4ZKIA

The crystal structure of histidine kinase yycg with adp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
239
structure length
233
Chain Sequence
VTEQQKIDNDRKQFVSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRVDKQGGTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine kinase
publication title Conformational dynamics of the essential sensor histidine kinase WalK
pubmed doi rcsb
source organism Lactobacillus plantarum jdm1
molecule tags Transferase
total genus 78
structure length 233
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4zkiA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4zkiA02
1I5CA 4CWQA 4JQLA 4MBCA 1Z5BA 2GFDA 4QPJA 3K97A 5F3KA 4JAUA 1MX0A 2WEPA 5D7DA 2XHXA 4BIUA 1TIDA 1GKXA 3U2KA 3HEKA 1UYDA 4XKOA 3VHAA 4CWRA 4ASBA 3HZ1A 2LFSA 3GIGA 4AWPA 2WI3A 3EKOA 3U67A 3EHHA 4YKUA 4NH7A 2XHRA 4GCZA 2YEEA 3OWDA 2QG2A 2BZ5A 5GGZA 3VADA 4AWQA 1UYKA 1B62A 3IEDA 2BU6A 4ASGA 4HYPA 1A4HA 1NHHA 1JM6A 3G7EA 1TC0A 2IWXA 4URLA 1BYQA 2YI5A 3ZRXA 1S16A 1YT1A 4NH9A 5BOCA 1F51A 5CTUA 1YT0A 2Q8IA 2YGEA 2WI7A 3H80A 4LWIA 4CE1A 1U0ZA 4U7NA 4LC1A 1Z5AA 2HKJA 2YI6A 2YKIA 3ZM7A 2XDXA 1YT2A 5M4NA 3T10A 3MD0A 2H8MA 2BYIA 1ZWHA 3MNRP 2VWCA 4XKAA 3RLPA 2FYPA 3GIFA 2YE4A 4CE3A 3RLRA 1I59A 4ZVIA 4XIRA 3A0TA 4P8OA 4I3HA 4I5SA 5CTXA 1Y4SA 2O1WA 2BYHA 3WHAA 3K60A 4O07A 4GGLA 5D7RA 2YEHA 4JYCA 2ZBKB 4GQTA 2XX4A 3JZ3A 2BTZA 4KQVA 3T1KA 4E00A 2YE5A 2IWSA 1R62A 3TZ4A 1YETA 4B7PA 5B1NA 2IORA 3O2FA 4MP7A 4FCPA 4ASAA 2YEGA 2XDSA 2QFOA 1MU5A 1ZXNA 2YE7A 5CF0A 2AKPA 1UY7A 3VHDA 5IDJA 2BU5A 1Z5CA 2YE3A 4EGKA 3K99A 1Y8PA 2HG1A 4KSGA 4R3MA 4L94A 2PNRA 4R1FA 4HXZA 4O05A 2VCIA 1I5BA 1KIJA 1YSZA 2WI1A 3R4OA 3G7BA 2O1VA 2YK2A 4HY6A 2YE6A 3R4PA 4YKYA 4L8ZA 3LNUA 4AS9A 3R4MA 1L0OA 4CWSA 2BU2A 2QG0A 2WI4A 5FNFA 4BQGA 4XD8A 1UY9A 1BGQA 2BU8A 3INXA 4W7TA 2JKIA 2YK9A 2WI5A 3NXSA 4XCLA 1S14A 3R4NA 1U2OA 4B6CA 2HCHA 2GQPA 4CWOA 3A0XA 4MP2A 4O0BA 1TH8A 1US7A 1UYHA 4BAEA 2YEJA 2FTKA 4QPKA 4UROA 3D36A 3OWBA 2BRCA 4FCRA 4WUDA 2FXSA 1AH6A 1PVGA 3TZ0A 2Q2EB 5C93A 3C0EA 3SL2A 4EM7A 4KFGA 1I58A 2FWYA 4XC0A 5IDMA 2WERA 4MTXA 2BREA 4LP0A 1EA6A 3WQ9A 2YI0A 3O6OA 4E02A 4URNA 4O09A 3TUHA 2XJJA 2YI7A 2WWWA 5IN9A 4BIZA 3HYZA 5D6QA 2YJXA 4H81A 2YEFA 4EFTA 3B25A 3A0RA 1QZRA 5FNCA 4EFUA 4AWOA 4BQJA 1Y4UA 2XABA 3HHUA 3A0ZA 2BT0A 1AH8A 2XDUA 3PEJA 1I5AA 2YECA 1H7UA 4CWPA 4FMTA 3T0ZA 3B27A 4LWGA 2YEAA 4K4OA 4GT8A 1H7SA 2YJWA 4JYBA 2YEDA 1JOYA 3ZXOA 2WI2A 3Q5LA 3DGEA 2FWZA 5L3JA 4YKWA 1UYIA 4WUCA 4LPBA 2UWDA 4L90A 4XTJA 3R91A 4LWHA 4HYMA 1TILA 4MPNA 4EGHA 3RLQA 3ZRVA 2QF6A 2IOQA 3EHGA 3GIEA 4YKTA 5FNDA 4PL9A 2K5BA 4ASFA 4MT8A 2CGFA 2BSMA 4CWNA 4JAVA 1TBWA 4EMVA 2QM7A 3OMUA 4V25A 2ZKJA 4URMA 2YE2A 4XIQA 3H4LA 1Y8OA 5B1OA 2CH4A 3O0IA 1ZW9A 4CWFA 3ZRWB 4LWEA 3ZXQA 5M4HA 2YEBA 1BXDA 3QTFA 4ZKIA 2LFRA 5J71A 3VHCA 1UY6A 5M4KA 4U93A 4YKRA 1B63A 4CWTA 2XDLA 1YC1A 5M4EA 2E0AA 2QM8A 1YSRA 4WUBA 3OW6A 2IOPA 3EHJA 4NH8A 2WI6A 4HZ0A 1GKZA 5M4MA 3BM9A 1Z59A 1NHJA 1UY8A 5CPHA 2XX2A 4V26A 4XCJA 2BU7A 3B26A 3OPDA 2JJCA 4R3AA 3LPSA 2IWUA 3FT8A 3T2SA 3D0BA 1AM1A 3RKZA 4MOTA 4P7AA 2H55A 4YKQA 4GT1A 5D6PA 3Q5JA 4KTNA 1GJVA 2C2AA 1YESA 1UYGA 3G75A 1YS3A 2YGFA 3B28A 3FV5A 3C11A 4L91A 4CE2A 4U7OA 2VW5A 2XJXA 3KE6A 3ZKBA 2CG9A 3K98A 3T0HA 4LWFA 4Q20A 3TZ5A 4MPCA 4YKZA 5D7CA 2YKEA 1IXMA 3B24A 4DZYA 2EXLA 3QDDA 3CRLA 2CCUA 5F5RA 4EEHA 2XHTA 2Q8HA 1AMWA 3GIGB 4H85A 4HZ5A 4PRXA 3HZ5A 2ESAA 2CCSA 5M4PA 4MPEA 1ZXMA 4KP4A 3HYYA 2Q8GA 3CGYA 3BMYA 4FCQA 2ZDXA 3Q5KA 2P67A 1UYEA 4X9LA 3PEHA 1UYFA 2XD6A 4XDMA 5CTYA 1QY8A 3CGZA 4PU9A 3CWVA 3ZKDA 1YC3A 1B3QA 4HXWA 4MB9A 2XK2A 3INWA 5BODA 3A0WA 2WEQA 3ZRWA 2YKJA 5CTWA 3FT5A 1AJ6A 1YC4A 5J6AA 2XCMA 4DUHA 4JASA 3TZ2A 2XJGA 4BXIA 3NMQA 4GEEA 1UYLA 4XITA 1QYEA 2VCJA 3TTZA 3ZCCA 4H7QA 1TC6A 4XKKA 1I5DA 2YE8A 1KZNA 2YKBA 3CRKA 4YKXA 2YGAA 3TK1A 1YERA 2ZDYA 3A0YA 3EKRA 3R92A 2O1UA 2YE9A 4E01A 1EI1A 4XE2A 3U2DA 2YEIA 5FWKA 2XDKA 4EGIA 1UYMA 1OSFA 2CCTA 4HY1A 1ID0A 3P32A 1UYCA 4L93A 4GFNA 4KSHA 4PRVA 1THNA 2XX5A 4FPPA 2Q8FA 1BKNA 3D2RA 4O04A 4XIPA 3EHFA 2YKCA 1Y8NA 1NHIA
chains in the Genus database with same CATH superfamily
4YY3O 4JQLA 2GFDA 3ABUA 3BRCA 3STLC 4DW1A 3K97A 3ZS8C 2OWOA 5D7DA 4K0KO 1EZVH 2XHXA 2XOKG 2JGUA 3B09A 3ML0A 1TIDA 2JK5C 4XKOA 5D5QA 1WN7A 3HZ1A 1H8EG 4NVPA 4NKGB 1K92A 1N0JA 3W7UA 2D3OW 1SZTA 1EBOA 4LFCB 2BZ5A 3VADA 3ZIAG 3IEDA 1VIBA 2BU6A 4ASGA 2PTMA 4JZ2A 3APOA 3K5OA 4B08A 2Q7GA 3ZMSA 1BYQA 4ZOLB 2YI5A 4DV4O 1YT1A 3G6EV 2ZXWC 2X0LA 4RQFA 4K35A 1YT0A 2Q8IA 2YGEA 5IJ9B 1QBZA 1WP8A 1H2KA 3UCSC 1EN4A 2YKIA 1LUWA 4UXNA 5LOVA 3ZM7A 5C8YA 1MMMA 2XDXA 1FXKC 5CB4A 3P3NA 2ADPA 3T10A 2EIJC 2H8MA 4FFBB 3MNRP 3EHBB 1NR1A 3FB5C 3RLPA 1SQQH 1LUVA 4X1YA 2FYPA 1ZWIC 3GIFA 4CE3A 1I59A 4DV1B 4XIRA 3O9OA 4I5SA 3N2KA 1EFRG 2O1WA 5BR8B 4JGSA 2FYUH 2YEHA 2ZBKB 1FFXA 2XX4A 5IWAO 4I9QA 3E8GA 5LXTA 3JZ3A 4UVAA 4KQVA 3T1KA 1M56C 4E00A 1QNMA 1YETA 4B7PA 5B1NA 2A9HA 1DK1A 2R9RB 3O2FA 3UT5B 4FCPA 1HR0O 3CCJV 3OFNG 1MU5A 3ASOC 3D8CA 1QHTA 2AKPA 2DWDC 1UY7A 2UXCO 5IDJA 1YZBA 4X65O 5LHIA 2HG1A 1XNQB 5GW7A 5CA3A 1AI6A 1H2LA 2VCIA 1KIJA 1R3JC 5KHIA 3G7BA 4HY6A 3RYIB 3K06A 3D36C 5IJ0A 3R4PA 4YKYA 2Y69C 3BY6A 2DYSC 3LNUA 4B7EA 4DR1B 2EX3A 4WFFA 4ZI7B 2QG0A 1G6UA 4BIOA 4BQGA 3MHHC 4LWSA 4XD8A 4KUMA 2EIKB 2BU8A 3INXA 2JKIA 2WI5A 4DR2B 5LGNA 1TA8A 3WU2Z 4B6CA 2MK3A 2RJZA 2GQPA 3A0XA 3K0DA 2A06H 4O0BA 1UYHA 3K9AA 1VQNV 1ZX3A 1TUBB 4QPKA 1D5NA 4XDLA 1MNGA 3H1IH 3K5MA 3CRQA 1KKCA 2YXLA 4WUDA 2QTOA 1WA8B 3RYFB 4JPRA 4LH7A 4O4IA 5J9PC 3C0EA 1N36B 4WFAV 1ZUQA 3SL2A 2UXNA 2XAFA 1XL6A 4MTXA 3TETA 1YJ9V 2BREA 2ADQB 4LP0A 1EA6A 4J11A 2YEVA 3WQ9A 1H2GA 2R9AA 1JVMA 3WB0A 3JAMN 3DSQA 4L8JA 1I5XA 4UFZA 2WWWA 1XNRB 1KMIZ 3X2QB 1B06A 3B4SA 2AHYA 1BQ0A 2BTQB 4O2AA 4D6TH 5FPOA 3A0RA 1SA0A 2F93B 2RMKB 5EYPB 4ZIBA 4RQEA 5B3SC 1NBMG 5EC1C 2DJVA 3HHUA 1R3KC 3H01A 4OXSA 4C7UA 3A0ZA 2OIEA 5IYCO 1J95A 2PGGA 1UJWB 2XDUA 3PEJA 4CWPA 1F4MA 4DRXA 4MTOA 3B27A 3KCXA 2YEAA 2ZR2A 1JOYA 5FLXN 1JX9A 1J5EB 4Z1MG 4JYAB 1NVPD 3CCUV 5EIBC 2FWZA 5L3JA 5GONB 2R9IA 4CS4A 4LFBO 2FKXA 3LDDA 4HBNA 2UU9O 3ASNC 1UYIA 3RVZA 1IBMO 4KXRA 3ABKC 4DV3B 4LF4B 1BGYH 3S5TA 4MVUA 1N33B 4MVOA 4TUYB 1TILA 4MPNA 4EGHA 3ZRVA 1HWYA 1AVMA 2HVKC 4NB5A 1OJHA 3CRRA 2IOQA 1WB8A 4R7CA 1KUQA 4YJ3B 1IXBA 4WF9V 4IYIA 1TVKB 1AI5A 1GMGA 1NH2B 5FNDA 2F66C 2YUAA 2QKCA 5KHJA 1KC8W 4RUEA 4GKJO 5LHGA 3U11A 2ZXWB 3ZHRA 2JEXA 4XIQA 4F4LA 3H4LA 1Y8OA 2CH4A 2QKSA 3OE7G 3BM9A 2VRZA 3ZRWB 1Y74A 3ABLC 1SQXH 5M4HA 2EIMB 2YEBA 1IBKO 1I08A 2LFRA 1X4TA 1IBLO 1FXKB 3VHCA 1SQGA 5M4KA 4DV5B 3WG7C 1FXVA 2XAGA 2XDLA 2ZE5A 1YC1A 2CDYA 2ZM6B 1GN4A 1M93A 1N0NA 2QM8A 3OW6A 2X6AA 5JQGA 2Q5ZA 4PI0A 3PJSK 5AG2A 2WI6A 1AJQA 5JH7B 1GM8A 4HZ0A 2KB1A 2ZQMA 1XI1A 1FPOA 2WA4A 2FB5A 4NYKA 5H6RA 4NXNB 2XX2A 4GKKO 2CTWA 4YY3B 1S5JA 1Q86W 1GN6A 1GRJA 3FB8C 2CK3G 3FT8A 3D0BA 3RKZA 4MOTA 4YKQA 4K0KB 2XAHA 1BZKA 3IJ4A 3TXQA 5IY5B 4JV5O 1YS3A 4CE2A 3AK2A 1YVWA 3B28A 3W7TA 5EBLC 5KMGB 2OYQA 2XJXA 1VQLV 4UCVA 4PI2A 4PDVA 3ABMC 2CG9A 2HJDA 3T0HA 3E8HA 4Q20A 3TZ5A 3OMNB 4YKZA 5D7CA 3E86A 4J42A 4W4KA 3QDDA 4EB6A 3DTUB 4JI2O 2CCUA 2ZDIC 5F5RA 2Y69B 3ETGA 1UPGA 2XHTA 2Q8HA 1NQTA 1AB3A 4UCRA 3AG1C 1QR9A 2E75B 4PRXA 4DV4B 2WLIA 3VQWA 3OEEG 3TCUA 2ZDXA 3Q5KA 1UYEA 5CTYA 1UYFA 2XD6A 2EZOA 5HFMA 1Y76A 4CZZA 2EILB 3CXCU 2JDIG 3K5NA 4MB9A 4O2BA 1GN3A 1Q8IA 3RW0A 1XDCA 1JPXA 1P84F 2DOSA 4IGGA 2DWEC 5BODA 3K5LA 1VF7A 4OGQB 3STZC 4FM0A 2WEQA 2YKJA 4P9PA 2OCHA 1AJ6A 5KUKA 3OTFA 1AILA 5LP6A 4X89A 4MW8A 4BXIA 3AG7A 1G1XB 4GEEA 4XITA 3JARA 4EKWA 5LOVB 2JIZG 4XDJA 2JVDA 1QR8A 5CB4B 5IWAB 4Q6GA 4I0XA 1YJWV 3BHPA 2DYRC 2Y0IA 3CRKA 4CS2A 4YKXA 1YERA 4RO2A 4X1YB 5IYBO 1HR0B 2IJHA 4XE2A 3N2KB 4TT3G 4DV7O 2XDKA 4EGIA 1VEWA 1OSFA 1FFXB 5KX5A 2UXCB 2HKOA 1ID0A 4X65B 3G67A 5LXTB 4X66O 1JA8A 1FYJA 2LGQA 5EK0A 2AZ2A 2XX5A 2QWRB 3H1JH 1T5EA 1N32O 3QO7A 4XIPA 3E22A 2JS5A 2OCCC 2YKCA 4N21A 3CMEV 1FJGB 1Y8NA 2XT9A 3SYQA 3SJQC 4O4LA 1GM9A 4N23A 4QPJA 5JJEB 3CEIA 1MX0A 2ZNIA 1GKXA 1UYDA 2NNUA 1Q5OA 3BVOA 1V54C 4ASBA 3ABKB 2LFSA 3GIGA 1NZ6A 1JFFA 3JAKA 5IJ0B 3EKOA 3U67A 3K04A 4J10A 1YJNV 4WFHA 3EHHA 3CXHF 1I7FA 4NH7A 5BMVA 4LWSB 1HNWO 2YDEA 3OWDA 2QG2A 1OCRC 4J41A 5LGUA 3QO5A 5IYZA 1SQFA 2VS0A 4YIOA 4UVCA 3CCQV 2Y48A 3G7EA 3KKYA 4DR4O 1TC0A 4QNHB 2IWXA 4LF9O 4I9WA 1N34O 4HNAA 2Q0AA 1F51A 1JJOA 3K57A 1BCCH 2YIBD 5LMUO 2WSSG 2WI7A 3ABLB 1K4CC 4UV8A 4O4IB 1VF6C 1U97A 2AW9A 2EBOA 4FFKA 5LP6C 4CH3A 3SJCC 3BA9A 1ENVA 2YEVB 2JRIA 3SYAA 2Q4PA 2E76B 3CPWU 2H8PC 3A8TA 3RLRA 5JCOC 1S3JA 2RDCA 1Q43A 2XHBA 1Y4SA 2R70A 3WHAA 4O2AB 3K60A 4GGLA 4O07A 5CBFA 4WFEA 1SA0B 1E79G 1SC5B 1WPXA 1XL4A 2LP7A 2YE5A 4JAAA 2Q67A 1R62A 4DUZO 4D7TA 4B3TO 3J81N 3B8NA 2IORA 4DO2A 4ASAA 1I94O 2JGDA 3LNMB 2CUGA 2P5OA 1XMOO 3M8AA 2YEGA 2UU9B 2QFOA 2XDSA 4DRXB 1IBMB 4P30A 3JAWA 3SYPA 3CC4V 4YHHO 1GO3F 3ABMB 2YE3A 3CHXA 4R3MA 4GYCB 4L94A 3SPGA 2CAZC 4QE7A 3LSUA 3JATA 1I5BA 2NLJC 4B3MO 2HP8A 2HVJC 5JJJB 2YK2A 1V55C 3E83A 1YCIA 2YC0A 3FX7A 4GKJB 4JI0O 4NXMB 4CWSA 5FNFA 1JCHA 2PI5A 2IW5A 4W7TA 2YSUB 3R4NA 1Y67A 3SR2C 5BY1A 4EEQA 3D3QA 3BCCH 4UB6Z 2YEJA 3HB3B 1IBLB 1XHZA 1K8AW 3RGBA 3D36A 4E4EA 1HNXO 4O4HA 3OWBA 3R66A 4FCRA 2ODMA 4ICGA 5B1AC 4H44B 1AP6A 2KQXA 1NTZH 2QA4V 3UKMA 5C93A 4X1KA 4EM7A 3N2GA 1I58A 2FWYA 1Y74B 3CCLV 2R72A 4XC0A 5L3FA 3IAYA 1S5LZ 3O6OA 4JI5O 4URNA 4GKKB 2GBOA 4QGPA 2DYRB 4JI4O 3RVYA 2YI7A 5IN9A 1K73W 2IH1C 4DR6O 3EFFK 4J9YB 2YJXA 1OCCC 4FK5C 2YEFA 5JQGB 5KAIZ 2HHIA 2V7QG 3K58A 1QZRA 4JV5B 2KG7A 4AWOA 4BQJA 1LNQA 1Y4UA 2WLMA 2XABA 3NR7A 2UUCO 4DYLA 5LYJA 2Q8VA 3RYCA 3D3IA 4PDMA 4BWAA 1NJIW 3E8FA 3T0ZA 3P3PA 4JI2B 3OTOO 2YJWA 4DR7O 2O57A 4G27B 5H5NA 5KAFZ 1UFIA 3CCMV 3J7AU 1A32A 1L8DA 1RP3B 3JD2A 2WI2A 3Q5LA 2EINC 3AG4C 2BE3A 3APQA 3DGEA 3CP1A 2D2CB 5JWPA 4X20A 1H2MA 3ZMUA 4X1IA 4RAIA 1KD1W 1JJ2U 4K3AA 4JTCB 2XNDG 4EB6B 1BQZA 4JYYA 2UWDA 4XTJA 3SJBC 4DR5O 3CB2A 3L72H 1XHXA 3RLQA 2WLHA 2YI9A 3EHGA 4IT5A 4YKTA 2WLIB 5H2FZ 3HKCA 3C90A 2WPDG 2ZT9B 3ZN0A 3SDLA 1Y76B 2CGFA 4CWNA 4JAVA 4CS3A 4AILC 1Q6HA 1R1BA 2IBZH 2P4KA 1XBLA 4V25A 4O2BB 4Z1VA 3ETQA 2ZKJA 4URMA 2GTSA 1K97A 4AI8A 2PYJA 4DUYO 4H0LB 4PELA 3F5TA 2B1GA 2CE4A 2P6JA 2NN4A 2XASA 4WFGA 1RSOA 5KA6A 1QLEC 4DV6O 4LWEA 5L3CA 2XAJA 5GTIZ 4LF7O 3VOUA 5LP6B 2Q69A 4ZKIA 4DV7B 1JMKC 4YKRA 3JARB 1B63A 1PL4A 3W7SA 1NI8A 4MTFA 1GAXA 3DC5A 3T4DA 4I0XB 4X66B 2E0AA 1Q6UA 1PD3A 4DR3O 1VQ8V 5BZBA 3LSSA 1P4RA 1N4CA 2IOPA 3AK3A 5M4MA 1N32B 3ETEA 3VQXA 1E1RG 1K7DA 3OUSA 3LDEA 3MDSA 3OM3B 4J7JA 5EIBD 1Z59A 4E72A 3KZIZ 3FAVA 2IJIA 2QEXV 1K5QA 5CPHA 1H2NA 2X6CA 3B26A 1SF9A 5KX5B 2JJCA 3AG2B 4B3RO 3LPSA 2IWUA 2PF4E 1AM1A 3SPIA 4GT1A 2N04A 5D6PA 2P4VA 4HAMA 2QGNA 5B5EZ 2YGFA 4L91A 3FV5A 4U3JA 5A2QN 1IVSA 3IC9A 4U7OA 4AQYO 5KUMA 3KE6A 1R3IC 2CH7A 2WLLA 5KA5A 3HKEA 4Z2WA 4MTGA 2HHHO 4O4LB 1HNWB 4LWFA 4RUFA 1CXZB 4H33A 3W7WA 1IXMA 4CC5A 4DZYA 3CRLA 1R73A 4PA9A 4JI1O 4X9QA 4DR4B 3CMAV 2BOBC 3GIGB 4HZ5A 1JFFB 3JAKB 1VQ7V 4B3SB 1Z5WA 2ESAA 1N34B 5M4PA 5BMVB 5K1XA 2QDOA 5LMUB 3BMYA 2P67A 4X9LA 4XDMA 3OEHG 5IYZB 2QR4A 3CCRV 3F5WC 1XUQA 3JD3A 3ZKDA 1PNMA 1R6TA 2Y0PA 3FYIB 2ZDIA 2XK2A 5EBWC 5J2UA 1VQ6V 2LGWA 5B1AB 3A0WA 4HNAB 3FT5A 1SQBH 1MG1A 5J6AA 3F7VC 4DUHA 4LCUC 1MABG 4PV1B 3NMQA 1UYLA 3TTZA 4UCUA 3ZCCA 4H7QA 3CC2V 3L70H 1I5DA 1Y6XA 3M99B 4DUZB 1DF4A 4B3TB 2QE7G 1OCCB 2DMXA 3TK1A 2ZDYA 1G8MA 4LBEC 1I94B 3R92A 2O1UA 1XMOB 1EI1A 2N05A 3U2DA 4MS2A 2ZKOA 2XUMA 1UYMA 2CCTA 4LF5O 2LW1A 4YHHB 5DECA 2GTAA 2E5LO 2QM4A 4FIPC 1B6QA 1UYCA 4WBNA 1WLEA 2EIJB 2QWNB 1SS3A 4GFNA 4PRVA 4FPPA 4ZBMA 1L0NH 3D2RA 2JGDB 3QG5A 3ZMTA 4B3MB 2W6IG 5DM6V 5TISZ 3H1KH 1XREA 1NHIA 2M6YA 1KP2A 1I5CA 4CWQA 3JAWB 1BT8A 3ZX6A 4MBCA 1Z5BA 3G80A 3JALA 1DTOA 2EINB 3AG4B 3JSLA 4IL6Z 2WEPA 1AR5A 1M56B 4BIUA 4L87A 4QJFB 3JATB 2DW4A 4CWRA 4TOIA 4DV2O 4U3FH 3VQYA 4LFCO 1V9PA 3ASOB 1HNXB 1NTKH 4CH6A 2B9ZA 3Q4HA 3JD1A 3VBBA 4GCZA 4AWQA 1UYKA 3HR0A 1B62A 2QKAA 1PNLA 2H3OA 1IURA 1A4HA 1NHHA 3SPJA 4GLXA 4MVMA 2ZE7A 3AG3C 4MVZA 3ZRXA 1S16A 4NH9A 3CJHA 3THOA 1EN6A 1S5HC 5BOCA 4O4HB 5CTUA 4QE9A 2DYSB 4TQFA 2B1IA 4JI4B 4DR6B 4ABMA 4XBFA 1JQ0A 1E1QG 4X1KB 1YEWA 1OZ0A 4U7NA 2HKJA 3N2GB 2YI6A 4PA7A 3OW2U 1ZLZA 2AXTZ 4E2LA 1GN2A 5CN0A 1YT2A 4JZGA 1X59A 1ZAUA 4LF6O 3H1HH 3JASA 4FLTA 1ZWHA 4NTXA 1KECA 2UUCB 2C1IA 1YHQV 2F23A 2YE4A 2IH3C 4ZVIA 3A0TA 3MHSC 4P8OA 2ZD9A 5CTXA 5H6QA 2BYHA 4JI8O 1VF6A 2LQTA 4JYCA 4FVMA 3OTOB 1K3EA 3G71V 1XOUA 2CTPA 2KG7B 4OPHA 3BAAA 5C8YB 1U96A 3SGIA 5LYJB 1YTFB 3WFVA 4NTWA 3RYCB 1MSWD 5JCOA 2HFEC 5LGTA 1ZXNA 2VQEO 4FLZA 2IU3A 1GKFA 2G38A 3CRAA 4TV9A 1GH6A 2YE7A 1AP5A 3VHDA 4DR5B 4YIPA 2RCVA 4EGKA 3K99A 5B3SB 4LH6A 1W0JG 4CH4A 2Q9LA 1KBHA 5K1PA 5CA0A 2ILMA 3CRCA 3HKDA 4X20B 1P7BA 2L35A 4X1IB 2CGOA 4G2KA 1M5IA 2K9PA 2YE6A 3DXRA 4I4TA 4L8ZA 1NR7A 5JVDA 4AS9A 1ROPA 1YI2V 1XILA 3K0GA 1S14A 2HCHA 2E3CA 3HKCB 4BR6A 4MP2A 1TH8A 1P7GA 1VARA 4DV6B 1VQOV 4LF7B 3ASNB 4O4JA 1OHHG 2EJ7A 2UUBO 2FXSA 1PVGA 3TZ0A 4X62O 4DR3B 2F43G 2BSKA 2JJ2G 4WCEV 3E89A 5F2VO 5IDMA 1RSOB 3LSQA 4MVQA 2YI0A 4E02A 4O09A 3TUHA 5JJNB 1WJZA 1MZFA 1AJNA 2IM9A 1K9MW 3HYZA 4B3RB 4B7KA 2A7WA 4I50A 2WAMA 4EFTA 1URFA 5DEDA 1WP7A 4IYHA 3QO8A 3FAVB 5FNCA 4EFUA 2OTLV 4AQYB 1BHBA 2BT0A 1BSMA 2A3QA 3WG7B 2VQFO 2HHHB 1ZSPA 1F23A 1I5AA 4AHCA 4BW5A 3GWOA 5J2TA 1O9GA 4FMTA 1SQVH 2FL4A 4LWGA 5FPRA 3ZMZA 1J5EO 2XTAA 4K4OA 5L3GA 3JCZA 4MVSA 2EJRA 5HFLA 4JI1B 4GT8A 1H7SA 2YXYA 2ZE8A 2EIKC 3K03A 4JYBA 1RPOA 3L9DA 4U3JB 4DV0O 3ZXOA 2CH7B 2JEUA 2WLLB 1FAFA 3HKEB 5LA6A 4DV3O 1WB7A 3K08A 2B5UA 2GUZA 1L0LH 4JI3O 1Q3EA 2Z0AA 4GX2A 2L6LA 3R91A 4LFBB 4HYMA 2QF6A 3ZEDA 4JTAB 2F4VO 3L73H 2IU0A 4KL1A 1CEZA 3GIEA 2WLKA 3CCVV 1SETA 4DXWA 4UCOA 2K5BA 4ASFA 3T2MA 3CCSV 3GB7C 4MT8A 5L3DA 4OX9O 3FFQA 3AG3B 3ZMVA 2ITDC 4J7ZA 4EMVA 3OMUA 3CC7V 2OIGA 2GSMB 1SQPH 5J2UB 2YE2A 5EZYA 3AG1B 3O0IA 4FZ1A 1MZEA 2QSAA 1VQ4V 2CTRA 1SESA 3T1YO 1BXDA 4CH5A 1R3LC 4LF5B 1IBKB 4TSFG 4YXWG 5M4EA 2E5LB 1CPYA 1YSRA 3HKBA 3EHJA 3A0HZ 1BS3A 4X64O 1GKZA 2JJ1G 3UQ8A 1NHJA 3T1CA 2VWKA 1O9HA 5IE9A 4XCJA 1RM1C 3OPDA 2Q6AA 3IGAC 2EZPA 4R3AA 3T2SA 3L75H 3TXSA 4WBNB 4CBCA 1KB9F 4LR3A 5L3EA 2H55A 4JI6O 3LMMA 3Q5JA 4KTNA 1MSDA 4K8XA 4DV2B 2V1DA 1YESA 1UYGA 1RFYA 3SPCA 1VQPV 4IIJA 4BW9A 2W0FC 3CSXA 1W2BU 2BCCH 3P30A 1AI4A 3R65A 1H8HG 1K34A 2H94A 2ZCEA 3GVMA 2WA3A 1YSCA 4KFMA 3JALB 1EM1A 4PHZA 4CC6A 2MW2B 1P49A 4MPCA 1SZXA 2LO1A 4UV9A 4NR1A 5FNVA 3B24A 1NKDA 1D5AA 2EXLA 1DF5A 2A0LA 4EEHA 1Q82W 1HDJA 4IHJA 1AMWA 2OCCB 3HZ5A 1PM9A 2GDSA 2Y4UA 3CRMA 2CCSA 3RYHA 4A5UB 1ZXMA 4KP4A 4MSWC 3Q4HB 3CS5A 2HJFC 3CGYA 1KYOF 3OGIB 3CCEV 2EIMC 3K79A 3ZRSA 3ZBHA 1B3QA 1V54B 5H9CA 5EC2C 4ASUG 2PYLA 5L3BA 3CJHB 4LF6B 4FLWA 5CTWA 1QCEA 4FLYA 4TQDA 3JYCA 5CA1A 5GTHZ 1YC4A 2ZE6A 1OCRB 4JASA 2XJGA 2RQ6A 4YJ2A 4BAYA 4JI8B 1M1KW 1QYEA 1TUEB 1S72V 1YTFD 2P7TC 2W0XA 4LF8O 1TC6A 2UUAO 2N74A 3EXAA 1G4YB 2KSDA 2YE8A 3JASB 1KZNA 5FL7G 4KHPO 2YKBA 1BE3H 2YGAA 3BFRA 5IY5C 3A0YA 3C3SA 3RFRA 2YE9A 1FKAO 2VQEB 3CD6V 1XMQO 3OR6C 4P9OA 1EZJA 4HY1A 3P32A 4L93A 2ZINA 4J80A 4GUNA 3ETDA 1FJGO 4JF3A 1VQKV 1IDSA 1BKNA 2HEPA 3ZHTA 3EHFA 4NTYA 3CE2A 1DLBA 4LFAO 4ZHQA 4TV9B 1Z5VA 1Q90D 2PY5A 1QQCA 5F3KA 4JAUA 1R6NA 4PJ0Z 2V4DA 1VP7A 2EILC 2ETNA 3LNNA 2KKWA 4JI7O 3U2KA 1NS1A 3HEKA 3B77A 3VHAA 5CA0B 1HNZO 1FXHA 3HKDB 1ZL8A 4AWPA 1XEQA 2WI3A 2Y4TA 3BPZA 1SRYA 1AR4A 3DXRB 4I4TB 1VMGA 4YKUA 2ATKC 5JVDB 2P06A 3E22B 4F6RA 2UUBB 4J9ZB 2XHRA 3B8MA 2YEEA 1PPJH 5GGZA 4X62B 3FB7C 4HYPA 5D5PA 3N27A 3CX5F 1JM6A 4UB8Z 3WB1A 2HR3A 2IJKA 1BHAA 4URLA 1V55B 4X88A 2QWQB 4O4JB 2UXBO 4UVBA 3U10A 3RN4A 5KLVH 4QIWF 1M4UA 4LF9B 5KHHA 1THZA 3OT7A 3H80A 4LWIA 1M90W 4CE1A 2BSKB 1DGSA 1OV9A 1U0ZA 4LC1A 1Z5AA 2UXDO 2ARHA 4FLUA 4G28B 1M57C 1QVFU 1NU1H 2P90A 2PUSA 5M4NA 3MD0A 1WPBA 2YIDA 4DK1A 1PKXA 3FYEB 1K5SA 1GK9A 1QU7A 2BYIA 1OCZC 2CTQA 2VWCA 4XKAA 3ICXA 5A9GA 2VQFB 1HP8A 4I50B 5ITZA 4LNUA 1JR9A 2W6JG 4I3HA 2DN9A 3T1HO 1S0VA 1OCOC 4TV8A 5D7RA 4GQTA 1VF5B 4FLVA 4I55A 1RM1B 1YIJV 4DV0B 1HW7A 4PA6A 5E1AC 2BTZA 2IWSA 3TZ4A 1K33A 3QTCA 1US6A 4MP7A 2GV9A 4W4LA 4EFEA 4JI3B 5J2TB 1Q7YW 1ORQC 3RWRD 2A79B 3ZHSA 5CF0A 4PD4F 2ITCC 1KP3A 2BU5A 1Z5CA 1Y8PA 2Q7EA 3UO2A 4KSGA 3SPHA 2F4VB 1SERA 1PV0A 2BTOA 2PNRA 4R1FA 1MOFA 4HXZA 5LA6B 4O05A 1YSZA 2WI1A 1KQSU 4PA3A 1GM7A 4NXMO 3R4OA 2GUZB 4K8ZA 1YDXA 2O1VA 3JD4A 5LMNO 3OGCC 3SYCA 4R8CA 4OX9B 4FLXA 3R4MA 2P22C 1L0OA 2X7RB 2BU2A 4HZ3A 2WI4A 4H37A 4GZRB 1UY9A 1TAEA 1BGQA 4R6ZA 2YK9A 3NXSA 4JI0B 4XCLA 4HYOA 1U2OA 1WAZA 1BL8A 1IX9A 4CWOA 4OPAA 3T1YB 5B1BC 1LR1A 1US7A 1AROP 3QF7A 4BAEA 4ZOLA 2FTKA 4UROA 1VQMV 2E74B 4RWUA 4D7SA 3OMAB 3OMIB 2M7WA 3BA8A 2BRCA 1BMFG 1Q6IA 1AH6A 5EZYB 3UO3A 5IJ9A 2Q2EB 5B66Z 3ABTA 3K59A 3CWBH 3C3TA 1YITV 4KFGA 4X64B 3OR7C 4I7ZB 2WERA 3CYGA 3KG2A 4FFBA 3G4SV 2XJJA 1IZ3A 3IC7A 2IJJA 2VWJA 4BIZA 4JI5B 5D6QA 1KU9A 2LJ2A 4H81A 3HKBB 2FMLA 4JI6B 3B25A 2AHZA 4P2ZA 1NT2B 1MA1A 2Q7HA 1QLEB 5KHGA 3ZHVA 4JTDB 5CBGA 4F6EA 1W59A 1AH8A 2QTSA 1ZTEA 1H2SB 5LHHA 3UT5A 3BABA 2BOCC 2YECA 1AR1B 4DV1O 1H7UA 3HPLC 3OUFA 3S3WA 3L71H 3QNEA 5BR8O 1QVGU 3RT3C 2YEDA 3G6BA 4IIJB 5LL6Y 3H9VA 1PP9H 2Z5UA 4DR7B 5CMUA 2RN9A 3JSNA 2RNBA 4YKWA 3S3XA 3RYIA 5FNVB 4WUCA 2QJ1A 4LPBA 3M7MX 4LP8A 4L90A 4ZI7A 4GX5A 4LWHA 3FB6C 1R6KA 5DN6G 4IHJB 2Q0OC 2YS8A 1XNQO 3PN1A 3RYHB 2HLDG 3SYOA 3OAAG 2OTJV 4UUJC 2NR5A 4PL9A 5IYDO 1TUBA 3OD4A 2BSMA 4J7KA 1KKDA 4DR1O 1TBWA 2QM7A 4LF8B 1B04A 2UUAB 4R50A 1WA8A 3RYFA 3I56V 4PA4A 3U0ZA 4DR2O 5B1OA 2DQ0A 3A2FA 4PDLA 4KHPB 1ZW9A 3F7YC 4CWFA 1PL0A 5CA1B 3ZXQA 4DUYB 3QTFA 1M57B 1VQ9V 5J71A 2K1EA 1AI7A 4TWKA 4YJ2B 1UY6A 1XMQB 3JCUZ 3E2EA 1YF2A 2EULA 2F95B 4U93A 4CWTA 2YI8A 1OCZB 2HG5C 2ZR3A 1I5YA 3IFXA 4WUBA 2UXXA 1QLNA 3TJTA 1N36O 2XAQA 2CGNA 4NH8A 2BTQA 2YXHA 3KCYA 1F7YA 3VQVA 2YIBA 4FM2A 1OCOB 3ZN1A 5EYPA 4FM1A 1UY8A 5BXZA 3K3WA 2PZSA 3TGUH 4WFBV 4LFAB 4EFBA 4V26A 2BU7A 1XNRO 3E8BA 4FZ0A 5JENA 2DQ3A 4P7AA 4GX1A 3B40A 4JI7B 2YIAA 3H1LH 4UCSA 1HNZB 2QWPB 2C2AA 3FKSG 1GJVA 2WLJA 1RPRA 3G75A 2DE0X 3C11A 1PNKA 5LBQA 2VW5A 3ZKBA 4ZHQB 2C1GA 3W7XA 3K98A 1WNSA 1FD9A 2ZIOA 3JD0A 3BEHA 5GONA 3I5DA 2OT5A 3B2EE 2YKEA 2X6BA 3O65A 2Q68A 4DW0A 4B3SO 1CP9A 5IT9N 3L74H 3RBZA 1GTOA 2QWOB 3K9SA 1S76D 4TUYA 1ZL8B 3J80N 2ZNJA 3ZHUA 4H85A 4UCTA 4H13B 1W0KG 4XDKA 3T4ZA 3CYOA 2UXBB 4JYAO 1K4DC 4MPEA 4YJ3A 4F6RB 3HYYA 2Q8GA 4FCQA 1TVKA 1COWG 3PEHA 5B1BB 3ZJZA 1QY8A 3CGZA 1N8RW 4PU9A 3CWVA 4LF4O 1YC3A 3AK1A 1NVPB 2UXDB 1N33O 4HXWA 1VQ5V 3ZHQA 2Q73A 4DK0A 2AZ0A 3INWA 3MAQA 3LDCA 4MVRA 2JS3A 3WB2A 1XQ8A 1H38A 3GWKC 3ZRWA 1Z2GA 2XCMA 1FFTB 1FS0G 1I0HA 4PDRA 1AJPA 5EBMC 4GX0A 2PI4A 3TZ2A 1EN5A 1FXKA 3T1HB 1L1FA 3I55V 2VCJA 3AG2C 1S77D 1YXBA 3QVNA 5CBHA 4XKKA 4MW3A 3EVKA 1Q81W 2Z3YA 3A0BZ 3X2QC 5JH7A 3EKRA 5E79Z 4E01A 3E35A 5ITZB 1M9NA 4LNUB 1SKVA 1D2DA 1NH2D 2YEIA 5FWKA 1TGOA 4DV5O 1F4NA 4TV8B 2YICA 2GHYA 3SJAC 2LW7A 4I55B 2ZM6O 3UM7A 1NTMH 3FD9A 5KHKA 3AEIA 2ZIMA 2F1MA 4KSHA 1THNA 3LUTB 2AGAA 2WLNA 2Q8FA 4FJCC 1Y66A 3DC6A 4O04A 4X8AA 5LMNB 1Y4MA 5KMGA 4NXNO
chains in the Genus database with same CATH topology
4JQLA 2GFDA 3ABUA 3STLC 3K97A 5D7DA 2XHXA 2XOKG 1TIDA 3ML0A 2JK5C 4XKOA 3HZ1A 1H8EG 1K92A 3W7UA 2D3OW 1SZTA 1EBOA 2BZ5A 3VADA 3ZIAG 3IEDA 2BU6A 4ASGA 3ZMSA 1BYQA 2YI5A 1YT1A 3G6EV 2ZXWC 2X0LA 4RQFA 1YT0A 2Q8IA 2YGEA 1QBZA 2YKIA 4UXNA 3ZM7A 2XDXA 1FXKC 3T10A 2EIJC 2H8MA 3MNRP 3EHBB 1NR1A 3FB5C 3RLPA 2FYPA 1ZWIC 3GIFA 4CE3A 1I59A 4XIRA 4I5SA 1EFRG 2O1WA 4JGSA 2YEHA 2ZBKB 2XX4A 3E8GA 3JZ3A 4UVAA 4KQVA 3T1KA 1M56C 4E00A 1YETA 4B7PA 5B1NA 2A9HA 2R9RB 3O2FA 4FCPA 3CCJV 3OFNG 1MU5A 3ASOC 2AKPA 2DWDC 1UY7A 5IDJA 5LHIA 2HG1A 5GW7A 5CA3A 1AI6A 2VCIA 1KIJA 1R3JC 3G7BA 4HY6A 3K06A 3R4PA 4YKYA 2Y69C 3BY6A 2DYSC 3LNUA 4WFFA 2QG0A 4BQGA 3MHHC 4XD8A 4KUMA 2EIKB 2BU8A 3INXA 2JKIA 2WI5A 5LGNA 4B6CA 2MK3A 2GQPA 3A0XA 3K0DA 4O0BA 1UYHA 3K9AA 1VQNV 4QPKA 4XDLA 4WUDA 2QTOA 4JPRA 5J9PC 3C0EA 4WFAV 3SL2A 2UXNA 2XAFA 1XL6A 4MTXA 3TETA 1YJ9V 2BREA 4LP0A 1EA6A 2YEVA 3WQ9A 1H2GA 1JVMA 1I5XA 2WWWA 3X2QB 2AHYA 3A0RA 4RQEA 5B3SC 1NBMG 5EC1C 3HHUA 1R3KC 3H01A 4OXSA 3A0ZA 5IYCO 1J95A 1UJWB 2XDUA 3PEJA 4CWPA 1F4MA 4MTOA 3B27A 2YEAA 2ZR2A 1JOYA 1JX9A 4Z1MG 1NVPD 3CCUV 2FWZA 5L3JA 2R9IA 3LDDA 3ASNC 1UYIA 3RVZA 3ABKC 4MVUA 4MVOA 1TILA 4MPNA 4EGHA 3ZRVA 1HWYA 2HVKC 2IOQA 4R7CA 4WF9V 1AI5A 1GMGA 1NH2B 5FNDA 1KC8W 4RUEA 5LHGA 2ZXWB 2JEXA 4XIQA 4F4LA 3H4LA 1Y8OA 2CH4A 2QKSA 3OE7G 3ZRWB 3ABLC 5M4HA 2EIMB 2YEBA 2LFRA 1FXKB 3VHCA 5M4KA 3WG7C 1FXVA 2XAGA 2XDLA 1YC1A 2QM8A 3OW6A 2X6AA 3PJSK 2WI6A 1AJQA 1GM8A 4HZ0A 2KB1A 2ZQMA 5H6RA 2XX2A 1Q86W 3FB8C 3FT8A 2CK3G 3D0BA 3RKZA 4MOTA 4YKQA 2XAHA 5IY5B 1YS3A 4CE2A 3B28A 3W7TA 5EBLC 2XJXA 1VQLV 4PDVA 3ABMC 2CG9A 3T0HA 3E8HA 4Q20A 3TZ5A 3OMNB 4YKZA 5D7CA 3E86A 3QDDA 3DTUB 2CCUA 2ZDIC 5F5RA 2Y69B 3ETGA 2XHTA 2Q8HA 1NQTA 3AG1C 1QR9A 4PRXA 2WLIA 3OEEG 3TCUA 2ZDXA 3Q5KA 1UYEA 5CTYA 1UYFA 2XD6A 2EZOA 5HFMA 4CZZA 2EILB 3CXCU 2JDIG 4MB9A 3RW0A 1JPXA 5BODA 2DWEC 3STZC 2WEQA 2YKJA 4P9PA 1AJ6A 5KUKA 4X89A 4MW8A 4BXIA 4GEEA 4XITA 4EKWA 2JIZG 4XDJA 1QR8A 1YJWV 2DYRC 3CRKA 4YKXA 1YERA 4RO2A 5IYBO 2IJHA 4XE2A 4TT3G 2XDKA 4EGIA 1OSFA 2HKOA 1ID0A 5EK0A 2XX5A 3QO7A 4XIPA 2OCCC 2YKCA 4N21A 3CMEV 1Y8NA 3SYQA 3SJQC 1GM9A 4N23A 4QPJA 1MX0A 1GKXA 1UYDA 2NNUA 1V54C 4ASBA 3ABKB 2LFSA 3GIGA 3EKOA 3U67A 3K04A 1YJNV 3EHHA 4WFHA 4NH7A 3OWDA 2QG2A 1OCRC 5LGUA 3QO5A 4UVCA 3CCQV 2Y48A 3G7EA 1TC0A 4QNHB 2IWXA 4I9WA 1F51A 2WSSG 2WI7A 3ABLB 1K4CC 4UV8A 2EBOA 1ENVA 2YEVB 3SYAA 3CPWU 2H8PC 3RLRA 1S3JA 1Y4SA 3WHAA 3K60A 4O07A 4GGLA 5CBFA 4WFEA 1E79G 1WPXA 1XL4A 2LP7A 2YE5A 2Q67A 1R62A 3B8NA 2IORA 4DO2A 4ASAA 3LNMB 2YEGA 2XDSA 2QFOA 4P30A 3SYPA 3CC4V 1GO3F 3ABMB 2YE3A 4R3MA 4L94A 3SPGA 4QE7A 1I5BA 2NLJC 2HVJC 2YK2A 1V55C 3E83A 4CWSA 5FNFA 1JCHA 2PI5A 2IW5A 4W7TA 2YSUB 3R4NA 2YEJA 3HB3B 1K8AW 3D36A 3OWBA 4FCRA 5B1AC 2QA4V 3UKMA 5C93A 4EM7A 1I58A 2FWYA 4XC0A 3CCLV 5L3FA 3O6OA 4URNA 2DYRB 3RVYA 2YI7A 5IN9A 1K73W 2IH1C 3EFFK 4J9YB 2YJXA 1OCCC 4FK5C 2YEFA 2V7QG 1QZRA 4AWOA 4BQJA 1LNQA 1Y4UA 2WLMA 2XABA 3D3IA 4PDMA 1NJIW 3E8FA 3T0ZA 2YJWA 4G27B 3CCMV 2WI2A 3JD2A 3Q5LA 2EINC 3AG4C 3DGEA 3CP1A 3ZMUA 4RAIA 1KD1W 1JJ2U 4JTCB 2XNDG 2UWDA 4XTJA 3RLQA 2WLHA 3EHGA 4YKTA 2WLIB 2WPDG 3ZN0A 2CGFA 4CWNA 4JAVA 4V25A 2ZKJA 4URMA 1K97A 4PELA 2B1GA 2P6JA 2XASA 4WFGA 5KA6A 1QLEC 4LWEA 5L3CA 2XAJA 3VOUA 2Q69A 4ZKIA 4YKRA 1B63A 3W7SA 4MTFA 3T4DA 2E0AA 1PD3A 1VQ8V 5BZBA 3LSSA 1P4RA 2IOPA 5M4MA 3BM9A 3ETEA 1E1RG 1K7DA 3OUSA 3LDEA 3OM3B 1Z59A 2IJIA 2QEXV 1K5QA 5CPHA 2X6CA 3B26A 2JJCA 3AG2B 3LPSA 2IWUA 1AM1A 3SPIA 4GT1A 5D6PA 4HAMA 2YGFA 4L91A 3FV5A 4U7OA 5KUMA 3KE6A 1R3IC 2WLLA 5KA5A 4MTGA 4LWFA 4RUFA 4H33A 3W7WA 1IXMA 4DZYA 3CRLA 1R73A 4PA9A 3CMAV 2BOBC 3GIGB 4HZ5A 1VQ7V 2ESAA 5M4PA 3BMYA 2P67A 4X9LA 4XDMA 3OEHG 3CCRV 3F5WC 3JD3A 3ZKDA 1PNMA 3FYIB 2ZDIA 2XK2A 5EBWC 1VQ6V 5B1AB 3A0WA 3FT5A 1MG1A 5J6AA 3F7VC 4DUHA 4LCUC 1MABG 3NMQA 1UYLA 3TTZA 3ZCCA 4H7QA 3CC2V 1I5DA 3M99B 1DF4A 2QE7G 1OCCB 3TK1A 2ZDYA 1G8MA 4LBEC 3R92A 2O1UA 1EI1A 3U2DA 4MS2A 1UYMA 2CCTA 1UYCA 4FIPC 1B6QA 1WLEA 2EIJB 4GFNA 4PRVA 4FPPA 4ZBMA 3D2RA 3ZMTA 2W6IG 5DM6V 1NHIA 1KP2A 1I5CA 4CWQA 4MBCA 1Z5BA 1DTOA 2EINB 3AG4B 2WEPA 1M56B 4BIUA 4L87A 4QJFB 2DW4A 4CWRA 3ASOB 3JD1A 3VBBA 4GCZA 4AWQA 1UYKA 1B62A 1PNLA 1A4HA 1NHHA 3SPJA 4MVMA 3AG3C 4MVZA 3ZRXA 1S16A 4NH9A 1S5HC 5BOCA 5CTUA 4QE9A 2DYSB 2B1IA 4XBFA 1JQ0A 1E1QG 1OZ0A 4U7NA 2HKJA 2YI6A 4PA7A 3OW2U 4E2LA 5CN0A 1YT2A 1ZWHA 1KECA 1YHQV 2YE4A 2IH3C 4ZVIA 3A0TA 3MHSC 4P8OA 2ZD9A 5CTXA 5H6QA 2BYHA 4JYCA 3G71V 1K3EA 1YTFB 3WFVA 1MSWD 2HFEC 5LGTA 1ZXNA 2IU3A 1GKFA 2YE7A 3VHDA 4EGKA 3K99A 5B3SB 1W0JG 1P7BA 4G2KA 2YE6A 4L8ZA 1NR7A 4AS9A 1ROPA 1YI2V 3K0GA 1S14A 2HCHA 4MP2A 1TH8A 1VQOV 3ASNB 1OHHG 2FXSA 1PVGA 3TZ0A 2F43G 2JJ2G 4WCEV 3E89A 5IDMA 3LSQA 4MVQA 2YI0A 4E02A 4O09A 3TUHA 1AJNA 1K9MW 3HYZA 2WAMA 4EFTA 3QO8A 5FNCA 4EFUA 2OTLV 1BHBA 2BT0A 3WG7B 1F23A 1I5AA 4BW5A 3GWOA 4FMTA 4LWGA 3ZMZA 4K4OA 5L3GA 3JCZA 4MVSA 2EJRA 5HFLA 4GT8A 1H7SA 3K03A 2EIKC 4JYBA 1RPOA 3ZXOA 2JEUA 2WLLB 3K08A 2B5UA 4GX2A 3R91A 4HYMA 2QF6A 4JTAB 2IU0A 1CEZA 3GIEA 2WLKA 3CCVV 1SETA 4DXWA 2K5BA 4ASFA 3T2MA 3CCSV 3GB7C 4MT8A 5L3DA 3AG3B 3ZMVA 2ITDC 4EMVA 3OMUA 3CC7V 2GSMB 2YE2A 3AG1B 3O0IA 1VQ4V 1SESA 1BXDA 1R3LC 4TSFG 4YXWG 5M4EA 1CPYA 1YSRA 3EHJA 1GKZA 2JJ1G 1NHJA 3T1CA 4XCJA 1RM1C 3OPDA 2Q6AA 3IGAC 2EZPA 4R3AA 3T2SA 4CBCA 5L3EA 2H55A 3Q5JA 4KTNA 2V1DA 1YESA 1UYGA 3SPCA 1VQPV 2W0FC 1W2BU 3P30A 1AI4A 3R65A 1H8HG 1K34A 2H94A 1YSCA 4KFMA 4MPCA 4UV9A 3B24A 1NKDA 2EXLA 1DF5A 2A0LA 4EEHA 1Q82W 1AMWA 2OCCB 3HZ5A 2CCSA 1ZXMA 4KP4A 4MSWC 2HJFC 3CGYA 3CCEV 2EIMC 3K79A 3ZRSA 1B3QA 1V54B 5H9CA 5EC2C 4ASUG 5L3BA 5CTWA 1QCEA 3JYCA 1YC4A 1OCRB 4JASA 2XJGA 4BAYA 1M1KW 1QYEA 1TUEB 1S72V 1YTFD 2P7TC 1TC6A 1G4YB 2YE8A 1KZNA 5FL7G 2YKBA 2YGAA 5IY5C 3A0YA 2YE9A 3CD6V 3OR6C 4P9OA 1EZJA 4HY1A 3P32A 4L93A 3ETDA 4JF3A 1VQKV 1BKNA 3EHFA 1DLBA 5F3KA 4JAUA 1R6NA 2EILC 3U2KA 3HEKA 3B77A 3VHAA 1FXHA 4AWPA 2WI3A 1SRYA 4YKUA 2ATKC 4J9ZB 2XHRA 3B8MA 2YEEA 5GGZA 3FB7C 4HYPA 1JM6A 2HR3A 2IJKA 1BHAA 4URLA 1V55B 4X88A 4UVBA 4QIWF 1THZA 3H80A 4LWIA 1M90W 4CE1A 1U0ZA 4LC1A 1Z5AA 4G28B 1M57C 1QVFU 2P90A 5M4NA 3MD0A 1PKXA 3FYEB 1K5SA 1GK9A 2BYIA 1OCZC 2VWCA 4XKAA 2W6JG 4I3HA 1S0VA 1OCOC 5D7RA 4GQTA 1RM1B 1YIJV 4PA6A 5E1AC 2BTZA 2IWSA 3TZ4A 1K33A 4MP7A 1Q7YW 1ORQC 2A79B 5CF0A 2ITCC 1KP3A 2BU5A 1Z5CA 1Y8PA 4KSGA 3SPHA 1SERA 2PNRA 4R1FA 1MOFA 4HXZA 4O05A 1YSZA 2WI1A 1KQSU 4PA3A 1GM7A 3R4OA 2O1VA 3JD4A 3OGCC 3SYCA 4R8CA 3R4MA 1L0OA 2X7RB 2BU2A 4HZ3A 2WI4A 4H37A 1UY9A 1BGQA 4R6ZA 2YK9A 3NXSA 4XCLA 4HYOA 1U2OA 1BL8A 4CWOA 5B1BC 1US7A 1AROP 4BAEA 2FTKA 4UROA 1VQMV 3OMAB 3OMIB 2M7WA 2BRCA 1BMFG 1AH6A 2Q2EB 3ABTA 1YITV 4KFGA 3OR7C 2WERA 3KG2A 3G4SV 2XJJA 3IC7A 2IJJA 4BIZA 5D6QA 4H81A 3B25A 2AHZA 4P2ZA 1QLEB 4JTDB 5CBGA 1AH8A 5LHHA 2BOCC 2YECA 1AR1B 1H7UA 3HPLC 3OUFA 3QNEA 1QVGU 2YEDA 2Z5UA 5CMUA 4YKWA 4WUCA 4LPBA 4LP8A 4L90A 4GX5A 4LWHA 3FB6C 1R6KA 5DN6G 2HLDG 3SYOA 3OAAG 2OTJV 4UUJC 4PL9A 5IYDO 2BSMA 1KKDA 1TBWA 2QM7A 4R50A 3I56V 4PA4A 5B1OA 2DQ0A 4PDLA 1ZW9A 3F7YC 4CWFA 1PL0A 3ZXQA 3QTFA 1M57B 1VQ9V 5J71A 2K1EA 1AI7A 4TWKA 1UY6A 3E2EA 4U93A 4CWTA 1OCZB 2HG5C 2ZR3A 1I5YA 3IFXA 4WUBA 2UXXA 1QLNA 2XAQA 4NH8A 1OCOB 3ZN1A 1UY8A 3K3WA 4WFBV 4V26A 2BU7A 3E8BA 2DQ3A 4P7AA 4GX1A 1GJVA 3FKSG 2C2AA 2WLJA 1RPRA 3G75A 3C11A 1PNKA 5LBQA 2VW5A 3ZKBA 3W7XA 3K98A 3JD0A 3BEHA 2OT5A 2YKEA 2X6BA 2Q68A 1CP9A 3RBZA 1GTOA 1S76D 4H85A 1W0KG 4XDKA 3T4ZA 3CYOA 1K4DC 4MPEA 3HYYA 2Q8GA 4FCQA 1COWG 3PEHA 5B1BB 3ZJZA 1QY8A 3CGZA 1N8RW 4PU9A 3CWVA 1YC3A 1NVPB 4HXWA 1VQ5V 3INWA 3LDCA 4MVRA 1H38A 3ZRWA 2XCMA 1FFTB 1FS0G 4PDRA 1AJPA 5EBMC 4GX0A 2PI4A 3TZ2A 1FXKA 1L1FA 3I55V 2VCJA 3AG2C 1S77D 5CBHA 4XKKA 4MW3A 1Q81W 2Z3YA 3X2QC 3EKRA 4E01A 3E35A 1M9NA 1NH2D 2YEIA 5FWKA 1F4NA 2GHYA 3UM7A 3AEIA 4KSHA 1THNA 3LUTB 2WLNA 2Q8FA 4FJCC 1Y66A 4O04A 4X8AA 1Y4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5C A;  4CWQ A;  4JQL A;  4MBC A;  1Z5B A;  2GFD A;  4QPJ A;  3K97 A;  5F3K A;  4JAU A;  1MX0 A;  2WEP A;  5D7D A;  2XHX A;  4BIU A;  1TID A;  1GKX A;  3U2K A;  3HEK A;  1UYD A;  4XKO A;  3VHA A;  4CWR A;  4ASB A;  3HZ1 A;  2LFS A;  3GIG A;  4AWP A;  2WI3 A;  3EKO A;  3U67 A;  3EHH A;  4YKU A;  4NH7 A;  2XHR A;  4GCZ A;  2YEE A;  3OWD A;  2QG2 A;  2BZ5 A;  5GGZ A;  3VAD A;  4AWQ A;  1UYK A;  1B62 A;  3IED A;  2BU6 A;  4ASG A;  4HYP A;  1A4H A;  1NHH A;  1JM6 A;  3G7E A;  1TC0 A;  2IWX A;  4URL A;  1BYQ A;  2YI5 A;  3ZRX A;  1S16 A;  1YT1 A;  4NH9 A;  5BOC A;  1F51 A;  5CTU A;  1YT0 A;  2Q8I A;  2YGE A;  2WI7 A;  3H80 A;  4LWI A;  4CE1 A;  1U0Z A;  4U7N A;  4LC1 A;  1Z5A A;  2HKJ A;  2YI6 A;  2YKI A;  3ZM7 A;  2XDX A;  1YT2 A;  5M4N A;  3T10 A;  3MD0 A;  2H8M A;  2BYI A;  1ZWH A;  3MNR P;  2VWC A;  4XKA A;  3RLP A;  2FYP A;  3GIF A;  2YE4 A;  4CE3 A;  3RLR A;  1I59 A;  4ZVI A;  4XIR A;  3A0T A;  4P8O A;  4I3H A;  4I5S A;  5CTX A;  1Y4S A;  2O1W A;  2BYH A;  3WHA A;  3K60 A;  4O07 A;  4GGL A;  5D7R A;  2YEH A;  4JYC A;  2ZBK B;  4GQT A;  2XX4 A;  3JZ3 A;  2BTZ A;  4KQV A;  3T1K A;  4E00 A;  2YE5 A;  2IWS A;  1R62 A;  3TZ4 A;  1YET A;  4B7P A;  5B1N A;  2IOR A;  3O2F A;  4MP7 A;  4FCP A;  4ASA A;  2YEG A;  2XDS A;  2QFO A;  1MU5 A;  1ZXN A;  2YE7 A;  5CF0 A;  2AKP A;  1UY7 A;  3VHD A;  5IDJ A;  2BU5 A;  1Z5C A;  2YE3 A;  4EGK A;  3K99 A;  1Y8P A;  2HG1 A;  4KSG A;  4R3M A;  4L94 A;  2PNR A;  4R1F A;  4HXZ A;  4O05 A;  2VCI A;  1I5B A;  1KIJ A;  1YSZ A;  2WI1 A;  3R4O A;  3G7B A;  2O1V A;  2YK2 A;  4HY6 A;  2YE6 A;  3R4P A;  4YKY A;  4L8Z A;  3LNU A;  4AS9 A;  3R4M A;  1L0O A;  4CWS A;  2BU2 A;  2QG0 A;  2WI4 A;  5FNF A;  4BQG A;  4XD8 A;  1UY9 A;  1BGQ A;  2BU8 A;  3INX A;  4W7T A;  2JKI A;  2YK9 A;  2WI5 A;  3NXS A;  4XCL A;  1S14 A;  3R4N A;  1U2O A;  4B6C A;  2HCH A;  2GQP A;  4CWO A;  3A0X A;  4MP2 A;  4O0B A;  1TH8 A;  1US7 A;  1UYH A;  4BAE A;  2YEJ A;  2FTK A;  4QPK A;  4URO A;  3D36 A;  3OWB A;  2BRC A;  4FCR A;  4WUD A;  2FXS A;  1AH6 A;  1PVG A;  3TZ0 A;  2Q2E B;  5C93 A;  3C0E A;  3SL2 A;  4EM7 A;  4KFG A;  1I58 A;  2FWY A;  4XC0 A;  5IDM A;  2WER A;  4MTX A;  2BRE A;  4LP0 A;  1EA6 A;  3WQ9 A;  2YI0 A;  3O6O A;  4E02 A;  4URN A;  4O09 A;  3TUH A;  2XJJ A;  2YI7 A;  2WWW A;  5IN9 A;  4BIZ A;  3HYZ A;  5D6Q A;  2YJX A;  4H81 A;  2YEF A;  4EFT A;  3B25 A;  3A0R A;  1QZR A;  5FNC A;  4EFU A;  4AWO A;  4BQJ A;  1Y4U A;  2XAB A;  3HHU A;  3A0Z A;  2BT0 A;  1AH8 A;  2XDU A;  3PEJ A;  1I5A A;  2YEC A;  1H7U A;  4CWP A;  4FMT A;  3T0Z A;  3B27 A;  4LWG A;  2YEA A;  4K4O A;  4GT8 A;  1H7S A;  2YJW A;  4JYB A;  2YED A;  1JOY A;  3ZXO A;  2WI2 A;  3Q5L A;  3DGE A;  2FWZ A;  5L3J A;  4YKW A;  1UYI A;  4WUC A;  4LPB A;  2UWD A;  4L90 A;  4XTJ A;  3R91 A;  4LWH A;  4HYM A;  1TIL A;  4MPN A;  4EGH A;  3RLQ A;  3ZRV A;  2QF6 A;  2IOQ A;  3EHG A;  3GIE A;  4YKT A;  5FND A;  4PL9 A;  2K5B A;  4ASF A;  4MT8 A;  2CGF A;  2BSM A;  4CWN A;  4JAV A;  1TBW A;  4EMV A;  2QM7 A;  3OMU A;  4V25 A;  2ZKJ A;  4URM A;  2YE2 A;  4XIQ A;  3H4L A;  1Y8O A;  5B1O A;  2CH4 A;  3O0I A;  1ZW9 A;  4CWF A;  3ZRW B;  4LWE A;  3ZXQ A;  5M4H A;  2YEB A;  1BXD A;  3QTF A;  4ZKI A;  2LFR A;  5J71 A;  3VHC A;  1UY6 A;  5M4K A;  4U93 A;  4YKR A;  1B63 A;  4CWT A;  2XDL A;  1YC1 A;  5M4E A;  2E0A A;  2QM8 A;  1YSR A;  4WUB A;  3OW6 A;  2IOP A;  3EHJ A;  4NH8 A;  2WI6 A;  4HZ0 A;  1GKZ A;  5M4M A;  3BM9 A;  1Z59 A;  1NHJ A;  1UY8 A;  5CPH A;  2XX2 A;  4V26 A;  4XCJ A;  2BU7 A;  3B26 A;  3OPD A;  2JJC A;  4R3A A;  3LPS A;  2IWU A;  3FT8 A;  3T2S A;  3D0B A;  1AM1 A;  3RKZ A;  4MOT A;  4P7A A;  2H55 A;  4YKQ A;  4GT1 A;  5D6P A;  3Q5J A;  4KTN A;  1GJV A;  2C2A A;  1YES A;  1UYG A;  3G75 A;  1YS3 A;  2YGF A;  3B28 A;  3FV5 A;  3C11 A;  4L91 A;  4CE2 A;  4U7O A;  2VW5 A;  2XJX A;  3KE6 A;  3ZKB A;  2CG9 A;  3K98 A;  3T0H A;  4LWF A;  4Q20 A;  3TZ5 A;  4MPC A;  4YKZ A;  5D7C A;  2YKE A;  1IXM A;  3B24 A;  4DZY A;  2EXL A;  3QDD A;  3CRL A;  2CCU A;  5F5R A;  4EEH A;  2XHT A;  2Q8H A;  1AMW A;  3GIG B;  4H85 A;  4HZ5 A;  4PRX A;  3HZ5 A;  2ESA A;  2CCS A;  5M4P A;  4MPE A;  1ZXM A;  4KP4 A;  3HYY A;  2Q8G A;  3CGY A;  3BMY A;  4FCQ A;  2ZDX A;  3Q5K A;  2P67 A;  1UYE A;  4X9L A;  3PEH A;  1UYF A;  2XD6 A;  4XDM A;  5CTY A;  1QY8 A;  3CGZ A;  4PU9 A;  3CWV A;  3ZKD A;  1YC3 A;  1B3Q A;  4HXW A;  4MB9 A;  2XK2 A;  3INW A;  5BOD A;  3A0W A;  2WEQ A;  3ZRW A;  2YKJ A;  5CTW A;  3FT5 A;  1AJ6 A;  1YC4 A;  5J6A A;  2XCM A;  4DUH A;  4JAS A;  3TZ2 A;  2XJG A;  4BXI A;  3NMQ A;  4GEE A;  1UYL A;  4XIT A;  1QYE A;  2VCJ A;  3TTZ A;  3ZCC A;  4H7Q A;  1TC6 A;  4XKK A;  1I5D A;  2YE8 A;  1KZN A;  2YKB A;  3CRK A;  4YKX A;  2YGA A;  3TK1 A;  1YER A;  2ZDY A;  3A0Y A;  3EKR A;  3R92 A;  2O1U A;  2YE9 A;  4E01 A;  1EI1 A;  4XE2 A;  3U2D A;  2YEI A;  5FWK A;  2XDK A;  4EGI A;  1UYM A;  1OSF A;  2CCT A;  4HY1 A;  1ID0 A;  3P32 A;  1UYC A;  4L93 A;  4GFN A;  4KSH A;  4PRV A;  1THN A;  2XX5 A;  4FPP A;  2Q8F A;  1BKN A;  3D2R A;  4O04 A;  4XIP A;  3EHF A;  2YKC A;  1Y8N A;  1NHI A; 
#chains in the Genus database with same CATH topology
 4YY3 O;  4JQL A;  2GFD A;  3ABU A;  3BRC A;  3STL C;  4DW1 A;  3K97 A;  3ZS8 C;  2OWO A;  5D7D A;  4K0K O;  1EZV H;  2XHX A;  2XOK G;  2JGU A;  3B09 A;  3ML0 A;  1TID A;  2JK5 C;  4XKO A;  5D5Q A;  1WN7 A;  3HZ1 A;  1H8E G;  4NVP A;  4NKG B;  1K92 A;  1N0J A;  3W7U A;  2D3O W;  1SZT A;  1EBO A;  4LFC B;  2BZ5 A;  3VAD A;  3ZIA G;  3IED A;  1VIB A;  2BU6 A;  4ASG A;  2PTM A;  4JZ2 A;  3APO A;  3K5O A;  4B08 A;  2Q7G A;  3ZMS A;  1BYQ A;  4ZOL B;  2YI5 A;  4DV4 O;  1YT1 A;  3G6E V;  2ZXW C;  2X0L A;  4RQF A;  4K35 A;  1YT0 A;  2Q8I A;  2YGE A;  5IJ9 B;  1QBZ A;  1WP8 A;  1H2K A;  3UCS C;  1EN4 A;  2YKI A;  1LUW A;  4UXN A;  5LOV A;  3ZM7 A;  5C8Y A;  1MMM A;  2XDX A;  1FXK C;  5CB4 A;  3P3N A;  2ADP A;  3T10 A;  2EIJ C;  2H8M A;  4FFB B;  3MNR P;  3EHB B;  1NR1 A;  3FB5 C;  3RLP A;  1SQQ H;  1LUV A;  4X1Y A;  2FYP A;  1ZWI C;  3GIF A;  4CE3 A;  1I59 A;  4DV1 B;  4XIR A;  3O9O A;  4I5S A;  3N2K A;  1EFR G;  2O1W A;  5BR8 B;  4JGS A;  2FYU H;  2YEH A;  2ZBK B;  1FFX A;  2XX4 A;  5IWA O;  4I9Q A;  3E8G A;  5LXT A;  3JZ3 A;  4UVA A;  4KQV A;  3T1K A;  1M56 C;  4E00 A;  1QNM A;  1YET A;  4B7P A;  5B1N A;  2A9H A;  1DK1 A;  2R9R B;  3O2F A;  3UT5 B;  4FCP A;  1HR0 O;  3CCJ V;  3OFN G;  1MU5 A;  3ASO C;  3D8C A;  1QHT A;  2AKP A;  2DWD C;  1UY7 A;  2UXC O;  5IDJ A;  1YZB A;  4X65 O;  5LHI A;  2HG1 A;  1XNQ B;  5GW7 A;  5CA3 A;  1AI6 A;  1H2L A;  2VCI A;  1KIJ A;  1R3J C;  5KHI A;  3G7B A;  4HY6 A;  3RYI B;  3K06 A;  3D36 C;  5IJ0 A;  3R4P A;  4YKY A;  2Y69 C;  3BY6 A;  2DYS C;  3LNU A;  4B7E A;  4DR1 B;  2EX3 A;  4WFF A;  4ZI7 B;  2QG0 A;  1G6U A;  4BIO A;  4BQG A;  3MHH C;  4LWS A;  4XD8 A;  4KUM A;  2EIK B;  2BU8 A;  3INX A;  2JKI A;  2WI5 A;  4DR2 B;  5LGN A;  1TA8 A;  3WU2 Z;  4B6C A;  2MK3 A;  2RJZ A;  2GQP A;  3A0X A;  3K0D A;  2A06 H;  4O0B A;  1UYH A;  3K9A A;  1VQN V;  1ZX3 A;  1TUB B;  4QPK A;  1D5N A;  4XDL A;  1MNG A;  3H1I H;  3K5M A;  3CRQ A;  1KKC A;  2YXL A;  4WUD A;  2QTO A;  1WA8 B;  3RYF B;  4JPR A;  4LH7 A;  4O4I A;  5J9P C;  3C0E A;  1N36 B;  4WFA V;  1ZUQ A;  3SL2 A;  2UXN A;  2XAF A;  1XL6 A;  4MTX A;  3TET A;  1YJ9 V;  2BRE A;  2ADQ B;  4LP0 A;  1EA6 A;  4J11 A;  2YEV A;  3WQ9 A;  1H2G A;  2R9A A;  1JVM A;  3WB0 A;  3JAM N;  3DSQ A;  4L8J A;  1I5X A;  4UFZ A;  2WWW A;  1XNR B;  1KMI Z;  3X2Q B;  1B06 A;  3B4S A;  2AHY A;  1BQ0 A;  2BTQ B;  4O2A A;  4D6T H;  5FPO A;  3A0R A;  1SA0 A;  2F93 B;  2RMK B;  5EYP B;  4ZIB A;  4RQE A;  5B3S C;  1NBM G;  5EC1 C;  2DJV A;  3HHU A;  1R3K C;  3H01 A;  4OXS A;  4C7U A;  3A0Z A;  2OIE A;  5IYC O;  1J95 A;  2PGG A;  1UJW B;  2XDU A;  3PEJ A;  4CWP A;  1F4M A;  4DRX A;  4MTO A;  3B27 A;  3KCX A;  2YEA A;  2ZR2 A;  1JOY A;  5FLX N;  1JX9 A;  1J5E B;  4Z1M G;  4JYA B;  1NVP D;  3CCU V;  5EIB C;  2FWZ A;  5L3J A;  5GON B;  2R9I A;  4CS4 A;  4LFB O;  2FKX A;  3LDD A;  4HBN A;  2UU9 O;  3ASN C;  1UYI A;  3RVZ A;  1IBM O;  4KXR A;  3ABK C;  4DV3 B;  4LF4 B;  1BGY H;  3S5T A;  4MVU A;  1N33 B;  4MVO A;  4TUY B;  1TIL A;  4MPN A;  4EGH A;  3ZRV A;  1HWY A;  1AVM A;  2HVK C;  4NB5 A;  1OJH A;  3CRR A;  2IOQ A;  1WB8 A;  4R7C A;  1KUQ A;  4YJ3 B;  1IXB A;  4WF9 V;  4IYI A;  1TVK B;  1AI5 A;  1GMG A;  1NH2 B;  5FND A;  2F66 C;  2YUA A;  2QKC A;  5KHJ A;  1KC8 W;  4RUE A;  4GKJ O;  5LHG A;  3U11 A;  2ZXW B;  3ZHR A;  2JEX A;  4XIQ A;  4F4L A;  3H4L A;  1Y8O A;  2CH4 A;  2QKS A;  3OE7 G;  3BM9 A;  2VRZ A;  3ZRW B;  1Y74 A;  3ABL C;  1SQX H;  5M4H A;  2EIM B;  2YEB A;  1IBK O;  1I08 A;  2LFR A;  1X4T A;  1IBL O;  1FXK B;  3VHC A;  1SQG A;  5M4K A;  4DV5 B;  3WG7 C;  1FXV A;  2XAG A;  2XDL A;  2ZE5 A;  1YC1 A;  2CDY A;  2ZM6 B;  1GN4 A;  1M93 A;  1N0N A;  2QM8 A;  3OW6 A;  2X6A A;  5JQG A;  2Q5Z A;  4PI0 A;  3PJS K;  5AG2 A;  2WI6 A;  1AJQ A;  5JH7 B;  1GM8 A;  4HZ0 A;  2KB1 A;  2ZQM A;  1XI1 A;  1FPO A;  2WA4 A;  2FB5 A;  4NYK A;  5H6R A;  4NXN B;  2XX2 A;  4GKK O;  2CTW A;  4YY3 B;  1S5J A;  1Q86 W;  1GN6 A;  1GRJ A;  3FB8 C;  2CK3 G;  3FT8 A;  3D0B A;  3RKZ A;  4MOT A;  4YKQ A;  4K0K B;  2XAH A;  1BZK A;  3IJ4 A;  3TXQ A;  5IY5 B;  4JV5 O;  1YS3 A;  4CE2 A;  3AK2 A;  1YVW A;  3B28 A;  3W7T A;  5EBL C;  5KMG B;  2OYQ A;  2XJX A;  1VQL V;  4UCV A;  4PI2 A;  4PDV A;  3ABM C;  2CG9 A;  2HJD A;  3T0H A;  3E8H A;  4Q20 A;  3TZ5 A;  3OMN B;  4YKZ A;  5D7C A;  3E86 A;  4J42 A;  4W4K A;  3QDD A;  4EB6 A;  3DTU B;  4JI2 O;  2CCU A;  2ZDI C;  5F5R A;  2Y69 B;  3ETG A;  1UPG A;  2XHT A;  2Q8H A;  1NQT A;  1AB3 A;  4UCR A;  3AG1 C;  1QR9 A;  2E75 B;  4PRX A;  4DV4 B;  2WLI A;  3VQW A;  3OEE G;  3TCU A;  2ZDX A;  3Q5K A;  1UYE A;  5CTY A;  1UYF A;  2XD6 A;  2EZO A;  5HFM A;  1Y76 A;  4CZZ A;  2EIL B;  3CXC U;  2JDI G;  3K5N A;  4MB9 A;  4O2B A;  1GN3 A;  1Q8I A;  3RW0 A;  1XDC A;  1JPX A;  1P84 F;  2DOS A;  4IGG A;  2DWE C;  5BOD A;  3K5L A;  1VF7 A;  4OGQ B;  3STZ C;  4FM0 A;  2WEQ A;  2YKJ A;  4P9P A;  2OCH A;  1AJ6 A;  5KUK A;  3OTF A;  1AIL A;  5LP6 A;  4X89 A;  4MW8 A;  4BXI A;  3AG7 A;  1G1X B;  4GEE A;  4XIT A;  3JAR A;  4EKW A;  5LOV B;  2JIZ G;  4XDJ A;  2JVD A;  1QR8 A;  5CB4 B;  5IWA B;  4Q6G A;  4I0X A;  1YJW V;  3BHP A;  2DYR C;  2Y0I A;  3CRK A;  4CS2 A;  4YKX A;  1YER A;  4RO2 A;  4X1Y B;  5IYB O;  1HR0 B;  2IJH A;  4XE2 A;  3N2K B;  4TT3 G;  4DV7 O;  2XDK A;  4EGI A;  1VEW A;  1OSF A;  1FFX B;  5KX5 A;  2UXC B;  2HKO A;  1ID0 A;  4X65 B;  3G67 A;  5LXT B;  4X66 O;  1JA8 A;  1FYJ A;  2LGQ A;  5EK0 A;  2AZ2 A;  2XX5 A;  2QWR B;  3H1J H;  1T5E A;  1N32 O;  3QO7 A;  4XIP A;  3E22 A;  2JS5 A;  2OCC C;  2YKC A;  4N21 A;  3CME V;  1FJG B;  1Y8N A;  2XT9 A;  3SYQ A;  3SJQ C;  4O4L A;  1GM9 A;  4N23 A;  4QPJ A;  5JJE B;  3CEI A;  1MX0 A;  2ZNI A;  1GKX A;  1UYD A;  2NNU A;  1Q5O A;  3BVO A;  1V54 C;  4ASB A;  3ABK B;  2LFS A;  3GIG A;  1NZ6 A;  1JFF A;  3JAK A;  5IJ0 B;  3EKO A;  3U67 A;  3K04 A;  4J10 A;  1YJN V;  4WFH A;  3EHH A;  3CXH F;  1I7F A;  4NH7 A;  5BMV A;  4LWS B;  1HNW O;  2YDE A;  3OWD A;  2QG2 A;  1OCR C;  4J41 A;  5LGU A;  3QO5 A;  5IYZ A;  1SQF A;  2VS0 A;  4YIO A;  4UVC A;  3CCQ V;  2Y48 A;  3G7E A;  3KKY A;  4DR4 O;  1TC0 A;  4QNH B;  2IWX A;  4LF9 O;  4I9W A;  1N34 O;  4HNA A;  2Q0A A;  1F51 A;  1JJO A;  3K57 A;  1BCC H;  2YIB D;  5LMU O;  2WSS G;  2WI7 A;  3ABL B;  1K4C C;  4UV8 A;  4O4I B;  1VF6 C;  1U97 A;  2AW9 A;  2EBO A;  4FFK A;  5LP6 C;  4CH3 A;  3SJC C;  3BA9 A;  1ENV A;  2YEV B;  2JRI A;  3SYA A;  2Q4P A;  2E76 B;  3CPW U;  2H8P C;  3A8T A;  3RLR A;  5JCO C;  1S3J A;  2RDC A;  1Q43 A;  2XHB A;  1Y4S A;  2R70 A;  3WHA A;  4O2A B;  3K60 A;  4GGL A;  4O07 A;  5CBF A;  4WFE A;  1SA0 B;  1E79 G;  1SC5 B;  1WPX A;  1XL4 A;  2LP7 A;  2YE5 A;  4JAA A;  2Q67 A;  1R62 A;  4DUZ O;  4D7T A;  4B3T O;  3J81 N;  3B8N A;  2IOR A;  4DO2 A;  4ASA A;  1I94 O;  2JGD A;  3LNM B;  2CUG A;  2P5O A;  1XMO O;  3M8A A;  2YEG A;  2UU9 B;  2QFO A;  2XDS A;  4DRX B;  1IBM B;  4P30 A;  3JAW A;  3SYP A;  3CC4 V;  4YHH O;  1GO3 F;  3ABM B;  2YE3 A;  3CHX A;  4R3M A;  4GYC B;  4L94 A;  3SPG A;  2CAZ C;  4QE7 A;  3LSU A;  3JAT A;  1I5B A;  2NLJ C;  4B3M O;  2HP8 A;  2HVJ C;  5JJJ B;  2YK2 A;  1V55 C;  3E83 A;  1YCI A;  2YC0 A;  3FX7 A;  4GKJ B;  4JI0 O;  4NXM B;  4CWS A;  5FNF A;  1JCH A;  2PI5 A;  2IW5 A;  4W7T A;  2YSU B;  3R4N A;  1Y67 A;  3SR2 C;  5BY1 A;  4EEQ A;  3D3Q A;  3BCC H;  4UB6 Z;  2YEJ A;  3HB3 B;  1IBL B;  1XHZ A;  1K8A W;  3RGB A;  3D36 A;  4E4E A;  1HNX O;  4O4H A;  3OWB A;  3R66 A;  4FCR A;  2ODM A;  4ICG A;  5B1A C;  4H44 B;  1AP6 A;  2KQX A;  1NTZ H;  2QA4 V;  3UKM A;  5C93 A;  4X1K A;  4EM7 A;  3N2G A;  1I58 A;  2FWY A;  1Y74 B;  3CCL V;  2R72 A;  4XC0 A;  5L3F A;  3IAY A;  1S5L Z;  3O6O A;  4JI5 O;  4URN A;  4GKK B;  2GBO A;  4QGP A;  2DYR B;  4JI4 O;  3RVY A;  2YI7 A;  5IN9 A;  1K73 W;  2IH1 C;  4DR6 O;  3EFF K;  4J9Y B;  2YJX A;  1OCC C;  4FK5 C;  2YEF A;  5JQG B;  5KAI Z;  2HHI A;  2V7Q G;  3K58 A;  1QZR A;  4JV5 B;  2KG7 A;  4AWO A;  4BQJ A;  1LNQ A;  1Y4U A;  2WLM A;  2XAB A;  3NR7 A;  2UUC O;  4DYL A;  5LYJ A;  2Q8V A;  3RYC A;  3D3I A;  4PDM A;  4BWA A;  1NJI W;  3E8F A;  3T0Z A;  3P3P A;  4JI2 B;  3OTO O;  2YJW A;  4DR7 O;  2O57 A;  4G27 B;  5H5N A;  5KAF Z;  1UFI A;  3CCM V;  3J7A U;  1A32 A;  1L8D A;  1RP3 B;  3JD2 A;  2WI2 A;  3Q5L A;  2EIN C;  3AG4 C;  2BE3 A;  3APQ A;  3DGE A;  3CP1 A;  2D2C B;  5JWP A;  4X20 A;  1H2M A;  3ZMU A;  4X1I A;  4RAI A;  1KD1 W;  1JJ2 U;  4K3A A;  4JTC B;  2XND G;  4EB6 B;  1BQZ A;  4JYY A;  2UWD A;  4XTJ A;  3SJB C;  4DR5 O;  3CB2 A;  3L72 H;  1XHX A;  3RLQ A;  2WLH A;  2YI9 A;  3EHG A;  4IT5 A;  4YKT A;  2WLI B;  5H2F Z;  3HKC A;  3C90 A;  2WPD G;  2ZT9 B;  3ZN0 A;  3SDL A;  1Y76 B;  2CGF A;  4CWN A;  4JAV A;  4CS3 A;  4AIL C;  1Q6H A;  1R1B A;  2IBZ H;  2P4K A;  1XBL A;  4V25 A;  4O2B B;  4Z1V A;  3ETQ A;  2ZKJ A;  4URM A;  2GTS A;  1K97 A;  4AI8 A;  2PYJ A;  4DUY O;  4H0L B;  4PEL A;  3F5T A;  2B1G A;  2CE4 A;  2P6J A;  2NN4 A;  2XAS A;  4WFG A;  1RSO A;  5KA6 A;  1QLE C;  4DV6 O;  4LWE A;  5L3C A;  2XAJ A;  5GTI Z;  4LF7 O;  3VOU A;  5LP6 B;  2Q69 A;  4ZKI A;  4DV7 B;  1JMK C;  4YKR A;  3JAR B;  1B63 A;  1PL4 A;  3W7S A;  1NI8 A;  4MTF A;  1GAX A;  3DC5 A;  3T4D A;  4I0X B;  4X66 B;  2E0A A;  1Q6U A;  1PD3 A;  4DR3 O;  1VQ8 V;  5BZB A;  3LSS A;  1P4R A;  1N4C A;  2IOP A;  3AK3 A;  5M4M A;  1N32 B;  3ETE A;  3VQX A;  1E1R G;  1K7D A;  3OUS A;  3LDE A;  3MDS A;  3OM3 B;  4J7J A;  5EIB D;  1Z59 A;  4E72 A;  3KZI Z;  3FAV A;  2IJI A;  2QEX V;  1K5Q A;  5CPH A;  1H2N A;  2X6C A;  3B26 A;  1SF9 A;  5KX5 B;  2JJC A;  3AG2 B;  4B3R O;  3LPS A;  2IWU A;  2PF4 E;  1AM1 A;  3SPI A;  4GT1 A;  2N04 A;  5D6P A;  2P4V A;  4HAM A;  2QGN A;  5B5E Z;  2YGF A;  4L91 A;  3FV5 A;  4U3J A;  5A2Q N;  1IVS A;  3IC9 A;  4U7O A;  4AQY O;  5KUM A;  3KE6 A;  1R3I C;  2CH7 A;  2WLL A;  5KA5 A;  3HKE A;  4Z2W A;  4MTG A;  2HHH O;  4O4L B;  1HNW B;  4LWF A;  4RUF A;  1CXZ B;  4H33 A;  3W7W A;  1IXM A;  4CC5 A;  4DZY A;  3CRL A;  1R73 A;  4PA9 A;  4JI1 O;  4X9Q A;  4DR4 B;  3CMA V;  2BOB C;  3GIG B;  4HZ5 A;  1JFF B;  3JAK B;  1VQ7 V;  4B3S B;  1Z5W A;  2ESA A;  1N34 B;  5M4P A;  5BMV B;  5K1X A;  2QDO A;  5LMU B;  3BMY A;  2P67 A;  4X9L A;  4XDM A;  3OEH G;  5IYZ B;  2QR4 A;  3CCR V;  3F5W C;  1XUQ A;  3JD3 A;  3ZKD A;  1PNM A;  1R6T A;  2Y0P A;  3FYI B;  2ZDI A;  2XK2 A;  5EBW C;  5J2U A;  1VQ6 V;  2LGW A;  5B1A B;  3A0W A;  4HNA B;  3FT5 A;  1SQB H;  1MG1 A;  5J6A A;  3F7V C;  4DUH A;  4LCU C;  1MAB G;  4PV1 B;  3NMQ A;  1UYL A;  3TTZ A;  4UCU A;  3ZCC A;  4H7Q A;  3CC2 V;  3L70 H;  1I5D A;  1Y6X A;  3M99 B;  4DUZ B;  1DF4 A;  4B3T B;  2QE7 G;  1OCC B;  2DMX A;  3TK1 A;  2ZDY A;  1G8M A;  4LBE C;  1I94 B;  3R92 A;  2O1U A;  1XMO B;  1EI1 A;  2N05 A;  3U2D A;  4MS2 A;  2ZKO A;  2XUM A;  1UYM A;  2CCT A;  4LF5 O;  2LW1 A;  4YHH B;  5DEC A;  2GTA A;  2E5L O;  2QM4 A;  4FIP C;  1B6Q A;  1UYC A;  4WBN A;  1WLE A;  2EIJ B;  2QWN B;  1SS3 A;  4GFN A;  4PRV A;  4FPP A;  4ZBM A;  1L0N H;  3D2R A;  2JGD B;  3QG5 A;  3ZMT A;  4B3M B;  2W6I G;  5DM6 V;  5TIS Z;  3H1K H;  1XRE A;  1NHI A;  2M6Y A;  1KP2 A;  1I5C A;  4CWQ A;  3JAW B;  1BT8 A;  3ZX6 A;  4MBC A;  1Z5B A;  3G80 A;  3JAL A;  1DTO A;  2EIN B;  3AG4 B;  3JSL A;  4IL6 Z;  2WEP A;  1AR5 A;  1M56 B;  4BIU A;  4L87 A;  4QJF B;  3JAT B;  2DW4 A;  4CWR A;  4TOI A;  4DV2 O;  4U3F H;  3VQY A;  4LFC O;  1V9P A;  3ASO B;  1HNX B;  1NTK H;  4CH6 A;  2B9Z A;  3Q4H A;  3JD1 A;  3VBB A;  4GCZ A;  4AWQ A;  1UYK A;  3HR0 A;  1B62 A;  2QKA A;  1PNL A;  2H3O A;  1IUR A;  1A4H A;  1NHH A;  3SPJ A;  4GLX A;  4MVM A;  2ZE7 A;  3AG3 C;  4MVZ A;  3ZRX A;  1S16 A;  4NH9 A;  3CJH A;  3THO A;  1EN6 A;  1S5H C;  5BOC A;  4O4H B;  5CTU A;  4QE9 A;  2DYS B;  4TQF A;  2B1I A;  4JI4 B;  4DR6 B;  4ABM A;  4XBF A;  1JQ0 A;  1E1Q G;  4X1K B;  1YEW A;  1OZ0 A;  4U7N A;  2HKJ A;  3N2G B;  2YI6 A;  4PA7 A;  3OW2 U;  1ZLZ A;  2AXT Z;  4E2L A;  1GN2 A;  5CN0 A;  1YT2 A;  4JZG A;  1X59 A;  1ZAU A;  4LF6 O;  3H1H H;  3JAS A;  4FLT A;  1ZWH A;  4NTX A;  1KEC A;  2UUC B;  2C1I A;  1YHQ V;  2F23 A;  2YE4 A;  2IH3 C;  4ZVI A;  3A0T A;  3MHS C;  4P8O A;  2ZD9 A;  5CTX A;  5H6Q A;  2BYH A;  4JI8 O;  1VF6 A;  2LQT A;  4JYC A;  4FVM A;  3OTO B;  1K3E A;  3G71 V;  1XOU A;  2CTP A;  2KG7 B;  4OPH A;  3BAA A;  5C8Y B;  1U96 A;  3SGI A;  5LYJ B;  1YTF B;  3WFV A;  4NTW A;  3RYC B;  1MSW D;  5JCO A;  2HFE C;  5LGT A;  1ZXN A;  2VQE O;  4FLZ A;  2IU3 A;  1GKF A;  2G38 A;  3CRA A;  4TV9 A;  1GH6 A;  2YE7 A;  1AP5 A;  3VHD A;  4DR5 B;  4YIP A;  2RCV A;  4EGK A;  3K99 A;  5B3S B;  4LH6 A;  1W0J G;  4CH4 A;  2Q9L A;  1KBH A;  5K1P A;  5CA0 A;  2ILM A;  3CRC A;  3HKD A;  4X20 B;  1P7B A;  2L35 A;  4X1I B;  2CGO A;  4G2K A;  1M5I A;  2K9P A;  2YE6 A;  3DXR A;  4I4T A;  4L8Z A;  1NR7 A;  5JVD A;  4AS9 A;  1ROP A;  1YI2 V;  1XIL A;  3K0G A;  1S14 A;  2HCH A;  2E3C A;  3HKC B;  4BR6 A;  4MP2 A;  1TH8 A;  1P7G A;  1VAR A;  4DV6 B;  1VQO V;  4LF7 B;  3ASN B;  4O4J A;  1OHH G;  2EJ7 A;  2UUB O;  2FXS A;  1PVG A;  3TZ0 A;  4X62 O;  4DR3 B;  2F43 G;  2BSK A;  2JJ2 G;  4WCE V;  3E89 A;  5F2V O;  5IDM A;  1RSO B;  3LSQ A;  4MVQ A;  2YI0 A;  4E02 A;  4O09 A;  3TUH A;  5JJN B;  1WJZ A;  1MZF A;  1AJN A;  2IM9 A;  1K9M W;  3HYZ A;  4B3R B;  4B7K A;  2A7W A;  4I50 A;  2WAM A;  4EFT A;  1URF A;  5DED A;  1WP7 A;  4IYH A;  3QO8 A;  3FAV B;  5FNC A;  4EFU A;  2OTL V;  4AQY B;  1BHB A;  2BT0 A;  1BSM A;  2A3Q A;  3WG7 B;  2VQF O;  2HHH B;  1ZSP A;  1F23 A;  1I5A A;  4AHC A;  4BW5 A;  3GWO A;  5J2T A;  1O9G A;  4FMT A;  1SQV H;  2FL4 A;  4LWG A;  5FPR A;  3ZMZ A;  1J5E O;  2XTA A;  4K4O A;  5L3G A;  3JCZ A;  4MVS A;  2EJR A;  5HFL A;  4JI1 B;  4GT8 A;  1H7S A;  2YXY A;  2ZE8 A;  2EIK C;  3K03 A;  4JYB A;  1RPO A;  3L9D A;  4U3J B;  4DV0 O;  3ZXO A;  2CH7 B;  2JEU A;  2WLL B;  1FAF A;  3HKE B;  5LA6 A;  4DV3 O;  1WB7 A;  3K08 A;  2B5U A;  2GUZ A;  1L0L H;  4JI3 O;  1Q3E A;  2Z0A A;  4GX2 A;  2L6L A;  3R91 A;  4LFB B;  4HYM A;  2QF6 A;  3ZED A;  4JTA B;  2F4V O;  3L73 H;  2IU0 A;  4KL1 A;  1CEZ A;  3GIE A;  2WLK A;  3CCV V;  1SET A;  4DXW A;  4UCO A;  2K5B A;  4ASF A;  3T2M A;  3CCS V;  3GB7 C;  4MT8 A;  5L3D A;  4OX9 O;  3FFQ A;  3AG3 B;  3ZMV A;  2ITD C;  4J7Z A;  4EMV A;  3OMU A;  3CC7 V;  2OIG A;  2GSM B;  1SQP H;  5J2U B;  2YE2 A;  5EZY A;  3AG1 B;  3O0I A;  4FZ1 A;  1MZE A;  2QSA A;  1VQ4 V;  2CTR A;  1SES A;  3T1Y O;  1BXD A;  4CH5 A;  1R3L C;  4LF5 B;  1IBK B;  4TSF G;  4YXW G;  5M4E A;  2E5L B;  1CPY A;  1YSR A;  3HKB A;  3EHJ A;  3A0H Z;  1BS3 A;  4X64 O;  1GKZ A;  2JJ1 G;  3UQ8 A;  1NHJ A;  3T1C A;  2VWK A;  1O9H A;  5IE9 A;  4XCJ A;  1RM1 C;  3OPD A;  2Q6A A;  3IGA C;  2EZP A;  4R3A A;  3T2S A;  3L75 H;  3TXS A;  4WBN B;  4CBC A;  1KB9 F;  4LR3 A;  5L3E A;  2H55 A;  4JI6 O;  3LMM A;  3Q5J A;  4KTN A;  1MSD A;  4K8X A;  4DV2 B;  2V1D A;  1YES A;  1UYG A;  1RFY A;  3SPC A;  1VQP V;  4IIJ A;  4BW9 A;  2W0F C;  3CSX A;  1W2B U;  2BCC H;  3P30 A;  1AI4 A;  3R65 A;  1H8H G;  1K34 A;  2H94 A;  2ZCE A;  3GVM A;  2WA3 A;  1YSC A;  4KFM A;  3JAL B;  1EM1 A;  4PHZ A;  4CC6 A;  2MW2 B;  1P49 A;  4MPC A;  1SZX A;  2LO1 A;  4UV9 A;  4NR1 A;  5FNV A;  3B24 A;  1NKD A;  1D5A A;  2EXL A;  1DF5 A;  2A0L A;  4EEH A;  1Q82 W;  1HDJ A;  4IHJ A;  1AMW A;  2OCC B;  3HZ5 A;  1PM9 A;  2GDS A;  2Y4U A;  3CRM A;  2CCS A;  3RYH A;  4A5U B;  1ZXM A;  4KP4 A;  4MSW C;  3Q4H B;  3CS5 A;  2HJF C;  3CGY A;  1KYO F;  3OGI B;  3CCE V;  2EIM C;  3K79 A;  3ZRS A;  3ZBH A;  1B3Q A;  1V54 B;  5H9C A;  5EC2 C;  4ASU G;  2PYL A;  5L3B A;  3CJH B;  4LF6 B;  4FLW A;  5CTW A;  1QCE A;  4FLY A;  4TQD A;  3JYC A;  5CA1 A;  5GTH Z;  1YC4 A;  2ZE6 A;  1OCR B;  4JAS A;  2XJG A;  2RQ6 A;  4YJ2 A;  4BAY A;  4JI8 B;  1M1K W;  1QYE A;  1TUE B;  1S72 V;  1YTF D;  2P7T C;  2W0X A;  4LF8 O;  1TC6 A;  2UUA O;  2N74 A;  3EXA A;  1G4Y B;  2KSD A;  2YE8 A;  3JAS B;  1KZN A;  5FL7 G;  4KHP O;  2YKB A;  1BE3 H;  2YGA A;  3BFR A;  5IY5 C;  3A0Y A;  3C3S A;  3RFR A;  2YE9 A;  1FKA O;  2VQE B;  3CD6 V;  1XMQ O;  3OR6 C;  4P9O A;  1EZJ A;  4HY1 A;  3P32 A;  4L93 A;  2ZIN A;  4J80 A;  4GUN A;  3ETD A;  1FJG O;  4JF3 A;  1VQK V;  1IDS A;  1BKN A;  2HEP A;  3ZHT A;  3EHF A;  4NTY A;  3CE2 A;  1DLB A;  4LFA O;  4ZHQ A;  4TV9 B;  1Z5V A;  1Q90 D;  2PY5 A;  1QQC A;  5F3K A;  4JAU A;  1R6N A;  4PJ0 Z;  2V4D A;  1VP7 A;  2EIL C;  2ETN A;  3LNN A;  2KKW A;  4JI7 O;  3U2K A;  1NS1 A;  3HEK A;  3B77 A;  3VHA A;  5CA0 B;  1HNZ O;  1FXH A;  3HKD B;  1ZL8 A;  4AWP A;  1XEQ A;  2WI3 A;  2Y4T A;  3BPZ A;  1SRY A;  1AR4 A;  3DXR B;  4I4T B;  1VMG A;  4YKU A;  2ATK C;  5JVD B;  2P06 A;  3E22 B;  4F6R A;  2UUB B;  4J9Z B;  2XHR A;  3B8M A;  2YEE A;  1PPJ H;  5GGZ A;  4X62 B;  3FB7 C;  4HYP A;  5D5P A;  3N27 A;  3CX5 F;  1JM6 A;  4UB8 Z;  3WB1 A;  2HR3 A;  2IJK A;  1BHA A;  4URL A;  1V55 B;  4X88 A;  2QWQ B;  4O4J B;  2UXB O;  4UVB A;  3U10 A;  3RN4 A;  5KLV H;  4QIW F;  1M4U A;  4LF9 B;  5KHH A;  1THZ A;  3OT7 A;  3H80 A;  4LWI A;  1M90 W;  4CE1 A;  2BSK B;  1DGS A;  1OV9 A;  1U0Z A;  4LC1 A;  1Z5A A;  2UXD O;  2ARH A;  4FLU A;  4G28 B;  1M57 C;  1QVF U;  1NU1 H;  2P90 A;  2PUS A;  5M4N A;  3MD0 A;  1WPB A;  2YID A;  4DK1 A;  1PKX A;  3FYE B;  1K5S A;  1GK9 A;  1QU7 A;  2BYI A;  1OCZ C;  2CTQ A;  2VWC A;  4XKA A;  3ICX A;  5A9G A;  2VQF B;  1HP8 A;  4I50 B;  5ITZ A;  4LNU A;  1JR9 A;  2W6J G;  4I3H A;  2DN9 A;  3T1H O;  1S0V A;  1OCO C;  4TV8 A;  5D7R A;  4GQT A;  1VF5 B;  4FLV A;  4I55 A;  1RM1 B;  1YIJ V;  4DV0 B;  1HW7 A;  4PA6 A;  5E1A C;  2BTZ A;  2IWS A;  3TZ4 A;  1K33 A;  3QTC A;  1US6 A;  4MP7 A;  2GV9 A;  4W4L A;  4EFE A;  4JI3 B;  5J2T B;  1Q7Y W;  1ORQ C;  3RWR D;  2A79 B;  3ZHS A;  5CF0 A;  4PD4 F;  2ITC C;  1KP3 A;  2BU5 A;  1Z5C A;  1Y8P A;  2Q7E A;  3UO2 A;  4KSG A;  3SPH A;  2F4V B;  1SER A;  1PV0 A;  2BTO A;  2PNR A;  4R1F A;  1MOF A;  4HXZ A;  5LA6 B;  4O05 A;  1YSZ A;  2WI1 A;  1KQS U;  4PA3 A;  1GM7 A;  4NXM O;  3R4O A;  2GUZ B;  4K8Z A;  1YDX A;  2O1V A;  3JD4 A;  5LMN O;  3OGC C;  3SYC A;  4R8C A;  4OX9 B;  4FLX A;  3R4M A;  2P22 C;  1L0O A;  2X7R B;  2BU2 A;  4HZ3 A;  2WI4 A;  4H37 A;  4GZR B;  1UY9 A;  1TAE A;  1BGQ A;  4R6Z A;  2YK9 A;  3NXS A;  4JI0 B;  4XCL A;  4HYO A;  1U2O A;  1WAZ A;  1BL8 A;  1IX9 A;  4CWO A;  4OPA A;  3T1Y B;  5B1B C;  1LR1 A;  1US7 A;  1ARO P;  3QF7 A;  4BAE A;  4ZOL A;  2FTK A;  4URO A;  1VQM V;  2E74 B;  4RWU A;  4D7S A;  3OMA B;  3OMI B;  2M7W A;  3BA8 A;  2BRC A;  1BMF G;  1Q6I A;  1AH6 A;  5EZY B;  3UO3 A;  5IJ9 A;  2Q2E B;  5B66 Z;  3ABT A;  3K59 A;  3CWB H;  3C3T A;  1YIT V;  4KFG A;  4X64 B;  3OR7 C;  4I7Z B;  2WER A;  3CYG A;  3KG2 A;  4FFB A;  3G4S V;  2XJJ A;  1IZ3 A;  3IC7 A;  2IJJ A;  2VWJ A;  4BIZ A;  4JI5 B;  5D6Q A;  1KU9 A;  2LJ2 A;  4H81 A;  3HKB B;  2FML A;  4JI6 B;  3B25 A;  2AHZ A;  4P2Z A;  1NT2 B;  1MA1 A;  2Q7H A;  1QLE B;  5KHG A;  3ZHV A;  4JTD B;  5CBG A;  4F6E A;  1W59 A;  1AH8 A;  2QTS A;  1ZTE A;  1H2S B;  5LHH A;  3UT5 A;  3BAB A;  2BOC C;  2YEC A;  1AR1 B;  4DV1 O;  1H7U A;  3HPL C;  3OUF A;  3S3W A;  3L71 H;  3QNE A;  5BR8 O;  1QVG U;  3RT3 C;  2YED A;  3G6B A;  4IIJ B;  5LL6 Y;  3H9V A;  1PP9 H;  2Z5U A;  4DR7 B;  5CMU A;  2RN9 A;  3JSN A;  2RNB A;  4YKW A;  3S3X A;  3RYI A;  5FNV B;  4WUC A;  2QJ1 A;  4LPB A;  3M7M X;  4LP8 A;  4L90 A;  4ZI7 A;  4GX5 A;  4LWH A;  3FB6 C;  1R6K A;  5DN6 G;  4IHJ B;  2Q0O C;  2YS8 A;  1XNQ O;  3PN1 A;  3RYH B;  2HLD G;  3SYO A;  3OAA G;  2OTJ V;  4UUJ C;  2NR5 A;  4PL9 A;  5IYD O;  1TUB A;  3OD4 A;  2BSM A;  4J7K A;  1KKD A;  4DR1 O;  1TBW A;  2QM7 A;  4LF8 B;  1B04 A;  2UUA B;  4R50 A;  1WA8 A;  3RYF A;  3I56 V;  4PA4 A;  3U0Z A;  4DR2 O;  5B1O A;  2DQ0 A;  3A2F A;  4PDL A;  4KHP B;  1ZW9 A;  3F7Y C;  4CWF A;  1PL0 A;  5CA1 B;  3ZXQ A;  4DUY B;  3QTF A;  1M57 B;  1VQ9 V;  5J71 A;  2K1E A;  1AI7 A;  4TWK A;  4YJ2 B;  1UY6 A;  1XMQ B;  3JCU Z;  3E2E A;  1YF2 A;  2EUL A;  2F95 B;  4U93 A;  4CWT A;  2YI8 A;  1OCZ B;  2HG5 C;  2ZR3 A;  1I5Y A;  3IFX A;  4WUB A;  2UXX A;  1QLN A;  3TJT A;  1N36 O;  2XAQ A;  2CGN A;  4NH8 A;  2BTQ A;  2YXH A;  3KCY A;  1F7Y A;  3VQV A;  2YIB A;  4FM2 A;  1OCO B;  3ZN1 A;  5EYP A;  4FM1 A;  1UY8 A;  5BXZ A;  3K3W A;  2PZS A;  3TGU H;  4WFB V;  4LFA B;  4EFB A;  4V26 A;  2BU7 A;  1XNR O;  3E8B A;  4FZ0 A;  5JEN A;  2DQ3 A;  4P7A A;  4GX1 A;  3B40 A;  4JI7 B;  2YIA A;  3H1L H;  4UCS A;  1HNZ B;  2QWP B;  2C2A A;  3FKS G;  1GJV A;  2WLJ A;  1RPR A;  3G75 A;  2DE0 X;  3C11 A;  1PNK A;  5LBQ A;  2VW5 A;  3ZKB A;  4ZHQ B;  2C1G A;  3W7X A;  3K98 A;  1WNS A;  1FD9 A;  2ZIO A;  3JD0 A;  3BEH A;  5GON A;  3I5D A;  2OT5 A;  3B2E E;  2YKE A;  2X6B A;  3O65 A;  2Q68 A;  4DW0 A;  4B3S O;  1CP9 A;  5IT9 N;  3L74 H;  3RBZ A;  1GTO A;  2QWO B;  3K9S A;  1S76 D;  4TUY A;  1ZL8 B;  3J80 N;  2ZNJ A;  3ZHU A;  4H85 A;  4UCT A;  4H13 B;  1W0K G;  4XDK A;  3T4Z A;  3CYO A;  2UXB B;  4JYA O;  1K4D C;  4MPE A;  4YJ3 A;  4F6R B;  3HYY A;  2Q8G A;  4FCQ A;  1TVK A;  1COW G;  3PEH A;  5B1B B;  3ZJZ A;  1QY8 A;  3CGZ A;  1N8R W;  4PU9 A;  3CWV A;  4LF4 O;  1YC3 A;  3AK1 A;  1NVP B;  2UXD B;  1N33 O;  4HXW A;  1VQ5 V;  3ZHQ A;  2Q73 A;  4DK0 A;  2AZ0 A;  3INW A;  3MAQ A;  3LDC A;  4MVR A;  2JS3 A;  3WB2 A;  1XQ8 A;  1H38 A;  3GWK C;  3ZRW A;  1Z2G A;  2XCM A;  1FFT B;  1FS0 G;  1I0H A;  4PDR A;  1AJP A;  5EBM C;  4GX0 A;  2PI4 A;  3TZ2 A;  1EN5 A;  1FXK A;  3T1H B;  1L1F A;  3I55 V;  2VCJ A;  3AG2 C;  1S77 D;  1YXB A;  3QVN A;  5CBH A;  4XKK A;  4MW3 A;  3EVK A;  1Q81 W;  2Z3Y A;  3A0B Z;  3X2Q C;  5JH7 A;  3EKR A;  5E79 Z;  4E01 A;  3E35 A;  5ITZ B;  1M9N A;  4LNU B;  1SKV A;  1D2D A;  1NH2 D;  2YEI A;  5FWK A;  1TGO A;  4DV5 O;  1F4N A;  4TV8 B;  2YIC A;  2GHY A;  3SJA C;  2LW7 A;  4I55 B;  2ZM6 O;  3UM7 A;  1NTM H;  3FD9 A;  5KHK A;  3AEI A;  2ZIM A;  2F1M A;  4KSH A;  1THN A;  3LUT B;  2AGA A;  2WLN A;  2Q8F A;  4FJC C;  1Y66 A;  3DC6 A;  4O04 A;  4X8A A;  5LMN B;  1Y4M A;  5KMG A;  4NXN O; 
#chains in the Genus database with same CATH homology
 4JQL A;  2GFD A;  3ABU A;  3STL C;  3K97 A;  5D7D A;  2XHX A;  2XOK G;  1TID A;  3ML0 A;  2JK5 C;  4XKO A;  3HZ1 A;  1H8E G;  1K92 A;  3W7U A;  2D3O W;  1SZT A;  1EBO A;  2BZ5 A;  3VAD A;  3ZIA G;  3IED A;  2BU6 A;  4ASG A;  3ZMS A;  1BYQ A;  2YI5 A;  1YT1 A;  3G6E V;  2ZXW C;  2X0L A;  4RQF A;  1YT0 A;  2Q8I A;  2YGE A;  1QBZ A;  2YKI A;  4UXN A;  3ZM7 A;  2XDX A;  1FXK C;  3T10 A;  2EIJ C;  2H8M A;  3MNR P;  3EHB B;  1NR1 A;  3FB5 C;  3RLP A;  2FYP A;  1ZWI C;  3GIF A;  4CE3 A;  1I59 A;  4XIR A;  4I5S A;  1EFR G;  2O1W A;  4JGS A;  2YEH A;  2ZBK B;  2XX4 A;  3E8G A;  3JZ3 A;  4UVA A;  4KQV A;  3T1K A;  1M56 C;  4E00 A;  1YET A;  4B7P A;  5B1N A;  2A9H A;  2R9R B;  3O2F A;  4FCP A;  3CCJ V;  3OFN G;  1MU5 A;  3ASO C;  2AKP A;  2DWD C;  1UY7 A;  5IDJ A;  5LHI A;  2HG1 A;  5GW7 A;  5CA3 A;  1AI6 A;  2VCI A;  1KIJ A;  1R3J C;  3G7B A;  4HY6 A;  3K06 A;  3R4P A;  4YKY A;  2Y69 C;  3BY6 A;  2DYS C;  3LNU A;  4WFF A;  2QG0 A;  4BQG A;  3MHH C;  4XD8 A;  4KUM A;  2EIK B;  2BU8 A;  3INX A;  2JKI A;  2WI5 A;  5LGN A;  4B6C A;  2MK3 A;  2GQP A;  3A0X A;  3K0D A;  4O0B A;  1UYH A;  3K9A A;  1VQN V;  4QPK A;  4XDL A;  4WUD A;  2QTO A;  4JPR A;  5J9P C;  3C0E A;  4WFA V;  3SL2 A;  2UXN A;  2XAF A;  1XL6 A;  4MTX A;  3TET A;  1YJ9 V;  2BRE A;  4LP0 A;  1EA6 A;  2YEV A;  3WQ9 A;  1H2G A;  1JVM A;  1I5X A;  2WWW A;  3X2Q B;  2AHY A;  3A0R A;  4RQE A;  5B3S C;  1NBM G;  5EC1 C;  3HHU A;  1R3K C;  3H01 A;  4OXS A;  3A0Z A;  5IYC O;  1J95 A;  1UJW B;  2XDU A;  3PEJ A;  4CWP A;  1F4M A;  4MTO A;  3B27 A;  2YEA A;  2ZR2 A;  1JOY A;  1JX9 A;  4Z1M G;  1NVP D;  3CCU V;  2FWZ A;  5L3J A;  2R9I A;  3LDD A;  3ASN C;  1UYI A;  3RVZ A;  3ABK C;  4MVU A;  4MVO A;  1TIL A;  4MPN A;  4EGH A;  3ZRV A;  1HWY A;  2HVK C;  2IOQ A;  4R7C A;  4WF9 V;  1AI5 A;  1GMG A;  1NH2 B;  5FND A;  1KC8 W;  4RUE A;  5LHG A;  2ZXW B;  2JEX A;  4XIQ A;  4F4L A;  3H4L A;  1Y8O A;  2CH4 A;  2QKS A;  3OE7 G;  3ZRW B;  3ABL C;  5M4H A;  2EIM B;  2YEB A;  2LFR A;  1FXK B;  3VHC A;  5M4K A;  3WG7 C;  1FXV A;  2XAG A;  2XDL A;  1YC1 A;  2QM8 A;  3OW6 A;  2X6A A;  3PJS K;  2WI6 A;  1AJQ A;  1GM8 A;  4HZ0 A;  2KB1 A;  2ZQM A;  5H6R A;  2XX2 A;  1Q86 W;  3FB8 C;  3FT8 A;  2CK3 G;  3D0B A;  3RKZ A;  4MOT A;  4YKQ A;  2XAH A;  5IY5 B;  1YS3 A;  4CE2 A;  3B28 A;  3W7T A;  5EBL C;  2XJX A;  1VQL V;  4PDV A;  3ABM C;  2CG9 A;  3T0H A;  3E8H A;  4Q20 A;  3TZ5 A;  3OMN B;  4YKZ A;  5D7C A;  3E86 A;  3QDD A;  3DTU B;  2CCU A;  2ZDI C;  5F5R A;  2Y69 B;  3ETG A;  2XHT A;  2Q8H A;  1NQT A;  3AG1 C;  1QR9 A;  4PRX A;  2WLI A;  3OEE G;  3TCU A;  2ZDX A;  3Q5K A;  1UYE A;  5CTY A;  1UYF A;  2XD6 A;  2EZO A;  5HFM A;  4CZZ A;  2EIL B;  3CXC U;  2JDI G;  4MB9 A;  3RW0 A;  1JPX A;  5BOD A;  2DWE C;  3STZ C;  2WEQ A;  2YKJ A;  4P9P A;  1AJ6 A;  5KUK A;  4X89 A;  4MW8 A;  4BXI A;  4GEE A;  4XIT A;  4EKW A;  2JIZ G;  4XDJ A;  1QR8 A;  1YJW V;  2DYR C;  3CRK A;  4YKX A;  1YER A;  4RO2 A;  5IYB O;  2IJH A;  4XE2 A;  4TT3 G;  2XDK A;  4EGI A;  1OSF A;  2HKO A;  1ID0 A;  5EK0 A;  2XX5 A;  3QO7 A;  4XIP A;  2OCC C;  2YKC A;  4N21 A;  3CME V;  1Y8N A;  3SYQ A;  3SJQ C;  1GM9 A;  4N23 A;  4QPJ A;  1MX0 A;  1GKX A;  1UYD A;  2NNU A;  1V54 C;  4ASB A;  3ABK B;  2LFS A;  3GIG A;  3EKO A;  3U67 A;  3K04 A;  1YJN V;  3EHH A;  4WFH A;  4NH7 A;  3OWD A;  2QG2 A;  1OCR C;  5LGU A;  3QO5 A;  4UVC A;  3CCQ V;  2Y48 A;  3G7E A;  1TC0 A;  4QNH B;  2IWX A;  4I9W A;  1F51 A;  2WSS G;  2WI7 A;  3ABL B;  1K4C C;  4UV8 A;  2EBO A;  1ENV A;  2YEV B;  3SYA A;  3CPW U;  2H8P C;  3RLR A;  1S3J A;  1Y4S A;  3WHA A;  3K60 A;  4O07 A;  4GGL A;  5CBF A;  4WFE A;  1E79 G;  1WPX A;  1XL4 A;  2LP7 A;  2YE5 A;  2Q67 A;  1R62 A;  3B8N A;  2IOR A;  4DO2 A;  4ASA A;  3LNM B;  2YEG A;  2XDS A;  2QFO A;  4P30 A;  3SYP A;  3CC4 V;  1GO3 F;  3ABM B;  2YE3 A;  4R3M A;  4L94 A;  3SPG A;  4QE7 A;  1I5B A;  2NLJ C;  2HVJ C;  2YK2 A;  1V55 C;  3E83 A;  4CWS A;  5FNF A;  1JCH A;  2PI5 A;  2IW5 A;  4W7T A;  2YSU B;  3R4N A;  2YEJ A;  3HB3 B;  1K8A W;  3D36 A;  3OWB A;  4FCR A;  5B1A C;  2QA4 V;  3UKM A;  5C93 A;  4EM7 A;  1I58 A;  2FWY A;  4XC0 A;  3CCL V;  5L3F A;  3O6O A;  4URN A;  2DYR B;  3RVY A;  2YI7 A;  5IN9 A;  1K73 W;  2IH1 C;  3EFF K;  4J9Y B;  2YJX A;  1OCC C;  4FK5 C;  2YEF A;  2V7Q G;  1QZR A;  4AWO A;  4BQJ A;  1LNQ A;  1Y4U A;  2WLM A;  2XAB A;  3D3I A;  4PDM A;  1NJI W;  3E8F A;  3T0Z A;  2YJW A;  4G27 B;  3CCM V;  2WI2 A;  3JD2 A;  3Q5L A;  2EIN C;  3AG4 C;  3DGE A;  3CP1 A;  3ZMU A;  4RAI A;  1KD1 W;  1JJ2 U;  4JTC B;  2XND G;  2UWD A;  4XTJ A;  3RLQ A;  2WLH A;  3EHG A;  4YKT A;  2WLI B;  2WPD G;  3ZN0 A;  2CGF A;  4CWN A;  4JAV A;  4V25 A;  2ZKJ A;  4URM A;  1K97 A;  4PEL A;  2B1G A;  2P6J A;  2XAS A;  4WFG A;  5KA6 A;  1QLE C;  4LWE A;  5L3C A;  2XAJ A;  3VOU A;  2Q69 A;  4ZKI A;  4YKR A;  1B63 A;  3W7S A;  4MTF A;  3T4D A;  2E0A A;  1PD3 A;  1VQ8 V;  5BZB A;  3LSS A;  1P4R A;  2IOP A;  5M4M A;  3BM9 A;  3ETE A;  1E1R G;  1K7D A;  3OUS A;  3LDE A;  3OM3 B;  1Z59 A;  2IJI A;  2QEX V;  1K5Q A;  5CPH A;  2X6C A;  3B26 A;  2JJC A;  3AG2 B;  3LPS A;  2IWU A;  1AM1 A;  3SPI A;  4GT1 A;  5D6P A;  4HAM A;  2YGF A;  4L91 A;  3FV5 A;  4U7O A;  5KUM A;  3KE6 A;  1R3I C;  2WLL A;  5KA5 A;  4MTG A;  4LWF A;  4RUF A;  4H33 A;  3W7W A;  1IXM A;  4DZY A;  3CRL A;  1R73 A;  4PA9 A;  3CMA V;  2BOB C;  3GIG B;  4HZ5 A;  1VQ7 V;  2ESA A;  5M4P A;  3BMY A;  2P67 A;  4X9L A;  4XDM A;  3OEH G;  3CCR V;  3F5W C;  3JD3 A;  3ZKD A;  1PNM A;  3FYI B;  2ZDI A;  2XK2 A;  5EBW C;  1VQ6 V;  5B1A B;  3A0W A;  3FT5 A;  1MG1 A;  5J6A A;  3F7V C;  4DUH A;  4LCU C;  1MAB G;  3NMQ A;  1UYL A;  3TTZ A;  3ZCC A;  4H7Q A;  3CC2 V;  1I5D A;  3M99 B;  1DF4 A;  2QE7 G;  1OCC B;  3TK1 A;  2ZDY A;  1G8M A;  4LBE C;  3R92 A;  2O1U A;  1EI1 A;  3U2D A;  4MS2 A;  1UYM A;  2CCT A;  1UYC A;  4FIP C;  1B6Q A;  1WLE A;  2EIJ B;  4GFN A;  4PRV A;  4FPP A;  4ZBM A;  3D2R A;  3ZMT A;  2W6I G;  5DM6 V;  1NHI A;  1KP2 A;  1I5C A;  4CWQ A;  4MBC A;  1Z5B A;  1DTO A;  2EIN B;  3AG4 B;  2WEP A;  1M56 B;  4BIU A;  4L87 A;  4QJF B;  2DW4 A;  4CWR A;  3ASO B;  3JD1 A;  3VBB A;  4GCZ A;  4AWQ A;  1UYK A;  1B62 A;  1PNL A;  1A4H A;  1NHH A;  3SPJ A;  4MVM A;  3AG3 C;  4MVZ A;  3ZRX A;  1S16 A;  4NH9 A;  1S5H C;  5BOC A;  5CTU A;  4QE9 A;  2DYS B;  2B1I A;  4XBF A;  1JQ0 A;  1E1Q G;  1OZ0 A;  4U7N A;  2HKJ A;  2YI6 A;  4PA7 A;  3OW2 U;  4E2L A;  5CN0 A;  1YT2 A;  1ZWH A;  1KEC A;  1YHQ V;  2YE4 A;  2IH3 C;  4ZVI A;  3A0T A;  3MHS C;  4P8O A;  2ZD9 A;  5CTX A;  5H6Q A;  2BYH A;  4JYC A;  3G71 V;  1K3E A;  1YTF B;  3WFV A;  1MSW D;  2HFE C;  5LGT A;  1ZXN A;  2IU3 A;  1GKF A;  2YE7 A;  3VHD A;  4EGK A;  3K99 A;  5B3S B;  1W0J G;  1P7B A;  4G2K A;  2YE6 A;  4L8Z A;  1NR7 A;  4AS9 A;  1ROP A;  1YI2 V;  3K0G A;  1S14 A;  2HCH A;  4MP2 A;  1TH8 A;  1VQO V;  3ASN B;  1OHH G;  2FXS A;  1PVG A;  3TZ0 A;  2F43 G;  2JJ2 G;  4WCE V;  3E89 A;  5IDM A;  3LSQ A;  4MVQ A;  2YI0 A;  4E02 A;  4O09 A;  3TUH A;  1AJN A;  1K9M W;  3HYZ A;  2WAM A;  4EFT A;  3QO8 A;  5FNC A;  4EFU A;  2OTL V;  1BHB A;  2BT0 A;  3WG7 B;  1F23 A;  1I5A A;  4BW5 A;  3GWO A;  4FMT A;  4LWG A;  3ZMZ A;  4K4O A;  5L3G A;  3JCZ A;  4MVS A;  2EJR A;  5HFL A;  4GT8 A;  1H7S A;  3K03 A;  2EIK C;  4JYB A;  1RPO A;  3ZXO A;  2JEU A;  2WLL B;  3K08 A;  2B5U A;  4GX2 A;  3R91 A;  4HYM A;  2QF6 A;  4JTA B;  2IU0 A;  1CEZ A;  3GIE A;  2WLK A;  3CCV V;  1SET A;  4DXW A;  2K5B A;  4ASF A;  3T2M A;  3CCS V;  3GB7 C;  4MT8 A;  5L3D A;  3AG3 B;  3ZMV A;  2ITD C;  4EMV A;  3OMU A;  3CC7 V;  2GSM B;  2YE2 A;  3AG1 B;  3O0I A;  1VQ4 V;  1SES A;  1BXD A;  1R3L C;  4TSF G;  4YXW G;  5M4E A;  1CPY A;  1YSR A;  3EHJ A;  1GKZ A;  2JJ1 G;  1NHJ A;  3T1C A;  4XCJ A;  1RM1 C;  3OPD A;  2Q6A A;  3IGA C;  2EZP A;  4R3A A;  3T2S A;  4CBC A;  5L3E A;  2H55 A;  3Q5J A;  4KTN A;  2V1D A;  1YES A;  1UYG A;  3SPC A;  1VQP V;  2W0F C;  1W2B U;  3P30 A;  1AI4 A;  3R65 A;  1H8H G;  1K34 A;  2H94 A;  1YSC A;  4KFM A;  4MPC A;  4UV9 A;  3B24 A;  1NKD A;  2EXL A;  1DF5 A;  2A0L A;  4EEH A;  1Q82 W;  1AMW A;  2OCC B;  3HZ5 A;  2CCS A;  1ZXM A;  4KP4 A;  4MSW C;  2HJF C;  3CGY A;  3CCE V;  2EIM C;  3K79 A;  3ZRS A;  1B3Q A;  1V54 B;  5H9C A;  5EC2 C;  4ASU G;  5L3B A;  5CTW A;  1QCE A;  3JYC A;  1YC4 A;  1OCR B;  4JAS A;  2XJG A;  4BAY A;  1M1K W;  1QYE A;  1TUE B;  1S72 V;  1YTF D;  2P7T C;  1TC6 A;  1G4Y B;  2YE8 A;  1KZN A;  5FL7 G;  2YKB A;  2YGA A;  5IY5 C;  3A0Y A;  2YE9 A;  3CD6 V;  3OR6 C;  4P9O A;  1EZJ A;  4HY1 A;  3P32 A;  4L93 A;  3ETD A;  4JF3 A;  1VQK V;  1BKN A;  3EHF A;  1DLB A;  5F3K A;  4JAU A;  1R6N A;  2EIL C;  3U2K A;  3HEK A;  3B77 A;  3VHA A;  1FXH A;  4AWP A;  2WI3 A;  1SRY A;  4YKU A;  2ATK C;  4J9Z B;  2XHR A;  3B8M A;  2YEE A;  5GGZ A;  3FB7 C;  4HYP A;  1JM6 A;  2HR3 A;  2IJK A;  1BHA A;  4URL A;  1V55 B;  4X88 A;  4UVB A;  4QIW F;  1THZ A;  3H80 A;  4LWI A;  1M90 W;  4CE1 A;  1U0Z A;  4LC1 A;  1Z5A A;  4G28 B;  1M57 C;  1QVF U;  2P90 A;  5M4N A;  3MD0 A;  1PKX A;  3FYE B;  1K5S A;  1GK9 A;  2BYI A;  1OCZ C;  2VWC A;  4XKA A;  2W6J G;  4I3H A;  1S0V A;  1OCO C;  5D7R A;  4GQT A;  1RM1 B;  1YIJ V;  4PA6 A;  5E1A C;  2BTZ A;  2IWS A;  3TZ4 A;  1K33 A;  4MP7 A;  1Q7Y W;  1ORQ C;  2A79 B;  5CF0 A;  2ITC C;  1KP3 A;  2BU5 A;  1Z5C A;  1Y8P A;  4KSG A;  3SPH A;  1SER A;  2PNR A;  4R1F A;  1MOF A;  4HXZ A;  4O05 A;  1YSZ A;  2WI1 A;  1KQS U;  4PA3 A;  1GM7 A;  3R4O A;  2O1V A;  3JD4 A;  3OGC C;  3SYC A;  4R8C A;  3R4M A;  1L0O A;  2X7R B;  2BU2 A;  4HZ3 A;  2WI4 A;  4H37 A;  1UY9 A;  1BGQ A;  4R6Z A;  2YK9 A;  3NXS A;  4XCL A;  4HYO A;  1U2O A;  1BL8 A;  4CWO A;  5B1B C;  1US7 A;  1ARO P;  4BAE A;  2FTK A;  4URO A;  1VQM V;  3OMA B;  3OMI B;  2M7W A;  2BRC A;  1BMF G;  1AH6 A;  2Q2E B;  3ABT A;  1YIT V;  4KFG A;  3OR7 C;  2WER A;  3KG2 A;  3G4S V;  2XJJ A;  3IC7 A;  2IJJ A;  4BIZ A;  5D6Q A;  4H81 A;  3B25 A;  2AHZ A;  4P2Z A;  1QLE B;  4JTD B;  5CBG A;  1AH8 A;  5LHH A;  2BOC C;  2YEC A;  1AR1 B;  1H7U A;  3HPL C;  3OUF A;  3QNE A;  1QVG U;  2YED A;  2Z5U A;  5CMU A;  4YKW A;  4WUC A;  4LPB A;  4LP8 A;  4L90 A;  4GX5 A;  4LWH A;  3FB6 C;  1R6K A;  5DN6 G;  2HLD G;  3SYO A;  3OAA G;  2OTJ V;  4UUJ C;  4PL9 A;  5IYD O;  2BSM A;  1KKD A;  1TBW A;  2QM7 A;  4R50 A;  3I56 V;  4PA4 A;  5B1O A;  2DQ0 A;  4PDL A;  1ZW9 A;  3F7Y C;  4CWF A;  1PL0 A;  3ZXQ A;  3QTF A;  1M57 B;  1VQ9 V;  5J71 A;  2K1E A;  1AI7 A;  4TWK A;  1UY6 A;  3E2E A;  4U93 A;  4CWT A;  1OCZ B;  2HG5 C;  2ZR3 A;  1I5Y A;  3IFX A;  4WUB A;  2UXX A;  1QLN A;  2XAQ A;  4NH8 A;  1OCO B;  3ZN1 A;  1UY8 A;  3K3W A;  4WFB V;  4V26 A;  2BU7 A;  3E8B A;  2DQ3 A;  4P7A A;  4GX1 A;  1GJV A;  3FKS G;  2C2A A;  2WLJ A;  1RPR A;  3G75 A;  3C11 A;  1PNK A;  5LBQ A;  2VW5 A;  3ZKB A;  3W7X A;  3K98 A;  3JD0 A;  3BEH A;  2OT5 A;  2YKE A;  2X6B A;  2Q68 A;  1CP9 A;  3RBZ A;  1GTO A;  1S76 D;  4H85 A;  1W0K G;  4XDK A;  3T4Z A;  3CYO A;  1K4D C;  4MPE A;  3HYY A;  2Q8G A;  4FCQ A;  1COW G;  3PEH A;  5B1B B;  3ZJZ A;  1QY8 A;  3CGZ A;  1N8R W;  4PU9 A;  3CWV A;  1YC3 A;  1NVP B;  4HXW A;  1VQ5 V;  3INW A;  3LDC A;  4MVR A;  1H38 A;  3ZRW A;  2XCM A;  1FFT B;  1FS0 G;  4PDR A;  1AJP A;  5EBM C;  4GX0 A;  2PI4 A;  3TZ2 A;  1FXK A;  1L1F A;  3I55 V;  2VCJ A;  3AG2 C;  1S77 D;  5CBH A;  4XKK A;  4MW3 A;  1Q81 W;  2Z3Y A;  3X2Q C;  3EKR A;  4E01 A;  3E35 A;  1M9N A;  1NH2 D;  2YEI A;  5FWK A;  1F4N A;  2GHY A;  3UM7 A;  3AEI A;  4KSH A;  1THN A;  3LUT B;  2WLN A;  2Q8F A;  4FJC C;  1Y66 A;  4O04 A;  4X8A A;  1Y4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...