4ZKIA

The crystal structure of histidine kinase yycg with adp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
239
structure length
233
Chain Sequence
b'VTEQQKIDNDRKQFVSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRVDKQGGTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine kinase
publication title Conformational dynamics of the essential sensor histidine kinase WalK
pubmed doi rcsb
source organism Lactobacillus plantarum jdm1
molecule tags Transferase
total genus 78
structure length 233
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4zkiA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4zkiA02
1ZXMA 2ZDYA 1UYLA 3RLPA 3Q5JA 4B7PA 3CRKA 1AH6A 4W7TA 2XJXA 4GCZA 4MBCA 2YE7A 2YI7A 4YKYA 2QFOA 4LWGA 3R92A 3CRLA 1UY7A 2VWCA 4XIQA 2BRCA 2ZKJA 3OPDA 4CE2A 4ZVIA 4FCPA 3NXSA 1US7A 1Y8OA 4U7NA 3FT8A 4KQVA 2YE5A 2VCIA 4Q20A 2ESAA 2AKPA 3C11A 4L91A 4GT1A 3ZRVA 4QPKA 2H55A 2IWXA 4QPJA 2YKBA 4MB9A 3A0TA 4LC1A 5FNFA 2YJXA 1MX0A 2YKIA 4H85A 2IOQA 2O1WA 2YGFA 2XJJA 4HYMA 5F5RA 2YGEA 1QZRA 2CCUA 4U93A 1Y4UA 3ZCCA 3CGYA 4FCQA 4MPCA 2WWWA 3NMQA 2BZ5A 3RKZA 2UWDA 4URMA 4MOTA 5M4HA 1TH8A 3O6OA 1L0OA 1YT2A 1ZW9A 1UY9A 4NH7A 5M4KA 4HZ0A 1B63A 4CWRA 3TZ5A 1OSFA 2YEBA 4ZKIA 2Q8GA 2IWSA 2XDUA 2WI1A 1I59A 3HHUA 4XCJA 4XIRA 1UY6A 1THNA 4XTJA 3EHJA 3G7BA 2BU5A 3EHFA 2YECA 1KIJA 3GIGB 3K98A 2YK2A 1BYQA 3A0YA 2YEAA 3VHCA 4EGHA 2Q8FA 4CE1A 5IDMA 1UYKA 3ZRXA 3PEJA 4O07A 4BIUA 3TTZA 2IWUA 3PEHA 4BAEA 1H7UA 4URLA 3HZ1A 1QY8A 2BT0A 1EI1A 1H7SA 1BGQA 2VCJA 4YKZA 3TUHA 3TZ4A 2FYPA 2YEIA 1F51A 3TZ2A 4CWTA 1I5BA 1Y4SA 4O09A 4XD8A 5M4MA 3ZKDA 4EMVA 1KZNA 1JOYA 1GKXA 3OW6A 4ASFA 2YKCA 4LP0A 2YEJA 4AS9A 3VHAA 4FCRA 4CE3A 2WEPA 1UYFA 2XX4A 4NH8A 4AWOA 4HY1A 3INXA 4LPBA 3A0WA 2YEGA 2IORA 2H8MA 4CWQA 1YSRA 3KE6A 1I5CA 5FWKA 5D7CA 4BIZA 1Y8PA 2XX2A 3R4MA 3T0ZA 2K5BA 2XDXA 4XCLA 2XDSA 3U67A 2FWZA 4YKUA 3H80A 4PU9A 2ZDXA 4EFUA 3BM9A 4U7OA 3GIFA 2GFDA 2XK2A 2HG1A 2VW5A 3OMUA 1NHHA 4JYCA 2LFRA 1IXMA 2YE3A 3A0XA 3MNRP 4FPPA 4JASA 2YEFA 2CH4A 3EHGA 1BKNA 4MPEA 4WUCA 4ASAA 3A0RA 2YI6A 2QM7A 3B26A 2XJGA 3VADA 1I5AA 1TBWA 3HYYA 2XDLA 3G7EA 2WERA 1YS3A 4MPNA 2XD6A 1Z5BA 3ZRWB 3RLQA 4UROA 3O2FA 3LPSA 4I5SA 2YE6A 4HZ5A 1Z5AA 4P8OA 2BSMA 5BODA 4PL9A 2FWYA 4JYBA 4B6CA 5J6AA 3EHHA 2BU7A 4XDMA 3TK1A 2YEHA 4LWEA 4XIPA 4O04A 4JQLA 2O1VA 4CWOA 2BTZA 2YE8A 3OWDA 2YE4A 4E02A 4O05A 2CCTA 1U2OA 3T10A 1NHIA 4AWPA 5CPHA 3CGZA 1TC6A 2XX5A 2YEDA 5FNDA 2BU6A 2YI5A 5D6PA 2WI4A 4E00A 4DUHA 2YK9A 2E0AA 4YKRA 1EA6A 3QTFA 5CTUA 4HXZA 4R3MA 4XC0A 2O1UA 3CWVA 4GGLA 1AJ6A 1UYCA 2XHRA 3HYZA 2BYHA 3LNUA 2FTKA 1Z5CA 2BU8A 1S16A 4MP7A 4LWFA 4BXIA 2YI0A 3R4OA 5IN9A 1Y8NA 2ZBKB 2CGFA 3JZ3A 1YT1A 4PRXA 2C2AA 2CCSA 3QDDA 3D0BA 5L3JA 3B28A 3Q5KA 4EM7A 3U2KA 3INWA 4XITA 1A4HA 2WI5A 4CWNA 4EGKA 2P67A 4ASGA 2GQPA 5B1NA 1UYHA 2XDKA 2YE2A 4CWFA 4AWQA 3GIGA 2JJCA 4NH9A 1AM1A 1I58A 4HXWA 4MTXA 1YERA 2YKJA 5CF0A 3R91A 4O0BA 3Q5LA 3ZXOA 1YESA 3B25A 4I3HA 3P32A 4BQGA 4JAUA 5D7RA 2YEEA 4CWSA 5M4EA 2BREA 4LWHA 3HZ5A 4EFTA 4URNA 2PNRA 2YGAA 4H81A 1UYDA 4L90A 3HEKA 4EGIA 1UY8A 3K99A 2BU2A 4GEEA 1YC3A 4XKAA 3B24A 1NHJA 3C0EA 1ZWHA 1JM6A 3T0HA 4E01A 2YKEA 3H4LA 2Q8IA 1PVGA 2IOPA 3RLRA 4L94A 1I5DA 1TILA 1UYEA 5C93A 3G75A 3EKOA 2FXSA 5B1OA 2WI2A 4H7QA 5D6QA 5F3KA 5J71A 2QF6A 5FNCA 4K4OA 5BOCA 3OWBA 5IDJA 3R4NA 4X9LA 2HKJA 3ZKBA 1YETA 1BXDA 4GFNA 4XKOA 3D2RA 2XABA 2WI3A 2QG0A 4LWIA 1AH8A 2XHXA 3BMYA 1B3QA 3IEDA 2WI7A 4L93A 3VHDA 1UYIA 1QYEA 2XCMA 4WUDA 2LFSA 4YKQA 5M4NA 3O0IA 4ASBA 4HYPA 1YSZA 1GKZA 2YJWA 1ZXNA 4KTNA 3EKRA 5CTWA 2JKIA 4EEHA 3T1KA 2BYIA 3R4PA 4YKWA 2Q8HA 3SL2A 4XKKA 5M4PA 1ID0A 3WQ9A 3B27A 3T2SA 4CWPA 4MT8A 5D7DA 1GJVA 3FT5A 4KP4A 5CTYA 3U2DA 2HCHA 3ZM7A 4WUBA 2WI6A 4V26A 1MU5A 3ZRWA 1U0ZA 3DGEA 1Z59A 2QM8A 1AMWA 4JAVA 3WHAA 4YKTA 3A0ZA 2YE9A 4KFGA 3TZ0A 4BQJA 2XHTA 3K97A 1YT0A 2WEQA 4KSGA 4FMTA 1YC4A 4GT8A 5CTXA 5GGZA 4YKXA 1UYMA 2EXLA 4GQTA 3GIEA 4PRVA 4HY6A 1R62A 3FV5A 1UYGA 4L8ZA 1TIDA 2QG2A 3MD0A 3ZXQA 3K60A 2Q2EB 2CG9A 3D36A 4R1FA 1S14A 4KSHA 4MP2A 4R3AA 1YC1A 1TC0A 4V25A 4P7AA 4DZYA 1B62A 4XE2A
chains in the Genus database with same CATH superfamily
3IJ4A 3RGBA 1LNQA 2JDIG 2UXNA 4YJ2B 4TV9A 1G6UA 3HKEB 1VQPV 1ORQC 3ASNB 4JI3O 3CRKA 4W7TA 3T4DA 4FM0A 3B4SA 2UXBO 1JPXA 2YE7A 2YI7A 4MBCA 4LWGA 2XAFA 3R92A 3OD4A 5L3BA 1Q6HA 2R9RB 3FYEB 3T1CA 2ZKJA 3OPDA 2XNDG 1GM8A 1US7A 2JJ2G 1Y8OA 2VCIA 1V9PA 4KHPB 5C8YB 3K0DA 4Q20A 4Q6GA 2AKPA 1SESA 4OGQB 3E2EA 4QPKA 2IWXA 5J2UA 1FKAO 4JI1O 1XMQO 4MB9A 2F23A 3A0TA 3VQYA 2HJDA 5KUKA 5KLVH 5IYZB 2IOQA 2O1WA 1B06A 4ZI7A 1SS3A 3ABUA 2XJJA 4HYMA 3CHXA 4O4IB 4I0XB 1YZBA 4FLVA 1QZRA 2CCUA 2ATKC 4U93A 1HNZO 2CAZC 2JEUA 3APOA 4DUYO 1NVPB 3SJQC 4X1YA 4MPCA 3J81N 3HKCA 2DMXA 3NMQA 2HKOA 2KSDA 5B1AC 1IXBA 2E5LB 5M4HA 4NR1A 4BWAA 1QVGU 3ZHTA 3OR6C 1D2DA 1UY9A 5JENA 1L0LH 1B63A 4J42A 1S3JA 4JI3B 3STZC 1VF7A 5JCOC 2UXBB 3CJHB 3QO8A 1XMOO 4DR6O 3TJTA 1IVSA 3ZMZA 2R9IA 5KAFZ 4O2BB 2WI1A 5ITZA 3K03A 3KKYA 4LFBO 1AR1B 1PV0A 3WU2Z 5LGNA 1M57C 3CCVV 2YECA 3GIGB 4G2KA 1SRYA 3CRCA 4JI1B 2H94A 1XMQB 2ZM6O 3JAMN 2ZNIA 3VHCA 4EGHA 1AR5A 4GX1A 4PA4A 5IDMA 2RNBA 1VQKV 3N2KA 3CCLV 1YXBA 1K7DA 3IAYA 1X59A 4EEQA 1TUBA 2HEPA 1HNZB 4BAEA 4MW3A 2YXLA 4DUYB 1HR0O 4J9YB 3CMEV 2YEIA 2UUAO 3CCSV 3JAWB 2QWPB 4NXMO 1KZNA 3K3WA 1JOYA 4PV1B 2NLJC 4U3JB 5JJJB 2OIEA 1R6NA 1BT8A 2CH7A 4I50A 2WEPA 1DF4A 3L74H 1UYFA 3U10A 4NH8A 2Q67A 1S0VA 4HY1A 1BGYH 4DV6O 2N05A 3LNNA 3Q4HB 4UV8A 5FWKA 1WP7A 1RM1C 4BIZA 5D7CA 1BQZA 3R4MA 4J10A 4LFBB 3T0ZA 1WB8A 3FAVB 4XCLA 4P9PA 3U67A 5KMGB 2E75B 1K4DC 3H9VA 4YY3O 1DLBA 3OGCC 3CP1A 4DRXA 2ZM6B 3JD1A 1MG1A 1GN4A 3GVMA 3DC6A 3OMUA 1GO3F 2GBOA 2Q4PA 5IYBO 2KB1A 2CH4A 1D5NA 4ASAA 2CDYA 2JS3A 4CC5A 3K9AA 1Y76A 1EZVH 1HR0B 1YVWA 1I5AA 4DV2O 1QNMA 4WBNA 4JI8B 1PL0A 2Y4UA 4NXMB 3IFXA 2HVJC 2VWJA 2XD6A 3P3PA 1VQ9V 3E8BA 1Q82W 3JASB 4UB8Z 3LPSA 2YE6A 1Z5AA 5BODA 1LUWA 4LFCB 4KUMA 4HNAA 4J7JA 3PN1A 4PJ0Z 4RO2A 4MTOA 5H6RA 4LWEA 3K9SA 4XIPA 1JCHA 3JARA 2XAJA 3W7SA 4H13B 4XDLA 2HHIA 3HKBB 1NH2D 4JAAA 4UCSA 4YY3B 1VQ6V 5KHIA 1BSMA 1QR9A 1XUQA 4IL6Z 2OTLV 2JS5A 2CTRA 3K06A 3RYFA 4YJ3B 1LR1A 2YI9A 3CGZA 4DYLA 1TC6A 4A5UB 2YI5A 4E2LA 4F6RA 1F23A 2YK9A 1S5JA 5CTUA 4TSFG 4JI2O 4TUYA 4R3MA 2O1UA 3M7MX 3RYHB 3CWVA 4GGLA 1AJ6A 2XHRA 4U3FH 3VQVA 3RYCA 1AROP 5EBLC 3JAKB 3LMMA 4EB6B 1I0HA 2BU8A 2ZR2A 2AXTZ 2OIGA 5GONB 3R4OA 5IN9A 5CA1B 1KU9A 4O4JA 2IM9A 4CC6A 1YJNV 4LF8O 2VS0A 2NNUA 1N36O 3D0BA 1V55B 3CYGA 3K79A 3B28A 1M4UA 4EM7A 1OHHG 1IX9A 3RYIB 4JI6O 2LGQA 1A4HA 1GN3A 4EGKA 3P30A 1FXKA 3OMNB 1YTFB 1GM9A 5B1NA 3K57A 2Z5UA 1NJIW 4CWFA 2X7RB 4YIPA 2Y69C 4UB6Z 5L3CA 2IU3A 2Q73A 1AM1A 2DWDC 4BW5A 4X64O 4DV5B 1I58A 4X1KA 4MTXA 1AP5A 1OCOB 4G28B 4O0BA 3U11A 5BY1A 3AG3B 4B7EA 4WFAV 3ZXOA 1YESA 1M56C 4BR6A 2WLLA 1O9GA 2E74B 3T1HO 1K73W 4EFTA 3JD2A 2EINC 1U96A 2HHHB 4L90A 1EN6A 1FXVA 4TWKA 1FAFA 4LF4O 1H2MA 1UY8A 1K9MW 1KC8W 4GEEA 1OCRB 4XKAA 4E01A 3L9DA 3EHBB 4PDVA 3GWKC 4AQYB 5JQGB 4DV3B 3AG4B 2Q8IA 1PVGA 5FNVA 4H33A 2QWOB 3ABLC 4JF3A 1TILA 5C93A 3BFRA 2EBOA 3EKOA 1N36B 4YIOA 4DR2O 1K34A 5IDJA 1FYJA 3OWBA 5L3DA 4BAYA 3R4NA 4DR1O 4JI6B 3ZKBA 4RQFA 4X9QA 5DN6G 3BABA 4GFNA 4OXSA 2C1IA 2M6YA 4DUZO 2HLDG 3BMYA 1B3QA 3OUFA 3SYPA 3VHDA 1QYEA 3CRRA 1FJGO 3LDEA 4YKQA 4DV7B 4X64B 4K8ZA 4GKKO 1Q7YW 1Q6UA 5CTWA 2Q68A 2DJVA 2GUZB 3CMAV 1H8HG 3C3TA 3CCUV 3T1HB 4LBEC 1GN6A 4FJCC 3AEIA 4IIJA 2XTAA 4UCVA 3OT7A 4MT8A 4ZHQA 4I4TB 4K8XA 1Y74A 2UXCO 1RSOA 3OEEG 1GJVA 4LF6B 2UXXA 3I56V 5LOVA 4QNHB 4DR4B 2UUBO 2Y0PA 1TA8A 2D2CB 1NKDA 1S5LZ 4V26A 5HFMA 4JPRA 3DGEA 1Z59A 3WHAA 3M99B 3SYQA 3ZBHA 1JFFA 2WEQA 2QWQB 3H1IH 4X20B 4YKXA 4DR1B 2UUCO 2YIDA 4J80A 3ZJZA 2JGDA 3QTCA 3L75H 3E8GA 3BRCA 2QE7G 3OTFA 4IHJA 4DUZB 1R62A 4GX2A 3E22B 2GV9A 1YCIA 1NTKH 2AZ2A 4D7TA 2QG2A 5IJ0A 2Q2EB 2Y48A 1FJGB 3D36A 4QE9A 1S14A 1S77D 3RW0A 4CS2A 2DOSA 2QKAA 3JD4A 5J2TA 5IYDO 3BHPA 1IBMO 1US6A 4FZ1A 4DZYA 4FVMA 5H5NA 3G67A 2DN9A 4B3RB 4DR7B 3J7AU 3B77A 1L8DA 3I55V 1TVKA 4NVPA 2DQ0A 3Q5JA 4B7PA 2UXCB 4YKYA 4PELA 3F7VC 1MZFA 1W0KG 3AG2B 2KG7B 2UUBB 1UY7A 2VWCA 2BRCA 4CE2A 3E8FA 4ZVIA 3QO7A 1H2GA 2P4VA 4U7NA 3CRAA 4DV4O 1FS0G 2EIMC 5B66Z 1R3LC 3ABKB 3FB8C 1NTMH 1E1QG 1WLEA 5CB4A 4MTGA 4LC1A 2XASA 2YKIA 2EIJB 5IWAO 1MA1A 2F4VB 3TGUH 3TXSA 5F5RA 2GTSA 3ZHUA 4CH6A 1M9NA 5LMNB 4K3AA 1NR7A 3D8CA 3G4SV 2R72A 3C90A 2CTPA 3CCJV 1K33A 4RWUA 5LMUO 1IBMB 3RKZA 1YHQV 3A2FA 2XAGA 1E1RG 5BMVA 3B40A 4O4HB 4URMA 3UKMA 1TH8A 3ICXA 1SQQH 1XNQO 1Z2GA 1YT2A 1ZW9A 1URFA 2EZOA 1Z5VA 5M4KA 4NH7A 3C3SA 2QWRB 4FIPC 4PA7A 3AG1C 4UVCA 1QR8A 5KA5A 2WLNA 2IWSA 4ZOLA 1I59A 4WFBV 3HHUA 4XCJA 4LNUB 1KP2A 1M93A 3K0GA 2MW2B 1H8EG 2ZXWC 4XTJA 4J7KA 3AK1A 3OW2U 3K98A 3E35A 1HNWO 4KHPO 2F66C 3A0YA 2YEAA 3QO5A 3LDCA 4UV9A 3R65A 3ZRSA 5IWAB 2QEXV 4PI2A 4JI7B 1HNXO 3DXRA 3GB7C 1K5SA 5L3GA 4DXWA 3HKDA 4BIUA 3BA8A 1OCCB 1GAXA 4B3MB 2IWUA 3PEHA 1H7UA 1J95A 3HZ1A 4HBNA 3ABMB 4MVOA 2Q5ZA 2A79B 1H7SA 3N27A 3ZN0A 2WLIB 4YKZA 2FYPA 1OZ0A 1EBOA 5LHHA 2YICA 1JQ0A 1KUQA 1Y4SA 2JGUA 3OW6A 2YKCA 4AS9A 4CE3A 2FKXA 1XNQB 3ZX6A 3LDDA 3X2QC 3A0WA 2E5LO 4F6EA 2PYLA 1B04A 1VP7A 4MVZA 2YEVA 4UCUA 1YSRA 2V1DA 4IT5A 1I5CA 1KQSU 4DK0A 4B3SO 1PPJH 2K5BA 2XDXA 2XDSA 3OFNG 4TOIA 2FWZA 1EZJA 3AK2A 5B3SC 3KCYA 4PU9A 5JH7A 1XREA 1HNWB 3BM9A 4U7OA 3OM3B 3WG7C 5IYCO 2XK2A 3ZMTA 1GN2A 3W7WA 3ETDA 3OTOO 2VW5A 3WB2A 2BTOA 4JYCA 1HNXB 2YE3A 3A0XA 4Z1MG 2PY5A 4FPPA 4JASA 5LGTA 3EHGA 3RVYA 5LA6B 2X6CA 5JWPA 2RJZA 2DYRB 1N8RW 3L71H 1WNSA 2QM7A 1MMMA 1YSCA 1F7YA 4PDMA 3HYYA 2YSUB 4PA6A 4FM1A 3CD6V 1VQLV 2PI4A 3BA9A 4DR3O 3F7YC 1EN5A 1O9HA 3EVKA 5JCOA 1XOUA 3UO3A 4J7ZA 3ZRWB 2IJJA 4TT3G 1E79G 3S3WA 1NH2B 1SA0A 4I5SA 4LF5O 4MW8A 5KX5A 4P8OA 4I55B 2FWYA 4B6CA 5J6AA 3EHHA 1ZL8B 5TISZ 4CS4A 1WA8A 1N0JA 1I7FA 4B3SB 2YEHA 1S76D 4TQFA 1CEZA 5KHKA 5CBGA 2A3QA 1KMIZ 1NTZH 2A0LA 4CWOA 1DGSA 2YE4A 3CCMV 5H2FZ 4E02A 1XNRO 3HR0A 1K8AW 3CRQA 1D5AA 1IBLO 4N23A 3MAQA 1ENVA 1NHIA 3O65A 2H8PC 2WLMA 2ZDIA 3OTOB 3SJBC 4XBFA 3ML0A 4GZRB 2ZCEA 3B2EE 5LHIA 5FNDA 3UM7A 4J11A 4E00A 1KP3A 4YKRA 4WCEV 3QTFA 2ZT9B 3MHSC 5FLXN 1G8MA 4HXZA 4WFHA 4FLWA 2L6LA 2GSMB 2C1GA 4FLZA 2ZDIC 5EK0A 1UYCA 4OX9B 5IY5C 3K5MA 3UQ8A 4DR3B 1Z5CA 4WF9V 4X88A 4BXIA 5LBQA 2P06A 2XAQA 4JI8O 1Y8NA 4CBCA 2ZBKB 2CGFA 3ZEDA 2WPDG 5J2UB 3U0ZA 4LF5B 2C2AA 5E1AC 1YITV 2CCSA 5KHHA 4LCUC 1N4CA 1IBKO 4ZI7B 3WB0A 3U2KA 3ZN1A 4LFCO 1GTOA 5LXTA 5B1AB 4MVSA 1SQBH 2WI5A 4IYHA 2PUSA 4F4LA 3QVNA 1XHZA 3CS5A 1SQXH 2ZQMA 4X1YB 1XNRB 4LF9O 1IBLB 2JJCA 4NH9A 3HKCB 4FM2A 3ASOB 1R3JC 1YERA 3CCRV 3ZS8C 3B25A 3P32A 1QU7A 3T2MA 1OCZB 2DYSC 2HJFC 1M57B 4H0LB 1KKCA 3UCSC 1SC5B 5H6QA 1JVMA 3OMAB 3DSQA 3QF7A 2P6JA 1FFXA 3SYCA 2HVKC 4X62O 2BU2A 5ITZB 1WP8A 1ZWHA 2JJ1G 1VQNV 1YF2A 3H4LA 1SQPH 2XAHA 5A9GA 4EFEA 2KQXA 3TCUA 1MSDA 5KAIZ 3RLRA 4TQDA 2Q7HA 2ZE6A 4FFBB 1CXZB 2IH3C 4H7QA 5EIBC 4LH6A 1IBKB 5FNCA 3H1KH 4FK5C 4LWSB 3N2KB 3JCUZ 2H3OA 2ILMA 4JYAO 2Q6AA 2EULA 3E86A 2XABA 1TUBB 2VQFO 2WI3A 1AH8A 2XHXA 4IYIA 4RQEA 3JATA 4LF9B 2F1MA 2LFSA 3UT5B 2AZ0A 5LGUA 1L1FA 1ZXNA 2Q7GA 3CCQV 1RM1B 4P9OA 1OV9A 4DV5O 2CH7B 2P22C 4I50B 2JK5C 1KYOF 4EEHA 1KBHA 3T1KA 1DF5A 4YKWA 2Y4TA 3SL2A 1MZEA 5M4PA 3H1LH 3FYIB 4W4KA 3O9OA 5DM6V 4CWPA 2QWNB 3OUSA 2HHHO 4X62B 3U2DA 1KECA 1XL6A 1NU1H 1AP6A 1AMWA 1WAZA 1P7BA 4YKTA 1WPXA 2YE9A 1FXHA 1SQVH 2P4KA 4DV3O 4AQYO 4DRXB 1JR9A 3IC9A 2XHTA 3K97A 1AJPA 4ZIBA 4XDJA 4CZZA 4KSGA 1KKDA 3AG4C 1XEQA 1PD3A 5FL7G 4TV8A 1R1BA 5LYJA 3B09A 4JYAB 3A0BZ 1DK1A 3GIEA 4NTWA 2VQFB 4HY6A 2X6BA 4PA9A 4X8AA 1T5EA 3JALA 3CB2A 5B1BC 3SPHA 1AJNA 1MNGA 1VQMV 1QLNA 4L8ZA 1Y76B 3IC7A 3APQA 3ZMUA 4ASUG 1WN7A 2GDSA 4WBNB 1F4MA 2GUZA 1TC0A 2WA4A 4QIWF 4DV7O 3JSLA 1AILA 1ZXMA 1NR1A 1EN4A 1PL4A 2MK3A 5KHJA 1Q86W 5GW7A 2ZDYA 1YEWA 5GTHZ 4KFMA 1UYLA 3RLPA 1EM1A 4UFZA 3DTUB 1AH6A 2QFOA 2LJ2A 4HNAB 1RPOA 5IJ9A 2DE0X 2YIBA 4ICGA 1AI7A 4X1IA 4XIQA 4MVUA 3NXSA 4LF6O 3JARB 1M90W 3FT8A 4DR4O 2YE5A 4NTXA 5A2QN 5LP6A 1YJWV 4FLTA 3C11A 3K58A 3JD3A 4GT1A 4L91A 3ZRVA 1XL4A 2EJRA 4DO2A 1Q43A 4CH5A 1XI1A 5FNFA 3RYFB 2BE3A 4YXWG 2LP7A 4F6RB 1VQ5V 2PTMA 1QVFU 1VQ8V 5GTIZ 5LP6C 2IH1C 2CTQA 4TUYB 1Y4UA 3CGYA 3SYOA 2EILB 4FCQA 4O2AA 1QHTA 3B8NA 1SZXA 3RYCB 2VQEB 1G4YB 1SERA 4P2ZA 2QR4A 2WWWA 5LHGA 2BZ5A 3TXQA 2BTQA 5DEDA 2N74A 1THZA 3VOUA 4O4JB 3QG5A 1KD1W 2HG5C 2IJKA 3FB6C 2BSKA 4B3RO 4DR7O 3ZHVA 3F5WC 4GX0A 5EBWC 1AI4A 4I7ZB 3TZ5A 4CWRA 4C7UA 4R7CA 1N0NA 2Y0IA 2YEBA 2Y69B 4EKWA 1UPGA 2VWKA 2Z3YA 3W7TA 2OCCC 1GK9A 1THNA 2RMKB 1FXKB 4H37A 2YDEA 2JRIA 2EZPA 4MS2A 3G7BA 5K1XA 3AG2C 1W2BU 3K59A 4X65B 3DC5A 2YK2A 4X1KB 2B9ZA 2ZINA 4CE1A 1SKVA 2IW5A 2WLLB 3D3IA 3P3NA 2BOCC 3ZRXA 3PEJA 3CEIA 1PKXA 3TTZA 4URLA 2F4VO 2BT0A 2EIJC 4HYOA 1EI1A 5EZYB 1BGQA 3TUHA 3T4ZA 1N34O 1F51A 5LMNO 1WJZA 1UFIA 5KHGA 3ABTA 4CWTA 4JI5B 3IGAC 5CA0A 1M1KW 3ZKDA 5BR8O 1GKXA 4ASFA 2V7QG 5JVDA 2YEJA 3N2GA 3VHAA 5FNVB 2RN9A 1AJQA 2CGOA 2F43G 2H8MA 5EIBD 3W7UA 4KXRA 4CWQA 3PJSK 2A9HA 3KE6A 3OMIB 4NTYA 2LO1A 3MDSA 5CBHA 2XX2A 4NKGB 3E8HA 3A0HZ 2W6IG 4YKUA 3H80A 1JJOA 2ZDXA 3CPWU 1YI2V 2WSSG 2DQ3A 2GFDA 1K3EA 2HG1A 2CTWA 1NHHA 2LFRA 1ZWIC 3MNRP 2N04A 1N32O 4BW9A 2YEFA 2ADPA 4JI7O 1BKNA 4MPEA 3AK3A 3BVOA 4IIJB 3A0RA 2UXDO 4ABMA 4ZHQB 1Y74B 1RSOB 4UCOA 3VADA 2M7WA 1TBWA 1U97A 2QGNA 2QTSA 1N34B 4B3MO 2XDLA 5LOVB 2P90A 1WPBA 4KL1A 3BPZA 2Q7EA 5BR8B 1YS3A 2X0LA 2IU0A 1Q3EA 2P5OA 1Z5BA 1XBLA 3RLQA 1Y66A 4UROA 2AHYA 4YJ2A 4N21A 3HKEA 4QE7A 4JI4B 1GH6A 2W0XA 1JFFB 5JJNB 1VQ7V 4JYBA 3FKSG 2BU7A 5DECA 4E4EA 4AHCA 2GTAA 1GM7A 2JGDB 1KB9F 3QNEA 3WFVA 4IHJB 4JQLA 4ZBMA 2BTZA 5C8YA 2YE8A 3ASNC 2Q8VA 4Z2WA 4JYYA 5IJ0B 2LQTA 2CCTA 2WLHA 3D3QA 1H2SB 1V54B 2BOBC 3T10A 4LFAO 5J2TB 4AWPA 3VQWA 5CPHA 2FMLA 1I94B 3HPLC 5IYZA 2XX5A 4WFEA 2YEDA 4JGSA 1N32B 1RPRA 1Y67A 3SPGA 4DUHA 1TVKB 2AW9A 3NR7A 4NB5A 3ETGA 2E0AA 4O4IA 2F93B 1I5XA 1NZ6A 4I0XA 2FL4A 2UXDB 4D6TH 2B1IA 4LF7O 4WFGA 4J9ZB 4L8JA 2K9PA 2BYHA 4OPAA 2XUMA 2DYRC 2AHZA 1MSWD 1S16A 4MP7A 4LWFA 2B5UA 1A32A 4DR5B 4JI0O 1VIBA 5JJEB 4PRXA 1HDJA 3T1YO 1IZ3A 1BCCH 5CB4B 1BQ0A 5L3JA 3CJHA 2EIKB 1NBMG 2YIBD 1Q6IA 1TGOA 4FFKA 3Q5KA 2E3CA 3ZMSA 5HFLA 4JTCB 4O2BA 1RP3B 4GUNA 2W0FC 2AGAA 3OGIB 1F4NA 5H9CA 4HZ3A 4DW0A 4CWNA 2P67A 2YS8A 1P84F 4ASGA 2GQPA 1HW7A 1LUVA 3VBBA 4GKJO 1UYHA 4AWQA 3GIGA 3AG1B 4LFAB 4HXWA 2YKJA 5CF0A 3BEHA 5BMVB 3Q5LA 1QLEB 5D7RA 4JTAB 2CE4A 4CWSA 2ZR3A 5M4EA 2ZIMA 2P7TC 4B7KA 2ZXWB 3HZ5A 4PA3A 1NT2B 2PNRA 2YGAA 4H81A 1UYDA 4LF7B 4EGIA 3OAAG 3K04A 3K99A 4ZOLB 3ETEA 1YC3A 3JAWA 3B24A 1NHJA 1X4TA 4O4LB 1JM6A 3T0HA 4OX9O 2YKEA 2ZE5A 5CN0A 4YHHO 4U3JA 4JI0B 2IOPA 1FD9A 3T1YB 3RT3C 1WB7A 4L94A 1XILA 2WI2A 5B1OA 3SGIA 3ZHSA 2QF6A 3JYCA 2HR3A 3Q4HA 1G1XB 4PDLA 3DXRB 4X9LA 2HKJA 3TETA 3EXAA 4R8CA 3FAVA 3HKDB 5EYPB 3E83A 4XKOA 3D2RA 2QG0A 4MVQA 2ZIOA 1HP8A 5KMGA 2OTJV 2HFEC 2WI7A 4GKJB 4L93A 2PZSA 3X2QB 1UYIA 2XCMA 1JX9A 2JVDA 4WUDA 4JZ2A 5EC2C 5M4NA 4I9QA 3O0IA 5KA6A 3SPCA 4HYPA 1YSZA 1GKZA 1H2KA 1M5IA 4RAIA 2IJHA 2JKIA 2YXYA 4K0KO 2Q8HA 3H1HH 3G80A 1I08A 3ASOC 5IE9A 2LW7A 4XKKA 2UU9O 1I5YA 5B3SB 3B27A 3T2SA 3FB5C 4TV9B 1TAEA 5D7DA 2YEVB 2Z0AA 3THOA 4LP8A 3WG7B 3FT5A 4KP4A 3GWOA 3KG2A 3OE7G 4JTDB 1OCZC 3S3XA 2QA4V 1COWG 5CTYA 1XQ8A 5FPOA 1AI6A 4CH3A 4YHHB 1MU5A 4UXNA 1U0ZA 2QM8A 1PNKA 4FFBA 4B3TO 1R3IC 3A0ZA 5JH7B 3JASA 5IT9N 4KFGA 3TZ0A 1L0NH 4LWSA 3L73H 2PGGA 1YC4A 1JA8A 4GT8A 1Y4MA 4DW1A 5GGZA 4X89A 4GQTA 3STLC 1W0JG 1K92A 2G38A 4PRVA 1K4CC 2XHBA 3FV5A 1UYGA 2ZE7A 1UJWB 3HKBA 3UT5A 1TIDA 2ZE8A 3MD0A 3K60A 1XHXA 1YDXA 2CG9A 1ROPA 3R66A 4NYKA 4R1FA 4KSHA 4R3AA 1YC1A 2KKWA 4R6ZA 4YJ3A 4D7SA 4DV0O 4P7AA 4XE2A 3B8MA 4J41A 4K0KB 1AVMA 1QCEA 4HAMA 1XMOB 2UU9B 1SA0B 5KX5B 4DR6B 4MTFA 2XJXA 4GCZA 4B08A 2WLJA 1GRJA 3RYHA 1WA8B 2XT9A 3A8TA 3L70H 1ZLZA 3JAKA 1AR4A 3CRLA 1J5EO 4EB6A 2ODMA 4FCPA 4KQVA 5GONA 1R73A 1JMKC 2RDCA 2DWEC 5CA1A 2ESAA 2XOKG 4B3TB 3EFFK 1ZTEA 4WFFA 3H01A 1Y6XA 2H55A 4QPJA 1N33O 2YKBA 3G6EV 2YJXA 1MX0A 4H85A 5IY5B 4FLUA 2JIZG 2YGFA 4X66O 2ZD9A 3RYIA 2L35A 4FLYA 1ZUQA 1XDCA 5EBMC 1PNMA 2NN4A 2YGEA 3CE2A 5FPRA 2UUAB 3CC2V 3ZCCA 4P30A 4GLXA 2B1GA 4PHZA 1V55C 3RVZA 2ETNA 3SDLA 4DV0B 3JD0A 3SPIA 3L72H 3S5TA 5AG2A 2UWDA 4MOTA 4DV6B 3LSSA 3O6OA 2LW1A 4PI0A 2D3OW 3HB3B 5K1PA 5L3EA 1L0OA 4I9WA 4E72A 4HZ0A 3ETQA 1NVPD 1OSFA 4EFBA 3G6BA 4ZKIA 2ADQB 2Q8GA 1OCOC 2YUAA 2VRZA 3AG3C 2XDUA 5LXTB 4UVAA 1VQOV 4XIRA 1J5EB 1UY6A 2Q9LA 5JQGA 4AILC 2DYSB 4XDKA 4IGGA 3ZIAG 3EHJA 3RBZA 2BU5A 3EHFA 2EX3A 3H1JH 1KIJA 1N33B 3FD9A 1BYQA 2R9AA 2RQ6A 1VF5B 3CCEV 1OCRC 2Q8FA 2E76B 3KZIZ 4X66B 4MSWC 3WB1A 1P7GA 3M8AA 1UYKA 4LH7A 1Q8IA 4O07A 3LSQA 1MABG 4DV2B 3ZHRA 3E89A 4GYCB 1QY8A 2QKCA 1CP9A 5CA3A 2PYJA 2VCJA 3TZ4A 3F5TA 4AI8A 1FFXB 3TZ2A 1VMGA 1I5BA 4O09A 1PM9A 4XD8A 3LSUA 4EMVA 2VQEO 5M4MA 4LP0A 2EILC 4FCRA 4Z1VA 4NXNO 4QGPA 1VF6A 4DK1A 1Q81W 2XX4A 3LNMB 4AWOA 2A06H 3INXA 4LPBA 1H2NA 1NI8A 2YEGA 2IORA 2WLKA 3G71V 2EJ7A 4I4TA 5BZBA 2FB5A 3RFRA 5J9PC 3BAAA 1Y8PA 3VQXA 4BIOA 1VF6C 4FZ0A 4RUFA 1CPYA 4GX5A 3BCCH 3JATB 4EFUA 2HP8A 3GIFA 1FXKC 4X65O 4X20A 3K5NA 2CGNA 2YI8A 1IXMA 1R3KC 3CXCU 4JI2B 2Q69A 1TUEB 4WUCA 5EZYA 3E22A 2YI6A 1FPOA 3B26A 2XJGA 4UCTA 2PF4E 3G7EA 1YIJV 2WERA 1P4RA 1Q90D 2ITDC 1NS1A 4MPNA 4LF8B 5D5PA 3K5LA 4JI5O 4NXNB 1AB3A 1IURA 3O2FA 5B1BB 4H44B 4HZ5A 1Q5OA 2BSMA 4PL9A 3SJCC 5CBFA 4TV8B 3BY6A 3ZMVA 2OWOA 5LYJB 3FFQA 4XDMA 3TK1A 3UO2A 2KG7A 4JV5O 1SF9A 4O04A 4FLXA 4G27B 5L3FA 2O1VA 3JALB 1PP9H 1ZAUA 3OWDA 1M56B 1GMGA 3KCXA 3K5OA 3SJAC 4O05A 2OYQA 1U2OA 2EINB 1JJ2U 1OJHA 5F2VO 3J80N 2WAMA 1AI5A 1SQGA 2BU6A 5D6PA 2WI4A 4W4LA 1EA6A 4LF4B 3ABKC 2QKSA 4RUEA 4XC0A 1ZX3A 1GKFA 3HYZA 5IJ9B 2OCHA 3ABLB 2CUGA 2YC0A 4X1IB 2FTKA 3LNUA 1P49A 3FX7A 1W59A 2YI0A 4O4HA 5LP6B 3JZ3A 2JEXA 1YT1A 4DR2B 1S72V 4CS3A 3QDDA 2BCCH 2RCVA 4JI4O 3JCZA 5BXZA 4JV5B 2QSAA 3CSXA 3INWA 4LNUA 2CK3G 4XITA 1BE3H 1DTOA 4PD4F 4GKKB 1Z5WA 4O2AB 2XDKA 2YE2A 1EFRG 1IDSA 4K35A 4UUJC 1BZKA 4QJFB 4R50A 3SPJA 3R91A 2BTQB 1FFTB 2OCCB 4I3HA 5EC1C 4JAUA 4DV1O 3I5DA 2YEEA 4BQGA 3D36C 3RWRD 1I94O 1YTFD 4CH4A 2BREA 1V54C 2BSKB 4LWHA 3RN4A 4URNA 2W6JG 1QQCA 2QJ1A 3HEKA 1ZSPA 4JZGA 2A7WA 1SQFA 2OT5A 2WLIA 3CC4V 3CXHF 3AG7A 3C0EA 5D5QA 4L87A 3CWBH 1OCCC 2K1EA 2FYUH 3ABMC 1H2LA 2IJIA 4DR5O 1I5DA 1UYEA 2R70A 3G75A 2Q0OC 4MVRA 2UUCB 2FXSA 5D6QA 5F3KA 5J71A 1B6QA 4K4OA 5BOCA 1YJ9V 2YXHA 1R6KA 1YETA 1BXDA 2V4DA 3FB7C 5CMUA 2O57A 3OR7C 2QDOA 1RFYA 5KUMA 4LWIA 2EIKC 3MHHC 3IEDA 2QTOA 3JSNA 2WA3A 5LL6Y 1BL8A 1PNLA 3W7XA 4ASBA 4MVMA 5CA0B 2YJWA 4KTNA 2ARHA 2ITCC 3EKRA 5JVDB 4DV1B 3N2GB 1K97A 2PI5A 4UCRA 1VARA 1H38A 2BYIA 2DW4A 3R4PA 1MOFA 5LA6A 1ID0A 3WQ9A 1QBZA 3LUTB 1VQ4V 3K08A 2IBZH 1QLEC 4O4LA 2EIMB 4DV4B 2HCHA 3CRMA 1NQTA 2Q0AA 3SR2C 4WUBA 3ZM7A 2WI6A 4LR3A 3ZRWA 4JAVA 4OPHA 3SYAA 4BQJA 3OEHG 2ZKOA 1YT0A 3CC7V 1S5HC 4FMTA 4I55A 3CX5F 1ZL8A 5CTXA 5EYPA 1BHAA 1UYMA 2EXLA 1BS3A 2X6AA 5E79Z 1R6TA 1BHBA 2F95B 2ZNJA 1BMFG 2GHYA 3ZHQA 3CYOA 5LMUB 4PDRA 1SETA 1K5QA 4UVBA 3ZXQA 2QM4A 1VEWA 2NR5A 5B5EZ 2LGWA 4MP2A 1HWYA 1SZTA 4V25A 1B62A 2YIAA
chains in the Genus database with same CATH topology
1LNQA 2JDIG 2UXNA 1VQPV 1ORQC 3ASNB 3CRKA 4W7TA 3T4DA 1JPXA 2YE7A 2YI7A 4MBCA 4LWGA 2XAFA 3R92A 5L3BA 2R9RB 3FYEB 3T1CA 2ZKJA 3OPDA 2XNDG 1GM8A 1US7A 2JJ2G 1Y8OA 2VCIA 3K0DA 4Q20A 2AKPA 1SESA 3E2EA 4QPKA 2IWXA 4MB9A 3A0TA 5KUKA 2IOQA 2O1WA 3ABUA 2XJJA 4HYMA 1QZRA 2CCUA 2ATKC 4U93A 2JEUA 1NVPB 3SJQC 4MPCA 3NMQA 2HKOA 5B1AC 5M4HA 1QVGU 3OR6C 1UY9A 1B63A 1S3JA 3STZC 3QO8A 3ZMZA 2R9IA 2WI1A 3K03A 1AR1B 5LGNA 1M57C 3CCVV 2YECA 3GIGB 4G2KA 1SRYA 2H94A 3VHCA 4EGHA 4GX1A 4PA4A 5IDMA 1VQKV 3CCLV 1K7DA 4BAEA 4MW3A 4J9YB 3CMEV 2YEIA 3CCSV 1KZNA 3K3WA 1JOYA 2NLJC 1R6NA 2WEPA 1DF4A 1UYFA 4NH8A 2Q67A 1S0VA 4HY1A 4UV8A 5FWKA 5D7CA 1RM1C 4BIZA 3R4MA 3T0ZA 4XCLA 4P9PA 3U67A 1K4DC 1DLBA 3OGCC 3CP1A 3JD1A 1MG1A 3OMUA 1GO3F 5IYBO 2KB1A 2CH4A 4ASAA 3K9AA 1I5AA 1PL0A 3IFXA 2HVJC 2XD6A 1VQ9V 3E8BA 1Q82W 3LPSA 2YE6A 1Z5AA 5BODA 4KUMA 5H6RA 4RO2A 4MTOA 4LWEA 4XIPA 1JCHA 2XAJA 3W7SA 4XDLA 1NH2D 1VQ6V 1QR9A 2OTLV 3K06A 3CGZA 1TC6A 2YI5A 4E2LA 1F23A 2YK9A 5CTUA 4TSFG 4R3MA 2O1UA 3CWVA 4GGLA 1AJ6A 2XHRA 1AROP 5EBLC 2BU8A 2ZR2A 3R4OA 5IN9A 1YJNV 2NNUA 3D0BA 1V55B 3K79A 3B28A 4EM7A 1OHHG 1A4HA 4EGKA 3P30A 1FXKA 3OMNB 1YTFB 1GM9A 5B1NA 2Z5UA 1NJIW 4CWFA 2X7RB 2Y69C 5L3CA 2IU3A 1AM1A 2DWDC 4BW5A 1I58A 4MTXA 1OCOB 4G28B 4O0BA 3AG3B 4WFAV 3ZXOA 1YESA 1M56C 2WLLA 1K73W 4EFTA 3JD2A 2EINC 4L90A 1FXVA 4TWKA 1UY8A 1K9MW 1KC8W 4GEEA 1OCRB 4XKAA 4E01A 3EHBB 4PDVA 3AG4B 2Q8IA 1PVGA 4H33A 3ABLC 4JF3A 1TILA 5C93A 2EBOA 3EKOA 1K34A 5IDJA 3OWBA 5L3DA 4BAYA 3R4NA 3ZKBA 4RQFA 5DN6G 4GFNA 4OXSA 2HLDG 3BMYA 1B3QA 3OUFA 3SYPA 3VHDA 1QYEA 3LDEA 4YKQA 1Q7YW 5CTWA 2Q68A 3CMAV 1H8HG 3CCUV 4LBEC 4FJCC 3AEIA 4MT8A 3OEEG 1GJVA 2UXXA 3I56V 4QNHB 1NKDA 4V26A 5HFMA 4JPRA 3DGEA 1Z59A 3WHAA 3M99B 3SYQA 2WEQA 4YKXA 3ZJZA 3E8GA 2QE7G 1R62A 4GX2A 2QG2A 2Q2EB 2Y48A 3D36A 4QE9A 1S14A 1S77D 3RW0A 3JD4A 5IYDO 4DZYA 3B77A 3I55V 2DQ0A 3Q5JA 4B7PA 4YKYA 4PELA 3F7VC 1W0KG 3AG2B 1UY7A 2VWCA 2BRCA 4CE2A 3E8FA 4ZVIA 3QO7A 1H2GA 4U7NA 1FS0G 2EIMC 1R3LC 3ABKB 3FB8C 1E1QG 1WLEA 4MTGA 4LC1A 2XASA 2YKIA 2EIJB 5F5RA 1M9NA 1NR7A 3G4SV 3CCJV 1K33A 3RKZA 1YHQV 2XAGA 1E1RG 4URMA 3UKMA 1TH8A 1YT2A 1ZW9A 2EZOA 5M4KA 4NH7A 4FIPC 4PA7A 3AG1C 4UVCA 1QR8A 5KA5A 2WLNA 2IWSA 1I59A 4WFBV 3HHUA 4XCJA 1KP2A 3K0GA 1H8EG 2ZXWC 4XTJA 3OW2U 3K98A 3E35A 3A0YA 2YEAA 3QO5A 3LDCA 4UV9A 3R65A 3ZRSA 2QEXV 3GB7C 1K5SA 5L3GA 4DXWA 4BIUA 1OCCB 2IWUA 3PEHA 1H7UA 1J95A 3HZ1A 3ABMB 4MVOA 2A79B 1H7SA 3ZN0A 2WLIB 4YKZA 2FYPA 1OZ0A 1EBOA 5LHHA 1JQ0A 1Y4SA 3OW6A 2YKCA 4AS9A 4CE3A 3LDDA 3X2QC 3A0WA 4MVZA 2YEVA 1YSRA 2V1DA 1I5CA 1KQSU 2K5BA 2XDXA 2XDSA 3OFNG 2FWZA 1EZJA 5B3SC 4PU9A 3BM9A 4U7OA 3OM3B 3WG7C 5IYCO 2XK2A 3ZMTA 3W7WA 3ETDA 2VW5A 4JYCA 2YE3A 3A0XA 4Z1MG 4FPPA 4JASA 5LGTA 3EHGA 3RVYA 2X6CA 2DYRB 1N8RW 2QM7A 1YSCA 4PDMA 3HYYA 2YSUB 4PA6A 3CD6V 1VQLV 2PI4A 3F7YC 3ZRWB 2IJJA 4TT3G 1E79G 1NH2B 4I5SA 4MW8A 4P8OA 2FWYA 4B6CA 5J6AA 3EHHA 2YEHA 1S76D 1CEZA 5CBGA 2A0LA 4CWOA 2YE4A 3CCMV 4E02A 1K8AW 4N23A 1ENVA 1NHIA 2H8PC 2WLMA 2ZDIA 4XBFA 3ML0A 5LHIA 5FNDA 3UM7A 4E00A 1KP3A 4YKRA 4WCEV 3QTFA 3MHSC 1G8MA 4HXZA 4WFHA 2GSMB 2ZDIC 5EK0A 1UYCA 5IY5C 1Z5CA 4WF9V 4X88A 4BXIA 5LBQA 2XAQA 1Y8NA 4CBCA 2ZBKB 2CGFA 2WPDG 2C2AA 5E1AC 1YITV 2CCSA 4LCUC 3U2KA 3ZN1A 1GTOA 5B1AB 4MVSA 2WI5A 4F4LA 2ZQMA 2JJCA 4NH9A 3ASOB 1R3JC 1YERA 3CCRV 3B25A 3P32A 3T2MA 1OCZB 2DYSC 2HJFC 1M57B 5H6QA 1JVMA 3OMAB 2P6JA 3SYCA 2HVKC 2BU2A 1ZWHA 2JJ1G 1VQNV 3H4LA 2XAHA 3TCUA 3RLRA 2IH3C 4H7QA 5FNCA 4FK5C 2Q6AA 3E86A 2XABA 2WI3A 1AH8A 2XHXA 4RQEA 2LFSA 5LGUA 1L1FA 1ZXNA 3CCQV 1RM1B 4P9OA 2JK5C 4EEHA 3T1KA 1DF5A 4YKWA 3SL2A 5M4PA 3FYIB 5DM6V 4CWPA 3OUSA 3U2DA 1KECA 1XL6A 1AMWA 1P7BA 4YKTA 1WPXA 2YE9A 1FXHA 2XHTA 3K97A 1AJPA 4XDJA 4CZZA 4KSGA 1KKDA 3AG4C 1PD3A 5FL7G 3GIEA 4HY6A 2X6BA 4PA9A 4X8AA 5B1BC 3SPHA 1AJNA 1VQMV 1QLNA 4L8ZA 3IC7A 3ZMUA 4ASUG 1F4MA 1TC0A 4QIWF 1ZXMA 1NR1A 2MK3A 1Q86W 5GW7A 2ZDYA 1UYLA 4KFMA 3RLPA 3DTUB 1AH6A 2QFOA 1RPOA 1AI7A 4XIQA 4MVUA 3NXSA 1M90W 3FT8A 2YE5A 1YJWV 3C11A 4L91A 3JD3A 4GT1A 3ZRVA 1XL4A 2EJRA 4DO2A 5FNFA 4YXWG 2LP7A 1VQ5V 1QVFU 1VQ8V 2IH1C 1Y4UA 3CGYA 3SYOA 2EILB 4FCQA 3B8NA 1G4YB 1SERA 4P2ZA 2WWWA 5LHGA 2BZ5A 1THZA 3VOUA 1KD1W 2HG5C 2IJKA 3FB6C 3F5WC 4GX0A 5EBWC 1AI4A 3TZ5A 4CWRA 4R7CA 2YEBA 2Y69B 4EKWA 2Z3YA 3W7TA 2OCCC 1GK9A 1THNA 1FXKB 4H37A 2EZPA 4MS2A 3G7BA 3AG2C 1W2BU 2YK2A 4CE1A 2IW5A 2WLLB 3D3IA 2BOCC 3ZRXA 3PEJA 1PKXA 3TTZA 4URLA 2BT0A 2EIJC 4HYOA 1EI1A 1BGQA 3TUHA 3T4ZA 1F51A 3ABTA 4CWTA 3IGAC 1M1KW 3ZKDA 1GKXA 4ASFA 2V7QG 2YEJA 3VHAA 1AJQA 2F43G 2H8MA 3W7UA 4CWQA 3PJSK 2A9HA 3KE6A 3OMIB 5CBHA 2XX2A 3E8HA 2W6IG 4YKUA 3H80A 2ZDXA 3CPWU 1YI2V 2WSSG 2DQ3A 2GFDA 1K3EA 2HG1A 1NHHA 2LFRA 1ZWIC 3MNRP 2YEFA 1BKNA 4MPEA 3A0RA 3VADA 2M7WA 1TBWA 2XDLA 2P90A 1YS3A 2X0LA 2IU0A 1Z5BA 3RLQA 1Y66A 4UROA 2AHYA 4N21A 4QE7A 1VQ7V 4JYBA 3FKSG 2BU7A 1GM7A 3QNEA 3WFVA 4JQLA 4ZBMA 2BTZA 2YE8A 3ASNC 2CCTA 2WLHA 1V54B 2BOBC 3T10A 4AWPA 5CPHA 3HPLC 2XX5A 4WFEA 2YEDA 4JGSA 1RPRA 3SPGA 4DUHA 3ETGA 2E0AA 1I5XA 2B1IA 4WFGA 4J9ZB 2BYHA 2DYRC 2AHZA 1MSWD 1S16A 4MP7A 4LWFA 2B5UA 4PRXA 5L3JA 2EIKB 1NBMG 3Q5KA 3ZMSA 5HFLA 4JTCB 2W0FC 5H9CA 1F4NA 4HZ3A 4CWNA 2P67A 4ASGA 2GQPA 3VBBA 1UYHA 4AWQA 3GIGA 3AG1B 4HXWA 2YKJA 5CF0A 3BEHA 3Q5LA 1QLEB 5D7RA 4JTAB 4CWSA 2ZR3A 5M4EA 2P7TC 2ZXWB 3HZ5A 4PA3A 2PNRA 2YGAA 4H81A 1UYDA 4EGIA 3OAAG 3K04A 3K99A 3ETEA 1YC3A 3B24A 1NHJA 1JM6A 3T0HA 2YKEA 5CN0A 2IOPA 4L94A 2WI2A 5B1OA 2QF6A 3JYCA 2HR3A 4PDLA 4X9LA 2HKJA 3TETA 4R8CA 3E83A 4XKOA 3D2RA 2QG0A 4MVQA 2OTJV 2HFEC 2WI7A 4L93A 3X2QB 1UYIA 2XCMA 1JX9A 4WUDA 5EC2C 5M4NA 3O0IA 5KA6A 3SPCA 4HYPA 1YSZA 1GKZA 4RAIA 2IJHA 2JKIA 2Q8HA 3ASOC 4XKKA 1I5YA 5B3SB 3B27A 3T2SA 3FB5C 5D7DA 2YEVB 4LP8A 3WG7B 3FT5A 4KP4A 3GWOA 3KG2A 3OE7G 4JTDB 1OCZC 2QA4V 1COWG 5CTYA 1AI6A 1MU5A 4UXNA 1U0ZA 2QM8A 1PNKA 1R3IC 3A0ZA 4KFGA 3TZ0A 1YC4A 4GT8A 1Y4MA 5GGZA 4X89A 4GQTA 3STLC 1W0JG 1K92A 4PRVA 1K4CC 3FV5A 1UYGA 1UJWB 1TIDA 3MD0A 3K60A 2CG9A 1ROPA 4R1FA 4KSHA 4R3AA 1YC1A 4R6ZA 4P7AA 4XE2A 3B8MA 1QCEA 4HAMA 4MTFA 2XJXA 4GCZA 2WLJA 3CRLA 4FCPA 4KQVA 1R73A 2DWEC 2ESAA 2XOKG 3EFFK 4WFFA 3H01A 2H55A 4QPJA 2YKBA 3G6EV 2YJXA 1MX0A 4H85A 5IY5B 2JIZG 2YGFA 2ZD9A 5EBMC 1PNMA 2YGEA 3CC2V 3ZCCA 4P30A 2B1GA 1V55C 3RVZA 3JD0A 3SPIA 2UWDA 4MOTA 3LSSA 3O6OA 2D3OW 3HB3B 1L0OA 5L3EA 4I9WA 4HZ0A 1NVPD 1OSFA 4ZKIA 2Q8GA 1OCOC 3AG3C 2XDUA 4UVAA 1VQOV 4XIRA 1UY6A 2DYSB 4XDKA 3ZIAG 3EHJA 3RBZA 2BU5A 3EHFA 1KIJA 1BYQA 3CCEV 1OCRC 2Q8FA 4MSWC 1UYKA 4O07A 3LSQA 1MABG 3E89A 1QY8A 1CP9A 5CA3A 2VCJA 3TZ4A 3TZ2A 1I5BA 4O09A 4XD8A 5M4MA 4EMVA 4LP0A 2EILC 4FCRA 1Q81W 2XX4A 3LNMB 4AWOA 3INXA 4LPBA 2YEGA 2IORA 2WLKA 3G71V 5BZBA 5J9PC 1Y8PA 4RUFA 1CPYA 4GX5A 4EFUA 3GIFA 1FXKC 1IXMA 1R3KC 3CXCU 2Q69A 1TUEB 4WUCA 2YI6A 3B26A 2XJGA 3G7EA 1YIJV 2WERA 1P4RA 2ITDC 4MPNA 3O2FA 5B1BB 4HZ5A 2BSMA 4PL9A 5CBFA 3BY6A 3ZMVA 4XDMA 3TK1A 4O04A 4G27B 5L3FA 2O1VA 3OWDA 1M56B 1GMGA 4O05A 1U2OA 2EINB 1JJ2U 2WAMA 1AI5A 2BU6A 5D6PA 2WI4A 1EA6A 3ABKC 2QKSA 4RUEA 4XC0A 1GKFA 3HYZA 3ABLB 3LNUA 2FTKA 2YI0A 3JZ3A 2JEXA 1YT1A 1S72V 3QDDA 3JCZA 3INWA 2CK3G 4XITA 1DTOA 2XDKA 2YE2A 1EFRG 4UUJC 4QJFB 4R50A 3SPJA 3R91A 1FFTB 2OCCB 4I3HA 5EC1C 4JAUA 4BQGA 2YEEA 1YTFD 2BREA 1V54C 4LWHA 4URNA 2W6JG 3HEKA 2OT5A 2WLIA 3CC4V 3C0EA 4L87A 1OCCC 2K1EA 3ABMC 2IJIA 1I5DA 1UYEA 3G75A 4MVRA 2FXSA 5D6QA 5F3KA 5J71A 1B6QA 4K4OA 5BOCA 1YJ9V 1R6KA 1YETA 1BXDA 3FB7C 5CMUA 3OR7C 5KUMA 4LWIA 2EIKC 3MHHC 3IEDA 2QTOA 1BL8A 1PNLA 3W7XA 4ASBA 4MVMA 2YJWA 4KTNA 2ITCC 3EKRA 1K97A 2PI5A 1H38A 2BYIA 3R4PA 2DW4A 1MOFA 1ID0A 3WQ9A 1QBZA 3LUTB 1VQ4V 3K08A 1QLEC 2EIMB 2HCHA 1NQTA 3ZM7A 4WUBA 2WI6A 3ZRWA 4JAVA 3SYAA 4BQJA 3OEHG 1YT0A 3CC7V 1S5HC 4FMTA 5CTXA 1BHAA 1UYMA 2EXLA 2X6AA 1BHBA 1BMFG 2GHYA 3CYOA 4PDRA 1SETA 1K5QA 4UVBA 3ZXQA 4MP2A 1HWYA 1SZTA 4V25A 1B62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXM A;  2ZDY A;  1UYL A;  3RLP A;  3Q5J A;  4B7P A;  3CRK A;  1AH6 A;  4W7T A;  2XJX A;  4GCZ A;  4MBC A;  2YE7 A;  2YI7 A;  4YKY A;  2QFO A;  4LWG A;  3R92 A;  3CRL A;  1UY7 A;  2VWC A;  4XIQ A;  2BRC A;  2ZKJ A;  3OPD A;  4CE2 A;  4ZVI A;  4FCP A;  3NXS A;  1US7 A;  1Y8O A;  4U7N A;  3FT8 A;  4KQV A;  2YE5 A;  2VCI A;  4Q20 A;  2ESA A;  2AKP A;  3C11 A;  4L91 A;  4GT1 A;  3ZRV A;  4QPK A;  2H55 A;  2IWX A;  4QPJ A;  2YKB A;  4MB9 A;  3A0T A;  4LC1 A;  5FNF A;  2YJX A;  1MX0 A;  2YKI A;  4H85 A;  2IOQ A;  2O1W A;  2YGF A;  2XJJ A;  4HYM A;  5F5R A;  2YGE A;  1QZR A;  2CCU A;  4U93 A;  1Y4U A;  3ZCC A;  3CGY A;  4FCQ A;  4MPC A;  2WWW A;  3NMQ A;  2BZ5 A;  3RKZ A;  2UWD A;  4URM A;  4MOT A;  5M4H A;  1TH8 A;  3O6O A;  1L0O A;  1YT2 A;  1ZW9 A;  1UY9 A;  4NH7 A;  5M4K A;  4HZ0 A;  1B63 A;  4CWR A;  3TZ5 A;  1OSF A;  2YEB A;  4ZKI A;  2Q8G A;  2IWS A;  2XDU A;  2WI1 A;  1I59 A;  3HHU A;  4XCJ A;  4XIR A;  1UY6 A;  1THN A;  4XTJ A;  3EHJ A;  3G7B A;  2BU5 A;  3EHF A;  2YEC A;  1KIJ A;  3GIG B;  3K98 A;  2YK2 A;  1BYQ A;  3A0Y A;  2YEA A;  3VHC A;  4EGH A;  2Q8F A;  4CE1 A;  5IDM A;  1UYK A;  3ZRX A;  3PEJ A;  4O07 A;  4BIU A;  3TTZ A;  2IWU A;  3PEH A;  4BAE A;  1H7U A;  4URL A;  3HZ1 A;  1QY8 A;  2BT0 A;  1EI1 A;  1H7S A;  1BGQ A;  2VCJ A;  4YKZ A;  3TUH A;  3TZ4 A;  2FYP A;  2YEI A;  1F51 A;  3TZ2 A;  4CWT A;  1I5B A;  1Y4S A;  4O09 A;  4XD8 A;  5M4M A;  3ZKD A;  4EMV A;  1KZN A;  1JOY A;  1GKX A;  3OW6 A;  4ASF A;  2YKC A;  4LP0 A;  2YEJ A;  4AS9 A;  3VHA A;  4FCR A;  4CE3 A;  2WEP A;  1UYF A;  2XX4 A;  4NH8 A;  4AWO A;  4HY1 A;  3INX A;  4LPB A;  3A0W A;  2YEG A;  2IOR A;  2H8M A;  4CWQ A;  1YSR A;  3KE6 A;  1I5C A;  5FWK A;  5D7C A;  4BIZ A;  1Y8P A;  2XX2 A;  3R4M A;  3T0Z A;  2K5B A;  2XDX A;  4XCL A;  2XDS A;  3U67 A;  2FWZ A;  4YKU A;  3H80 A;  4PU9 A;  2ZDX A;  4EFU A;  3BM9 A;  4U7O A;  3GIF A;  2GFD A;  2XK2 A;  2HG1 A;  2VW5 A;  3OMU A;  1NHH A;  4JYC A;  2LFR A;  1IXM A;  2YE3 A;  3A0X A;  3MNR P;  4FPP A;  4JAS A;  2YEF A;  2CH4 A;  3EHG A;  1BKN A;  4MPE A;  4WUC A;  4ASA A;  3A0R A;  2YI6 A;  2QM7 A;  3B26 A;  2XJG A;  3VAD A;  1I5A A;  1TBW A;  3HYY A;  2XDL A;  3G7E A;  2WER A;  1YS3 A;  4MPN A;  2XD6 A;  1Z5B A;  3ZRW B;  3RLQ A;  4URO A;  3O2F A;  3LPS A;  4I5S A;  2YE6 A;  4HZ5 A;  1Z5A A;  4P8O A;  2BSM A;  5BOD A;  4PL9 A;  2FWY A;  4JYB A;  4B6C A;  5J6A A;  3EHH A;  2BU7 A;  4XDM A;  3TK1 A;  2YEH A;  4LWE A;  4XIP A;  4O04 A;  4JQL A;  2O1V A;  4CWO A;  2BTZ A;  2YE8 A;  3OWD A;  2YE4 A;  4E02 A;  4O05 A;  2CCT A;  1U2O A;  3T10 A;  1NHI A;  4AWP A;  5CPH A;  3CGZ A;  1TC6 A;  2XX5 A;  2YED A;  5FND A;  2BU6 A;  2YI5 A;  5D6P A;  2WI4 A;  4E00 A;  4DUH A;  2YK9 A;  2E0A A;  4YKR A;  1EA6 A;  3QTF A;  5CTU A;  4HXZ A;  4R3M A;  4XC0 A;  2O1U A;  3CWV A;  4GGL A;  1AJ6 A;  1UYC A;  2XHR A;  3HYZ A;  2BYH A;  3LNU A;  2FTK A;  1Z5C A;  2BU8 A;  1S16 A;  4MP7 A;  4LWF A;  4BXI A;  2YI0 A;  3R4O A;  5IN9 A;  1Y8N A;  2ZBK B;  2CGF A;  3JZ3 A;  1YT1 A;  4PRX A;  2C2A A;  2CCS A;  3QDD A;  3D0B A;  5L3J A;  3B28 A;  3Q5K A;  4EM7 A;  3U2K A;  3INW A;  4XIT A;  1A4H A;  2WI5 A;  4CWN A;  4EGK A;  2P67 A;  4ASG A;  2GQP A;  5B1N A;  1UYH A;  2XDK A;  2YE2 A;  4CWF A;  4AWQ A;  3GIG A;  2JJC A;  4NH9 A;  1AM1 A;  1I58 A;  4HXW A;  4MTX A;  1YER A;  2YKJ A;  5CF0 A;  3R91 A;  4O0B A;  3Q5L A;  3ZXO A;  1YES A;  3B25 A;  4I3H A;  3P32 A;  4BQG A;  4JAU A;  5D7R A;  2YEE A;  4CWS A;  5M4E A;  2BRE A;  4LWH A;  3HZ5 A;  4EFT A;  4URN A;  2PNR A;  2YGA A;  4H81 A;  1UYD A;  4L90 A;  3HEK A;  4EGI A;  1UY8 A;  3K99 A;  2BU2 A;  4GEE A;  1YC3 A;  4XKA A;  3B24 A;  1NHJ A;  3C0E A;  1ZWH A;  1JM6 A;  3T0H A;  4E01 A;  2YKE A;  3H4L A;  2Q8I A;  1PVG A;  2IOP A;  3RLR A;  4L94 A;  1I5D A;  1TIL A;  1UYE A;  5C93 A;  3G75 A;  3EKO A;  2FXS A;  5B1O A;  2WI2 A;  4H7Q A;  5D6Q A;  5F3K A;  5J71 A;  2QF6 A;  5FNC A;  4K4O A;  5BOC A;  3OWB A;  5IDJ A;  3R4N A;  4X9L A;  2HKJ A;  3ZKB A;  1YET A;  1BXD A;  4GFN A;  4XKO A;  3D2R A;  2XAB A;  2WI3 A;  2QG0 A;  4LWI A;  1AH8 A;  2XHX A;  3BMY A;  1B3Q A;  3IED A;  2WI7 A;  4L93 A;  3VHD A;  1UYI A;  1QYE A;  2XCM A;  4WUD A;  2LFS A;  4YKQ A;  5M4N A;  3O0I A;  4ASB A;  4HYP A;  1YSZ A;  1GKZ A;  2YJW A;  1ZXN A;  4KTN A;  3EKR A;  5CTW A;  2JKI A;  4EEH A;  3T1K A;  2BYI A;  3R4P A;  4YKW A;  2Q8H A;  3SL2 A;  4XKK A;  5M4P A;  1ID0 A;  3WQ9 A;  3B27 A;  3T2S A;  4CWP A;  4MT8 A;  5D7D A;  1GJV A;  3FT5 A;  4KP4 A;  5CTY A;  3U2D A;  2HCH A;  3ZM7 A;  4WUB A;  2WI6 A;  4V26 A;  1MU5 A;  3ZRW A;  1U0Z A;  3DGE A;  1Z59 A;  2QM8 A;  1AMW A;  4JAV A;  3WHA A;  4YKT A;  3A0Z A;  2YE9 A;  4KFG A;  3TZ0 A;  4BQJ A;  2XHT A;  3K97 A;  1YT0 A;  2WEQ A;  4KSG A;  4FMT A;  1YC4 A;  4GT8 A;  5CTX A;  5GGZ A;  4YKX A;  1UYM A;  2EXL A;  4GQT A;  3GIE A;  4PRV A;  4HY6 A;  1R62 A;  3FV5 A;  1UYG A;  4L8Z A;  1TID A;  2QG2 A;  3MD0 A;  3ZXQ A;  3K60 A;  2Q2E B;  2CG9 A;  3D36 A;  4R1F A;  1S14 A;  4KSH A;  4MP2 A;  4R3A A;  1YC1 A;  1TC0 A;  4V25 A;  4P7A A;  4DZY A;  1B62 A;  4XE2 A; 
#chains in the Genus database with same CATH topology
 3IJ4 A;  3RGB A;  1LNQ A;  2JDI G;  2UXN A;  4YJ2 B;  4TV9 A;  1G6U A;  3HKE B;  1VQP V;  1ORQ C;  3ASN B;  4JI3 O;  3CRK A;  4W7T A;  3T4D A;  4FM0 A;  3B4S A;  2UXB O;  1JPX A;  2YE7 A;  2YI7 A;  4MBC A;  4LWG A;  2XAF A;  3R92 A;  3OD4 A;  5L3B A;  1Q6H A;  2R9R B;  3FYE B;  3T1C A;  2ZKJ A;  3OPD A;  2XND G;  1GM8 A;  1US7 A;  2JJ2 G;  1Y8O A;  2VCI A;  1V9P A;  4KHP B;  5C8Y B;  3K0D A;  4Q20 A;  4Q6G A;  2AKP A;  1SES A;  4OGQ B;  3E2E A;  4QPK A;  2IWX A;  5J2U A;  1FKA O;  4JI1 O;  1XMQ O;  4MB9 A;  2F23 A;  3A0T A;  3VQY A;  2HJD A;  5KUK A;  5KLV H;  5IYZ B;  2IOQ A;  2O1W A;  1B06 A;  4ZI7 A;  1SS3 A;  3ABU A;  2XJJ A;  4HYM A;  3CHX A;  4O4I B;  4I0X B;  1YZB A;  4FLV A;  1QZR A;  2CCU A;  2ATK C;  4U93 A;  1HNZ O;  2CAZ C;  2JEU A;  3APO A;  4DUY O;  1NVP B;  3SJQ C;  4X1Y A;  4MPC A;  3J81 N;  3HKC A;  2DMX A;  3NMQ A;  2HKO A;  2KSD A;  5B1A C;  1IXB A;  2E5L B;  5M4H A;  4NR1 A;  4BWA A;  1QVG U;  3ZHT A;  3OR6 C;  1D2D A;  1UY9 A;  5JEN A;  1L0L H;  1B63 A;  4J42 A;  1S3J A;  4JI3 B;  3STZ C;  1VF7 A;  5JCO C;  2UXB B;  3CJH B;  3QO8 A;  1XMO O;  4DR6 O;  3TJT A;  1IVS A;  3ZMZ A;  2R9I A;  5KAF Z;  4O2B B;  2WI1 A;  5ITZ A;  3K03 A;  3KKY A;  4LFB O;  1AR1 B;  1PV0 A;  3WU2 Z;  5LGN A;  1M57 C;  3CCV V;  2YEC A;  3GIG B;  4G2K A;  1SRY A;  3CRC A;  4JI1 B;  2H94 A;  1XMQ B;  2ZM6 O;  3JAM N;  2ZNI A;  3VHC A;  4EGH A;  1AR5 A;  4GX1 A;  4PA4 A;  5IDM A;  2RNB A;  1VQK V;  3N2K A;  3CCL V;  1YXB A;  1K7D A;  3IAY A;  1X59 A;  4EEQ A;  1TUB A;  2HEP A;  1HNZ B;  4BAE A;  4MW3 A;  2YXL A;  4DUY B;  1HR0 O;  4J9Y B;  3CME V;  2YEI A;  2UUA O;  3CCS V;  3JAW B;  2QWP B;  4NXM O;  1KZN A;  3K3W A;  1JOY A;  4PV1 B;  2NLJ C;  4U3J B;  5JJJ B;  2OIE A;  1R6N A;  1BT8 A;  2CH7 A;  4I50 A;  2WEP A;  1DF4 A;  3L74 H;  1UYF A;  3U10 A;  4NH8 A;  2Q67 A;  1S0V A;  4HY1 A;  1BGY H;  4DV6 O;  2N05 A;  3LNN A;  3Q4H B;  4UV8 A;  5FWK A;  1WP7 A;  1RM1 C;  4BIZ A;  5D7C A;  1BQZ A;  3R4M A;  4J10 A;  4LFB B;  3T0Z A;  1WB8 A;  3FAV B;  4XCL A;  4P9P A;  3U67 A;  5KMG B;  2E75 B;  1K4D C;  3H9V A;  4YY3 O;  1DLB A;  3OGC C;  3CP1 A;  4DRX A;  2ZM6 B;  3JD1 A;  1MG1 A;  1GN4 A;  3GVM A;  3DC6 A;  3OMU A;  1GO3 F;  2GBO A;  2Q4P A;  5IYB O;  2KB1 A;  2CH4 A;  1D5N A;  4ASA A;  2CDY A;  2JS3 A;  4CC5 A;  3K9A A;  1Y76 A;  1EZV H;  1HR0 B;  1YVW A;  1I5A A;  4DV2 O;  1QNM A;  4WBN A;  4JI8 B;  1PL0 A;  2Y4U A;  4NXM B;  3IFX A;  2HVJ C;  2VWJ A;  2XD6 A;  3P3P A;  1VQ9 V;  3E8B A;  1Q82 W;  3JAS B;  4UB8 Z;  3LPS A;  2YE6 A;  1Z5A A;  5BOD A;  1LUW A;  4LFC B;  4KUM A;  4HNA A;  4J7J A;  3PN1 A;  4PJ0 Z;  4RO2 A;  4MTO A;  5H6R A;  4LWE A;  3K9S A;  4XIP A;  1JCH A;  3JAR A;  2XAJ A;  3W7S A;  4H13 B;  4XDL A;  2HHI A;  3HKB B;  1NH2 D;  4JAA A;  4UCS A;  4YY3 B;  1VQ6 V;  5KHI A;  1BSM A;  1QR9 A;  1XUQ A;  4IL6 Z;  2OTL V;  2JS5 A;  2CTR A;  3K06 A;  3RYF A;  4YJ3 B;  1LR1 A;  2YI9 A;  3CGZ A;  4DYL A;  1TC6 A;  4A5U B;  2YI5 A;  4E2L A;  4F6R A;  1F23 A;  2YK9 A;  1S5J A;  5CTU A;  4TSF G;  4JI2 O;  4TUY A;  4R3M A;  2O1U A;  3M7M X;  3RYH B;  3CWV A;  4GGL A;  1AJ6 A;  2XHR A;  4U3F H;  3VQV A;  3RYC A;  1ARO P;  5EBL C;  3JAK B;  3LMM A;  4EB6 B;  1I0H A;  2BU8 A;  2ZR2 A;  2AXT Z;  2OIG A;  5GON B;  3R4O A;  5IN9 A;  5CA1 B;  1KU9 A;  4O4J A;  2IM9 A;  4CC6 A;  1YJN V;  4LF8 O;  2VS0 A;  2NNU A;  1N36 O;  3D0B A;  1V55 B;  3CYG A;  3K79 A;  3B28 A;  1M4U A;  4EM7 A;  1OHH G;  1IX9 A;  3RYI B;  4JI6 O;  2LGQ A;  1A4H A;  1GN3 A;  4EGK A;  3P30 A;  1FXK A;  3OMN B;  1YTF B;  1GM9 A;  5B1N A;  3K57 A;  2Z5U A;  1NJI W;  4CWF A;  2X7R B;  4YIP A;  2Y69 C;  4UB6 Z;  5L3C A;  2IU3 A;  2Q73 A;  1AM1 A;  2DWD C;  4BW5 A;  4X64 O;  4DV5 B;  1I58 A;  4X1K A;  4MTX A;  1AP5 A;  1OCO B;  4G28 B;  4O0B A;  3U11 A;  5BY1 A;  3AG3 B;  4B7E A;  4WFA V;  3ZXO A;  1YES A;  1M56 C;  4BR6 A;  2WLL A;  1O9G A;  2E74 B;  3T1H O;  1K73 W;  4EFT A;  3JD2 A;  2EIN C;  1U96 A;  2HHH B;  4L90 A;  1EN6 A;  1FXV A;  4TWK A;  1FAF A;  4LF4 O;  1H2M A;  1UY8 A;  1K9M W;  1KC8 W;  4GEE A;  1OCR B;  4XKA A;  4E01 A;  3L9D A;  3EHB B;  4PDV A;  3GWK C;  4AQY B;  5JQG B;  4DV3 B;  3AG4 B;  2Q8I A;  1PVG A;  5FNV A;  4H33 A;  2QWO B;  3ABL C;  4JF3 A;  1TIL A;  5C93 A;  3BFR A;  2EBO A;  3EKO A;  1N36 B;  4YIO A;  4DR2 O;  1K34 A;  5IDJ A;  1FYJ A;  3OWB A;  5L3D A;  4BAY A;  3R4N A;  4DR1 O;  4JI6 B;  3ZKB A;  4RQF A;  4X9Q A;  5DN6 G;  3BAB A;  4GFN A;  4OXS A;  2C1I A;  2M6Y A;  4DUZ O;  2HLD G;  3BMY A;  1B3Q A;  3OUF A;  3SYP A;  3VHD A;  1QYE A;  3CRR A;  1FJG O;  3LDE A;  4YKQ A;  4DV7 B;  4X64 B;  4K8Z A;  4GKK O;  1Q7Y W;  1Q6U A;  5CTW A;  2Q68 A;  2DJV A;  2GUZ B;  3CMA V;  1H8H G;  3C3T A;  3CCU V;  3T1H B;  4LBE C;  1GN6 A;  4FJC C;  3AEI A;  4IIJ A;  2XTA A;  4UCV A;  3OT7 A;  4MT8 A;  4ZHQ A;  4I4T B;  4K8X A;  1Y74 A;  2UXC O;  1RSO A;  3OEE G;  1GJV A;  4LF6 B;  2UXX A;  3I56 V;  5LOV A;  4QNH B;  4DR4 B;  2UUB O;  2Y0P A;  1TA8 A;  2D2C B;  1NKD A;  1S5L Z;  4V26 A;  5HFM A;  4JPR A;  3DGE A;  1Z59 A;  3WHA A;  3M99 B;  3SYQ A;  3ZBH A;  1JFF A;  2WEQ A;  2QWQ B;  3H1I H;  4X20 B;  4YKX A;  4DR1 B;  2UUC O;  2YID A;  4J80 A;  3ZJZ A;  2JGD A;  3QTC A;  3L75 H;  3E8G A;  3BRC A;  2QE7 G;  3OTF A;  4IHJ A;  4DUZ B;  1R62 A;  4GX2 A;  3E22 B;  2GV9 A;  1YCI A;  1NTK H;  2AZ2 A;  4D7T A;  2QG2 A;  5IJ0 A;  2Q2E B;  2Y48 A;  1FJG B;  3D36 A;  4QE9 A;  1S14 A;  1S77 D;  3RW0 A;  4CS2 A;  2DOS A;  2QKA A;  3JD4 A;  5J2T A;  5IYD O;  3BHP A;  1IBM O;  1US6 A;  4FZ1 A;  4DZY A;  4FVM A;  5H5N A;  3G67 A;  2DN9 A;  4B3R B;  4DR7 B;  3J7A U;  3B77 A;  1L8D A;  3I55 V;  1TVK A;  4NVP A;  2DQ0 A;  3Q5J A;  4B7P A;  2UXC B;  4YKY A;  4PEL A;  3F7V C;  1MZF A;  1W0K G;  3AG2 B;  2KG7 B;  2UUB B;  1UY7 A;  2VWC A;  2BRC A;  4CE2 A;  3E8F A;  4ZVI A;  3QO7 A;  1H2G A;  2P4V A;  4U7N A;  3CRA A;  4DV4 O;  1FS0 G;  2EIM C;  5B66 Z;  1R3L C;  3ABK B;  3FB8 C;  1NTM H;  1E1Q G;  1WLE A;  5CB4 A;  4MTG A;  4LC1 A;  2XAS A;  2YKI A;  2EIJ B;  5IWA O;  1MA1 A;  2F4V B;  3TGU H;  3TXS A;  5F5R A;  2GTS A;  3ZHU A;  4CH6 A;  1M9N A;  5LMN B;  4K3A A;  1NR7 A;  3D8C A;  3G4S V;  2R72 A;  3C90 A;  2CTP A;  3CCJ V;  1K33 A;  4RWU A;  5LMU O;  1IBM B;  3RKZ A;  1YHQ V;  3A2F A;  2XAG A;  1E1R G;  5BMV A;  3B40 A;  4O4H B;  4URM A;  3UKM A;  1TH8 A;  3ICX A;  1SQQ H;  1XNQ O;  1Z2G A;  1YT2 A;  1ZW9 A;  1URF A;  2EZO A;  1Z5V A;  5M4K A;  4NH7 A;  3C3S A;  2QWR B;  4FIP C;  4PA7 A;  3AG1 C;  4UVC A;  1QR8 A;  5KA5 A;  2WLN A;  2IWS A;  4ZOL A;  1I59 A;  4WFB V;  3HHU A;  4XCJ A;  4LNU B;  1KP2 A;  1M93 A;  3K0G A;  2MW2 B;  1H8E G;  2ZXW C;  4XTJ A;  4J7K A;  3AK1 A;  3OW2 U;  3K98 A;  3E35 A;  1HNW O;  4KHP O;  2F66 C;  3A0Y A;  2YEA A;  3QO5 A;  3LDC A;  4UV9 A;  3R65 A;  3ZRS A;  5IWA B;  2QEX V;  4PI2 A;  4JI7 B;  1HNX O;  3DXR A;  3GB7 C;  1K5S A;  5L3G A;  4DXW A;  3HKD A;  4BIU A;  3BA8 A;  1OCC B;  1GAX A;  4B3M B;  2IWU A;  3PEH A;  1H7U A;  1J95 A;  3HZ1 A;  4HBN A;  3ABM B;  4MVO A;  2Q5Z A;  2A79 B;  1H7S A;  3N27 A;  3ZN0 A;  2WLI B;  4YKZ A;  2FYP A;  1OZ0 A;  1EBO A;  5LHH A;  2YIC A;  1JQ0 A;  1KUQ A;  1Y4S A;  2JGU A;  3OW6 A;  2YKC A;  4AS9 A;  4CE3 A;  2FKX A;  1XNQ B;  3ZX6 A;  3LDD A;  3X2Q C;  3A0W A;  2E5L O;  4F6E A;  2PYL A;  1B04 A;  1VP7 A;  4MVZ A;  2YEV A;  4UCU A;  1YSR A;  2V1D A;  4IT5 A;  1I5C A;  1KQS U;  4DK0 A;  4B3S O;  1PPJ H;  2K5B A;  2XDX A;  2XDS A;  3OFN G;  4TOI A;  2FWZ A;  1EZJ A;  3AK2 A;  5B3S C;  3KCY A;  4PU9 A;  5JH7 A;  1XRE A;  1HNW B;  3BM9 A;  4U7O A;  3OM3 B;  3WG7 C;  5IYC O;  2XK2 A;  3ZMT A;  1GN2 A;  3W7W A;  3ETD A;  3OTO O;  2VW5 A;  3WB2 A;  2BTO A;  4JYC A;  1HNX B;  2YE3 A;  3A0X A;  4Z1M G;  2PY5 A;  4FPP A;  4JAS A;  5LGT A;  3EHG A;  3RVY A;  5LA6 B;  2X6C A;  5JWP A;  2RJZ A;  2DYR B;  1N8R W;  3L71 H;  1WNS A;  2QM7 A;  1MMM A;  1YSC A;  1F7Y A;  4PDM A;  3HYY A;  2YSU B;  4PA6 A;  4FM1 A;  3CD6 V;  1VQL V;  2PI4 A;  3BA9 A;  4DR3 O;  3F7Y C;  1EN5 A;  1O9H A;  3EVK A;  5JCO A;  1XOU A;  3UO3 A;  4J7Z A;  3ZRW B;  2IJJ A;  4TT3 G;  1E79 G;  3S3W A;  1NH2 B;  1SA0 A;  4I5S A;  4LF5 O;  4MW8 A;  5KX5 A;  4P8O A;  4I55 B;  2FWY A;  4B6C A;  5J6A A;  3EHH A;  1ZL8 B;  5TIS Z;  4CS4 A;  1WA8 A;  1N0J A;  1I7F A;  4B3S B;  2YEH A;  1S76 D;  4TQF A;  1CEZ A;  5KHK A;  5CBG A;  2A3Q A;  1KMI Z;  1NTZ H;  2A0L A;  4CWO A;  1DGS A;  2YE4 A;  3CCM V;  5H2F Z;  4E02 A;  1XNR O;  3HR0 A;  1K8A W;  3CRQ A;  1D5A A;  1IBL O;  4N23 A;  3MAQ A;  1ENV A;  1NHI A;  3O65 A;  2H8P C;  2WLM A;  2ZDI A;  3OTO B;  3SJB C;  4XBF A;  3ML0 A;  4GZR B;  2ZCE A;  3B2E E;  5LHI A;  5FND A;  3UM7 A;  4J11 A;  4E00 A;  1KP3 A;  4YKR A;  4WCE V;  3QTF A;  2ZT9 B;  3MHS C;  5FLX N;  1G8M A;  4HXZ A;  4WFH A;  4FLW A;  2L6L A;  2GSM B;  2C1G A;  4FLZ A;  2ZDI C;  5EK0 A;  1UYC A;  4OX9 B;  5IY5 C;  3K5M A;  3UQ8 A;  4DR3 B;  1Z5C A;  4WF9 V;  4X88 A;  4BXI A;  5LBQ A;  2P06 A;  2XAQ A;  4JI8 O;  1Y8N A;  4CBC A;  2ZBK B;  2CGF A;  3ZED A;  2WPD G;  5J2U B;  3U0Z A;  4LF5 B;  2C2A A;  5E1A C;  1YIT V;  2CCS A;  5KHH A;  4LCU C;  1N4C A;  1IBK O;  4ZI7 B;  3WB0 A;  3U2K A;  3ZN1 A;  4LFC O;  1GTO A;  5LXT A;  5B1A B;  4MVS A;  1SQB H;  2WI5 A;  4IYH A;  2PUS A;  4F4L A;  3QVN A;  1XHZ A;  3CS5 A;  1SQX H;  2ZQM A;  4X1Y B;  1XNR B;  4LF9 O;  1IBL B;  2JJC A;  4NH9 A;  3HKC B;  4FM2 A;  3ASO B;  1R3J C;  1YER A;  3CCR V;  3ZS8 C;  3B25 A;  3P32 A;  1QU7 A;  3T2M A;  1OCZ B;  2DYS C;  2HJF C;  1M57 B;  4H0L B;  1KKC A;  3UCS C;  1SC5 B;  5H6Q A;  1JVM A;  3OMA B;  3DSQ A;  3QF7 A;  2P6J A;  1FFX A;  3SYC A;  2HVK C;  4X62 O;  2BU2 A;  5ITZ B;  1WP8 A;  1ZWH A;  2JJ1 G;  1VQN V;  1YF2 A;  3H4L A;  1SQP H;  2XAH A;  5A9G A;  4EFE A;  2KQX A;  3TCU A;  1MSD A;  5KAI Z;  3RLR A;  4TQD A;  2Q7H A;  2ZE6 A;  4FFB B;  1CXZ B;  2IH3 C;  4H7Q A;  5EIB C;  4LH6 A;  1IBK B;  5FNC A;  3H1K H;  4FK5 C;  4LWS B;  3N2K B;  3JCU Z;  2H3O A;  2ILM A;  4JYA O;  2Q6A A;  2EUL A;  3E86 A;  2XAB A;  1TUB B;  2VQF O;  2WI3 A;  1AH8 A;  2XHX A;  4IYI A;  4RQE A;  3JAT A;  4LF9 B;  2F1M A;  2LFS A;  3UT5 B;  2AZ0 A;  5LGU A;  1L1F A;  1ZXN A;  2Q7G A;  3CCQ V;  1RM1 B;  4P9O A;  1OV9 A;  4DV5 O;  2CH7 B;  2P22 C;  4I50 B;  2JK5 C;  1KYO F;  4EEH A;  1KBH A;  3T1K A;  1DF5 A;  4YKW A;  2Y4T A;  3SL2 A;  1MZE A;  5M4P A;  3H1L H;  3FYI B;  4W4K A;  3O9O A;  5DM6 V;  4CWP A;  2QWN B;  3OUS A;  2HHH O;  4X62 B;  3U2D A;  1KEC A;  1XL6 A;  1NU1 H;  1AP6 A;  1AMW A;  1WAZ A;  1P7B A;  4YKT A;  1WPX A;  2YE9 A;  1FXH A;  1SQV H;  2P4K A;  4DV3 O;  4AQY O;  4DRX B;  1JR9 A;  3IC9 A;  2XHT A;  3K97 A;  1AJP A;  4ZIB A;  4XDJ A;  4CZZ A;  4KSG A;  1KKD A;  3AG4 C;  1XEQ A;  1PD3 A;  5FL7 G;  4TV8 A;  1R1B A;  5LYJ A;  3B09 A;  4JYA B;  3A0B Z;  1DK1 A;  3GIE A;  4NTW A;  2VQF B;  4HY6 A;  2X6B A;  4PA9 A;  4X8A A;  1T5E A;  3JAL A;  3CB2 A;  5B1B C;  3SPH A;  1AJN A;  1MNG A;  1VQM V;  1QLN A;  4L8Z A;  1Y76 B;  3IC7 A;  3APQ A;  3ZMU A;  4ASU G;  1WN7 A;  2GDS A;  4WBN B;  1F4M A;  2GUZ A;  1TC0 A;  2WA4 A;  4QIW F;  4DV7 O;  3JSL A;  1AIL A;  1ZXM A;  1NR1 A;  1EN4 A;  1PL4 A;  2MK3 A;  5KHJ A;  1Q86 W;  5GW7 A;  2ZDY A;  1YEW A;  5GTH Z;  4KFM A;  1UYL A;  3RLP A;  1EM1 A;  4UFZ A;  3DTU B;  1AH6 A;  2QFO A;  2LJ2 A;  4HNA B;  1RPO A;  5IJ9 A;  2DE0 X;  2YIB A;  4ICG A;  1AI7 A;  4X1I A;  4XIQ A;  4MVU A;  3NXS A;  4LF6 O;  3JAR B;  1M90 W;  3FT8 A;  4DR4 O;  2YE5 A;  4NTX A;  5A2Q N;  5LP6 A;  1YJW V;  4FLT A;  3C11 A;  3K58 A;  3JD3 A;  4GT1 A;  4L91 A;  3ZRV A;  1XL4 A;  2EJR A;  4DO2 A;  1Q43 A;  4CH5 A;  1XI1 A;  5FNF A;  3RYF B;  2BE3 A;  4YXW G;  2LP7 A;  4F6R B;  1VQ5 V;  2PTM A;  1QVF U;  1VQ8 V;  5GTI Z;  5LP6 C;  2IH1 C;  2CTQ A;  4TUY B;  1Y4U A;  3CGY A;  3SYO A;  2EIL B;  4FCQ A;  4O2A A;  1QHT A;  3B8N A;  1SZX A;  3RYC B;  2VQE B;  1G4Y B;  1SER A;  4P2Z A;  2QR4 A;  2WWW A;  5LHG A;  2BZ5 A;  3TXQ A;  2BTQ A;  5DED A;  2N74 A;  1THZ A;  3VOU A;  4O4J B;  3QG5 A;  1KD1 W;  2HG5 C;  2IJK A;  3FB6 C;  2BSK A;  4B3R O;  4DR7 O;  3ZHV A;  3F5W C;  4GX0 A;  5EBW C;  1AI4 A;  4I7Z B;  3TZ5 A;  4CWR A;  4C7U A;  4R7C A;  1N0N A;  2Y0I A;  2YEB A;  2Y69 B;  4EKW A;  1UPG A;  2VWK A;  2Z3Y A;  3W7T A;  2OCC C;  1GK9 A;  1THN A;  2RMK B;  1FXK B;  4H37 A;  2YDE A;  2JRI A;  2EZP A;  4MS2 A;  3G7B A;  5K1X A;  3AG2 C;  1W2B U;  3K59 A;  4X65 B;  3DC5 A;  2YK2 A;  4X1K B;  2B9Z A;  2ZIN A;  4CE1 A;  1SKV A;  2IW5 A;  2WLL B;  3D3I A;  3P3N A;  2BOC C;  3ZRX A;  3PEJ A;  3CEI A;  1PKX A;  3TTZ A;  4URL A;  2F4V O;  2BT0 A;  2EIJ C;  4HYO A;  1EI1 A;  5EZY B;  1BGQ A;  3TUH A;  3T4Z A;  1N34 O;  1F51 A;  5LMN O;  1WJZ A;  1UFI A;  5KHG A;  3ABT A;  4CWT A;  4JI5 B;  3IGA C;  5CA0 A;  1M1K W;  3ZKD A;  5BR8 O;  1GKX A;  4ASF A;  2V7Q G;  5JVD A;  2YEJ A;  3N2G A;  3VHA A;  5FNV B;  2RN9 A;  1AJQ A;  2CGO A;  2F43 G;  2H8M A;  5EIB D;  3W7U A;  4KXR A;  4CWQ A;  3PJS K;  2A9H A;  3KE6 A;  3OMI B;  4NTY A;  2LO1 A;  3MDS A;  5CBH A;  2XX2 A;  4NKG B;  3E8H A;  3A0H Z;  2W6I G;  4YKU A;  3H80 A;  1JJO A;  2ZDX A;  3CPW U;  1YI2 V;  2WSS G;  2DQ3 A;  2GFD A;  1K3E A;  2HG1 A;  2CTW A;  1NHH A;  2LFR A;  1ZWI C;  3MNR P;  2N04 A;  1N32 O;  4BW9 A;  2YEF A;  2ADP A;  4JI7 O;  1BKN A;  4MPE A;  3AK3 A;  3BVO A;  4IIJ B;  3A0R A;  2UXD O;  4ABM A;  4ZHQ B;  1Y74 B;  1RSO B;  4UCO A;  3VAD A;  2M7W A;  1TBW A;  1U97 A;  2QGN A;  2QTS A;  1N34 B;  4B3M O;  2XDL A;  5LOV B;  2P90 A;  1WPB A;  4KL1 A;  3BPZ A;  2Q7E A;  5BR8 B;  1YS3 A;  2X0L A;  2IU0 A;  1Q3E A;  2P5O A;  1Z5B A;  1XBL A;  3RLQ A;  1Y66 A;  4URO A;  2AHY A;  4YJ2 A;  4N21 A;  3HKE A;  4QE7 A;  4JI4 B;  1GH6 A;  2W0X A;  1JFF B;  5JJN B;  1VQ7 V;  4JYB A;  3FKS G;  2BU7 A;  5DEC A;  4E4E A;  4AHC A;  2GTA A;  1GM7 A;  2JGD B;  1KB9 F;  3QNE A;  3WFV A;  4IHJ B;  4JQL A;  4ZBM A;  2BTZ A;  5C8Y A;  2YE8 A;  3ASN C;  2Q8V A;  4Z2W A;  4JYY A;  5IJ0 B;  2LQT A;  2CCT A;  2WLH A;  3D3Q A;  1H2S B;  1V54 B;  2BOB C;  3T10 A;  4LFA O;  5J2T B;  4AWP A;  3VQW A;  5CPH A;  2FML A;  1I94 B;  3HPL C;  5IYZ A;  2XX5 A;  4WFE A;  2YED A;  4JGS A;  1N32 B;  1RPR A;  1Y67 A;  3SPG A;  4DUH A;  1TVK B;  2AW9 A;  3NR7 A;  4NB5 A;  3ETG A;  2E0A A;  4O4I A;  2F93 B;  1I5X A;  1NZ6 A;  4I0X A;  2FL4 A;  2UXD B;  4D6T H;  2B1I A;  4LF7 O;  4WFG A;  4J9Z B;  4L8J A;  2K9P A;  2BYH A;  4OPA A;  2XUM A;  2DYR C;  2AHZ A;  1MSW D;  1S16 A;  4MP7 A;  4LWF A;  2B5U A;  1A32 A;  4DR5 B;  4JI0 O;  1VIB A;  5JJE B;  4PRX A;  1HDJ A;  3T1Y O;  1IZ3 A;  1BCC H;  5CB4 B;  1BQ0 A;  5L3J A;  3CJH A;  2EIK B;  1NBM G;  2YIB D;  1Q6I A;  1TGO A;  4FFK A;  3Q5K A;  2E3C A;  3ZMS A;  5HFL A;  4JTC B;  4O2B A;  1RP3 B;  4GUN A;  2W0F C;  2AGA A;  3OGI B;  1F4N A;  5H9C A;  4HZ3 A;  4DW0 A;  4CWN A;  2P67 A;  2YS8 A;  1P84 F;  4ASG A;  2GQP A;  1HW7 A;  1LUV A;  3VBB A;  4GKJ O;  1UYH A;  4AWQ A;  3GIG A;  3AG1 B;  4LFA B;  4HXW A;  2YKJ A;  5CF0 A;  3BEH A;  5BMV B;  3Q5L A;  1QLE B;  5D7R A;  4JTA B;  2CE4 A;  4CWS A;  2ZR3 A;  5M4E A;  2ZIM A;  2P7T C;  4B7K A;  2ZXW B;  3HZ5 A;  4PA3 A;  1NT2 B;  2PNR A;  2YGA A;  4H81 A;  1UYD A;  4LF7 B;  4EGI A;  3OAA G;  3K04 A;  3K99 A;  4ZOL B;  3ETE A;  1YC3 A;  3JAW A;  3B24 A;  1NHJ A;  1X4T A;  4O4L B;  1JM6 A;  3T0H A;  4OX9 O;  2YKE A;  2ZE5 A;  5CN0 A;  4YHH O;  4U3J A;  4JI0 B;  2IOP A;  1FD9 A;  3T1Y B;  3RT3 C;  1WB7 A;  4L94 A;  1XIL A;  2WI2 A;  5B1O A;  3SGI A;  3ZHS A;  2QF6 A;  3JYC A;  2HR3 A;  3Q4H A;  1G1X B;  4PDL A;  3DXR B;  4X9L A;  2HKJ A;  3TET A;  3EXA A;  4R8C A;  3FAV A;  3HKD B;  5EYP B;  3E83 A;  4XKO A;  3D2R A;  2QG0 A;  4MVQ A;  2ZIO A;  1HP8 A;  5KMG A;  2OTJ V;  2HFE C;  2WI7 A;  4GKJ B;  4L93 A;  2PZS A;  3X2Q B;  1UYI A;  2XCM A;  1JX9 A;  2JVD A;  4WUD A;  4JZ2 A;  5EC2 C;  5M4N A;  4I9Q A;  3O0I A;  5KA6 A;  3SPC A;  4HYP A;  1YSZ A;  1GKZ A;  1H2K A;  1M5I A;  4RAI A;  2IJH A;  2JKI A;  2YXY A;  4K0K O;  2Q8H A;  3H1H H;  3G80 A;  1I08 A;  3ASO C;  5IE9 A;  2LW7 A;  4XKK A;  2UU9 O;  1I5Y A;  5B3S B;  3B27 A;  3T2S A;  3FB5 C;  4TV9 B;  1TAE A;  5D7D A;  2YEV B;  2Z0A A;  3THO A;  4LP8 A;  3WG7 B;  3FT5 A;  4KP4 A;  3GWO A;  3KG2 A;  3OE7 G;  4JTD B;  1OCZ C;  3S3X A;  2QA4 V;  1COW G;  5CTY A;  1XQ8 A;  5FPO A;  1AI6 A;  4CH3 A;  4YHH B;  1MU5 A;  4UXN A;  1U0Z A;  2QM8 A;  1PNK A;  4FFB A;  4B3T O;  1R3I C;  3A0Z A;  5JH7 B;  3JAS A;  5IT9 N;  4KFG A;  3TZ0 A;  1L0N H;  4LWS A;  3L73 H;  2PGG A;  1YC4 A;  1JA8 A;  4GT8 A;  1Y4M A;  4DW1 A;  5GGZ A;  4X89 A;  4GQT A;  3STL C;  1W0J G;  1K92 A;  2G38 A;  4PRV A;  1K4C C;  2XHB A;  3FV5 A;  1UYG A;  2ZE7 A;  1UJW B;  3HKB A;  3UT5 A;  1TID A;  2ZE8 A;  3MD0 A;  3K60 A;  1XHX A;  1YDX A;  2CG9 A;  1ROP A;  3R66 A;  4NYK A;  4R1F A;  4KSH A;  4R3A A;  1YC1 A;  2KKW A;  4R6Z A;  4YJ3 A;  4D7S A;  4DV0 O;  4P7A A;  4XE2 A;  3B8M A;  4J41 A;  4K0K B;  1AVM A;  1QCE A;  4HAM A;  1XMO B;  2UU9 B;  1SA0 B;  5KX5 B;  4DR6 B;  4MTF A;  2XJX A;  4GCZ A;  4B08 A;  2WLJ A;  1GRJ A;  3RYH A;  1WA8 B;  2XT9 A;  3A8T A;  3L70 H;  1ZLZ A;  3JAK A;  1AR4 A;  3CRL A;  1J5E O;  4EB6 A;  2ODM A;  4FCP A;  4KQV A;  5GON A;  1R73 A;  1JMK C;  2RDC A;  2DWE C;  5CA1 A;  2ESA A;  2XOK G;  4B3T B;  3EFF K;  1ZTE A;  4WFF A;  3H01 A;  1Y6X A;  2H55 A;  4QPJ A;  1N33 O;  2YKB A;  3G6E V;  2YJX A;  1MX0 A;  4H85 A;  5IY5 B;  4FLU A;  2JIZ G;  2YGF A;  4X66 O;  2ZD9 A;  3RYI A;  2L35 A;  4FLY A;  1ZUQ A;  1XDC A;  5EBM C;  1PNM A;  2NN4 A;  2YGE A;  3CE2 A;  5FPR A;  2UUA B;  3CC2 V;  3ZCC A;  4P30 A;  4GLX A;  2B1G A;  4PHZ A;  1V55 C;  3RVZ A;  2ETN A;  3SDL A;  4DV0 B;  3JD0 A;  3SPI A;  3L72 H;  3S5T A;  5AG2 A;  2UWD A;  4MOT A;  4DV6 B;  3LSS A;  3O6O A;  2LW1 A;  4PI0 A;  2D3O W;  3HB3 B;  5K1P A;  5L3E A;  1L0O A;  4I9W A;  4E72 A;  4HZ0 A;  3ETQ A;  1NVP D;  1OSF A;  4EFB A;  3G6B A;  4ZKI A;  2ADQ B;  2Q8G A;  1OCO C;  2YUA A;  2VRZ A;  3AG3 C;  2XDU A;  5LXT B;  4UVA A;  1VQO V;  4XIR A;  1J5E B;  1UY6 A;  2Q9L A;  5JQG A;  4AIL C;  2DYS B;  4XDK A;  4IGG A;  3ZIA G;  3EHJ A;  3RBZ A;  2BU5 A;  3EHF A;  2EX3 A;  3H1J H;  1KIJ A;  1N33 B;  3FD9 A;  1BYQ A;  2R9A A;  2RQ6 A;  1VF5 B;  3CCE V;  1OCR C;  2Q8F A;  2E76 B;  3KZI Z;  4X66 B;  4MSW C;  3WB1 A;  1P7G A;  3M8A A;  1UYK A;  4LH7 A;  1Q8I A;  4O07 A;  3LSQ A;  1MAB G;  4DV2 B;  3ZHR A;  3E89 A;  4GYC B;  1QY8 A;  2QKC A;  1CP9 A;  5CA3 A;  2PYJ A;  2VCJ A;  3TZ4 A;  3F5T A;  4AI8 A;  1FFX B;  3TZ2 A;  1VMG A;  1I5B A;  4O09 A;  1PM9 A;  4XD8 A;  3LSU A;  4EMV A;  2VQE O;  5M4M A;  4LP0 A;  2EIL C;  4FCR A;  4Z1V A;  4NXN O;  4QGP A;  1VF6 A;  4DK1 A;  1Q81 W;  2XX4 A;  3LNM B;  4AWO A;  2A06 H;  3INX A;  4LPB A;  1H2N A;  1NI8 A;  2YEG A;  2IOR A;  2WLK A;  3G71 V;  2EJ7 A;  4I4T A;  5BZB A;  2FB5 A;  3RFR A;  5J9P C;  3BAA A;  1Y8P A;  3VQX A;  4BIO A;  1VF6 C;  4FZ0 A;  4RUF A;  1CPY A;  4GX5 A;  3BCC H;  3JAT B;  4EFU A;  2HP8 A;  3GIF A;  1FXK C;  4X65 O;  4X20 A;  3K5N A;  2CGN A;  2YI8 A;  1IXM A;  1R3K C;  3CXC U;  4JI2 B;  2Q69 A;  1TUE B;  4WUC A;  5EZY A;  3E22 A;  2YI6 A;  1FPO A;  3B26 A;  2XJG A;  4UCT A;  2PF4 E;  3G7E A;  1YIJ V;  2WER A;  1P4R A;  1Q90 D;  2ITD C;  1NS1 A;  4MPN A;  4LF8 B;  5D5P A;  3K5L A;  4JI5 O;  4NXN B;  1AB3 A;  1IUR A;  3O2F A;  5B1B B;  4H44 B;  4HZ5 A;  1Q5O A;  2BSM A;  4PL9 A;  3SJC C;  5CBF A;  4TV8 B;  3BY6 A;  3ZMV A;  2OWO A;  5LYJ B;  3FFQ A;  4XDM A;  3TK1 A;  3UO2 A;  2KG7 A;  4JV5 O;  1SF9 A;  4O04 A;  4FLX A;  4G27 B;  5L3F A;  2O1V A;  3JAL B;  1PP9 H;  1ZAU A;  3OWD A;  1M56 B;  1GMG A;  3KCX A;  3K5O A;  3SJA C;  4O05 A;  2OYQ A;  1U2O A;  2EIN B;  1JJ2 U;  1OJH A;  5F2V O;  3J80 N;  2WAM A;  1AI5 A;  1SQG A;  2BU6 A;  5D6P A;  2WI4 A;  4W4L A;  1EA6 A;  4LF4 B;  3ABK C;  2QKS A;  4RUE A;  4XC0 A;  1ZX3 A;  1GKF A;  3HYZ A;  5IJ9 B;  2OCH A;  3ABL B;  2CUG A;  2YC0 A;  4X1I B;  2FTK A;  3LNU A;  1P49 A;  3FX7 A;  1W59 A;  2YI0 A;  4O4H A;  5LP6 B;  3JZ3 A;  2JEX A;  1YT1 A;  4DR2 B;  1S72 V;  4CS3 A;  3QDD A;  2BCC H;  2RCV A;  4JI4 O;  3JCZ A;  5BXZ A;  4JV5 B;  2QSA A;  3CSX A;  3INW A;  4LNU A;  2CK3 G;  4XIT A;  1BE3 H;  1DTO A;  4PD4 F;  4GKK B;  1Z5W A;  4O2A B;  2XDK A;  2YE2 A;  1EFR G;  1IDS A;  4K35 A;  4UUJ C;  1BZK A;  4QJF B;  4R50 A;  3SPJ A;  3R91 A;  2BTQ B;  1FFT B;  2OCC B;  4I3H A;  5EC1 C;  4JAU A;  4DV1 O;  3I5D A;  2YEE A;  4BQG A;  3D36 C;  3RWR D;  1I94 O;  1YTF D;  4CH4 A;  2BRE A;  1V54 C;  2BSK B;  4LWH A;  3RN4 A;  4URN A;  2W6J G;  1QQC A;  2QJ1 A;  3HEK A;  1ZSP A;  4JZG A;  2A7W A;  1SQF A;  2OT5 A;  2WLI A;  3CC4 V;  3CXH F;  3AG7 A;  3C0E A;  5D5Q A;  4L87 A;  3CWB H;  1OCC C;  2K1E A;  2FYU H;  3ABM C;  1H2L A;  2IJI A;  4DR5 O;  1I5D A;  1UYE A;  2R70 A;  3G75 A;  2Q0O C;  4MVR A;  2UUC B;  2FXS A;  5D6Q A;  5F3K A;  5J71 A;  1B6Q A;  4K4O A;  5BOC A;  1YJ9 V;  2YXH A;  1R6K A;  1YET A;  1BXD A;  2V4D A;  3FB7 C;  5CMU A;  2O57 A;  3OR7 C;  2QDO A;  1RFY A;  5KUM A;  4LWI A;  2EIK C;  3MHH C;  3IED A;  2QTO A;  3JSN A;  2WA3 A;  5LL6 Y;  1BL8 A;  1PNL A;  3W7X A;  4ASB A;  4MVM A;  5CA0 B;  2YJW A;  4KTN A;  2ARH A;  2ITC C;  3EKR A;  5JVD B;  4DV1 B;  3N2G B;  1K97 A;  2PI5 A;  4UCR A;  1VAR A;  1H38 A;  2BYI A;  2DW4 A;  3R4P A;  1MOF A;  5LA6 A;  1ID0 A;  3WQ9 A;  1QBZ A;  3LUT B;  1VQ4 V;  3K08 A;  2IBZ H;  1QLE C;  4O4L A;  2EIM B;  4DV4 B;  2HCH A;  3CRM A;  1NQT A;  2Q0A A;  3SR2 C;  4WUB A;  3ZM7 A;  2WI6 A;  4LR3 A;  3ZRW A;  4JAV A;  4OPH A;  3SYA A;  4BQJ A;  3OEH G;  2ZKO A;  1YT0 A;  3CC7 V;  1S5H C;  4FMT A;  4I55 A;  3CX5 F;  1ZL8 A;  5CTX A;  5EYP A;  1BHA A;  1UYM A;  2EXL A;  1BS3 A;  2X6A A;  5E79 Z;  1R6T A;  1BHB A;  2F95 B;  2ZNJ A;  1BMF G;  2GHY A;  3ZHQ A;  3CYO A;  5LMU B;  4PDR A;  1SET A;  1K5Q A;  4UVB A;  3ZXQ A;  2QM4 A;  1VEW A;  2NR5 A;  5B5E Z;  2LGW A;  4MP2 A;  1HWY A;  1SZT A;  4V25 A;  1B62 A;  2YIA A; 
#chains in the Genus database with same CATH homology
 1LNQ A;  2JDI G;  2UXN A;  1VQP V;  1ORQ C;  3ASN B;  3CRK A;  4W7T A;  3T4D A;  1JPX A;  2YE7 A;  2YI7 A;  4MBC A;  4LWG A;  2XAF A;  3R92 A;  5L3B A;  2R9R B;  3FYE B;  3T1C A;  2ZKJ A;  3OPD A;  2XND G;  1GM8 A;  1US7 A;  2JJ2 G;  1Y8O A;  2VCI A;  3K0D A;  4Q20 A;  2AKP A;  1SES A;  3E2E A;  4QPK A;  2IWX A;  4MB9 A;  3A0T A;  5KUK A;  2IOQ A;  2O1W A;  3ABU A;  2XJJ A;  4HYM A;  1QZR A;  2CCU A;  2ATK C;  4U93 A;  2JEU A;  1NVP B;  3SJQ C;  4MPC A;  3NMQ A;  2HKO A;  5B1A C;  5M4H A;  1QVG U;  3OR6 C;  1UY9 A;  1B63 A;  1S3J A;  3STZ C;  3QO8 A;  3ZMZ A;  2R9I A;  2WI1 A;  3K03 A;  1AR1 B;  5LGN A;  1M57 C;  3CCV V;  2YEC A;  3GIG B;  4G2K A;  1SRY A;  2H94 A;  3VHC A;  4EGH A;  4GX1 A;  4PA4 A;  5IDM A;  1VQK V;  3CCL V;  1K7D A;  4BAE A;  4MW3 A;  4J9Y B;  3CME V;  2YEI A;  3CCS V;  1KZN A;  3K3W A;  1JOY A;  2NLJ C;  1R6N A;  2WEP A;  1DF4 A;  1UYF A;  4NH8 A;  2Q67 A;  1S0V A;  4HY1 A;  4UV8 A;  5FWK A;  5D7C A;  1RM1 C;  4BIZ A;  3R4M A;  3T0Z A;  4XCL A;  4P9P A;  3U67 A;  1K4D C;  1DLB A;  3OGC C;  3CP1 A;  3JD1 A;  1MG1 A;  3OMU A;  1GO3 F;  5IYB O;  2KB1 A;  2CH4 A;  4ASA A;  3K9A A;  1I5A A;  1PL0 A;  3IFX A;  2HVJ C;  2XD6 A;  1VQ9 V;  3E8B A;  1Q82 W;  3LPS A;  2YE6 A;  1Z5A A;  5BOD A;  4KUM A;  5H6R A;  4RO2 A;  4MTO A;  4LWE A;  4XIP A;  1JCH A;  2XAJ A;  3W7S A;  4XDL A;  1NH2 D;  1VQ6 V;  1QR9 A;  2OTL V;  3K06 A;  3CGZ A;  1TC6 A;  2YI5 A;  4E2L A;  1F23 A;  2YK9 A;  5CTU A;  4TSF G;  4R3M A;  2O1U A;  3CWV A;  4GGL A;  1AJ6 A;  2XHR A;  1ARO P;  5EBL C;  2BU8 A;  2ZR2 A;  3R4O A;  5IN9 A;  1YJN V;  2NNU A;  3D0B A;  1V55 B;  3K79 A;  3B28 A;  4EM7 A;  1OHH G;  1A4H A;  4EGK A;  3P30 A;  1FXK A;  3OMN B;  1YTF B;  1GM9 A;  5B1N A;  2Z5U A;  1NJI W;  4CWF A;  2X7R B;  2Y69 C;  5L3C A;  2IU3 A;  1AM1 A;  2DWD C;  4BW5 A;  1I58 A;  4MTX A;  1OCO B;  4G28 B;  4O0B A;  3AG3 B;  4WFA V;  3ZXO A;  1YES A;  1M56 C;  2WLL A;  1K73 W;  4EFT A;  3JD2 A;  2EIN C;  4L90 A;  1FXV A;  4TWK A;  1UY8 A;  1K9M W;  1KC8 W;  4GEE A;  1OCR B;  4XKA A;  4E01 A;  3EHB B;  4PDV A;  3AG4 B;  2Q8I A;  1PVG A;  4H33 A;  3ABL C;  4JF3 A;  1TIL A;  5C93 A;  2EBO A;  3EKO A;  1K34 A;  5IDJ A;  3OWB A;  5L3D A;  4BAY A;  3R4N A;  3ZKB A;  4RQF A;  5DN6 G;  4GFN A;  4OXS A;  2HLD G;  3BMY A;  1B3Q A;  3OUF A;  3SYP A;  3VHD A;  1QYE A;  3LDE A;  4YKQ A;  1Q7Y W;  5CTW A;  2Q68 A;  3CMA V;  1H8H G;  3CCU V;  4LBE C;  4FJC C;  3AEI A;  4MT8 A;  3OEE G;  1GJV A;  2UXX A;  3I56 V;  4QNH B;  1NKD A;  4V26 A;  5HFM A;  4JPR A;  3DGE A;  1Z59 A;  3WHA A;  3M99 B;  3SYQ A;  2WEQ A;  4YKX A;  3ZJZ A;  3E8G A;  2QE7 G;  1R62 A;  4GX2 A;  2QG2 A;  2Q2E B;  2Y48 A;  3D36 A;  4QE9 A;  1S14 A;  1S77 D;  3RW0 A;  3JD4 A;  5IYD O;  4DZY A;  3B77 A;  3I55 V;  2DQ0 A;  3Q5J A;  4B7P A;  4YKY A;  4PEL A;  3F7V C;  1W0K G;  3AG2 B;  1UY7 A;  2VWC A;  2BRC A;  4CE2 A;  3E8F A;  4ZVI A;  3QO7 A;  1H2G A;  4U7N A;  1FS0 G;  2EIM C;  1R3L C;  3ABK B;  3FB8 C;  1E1Q G;  1WLE A;  4MTG A;  4LC1 A;  2XAS A;  2YKI A;  2EIJ B;  5F5R A;  1M9N A;  1NR7 A;  3G4S V;  3CCJ V;  1K33 A;  3RKZ A;  1YHQ V;  2XAG A;  1E1R G;  4URM A;  3UKM A;  1TH8 A;  1YT2 A;  1ZW9 A;  2EZO A;  5M4K A;  4NH7 A;  4FIP C;  4PA7 A;  3AG1 C;  4UVC A;  1QR8 A;  5KA5 A;  2WLN A;  2IWS A;  1I59 A;  4WFB V;  3HHU A;  4XCJ A;  1KP2 A;  3K0G A;  1H8E G;  2ZXW C;  4XTJ A;  3OW2 U;  3K98 A;  3E35 A;  3A0Y A;  2YEA A;  3QO5 A;  3LDC A;  4UV9 A;  3R65 A;  3ZRS A;  2QEX V;  3GB7 C;  1K5S A;  5L3G A;  4DXW A;  4BIU A;  1OCC B;  2IWU A;  3PEH A;  1H7U A;  1J95 A;  3HZ1 A;  3ABM B;  4MVO A;  2A79 B;  1H7S A;  3ZN0 A;  2WLI B;  4YKZ A;  2FYP A;  1OZ0 A;  1EBO A;  5LHH A;  1JQ0 A;  1Y4S A;  3OW6 A;  2YKC A;  4AS9 A;  4CE3 A;  3LDD A;  3X2Q C;  3A0W A;  4MVZ A;  2YEV A;  1YSR A;  2V1D A;  1I5C A;  1KQS U;  2K5B A;  2XDX A;  2XDS A;  3OFN G;  2FWZ A;  1EZJ A;  5B3S C;  4PU9 A;  3BM9 A;  4U7O A;  3OM3 B;  3WG7 C;  5IYC O;  2XK2 A;  3ZMT A;  3W7W A;  3ETD A;  2VW5 A;  4JYC A;  2YE3 A;  3A0X A;  4Z1M G;  4FPP A;  4JAS A;  5LGT A;  3EHG A;  3RVY A;  2X6C A;  2DYR B;  1N8R W;  2QM7 A;  1YSC A;  4PDM A;  3HYY A;  2YSU B;  4PA6 A;  3CD6 V;  1VQL V;  2PI4 A;  3F7Y C;  3ZRW B;  2IJJ A;  4TT3 G;  1E79 G;  1NH2 B;  4I5S A;  4MW8 A;  4P8O A;  2FWY A;  4B6C A;  5J6A A;  3EHH A;  2YEH A;  1S76 D;  1CEZ A;  5CBG A;  2A0L A;  4CWO A;  2YE4 A;  3CCM V;  4E02 A;  1K8A W;  4N23 A;  1ENV A;  1NHI A;  2H8P C;  2WLM A;  2ZDI A;  4XBF A;  3ML0 A;  5LHI A;  5FND A;  3UM7 A;  4E00 A;  1KP3 A;  4YKR A;  4WCE V;  3QTF A;  3MHS C;  1G8M A;  4HXZ A;  4WFH A;  2GSM B;  2ZDI C;  5EK0 A;  1UYC A;  5IY5 C;  1Z5C A;  4WF9 V;  4X88 A;  4BXI A;  5LBQ A;  2XAQ A;  1Y8N A;  4CBC A;  2ZBK B;  2CGF A;  2WPD G;  2C2A A;  5E1A C;  1YIT V;  2CCS A;  4LCU C;  3U2K A;  3ZN1 A;  1GTO A;  5B1A B;  4MVS A;  2WI5 A;  4F4L A;  2ZQM A;  2JJC A;  4NH9 A;  3ASO B;  1R3J C;  1YER A;  3CCR V;  3B25 A;  3P32 A;  3T2M A;  1OCZ B;  2DYS C;  2HJF C;  1M57 B;  5H6Q A;  1JVM A;  3OMA B;  2P6J A;  3SYC A;  2HVK C;  2BU2 A;  1ZWH A;  2JJ1 G;  1VQN V;  3H4L A;  2XAH A;  3TCU A;  3RLR A;  2IH3 C;  4H7Q A;  5FNC A;  4FK5 C;  2Q6A A;  3E86 A;  2XAB A;  2WI3 A;  1AH8 A;  2XHX A;  4RQE A;  2LFS A;  5LGU A;  1L1F A;  1ZXN A;  3CCQ V;  1RM1 B;  4P9O A;  2JK5 C;  4EEH A;  3T1K A;  1DF5 A;  4YKW A;  3SL2 A;  5M4P A;  3FYI B;  5DM6 V;  4CWP A;  3OUS A;  3U2D A;  1KEC A;  1XL6 A;  1AMW A;  1P7B A;  4YKT A;  1WPX A;  2YE9 A;  1FXH A;  2XHT A;  3K97 A;  1AJP A;  4XDJ A;  4CZZ A;  4KSG A;  1KKD A;  3AG4 C;  1PD3 A;  5FL7 G;  3GIE A;  4HY6 A;  2X6B A;  4PA9 A;  4X8A A;  5B1B C;  3SPH A;  1AJN A;  1VQM V;  1QLN A;  4L8Z A;  3IC7 A;  3ZMU A;  4ASU G;  1F4M A;  1TC0 A;  4QIW F;  1ZXM A;  1NR1 A;  2MK3 A;  1Q86 W;  5GW7 A;  2ZDY A;  1UYL A;  4KFM A;  3RLP A;  3DTU B;  1AH6 A;  2QFO A;  1RPO A;  1AI7 A;  4XIQ A;  4MVU A;  3NXS A;  1M90 W;  3FT8 A;  2YE5 A;  1YJW V;  3C11 A;  4L91 A;  3JD3 A;  4GT1 A;  3ZRV A;  1XL4 A;  2EJR A;  4DO2 A;  5FNF A;  4YXW G;  2LP7 A;  1VQ5 V;  1QVF U;  1VQ8 V;  2IH1 C;  1Y4U A;  3CGY A;  3SYO A;  2EIL B;  4FCQ A;  3B8N A;  1G4Y B;  1SER A;  4P2Z A;  2WWW A;  5LHG A;  2BZ5 A;  1THZ A;  3VOU A;  1KD1 W;  2HG5 C;  2IJK A;  3FB6 C;  3F5W C;  4GX0 A;  5EBW C;  1AI4 A;  3TZ5 A;  4CWR A;  4R7C A;  2YEB A;  2Y69 B;  4EKW A;  2Z3Y A;  3W7T A;  2OCC C;  1GK9 A;  1THN A;  1FXK B;  4H37 A;  2EZP A;  4MS2 A;  3G7B A;  3AG2 C;  1W2B U;  2YK2 A;  4CE1 A;  2IW5 A;  2WLL B;  3D3I A;  2BOC C;  3ZRX A;  3PEJ A;  1PKX A;  3TTZ A;  4URL A;  2BT0 A;  2EIJ C;  4HYO A;  1EI1 A;  1BGQ A;  3TUH A;  3T4Z A;  1F51 A;  3ABT A;  4CWT A;  3IGA C;  1M1K W;  3ZKD A;  1GKX A;  4ASF A;  2V7Q G;  2YEJ A;  3VHA A;  1AJQ A;  2F43 G;  2H8M A;  3W7U A;  4CWQ A;  3PJS K;  2A9H A;  3KE6 A;  3OMI B;  5CBH A;  2XX2 A;  3E8H A;  2W6I G;  4YKU A;  3H80 A;  2ZDX A;  3CPW U;  1YI2 V;  2WSS G;  2DQ3 A;  2GFD A;  1K3E A;  2HG1 A;  1NHH A;  2LFR A;  1ZWI C;  3MNR P;  2YEF A;  1BKN A;  4MPE A;  3A0R A;  3VAD A;  2M7W A;  1TBW A;  2XDL A;  2P90 A;  1YS3 A;  2X0L A;  2IU0 A;  1Z5B A;  3RLQ A;  1Y66 A;  4URO A;  2AHY A;  4N21 A;  4QE7 A;  1VQ7 V;  4JYB A;  3FKS G;  2BU7 A;  1GM7 A;  3QNE A;  3WFV A;  4JQL A;  4ZBM A;  2BTZ A;  2YE8 A;  3ASN C;  2CCT A;  2WLH A;  1V54 B;  2BOB C;  3T10 A;  4AWP A;  5CPH A;  3HPL C;  2XX5 A;  4WFE A;  2YED A;  4JGS A;  1RPR A;  3SPG A;  4DUH A;  3ETG A;  2E0A A;  1I5X A;  2B1I A;  4WFG A;  4J9Z B;  2BYH A;  2DYR C;  2AHZ A;  1MSW D;  1S16 A;  4MP7 A;  4LWF A;  2B5U A;  4PRX A;  5L3J A;  2EIK B;  1NBM G;  3Q5K A;  3ZMS A;  5HFL A;  4JTC B;  2W0F C;  5H9C A;  1F4N A;  4HZ3 A;  4CWN A;  2P67 A;  4ASG A;  2GQP A;  3VBB A;  1UYH A;  4AWQ A;  3GIG A;  3AG1 B;  4HXW A;  2YKJ A;  5CF0 A;  3BEH A;  3Q5L A;  1QLE B;  5D7R A;  4JTA B;  4CWS A;  2ZR3 A;  5M4E A;  2P7T C;  2ZXW B;  3HZ5 A;  4PA3 A;  2PNR A;  2YGA A;  4H81 A;  1UYD A;  4EGI A;  3OAA G;  3K04 A;  3K99 A;  3ETE A;  1YC3 A;  3B24 A;  1NHJ A;  1JM6 A;  3T0H A;  2YKE A;  5CN0 A;  2IOP A;  4L94 A;  2WI2 A;  5B1O A;  2QF6 A;  3JYC A;  2HR3 A;  4PDL A;  4X9L A;  2HKJ A;  3TET A;  4R8C A;  3E83 A;  4XKO A;  3D2R A;  2QG0 A;  4MVQ A;  2OTJ V;  2HFE C;  2WI7 A;  4L93 A;  3X2Q B;  1UYI A;  2XCM A;  1JX9 A;  4WUD A;  5EC2 C;  5M4N A;  3O0I A;  5KA6 A;  3SPC A;  4HYP A;  1YSZ A;  1GKZ A;  4RAI A;  2IJH A;  2JKI A;  2Q8H A;  3ASO C;  4XKK A;  1I5Y A;  5B3S B;  3B27 A;  3T2S A;  3FB5 C;  5D7D A;  2YEV B;  4LP8 A;  3WG7 B;  3FT5 A;  4KP4 A;  3GWO A;  3KG2 A;  3OE7 G;  4JTD B;  1OCZ C;  2QA4 V;  1COW G;  5CTY A;  1AI6 A;  1MU5 A;  4UXN A;  1U0Z A;  2QM8 A;  1PNK A;  1R3I C;  3A0Z A;  4KFG A;  3TZ0 A;  1YC4 A;  4GT8 A;  1Y4M A;  5GGZ A;  4X89 A;  4GQT A;  3STL C;  1W0J G;  1K92 A;  4PRV A;  1K4C C;  3FV5 A;  1UYG A;  1UJW B;  1TID A;  3MD0 A;  3K60 A;  2CG9 A;  1ROP A;  4R1F A;  4KSH A;  4R3A A;  1YC1 A;  4R6Z A;  4P7A A;  4XE2 A;  3B8M A;  1QCE A;  4HAM A;  4MTF A;  2XJX A;  4GCZ A;  2WLJ A;  3CRL A;  4FCP A;  4KQV A;  1R73 A;  2DWE C;  2ESA A;  2XOK G;  3EFF K;  4WFF A;  3H01 A;  2H55 A;  4QPJ A;  2YKB A;  3G6E V;  2YJX A;  1MX0 A;  4H85 A;  5IY5 B;  2JIZ G;  2YGF A;  2ZD9 A;  5EBM C;  1PNM A;  2YGE A;  3CC2 V;  3ZCC A;  4P30 A;  2B1G A;  1V55 C;  3RVZ A;  3JD0 A;  3SPI A;  2UWD A;  4MOT A;  3LSS A;  3O6O A;  2D3O W;  3HB3 B;  1L0O A;  5L3E A;  4I9W A;  4HZ0 A;  1NVP D;  1OSF A;  4ZKI A;  2Q8G A;  1OCO C;  3AG3 C;  2XDU A;  4UVA A;  1VQO V;  4XIR A;  1UY6 A;  2DYS B;  4XDK A;  3ZIA G;  3EHJ A;  3RBZ A;  2BU5 A;  3EHF A;  1KIJ A;  1BYQ A;  3CCE V;  1OCR C;  2Q8F A;  4MSW C;  1UYK A;  4O07 A;  3LSQ A;  1MAB G;  3E89 A;  1QY8 A;  1CP9 A;  5CA3 A;  2VCJ A;  3TZ4 A;  3TZ2 A;  1I5B A;  4O09 A;  4XD8 A;  5M4M A;  4EMV A;  4LP0 A;  2EIL C;  4FCR A;  1Q81 W;  2XX4 A;  3LNM B;  4AWO A;  3INX A;  4LPB A;  2YEG A;  2IOR A;  2WLK A;  3G71 V;  5BZB A;  5J9P C;  1Y8P A;  4RUF A;  1CPY A;  4GX5 A;  4EFU A;  3GIF A;  1FXK C;  1IXM A;  1R3K C;  3CXC U;  2Q69 A;  1TUE B;  4WUC A;  2YI6 A;  3B26 A;  2XJG A;  3G7E A;  1YIJ V;  2WER A;  1P4R A;  2ITD C;  4MPN A;  3O2F A;  5B1B B;  4HZ5 A;  2BSM A;  4PL9 A;  5CBF A;  3BY6 A;  3ZMV A;  4XDM A;  3TK1 A;  4O04 A;  4G27 B;  5L3F A;  2O1V A;  3OWD A;  1M56 B;  1GMG A;  4O05 A;  1U2O A;  2EIN B;  1JJ2 U;  2WAM A;  1AI5 A;  2BU6 A;  5D6P A;  2WI4 A;  1EA6 A;  3ABK C;  2QKS A;  4RUE A;  4XC0 A;  1GKF A;  3HYZ A;  3ABL B;  3LNU A;  2FTK A;  2YI0 A;  3JZ3 A;  2JEX A;  1YT1 A;  1S72 V;  3QDD A;  3JCZ A;  3INW A;  2CK3 G;  4XIT A;  1DTO A;  2XDK A;  2YE2 A;  1EFR G;  4UUJ C;  4QJF B;  4R50 A;  3SPJ A;  3R91 A;  1FFT B;  2OCC B;  4I3H A;  5EC1 C;  4JAU A;  4BQG A;  2YEE A;  1YTF D;  2BRE A;  1V54 C;  4LWH A;  4URN A;  2W6J G;  3HEK A;  2OT5 A;  2WLI A;  3CC4 V;  3C0E A;  4L87 A;  1OCC C;  2K1E A;  3ABM C;  2IJI A;  1I5D A;  1UYE A;  3G75 A;  4MVR A;  2FXS A;  5D6Q A;  5F3K A;  5J71 A;  1B6Q A;  4K4O A;  5BOC A;  1YJ9 V;  1R6K A;  1YET A;  1BXD A;  3FB7 C;  5CMU A;  3OR7 C;  5KUM A;  4LWI A;  2EIK C;  3MHH C;  3IED A;  2QTO A;  1BL8 A;  1PNL A;  3W7X A;  4ASB A;  4MVM A;  2YJW A;  4KTN A;  2ITC C;  3EKR A;  1K97 A;  2PI5 A;  1H38 A;  2BYI A;  3R4P A;  2DW4 A;  1MOF A;  1ID0 A;  3WQ9 A;  1QBZ A;  3LUT B;  1VQ4 V;  3K08 A;  1QLE C;  2EIM B;  2HCH A;  1NQT A;  3ZM7 A;  4WUB A;  2WI6 A;  3ZRW A;  4JAV A;  3SYA A;  4BQJ A;  3OEH G;  1YT0 A;  3CC7 V;  1S5H C;  4FMT A;  5CTX A;  1BHA A;  1UYM A;  2EXL A;  2X6A A;  1BHB A;  1BMF G;  2GHY A;  3CYO A;  4PDR A;  1SET A;  1K5Q A;  4UVB A;  3ZXQ A;  4MP2 A;  1HWY A;  1SZT A;  4V25 A;  1B62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...