4ZKIA

The crystal structure of histidine kinase yycg with adp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
239
structure length
233
Chain Sequence
VTEQQKIDNDRKQFVSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRVDKQGGTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine kinase
publication title Conformational dynamics of the essential sensor histidine kinase WalK
pubmed doi rcsb
source organism Lactobacillus plantarum jdm1
molecule tags Transferase
total genus 78
structure length 233
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4zkiA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4zkiA02
5FNFA 1TH8A 5IDMA 4NH9A 2ZDXA 4KTNA 4CE2A 2VCIA 4EGKA 2XHRA 3Q5KA 2YI6A 1H7SA 2E0AA 3R91A 1THNA 2YJWA 1Y4UA 2VCJA 5J6AA 4XCJA 1IXMA 4XCLA 1S14A 1UYIA 3T0ZA 2JJCA 5M4MA 1UY6A 2YKIA 3INXA 4L94A 2Q8GA 3NMQA 3TZ4A 3K98A 1GKZA 5J71A 4L90A 1B3QA 3TZ5A 4MPCA 4CWOA 1YETA 2BTZA 2CCSA 3WQ9A 2IOQA 2VW5A 4NH7A 4U93A 2YE3A 4CE3A 4B6CA 1QZRA 3GIEA 2HKJA 4AWPA 1H7UA 1YT2A 1YC4A 3T2SA 4I3HA 1ZXMA 2WEPA 4XIPA 3JZ3A 3P32A 2WI2A 1UYKA 2YK2A 3QTFA 5M4KA 1ZWHA 4HXWA 1YC1A 3HHUA 3VHAA 4MP7A 1AMWA 5B1OA 1TIDA 3RLPA 1UYEA 1Z59A 1YERA 4U7OA 4GEEA 5D6QA 4KQVA 4EGIA 1BYQA 1EI1A 3SL2A 4R3AA 3OWBA 4H85A 4URMA 2O1WA 2YKBA 3B28A 2BT0A 2XX4A 3VADA 3PEHA 2VWCA 2K5BA 4BQJA 4XITA 4ZVIA 4GT1A 3GIFA 1UY8A 3T0HA 2YI5A 3HEKA 4GGLA 2JKIA 2CCTA 2PNRA 1KIJA 4KSGA 2ZKJA 4QPJA 3EKOA 4EGHA 1UYLA 2YE9A 1Y8NA 4HYPA 4O0BA 4PL9A 4V25A 4E00A 3K99A 1NHHA 4ZKIA 2YEHA 4CWNA 1ID0A 2YJXA 1YESA 1B63A 3EHFA 4LC1A 3FV5A 2BYHA 4AWOA 1I5CA 1ZW9A 2YEAA 4FPPA 4JYBA 1I59A 4PRXA 5CTWA 2WERA 4WUDA 1S16A 2AKPA 2YGAA 2XABA 4AWQA 1BGQA 1UYDA 4GT8A 4ASGA 3CRLA 1I5DA 2HG1A 4EMVA 5CTUA 4JQLA 2YEFA 2ZBKB 4CE1A 3A0XA 4YKUA 4AS9A 3B26A 4LWGA 4CWFA 2BU2A 5D7RA 4PRVA 4R1FA 5D7CA 2YK9A 2YEGA 3G7EA 3D36A 1F51A 2IWXA 4BAEA 1MX0A 1BXDA 5F5RA 3VHDA 2H8MA 4YKRA 2GQPA 3LNUA 5IN9A 2XDSA 3ZKBA 3CRKA 2ZDYA 1U2OA 3ZRVA 4XKAA 2FWYA 1AH8A 1AH6A 3ZRXA 1JM6A 5M4EA 4U7NA 4GCZA 4HXZA 3ZRWB 1PVGA 1A4HA 2IWSA 4QPKA 3ZXQA 3R4OA 1MU5A 4I5SA 4EFUA 4XKKA 5D6PA 3MD0A 1YC3A 2BYIA 2LFSA 4LWFA 3ZM7A 4WUBA 4YKXA 5F3KA 1AM1A 4DUHA 2XD6A 1I5BA 1Y4SA 3DGEA 2XJXA 4LWHA 1L0OA 5M4NA 2XJJA 2YE6A 4MTXA 3GIGB 4CWTA 5CF0A 4XIRA 1Y8OA 2YKEA 5BOCA 1YSRA 2HCHA 1ZXNA 2XDLA 4O09A 3G75A 4H81A 5B1NA 4ASBA 2WI3A 3HZ1A 4BIUA 3RLRA 4JYCA 2LFRA 1EA6A 5CTXA 4CWQA 3ZCCA 3BMYA 2XX5A 3GIGA 4HYMA 3CWVA 4E01A 3U67A 2XK2A 3HYYA 4FCQA 3OWDA 4CWPA 3T1KA 3HZ5A 3FT8A 4JAUA 4H7QA 2IOPA 3A0RA 4KSHA 2XHTA 4E02A 1JOYA 1UYGA 3KE6A 3RLQA 2BU7A 3R4NA 3R4PA 4WUCA 2P67A 1GJVA 2BRCA 2YE2A 2YE8A 1Z5AA 5CPHA 4B7PA 4XC0A 4V26A 3CGZA 3BM9A 4YKWA 5GGZA 4XKOA 4XE2A 3TUHA 4HY1A 2QFOA 1U0ZA 2Q8HA 2QM8A 4UROA 4EFTA 3R92A 3RKZA 2QF6A 1QY8A 3QDDA 4KP4A 3C11A 3A0YA 3MNRP 4LWIA 4O07A 2YGEA 3CGYA 2CGFA 2QG2A 4EEHA 4GQTA 2CH4A 2WI4A 1R62A 2IWUA 2YI0A 4YKTA 1Y8PA 4CWSA 2YECA 3IEDA 4HY6A 4BXIA 2BSMA 2C2AA 2WI7A 2IORA 4ASAA 2BREA 4FCPA 1B62A 3B24A 5FNCA 3A0ZA 2XDUA 4ASFA 4JAVA 5IDJA 2FWZA 3B27A 3TZ2A 4YKZA 2WI6A 3OW6A 3EHHA 4JASA 4FMTA 2YKJA 1QYEA 3B25A 3Q5JA 3INWA 3OMUA 2WEQA 4YKQA 3EHGA 2UWDA 4BQGA 4MT8A 1UYHA 1I5AA 4X9LA 2FXSA 1YT0A 3O0IA 2H55A 3R4MA 1NHJA 4LWEA 3NXSA 3T10A 3U2DA 2XDXA 1YS3A 1US7A 4XDMA 2GFDA 3TZ0A 4O05A 3K97A 3A0TA 2YEJA 2O1UA 4L93A 4MP2A 4NH8A 1TC6A 2BZ5A 3OPDA 3H80A 2YE4A 3O2FA 2Q2EB 4XTJA 2YE7A 3K60A 2FYPA 3ZRWA 4XD8A 2QM7A 1YT1A 2FTKA 1UY9A 1Z5CA 5D7DA 1Z5BA 5CTYA 2YE5A 3TTZA 4GFNA 2YGFA 5BODA 4L91A 3ZKDA 5C93A 2YI7A 1BKNA 1AJ6A 5FNDA 1OSFA 1TC0A 2BU6A 4DZYA 4W7TA 4HZ0A 2ESAA 3FT5A 3U2KA 4YKYA 4KFGA 1YSZA 3EKRA 2CCUA 1UYFA 2BU8A 4URNA 4P8OA 4PU9A 4FCRA 4R3MA 3WHAA 2O1VA 1UY7A 1UYMA 3ZXOA 2YEEA 3A0WA 1KZNA 1TBWA 2XCMA 4LPBA 4LP0A 4MB9A 5FWKA 3VHCA 1I58A 3LPSA 4P7AA 3EHJA 4URLA 2WI1A 5L3JA 2WI5A 3TK1A 5M4PA 4K4OA 4L8ZA 2QG0A 2XX2A 3C0EA 3D2RA 2XJGA 4O04A 3G7BA 3H4LA 1UYCA 4MPEA 4BIZA 3D0BA 4Q20A 4MOTA 2YKCA 2CG9A 2YEBA 2EXLA 2Q8IA 2XHXA 4XIQA 3O6OA 3Q5LA 2YEIA 2WWWA 2YEDA 2XDKA 1NHIA 3PEJA 2Q8FA 1GKXA 3HYZA 4HZ5A 4CWRA 5M4HA 4EM7A 4MPNA 2BU5A 1TILA 4MBCA
chains in the Genus database with same CATH superfamily
3AG7A 4UCRA 4KHPB 2ZDXA 4EGKA 1EN4A 1P7GA 3CHXA 3DC5A 5L3DA 2WLMA 5LMUO 5JH7A 5J6AA 4YY3O 5FPRA 2R70A 4XCJA 1IXMA 1S14A 3T0ZA 2JDIG 2JJCA 1GN2A 1S77D 4CS4A 4K8ZA 2L35A 2NNUA 4B3MB 3TZ4A 3CPWU 3E2EA 3CCMV 2FMLA 1M9NA 5D5PA 1JMKC 4ZI7B 4DR5B 1VF7A 4MVMA 2BTZA 3DC6A 3RW0A 2IOQA 1S5LZ 4RWUA 4NH7A 5GONA 1BZKA 1NVPB 2HHHB 3SPCA 4B6CA 1MA1A 4WFGA 2V4DA 1CPYA 2X7RB 5LL6Y 2HKJA 4AWPA 3FYEB 5ITZA 3K0DA 1Q90D 3OTOB 2NR5A 3T2SA 1YXBA 1QBZA 5KHKA 4UCUA 1VEWA 2B1GA 5LHGA 2WEPA 4XIPA 1TVKB 2L6LA 3P32A 5JENA 1UYKA 3M99B 1Y74A 4NXMB 2QWRB 3G80A 2F93B 5LMNB 5TISZ 5D5QA 2BTQA 5KHGA 5L3BA 1TIDA 2OTJV 2PYJA 1UYEA 1EM1A 1I94B 2QA4V 2QKAA 3J80N 3H9VA 1RSOA 1K34A 2DE0X 3CC2V 2YI8A 4EGIA 1BYQA 1AR5A 3ETGA 3OWBA 4JI1B 2KB1A 2O1WA 1NU1H 1IBMO 4K0KO 1VF5B 3L70H 1UY8A 1HNXO 1KQSU 3CCEV 4X20B 1H2NA 1GRJA 2QDOA 2QTOA 5EZYB 3ABLB 4P9OA 3ABMC 1FXKB 1IBLO 4LH7A 4DR4O 4QPJA 4TQFA 3HB3B 1AR4A 4FLZA 4O0BA 1Y8NA 4DXWA 2XAHA 1DF4A 4ZKIA 3PJSK 4CWNA 1ID0A 2YJXA 2QWPB 3RYCB 2ZDIA 1I0HA 4TV8A 4IL6Z 2BYHA 2H3OA 4AWOA 2YEAA 5KMGA 2ZIMA 5KHIA 4G27B 4PA4A 4WUDA 3S3WA 4NYKA 2YGAA 2OIGA 1EZVH 2XTAA 2PF4E 1Q82W 1XBLA 4GT8A 3RGBA 1I5DA 1N32O 2BTOA 3JAWB 5DEDA 4DV2B 4O2BA 1B6QA 2EIJB 2GUZB 2D2CB 1K4CC 3STZC 5J2TB 1IDSA 2YUAA 5D7CA 4O4LB 3K06A 1T5EA 3D36A 1H2KA 2N74A 2IWXA 4OPAA 1SS3A 2H8MA 2GQPA 3LNUA 2XDSA 2RJZA 4WF9V 3K9SA 4AI8A 3QO5A 3ZHRA 1O9HA 2F95B 1QNMA 1AH6A 4YJ3A 1US6A 1NI8A 3OR7C 2OTLV 3ZN1A 1YTFB 2PTMA 2IWSA 1TGOA 1KYOF 3DXRA 4QPKA 5LP6A 1D2DA 3ZXQA 4KFMA 5KHJA 3SPGA 1VQNV 1YC3A 1VP7A 2Q73A 2BYIA 2VQFO 2CAZC 1K5SA 4MW3A 5F3KA 1AM1A 5HFLA 5CA1B 5IYZB 1KU9A 1Y4SA 5L3FA 2XJXA 4LWHA 4DV6B 2DYSB 2XAQA 3B8MA 1EN5A 4XDLA 1AJPA 2LJ2A 5IWAB 3CRAA 4X1KB 1GN4A 4O09A 3JD2A 4JI0O 4ASBA 2EJ7A 1XMQO 1VQPV 4FLWA 4CC6A 1H2GA 2LFRA 3H1IH 1KKCA 5EC2C 1UPGA 2XX5A 4DR6O 4LF6O 2ZE5A 4JI6B 1RP3B 4H7QA 2IOPA 4KSHA 2UUCO 4JI8O 3OAAG 2BU7A 5LOVA 1V55B 1SQFA 2FYUH 4I7ZB 4J11A 1XMOB 3I5DA 2YICA 2VWJA 2QFOA 1XILA 1MZFA 1BL8A 1L8DA 4DV4O 4CH6A 1WPXA 1Q81W 2XAJA 3CB2A 4PHZA 2W6JG 2PI5A 2YGEA 3T4ZA 2QG2A 1Q6IA 4LNUA 4PA7A 2JK5C 3K5LA 3STLC 2EIKB 4LFCB 2WI4A 3B77A 5LYJB 3LSSA 5JJEB 1K33A 3B40A 1HNWB 3RYIB 2Y69B 3IEDA 4FFKA 4YIOA 4HY6A 2YXHA 2WLIB 4PDVA 4Z1VA 2WI7A 1AILA 1PNKA 1G6UA 2HFEC 2GHYA 2VQEO 1NH2D 4JV5B 1B62A 3TETA 1SERA 1YVWA 4JYAB 3WB2A 3K3WA 2HHHO 1RM1B 1KMIZ 4DV0B 4RUFA 5IDJA 4FMTA 5LHIA 2YKJA 1QYEA 2DJVA 2EILC 3OMUA 2WEQA 4YKQA 3QNEA 4EKWA 1W0KG 1XQ8A 1RPRA 3ZS8C 4DV5B 1CXZB 4B3SO 2XT9A 2VWKA 2X0LA 5B1BB 3R4MA 5IJ9B 3K03A 3W7SA 1DF5A 3CMAV 3ABLC 1I94O 4JF3A 1FFXB 1FXKC 2YSUB 3ZMUA 1O9GA 3T10A 5KA5A 1YS3A 1US7A 3CXCU 4PDLA 5BY1A 2GFDA 1VARA 3WB0A 4GKKO 1AP5A 3K97A 3A0TA 3LDDA 4L93A 4J7ZA 1BGYH 4NH8A 4JI4B 2Y48A 3ICXA 3O2FA 2ZR2A 4DV3O 4XTJA 1IZ3A 5LBQA 1AI5A 4FIPC 2YE7A 3K60A 3KCYA 2LGWA 5LMUB 3AK3A 1YHQV 1UY9A 4YY3B 5KAIZ 5CTYA 3E86A 1GN6A 4GFNA 4TT3G 3FB6C 2LW7A 4E72A 3CYGA 4NTXA 2YXYA 1G8MA 4N21A 2ZE7A 2QE7G 4JI7O 3BY6A 2ZD9A 3AK1A 4DZYA 3O9OA 4W7TA 3FT5A 3U2KA 4YKYA 1XEQA 2ZE8A 4JTAB 3EKRA 3QG5A 2QJ1A 4LH6A 1UYFA 4C7UA 3WHAA 2WPDG 3RYHA 1FFTB 2LGQA 3A0BZ 2XCMA 4LPBA 4U3JA 1AROP 2Q0AA 4LP0A 4MB9A 3K04A 1NKDA 5JJJB 1XDCA 1XUQA 2ARHA 2BCCH 4DUYO 2YEVB 2WI1A 1YSCA 3SJBC 2WI5A 3SYQA 4L8ZA 3C0EA 1F23A 5EYPB 4I9QA 2DYSC 1UYCA 1BQZA 1SQVH 3JATA 5BXZA 1WJZA 2YKCA 2CG9A 3G71V 2ATKC 2Q8IA 2XHXA 1HWYA 4DW0A 3O6OA 5CBHA 1GM8A 2ZIOA 1X4TA 3OT7A 2ZQMA 3ZIAG 1E1RG 3CJHB 4UV9A 2QKSA 2QEXV 1IBMB 1NHIA 4K0KB 4BW5A 5KX5B 3HYZA 1FD9A 3SJCC 4X89A 1NZ6A 3IGAC 2Y0IA 4MBCA 2WA4A 5IDMA 2A7WA 4FM2A 4DW1A 1QCEA 2Y4TA 3GB7C 4CE2A 1E79G 4TV9A 4DR4B 3Q5KA 1AJNA 2YI6A 4UVAA 3Q4HB 2E0AA 4WFFA 3R91A 1N4CA 2A79B 2YJWA 1V55C 3JAMN 5IWAO 2QWOB 4BWAA 2ZXWB 3ZBHA 4PELA 1UYIA 1S5JA 4I4TA 4I50B 1TA8A 2YKIA 3QTCA 2Q8GA 4J7KA 3K98A 1GKZA 2QM4A 3HKCB 1Z2GA 4IT5A 1BE3H 4PDRA 5IJ0B 4X64O 5B66Z 2EIKC 1R3IC 4UXNA 2ZT9B 3E22B 1N32B 2VW5A 1Z5WA 2ZNIA 2YE3A 2V7QG 4CE3A 5JJNB 2Y69C 3GIEA 2B1IA 4ZHQB 3E89A 3AG4B 1YT2A 3X2QB 1XL4A 1XI1A 1EN6A 3SPJA 4YHHO 2FL4A 1TUBB 4L87A 5FNVB 4DV7O 1K97A 4EB6A 2QWQB 2YK2A 1RM1C 3QTFA 5M4KA 1VQ9V 4ZOLB 3HHUA 3L74H 4ABMA 5EC1C 1NR1A 2OCHA 3RLPA 4EFBA 1ZWIC 1Z59A 1OJHA 1YERA 1I5XA 2DQ0A 2YIAA 1TVKA 3CCQV 1NTMH 2VQFB 2AGAA 4TUYB 5B1BC 5DN6G 3K5OA 3JALB 1M1KW 1KKDA 4URMA 4JYAO 2YKBA 1N34O 3BRCA 1DLBA 3VADA 4BQJA 2K5BA 4GT1A 3GIFA 3EFFK 1PL0A 3HEKA 4GGLA 4MS2A 4IYHA 2JKIA 3C3SA 2CCTA 2JJ2G 3JASB 3WFVA 3W7TA 1KIJA 4JI0B 1XMQB 3ETQA 1SQXH 3HKDB 4DK0A 2MW2B 4UVCA 1VQ8V 1XNQO 4EGHA 4DR6B 4LF6B 4HYPA 4X66B 2CE4A 2HP8A 4PL9A 1EBOA 2E5LB 1SC5B 2WLHA 3OMIB 4GX0A 3FB8C 4DK1A 1NHHA 3E8HA 1D5AA 2UXBO 5EBWC 1YESA 4X20A 1B63A 2UUCB 3ABKB 4GLXA 3JARA 3EHFA 4LC1A 2EJRA 1P49A 2IJHA 2WLNA 4J41A 4PRXA 2UXXA 2R72A 2WERA 1NH2B 4JI4O 1OV9A 3IFXA 4AWQA 1UYDA 4DV4B 3FAVB 3O65A 4I55A 2HG5C 4ASGA 4EMVA 4FM0A 4JQLA 5CB4A 2YEFA 4FLYA 2KQXA 2CGNA 3WU2Z 3CRCA 2ZBKB 3B09A 2ZINA 2CGOA 3OGIB 1VQ5V 4AS9A 5LGNA 2H94A 5D7RA 4J10A 4R1FA 3N2KB 1F51A 2CTQA 1BXDA 4F6RB 4YKRA 5IN9A 4WFHA 4GKJB 3HKEB 4X62O 3FKSG 3CRKA 3AEIA 4X1IA 5H6QA 2GTAA 2VQEB 5IY5B 1AH8A 1JM6A 5M4EA 1K5QA 2ZCEA 4Q6GA 3ZEDA 3L72H 1SKVA 3ZRWB 4HXZA 1ZX3A 4GX2A 4O4LA 1MU5A 4I5SA 2ETNA 4WBNA 1GAXA 3TXQA 4EFUA 3WB1A 1WLEA 4LWFA 4WUBA 3U10A 5JCOA 2A0LA 2E3CA 3BFRA 1I5BA 4GX5A 3P3NA 3DGEA 2DMXA 5A2QN 1L0OA 1NQTA 2YE6A 3GIGB 4CWTA 5H6RA 4XIRA 1E1QG 1OCRB 2ZKOA 3ML0A 2W0XA 4B3SB 2CTRA 5BOCA 2DQ3A 2HCHA 4LF8O 1H2LA 1SRYA 3OUFA 2IJIA 1KP3A 3SDLA 4JYCA 1EA6A 1Y6XA 4ICGA 5CTXA 4CWQA 3ZHVA 5IYZA 5K1XA 1Q6HA 3BMYA 4LWSB 4NTYA 3RBZA 4CBCA 3K5NA 4GKKB 1XHXA 2Q9LA 1NTZH 3HYYA 3OWDA 4CWPA 2ZM6O 2EILB 2ZXWC 1H8HG 3FT8A 1WB8A 4DV3B 3A0RA 4PA6A 3CS5A 1NS1A 2Q0OC 3CRRA 2KG7B 1R3KC 3RLQA 2ODMA 1Q7YW 2BRCA 2VRZA 3IAYA 4XE2A 3TUHA 4HY1A 1L0LH 2N05A 1U0ZA 2QM8A 1VQ7V 1S3JA 1I5YA 3RKZA 2QF6A 5H5NA 4WFAV 1QQCA 2HJDA 3A0YA 1D5NA 3CYOA 1P7BA 4NB5A 2GBOA 3AG4C 1H2MA 2CTPA 1GKFA 2E76B 2CGFA 3X2QC 3ASOB 4JI7B 1FXHA 1M57B 2CH4A 4Z1MG 2CH7B 4O4IB 4DUZO 1F4MA 1R3JC 1BT8A 4O4JB 2F4VO 4YKTA 5LHHA 5BMVA 2OCCB 1Y76A 4CWSA 3HKBA 2M6YA 2BSKB 2JGUA 2C2AA 2WSSG 3THOA 4ASAA 1JVMA 3UM7A 2FB5A 5H2FZ 3E8GA 2BREA 4JYYA 4X1YA 1K73W 3K57A 4DUYB 2Q67A 2H8PC 4YKZA 1AVMA 3EHHA 3BAAA 2WLIA 3ZMVA 2WAMA 3INWA 4TSFG 3U11A 3OUSA 3FD9A 1V54B 4R7CA 1SF9A 4BQGA 4MT8A 4X9LA 3JAKB 3EXAA 4WFEA 1OHHG 4ASUG 4IIJB 1YT0A 4OXSA 2Q6AA 4LWEA 5GONB 2DN9A 4HNAA 2HHIA 1SQPH 1L1FA 4CH5A 1SETA 4WCEV 3U2DA 1QVFU 4XDMA 5CA0A 4KL1A 5ITZB 1R1BA 5B3SB 3TZ0A 4O05A 4DR1B 4JZ2A 2YEJA 4IYIA 3CX5F 2BZ5A 4Z2WA 1JQ0A 2EZOA 2YE4A 5IJ9A 2O57A 1B06A 4PDMA 2Q2EB 1V9PA 3ABKC 1Y74B 2AXTZ 2Q8VA 1NR7A 3IC9A 4RAIA 3ZHSA 5KUKA 1YT1A 2BTQB 1Z5CA 4DRXA 5D7DA 2JGDA 3MDSA 2YE5A 1N36B 4YJ2A 2EIMB 3ZHTA 1G1XB 1UJWB 1KUQA 5LA6B 2DW4A 3APQA 3W7WA 4X66O 2XASA 3EHBB 5C93A 1S76D 1N0JA 3K59A 2E5LO 1BKNA 1AJ6A 4X64B 4X9QA 1CP9A 2UXDO 4TQDA 4HZ0A 1MNGA 2UUBO 2DWEC 2XNDG 4OGQB 2N04A 3LDEA 5GW7A 4URNA 1COWG 2V1DA 2HR3A 5JVDA 2O1VA 3WG7B 1YI2V 1SZXA 2E74B 3A8TA 4H33A 1GN3A 4UCVA 1S72V 2AW9A 4YHHB 3C3TA 4MTFA 5IY5C 1P84F 3SGIA 4AHCA 2P22C 3F7VC 4DV7B 1JFFA 5FWKA 1LUVA 1Q3EA 4NKGB 1VQKV 2MK3A 4FFBA 5L3JA 2DYRB 3TK1A 2P4VA 4TV8B 2YXLA 3MHSC 3SYAA 3G7BA 1WPBA 1F7YA 5KMGB 1PNMA 4MPEA 3N2GA 4XBFA 4N23A 3G4SV 1OCRC 3GVMA 4GKJO 2YEBA 4PV1B 1FJGO 5F2VO 1W59A 3T1CA 2YEIA 2WWWA 3ZMTA 5IYCO 2XDKA 1N34B 3PEJA 2Q8FA 5BR8O 4O2BB 5A9GA 4HZ5A 2VS0A 4B7EA 3LNMB 3SYOA 2PI4A 3H1HH 1DTOA 2BU5A 1TILA 5FNFA 4NH9A 4KTNA 3AG3B 4AQYO 3CC4V 2XHRA 4OPHA 1XNQB 2B5UA 1OCOC 5IE9A 1Y4UA 1MG1A 5KX5A 2VCJA 5HFMA 2R9RB 2UXBB 1R6NA 3JSLA 3DXRB 1UY6A 4FLTA 2JS3A 5J71A 1VQOV 1YCIA 4L90A 1B3QA 1IXBA 3TZ5A 3OFNG 1G4YB 4MPCA 3ASOC 1YJ9V 5KHHA 2R9IA 1M57C 3WQ9A 4HYOA 5J2UA 1RFYA 2KKWA 3AG1B 1ZL8A 1RPOA 4U93A 2UU9O 1JJOA 1WP8A 1OZ0A 4I50A 2OCCC 1QZRA 4NTWA 1SA0B 4JTCB 2F66C 3RN4A 2PYLA 3S3XA 1YC4A 2E75B 3TXSA 3CCUV 3CMEV 1ZXMA 4BAYA 1YITV 4HBNA 1J95A 1P4RA 3JZ3A 2JS5A 1ZWHA 4X62B 4HXWA 4PJ0Z 4MVQA 4RUEA 1F4NA 4ZHQA 4MP7A 2X6BA 3LNNA 5L3EA 5B1OA 2XAGA 3JSNA 3FB5C 2OT5A 3UO3A 4U7OA 1V54C 5LOVB 4H37A 1ZSPA 4PI2A 3JD3A 4D7SA 3L73H 3SL2A 2GTSA 4P2ZA 4J80A 2ADQB 4CS2A 4MVUA 4H13B 3UT5A 2XX4A 3PEHA 4XITA 4ZVIA 1FKAO 4ZIBA 3T0HA 4UCSA 5B3SC 3OR6C 4XDJA 4LNUB 4U3FH 4LF8B 2PNRA 2RMKB 1BHBA 2X6AA 4TUYA 1H8EG 4J9ZB 1BHAA 4HAMA 3EKOA 2P7TC 4ZBMA 4MW8A 2ZM6B 2YEHA 2ILMA 4B3TB 2UUAO 3BA9A 4JTDB 5DM6V 1B04A 2HVJC 2EIMC 3B8NA 5KUMA 2CDYA 3FV5A 4JYBA 3QF7A 4P9PA 5IYDO 1I59A 4DR1O 4X88A 3H1JH 3B4SA 5JQGB 1S16A 2AKPA 1M93A 3ASNB 4QJFB 3CRLA 2CTWA 2IM9A 2YI9A 4B08A 1ORQC 1UFIA 4O2AA 1QHTA 3A0XA 4FLXA 3W7UA 1EFRG 3WG7C 1X59A 4YKUA 3AG2B 3B26A 3OW2U 4LWGA 1N36O 1FYJA 4PRVA 1Q5OA 1WN7A 3G67A 4DUZB 2BSKA 2F4VB 2YEGA 2YK9A 3G7EA 4YXWG 4BAEA 2JJ1G 1A32A 5F5RA 2W0FC 3RFRA 3ZKBA 3OD4A 1IURA 2ZDYA 3LUTB 3ZRVA 1WA8B 2DYRC 2FWYA 2ZDIC 4LF7O 4I0XB 4U7NA 3M7MX 1K3EA 3R4OA 2HEPA 3N2KA 3OEHG 4XKKA 3VQXA 2LFSA 1ENVA 2IU3A 4YKXA 3HKEA 4PD4F 4ZI7A 3ZX6A 3T1HB 3BPZA 5M4NA 2XJJA 4MTXA 3OM3B 3RWRD 1YDXA 1GTOA 1Y8OA 2BE3A 5BZBA 1YIJV 2YKEA 1N33B 4J9YB 2F1MA 2IJKA 1ZAUA 2F23A 4CC5A 2Z3YA 2Z0AA 3BABA 1S5HC 3C90A 3D36C 4BW9A 5B1NA 2EBOA 3J7AU 3G75A 3AG3C 4DYLA 3RLRA 2A9HA 2QSAA 3CE2A 1CEZA 5CMUA 3GIGA 1IBKO 4HYMA 4O4HB 4FM1A 3CWVA 4E01A 3RYHB 3A0HZ 1R3LC 4UVBA 3SYPA 4U3JB 4FVMA 4FCQA 2RN9A 5B1AB 3HZ5A 4JAUA 4BR6A 1VF6C 2XHTA 4E02A 1MSWD 2IBZH 3RYFB 1JOYA 3KE6A 2P90A 4FZ0A 4X65O 1GJVA 2YE8A 2ADPA 4DR7O 4EEQA 2HJFC 4V26A 4YKWA 5GGZA 1H2SB 3UQ8A 3CD6V 4XKOA 4IHJB 3UO2A 4HZ3A 3CEIA 3W7XA 2YIBA 3AG1C 4UROA 5FPOA 3R92A 3QDDA 4KP4A 1I7FA 2IW5A 2WLJA 3E8FA 3MNRP 4O07A 1GO3F 2QWNB 2LQTA 2UXDB 4GQTA 1AI6A 5EZYA 2UUBB 2IWUA 2AZ0A 2R9AA 5EK0A 2BOCC 4GZRB 1FXKA 1Y8PA 1VQ6V 1YJWV 2YECA 1WAZA 2NN4A 4BXIA 3I56V 2BSMA 4DR2B 1J5EO 4FCPA 2ITCC 3B24A 2PY5A 3RYCA 1PM9A 3CRQA 1DGSA 5J9PC 5C8YB 2CH7A 1VMGA 4E2LA 2XDUA 3CCRV 1XNRO 4ASFA 2Q7EA 3B27A 2UXCO 3TZ2A 2WI6A 3MHHC 4I4TB 2XAFA 4D7TA 3B25A 2W6IG 3EHGA 3VQYA 3JCUZ 1UYHA 4YIPA 4JI5O 3JAWA 4KUMA 3PN1A 1FJGB 2GUZA 1TUEB 3ZHUA 2G38A 3BVOA 3G6BA 1NHJA 1EZJA 3E35A 3NXSA 4JPRA 2EINC 5J2TA 1PP9H 1MZEA 5BR8B 2GV9A 2WLLB 4IGGA 2YIDA 2Q5ZA 4FJCC 3JAKA 3S5TA 1YJNV 2O1UA 4MVOA 1TC6A 4IIJA 2OIEA 3OPDA 1VQMV 4AQYB 2XUMA 3H80A 5LGTA 4TWKA 1SESA 4EB6B 4L8JA 1U96A 1OCZB 4I9WA 2FYPA 4LFBO 1KBHA 1IVSA 5FL7G 3TTZA 2YGFA 3OE7G 3ASNC 3E83A 4L91A 1KECA 2YS8A 5CA1A 1LNQA 3SPHA 1Q86W 2PUSA 2NLJC 1DK1A 3OGCC 2YI7A 2CK3G 1K92A 3AG2C 4DR3O 4PI0A 1TC0A 2BU6A 4B3TO 1SQQH 4X1KA 2UU9B 4KFGA 1M90W 1OCOB 2BU8A 4TOIA 2IH3C 4FCRA 1JCHA 5LA6A 1UY7A 1UYMA 3JD4A 1FAFA 4MSWC 1QVGU 3CCJV 1VQLV 3KG2A 2OWOA 3SR2C 2JRIA 1MSDA 4MVZA 3VHCA 1I58A 2GSMB 5LXTB 2IJJA 3D3QA 2WA3A 3LPSA 4LP8A 1LR1A 4G2KA 4MVRA 1JJ2U 3R65A 4FLUA 2QG0A 1NJIW 3JARB 1AJQA 4O04A 3H4LA 4LF5B 4BIZA 3D0BA 3T4DA 3RVYA 4MOTA 4JI2O 2JEXA 2EXLA 2JVDA 1Q8IA 1IX9A 4R8CA 4I55B 3LSUA 2D3OW 2X6CA 3VOUA 3FX7A 2M7WA 2YC0A 5CB4B 3U0ZA 5LYJA 3J81N 5JH7B 4CWRA 4EFEA 5M4HA 1ZUQA 3RYIA 2DOSA 4UUJC 4P30A 3H01A 1GMGA 3LDCA 2AZ2A 1VQ4V 4J42A 1TH8A 4UFZA 3K08A 5B1AC 1QLEB 1I08A 5KA6A 3T1HO 4R50A 2VCIA 1Q6UA 2AHYA 1H7SA 1KD1W 1THNA 2HKOA 4X1IB 1N33O 1K9MW 3HPLC 4XCLA 2EZPA 2UUAB 3CC7V 5M4MA 2Q69A 5EIBC 1M56B 3DTUB 1HNZO 3INXA 4L94A 3NMQA 4WBNB 3NR7A 2IH1C 1QR8A 3TCUA 1AB3A 4LCUC 2P6JA 1FXVA 1KB9F 4CWOA 4GYCB 1YETA 3JD1A 3OEEG 2CCSA 3I55V 4LR3A 5K1PA 4LFAB 3EVKA 3VBBA 1FFXA 1VF6A 4J7JA 3LSQA 5CBFA 1QR9A 4LF9O 3D8CA 3F5TA 1W2BU 1HP8A 1H7UA 4I3HA 5AG2A 2GDSA 1YEWA 4K8XA 2UXNA 1RSOB 2JIZG 1HR0B 2JEUA 4QE7A 2WI2A 3K0GA 1KC8W 1WNSA 4B7KA 4WFBV 1HW7A 1YC1A 3BHPA 3VHAA 1JPXA 1SA0A 3HR0A 5L3GA 3T1YO 4LF7B 4JZGA 1AMWA 3E8BA 4GEEA 3MAQA 3ETDA 4B3RB 5D6QA 3TGUH 1TAEA 5B5EZ 4KQVA 2XHBA 2Y0PA 3QO7A 4DR2O 2PGGA 1EI1A 5IYBO 3UKMA 4R3AA 1NTKH 1R6TA 3DSQA 2CUGA 4H85A 4QIWF 2ZNJA 4JAAA 3B28A 5EIBD 2BT0A 2VWCA 5KLVH 4JI3O 2YI5A 3BA8A 4UCTA 2PZSA 4OX9B 1FPOA 5CN0A 3K58A 1BMFG 5CA3A 2KSDA 4H44B 4UB6Z 1SQBH 4KSGA 4FK5C 4KHPO 5BMVB 3SJQC 1Y76B 1XHZA 3HKBB 2ZKJA 1OCZC 1ZTEA 1UYLA 2YE9A 1IBKB 4V25A 1H38A 2HVKC 4E00A 4LF4B 3K99A 4X1YB 5LGUA 2YEVA 3CCVV 1SZTA 3B2EE 5EYPA 1PV0A 4NXNB 1R6KA 4H0LB 4X65B 4B3MO 1W0JG 1I5CA 1ZW9A 4DR7B 4FPPA 1Y66A 4NVPA 5CTWA 2F43G 3ZN0A 2YDEA 3T2MA 4CS3A 3ABUA 4UB8Z 2XABA 4DR5O 1BGQA 1AP6A 1S0VA 4DV1B 3BCCH 2HG1A 3CJHA 5CTUA 1GH6A 4CH4A 2C1IA 4CE1A 4FZ1A 3QVNA 4W4KA 3L75H 2RDCA 4F4LA 4YJ3B 4CWFA 3OTOO 1WP7A 1OCCB 1GK9A 1LUWA 2WLKA 3F7YC 3P30A 2BU2A 1MOFA 4HNAB 3JYCA 5LP6B 3TJTA 5JQGA 2BOBC 5CA0B 3OTFA 1MX0A 3VHDA 4NXMO 3N27A 3Q4HA 1QLNA 5LMNO 1J5EB 1U2OA 4XKAA 5GTIZ 1MMMA 1AI4A 3ZRXA 1Y4MA 3P3PA 4GCZA 3UCSC 4BIOA 3CCLV 3ABTA 1PVGA 1A4HA 3H1KH 2IU0A 1NVPD 1XNRB 3IJ4A 4DRXB 2UXCB 5D6PA 3MD0A 2JGDB 2RNBA 1PNLA 3HKCA 1XL6A 2K1EA 4YJ2B 3H1LH 3ZM7A 4DUHA 1N0NA 4R6ZA 1BS3A 2XD6A 1WA8A 4JI1O 5IJ0A 4I0XA 3E22A 5CF0A 4JI5B 3K9AA 4PA3A 1YSRA 4GUNA 5KAFZ 1ZXNA 4MTOA 3KZIZ 2XDLA 4H81A 1QLEC 2WI3A 2A3QA 1TUBA 3HZ1A 4BIUA 4LF5O 3ZCCA 4RQFA 1NT2B 5FNVA 1PPJH 5JVDB 3SPIA 3AK2A 4CH3A 5FLXN 2P5OA 2EIJC 5EBMC 4DO2A 2XK2A 3U67A 3KCXA 1PKXA 4ZOLA 1PD3A 1PL4A 3T1KA 1JFFB 2YIBD 4MVSA 1UYGA 1M56C 2Y4UA 4UV8A 4FFBB 3R4NA 3R4PA 2P67A 1JX9A 2YE2A 4LFBB 4WUCA 1Z5AA 3CSXA 5CPHA 4B7PA 4XC0A 3CGZA 3BM9A 1SQGA 5JCOC 1AR1B 3ZJZA 4O4HA 2EINB 3JALA 2LW1A 1ROPA 2Q8HA 3N2GB 4EFTA 4D6TH 1QY8A 3C11A 3ZMZA 4DV2O 3RYFA 2Q68A 3SYCA 4LWIA 1K7DA 1K4DC 3CGYA 2Q7HA 4DR3B 1M4UA 5CBGA 4EEHA 1FS0G 2K9PA 1WB7A 3JASA 1R62A 2YI0A 4IHJA 1N8RW 2ZE6A 2P4KA 3HKDA 3CXHF 2QGNA 1QU7A 1JA8A 2IORA 4W4LA 1YZBA 2Q4PA 3CP1A 3IC7A 4LFAO 4PA9A 5FNCA 3K5MA 3ZRSA 3A0ZA 3CWBH 4KXRA 4JAVA 2FWZA 3F5WC 1HNXB 3OW6A 1KP2A 4JASA 4AILC 3Q5JA 3FB7C 4QE9A 2P06A 1Y67A 1IBLB 1HR0O 2B9ZA 4DV6O 2C1GA 3FAVA 2UWDA 1I5AA 4JI2B 2FXSA 3M8AA 3FFQA 5C8YA 3O0IA 3FYIB 2H55A 1ZLZA 3BEHA 1BSMA 3D3IA 1HDJA 2QTSA 5J2UB 1ZL8B 2RCVA 2QKCA 2LO1A 4B3RO 3VQVA 1YTFD 5L3CA 2XDXA 3ETEA 4XDKA 1L0NH 4MTGA 2HLDG 4F6RA 2Z5UA 4MP2A 1M5IA 3ZMSA 3SJAC 1VIBA 4JI6O 2AHZA 3ABMB 4CZZA 4GX1A 5IT9N 4RO2A 1Q43A 3ZRWA 4XD8A 2QM7A 5E1AC 2WLLA 2FTKA 4OX9O 2QR4A 2Q7GA 3ZHQA 4FLVA 4F6EA 1Z5BA 1XMOO 3GWOA 5BODA 2ZR3A 1HNZB 4K3AA 3ZKDA 5E79Z 1NBMG 4NR1A 1R73A 2DWDC 5DECA 4UCOA 3JCZA 1U97A 4LF4O 5FNDA 3L71H 1OSFA 3RVZA 3L9DA 1OCCC 2XOKG 3LMMA 4LBEC 2OYQA 1BQ0A 3OMNB 3UT5B 5LP6C 4LFCO 2ESAA 4NXNO 2EX3A 1YSZA 2CCUA 1HNWO 4LF9B 5H9CA 3CCSV 4RQEA 4P8OA 4PU9A 1GM9A 4LWSA 2A06H 3KKYA 4X8AA 4R3MA 3ZXOA 3R66A 2YEEA 1KZNA 3A0WA 1TBWA 1URFA 4QNHB 3APOA 1GM7A 4JV5O 3JATB 1MABG 4DV1O 1XOUA 3K79A 2ITDC 3VQWA 2EULA 2KG7A 1Z5VA 4P7AA 3EHJA 4K35A 4QGPA 4DV0O 4URLA 5JWPA 5M4PA 1YF2A 4K4OA 1AI7A 3T1YB 4A5UB 3JD0A 2XX2A 3D2RA 2XJGA 3RT3C 5GTHZ 2RQ6A 3GWKC 1BCCH 1XREA 4E4EA 4Q20A 4G28B 3OMAB 4DV5O 5LXTA 2FKXA 3CRMA 3Q5LA 4XIQA 3G6EV 4TV9B 1K8AW 2YEDA 1THZA 4JGSA 1JR9A 1GKXA 2LP7A 4O2AB 4O4IA 4JI8B 4O4JA 5EBLC 4JI3B 4EM7A 4MPNA 3QO8A 3A2FA
chains in the Genus database with same CATH topology
2ZDXA 4EGKA 5L3DA 2WLMA 5J6AA 4XCJA 1IXMA 1S14A 3T0ZA 2JDIG 2JJCA 1S77D 2NNUA 3TZ4A 3CPWU 3E2EA 3CCMV 1M9NA 4MVMA 2BTZA 3RW0A 2IOQA 4NH7A 1NVPB 3SPCA 4B6CA 4WFGA 2HKJA 1CPYA 2X7RB 4AWPA 3FYEB 3K0DA 3T2SA 1QBZA 2B1GA 5LHGA 2WEPA 4XIPA 3P32A 1UYKA 3M99B 5L3BA 1TIDA 2OTJV 1UYEA 2QA4V 1K34A 3CC2V 4EGIA 1BYQA 3ETGA 3OWBA 2KB1A 2O1WA 1UY8A 1KQSU 3CCEV 2QTOA 3ABLB 4P9OA 3ABMC 1FXKB 4QPJA 3HB3B 4O0BA 1Y8NA 4DXWA 2XAHA 1DF4A 4ZKIA 3PJSK 4CWNA 1ID0A 2YJXA 2ZDIA 2BYHA 4AWOA 2YEAA 4G27B 4PA4A 4WUDA 2YGAA 1Q82W 4GT8A 1I5DA 1B6QA 2EIJB 1K4CC 3STZC 5D7CA 3K06A 3D36A 2IWXA 2H8MA 2GQPA 3LNUA 2XDSA 4WF9V 3QO5A 1AH6A 3OR7C 2OTLV 3ZN1A 1YTFB 2IWSA 4QPKA 3ZXQA 4KFMA 3SPGA 1VQNV 1YC3A 2BYIA 1K5SA 4MW3A 5F3KA 1AM1A 5HFLA 1Y4SA 5L3FA 2XJXA 4LWHA 2DYSB 2XAQA 3B8MA 4XDLA 1AJPA 4O09A 3JD2A 4ASBA 1VQPV 1H2GA 2LFRA 5EC2C 2XX5A 4H7QA 2IOPA 4KSHA 3OAAG 2BU7A 1V55B 2QFOA 1BL8A 1WPXA 1Q81W 2XAJA 2W6JG 2PI5A 2YGEA 3T4ZA 2QG2A 4PA7A 2JK5C 3STLC 2EIKB 2WI4A 3B77A 3LSSA 1K33A 2Y69B 3IEDA 4HY6A 2WLIB 4PDVA 2WI7A 1PNKA 2HFEC 2GHYA 1NH2D 1B62A 3TETA 1SERA 3K3WA 1RM1B 4RUFA 5IDJA 4FMTA 5LHIA 2YKJA 1QYEA 2EILC 3OMUA 2WEQA 4YKQA 3QNEA 4EKWA 1W0KG 1RPRA 2X0LA 5B1BB 3R4MA 3K03A 3W7SA 1DF5A 3CMAV 3ABLC 4JF3A 1FXKC 2YSUB 3ZMUA 3T10A 5KA5A 1YS3A 1US7A 3CXCU 4PDLA 2GFDA 3K97A 3A0TA 3LDDA 4L93A 4NH8A 2Y48A 3O2FA 2ZR2A 4XTJA 5LBQA 1AI5A 4FIPC 2YE7A 3K60A 1YHQV 1UY9A 5CTYA 3E86A 4GFNA 4TT3G 3FB6C 1G8MA 4N21A 2QE7G 3BY6A 2ZD9A 4DZYA 4W7TA 3FT5A 3U2KA 4YKYA 4JTAB 3EKRA 1UYFA 3WHAA 2WPDG 1FFTB 2XCMA 4LPBA 1AROP 4LP0A 4MB9A 3K04A 1NKDA 2YEVB 2WI1A 1YSCA 2WI5A 3SYQA 4L8ZA 3C0EA 1F23A 2DYSC 1UYCA 2YKCA 2CG9A 3G71V 2ATKC 2Q8IA 2XHXA 1HWYA 3O6OA 5CBHA 1GM8A 2ZQMA 3ZIAG 1E1RG 4UV9A 2QKSA 2QEXV 1NHIA 4BW5A 3HYZA 4X89A 3IGAC 4MBCA 5IDMA 1QCEA 3GB7C 4CE2A 1E79G 3Q5KA 1AJNA 2YI6A 4UVAA 2E0AA 4WFFA 3R91A 2A79B 2YJWA 1V55C 2ZXWB 4PELA 1UYIA 2YKIA 2Q8GA 3K98A 1GKZA 4PDRA 2EIKC 1R3IC 4UXNA 2VW5A 2YE3A 2V7QG 4CE3A 3GIEA 2Y69C 2B1IA 3E89A 3AG4B 1YT2A 3X2QB 1XL4A 3SPJA 4L87A 1K97A 2YK2A 1RM1C 3QTFA 5M4KA 1VQ9V 3HHUA 5EC1C 1NR1A 3RLPA 1ZWIC 1Z59A 1YERA 1I5XA 2DQ0A 3CCQV 5DN6G 5B1BC 1M1KW 1KKDA 4URMA 2YKBA 1DLBA 3VADA 4BQJA 2K5BA 4GT1A 3GIFA 3EFFK 1PL0A 3HEKA 4GGLA 4MS2A 2JKIA 2CCTA 2JJ2G 3W7TA 3WFVA 1KIJA 4UVCA 1VQ8V 4EGHA 4HYPA 4PL9A 1EBOA 3OMIB 2WLHA 1NHHA 4GX0A 3FB8C 3E8HA 5EBWC 1YESA 1B63A 3ABKB 3EHFA 4LC1A 2EJRA 2IJHA 2WLNA 4PRXA 2UXXA 2WERA 1NH2B 3IFXA 4AWQA 1UYDA 2HG5C 4ASGA 4EMVA 4JQLA 2YEFA 2ZBKB 1VQ5V 4AS9A 5D7RA 2H94A 5LGNA 4R1FA 1F51A 1BXDA 4YKRA 5IN9A 4WFHA 3CRKA 3FKSG 3AEIA 5H6QA 1AH8A 5IY5B 1JM6A 5M4EA 1K5QA 4HXZA 3ZRWB 4GX2A 1MU5A 4I5SA 4EFUA 1WLEA 4LWFA 4WUBA 2A0LA 1I5BA 4GX5A 3DGEA 1L0OA 1NQTA 2YE6A 3GIGB 4CWTA 5H6RA 4XIRA 1E1QG 1OCRB 3ML0A 5BOCA 2DQ3A 2HCHA 1SRYA 3OUFA 2IJIA 1KP3A 4JYCA 1EA6A 5CTXA 4CWQA 3BMYA 3RBZA 4CBCA 3HYYA 3OWDA 4CWPA 2EILB 2ZXWC 1H8HG 3FT8A 3A0RA 4PA6A 1R3KC 3RLQA 1Q7YW 2BRCA 4XE2A 3TUHA 4HY1A 1U0ZA 2QM8A 1VQ7V 1S3JA 1I5YA 3RKZA 2QF6A 4WFAV 3A0YA 3CYOA 1P7BA 3AG4C 1GKFA 2CGFA 3X2QC 3ASOB 1FXHA 1M57B 2CH4A 4Z1MG 1F4MA 1R3JC 4YKTA 5LHHA 2OCCB 4CWSA 2C2AA 2WSSG 4ASAA 1JVMA 3UM7A 2BREA 3E8GA 1K73W 2Q67A 2H8PC 4YKZA 3EHHA 2WLIA 3ZMVA 2WAMA 3INWA 4TSFG 3OUSA 1V54B 4R7CA 4BQGA 4MT8A 4X9LA 4WFEA 1OHHG 4ASUG 1YT0A 4OXSA 2Q6AA 4LWEA 1L1FA 1SETA 4WCEV 3U2DA 1QVFU 4XDMA 5B3SB 3TZ0A 4O05A 2YEJA 2BZ5A 1JQ0A 2EZOA 2YE4A 4PDMA 2Q2EB 3ABKC 1NR7A 4RAIA 1YT1A 5KUKA 1Z5CA 5D7DA 2YE5A 2EIMB 1UJWB 2DW4A 3W7WA 2XASA 3EHBB 5C93A 1S76D 1BKNA 1AJ6A 1CP9A 4HZ0A 2DWEC 2XNDG 3LDEA 5GW7A 4URNA 1COWG 2V1DA 2HR3A 2O1VA 3WG7B 1YI2V 4H33A 1S72V 4MTFA 5IY5C 3F7VC 5FWKA 1VQKV 2MK3A 5L3JA 2DYRB 3TK1A 3MHSC 3SYAA 3G7BA 1PNMA 4MPEA 4XBFA 4N23A 3G4SV 1OCRC 2YEBA 3T1CA 2YEIA 2WWWA 3ZMTA 5IYCO 2XDKA 3PEJA 2Q8FA 4HZ5A 3LNMB 3SYOA 2PI4A 1DTOA 2BU5A 1TILA 5FNFA 4NH9A 4KTNA 3AG3B 3CC4V 2XHRA 2B5UA 1OCOC 1Y4UA 1MG1A 2VCJA 5HFMA 2R9RB 1R6NA 1UY6A 5J71A 1VQOV 4L90A 1B3QA 3TZ5A 3OFNG 1G4YB 4MPCA 3ASOC 1YJ9V 2R9IA 1M57C 3WQ9A 4HYOA 3AG1B 1RPOA 4U93A 1OZ0A 2OCCC 1QZRA 4JTCB 1YC4A 3CCUV 3CMEV 1ZXMA 4BAYA 1YITV 1J95A 1P4RA 3JZ3A 1ZWHA 4HXWA 4MVQA 4RUEA 1F4NA 4MP7A 2X6BA 5L3EA 5B1OA 2XAGA 3FB5C 2OT5A 4U7OA 1V54C 4H37A 3JD3A 3SL2A 4P2ZA 4MVUA 2XX4A 3PEHA 4XITA 4ZVIA 3T0HA 5B3SC 3OR6C 4XDJA 2PNRA 1BHBA 2X6AA 1H8EG 4J9ZB 1BHAA 4HAMA 3EKOA 2P7TC 4ZBMA 4MW8A 2YEHA 4JTDB 5DM6V 2HVJC 2EIMC 3B8NA 5KUMA 3FV5A 4JYBA 4P9PA 5IYDO 1I59A 4X88A 1S16A 2AKPA 3ASNB 4QJFB 3CRLA 1ORQC 3A0XA 3W7UA 1EFRG 3WG7C 4YKUA 3AG2B 3B26A 3OW2U 4LWGA 4PRVA 2YK9A 2YEGA 3G7EA 4YXWG 4BAEA 2JJ1G 5F5RA 2W0FC 3ZKBA 2ZDYA 3LUTB 3ZRVA 2DYRC 2FWYA 2ZDIC 4U7NA 1K3EA 3R4OA 3OEHG 4XKKA 2LFSA 1ENVA 2IU3A 4YKXA 5M4NA 2XJJA 4MTXA 3OM3B 1GTOA 1Y8OA 5BZBA 1YIJV 2YKEA 4J9YB 2IJKA 2Z3YA 1S5HC 3G75A 2EBOA 5B1NA 3AG3C 3RLRA 2A9HA 1CEZA 5CMUA 3GIGA 4HYMA 3CWVA 4E01A 1R3LC 4UVBA 3SYPA 4FCQA 5B1AB 3HZ5A 4JAUA 2XHTA 4E02A 1MSWD 1JOYA 3KE6A 2P90A 2YE8A 1GJVA 2HJFC 4V26A 4YKWA 5GGZA 3CD6V 4XKOA 4HZ3A 3W7XA 3AG1C 4UROA 3R92A 3QDDA 4KP4A 2IW5A 2WLJA 3E8FA 3MNRP 4O07A 1GO3F 4GQTA 1AI6A 2IWUA 5EK0A 2BOCC 1FXKA 1Y8PA 1VQ6V 1YJWV 2YECA 4BXIA 3I56V 2BSMA 4FCPA 2ITCC 3B24A 5J9PC 4E2LA 2XDUA 3CCRV 4ASFA 3B27A 3TZ2A 2WI6A 3MHHC 2XAFA 3B25A 2W6IG 3EHGA 1UYHA 4KUMA 1TUEB 1NHJA 1EZJA 3E35A 3NXSA 2EINC 4JPRA 2WLLB 4FJCC 1YJNV 2O1UA 4MVOA 1TC6A 3OPDA 1VQMV 3H80A 5LGTA 4TWKA 1SESA 1OCZB 4I9WA 2FYPA 5FL7G 3TTZA 2YGFA 3OE7G 3ASNC 3E83A 4L91A 1KECA 1LNQA 3SPHA 1Q86W 2NLJC 3OGCC 2YI7A 2CK3G 1K92A 3AG2C 1TC0A 2BU6A 4KFGA 1M90W 1OCOB 2BU8A 2IH3C 4FCRA 1JCHA 1UY7A 1UYMA 3JD4A 4MSWC 1QVGU 3CCJV 1VQLV 3KG2A 4MVZA 3VHCA 1I58A 2GSMB 2IJJA 3LPSA 4LP8A 4G2KA 4MVRA 1JJ2U 3R65A 2QG0A 1NJIW 1AJQA 4O04A 3H4LA 4BIZA 3D0BA 3T4DA 3RVYA 4MOTA 2JEXA 2EXLA 4R8CA 2D3OW 2X6CA 3VOUA 2M7WA 4CWRA 5M4HA 4UUJC 4P30A 3H01A 1GMGA 3LDCA 1VQ4V 1TH8A 3K08A 5B1AC 1QLEB 5KA6A 4R50A 2VCIA 2AHYA 1H7SA 1KD1W 1THNA 2HKOA 1K9MW 3HPLC 4XCLA 2EZPA 3CC7V 5M4MA 2Q69A 1M56B 3DTUB 3INXA 4L94A 3NMQA 2IH1C 1QR8A 3TCUA 4LCUC 2P6JA 1FXVA 4CWOA 1YETA 3JD1A 3OEEG 2CCSA 3I55V 3VBBA 3LSQA 5CBFA 1QR9A 1W2BU 1H7UA 4I3HA 2UXNA 2JIZG 2JEUA 4QE7A 2WI2A 3K0GA 1KC8W 4WFBV 1YC1A 3VHAA 1JPXA 5L3GA 1AMWA 3E8BA 4GEEA 3ETDA 5D6QA 4KQVA 3QO7A 1EI1A 5IYBO 3UKMA 4R3AA 4H85A 4QIWF 3B28A 2BT0A 2VWCA 2YI5A 5CN0A 1BMFG 5CA3A 4KSGA 4FK5C 3SJQC 2ZKJA 1OCZC 1UYLA 2YE9A 4V25A 1H38A 2HVKC 4E00A 3K99A 5LGUA 2YEVA 3CCVV 1SZTA 1R6KA 1W0JG 1I5CA 1ZW9A 4FPPA 1Y66A 5CTWA 2F43G 3ZN0A 3T2MA 3ABUA 2XABA 1BGQA 1S0VA 2HG1A 5CTUA 4CE1A 4F4LA 4CWFA 1OCCB 1GK9A 2WLKA 3F7YC 3P30A 2BU2A 1MOFA 3JYCA 2BOBC 1MX0A 3VHDA 1QLNA 1U2OA 4XKAA 1AI4A 3ZRXA 1Y4MA 4GCZA 3CCLV 3ABTA 1PVGA 1A4HA 2IU0A 1NVPD 5D6PA 3MD0A 1PNLA 1XL6A 2K1EA 3ZM7A 4DUHA 4R6ZA 2XD6A 5CF0A 3K9AA 4PA3A 1YSRA 1ZXNA 4MTOA 2XDLA 4H81A 1QLEC 2WI3A 3HZ1A 4BIUA 3ZCCA 4RQFA 3SPIA 2EIJC 5EBMC 4DO2A 2XK2A 3U67A 1PKXA 1PD3A 3T1KA 4MVSA 1UYGA 1M56C 4UV8A 3R4NA 3R4PA 4WUCA 2P67A 1JX9A 2YE2A 1Z5AA 5CPHA 4B7PA 4XC0A 3CGZA 3BM9A 1AR1B 3ZJZA 2EINB 1ROPA 2Q8HA 4EFTA 1QY8A 3C11A 3ZMZA 2Q68A 3SYCA 4LWIA 1K7DA 1K4DC 3CGYA 5CBGA 4EEHA 1FS0G 1R62A 2YI0A 1N8RW 2IORA 3CP1A 3IC7A 4PA9A 5FNCA 3ZRSA 3A0ZA 4JAVA 2FWZA 3F5WC 3OW6A 1KP2A 4JASA 3Q5JA 3FB7C 4QE9A 2UWDA 1I5AA 2FXSA 3O0IA 3FYIB 2H55A 3BEHA 3D3IA 1YTFD 5L3CA 2XDXA 3ETEA 4XDKA 4MTGA 2HLDG 2Z5UA 4MP2A 3ZMSA 2AHZA 3ABMB 4CZZA 4GX1A 4RO2A 3ZRWA 4XD8A 2QM7A 5E1AC 2WLLA 2FTKA 1Z5BA 3GWOA 5BODA 2ZR3A 3ZKDA 1NBMG 1R73A 2DWDC 3JCZA 5FNDA 1OSFA 3RVZA 1OCCC 2XOKG 4LBEC 3OMNB 2ESAA 1YSZA 2CCUA 5H9CA 3CCSV 4RQEA 4P8OA 4PU9A 1GM9A 4X8AA 4R3MA 3ZXOA 2YEEA 3A0WA 1KZNA 1TBWA 4QNHB 1GM7A 1MABG 3K79A 2ITDC 4P7AA 3EHJA 4URLA 5M4PA 4K4OA 1AI7A 3JD0A 2XX2A 3D2RA 2XJGA 4Q20A 4G28B 3OMAB 4XIQA 3Q5LA 3G6EV 1K8AW 2YEDA 1THZA 4JGSA 1GKXA 2LP7A 5EBLC 4EM7A 4MPNA 3QO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FNF A;  1TH8 A;  5IDM A;  4NH9 A;  2ZDX A;  4KTN A;  4CE2 A;  2VCI A;  4EGK A;  2XHR A;  3Q5K A;  2YI6 A;  1H7S A;  2E0A A;  3R91 A;  1THN A;  2YJW A;  1Y4U A;  2VCJ A;  5J6A A;  4XCJ A;  1IXM A;  4XCL A;  1S14 A;  1UYI A;  3T0Z A;  2JJC A;  5M4M A;  1UY6 A;  2YKI A;  3INX A;  4L94 A;  2Q8G A;  3NMQ A;  3TZ4 A;  3K98 A;  1GKZ A;  5J71 A;  4L90 A;  1B3Q A;  3TZ5 A;  4MPC A;  4CWO A;  1YET A;  2BTZ A;  2CCS A;  3WQ9 A;  2IOQ A;  2VW5 A;  4NH7 A;  4U93 A;  2YE3 A;  4CE3 A;  4B6C A;  1QZR A;  3GIE A;  2HKJ A;  4AWP A;  1H7U A;  1YT2 A;  1YC4 A;  3T2S A;  4I3H A;  1ZXM A;  2WEP A;  4XIP A;  3JZ3 A;  3P32 A;  2WI2 A;  1UYK A;  2YK2 A;  3QTF A;  5M4K A;  1ZWH A;  4HXW A;  1YC1 A;  3HHU A;  3VHA A;  4MP7 A;  1AMW A;  5B1O A;  1TID A;  3RLP A;  1UYE A;  1Z59 A;  1YER A;  4U7O A;  4GEE A;  5D6Q A;  4KQV A;  4EGI A;  1BYQ A;  1EI1 A;  3SL2 A;  4R3A A;  3OWB A;  4H85 A;  4URM A;  2O1W A;  2YKB A;  3B28 A;  2BT0 A;  2XX4 A;  3VAD A;  3PEH A;  2VWC A;  2K5B A;  4BQJ A;  4XIT A;  4ZVI A;  4GT1 A;  3GIF A;  1UY8 A;  3T0H A;  2YI5 A;  3HEK A;  4GGL A;  2JKI A;  2CCT A;  2PNR A;  1KIJ A;  4KSG A;  2ZKJ A;  4QPJ A;  3EKO A;  4EGH A;  1UYL A;  2YE9 A;  1Y8N A;  4HYP A;  4O0B A;  4PL9 A;  4V25 A;  4E00 A;  3K99 A;  1NHH A;  4ZKI A;  2YEH A;  4CWN A;  1ID0 A;  2YJX A;  1YES A;  1B63 A;  3EHF A;  4LC1 A;  3FV5 A;  2BYH A;  4AWO A;  1I5C A;  1ZW9 A;  2YEA A;  4FPP A;  4JYB A;  1I59 A;  4PRX A;  5CTW A;  2WER A;  4WUD A;  1S16 A;  2AKP A;  2YGA A;  2XAB A;  4AWQ A;  1BGQ A;  1UYD A;  4GT8 A;  4ASG A;  3CRL A;  1I5D A;  2HG1 A;  4EMV A;  5CTU A;  4JQL A;  2YEF A;  2ZBK B;  4CE1 A;  3A0X A;  4YKU A;  4AS9 A;  3B26 A;  4LWG A;  4CWF A;  2BU2 A;  5D7R A;  4PRV A;  4R1F A;  5D7C A;  2YK9 A;  2YEG A;  3G7E A;  3D36 A;  1F51 A;  2IWX A;  4BAE A;  1MX0 A;  1BXD A;  5F5R A;  3VHD A;  2H8M A;  4YKR A;  2GQP A;  3LNU A;  5IN9 A;  2XDS A;  3ZKB A;  3CRK A;  2ZDY A;  1U2O A;  3ZRV A;  4XKA A;  2FWY A;  1AH8 A;  1AH6 A;  3ZRX A;  1JM6 A;  5M4E A;  4U7N A;  4GCZ A;  4HXZ A;  3ZRW B;  1PVG A;  1A4H A;  2IWS A;  4QPK A;  3ZXQ A;  3R4O A;  1MU5 A;  4I5S A;  4EFU A;  4XKK A;  5D6P A;  3MD0 A;  1YC3 A;  2BYI A;  2LFS A;  4LWF A;  3ZM7 A;  4WUB A;  4YKX A;  5F3K A;  1AM1 A;  4DUH A;  2XD6 A;  1I5B A;  1Y4S A;  3DGE A;  2XJX A;  4LWH A;  1L0O A;  5M4N A;  2XJJ A;  2YE6 A;  4MTX A;  3GIG B;  4CWT A;  5CF0 A;  4XIR A;  1Y8O A;  2YKE A;  5BOC A;  1YSR A;  2HCH A;  1ZXN A;  2XDL A;  4O09 A;  3G75 A;  4H81 A;  5B1N A;  4ASB A;  2WI3 A;  3HZ1 A;  4BIU A;  3RLR A;  4JYC A;  2LFR A;  1EA6 A;  5CTX A;  4CWQ A;  3ZCC A;  3BMY A;  2XX5 A;  3GIG A;  4HYM A;  3CWV A;  4E01 A;  3U67 A;  2XK2 A;  3HYY A;  4FCQ A;  3OWD A;  4CWP A;  3T1K A;  3HZ5 A;  3FT8 A;  4JAU A;  4H7Q A;  2IOP A;  3A0R A;  4KSH A;  2XHT A;  4E02 A;  1JOY A;  1UYG A;  3KE6 A;  3RLQ A;  2BU7 A;  3R4N A;  3R4P A;  4WUC A;  2P67 A;  1GJV A;  2BRC A;  2YE2 A;  2YE8 A;  1Z5A A;  5CPH A;  4B7P A;  4XC0 A;  4V26 A;  3CGZ A;  3BM9 A;  4YKW A;  5GGZ A;  4XKO A;  4XE2 A;  3TUH A;  4HY1 A;  2QFO A;  1U0Z A;  2Q8H A;  2QM8 A;  4URO A;  4EFT A;  3R92 A;  3RKZ A;  2QF6 A;  1QY8 A;  3QDD A;  4KP4 A;  3C11 A;  3A0Y A;  3MNR P;  4LWI A;  4O07 A;  2YGE A;  3CGY A;  2CGF A;  2QG2 A;  4EEH A;  4GQT A;  2CH4 A;  2WI4 A;  1R62 A;  2IWU A;  2YI0 A;  4YKT A;  1Y8P A;  4CWS A;  2YEC A;  3IED A;  4HY6 A;  4BXI A;  2BSM A;  2C2A A;  2WI7 A;  2IOR A;  4ASA A;  2BRE A;  4FCP A;  1B62 A;  3B24 A;  5FNC A;  3A0Z A;  2XDU A;  4ASF A;  4JAV A;  5IDJ A;  2FWZ A;  3B27 A;  3TZ2 A;  4YKZ A;  2WI6 A;  3OW6 A;  3EHH A;  4JAS A;  4FMT A;  2YKJ A;  1QYE A;  3B25 A;  3Q5J A;  3INW A;  3OMU A;  2WEQ A;  4YKQ A;  3EHG A;  2UWD A;  4BQG A;  4MT8 A;  1UYH A;  1I5A A;  4X9L A;  2FXS A;  1YT0 A;  3O0I A;  2H55 A;  3R4M A;  1NHJ A;  4LWE A;  3NXS A;  3T10 A;  3U2D A;  2XDX A;  1YS3 A;  1US7 A;  4XDM A;  2GFD A;  3TZ0 A;  4O05 A;  3K97 A;  3A0T A;  2YEJ A;  2O1U A;  4L93 A;  4MP2 A;  4NH8 A;  1TC6 A;  2BZ5 A;  3OPD A;  3H80 A;  2YE4 A;  3O2F A;  2Q2E B;  4XTJ A;  2YE7 A;  3K60 A;  2FYP A;  3ZRW A;  4XD8 A;  2QM7 A;  1YT1 A;  2FTK A;  1UY9 A;  1Z5C A;  5D7D A;  1Z5B A;  5CTY A;  2YE5 A;  3TTZ A;  4GFN A;  2YGF A;  5BOD A;  4L91 A;  3ZKD A;  5C93 A;  2YI7 A;  1BKN A;  1AJ6 A;  5FND A;  1OSF A;  1TC0 A;  2BU6 A;  4DZY A;  4W7T A;  4HZ0 A;  2ESA A;  3FT5 A;  3U2K A;  4YKY A;  4KFG A;  1YSZ A;  3EKR A;  2CCU A;  1UYF A;  2BU8 A;  4URN A;  4P8O A;  4PU9 A;  4FCR A;  4R3M A;  3WHA A;  2O1V A;  1UY7 A;  1UYM A;  3ZXO A;  2YEE A;  3A0W A;  1KZN A;  1TBW A;  2XCM A;  4LPB A;  4LP0 A;  4MB9 A;  5FWK A;  3VHC A;  1I58 A;  3LPS A;  4P7A A;  3EHJ A;  4URL A;  2WI1 A;  5L3J A;  2WI5 A;  3TK1 A;  5M4P A;  4K4O A;  4L8Z A;  2QG0 A;  2XX2 A;  3C0E A;  3D2R A;  2XJG A;  4O04 A;  3G7B A;  3H4L A;  1UYC A;  4MPE A;  4BIZ A;  3D0B A;  4Q20 A;  4MOT A;  2YKC A;  2CG9 A;  2YEB A;  2EXL A;  2Q8I A;  2XHX A;  4XIQ A;  3O6O A;  3Q5L A;  2YEI A;  2WWW A;  2YED A;  2XDK A;  1NHI A;  3PEJ A;  2Q8F A;  1GKX A;  3HYZ A;  4HZ5 A;  4CWR A;  5M4H A;  4EM7 A;  4MPN A;  2BU5 A;  1TIL A;  4MBC A; 
#chains in the Genus database with same CATH topology
 3AG7 A;  4UCR A;  4KHP B;  2ZDX A;  4EGK A;  1EN4 A;  1P7G A;  3CHX A;  3DC5 A;  5L3D A;  2WLM A;  5LMU O;  5JH7 A;  5J6A A;  4YY3 O;  5FPR A;  2R70 A;  4XCJ A;  1IXM A;  1S14 A;  3T0Z A;  2JDI G;  2JJC A;  1GN2 A;  1S77 D;  4CS4 A;  4K8Z A;  2L35 A;  2NNU A;  4B3M B;  3TZ4 A;  3CPW U;  3E2E A;  3CCM V;  2FML A;  1M9N A;  5D5P A;  1JMK C;  4ZI7 B;  4DR5 B;  1VF7 A;  4MVM A;  2BTZ A;  3DC6 A;  3RW0 A;  2IOQ A;  1S5L Z;  4RWU A;  4NH7 A;  5GON A;  1BZK A;  1NVP B;  2HHH B;  3SPC A;  4B6C A;  1MA1 A;  4WFG A;  2V4D A;  1CPY A;  2X7R B;  5LL6 Y;  2HKJ A;  4AWP A;  3FYE B;  5ITZ A;  3K0D A;  1Q90 D;  3OTO B;  2NR5 A;  3T2S A;  1YXB A;  1QBZ A;  5KHK A;  4UCU A;  1VEW A;  2B1G A;  5LHG A;  2WEP A;  4XIP A;  1TVK B;  2L6L A;  3P32 A;  5JEN A;  1UYK A;  3M99 B;  1Y74 A;  4NXM B;  2QWR B;  3G80 A;  2F93 B;  5LMN B;  5TIS Z;  5D5Q A;  2BTQ A;  5KHG A;  5L3B A;  1TID A;  2OTJ V;  2PYJ A;  1UYE A;  1EM1 A;  1I94 B;  2QA4 V;  2QKA A;  3J80 N;  3H9V A;  1RSO A;  1K34 A;  2DE0 X;  3CC2 V;  2YI8 A;  4EGI A;  1BYQ A;  1AR5 A;  3ETG A;  3OWB A;  4JI1 B;  2KB1 A;  2O1W A;  1NU1 H;  1IBM O;  4K0K O;  1VF5 B;  3L70 H;  1UY8 A;  1HNX O;  1KQS U;  3CCE V;  4X20 B;  1H2N A;  1GRJ A;  2QDO A;  2QTO A;  5EZY B;  3ABL B;  4P9O A;  3ABM C;  1FXK B;  1IBL O;  4LH7 A;  4DR4 O;  4QPJ A;  4TQF A;  3HB3 B;  1AR4 A;  4FLZ A;  4O0B A;  1Y8N A;  4DXW A;  2XAH A;  1DF4 A;  4ZKI A;  3PJS K;  4CWN A;  1ID0 A;  2YJX A;  2QWP B;  3RYC B;  2ZDI A;  1I0H A;  4TV8 A;  4IL6 Z;  2BYH A;  2H3O A;  4AWO A;  2YEA A;  5KMG A;  2ZIM A;  5KHI A;  4G27 B;  4PA4 A;  4WUD A;  3S3W A;  4NYK A;  2YGA A;  2OIG A;  1EZV H;  2XTA A;  2PF4 E;  1Q82 W;  1XBL A;  4GT8 A;  3RGB A;  1I5D A;  1N32 O;  2BTO A;  3JAW B;  5DED A;  4DV2 B;  4O2B A;  1B6Q A;  2EIJ B;  2GUZ B;  2D2C B;  1K4C C;  3STZ C;  5J2T B;  1IDS A;  2YUA A;  5D7C A;  4O4L B;  3K06 A;  1T5E A;  3D36 A;  1H2K A;  2N74 A;  2IWX A;  4OPA A;  1SS3 A;  2H8M A;  2GQP A;  3LNU A;  2XDS A;  2RJZ A;  4WF9 V;  3K9S A;  4AI8 A;  3QO5 A;  3ZHR A;  1O9H A;  2F95 B;  1QNM A;  1AH6 A;  4YJ3 A;  1US6 A;  1NI8 A;  3OR7 C;  2OTL V;  3ZN1 A;  1YTF B;  2PTM A;  2IWS A;  1TGO A;  1KYO F;  3DXR A;  4QPK A;  5LP6 A;  1D2D A;  3ZXQ A;  4KFM A;  5KHJ A;  3SPG A;  1VQN V;  1YC3 A;  1VP7 A;  2Q73 A;  2BYI A;  2VQF O;  2CAZ C;  1K5S A;  4MW3 A;  5F3K A;  1AM1 A;  5HFL A;  5CA1 B;  5IYZ B;  1KU9 A;  1Y4S A;  5L3F A;  2XJX A;  4LWH A;  4DV6 B;  2DYS B;  2XAQ A;  3B8M A;  1EN5 A;  4XDL A;  1AJP A;  2LJ2 A;  5IWA B;  3CRA A;  4X1K B;  1GN4 A;  4O09 A;  3JD2 A;  4JI0 O;  4ASB A;  2EJ7 A;  1XMQ O;  1VQP V;  4FLW A;  4CC6 A;  1H2G A;  2LFR A;  3H1I H;  1KKC A;  5EC2 C;  1UPG A;  2XX5 A;  4DR6 O;  4LF6 O;  2ZE5 A;  4JI6 B;  1RP3 B;  4H7Q A;  2IOP A;  4KSH A;  2UUC O;  4JI8 O;  3OAA G;  2BU7 A;  5LOV A;  1V55 B;  1SQF A;  2FYU H;  4I7Z B;  4J11 A;  1XMO B;  3I5D A;  2YIC A;  2VWJ A;  2QFO A;  1XIL A;  1MZF A;  1BL8 A;  1L8D A;  4DV4 O;  4CH6 A;  1WPX A;  1Q81 W;  2XAJ A;  3CB2 A;  4PHZ A;  2W6J G;  2PI5 A;  2YGE A;  3T4Z A;  2QG2 A;  1Q6I A;  4LNU A;  4PA7 A;  2JK5 C;  3K5L A;  3STL C;  2EIK B;  4LFC B;  2WI4 A;  3B77 A;  5LYJ B;  3LSS A;  5JJE B;  1K33 A;  3B40 A;  1HNW B;  3RYI B;  2Y69 B;  3IED A;  4FFK A;  4YIO A;  4HY6 A;  2YXH A;  2WLI B;  4PDV A;  4Z1V A;  2WI7 A;  1AIL A;  1PNK A;  1G6U A;  2HFE C;  2GHY A;  2VQE O;  1NH2 D;  4JV5 B;  1B62 A;  3TET A;  1SER A;  1YVW A;  4JYA B;  3WB2 A;  3K3W A;  2HHH O;  1RM1 B;  1KMI Z;  4DV0 B;  4RUF A;  5IDJ A;  4FMT A;  5LHI A;  2YKJ A;  1QYE A;  2DJV A;  2EIL C;  3OMU A;  2WEQ A;  4YKQ A;  3QNE A;  4EKW A;  1W0K G;  1XQ8 A;  1RPR A;  3ZS8 C;  4DV5 B;  1CXZ B;  4B3S O;  2XT9 A;  2VWK A;  2X0L A;  5B1B B;  3R4M A;  5IJ9 B;  3K03 A;  3W7S A;  1DF5 A;  3CMA V;  3ABL C;  1I94 O;  4JF3 A;  1FFX B;  1FXK C;  2YSU B;  3ZMU A;  1O9G A;  3T10 A;  5KA5 A;  1YS3 A;  1US7 A;  3CXC U;  4PDL A;  5BY1 A;  2GFD A;  1VAR A;  3WB0 A;  4GKK O;  1AP5 A;  3K97 A;  3A0T A;  3LDD A;  4L93 A;  4J7Z A;  1BGY H;  4NH8 A;  4JI4 B;  2Y48 A;  3ICX A;  3O2F A;  2ZR2 A;  4DV3 O;  4XTJ A;  1IZ3 A;  5LBQ A;  1AI5 A;  4FIP C;  2YE7 A;  3K60 A;  3KCY A;  2LGW A;  5LMU B;  3AK3 A;  1YHQ V;  1UY9 A;  4YY3 B;  5KAI Z;  5CTY A;  3E86 A;  1GN6 A;  4GFN A;  4TT3 G;  3FB6 C;  2LW7 A;  4E72 A;  3CYG A;  4NTX A;  2YXY A;  1G8M A;  4N21 A;  2ZE7 A;  2QE7 G;  4JI7 O;  3BY6 A;  2ZD9 A;  3AK1 A;  4DZY A;  3O9O A;  4W7T A;  3FT5 A;  3U2K A;  4YKY A;  1XEQ A;  2ZE8 A;  4JTA B;  3EKR A;  3QG5 A;  2QJ1 A;  4LH6 A;  1UYF A;  4C7U A;  3WHA A;  2WPD G;  3RYH A;  1FFT B;  2LGQ A;  3A0B Z;  2XCM A;  4LPB A;  4U3J A;  1ARO P;  2Q0A A;  4LP0 A;  4MB9 A;  3K04 A;  1NKD A;  5JJJ B;  1XDC A;  1XUQ A;  2ARH A;  2BCC H;  4DUY O;  2YEV B;  2WI1 A;  1YSC A;  3SJB C;  2WI5 A;  3SYQ A;  4L8Z A;  3C0E A;  1F23 A;  5EYP B;  4I9Q A;  2DYS C;  1UYC A;  1BQZ A;  1SQV H;  3JAT A;  5BXZ A;  1WJZ A;  2YKC A;  2CG9 A;  3G71 V;  2ATK C;  2Q8I A;  2XHX A;  1HWY A;  4DW0 A;  3O6O A;  5CBH A;  1GM8 A;  2ZIO A;  1X4T A;  3OT7 A;  2ZQM A;  3ZIA G;  1E1R G;  3CJH B;  4UV9 A;  2QKS A;  2QEX V;  1IBM B;  1NHI A;  4K0K B;  4BW5 A;  5KX5 B;  3HYZ A;  1FD9 A;  3SJC C;  4X89 A;  1NZ6 A;  3IGA C;  2Y0I A;  4MBC A;  2WA4 A;  5IDM A;  2A7W A;  4FM2 A;  4DW1 A;  1QCE A;  2Y4T A;  3GB7 C;  4CE2 A;  1E79 G;  4TV9 A;  4DR4 B;  3Q5K A;  1AJN A;  2YI6 A;  4UVA A;  3Q4H B;  2E0A A;  4WFF A;  3R91 A;  1N4C A;  2A79 B;  2YJW A;  1V55 C;  3JAM N;  5IWA O;  2QWO B;  4BWA A;  2ZXW B;  3ZBH A;  4PEL A;  1UYI A;  1S5J A;  4I4T A;  4I50 B;  1TA8 A;  2YKI A;  3QTC A;  2Q8G A;  4J7K A;  3K98 A;  1GKZ A;  2QM4 A;  3HKC B;  1Z2G A;  4IT5 A;  1BE3 H;  4PDR A;  5IJ0 B;  4X64 O;  5B66 Z;  2EIK C;  1R3I C;  4UXN A;  2ZT9 B;  3E22 B;  1N32 B;  2VW5 A;  1Z5W A;  2ZNI A;  2YE3 A;  2V7Q G;  4CE3 A;  5JJN B;  2Y69 C;  3GIE A;  2B1I A;  4ZHQ B;  3E89 A;  3AG4 B;  1YT2 A;  3X2Q B;  1XL4 A;  1XI1 A;  1EN6 A;  3SPJ A;  4YHH O;  2FL4 A;  1TUB B;  4L87 A;  5FNV B;  4DV7 O;  1K97 A;  4EB6 A;  2QWQ B;  2YK2 A;  1RM1 C;  3QTF A;  5M4K A;  1VQ9 V;  4ZOL B;  3HHU A;  3L74 H;  4ABM A;  5EC1 C;  1NR1 A;  2OCH A;  3RLP A;  4EFB A;  1ZWI C;  1Z59 A;  1OJH A;  1YER A;  1I5X A;  2DQ0 A;  2YIA A;  1TVK A;  3CCQ V;  1NTM H;  2VQF B;  2AGA A;  4TUY B;  5B1B C;  5DN6 G;  3K5O A;  3JAL B;  1M1K W;  1KKD A;  4URM A;  4JYA O;  2YKB A;  1N34 O;  3BRC A;  1DLB A;  3VAD A;  4BQJ A;  2K5B A;  4GT1 A;  3GIF A;  3EFF K;  1PL0 A;  3HEK A;  4GGL A;  4MS2 A;  4IYH A;  2JKI A;  3C3S A;  2CCT A;  2JJ2 G;  3JAS B;  3WFV A;  3W7T A;  1KIJ A;  4JI0 B;  1XMQ B;  3ETQ A;  1SQX H;  3HKD B;  4DK0 A;  2MW2 B;  4UVC A;  1VQ8 V;  1XNQ O;  4EGH A;  4DR6 B;  4LF6 B;  4HYP A;  4X66 B;  2CE4 A;  2HP8 A;  4PL9 A;  1EBO A;  2E5L B;  1SC5 B;  2WLH A;  3OMI B;  4GX0 A;  3FB8 C;  4DK1 A;  1NHH A;  3E8H A;  1D5A A;  2UXB O;  5EBW C;  1YES A;  4X20 A;  1B63 A;  2UUC B;  3ABK B;  4GLX A;  3JAR A;  3EHF A;  4LC1 A;  2EJR A;  1P49 A;  2IJH A;  2WLN A;  4J41 A;  4PRX A;  2UXX A;  2R72 A;  2WER A;  1NH2 B;  4JI4 O;  1OV9 A;  3IFX A;  4AWQ A;  1UYD A;  4DV4 B;  3FAV B;  3O65 A;  4I55 A;  2HG5 C;  4ASG A;  4EMV A;  4FM0 A;  4JQL A;  5CB4 A;  2YEF A;  4FLY A;  2KQX A;  2CGN A;  3WU2 Z;  3CRC A;  2ZBK B;  3B09 A;  2ZIN A;  2CGO A;  3OGI B;  1VQ5 V;  4AS9 A;  5LGN A;  2H94 A;  5D7R A;  4J10 A;  4R1F A;  3N2K B;  1F51 A;  2CTQ A;  1BXD A;  4F6R B;  4YKR A;  5IN9 A;  4WFH A;  4GKJ B;  3HKE B;  4X62 O;  3FKS G;  3CRK A;  3AEI A;  4X1I A;  5H6Q A;  2GTA A;  2VQE B;  5IY5 B;  1AH8 A;  1JM6 A;  5M4E A;  1K5Q A;  2ZCE A;  4Q6G A;  3ZED A;  3L72 H;  1SKV A;  3ZRW B;  4HXZ A;  1ZX3 A;  4GX2 A;  4O4L A;  1MU5 A;  4I5S A;  2ETN A;  4WBN A;  1GAX A;  3TXQ A;  4EFU A;  3WB1 A;  1WLE A;  4LWF A;  4WUB A;  3U10 A;  5JCO A;  2A0L A;  2E3C A;  3BFR A;  1I5B A;  4GX5 A;  3P3N A;  3DGE A;  2DMX A;  5A2Q N;  1L0O A;  1NQT A;  2YE6 A;  3GIG B;  4CWT A;  5H6R A;  4XIR A;  1E1Q G;  1OCR B;  2ZKO A;  3ML0 A;  2W0X A;  4B3S B;  2CTR A;  5BOC A;  2DQ3 A;  2HCH A;  4LF8 O;  1H2L A;  1SRY A;  3OUF A;  2IJI A;  1KP3 A;  3SDL A;  4JYC A;  1EA6 A;  1Y6X A;  4ICG A;  5CTX A;  4CWQ A;  3ZHV A;  5IYZ A;  5K1X A;  1Q6H A;  3BMY A;  4LWS B;  4NTY A;  3RBZ A;  4CBC A;  3K5N A;  4GKK B;  1XHX A;  2Q9L A;  1NTZ H;  3HYY A;  3OWD A;  4CWP A;  2ZM6 O;  2EIL B;  2ZXW C;  1H8H G;  3FT8 A;  1WB8 A;  4DV3 B;  3A0R A;  4PA6 A;  3CS5 A;  1NS1 A;  2Q0O C;  3CRR A;  2KG7 B;  1R3K C;  3RLQ A;  2ODM A;  1Q7Y W;  2BRC A;  2VRZ A;  3IAY A;  4XE2 A;  3TUH A;  4HY1 A;  1L0L H;  2N05 A;  1U0Z A;  2QM8 A;  1VQ7 V;  1S3J A;  1I5Y A;  3RKZ A;  2QF6 A;  5H5N A;  4WFA V;  1QQC A;  2HJD A;  3A0Y A;  1D5N A;  3CYO A;  1P7B A;  4NB5 A;  2GBO A;  3AG4 C;  1H2M A;  2CTP A;  1GKF A;  2E76 B;  2CGF A;  3X2Q C;  3ASO B;  4JI7 B;  1FXH A;  1M57 B;  2CH4 A;  4Z1M G;  2CH7 B;  4O4I B;  4DUZ O;  1F4M A;  1R3J C;  1BT8 A;  4O4J B;  2F4V O;  4YKT A;  5LHH A;  5BMV A;  2OCC B;  1Y76 A;  4CWS A;  3HKB A;  2M6Y A;  2BSK B;  2JGU A;  2C2A A;  2WSS G;  3THO A;  4ASA A;  1JVM A;  3UM7 A;  2FB5 A;  5H2F Z;  3E8G A;  2BRE A;  4JYY A;  4X1Y A;  1K73 W;  3K57 A;  4DUY B;  2Q67 A;  2H8P C;  4YKZ A;  1AVM A;  3EHH A;  3BAA A;  2WLI A;  3ZMV A;  2WAM A;  3INW A;  4TSF G;  3U11 A;  3OUS A;  3FD9 A;  1V54 B;  4R7C A;  1SF9 A;  4BQG A;  4MT8 A;  4X9L A;  3JAK B;  3EXA A;  4WFE A;  1OHH G;  4ASU G;  4IIJ B;  1YT0 A;  4OXS A;  2Q6A A;  4LWE A;  5GON B;  2DN9 A;  4HNA A;  2HHI A;  1SQP H;  1L1F A;  4CH5 A;  1SET A;  4WCE V;  3U2D A;  1QVF U;  4XDM A;  5CA0 A;  4KL1 A;  5ITZ B;  1R1B A;  5B3S B;  3TZ0 A;  4O05 A;  4DR1 B;  4JZ2 A;  2YEJ A;  4IYI A;  3CX5 F;  2BZ5 A;  4Z2W A;  1JQ0 A;  2EZO A;  2YE4 A;  5IJ9 A;  2O57 A;  1B06 A;  4PDM A;  2Q2E B;  1V9P A;  3ABK C;  1Y74 B;  2AXT Z;  2Q8V A;  1NR7 A;  3IC9 A;  4RAI A;  3ZHS A;  5KUK A;  1YT1 A;  2BTQ B;  1Z5C A;  4DRX A;  5D7D A;  2JGD A;  3MDS A;  2YE5 A;  1N36 B;  4YJ2 A;  2EIM B;  3ZHT A;  1G1X B;  1UJW B;  1KUQ A;  5LA6 B;  2DW4 A;  3APQ A;  3W7W A;  4X66 O;  2XAS A;  3EHB B;  5C93 A;  1S76 D;  1N0J A;  3K59 A;  2E5L O;  1BKN A;  1AJ6 A;  4X64 B;  4X9Q A;  1CP9 A;  2UXD O;  4TQD A;  4HZ0 A;  1MNG A;  2UUB O;  2DWE C;  2XND G;  4OGQ B;  2N04 A;  3LDE A;  5GW7 A;  4URN A;  1COW G;  2V1D A;  2HR3 A;  5JVD A;  2O1V A;  3WG7 B;  1YI2 V;  1SZX A;  2E74 B;  3A8T A;  4H33 A;  1GN3 A;  4UCV A;  1S72 V;  2AW9 A;  4YHH B;  3C3T A;  4MTF A;  5IY5 C;  1P84 F;  3SGI A;  4AHC A;  2P22 C;  3F7V C;  4DV7 B;  1JFF A;  5FWK A;  1LUV A;  1Q3E A;  4NKG B;  1VQK V;  2MK3 A;  4FFB A;  5L3J A;  2DYR B;  3TK1 A;  2P4V A;  4TV8 B;  2YXL A;  3MHS C;  3SYA A;  3G7B A;  1WPB A;  1F7Y A;  5KMG B;  1PNM A;  4MPE A;  3N2G A;  4XBF A;  4N23 A;  3G4S V;  1OCR C;  3GVM A;  4GKJ O;  2YEB A;  4PV1 B;  1FJG O;  5F2V O;  1W59 A;  3T1C A;  2YEI A;  2WWW A;  3ZMT A;  5IYC O;  2XDK A;  1N34 B;  3PEJ A;  2Q8F A;  5BR8 O;  4O2B B;  5A9G A;  4HZ5 A;  2VS0 A;  4B7E A;  3LNM B;  3SYO A;  2PI4 A;  3H1H H;  1DTO A;  2BU5 A;  1TIL A;  5FNF A;  4NH9 A;  4KTN A;  3AG3 B;  4AQY O;  3CC4 V;  2XHR A;  4OPH A;  1XNQ B;  2B5U A;  1OCO C;  5IE9 A;  1Y4U A;  1MG1 A;  5KX5 A;  2VCJ A;  5HFM A;  2R9R B;  2UXB B;  1R6N A;  3JSL A;  3DXR B;  1UY6 A;  4FLT A;  2JS3 A;  5J71 A;  1VQO V;  1YCI A;  4L90 A;  1B3Q A;  1IXB A;  3TZ5 A;  3OFN G;  1G4Y B;  4MPC A;  3ASO C;  1YJ9 V;  5KHH A;  2R9I A;  1M57 C;  3WQ9 A;  4HYO A;  5J2U A;  1RFY A;  2KKW A;  3AG1 B;  1ZL8 A;  1RPO A;  4U93 A;  2UU9 O;  1JJO A;  1WP8 A;  1OZ0 A;  4I50 A;  2OCC C;  1QZR A;  4NTW A;  1SA0 B;  4JTC B;  2F66 C;  3RN4 A;  2PYL A;  3S3X A;  1YC4 A;  2E75 B;  3TXS A;  3CCU V;  3CME V;  1ZXM A;  4BAY A;  1YIT V;  4HBN A;  1J95 A;  1P4R A;  3JZ3 A;  2JS5 A;  1ZWH A;  4X62 B;  4HXW A;  4PJ0 Z;  4MVQ A;  4RUE A;  1F4N A;  4ZHQ A;  4MP7 A;  2X6B A;  3LNN A;  5L3E A;  5B1O A;  2XAG A;  3JSN A;  3FB5 C;  2OT5 A;  3UO3 A;  4U7O A;  1V54 C;  5LOV B;  4H37 A;  1ZSP A;  4PI2 A;  3JD3 A;  4D7S A;  3L73 H;  3SL2 A;  2GTS A;  4P2Z A;  4J80 A;  2ADQ B;  4CS2 A;  4MVU A;  4H13 B;  3UT5 A;  2XX4 A;  3PEH A;  4XIT A;  4ZVI A;  1FKA O;  4ZIB A;  3T0H A;  4UCS A;  5B3S C;  3OR6 C;  4XDJ A;  4LNU B;  4U3F H;  4LF8 B;  2PNR A;  2RMK B;  1BHB A;  2X6A A;  4TUY A;  1H8E G;  4J9Z B;  1BHA A;  4HAM A;  3EKO A;  2P7T C;  4ZBM A;  4MW8 A;  2ZM6 B;  2YEH A;  2ILM A;  4B3T B;  2UUA O;  3BA9 A;  4JTD B;  5DM6 V;  1B04 A;  2HVJ C;  2EIM C;  3B8N A;  5KUM A;  2CDY A;  3FV5 A;  4JYB A;  3QF7 A;  4P9P A;  5IYD O;  1I59 A;  4DR1 O;  4X88 A;  3H1J H;  3B4S A;  5JQG B;  1S16 A;  2AKP A;  1M93 A;  3ASN B;  4QJF B;  3CRL A;  2CTW A;  2IM9 A;  2YI9 A;  4B08 A;  1ORQ C;  1UFI A;  4O2A A;  1QHT A;  3A0X A;  4FLX A;  3W7U A;  1EFR G;  3WG7 C;  1X59 A;  4YKU A;  3AG2 B;  3B26 A;  3OW2 U;  4LWG A;  1N36 O;  1FYJ A;  4PRV A;  1Q5O A;  1WN7 A;  3G67 A;  4DUZ B;  2BSK A;  2F4V B;  2YEG A;  2YK9 A;  3G7E A;  4YXW G;  4BAE A;  2JJ1 G;  1A32 A;  5F5R A;  2W0F C;  3RFR A;  3ZKB A;  3OD4 A;  1IUR A;  2ZDY A;  3LUT B;  3ZRV A;  1WA8 B;  2DYR C;  2FWY A;  2ZDI C;  4LF7 O;  4I0X B;  4U7N A;  3M7M X;  1K3E A;  3R4O A;  2HEP A;  3N2K A;  3OEH G;  4XKK A;  3VQX A;  2LFS A;  1ENV A;  2IU3 A;  4YKX A;  3HKE A;  4PD4 F;  4ZI7 A;  3ZX6 A;  3T1H B;  3BPZ A;  5M4N A;  2XJJ A;  4MTX A;  3OM3 B;  3RWR D;  1YDX A;  1GTO A;  1Y8O A;  2BE3 A;  5BZB A;  1YIJ V;  2YKE A;  1N33 B;  4J9Y B;  2F1M A;  2IJK A;  1ZAU A;  2F23 A;  4CC5 A;  2Z3Y A;  2Z0A A;  3BAB A;  1S5H C;  3C90 A;  3D36 C;  4BW9 A;  5B1N A;  2EBO A;  3J7A U;  3G75 A;  3AG3 C;  4DYL A;  3RLR A;  2A9H A;  2QSA A;  3CE2 A;  1CEZ A;  5CMU A;  3GIG A;  1IBK O;  4HYM A;  4O4H B;  4FM1 A;  3CWV A;  4E01 A;  3RYH B;  3A0H Z;  1R3L C;  4UVB A;  3SYP A;  4U3J B;  4FVM A;  4FCQ A;  2RN9 A;  5B1A B;  3HZ5 A;  4JAU A;  4BR6 A;  1VF6 C;  2XHT A;  4E02 A;  1MSW D;  2IBZ H;  3RYF B;  1JOY A;  3KE6 A;  2P90 A;  4FZ0 A;  4X65 O;  1GJV A;  2YE8 A;  2ADP A;  4DR7 O;  4EEQ A;  2HJF C;  4V26 A;  4YKW A;  5GGZ A;  1H2S B;  3UQ8 A;  3CD6 V;  4XKO A;  4IHJ B;  3UO2 A;  4HZ3 A;  3CEI A;  3W7X A;  2YIB A;  3AG1 C;  4URO A;  5FPO A;  3R92 A;  3QDD A;  4KP4 A;  1I7F A;  2IW5 A;  2WLJ A;  3E8F A;  3MNR P;  4O07 A;  1GO3 F;  2QWN B;  2LQT A;  2UXD B;  4GQT A;  1AI6 A;  5EZY A;  2UUB B;  2IWU A;  2AZ0 A;  2R9A A;  5EK0 A;  2BOC C;  4GZR B;  1FXK A;  1Y8P A;  1VQ6 V;  1YJW V;  2YEC A;  1WAZ A;  2NN4 A;  4BXI A;  3I56 V;  2BSM A;  4DR2 B;  1J5E O;  4FCP A;  2ITC C;  3B24 A;  2PY5 A;  3RYC A;  1PM9 A;  3CRQ A;  1DGS A;  5J9P C;  5C8Y B;  2CH7 A;  1VMG A;  4E2L A;  2XDU A;  3CCR V;  1XNR O;  4ASF A;  2Q7E A;  3B27 A;  2UXC O;  3TZ2 A;  2WI6 A;  3MHH C;  4I4T B;  2XAF A;  4D7T A;  3B25 A;  2W6I G;  3EHG A;  3VQY A;  3JCU Z;  1UYH A;  4YIP A;  4JI5 O;  3JAW A;  4KUM A;  3PN1 A;  1FJG B;  2GUZ A;  1TUE B;  3ZHU A;  2G38 A;  3BVO A;  3G6B A;  1NHJ A;  1EZJ A;  3E35 A;  3NXS A;  4JPR A;  2EIN C;  5J2T A;  1PP9 H;  1MZE A;  5BR8 B;  2GV9 A;  2WLL B;  4IGG A;  2YID A;  2Q5Z A;  4FJC C;  3JAK A;  3S5T A;  1YJN V;  2O1U A;  4MVO A;  1TC6 A;  4IIJ A;  2OIE A;  3OPD A;  1VQM V;  4AQY B;  2XUM A;  3H80 A;  5LGT A;  4TWK A;  1SES A;  4EB6 B;  4L8J A;  1U96 A;  1OCZ B;  4I9W A;  2FYP A;  4LFB O;  1KBH A;  1IVS A;  5FL7 G;  3TTZ A;  2YGF A;  3OE7 G;  3ASN C;  3E83 A;  4L91 A;  1KEC A;  2YS8 A;  5CA1 A;  1LNQ A;  3SPH A;  1Q86 W;  2PUS A;  2NLJ C;  1DK1 A;  3OGC C;  2YI7 A;  2CK3 G;  1K92 A;  3AG2 C;  4DR3 O;  4PI0 A;  1TC0 A;  2BU6 A;  4B3T O;  1SQQ H;  4X1K A;  2UU9 B;  4KFG A;  1M90 W;  1OCO B;  2BU8 A;  4TOI A;  2IH3 C;  4FCR A;  1JCH A;  5LA6 A;  1UY7 A;  1UYM A;  3JD4 A;  1FAF A;  4MSW C;  1QVG U;  3CCJ V;  1VQL V;  3KG2 A;  2OWO A;  3SR2 C;  2JRI A;  1MSD A;  4MVZ A;  3VHC A;  1I58 A;  2GSM B;  5LXT B;  2IJJ A;  3D3Q A;  2WA3 A;  3LPS A;  4LP8 A;  1LR1 A;  4G2K A;  4MVR A;  1JJ2 U;  3R65 A;  4FLU A;  2QG0 A;  1NJI W;  3JAR B;  1AJQ A;  4O04 A;  3H4L A;  4LF5 B;  4BIZ A;  3D0B A;  3T4D A;  3RVY A;  4MOT A;  4JI2 O;  2JEX A;  2EXL A;  2JVD A;  1Q8I A;  1IX9 A;  4R8C A;  4I55 B;  3LSU A;  2D3O W;  2X6C A;  3VOU A;  3FX7 A;  2M7W A;  2YC0 A;  5CB4 B;  3U0Z A;  5LYJ A;  3J81 N;  5JH7 B;  4CWR A;  4EFE A;  5M4H A;  1ZUQ A;  3RYI A;  2DOS A;  4UUJ C;  4P30 A;  3H01 A;  1GMG A;  3LDC A;  2AZ2 A;  1VQ4 V;  4J42 A;  1TH8 A;  4UFZ A;  3K08 A;  5B1A C;  1QLE B;  1I08 A;  5KA6 A;  3T1H O;  4R50 A;  2VCI A;  1Q6U A;  2AHY A;  1H7S A;  1KD1 W;  1THN A;  2HKO A;  4X1I B;  1N33 O;  1K9M W;  3HPL C;  4XCL A;  2EZP A;  2UUA B;  3CC7 V;  5M4M A;  2Q69 A;  5EIB C;  1M56 B;  3DTU B;  1HNZ O;  3INX A;  4L94 A;  3NMQ A;  4WBN B;  3NR7 A;  2IH1 C;  1QR8 A;  3TCU A;  1AB3 A;  4LCU C;  2P6J A;  1FXV A;  1KB9 F;  4CWO A;  4GYC B;  1YET A;  3JD1 A;  3OEE G;  2CCS A;  3I55 V;  4LR3 A;  5K1P A;  4LFA B;  3EVK A;  3VBB A;  1FFX A;  1VF6 A;  4J7J A;  3LSQ A;  5CBF A;  1QR9 A;  4LF9 O;  3D8C A;  3F5T A;  1W2B U;  1HP8 A;  1H7U A;  4I3H A;  5AG2 A;  2GDS A;  1YEW A;  4K8X A;  2UXN A;  1RSO B;  2JIZ G;  1HR0 B;  2JEU A;  4QE7 A;  2WI2 A;  3K0G A;  1KC8 W;  1WNS A;  4B7K A;  4WFB V;  1HW7 A;  1YC1 A;  3BHP A;  3VHA A;  1JPX A;  1SA0 A;  3HR0 A;  5L3G A;  3T1Y O;  4LF7 B;  4JZG A;  1AMW A;  3E8B A;  4GEE A;  3MAQ A;  3ETD A;  4B3R B;  5D6Q A;  3TGU H;  1TAE A;  5B5E Z;  4KQV A;  2XHB A;  2Y0P A;  3QO7 A;  4DR2 O;  2PGG A;  1EI1 A;  5IYB O;  3UKM A;  4R3A A;  1NTK H;  1R6T A;  3DSQ A;  2CUG A;  4H85 A;  4QIW F;  2ZNJ A;  4JAA A;  3B28 A;  5EIB D;  2BT0 A;  2VWC A;  5KLV H;  4JI3 O;  2YI5 A;  3BA8 A;  4UCT A;  2PZS A;  4OX9 B;  1FPO A;  5CN0 A;  3K58 A;  1BMF G;  5CA3 A;  2KSD A;  4H44 B;  4UB6 Z;  1SQB H;  4KSG A;  4FK5 C;  4KHP O;  5BMV B;  3SJQ C;  1Y76 B;  1XHZ A;  3HKB B;  2ZKJ A;  1OCZ C;  1ZTE A;  1UYL A;  2YE9 A;  1IBK B;  4V25 A;  1H38 A;  2HVK C;  4E00 A;  4LF4 B;  3K99 A;  4X1Y B;  5LGU A;  2YEV A;  3CCV V;  1SZT A;  3B2E E;  5EYP A;  1PV0 A;  4NXN B;  1R6K A;  4H0L B;  4X65 B;  4B3M O;  1W0J G;  1I5C A;  1ZW9 A;  4DR7 B;  4FPP A;  1Y66 A;  4NVP A;  5CTW A;  2F43 G;  3ZN0 A;  2YDE A;  3T2M A;  4CS3 A;  3ABU A;  4UB8 Z;  2XAB A;  4DR5 O;  1BGQ A;  1AP6 A;  1S0V A;  4DV1 B;  3BCC H;  2HG1 A;  3CJH A;  5CTU A;  1GH6 A;  4CH4 A;  2C1I A;  4CE1 A;  4FZ1 A;  3QVN A;  4W4K A;  3L75 H;  2RDC A;  4F4L A;  4YJ3 B;  4CWF A;  3OTO O;  1WP7 A;  1OCC B;  1GK9 A;  1LUW A;  2WLK A;  3F7Y C;  3P30 A;  2BU2 A;  1MOF A;  4HNA B;  3JYC A;  5LP6 B;  3TJT A;  5JQG A;  2BOB C;  5CA0 B;  3OTF A;  1MX0 A;  3VHD A;  4NXM O;  3N27 A;  3Q4H A;  1QLN A;  5LMN O;  1J5E B;  1U2O A;  4XKA A;  5GTI Z;  1MMM A;  1AI4 A;  3ZRX A;  1Y4M A;  3P3P A;  4GCZ A;  3UCS C;  4BIO A;  3CCL V;  3ABT A;  1PVG A;  1A4H A;  3H1K H;  2IU0 A;  1NVP D;  1XNR B;  3IJ4 A;  4DRX B;  2UXC B;  5D6P A;  3MD0 A;  2JGD B;  2RNB A;  1PNL A;  3HKC A;  1XL6 A;  2K1E A;  4YJ2 B;  3H1L H;  3ZM7 A;  4DUH A;  1N0N A;  4R6Z A;  1BS3 A;  2XD6 A;  1WA8 A;  4JI1 O;  5IJ0 A;  4I0X A;  3E22 A;  5CF0 A;  4JI5 B;  3K9A A;  4PA3 A;  1YSR A;  4GUN A;  5KAF Z;  1ZXN A;  4MTO A;  3KZI Z;  2XDL A;  4H81 A;  1QLE C;  2WI3 A;  2A3Q A;  1TUB A;  3HZ1 A;  4BIU A;  4LF5 O;  3ZCC A;  4RQF A;  1NT2 B;  5FNV A;  1PPJ H;  5JVD B;  3SPI A;  3AK2 A;  4CH3 A;  5FLX N;  2P5O A;  2EIJ C;  5EBM C;  4DO2 A;  2XK2 A;  3U67 A;  3KCX A;  1PKX A;  4ZOL A;  1PD3 A;  1PL4 A;  3T1K A;  1JFF B;  2YIB D;  4MVS A;  1UYG A;  1M56 C;  2Y4U A;  4UV8 A;  4FFB B;  3R4N A;  3R4P A;  2P67 A;  1JX9 A;  2YE2 A;  4LFB B;  4WUC A;  1Z5A A;  3CSX A;  5CPH A;  4B7P A;  4XC0 A;  3CGZ A;  3BM9 A;  1SQG A;  5JCO C;  1AR1 B;  3ZJZ A;  4O4H A;  2EIN B;  3JAL A;  2LW1 A;  1ROP A;  2Q8H A;  3N2G B;  4EFT A;  4D6T H;  1QY8 A;  3C11 A;  3ZMZ A;  4DV2 O;  3RYF A;  2Q68 A;  3SYC A;  4LWI A;  1K7D A;  1K4D C;  3CGY A;  2Q7H A;  4DR3 B;  1M4U A;  5CBG A;  4EEH A;  1FS0 G;  2K9P A;  1WB7 A;  3JAS A;  1R62 A;  2YI0 A;  4IHJ A;  1N8R W;  2ZE6 A;  2P4K A;  3HKD A;  3CXH F;  2QGN A;  1QU7 A;  1JA8 A;  2IOR A;  4W4L A;  1YZB A;  2Q4P A;  3CP1 A;  3IC7 A;  4LFA O;  4PA9 A;  5FNC A;  3K5M A;  3ZRS A;  3A0Z A;  3CWB H;  4KXR A;  4JAV A;  2FWZ A;  3F5W C;  1HNX B;  3OW6 A;  1KP2 A;  4JAS A;  4AIL C;  3Q5J A;  3FB7 C;  4QE9 A;  2P06 A;  1Y67 A;  1IBL B;  1HR0 O;  2B9Z A;  4DV6 O;  2C1G A;  3FAV A;  2UWD A;  1I5A A;  4JI2 B;  2FXS A;  3M8A A;  3FFQ A;  5C8Y A;  3O0I A;  3FYI B;  2H55 A;  1ZLZ A;  3BEH A;  1BSM A;  3D3I A;  1HDJ A;  2QTS A;  5J2U B;  1ZL8 B;  2RCV A;  2QKC A;  2LO1 A;  4B3R O;  3VQV A;  1YTF D;  5L3C A;  2XDX A;  3ETE A;  4XDK A;  1L0N H;  4MTG A;  2HLD G;  4F6R A;  2Z5U A;  4MP2 A;  1M5I A;  3ZMS A;  3SJA C;  1VIB A;  4JI6 O;  2AHZ A;  3ABM B;  4CZZ A;  4GX1 A;  5IT9 N;  4RO2 A;  1Q43 A;  3ZRW A;  4XD8 A;  2QM7 A;  5E1A C;  2WLL A;  2FTK A;  4OX9 O;  2QR4 A;  2Q7G A;  3ZHQ A;  4FLV A;  4F6E A;  1Z5B A;  1XMO O;  3GWO A;  5BOD A;  2ZR3 A;  1HNZ B;  4K3A A;  3ZKD A;  5E79 Z;  1NBM G;  4NR1 A;  1R73 A;  2DWD C;  5DEC A;  4UCO A;  3JCZ A;  1U97 A;  4LF4 O;  5FND A;  3L71 H;  1OSF A;  3RVZ A;  3L9D A;  1OCC C;  2XOK G;  3LMM A;  4LBE C;  2OYQ A;  1BQ0 A;  3OMN B;  3UT5 B;  5LP6 C;  4LFC O;  2ESA A;  4NXN O;  2EX3 A;  1YSZ A;  2CCU A;  1HNW O;  4LF9 B;  5H9C A;  3CCS V;  4RQE A;  4P8O A;  4PU9 A;  1GM9 A;  4LWS A;  2A06 H;  3KKY A;  4X8A A;  4R3M A;  3ZXO A;  3R66 A;  2YEE A;  1KZN A;  3A0W A;  1TBW A;  1URF A;  4QNH B;  3APO A;  1GM7 A;  4JV5 O;  3JAT B;  1MAB G;  4DV1 O;  1XOU A;  3K79 A;  2ITD C;  3VQW A;  2EUL A;  2KG7 A;  1Z5V A;  4P7A A;  3EHJ A;  4K35 A;  4QGP A;  4DV0 O;  4URL A;  5JWP A;  5M4P A;  1YF2 A;  4K4O A;  1AI7 A;  3T1Y B;  4A5U B;  3JD0 A;  2XX2 A;  3D2R A;  2XJG A;  3RT3 C;  5GTH Z;  2RQ6 A;  3GWK C;  1BCC H;  1XRE A;  4E4E A;  4Q20 A;  4G28 B;  3OMA B;  4DV5 O;  5LXT A;  2FKX A;  3CRM A;  3Q5L A;  4XIQ A;  3G6E V;  4TV9 B;  1K8A W;  2YED A;  1THZ A;  4JGS A;  1JR9 A;  1GKX A;  2LP7 A;  4O2A B;  4O4I A;  4JI8 B;  4O4J A;  5EBL C;  4JI3 B;  4EM7 A;  4MPN A;  3QO8 A;  3A2F A; 
#chains in the Genus database with same CATH homology
 2ZDX A;  4EGK A;  5L3D A;  2WLM A;  5J6A A;  4XCJ A;  1IXM A;  1S14 A;  3T0Z A;  2JDI G;  2JJC A;  1S77 D;  2NNU A;  3TZ4 A;  3CPW U;  3E2E A;  3CCM V;  1M9N A;  4MVM A;  2BTZ A;  3RW0 A;  2IOQ A;  4NH7 A;  1NVP B;  3SPC A;  4B6C A;  4WFG A;  2HKJ A;  1CPY A;  2X7R B;  4AWP A;  3FYE B;  3K0D A;  3T2S A;  1QBZ A;  2B1G A;  5LHG A;  2WEP A;  4XIP A;  3P32 A;  1UYK A;  3M99 B;  5L3B A;  1TID A;  2OTJ V;  1UYE A;  2QA4 V;  1K34 A;  3CC2 V;  4EGI A;  1BYQ A;  3ETG A;  3OWB A;  2KB1 A;  2O1W A;  1UY8 A;  1KQS U;  3CCE V;  2QTO A;  3ABL B;  4P9O A;  3ABM C;  1FXK B;  4QPJ A;  3HB3 B;  4O0B A;  1Y8N A;  4DXW A;  2XAH A;  1DF4 A;  4ZKI A;  3PJS K;  4CWN A;  1ID0 A;  2YJX A;  2ZDI A;  2BYH A;  4AWO A;  2YEA A;  4G27 B;  4PA4 A;  4WUD A;  2YGA A;  1Q82 W;  4GT8 A;  1I5D A;  1B6Q A;  2EIJ B;  1K4C C;  3STZ C;  5D7C A;  3K06 A;  3D36 A;  2IWX A;  2H8M A;  2GQP A;  3LNU A;  2XDS A;  4WF9 V;  3QO5 A;  1AH6 A;  3OR7 C;  2OTL V;  3ZN1 A;  1YTF B;  2IWS A;  4QPK A;  3ZXQ A;  4KFM A;  3SPG A;  1VQN V;  1YC3 A;  2BYI A;  1K5S A;  4MW3 A;  5F3K A;  1AM1 A;  5HFL A;  1Y4S A;  5L3F A;  2XJX A;  4LWH A;  2DYS B;  2XAQ A;  3B8M A;  4XDL A;  1AJP A;  4O09 A;  3JD2 A;  4ASB A;  1VQP V;  1H2G A;  2LFR A;  5EC2 C;  2XX5 A;  4H7Q A;  2IOP A;  4KSH A;  3OAA G;  2BU7 A;  1V55 B;  2QFO A;  1BL8 A;  1WPX A;  1Q81 W;  2XAJ A;  2W6J G;  2PI5 A;  2YGE A;  3T4Z A;  2QG2 A;  4PA7 A;  2JK5 C;  3STL C;  2EIK B;  2WI4 A;  3B77 A;  3LSS A;  1K33 A;  2Y69 B;  3IED A;  4HY6 A;  2WLI B;  4PDV A;  2WI7 A;  1PNK A;  2HFE C;  2GHY A;  1NH2 D;  1B62 A;  3TET A;  1SER A;  3K3W A;  1RM1 B;  4RUF A;  5IDJ A;  4FMT A;  5LHI A;  2YKJ A;  1QYE A;  2EIL C;  3OMU A;  2WEQ A;  4YKQ A;  3QNE A;  4EKW A;  1W0K G;  1RPR A;  2X0L A;  5B1B B;  3R4M A;  3K03 A;  3W7S A;  1DF5 A;  3CMA V;  3ABL C;  4JF3 A;  1FXK C;  2YSU B;  3ZMU A;  3T10 A;  5KA5 A;  1YS3 A;  1US7 A;  3CXC U;  4PDL A;  2GFD A;  3K97 A;  3A0T A;  3LDD A;  4L93 A;  4NH8 A;  2Y48 A;  3O2F A;  2ZR2 A;  4XTJ A;  5LBQ A;  1AI5 A;  4FIP C;  2YE7 A;  3K60 A;  1YHQ V;  1UY9 A;  5CTY A;  3E86 A;  4GFN A;  4TT3 G;  3FB6 C;  1G8M A;  4N21 A;  2QE7 G;  3BY6 A;  2ZD9 A;  4DZY A;  4W7T A;  3FT5 A;  3U2K A;  4YKY A;  4JTA B;  3EKR A;  1UYF A;  3WHA A;  2WPD G;  1FFT B;  2XCM A;  4LPB A;  1ARO P;  4LP0 A;  4MB9 A;  3K04 A;  1NKD A;  2YEV B;  2WI1 A;  1YSC A;  2WI5 A;  3SYQ A;  4L8Z A;  3C0E A;  1F23 A;  2DYS C;  1UYC A;  2YKC A;  2CG9 A;  3G71 V;  2ATK C;  2Q8I A;  2XHX A;  1HWY A;  3O6O A;  5CBH A;  1GM8 A;  2ZQM A;  3ZIA G;  1E1R G;  4UV9 A;  2QKS A;  2QEX V;  1NHI A;  4BW5 A;  3HYZ A;  4X89 A;  3IGA C;  4MBC A;  5IDM A;  1QCE A;  3GB7 C;  4CE2 A;  1E79 G;  3Q5K A;  1AJN A;  2YI6 A;  4UVA A;  2E0A A;  4WFF A;  3R91 A;  2A79 B;  2YJW A;  1V55 C;  2ZXW B;  4PEL A;  1UYI A;  2YKI A;  2Q8G A;  3K98 A;  1GKZ A;  4PDR A;  2EIK C;  1R3I C;  4UXN A;  2VW5 A;  2YE3 A;  2V7Q G;  4CE3 A;  3GIE A;  2Y69 C;  2B1I A;  3E89 A;  3AG4 B;  1YT2 A;  3X2Q B;  1XL4 A;  3SPJ A;  4L87 A;  1K97 A;  2YK2 A;  1RM1 C;  3QTF A;  5M4K A;  1VQ9 V;  3HHU A;  5EC1 C;  1NR1 A;  3RLP A;  1ZWI C;  1Z59 A;  1YER A;  1I5X A;  2DQ0 A;  3CCQ V;  5DN6 G;  5B1B C;  1M1K W;  1KKD A;  4URM A;  2YKB A;  1DLB A;  3VAD A;  4BQJ A;  2K5B A;  4GT1 A;  3GIF A;  3EFF K;  1PL0 A;  3HEK A;  4GGL A;  4MS2 A;  2JKI A;  2CCT A;  2JJ2 G;  3W7T A;  3WFV A;  1KIJ A;  4UVC A;  1VQ8 V;  4EGH A;  4HYP A;  4PL9 A;  1EBO A;  3OMI B;  2WLH A;  1NHH A;  4GX0 A;  3FB8 C;  3E8H A;  5EBW C;  1YES A;  1B63 A;  3ABK B;  3EHF A;  4LC1 A;  2EJR A;  2IJH A;  2WLN A;  4PRX A;  2UXX A;  2WER A;  1NH2 B;  3IFX A;  4AWQ A;  1UYD A;  2HG5 C;  4ASG A;  4EMV A;  4JQL A;  2YEF A;  2ZBK B;  1VQ5 V;  4AS9 A;  5D7R A;  2H94 A;  5LGN A;  4R1F A;  1F51 A;  1BXD A;  4YKR A;  5IN9 A;  4WFH A;  3CRK A;  3FKS G;  3AEI A;  5H6Q A;  1AH8 A;  5IY5 B;  1JM6 A;  5M4E A;  1K5Q A;  4HXZ A;  3ZRW B;  4GX2 A;  1MU5 A;  4I5S A;  4EFU A;  1WLE A;  4LWF A;  4WUB A;  2A0L A;  1I5B A;  4GX5 A;  3DGE A;  1L0O A;  1NQT A;  2YE6 A;  3GIG B;  4CWT A;  5H6R A;  4XIR A;  1E1Q G;  1OCR B;  3ML0 A;  5BOC A;  2DQ3 A;  2HCH A;  1SRY A;  3OUF A;  2IJI A;  1KP3 A;  4JYC A;  1EA6 A;  5CTX A;  4CWQ A;  3BMY A;  3RBZ A;  4CBC A;  3HYY A;  3OWD A;  4CWP A;  2EIL B;  2ZXW C;  1H8H G;  3FT8 A;  3A0R A;  4PA6 A;  1R3K C;  3RLQ A;  1Q7Y W;  2BRC A;  4XE2 A;  3TUH A;  4HY1 A;  1U0Z A;  2QM8 A;  1VQ7 V;  1S3J A;  1I5Y A;  3RKZ A;  2QF6 A;  4WFA V;  3A0Y A;  3CYO A;  1P7B A;  3AG4 C;  1GKF A;  2CGF A;  3X2Q C;  3ASO B;  1FXH A;  1M57 B;  2CH4 A;  4Z1M G;  1F4M A;  1R3J C;  4YKT A;  5LHH A;  2OCC B;  4CWS A;  2C2A A;  2WSS G;  4ASA A;  1JVM A;  3UM7 A;  2BRE A;  3E8G A;  1K73 W;  2Q67 A;  2H8P C;  4YKZ A;  3EHH A;  2WLI A;  3ZMV A;  2WAM A;  3INW A;  4TSF G;  3OUS A;  1V54 B;  4R7C A;  4BQG A;  4MT8 A;  4X9L A;  4WFE A;  1OHH G;  4ASU G;  1YT0 A;  4OXS A;  2Q6A A;  4LWE A;  1L1F A;  1SET A;  4WCE V;  3U2D A;  1QVF U;  4XDM A;  5B3S B;  3TZ0 A;  4O05 A;  2YEJ A;  2BZ5 A;  1JQ0 A;  2EZO A;  2YE4 A;  4PDM A;  2Q2E B;  3ABK C;  1NR7 A;  4RAI A;  1YT1 A;  5KUK A;  1Z5C A;  5D7D A;  2YE5 A;  2EIM B;  1UJW B;  2DW4 A;  3W7W A;  2XAS A;  3EHB B;  5C93 A;  1S76 D;  1BKN A;  1AJ6 A;  1CP9 A;  4HZ0 A;  2DWE C;  2XND G;  3LDE A;  5GW7 A;  4URN A;  1COW G;  2V1D A;  2HR3 A;  2O1V A;  3WG7 B;  1YI2 V;  4H33 A;  1S72 V;  4MTF A;  5IY5 C;  3F7V C;  5FWK A;  1VQK V;  2MK3 A;  5L3J A;  2DYR B;  3TK1 A;  3MHS C;  3SYA A;  3G7B A;  1PNM A;  4MPE A;  4XBF A;  4N23 A;  3G4S V;  1OCR C;  2YEB A;  3T1C A;  2YEI A;  2WWW A;  3ZMT A;  5IYC O;  2XDK A;  3PEJ A;  2Q8F A;  4HZ5 A;  3LNM B;  3SYO A;  2PI4 A;  1DTO A;  2BU5 A;  1TIL A;  5FNF A;  4NH9 A;  4KTN A;  3AG3 B;  3CC4 V;  2XHR A;  2B5U A;  1OCO C;  1Y4U A;  1MG1 A;  2VCJ A;  5HFM A;  2R9R B;  1R6N A;  1UY6 A;  5J71 A;  1VQO V;  4L90 A;  1B3Q A;  3TZ5 A;  3OFN G;  1G4Y B;  4MPC A;  3ASO C;  1YJ9 V;  2R9I A;  1M57 C;  3WQ9 A;  4HYO A;  3AG1 B;  1RPO A;  4U93 A;  1OZ0 A;  2OCC C;  1QZR A;  4JTC B;  1YC4 A;  3CCU V;  3CME V;  1ZXM A;  4BAY A;  1YIT V;  1J95 A;  1P4R A;  3JZ3 A;  1ZWH A;  4HXW A;  4MVQ A;  4RUE A;  1F4N A;  4MP7 A;  2X6B A;  5L3E A;  5B1O A;  2XAG A;  3FB5 C;  2OT5 A;  4U7O A;  1V54 C;  4H37 A;  3JD3 A;  3SL2 A;  4P2Z A;  4MVU A;  2XX4 A;  3PEH A;  4XIT A;  4ZVI A;  3T0H A;  5B3S C;  3OR6 C;  4XDJ A;  2PNR A;  1BHB A;  2X6A A;  1H8E G;  4J9Z B;  1BHA A;  4HAM A;  3EKO A;  2P7T C;  4ZBM A;  4MW8 A;  2YEH A;  4JTD B;  5DM6 V;  2HVJ C;  2EIM C;  3B8N A;  5KUM A;  3FV5 A;  4JYB A;  4P9P A;  5IYD O;  1I59 A;  4X88 A;  1S16 A;  2AKP A;  3ASN B;  4QJF B;  3CRL A;  1ORQ C;  3A0X A;  3W7U A;  1EFR G;  3WG7 C;  4YKU A;  3AG2 B;  3B26 A;  3OW2 U;  4LWG A;  4PRV A;  2YK9 A;  2YEG A;  3G7E A;  4YXW G;  4BAE A;  2JJ1 G;  5F5R A;  2W0F C;  3ZKB A;  2ZDY A;  3LUT B;  3ZRV A;  2DYR C;  2FWY A;  2ZDI C;  4U7N A;  1K3E A;  3R4O A;  3OEH G;  4XKK A;  2LFS A;  1ENV A;  2IU3 A;  4YKX A;  5M4N A;  2XJJ A;  4MTX A;  3OM3 B;  1GTO A;  1Y8O A;  5BZB A;  1YIJ V;  2YKE A;  4J9Y B;  2IJK A;  2Z3Y A;  1S5H C;  3G75 A;  2EBO A;  5B1N A;  3AG3 C;  3RLR A;  2A9H A;  1CEZ A;  5CMU A;  3GIG A;  4HYM A;  3CWV A;  4E01 A;  1R3L C;  4UVB A;  3SYP A;  4FCQ A;  5B1A B;  3HZ5 A;  4JAU A;  2XHT A;  4E02 A;  1MSW D;  1JOY A;  3KE6 A;  2P90 A;  2YE8 A;  1GJV A;  2HJF C;  4V26 A;  4YKW A;  5GGZ A;  3CD6 V;  4XKO A;  4HZ3 A;  3W7X A;  3AG1 C;  4URO A;  3R92 A;  3QDD A;  4KP4 A;  2IW5 A;  2WLJ A;  3E8F A;  3MNR P;  4O07 A;  1GO3 F;  4GQT A;  1AI6 A;  2IWU A;  5EK0 A;  2BOC C;  1FXK A;  1Y8P A;  1VQ6 V;  1YJW V;  2YEC A;  4BXI A;  3I56 V;  2BSM A;  4FCP A;  2ITC C;  3B24 A;  5J9P C;  4E2L A;  2XDU A;  3CCR V;  4ASF A;  3B27 A;  3TZ2 A;  2WI6 A;  3MHH C;  2XAF A;  3B25 A;  2W6I G;  3EHG A;  1UYH A;  4KUM A;  1TUE B;  1NHJ A;  1EZJ A;  3E35 A;  3NXS A;  2EIN C;  4JPR A;  2WLL B;  4FJC C;  1YJN V;  2O1U A;  4MVO A;  1TC6 A;  3OPD A;  1VQM V;  3H80 A;  5LGT A;  4TWK A;  1SES A;  1OCZ B;  4I9W A;  2FYP A;  5FL7 G;  3TTZ A;  2YGF A;  3OE7 G;  3ASN C;  3E83 A;  4L91 A;  1KEC A;  1LNQ A;  3SPH A;  1Q86 W;  2NLJ C;  3OGC C;  2YI7 A;  2CK3 G;  1K92 A;  3AG2 C;  1TC0 A;  2BU6 A;  4KFG A;  1M90 W;  1OCO B;  2BU8 A;  2IH3 C;  4FCR A;  1JCH A;  1UY7 A;  1UYM A;  3JD4 A;  4MSW C;  1QVG U;  3CCJ V;  1VQL V;  3KG2 A;  4MVZ A;  3VHC A;  1I58 A;  2GSM B;  2IJJ A;  3LPS A;  4LP8 A;  4G2K A;  4MVR A;  1JJ2 U;  3R65 A;  2QG0 A;  1NJI W;  1AJQ A;  4O04 A;  3H4L A;  4BIZ A;  3D0B A;  3T4D A;  3RVY A;  4MOT A;  2JEX A;  2EXL A;  4R8C A;  2D3O W;  2X6C A;  3VOU A;  2M7W A;  4CWR A;  5M4H A;  4UUJ C;  4P30 A;  3H01 A;  1GMG A;  3LDC A;  1VQ4 V;  1TH8 A;  3K08 A;  5B1A C;  1QLE B;  5KA6 A;  4R50 A;  2VCI A;  2AHY A;  1H7S A;  1KD1 W;  1THN A;  2HKO A;  1K9M W;  3HPL C;  4XCL A;  2EZP A;  3CC7 V;  5M4M A;  2Q69 A;  1M56 B;  3DTU B;  3INX A;  4L94 A;  3NMQ A;  2IH1 C;  1QR8 A;  3TCU A;  4LCU C;  2P6J A;  1FXV A;  4CWO A;  1YET A;  3JD1 A;  3OEE G;  2CCS A;  3I55 V;  3VBB A;  3LSQ A;  5CBF A;  1QR9 A;  1W2B U;  1H7U A;  4I3H A;  2UXN A;  2JIZ G;  2JEU A;  4QE7 A;  2WI2 A;  3K0G A;  1KC8 W;  4WFB V;  1YC1 A;  3VHA A;  1JPX A;  5L3G A;  1AMW A;  3E8B A;  4GEE A;  3ETD A;  5D6Q A;  4KQV A;  3QO7 A;  1EI1 A;  5IYB O;  3UKM A;  4R3A A;  4H85 A;  4QIW F;  3B28 A;  2BT0 A;  2VWC A;  2YI5 A;  5CN0 A;  1BMF G;  5CA3 A;  4KSG A;  4FK5 C;  3SJQ C;  2ZKJ A;  1OCZ C;  1UYL A;  2YE9 A;  4V25 A;  1H38 A;  2HVK C;  4E00 A;  3K99 A;  5LGU A;  2YEV A;  3CCV V;  1SZT A;  1R6K A;  1W0J G;  1I5C A;  1ZW9 A;  4FPP A;  1Y66 A;  5CTW A;  2F43 G;  3ZN0 A;  3T2M A;  3ABU A;  2XAB A;  1BGQ A;  1S0V A;  2HG1 A;  5CTU A;  4CE1 A;  4F4L A;  4CWF A;  1OCC B;  1GK9 A;  2WLK A;  3F7Y C;  3P30 A;  2BU2 A;  1MOF A;  3JYC A;  2BOB C;  1MX0 A;  3VHD A;  1QLN A;  1U2O A;  4XKA A;  1AI4 A;  3ZRX A;  1Y4M A;  4GCZ A;  3CCL V;  3ABT A;  1PVG A;  1A4H A;  2IU0 A;  1NVP D;  5D6P A;  3MD0 A;  1PNL A;  1XL6 A;  2K1E A;  3ZM7 A;  4DUH A;  4R6Z A;  2XD6 A;  5CF0 A;  3K9A A;  4PA3 A;  1YSR A;  1ZXN A;  4MTO A;  2XDL A;  4H81 A;  1QLE C;  2WI3 A;  3HZ1 A;  4BIU A;  3ZCC A;  4RQF A;  3SPI A;  2EIJ C;  5EBM C;  4DO2 A;  2XK2 A;  3U67 A;  1PKX A;  1PD3 A;  3T1K A;  4MVS A;  1UYG A;  1M56 C;  4UV8 A;  3R4N A;  3R4P A;  4WUC A;  2P67 A;  1JX9 A;  2YE2 A;  1Z5A A;  5CPH A;  4B7P A;  4XC0 A;  3CGZ A;  3BM9 A;  1AR1 B;  3ZJZ A;  2EIN B;  1ROP A;  2Q8H A;  4EFT A;  1QY8 A;  3C11 A;  3ZMZ A;  2Q68 A;  3SYC A;  4LWI A;  1K7D A;  1K4D C;  3CGY A;  5CBG A;  4EEH A;  1FS0 G;  1R62 A;  2YI0 A;  1N8R W;  2IOR A;  3CP1 A;  3IC7 A;  4PA9 A;  5FNC A;  3ZRS A;  3A0Z A;  4JAV A;  2FWZ A;  3F5W C;  3OW6 A;  1KP2 A;  4JAS A;  3Q5J A;  3FB7 C;  4QE9 A;  2UWD A;  1I5A A;  2FXS A;  3O0I A;  3FYI B;  2H55 A;  3BEH A;  3D3I A;  1YTF D;  5L3C A;  2XDX A;  3ETE A;  4XDK A;  4MTG A;  2HLD G;  2Z5U A;  4MP2 A;  3ZMS A;  2AHZ A;  3ABM B;  4CZZ A;  4GX1 A;  4RO2 A;  3ZRW A;  4XD8 A;  2QM7 A;  5E1A C;  2WLL A;  2FTK A;  1Z5B A;  3GWO A;  5BOD A;  2ZR3 A;  3ZKD A;  1NBM G;  1R73 A;  2DWD C;  3JCZ A;  5FND A;  1OSF A;  3RVZ A;  1OCC C;  2XOK G;  4LBE C;  3OMN B;  2ESA A;  1YSZ A;  2CCU A;  5H9C A;  3CCS V;  4RQE A;  4P8O A;  4PU9 A;  1GM9 A;  4X8A A;  4R3M A;  3ZXO A;  2YEE A;  3A0W A;  1KZN A;  1TBW A;  4QNH B;  1GM7 A;  1MAB G;  3K79 A;  2ITD C;  4P7A A;  3EHJ A;  4URL A;  5M4P A;  4K4O A;  1AI7 A;  3JD0 A;  2XX2 A;  3D2R A;  2XJG A;  4Q20 A;  4G28 B;  3OMA B;  4XIQ A;  3Q5L A;  3G6E V;  1K8A W;  2YED A;  1THZ A;  4JGS A;  1GKX A;  2LP7 A;  5EBL C;  4EM7 A;  4MPN A;  3QO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...