3OPDA

Crystal structure of the n-terminal domain of an hsp90 from trypanosoma brucei, tb10.26.1080 in the presence of a benzamide derivative
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
208
Chain Sequence
GMTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQSVLGDEPHLRIRVIPDRVNKTLTVEDSGIGMTKADLVNNLGTIARSGTKSFMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVVSKNNEDDAYTWESSAGGTFTVTSTPDLKRGTRIVLHLKEDQQEYLEERRLKDLIKKHSEFIGYDIELMVEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the Trypanosoma brucei Hsp83 potential as a target for structure guided drug design.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Chaperone
molecule keywords Heat shock protein 83
total genus 67
structure length 208
sequence length 210
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3opdA00
2XCMA 1ZW9A 3T1KA 2YI5A 2WI5A 1NHHA 3HZ1A 1S14A 2Q8FA 4E02A 3BMYA 4JAUA 3B28A 4FCQA 3DGEA 2XJGA 3HZ5A 1GKZA 2XHRA 1UY9A 4CE2A 1BKNA 4HXWA 4W7TA 3A0YA 1Y8PA 1Z5CA 4O0BA 3T10A 4KFGA 4L8ZA 3INWA 1OSFA 4I5SA 1QYEA 2WI1A 3Q5KA 1UYKA 4BIZA 4HYMA 3G75A 4L90A 3HEKA 1YSRA 4R3MA 2CCUA 2IORA 3R4PA 4AWPA 1MX0A 4ASFA 3KE6A 3B25A 5IDMA 4KQVA 2IOPA 2O1WA 4DZYA 2XDKA 3Q5JA 4WUBA 4P7AA 2WEPA 4GT8A 5D7RA 1U2OA 3R4OA 2IWUA 4EGHA 1AH6A 1Y4UA 2BRCA 5L3JA 2XJJA 1ZXMA 2VCJA 4YKRA 2EXLA 3RKZA 3CRKA 1YC1A 1EA6A 1YETA 5F5RA 5CF0A 4H81A 4R1FA 1UYFA 2O1UA 4PRXA 4PL9A 1UYGA 2YEHA 1QY8A 4EFUA 1I5CA 5J6AA 2Q8GA 2XDUA 2YK2A 2HKJA 3U2DA 3HYZA 4X9LA 2VW5A 2WI3A 3IEDA 4NH9A 3K99A 3MNRP 1ID0A 4LWHA 4LWGA 4FPPA 4XITA 4CWOA 5CTUA 3D36A 3TZ0A 2FXSA 1GJVA 2YEDA 4LWFA 4GQTA 1TC0A 3CWVA 5D6PA 4HZ0A 1US7A 4P8OA 4MPNA 4PRVA 2XDLA 2YE2A 3ZKBA 1I58A 3ZXQA 3K98A 2K5BA 2AKPA 3H80A 4MOTA 4HXZA 4Q20A 3NMQA 3TUHA 3C0EA 2BREA 1I5AA 4EGKA 1Z5BA 1UYEA 2QG0A 2XJXA 4CE1A 1YT2A 1A4HA 5M4PA 3HYYA 2CH4A 3CRLA 2VWCA 5CTXA 4WUDA 1YT0A 4BIUA 2ESAA 2O1VA 4YKQA 2JKIA 4CWNA 5FNFA 3O0IA 4XIQA 1I59A 1NHIA 1I5BA 2XX5A 3U67A 4CWPA 3K97A 4XCLA 5M4EA 2YKBA 2YGEA 2YE3A 4HY6A 1MU5A 4XE2A 3INXA 1UYDA 3TZ4A 4KTNA 2BU6A 4YKTA 2YE8A 2BU8A 4FMTA 1I5DA 4ASBA 2YEFA 4KSGA 3RLPA 3A0WA 4B6CA 2FWZA 4YKYA 3GIGB 2GQPA 4XIRA 5GGZA 5F3KA 2JJCA 2QFOA 3EHGA 2ZBKB 3O6OA 3FV5A 1YT1A 2WI4A 1KZNA 5CPHA 2IOQA 2XX2A 4B7PA 4CE3A 1ZWHA 5M4HA 2YKEA 4E01A 4CWFA 2QG2A 4EEHA 2YKJA 3HHUA 4CWQA 4PU9A 2XHTA 4XD8A 3ZKDA 4O07A 5CTYA 3B24A 3EHFA 2FWYA 4HYPA 3T0ZA 3CGZA 4XC0A 4BQGA 2YKIA 3O2FA 2IWSA 3OWDA 3U2KA 2XX4A 4MPCA 3R92A 5D6QA 4L93A 4L91A 2YI7A 3EKOA 4MBCA 3JZ3A 1YERA 4XKKA 4XKAA 5IN9A 2Q8IA 4BXIA 3GIFA 3OW6A 2PNRA 3D2RA 2YE7A 4V25A 2GFDA 1UYCA 2Q8HA 1TILA 1Y8OA 3PEJA 4DUHA 4LP0A 4E00A 3CGYA 4L94A 1L0OA 5D7DA 3LNUA 1BGQA 1TC6A 2YEEA 3VADA 4U7NA 4CWTA 2YE4A 2BU2A 5C93A 4CWSA 2HG1A 1JM6A 2XDSA 4HZ5A 3OWBA 2YEIA 2YI0A 3EHJA 3BM9A 2C2AA 1PVGA 4ZKIA 3GIGA 4O04A 3QDDA 1B62A 1YSZA 3TTZA 2ZDXA 3GIEA 4KSHA 2XK2A 2CGFA 1UYMA 2CG9A 4U93A 3EKRA 1YC3A 2YJWA 3R4MA 5FNDA 3R4NA 3A0ZA 3WHAA 4FCPA 4XIPA 2YEJA 2HCHA 4XTJA 1NHJA 4GGLA 1BYQA 3A0RA 2WEQA 2BSMA 4K4OA 2WERA 1GKXA 4URMA 1BXDA 4AS9A 4NH8A 5BODA 5FWKA 3OPDA 3SL2A 1AMWA 4FCRA 4NH7A 3PEHA 4KP4A 2XDXA 1EI1A 2BYHA 2YECA 1THNA 4LWIA 5IDJA 4URNA 2FYPA 3T0HA 1H7UA 4MP2A 2CCSA 2YKCA 1B63A 1AM1A 3A0XA 3LPSA 1Z5AA 2XHXA 2BTZA 1KIJA 3QTFA 1YS3A 2BU7A 3A0TA 4MP7A 1TBWA 1ZXNA 4GEEA 2Q2EB 3B26A 2E0AA 3FT8A 5M4NA 2YE6A 1H7SA 1UY8A 2H55A 1UYIA 2ZDYA 4U7OA 2ZKJA 5CTWA 3T2SA 1TIDA 4CWRA 5J71A 4QPKA 3WQ9A 4MPEA 4XKOA 3TZ5A 5M4KA 3ZXOA 3TZ2A 2YGFA 4AWOA 1YC4A 2YEAA 2YK9A 4R3AA 4URLA 4LWEA 4AWQA 1QZRA 4O05A 3G7EA 2WI2A 2YI6A 4YKXA 3VHAA 4YKZA 2YEGA 4EFTA 1UY6A 2YJXA 4EM7A 4GCZA 4H7QA 1UYLA 2CCTA 3D0BA 4GFNA 5BOCA 1UYHA 3H4LA 2WI7A 4JQLA 2YEBA 2YE5A 4H85A 2XABA 4JASA 2BU5A 1U0ZA 1Z59A 4MB9A 2UWDA 4O09A 3R91A 4BAEA 4ASGA 2IWXA 4JAVA 4WUCA 2H8MA 1AJ6A 4QPJA 3B27A 2XD6A 3EHHA 4XCJA 4V26A 3VHCA 2BYIA 3RLQA 4EMVA 4ZVIA 1AH8A 1UY7A 4BQJA 3ZM7A 4HY1A 4YKUA 3VHDA 1R62A 2QF6A 4XDMA 2VCIA 2YGAA 4LPBA 1Y4SA 2YE9A 3G7BA 3C11A 3Q5LA 3K60A 1Y8NA 5D7CA 1S16A 4ASAA 1B3QA 3OMUA 3FT5A 4UROA 5M4MA 2WI6A 5FNCA 2BT0A 4EGIA 4I3HA 1YESA 2BZ5A 4YKWA 3RLRA 1TH8A
chains in the Genus database with same CATH superfamily
2XCMA 1ZW9A 3T1KA 2YI5A 2WI5A 1NHHA 3HZ1A 1S14A 2Q8FA 4E02A 3BMYA 3LMMA 4JAUA 3B28A 4FCQA 3DGEA 2XJGA 3HZ5A 1GKZA 2XHRA 1UY9A 4CE2A 1BKNA 4HXWA 4W7TA 3A0YA 1Y8PA 1Z5CA 4O0BA 3T10A 4KFGA 4L8ZA 3INWA 1OSFA 4I5SA 1QYEA 2WI1A 3Q5KA 1UYKA 4BIZA 4HYMA 3G75A 4L90A 3HEKA 1YSRA 4R3MA 2CCUA 2IORA 3R4PA 4AWPA 1MX0A 4ASFA 3KE6A 3B25A 5IDMA 4KQVA 2IOPA 2O1WA 4DZYA 2XDKA 3Q5JA 4WUBA 4P7AA 2WEPA 4GT8A 5D7RA 1U2OA 3R4OA 1F51A 2IWUA 4EGHA 1AH6A 1Y4UA 2BRCA 5L3JA 2XJJA 1ZXMA 2VCJA 4YKRA 2EXLA 3RKZA 3CRKA 1YC1A 1EA6A 1YETA 5F5RA 5CF0A 4H81A 4R1FA 2C1GA 1UYFA 2O1UA 4PRXA 4PL9A 1UYGA 2YEHA 1QY8A 4EFUA 1I5CA 5J6AA 2Q8GA 2XDUA 2YK2A 2HKJA 3U2DA 3HYZA 4X9LA 2VW5A 2WI3A 3IEDA 4NH9A 3K99A 3MNRP 1ID0A 4LWHA 4LWGA 4FPPA 4XITA 4CWOA 5CTUA 3D36A 3TZ0A 2FXSA 1GJVA 2YEDA 4LWFA 4GQTA 1TC0A 3CWVA 5D6PA 4HZ0A 1US7A 4P8OA 4MPNA 4PRVA 1IXMA 2XDLA 2YE2A 3ZKBA 1I58A 3ZXQA 3K98A 2K5BA 2AKPA 3H80A 4MOTA 4HXZA 4Q20A 3NMQA 3TUHA 3C0EA 2BREA 1I5AA 4EGKA 1Z5BA 1UYEA 2QG0A 2XJXA 4CE1A 1YT2A 1A4HA 5M4PA 3HYYA 2CH4A 3CRLA 2VWCA 5CTXA 4WUDA 1YT0A 4BIUA 2ESAA 2O1VA 4YKQA 2JKIA 4CWNA 5FNFA 3O0IA 4XIQA 1I59A 1NHIA 1I5BA 2XX5A 3U67A 4CWPA 3K97A 4XCLA 5M4EA 2YKBA 2YGEA 2YE3A 4HY6A 1MU5A 4XE2A 3INXA 1UYDA 3TZ4A 4KTNA 2BU6A 4YKTA 2YE8A 2BU8A 4FMTA 1I5DA 4ASBA 2YEFA 4KSGA 3RLPA 3A0WA 4B6CA 2FWZA 4YKYA 3GIGB 2GQPA 4XIRA 5GGZA 5F3KA 2JJCA 2QFOA 3EHGA 2ZBKB 3O6OA 3FV5A 1YT1A 2WI4A 1KZNA 5CPHA 2IOQA 2XX2A 4B7PA 4CE3A 1ZWHA 5M4HA 2YKEA 4E01A 4CWFA 2QG2A 4EEHA 2YKJA 3HHUA 4CWQA 4PU9A 2XHTA 4XD8A 3ZKDA 4O07A 5CTYA 3B24A 3EHFA 2FWYA 5JENA 4HYPA 3T0ZA 3CGZA 4XC0A 4BQGA 2YKIA 3O2FA 2IWSA 3OWDA 3U2KA 2XX4A 4MPCA 3R92A 5D6QA 4L93A 4L91A 2YI7A 3EKOA 4MBCA 3JZ3A 3S5TA 1YERA 4XKKA 4XKAA 5IN9A 2Q8IA 4BXIA 3GIFA 3OW6A 2PNRA 3D2RA 2YE7A 4V25A 2GFDA 1UYCA 2Q8HA 1TILA 1Y8OA 3PEJA 4DUHA 4LP0A 4E00A 3CGYA 4L94A 1L0OA 5D7DA 3LNUA 1BGQA 1TC6A 2YEEA 3VADA 4U7NA 4CWTA 2YE4A 4E72A 2BU2A 5C93A 4CWSA 2HG1A 1JM6A 2XDSA 4HZ5A 3OWBA 2YEIA 2YI0A 3EHJA 3BM9A 2C2AA 1PVGA 4ZKIA 3GIGA 4O04A 2HHIA 3QDDA 1B62A 1YSZA 3TTZA 2ZDXA 3GIEA 4KSHA 2XK2A 2CGFA 1UYMA 2CG9A 4U93A 3EKRA 1YC3A 2YJWA 3R4MA 5FNDA 3R4NA 3A0ZA 3WHAA 4FCPA 4XIPA 2YEJA 2HCHA 4XTJA 1NHJA 4GGLA 1BYQA 3A0RA 2WEQA 2BSMA 4K4OA 2WERA 1GKXA 4URMA 1BXDA 4AS9A 4NH8A 5BODA 5FWKA 3OPDA 3SL2A 1AMWA 4FCRA 4NH7A 3PEHA 4KP4A 2XDXA 1EI1A 2BYHA 2YECA 1THNA 4LWIA 5IDJA 4URNA 2FYPA 3T0HA 1H7UA 4MP2A 2CCSA 2YKCA 1B63A 1AM1A 3A0XA 3LPSA 1Z5AA 2XHXA 2BTZA 1KIJA 3QTFA 1YS3A 2BU7A 3A0TA 4MP7A 1TBWA 1ZXNA 4GEEA 2Q2EB 3B26A 2E0AA 3FT8A 5M4NA 2YE6A 1H7SA 1UY8A 2H55A 1UYIA 2ZDYA 4U7OA 2ZKJA 5CTWA 3T2SA 1TIDA 4CWRA 5J71A 4QPKA 2C1IA 3WQ9A 4MPEA 4XKOA 3TZ5A 5M4KA 3ZXOA 3TZ2A 2YGFA 4AWOA 1YC4A 2YEAA 2YK9A 4R3AA 4URLA 4LWEA 4AWQA 1QZRA 4O05A 3G7EA 2WI2A 2YI6A 4YKXA 3VHAA 4YKZA 2YEGA 4EFTA 1UY6A 2YJXA 4EM7A 4GCZA 4H7QA 1UYLA 2CCTA 3D0BA 4GFNA 5BOCA 1UYHA 3H4LA 2WI7A 4JQLA 2YEBA 2YE5A 4H85A 2XABA 4JASA 2BU5A 1U0ZA 1Z59A 4MB9A 2UWDA 4O09A 3R91A 4BAEA 4ASGA 2IWXA 4JAVA 4WUCA 2H8MA 1AJ6A 4QPJA 3B27A 2XD6A 3EHHA 4XCJA 4V26A 3VHCA 2BYIA 3RLQA 4EMVA 4ZVIA 1AH8A 1UY7A 4BQJA 3ZM7A 4HY1A 4YKUA 3VHDA 1R62A 2QF6A 4XDMA 2VCIA 2YGAA 4LPBA 1Y4SA 2YE9A 3G7BA 3C11A 3Q5LA 3K60A 1Y8NA 2FTKA 5D7CA 1S16A 4ASAA 1B3QA 3OMUA 3FT5A 4UROA 5M4MA 2WI6A 5FNCA 2BT0A 4EGIA 4I3HA 1YESA 2BZ5A 3CYGA 4YKWA 3RLRA 1TH8A
chains in the Genus database with same CATH topology
2XCMA 1ZW9A 3T1KA 2YI5A 2WI5A 1NHHA 3HZ1A 1S14A 2Q8FA 4E02A 3BMYA 4JAUA 3B28A 4FCQA 3DGEA 2XJGA 3HZ5A 1GKZA 2XHRA 1UY9A 4CE2A 1BKNA 4HXWA 4W7TA 3A0YA 1Y8PA 1Z5CA 4O0BA 3T10A 4KFGA 4L8ZA 3INWA 1OSFA 4I5SA 1QYEA 2WI1A 3Q5KA 1UYKA 4BIZA 4HYMA 3G75A 4L90A 3HEKA 1YSRA 4R3MA 2CCUA 2IORA 3R4PA 4AWPA 1MX0A 4ASFA 3KE6A 3B25A 5IDMA 4KQVA 2IOPA 2O1WA 4DZYA 2XDKA 3Q5JA 4WUBA 4P7AA 2WEPA 4GT8A 5D7RA 1U2OA 3R4OA 2IWUA 4EGHA 1AH6A 1Y4UA 2BRCA 5L3JA 2XJJA 1ZXMA 2VCJA 4YKRA 2EXLA 3RKZA 3CRKA 1YC1A 1EA6A 1YETA 5F5RA 5CF0A 4H81A 4R1FA 1UYFA 2O1UA 4PRXA 4PL9A 1UYGA 2YEHA 1QY8A 4EFUA 1I5CA 5J6AA 2Q8GA 2XDUA 2YK2A 2HKJA 3U2DA 3HYZA 4X9LA 2VW5A 2WI3A 3IEDA 4NH9A 3K99A 3MNRP 1ID0A 4LWHA 4LWGA 4FPPA 4XITA 4CWOA 5CTUA 3D36A 3TZ0A 2FXSA 1GJVA 2YEDA 4LWFA 4GQTA 1TC0A 3CWVA 5D6PA 4HZ0A 1US7A 4P8OA 4MPNA 4PRVA 2XDLA 2YE2A 3ZKBA 1I58A 3ZXQA 3K98A 2K5BA 2AKPA 3H80A 4MOTA 4HXZA 4Q20A 3NMQA 3TUHA 3C0EA 2BREA 1I5AA 4EGKA 1Z5BA 1UYEA 2QG0A 2XJXA 4CE1A 1YT2A 1A4HA 5M4PA 3HYYA 2CH4A 3CRLA 2VWCA 5CTXA 4WUDA 1YT0A 4BIUA 2ESAA 2O1VA 4YKQA 2JKIA 4CWNA 5FNFA 3O0IA 4XIQA 1I59A 1NHIA 1I5BA 2XX5A 3U67A 4CWPA 3K97A 4XCLA 5M4EA 2YKBA 2YGEA 2YE3A 4HY6A 1MU5A 4XE2A 3INXA 1UYDA 3TZ4A 4KTNA 2BU6A 4YKTA 2YE8A 2BU8A 4FMTA 1I5DA 4ASBA 2YEFA 4KSGA 3RLPA 3A0WA 4B6CA 2FWZA 4YKYA 3GIGB 2GQPA 4XIRA 5GGZA 5F3KA 2JJCA 2QFOA 3EHGA 2ZBKB 3O6OA 3FV5A 1YT1A 2WI4A 1KZNA 5CPHA 2IOQA 2XX2A 4B7PA 4CE3A 1ZWHA 5M4HA 2YKEA 4E01A 4CWFA 2QG2A 4EEHA 2YKJA 3HHUA 4CWQA 4PU9A 2XHTA 4XD8A 3ZKDA 4O07A 5CTYA 3B24A 3EHFA 2FWYA 4HYPA 3T0ZA 3CGZA 4XC0A 4BQGA 2YKIA 3O2FA 2IWSA 3OWDA 3U2KA 2XX4A 4MPCA 3R92A 5D6QA 4L93A 4L91A 2YI7A 3EKOA 4MBCA 3JZ3A 1YERA 4XKKA 4XKAA 5IN9A 2Q8IA 4BXIA 3GIFA 3OW6A 2PNRA 3D2RA 2YE7A 4V25A 2GFDA 1UYCA 2Q8HA 1TILA 1Y8OA 3PEJA 4DUHA 4LP0A 4E00A 3CGYA 4L94A 1L0OA 5D7DA 3LNUA 1BGQA 1TC6A 2YEEA 3VADA 4U7NA 4CWTA 2YE4A 2BU2A 5C93A 4CWSA 2HG1A 1JM6A 2XDSA 4HZ5A 3OWBA 2YEIA 2YI0A 3EHJA 3BM9A 2C2AA 1PVGA 4ZKIA 3GIGA 4O04A 3QDDA 1B62A 1YSZA 3TTZA 2ZDXA 3GIEA 4KSHA 2XK2A 2CGFA 1UYMA 2CG9A 4U93A 3EKRA 1YC3A 2YJWA 3R4MA 5FNDA 3R4NA 3A0ZA 3WHAA 4FCPA 4XIPA 2YEJA 2HCHA 4XTJA 1NHJA 4GGLA 1BYQA 3A0RA 2WEQA 2BSMA 4K4OA 2WERA 1GKXA 4URMA 1BXDA 4AS9A 4NH8A 5BODA 5FWKA 3OPDA 3SL2A 1AMWA 4FCRA 4NH7A 3PEHA 4KP4A 2XDXA 1EI1A 2BYHA 2YECA 1THNA 4LWIA 5IDJA 4URNA 2FYPA 3T0HA 1H7UA 4MP2A 2CCSA 2YKCA 1B63A 1AM1A 3A0XA 3LPSA 1Z5AA 2XHXA 2BTZA 1KIJA 3QTFA 1YS3A 2BU7A 3A0TA 4MP7A 1TBWA 1ZXNA 4GEEA 2Q2EB 3B26A 2E0AA 3FT8A 5M4NA 2YE6A 1H7SA 1UY8A 2H55A 1UYIA 2ZDYA 4U7OA 2ZKJA 5CTWA 3T2SA 1TIDA 4CWRA 5J71A 4QPKA 3WQ9A 4MPEA 4XKOA 3TZ5A 5M4KA 3ZXOA 3TZ2A 2YGFA 4AWOA 1YC4A 2YEAA 2YK9A 4R3AA 4URLA 4LWEA 4AWQA 1QZRA 4O05A 3G7EA 2WI2A 2YI6A 4YKXA 3VHAA 4YKZA 2YEGA 4EFTA 1UY6A 2YJXA 4EM7A 4GCZA 4H7QA 1UYLA 2CCTA 3D0BA 4GFNA 5BOCA 1UYHA 3H4LA 2WI7A 4JQLA 2YEBA 2YE5A 4H85A 2XABA 4JASA 2BU5A 1U0ZA 1Z59A 4MB9A 2UWDA 4O09A 3R91A 4BAEA 4ASGA 2IWXA 4JAVA 4WUCA 2H8MA 1AJ6A 4QPJA 3B27A 2XD6A 3EHHA 4XCJA 4V26A 3VHCA 2BYIA 3RLQA 4EMVA 4ZVIA 1AH8A 1UY7A 4BQJA 3ZM7A 4HY1A 4YKUA 3VHDA 1R62A 2QF6A 4XDMA 2VCIA 2YGAA 4LPBA 1Y4SA 2YE9A 3G7BA 3C11A 3Q5LA 3K60A 1Y8NA 5D7CA 1S16A 4ASAA 1B3QA 3OMUA 3FT5A 4UROA 5M4MA 2WI6A 5FNCA 2BT0A 4EGIA 4I3HA 1YESA 2BZ5A 4YKWA 3RLRA 1TH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XCM A;  1ZW9 A;  3T1K A;  2YI5 A;  2WI5 A;  1NHH A;  3HZ1 A;  1S14 A;  2Q8F A;  4E02 A;  3BMY A;  4JAU A;  3B28 A;  4FCQ A;  3DGE A;  2XJG A;  3HZ5 A;  1GKZ A;  2XHR A;  1UY9 A;  4CE2 A;  1BKN A;  4HXW A;  4W7T A;  3A0Y A;  1Y8P A;  1Z5C A;  4O0B A;  3T10 A;  4KFG A;  4L8Z A;  3INW A;  1OSF A;  4I5S A;  1QYE A;  2WI1 A;  3Q5K A;  1UYK A;  4BIZ A;  4HYM A;  3G75 A;  4L90 A;  3HEK A;  1YSR A;  4R3M A;  2CCU A;  2IOR A;  3R4P A;  4AWP A;  1MX0 A;  4ASF A;  3KE6 A;  3B25 A;  5IDM A;  4KQV A;  2IOP A;  2O1W A;  4DZY A;  2XDK A;  3Q5J A;  4WUB A;  4P7A A;  2WEP A;  4GT8 A;  5D7R A;  1U2O A;  3R4O A;  2IWU A;  4EGH A;  1AH6 A;  1Y4U A;  2BRC A;  5L3J A;  2XJJ A;  1ZXM A;  2VCJ A;  4YKR A;  2EXL A;  3RKZ A;  3CRK A;  1YC1 A;  1EA6 A;  1YET A;  5F5R A;  5CF0 A;  4H81 A;  4R1F A;  1UYF A;  2O1U A;  4PRX A;  4PL9 A;  1UYG A;  2YEH A;  1QY8 A;  4EFU A;  1I5C A;  5J6A A;  2Q8G A;  2XDU A;  2YK2 A;  2HKJ A;  3U2D A;  3HYZ A;  4X9L A;  2VW5 A;  2WI3 A;  3IED A;  4NH9 A;  3K99 A;  3MNR P;  1ID0 A;  4LWH A;  4LWG A;  4FPP A;  4XIT A;  4CWO A;  5CTU A;  3D36 A;  3TZ0 A;  2FXS A;  1GJV A;  2YED A;  4LWF A;  4GQT A;  1TC0 A;  3CWV A;  5D6P A;  4HZ0 A;  1US7 A;  4P8O A;  4MPN A;  4PRV A;  2XDL A;  2YE2 A;  3ZKB A;  1I58 A;  3ZXQ A;  3K98 A;  2K5B A;  2AKP A;  3H80 A;  4MOT A;  4HXZ A;  4Q20 A;  3NMQ A;  3TUH A;  3C0E A;  2BRE A;  1I5A A;  4EGK A;  1Z5B A;  1UYE A;  2QG0 A;  2XJX A;  4CE1 A;  1YT2 A;  1A4H A;  5M4P A;  3HYY A;  2CH4 A;  3CRL A;  2VWC A;  5CTX A;  4WUD A;  1YT0 A;  4BIU A;  2ESA A;  2O1V A;  4YKQ A;  2JKI A;  4CWN A;  5FNF A;  3O0I A;  4XIQ A;  1I59 A;  1NHI A;  1I5B A;  2XX5 A;  3U67 A;  4CWP A;  3K97 A;  4XCL A;  5M4E A;  2YKB A;  2YGE A;  2YE3 A;  4HY6 A;  1MU5 A;  4XE2 A;  3INX A;  1UYD A;  3TZ4 A;  4KTN A;  2BU6 A;  4YKT A;  2YE8 A;  2BU8 A;  4FMT A;  1I5D A;  4ASB A;  2YEF A;  4KSG A;  3RLP A;  3A0W A;  4B6C A;  2FWZ A;  4YKY A;  3GIG B;  2GQP A;  4XIR A;  5GGZ A;  5F3K A;  2JJC A;  2QFO A;  3EHG A;  2ZBK B;  3O6O A;  3FV5 A;  1YT1 A;  2WI4 A;  1KZN A;  5CPH A;  2IOQ A;  2XX2 A;  4B7P A;  4CE3 A;  1ZWH A;  5M4H A;  2YKE A;  4E01 A;  4CWF A;  2QG2 A;  4EEH A;  2YKJ A;  3HHU A;  4CWQ A;  4PU9 A;  2XHT A;  4XD8 A;  3ZKD A;  4O07 A;  5CTY A;  3B24 A;  3EHF A;  2FWY A;  4HYP A;  3T0Z A;  3CGZ A;  4XC0 A;  4BQG A;  2YKI A;  3O2F A;  2IWS A;  3OWD A;  3U2K A;  2XX4 A;  4MPC A;  3R92 A;  5D6Q A;  4L93 A;  4L91 A;  2YI7 A;  3EKO A;  4MBC A;  3JZ3 A;  1YER A;  4XKK A;  4XKA A;  5IN9 A;  2Q8I A;  4BXI A;  3GIF A;  3OW6 A;  2PNR A;  3D2R A;  2YE7 A;  4V25 A;  2GFD A;  1UYC A;  2Q8H A;  1TIL A;  1Y8O A;  3PEJ A;  4DUH A;  4LP0 A;  4E00 A;  3CGY A;  4L94 A;  1L0O A;  5D7D A;  3LNU A;  1BGQ A;  1TC6 A;  2YEE A;  3VAD A;  4U7N A;  4CWT A;  2YE4 A;  2BU2 A;  5C93 A;  4CWS A;  2HG1 A;  1JM6 A;  2XDS A;  4HZ5 A;  3OWB A;  2YEI A;  2YI0 A;  3EHJ A;  3BM9 A;  2C2A A;  1PVG A;  4ZKI A;  3GIG A;  4O04 A;  3QDD A;  1B62 A;  1YSZ A;  3TTZ A;  2ZDX A;  3GIE A;  4KSH A;  2XK2 A;  2CGF A;  1UYM A;  2CG9 A;  4U93 A;  3EKR A;  1YC3 A;  2YJW A;  3R4M A;  5FND A;  3R4N A;  3A0Z A;  3WHA A;  4FCP A;  4XIP A;  2YEJ A;  2HCH A;  4XTJ A;  1NHJ A;  4GGL A;  1BYQ A;  3A0R A;  2WEQ A;  2BSM A;  4K4O A;  2WER A;  1GKX A;  4URM A;  1BXD A;  4AS9 A;  4NH8 A;  5BOD A;  5FWK A;  3OPD A;  3SL2 A;  1AMW A;  4FCR A;  4NH7 A;  3PEH A;  4KP4 A;  2XDX A;  1EI1 A;  2BYH A;  2YEC A;  1THN A;  4LWI A;  5IDJ A;  4URN A;  2FYP A;  3T0H A;  1H7U A;  4MP2 A;  2CCS A;  2YKC A;  1B63 A;  1AM1 A;  3A0X A;  3LPS A;  1Z5A A;  2XHX A;  2BTZ A;  1KIJ A;  3QTF A;  1YS3 A;  2BU7 A;  3A0T A;  4MP7 A;  1TBW A;  1ZXN A;  4GEE A;  2Q2E B;  3B26 A;  2E0A A;  3FT8 A;  5M4N A;  2YE6 A;  1H7S A;  1UY8 A;  2H55 A;  1UYI A;  2ZDY A;  4U7O A;  2ZKJ A;  5CTW A;  3T2S A;  1TID A;  4CWR A;  5J71 A;  4QPK A;  3WQ9 A;  4MPE A;  4XKO A;  3TZ5 A;  5M4K A;  3ZXO A;  3TZ2 A;  2YGF A;  4AWO A;  1YC4 A;  2YEA A;  2YK9 A;  4R3A A;  4URL A;  4LWE A;  4AWQ A;  1QZR A;  4O05 A;  3G7E A;  2WI2 A;  2YI6 A;  4YKX A;  3VHA A;  4YKZ A;  2YEG A;  4EFT A;  1UY6 A;  2YJX A;  4EM7 A;  4GCZ A;  4H7Q A;  1UYL A;  2CCT A;  3D0B A;  4GFN A;  5BOC A;  1UYH A;  3H4L A;  2WI7 A;  4JQL A;  2YEB A;  2YE5 A;  4H85 A;  2XAB A;  4JAS A;  2BU5 A;  1U0Z A;  1Z59 A;  4MB9 A;  2UWD A;  4O09 A;  3R91 A;  4BAE A;  4ASG A;  2IWX A;  4JAV A;  4WUC A;  2H8M A;  1AJ6 A;  4QPJ A;  3B27 A;  2XD6 A;  3EHH A;  4XCJ A;  4V26 A;  3VHC A;  2BYI A;  3RLQ A;  4EMV A;  4ZVI A;  1AH8 A;  1UY7 A;  4BQJ A;  3ZM7 A;  4HY1 A;  4YKU A;  3VHD A;  1R62 A;  2QF6 A;  4XDM A;  2VCI A;  2YGA A;  4LPB A;  1Y4S A;  2YE9 A;  3G7B A;  3C11 A;  3Q5L A;  3K60 A;  1Y8N A;  5D7C A;  1S16 A;  4ASA A;  1B3Q A;  3OMU A;  3FT5 A;  4URO A;  5M4M A;  2WI6 A;  5FNC A;  2BT0 A;  4EGI A;  4I3H A;  1YES A;  2BZ5 A;  4YKW A;  3RLR A;  1TH8 A; 
#chains in the Genus database with same CATH topology
 2XCM A;  1ZW9 A;  3T1K A;  2YI5 A;  2WI5 A;  1NHH A;  3HZ1 A;  1S14 A;  2Q8F A;  4E02 A;  3BMY A;  3LMM A;  4JAU A;  3B28 A;  4FCQ A;  3DGE A;  2XJG A;  3HZ5 A;  1GKZ A;  2XHR A;  1UY9 A;  4CE2 A;  1BKN A;  4HXW A;  4W7T A;  3A0Y A;  1Y8P A;  1Z5C A;  4O0B A;  3T10 A;  4KFG A;  4L8Z A;  3INW A;  1OSF A;  4I5S A;  1QYE A;  2WI1 A;  3Q5K A;  1UYK A;  4BIZ A;  4HYM A;  3G75 A;  4L90 A;  3HEK A;  1YSR A;  4R3M A;  2CCU A;  2IOR A;  3R4P A;  4AWP A;  1MX0 A;  4ASF A;  3KE6 A;  3B25 A;  5IDM A;  4KQV A;  2IOP A;  2O1W A;  4DZY A;  2XDK A;  3Q5J A;  4WUB A;  4P7A A;  2WEP A;  4GT8 A;  5D7R A;  1U2O A;  3R4O A;  1F51 A;  2IWU A;  4EGH A;  1AH6 A;  1Y4U A;  2BRC A;  5L3J A;  2XJJ A;  1ZXM A;  2VCJ A;  4YKR A;  2EXL A;  3RKZ A;  3CRK A;  1YC1 A;  1EA6 A;  1YET A;  5F5R A;  5CF0 A;  4H81 A;  4R1F A;  2C1G A;  1UYF A;  2O1U A;  4PRX A;  4PL9 A;  1UYG A;  2YEH A;  1QY8 A;  4EFU A;  1I5C A;  5J6A A;  2Q8G A;  2XDU A;  2YK2 A;  2HKJ A;  3U2D A;  3HYZ A;  4X9L A;  2VW5 A;  2WI3 A;  3IED A;  4NH9 A;  3K99 A;  3MNR P;  1ID0 A;  4LWH A;  4LWG A;  4FPP A;  4XIT A;  4CWO A;  5CTU A;  3D36 A;  3TZ0 A;  2FXS A;  1GJV A;  2YED A;  4LWF A;  4GQT A;  1TC0 A;  3CWV A;  5D6P A;  4HZ0 A;  1US7 A;  4P8O A;  4MPN A;  4PRV A;  1IXM A;  2XDL A;  2YE2 A;  3ZKB A;  1I58 A;  3ZXQ A;  3K98 A;  2K5B A;  2AKP A;  3H80 A;  4MOT A;  4HXZ A;  4Q20 A;  3NMQ A;  3TUH A;  3C0E A;  2BRE A;  1I5A A;  4EGK A;  1Z5B A;  1UYE A;  2QG0 A;  2XJX A;  4CE1 A;  1YT2 A;  1A4H A;  5M4P A;  3HYY A;  2CH4 A;  3CRL A;  2VWC A;  5CTX A;  4WUD A;  1YT0 A;  4BIU A;  2ESA A;  2O1V A;  4YKQ A;  2JKI A;  4CWN A;  5FNF A;  3O0I A;  4XIQ A;  1I59 A;  1NHI A;  1I5B A;  2XX5 A;  3U67 A;  4CWP A;  3K97 A;  4XCL A;  5M4E A;  2YKB A;  2YGE A;  2YE3 A;  4HY6 A;  1MU5 A;  4XE2 A;  3INX A;  1UYD A;  3TZ4 A;  4KTN A;  2BU6 A;  4YKT A;  2YE8 A;  2BU8 A;  4FMT A;  1I5D A;  4ASB A;  2YEF A;  4KSG A;  3RLP A;  3A0W A;  4B6C A;  2FWZ A;  4YKY A;  3GIG B;  2GQP A;  4XIR A;  5GGZ A;  5F3K A;  2JJC A;  2QFO A;  3EHG A;  2ZBK B;  3O6O A;  3FV5 A;  1YT1 A;  2WI4 A;  1KZN A;  5CPH A;  2IOQ A;  2XX2 A;  4B7P A;  4CE3 A;  1ZWH A;  5M4H A;  2YKE A;  4E01 A;  4CWF A;  2QG2 A;  4EEH A;  2YKJ A;  3HHU A;  4CWQ A;  4PU9 A;  2XHT A;  4XD8 A;  3ZKD A;  4O07 A;  5CTY A;  3B24 A;  3EHF A;  2FWY A;  5JEN A;  4HYP A;  3T0Z A;  3CGZ A;  4XC0 A;  4BQG A;  2YKI A;  3O2F A;  2IWS A;  3OWD A;  3U2K A;  2XX4 A;  4MPC A;  3R92 A;  5D6Q A;  4L93 A;  4L91 A;  2YI7 A;  3EKO A;  4MBC A;  3JZ3 A;  3S5T A;  1YER A;  4XKK A;  4XKA A;  5IN9 A;  2Q8I A;  4BXI A;  3GIF A;  3OW6 A;  2PNR A;  3D2R A;  2YE7 A;  4V25 A;  2GFD A;  1UYC A;  2Q8H A;  1TIL A;  1Y8O A;  3PEJ A;  4DUH A;  4LP0 A;  4E00 A;  3CGY A;  4L94 A;  1L0O A;  5D7D A;  3LNU A;  1BGQ A;  1TC6 A;  2YEE A;  3VAD A;  4U7N A;  4CWT A;  2YE4 A;  4E72 A;  2BU2 A;  5C93 A;  4CWS A;  2HG1 A;  1JM6 A;  2XDS A;  4HZ5 A;  3OWB A;  2YEI A;  2YI0 A;  3EHJ A;  3BM9 A;  2C2A A;  1PVG A;  4ZKI A;  3GIG A;  4O04 A;  2HHI A;  3QDD A;  1B62 A;  1YSZ A;  3TTZ A;  2ZDX A;  3GIE A;  4KSH A;  2XK2 A;  2CGF A;  1UYM A;  2CG9 A;  4U93 A;  3EKR A;  1YC3 A;  2YJW A;  3R4M A;  5FND A;  3R4N A;  3A0Z A;  3WHA A;  4FCP A;  4XIP A;  2YEJ A;  2HCH A;  4XTJ A;  1NHJ A;  4GGL A;  1BYQ A;  3A0R A;  2WEQ A;  2BSM A;  4K4O A;  2WER A;  1GKX A;  4URM A;  1BXD A;  4AS9 A;  4NH8 A;  5BOD A;  5FWK A;  3OPD A;  3SL2 A;  1AMW A;  4FCR A;  4NH7 A;  3PEH A;  4KP4 A;  2XDX A;  1EI1 A;  2BYH A;  2YEC A;  1THN A;  4LWI A;  5IDJ A;  4URN A;  2FYP A;  3T0H A;  1H7U A;  4MP2 A;  2CCS A;  2YKC A;  1B63 A;  1AM1 A;  3A0X A;  3LPS A;  1Z5A A;  2XHX A;  2BTZ A;  1KIJ A;  3QTF A;  1YS3 A;  2BU7 A;  3A0T A;  4MP7 A;  1TBW A;  1ZXN A;  4GEE A;  2Q2E B;  3B26 A;  2E0A A;  3FT8 A;  5M4N A;  2YE6 A;  1H7S A;  1UY8 A;  2H55 A;  1UYI A;  2ZDY A;  4U7O A;  2ZKJ A;  5CTW A;  3T2S A;  1TID A;  4CWR A;  5J71 A;  4QPK A;  2C1I A;  3WQ9 A;  4MPE A;  4XKO A;  3TZ5 A;  5M4K A;  3ZXO A;  3TZ2 A;  2YGF A;  4AWO A;  1YC4 A;  2YEA A;  2YK9 A;  4R3A A;  4URL A;  4LWE A;  4AWQ A;  1QZR A;  4O05 A;  3G7E A;  2WI2 A;  2YI6 A;  4YKX A;  3VHA A;  4YKZ A;  2YEG A;  4EFT A;  1UY6 A;  2YJX A;  4EM7 A;  4GCZ A;  4H7Q A;  1UYL A;  2CCT A;  3D0B A;  4GFN A;  5BOC A;  1UYH A;  3H4L A;  2WI7 A;  4JQL A;  2YEB A;  2YE5 A;  4H85 A;  2XAB A;  4JAS A;  2BU5 A;  1U0Z A;  1Z59 A;  4MB9 A;  2UWD A;  4O09 A;  3R91 A;  4BAE A;  4ASG A;  2IWX A;  4JAV A;  4WUC A;  2H8M A;  1AJ6 A;  4QPJ A;  3B27 A;  2XD6 A;  3EHH A;  4XCJ A;  4V26 A;  3VHC A;  2BYI A;  3RLQ A;  4EMV A;  4ZVI A;  1AH8 A;  1UY7 A;  4BQJ A;  3ZM7 A;  4HY1 A;  4YKU A;  3VHD A;  1R62 A;  2QF6 A;  4XDM A;  2VCI A;  2YGA A;  4LPB A;  1Y4S A;  2YE9 A;  3G7B A;  3C11 A;  3Q5L A;  3K60 A;  1Y8N A;  2FTK A;  5D7C A;  1S16 A;  4ASA A;  1B3Q A;  3OMU A;  3FT5 A;  4URO A;  5M4M A;  2WI6 A;  5FNC A;  2BT0 A;  4EGI A;  4I3H A;  1YES A;  2BZ5 A;  3CYG A;  4YKW A;  3RLR A;  1TH8 A; 
#chains in the Genus database with same CATH homology
 2XCM A;  1ZW9 A;  3T1K A;  2YI5 A;  2WI5 A;  1NHH A;  3HZ1 A;  1S14 A;  2Q8F A;  4E02 A;  3BMY A;  4JAU A;  3B28 A;  4FCQ A;  3DGE A;  2XJG A;  3HZ5 A;  1GKZ A;  2XHR A;  1UY9 A;  4CE2 A;  1BKN A;  4HXW A;  4W7T A;  3A0Y A;  1Y8P A;  1Z5C A;  4O0B A;  3T10 A;  4KFG A;  4L8Z A;  3INW A;  1OSF A;  4I5S A;  1QYE A;  2WI1 A;  3Q5K A;  1UYK A;  4BIZ A;  4HYM A;  3G75 A;  4L90 A;  3HEK A;  1YSR A;  4R3M A;  2CCU A;  2IOR A;  3R4P A;  4AWP A;  1MX0 A;  4ASF A;  3KE6 A;  3B25 A;  5IDM A;  4KQV A;  2IOP A;  2O1W A;  4DZY A;  2XDK A;  3Q5J A;  4WUB A;  4P7A A;  2WEP A;  4GT8 A;  5D7R A;  1U2O A;  3R4O A;  2IWU A;  4EGH A;  1AH6 A;  1Y4U A;  2BRC A;  5L3J A;  2XJJ A;  1ZXM A;  2VCJ A;  4YKR A;  2EXL A;  3RKZ A;  3CRK A;  1YC1 A;  1EA6 A;  1YET A;  5F5R A;  5CF0 A;  4H81 A;  4R1F A;  1UYF A;  2O1U A;  4PRX A;  4PL9 A;  1UYG A;  2YEH A;  1QY8 A;  4EFU A;  1I5C A;  5J6A A;  2Q8G A;  2XDU A;  2YK2 A;  2HKJ A;  3U2D A;  3HYZ A;  4X9L A;  2VW5 A;  2WI3 A;  3IED A;  4NH9 A;  3K99 A;  3MNR P;  1ID0 A;  4LWH A;  4LWG A;  4FPP A;  4XIT A;  4CWO A;  5CTU A;  3D36 A;  3TZ0 A;  2FXS A;  1GJV A;  2YED A;  4LWF A;  4GQT A;  1TC0 A;  3CWV A;  5D6P A;  4HZ0 A;  1US7 A;  4P8O A;  4MPN A;  4PRV A;  2XDL A;  2YE2 A;  3ZKB A;  1I58 A;  3ZXQ A;  3K98 A;  2K5B A;  2AKP A;  3H80 A;  4MOT A;  4HXZ A;  4Q20 A;  3NMQ A;  3TUH A;  3C0E A;  2BRE A;  1I5A A;  4EGK A;  1Z5B A;  1UYE A;  2QG0 A;  2XJX A;  4CE1 A;  1YT2 A;  1A4H A;  5M4P A;  3HYY A;  2CH4 A;  3CRL A;  2VWC A;  5CTX A;  4WUD A;  1YT0 A;  4BIU A;  2ESA A;  2O1V A;  4YKQ A;  2JKI A;  4CWN A;  5FNF A;  3O0I A;  4XIQ A;  1I59 A;  1NHI A;  1I5B A;  2XX5 A;  3U67 A;  4CWP A;  3K97 A;  4XCL A;  5M4E A;  2YKB A;  2YGE A;  2YE3 A;  4HY6 A;  1MU5 A;  4XE2 A;  3INX A;  1UYD A;  3TZ4 A;  4KTN A;  2BU6 A;  4YKT A;  2YE8 A;  2BU8 A;  4FMT A;  1I5D A;  4ASB A;  2YEF A;  4KSG A;  3RLP A;  3A0W A;  4B6C A;  2FWZ A;  4YKY A;  3GIG B;  2GQP A;  4XIR A;  5GGZ A;  5F3K A;  2JJC A;  2QFO A;  3EHG A;  2ZBK B;  3O6O A;  3FV5 A;  1YT1 A;  2WI4 A;  1KZN A;  5CPH A;  2IOQ A;  2XX2 A;  4B7P A;  4CE3 A;  1ZWH A;  5M4H A;  2YKE A;  4E01 A;  4CWF A;  2QG2 A;  4EEH A;  2YKJ A;  3HHU A;  4CWQ A;  4PU9 A;  2XHT A;  4XD8 A;  3ZKD A;  4O07 A;  5CTY A;  3B24 A;  3EHF A;  2FWY A;  4HYP A;  3T0Z A;  3CGZ A;  4XC0 A;  4BQG A;  2YKI A;  3O2F A;  2IWS A;  3OWD A;  3U2K A;  2XX4 A;  4MPC A;  3R92 A;  5D6Q A;  4L93 A;  4L91 A;  2YI7 A;  3EKO A;  4MBC A;  3JZ3 A;  1YER A;  4XKK A;  4XKA A;  5IN9 A;  2Q8I A;  4BXI A;  3GIF A;  3OW6 A;  2PNR A;  3D2R A;  2YE7 A;  4V25 A;  2GFD A;  1UYC A;  2Q8H A;  1TIL A;  1Y8O A;  3PEJ A;  4DUH A;  4LP0 A;  4E00 A;  3CGY A;  4L94 A;  1L0O A;  5D7D A;  3LNU A;  1BGQ A;  1TC6 A;  2YEE A;  3VAD A;  4U7N A;  4CWT A;  2YE4 A;  2BU2 A;  5C93 A;  4CWS A;  2HG1 A;  1JM6 A;  2XDS A;  4HZ5 A;  3OWB A;  2YEI A;  2YI0 A;  3EHJ A;  3BM9 A;  2C2A A;  1PVG A;  4ZKI A;  3GIG A;  4O04 A;  3QDD A;  1B62 A;  1YSZ A;  3TTZ A;  2ZDX A;  3GIE A;  4KSH A;  2XK2 A;  2CGF A;  1UYM A;  2CG9 A;  4U93 A;  3EKR A;  1YC3 A;  2YJW A;  3R4M A;  5FND A;  3R4N A;  3A0Z A;  3WHA A;  4FCP A;  4XIP A;  2YEJ A;  2HCH A;  4XTJ A;  1NHJ A;  4GGL A;  1BYQ A;  3A0R A;  2WEQ A;  2BSM A;  4K4O A;  2WER A;  1GKX A;  4URM A;  1BXD A;  4AS9 A;  4NH8 A;  5BOD A;  5FWK A;  3OPD A;  3SL2 A;  1AMW A;  4FCR A;  4NH7 A;  3PEH A;  4KP4 A;  2XDX A;  1EI1 A;  2BYH A;  2YEC A;  1THN A;  4LWI A;  5IDJ A;  4URN A;  2FYP A;  3T0H A;  1H7U A;  4MP2 A;  2CCS A;  2YKC A;  1B63 A;  1AM1 A;  3A0X A;  3LPS A;  1Z5A A;  2XHX A;  2BTZ A;  1KIJ A;  3QTF A;  1YS3 A;  2BU7 A;  3A0T A;  4MP7 A;  1TBW A;  1ZXN A;  4GEE A;  2Q2E B;  3B26 A;  2E0A A;  3FT8 A;  5M4N A;  2YE6 A;  1H7S A;  1UY8 A;  2H55 A;  1UYI A;  2ZDY A;  4U7O A;  2ZKJ A;  5CTW A;  3T2S A;  1TID A;  4CWR A;  5J71 A;  4QPK A;  3WQ9 A;  4MPE A;  4XKO A;  3TZ5 A;  5M4K A;  3ZXO A;  3TZ2 A;  2YGF A;  4AWO A;  1YC4 A;  2YEA A;  2YK9 A;  4R3A A;  4URL A;  4LWE A;  4AWQ A;  1QZR A;  4O05 A;  3G7E A;  2WI2 A;  2YI6 A;  4YKX A;  3VHA A;  4YKZ A;  2YEG A;  4EFT A;  1UY6 A;  2YJX A;  4EM7 A;  4GCZ A;  4H7Q A;  1UYL A;  2CCT A;  3D0B A;  4GFN A;  5BOC A;  1UYH A;  3H4L A;  2WI7 A;  4JQL A;  2YEB A;  2YE5 A;  4H85 A;  2XAB A;  4JAS A;  2BU5 A;  1U0Z A;  1Z59 A;  4MB9 A;  2UWD A;  4O09 A;  3R91 A;  4BAE A;  4ASG A;  2IWX A;  4JAV A;  4WUC A;  2H8M A;  1AJ6 A;  4QPJ A;  3B27 A;  2XD6 A;  3EHH A;  4XCJ A;  4V26 A;  3VHC A;  2BYI A;  3RLQ A;  4EMV A;  4ZVI A;  1AH8 A;  1UY7 A;  4BQJ A;  3ZM7 A;  4HY1 A;  4YKU A;  3VHD A;  1R62 A;  2QF6 A;  4XDM A;  2VCI A;  2YGA A;  4LPB A;  1Y4S A;  2YE9 A;  3G7B A;  3C11 A;  3Q5L A;  3K60 A;  1Y8N A;  5D7C A;  1S16 A;  4ASA A;  1B3Q A;  3OMU A;  3FT5 A;  4URO A;  5M4M A;  2WI6 A;  5FNC A;  2BT0 A;  4EGI A;  4I3H A;  1YES A;  2BZ5 A;  4YKW A;  3RLR A;  1TH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...