3OPDA

Crystal structure of the n-terminal domain of an hsp90 from trypanosoma brucei, tb10.26.1080 in the presence of a benzamide derivative
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
208
Chain Sequence
GMTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQSVLGDEPHLRIRVIPDRVNKTLTVEDSGIGMTKADLVNNLGTIARSGTKSFMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVVSKNNEDDAYTWESSAGGTFTVTSTPDLKRGTRIVLHLKEDQQEYLEERRLKDLIKKHSEFIGYDIELMVEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the Trypanosoma brucei Hsp83 potential as a target for structure guided drug design.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Chaperone
molecule keywords Heat shock protein 83
total genus 67
structure length 208
sequence length 210
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3opdA00
3R4OA 4HYPA 2YJXA 3B26A 2FYPA 1YSRA 2FWYA 3QTFA 2GQPA 2AKPA 2BU5A 2QF6A 4LWGA 5CTXA 3WHAA 2XHXA 3T0ZA 2H8MA 4HY1A 4FMTA 3G7BA 3A0ZA 5CTUA 2WI5A 2HCHA 3EKOA 4O05A 1Y4SA 1Y8PA 4MPEA 2BYIA 4KTNA 4ASFA 3D2RA 2YEEA 2YGEA 4XC0A 4O09A 4XKKA 3VADA 2YI6A 1EI1A 2WI4A 5BOCA 2FXSA 4FCQA 1UY8A 4HXZA 4YKZA 5D7RA 2ZKJA 2VWCA 2XX2A 4NH8A 3B24A 3C11A 3HYYA 2YE9A 3KE6A 2YI5A 1UYGA 3A0YA 3HYZA 4BAEA 4BQGA 2CCTA 4U7OA 3ZXOA 1GKXA 1QY8A 3RLQA 2WI6A 4LP0A 1TILA 4H85A 2BSMA 4E01A 2BU6A 2XDUA 4O04A 3GIGB 4URMA 4EMVA 4XKOA 1QZRA 3CRKA 4EM7A 2XD6A 3SL2A 1UYHA 5D7DA 1YC3A 4EGHA 2EXLA 4HYMA 2WI2A 2O1UA 3EHFA 3OMUA 4AWPA 3EHJA 4XKAA 2XJXA 1B3QA 5J71A 1UYCA 2BYHA 3TUHA 4H7QA 3O2FA 3D36A 2ESAA 4CWTA 4EGIA 2IWXA 2YEJA 2BT0A 4WUDA 4XTJA 4MPCA 3U67A 1KIJA 3A0RA 1PVGA 1OSFA 5M4KA 4XIQA 2BTZA 1ID0A 4MBCA 3HZ1A 3INWA 5BODA 3LNUA 1S14A 2QG0A 4XCLA 4E00A 1I5AA 3G7EA 4Q20A 2YE8A 3PEHA 2GFDA 1TH8A 2YKBA 3T1KA 1AMWA 4XITA 4L93A 4YKUA 3K99A 4YKXA 2YK9A 4AWQA 4B7PA 3INXA 2YECA 3BMYA 3GIEA 2K5BA 5GGZA 1GJVA 5CPHA 1UYFA 4JQLA 4R3AA 5FNDA 4V25A 4GT8A 4LWEA 1UY9A 2YGFA 1UYKA 4NH9A 4CWNA 4W7TA 4URLA 2YI0A 2XCMA 2YKCA 1NHHA 3TZ4A 1BXDA 4DZYA 4XDMA 2XX5A 3FT5A 3D0BA 3K60A 4KP4A 3CGYA 1TBWA 1H7UA 4KQVA 2XHRA 2WI7A 1BYQA 1YT2A 2C2AA 4U7NA 4UROA 4YKRA 1UYIA 2Q8FA 4MP2A 1AM1A 2XDKA 3DGEA 1AH8A 1YERA 4PRXA 1Z5AA 5M4PA 2QG2A 2XDLA 4L90A 5FNCA 4ASBA 3H80A 1QYEA 3H4LA 2Q8IA 1ZWHA 3QDDA 4H81A 4DUHA 2E0AA 3R91A 4URNA 3TZ2A 4HZ0A 4K4OA 3OWBA 4LPBA 3MNRP 2XX4A 4L94A 4CWOA 4XIRA 4GCZA 2IORA 2IWUA 4WUCA 3WQ9A 2QFOA 2YE7A 1UYLA 1TIDA 3EKRA 4LWFA 4I3HA 4EFUA 2XDXA 2PNRA 4EEHA 2XJGA 1ZW9A 2YE3A 3CGZA 3K97A 4PU9A 1U0ZA 4LWHA 2WEPA 3R4PA 2YEAA 3G75A 3PEJA 3GIGA 1THNA 2YEDA 3U2DA 3CRLA 4MP7A 1S16A 2CG9A 3T2SA 2Q8HA 1B63A 1Z59A 3B27A 2VW5A 3NMQA 4YKTA 4CWPA 1ZXNA 2YK2A 3FT8A 4XE2A 2XDSA 4PL9A 5D7CA 1H7SA 4KSGA 2XABA 3HEKA 5CF0A 1I5CA 2WEQA 2HG1A 1AH6A 2BU2A 3TZ5A 1BGQA 5F5RA 4KFGA 4U93A 1Y4UA 1UY6A 5M4MA 4FCPA 4R3MA 2H55A 1A4HA 4E02A 4PRVA 5F3KA 2JJCA 1YESA 2BU8A 3A0TA 2CCUA 4GQTA 2CCSA 2YE4A 5IDJA 1UYDA 3GIFA 4QPJA 4R1FA 4CWSA 3IEDA 1AJ6A 1KZNA 1UY7A 2WERA 3Q5LA 1U2OA 2CGFA 4CWFA 4WUBA 4B6CA 3EHGA 1JM6A 3RLPA 4V26A 4NH7A 4ASAA 4YKYA 3T10A 3VHCA 2YKIA 3CWVA 1YT1A 3R92A 5D6QA 1Z5BA 1I5DA 2O1WA 4GEEA 1B62A 3RKZA 2Q8GA 2BREA 2CH4A 4ZVIA 1I59A 1YSZA 3B28A 1R62A 3O0IA 1MU5A 5IDMA 1ZXMA 1EA6A 3Q5KA 1UYEA 5L3JA 2YEIA 5IN9A 3A0WA 2BZ5A 2UWDA 2YEGA 2ZDYA 4O07A 4ZKIA 3VHDA 4L8ZA 1MX0A 2IOPA 3OPDA 4P7AA 1Y8OA 2HKJA 2YEFA 2XHTA 4BIUA 4CE2A 3VHAA 2YE5A 4P8OA 3LPSA 2XJJA 3ZXQA 3BM9A 2IOQA 3R4MA 3R4NA 3FV5A 2BRCA 3HHUA 4JAUA 5CTYA 4BXIA 3OW6A 4EFTA 2JKIA 4FPPA 4BIZA 4YKQA 5M4HA 5J6AA 2Q2EB 1YT0A 4AS9A 5M4EA 4XIPA 4MPNA 3O6OA 5M4NA 3HZ5A 3ZM7A 2YE6A 4HY6A 4CE1A 4I5SA 1UYMA 4MB9A 1I5BA 3TTZA 1NHJA 4X9LA 4O0BA 2YI7A 4KSHA 3RLRA 4XD8A 4CWQA 3EHHA 2FWZA 1NHIA 4LWIA 2VCIA 3B25A 2YGAA 3Q5JA 4L91A 4EGKA 2YEHA 4CWRA 4HZ5A 5FNFA 1BKNA 4QPKA 2YKEA 4YKWA 3OWDA 1US7A 1YC1A 1Y8NA 4FCRA 4GFNA 1TC0A 2O1VA 2ZDXA 2WI1A 2VCJA 3TZ0A 3ZKBA 4JAVA 2YKJA 4ASGA 2YJWA 3C0EA 4GGLA 1GKZA 2YE2A 5CTWA 1YC4A 1YS3A 1I58A 5FWKA 3JZ3A 4CE3A 4MOTA 1Z5CA 2WI3A 5D6PA 1TC6A 2XK2A 3K98A 2ZBKB 3T0HA 4BQJA 3A0XA 5C93A 2BU7A 4HXWA 4AWOA 2IWSA 1YETA 4JASA 3U2KA 4XCJA 1L0OA 3ZKDA 2YEBA
chains in the Genus database with same CATH superfamily
3R4OA 4HYPA 2YJXA 3B26A 2FYPA 1YSRA 2FWYA 3QTFA 4E72A 2GQPA 2AKPA 2BU5A 2QF6A 4LWGA 1IXMA 5CTXA 3WHAA 2XHXA 3T0ZA 2H8MA 4HY1A 4FMTA 3G7BA 3A0ZA 5CTUA 2WI5A 2HCHA 3EKOA 4O05A 1Y4SA 1Y8PA 4MPEA 2BYIA 4KTNA 4ASFA 3D2RA 2YEEA 2YGEA 4XC0A 4O09A 4XKKA 3VADA 2YI6A 1EI1A 2WI4A 5BOCA 2FXSA 4FCQA 1UY8A 4HXZA 4YKZA 5D7RA 2ZKJA 2VWCA 2XX2A 4NH8A 3B24A 3C11A 3HYYA 2YE9A 3KE6A 2YI5A 1UYGA 3A0YA 3HYZA 4BAEA 4BQGA 2CCTA 4U7OA 3ZXOA 1GKXA 1QY8A 3RLQA 2WI6A 4LP0A 1TILA 4H85A 2BSMA 4E01A 2BU6A 2XDUA 4O04A 3GIGB 4URMA 4EMVA 4XKOA 1QZRA 3CRKA 4EM7A 2XD6A 3SL2A 1UYHA 5D7DA 1YC3A 4EGHA 2EXLA 4HYMA 2WI2A 2O1UA 3EHFA 3OMUA 4AWPA 3EHJA 4XKAA 2XJXA 1B3QA 5J71A 1UYCA 2BYHA 3TUHA 4H7QA 3O2FA 3D36A 2ESAA 4CWTA 4EGIA 2IWXA 2YEJA 2BT0A 4WUDA 4XTJA 4MPCA 3U67A 1KIJA 3A0RA 1PVGA 1OSFA 5M4KA 4XIQA 2BTZA 1ID0A 4MBCA 3HZ1A 3INWA 5BODA 3LNUA 1S14A 2QG0A 4XCLA 4E00A 1I5AA 3G7EA 4Q20A 2YE8A 3PEHA 2GFDA 1TH8A 2YKBA 5JENA 3T1KA 1AMWA 4XITA 4L93A 4YKUA 3K99A 2HHIA 2YK9A 4YKXA 4AWQA 4B7PA 3INXA 2YECA 3BMYA 3GIEA 2K5BA 5GGZA 1GJVA 5CPHA 1UYFA 4JQLA 4R3AA 5FNDA 4V25A 4GT8A 4LWEA 1UY9A 2YGFA 1UYKA 4NH9A 4CWNA 4W7TA 4URLA 2YI0A 2XCMA 2YKCA 1NHHA 3TZ4A 1BXDA 4DZYA 4XDMA 2XX5A 3FT5A 3D0BA 3K60A 4KP4A 3CGYA 1TBWA 1H7UA 4KQVA 2XHRA 2WI7A 1BYQA 1YT2A 2C2AA 4U7NA 4UROA 4YKRA 1UYIA 2Q8FA 4MP2A 1AM1A 2XDKA 3DGEA 1AH8A 1YERA 4PRXA 1Z5AA 5M4PA 2QG2A 2XDLA 4L90A 5FNCA 4ASBA 3H80A 1QYEA 3H4LA 2Q8IA 1ZWHA 3QDDA 4H81A 2FTKA 4DUHA 2E0AA 3R91A 4URNA 3TZ2A 4HZ0A 4K4OA 3OWBA 4LPBA 3MNRP 2XX4A 4L94A 4CWOA 4XIRA 4GCZA 2IORA 2IWUA 4WUCA 3WQ9A 2QFOA 2YE7A 1UYLA 3S5TA 1TIDA 3EKRA 4LWFA 4I3HA 4EFUA 2XDXA 2PNRA 4EEHA 2XJGA 1ZW9A 2YE3A 3CGZA 3K97A 4PU9A 1U0ZA 4LWHA 2WEPA 3R4PA 2YEAA 3G75A 3PEJA 3GIGA 1THNA 2YEDA 3U2DA 3CRLA 4MP7A 1S16A 2CG9A 3T2SA 2Q8HA 1B63A 1Z59A 3B27A 2VW5A 3NMQA 4YKTA 4CWPA 3CYGA 1ZXNA 2YK2A 3FT8A 4XE2A 2XDSA 4PL9A 5D7CA 1H7SA 4KSGA 2XABA 3HEKA 5CF0A 1I5CA 2WEQA 2HG1A 1AH6A 2BU2A 3TZ5A 1BGQA 5F5RA 4KFGA 4U93A 1Y4UA 1UY6A 5M4MA 4FCPA 4R3MA 2H55A 2C1GA 1A4HA 4E02A 4PRVA 5F3KA 2JJCA 1YESA 2BU8A 3A0TA 2CCUA 4GQTA 2CCSA 2YE4A 5IDJA 1UYDA 3GIFA 4QPJA 4R1FA 4CWSA 3IEDA 1AJ6A 1KZNA 3LMMA 1UY7A 2WERA 3Q5LA 1U2OA 2CGFA 4CWFA 4WUBA 4B6CA 3EHGA 1JM6A 3RLPA 4V26A 4NH7A 4ASAA 4YKYA 3T10A 3VHCA 2YKIA 3CWVA 1YT1A 3R92A 5D6QA 1Z5BA 1I5DA 2O1WA 4GEEA 1B62A 3RKZA 2Q8GA 2BREA 2CH4A 4ZVIA 1I59A 1YSZA 3B28A 1R62A 3O0IA 1MU5A 5IDMA 1ZXMA 1EA6A 3Q5KA 1UYEA 5L3JA 2YEIA 5IN9A 1F51A 3A0WA 2BZ5A 2UWDA 2YEGA 2ZDYA 4O07A 4ZKIA 3VHDA 4L8ZA 1MX0A 2IOPA 3OPDA 4P7AA 1Y8OA 2HKJA 2YEFA 2XHTA 4BIUA 4CE2A 3VHAA 2YE5A 4P8OA 3LPSA 2XJJA 3ZXQA 3BM9A 2IOQA 3R4MA 3R4NA 3FV5A 2BRCA 3HHUA 4JAUA 5CTYA 4BXIA 3OW6A 4EFTA 2JKIA 4FPPA 4BIZA 4YKQA 5M4HA 5J6AA 2Q2EB 1YT0A 4AS9A 5M4EA 4XIPA 4MPNA 3O6OA 5M4NA 3HZ5A 3ZM7A 2YE6A 4HY6A 4CE1A 4I5SA 1UYMA 4MB9A 1I5BA 3TTZA 1NHJA 4X9LA 4O0BA 2YI7A 4KSHA 3RLRA 4XD8A 4CWQA 3EHHA 2FWZA 1NHIA 4LWIA 2VCIA 3B25A 2YGAA 3Q5JA 4L91A 4EGKA 2YEHA 4CWRA 4HZ5A 5FNFA 1BKNA 4QPKA 2YKEA 4YKWA 3OWDA 1US7A 1YC1A 1Y8NA 4FCRA 4GFNA 1TC0A 2O1VA 2ZDXA 2WI1A 2VCJA 3TZ0A 3ZKBA 4JAVA 2YKJA 2C1IA 4ASGA 2YJWA 3C0EA 4GGLA 1GKZA 2YE2A 5CTWA 1YC4A 1YS3A 1I58A 5FWKA 3JZ3A 4CE3A 4MOTA 1Z5CA 2WI3A 5D6PA 1TC6A 2XK2A 3K98A 2ZBKB 3T0HA 4BQJA 3A0XA 5C93A 2BU7A 4HXWA 4AWOA 2IWSA 1YETA 4JASA 3U2KA 4XCJA 1L0OA 3ZKDA 2YEBA
chains in the Genus database with same CATH topology
3R4OA 4HYPA 2YJXA 3B26A 2FYPA 1YSRA 2FWYA 3QTFA 2GQPA 2AKPA 2BU5A 2QF6A 4LWGA 5CTXA 3WHAA 2XHXA 3T0ZA 2H8MA 4HY1A 4FMTA 3G7BA 3A0ZA 5CTUA 2WI5A 2HCHA 3EKOA 4O05A 1Y4SA 1Y8PA 4MPEA 2BYIA 4KTNA 4ASFA 3D2RA 2YEEA 2YGEA 4XC0A 4O09A 4XKKA 3VADA 2YI6A 1EI1A 2WI4A 5BOCA 2FXSA 4FCQA 1UY8A 4HXZA 4YKZA 5D7RA 2ZKJA 2VWCA 2XX2A 4NH8A 3B24A 3C11A 3HYYA 2YE9A 3KE6A 2YI5A 1UYGA 3A0YA 3HYZA 4BAEA 4BQGA 2CCTA 4U7OA 3ZXOA 1GKXA 1QY8A 3RLQA 2WI6A 4LP0A 1TILA 4H85A 2BSMA 4E01A 2BU6A 2XDUA 4O04A 3GIGB 4URMA 4EMVA 4XKOA 1QZRA 3CRKA 4EM7A 2XD6A 3SL2A 1UYHA 5D7DA 1YC3A 4EGHA 2EXLA 4HYMA 2WI2A 2O1UA 3EHFA 3OMUA 4AWPA 3EHJA 4XKAA 2XJXA 1B3QA 5J71A 1UYCA 2BYHA 3TUHA 4H7QA 3O2FA 3D36A 2ESAA 4CWTA 4EGIA 2IWXA 2YEJA 2BT0A 4WUDA 4XTJA 4MPCA 3U67A 1KIJA 3A0RA 1PVGA 1OSFA 5M4KA 4XIQA 2BTZA 1ID0A 4MBCA 3HZ1A 3INWA 5BODA 3LNUA 1S14A 2QG0A 4XCLA 4E00A 1I5AA 3G7EA 4Q20A 2YE8A 3PEHA 2GFDA 1TH8A 2YKBA 3T1KA 1AMWA 4XITA 4L93A 4YKUA 3K99A 4YKXA 2YK9A 4AWQA 4B7PA 3INXA 2YECA 3BMYA 3GIEA 2K5BA 5GGZA 1GJVA 5CPHA 1UYFA 4JQLA 4R3AA 5FNDA 4V25A 4GT8A 4LWEA 1UY9A 2YGFA 1UYKA 4NH9A 4CWNA 4W7TA 4URLA 2YI0A 2XCMA 2YKCA 1NHHA 3TZ4A 1BXDA 4DZYA 4XDMA 2XX5A 3FT5A 3D0BA 3K60A 4KP4A 3CGYA 1TBWA 1H7UA 4KQVA 2XHRA 2WI7A 1BYQA 1YT2A 2C2AA 4U7NA 4UROA 4YKRA 1UYIA 2Q8FA 4MP2A 1AM1A 2XDKA 3DGEA 1AH8A 1YERA 4PRXA 1Z5AA 5M4PA 2QG2A 2XDLA 4L90A 5FNCA 4ASBA 3H80A 1QYEA 3H4LA 2Q8IA 1ZWHA 3QDDA 4H81A 4DUHA 2E0AA 3R91A 4URNA 3TZ2A 4HZ0A 4K4OA 3OWBA 4LPBA 3MNRP 2XX4A 4L94A 4CWOA 4XIRA 4GCZA 2IORA 2IWUA 4WUCA 3WQ9A 2QFOA 2YE7A 1UYLA 1TIDA 3EKRA 4LWFA 4I3HA 4EFUA 2XDXA 2PNRA 4EEHA 2XJGA 1ZW9A 2YE3A 3CGZA 3K97A 4PU9A 1U0ZA 4LWHA 2WEPA 3R4PA 2YEAA 3G75A 3PEJA 3GIGA 1THNA 2YEDA 3U2DA 3CRLA 4MP7A 1S16A 2CG9A 3T2SA 2Q8HA 1B63A 1Z59A 3B27A 2VW5A 3NMQA 4YKTA 4CWPA 1ZXNA 2YK2A 3FT8A 4XE2A 2XDSA 4PL9A 5D7CA 1H7SA 4KSGA 2XABA 3HEKA 5CF0A 1I5CA 2WEQA 2HG1A 1AH6A 2BU2A 3TZ5A 1BGQA 5F5RA 4KFGA 4U93A 1Y4UA 1UY6A 5M4MA 4FCPA 4R3MA 2H55A 1A4HA 4E02A 4PRVA 5F3KA 2JJCA 1YESA 2BU8A 3A0TA 2CCUA 4GQTA 2CCSA 2YE4A 5IDJA 1UYDA 3GIFA 4QPJA 4R1FA 4CWSA 3IEDA 1AJ6A 1KZNA 1UY7A 2WERA 3Q5LA 1U2OA 2CGFA 4CWFA 4WUBA 4B6CA 3EHGA 1JM6A 3RLPA 4V26A 4NH7A 4ASAA 4YKYA 3T10A 3VHCA 2YKIA 3CWVA 1YT1A 3R92A 5D6QA 1Z5BA 1I5DA 2O1WA 4GEEA 1B62A 3RKZA 2Q8GA 2BREA 2CH4A 4ZVIA 1I59A 1YSZA 3B28A 1R62A 3O0IA 1MU5A 5IDMA 1ZXMA 1EA6A 3Q5KA 1UYEA 5L3JA 2YEIA 5IN9A 3A0WA 2BZ5A 2UWDA 2YEGA 2ZDYA 4O07A 4ZKIA 3VHDA 4L8ZA 1MX0A 2IOPA 3OPDA 4P7AA 1Y8OA 2HKJA 2YEFA 2XHTA 4BIUA 4CE2A 3VHAA 2YE5A 4P8OA 3LPSA 2XJJA 3ZXQA 3BM9A 2IOQA 3R4MA 3R4NA 3FV5A 2BRCA 3HHUA 4JAUA 5CTYA 4BXIA 3OW6A 4EFTA 2JKIA 4FPPA 4BIZA 4YKQA 5M4HA 5J6AA 2Q2EB 1YT0A 4AS9A 5M4EA 4XIPA 4MPNA 3O6OA 5M4NA 3HZ5A 3ZM7A 2YE6A 4HY6A 4CE1A 4I5SA 1UYMA 4MB9A 1I5BA 3TTZA 1NHJA 4X9LA 4O0BA 2YI7A 4KSHA 3RLRA 4XD8A 4CWQA 3EHHA 2FWZA 1NHIA 4LWIA 2VCIA 3B25A 2YGAA 3Q5JA 4L91A 4EGKA 2YEHA 4CWRA 4HZ5A 5FNFA 1BKNA 4QPKA 2YKEA 4YKWA 3OWDA 1US7A 1YC1A 1Y8NA 4FCRA 4GFNA 1TC0A 2O1VA 2ZDXA 2WI1A 2VCJA 3TZ0A 3ZKBA 4JAVA 2YKJA 4ASGA 2YJWA 3C0EA 4GGLA 1GKZA 2YE2A 5CTWA 1YC4A 1YS3A 1I58A 5FWKA 3JZ3A 4CE3A 4MOTA 1Z5CA 2WI3A 5D6PA 1TC6A 2XK2A 3K98A 2ZBKB 3T0HA 4BQJA 3A0XA 5C93A 2BU7A 4HXWA 4AWOA 2IWSA 1YETA 4JASA 3U2KA 4XCJA 1L0OA 3ZKDA 2YEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R4O A;  4HYP A;  2YJX A;  3B26 A;  2FYP A;  1YSR A;  2FWY A;  3QTF A;  2GQP A;  2AKP A;  2BU5 A;  2QF6 A;  4LWG A;  5CTX A;  3WHA A;  2XHX A;  3T0Z A;  2H8M A;  4HY1 A;  4FMT A;  3G7B A;  3A0Z A;  5CTU A;  2WI5 A;  2HCH A;  3EKO A;  4O05 A;  1Y4S A;  1Y8P A;  4MPE A;  2BYI A;  4KTN A;  4ASF A;  3D2R A;  2YEE A;  2YGE A;  4XC0 A;  4O09 A;  4XKK A;  3VAD A;  2YI6 A;  1EI1 A;  2WI4 A;  5BOC A;  2FXS A;  4FCQ A;  1UY8 A;  4HXZ A;  4YKZ A;  5D7R A;  2ZKJ A;  2VWC A;  2XX2 A;  4NH8 A;  3B24 A;  3C11 A;  3HYY A;  2YE9 A;  3KE6 A;  2YI5 A;  1UYG A;  3A0Y A;  3HYZ A;  4BAE A;  4BQG A;  2CCT A;  4U7O A;  3ZXO A;  1GKX A;  1QY8 A;  3RLQ A;  2WI6 A;  4LP0 A;  1TIL A;  4H85 A;  2BSM A;  4E01 A;  2BU6 A;  2XDU A;  4O04 A;  3GIG B;  4URM A;  4EMV A;  4XKO A;  1QZR A;  3CRK A;  4EM7 A;  2XD6 A;  3SL2 A;  1UYH A;  5D7D A;  1YC3 A;  4EGH A;  2EXL A;  4HYM A;  2WI2 A;  2O1U A;  3EHF A;  3OMU A;  4AWP A;  3EHJ A;  4XKA A;  2XJX A;  1B3Q A;  5J71 A;  1UYC A;  2BYH A;  3TUH A;  4H7Q A;  3O2F A;  3D36 A;  2ESA A;  4CWT A;  4EGI A;  2IWX A;  2YEJ A;  2BT0 A;  4WUD A;  4XTJ A;  4MPC A;  3U67 A;  1KIJ A;  3A0R A;  1PVG A;  1OSF A;  5M4K A;  4XIQ A;  2BTZ A;  1ID0 A;  4MBC A;  3HZ1 A;  3INW A;  5BOD A;  3LNU A;  1S14 A;  2QG0 A;  4XCL A;  4E00 A;  1I5A A;  3G7E A;  4Q20 A;  2YE8 A;  3PEH A;  2GFD A;  1TH8 A;  2YKB A;  3T1K A;  1AMW A;  4XIT A;  4L93 A;  4YKU A;  3K99 A;  4YKX A;  2YK9 A;  4AWQ A;  4B7P A;  3INX A;  2YEC A;  3BMY A;  3GIE A;  2K5B A;  5GGZ A;  1GJV A;  5CPH A;  1UYF A;  4JQL A;  4R3A A;  5FND A;  4V25 A;  4GT8 A;  4LWE A;  1UY9 A;  2YGF A;  1UYK A;  4NH9 A;  4CWN A;  4W7T A;  4URL A;  2YI0 A;  2XCM A;  2YKC A;  1NHH A;  3TZ4 A;  1BXD A;  4DZY A;  4XDM A;  2XX5 A;  3FT5 A;  3D0B A;  3K60 A;  4KP4 A;  3CGY A;  1TBW A;  1H7U A;  4KQV A;  2XHR A;  2WI7 A;  1BYQ A;  1YT2 A;  2C2A A;  4U7N A;  4URO A;  4YKR A;  1UYI A;  2Q8F A;  4MP2 A;  1AM1 A;  2XDK A;  3DGE A;  1AH8 A;  1YER A;  4PRX A;  1Z5A A;  5M4P A;  2QG2 A;  2XDL A;  4L90 A;  5FNC A;  4ASB A;  3H80 A;  1QYE A;  3H4L A;  2Q8I A;  1ZWH A;  3QDD A;  4H81 A;  4DUH A;  2E0A A;  3R91 A;  4URN A;  3TZ2 A;  4HZ0 A;  4K4O A;  3OWB A;  4LPB A;  3MNR P;  2XX4 A;  4L94 A;  4CWO A;  4XIR A;  4GCZ A;  2IOR A;  2IWU A;  4WUC A;  3WQ9 A;  2QFO A;  2YE7 A;  1UYL A;  1TID A;  3EKR A;  4LWF A;  4I3H A;  4EFU A;  2XDX A;  2PNR A;  4EEH A;  2XJG A;  1ZW9 A;  2YE3 A;  3CGZ A;  3K97 A;  4PU9 A;  1U0Z A;  4LWH A;  2WEP A;  3R4P A;  2YEA A;  3G75 A;  3PEJ A;  3GIG A;  1THN A;  2YED A;  3U2D A;  3CRL A;  4MP7 A;  1S16 A;  2CG9 A;  3T2S A;  2Q8H A;  1B63 A;  1Z59 A;  3B27 A;  2VW5 A;  3NMQ A;  4YKT A;  4CWP A;  1ZXN A;  2YK2 A;  3FT8 A;  4XE2 A;  2XDS A;  4PL9 A;  5D7C A;  1H7S A;  4KSG A;  2XAB A;  3HEK A;  5CF0 A;  1I5C A;  2WEQ A;  2HG1 A;  1AH6 A;  2BU2 A;  3TZ5 A;  1BGQ A;  5F5R A;  4KFG A;  4U93 A;  1Y4U A;  1UY6 A;  5M4M A;  4FCP A;  4R3M A;  2H55 A;  1A4H A;  4E02 A;  4PRV A;  5F3K A;  2JJC A;  1YES A;  2BU8 A;  3A0T A;  2CCU A;  4GQT A;  2CCS A;  2YE4 A;  5IDJ A;  1UYD A;  3GIF A;  4QPJ A;  4R1F A;  4CWS A;  3IED A;  1AJ6 A;  1KZN A;  1UY7 A;  2WER A;  3Q5L A;  1U2O A;  2CGF A;  4CWF A;  4WUB A;  4B6C A;  3EHG A;  1JM6 A;  3RLP A;  4V26 A;  4NH7 A;  4ASA A;  4YKY A;  3T10 A;  3VHC A;  2YKI A;  3CWV A;  1YT1 A;  3R92 A;  5D6Q A;  1Z5B A;  1I5D A;  2O1W A;  4GEE A;  1B62 A;  3RKZ A;  2Q8G A;  2BRE A;  2CH4 A;  4ZVI A;  1I59 A;  1YSZ A;  3B28 A;  1R62 A;  3O0I A;  1MU5 A;  5IDM A;  1ZXM A;  1EA6 A;  3Q5K A;  1UYE A;  5L3J A;  2YEI A;  5IN9 A;  3A0W A;  2BZ5 A;  2UWD A;  2YEG A;  2ZDY A;  4O07 A;  4ZKI A;  3VHD A;  4L8Z A;  1MX0 A;  2IOP A;  3OPD A;  4P7A A;  1Y8O A;  2HKJ A;  2YEF A;  2XHT A;  4BIU A;  4CE2 A;  3VHA A;  2YE5 A;  4P8O A;  3LPS A;  2XJJ A;  3ZXQ A;  3BM9 A;  2IOQ A;  3R4M A;  3R4N A;  3FV5 A;  2BRC A;  3HHU A;  4JAU A;  5CTY A;  4BXI A;  3OW6 A;  4EFT A;  2JKI A;  4FPP A;  4BIZ A;  4YKQ A;  5M4H A;  5J6A A;  2Q2E B;  1YT0 A;  4AS9 A;  5M4E A;  4XIP A;  4MPN A;  3O6O A;  5M4N A;  3HZ5 A;  3ZM7 A;  2YE6 A;  4HY6 A;  4CE1 A;  4I5S A;  1UYM A;  4MB9 A;  1I5B A;  3TTZ A;  1NHJ A;  4X9L A;  4O0B A;  2YI7 A;  4KSH A;  3RLR A;  4XD8 A;  4CWQ A;  3EHH A;  2FWZ A;  1NHI A;  4LWI A;  2VCI A;  3B25 A;  2YGA A;  3Q5J A;  4L91 A;  4EGK A;  2YEH A;  4CWR A;  4HZ5 A;  5FNF A;  1BKN A;  4QPK A;  2YKE A;  4YKW A;  3OWD A;  1US7 A;  1YC1 A;  1Y8N A;  4FCR A;  4GFN A;  1TC0 A;  2O1V A;  2ZDX A;  2WI1 A;  2VCJ A;  3TZ0 A;  3ZKB A;  4JAV A;  2YKJ A;  4ASG A;  2YJW A;  3C0E A;  4GGL A;  1GKZ A;  2YE2 A;  5CTW A;  1YC4 A;  1YS3 A;  1I58 A;  5FWK A;  3JZ3 A;  4CE3 A;  4MOT A;  1Z5C A;  2WI3 A;  5D6P A;  1TC6 A;  2XK2 A;  3K98 A;  2ZBK B;  3T0H A;  4BQJ A;  3A0X A;  5C93 A;  2BU7 A;  4HXW A;  4AWO A;  2IWS A;  1YET A;  4JAS A;  3U2K A;  4XCJ A;  1L0O A;  3ZKD A;  2YEB A; 
#chains in the Genus database with same CATH topology
 3R4O A;  4HYP A;  2YJX A;  3B26 A;  2FYP A;  1YSR A;  2FWY A;  3QTF A;  4E72 A;  2GQP A;  2AKP A;  2BU5 A;  2QF6 A;  4LWG A;  1IXM A;  5CTX A;  3WHA A;  2XHX A;  3T0Z A;  2H8M A;  4HY1 A;  4FMT A;  3G7B A;  3A0Z A;  5CTU A;  2WI5 A;  2HCH A;  3EKO A;  4O05 A;  1Y4S A;  1Y8P A;  4MPE A;  2BYI A;  4KTN A;  4ASF A;  3D2R A;  2YEE A;  2YGE A;  4XC0 A;  4O09 A;  4XKK A;  3VAD A;  2YI6 A;  1EI1 A;  2WI4 A;  5BOC A;  2FXS A;  4FCQ A;  1UY8 A;  4HXZ A;  4YKZ A;  5D7R A;  2ZKJ A;  2VWC A;  2XX2 A;  4NH8 A;  3B24 A;  3C11 A;  3HYY A;  2YE9 A;  3KE6 A;  2YI5 A;  1UYG A;  3A0Y A;  3HYZ A;  4BAE A;  4BQG A;  2CCT A;  4U7O A;  3ZXO A;  1GKX A;  1QY8 A;  3RLQ A;  2WI6 A;  4LP0 A;  1TIL A;  4H85 A;  2BSM A;  4E01 A;  2BU6 A;  2XDU A;  4O04 A;  3GIG B;  4URM A;  4EMV A;  4XKO A;  1QZR A;  3CRK A;  4EM7 A;  2XD6 A;  3SL2 A;  1UYH A;  5D7D A;  1YC3 A;  4EGH A;  2EXL A;  4HYM A;  2WI2 A;  2O1U A;  3EHF A;  3OMU A;  4AWP A;  3EHJ A;  4XKA A;  2XJX A;  1B3Q A;  5J71 A;  1UYC A;  2BYH A;  3TUH A;  4H7Q A;  3O2F A;  3D36 A;  2ESA A;  4CWT A;  4EGI A;  2IWX A;  2YEJ A;  2BT0 A;  4WUD A;  4XTJ A;  4MPC A;  3U67 A;  1KIJ A;  3A0R A;  1PVG A;  1OSF A;  5M4K A;  4XIQ A;  2BTZ A;  1ID0 A;  4MBC A;  3HZ1 A;  3INW A;  5BOD A;  3LNU A;  1S14 A;  2QG0 A;  4XCL A;  4E00 A;  1I5A A;  3G7E A;  4Q20 A;  2YE8 A;  3PEH A;  2GFD A;  1TH8 A;  2YKB A;  5JEN A;  3T1K A;  1AMW A;  4XIT A;  4L93 A;  4YKU A;  3K99 A;  2HHI A;  2YK9 A;  4YKX A;  4AWQ A;  4B7P A;  3INX A;  2YEC A;  3BMY A;  3GIE A;  2K5B A;  5GGZ A;  1GJV A;  5CPH A;  1UYF A;  4JQL A;  4R3A A;  5FND A;  4V25 A;  4GT8 A;  4LWE A;  1UY9 A;  2YGF A;  1UYK A;  4NH9 A;  4CWN A;  4W7T A;  4URL A;  2YI0 A;  2XCM A;  2YKC A;  1NHH A;  3TZ4 A;  1BXD A;  4DZY A;  4XDM A;  2XX5 A;  3FT5 A;  3D0B A;  3K60 A;  4KP4 A;  3CGY A;  1TBW A;  1H7U A;  4KQV A;  2XHR A;  2WI7 A;  1BYQ A;  1YT2 A;  2C2A A;  4U7N A;  4URO A;  4YKR A;  1UYI A;  2Q8F A;  4MP2 A;  1AM1 A;  2XDK A;  3DGE A;  1AH8 A;  1YER A;  4PRX A;  1Z5A A;  5M4P A;  2QG2 A;  2XDL A;  4L90 A;  5FNC A;  4ASB A;  3H80 A;  1QYE A;  3H4L A;  2Q8I A;  1ZWH A;  3QDD A;  4H81 A;  2FTK A;  4DUH A;  2E0A A;  3R91 A;  4URN A;  3TZ2 A;  4HZ0 A;  4K4O A;  3OWB A;  4LPB A;  3MNR P;  2XX4 A;  4L94 A;  4CWO A;  4XIR A;  4GCZ A;  2IOR A;  2IWU A;  4WUC A;  3WQ9 A;  2QFO A;  2YE7 A;  1UYL A;  3S5T A;  1TID A;  3EKR A;  4LWF A;  4I3H A;  4EFU A;  2XDX A;  2PNR A;  4EEH A;  2XJG A;  1ZW9 A;  2YE3 A;  3CGZ A;  3K97 A;  4PU9 A;  1U0Z A;  4LWH A;  2WEP A;  3R4P A;  2YEA A;  3G75 A;  3PEJ A;  3GIG A;  1THN A;  2YED A;  3U2D A;  3CRL A;  4MP7 A;  1S16 A;  2CG9 A;  3T2S A;  2Q8H A;  1B63 A;  1Z59 A;  3B27 A;  2VW5 A;  3NMQ A;  4YKT A;  4CWP A;  3CYG A;  1ZXN A;  2YK2 A;  3FT8 A;  4XE2 A;  2XDS A;  4PL9 A;  5D7C A;  1H7S A;  4KSG A;  2XAB A;  3HEK A;  5CF0 A;  1I5C A;  2WEQ A;  2HG1 A;  1AH6 A;  2BU2 A;  3TZ5 A;  1BGQ A;  5F5R A;  4KFG A;  4U93 A;  1Y4U A;  1UY6 A;  5M4M A;  4FCP A;  4R3M A;  2H55 A;  2C1G A;  1A4H A;  4E02 A;  4PRV A;  5F3K A;  2JJC A;  1YES A;  2BU8 A;  3A0T A;  2CCU A;  4GQT A;  2CCS A;  2YE4 A;  5IDJ A;  1UYD A;  3GIF A;  4QPJ A;  4R1F A;  4CWS A;  3IED A;  1AJ6 A;  1KZN A;  3LMM A;  1UY7 A;  2WER A;  3Q5L A;  1U2O A;  2CGF A;  4CWF A;  4WUB A;  4B6C A;  3EHG A;  1JM6 A;  3RLP A;  4V26 A;  4NH7 A;  4ASA A;  4YKY A;  3T10 A;  3VHC A;  2YKI A;  3CWV A;  1YT1 A;  3R92 A;  5D6Q A;  1Z5B A;  1I5D A;  2O1W A;  4GEE A;  1B62 A;  3RKZ A;  2Q8G A;  2BRE A;  2CH4 A;  4ZVI A;  1I59 A;  1YSZ A;  3B28 A;  1R62 A;  3O0I A;  1MU5 A;  5IDM A;  1ZXM A;  1EA6 A;  3Q5K A;  1UYE A;  5L3J A;  2YEI A;  5IN9 A;  1F51 A;  3A0W A;  2BZ5 A;  2UWD A;  2YEG A;  2ZDY A;  4O07 A;  4ZKI A;  3VHD A;  4L8Z A;  1MX0 A;  2IOP A;  3OPD A;  4P7A A;  1Y8O A;  2HKJ A;  2YEF A;  2XHT A;  4BIU A;  4CE2 A;  3VHA A;  2YE5 A;  4P8O A;  3LPS A;  2XJJ A;  3ZXQ A;  3BM9 A;  2IOQ A;  3R4M A;  3R4N A;  3FV5 A;  2BRC A;  3HHU A;  4JAU A;  5CTY A;  4BXI A;  3OW6 A;  4EFT A;  2JKI A;  4FPP A;  4BIZ A;  4YKQ A;  5M4H A;  5J6A A;  2Q2E B;  1YT0 A;  4AS9 A;  5M4E A;  4XIP A;  4MPN A;  3O6O A;  5M4N A;  3HZ5 A;  3ZM7 A;  2YE6 A;  4HY6 A;  4CE1 A;  4I5S A;  1UYM A;  4MB9 A;  1I5B A;  3TTZ A;  1NHJ A;  4X9L A;  4O0B A;  2YI7 A;  4KSH A;  3RLR A;  4XD8 A;  4CWQ A;  3EHH A;  2FWZ A;  1NHI A;  4LWI A;  2VCI A;  3B25 A;  2YGA A;  3Q5J A;  4L91 A;  4EGK A;  2YEH A;  4CWR A;  4HZ5 A;  5FNF A;  1BKN A;  4QPK A;  2YKE A;  4YKW A;  3OWD A;  1US7 A;  1YC1 A;  1Y8N A;  4FCR A;  4GFN A;  1TC0 A;  2O1V A;  2ZDX A;  2WI1 A;  2VCJ A;  3TZ0 A;  3ZKB A;  4JAV A;  2YKJ A;  2C1I A;  4ASG A;  2YJW A;  3C0E A;  4GGL A;  1GKZ A;  2YE2 A;  5CTW A;  1YC4 A;  1YS3 A;  1I58 A;  5FWK A;  3JZ3 A;  4CE3 A;  4MOT A;  1Z5C A;  2WI3 A;  5D6P A;  1TC6 A;  2XK2 A;  3K98 A;  2ZBK B;  3T0H A;  4BQJ A;  3A0X A;  5C93 A;  2BU7 A;  4HXW A;  4AWO A;  2IWS A;  1YET A;  4JAS A;  3U2K A;  4XCJ A;  1L0O A;  3ZKD A;  2YEB A; 
#chains in the Genus database with same CATH homology
 3R4O A;  4HYP A;  2YJX A;  3B26 A;  2FYP A;  1YSR A;  2FWY A;  3QTF A;  2GQP A;  2AKP A;  2BU5 A;  2QF6 A;  4LWG A;  5CTX A;  3WHA A;  2XHX A;  3T0Z A;  2H8M A;  4HY1 A;  4FMT A;  3G7B A;  3A0Z A;  5CTU A;  2WI5 A;  2HCH A;  3EKO A;  4O05 A;  1Y4S A;  1Y8P A;  4MPE A;  2BYI A;  4KTN A;  4ASF A;  3D2R A;  2YEE A;  2YGE A;  4XC0 A;  4O09 A;  4XKK A;  3VAD A;  2YI6 A;  1EI1 A;  2WI4 A;  5BOC A;  2FXS A;  4FCQ A;  1UY8 A;  4HXZ A;  4YKZ A;  5D7R A;  2ZKJ A;  2VWC A;  2XX2 A;  4NH8 A;  3B24 A;  3C11 A;  3HYY A;  2YE9 A;  3KE6 A;  2YI5 A;  1UYG A;  3A0Y A;  3HYZ A;  4BAE A;  4BQG A;  2CCT A;  4U7O A;  3ZXO A;  1GKX A;  1QY8 A;  3RLQ A;  2WI6 A;  4LP0 A;  1TIL A;  4H85 A;  2BSM A;  4E01 A;  2BU6 A;  2XDU A;  4O04 A;  3GIG B;  4URM A;  4EMV A;  4XKO A;  1QZR A;  3CRK A;  4EM7 A;  2XD6 A;  3SL2 A;  1UYH A;  5D7D A;  1YC3 A;  4EGH A;  2EXL A;  4HYM A;  2WI2 A;  2O1U A;  3EHF A;  3OMU A;  4AWP A;  3EHJ A;  4XKA A;  2XJX A;  1B3Q A;  5J71 A;  1UYC A;  2BYH A;  3TUH A;  4H7Q A;  3O2F A;  3D36 A;  2ESA A;  4CWT A;  4EGI A;  2IWX A;  2YEJ A;  2BT0 A;  4WUD A;  4XTJ A;  4MPC A;  3U67 A;  1KIJ A;  3A0R A;  1PVG A;  1OSF A;  5M4K A;  4XIQ A;  2BTZ A;  1ID0 A;  4MBC A;  3HZ1 A;  3INW A;  5BOD A;  3LNU A;  1S14 A;  2QG0 A;  4XCL A;  4E00 A;  1I5A A;  3G7E A;  4Q20 A;  2YE8 A;  3PEH A;  2GFD A;  1TH8 A;  2YKB A;  3T1K A;  1AMW A;  4XIT A;  4L93 A;  4YKU A;  3K99 A;  4YKX A;  2YK9 A;  4AWQ A;  4B7P A;  3INX A;  2YEC A;  3BMY A;  3GIE A;  2K5B A;  5GGZ A;  1GJV A;  5CPH A;  1UYF A;  4JQL A;  4R3A A;  5FND A;  4V25 A;  4GT8 A;  4LWE A;  1UY9 A;  2YGF A;  1UYK A;  4NH9 A;  4CWN A;  4W7T A;  4URL A;  2YI0 A;  2XCM A;  2YKC A;  1NHH A;  3TZ4 A;  1BXD A;  4DZY A;  4XDM A;  2XX5 A;  3FT5 A;  3D0B A;  3K60 A;  4KP4 A;  3CGY A;  1TBW A;  1H7U A;  4KQV A;  2XHR A;  2WI7 A;  1BYQ A;  1YT2 A;  2C2A A;  4U7N A;  4URO A;  4YKR A;  1UYI A;  2Q8F A;  4MP2 A;  1AM1 A;  2XDK A;  3DGE A;  1AH8 A;  1YER A;  4PRX A;  1Z5A A;  5M4P A;  2QG2 A;  2XDL A;  4L90 A;  5FNC A;  4ASB A;  3H80 A;  1QYE A;  3H4L A;  2Q8I A;  1ZWH A;  3QDD A;  4H81 A;  4DUH A;  2E0A A;  3R91 A;  4URN A;  3TZ2 A;  4HZ0 A;  4K4O A;  3OWB A;  4LPB A;  3MNR P;  2XX4 A;  4L94 A;  4CWO A;  4XIR A;  4GCZ A;  2IOR A;  2IWU A;  4WUC A;  3WQ9 A;  2QFO A;  2YE7 A;  1UYL A;  1TID A;  3EKR A;  4LWF A;  4I3H A;  4EFU A;  2XDX A;  2PNR A;  4EEH A;  2XJG A;  1ZW9 A;  2YE3 A;  3CGZ A;  3K97 A;  4PU9 A;  1U0Z A;  4LWH A;  2WEP A;  3R4P A;  2YEA A;  3G75 A;  3PEJ A;  3GIG A;  1THN A;  2YED A;  3U2D A;  3CRL A;  4MP7 A;  1S16 A;  2CG9 A;  3T2S A;  2Q8H A;  1B63 A;  1Z59 A;  3B27 A;  2VW5 A;  3NMQ A;  4YKT A;  4CWP A;  1ZXN A;  2YK2 A;  3FT8 A;  4XE2 A;  2XDS A;  4PL9 A;  5D7C A;  1H7S A;  4KSG A;  2XAB A;  3HEK A;  5CF0 A;  1I5C A;  2WEQ A;  2HG1 A;  1AH6 A;  2BU2 A;  3TZ5 A;  1BGQ A;  5F5R A;  4KFG A;  4U93 A;  1Y4U A;  1UY6 A;  5M4M A;  4FCP A;  4R3M A;  2H55 A;  1A4H A;  4E02 A;  4PRV A;  5F3K A;  2JJC A;  1YES A;  2BU8 A;  3A0T A;  2CCU A;  4GQT A;  2CCS A;  2YE4 A;  5IDJ A;  1UYD A;  3GIF A;  4QPJ A;  4R1F A;  4CWS A;  3IED A;  1AJ6 A;  1KZN A;  1UY7 A;  2WER A;  3Q5L A;  1U2O A;  2CGF A;  4CWF A;  4WUB A;  4B6C A;  3EHG A;  1JM6 A;  3RLP A;  4V26 A;  4NH7 A;  4ASA A;  4YKY A;  3T10 A;  3VHC A;  2YKI A;  3CWV A;  1YT1 A;  3R92 A;  5D6Q A;  1Z5B A;  1I5D A;  2O1W A;  4GEE A;  1B62 A;  3RKZ A;  2Q8G A;  2BRE A;  2CH4 A;  4ZVI A;  1I59 A;  1YSZ A;  3B28 A;  1R62 A;  3O0I A;  1MU5 A;  5IDM A;  1ZXM A;  1EA6 A;  3Q5K A;  1UYE A;  5L3J A;  2YEI A;  5IN9 A;  3A0W A;  2BZ5 A;  2UWD A;  2YEG A;  2ZDY A;  4O07 A;  4ZKI A;  3VHD A;  4L8Z A;  1MX0 A;  2IOP A;  3OPD A;  4P7A A;  1Y8O A;  2HKJ A;  2YEF A;  2XHT A;  4BIU A;  4CE2 A;  3VHA A;  2YE5 A;  4P8O A;  3LPS A;  2XJJ A;  3ZXQ A;  3BM9 A;  2IOQ A;  3R4M A;  3R4N A;  3FV5 A;  2BRC A;  3HHU A;  4JAU A;  5CTY A;  4BXI A;  3OW6 A;  4EFT A;  2JKI A;  4FPP A;  4BIZ A;  4YKQ A;  5M4H A;  5J6A A;  2Q2E B;  1YT0 A;  4AS9 A;  5M4E A;  4XIP A;  4MPN A;  3O6O A;  5M4N A;  3HZ5 A;  3ZM7 A;  2YE6 A;  4HY6 A;  4CE1 A;  4I5S A;  1UYM A;  4MB9 A;  1I5B A;  3TTZ A;  1NHJ A;  4X9L A;  4O0B A;  2YI7 A;  4KSH A;  3RLR A;  4XD8 A;  4CWQ A;  3EHH A;  2FWZ A;  1NHI A;  4LWI A;  2VCI A;  3B25 A;  2YGA A;  3Q5J A;  4L91 A;  4EGK A;  2YEH A;  4CWR A;  4HZ5 A;  5FNF A;  1BKN A;  4QPK A;  2YKE A;  4YKW A;  3OWD A;  1US7 A;  1YC1 A;  1Y8N A;  4FCR A;  4GFN A;  1TC0 A;  2O1V A;  2ZDX A;  2WI1 A;  2VCJ A;  3TZ0 A;  3ZKB A;  4JAV A;  2YKJ A;  4ASG A;  2YJW A;  3C0E A;  4GGL A;  1GKZ A;  2YE2 A;  5CTW A;  1YC4 A;  1YS3 A;  1I58 A;  5FWK A;  3JZ3 A;  4CE3 A;  4MOT A;  1Z5C A;  2WI3 A;  5D6P A;  1TC6 A;  2XK2 A;  3K98 A;  2ZBK B;  3T0H A;  4BQJ A;  3A0X A;  5C93 A;  2BU7 A;  4HXW A;  4AWO A;  2IWS A;  1YET A;  4JAS A;  3U2K A;  4XCJ A;  1L0O A;  3ZKD A;  2YEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...