L94 A;  4NH9 A;  5J71 A;  2FWZ A;  4XIP A;  2IWS A;  4MPE A;  5D6P A;  3EKO A;  2YED A;  3O2F A;  2FWY A;  3A0Z A;  4GT8 A;  1L0O A;  3TZ0 A;  4P7A A;  4X9L A;  5M4E A;  2IOP A;  4PRX A;  4ASB A;  4P8O A;  1JM6 A;  1EA6 A;  4MBC A;  4HZ5 A;  4KP4 A;  4U7N A;  1YES A;  1R62 A;  2C2A A;  4JAV A;  4XTJ A;  5D7R A;  4NH7 A;  4H7Q A;  2Q8H A;  2Q8G A;  3B25 A;  2XJX A;  4MPN A;  1YC3 A;  4GGL A;  4XIT A;  4HZ0 A;  4KTN A;  3A0T A;  3R4O A;  1H7U A;  4URN A;  2FXS A;  3CRL A;  4L93 A;  1BXD A;  4ZVI A;  4LP0 A;  2BSM A;  4YKU A;  3TTZ A;  5FWK A;  3EHH A;  4MOT A;  4Q20 A;  2YI5 A;  5BOD A;  2QG2 A;  4YKT A;  3T10 A;  3Q5K A;  2WI7 A;  2XHR A;  2XDL A;  2XDS A;  4WUC A;  4BIU A;  2WEP A;  3O6O A;  1NHJ A;  1UYE A;  4FMT A;  2BZ5 A;  3HZ1 A;  1TC6 A;  4XKA A;  3GIE A;  5IDM A;  3HYZ A;  3INW A;  2WI2 A;  4GEE A;  2BYI A;  1UYH A;  4KSH A;  3ZXQ A;  2CCS A;  3WHA A;  4O0B A;  3Q5J A;  4O05 A;  5J6A A;  4LPB A;  2HG1 A;  2YKJ A;  4JAS A;  4BQG A;  1YT1 A;  2JKI A;  1I59 A;  3D0B A;  3FV5 A;  1UY8 A;  4U7O A;  3U67 A;  2WI3 A;  4CWQ A;  5CTX A;  4W7T A;  4MP2 A;  1U0Z A;  4CE1 A;  2WEQ A;  1I5D A;  4LWG A;  4R3M A;  5IDJ A;  3OWB A;  2XAB A;  4CWT A;  3ZM7 A;  4JQL A;  5GGZ A;  2YEA A;  5FNF A;  1ZXM A;  3R4P A;  4URO A;  3EHF A;  3RLR A;  2BT0 A;  3H80 A;  3MNR P;  2YI7 A;  4XIQ A;  4E01 A;  2XD6 A;  1TC0 A;  4CE2 A;  4DZY A;  4L90 A;  2Q2E B;  2YKI A;  4HY6 A;  4AWP A;  1BGQ A;  1GKX A;  2CH4 A;  3A0W A;  1I5C A;  3K60 A;  2XDU A;  2XHT A;  2CG9 A;  3VAD A;  4KQV A;  4O09 A;  2WI6 A;  1UYG A;  1YT2 A;  3SL2 A;  3HZ5 A;  3CGY A;  2XHX A;  4CWN A;  3DGE A;  5D7C A;  4NH8 A;  2ZDX A;  1EI1 A;  5F5R A;  1Y4U A;  3G7E A;  4H85 A;  2XX5 A;  3OWD A;  4H81 A;  4LWH A;  1QYE A;  5CTY A;  3QDD A;  2BU6 A;  4BXI A;  1NHH A;  3BMY A;  2YEB A;  3GIG B;  1UYK A;  1UYM A;  1S16 A;  4YKZ A;  1AM1 A;  4AWO A;  4FCQ A;  5CPH A;  3TZ5 A;  4HYM A;  2O1U A;  3CRK A;  3U2K A;  3ZKB A;  2IOR A;  2O1V A;  4YKY A;  4I3H A;  3G7B A;  1S14 A;  1UYL A;  1I58 A;  2YE8 A;  3VHD A;  3PEH A;  4V26 A;  2YK9 A;  1QY8 A;  4ASA A;  2VCI A;  4YKX A;  2VCJ A;  1UY7 A;  5FNC A;  1TID A;  2Q8I A;  3ZXO A;  3D36 A;  4YKW A;  1ZW9 A;  2YE5 A;  2BRE A;  3RLP A;  2WER A;  4XIR A;  5M4P A;  3D2R A;  4QPJ A;  2YE7 A;  3ZKD A;  2ZDY A;  5FND A;  3NMQ A;  3R92 A;  1ZWH A;  3TZ2 A;  3RLQ A;  1I5B A;  1A4H A;  2QFO A;  2K5B A;  4CWP A;  2IOQ A;  4CWR A;  3VHC A;  3T0H A;  4LWF A;  3R4N A;  4I5S A;  4PL9 A;  1THN A;  3C11 A;  1AMW A;  4E02 A;  2BU2 A;  3INX A;  2WI5 A;  5BOC A;  2CGF A;  2YE6 A;  2VWC A;  2YI0 A;  1Y4S A;  3R4M A;  3EHG A;  3HHU A;  1MU5 A;  2PNR A;  3QTF A;  4HXW A;  3A0X A;  3FT8 A;  4AS9 A;  2BU5 A;  1QZR A;  3OW6 A;  4HYP A;  1GJV A;  1YC4 A;  1U2O A;  1YSZ A;  3LNU A;  4GFN A;  3CWV A;  1UY6 A;  4EFT A;  2XJJ A;  5CTU A;  3OPD A;  4O04 A;  2YEE A;  4CE3 A;  2YGE A;  3HYY A;  1I5A A;  1BKN A;  2YKE A;  4B6C A;  3WQ9 A;  1B3Q A;  2YGF A;  2GQP A;  4ASG A;  2YEJ A;  4ZKI A;  4E00 A;  2YE2 A;  2VW5 A;  2YEH A;  4R3A A;  2CCU A;  2H55 A;  2IWX A;  2YE4 A;  3B24 A;  3CGZ A;  4YKQ A;  5M4N A;  2E0A A;  2YKB A;  1AH6 A;  3TUH A;  4K4O A;  2XX2 A;  4GQT A;  2BU8 A;  4MP7 A;  3T0Z A;  2O1W A;  1TIL A;  2UWD A;  1ZXN A;  1Z5A A;  1US7 A;  1UYD A;  3B26 A;  4KSG A;  4FCP A;  4EM7 A;  4WUD A;  3PEJ A;  1MX0 A;  2XDK A;  2XK2 A;  5M4K A;  5CTW A;  3U2D A;  4EEH A;  3VHA A;  4BIZ A;  2BYH A;  4BAE A;  4FCR A;  2QG0 A;  5M4M A;  2ZKJ A;  4XDM A;  4FPP A;  3HEK A;  1ID0 A;  3GIG A;  3A0R A;  1YSR A;  4AWQ A;  1YT0 A;  2EXL A;  2YEC A;  1Z5B A;  4CWS A;  4DUH A;  1Z5C A;  3R91 A;  4EGH A;  2YJX A;  1GKZ A;  2CCT A;  4MB9 A;  4URL A;  2QF6 A;  5F3K A;  3BM9 A;  2XDX A;  4XD8 A;  5CF0 A;  2YEG A;  3JZ3 A;  4WUB A;  2YE9 A;  1YS3 A;  4KFG A;  3GIF A;  4XC0 A;  1UYC A;  3H4L A;  4ASF A;  1TBW A;  4XKK A;  4L91 A;  4U93 A;  1H7S A;  2WI4 A;  4MPC A;  2YKC A;  3K99 A;  4XE2 A;  1Y8P A;  5C93 A;  1OSF A;  2XJG A;  2WI1 A;  4JAU A;  4XCL A;  4BQJ A;  1UYI A;  1BYQ A;  3RKZ A;  3EHJ A;  1B62 A;  2YI6 A;  3B28 A;  4PRV A;  4GCZ A;  2ZBK B;  4HY1 A;  4R1F A;  4L8Z A;  5D6Q A;  2YK2 A;  2YEF A;  2BTZ A;  1KZN A;  3K98 A;  2YJW A;  3B27 A;  2XX4 A;  5D7D A;  1UYF A;  1YER A;  4O07 A;  2FYP A;  4EGK A;  3G75 A;  2BU7 A;  4V25 A;  3IED A;  4PU9 A;  4B7P A;  2JJC A;  5IN9 A;  1PVG A;  3K97 A;  1B63 A;  4HXZ A;  4XKO A;  3LPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...