4ZKIA

The crystal structure of histidine kinase yycg with adp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
239
structure length
233
Chain Sequence
VTEQQKIDNDRKQFVSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRVDKQGGTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histidine kinase
publication title Conformational dynamics of the essential sensor histidine kinase WalK
pubmed doi rcsb
source organism Lactobacillus plantarum jdm1
total genus 78
structure length 233
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4zkiA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4zkiA02
4LWEA 4QPJA 4URMA 3U2KA 3CRKA 2QG0A 3FT8A 3OW6A 1AH8A 4HY6A 4BQGA 4LWHA 2IWSA 3ZRVA 3HYZA 4JAUA 1Z5BA 4XKKA 2YJWA 2BU5A 5FWKA 4E00A 2QF6A 2YEIA 2IOPA 1BGQA 2BU6A 4XC0A 2YECA 1YC3A 4URLA 1ZWHA 4YKZA 1YETA 1I58A 4I5SA 4CE3A 2IWUA 5B1OA 1NHJA 3Q5JA 5IDJA 4WUDA 4ZKIA 3TZ0A 4MTXA 1F51A 3K99A 4URNA 2YE5A 1I5DA 3R4NA 3VHCA 2YGAA 2YEJA 3VHAA 2LFSA 5L3JA 1TILA 3A0RA 4GFNA 3A0TA 3HEKA 4HXZA 1I5CA 3CGZA 4V25A 2VWCA 5FNFA 2YEHA 3B24A 4H81A 1Z5AA 4DZYA 4DUHA 2BYHA 2QFOA 2WEPA 1UYMA 1UYEA 2BZ5A 3LPSA 2WWWA 2E0AA 1S16A 4EEHA 4NH7A 3D2RA 4K4OA 4XKOA 1YT2A 4FCPA 4EMVA 1YT1A 1UY8A 1GKZA 3C11A 2WI6A 1BXDA 1EI1A 2O1WA 4HXWA 3Q5LA 3MD0A 2YEFA 5CTXA 1QYEA 2WI7A 3A0XA 4QPKA 4YKRA 4P8OA 4GCZA 4O09A 1AMWA 4XDMA 3PEHA 3T1KA 3FT5A 2P67A 4MPNA 4E02A 2GQPA 3VADA 3A0ZA 4O07A 4JASA 2IORA 3GIGB 1Y4SA 5J6AA 1Y8OA 1UYIA 4B6CA 4U7NA 1JOYA 1UYGA 2YKIA 5IN9A 1EA6A 4EM7A 5D6QA 1U0ZA 5BODA 2BU2A 4XIQA 1TBWA 5CTUA 3ZXQA 3G75A 2YEAA 2CCSA 4GT1A 3TZ4A 1THNA 3OPDA 3SL2A 4X9LA 4BAEA 2FWZA 1NHIA 4KSGA 3RLPA 3R4MA 4MP7A 1L0OA 3GIGA 1YS3A 2XX2A 1Y8PA 4LP0A 2Q8GA 4R3AA 4L94A 5IDMA 2FTKA 2XX4A 4HYPA 4JYBA 3R92A 3LNUA 4MT8A 5M4HA 3ZKBA 3O2FA 2HG1A 3NXSA 3B26A 3CWVA 5M4KA 2HCHA 4NH9A 3INXA 2YGEA 1JM6A 3GIEA 5M4NA 1YSRA 4L8ZA 2WI2A 2IOQA 3QDDA 4ASAA 2XJJA 1YSZA 1TIDA 2YE2A 2YEBA 1KIJA 1UY9A 2XHTA 3EKOA 1UYLA 3K60A 4BIZA 5M4MA 4H7QA 2WEQA 2YI7A 4MPCA 5CTWA 4XCLA 4O04A 3C0EA 3HZ5A 4CWRA 3CGYA 1TC0A 1I5BA 4EGHA 2CG9A 4KTNA 3ZXOA 2YKJA 4W7TA 3B28A 3NMQA 2XABA 2XDKA 2YEDA 2ZDYA 1IXMA 2YE3A 3R4OA 4XIRA 3TTZA 4XTJA 2UWDA 3EHHA 4CWQA 1Y4UA 2JKIA 4LWFA 3P32A 4MOTA 2VCJA 4PU9A 2Q2EB 1UY7A 4FPPA 2WI1A 4L90A 4YKUA 2BTZA 4ZVIA 2FYPA 2Q8HA 3TUHA 4XKAA 4XITA 4YKXA 2XDUA 4BQJA 2WI3A 4LWGA 5D6PA 1UY6A 4YKYA 2VCIA 2YE4A 1ZW9A 1GKXA 4WUBA 2H8MA 1ZXMA 4L93A 4MP2A 1I59A 3INWA 4LPBA 4CWTA 3MNRP 3BM9A 3G7BA 2YI6A 3BMYA 3H4LA 4CE2A 2YE8A 2XDLA 3R91A 1H7UA 1BYQA 5D7DA 2YK2A 5F5RA 4O05A 3KE6A 3HHUA 3CRLA 2YEEA 1GJVA 4PRVA 5BOCA 3R4PA 4R3MA 3U67A 5CPHA 1YESA 4GGLA 2HKJA 4P7AA 4FCRA 1NHHA 4JYCA 3WHAA 1YT0A 4KFGA 4CWOA 3OWBA 4EGIA 4AWQA 3PEJA 4GEEA 3T10A 2XJGA 3H80A 3ZRWB 2ZDXA 2CCUA 2H55A 3RLQA 2XJXA 2YI0A 4H85A 1OSFA 2QM8A 3EHGA 2GFDA 2WERA 2YKCA 4GT8A 3HZ1A 4R1FA 2XD6A 1UYFA 4BXIA 1B3QA 2XK2A 2XX5A 2WI4A 4YKQA 3RLRA 3D36A 2LFRA 4WUCA 3ZKDA 2YEGA 2YJXA 4GQTA 1MX0A 4MPEA 1ZXNA 3T2SA 2XCMA 4NH8A 4JAVA 2CH4A 5D7CA 1B63A 1YC1A 2BU8A 3Q5KA 2ZBKB 2IWXA 3B25A 5FNDA 4E01A 3TZ5A 2YK9A 3O6OA 2XDSA 3ZRWA 4CWPA 3K97A 1U2OA 5M4EA 3ZM7A 4FMTA 2BSMA 4O0BA 2YKEA 5C93A 4PRXA 3OWDA 4AWPA 1YC4A 2QG2A 3FV5A 4XE2A 1Z59A 4MBCA 2BYIA 2C2AA 4XCJA 4MB9A 1ID0A 4HYMA 4LC1A 2Q8FA 1QY8A 2O1VA 4CWSA 2FXSA 4KQVA 1B62A 1TH8A 2WI5A 1UYDA 2PNRA 3JZ3A 2Q8IA 4ASBA 3U2DA 4CE1A 5FNCA 1Z5CA 4ASFA 2YKBA 5GGZA 5F3KA 4PL9A 3T0HA 1I5AA 1A4HA 1US7A 4HZ0A 4KSHA 1H7SA 3G7EA 2O1UA 3T0ZA 4YKWA 3ZRXA 1BKNA 1AH6A 2QM7A 4V26A 1AM1A 2XHRA 4YKTA 4FCQA 4EFUA 3EKRA 1Y8NA 1MU5A 2CCTA 3QTFA 3VHDA 4KP4A 1QZRA 4BIUA 3EHJA 1PVGA 3A0WA 5D7RA 5B1NA 1R62A 2EXLA 5CF0A 3A0YA 4AS9A 1YERA 3EHFA 2CGFA 4U93A 2YE9A 4XD8A 3B27A 3ZCCA 3GIFA 1UYHA 5CTYA 4B7PA 3HYYA 1S14A 2YE6A 1TC6A 1KZNA 2K5BA 4UROA 5M4PA 4JQLA 4L91A 3OMUA 1AJ6A 3DGEA 4EFTA 2BT0A 4U7OA 2YE7A 3O0IA 4CWNA 2YGFA 2BRCA 1UYKA 4HZ5A 2FWYA 4AWOA 3IEDA 2VW5A 4XIPA 1UYCA 3WQ9A 4HY1A 4ASGA 4Q20A 2BU7A 4CWFA 3TK1A 2YI5A 4LWIA 2JJCA 3RKZA 4EGKA 4I3HA 2BREA 5J71A 2AKPA 3D0BA 3K98A 2ESAA 2XHXA 3TZ2A 2XDXA 2ZKJA
chains in the Genus database with same CATH superfamily
4LWEA 3ABMB 3E8HA 5LHIA 1KBHA 3OW6A 1AH8A 4JI8B 4JI4B 2UU9O 4ZI7B 1VP7A 1MA1A 4FLUA 1WN7A 3FB8C 2IWSA 2UXBO 4JAUA 5FNVB 1YI2V 1BSMA 5IJ9A 1FFXA 5KA5A 3P30A 1GN3A 2YEIA 1BGQA 5JJNB 1VQLV 4XC0A 5H2FZ 3K5MA 2N05A 4EB6A 2GHYA 2YC0A 3EHBB 3ZHVA 1R73A 3E86A 1TUBB 1AJQA 4B7EA 3G67A 5IDJA 4X88A 4ZKIA 4DUYB 4ZI7A 3FYEB 4DV5O 1HNWO 3RYFB 3OGCC 4FZ1A 2VWKA 4URNA 5FNVA 2DQ3A 3B77A 5B3SB 3IAYA 1T5EA 3GB7C 3VHCA 2DJVA 2X6AA 5L3JA 4X1IB 3STLC 4GFNA 4X1YB 3M99B 3A0TA 3RVYA 4HXZA 1I5CA 4RUFA 2VWCA 3CCUV 4DR5B 2YEHA 4H81A 1FKAO 1S0VA 1EZVH 1HP8A 3AG4C 4KUMA 3CC7V 3CSXA 2XT9A 2YIBA 4BW9A 2E0AA 2QTOA 5EIBC 2UUCO 4DV0O 3RYFA 5LMUB 1UY8A 4UCVA 2O1WA 5EZYA 5JENA 1MMMA 2XTAA 1SC5B 4X1IA 2WI7A 1H2MA 1SQVH 1K92A 3A0HZ 4YKRA 1KQSU 3G4SV 3TXQA 3T1KA 2HR3A 2X6BA 4JI2B 1HWYA 1RSOB 1R6TA 3ZMVA 1K5QA 4CH3A 4KFMA 4LF9O 3OTOO 4UVBA 3ZMSA 5J6AA 1YIJV 2A7WA 3LUTB 2GBOA 2OIEA 4OXSA 1UYIA 4MVSA 1Y6XA 2YKIA 5IN9A 1VQ6V 1GK9A 1BL8A 3QTCA 1GH6A 2BU2A 2JEXA 2EINC 4JZ2A 1VQMV 4UV9A 2YEAA 3TZ4A 5B1AB 1RSOA 1TVKA 3R4MA 3RLPA 1N33O 2YIAA 3SPJA 5BY1A 2QKAA 4B3TO 1YS3A 4XDLA 2CAZC 2RDCA 1RM1C 4KHPO 2Q8GA 1DF5A 2DYRB 4R3AA 2KSDA 3AK2A 4L94A 2XX4A 4DR4B 3ABUA 3MHSC 5KHKA 1ZL8B 1ZSPA 1ORQC 4X62O 1I08A 5LYJB 2HG1A 3NXSA 3B26A 2ZKOA 1F23A 3TGUH 4LFBB 4TSFG 4NH9A 5LA6B 2CTPA 5M4NA 1YSRA 2YUAA 2BOBC 3P3PA 1RP3B 1YSZA 3RYCB 2YE2A 2CTQA 1OCCB 1G6UA 1LR1A 2XHTA 1AI7A 1N0JA 1UYLA 3KG2A 3K60A 3FAVB 3BCCH 2YI7A 4MPCA 5CTWA 1ZL8A 5CB4B 4XCLA 2QWOB 4OPAA 1WP7A 2NN4A 5H6QA 1XL4A 5IWAB 5LA6A 1IBLO 4W7TA 2Q7HA 1NTZH 2XDKA 2ZDYA 4XIRA 3JD3A 3R4OA 3UKMA 1JR9A 2UXXA 4RO2A 2ADPA 1GMGA 4MOTA 2VCJA 5LXTB 2OWOA 4UCUA 4L90A 1EFRG 5KHGA 3G6EV 2FYPA 2M6YA 4XKAA 3RGBA 4YKXA 2XDUA 1CPYA 2WI3A 3DC5A 4LWGA 4YKYA 3BPZA 1N36B 3PN1A 1ZW9A 3CCLV 3T1YB 4UFZA 2FL4A 1ENVA 2HVJC 1WNSA 4G27B 4J41A 4MP2A 2AZ2A 1CEZA 1HNXB 3INWA 3HKEA 2D3OW 2B1IA 3MNRP 2YS8A 4TV8B 3A8TA 1L0NH 2N04A 4B08A 2YI6A 3BMYA 1GM9A 5LXTA 4CE2A 4E2LA 1H7UA 4AQYB 5F5RA 4O05A 2X6CA 1YJ9V 3ZMUA 5DM6V 3CRLA 4FLXA 2RCVA 1Q3EA 3HPLC 5A9GA 1PV0A 5BOCA 3R4PA 4G2KA 1YESA 1BE3H 3IC9A 4PD4F 3ABKC 3DSQA 4TV8A 3ICXA 4XDKA 1YT0A 3S3XA 1JQ0A 1NBMG 4PI2A 4CWOA 3OWBA 4MVZA 4FVMA 1NQTA 3OT7A 3T10A 3CYOA 4GX0A 2ZDXA 3CYGA 2Q5ZA 2A79B 4WFEA 4JV5O 4MS2A 4Q6GA 1QNMA 2Z5UA 4PDVA 4DV7B 4LF7B 4H85A 3N2KB 1VQ9V 3HZ1A 4R1FA 5FLXN 2WI4A 3D36A 4O2AB 1UFIA 2YEGA 4MPEA 5TISZ 1MX0A 5EBLC 2G38A 5D7CA 4I9QA 2HG5C 3H1HH 3Q5KA 2IWXA 4FFBB 3TZ5A 4HNAB 2OTLV 2XASA 3O6OA 1U2OA 1R6KA 4MVRA 3ZM7A 4PDMA 4FMTA 3SYQA 1H2KA 2YIDA 3N2KA 4O0BA 2PY5A 5C93A 4PRXA 5LMNO 3APOA 3H1IH 2HJFC 3KKYA 4YY3O 3OWDA 1RFYA 1N34O 4O2AA 3B40A 3X2QB 3QNEA 1Z59A 2C2AA 4JYAB 4HYMA 4LC1A 1NTMH 4DR7O 2O1VA 4HNAA 4KQVA 1B62A 2Y69B 3ZMZA 2PNRA 2Q8IA 5GTIZ 3K0GA 4CE1A 4PDRA 3KCYA 2PYLA 4BAYA 2YKBA 1BQZA 4RWUA 3ETQA 2H94A 1N4CA 1US7A 5J2UB 1ROPA 5E1AC 4CS4A 3F5TA 4C7UA 1XOUA 2ZT9B 2Y0PA 1QVFU 1PL4A 1Y74A 2WPDG 3RW0A 2LP7A 3ZRXA 4O4HB 1OCOB 5LGUA 5ITZB 1QU7A 3CCRV 4W4LA 4JI4O 4JI8O 2EULA 2QR4A 1BQ0A 3Q4HA 3SJQC 3IC7A 4EFUA 1IURA 4GX1A 2LQTA 3EKRA 4DV3B 3U10A 4MVMA 1AI6A 1SQBH 2LGWA 3CCEV 5L3CA 2HFEC 2AHYA 1QR9A 1B6QA 5LP6B 3QO8A 5J2UA 1PKXA 3JCUZ 3NR7A 5CF0A 2AGAA 4JTDB 2W0FC 2JK5C 3LDCA 1WJZA 4JAAA 1K34A 4O4HA 4XD8A 3EVKA 3B27A 5ITZA 1UYHA 4JF3A 2C1IA 4X66B 1S14A 5KHHA 1TAEA 2QA4V 2BTQB 4FM0A 2PZSA 2DYSB 1KZNA 4UROA 4P2ZA 4EKWA 4B3SO 1AJ6A 4DV6B 3SYAA 3O0IA 2E75B 5LP6A 4J9YB 2YGFA 1YZBA 5KMGB 3F7VC 1VQNV 5BR8B 5IE9A 2VW5A 2DWEC 4XIPA 1UYCA 1EN5A 2HLDG 3SPHA 4BR6A 4TQDA 4HY1A 4ASGA 2CTRA 5JJEB 4CWFA 3TK1A 4LWIA 1XREA 4QIWF 4LBEC 3RKZA 4DW1A 4I3HA 4EGKA 2BTQA 1WB8A 4IIJB 2BREA 1AROP 2AKPA 3SJCC 4PHZA 1FXHA 3TZ2A 5FNFA 2F4VB 5LL6Y 4Z2WA 4JI5B 3JYCA 4UCSA 2QG0A 1XEQA 3VOUA 5KMGA 1SA0B 1VQ5V 4YIOA 4BQGA 3L72H 3HYZA 4F6EA 5BXZA 3K57A 2PTMA 4LNUB 1JMKC 3B4SA 2Q6AA 2F95B 3APQA 4UCTA 2YECA 4IIJA 1YC3A 4URLA 2YEVB 4JYYA 4YKZA 2A0LA 4PA4A 2WSSG 1I58A 4I5SA 1Z5WA 4JI1B 5B1OA 1M90W 2JEUA 2PF4E 3FKSG 1CXZB 3JARB 2P22C 4WUDA 2ADQB 2NNUA 5B1BC 3TZ0A 1XQ8A 2L6LA 2AHZA 5DEDA 5CA3A 1SA0A 1F51A 1VQ7V 3UO3A 3K99A 1I5YA 2X7RB 4DV1B 2YE5A 3R4NA 4CC5A 4X64O 1TILA 1GRJA 2BCCH 2XHBA 4DR4O 1D2DA 5GONB 4TOIA 3THOA 2JVDA 2RN9A 1H8HG 2BYHA 5IYCO 2Q8VA 2WEPA 5GW7A 2DQ0A 2HVKC 1S16A 4NH7A 4NTWA 3D2RA 1YT2A 5JH7A 1YT1A 2ZE7A 3CCVV 2A3QA 4B3MB 5K1PA 1BXDA 3HB3B 4WFFA 1YTFD 3Q5LA 2GUZA 3ABMC 3MD0A 1W2BU 1NTKH 1LUWA 4IT5A 2KG7B 4O09A 2OIGA 4DR3B 1G1XB 4MPNA 5A2QN 4E02A 3CXCU 2GQPA 5GONA 3VADA 5B1BB 3ZN0A 3LNNA 3CEIA 3IGAC 3RYHB 1Y4SA 3LSUA 3I5DA 3JAKB 5IWAO 3I55V 4JI3B 3OR6C 2QKSA 1UYGA 1WAZA 1AP5A 3T4ZA 1V54B 5LOVB 3K0DA 5D6QA 1U0ZA 1TBWA 2HJDA 1SF9A 5CTUA 3WB1A 4TT3G 3JAWB 1E79G 4IYHA 5LGNA 1OCZC 2R9AA 4GT1A 3SL2A 4LWSB 3ZHSA 1CP9A 3BVOA 2PI4A 3ZJZA 1Z2GA 4KSGA 1R1BA 1DTOA 3RYHA 1L0OA 4JI7O 3H1LH 3JAKA 1FXVA 1Y8PA 4FLYA 3VQWA 3T1YO 4ZOLB 4DO2A 2EZOA 5KA6A 2ZNIA 2FTKA 1BGYH 1O9GA 1HNXO 4UUJC 3E8GA 3LNUA 5LOVA 4NYKA 4MT8A 5M4HA 3ZKBA 1XHZA 2K9PA 3ABTA 3E22B 2ZXWB 4PV1B 2HCHA 3ASNB 3N2GB 1NI8A 3VQVA 2IU0A 3INXA 2IU3A 4EFEA 3GIEA 4LWSA 4AQYO 4L8ZA 3J81N 4ASAA 4GLXA 4WCEV 1MNGA 4D6TH 3O65A 4TUYB 4D7TA 1FXKB 3W7UA 4ZOLA 4FIPC 3K08A 3CRCA 3E8FA 2YIBD 3C3SA 5M4MA 1YCIA 3JAMN 1EZJA 4LH7A 1OCZB 1JPXA 5IT9N 1PM9A 3JASB 1BHBA 1SS3A 3CGYA 1TC0A 4EGHA 1XL6A 3CRQA 3E89A 3T1CA 4D7SA 2KQXA 4K3AA 2RNBA 3ZXOA 2AZ0A 3ML0A 2AW9A 4DV7O 4LF7O 1N0NA 2XABA 4F6RB 1IXMA 4U3JB 4XTJA 1HDJA 4TUYA 4LWFA 3FB7C 1TUBA 1S77D 5B1AC 2LGQA 1GKFA 1IBMB 3G80A 3JASA 2IJKA 4RQEA 2ZD9A 2WA3A 1WLEA 5GTHZ 4J7ZA 1UY6A 4J80A 2YE4A 1GKXA 4WUBA 2DYRC 3QO5A 2H8MA 1JFFB 3TXSA 5BZBA 4L93A 4I0XB 3CPWU 1I59A 4X1YA 1NVPD 1RPRA 5KX5B 1HW7A 5L3DA 4F6RA 4AI8A 4DR2B 3ZHQA 4YHHB 3G7BA 1NH2D 1FD9A 5D7DA 1XNRB 4PJ0Z 4JYAO 3J80N 1L1FA 3HHUA 3CE2A 1OCCC 1QBZA 2Y4TA 5CBFA 3H1JH 2RJZA 3UO2A 3LNMB 3R65A 4R3MA 2F43G 4I0XA 3BRCA 4GGLA 4H33A 2IJHA 5KX5A 4K0KO 1H2SB 3CD6V 4P7AA 2HHIA 2H8PC 5J9PC 1I5XA 1QVGU 4JPRA 4UB6Z 1NU1H 3PEJA 1S76D 2XJGA 3H80A 1D5NA 2BOCC 4DV4B 1XUQA 3HKCB 2YI0A 3EHGA 2GFDA 4JTAB 2XD6A 4JTCB 4MSWC 2GTSA 2YSUB 4DV3O 1PP9H 2MW2B 3GVMA 4GKKB 4QGPA 1YF2A 1ZXNA 2CH4A 5K1XA 2BU8A 1X59A 3B25A 1NJIW 2UXCB 2W6IG 3WG7C 2B5UA 1QHTA 2LW1A 2UUBB 3CJHB 5JCOC 4OX9O 2GSMB 3HKCA 3RWRD 1BZKA 2HHHB 3TCUA 4X20B 4X66O 3L75H 4LCUC 4R7CA 4DR6O 5LYJA 1AR1B 2VS0A 4LFCB 2OCCB 1J5EB 4XE2A 1WPXA 2FYUH 1M4UA 2BYIA 4JGSA 3BEHA 1WPBA 4MB9A 2E5LB 2Q8FA 2R70A 2QWNB 4P30A 3RYCA 3CX5F 3CMAV 4H0LB 3D36C 2WI5A 1UYDA 3CJHA 3N27A 4O4JB 3S3WA 3FAVA 4ASFA 4UVAA 5F3KA 4PL9A 2P90A 5CB4A 3AEIA 3VQXA 1I5AA 4HZ0A 2HEPA 1AJNA 1H7SA 2ATKC 3WG7B 4YJ3B 3WU2Z 2F4VO 3SR2C 2RMKB 3W7WA 3L74H 5JVDB 5IY5B 4YKWA 2A06H 4DRXB 3ETEA 4O2BB 1IBKB 1AM1A 2XHRA 2QWRB 1YITV 2L35A 4GUNA 1Y8NA 3QTFA 1GTOA 3ZN1A 5KHJA 4O4JA 3VHDA 3RT3C 1QZRA 3EHJA 1PVGA 3C3TA 1KYOF 3BAAA 5D7RA 5B1NA 3BHPA 4UB8Z 3R66A 2AXTZ 2O57A 3HKBB 4MVOA 3A0YA 2VQFB 2F93B 4YJ3A 5JWPA 3EHFA 5JVDA 2CGFA 4LF8O 2B9ZA 4CH4A 4FLWA 4U93A 2YE9A 5IJ0B 5C8YB 1FYJA 5JCOA 3ZCCA 3GIFA 3FFQA 3HYYA 1FJGB 1EM1A 4DV1O 1R3KC 3X2QC 4NTXA 3AG1B 1SQGA 2ZCEA 2CK3G 4JQLA 3BA9A 1UPGA 4BW5A 3OMUA 2QE7G 2XAHA 4EFTA 4CWNA 1ZLZA 3HKBA 4K8ZA 1UYKA 1TGOA 3IEDA 2Y69C 2WLKA 3WQ9A 2PYJA 3BABA 1P84F 2ZQMA 1Q82W 4DV5B 4Q20A 5C8YA 1K4DC 2BU7A 1YVWA 1PPJH 5J71A 3QF7A 2ESAA 1D5AA 2XHXA 2ZKJA 3J7AU 3TETA 4QPJA 1EN4A 3U2KA 1KKCA 5LBQA 1OCOC 4LP8A 4DR3O 1GN6A 2EIMB 2WLIB 4PI0A 4PELA 1IDSA 3OUSA 2P5OA 4ZIBA 3SYCA 4LWHA 2UUAO 2W0XA 2ZR2A 2E3CA 2JGDB 4DV0B 2YJWA 2WLLB 3FYIB 2BU5A 4LF4O 1NS1A 4DV2B 2Q7GA 5FWKA 2WLNA 4LF5B 3WB2A 2OTJV 4X65B 5LP6C 2JGUA 4MW8A 1ZWHA 2HKOA 4J11A 3WB0A 4HBNA 1YETA 4FFBA 2EX3A 5EK0A 1IZ3A 1N32B 1H2NA 1BCCH 4MTXA 2ZIOA 2DYSC 5H6RA 3ETGA 4O4LB 4FLVA 2JGDA 4DK0A 4R50A 5HFLA 3CXHF 5H5NA 2YEJA 3E8BA 3K03A 4G28B 1KC8W 1B04A 3B24A 2YXHA 2CH7B 4NVPA 1Z5AA 3OD4A 2P7TC 5KUMA 1UYMA 3LPSA 2BZ5A 3SJBC 1VF7A 2WWWA 1M9NA 5L3FA 4WBNB 1KP3A 1LUVA 3SPCA 5EC2C 4K4OA 4FCPA 4B3TB 4RAIA 1GKZA 3C11A 2QTSA 2F23A 5AG2A 2YI8A 2H3OA 3AG7A 4O4LA 3CRMA 1SZTA 5CTXA 4A5UB 2P4VA 3C90A 4QPKA 1R3JC 1E1QG 4P8OA 4X62B 4XDMA 4L8JA 3G6BA 2P67A 2YXYA 3L71H 2LW7A 3SPGA 3ZBHA 2QM4A 4DUYO 3A0ZA 1GN2A 3OAAG 2CH7A 3L73H 4O07A 1Q6IA 3GIGB 5L3EA 1Y8OA 1ZUQA 4R8CA 4WBNA 5FPOA 1L0LH 3PJSK 1WP8A 3JSLA 1NR1A 2WLJA 1EA6A 3SYOA 5BODA 1F4NA 1S3JA 1Y66A 3T1HB 4XIQA 1K9MW 1VQPV 4J7JA 3G75A 3ZXQA 4DR5O 4AHCA 3JALB 4I7ZB 3OPDA 1XMOB 3QVNA 4X9LA 4UCOA 3T2MA 1VEWA 1NHIA 3CS5A 4MP7A 1M57B 1DF4A 1EN6A 1P4RA 5LMUO 3GIGA 3L70H 1VIBA 1IBLB 1AVMA 2WLHA 1QCEA 4DK1A 1GAXA 3ZIAG 2F66C 3O2FA 4DR2O 4JI2O 2LJ2A 4YHHO 1AP6A 5M4KA 3OGIB 2Q0AA 2Q67A 3ZHUA 4QE9A 2ZE5A 5J2TB 1DGSA 2YGEA 1JM6A 1G8MA 1XNRO 4FM2A 1VMGA 3MHHC 2IOQA 5DN6G 1FFTB 3QDDA 2XJJA 3AK3A 4PA7A 3GWKC 1TIDA 2YEBA 5KAFZ 5CA0B 3I56V 1K33A 3EKOA 2JIZG 4ZBMA 3TJTA 4H37A 4H7QA 2WEQA 4R6ZA 2OCHA 4KL1A 5BMVB 1OJHA 2ZM6B 2D2CB 2VQEB 4B3RB 3HZ5A 4CWRA 2CG9A 1H2LA 1KP2A 5J2TA 2FB5A 1VQ4V 3D8CA 4LNUA 2YKJA 4DV4O 1F7YA 2BE3A 1KMIZ 4LR3A 1V54C 1AR4A 2WAMA 2V1DA 1BHAA 2YEDA 2VWJA 2YE3A 3TTZA 4CWQA 2YEVA 2UWDA 1XI1A 1Y4UA 2JKIA 1K5SA 2UXNA 4GYCB 3P32A 2DE0X 3A2FA 1UY7A 4GKKO 2HP8A 1QLEB 4FPPA 2WLMA 3JARA 4LFBO 2F1MA 3AG3B 3TUHA 2Q8HA 3T4DA 1Y4MA 2UXCO 4XITA 1H38A 2QEXV 4JV5B 4WFAV 2UUBO 4P9OA 2EZPA 4LPBA 1V55B 2HHHO 3ABLC 3K9SA 4F4LA 3HR0A 2ZXWC 3ASNC 3H4LA 1I94B 4LFCO 1URFA 1J5EO 2YE8A 2XDLA 1YHQV 4XBFA 2YK2A 1MOFA 2EIKC 1KB9F 3ZX6A 1VQKV 2E5LO 4GKJB 1YEWA 1YTFB 3ZEDA 2YEEA 3LMMA 4DUZB 1GJVA 1FXKC 3CRAA 4X1KB 1TA8A 3U67A 5CPHA 4CBCA 4OGQB 4YJ2B 2KG7A 3B8NA 3K59A 5KAIZ 1N34B 3K04A 2EILC 4JYCA 4K8XA 3DXRB 1THZA 1SZXA 4EGIA 2V4DA 1R3LC 1U97A 3FB5C 5KUKA 4NXMB 4I4TB 1HR0B 4QJFB 4GEEA 1OCRB 3ZRWB 1N36O 3D3QA 3RLQA 3CHXA 4UCRA 1OSFA 2QKCA 1IBKO 2YXLA 2XAGA 2IBZH 5DECA 1M56C 1UYFA 1B3QA 2XX5A 5IJ9B 1FFXB 2LFRA 3ABLB 4WFHA 4WUCA 1WB7A 3JAWA 4YJ2A 1PNLA 3RVZA 2XAJA 4NH8A 1A32A 1B63A 4EB6B 4DXWA 1WA8B 5FNDA 3DXRA 1FS0G 1ZWIC 2EIKB 1SQXH 1PNKA 2VQFO 4I4TA 4W4KA 2JS5A 1SERA 2CDYA 2ZR3A 3ZRWA 3K97A 5M4EA 3W7XA 1COWG 4CS3A 2GDSA 1FJGO 3CCQV 3OTFA 2EILB 3E22A 2NLJC 1YC4A 2QG2A 2IJJA 2XNDG 3N2GA 4DR1B 1QLNA 2JRIA 2R72A 1WA8A 1JCHA 3OEEG 1QY8A 1GM7A 4CWSA 2FXSA 4X8AA 1Z5VA 3QG5A 3STZC 2Q0OC 3JZ3A 1M56B 1FXKA 2IW5A 4MW3A 3U2DA 3K58A 5CBGA 3WFVA 1Z5CA 4LFAB 3K06A 5GGZA 3T0HA 5EZYB 2UXDB 4KSHA 2EJRA 4PA9A 4B3SB 1OHHG 5D5QA 3RBZA 3CCMV 1VARA 4CC6A 4IHJB 2V7QG 3VBBA 5CA1B 1J95A 3U0ZA 1FAFA 4YKTA 2NR5A 1MG1A 1H2GA 4FCQA 1Q7YW 4NB5A 4U3JA 2P4KA 1MU5A 1VQOV 1W0JG 4J7KA 1GN4A 4DV2O 4CH6A 4LF5O 1IVSA 1KUQA 4X65O 1YJWV 3A0WA 4X9QA 4IL6Z 3SDLA 1S72V 2EXLA 3FD9A 3FB6C 1N32O 2IH1C 4IHJA 1S5LZ 2XUMA 3QO7A 1JFFA 4YIPA 5CA1A 1NVPB 1Q81W 1K73W 1NR7A 4I50B 3UM7A 1TVKB 1G4YB 5CTYA 4B7PA 1NH2B 4WFBV 5EIBD 1TC6A 4TQFA 3SYPA 2K5BA 4LF6B 2OCCC 4FFKA 3SGIA 3DGEA 3ZHTA 5FL7G 4U7OA 2JJ2G 1HNZB 5L3GA 2C1GA 4HZ5A 4AWOA 2VRZA 3AG4B 4NXNB 1VF6C 1Q43A 2Z3YA 4I50A 1GM8A 2ZNJA 1O9HA 3OM3B 2JJCA 5D5PA 5KHIA 1M93A 1DK1A 3L9DA 1Y76B 2Q9LA 3K98A 4X64B 4ZHQB 4PRVA 2QSAA 1ZTEA 3OR7C 2EJ7A 2KB1A 5IY5C 4URMA 3ZRSA 1X4TA 2LO1A 3CRKA 3FT8A 3W7SA 4HY6A 4MVUA 4DYLA 1B06A 3ZRVA 4WF9V 4MVQA 1Z5BA 3JD0A 3CWBH 5H9CA 4XKKA 1XMQB 1K97A 4JI0B 5E79Z 2QF6A 4E00A 4DV6O 2IOPA 2BU6A 2QGNA 3K9AA 2ILMA 1Y76A 3ASOC 4BIOA 4ZHQA 1P7BA 4FLTA 3T1HO 1SQQH 4CE3A 3JATB 5BR8O 3EXAA 2IWUA 2IM9A 2EINB 1MABG 1NHJA 1I7FA 2EIJC 4J42A 3Q5JA 4GX5A 1XMOO 4X20A 4Z1MG 3AG1C 2JDIG 4BWAA 1I5DA 2ZINA 1TUEB 2DN9A 2YGAA 3VHAA 2LFSA 5CN0A 4TV9B 3A0RA 1RM1B 4O4IB 1KECA 4CH5A 4NKGB 3HKEB 3HEKA 3OE7G 4JI5O 1DLBA 1RPOA 3CGZA 3JD1A 4HAMA 2Y0IA 4V25A 5EBWC 1Q5OA 2ZDIC 2B1GA 3JATA 3LSSA 3ZHRA 4JI6B 4DUHA 4DZYA 2QDOA 3K3WA 5F2VO 2QFOA 4I55B 1UYEA 2ZE6A 2N74A 3JD4A 4I9WA 4EEHA 5IYZB 4XKOA 1VF6A 1XILA 2JS3A 1BT8A 3O9OA 4EMVA 1SQPH 4PA6A 4JI7B 2RQ6A 2WI6A 3HKDB 1EI1A 1XHXA 4HXWA 1XNQB 2ITDC 1AB3A 2YEFA 2MK3A 3ASOB 4HZ3A 1QYEA 4TV9A 2ZE8A 4O4IA 3A0XA 4GCZA 4JI1O 1AMWA 3PEHA 2EIMC 5LHGA 4DRXA 3FT5A 2EIJB 4CZZA 4O2BA 1YJNV 1JVMA 2UU9B 2ZM6O 2VQEO 4J10A 4B3RO 1OZ0A 2DOSA 2UXBB 1MSWD 4JASA 2IORA 4I55A 1QR8A 4FJCC 2Z0AA 3SPIA 1PD3A 1JX9A 5IYZA 3OW2U 4B6CA 4U7NA 5IYDO 3EFFK 1JOYA 2R9IA 3G71V 3HKDA 4EM7A 1QQCA 1BS3A 1EBOA 2GV9A 4MTGA 4EFBA 3CC2V 3MDSA 1I0HA 2CCSA 2YICA 3CC4V 1MZFA 1THNA 5IJ0A 3M8AA 4BAEA 1HNWB 1JJOA 4HYOA 2FWZA 3FX7A 5LGTA 4N23A 3CP1A 1JJ2U 4PA3A 4B3MO 2XX2A 4LP0A 3IJ4A 5IDMA 4HYPA 1GO3F 4JYBA 3R92A 3ZS8C 3CRRA 4FZ0A 2WA4A 1NKDA 2CGNA 2CTWA 3CWVA 2DWDC 2ZDIA 1I94O 4JZGA 5JJJB 2UUCB 1S5HC 4FK5C 3AG2C 4DW0A 2WI2A 4JI3O 1H8EG 4IYIA 3H01A 4XDJA 4GKJO 1ZX3A 4DUZO 2ETNA 3B2EE 1KIJA 1UY9A 4TWKA 1F4MA 1KD1W 4B7KA 1SQFA 4BIZA 2E74B 2CE4A 3RYIB 4MTOA 1YDXA 3LDEA 4O04A 2WLIA 3C0EA 4K35A 3JCZA 3ABKB 1AJPA 1I5BA 4P9PA 4KTNA 4LF9B 4NXMO 1SETA 1Y74B 1K3EA 3OTOB 1HR0O 4NTYA 1JA8A 2ODMA 4WFGA 2WLLA 5B5EZ 3B28A 3K79A 3K5LA 1M1KW 3E35A 3NMQA 3D3IA 3W7TA 3Q4HB 3U11A 4RUEA 3EHHA 4PU9A 1L8DA 3K5OA 1R6NA 2QWPB 3CCSV 2Q2EB 1KU9A 3RYIA 1AI5A 4K0KB 2WI1A 4YKUA 3OFNG 2BTZA 1XDCA 3BFRA 3JD2A 4ZVIA 4ASUG 1M57C 1N33B 3AG2B 3OUFA 4BQJA 5D6PA 2XAQA 2FKXA 2VCIA 2OT5A 4J9ZB 4KHPB 3M7MX 1ZXMA 1U96A 2BSKB 3UQ8A 4AILC 4CWTA 1AILA 1K8AW 3BM9A 1W0KG 3ZMTA 3H9VA 4FLZA 3R91A 1SKVA 1XBLA 4DR1O 1BYQA 5HFMA 1OV9A 2P6JA 2X0LA 3KE6A 2A9HA 1VQ8V 4OX9B 2XOKG 1R3IC 4UV8A 1Q6HA 3MAQA 2BSKA 3BY6A 4GZRB 3OEHG 2Y48A 4RQFA 1PL0A 5LHHA 1UJWB 2HKJA 4LFAO 1ZAUA 4DR6B 4H44B 3OMAB 2PI5A 5B66Z 1IBMO 4FCRA 1NHHA 1MSDA 1V9PA 4UVCA 3WHAA 2UXDO 4KFGA 1YSCA 1E1RG 4PDLA 5L3BA 4AWQA 1SRYA 3KCXA 2CCUA 1NT2B 2H55A 5IYBO 2XJXA 3DTUB 2QM8A 3DC6A 2WERA 5CBHA 2YKCA 4GT8A 3UT5B 4BXIA 3ETDA 1M5IA 2XK2A 3RLRA 4YKQA 2W6JG 1QLEC 3ZKDA 2YJXA 4GQTA 4KXRA 3T2SA 2ITCC 3JALA 2XCMA 3F5WC 4JAVA 3AG3C 1W59A 1YC1A 2YI9A 5JQGB 2ZBKB 3E83A 5EYPB 4GX2A 4E01A 3H1KH 1LNQA 3VQYA 2YK9A 3JSNA 2XDSA 1P49A 3RN4A 4CWPA 2OYQA 1NZ6A 3K5NA 1KKDA 1V55C 2BSMA 3CCJV 2PUSA 2YKEA 1P7GA 3BA8A 3P3NA 4Z1VA 3UT5A 2IH3C 3LDDA 2XAFA 3UCSC 4AWPA 2EBOA 4LF6O 4CS2A 3S5TA 3FV5A 1MZEA 4MBCA 4XCJA 1N8RW 2K1EA 5JQGA 1ID0A 5EYPA 1HNZO 3B8MA 4E4EA 2DW4A 3SJAC 2Q68A 2KKWA 1IXBA 3CMEV 4MTFA 1AI4A 1TH8A 4LF8B 4IGGA 4ASBA 1IX9A 4NXNO 5CA0A 4OPHA 2ARHA 5FNCA 4QE7A 5JH7B 5KLVH 2IJIA 1S5JA 5BMVA 2GTAA 1Q86W 1A4HA 2BTOA 2GUZB 2Q69A 3G7EA 2O1UA 4EEQA 1OCRC 4ICGA 3T0ZA 1Y67A 4U3FH 1Q8IA 3OMNB 2QWQB 1BKNA 1AH6A 2QM7A 4UXNA 1Q6UA 4V26A 2DMXA 4YXWG 3A0BZ 1Q90D 1K4CC 2Y4UA 2YDEA 3OMIB 2CCTA 2CUGA 4QNHB 1XMQO 4KP4A 4JI0O 1YXBA 5CMUA 4BIUA 3AK1A 5EC1C 1FPOA 1PNMA 4H13B 1R62A 3KZIZ 4E72A 2P06A 2QJ1A 5EBMC 2Q7EA 4AS9A 2JJ1G 1YERA 2E76B 3LSQA 3B09A 4L87A 1AR5A 3CB2A 2UUAB 2FMLA 5LMNB 4ABMA 4YY3B 2YE6A 5FPRA 2ZIMA 1SESA 1K7DA 2Q4PA 4LF4B 3GWOA 5M4PA 4L91A 1US6A 2R9RB 3RFRA 2Q73A 2BT0A 2YE7A 4DR7B 2BRCA 2FWYA 2CGOA 3E2EA 2PGGA 4X89A 4JI6O 4FM1A 4LH6A 4X1KA 2M7WA 2YI5A 1VF5B 3F7YC 3IFXA 5B3SC 1BMFG 4NR1A 3D0BA 1XNQO 2XDXA 4N21A
chains in the Genus database with same CATH topology
4LWEA 3ABMB 3E8HA 5LHIA 3OW6A 1AH8A 3FB8C 2IWSA 4JAUA 1YI2V 5KA5A 3P30A 2YEIA 1BGQA 1VQLV 4XC0A 2GHYA 3EHBB 1R73A 3E86A 1AJQA 5IDJA 4X88A 4ZKIA 3FYEB 3OGCC 4URNA 2DQ3A 3B77A 5B3SB 3GB7C 3VHCA 2X6AA 5L3JA 3STLC 4GFNA 3M99B 3A0TA 3RVYA 4HXZA 1I5CA 4RUFA 2VWCA 3CCUV 2YEHA 4H81A 1S0VA 3AG4C 4KUMA 3CC7V 2E0AA 2QTOA 1UY8A 2O1WA 2WI7A 1K92A 4YKRA 1KQSU 3G4SV 3T1KA 2HR3A 2X6BA 1HWYA 3ZMVA 1K5QA 4KFMA 4UVBA 3ZMSA 5J6AA 1YIJV 3LUTB 4OXSA 1UYIA 4MVSA 2YKIA 5IN9A 1VQ6V 1GK9A 1BL8A 2BU2A 2JEXA 2EINC 1VQMV 4UV9A 2YEAA 3TZ4A 5B1AB 3RLPA 3R4MA 3SPJA 1YS3A 4XDLA 1RM1C 2Q8GA 1DF5A 2DYRB 4R3AA 4L94A 2XX4A 3ABUA 3MHSC 1ORQC 2HG1A 3NXSA 3B26A 1F23A 4NH9A 4TSFG 5M4NA 1YSRA 2BOBC 1YSZA 2YE2A 1OCCB 2XHTA 1AI7A 1UYLA 3K60A 3KG2A 2YI7A 4MPCA 5CTWA 4XCLA 5H6QA 1XL4A 4W7TA 2XDKA 4XIRA 2ZDYA 3JD3A 3R4OA 3UKMA 2UXXA 4RO2A 4MOTA 1GMGA 2VCJA 4L90A 1EFRG 3G6EV 2FYPA 4XKAA 4YKXA 2XDUA 1CPYA 2WI3A 4LWGA 4YKYA 1ZW9A 3CCLV 1ENVA 2HVJC 4G27B 4MP2A 1CEZA 3INWA 2D3OW 2B1IA 3MNRP 2YI6A 3BMYA 1GM9A 4CE2A 4E2LA 1H7UA 5F5RA 4O05A 2X6CA 1YJ9V 3ZMUA 5DM6V 3CRLA 3HPLC 5BOCA 3R4PA 4G2KA 1YESA 3ABKC 4XDKA 1YT0A 1JQ0A 1NBMG 4CWOA 3OWBA 4MVZA 1NQTA 3T10A 3CYOA 4GX0A 2ZDXA 2A79B 4WFEA 4MS2A 2Z5UA 4PDVA 4H85A 1VQ9V 3HZ1A 4R1FA 2WI4A 3D36A 2YEGA 4MPEA 1MX0A 5EBLC 5D7CA 2HG5C 3Q5KA 2IWXA 3TZ5A 2OTLV 3O6OA 2XASA 1U2OA 1R6KA 4MVRA 3ZM7A 4PDMA 4FMTA 3SYQA 4O0BA 5C93A 4PRXA 2HJFC 3OWDA 3X2QB 3QNEA 1Z59A 2C2AA 4HYMA 4LC1A 2O1VA 4KQVA 1B62A 2Y69B 3ZMZA 2PNRA 2Q8IA 3K0GA 4CE1A 4PDRA 2YKBA 4BAYA 2H94A 1US7A 1ROPA 5E1AC 1QVFU 2WPDG 3RW0A 2LP7A 3ZRXA 1OCOB 5LGUA 3CCRV 3SJQC 3IC7A 4EFUA 4GX1A 3EKRA 4MVMA 1AI6A 3CCEV 5L3CA 2HFEC 2AHYA 1QR9A 1B6QA 3QO8A 1PKXA 5CF0A 4JTDB 2W0FC 2JK5C 3LDCA 1K34A 4XD8A 3B27A 1UYHA 4JF3A 1S14A 2QA4V 2DYSB 1KZNA 4UROA 4P2ZA 4EKWA 1AJ6A 3SYAA 3O0IA 4J9YB 2YGFA 3F7VC 1VQNV 2VW5A 2DWEC 4XIPA 1UYCA 2HLDG 3SPHA 4HY1A 4ASGA 4CWFA 3TK1A 4LWIA 4QIWF 4LBEC 3RKZA 4EGKA 4I3HA 2BREA 1AROP 2AKPA 3TZ2A 5FNFA 1FXHA 3JYCA 2QG0A 3VOUA 1VQ5V 4BQGA 3HYZA 2Q6AA 2YECA 1YC3A 4URLA 2YEVB 4YKZA 2A0LA 4PA4A 2WSSG 1I58A 4I5SA 5B1OA 1M90W 2JEUA 3FKSG 4WUDA 2NNUA 5B1BC 3TZ0A 2AHZA 5CA3A 1VQ7V 1F51A 3K99A 1I5YA 2X7RB 2YE5A 3R4NA 1TILA 1H8HG 2BYHA 5IYCO 2WEPA 5GW7A 2DQ0A 2HVKC 1S16A 4NH7A 3D2RA 1YT2A 1YT1A 3CCVV 1BXDA 3HB3B 4WFFA 1YTFD 3Q5LA 3ABMC 3MD0A 1W2BU 4O09A 4MPNA 4E02A 3CXCU 2GQPA 3VADA 5B1BB 3ZN0A 3IGAC 1Y4SA 3I55V 3OR6C 2QKSA 1UYGA 3T4ZA 1V54B 3K0DA 5D6QA 1U0ZA 1TBWA 5CTUA 4TT3G 1E79G 5LGNA 1OCZC 4GT1A 3SL2A 1CP9A 2PI4A 3ZJZA 4KSGA 1DTOA 1L0OA 1FXVA 1Y8PA 4DO2A 2EZOA 5KA6A 2FTKA 4UUJC 3E8GA 3LNUA 4MT8A 5M4HA 3ZKBA 3ABTA 2ZXWB 2HCHA 3ASNB 2IU0A 3INXA 2IU3A 3GIEA 4L8ZA 4ASAA 4WCEV 1FXKB 3W7UA 4FIPC 3K08A 3E8FA 5M4MA 1EZJA 1OCZB 1JPXA 1BHBA 3CGYA 1TC0A 4EGHA 1XL6A 3E89A 3T1CA 3ZXOA 3ML0A 2XABA 1IXMA 4XTJA 4LWFA 3FB7C 1S77D 5B1AC 1GKFA 2IJKA 4RQEA 2ZD9A 1WLEA 1UY6A 2YE4A 1GKXA 4WUBA 2DYRC 3QO5A 2H8MA 5BZBA 4L93A 3CPWU 1I59A 1NVPD 1RPRA 5L3DA 3G7BA 1NH2D 5D7DA 1L1FA 3HHUA 1OCCC 1QBZA 5CBFA 3LNMB 3R65A 4R3MA 2F43G 4GGLA 4H33A 2IJHA 3CD6V 4P7AA 2H8PC 5J9PC 1I5XA 1QVGU 4JPRA 3PEJA 1S76D 2XJGA 3H80A 2BOCC 2YI0A 3EHGA 2GFDA 4JTAB 2XD6A 4JTCB 4MSWC 2YSUB 1ZXNA 2CH4A 2BU8A 3B25A 1NJIW 2W6IG 3WG7C 2B5UA 2GSMB 3TCUA 4LCUC 4R7CA 1AR1B 2OCCB 4XE2A 1WPXA 2BYIA 4JGSA 3BEHA 4MB9A 2Q8FA 4P30A 3CMAV 2WI5A 1UYDA 4ASFA 4UVAA 5F3KA 4PL9A 2P90A 3AEIA 1I5AA 4HZ0A 1AJNA 1H7SA 2ATKC 3WG7B 3W7WA 5IY5B 4YKWA 3ETEA 1AM1A 2XHRA 1YITV 1Y8NA 3QTFA 1GTOA 3ZN1A 3VHDA 1QZRA 3EHJA 1PVGA 5D7RA 5B1NA 4MVOA 3A0YA 3EHFA 2CGFA 4U93A 2YE9A 3ZCCA 3GIFA 3HYYA 1R3KC 3X2QC 3AG1B 2CK3G 4JQLA 4BW5A 3OMUA 2QE7G 2XAHA 4EFTA 4CWNA 1UYKA 3IEDA 2Y69C 2WLKA 3WQ9A 2ZQMA 1Q82W 4Q20A 1K4DC 2BU7A 5J71A 2ESAA 2XHXA 2ZKJA 3TETA 4QPJA 3U2KA 5LBQA 1OCOC 4LP8A 2EIMB 2WLIB 4PELA 3OUSA 3SYCA 4LWHA 2ZR2A 2YJWA 2WLLB 3FYIB 2BU5A 5FWKA 2WLNA 2OTJV 4MW8A 1ZWHA 2HKOA 1YETA 5EK0A 4MTXA 2DYSC 5H6RA 3ETGA 4R50A 5HFLA 2YEJA 3E8BA 3K03A 4G28B 1KC8W 3B24A 1Z5AA 2P7TC 5KUMA 1UYMA 3LPSA 2BZ5A 2WWWA 1M9NA 5L3FA 1KP3A 3SPCA 5EC2C 4K4OA 4FCPA 4RAIA 1GKZA 3C11A 1SZTA 5CTXA 4QPKA 1R3JC 1E1QG 4P8OA 4XDMA 2P67A 3SPGA 3A0ZA 3OAAG 4O07A 3GIGB 5L3EA 1Y8OA 4R8CA 3PJSK 1NR1A 2WLJA 1EA6A 3SYOA 5BODA 1F4NA 1S3JA 1Y66A 4XIQA 1K9MW 1VQPV 3ZXQA 3G75A 3OPDA 4X9LA 3T2MA 1NHIA 4MP7A 1M57B 1DF4A 1P4RA 3GIGA 2WLHA 1QCEA 3ZIAG 3O2FA 5M4KA 2Q67A 4QE9A 2YGEA 1JM6A 1G8MA 3MHHC 2IOQA 5DN6G 1FFTB 3QDDA 2XJJA 4PA7A 1TIDA 2YEBA 3I56V 1K33A 3EKOA 2JIZG 4ZBMA 4H37A 4H7QA 2WEQA 4R6ZA 3HZ5A 4CWRA 2CG9A 1KP2A 1VQ4V 2YKJA 1V54C 2WAMA 2V1DA 1BHAA 2YEDA 3TTZA 2YE3A 4CWQA 2YEVA 2UWDA 1Y4UA 2JKIA 1K5SA 2UXNA 3P32A 1UY7A 1QLEB 4FPPA 2WLMA 3AG3B 3TUHA 2Q8HA 3T4DA 1Y4MA 4XITA 1H38A 2QEXV 4WFAV 4P9OA 2EZPA 4LPBA 1V55B 3ABLC 4F4LA 2ZXWC 3ASNC 3H4LA 2YE8A 2XDLA 1YHQV 4XBFA 2YK2A 1MOFA 2EIKC 1VQKV 1YTFB 2YEEA 1GJVA 1FXKC 3U67A 5CPHA 4CBCA 3B8NA 3K04A 2EILC 4JYCA 1THZA 4EGIA 3FB5C 1R3LC 5KUKA 4QJFB 4GEEA 1OCRB 3ZRWB 3RLQA 1OSFA 2XAGA 1M56C 1UYFA 1B3QA 2XX5A 3ABLB 2LFRA 4WUCA 4WFHA 1PNLA 3RVZA 2XAJA 4NH8A 1B63A 4DXWA 5FNDA 1FS0G 1ZWIC 2EIKB 1PNKA 1SERA 3ZRWA 2ZR3A 3K97A 5M4EA 3W7XA 1COWG 3CCQV 2EILB 2NLJC 1YC4A 2QG2A 2IJJA 2XNDG 1QLNA 1JCHA 3OEEG 1QY8A 1GM7A 4CWSA 2FXSA 4X8AA 3STZC 3JZ3A 1M56B 1FXKA 2IW5A 4MW3A 3U2DA 5CBGA 3WFVA 1Z5CA 3K06A 5GGZA 3T0HA 4KSHA 2EJRA 4PA9A 1OHHG 3RBZA 3CCMV 2V7QG 3VBBA 1J95A 4YKTA 1MG1A 1H2GA 4FCQA 1Q7YW 1MU5A 1VQOV 1W0JG 1YJWV 3A0WA 1S72V 2EXLA 3FB6C 2IH1C 1NVPB 3QO7A 1K73W 1Q81W 1NR7A 3UM7A 1G4YB 5CTYA 4B7PA 1NH2B 4WFBV 1TC6A 3SYPA 2K5BA 2OCCC 3DGEA 5FL7G 4U7OA 2JJ2G 5L3GA 4HZ5A 4AWOA 3AG4B 2Z3YA 1GM8A 3OM3B 2JJCA 3K98A 4PRVA 3OR7C 2KB1A 5IY5C 4URMA 3ZRSA 3CRKA 3FT8A 3W7SA 4HY6A 4MVUA 3ZRVA 4WF9V 4MVQA 1Z5BA 3JD0A 4XKKA 5H9CA 1K97A 4E00A 2QF6A 2IOPA 2BU6A 3K9AA 3ASOC 1P7BA 4CE3A 2IWUA 2EINB 1MABG 1NHJA 2EIJC 3Q5JA 4GX5A 4Z1MG 3AG1C 2JDIG 1I5DA 1TUEB 2YGAA 3VHAA 2LFSA 5CN0A 3A0RA 1RM1B 1KECA 3HEKA 3OE7G 1DLBA 1RPOA 3CGZA 3JD1A 4HAMA 4V25A 5EBWC 2ZDIC 2B1GA 3LSSA 4DZYA 4DUHA 3K3WA 2QFOA 1UYEA 3JD4A 4I9WA 4EEHA 4XKOA 4EMVA 4PA6A 2WI6A 1EI1A 4HXWA 2ITDC 2YEFA 2MK3A 3ASOB 4HZ3A 1QYEA 3A0XA 4GCZA 1AMWA 3PEHA 2EIMC 5LHGA 3FT5A 2EIJB 4CZZA 1YJNV 1JVMA 1OZ0A 1MSWD 4JASA 2IORA 1QR8A 4FJCC 3SPIA 1PD3A 1JX9A 3OW2U 4B6CA 4U7NA 5IYDO 3EFFK 1JOYA 2R9IA 3G71V 4EM7A 1EBOA 4MTGA 3CC2V 2CCSA 3CC4V 1THNA 4BAEA 4HYOA 2FWZA 5LGTA 4N23A 3CP1A 1JJ2U 4PA3A 2XX2A 4LP0A 5IDMA 4HYPA 1GO3F 4JYBA 3R92A 1NKDA 3CWVA 2DWDC 2ZDIA 1S5HC 4FK5C 3AG2C 2WI2A 1H8EG 3H01A 4XDJA 1KIJA 1UY9A 4TWKA 1F4MA 1KD1W 4BIZA 4MTOA 3LDEA 4O04A 2WLIA 3C0EA 3JCZA 3ABKB 1AJPA 1I5BA 4P9PA 4KTNA 1SETA 1K3EA 4WFGA 2WLLA 3B28A 3K79A 1M1KW 3E35A 3NMQA 3D3IA 3W7TA 4RUEA 3EHHA 4PU9A 2Q2EB 1R6NA 3CCSV 1AI5A 2WI1A 4YKUA 3OFNG 2BTZA 3JD2A 4ZVIA 4ASUG 1M57C 3AG2B 3OUFA 4BQJA 5D6PA 2XAQA 2VCIA 2OT5A 4J9ZB 1ZXMA 4CWTA 1K8AW 3BM9A 1W0KG 3ZMTA 3R91A 1BYQA 5HFMA 2P6JA 2X0LA 3KE6A 2A9HA 1VQ8V 2XOKG 1R3IC 4UV8A 3BY6A 4RQFA 3OEHG 2Y48A 1PL0A 5LHHA 1UJWB 2HKJA 3OMAB 2PI5A 4FCRA 1NHHA 4UVCA 3WHAA 4KFGA 1YSCA 1E1RG 4PDLA 5L3BA 4AWQA 1SRYA 2CCUA 2H55A 5IYBO 2XJXA 3DTUB 2QM8A 2WERA 5CBHA 2YKCA 4GT8A 4BXIA 3ETDA 2XK2A 3RLRA 4YKQA 2W6JG 1QLEC 3ZKDA 2YJXA 4GQTA 3T2SA 2ITCC 2XCMA 3F5WC 4JAVA 3AG3C 1YC1A 2ZBKB 3E83A 4GX2A 4E01A 1LNQA 2YK9A 2XDSA 4CWPA 1KKDA 1V55C 2BSMA 3CCJV 2YKEA 2IH3C 3LDDA 2XAFA 4AWPA 2EBOA 3FV5A 4MBCA 4XCJA 1N8RW 2K1EA 1ID0A 3B8MA 2DW4A 2Q68A 3CMEV 4MTFA 1AI4A 1TH8A 4ASBA 5FNCA 4QE7A 2IJIA 1Q86W 1A4HA 2Q69A 3G7EA 2O1UA 1OCRC 3T0ZA 3OMNB 1BKNA 1AH6A 2QM7A 4UXNA 4V26A 4YXWG 1K4CC 3OMIB 2CCTA 4QNHB 4KP4A 5CMUA 4BIUA 5EC1C 1PNMA 1R62A 5EBMC 4AS9A 2JJ1G 1YERA 3LSQA 4L87A 2YE6A 1SESA 1K7DA 5M4PA 3GWOA 4L91A 2R9RB 2BT0A 2YE7A 2BRCA 2FWYA 3E2EA 4X89A 2M7WA 2YI5A 3F7YC 3IFXA 5B3SC 1BMFG 3D0BA 2XDXA 4N21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LWE A;  4QPJ A;  4URM A;  3U2K A;  3CRK A;  2QG0 A;  3FT8 A;  3OW6 A;  1AH8 A;  4HY6 A;  4BQG A;  4LWH A;  2IWS A;  3ZRV A;  3HYZ A;  4JAU A;  1Z5B A;  4XKK A;  2YJW A;  2BU5 A;  5FWK A;  4E00 A;  2QF6 A;  2YEI A;  2IOP A;  1BGQ A;  2BU6 A;  4XC0 A;  2YEC A;  1YC3 A;  4URL A;  1ZWH A;  4YKZ A;  1YET A;  1I58 A;  4I5S A;  4CE3 A;  2IWU A;  5B1O A;  1NHJ A;  3Q5J A;  5IDJ A;  4WUD A;  4ZKI A;  3TZ0 A;  4MTX A;  1F51 A;  3K99 A;  4URN A;  2YE5 A;  1I5D A;  3R4N A;  3VHC A;  2YGA A;  2YEJ A;  3VHA A;  2LFS A;  5L3J A;  1TIL A;  3A0R A;  4GFN A;  3A0T A;  3HEK A;  4HXZ A;  1I5C A;  3CGZ A;  4V25 A;  2VWC A;  5FNF A;  2YEH A;  3B24 A;  4H81 A;  1Z5A A;  4DZY A;  4DUH A;  2BYH A;  2QFO A;  2WEP A;  1UYM A;  1UYE A;  2BZ5 A;  3LPS A;  2WWW A;  2E0A A;  1S16 A;  4EEH A;  4NH7 A;  3D2R A;  4K4O A;  4XKO A;  1YT2 A;  4FCP A;  4EMV A;  1YT1 A;  1UY8 A;  1GKZ A;  3C11 A;  2WI6 A;  1BXD A;  1EI1 A;  2O1W A;  4HXW A;  3Q5L A;  3MD0 A;  2YEF A;  5CTX A;  1QYE A;  2WI7 A;  3A0X A;  4QPK A;  4YKR A;  4P8O A;  4GCZ A;  4O09 A;  1AMW A;  4XDM A;  3PEH A;  3T1K A;  3FT5 A;  2P67 A;  4MPN A;  4E02 A;  2GQP A;  3VAD A;  3A0Z A;  4O07 A;  4JAS A;  2IOR A;  3GIG B;  1Y4S A;  5J6A A;  1Y8O A;  1UYI A;  4B6C A;  4U7N A;  1JOY A;  1UYG A;  2YKI A;  5IN9 A;  1EA6 A;  4EM7 A;  5D6Q A;  1U0Z A;  5BOD A;  2BU2 A;  4XIQ A;  1TBW A;  5CTU A;  3ZXQ A;  3G75 A;  2YEA A;  2CCS A;  4GT1 A;  3TZ4 A;  1THN A;  3OPD A;  3SL2 A;  4X9L A;  4BAE A;  2FWZ A;  1NHI A;  4KSG A;  3RLP A;  3R4M A;  4MP7 A;  1L0O A;  3GIG A;  1YS3 A;  2XX2 A;  1Y8P A;  4LP0 A;  2Q8G A;  4R3A A;  4L94 A;  5IDM A;  2FTK A;  2XX4 A;  4HYP A;  4JYB A;  3R92 A;  3LNU A;  4MT8 A;  5M4H A;  3ZKB A;  3O2F A;  2HG1 A;  3NXS A;  3B26 A;  3CWV A;  5M4K A;  2HCH A;  4NH9 A;  3INX A;  2YGE A;  1JM6 A;  3GIE A;  5M4N A;  1YSR A;  4L8Z A;  2WI2 A;  2IOQ A;  3QDD A;  4ASA A;  2XJJ A;  1YSZ A;  1TID A;  2YE2 A;  2YEB A;  1KIJ A;  1UY9 A;  2XHT A;  3EKO A;  1UYL A;  3K60 A;  4BIZ A;  5M4M A;  4H7Q A;  2WEQ A;  2YI7 A;  4MPC A;  5CTW A;  4XCL A;  4O04 A;  3C0E A;  3HZ5 A;  4CWR A;  3CGY A;  1TC0 A;  1I5B A;  4EGH A;  2CG9 A;  4KTN A;  3ZXO A;  2YKJ A;  4W7T A;  3B28 A;  3NMQ A;  2XAB A;  2XDK A;  2YED A;  2ZDY A;  1IXM A;  2YE3 A;  3R4O A;  4XIR A;  3TTZ A;  4XTJ A;  2UWD A;  3EHH A;  4CWQ A;  1Y4U A;  2JKI A;  4LWF A;  3P32 A;  4MOT A;  2VCJ A;  4PU9 A;  2Q2E B;  1UY7 A;  4FPP A;  2WI1 A;  4L90 A;  4YKU A;  2BTZ A;  4ZVI A;  2FYP A;  2Q8H A;  3TUH A;  4XKA A;  4XIT A;  4YKX A;  2XDU A;  4BQJ A;  2WI3 A;  4LWG A;  5D6P A;  1UY6 A;  4YKY A;  2VCI A;  2YE4 A;  1ZW9 A;  1GKX A;  4WUB A;  2H8M A;  1ZXM A;  4L93 A;  4MP2 A;  1I59 A;  3INW A;  4LPB A;  4CWT A;  3MNR P;  3BM9 A;  3G7B A;  2YI6 A;  3BMY A;  3H4L A;  4CE2 A;  2YE8 A;  2XDL A;  3R91 A;  1H7U A;  1BYQ A;  5D7D A;  2YK2 A;  5F5R A;  4O05 A;  3KE6 A;  3HHU A;  3CRL A;  2YEE A;  1GJV A;  4PRV A;  5BOC A;  3R4P A;  4R3M A;  3U67 A;  5CPH A;  1YES A;  4GGL A;  2HKJ A;  4P7A A;  4FCR A;  1NHH A;  4JYC A;  3WHA A;  1YT0 A;  4KFG A;  4CWO A;  3OWB A;  4EGI A;  4AWQ A;  3PEJ A;  4GEE A;  3T10 A;  2XJG A;  3H80 A;  3ZRW B;  2ZDX A;  2CCU A;  2H55 A;  3RLQ A;  2XJX A;  2YI0 A;  4H85 A;  1OSF A;  2QM8 A;  3EHG A;  2GFD A;  2WER A;  2YKC A;  4GT8 A;  3HZ1 A;  4R1F A;  2XD6 A;  1UYF A;  4BXI A;  1B3Q A;  2XK2 A;  2XX5 A;  2WI4 A;  4YKQ A;  3RLR A;  3D36 A;  2LFR A;  4WUC A;  3ZKD A;  2YEG A;  2YJX A;  4GQT A;  1MX0 A;  4MPE A;  1ZXN A;  3T2S A;  2XCM A;  4NH8 A;  4JAV A;  2CH4 A;  5D7C A;  1B63 A;  1YC1 A;  2BU8 A;  3Q5K A;  2ZBK B;  2IWX A;  3B25 A;  5FND A;  4E01 A;  3TZ5 A;  2YK9 A;  3O6O A;  2XDS A;  3ZRW A;  4CWP A;  3K97 A;  1U2O A;  5M4E A;  3ZM7 A;  4FMT A;  2BSM A;  4O0B A;  2YKE A;  5C93 A;  4PRX A;  3OWD A;  4AWP A;  1YC4 A;  2QG2 A;  3FV5 A;  4XE2 A;  1Z59 A;  4MBC A;  2BYI A;  2C2A A;  4XCJ A;  4MB9 A;  1ID0 A;  4HYM A;  4LC1 A;  2Q8F A;  1QY8 A;  2O1V A;  4CWS A;  2FXS A;  4KQV A;  1B62 A;  1TH8 A;  2WI5 A;  1UYD A;  2PNR A;  3JZ3 A;  2Q8I A;  4ASB A;  3U2D A;  4CE1 A;  5FNC A;  1Z5C A;  4ASF A;  2YKB A;  5GGZ A;  5F3K A;  4PL9 A;  3T0H A;  1I5A A;  1A4H A;  1US7 A;  4HZ0 A;  4KSH A;  1H7S A;  3G7E A;  2O1U A;  3T0Z A;  4YKW A;  3ZRX A;  1BKN A;  1AH6 A;  2QM7 A;  4V26 A;  1AM1 A;  2XHR A;  4YKT A;  4FCQ A;  4EFU A;  3EKR A;  1Y8N A;  1MU5 A;  2CCT A;  3QTF A;  3VHD A;  4KP4 A;  1QZR A;  4BIU A;  3EHJ A;  1PVG A;  3A0W A;  5D7R A;  5B1N A;  1R62 A;  2EXL A;  5CF0 A;  3A0Y A;  4AS9 A;  1YER A;  3EHF A;  2CGF A;  4U93 A;  2YE9 A;  4XD8 A;  3B27 A;  3ZCC A;  3GIF A;  1UYH A;  5CTY A;  4B7P A;  3HYY A;  1S14 A;  2YE6 A;  1TC6 A;  1KZN A;  2K5B A;  4URO A;  5M4P A;  4JQL A;  4L91 A;  3OMU A;  1AJ6 A;  3DGE A;  4EFT A;  2BT0 A;  4U7O A;  2YE7 A;  3O0I A;  4CWN A;  2YGF A;  2BRC A;  1UYK A;  4HZ5 A;  2FWY A;  4AWO A;  3IED A;  2VW5 A;  4XIP A;  1UYC A;  3WQ9 A;  4HY1 A;  4ASG A;  4Q20 A;  2BU7 A;  4CWF A;  3TK1 A;  2YI5 A;  4LWI A;  2JJC A;  3RKZ A;  4EGK A;  4I3H A;  2BRE A;  5J71 A;  2AKP A;  3D0B A;  3K98 A;  2ESA A;  2XHX A;  3TZ2 A;  2XDX A;  2ZKJ A; 
#chains in the Genus database with same CATH topology
 4LWE A;  3ABM B;  3E8H A;  5LHI A;  1KBH A;  3OW6 A;  1AH8 A;  4JI8 B;  4JI4 B;  2UU9 O;  4ZI7 B;  1VP7 A;  1MA1 A;  4FLU A;  1WN7 A;  3FB8 C;  2IWS A;  2UXB O;  4JAU A;  5FNV B;  1YI2 V;  1BSM A;  5IJ9 A;  1FFX A;  5KA5 A;  3P30 A;  1GN3 A;  2YEI A;  1BGQ A;  5JJN B;  1VQL V;  4XC0 A;  5H2F Z;  3K5M A;  2N05 A;  4EB6 A;  2GHY A;  2YC0 A;  3EHB B;  3ZHV A;  1R73 A;  3E86 A;  1TUB B;  1AJQ A;  4B7E A;  3G67 A;  5IDJ A;  4X88 A;  4ZKI A;  4DUY B;  4ZI7 A;  3FYE B;  4DV5 O;  1HNW O;  3RYF B;  3OGC C;  4FZ1 A;  2VWK A;  4URN A;  5FNV A;  2DQ3 A;  3B77 A;  5B3S B;  3IAY A;  1T5E A;  3GB7 C;  3VHC A;  2DJV A;  2X6A A;  5L3J A;  4X1I B;  3STL C;  4GFN A;  4X1Y B;  3M99 B;  3A0T A;  3RVY A;  4HXZ A;  1I5C A;  4RUF A;  2VWC A;  3CCU V;  4DR5 B;  2YEH A;  4H81 A;  1FKA O;  1S0V A;  1EZV H;  1HP8 A;  3AG4 C;  4KUM A;  3CC7 V;  3CSX A;  2XT9 A;  2YIB A;  4BW9 A;  2E0A A;  2QTO A;  5EIB C;  2UUC O;  4DV0 O;  3RYF A;  5LMU B;  1UY8 A;  4UCV A;  2O1W A;  5EZY A;  5JEN A;  1MMM A;  2XTA A;  1SC5 B;  4X1I A;  2WI7 A;  1H2M A;  1SQV H;  1K92 A;  3A0H Z;  4YKR A;  1KQS U;  3G4S V;  3TXQ A;  3T1K A;  2HR3 A;  2X6B A;  4JI2 B;  1HWY A;  1RSO B;  1R6T A;  3ZMV A;  1K5Q A;  4CH3 A;  4KFM A;  4LF9 O;  3OTO O;  4UVB A;  3ZMS A;  5J6A A;  1YIJ V;  2A7W A;  3LUT B;  2GBO A;  2OIE A;  4OXS A;  1UYI A;  4MVS A;  1Y6X A;  2YKI A;  5IN9 A;  1VQ6 V;  1GK9 A;  1BL8 A;  3QTC A;  1GH6 A;  2BU2 A;  2JEX A;  2EIN C;  4JZ2 A;  1VQM V;  4UV9 A;  2YEA A;  3TZ4 A;  5B1A B;  1RSO A;  1TVK A;  3R4M A;  3RLP A;  1N33 O;  2YIA A;  3SPJ A;  5BY1 A;  2QKA A;  4B3T O;  1YS3 A;  4XDL A;  2CAZ C;  2RDC A;  1RM1 C;  4KHP O;  2Q8G A;  1DF5 A;  2DYR B;  4R3A A;  2KSD A;  3AK2 A;  4L94 A;  2XX4 A;  4DR4 B;  3ABU A;  3MHS C;  5KHK A;  1ZL8 B;  1ZSP A;  1ORQ C;  4X62 O;  1I08 A;  5LYJ B;  2HG1 A;  3NXS A;  3B26 A;  2ZKO A;  1F23 A;  3TGU H;  4LFB B;  4TSF G;  4NH9 A;  5LA6 B;  2CTP A;  5M4N A;  1YSR A;  2YUA A;  2BOB C;  3P3P A;  1RP3 B;  1YSZ A;  3RYC B;  2YE2 A;  2CTQ A;  1OCC B;  1G6U A;  1LR1 A;  2XHT A;  1AI7 A;  1N0J A;  1UYL A;  3KG2 A;  3K60 A;  3FAV B;  3BCC H;  2YI7 A;  4MPC A;  5CTW A;  1ZL8 A;  5CB4 B;  4XCL A;  2QWO B;  4OPA A;  1WP7 A;  2NN4 A;  5H6Q A;  1XL4 A;  5IWA B;  5LA6 A;  1IBL O;  4W7T A;  2Q7H A;  1NTZ H;  2XDK A;  2ZDY A;  4XIR A;  3JD3 A;  3R4O A;  3UKM A;  1JR9 A;  2UXX A;  4RO2 A;  2ADP A;  1GMG A;  4MOT A;  2VCJ A;  5LXT B;  2OWO A;  4UCU A;  4L90 A;  1EFR G;  5KHG A;  3G6E V;  2FYP A;  2M6Y A;  4XKA A;  3RGB A;  4YKX A;  2XDU A;  1CPY A;  2WI3 A;  3DC5 A;  4LWG A;  4YKY A;  3BPZ A;  1N36 B;  3PN1 A;  1ZW9 A;  3CCL V;  3T1Y B;  4UFZ A;  2FL4 A;  1ENV A;  2HVJ C;  1WNS A;  4G27 B;  4J41 A;  4MP2 A;  2AZ2 A;  1CEZ A;  1HNX B;  3INW A;  3HKE A;  2D3O W;  2B1I A;  3MNR P;  2YS8 A;  4TV8 B;  3A8T A;  1L0N H;  2N04 A;  4B08 A;  2YI6 A;  3BMY A;  1GM9 A;  5LXT A;  4CE2 A;  4E2L A;  1H7U A;  4AQY B;  5F5R A;  4O05 A;  2X6C A;  1YJ9 V;  3ZMU A;  5DM6 V;  3CRL A;  4FLX A;  2RCV A;  1Q3E A;  3HPL C;  5A9G A;  1PV0 A;  5BOC A;  3R4P A;  4G2K A;  1YES A;  1BE3 H;  3IC9 A;  4PD4 F;  3ABK C;  3DSQ A;  4TV8 A;  3ICX A;  4XDK A;  1YT0 A;  3S3X A;  1JQ0 A;  1NBM G;  4PI2 A;  4CWO A;  3OWB A;  4MVZ A;  4FVM A;  1NQT A;  3OT7 A;  3T10 A;  3CYO A;  4GX0 A;  2ZDX A;  3CYG A;  2Q5Z A;  2A79 B;  4WFE A;  4JV5 O;  4MS2 A;  4Q6G A;  1QNM A;  2Z5U A;  4PDV A;  4DV7 B;  4LF7 B;  4H85 A;  3N2K B;  1VQ9 V;  3HZ1 A;  4R1F A;  5FLX N;  2WI4 A;  3D36 A;  4O2A B;  1UFI A;  2YEG A;  4MPE A;  5TIS Z;  1MX0 A;  5EBL C;  2G38 A;  5D7C A;  4I9Q A;  2HG5 C;  3H1H H;  3Q5K A;  2IWX A;  4FFB B;  3TZ5 A;  4HNA B;  2OTL V;  2XAS A;  3O6O A;  1U2O A;  1R6K A;  4MVR A;  3ZM7 A;  4PDM A;  4FMT A;  3SYQ A;  1H2K A;  2YID A;  3N2K A;  4O0B A;  2PY5 A;  5C93 A;  4PRX A;  5LMN O;  3APO A;  3H1I H;  2HJF C;  3KKY A;  4YY3 O;  3OWD A;  1RFY A;  1N34 O;  4O2A A;  3B40 A;  3X2Q B;  3QNE A;  1Z59 A;  2C2A A;  4JYA B;  4HYM A;  4LC1 A;  1NTM H;  4DR7 O;  2O1V A;  4HNA A;  4KQV A;  1B62 A;  2Y69 B;  3ZMZ A;  2PNR A;  2Q8I A;  5GTI Z;  3K0G A;  4CE1 A;  4PDR A;  3KCY A;  2PYL A;  4BAY A;  2YKB A;  1BQZ A;  4RWU A;  3ETQ A;  2H94 A;  1N4C A;  1US7 A;  5J2U B;  1ROP A;  5E1A C;  4CS4 A;  3F5T A;  4C7U A;  1XOU A;  2ZT9 B;  2Y0P A;  1QVF U;  1PL4 A;  1Y74 A;  2WPD G;  3RW0 A;  2LP7 A;  3ZRX A;  4O4H B;  1OCO B;  5LGU A;  5ITZ B;  1QU7 A;  3CCR V;  4W4L A;  4JI4 O;  4JI8 O;  2EUL A;  2QR4 A;  1BQ0 A;  3Q4H A;  3SJQ C;  3IC7 A;  4EFU A;  1IUR A;  4GX1 A;  2LQT A;  3EKR A;  4DV3 B;  3U10 A;  4MVM A;  1AI6 A;  1SQB H;  2LGW A;  3CCE V;  5L3C A;  2HFE C;  2AHY A;  1QR9 A;  1B6Q A;  5LP6 B;  3QO8 A;  5J2U A;  1PKX A;  3JCU Z;  3NR7 A;  5CF0 A;  2AGA A;  4JTD B;  2W0F C;  2JK5 C;  3LDC A;  1WJZ A;  4JAA A;  1K34 A;  4O4H A;  4XD8 A;  3EVK A;  3B27 A;  5ITZ A;  1UYH A;  4JF3 A;  2C1I A;  4X66 B;  1S14 A;  5KHH A;  1TAE A;  2QA4 V;  2BTQ B;  4FM0 A;  2PZS A;  2DYS B;  1KZN A;  4URO A;  4P2Z A;  4EKW A;  4B3S O;  1AJ6 A;  4DV6 B;  3SYA A;  3O0I A;  2E75 B;  5LP6 A;  4J9Y B;  2YGF A;  1YZB A;  5KMG B;  3F7V C;  1VQN V;  5BR8 B;  5IE9 A;  2VW5 A;  2DWE C;  4XIP A;  1UYC A;  1EN5 A;  2HLD G;  3SPH A;  4BR6 A;  4TQD A;  4HY1 A;  4ASG A;  2CTR A;  5JJE B;  4CWF A;  3TK1 A;  4LWI A;  1XRE A;  4QIW F;  4LBE C;  3RKZ A;  4DW1 A;  4I3H A;  4EGK A;  2BTQ A;  1WB8 A;  4IIJ B;  2BRE A;  1ARO P;  2AKP A;  3SJC C;  4PHZ A;  1FXH A;  3TZ2 A;  5FNF A;  2F4V B;  5LL6 Y;  4Z2W A;  4JI5 B;  3JYC A;  4UCS A;  2QG0 A;  1XEQ A;  3VOU A;  5KMG A;  1SA0 B;  1VQ5 V;  4YIO A;  4BQG A;  3L72 H;  3HYZ A;  4F6E A;  5BXZ A;  3K57 A;  2PTM A;  4LNU B;  1JMK C;  3B4S A;  2Q6A A;  2F95 B;  3APQ A;  4UCT A;  2YEC A;  4IIJ A;  1YC3 A;  4URL A;  2YEV B;  4JYY A;  4YKZ A;  2A0L A;  4PA4 A;  2WSS G;  1I58 A;  4I5S A;  1Z5W A;  4JI1 B;  5B1O A;  1M90 W;  2JEU A;  2PF4 E;  3FKS G;  1CXZ B;  3JAR B;  2P22 C;  4WUD A;  2ADQ B;  2NNU A;  5B1B C;  3TZ0 A;  1XQ8 A;  2L6L A;  2AHZ A;  5DED A;  5CA3 A;  1SA0 A;  1F51 A;  1VQ7 V;  3UO3 A;  3K99 A;  1I5Y A;  2X7R B;  4DV1 B;  2YE5 A;  3R4N A;  4CC5 A;  4X64 O;  1TIL A;  1GRJ A;  2BCC H;  2XHB A;  4DR4 O;  1D2D A;  5GON B;  4TOI A;  3THO A;  2JVD A;  2RN9 A;  1H8H G;  2BYH A;  5IYC O;  2Q8V A;  2WEP A;  5GW7 A;  2DQ0 A;  2HVK C;  1S16 A;  4NH7 A;  4NTW A;  3D2R A;  1YT2 A;  5JH7 A;  1YT1 A;  2ZE7 A;  3CCV V;  2A3Q A;  4B3M B;  5K1P A;  1BXD A;  3HB3 B;  4WFF A;  1YTF D;  3Q5L A;  2GUZ A;  3ABM C;  3MD0 A;  1W2B U;  1NTK H;  1LUW A;  4IT5 A;  2KG7 B;  4O09 A;  2OIG A;  4DR3 B;  1G1X B;  4MPN A;  5A2Q N;  4E02 A;  3CXC U;  2GQP A;  5GON A;  3VAD A;  5B1B B;  3ZN0 A;  3LNN A;  3CEI A;  3IGA C;  3RYH B;  1Y4S A;  3LSU A;  3I5D A;  3JAK B;  5IWA O;  3I55 V;  4JI3 B;  3OR6 C;  2QKS A;  1UYG A;  1WAZ A;  1AP5 A;  3T4Z A;  1V54 B;  5LOV B;  3K0D A;  5D6Q A;  1U0Z A;  1TBW A;  2HJD A;  1SF9 A;  5CTU A;  3WB1 A;  4TT3 G;  3JAW B;  1E79 G;  4IYH A;  5LGN A;  1OCZ C;  2R9A A;  4GT1 A;  3SL2 A;  4LWS B;  3ZHS A;  1CP9 A;  3BVO A;  2PI4 A;  3ZJZ A;  1Z2G A;  4KSG A;  1R1B A;  1DTO A;  3RYH A;  1L0O A;  4JI7 O;  3H1L H;  3JAK A;  1FXV A;  1Y8P A;  4FLY A;  3VQW A;  3T1Y O;  4ZOL B;  4DO2 A;  2EZO A;  5KA6 A;  2ZNI A;  2FTK A;  1BGY H;  1O9G A;  1HNX O;  4UUJ C;  3E8G A;  3LNU A;  5LOV A;  4NYK A;  4MT8 A;  5M4H A;  3ZKB A;  1XHZ A;  2K9P A;  3ABT A;  3E22 B;  2ZXW B;  4PV1 B;  2HCH A;  3ASN B;  3N2G B;  1NI8 A;  3VQV A;  2IU0 A;  3INX A;  2IU3 A;  4EFE A;  3GIE A;  4LWS A;  4AQY O;  4L8Z A;  3J81 N;  4ASA A;  4GLX A;  4WCE V;  1MNG A;  4D6T H;  3O65 A;  4TUY B;  4D7T A;  1FXK B;  3W7U A;  4ZOL A;  4FIP C;  3K08 A;  3CRC A;  3E8F A;  2YIB D;  3C3S A;  5M4M A;  1YCI A;  3JAM N;  1EZJ A;  4LH7 A;  1OCZ B;  1JPX A;  5IT9 N;  1PM9 A;  3JAS B;  1BHB A;  1SS3 A;  3CGY A;  1TC0 A;  4EGH A;  1XL6 A;  3CRQ A;  3E89 A;  3T1C A;  4D7S A;  2KQX A;  4K3A A;  2RNB A;  3ZXO A;  2AZ0 A;  3ML0 A;  2AW9 A;  4DV7 O;  4LF7 O;  1N0N A;  2XAB A;  4F6R B;  1IXM A;  4U3J B;  4XTJ A;  1HDJ A;  4TUY A;  4LWF A;  3FB7 C;  1TUB A;  1S77 D;  5B1A C;  2LGQ A;  1GKF A;  1IBM B;  3G80 A;  3JAS A;  2IJK A;  4RQE A;  2ZD9 A;  2WA3 A;  1WLE A;  5GTH Z;  4J7Z A;  1UY6 A;  4J80 A;  2YE4 A;  1GKX A;  4WUB A;  2DYR C;  3QO5 A;  2H8M A;  1JFF B;  3TXS A;  5BZB A;  4L93 A;  4I0X B;  3CPW U;  1I59 A;  4X1Y A;  1NVP D;  1RPR A;  5KX5 B;  1HW7 A;  5L3D A;  4F6R A;  4AI8 A;  4DR2 B;  3ZHQ A;  4YHH B;  3G7B A;  1NH2 D;  1FD9 A;  5D7D A;  1XNR B;  4PJ0 Z;  4JYA O;  3J80 N;  1L1F A;  3HHU A;  3CE2 A;  1OCC C;  1QBZ A;  2Y4T A;  5CBF A;  3H1J H;  2RJZ A;  3UO2 A;  3LNM B;  3R65 A;  4R3M A;  2F43 G;  4I0X A;  3BRC A;  4GGL A;  4H33 A;  2IJH A;  5KX5 A;  4K0K O;  1H2S B;  3CD6 V;  4P7A A;  2HHI A;  2H8P C;  5J9P C;  1I5X A;  1QVG U;  4JPR A;  4UB6 Z;  1NU1 H;  3PEJ A;  1S76 D;  2XJG A;  3H80 A;  1D5N A;  2BOC C;  4DV4 B;  1XUQ A;  3HKC B;  2YI0 A;  3EHG A;  2GFD A;  4JTA B;  2XD6 A;  4JTC B;  4MSW C;  2GTS A;  2YSU B;  4DV3 O;  1PP9 H;  2MW2 B;  3GVM A;  4GKK B;  4QGP A;  1YF2 A;  1ZXN A;  2CH4 A;  5K1X A;  2BU8 A;  1X59 A;  3B25 A;  1NJI W;  2UXC B;  2W6I G;  3WG7 C;  2B5U A;  1QHT A;  2LW1 A;  2UUB B;  3CJH B;  5JCO C;  4OX9 O;  2GSM B;  3HKC A;  3RWR D;  1BZK A;  2HHH B;  3TCU A;  4X20 B;  4X66 O;  3L75 H;  4LCU C;  4R7C A;  4DR6 O;  5LYJ A;  1AR1 B;  2VS0 A;  4LFC B;  2OCC B;  1J5E B;  4XE2 A;  1WPX A;  2FYU H;  1M4U A;  2BYI A;  4JGS A;  3BEH A;  1WPB A;  4MB9 A;  2E5L B;  2Q8F A;  2R70 A;  2QWN B;  4P30 A;  3RYC A;  3CX5 F;  3CMA V;  4H0L B;  3D36 C;  2WI5 A;  1UYD A;  3CJH A;  3N27 A;  4O4J B;  3S3W A;  3FAV A;  4ASF A;  4UVA A;  5F3K A;  4PL9 A;  2P90 A;  5CB4 A;  3AEI A;  3VQX A;  1I5A A;  4HZ0 A;  2HEP A;  1AJN A;  1H7S A;  2ATK C;  3WG7 B;  4YJ3 B;  3WU2 Z;  2F4V O;  3SR2 C;  2RMK B;  3W7W A;  3L74 H;  5JVD B;  5IY5 B;  4YKW A;  2A06 H;  4DRX B;  3ETE A;  4O2B B;  1IBK B;  1AM1 A;  2XHR A;  2QWR B;  1YIT V;  2L35 A;  4GUN A;  1Y8N A;  3QTF A;  1GTO A;  3ZN1 A;  5KHJ A;  4O4J A;  3VHD A;  3RT3 C;  1QZR A;  3EHJ A;  1PVG A;  3C3T A;  1KYO F;  3BAA A;  5D7R A;  5B1N A;  3BHP A;  4UB8 Z;  3R66 A;  2AXT Z;  2O57 A;  3HKB B;  4MVO A;  3A0Y A;  2VQF B;  2F93 B;  4YJ3 A;  5JWP A;  3EHF A;  5JVD A;  2CGF A;  4LF8 O;  2B9Z A;  4CH4 A;  4FLW A;  4U93 A;  2YE9 A;  5IJ0 B;  5C8Y B;  1FYJ A;  5JCO A;  3ZCC A;  3GIF A;  3FFQ A;  3HYY A;  1FJG B;  1EM1 A;  4DV1 O;  1R3K C;  3X2Q C;  4NTX A;  3AG1 B;  1SQG A;  2ZCE A;  2CK3 G;  4JQL A;  3BA9 A;  1UPG A;  4BW5 A;  3OMU A;  2QE7 G;  2XAH A;  4EFT A;  4CWN A;  1ZLZ A;  3HKB A;  4K8Z A;  1UYK A;  1TGO A;  3IED A;  2Y69 C;  2WLK A;  3WQ9 A;  2PYJ A;  3BAB A;  1P84 F;  2ZQM A;  1Q82 W;  4DV5 B;  4Q20 A;  5C8Y A;  1K4D C;  2BU7 A;  1YVW A;  1PPJ H;  5J71 A;  3QF7 A;  2ESA A;  1D5A A;  2XHX A;  2ZKJ A;  3J7A U;  3TET A;  4QPJ A;  1EN4 A;  3U2K A;  1KKC A;  5LBQ A;  1OCO C;  4LP8 A;  4DR3 O;  1GN6 A;  2EIM B;  2WLI B;  4PI0 A;  4PEL A;  1IDS A;  3OUS A;  2P5O A;  4ZIB A;  3SYC A;  4LWH A;  2UUA O;  2W0X A;  2ZR2 A;  2E3C A;  2JGD B;  4DV0 B;  2YJW A;  2WLL B;  3FYI B;  2BU5 A;  4LF4 O;  1NS1 A;  4DV2 B;  2Q7G A;  5FWK A;  2WLN A;  4LF5 B;  3WB2 A;  2OTJ V;  4X65 B;  5LP6 C;  2JGU A;  4MW8 A;  1ZWH A;  2HKO A;  4J11 A;  3WB0 A;  4HBN A;  1YET A;  4FFB A;  2EX3 A;  5EK0 A;  1IZ3 A;  1N32 B;  1H2N A;  1BCC H;  4MTX A;  2ZIO A;  2DYS C;  5H6R A;  3ETG A;  4O4L B;  4FLV A;  2JGD A;  4DK0 A;  4R50 A;  5HFL A;  3CXH F;  5H5N A;  2YEJ A;  3E8B A;  3K03 A;  4G28 B;  1KC8 W;  1B04 A;  3B24 A;  2YXH A;  2CH7 B;  4NVP A;  1Z5A A;  3OD4 A;  2P7T C;  5KUM A;  1UYM A;  3LPS A;  2BZ5 A;  3SJB C;  1VF7 A;  2WWW A;  1M9N A;  5L3F A;  4WBN B;  1KP3 A;  1LUV A;  3SPC A;  5EC2 C;  4K4O A;  4FCP A;  4B3T B;  4RAI A;  1GKZ A;  3C11 A;  2QTS A;  2F23 A;  5AG2 A;  2YI8 A;  2H3O A;  3AG7 A;  4O4L A;  3CRM A;  1SZT A;  5CTX A;  4A5U B;  2P4V A;  3C90 A;  4QPK A;  1R3J C;  1E1Q G;  4P8O A;  4X62 B;  4XDM A;  4L8J A;  3G6B A;  2P67 A;  2YXY A;  3L71 H;  2LW7 A;  3SPG A;  3ZBH A;  2QM4 A;  4DUY O;  3A0Z A;  1GN2 A;  3OAA G;  2CH7 A;  3L73 H;  4O07 A;  1Q6I A;  3GIG B;  5L3E A;  1Y8O A;  1ZUQ A;  4R8C A;  4WBN A;  5FPO A;  1L0L H;  3PJS K;  1WP8 A;  3JSL A;  1NR1 A;  2WLJ A;  1EA6 A;  3SYO A;  5BOD A;  1F4N A;  1S3J A;  1Y66 A;  3T1H B;  4XIQ A;  1K9M W;  1VQP V;  4J7J A;  3G75 A;  3ZXQ A;  4DR5 O;  4AHC A;  3JAL B;  4I7Z B;  3OPD A;  1XMO B;  3QVN A;  4X9L A;  4UCO A;  3T2M A;  1VEW A;  1NHI A;  3CS5 A;  4MP7 A;  1M57 B;  1DF4 A;  1EN6 A;  1P4R A;  5LMU O;  3GIG A;  3L70 H;  1VIB A;  1IBL B;  1AVM A;  2WLH A;  1QCE A;  4DK1 A;  1GAX A;  3ZIA G;  2F66 C;  3O2F A;  4DR2 O;  4JI2 O;  2LJ2 A;  4YHH O;  1AP6 A;  5M4K A;  3OGI B;  2Q0A A;  2Q67 A;  3ZHU A;  4QE9 A;  2ZE5 A;  5J2T B;  1DGS A;  2YGE A;  1JM6 A;  1G8M A;  1XNR O;  4FM2 A;  1VMG A;  3MHH C;  2IOQ A;  5DN6 G;  1FFT B;  3QDD A;  2XJJ A;  3AK3 A;  4PA7 A;  3GWK C;  1TID A;  2YEB A;  5KAF Z;  5CA0 B;  3I56 V;  1K33 A;  3EKO A;  2JIZ G;  4ZBM A;  3TJT A;  4H37 A;  4H7Q A;  2WEQ A;  4R6Z A;  2OCH A;  4KL1 A;  5BMV B;  1OJH A;  2ZM6 B;  2D2C B;  2VQE B;  4B3R B;  3HZ5 A;  4CWR A;  2CG9 A;  1H2L A;  1KP2 A;  5J2T A;  2FB5 A;  1VQ4 V;  3D8C A;  4LNU A;  2YKJ A;  4DV4 O;  1F7Y A;  2BE3 A;  1KMI Z;  4LR3 A;  1V54 C;  1AR4 A;  2WAM A;  2V1D A;  1BHA A;  2YED A;  2VWJ A;  2YE3 A;  3TTZ A;  4CWQ A;  2YEV A;  2UWD A;  1XI1 A;  1Y4U A;  2JKI A;  1K5S A;  2UXN A;  4GYC B;  3P32 A;  2DE0 X;  3A2F A;  1UY7 A;  4GKK O;  2HP8 A;  1QLE B;  4FPP A;  2WLM A;  3JAR A;  4LFB O;  2F1M A;  3AG3 B;  3TUH A;  2Q8H A;  3T4D A;  1Y4M A;  2UXC O;  4XIT A;  1H38 A;  2QEX V;  4JV5 B;  4WFA V;  2UUB O;  4P9O A;  2EZP A;  4LPB A;  1V55 B;  2HHH O;  3ABL C;  3K9S A;  4F4L A;  3HR0 A;  2ZXW C;  3ASN C;  3H4L A;  1I94 B;  4LFC O;  1URF A;  1J5E O;  2YE8 A;  2XDL A;  1YHQ V;  4XBF A;  2YK2 A;  1MOF A;  2EIK C;  1KB9 F;  3ZX6 A;  1VQK V;  2E5L O;  4GKJ B;  1YEW A;  1YTF B;  3ZED A;  2YEE A;  3LMM A;  4DUZ B;  1GJV A;  1FXK C;  3CRA A;  4X1K B;  1TA8 A;  3U67 A;  5CPH A;  4CBC A;  4OGQ B;  4YJ2 B;  2KG7 A;  3B8N A;  3K59 A;  5KAI Z;  1N34 B;  3K04 A;  2EIL C;  4JYC A;  4K8X A;  3DXR B;  1THZ A;  1SZX A;  4EGI A;  2V4D A;  1R3L C;  1U97 A;  3FB5 C;  5KUK A;  4NXM B;  4I4T B;  1HR0 B;  4QJF B;  4GEE A;  1OCR B;  3ZRW B;  1N36 O;  3D3Q A;  3RLQ A;  3CHX A;  4UCR A;  1OSF A;  2QKC A;  1IBK O;  2YXL A;  2XAG A;  2IBZ H;  5DEC A;  1M56 C;  1UYF A;  1B3Q A;  2XX5 A;  5IJ9 B;  1FFX B;  2LFR A;  3ABL B;  4WFH A;  4WUC A;  1WB7 A;  3JAW A;  4YJ2 A;  1PNL A;  3RVZ A;  2XAJ A;  4NH8 A;  1A32 A;  1B63 A;  4EB6 B;  4DXW A;  1WA8 B;  5FND A;  3DXR A;  1FS0 G;  1ZWI C;  2EIK B;  1SQX H;  1PNK A;  2VQF O;  4I4T A;  4W4K A;  2JS5 A;  1SER A;  2CDY A;  2ZR3 A;  3ZRW A;  3K97 A;  5M4E A;  3W7X A;  1COW G;  4CS3 A;  2GDS A;  1FJG O;  3CCQ V;  3OTF A;  2EIL B;  3E22 A;  2NLJ C;  1YC4 A;  2QG2 A;  2IJJ A;  2XND G;  3N2G A;  4DR1 B;  1QLN A;  2JRI A;  2R72 A;  1WA8 A;  1JCH A;  3OEE G;  1QY8 A;  1GM7 A;  4CWS A;  2FXS A;  4X8A A;  1Z5V A;  3QG5 A;  3STZ C;  2Q0O C;  3JZ3 A;  1M56 B;  1FXK A;  2IW5 A;  4MW3 A;  3U2D A;  3K58 A;  5CBG A;  3WFV A;  1Z5C A;  4LFA B;  3K06 A;  5GGZ A;  3T0H A;  5EZY B;  2UXD B;  4KSH A;  2EJR A;  4PA9 A;  4B3S B;  1OHH G;  5D5Q A;  3RBZ A;  3CCM V;  1VAR A;  4CC6 A;  4IHJ B;  2V7Q G;  3VBB A;  5CA1 B;  1J95 A;  3U0Z A;  1FAF A;  4YKT A;  2NR5 A;  1MG1 A;  1H2G A;  4FCQ A;  1Q7Y W;  4NB5 A;  4U3J A;  2P4K A;  1MU5 A;  1VQO V;  1W0J G;  4J7K A;  1GN4 A;  4DV2 O;  4CH6 A;  4LF5 O;  1IVS A;  1KUQ A;  4X65 O;  1YJW V;  3A0W A;  4X9Q A;  4IL6 Z;  3SDL A;  1S72 V;  2EXL A;  3FD9 A;  3FB6 C;  1N32 O;  2IH1 C;  4IHJ A;  1S5L Z;  2XUM A;  3QO7 A;  1JFF A;  4YIP A;  5CA1 A;  1NVP B;  1Q81 W;  1K73 W;  1NR7 A;  4I50 B;  3UM7 A;  1TVK B;  1G4Y B;  5CTY A;  4B7P A;  1NH2 B;  4WFB V;  5EIB D;  1TC6 A;  4TQF A;  3SYP A;  2K5B A;  4LF6 B;  2OCC C;  4FFK A;  3SGI A;  3DGE A;  3ZHT A;  5FL7 G;  4U7O A;  2JJ2 G;  1HNZ B;  5L3G A;  2C1G A;  4HZ5 A;  4AWO A;  2VRZ A;  3AG4 B;  4NXN B;  1VF6 C;  1Q43 A;  2Z3Y A;  4I50 A;  1GM8 A;  2ZNJ A;  1O9H A;  3OM3 B;  2JJC A;  5D5P A;  5KHI A;  1M93 A;  1DK1 A;  3L9D A;  1Y76 B;  2Q9L A;  3K98 A;  4X64 B;  4ZHQ B;  4PRV A;  2QSA A;  1ZTE A;  3OR7 C;  2EJ7 A;  2KB1 A;  5IY5 C;  4URM A;  3ZRS A;  1X4T A;  2LO1 A;  3CRK A;  3FT8 A;  3W7S A;  4HY6 A;  4MVU A;  4DYL A;  1B06 A;  3ZRV A;  4WF9 V;  4MVQ A;  1Z5B A;  3JD0 A;  3CWB H;  5H9C A;  4XKK A;  1XMQ B;  1K97 A;  4JI0 B;  5E79 Z;  2QF6 A;  4E00 A;  4DV6 O;  2IOP A;  2BU6 A;  2QGN A;  3K9A A;  2ILM A;  1Y76 A;  3ASO C;  4BIO A;  4ZHQ A;  1P7B A;  4FLT A;  3T1H O;  1SQQ H;  4CE3 A;  3JAT B;  5BR8 O;  3EXA A;  2IWU A;  2IM9 A;  2EIN B;  1MAB G;  1NHJ A;  1I7F A;  2EIJ C;  4J42 A;  3Q5J A;  4GX5 A;  1XMO O;  4X20 A;  4Z1M G;  3AG1 C;  2JDI G;  4BWA A;  1I5D A;  2ZIN A;  1TUE B;  2DN9 A;  2YGA A;  3VHA A;  2LFS A;  5CN0 A;  4TV9 B;  3A0R A;  1RM1 B;  4O4I B;  1KEC A;  4CH5 A;  4NKG B;  3HKE B;  3HEK A;  3OE7 G;  4JI5 O;  1DLB A;  1RPO A;  3CGZ A;  3JD1 A;  4HAM A;  2Y0I A;  4V25 A;  5EBW C;  1Q5O A;  2ZDI C;  2B1G A;  3JAT A;  3LSS A;  3ZHR A;  4JI6 B;  4DUH A;  4DZY A;  2QDO A;  3K3W A;  5F2V O;  2QFO A;  4I55 B;  1UYE A;  2ZE6 A;  2N74 A;  3JD4 A;  4I9W A;  4EEH A;  5IYZ B;  4XKO A;  1VF6 A;  1XIL A;  2JS3 A;  1BT8 A;  3O9O A;  4EMV A;  1SQP H;  4PA6 A;  4JI7 B;  2RQ6 A;  2WI6 A;  3HKD B;  1EI1 A;  1XHX A;  4HXW A;  1XNQ B;  2ITD C;  1AB3 A;  2YEF A;  2MK3 A;  3ASO B;  4HZ3 A;  1QYE A;  4TV9 A;  2ZE8 A;  4O4I A;  3A0X A;  4GCZ A;  4JI1 O;  1AMW A;  3PEH A;  2EIM C;  5LHG A;  4DRX A;  3FT5 A;  2EIJ B;  4CZZ A;  4O2B A;  1YJN V;  1JVM A;  2UU9 B;  2ZM6 O;  2VQE O;  4J10 A;  4B3R O;  1OZ0 A;  2DOS A;  2UXB B;  1MSW D;  4JAS A;  2IOR A;  4I55 A;  1QR8 A;  4FJC C;  2Z0A A;  3SPI A;  1PD3 A;  1JX9 A;  5IYZ A;  3OW2 U;  4B6C A;  4U7N A;  5IYD O;  3EFF K;  1JOY A;  2R9I A;  3G71 V;  3HKD A;  4EM7 A;  1QQC A;  1BS3 A;  1EBO A;  2GV9 A;  4MTG A;  4EFB A;  3CC2 V;  3MDS A;  1I0H A;  2CCS A;  2YIC A;  3CC4 V;  1MZF A;  1THN A;  5IJ0 A;  3M8A A;  4BAE A;  1HNW B;  1JJO A;  4HYO A;  2FWZ A;  3FX7 A;  5LGT A;  4N23 A;  3CP1 A;  1JJ2 U;  4PA3 A;  4B3M O;  2XX2 A;  4LP0 A;  3IJ4 A;  5IDM A;  4HYP A;  1GO3 F;  4JYB A;  3R92 A;  3ZS8 C;  3CRR A;  4FZ0 A;  2WA4 A;  1NKD A;  2CGN A;  2CTW A;  3CWV A;  2DWD C;  2ZDI A;  1I94 O;  4JZG A;  5JJJ B;  2UUC B;  1S5H C;  4FK5 C;  3AG2 C;  4DW0 A;  2WI2 A;  4JI3 O;  1H8E G;  4IYI A;  3H01 A;  4XDJ A;  4GKJ O;  1ZX3 A;  4DUZ O;  2ETN A;  3B2E E;  1KIJ A;  1UY9 A;  4TWK A;  1F4M A;  1KD1 W;  4B7K A;  1SQF A;  4BIZ A;  2E74 B;  2CE4 A;  3RYI B;  4MTO A;  1YDX A;  3LDE A;  4O04 A;  2WLI A;  3C0E A;  4K35 A;  3JCZ A;  3ABK B;  1AJP A;  1I5B A;  4P9P A;  4KTN A;  4LF9 B;  4NXM O;  1SET A;  1Y74 B;  1K3E A;  3OTO B;  1HR0 O;  4NTY A;  1JA8 A;  2ODM A;  4WFG A;  2WLL A;  5B5E Z;  3B28 A;  3K79 A;  3K5L A;  1M1K W;  3E35 A;  3NMQ A;  3D3I A;  3W7T A;  3Q4H B;  3U11 A;  4RUE A;  3EHH A;  4PU9 A;  1L8D A;  3K5O A;  1R6N A;  2QWP B;  3CCS V;  2Q2E B;  1KU9 A;  3RYI A;  1AI5 A;  4K0K B;  2WI1 A;  4YKU A;  3OFN G;  2BTZ A;  1XDC A;  3BFR A;  3JD2 A;  4ZVI A;  4ASU G;  1M57 C;  1N33 B;  3AG2 B;  3OUF A;  4BQJ A;  5D6P A;  2XAQ A;  2FKX A;  2VCI A;  2OT5 A;  4J9Z B;  4KHP B;  3M7M X;  1ZXM A;  1U96 A;  2BSK B;  3UQ8 A;  4AIL C;  4CWT A;  1AIL A;  1K8A W;  3BM9 A;  1W0K G;  3ZMT A;  3H9V A;  4FLZ A;  3R91 A;  1SKV A;  1XBL A;  4DR1 O;  1BYQ A;  5HFM A;  1OV9 A;  2P6J A;  2X0L A;  3KE6 A;  2A9H A;  1VQ8 V;  4OX9 B;  2XOK G;  1R3I C;  4UV8 A;  1Q6H A;  3MAQ A;  2BSK A;  3BY6 A;  4GZR B;  3OEH G;  2Y48 A;  4RQF A;  1PL0 A;  5LHH A;  1UJW B;  2HKJ A;  4LFA O;  1ZAU A;  4DR6 B;  4H44 B;  3OMA B;  2PI5 A;  5B66 Z;  1IBM O;  4FCR A;  1NHH A;  1MSD A;  1V9P A;  4UVC A;  3WHA A;  2UXD O;  4KFG A;  1YSC A;  1E1R G;  4PDL A;  5L3B A;  4AWQ A;  1SRY A;  3KCX A;  2CCU A;  1NT2 B;  2H55 A;  5IYB O;  2XJX A;  3DTU B;  2QM8 A;  3DC6 A;  2WER A;  5CBH A;  2YKC A;  4GT8 A;  3UT5 B;  4BXI A;  3ETD A;  1M5I A;  2XK2 A;  3RLR A;  4YKQ A;  2W6J G;  1QLE C;  3ZKD A;  2YJX A;  4GQT A;  4KXR A;  3T2S A;  2ITC C;  3JAL A;  2XCM A;  3F5W C;  4JAV A;  3AG3 C;  1W59 A;  1YC1 A;  2YI9 A;  5JQG B;  2ZBK B;  3E83 A;  5EYP B;  4GX2 A;  4E01 A;  3H1K H;  1LNQ A;  3VQY A;  2YK9 A;  3JSN A;  2XDS A;  1P49 A;  3RN4 A;  4CWP A;  2OYQ A;  1NZ6 A;  3K5N A;  1KKD A;  1V55 C;  2BSM A;  3CCJ V;  2PUS A;  2YKE A;  1P7G A;  3BA8 A;  3P3N A;  4Z1V A;  3UT5 A;  2IH3 C;  3LDD A;  2XAF A;  3UCS C;  4AWP A;  2EBO A;  4LF6 O;  4CS2 A;  3S5T A;  3FV5 A;  1MZE A;  4MBC A;  4XCJ A;  1N8R W;  2K1E A;  5JQG A;  1ID0 A;  5EYP A;  1HNZ O;  3B8M A;  4E4E A;  2DW4 A;  3SJA C;  2Q68 A;  2KKW A;  1IXB A;  3CME V;  4MTF A;  1AI4 A;  1TH8 A;  4LF8 B;  4IGG A;  4ASB A;  1IX9 A;  4NXN O;  5CA0 A;  4OPH A;  2ARH A;  5FNC A;  4QE7 A;  5JH7 B;  5KLV H;  2IJI A;  1S5J A;  5BMV A;  2GTA A;  1Q86 W;  1A4H A;  2BTO A;  2GUZ B;  2Q69 A;  3G7E A;  2O1U A;  4EEQ A;  1OCR C;  4ICG A;  3T0Z A;  1Y67 A;  4U3F H;  1Q8I A;  3OMN B;  2QWQ B;  1BKN A;  1AH6 A;  2QM7 A;  4UXN A;  1Q6U A;  4V26 A;  2DMX A;  4YXW G;  3A0B Z;  1Q90 D;  1K4C C;  2Y4U A;  2YDE A;  3OMI B;  2CCT A;  2CUG A;  4QNH B;  1XMQ O;  4KP4 A;  4JI0 O;  1YXB A;  5CMU A;  4BIU A;  3AK1 A;  5EC1 C;  1FPO A;  1PNM A;  4H13 B;  1R62 A;  3KZI Z;  4E72 A;  2P06 A;  2QJ1 A;  5EBM C;  2Q7E A;  4AS9 A;  2JJ1 G;  1YER A;  2E76 B;  3LSQ A;  3B09 A;  4L87 A;  1AR5 A;  3CB2 A;  2UUA B;  2FML A;  5LMN B;  4ABM A;  4YY3 B;  2YE6 A;  5FPR A;  2ZIM A;  1SES A;  1K7D A;  2Q4P A;  4LF4 B;  3GWO A;  5M4P A;  4L91 A;  1US6 A;  2R9R B;  3RFR A;  2Q73 A;  2BT0 A;  2YE7 A;  4DR7 B;  2BRC A;  2FWY A;  2CGO A;  3E2E A;  2PGG A;  4X89 A;  4JI6 O;  4FM1 A;  4LH6 A;  4X1K A;  2M7W A;  2YI5 A;  1VF5 B;  3F7Y C;  3IFX A;  5B3S C;  1BMF G;  4NR1 A;  3D0B A;  1XNQ O;  2XDX A;  4N21 A; 
#chains in the Genus database with same CATH homology
 4LWE A;  3ABM B;  3E8H A;  5LHI A;  3OW6 A;  1AH8 A;  3FB8 C;  2IWS A;  4JAU A;  1YI2 V;  5KA5 A;  3P30 A;  2YEI A;  1BGQ A;  1VQL V;  4XC0 A;  2GHY A;  3EHB B;  1R73 A;  3E86 A;  1AJQ A;  5IDJ A;  4X88 A;  4ZKI A;  3FYE B;  3OGC C;  4URN A;  2DQ3 A;  3B77 A;  5B3S B;  3GB7 C;  3VHC A;  2X6A A;  5L3J A;  3STL C;  4GFN A;  3M99 B;  3A0T A;  3RVY A;  4HXZ A;  1I5C A;  4RUF A;  2VWC A;  3CCU V;  2YEH A;  4H81 A;  1S0V A;  3AG4 C;  4KUM A;  3CC7 V;  2E0A A;  2QTO A;  1UY8 A;  2O1W A;  2WI7 A;  1K92 A;  4YKR A;  1KQS U;  3G4S V;  3T1K A;  2HR3 A;  2X6B A;  1HWY A;  3ZMV A;  1K5Q A;  4KFM A;  4UVB A;  3ZMS A;  5J6A A;  1YIJ V;  3LUT B;  4OXS A;  1UYI A;  4MVS A;  2YKI A;  5IN9 A;  1VQ6 V;  1GK9 A;  1BL8 A;  2BU2 A;  2JEX A;  2EIN C;  1VQM V;  4UV9 A;  2YEA A;  3TZ4 A;  5B1A B;  3RLP A;  3R4M A;  3SPJ A;  1YS3 A;  4XDL A;  1RM1 C;  2Q8G A;  1DF5 A;  2DYR B;  4R3A A;  4L94 A;  2XX4 A;  3ABU A;  3MHS C;  1ORQ C;  2HG1 A;  3NXS A;  3B26 A;  1F23 A;  4NH9 A;  4TSF G;  5M4N A;  1YSR A;  2BOB C;  1YSZ A;  2YE2 A;  1OCC B;  2XHT A;  1AI7 A;  1UYL A;  3K60 A;  3KG2 A;  2YI7 A;  4MPC A;  5CTW A;  4XCL A;  5H6Q A;  1XL4 A;  4W7T A;  2XDK A;  4XIR A;  2ZDY A;  3JD3 A;  3R4O A;  3UKM A;  2UXX A;  4RO2 A;  4MOT A;  1GMG A;  2VCJ A;  4L90 A;  1EFR G;  3G6E V;  2FYP A;  4XKA A;  4YKX A;  2XDU A;  1CPY A;  2WI3 A;  4LWG A;  4YKY A;  1ZW9 A;  3CCL V;  1ENV A;  2HVJ C;  4G27 B;  4MP2 A;  1CEZ A;  3INW A;  2D3O W;  2B1I A;  3MNR P;  2YI6 A;  3BMY A;  1GM9 A;  4CE2 A;  4E2L A;  1H7U A;  5F5R A;  4O05 A;  2X6C A;  1YJ9 V;  3ZMU A;  5DM6 V;  3CRL A;  3HPL C;  5BOC A;  3R4P A;  4G2K A;  1YES A;  3ABK C;  4XDK A;  1YT0 A;  1JQ0 A;  1NBM G;  4CWO A;  3OWB A;  4MVZ A;  1NQT A;  3T10 A;  3CYO A;  4GX0 A;  2ZDX A;  2A79 B;  4WFE A;  4MS2 A;  2Z5U A;  4PDV A;  4H85 A;  1VQ9 V;  3HZ1 A;  4R1F A;  2WI4 A;  3D36 A;  2YEG A;  4MPE A;  1MX0 A;  5EBL C;  5D7C A;  2HG5 C;  3Q5K A;  2IWX A;  3TZ5 A;  2OTL V;  3O6O A;  2XAS A;  1U2O A;  1R6K A;  4MVR A;  3ZM7 A;  4PDM A;  4FMT A;  3SYQ A;  4O0B A;  5C93 A;  4PRX A;  2HJF C;  3OWD A;  3X2Q B;  3QNE A;  1Z59 A;  2C2A A;  4HYM A;  4LC1 A;  2O1V A;  4KQV A;  1B62 A;  2Y69 B;  3ZMZ A;  2PNR A;  2Q8I A;  3K0G A;  4CE1 A;  4PDR A;  2YKB A;  4BAY A;  2H94 A;  1US7 A;  1ROP A;  5E1A C;  1QVF U;  2WPD G;  3RW0 A;  2LP7 A;  3ZRX A;  1OCO B;  5LGU A;  3CCR V;  3SJQ C;  3IC7 A;  4EFU A;  4GX1 A;  3EKR A;  4MVM A;  1AI6 A;  3CCE V;  5L3C A;  2HFE C;  2AHY A;  1QR9 A;  1B6Q A;  3QO8 A;  1PKX A;  5CF0 A;  4JTD B;  2W0F C;  2JK5 C;  3LDC A;  1K34 A;  4XD8 A;  3B27 A;  1UYH A;  4JF3 A;  1S14 A;  2QA4 V;  2DYS B;  1KZN A;  4URO A;  4P2Z A;  4EKW A;  1AJ6 A;  3SYA A;  3O0I A;  4J9Y B;  2YGF A;  3F7V C;  1VQN V;  2VW5 A;  2DWE C;  4XIP A;  1UYC A;  2HLD G;  3SPH A;  4HY1 A;  4ASG A;  4CWF A;  3TK1 A;  4LWI A;  4QIW F;  4LBE C;  3RKZ A;  4EGK A;  4I3H A;  2BRE A;  1ARO P;  2AKP A;  3TZ2 A;  5FNF A;  1FXH A;  3JYC A;  2QG0 A;  3VOU A;  1VQ5 V;  4BQG A;  3HYZ A;  2Q6A A;  2YEC A;  1YC3 A;  4URL A;  2YEV B;  4YKZ A;  2A0L A;  4PA4 A;  2WSS G;  1I58 A;  4I5S A;  5B1O A;  1M90 W;  2JEU A;  3FKS G;  4WUD A;  2NNU A;  5B1B C;  3TZ0 A;  2AHZ A;  5CA3 A;  1VQ7 V;  1F51 A;  3K99 A;  1I5Y A;  2X7R B;  2YE5 A;  3R4N A;  1TIL A;  1H8H G;  2BYH A;  5IYC O;  2WEP A;  5GW7 A;  2DQ0 A;  2HVK C;  1S16 A;  4NH7 A;  3D2R A;  1YT2 A;  1YT1 A;  3CCV V;  1BXD A;  3HB3 B;  4WFF A;  1YTF D;  3Q5L A;  3ABM C;  3MD0 A;  1W2B U;  4O09 A;  4MPN A;  4E02 A;  3CXC U;  2GQP A;  3VAD A;  5B1B B;  3ZN0 A;  3IGA C;  1Y4S A;  3I55 V;  3OR6 C;  2QKS A;  1UYG A;  3T4Z A;  1V54 B;  3K0D A;  5D6Q A;  1U0Z A;  1TBW A;  5CTU A;  4TT3 G;  1E79 G;  5LGN A;  1OCZ C;  4GT1 A;  3SL2 A;  1CP9 A;  2PI4 A;  3ZJZ A;  4KSG A;  1DTO A;  1L0O A;  1FXV A;  1Y8P A;  4DO2 A;  2EZO A;  5KA6 A;  2FTK A;  4UUJ C;  3E8G A;  3LNU A;  4MT8 A;  5M4H A;  3ZKB A;  3ABT A;  2ZXW B;  2HCH A;  3ASN B;  2IU0 A;  3INX A;  2IU3 A;  3GIE A;  4L8Z A;  4ASA A;  4WCE V;  1FXK B;  3W7U A;  4FIP C;  3K08 A;  3E8F A;  5M4M A;  1EZJ A;  1OCZ B;  1JPX A;  1BHB A;  3CGY A;  1TC0 A;  4EGH A;  1XL6 A;  3E89 A;  3T1C A;  3ZXO A;  3ML0 A;  2XAB A;  1IXM A;  4XTJ A;  4LWF A;  3FB7 C;  1S77 D;  5B1A C;  1GKF A;  2IJK A;  4RQE A;  2ZD9 A;  1WLE A;  1UY6 A;  2YE4 A;  1GKX A;  4WUB A;  2DYR C;  3QO5 A;  2H8M A;  5BZB A;  4L93 A;  3CPW U;  1I59 A;  1NVP D;  1RPR A;  5L3D A;  3G7B A;  1NH2 D;  5D7D A;  1L1F A;  3HHU A;  1OCC C;  1QBZ A;  5CBF A;  3LNM B;  3R65 A;  4R3M A;  2F43 G;  4GGL A;  4H33 A;  2IJH A;  3CD6 V;  4P7A A;  2H8P C;  5J9P C;  1I5X A;  1QVG U;  4JPR A;  3PEJ A;  1S76 D;  2XJG A;  3H80 A;  2BOC C;  2YI0 A;  3EHG A;  2GFD A;  4JTA B;  2XD6 A;  4JTC B;  4MSW C;  2YSU B;  1ZXN A;  2CH4 A;  2BU8 A;  3B25 A;  1NJI W;  2W6I G;  3WG7 C;  2B5U A;  2GSM B;  3TCU A;  4LCU C;  4R7C A;  1AR1 B;  2OCC B;  4XE2 A;  1WPX A;  2BYI A;  4JGS A;  3BEH A;  4MB9 A;  2Q8F A;  4P30 A;  3CMA V;  2WI5 A;  1UYD A;  4ASF A;  4UVA A;  5F3K A;  4PL9 A;  2P90 A;  3AEI A;  1I5A A;  4HZ0 A;  1AJN A;  1H7S A;  2ATK C;  3WG7 B;  3W7W A;  5IY5 B;  4YKW A;  3ETE A;  1AM1 A;  2XHR A;  1YIT V;  1Y8N A;  3QTF A;  1GTO A;  3ZN1 A;  3VHD A;  1QZR A;  3EHJ A;  1PVG A;  5D7R A;  5B1N A;  4MVO A;  3A0Y A;  3EHF A;  2CGF A;  4U93 A;  2YE9 A;  3ZCC A;  3GIF A;  3HYY A;  1R3K C;  3X2Q C;  3AG1 B;  2CK3 G;  4JQL A;  4BW5 A;  3OMU A;  2QE7 G;  2XAH A;  4EFT A;  4CWN A;  1UYK A;  3IED A;  2Y69 C;  2WLK A;  3WQ9 A;  2ZQM A;  1Q82 W;  4Q20 A;  1K4D C;  2BU7 A;  5J71 A;  2ESA A;  2XHX A;  2ZKJ A;  3TET A;  4QPJ A;  3U2K A;  5LBQ A;  1OCO C;  4LP8 A;  2EIM B;  2WLI B;  4PEL A;  3OUS A;  3SYC A;  4LWH A;  2ZR2 A;  2YJW A;  2WLL B;  3FYI B;  2BU5 A;  5FWK A;  2WLN A;  2OTJ V;  4MW8 A;  1ZWH A;  2HKO A;  1YET A;  5EK0 A;  4MTX A;  2DYS C;  5H6R A;  3ETG A;  4R50 A;  5HFL A;  2YEJ A;  3E8B A;  3K03 A;  4G28 B;  1KC8 W;  3B24 A;  1Z5A A;  2P7T C;  5KUM A;  1UYM A;  3LPS A;  2BZ5 A;  2WWW A;  1M9N A;  5L3F A;  1KP3 A;  3SPC A;  5EC2 C;  4K4O A;  4FCP A;  4RAI A;  1GKZ A;  3C11 A;  1SZT A;  5CTX A;  4QPK A;  1R3J C;  1E1Q G;  4P8O A;  4XDM A;  2P67 A;  3SPG A;  3A0Z A;  3OAA G;  4O07 A;  3GIG B;  5L3E A;  1Y8O A;  4R8C A;  3PJS K;  1NR1 A;  2WLJ A;  1EA6 A;  3SYO A;  5BOD A;  1F4N A;  1S3J A;  1Y66 A;  4XIQ A;  1K9M W;  1VQP V;  3ZXQ A;  3G75 A;  3OPD A;  4X9L A;  3T2M A;  1NHI A;  4MP7 A;  1M57 B;  1DF4 A;  1P4R A;  3GIG A;  2WLH A;  1QCE A;  3ZIA G;  3O2F A;  5M4K A;  2Q67 A;  4QE9 A;  2YGE A;  1JM6 A;  1G8M A;  3MHH C;  2IOQ A;  5DN6 G;  1FFT B;  3QDD A;  2XJJ A;  4PA7 A;  1TID A;  2YEB A;  3I56 V;  1K33 A;  3EKO A;  2JIZ G;  4ZBM A;  4H37 A;  4H7Q A;  2WEQ A;  4R6Z A;  3HZ5 A;  4CWR A;  2CG9 A;  1KP2 A;  1VQ4 V;  2YKJ A;  1V54 C;  2WAM A;  2V1D A;  1BHA A;  2YED A;  3TTZ A;  2YE3 A;  4CWQ A;  2YEV A;  2UWD A;  1Y4U A;  2JKI A;  1K5S A;  2UXN A;  3P32 A;  1UY7 A;  1QLE B;  4FPP A;  2WLM A;  3AG3 B;  3TUH A;  2Q8H A;  3T4D A;  1Y4M A;  4XIT A;  1H38 A;  2QEX V;  4WFA V;  4P9O A;  2EZP A;  4LPB A;  1V55 B;  3ABL C;  4F4L A;  2ZXW C;  3ASN C;  3H4L A;  2YE8 A;  2XDL A;  1YHQ V;  4XBF A;  2YK2 A;  1MOF A;  2EIK C;  1VQK V;  1YTF B;  2YEE A;  1GJV A;  1FXK C;  3U67 A;  5CPH A;  4CBC A;  3B8N A;  3K04 A;  2EIL C;  4JYC A;  1THZ A;  4EGI A;  3FB5 C;  1R3L C;  5KUK A;  4QJF B;  4GEE A;  1OCR B;  3ZRW B;  3RLQ A;  1OSF A;  2XAG A;  1M56 C;  1UYF A;  1B3Q A;  2XX5 A;  3ABL B;  2LFR A;  4WUC A;  4WFH A;  1PNL A;  3RVZ A;  2XAJ A;  4NH8 A;  1B63 A;  4DXW A;  5FND A;  1FS0 G;  1ZWI C;  2EIK B;  1PNK A;  1SER A;  3ZRW A;  2ZR3 A;  3K97 A;  5M4E A;  3W7X A;  1COW G;  3CCQ V;  2EIL B;  2NLJ C;  1YC4 A;  2QG2 A;  2IJJ A;  2XND G;  1QLN A;  1JCH A;  3OEE G;  1QY8 A;  1GM7 A;  4CWS A;  2FXS A;  4X8A A;  3STZ C;  3JZ3 A;  1M56 B;  1FXK A;  2IW5 A;  4MW3 A;  3U2D A;  5CBG A;  3WFV A;  1Z5C A;  3K06 A;  5GGZ A;  3T0H A;  4KSH A;  2EJR A;  4PA9 A;  1OHH G;  3RBZ A;  3CCM V;  2V7Q G;  3VBB A;  1J95 A;  4YKT A;  1MG1 A;  1H2G A;  4FCQ A;  1Q7Y W;  1MU5 A;  1VQO V;  1W0J G;  1YJW V;  3A0W A;  1S72 V;  2EXL A;  3FB6 C;  2IH1 C;  1NVP B;  3QO7 A;  1K73 W;  1Q81 W;  1NR7 A;  3UM7 A;  1G4Y B;  5CTY A;  4B7P A;  1NH2 B;  4WFB V;  1TC6 A;  3SYP A;  2K5B A;  2OCC C;  3DGE A;  5FL7 G;  4U7O A;  2JJ2 G;  5L3G A;  4HZ5 A;  4AWO A;  3AG4 B;  2Z3Y A;  1GM8 A;  3OM3 B;  2JJC A;  3K98 A;  4PRV A;  3OR7 C;  2KB1 A;  5IY5 C;  4URM A;  3ZRS A;  3CRK A;  3FT8 A;  3W7S A;  4HY6 A;  4MVU A;  3ZRV A;  4WF9 V;  4MVQ A;  1Z5B A;  3JD0 A;  4XKK A;  5H9C A;  1K97 A;  4E00 A;  2QF6 A;  2IOP A;  2BU6 A;  3K9A A;  3ASO C;  1P7B A;  4CE3 A;  2IWU A;  2EIN B;  1MAB G;  1NHJ A;  2EIJ C;  3Q5J A;  4GX5 A;  4Z1M G;  3AG1 C;  2JDI G;  1I5D A;  1TUE B;  2YGA A;  3VHA A;  2LFS A;  5CN0 A;  3A0R A;  1RM1 B;  1KEC A;  3HEK A;  3OE7 G;  1DLB A;  1RPO A;  3CGZ A;  3JD1 A;  4HAM A;  4V25 A;  5EBW C;  2ZDI C;  2B1G A;  3LSS A;  4DZY A;  4DUH A;  3K3W A;  2QFO A;  1UYE A;  3JD4 A;  4I9W A;  4EEH A;  4XKO A;  4EMV A;  4PA6 A;  2WI6 A;  1EI1 A;  4HXW A;  2ITD C;  2YEF A;  2MK3 A;  3ASO B;  4HZ3 A;  1QYE A;  3A0X A;  4GCZ A;  1AMW A;  3PEH A;  2EIM C;  5LHG A;  3FT5 A;  2EIJ B;  4CZZ A;  1YJN V;  1JVM A;  1OZ0 A;  1MSW D;  4JAS A;  2IOR A;  1QR8 A;  4FJC C;  3SPI A;  1PD3 A;  1JX9 A;  3OW2 U;  4B6C A;  4U7N A;  5IYD O;  3EFF K;  1JOY A;  2R9I A;  3G71 V;  4EM7 A;  1EBO A;  4MTG A;  3CC2 V;  2CCS A;  3CC4 V;  1THN A;  4BAE A;  4HYO A;  2FWZ A;  5LGT A;  4N23 A;  3CP1 A;  1JJ2 U;  4PA3 A;  2XX2 A;  4LP0 A;  5IDM A;  4HYP A;  1GO3 F;  4JYB A;  3R92 A;  1NKD A;  3CWV A;  2DWD C;  2ZDI A;  1S5H C;  4FK5 C;  3AG2 C;  2WI2 A;  1H8E G;  3H01 A;  4XDJ A;  1KIJ A;  1UY9 A;  4TWK A;  1F4M A;  1KD1 W;  4BIZ A;  4MTO A;  3LDE A;  4O04 A;  2WLI A;  3C0E A;  3JCZ A;  3ABK B;  1AJP A;  1I5B A;  4P9P A;  4KTN A;  1SET A;  1K3E A;  4WFG A;  2WLL A;  3B28 A;  3K79 A;  1M1K W;  3E35 A;  3NMQ A;  3D3I A;  3W7T A;  4RUE A;  3EHH A;  4PU9 A;  2Q2E B;  1R6N A;  3CCS V;  1AI5 A;  2WI1 A;  4YKU A;  3OFN G;  2BTZ A;  3JD2 A;  4ZVI A;  4ASU G;  1M57 C;  3AG2 B;  3OUF A;  4BQJ A;  5D6P A;  2XAQ A;  2VCI A;  2OT5 A;  4J9Z B;  1ZXM A;  4CWT A;  1K8A W;  3BM9 A;  1W0K G;  3ZMT A;  3R91 A;  1BYQ A;  5HFM A;  2P6J A;  2X0L A;  3KE6 A;  2A9H A;  1VQ8 V;  2XOK G;  1R3I C;  4UV8 A;  3BY6 A;  4RQF A;  3OEH G;  2Y48 A;  1PL0 A;  5LHH A;  1UJW B;  2HKJ A;  3OMA B;  2PI5 A;  4FCR A;  1NHH A;  4UVC A;  3WHA A;  4KFG A;  1YSC A;  1E1R G;  4PDL A;  5L3B A;  4AWQ A;  1SRY A;  2CCU A;  2H55 A;  5IYB O;  2XJX A;  3DTU B;  2QM8 A;  2WER A;  5CBH A;  2YKC A;  4GT8 A;  4BXI A;  3ETD A;  2XK2 A;  3RLR A;  4YKQ A;  2W6J G;  1QLE C;  3ZKD A;  2YJX A;  4GQT A;  3T2S A;  2ITC C;  2XCM A;  3F5W C;  4JAV A;  3AG3 C;  1YC1 A;  2ZBK B;  3E83 A;  4GX2 A;  4E01 A;  1LNQ A;  2YK9 A;  2XDS A;  4CWP A;  1KKD A;  1V55 C;  2BSM A;  3CCJ V;  2YKE A;  2IH3 C;  3LDD A;  2XAF A;  4AWP A;  2EBO A;  3FV5 A;  4MBC A;  4XCJ A;  1N8R W;  2K1E A;  1ID0 A;  3B8M A;  2DW4 A;  2Q68 A;  3CME V;  4MTF A;  1AI4 A;  1TH8 A;  4ASB A;  5FNC A;  4QE7 A;  2IJI A;  1Q86 W;  1A4H A;  2Q69 A;  3G7E A;  2O1U A;  1OCR C;  3T0Z A;  3OMN B;  1BKN A;  1AH6 A;  2QM7 A;  4UXN A;  4V26 A;  4YXW G;  1K4C C;  3OMI B;  2CCT A;  4QNH B;  4KP4 A;  5CMU A;  4BIU A;  5EC1 C;  1PNM A;  1R62 A;  5EBM C;  4AS9 A;  2JJ1 G;  1YER A;  3LSQ A;  4L87 A;  2YE6 A;  1SES A;  1K7D A;  5M4P A;  3GWO A;  4L91 A;  2R9R B;  2BT0 A;  2YE7 A;  2BRC A;  2FWY A;  3E2E A;  4X89 A;  2M7W A;  2YI5 A;  3F7Y C;  3IFX A;  5B3S C;  1BMF G;  3D0B A;  2XDX A;  4N21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...