3FV5A

Crystal structure of e. coli topoisomerase iv co-complexed with inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
201
structure length
180
Chain Sequence
GLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLISVVNALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords DNA topoisomerase 4 subunit B
publication title Design and syntheses of novel C7-derived-aminobenzimidazole ureas: bacterial gyrase/topoisomerase IV inhibitors with potent Gram-positve antibacterial activity
rcsb
source organism Escherichia coli
total genus 54
structure length 180
sequence length 201
chains with identical sequence B
ec nomenclature ec 5.99.1.-:
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3fv5A00
4GCZA 2Q8HA 2WERA 3BMYA 2YGEA 1I5AA 2FWYA 4ZKIA 2BTZA 4JQLA 4GT8A 4XCJA 4CWPA 4WUCA 5CTWA 1UYEA 2CCSA 2XABA 3ZXOA 5IDJA 3O6OA 5J6AA 1YC1A 2YEFA 5CTUA 4XD8A 4MBCA 1BYQA 1TBWA 4BQJA 5FNFA 1OSFA 4DUHA 4P8OA 4GGLA 4YKRA 1B63A 5D7RA 3OWDA 2YEAA 4XKOA 2CCTA 3T0ZA 5GGZA 4XE2A 4HXZA 4EMVA 4AWQA 4GFNA 2QF6A 4O04A 2WI1A 4JAVA 3A0XA 4CWNA 4QPJA 3ZM7A 2YE6A 5M4MA 4YKTA 1UYCA 3EHHA 3HHUA 2ZKJA 4W7TA 4WUDA 5L3JA 1YT0A 1NHJA 3SL2A 1YT2A 1I59A 4ASBA 4E01A 2XK2A 3LPSA 2IOPA 2H55A 4EFTA 4HZ5A 5FNCA 2YE9A 4YKXA 2O1WA 1Z5CA 2WEPA 2XCMA 4PU9A 4R1FA 3JZ3A 2BRCA 2XDSA 2VCIA 1THNA 2YK9A 3HYYA 4CE1A 5FNDA 4CWRA 4XCLA 2H8MA 2BYHA 3GIEA 4LWEA 2HG1A 1EA6A 2XDUA 5D6PA 4EGKA 2O1UA 2Q2EB 4ASGA 3RLQA 3HYZA 3K97A 3A0WA 2XX4A 2FWZA 3T0HA 4BIZA 5D6QA 1EI1A 3RLRA 5C93A 3DGEA 3R91A 4HYPA 3TZ2A 4X9LA 2VWCA 2YKJA 1AJ6A 4R3MA 1U2OA 1ZWHA 4EGIA 2XDXA 2JJCA 4BXIA 2YKCA 3B25A 4FCPA 1I5DA 2XX2A 3FV5A 3OPDA 1L0OA 4GEEA 3B24A 2FYPA 1UY7A 5IN9A 4ASAA 4XKAA 2Q8IA 4FMTA 1YETA 2WI5A 1BXDA 3HZ1A 4URLA 1GKXA 1I5BA 3IEDA 4XIRA 1YC3A 4H7QA 3U67A 2WI2A 4L93A 4JASA 4O0BA 1UYMA 2YEIA 2BYIA 3T10A 5D7DA 1I58A 2YE2A 1UYKA 3D2RA 4BAEA 2C2AA 1YESA 1YS3A 2YJWA 3G7BA 1YERA 3OMUA 4L90A 4L8ZA 4U93A 4QPKA 3A0RA 4NH8A 1B3QA 3INWA 4EM7A 1A4HA 3R4NA 4XC0A 4P7AA 1UY8A 5BODA 5J71A 2XJGA 1MX0A 3CRLA 3R4MA 1UY6A 3U2DA 2YKIA 3ZKDA 3KE6A 4FCQA 4O05A 4ZVIA 3NMQA 1TC0A 3HZ5A 2YI0A 5M4HA 1TILA 3EHFA 3A0TA 2HCHA 2XHRA 1YC4A 2WEQA 4V25A 2YI6A 3G7EA 4LWHA 3VHAA 5IDMA 4CWTA 1Y4SA 4CWOA 3TZ5A 3GIFA 4AS9A 2BU8A 1NHIA 1Z5BA 3WHAA 2WI6A 1S16A 3RKZA 4JAUA 2BREA 4CE3A 4MB9A 4LWGA 4XTJA 4XIPA 5D7CA 2GQPA 1B62A 3B28A 3HEKA 4PL9A 2YI5A 2E0AA 1GKZA 2WI3A 3QTFA 3U2KA 1I5CA 2ZBKB 4LPBA 4HYMA 2JKIA 4B7PA 2IWXA 2YEDA 1KZNA 4XITA 1UY9A 2YJXA 2XDKA 4KTNA 2YEHA 1AH8A 2AKPA 4XDMA 4KSHA 2PNRA 5FWKA 1UYIA 2XJJA 4YKWA 3CGYA 3VHDA 5F5RA 2BU7A 1ZXMA 4O09A 5F3KA 2YKEA 3FT5A 1YSRA 1U0ZA 2CGFA 4YKZA 1BKNA 2WI7A 4LWFA 3EHGA 4LP0A 2YGFA 4NH7A 1BGQA 2IWSA 3FT8A 2IORA 5CTXA 3Q5LA 2YE7A 3C0EA 4MPCA 5M4NA 4R3AA 2YECA 2YEEA 2BT0A 2ZDYA 4MP2A 1Y8PA 2BZ5A 3H80A 4HZ0A 3PEHA 1AM1A 3EKOA 1UYFA 1UYLA 4NH9A 3EHJA 4Q20A 3D0BA 2WI4A 4MOTA 5M4EA 2XJXA 4UROA 4H85A 2YE3A 5CF0A 1ID0A 4CWFA 1MU5A 3ZXQA 1S14A 3INXA 3VADA 3B26A 4MP7A 4KP4A 1JM6A 2QG0A 4PRXA 2BU6A 4DZYA 1YSZA 4HY6A 4WUBA 4E02A 2YE5A 1ZXNA 1PVGA 3K98A 3TTZA 3G75A 1Y8NA 1Z59A 4AWOA 4O07A 1QY8A 4LWIA 4FCRA 3GIGA 3D36A 3Q5KA 4CWSA 2UWDA 2Q8FA 1NHHA 1UYGA 5CTYA 2YEBA 5CPHA 3OW6A 3K60A 3MNRP 4AWPA 4EEHA 4URNA 1AMWA 4FPPA 1YT1A 5M4PA 2GFDA 2QFOA 4XKKA 2QG2A 4MPEA 4H81A 4YKYA 2YEJA 3R92A 1GJVA 3LNUA 2XDLA 3GIGB 4BIUA 1Y4UA 3RLPA 4K4OA 1H7UA 1KIJA 1US7A 3R4PA 4CWQA 2BU2A 4XIQA 4ASFA 2ESAA 3BM9A 3CRKA 2YEGA 1AH6A 3B27A 1ZW9A 3EKRA 2YGAA 2ZDXA 2YE8A 3TUHA 4URMA 2IOQA 2CG9A 3Q5JA 4YKQA 4U7OA 2XD6A 5BOCA 3A0YA 2IWUA 3CWVA 4YKUA 2BSMA 4MPNA 4CE2A 1TIDA 3O2FA 2VCJA 2YKBA 4EGHA 1R62A 4GQTA 4BQGA 3PEJA 2BU5A 1TC6A 3TZ0A 3R4OA 2YI7A 4HY1A 2XX5A 4I3HA 1QZRA 2XHXA 4KFGA 1Z5AA 3VHCA 4U7NA 2HKJA 2K5BA 4KQVA 3T2SA 3ZKBA 5M4KA 2YK2A 4I5SA 4EFUA 3O0IA 4L94A 2CCUA 3H4LA 2Q8GA 3QDDA 4E00A 1H7SA 3TZ4A 3OWBA 3T1KA 3C11A 4B6CA 1Y8OA 2EXLA 2YE4A 3CGZA 3A0ZA 1TH8A 1UYHA 4KSGA 3WQ9A 2O1VA 4PRVA 2VW5A 2CH4A 1UYDA 4L91A 2FXSA 1QYEA 4HXWA 3K99A 4V26A 2XHTA
chains in the Genus database with same CATH superfamily
4GCZA 2Q8HA 2FTKA 2WERA 3BMYA 2YGEA 1I5AA 2FWYA 4ZKIA 2BTZA 4JQLA 4GT8A 4XCJA 4CWPA 4WUCA 5CTWA 1UYEA 2CCSA 2XABA 3ZXOA 5IDJA 3O6OA 5J6AA 1YC1A 2YEFA 5CTUA 4XD8A 4MBCA 1BYQA 1TBWA 4BQJA 5FNFA 1OSFA 4DUHA 4P8OA 4GGLA 4YKRA 1B63A 5D7RA 3OWDA 2YEAA 4XKOA 2CCTA 3T0ZA 5GGZA 4XE2A 4HXZA 4EMVA 4AWQA 4GFNA 2C1IA 2QF6A 4O04A 2WI1A 4JAVA 3A0XA 4CWNA 4QPJA 3ZM7A 2YE6A 5M4MA 4YKTA 1UYCA 3EHHA 3HHUA 2ZKJA 4W7TA 4WUDA 5L3JA 1YT0A 1NHJA 3SL2A 1YT2A 1I59A 4ASBA 4E01A 2XK2A 3LPSA 2IOPA 2H55A 4EFTA 4HZ5A 5FNCA 2YE9A 4YKXA 2O1WA 1Z5CA 2WEPA 2XCMA 4PU9A 4R1FA 3JZ3A 2BRCA 2XDSA 2VCIA 1THNA 2YK9A 3HYYA 2C1GA 4CE1A 5FNDA 4CWRA 4XCLA 2H8MA 2BYHA 3GIEA 4LWEA 2HG1A 1EA6A 2XDUA 5D6PA 4EGKA 2O1UA 2Q2EB 4ASGA 3RLQA 3HYZA 3K97A 3A0WA 2XX4A 2FWZA 3T0HA 4BIZA 5D6QA 1EI1A 3RLRA 5C93A 3DGEA 3R91A 4HYPA 3TZ2A 4X9LA 2VWCA 2YKJA 1AJ6A 4R3MA 1U2OA 1ZWHA 4EGIA 2XDXA 2JJCA 4BXIA 2YKCA 3B25A 4FCPA 1I5DA 2XX2A 3FV5A 3OPDA 1L0OA 4GEEA 3B24A 2FYPA 1UY7A 5IN9A 4ASAA 4XKAA 2Q8IA 4FMTA 2HHIA 1YETA 2WI5A 1BXDA 3HZ1A 4URLA 1GKXA 1I5BA 3IEDA 4XIRA 1YC3A 4H7QA 3U67A 2WI2A 4L93A 4JASA 4O0BA 1UYMA 2YEIA 2BYIA 3T10A 5D7DA 1I58A 2YE2A 1UYKA 3D2RA 4BAEA 2C2AA 1YESA 1YS3A 2YJWA 3G7BA 1YERA 3OMUA 4L90A 4L8ZA 4U93A 4QPKA 3A0RA 4NH8A 1B3QA 3INWA 4EM7A 1A4HA 3R4NA 4XC0A 4P7AA 1UY8A 5BODA 5J71A 2XJGA 1MX0A 3CRLA 3R4MA 1UY6A 3U2DA 2YKIA 3ZKDA 3KE6A 4FCQA 5JENA 4O05A 4ZVIA 3NMQA 1TC0A 3HZ5A 2YI0A 1IXMA 5M4HA 1TILA 3EHFA 3A0TA 2HCHA 2XHRA 1YC4A 2WEQA 4V25A 2YI6A 3G7EA 4LWHA 3VHAA 5IDMA 4CWTA 1Y4SA 4CWOA 3TZ5A 3GIFA 4AS9A 2BU8A 1NHIA 1Z5BA 3WHAA 2WI6A 1S16A 3RKZA 4JAUA 2BREA 4CE3A 4MB9A 4LWGA 4XTJA 4XIPA 5D7CA 2GQPA 1B62A 3B28A 3HEKA 4PL9A 2YI5A 2E0AA 1GKZA 2WI3A 3QTFA 3U2KA 1I5CA 2ZBKB 4LPBA 4HYMA 2JKIA 4B7PA 2IWXA 2YEDA 1KZNA 4XITA 1UY9A 2YJXA 2XDKA 4KTNA 2YEHA 4E72A 1AH8A 2AKPA 4XDMA 4KSHA 2PNRA 5FWKA 1UYIA 2XJJA 4YKWA 3CGYA 3VHDA 5F5RA 2BU7A 1ZXMA 4O09A 5F3KA 2YKEA 3FT5A 1YSRA 1U0ZA 2CGFA 4YKZA 1BKNA 2WI7A 4LWFA 3EHGA 4LP0A 2YGFA 4NH7A 1BGQA 2IWSA 3FT8A 2IORA 5CTXA 3Q5LA 2YE7A 3C0EA 4MPCA 5M4NA 4R3AA 3CYGA 2YECA 2YEEA 2BT0A 2ZDYA 4MP2A 1Y8PA 2BZ5A 3H80A 4HZ0A 3PEHA 1AM1A 3EKOA 1UYFA 1UYLA 4NH9A 3EHJA 4Q20A 3D0BA 2WI4A 4MOTA 5M4EA 2XJXA 4UROA 4H85A 2YE3A 5CF0A 3LMMA 1ID0A 4CWFA 1MU5A 3ZXQA 1S14A 3INXA 3VADA 3B26A 4MP7A 4KP4A 1JM6A 2QG0A 4PRXA 2BU6A 4DZYA 1YSZA 4HY6A 4WUBA 4E02A 2YE5A 1ZXNA 1PVGA 3K98A 3TTZA 3G75A 1Y8NA 1Z59A 4AWOA 4O07A 1QY8A 4LWIA 4FCRA 3GIGA 3D36A 3Q5KA 4CWSA 2UWDA 2Q8FA 1NHHA 1UYGA 5CTYA 2YEBA 5CPHA 3OW6A 3K60A 3MNRP 4AWPA 4EEHA 4URNA 1AMWA 4FPPA 1YT1A 5M4PA 2GFDA 2QFOA 4XKKA 2QG2A 4MPEA 4H81A 4YKYA 2YEJA 3R92A 1GJVA 3LNUA 2XDLA 3GIGB 4BIUA 1Y4UA 3RLPA 4K4OA 1H7UA 1KIJA 1US7A 3R4PA 4CWQA 2BU2A 4XIQA 4ASFA 2ESAA 3BM9A 3CRKA 2YEGA 1AH6A 3B27A 1ZW9A 3EKRA 2YGAA 2ZDXA 2YE8A 3TUHA 4URMA 2IOQA 2CG9A 3Q5JA 4YKQA 4U7OA 2XD6A 5BOCA 3A0YA 2IWUA 1F51A 3CWVA 4YKUA 2BSMA 4MPNA 4CE2A 1TIDA 3O2FA 2VCJA 2YKBA 4EGHA 1R62A 4GQTA 4BQGA 3PEJA 2BU5A 1TC6A 3TZ0A 3R4OA 2YI7A 4HY1A 2XX5A 4I3HA 3S5TA 1QZRA 2XHXA 4KFGA 1Z5AA 3VHCA 4U7NA 2HKJA 2K5BA 4KQVA 3T2SA 3ZKBA 5M4KA 2YK2A 4I5SA 4EFUA 3O0IA 4L94A 2CCUA 3H4LA 2Q8GA 3QDDA 4E00A 1H7SA 3TZ4A 3OWBA 3T1KA 3C11A 4B6CA 1Y8OA 2EXLA 2YE4A 3CGZA 3A0ZA 1TH8A 1UYHA 4KSGA 3WQ9A 2O1VA 4PRVA 2VW5A 2CH4A 1UYDA 4L91A 2FXSA 1QYEA 4HXWA 3K99A 4V26A 2XHTA
chains in the Genus database with same CATH topology
4GCZA 2Q8HA 2WERA 3BMYA 2YGEA 1I5AA 2FWYA 4ZKIA 2BTZA 4JQLA 4GT8A 4XCJA 4CWPA 4WUCA 5CTWA 1UYEA 2CCSA 2XABA 3ZXOA 5IDJA 3O6OA 5J6AA 1YC1A 2YEFA 5CTUA 4XD8A 4MBCA 1BYQA 1TBWA 4BQJA 5FNFA 1OSFA 4DUHA 4P8OA 4GGLA 4YKRA 1B63A 5D7RA 3OWDA 2YEAA 4XKOA 2CCTA 3T0ZA 5GGZA 4XE2A 4HXZA 4EMVA 4AWQA 4GFNA 2QF6A 4O04A 2WI1A 4JAVA 3A0XA 4CWNA 4QPJA 3ZM7A 2YE6A 5M4MA 4YKTA 1UYCA 3EHHA 3HHUA 2ZKJA 4W7TA 4WUDA 5L3JA 1YT0A 1NHJA 3SL2A 1YT2A 1I59A 4ASBA 4E01A 2XK2A 3LPSA 2IOPA 2H55A 4EFTA 4HZ5A 5FNCA 2YE9A 4YKXA 2O1WA 1Z5CA 2WEPA 2XCMA 4PU9A 4R1FA 3JZ3A 2BRCA 2XDSA 2VCIA 1THNA 2YK9A 3HYYA 4CE1A 5FNDA 4CWRA 4XCLA 2H8MA 2BYHA 3GIEA 4LWEA 2HG1A 1EA6A 2XDUA 5D6PA 4EGKA 2O1UA 2Q2EB 4ASGA 3RLQA 3HYZA 3K97A 3A0WA 2XX4A 2FWZA 3T0HA 4BIZA 5D6QA 1EI1A 3RLRA 5C93A 3DGEA 3R91A 4HYPA 3TZ2A 4X9LA 2VWCA 2YKJA 1AJ6A 4R3MA 1U2OA 1ZWHA 4EGIA 2XDXA 2JJCA 4BXIA 2YKCA 3B25A 4FCPA 1I5DA 2XX2A 3FV5A 3OPDA 1L0OA 4GEEA 3B24A 2FYPA 1UY7A 5IN9A 4ASAA 4XKAA 2Q8IA 4FMTA 1YETA 2WI5A 1BXDA 3HZ1A 4URLA 1GKXA 1I5BA 3IEDA 4XIRA 1YC3A 4H7QA 3U67A 2WI2A 4L93A 4JASA 4O0BA 1UYMA 2YEIA 2BYIA 3T10A 5D7DA 1I58A 2YE2A 1UYKA 3D2RA 4BAEA 2C2AA 1YESA 1YS3A 2YJWA 3G7BA 1YERA 3OMUA 4L90A 4L8ZA 4U93A 4QPKA 3A0RA 4NH8A 1B3QA 3INWA 4EM7A 1A4HA 3R4NA 4XC0A 4P7AA 1UY8A 5BODA 5J71A 2XJGA 1MX0A 3CRLA 3R4MA 1UY6A 3U2DA 2YKIA 3ZKDA 3KE6A 4FCQA 4O05A 4ZVIA 3NMQA 1TC0A 3HZ5A 2YI0A 5M4HA 1TILA 3EHFA 3A0TA 2HCHA 2XHRA 1YC4A 2WEQA 4V25A 2YI6A 3G7EA 4LWHA 3VHAA 5IDMA 4CWTA 1Y4SA 4CWOA 3TZ5A 3GIFA 4AS9A 2BU8A 1NHIA 1Z5BA 3WHAA 2WI6A 1S16A 3RKZA 4JAUA 2BREA 4CE3A 4MB9A 4LWGA 4XTJA 4XIPA 5D7CA 2GQPA 1B62A 3B28A 3HEKA 4PL9A 2YI5A 2E0AA 1GKZA 2WI3A 3QTFA 3U2KA 1I5CA 2ZBKB 4LPBA 4HYMA 2JKIA 4B7PA 2IWXA 2YEDA 1KZNA 4XITA 1UY9A 2YJXA 2XDKA 4KTNA 2YEHA 1AH8A 2AKPA 4XDMA 4KSHA 2PNRA 5FWKA 1UYIA 2XJJA 4YKWA 3CGYA 3VHDA 5F5RA 2BU7A 1ZXMA 4O09A 5F3KA 2YKEA 3FT5A 1YSRA 1U0ZA 2CGFA 4YKZA 1BKNA 2WI7A 4LWFA 3EHGA 4LP0A 2YGFA 4NH7A 1BGQA 2IWSA 3FT8A 2IORA 5CTXA 3Q5LA 2YE7A 3C0EA 4MPCA 5M4NA 4R3AA 2YECA 2YEEA 2BT0A 2ZDYA 4MP2A 1Y8PA 2BZ5A 3H80A 4HZ0A 3PEHA 1AM1A 3EKOA 1UYFA 1UYLA 4NH9A 3EHJA 4Q20A 3D0BA 2WI4A 4MOTA 5M4EA 2XJXA 4UROA 4H85A 2YE3A 5CF0A 1ID0A 4CWFA 1MU5A 3ZXQA 1S14A 3INXA 3VADA 3B26A 4MP7A 4KP4A 1JM6A 2QG0A 4PRXA 2BU6A 4DZYA 1YSZA 4HY6A 4WUBA 4E02A 2YE5A 1ZXNA 1PVGA 3K98A 3TTZA 3G75A 1Y8NA 1Z59A 4AWOA 4O07A 1QY8A 4LWIA 4FCRA 3GIGA 3D36A 3Q5KA 4CWSA 2UWDA 2Q8FA 1NHHA 1UYGA 5CTYA 2YEBA 5CPHA 3OW6A 3K60A 3MNRP 4AWPA 4EEHA 4URNA 1AMWA 4FPPA 1YT1A 5M4PA 2GFDA 2QFOA 4XKKA 2QG2A 4MPEA 4H81A 4YKYA 2YEJA 3R92A 1GJVA 3LNUA 2XDLA 3GIGB 4BIUA 1Y4UA 3RLPA 4K4OA 1H7UA 1KIJA 1US7A 3R4PA 4CWQA 2BU2A 4XIQA 4ASFA 2ESAA 3BM9A 3CRKA 2YEGA 1AH6A 3B27A 1ZW9A 3EKRA 2YGAA 2ZDXA 2YE8A 3TUHA 4URMA 2IOQA 2CG9A 3Q5JA 4YKQA 4U7OA 2XD6A 5BOCA 3A0YA 2IWUA 3CWVA 4YKUA 2BSMA 4MPNA 4CE2A 1TIDA 3O2FA 2VCJA 2YKBA 4EGHA 1R62A 4GQTA 4BQGA 3PEJA 2BU5A 1TC6A 3TZ0A 3R4OA 2YI7A 4HY1A 2XX5A 4I3HA 1QZRA 2XHXA 4KFGA 1Z5AA 3VHCA 4U7NA 2HKJA 2K5BA 4KQVA 3T2SA 3ZKBA 5M4KA 2YK2A 4I5SA 4EFUA 3O0IA 4L94A 2CCUA 3H4LA 2Q8GA 3QDDA 4E00A 1H7SA 3TZ4A 3OWBA 3T1KA 3C11A 4B6CA 1Y8OA 2EXLA 2YE4A 3CGZA 3A0ZA 1TH8A 1UYHA 4KSGA 3WQ9A 2O1VA 4PRVA 2VW5A 2CH4A 1UYDA 4L91A 2FXSA 1QYEA 4HXWA 3K99A 4V26A 2XHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCZ A;  2Q8H A;  2WER A;  3BMY A;  2YGE A;  1I5A A;  2FWY A;  4ZKI A;  2BTZ A;  4JQL A;  4GT8 A;  4XCJ A;  4CWP A;  4WUC A;  5CTW A;  1UYE A;  2CCS A;  2XAB A;  3ZXO A;  5IDJ A;  3O6O A;  5J6A A;  1YC1 A;  2YEF A;  5CTU A;  4XD8 A;  4MBC A;  1BYQ A;  1TBW A;  4BQJ A;  5FNF A;  1OSF A;  4DUH A;  4P8O A;  4GGL A;  4YKR A;  1B63 A;  5D7R A;  3OWD A;  2YEA A;  4XKO A;  2CCT A;  3T0Z A;  5GGZ A;  4XE2 A;  4HXZ A;  4EMV A;  4AWQ A;  4GFN A;  2QF6 A;  4O04 A;  2WI1 A;  4JAV A;  3A0X A;  4CWN A;  4QPJ A;  3ZM7 A;  2YE6 A;  5M4M A;  4YKT A;  1UYC A;  3EHH A;  3HHU A;  2ZKJ A;  4W7T A;  4WUD A;  5L3J A;  1YT0 A;  1NHJ A;  3SL2 A;  1YT2 A;  1I59 A;  4ASB A;  4E01 A;  2XK2 A;  3LPS A;  2IOP A;  2H55 A;  4EFT A;  4HZ5 A;  5FNC A;  2YE9 A;  4YKX A;  2O1W A;  1Z5C A;  2WEP A;  2XCM A;  4PU9 A;  4R1F A;  3JZ3 A;  2BRC A;  2XDS A;  2VCI A;  1THN A;  2YK9 A;  3HYY A;  4CE1 A;  5FND A;  4CWR A;  4XCL A;  2H8M A;  2BYH A;  3GIE A;  4LWE A;  2HG1 A;  1EA6 A;  2XDU A;  5D6P A;  4EGK A;  2O1U A;  2Q2E B;  4ASG A;  3RLQ A;  3HYZ A;  3K97 A;  3A0W A;  2XX4 A;  2FWZ A;  3T0H A;  4BIZ A;  5D6Q A;  1EI1 A;  3RLR A;  5C93 A;  3DGE A;  3R91 A;  4HYP A;  3TZ2 A;  4X9L A;  2VWC A;  2YKJ A;  1AJ6 A;  4R3M A;  1U2O A;  1ZWH A;  4EGI A;  2XDX A;  2JJC A;  4BXI A;  2YKC A;  3B25 A;  4FCP A;  1I5D A;  2XX2 A;  3FV5 A;  3OPD A;  1L0O A;  4GEE A;  3B24 A;  2FYP A;  1UY7 A;  5IN9 A;  4ASA A;  4XKA A;  2Q8I A;  4FMT A;  1YET A;  2WI5 A;  1BXD A;  3HZ1 A;  4URL A;  1GKX A;  1I5B A;  3IED A;  4XIR A;  1YC3 A;  4H7Q A;  3U67 A;  2WI2 A;  4L93 A;  4JAS A;  4O0B A;  1UYM A;  2YEI A;  2BYI A;  3T10 A;  5D7D A;  1I58 A;  2YE2 A;  1UYK A;  3D2R A;  4BAE A;  2C2A A;  1YES A;  1YS3 A;  2YJW A;  3G7B A;  1YER A;  3OMU A;  4L90 A;  4L8Z A;  4U93 A;  4QPK A;  3A0R A;  4NH8 A;  1B3Q A;  3INW A;  4EM7 A;  1A4H A;  3R4N A;  4XC0 A;  4P7A A;  1UY8 A;  5BOD A;  5J71 A;  2XJG A;  1MX0 A;  3CRL A;  3R4M A;  1UY6 A;  3U2D A;  2YKI A;  3ZKD A;  3KE6 A;  4FCQ A;  4O05 A;  4ZVI A;  3NMQ A;  1TC0 A;  3HZ5 A;  2YI0 A;  5M4H A;  1TIL A;  3EHF A;  3A0T A;  2HCH A;  2XHR A;  1YC4 A;  2WEQ A;  4V25 A;  2YI6 A;  3G7E A;  4LWH A;  3VHA A;  5IDM A;  4CWT A;  1Y4S A;  4CWO A;  3TZ5 A;  3GIF A;  4AS9 A;  2BU8 A;  1NHI A;  1Z5B A;  3WHA A;  2WI6 A;  1S16 A;  3RKZ A;  4JAU A;  2BRE A;  4CE3 A;  4MB9 A;  4LWG A;  4XTJ A;  4XIP A;  5D7C A;  2GQP A;  1B62 A;  3B28 A;  3HEK A;  4PL9 A;  2YI5 A;  2E0A A;  1GKZ A;  2WI3 A;  3QTF A;  3U2K A;  1I5C A;  2ZBK B;  4LPB A;  4HYM A;  2JKI A;  4B7P A;  2IWX A;  2YED A;  1KZN A;  4XIT A;  1UY9 A;  2YJX A;  2XDK A;  4KTN A;  2YEH A;  1AH8 A;  2AKP A;  4XDM A;  4KSH A;  2PNR A;  5FWK A;  1UYI A;  2XJJ A;  4YKW A;  3CGY A;  3VHD A;  5F5R A;  2BU7 A;  1ZXM A;  4O09 A;  5F3K A;  2YKE A;  3FT5 A;  1YSR A;  1U0Z A;  2CGF A;  4YKZ A;  1BKN A;  2WI7 A;  4LWF A;  3EHG A;  4LP0 A;  2YGF A;  4NH7 A;  1BGQ A;  2IWS A;  3FT8 A;  2IOR A;  5CTX A;  3Q5L A;  2YE7 A;  3C0E A;  4MPC A;  5M4N A;  4R3A A;  2YEC A;  2YEE A;  2BT0 A;  2ZDY A;  4MP2 A;  1Y8P A;  2BZ5 A;  3H80 A;  4HZ0 A;  3PEH A;  1AM1 A;  3EKO A;  1UYF A;  1UYL A;  4NH9 A;  3EHJ A;  4Q20 A;  3D0B A;  2WI4 A;  4MOT A;  5M4E A;  2XJX A;  4URO A;  4H85 A;  2YE3 A;  5CF0 A;  1ID0 A;  4CWF A;  1MU5 A;  3ZXQ A;  1S14 A;  3INX A;  3VAD A;  3B26 A;  4MP7 A;  4KP4 A;  1JM6 A;  2QG0 A;  4PRX A;  2BU6 A;  4DZY A;  1YSZ A;  4HY6 A;  4WUB A;  4E02 A;  2YE5 A;  1ZXN A;  1PVG A;  3K98 A;  3TTZ A;  3G75 A;  1Y8N A;  1Z59 A;  4AWO A;  4O07 A;  1QY8 A;  4LWI A;  4FCR A;  3GIG A;  3D36 A;  3Q5K A;  4CWS A;  2UWD A;  2Q8F A;  1NHH A;  1UYG A;  5CTY A;  2YEB A;  5CPH A;  3OW6 A;  3K60 A;  3MNR P;  4AWP A;  4EEH A;  4URN A;  1AMW A;  4FPP A;  1YT1 A;  5M4P A;  2GFD A;  2QFO A;  4XKK A;  2QG2 A;  4MPE A;  4H81 A;  4YKY A;  2YEJ A;  3R92 A;  1GJV A;  3LNU A;  2XDL A;  3GIG B;  4BIU A;  1Y4U A;  3RLP A;  4K4O A;  1H7U A;  1KIJ A;  1US7 A;  3R4P A;  4CWQ A;  2BU2 A;  4XIQ A;  4ASF A;  2ESA A;  3BM9 A;  3CRK A;  2YEG A;  1AH6 A;  3B27 A;  1ZW9 A;  3EKR A;  2YGA A;  2ZDX A;  2YE8 A;  3TUH A;  4URM A;  2IOQ A;  2CG9 A;  3Q5J A;  4YKQ A;  4U7O A;  2XD6 A;  5BOC A;  3A0Y A;  2IWU A;  3CWV A;  4YKU A;  2BSM A;  4MPN A;  4CE2 A;  1TID A;  3O2F A;  2VCJ A;  2YKB A;  4EGH A;  1R62 A;  4GQT A;  4BQG A;  3PEJ A;  2BU5 A;  1TC6 A;  3TZ0 A;  3R4O A;  2YI7 A;  4HY1 A;  2XX5 A;  4I3H A;  1QZR A;  2XHX A;  4KFG A;  1Z5A A;  3VHC A;  4U7N A;  2HKJ A;  2K5B A;  4KQV A;  3T2S A;  3ZKB A;  5M4K A;  2YK2 A;  4I5S A;  4EFU A;  3O0I A;  4L94 A;  2CCU A;  3H4L A;  2Q8G A;  3QDD A;  4E00 A;  1H7S A;  3TZ4 A;  3OWB A;  3T1K A;  3C11 A;  4B6C A;  1Y8O A;  2EXL A;  2YE4 A;  3CGZ A;  3A0Z A;  1TH8 A;  1UYH A;  4KSG A;  3WQ9 A;  2O1V A;  4PRV A;  2VW5 A;  2CH4 A;  1UYD A;  4L91 A;  2FXS A;  1QYE A;  4HXW A;  3K99 A;  4V26 A;  2XHT A; 
#chains in the Genus database with same CATH topology
 4GCZ A;  2Q8H A;  2FTK A;  2WER A;  3BMY A;  2YGE A;  1I5A A;  2FWY A;  4ZKI A;  2BTZ A;  4JQL A;  4GT8 A;  4XCJ A;  4CWP A;  4WUC A;  5CTW A;  1UYE A;  2CCS A;  2XAB A;  3ZXO A;  5IDJ A;  3O6O A;  5J6A A;  1YC1 A;  2YEF A;  5CTU A;  4XD8 A;  4MBC A;  1BYQ A;  1TBW A;  4BQJ A;  5FNF A;  1OSF A;  4DUH A;  4P8O A;  4GGL A;  4YKR A;  1B63 A;  5D7R A;  3OWD A;  2YEA A;  4XKO A;  2CCT A;  3T0Z A;  5GGZ A;  4XE2 A;  4HXZ A;  4EMV A;  4AWQ A;  4GFN A;  2C1I A;  2QF6 A;  4O04 A;  2WI1 A;  4JAV A;  3A0X A;  4CWN A;  4QPJ A;  3ZM7 A;  2YE6 A;  5M4M A;  4YKT A;  1UYC A;  3EHH A;  3HHU A;  2ZKJ A;  4W7T A;  4WUD A;  5L3J A;  1YT0 A;  1NHJ A;  3SL2 A;  1YT2 A;  1I59 A;  4ASB A;  4E01 A;  2XK2 A;  3LPS A;  2IOP A;  2H55 A;  4EFT A;  4HZ5 A;  5FNC A;  2YE9 A;  4YKX A;  2O1W A;  1Z5C A;  2WEP A;  2XCM A;  4PU9 A;  4R1F A;  3JZ3 A;  2BRC A;  2XDS A;  2VCI A;  1THN A;  2YK9 A;  3HYY A;  2C1G A;  4CE1 A;  5FND A;  4CWR A;  4XCL A;  2H8M A;  2BYH A;  3GIE A;  4LWE A;  2HG1 A;  1EA6 A;  2XDU A;  5D6P A;  4EGK A;  2O1U A;  2Q2E B;  4ASG A;  3RLQ A;  3HYZ A;  3K97 A;  3A0W A;  2XX4 A;  2FWZ A;  3T0H A;  4BIZ A;  5D6Q A;  1EI1 A;  3RLR A;  5C93 A;  3DGE A;  3R91 A;  4HYP A;  3TZ2 A;  4X9L A;  2VWC A;  2YKJ A;  1AJ6 A;  4R3M A;  1U2O A;  1ZWH A;  4EGI A;  2XDX A;  2JJC A;  4BXI A;  2YKC A;  3B25 A;  4FCP A;  1I5D A;  2XX2 A;  3FV5 A;  3OPD A;  1L0O A;  4GEE A;  3B24 A;  2FYP A;  1UY7 A;  5IN9 A;  4ASA A;  4XKA A;  2Q8I A;  4FMT A;  2HHI A;  1YET A;  2WI5 A;  1BXD A;  3HZ1 A;  4URL A;  1GKX A;  1I5B A;  3IED A;  4XIR A;  1YC3 A;  4H7Q A;  3U67 A;  2WI2 A;  4L93 A;  4JAS A;  4O0B A;  1UYM A;  2YEI A;  2BYI A;  3T10 A;  5D7D A;  1I58 A;  2YE2 A;  1UYK A;  3D2R A;  4BAE A;  2C2A A;  1YES A;  1YS3 A;  2YJW A;  3G7B A;  1YER A;  3OMU A;  4L90 A;  4L8Z A;  4U93 A;  4QPK A;  3A0R A;  4NH8 A;  1B3Q A;  3INW A;  4EM7 A;  1A4H A;  3R4N A;  4XC0 A;  4P7A A;  1UY8 A;  5BOD A;  5J71 A;  2XJG A;  1MX0 A;  3CRL A;  3R4M A;  1UY6 A;  3U2D A;  2YKI A;  3ZKD A;  3KE6 A;  4FCQ A;  5JEN A;  4O05 A;  4ZVI A;  3NMQ A;  1TC0 A;  3HZ5 A;  2YI0 A;  1IXM A;  5M4H A;  1TIL A;  3EHF A;  3A0T A;  2HCH A;  2XHR A;  1YC4 A;  2WEQ A;  4V25 A;  2YI6 A;  3G7E A;  4LWH A;  3VHA A;  5IDM A;  4CWT A;  1Y4S A;  4CWO A;  3TZ5 A;  3GIF A;  4AS9 A;  2BU8 A;  1NHI A;  1Z5B A;  3WHA A;  2WI6 A;  1S16 A;  3RKZ A;  4JAU A;  2BRE A;  4CE3 A;  4MB9 A;  4LWG A;  4XTJ A;  4XIP A;  5D7C A;  2GQP A;  1B62 A;  3B28 A;  3HEK A;  4PL9 A;  2YI5 A;  2E0A A;  1GKZ A;  2WI3 A;  3QTF A;  3U2K A;  1I5C A;  2ZBK B;  4LPB A;  4HYM A;  2JKI A;  4B7P A;  2IWX A;  2YED A;  1KZN A;  4XIT A;  1UY9 A;  2YJX A;  2XDK A;  4KTN A;  2YEH A;  4E72 A;  1AH8 A;  2AKP A;  4XDM A;  4KSH A;  2PNR A;  5FWK A;  1UYI A;  2XJJ A;  4YKW A;  3CGY A;  3VHD A;  5F5R A;  2BU7 A;  1ZXM A;  4O09 A;  5F3K A;  2YKE A;  3FT5 A;  1YSR A;  1U0Z A;  2CGF A;  4YKZ A;  1BKN A;  2WI7 A;  4LWF A;  3EHG A;  4LP0 A;  2YGF A;  4NH7 A;  1BGQ A;  2IWS A;  3FT8 A;  2IOR A;  5CTX A;  3Q5L A;  2YE7 A;  3C0E A;  4MPC A;  5M4N A;  4R3A A;  3CYG A;  2YEC A;  2YEE A;  2BT0 A;  2ZDY A;  4MP2 A;  1Y8P A;  2BZ5 A;  3H80 A;  4HZ0 A;  3PEH A;  1AM1 A;  3EKO A;  1UYF A;  1UYL A;  4NH9 A;  3EHJ A;  4Q20 A;  3D0B A;  2WI4 A;  4MOT A;  5M4E A;  2XJX A;  4URO A;  4H85 A;  2YE3 A;  5CF0 A;  3LMM A;  1ID0 A;  4CWF A;  1MU5 A;  3ZXQ A;  1S14 A;  3INX A;  3VAD A;  3B26 A;  4MP7 A;  4KP4 A;  1JM6 A;  2QG0 A;  4PRX A;  2BU6 A;  4DZY A;  1YSZ A;  4HY6 A;  4WUB A;  4E02 A;  2YE5 A;  1ZXN A;  1PVG A;  3K98 A;  3TTZ A;  3G75 A;  1Y8N A;  1Z59 A;  4AWO A;  4O07 A;  1QY8 A;  4LWI A;  4FCR A;  3GIG A;  3D36 A;  3Q5K A;  4CWS A;  2UWD A;  2Q8F A;  1NHH A;  1UYG A;  5CTY A;  2YEB A;  5CPH A;  3OW6 A;  3K60 A;  3MNR P;  4AWP A;  4EEH A;  4URN A;  1AMW A;  4FPP A;  1YT1 A;  5M4P A;  2GFD A;  2QFO A;  4XKK A;  2QG2 A;  4MPE A;  4H81 A;  4YKY A;  2YEJ A;  3R92 A;  1GJV A;  3LNU A;  2XDL A;  3GIG B;  4BIU A;  1Y4U A;  3RLP A;  4K4O A;  1H7U A;  1KIJ A;  1US7 A;  3R4P A;  4CWQ A;  2BU2 A;  4XIQ A;  4ASF A;  2ESA A;  3BM9 A;  3CRK A;  2YEG A;  1AH6 A;  3B27 A;  1ZW9 A;  3EKR A;  2YGA A;  2ZDX A;  2YE8 A;  3TUH A;  4URM A;  2IOQ A;  2CG9 A;  3Q5J A;  4YKQ A;  4U7O A;  2XD6 A;  5BOC A;  3A0Y A;  2IWU A;  1F51 A;  3CWV A;  4YKU A;  2BSM A;  4MPN A;  4CE2 A;  1TID A;  3O2F A;  2VCJ A;  2YKB A;  4EGH A;  1R62 A;  4GQT A;  4BQG A;  3PEJ A;  2BU5 A;  1TC6 A;  3TZ0 A;  3R4O A;  2YI7 A;  4HY1 A;  2XX5 A;  4I3H A;  3S5T A;  1QZR A;  2XHX A;  4KFG A;  1Z5A A;  3VHC A;  4U7N A;  2HKJ A;  2K5B A;  4KQV A;  3T2S A;  3ZKB A;  5M4K A;  2YK2 A;  4I5S A;  4EFU A;  3O0I A;  4L94 A;  2CCU A;  3H4L A;  2Q8G A;  3QDD A;  4E00 A;  1H7S A;  3TZ4 A;  3OWB A;  3T1K A;  3C11 A;  4B6C A;  1Y8O A;  2EXL A;  2YE4 A;  3CGZ A;  3A0Z A;  1TH8 A;  1UYH A;  4KSG A;  3WQ9 A;  2O1V A;  4PRV A;  2VW5 A;  2CH4 A;  1UYD A;  4L91 A;  2FXS A;  1QYE A;  4HXW A;  3K99 A;  4V26 A;  2XHT A; 
#chains in the Genus database with same CATH homology
 4GCZ A;  2Q8H A;  2WER A;  3BMY A;  2YGE A;  1I5A A;  2FWY A;  4ZKI A;  2BTZ A;  4JQL A;  4GT8 A;  4XCJ A;  4CWP A;  4WUC A;  5CTW A;  1UYE A;  2CCS A;  2XAB A;  3ZXO A;  5IDJ A;  3O6O A;  5J6A A;  1YC1 A;  2YEF A;  5CTU A;  4XD8 A;  4MBC A;  1BYQ A;  1TBW A;  4BQJ A;  5FNF A;  1OSF A;  4DUH A;  4P8O A;  4GGL A;  4YKR A;  1B63 A;  5D7R A;  3OWD A;  2YEA A;  4XKO A;  2CCT A;  3T0Z A;  5GGZ A;  4XE2 A;  4HXZ A;  4EMV A;  4AWQ A;  4GFN A;  2QF6 A;  4O04 A;  2WI1 A;  4JAV A;  3A0X A;  4CWN A;  4QPJ A;  3ZM7 A;  2YE6 A;  5M4M A;  4YKT A;  1UYC A;  3EHH A;  3HHU A;  2ZKJ A;  4W7T A;  4WUD A;  5L3J A;  1YT0 A;  1NHJ A;  3SL2 A;  1YT2 A;  1I59 A;  4ASB A;  4E01 A;  2XK2 A;  3LPS A;  2IOP A;  2H55 A;  4EFT A;  4HZ5 A;  5FNC A;  2YE9 A;  4YKX A;  2O1W A;  1Z5C A;  2WEP A;  2XCM A;  4PU9 A;  4R1F A;  3JZ3 A;  2BRC A;  2XDS A;  2VCI A;  1THN A;  2YK9 A;  3HYY A;  4CE1 A;  5FND A;  4CWR A;  4XCL A;  2H8M A;  2BYH A;  3GIE A;  4LWE A;  2HG1 A;  1EA6 A;  2XDU A;  5D6P A;  4EGK A;  2O1U A;  2Q2E B;  4ASG A;  3RLQ A;  3HYZ A;  3K97 A;  3A0W A;  2XX4 A;  2FWZ A;  3T0H A;  4BIZ A;  5D6Q A;  1EI1 A;  3RLR A;  5C93 A;  3DGE A;  3R91 A;  4HYP A;  3TZ2 A;  4X9L A;  2VWC A;  2YKJ A;  1AJ6 A;  4R3M A;  1U2O A;  1ZWH A;  4EGI A;  2XDX A;  2JJC A;  4BXI A;  2YKC A;  3B25 A;  4FCP A;  1I5D A;  2XX2 A;  3FV5 A;  3OPD A;  1L0O A;  4GEE A;  3B24 A;  2FYP A;  1UY7 A;  5IN9 A;  4ASA A;  4XKA A;  2Q8I A;  4FMT A;  1YET A;  2WI5 A;  1BXD A;  3HZ1 A;  4URL A;  1GKX A;  1I5B A;  3IED A;  4XIR A;  1YC3 A;  4H7Q A;  3U67 A;  2WI2 A;  4L93 A;  4JAS A;  4O0B A;  1UYM A;  2YEI A;  2BYI A;  3T10 A;  5D7D A;  1I58 A;  2YE2 A;  1UYK A;  3D2R A;  4BAE A;  2C2A A;  1YES A;  1YS3 A;  2YJW A;  3G7B A;  1YER A;  3OMU A;  4L90 A;  4L8Z A;  4U93 A;  4QPK A;  3A0R A;  4NH8 A;  1B3Q A;  3INW A;  4EM7 A;  1A4H A;  3R4N A;  4XC0 A;  4P7A A;  1UY8 A;  5BOD A;  5J71 A;  2XJG A;  1MX0 A;  3CRL A;  3R4M A;  1UY6 A;  3U2D A;  2YKI A;  3ZKD A;  3KE6 A;  4FCQ A;  4O05 A;  4ZVI A;  3NMQ A;  1TC0 A;  3HZ5 A;  2YI0 A;  5M4H A;  1TIL A;  3EHF A;  3A0T A;  2HCH A;  2XHR A;  1YC4 A;  2WEQ A;  4V25 A;  2YI6 A;  3G7E A;  4LWH A;  3VHA A;  5IDM A;  4CWT A;  1Y4S A;  4CWO A;  3TZ5 A;  3GIF A;  4AS9 A;  2BU8 A;  1NHI A;  1Z5B A;  3WHA A;  2WI6 A;  1S16 A;  3RKZ A;  4JAU A;  2BRE A;  4CE3 A;  4MB9 A;  4LWG A;  4XTJ A;  4XIP A;  5D7C A;  2GQP A;  1B62 A;  3B28 A;  3HEK A;  4PL9 A;  2YI5 A;  2E0A A;  1GKZ A;  2WI3 A;  3QTF A;  3U2K A;  1I5C A;  2ZBK B;  4LPB A;  4HYM A;  2JKI A;  4B7P A;  2IWX A;  2YED A;  1KZN A;  4XIT A;  1UY9 A;  2YJX A;  2XDK A;  4KTN A;  2YEH A;  1AH8 A;  2AKP A;  4XDM A;  4KSH A;  2PNR A;  5FWK A;  1UYI A;  2XJJ A;  4YKW A;  3CGY A;  3VHD A;  5F5R A;  2BU7 A;  1ZXM A;  4O09 A;  5F3K A;  2YKE A;  3FT5 A;  1YSR A;  1U0Z A;  2CGF A;  4YKZ A;  1BKN A;  2WI7 A;  4LWF A;  3EHG A;  4LP0 A;  2YGF A;  4NH7 A;  1BGQ A;  2IWS A;  3FT8 A;  2IOR A;  5CTX A;  3Q5L A;  2YE7 A;  3C0E A;  4MPC A;  5M4N A;  4R3A A;  2YEC A;  2YEE A;  2BT0 A;  2ZDY A;  4MP2 A;  1Y8P A;  2BZ5 A;  3H80 A;  4HZ0 A;  3PEH A;  1AM1 A;  3EKO A;  1UYF A;  1UYL A;  4NH9 A;  3EHJ A;  4Q20 A;  3D0B A;  2WI4 A;  4MOT A;  5M4E A;  2XJX A;  4URO A;  4H85 A;  2YE3 A;  5CF0 A;  1ID0 A;  4CWF A;  1MU5 A;  3ZXQ A;  1S14 A;  3INX A;  3VAD A;  3B26 A;  4MP7 A;  4KP4 A;  1JM6 A;  2QG0 A;  4PRX A;  2BU6 A;  4DZY A;  1YSZ A;  4HY6 A;  4WUB A;  4E02 A;  2YE5 A;  1ZXN A;  1PVG A;  3K98 A;  3TTZ A;  3G75 A;  1Y8N A;  1Z59 A;  4AWO A;  4O07 A;  1QY8 A;  4LWI A;  4FCR A;  3GIG A;  3D36 A;  3Q5K A;  4CWS A;  2UWD A;  2Q8F A;  1NHH A;  1UYG A;  5CTY A;  2YEB A;  5CPH A;  3OW6 A;  3K60 A;  3MNR P;  4AWP A;  4EEH A;  4URN A;  1AMW A;  4FPP A;  1YT1 A;  5M4P A;  2GFD A;  2QFO A;  4XKK A;  2QG2 A;  4MPE A;  4H81 A;  4YKY A;  2YEJ A;  3R92 A;  1GJV A;  3LNU A;  2XDL A;  3GIG B;  4BIU A;  1Y4U A;  3RLP A;  4K4O A;  1H7U A;  1KIJ A;  1US7 A;  3R4P A;  4CWQ A;  2BU2 A;  4XIQ A;  4ASF A;  2ESA A;  3BM9 A;  3CRK A;  2YEG A;  1AH6 A;  3B27 A;  1ZW9 A;  3EKR A;  2YGA A;  2ZDX A;  2YE8 A;  3TUH A;  4URM A;  2IOQ A;  2CG9 A;  3Q5J A;  4YKQ A;  4U7O A;  2XD6 A;  5BOC A;  3A0Y A;  2IWU A;  3CWV A;  4YKU A;  2BSM A;  4MPN A;  4CE2 A;  1TID A;  3O2F A;  2VCJ A;  2YKB A;  4EGH A;  1R62 A;  4GQT A;  4BQG A;  3PEJ A;  2BU5 A;  1TC6 A;  3TZ0 A;  3R4O A;  2YI7 A;  4HY1 A;  2XX5 A;  4I3H A;  1QZR A;  2XHX A;  4KFG A;  1Z5A A;  3VHC A;  4U7N A;  2HKJ A;  2K5B A;  4KQV A;  3T2S A;  3ZKB A;  5M4K A;  2YK2 A;  4I5S A;  4EFU A;  3O0I A;  4L94 A;  2CCU A;  3H4L A;  2Q8G A;  3QDD A;  4E00 A;  1H7S A;  3TZ4 A;  3OWB A;  3T1K A;  3C11 A;  4B6C A;  1Y8O A;  2EXL A;  2YE4 A;  3CGZ A;  3A0Z A;  1TH8 A;  1UYH A;  4KSG A;  3WQ9 A;  2O1V A;  4PRV A;  2VW5 A;  2CH4 A;  1UYD A;  4L91 A;  2FXS A;  1QYE A;  4HXW A;  3K99 A;  4V26 A;  2XHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...