3OPDA

Crystal structure of the n-terminal domain of an hsp90 from trypanosoma brucei, tb10.26.1080 in the presence of a benzamide derivative
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
208
Chain Sequence
GMTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQSVLGDEPHLRIRVIPDRVNKTLTVEDSGIGMTKADLVNNLGTIARSGTKSFMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVVSKNNEDDAYTWESSAGGTFTVTSTPDLKRGTRIVLHLKEDQQEYLEERRLKDLIKKHSEFIGYDIELMVEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Heat shock protein 83
publication title Exploring the Trypanosoma brucei Hsp83 potential as a target for structure guided drug design.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 67
structure length 208
sequence length 210
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3opdA00
4L93A 3RLPA 3HEKA 5C93A 2Q2EB 1I58A 4PU9A 3A0XA 4BQGA 3GIGB 4CWRA 1QYEA 3EKOA 3B25A 4FMTA 3CRKA 5L3JA 4LWIA 3U2DA 4BQJA 4AWPA 1QY8A 2H55A 4HY1A 2XHTA 2CCTA 1PVGA 1UYLA 5BOCA 3A0TA 3CWVA 1GKZA 1B3QA 1KZNA 4XIPA 2XD6A 3QTFA 1Y4SA 2HG1A 2WI5A 3TUHA 3INWA 1H7UA 4YKXA 2Q8IA 4YKWA 4YKYA 4URNA 4DZYA 3OMUA 2O1WA 4KSGA 2YEJA 2E0AA 3O2FA 4KQVA 2H8MA 3FV5A 1TH8A 3ZKBA 1UYHA 2IWSA 3GIGA 1ID0A 4H85A 2YEGA 3MNRP 5FNFA 2YGEA 3O0IA 2WEPA 3R4PA 4E00A 1YC4A 2BZ5A 4HZ0A 4WUDA 1TILA 2XJXA 2EXLA 2CCSA 5CTYA 2VCIA 1Y4UA 3D0BA 5BODA 1Y8NA 4AWOA 2Q8HA 3T10A 1TC0A 2XABA 1YT2A 2ZBKB 4YKZA 4JQLA 4H7QA 2WI4A 4QPKA 2YJXA 4I3HA 3K98A 2BU6A 2YE2A 1UYGA 2VWCA 2YEHA 1YT0A 4MP7A 5D7CA 2XDXA 4AWQA 4O07A 2QG0A 4FCPA 5D6QA 4CWTA 5D7RA 5CTXA 4E01A 3D2RA 2XHXA 3K97A 2CCUA 4LPBA 4XD8A 2XDSA 2Q8FA 4LP0A 2XDKA 4ASGA 4WUBA 1UYIA 1NHJA 3H4LA 3A0RA 4XIRA 4U7NA 4ASFA 3KE6A 2QF6A 3B26A 1B62A 3G7EA 4HY6A 4LWFA 4CWQA 2O1UA 4O09A 5M4EA 4UROA 3JZ3A 1I5AA 3IEDA 4MOTA 4MB9A 4EFTA 5M4HA 3QDDA 4FCQA 2YKEA 2ZDXA 3A0WA 3LPSA 2XJJA 1I5CA 3OPDA 1BKNA 2VCJA 4NH8A 2C2AA 4FPPA 3DGEA 3WHAA 4B7PA 1UY9A 4KP4A 4WUCA 4CWFA 2YKBA 3TZ2A 1AJ6A 1ZWHA 5CTUA 1TIDA 4BAEA 4GEEA 1EA6A 3OWDA 2WI2A 2WERA 1I5DA 1S16A 3U67A 3R4OA 4PRXA 2YEEA 5FWKA 3EHHA 3LNUA 2YEBA 5FNDA 1JM6A 2XCMA 4XIQA 3EHJA 5IDJA 3SL2A 1TBWA 4MPCA 3R92A 5CPHA 1I59A 4BXIA 4L91A 1AH6A 3BM9A 4GFNA 3VHAA 1Y8PA 4MPEA 4P8OA 3T0HA 4CE3A 3T2SA 4EGKA 4U7OA 3R4NA 4O0BA 1YETA 2GQPA 3GIEA 4LWHA 4CWPA 4JASA 2FWZA 1BYQA 3TTZA 1BGQA 2YK2A 3G7BA 1ZXNA 3OW6A 3Q5LA 2GFDA 2BSMA 4XKKA 1UYKA 2BU7A 2XX5A 4PRVA 3Q5KA 2YEIA 4HXWA 4HZ5A 3A0ZA 3EKRA 1U0ZA 3OWBA 1YERA 3ZM7A 1YESA 4MP2A 3PEHA 2YE9A 4XDMA 2BREA 4CWNA 4Q20A 1US7A 4EFUA 2CH4A 4QPJA 5M4MA 2FXSA 4XE2A 2HKJA 1B63A 2YI7A 2YE5A 2ZKJA 5J71A 1Y8OA 2XX2A 5M4PA 4ASBA 4DUHA 4R1FA 2YECA 1NHIA 4XKAA 2YGAA 2WI1A 3HHUA 4O05A 1TC6A 2UWDA 4ZVIA 2K5BA 4GGLA 3NMQA 4HXZA 1OSFA 2FWYA 2IWUA 1BXDA 3R91A 2BYHA 2QFOA 2YI0A 5M4NA 4HYMA 4GT8A 1U2OA 3FT8A 5F5RA 4EGIA 2CG9A 3C0EA 1YT1A 2ZDYA 3RLQA 4MBCA 3BMYA 4AS9A 4URMA 4H81A 4HYPA 3EHFA 4EEHA 3INXA 5D7DA 2BYIA 3FT5A 5J6AA 4LWGA 4P7AA 1UYEA 2YI5A 2IORA 3H80A 2XK2A 4EM7A 2XDLA 4XCJA 2IOQA 3B28A 3VHCA 4JAVA 4CWOA 3CGZA 4O04A 1YSZA 3B27A 3C11A 3EHGA 3PEJA 5D6PA 3HZ1A 2XX4A 4L8ZA 1AH8A 1S14A 3HZ5A 3VADA 4EGHA 4XKOA 4I5SA 4ZKIA 4B6CA 1ZXMA 2XDUA 3B24A 4PL9A 4V26A 4V25A 3Q5JA 3T1KA 2JJCA 2XHRA 2ESAA 4U93A 2CGFA 1H7SA 5FNCA 3TZ4A 1UY8A 3RLRA 4L94A 2WI6A 5CF0A 3ZKDA 1THNA 3ZXQA 2YJWA 3CGYA 2JKIA 3K99A 3T0ZA 1UYFA 5GGZA 5IN9A 1YSRA 1UYDA 2FYPA 2YEDA 4FCRA 3HYYA 5IDMA 2YEAA 3CRLA 4KSHA 1ZW9A 2WI7A 1Z59A 1Z5AA 2O1VA 2YI6A 4XTJA 3VHDA 1QZRA 4ASAA 4EMVA 4CWSA 3TZ0A 3R4MA 1KIJA 1UYCA 5CTWA 2YKIA 1GJVA 4BIZA 4LWEA 1MU5A 4URLA 1MX0A 1R62A 3D36A 4YKQA 2IWXA 1Z5CA 3O6OA 4L90A 4YKRA 4CE2A 3G75A 2BU5A 2BT0A 2BU2A 2YE7A 2WI3A 2YE4A 2HCHA 1AMWA 2IOPA 4GQTA 2BU8A 1I5BA 4NH7A 3TZ5A 2YE3A 3A0YA 1UY7A 3GIFA 2YE6A 2YK9A 4XC0A 3ZXOA 1UYMA 3HYZA 1AM1A 4GCZA 2Q8GA 1GKXA 1YS3A 4R3MA 1L0OA 2AKPA 2VW5A 4W7TA 3WQ9A 3U2KA 1UY6A 2YKJA 4KTNA 2QG2A 2YGFA 4YKUA 1NHHA 2YEFA 3K60A 2YKCA 4YKTA 4E02A 2YE8A 4BIUA 4XCLA 5F3KA 4CE1A 2XJGA 2BRCA 4KFGA 1A4HA 4JAUA 1EI1A 4R3AA 4XITA 1YC3A 2BTZA 5M4KA 4NH9A 2PNRA 4K4OA 3RKZA 1YC1A 2WEQA 4X9LA 1Z5BA 4MPNA
chains in the Genus database with same CATH superfamily
4L93A 3RLPA 3HEKA 5C93A 2Q2EB 1I58A 4PU9A 1IXMA 3A0XA 4BQGA 3GIGB 4CWRA 1QYEA 3EKOA 3B25A 4FMTA 3CRKA 5L3JA 4LWIA 3U2DA 4BQJA 4AWPA 1QY8A 2H55A 4HY1A 2XHTA 2CCTA 1PVGA 1UYLA 5BOCA 3A0TA 3CWVA 1GKZA 1B3QA 1KZNA 4XIPA 2XD6A 3QTFA 1Y4SA 2HG1A 2WI5A 3TUHA 3INWA 1H7UA 4YKXA 2Q8IA 4YKWA 4YKYA 4URNA 4DZYA 3OMUA 2O1WA 4KSGA 2YEJA 2E0AA 3O2FA 4KQVA 2H8MA 3FV5A 1TH8A 3ZKBA 1UYHA 2IWSA 3GIGA 1ID0A 4H85A 2YEGA 3MNRP 3S5TA 5FNFA 2YGEA 3O0IA 2WEPA 3R4PA 4E00A 1YC4A 2BZ5A 4HZ0A 4WUDA 1TILA 2XJXA 2EXLA 2CCSA 5CTYA 2VCIA 1Y4UA 3D0BA 5BODA 1Y8NA 4AWOA 2Q8HA 3T10A 1TC0A 2XABA 1YT2A 2ZBKB 4YKZA 4JQLA 4H7QA 2WI4A 4QPKA 2YJXA 4I3HA 3K98A 2BU6A 2YE2A 1UYGA 2VWCA 2YEHA 1YT0A 4MP7A 5D7CA 2XDXA 4AWQA 4O07A 2QG0A 4FCPA 5D6QA 4CWTA 5D7RA 5CTXA 4E01A 3D2RA 2XHXA 3K97A 2CCUA 4LPBA 4XD8A 2XDSA 2Q8FA 4LP0A 2XDKA 4ASGA 4WUBA 1UYIA 1NHJA 3H4LA 3A0RA 4XIRA 4U7NA 4ASFA 3KE6A 2QF6A 3B26A 1B62A 3G7EA 4HY6A 2C1IA 4LWFA 4CWQA 2O1UA 4O09A 5M4EA 4UROA 3JZ3A 1I5AA 3IEDA 4MOTA 4MB9A 4EFTA 5M4HA 3QDDA 4FCQA 2YKEA 2ZDXA 3A0WA 3LPSA 2XJJA 1I5CA 3OPDA 1BKNA 2VCJA 4NH8A 2C2AA 4FPPA 3DGEA 3WHAA 4B7PA 1UY9A 4KP4A 4WUCA 4CWFA 2YKBA 3TZ2A 1AJ6A 1ZWHA 5CTUA 1TIDA 4BAEA 3LMMA 4GEEA 1EA6A 3OWDA 2WI2A 2WERA 1I5DA 1S16A 3U67A 3R4OA 4PRXA 2YEEA 5FWKA 3EHHA 3LNUA 2YEBA 5FNDA 1JM6A 2XCMA 4XIQA 3EHJA 5IDJA 3SL2A 1TBWA 4MPCA 3R92A 5CPHA 1I59A 4BXIA 4L91A 1AH6A 3BM9A 4GFNA 3VHAA 1Y8PA 4MPEA 4P8OA 3T0HA 4CE3A 3T2SA 4EGKA 4U7OA 3R4NA 4E72A 4O0BA 1YETA 2GQPA 3GIEA 4LWHA 4CWPA 4JASA 2FWZA 1BYQA 3TTZA 1BGQA 3CYGA 2YK2A 3G7BA 1ZXNA 3OW6A 3Q5LA 2GFDA 2BSMA 4XKKA 1UYKA 2BU7A 2XX5A 4PRVA 3Q5KA 2YEIA 4HXWA 4HZ5A 3A0ZA 3EKRA 1U0ZA 3OWBA 1YERA 5JENA 3ZM7A 1YESA 4MP2A 3PEHA 2YE9A 4XDMA 2BREA 4CWNA 4Q20A 1US7A 4EFUA 2CH4A 4QPJA 5M4MA 2FXSA 4XE2A 2HKJA 1B63A 2YI7A 2YE5A 2ZKJA 5J71A 1Y8OA 2XX2A 5M4PA 4ASBA 4DUHA 4R1FA 2YECA 1NHIA 4XKAA 2YGAA 2WI1A 3HHUA 4O05A 1TC6A 2UWDA 4ZVIA 2K5BA 3NMQA 4GGLA 4HXZA 1OSFA 2FWYA 2IWUA 1BXDA 3R91A 2BYHA 2QFOA 2YI0A 5M4NA 4HYMA 4GT8A 1U2OA 3FT8A 5F5RA 4EGIA 2CG9A 3C0EA 1YT1A 2ZDYA 3RLQA 4MBCA 3BMYA 4AS9A 4URMA 4H81A 4HYPA 3EHFA 4EEHA 3INXA 5D7DA 2BYIA 3FT5A 5J6AA 4LWGA 4P7AA 1UYEA 2YI5A 2IORA 3H80A 2XK2A 4EM7A 2XDLA 4XCJA 2IOQA 3B28A 3VHCA 4JAVA 4CWOA 3CGZA 2C1GA 1YSZA 4O04A 3B27A 3C11A 3EHGA 3PEJA 5D6PA 3HZ1A 1F51A 2XX4A 4L8ZA 1AH8A 1S14A 3HZ5A 3VADA 4EGHA 4XKOA 4I5SA 4ZKIA 4B6CA 1ZXMA 2XDUA 3B24A 4PL9A 4V26A 4V25A 3Q5JA 3T1KA 2JJCA 2XHRA 2ESAA 4U93A 2CGFA 1H7SA 5FNCA 3TZ4A 1UY8A 3RLRA 4L94A 2WI6A 5CF0A 3ZKDA 1THNA 3ZXQA 2YJWA 3CGYA 2JKIA 3K99A 3T0ZA 1UYFA 5GGZA 5IN9A 1YSRA 1UYDA 2FYPA 2YEDA 4FCRA 3HYYA 5IDMA 2YEAA 3CRLA 4KSHA 1ZW9A 2WI7A 1Z59A 1Z5AA 2O1VA 2YI6A 4XTJA 3VHDA 1QZRA 4ASAA 4EMVA 4CWSA 3TZ0A 3R4MA 1KIJA 1UYCA 5CTWA 2YKIA 1GJVA 4BIZA 4LWEA 1MU5A 4URLA 1MX0A 1R62A 3D36A 4YKQA 2IWXA 1Z5CA 3O6OA 4L90A 4YKRA 4CE2A 3G75A 2BU5A 2BT0A 2BU2A 2YE7A 2FTKA 2WI3A 2YE4A 2HCHA 1AMWA 2IOPA 4GQTA 2BU8A 1I5BA 4NH7A 3TZ5A 2YE3A 3A0YA 1UY7A 3GIFA 2YE6A 2YK9A 4XC0A 3ZXOA 1UYMA 3HYZA 1AM1A 4GCZA 2Q8GA 1GKXA 1YS3A 4R3MA 1L0OA 2AKPA 2VW5A 4W7TA 3WQ9A 3U2KA 1UY6A 2YKJA 4KTNA 2QG2A 2YGFA 4YKUA 1NHHA 2YEFA 3K60A 2YKCA 4YKTA 4E02A 2YE8A 4BIUA 4XCLA 5F3KA 4CE1A 2XJGA 2BRCA 2HHIA 4KFGA 1A4HA 4JAUA 1EI1A 4R3AA 4XITA 1YC3A 2BTZA 5M4KA 4NH9A 2PNRA 4K4OA 3RKZA 1YC1A 2WEQA 4X9LA 1Z5BA 4MPNA
chains in the Genus database with same CATH topology
4L93A 3RLPA 3HEKA 5C93A 2Q2EB 1I58A 4PU9A 3A0XA 4BQGA 3GIGB 4CWRA 1QYEA 3EKOA 3B25A 4FMTA 3CRKA 5L3JA 4LWIA 3U2DA 4BQJA 4AWPA 1QY8A 2H55A 4HY1A 2XHTA 2CCTA 1PVGA 1UYLA 5BOCA 3A0TA 3CWVA 1GKZA 1B3QA 1KZNA 4XIPA 2XD6A 3QTFA 1Y4SA 2HG1A 2WI5A 3TUHA 3INWA 1H7UA 4YKXA 2Q8IA 4YKWA 4YKYA 4URNA 4DZYA 3OMUA 2O1WA 4KSGA 2YEJA 2E0AA 3O2FA 4KQVA 2H8MA 3FV5A 1TH8A 3ZKBA 1UYHA 2IWSA 3GIGA 1ID0A 4H85A 2YEGA 3MNRP 5FNFA 2YGEA 3O0IA 2WEPA 3R4PA 4E00A 1YC4A 2BZ5A 4HZ0A 4WUDA 1TILA 2XJXA 2EXLA 2CCSA 5CTYA 2VCIA 1Y4UA 3D0BA 5BODA 1Y8NA 4AWOA 2Q8HA 3T10A 1TC0A 2XABA 1YT2A 2ZBKB 4YKZA 4JQLA 4H7QA 2WI4A 4QPKA 2YJXA 4I3HA 3K98A 2BU6A 2YE2A 1UYGA 2VWCA 2YEHA 1YT0A 4MP7A 5D7CA 2XDXA 4AWQA 4O07A 2QG0A 4FCPA 5D6QA 4CWTA 5D7RA 5CTXA 4E01A 3D2RA 2XHXA 3K97A 2CCUA 4LPBA 4XD8A 2XDSA 2Q8FA 4LP0A 2XDKA 4ASGA 4WUBA 1UYIA 1NHJA 3H4LA 3A0RA 4XIRA 4U7NA 4ASFA 3KE6A 2QF6A 3B26A 1B62A 3G7EA 4HY6A 4LWFA 4CWQA 2O1UA 4O09A 5M4EA 4UROA 3JZ3A 1I5AA 3IEDA 4MOTA 4MB9A 4EFTA 5M4HA 3QDDA 4FCQA 2YKEA 2ZDXA 3A0WA 3LPSA 2XJJA 1I5CA 3OPDA 1BKNA 2VCJA 4NH8A 2C2AA 4FPPA 3DGEA 3WHAA 4B7PA 1UY9A 4KP4A 4WUCA 4CWFA 2YKBA 3TZ2A 1AJ6A 1ZWHA 5CTUA 1TIDA 4BAEA 4GEEA 1EA6A 3OWDA 2WI2A 2WERA 1I5DA 1S16A 3U67A 3R4OA 4PRXA 2YEEA 5FWKA 3EHHA 3LNUA 2YEBA 5FNDA 1JM6A 2XCMA 4XIQA 3EHJA 5IDJA 3SL2A 1TBWA 4MPCA 3R92A 5CPHA 1I59A 4BXIA 4L91A 1AH6A 3BM9A 4GFNA 3VHAA 1Y8PA 4MPEA 4P8OA 3T0HA 4CE3A 3T2SA 4EGKA 4U7OA 3R4NA 4O0BA 1YETA 2GQPA 3GIEA 4LWHA 4CWPA 4JASA 2FWZA 1BYQA 3TTZA 1BGQA 2YK2A 3G7BA 1ZXNA 3OW6A 3Q5LA 2GFDA 2BSMA 4XKKA 1UYKA 2BU7A 2XX5A 4PRVA 3Q5KA 2YEIA 4HXWA 4HZ5A 3A0ZA 3EKRA 1U0ZA 3OWBA 1YERA 3ZM7A 1YESA 4MP2A 3PEHA 2YE9A 4XDMA 2BREA 4CWNA 4Q20A 1US7A 4EFUA 2CH4A 4QPJA 5M4MA 2FXSA 4XE2A 2HKJA 1B63A 2YI7A 2YE5A 2ZKJA 5J71A 1Y8OA 2XX2A 5M4PA 4ASBA 4DUHA 4R1FA 2YECA 1NHIA 4XKAA 2YGAA 2WI1A 3HHUA 4O05A 1TC6A 2UWDA 4ZVIA 2K5BA 4GGLA 3NMQA 4HXZA 1OSFA 2FWYA 2IWUA 1BXDA 3R91A 2BYHA 2QFOA 2YI0A 5M4NA 4HYMA 4GT8A 1U2OA 3FT8A 5F5RA 4EGIA 2CG9A 3C0EA 1YT1A 2ZDYA 3RLQA 4MBCA 3BMYA 4AS9A 4URMA 4H81A 4HYPA 3EHFA 4EEHA 3INXA 5D7DA 2BYIA 3FT5A 5J6AA 4LWGA 4P7AA 1UYEA 2YI5A 2IORA 3H80A 2XK2A 4EM7A 2XDLA 4XCJA 2IOQA 3B28A 3VHCA 4JAVA 4CWOA 3CGZA 4O04A 1YSZA 3B27A 3C11A 3EHGA 3PEJA 5D6PA 3HZ1A 2XX4A 4L8ZA 1AH8A 1S14A 3HZ5A 3VADA 4EGHA 4XKOA 4I5SA 4ZKIA 4B6CA 1ZXMA 2XDUA 3B24A 4PL9A 4V26A 4V25A 3Q5JA 3T1KA 2JJCA 2XHRA 2ESAA 4U93A 2CGFA 1H7SA 5FNCA 3TZ4A 1UY8A 3RLRA 4L94A 2WI6A 5CF0A 3ZKDA 1THNA 3ZXQA 2YJWA 3CGYA 2JKIA 3K99A 3T0ZA 1UYFA 5GGZA 5IN9A 1YSRA 1UYDA 2FYPA 2YEDA 4FCRA 3HYYA 5IDMA 2YEAA 3CRLA 4KSHA 1ZW9A 2WI7A 1Z59A 1Z5AA 2O1VA 2YI6A 4XTJA 3VHDA 1QZRA 4ASAA 4EMVA 4CWSA 3TZ0A 3R4MA 1KIJA 1UYCA 5CTWA 2YKIA 1GJVA 4BIZA 4LWEA 1MU5A 4URLA 1MX0A 1R62A 3D36A 4YKQA 2IWXA 1Z5CA 3O6OA 4L90A 4YKRA 4CE2A 3G75A 2BU5A 2BT0A 2BU2A 2YE7A 2WI3A 2YE4A 2HCHA 1AMWA 2IOPA 4GQTA 2BU8A 1I5BA 4NH7A 3TZ5A 2YE3A 3A0YA 1UY7A 3GIFA 2YE6A 2YK9A 4XC0A 3ZXOA 1UYMA 3HYZA 1AM1A 4GCZA 2Q8GA 1GKXA 1YS3A 4R3MA 1L0OA 2AKPA 2VW5A 4W7TA 3WQ9A 3U2KA 1UY6A 2YKJA 4KTNA 2QG2A 2YGFA 4YKUA 1NHHA 2YEFA 3K60A 2YKCA 4YKTA 4E02A 2YE8A 4BIUA 4XCLA 5F3KA 4CE1A 2XJGA 2BRCA 4KFGA 1A4HA 4JAUA 1EI1A 4R3AA 4XITA 1YC3A 2BTZA 5M4KA 4NH9A 2PNRA 4K4OA 3RKZA 1YC1A 2WEQA 4X9LA 1Z5BA 4MPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L93 A;  3RLP A;  3HEK A;  5C93 A;  2Q2E B;  1I58 A;  4PU9 A;  3A0X A;  4BQG A;  3GIG B;  4CWR A;  1QYE A;  3EKO A;  3B25 A;  4FMT A;  3CRK A;  5L3J A;  4LWI A;  3U2D A;  4BQJ A;  4AWP A;  1QY8 A;  2H55 A;  4HY1 A;  2XHT A;  2CCT A;  1PVG A;  1UYL A;  5BOC A;  3A0T A;  3CWV A;  1GKZ A;  1B3Q A;  1KZN A;  4XIP A;  2XD6 A;  3QTF A;  1Y4S A;  2HG1 A;  2WI5 A;  3TUH A;  3INW A;  1H7U A;  4YKX A;  2Q8I A;  4YKW A;  4YKY A;  4URN A;  4DZY A;  3OMU A;  2O1W A;  4KSG A;  2YEJ A;  2E0A A;  3O2F A;  4KQV A;  2H8M A;  3FV5 A;  1TH8 A;  3ZKB A;  1UYH A;  2IWS A;  3GIG A;  1ID0 A;  4H85 A;  2YEG A;  3MNR P;  5FNF A;  2YGE A;  3O0I A;  2WEP A;  3R4P A;  4E00 A;  1YC4 A;  2BZ5 A;  4HZ0 A;  4WUD A;  1TIL A;  2XJX A;  2EXL A;  2CCS A;  5CTY A;  2VCI A;  1Y4U A;  3D0B A;  5BOD A;  1Y8N A;  4AWO A;  2Q8H A;  3T10 A;  1TC0 A;  2XAB A;  1YT2 A;  2ZBK B;  4YKZ A;  4JQL A;  4H7Q A;  2WI4 A;  4QPK A;  2YJX A;  4I3H A;  3K98 A;  2BU6 A;  2YE2 A;  1UYG A;  2VWC A;  2YEH A;  1YT0 A;  4MP7 A;  5D7C A;  2XDX A;  4AWQ A;  4O07 A;  2QG0 A;  4FCP A;  5D6Q A;  4CWT A;  5D7R A;  5CTX A;  4E01 A;  3D2R A;  2XHX A;  3K97 A;  2CCU A;  4LPB A;  4XD8 A;  2XDS A;  2Q8F A;  4LP0 A;  2XDK A;  4ASG A;  4WUB A;  1UYI A;  1NHJ A;  3H4L A;  3A0R A;  4XIR A;  4U7N A;  4ASF A;  3KE6 A;  2QF6 A;  3B26 A;  1B62 A;  3G7E A;  4HY6 A;  4LWF A;  4CWQ A;  2O1U A;  4O09 A;  5M4E A;  4URO A;  3JZ3 A;  1I5A A;  3IED A;  4MOT A;  4MB9 A;  4EFT A;  5M4H A;  3QDD A;  4FCQ A;  2YKE A;  2ZDX A;  3A0W A;  3LPS A;  2XJJ A;  1I5C A;  3OPD A;  1BKN A;  2VCJ A;  4NH8 A;  2C2A A;  4FPP A;  3DGE A;  3WHA A;  4B7P A;  1UY9 A;  4KP4 A;  4WUC A;  4CWF A;  2YKB A;  3TZ2 A;  1AJ6 A;  1ZWH A;  5CTU A;  1TID A;  4BAE A;  4GEE A;  1EA6 A;  3OWD A;  2WI2 A;  2WER A;  1I5D A;  1S16 A;  3U67 A;  3R4O A;  4PRX A;  2YEE A;  5FWK A;  3EHH A;  3LNU A;  2YEB A;  5FND A;  1JM6 A;  2XCM A;  4XIQ A;  3EHJ A;  5IDJ A;  3SL2 A;  1TBW A;  4MPC A;  3R92 A;  5CPH A;  1I59 A;  4BXI A;  4L91 A;  1AH6 A;  3BM9 A;  4GFN A;  3VHA A;  1Y8P A;  4MPE A;  4P8O A;  3T0H A;  4CE3 A;  3T2S A;  4EGK A;  4U7O A;  3R4N A;  4O0B A;  1YET A;  2GQP A;  3GIE A;  4LWH A;  4CWP A;  4JAS A;  2FWZ A;  1BYQ A;  3TTZ A;  1BGQ A;  2YK2 A;  3G7B A;  1ZXN A;  3OW6 A;  3Q5L A;  2GFD A;  2BSM A;  4XKK A;  1UYK A;  2BU7 A;  2XX5 A;  4PRV A;  3Q5K A;  2YEI A;  4HXW A;  4HZ5 A;  3A0Z A;  3EKR A;  1U0Z A;  3OWB A;  1YER A;  3ZM7 A;  1YES A;  4MP2 A;  3PEH A;  2YE9 A;  4XDM A;  2BRE A;  4CWN A;  4Q20 A;  1US7 A;  4EFU A;  2CH4 A;  4QPJ A;  5M4M A;  2FXS A;  4XE2 A;  2HKJ A;  1B63 A;  2YI7 A;  2YE5 A;  2ZKJ A;  5J71 A;  1Y8O A;  2XX2 A;  5M4P A;  4ASB A;  4DUH A;  4R1F A;  2YEC A;  1NHI A;  4XKA A;  2YGA A;  2WI1 A;  3HHU A;  4O05 A;  1TC6 A;  2UWD A;  4ZVI A;  2K5B A;  4GGL A;  3NMQ A;  4HXZ A;  1OSF A;  2FWY A;  2IWU A;  1BXD A;  3R91 A;  2BYH A;  2QFO A;  2YI0 A;  5M4N A;  4HYM A;  4GT8 A;  1U2O A;  3FT8 A;  5F5R A;  4EGI A;  2CG9 A;  3C0E A;  1YT1 A;  2ZDY A;  3RLQ A;  4MBC A;  3BMY A;  4AS9 A;  4URM A;  4H81 A;  4HYP A;  3EHF A;  4EEH A;  3INX A;  5D7D A;  2BYI A;  3FT5 A;  5J6A A;  4LWG A;  4P7A A;  1UYE A;  2YI5 A;  2IOR A;  3H80 A;  2XK2 A;  4EM7 A;  2XDL A;  4XCJ A;  2IOQ A;  3B28 A;  3VHC A;  4JAV A;  4CWO A;  3CGZ A;  4O04 A;  1YSZ A;  3B27 A;  3C11 A;  3EHG A;  3PEJ A;  5D6P A;  3HZ1 A;  2XX4 A;  4L8Z A;  1AH8 A;  1S14 A;  3HZ5 A;  3VAD A;  4EGH A;  4XKO A;  4I5S A;  4ZKI A;  4B6C A;  1ZXM A;  2XDU A;  3B24 A;  4PL9 A;  4V26 A;  4V25 A;  3Q5J A;  3T1K A;  2JJC A;  2XHR A;  2ESA A;  4U93 A;  2CGF A;  1H7S A;  5FNC A;  3TZ4 A;  1UY8 A;  3RLR A;  4L94 A;  2WI6 A;  5CF0 A;  3ZKD A;  1THN A;  3ZXQ A;  2YJW A;  3CGY A;  2JKI A;  3K99 A;  3T0Z A;  1UYF A;  5GGZ A;  5IN9 A;  1YSR A;  1UYD A;  2FYP A;  2YED A;  4FCR A;  3HYY A;  5IDM A;  2YEA A;  3CRL A;  4KSH A;  1ZW9 A;  2WI7 A;  1Z59 A;  1Z5A A;  2O1V A;  2YI6 A;  4XTJ A;  3VHD A;  1QZR A;  4ASA A;  4EMV A;  4CWS A;  3TZ0 A;  3R4M A;  1KIJ A;  1UYC A;  5CTW A;  2YKI A;  1GJV A;  4BIZ A;  4LWE A;  1MU5 A;  4URL A;  1MX0 A;  1R62 A;  3D36 A;  4YKQ A;  2IWX A;  1Z5C A;  3O6O A;  4L90 A;  4YKR A;  4CE2 A;  3G75 A;  2BU5 A;  2BT0 A;  2BU2 A;  2YE7 A;  2WI3 A;  2YE4 A;  2HCH A;  1AMW A;  2IOP A;  4GQT A;  2BU8 A;  1I5B A;  4NH7 A;  3TZ5 A;  2YE3 A;  3A0Y A;  1UY7 A;  3GIF A;  2YE6 A;  2YK9 A;  4XC0 A;  3ZXO A;  1UYM A;  3HYZ A;  1AM1 A;  4GCZ A;  2Q8G A;  1GKX A;  1YS3 A;  4R3M A;  1L0O A;  2AKP A;  2VW5 A;  4W7T A;  3WQ9 A;  3U2K A;  1UY6 A;  2YKJ A;  4KTN A;  2QG2 A;  2YGF A;  4YKU A;  1NHH A;  2YEF A;  3K60 A;  2YKC A;  4YKT A;  4E02 A;  2YE8 A;  4BIU A;  4XCL A;  5F3K A;  4CE1 A;  2XJG A;  2BRC A;  4KFG A;  1A4H A;  4JAU A;  1EI1 A;  4R3A A;  4XIT A;  1YC3 A;  2BTZ A;  5M4K A;  4NH9 A;  2PNR A;  4K4O A;  3RKZ A;  1YC1 A;  2WEQ A;  4X9L A;  1Z5B A;  4MPN A; 
#chains in the Genus database with same CATH topology
 4L93 A;  3RLP A;  3HEK A;  5C93 A;  2Q2E B;  1I58 A;  4PU9 A;  1IXM A;  3A0X A;  4BQG A;  3GIG B;  4CWR A;  1QYE A;  3EKO A;  3B25 A;  4FMT A;  3CRK A;  5L3J A;  4LWI A;  3U2D A;  4BQJ A;  4AWP A;  1QY8 A;  2H55 A;  4HY1 A;  2XHT A;  2CCT A;  1PVG A;  1UYL A;  5BOC A;  3A0T A;  3CWV A;  1GKZ A;  1B3Q A;  1KZN A;  4XIP A;  2XD6 A;  3QTF A;  1Y4S A;  2HG1 A;  2WI5 A;  3TUH A;  3INW A;  1H7U A;  4YKX A;  2Q8I A;  4YKW A;  4YKY A;  4URN A;  4DZY A;  3OMU A;  2O1W A;  4KSG A;  2YEJ A;  2E0A A;  3O2F A;  4KQV A;  2H8M A;  3FV5 A;  1TH8 A;  3ZKB A;  1UYH A;  2IWS A;  3GIG A;  1ID0 A;  4H85 A;  2YEG A;  3MNR P;  3S5T A;  5FNF A;  2YGE A;  3O0I A;  2WEP A;  3R4P A;  4E00 A;  1YC4 A;  2BZ5 A;  4HZ0 A;  4WUD A;  1TIL A;  2XJX A;  2EXL A;  2CCS A;  5CTY A;  2VCI A;  1Y4U A;  3D0B A;  5BOD A;  1Y8N A;  4AWO A;  2Q8H A;  3T10 A;  1TC0 A;  2XAB A;  1YT2 A;  2ZBK B;  4YKZ A;  4JQL A;  4H7Q A;  2WI4 A;  4QPK A;  2YJX A;  4I3H A;  3K98 A;  2BU6 A;  2YE2 A;  1UYG A;  2VWC A;  2YEH A;  1YT0 A;  4MP7 A;  5D7C A;  2XDX A;  4AWQ A;  4O07 A;  2QG0 A;  4FCP A;  5D6Q A;  4CWT A;  5D7R A;  5CTX A;  4E01 A;  3D2R A;  2XHX A;  3K97 A;  2CCU A;  4LPB A;  4XD8 A;  2XDS A;  2Q8F A;  4LP0 A;  2XDK A;  4ASG A;  4WUB A;  1UYI A;  1NHJ A;  3H4L A;  3A0R A;  4XIR A;  4U7N A;  4ASF A;  3KE6 A;  2QF6 A;  3B26 A;  1B62 A;  3G7E A;  4HY6 A;  2C1I A;  4LWF A;  4CWQ A;  2O1U A;  4O09 A;  5M4E A;  4URO A;  3JZ3 A;  1I5A A;  3IED A;  4MOT A;  4MB9 A;  4EFT A;  5M4H A;  3QDD A;  4FCQ A;  2YKE A;  2ZDX A;  3A0W A;  3LPS A;  2XJJ A;  1I5C A;  3OPD A;  1BKN A;  2VCJ A;  4NH8 A;  2C2A A;  4FPP A;  3DGE A;  3WHA A;  4B7P A;  1UY9 A;  4KP4 A;  4WUC A;  4CWF A;  2YKB A;  3TZ2 A;  1AJ6 A;  1ZWH A;  5CTU A;  1TID A;  4BAE A;  3LMM A;  4GEE A;  1EA6 A;  3OWD A;  2WI2 A;  2WER A;  1I5D A;  1S16 A;  3U67 A;  3R4O A;  4PRX A;  2YEE A;  5FWK A;  3EHH A;  3LNU A;  2YEB A;  5FND A;  1JM6 A;  2XCM A;  4XIQ A;  3EHJ A;  5IDJ A;  3SL2 A;  1TBW A;  4MPC A;  3R92 A;  5CPH A;  1I59 A;  4BXI A;  4L91 A;  1AH6 A;  3BM9 A;  4GFN A;  3VHA A;  1Y8P A;  4MPE A;  4P8O A;  3T0H A;  4CE3 A;  3T2S A;  4EGK A;  4U7O A;  3R4N A;  4E72 A;  4O0B A;  1YET A;  2GQP A;  3GIE A;  4LWH A;  4CWP A;  4JAS A;  2FWZ A;  1BYQ A;  3TTZ A;  1BGQ A;  3CYG A;  2YK2 A;  3G7B A;  1ZXN A;  3OW6 A;  3Q5L A;  2GFD A;  2BSM A;  4XKK A;  1UYK A;  2BU7 A;  2XX5 A;  4PRV A;  3Q5K A;  2YEI A;  4HXW A;  4HZ5 A;  3A0Z A;  3EKR A;  1U0Z A;  3OWB A;  1YER A;  5JEN A;  3ZM7 A;  1YES A;  4MP2 A;  3PEH A;  2YE9 A;  4XDM A;  2BRE A;  4CWN A;  4Q20 A;  1US7 A;  4EFU A;  2CH4 A;  4QPJ A;  5M4M A;  2FXS A;  4XE2 A;  2HKJ A;  1B63 A;  2YI7 A;  2YE5 A;  2ZKJ A;  5J71 A;  1Y8O A;  2XX2 A;  5M4P A;  4ASB A;  4DUH A;  4R1F A;  2YEC A;  1NHI A;  4XKA A;  2YGA A;  2WI1 A;  3HHU A;  4O05 A;  1TC6 A;  2UWD A;  4ZVI A;  2K5B A;  3NMQ A;  4GGL A;  4HXZ A;  1OSF A;  2FWY A;  2IWU A;  1BXD A;  3R91 A;  2BYH A;  2QFO A;  2YI0 A;  5M4N A;  4HYM A;  4GT8 A;  1U2O A;  3FT8 A;  5F5R A;  4EGI A;  2CG9 A;  3C0E A;  1YT1 A;  2ZDY A;  3RLQ A;  4MBC A;  3BMY A;  4AS9 A;  4URM A;  4H81 A;  4HYP A;  3EHF A;  4EEH A;  3INX A;  5D7D A;  2BYI A;  3FT5 A;  5J6A A;  4LWG A;  4P7A A;  1UYE A;  2YI5 A;  2IOR A;  3H80 A;  2XK2 A;  4EM7 A;  2XDL A;  4XCJ A;  2IOQ A;  3B28 A;  3VHC A;  4JAV A;  4CWO A;  3CGZ A;  2C1G A;  1YSZ A;  4O04 A;  3B27 A;  3C11 A;  3EHG A;  3PEJ A;  5D6P A;  3HZ1 A;  1F51 A;  2XX4 A;  4L8Z A;  1AH8 A;  1S14 A;  3HZ5 A;  3VAD A;  4EGH A;  4XKO A;  4I5S A;  4ZKI A;  4B6C A;  1ZXM A;  2XDU A;  3B24 A;  4PL9 A;  4V26 A;  4V25 A;  3Q5J A;  3T1K A;  2JJC A;  2XHR A;  2ESA A;  4U93 A;  2CGF A;  1H7S A;  5FNC A;  3TZ4 A;  1UY8 A;  3RLR A;  4L94 A;  2WI6 A;  5CF0 A;  3ZKD A;  1THN A;  3ZXQ A;  2YJW A;  3CGY A;  2JKI A;  3K99 A;  3T0Z A;  1UYF A;  5GGZ A;  5IN9 A;  1YSR A;  1UYD A;  2FYP A;  2YED A;  4FCR A;  3HYY A;  5IDM A;  2YEA A;  3CRL A;  4KSH A;  1ZW9 A;  2WI7 A;  1Z59 A;  1Z5A A;  2O1V A;  2YI6 A;  4XTJ A;  3VHD A;  1QZR A;  4ASA A;  4EMV A;  4CWS A;  3TZ0 A;  3R4M A;  1KIJ A;  1UYC A;  5CTW A;  2YKI A;  1GJV A;  4BIZ A;  4LWE A;  1MU5 A;  4URL A;  1MX0 A;  1R62 A;  3D36 A;  4YKQ A;  2IWX A;  1Z5C A;  3O6O A;  4L90 A;  4YKR A;  4CE2 A;  3G75 A;  2BU5 A;  2BT0 A;  2BU2 A;  2YE7 A;  2FTK A;  2WI3 A;  2YE4 A;  2HCH A;  1AMW A;  2IOP A;  4GQT A;  2BU8 A;  1I5B A;  4NH7 A;  3TZ5 A;  2YE3 A;  3A0Y A;  1UY7 A;  3GIF A;  2YE6 A;  2YK9 A;  4XC0 A;  3ZXO A;  1UYM A;  3HYZ A;  1AM1 A;  4GCZ A;  2Q8G A;  1GKX A;  1YS3 A;  4R3M A;  1L0O A;  2AKP A;  2VW5 A;  4W7T A;  3WQ9 A;  3U2K A;  1UY6 A;  2YKJ A;  4KTN A;  2QG2 A;  2YGF A;  4YKU A;  1NHH A;  2YEF A;  3K60 A;  2YKC A;  4YKT A;  4E02 A;  2YE8 A;  4BIU A;  4XCL A;  5F3K A;  4CE1 A;  2XJG A;  2BRC A;  2HHI A;  4KFG A;  1A4H A;  4JAU A;  1EI1 A;  4R3A A;  4XIT A;  1YC3 A;  2BTZ A;  5M4K A;  4NH9 A;  2PNR A;  4K4O A;  3RKZ A;  1YC1 A;  2WEQ A;  4X9L A;  1Z5B A;  4MPN A; 
#chains in the Genus database with same CATH homology
 4L93 A;  3RLP A;  3HEK A;  5C93 A;  2Q2E B;  1I58 A;  4PU9 A;  3A0X A;  4BQG A;  3GIG B;  4CWR A;  1QYE A;  3EKO A;  3B25 A;  4FMT A;  3CRK A;  5L3J A;  4LWI A;  3U2D A;  4BQJ A;  4AWP A;  1QY8 A;  2H55 A;  4HY1 A;  2XHT A;  2CCT A;  1PVG A;  1UYL A;  5BOC A;  3A0T A;  3CWV A;  1GKZ A;  1B3Q A;  1KZN A;  4XIP A;  2XD6 A;  3QTF A;  1Y4S A;  2HG1 A;  2WI5 A;  3TUH A;  3INW A;  1H7U A;  4YKX A;  2Q8I A;  4YKW A;  4YKY A;  4URN A;  4DZY A;  3OMU A;  2O1W A;  4KSG A;  2YEJ A;  2E0A A;  3O2F A;  4KQV A;  2H8M A;  3FV5 A;  1TH8 A;  3ZKB A;  1UYH A;  2IWS A;  3GIG A;  1ID0 A;  4H85 A;  2YEG A;  3MNR P;  5FNF A;  2YGE A;  3O0I A;  2WEP A;  3R4P A;  4E00 A;  1YC4 A;  2BZ5 A;  4HZ0 A;  4WUD A;  1TIL A;  2XJX A;  2EXL A;  2CCS A;  5CTY A;  2VCI A;  1Y4U A;  3D0B A;  5BOD A;  1Y8N A;  4AWO A;  2Q8H A;  3T10 A;  1TC0 A;  2XAB A;  1YT2 A;  2ZBK B;  4YKZ A;  4JQL A;  4H7Q A;  2WI4 A;  4QPK A;  2YJX A;  4I3H A;  3K98 A;  2BU6 A;  2YE2 A;  1UYG A;  2VWC A;  2YEH A;  1YT0 A;  4MP7 A;  5D7C A;  2XDX A;  4AWQ A;  4O07 A;  2QG0 A;  4FCP A;  5D6Q A;  4CWT A;  5D7R A;  5CTX A;  4E01 A;  3D2R A;  2XHX A;  3K97 A;  2CCU A;  4LPB A;  4XD8 A;  2XDS A;  2Q8F A;  4LP0 A;  2XDK A;  4ASG A;  4WUB A;  1UYI A;  1NHJ A;  3H4L A;  3A0R A;  4XIR A;  4U7N A;  4ASF A;  3KE6 A;  2QF6 A;  3B26 A;  1B62 A;  3G7E A;  4HY6 A;  4LWF A;  4CWQ A;  2O1U A;  4O09 A;  5M4E A;  4URO A;  3JZ3 A;  1I5A A;  3IED A;  4MOT A;  4MB9 A;  4EFT A;  5M4H A;  3QDD A;  4FCQ A;  2YKE A;  2ZDX A;  3A0W A;  3LPS A;  2XJJ A;  1I5C A;  3OPD A;  1BKN A;  2VCJ A;  4NH8 A;  2C2A A;  4FPP A;  3DGE A;  3WHA A;  4B7P A;  1UY9 A;  4KP4 A;  4WUC A;  4CWF A;  2YKB A;  3TZ2 A;  1AJ6 A;  1ZWH A;  5CTU A;  1TID A;  4BAE A;  4GEE A;  1EA6 A;  3OWD A;  2WI2 A;  2WER A;  1I5D A;  1S16 A;  3U67 A;  3R4O A;  4PRX A;  2YEE A;  5FWK A;  3EHH A;  3LNU A;  2YEB A;  5FND A;  1JM6 A;  2XCM A;  4XIQ A;  3EHJ A;  5IDJ A;  3SL2 A;  1TBW A;  4MPC A;  3R92 A;  5CPH A;  1I59 A;  4BXI A;  4L91 A;  1AH6 A;  3BM9 A;  4GFN A;  3VHA A;  1Y8P A;  4MPE A;  4P8O A;  3T0H A;  4CE3 A;  3T2S A;  4EGK A;  4U7O A;  3R4N A;  4O0B A;  1YET A;  2GQP A;  3GIE A;  4LWH A;  4CWP A;  4JAS A;  2FWZ A;  1BYQ A;  3TTZ A;  1BGQ A;  2YK2 A;  3G7B A;  1ZXN A;  3OW6 A;  3Q5L A;  2GFD A;  2BSM A;  4XKK A;  1UYK A;  2BU7 A;  2XX5 A;  4PRV A;  3Q5K A;  2YEI A;  4HXW A;  4HZ5 A;  3A0Z A;  3EKR A;  1U0Z A;  3OWB A;  1YER A;  3ZM7 A;  1YES A;  4MP2 A;  3PEH A;  2YE9 A;  4XDM A;  2BRE A;  4CWN A;  4Q20 A;  1US7 A;  4EFU A;  2CH4 A;  4QPJ A;  5M4M A;  2FXS A;  4XE2 A;  2HKJ A;  1B63 A;  2YI7 A;  2YE5 A;  2ZKJ A;  5J71 A;  1Y8O A;  2XX2 A;  5M4P A;  4ASB A;  4DUH A;  4R1F A;  2YEC A;  1NHI A;  4XKA A;  2YGA A;  2WI1 A;  3HHU A;  4O05 A;  1TC6 A;  2UWD A;  4ZVI A;  2K5B A;  4GGL A;  3NMQ A;  4HXZ A;  1OSF A;  2FWY A;  2IWU A;  1BXD A;  3R91 A;  2BYH A;  2QFO A;  2YI0 A;  5M4N A;  4HYM A;  4GT8 A;  1U2O A;  3FT8 A;  5F5R A;  4EGI A;  2CG9 A;  3C0E A;  1YT1 A;  2ZDY A;  3RLQ A;  4MBC A;  3BMY A;  4AS9 A;  4URM A;  4H81 A;  4HYP A;  3EHF A;  4EEH A;  3INX A;  5D7D A;  2BYI A;  3FT5 A;  5J6A A;  4LWG A;  4P7A A;  1UYE A;  2YI5 A;  2IOR A;  3H80 A;  2XK2 A;  4EM7 A;  2XDL A;  4XCJ A;  2IOQ A;  3B28 A;  3VHC A;  4JAV A;  4CWO A;  3CGZ A;  4O04 A;  1YSZ A;  3B27 A;  3C11 A;  3EHG A;  3PEJ A;  5D6P A;  3HZ1 A;  2XX4 A;  4L8Z A;  1AH8 A;  1S14 A;  3HZ5 A;  3VAD A;  4EGH A;  4XKO A;  4I5S A;  4ZKI A;  4B6C A;  1ZXM A;  2XDU A;  3B24 A;  4PL9 A;  4V26 A;  4V25 A;  3Q5J A;  3T1K A;  2JJC A;  2XHR A;  2ESA A;  4U93 A;  2CGF A;  1H7S A;  5FNC A;  3TZ4 A;  1UY8 A;  3RLR A;  4L94 A;  2WI6 A;  5CF0 A;  3ZKD A;  1THN A;  3ZXQ A;  2YJW A;  3CGY A;  2JKI A;  3K99 A;  3T0Z A;  1UYF A;  5GGZ A;  5IN9 A;  1YSR A;  1UYD A;  2FYP A;  2YED A;  4FCR A;  3HYY A;  5IDM A;  2YEA A;  3CRL A;  4KSH A;  1ZW9 A;  2WI7 A;  1Z59 A;  1Z5A A;  2O1V A;  2YI6 A;  4XTJ A;  3VHD A;  1QZR A;  4ASA A;  4EMV A;  4CWS A;  3TZ0 A;  3R4M A;  1KIJ A;  1UYC A;  5CTW A;  2YKI A;  1GJV A;  4BIZ A;  4LWE A;  1MU5 A;  4URL A;  1MX0 A;  1R62 A;  3D36 A;  4YKQ A;  2IWX A;  1Z5C A;  3O6O A;  4L90 A;  4YKR A;  4CE2 A;  3G75 A;  2BU5 A;  2BT0 A;  2BU2 A;  2YE7 A;  2WI3 A;  2YE4 A;  2HCH A;  1AMW A;  2IOP A;  4GQT A;  2BU8 A;  1I5B A;  4NH7 A;  3TZ5 A;  2YE3 A;  3A0Y A;  1UY7 A;  3GIF A;  2YE6 A;  2YK9 A;  4XC0 A;  3ZXO A;  1UYM A;  3HYZ A;  1AM1 A;  4GCZ A;  2Q8G A;  1GKX A;  1YS3 A;  4R3M A;  1L0O A;  2AKP A;  2VW5 A;  4W7T A;  3WQ9 A;  3U2K A;  1UY6 A;  2YKJ A;  4KTN A;  2QG2 A;  2YGF A;  4YKU A;  1NHH A;  2YEF A;  3K60 A;  2YKC A;  4YKT A;  4E02 A;  2YE8 A;  4BIU A;  4XCL A;  5F3K A;  4CE1 A;  2XJG A;  2BRC A;  4KFG A;  1A4H A;  4JAU A;  1EI1 A;  4R3A A;  4XIT A;  1YC3 A;  2BTZ A;  5M4K A;  4NH9 A;  2PNR A;  4K4O A;  3RKZ A;  1YC1 A;  2WEQ A;  4X9L A;  1Z5B A;  4MPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...