3FV5A

Crystal structure of e. coli topoisomerase iv co-complexed with inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
201
structure length
180
Chain Sequence
GLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLISVVNALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and syntheses of novel C7-derived-aminobenzimidazole ureas: bacterial gyrase/topoisomerase IV inhibitors with potent Gram-positve antibacterial activity
rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords DNA topoisomerase 4 subunit B
total genus 54
structure length 180
sequence length 201
chains with identical sequence B
ec nomenclature ec 5.99.1.-:
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3fv5A00
4EMVA 1I58A 2GQPA 3QTFA 4K4OA 1BGQA 3RLQA 4R3MA 1YC1A 5FNDA 3GIGA 1MU5A 4DZYA 5FNFA 4DUHA 1ID0A 3ZM7A 3D36A 4WUDA 3SL2A 5J71A 2ZDXA 1ZXMA 4H81A 5F5RA 1B63A 4BAEA 4HZ5A 2O1UA 1ZWHA 4E01A 4I3HA 3Q5LA 3DGEA 3R4MA 4LWIA 3INXA 4YKRA 3A0XA 3EHHA 4U7OA 4O07A 1OSFA 1AM1A 4AS9A 1Y4SA 1YERA 2H8MA 4FPPA 4EGHA 2VW5A 2XX5A 3G7EA 1AJ6A 3R4PA 4XIPA 1I5AA 2YEIA 2CCTA 5D7RA 2XHXA 3CGYA 4XKKA 4XE2A 4XC0A 3ZXQA 3G7BA 3K98A 4U7NA 4HYMA 1Y8OA 4ZVIA 4YKZA 1AH8A 2YKEA 5C93A 3Q5JA 3CRKA 1TBWA 2WI2A 3FV5A 3VHDA 2YK2A 1PVGA 2XABA 4EGKA 3H80A 1AH6A 5GGZA 3TZ5A 4CE2A 2XDSA 2CH4A 4MP2A 2BRCA 2YE7A 4XTJA 2YGFA 3K60A 1L0OA 4JASA 3FT8A 5M4PA 1YETA 3C11A 3PEJA 4YKUA 1UYMA 4BXIA 4XIRA 3RLPA 3A0TA 3HZ1A 2ZBKB 3VADA 2YEEA 3R4NA 4L91A 1NHIA 4CWOA 5CTYA 1UYKA 3VHAA 4R1FA 4URNA 3R4OA 1GKXA 2YKBA 3T2SA 1QY8A 2BSMA 4MPNA 2YE2A 4U93A 4KFGA 1U0ZA 4XDMA 4BQJA 3GIFA 5FNCA 3T0ZA 4L90A 3O2FA 4H85A 4XCLA 2YE3A 2E0AA 3IEDA 2BU6A 1YT2A 1GJVA 1UYLA 3OW6A 1YC3A 2IWUA 4XCJA 1Z59A 1YS3A 2BYIA 2YKIA 3JZ3A 5CTUA 4MP7A 2YEHA 5M4NA 1A4HA 2QFOA 2YI7A 2C2AA 3OWBA 2Q2EB 4HXZA 1EA6A 4NH8A 1H7SA 2YGEA 4GFNA 4GCZA 2IWXA 3G75A 4FCPA 4MPEA 2BU5A 4L8ZA 1ZXNA 5M4EA 2WI3A 1QZRA 4CE3A 4WUBA 4HY6A 4P8OA 3CWVA 3EHJA 4YKYA 2CCSA 4H7QA 4KP4A 2YI6A 3ZXOA 1JM6A 4EFUA 2CG9A 4P7AA 4PRXA 4YKWA 2GFDA 3B27A 4ASFA 4B6CA 5IDMA 3Q5KA 4L93A 4GGLA 3B26A 4BQGA 2EXLA 4HYPA 4LWHA 3GIEA 5D7CA 5D7DA 2YEGA 4MBCA 3ZKBA 4GEEA 4FCQA 5IDJA 2XJXA 4PL9A 5D6PA 3MNRP 3A0RA 2BU2A 1KIJA 2XDLA 5BODA 4L94A 3T1KA 2YI5A 2XDKA 2IORA 5CPHA 4LWGA 3R92A 4AWQA 1UYHA 4ASGA 2YEAA 2ESAA 1AMWA 4MB9A 2XCMA 4EFTA 2YJXA 1TC0A 1UY7A 2FWYA 1UY6A 1I59A 2YGAA 3LNUA 2Q8HA 2UWDA 2XHRA 3FT5A 4E00A 3VHCA 2JJCA 3B28A 3D2RA 1U2OA 3U67A 3TZ0A 2WI6A 4MOTA 3D0BA 4URMA 1BKNA 3CGZA 1THNA 1UYDA 1B3QA 5IN9A 2XX2A 3T10A 2YEFA 3A0ZA 5J6AA 1NHJA 4PU9A 1TIDA 1UYGA 1BYQA 2YE9A 4NH9A 4R3AA 3TZ4A 3TUHA 3K97A 2BU8A 3BMYA 4EEHA 4B7PA 2XHTA 2WI7A 4CWNA 4JAUA 2HCHA 4CWQA 4EGIA 1UYIA 4URLA 1MX0A 2YE6A 2ZKJA 1S14A 1KZNA 2WI1A 1Z5CA 4E02A 1UYEA 2WI5A 4CWPA 2YE8A 4Q20A 3OPDA 3HEKA 4KSGA 1UYCA 4KTNA 2FWZA 2BZ5A 2BTZA 2BYHA 1YSRA 4FMTA 1YC4A 4WUCA 1Z5BA 4CWSA 2BU7A 4AWOA 3HYZA 4XIQA 1BXDA 1R62A 3OMUA 4HZ0A 2YK9A 1EI1A 2Q8GA 1TC6A 2BREA 3ZKDA 2XDXA 3CRLA 4CE1A 4I5SA 3OWDA 4AWPA 3WQ9A 3C0EA 2XD6A 4ASAA 2AKPA 3RKZA 2XX4A 2YKCA 5CTWA 2XJGA 1I5DA 2HG1A 3GIGB 5CTXA 2YECA 3U2DA 2QG2A 3B25A 3O6OA 2O1WA 2WI4A 4O09A 1Y4UA 4LWEA 3RLRA 2YEJA 2XJJA 2WEPA 3HZ5A 3HYYA 3QDDA 3INWA 1H7UA 5D6QA 4CWRA 2Q8FA 2H55A 3T0HA 5FWKA 4JQLA 3K99A 2CGFA 3EHFA 3NMQA 2YKJA 3O0IA 1B62A 4BIZA 5L3JA 5BOCA 1I5CA 3KE6A 4V25A 4W7TA 1YESA 4CWFA 1QYEA 4JAVA 3A0YA 3U2KA 1TILA 4LP0A 4XD8A 4HXWA 4YKQA 2YEDA 4YKXA 4XITA 4QPJA 5F3KA 4V26A 5M4MA 1Y8PA 3EKRA 2FXSA 1ZW9A 1I5BA 2YI0A 4XKOA 3WHAA 2WERA 2IOQA 3H4LA 4KQVA 5CF0A 3TZ2A 2YEBA 4EM7A 4ZKIA 1UY8A 2IWSA 2JKIA 3B24A 4O05A 3A0WA 2O1VA 2PNRA 4UROA 2QF6A 3EHGA 4GQTA 2Q8IA 1TH8A 1UY9A 2XK2A 4X9LA 2VCIA 2BT0A 2YJWA 1UYFA 1Y8NA 4LPBA 3LPSA 2YE5A 1Z5AA 4O0BA 2WEQA 1NHHA 2K5BA 3TTZA 2YE4A 4NH7A 2ZDYA 1YT0A 2VCJA 2CCUA 1YSZA 4MPCA 3HHUA 4QPKA 1GKZA 4LWFA 4GT8A 5M4KA 4HY1A 4XKAA 4YKTA 4PRVA 4BIUA 4KSHA 3EKOA 4ASBA 2XDUA 1YT1A 2QG0A 3BM9A 4O04A 4FCRA 2IOPA 3PEHA 5M4HA 1US7A 4CWTA 2HKJA 2FYPA 2VWCA 3R91A 1S16A
chains in the Genus database with same CATH superfamily
4EMVA 1I58A 2GQPA 3QTFA 4K4OA 1BGQA 3RLQA 4R3MA 1YC1A 5FNDA 3GIGA 1MU5A 4DZYA 5FNFA 4DUHA 1ID0A 3ZM7A 3D36A 4WUDA 3SL2A 5J71A 2ZDXA 1ZXMA 4H81A 5F5RA 1B63A 4BAEA 4HZ5A 2O1UA 1ZWHA 4E01A 4I3HA 3Q5LA 3DGEA 3R4MA 4LWIA 3INXA 4YKRA 3A0XA 3EHHA 4U7OA 4O07A 1OSFA 1AM1A 4AS9A 1Y4SA 1YERA 2H8MA 4FPPA 4EGHA 2VW5A 2XX5A 3G7EA 1AJ6A 3R4PA 4XIPA 1I5AA 2YEIA 2CCTA 5D7RA 2XHXA 3CGYA 4XKKA 4XE2A 4XC0A 3ZXQA 3G7BA 3K98A 4U7NA 4HYMA 1Y8OA 4ZVIA 4YKZA 1AH8A 2YKEA 5C93A 3Q5JA 3CRKA 1TBWA 2WI2A 3FV5A 3VHDA 2YK2A 1PVGA 2XABA 4EGKA 3H80A 1AH6A 5GGZA 3TZ5A 4CE2A 2XDSA 2CH4A 4MP2A 2BRCA 2YE7A 4XTJA 2YGFA 3K60A 1L0OA 4JASA 3FT8A 5M4PA 1YETA 3C11A 3PEJA 4YKUA 1UYMA 4BXIA 4XIRA 3RLPA 3A0TA 3HZ1A 2ZBKB 3VADA 2YEEA 3R4NA 4L91A 1NHIA 4CWOA 5CTYA 1UYKA 3VHAA 4R1FA 4URNA 3R4OA 1GKXA 2YKBA 3T2SA 1QY8A 2BSMA 4MPNA 2YE2A 4U93A 4KFGA 1U0ZA 4XDMA 4BQJA 3GIFA 5FNCA 3T0ZA 4L90A 3O2FA 4H85A 4XCLA 2YE3A 2E0AA 3IEDA 2BU6A 1YT2A 1GJVA 1UYLA 3OW6A 1YC3A 2IWUA 4XCJA 1Z59A 1YS3A 2BYIA 2YKIA 3JZ3A 5CTUA 4MP7A 2YEHA 5M4NA 1A4HA 2QFOA 2YI7A 2C2AA 3OWBA 2Q2EB 4HXZA 1EA6A 4NH8A 1H7SA 2YGEA 4GFNA 4GCZA 2FTKA 2IWXA 3G75A 4FCPA 4MPEA 2BU5A 4L8ZA 1ZXNA 5M4EA 2WI3A 1QZRA 4CE3A 4WUBA 4HY6A 4P8OA 2HHIA 3CWVA 3EHJA 4YKYA 2CCSA 4H7QA 4KP4A 2YI6A 3ZXOA 1JM6A 4EFUA 2CG9A 4P7AA 4PRXA 4YKWA 2GFDA 3B27A 4ASFA 4B6CA 5IDMA 3Q5KA 4L93A 4GGLA 3B26A 4BQGA 2EXLA 4HYPA 4LWHA 3GIEA 5D7CA 5D7DA 2YEGA 4MBCA 3ZKBA 4GEEA 4FCQA 5IDJA 2XJXA 4PL9A 5D6PA 3MNRP 3A0RA 2BU2A 1KIJA 2XDLA 5BODA 4L94A 3T1KA 2YI5A 2XDKA 2IORA 5CPHA 4LWGA 3R92A 4AWQA 1UYHA 4ASGA 2YEAA 2ESAA 1AMWA 4MB9A 2XCMA 4EFTA 2YJXA 1TC0A 1UY7A 2FWYA 1UY6A 1I59A 2YGAA 3LNUA 2Q8HA 2UWDA 2XHRA 3FT5A 4E00A 3VHCA 2JJCA 3B28A 3CYGA 3D2RA 1U2OA 3U67A 3TZ0A 2WI6A 4MOTA 3D0BA 4URMA 1BKNA 3CGZA 1THNA 1UYDA 1B3QA 5IN9A 2XX2A 3T10A 2YEFA 3A0ZA 5J6AA 1NHJA 4PU9A 1TIDA 1UYGA 1BYQA 2YE9A 4NH9A 4R3AA 3TZ4A 3TUHA 3K97A 5JENA 2BU8A 3BMYA 4EEHA 4B7PA 2XHTA 2WI7A 4CWNA 4JAUA 1IXMA 2HCHA 4CWQA 4EGIA 1UYIA 4URLA 1MX0A 2YE6A 3S5TA 2ZKJA 1S14A 1KZNA 2WI1A 1Z5CA 4E02A 1UYEA 2WI5A 4CWPA 2YE8A 4Q20A 3OPDA 3HEKA 4KSGA 2C1GA 1UYCA 4KTNA 2FWZA 2BZ5A 2BTZA 2BYHA 1YSRA 4FMTA 1YC4A 4WUCA 1Z5BA 4CWSA 2BU7A 4AWOA 3HYZA 4XIQA 1BXDA 1R62A 3OMUA 4HZ0A 2YK9A 1EI1A 2Q8GA 1TC6A 2BREA 3ZKDA 2XDXA 3CRLA 4CE1A 4I5SA 3OWDA 4AWPA 3WQ9A 3C0EA 2XD6A 4ASAA 2AKPA 3RKZA 2XX4A 2YKCA 5CTWA 2XJGA 1I5DA 2HG1A 3GIGB 5CTXA 2YECA 3U2DA 2QG2A 3B25A 3O6OA 2O1WA 2WI4A 4O09A 1Y4UA 4LWEA 3RLRA 2YEJA 2XJJA 2WEPA 3HZ5A 3HYYA 3QDDA 3INWA 1H7UA 5D6QA 4CWRA 2Q8FA 2H55A 3T0HA 5FWKA 4JQLA 3K99A 2CGFA 3EHFA 3NMQA 2YKJA 3O0IA 1B62A 4BIZA 5L3JA 5BOCA 1I5CA 3KE6A 4V25A 4W7TA 1F51A 1YESA 4CWFA 1QYEA 4JAVA 3A0YA 3U2KA 1TILA 4LP0A 4XD8A 4HXWA 4YKQA 2YEDA 4YKXA 4XITA 4QPJA 5F3KA 4V26A 5M4MA 1Y8PA 3EKRA 2FXSA 1ZW9A 1I5BA 2YI0A 4XKOA 3WHAA 2WERA 2IOQA 3H4LA 4KQVA 5CF0A 3TZ2A 2C1IA 2YEBA 4EM7A 4ZKIA 1UY8A 2IWSA 2JKIA 3B24A 4O05A 3A0WA 2O1VA 2PNRA 4UROA 2QF6A 3EHGA 4GQTA 2Q8IA 1TH8A 1UY9A 2XK2A 4X9LA 2VCIA 2BT0A 2YJWA 1UYFA 1Y8NA 4LPBA 3LPSA 2YE5A 1Z5AA 4O0BA 2WEQA 1NHHA 2K5BA 3TTZA 2YE4A 4NH7A 2ZDYA 1YT0A 2VCJA 2CCUA 1YSZA 4MPCA 3HHUA 4QPKA 1GKZA 4LWFA 4GT8A 5M4KA 4E72A 4HY1A 4XKAA 4YKTA 4PRVA 4BIUA 4KSHA 3EKOA 4ASBA 2XDUA 1YT1A 2QG0A 3BM9A 4O04A 4FCRA 2IOPA 3PEHA 5M4HA 3LMMA 1US7A 4CWTA 2HKJA 2FYPA 2VWCA 3R91A 1S16A
chains in the Genus database with same CATH topology
4EMVA 1I58A 2GQPA 3QTFA 4K4OA 1BGQA 3RLQA 4R3MA 1YC1A 5FNDA 3GIGA 1MU5A 4DZYA 5FNFA 4DUHA 1ID0A 3ZM7A 3D36A 4WUDA 3SL2A 5J71A 2ZDXA 1ZXMA 4H81A 5F5RA 1B63A 4BAEA 4HZ5A 2O1UA 1ZWHA 4E01A 4I3HA 3Q5LA 3DGEA 3R4MA 4LWIA 3INXA 4YKRA 3A0XA 3EHHA 4U7OA 4O07A 1OSFA 1AM1A 4AS9A 1Y4SA 1YERA 2H8MA 4FPPA 4EGHA 2VW5A 2XX5A 3G7EA 1AJ6A 3R4PA 4XIPA 1I5AA 2YEIA 2CCTA 5D7RA 2XHXA 3CGYA 4XKKA 4XE2A 4XC0A 3ZXQA 3G7BA 3K98A 4U7NA 4HYMA 1Y8OA 4ZVIA 4YKZA 1AH8A 2YKEA 5C93A 3Q5JA 3CRKA 1TBWA 2WI2A 3FV5A 3VHDA 2YK2A 1PVGA 2XABA 4EGKA 3H80A 1AH6A 5GGZA 3TZ5A 4CE2A 2XDSA 2CH4A 4MP2A 2BRCA 2YE7A 4XTJA 2YGFA 3K60A 1L0OA 4JASA 3FT8A 5M4PA 1YETA 3C11A 3PEJA 4YKUA 1UYMA 4BXIA 4XIRA 3RLPA 3A0TA 3HZ1A 2ZBKB 3VADA 2YEEA 3R4NA 4L91A 1NHIA 4CWOA 5CTYA 1UYKA 3VHAA 4R1FA 4URNA 3R4OA 1GKXA 2YKBA 3T2SA 1QY8A 2BSMA 4MPNA 2YE2A 4U93A 4KFGA 1U0ZA 4XDMA 4BQJA 3GIFA 5FNCA 3T0ZA 4L90A 3O2FA 4H85A 4XCLA 2YE3A 2E0AA 3IEDA 2BU6A 1YT2A 1GJVA 1UYLA 3OW6A 1YC3A 2IWUA 4XCJA 1Z59A 1YS3A 2BYIA 2YKIA 3JZ3A 5CTUA 4MP7A 2YEHA 5M4NA 1A4HA 2QFOA 2YI7A 2C2AA 3OWBA 2Q2EB 4HXZA 1EA6A 4NH8A 1H7SA 2YGEA 4GFNA 4GCZA 2IWXA 3G75A 4FCPA 4MPEA 2BU5A 4L8ZA 1ZXNA 5M4EA 2WI3A 1QZRA 4CE3A 4WUBA 4HY6A 4P8OA 3CWVA 3EHJA 4YKYA 2CCSA 4H7QA 4KP4A 2YI6A 3ZXOA 1JM6A 4EFUA 2CG9A 4P7AA 4PRXA 4YKWA 2GFDA 3B27A 4ASFA 4B6CA 5IDMA 3Q5KA 4L93A 4GGLA 3B26A 4BQGA 2EXLA 4HYPA 4LWHA 3GIEA 5D7CA 5D7DA 2YEGA 4MBCA 3ZKBA 4GEEA 4FCQA 5IDJA 2XJXA 4PL9A 5D6PA 3MNRP 3A0RA 2BU2A 1KIJA 2XDLA 5BODA 4L94A 3T1KA 2YI5A 2XDKA 2IORA 5CPHA 4LWGA 3R92A 4AWQA 1UYHA 4ASGA 2YEAA 2ESAA 1AMWA 4MB9A 2XCMA 4EFTA 2YJXA 1TC0A 1UY7A 2FWYA 1UY6A 1I59A 2YGAA 3LNUA 2Q8HA 2UWDA 2XHRA 3FT5A 4E00A 3VHCA 2JJCA 3B28A 3D2RA 1U2OA 3U67A 3TZ0A 2WI6A 4MOTA 3D0BA 4URMA 1BKNA 3CGZA 1THNA 1UYDA 1B3QA 5IN9A 2XX2A 3T10A 2YEFA 3A0ZA 5J6AA 1NHJA 4PU9A 1TIDA 1UYGA 1BYQA 2YE9A 4NH9A 4R3AA 3TZ4A 3TUHA 3K97A 2BU8A 3BMYA 4EEHA 4B7PA 2XHTA 2WI7A 4CWNA 4JAUA 2HCHA 4CWQA 4EGIA 1UYIA 4URLA 1MX0A 2YE6A 2ZKJA 1S14A 1KZNA 2WI1A 1Z5CA 4E02A 1UYEA 2WI5A 4CWPA 2YE8A 4Q20A 3OPDA 3HEKA 4KSGA 1UYCA 4KTNA 2FWZA 2BZ5A 2BTZA 2BYHA 1YSRA 4FMTA 1YC4A 4WUCA 1Z5BA 4CWSA 2BU7A 4AWOA 3HYZA 4XIQA 1BXDA 1R62A 3OMUA 4HZ0A 2YK9A 1EI1A 2Q8GA 1TC6A 2BREA 3ZKDA 2XDXA 3CRLA 4CE1A 4I5SA 3OWDA 4AWPA 3WQ9A 3C0EA 2XD6A 4ASAA 2AKPA 3RKZA 2XX4A 2YKCA 5CTWA 2XJGA 1I5DA 2HG1A 3GIGB 5CTXA 2YECA 3U2DA 2QG2A 3B25A 3O6OA 2O1WA 2WI4A 4O09A 1Y4UA 4LWEA 3RLRA 2YEJA 2XJJA 2WEPA 3HZ5A 3HYYA 3QDDA 3INWA 1H7UA 5D6QA 4CWRA 2Q8FA 2H55A 3T0HA 5FWKA 4JQLA 3K99A 2CGFA 3EHFA 3NMQA 2YKJA 3O0IA 1B62A 4BIZA 5L3JA 5BOCA 1I5CA 3KE6A 4V25A 4W7TA 1YESA 4CWFA 1QYEA 4JAVA 3A0YA 3U2KA 1TILA 4LP0A 4XD8A 4HXWA 4YKQA 2YEDA 4YKXA 4XITA 4QPJA 5F3KA 4V26A 5M4MA 1Y8PA 3EKRA 2FXSA 1ZW9A 1I5BA 2YI0A 4XKOA 3WHAA 2WERA 2IOQA 3H4LA 4KQVA 5CF0A 3TZ2A 2YEBA 4EM7A 4ZKIA 1UY8A 2IWSA 2JKIA 3B24A 4O05A 3A0WA 2O1VA 2PNRA 4UROA 2QF6A 3EHGA 4GQTA 2Q8IA 1TH8A 1UY9A 2XK2A 4X9LA 2VCIA 2BT0A 2YJWA 1UYFA 1Y8NA 4LPBA 3LPSA 2YE5A 1Z5AA 4O0BA 2WEQA 1NHHA 2K5BA 3TTZA 2YE4A 4NH7A 2ZDYA 1YT0A 2VCJA 2CCUA 1YSZA 4MPCA 3HHUA 4QPKA 1GKZA 4LWFA 4GT8A 5M4KA 4HY1A 4XKAA 4YKTA 4PRVA 4BIUA 4KSHA 3EKOA 4ASBA 2XDUA 1YT1A 2QG0A 3BM9A 4O04A 4FCRA 2IOPA 3PEHA 5M4HA 1US7A 4CWTA 2HKJA 2FYPA 2VWCA 3R91A 1S16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMV A;  1I58 A;  2GQP A;  3QTF A;  4K4O A;  1BGQ A;  3RLQ A;  4R3M A;  1YC1 A;  5FND A;  3GIG A;  1MU5 A;  4DZY A;  5FNF A;  4DUH A;  1ID0 A;  3ZM7 A;  3D36 A;  4WUD A;  3SL2 A;  5J71 A;  2ZDX A;  1ZXM A;  4H81 A;  5F5R A;  1B63 A;  4BAE A;  4HZ5 A;  2O1U A;  1ZWH A;  4E01 A;  4I3H A;  3Q5L A;  3DGE A;  3R4M A;  4LWI A;  3INX A;  4YKR A;  3A0X A;  3EHH A;  4U7O A;  4O07 A;  1OSF A;  1AM1 A;  4AS9 A;  1Y4S A;  1YER A;  2H8M A;  4FPP A;  4EGH A;  2VW5 A;  2XX5 A;  3G7E A;  1AJ6 A;  3R4P A;  4XIP A;  1I5A A;  2YEI A;  2CCT A;  5D7R A;  2XHX A;  3CGY A;  4XKK A;  4XE2 A;  4XC0 A;  3ZXQ A;  3G7B A;  3K98 A;  4U7N A;  4HYM A;  1Y8O A;  4ZVI A;  4YKZ A;  1AH8 A;  2YKE A;  5C93 A;  3Q5J A;  3CRK A;  1TBW A;  2WI2 A;  3FV5 A;  3VHD A;  2YK2 A;  1PVG A;  2XAB A;  4EGK A;  3H80 A;  1AH6 A;  5GGZ A;  3TZ5 A;  4CE2 A;  2XDS A;  2CH4 A;  4MP2 A;  2BRC A;  2YE7 A;  4XTJ A;  2YGF A;  3K60 A;  1L0O A;  4JAS A;  3FT8 A;  5M4P A;  1YET A;  3C11 A;  3PEJ A;  4YKU A;  1UYM A;  4BXI A;  4XIR A;  3RLP A;  3A0T A;  3HZ1 A;  2ZBK B;  3VAD A;  2YEE A;  3R4N A;  4L91 A;  1NHI A;  4CWO A;  5CTY A;  1UYK A;  3VHA A;  4R1F A;  4URN A;  3R4O A;  1GKX A;  2YKB A;  3T2S A;  1QY8 A;  2BSM A;  4MPN A;  2YE2 A;  4U93 A;  4KFG A;  1U0Z A;  4XDM A;  4BQJ A;  3GIF A;  5FNC A;  3T0Z A;  4L90 A;  3O2F A;  4H85 A;  4XCL A;  2YE3 A;  2E0A A;  3IED A;  2BU6 A;  1YT2 A;  1GJV A;  1UYL A;  3OW6 A;  1YC3 A;  2IWU A;  4XCJ A;  1Z59 A;  1YS3 A;  2BYI A;  2YKI A;  3JZ3 A;  5CTU A;  4MP7 A;  2YEH A;  5M4N A;  1A4H A;  2QFO A;  2YI7 A;  2C2A A;  3OWB A;  2Q2E B;  4HXZ A;  1EA6 A;  4NH8 A;  1H7S A;  2YGE A;  4GFN A;  4GCZ A;  2IWX A;  3G75 A;  4FCP A;  4MPE A;  2BU5 A;  4L8Z A;  1ZXN A;  5M4E A;  2WI3 A;  1QZR A;  4CE3 A;  4WUB A;  4HY6 A;  4P8O A;  3CWV A;  3EHJ A;  4YKY A;  2CCS A;  4H7Q A;  4KP4 A;  2YI6 A;  3ZXO A;  1JM6 A;  4EFU A;  2CG9 A;  4P7A A;  4PRX A;  4YKW A;  2GFD A;  3B27 A;  4ASF A;  4B6C A;  5IDM A;  3Q5K A;  4L93 A;  4GGL A;  3B26 A;  4BQG A;  2EXL A;  4HYP A;  4LWH A;  3GIE A;  5D7C A;  5D7D A;  2YEG A;  4MBC A;  3ZKB A;  4GEE A;  4FCQ A;  5IDJ A;  2XJX A;  4PL9 A;  5D6P A;  3MNR P;  3A0R A;  2BU2 A;  1KIJ A;  2XDL A;  5BOD A;  4L94 A;  3T1K A;  2YI5 A;  2XDK A;  2IOR A;  5CPH A;  4LWG A;  3R92 A;  4AWQ A;  1UYH A;  4ASG A;  2YEA A;  2ESA A;  1AMW A;  4MB9 A;  2XCM A;  4EFT A;  2YJX A;  1TC0 A;  1UY7 A;  2FWY A;  1UY6 A;  1I59 A;  2YGA A;  3LNU A;  2Q8H A;  2UWD A;  2XHR A;  3FT5 A;  4E00 A;  3VHC A;  2JJC A;  3B28 A;  3D2R A;  1U2O A;  3U67 A;  3TZ0 A;  2WI6 A;  4MOT A;  3D0B A;  4URM A;  1BKN A;  3CGZ A;  1THN A;  1UYD A;  1B3Q A;  5IN9 A;  2XX2 A;  3T10 A;  2YEF A;  3A0Z A;  5J6A A;  1NHJ A;  4PU9 A;  1TID A;  1UYG A;  1BYQ A;  2YE9 A;  4NH9 A;  4R3A A;  3TZ4 A;  3TUH A;  3K97 A;  2BU8 A;  3BMY A;  4EEH A;  4B7P A;  2XHT A;  2WI7 A;  4CWN A;  4JAU A;  2HCH A;  4CWQ A;  4EGI A;  1UYI A;  4URL A;  1MX0 A;  2YE6 A;  2ZKJ A;  1S14 A;  1KZN A;  2WI1 A;  1Z5C A;  4E02 A;  1UYE A;  2WI5 A;  4CWP A;  2YE8 A;  4Q20 A;  3OPD A;  3HEK A;  4KSG A;  1UYC A;  4KTN A;  2FWZ A;  2BZ5 A;  2BTZ A;  2BYH A;  1YSR A;  4FMT A;  1YC4 A;  4WUC A;  1Z5B A;  4CWS A;  2BU7 A;  4AWO A;  3HYZ A;  4XIQ A;  1BXD A;  1R62 A;  3OMU A;  4HZ0 A;  2YK9 A;  1EI1 A;  2Q8G A;  1TC6 A;  2BRE A;  3ZKD A;  2XDX A;  3CRL A;  4CE1 A;  4I5S A;  3OWD A;  4AWP A;  3WQ9 A;  3C0E A;  2XD6 A;  4ASA A;  2AKP A;  3RKZ A;  2XX4 A;  2YKC A;  5CTW A;  2XJG A;  1I5D A;  2HG1 A;  3GIG B;  5CTX A;  2YEC A;  3U2D A;  2QG2 A;  3B25 A;  3O6O A;  2O1W A;  2WI4 A;  4O09 A;  1Y4U A;  4LWE A;  3RLR A;  2YEJ A;  2XJJ A;  2WEP A;  3HZ5 A;  3HYY A;  3QDD A;  3INW A;  1H7U A;  5D6Q A;  4CWR A;  2Q8F A;  2H55 A;  3T0H A;  5FWK A;  4JQL A;  3K99 A;  2CGF A;  3EHF A;  3NMQ A;  2YKJ A;  3O0I A;  1B62 A;  4BIZ A;  5L3J A;  5BOC A;  1I5C A;  3KE6 A;  4V25 A;  4W7T A;  1YES A;  4CWF A;  1QYE A;  4JAV A;  3A0Y A;  3U2K A;  1TIL A;  4LP0 A;  4XD8 A;  4HXW A;  4YKQ A;  2YED A;  4YKX A;  4XIT A;  4QPJ A;  5F3K A;  4V26 A;  5M4M A;  1Y8P A;  3EKR A;  2FXS A;  1ZW9 A;  1I5B A;  2YI0 A;  4XKO A;  3WHA A;  2WER A;  2IOQ A;  3H4L A;  4KQV A;  5CF0 A;  3TZ2 A;  2YEB A;  4EM7 A;  4ZKI A;  1UY8 A;  2IWS A;  2JKI A;  3B24 A;  4O05 A;  3A0W A;  2O1V A;  2PNR A;  4URO A;  2QF6 A;  3EHG A;  4GQT A;  2Q8I A;  1TH8 A;  1UY9 A;  2XK2 A;  4X9L A;  2VCI A;  2BT0 A;  2YJW A;  1UYF A;  1Y8N A;  4LPB A;  3LPS A;  2YE5 A;  1Z5A A;  4O0B A;  2WEQ A;  1NHH A;  2K5B A;  3TTZ A;  2YE4 A;  4NH7 A;  2ZDY A;  1YT0 A;  2VCJ A;  2CCU A;  1YSZ A;  4MPC A;  3HHU A;  4QPK A;  1GKZ A;  4LWF A;  4GT8 A;  5M4K A;  4HY1 A;  4XKA A;  4YKT A;  4PRV A;  4BIU A;  4KSH A;  3EKO A;  4ASB A;  2XDU A;  1YT1 A;  2QG0 A;  3BM9 A;  4O04 A;  4FCR A;  2IOP A;  3PEH A;  5M4H A;  1US7 A;  4CWT A;  2HKJ A;  2FYP A;  2VWC A;  3R91 A;  1S16 A; 
#chains in the Genus database with same CATH topology
 4EMV A;  1I58 A;  2GQP A;  3QTF A;  4K4O A;  1BGQ A;  3RLQ A;  4R3M A;  1YC1 A;  5FND A;  3GIG A;  1MU5 A;  4DZY A;  5FNF A;  4DUH A;  1ID0 A;  3ZM7 A;  3D36 A;  4WUD A;  3SL2 A;  5J71 A;  2ZDX A;  1ZXM A;  4H81 A;  5F5R A;  1B63 A;  4BAE A;  4HZ5 A;  2O1U A;  1ZWH A;  4E01 A;  4I3H A;  3Q5L A;  3DGE A;  3R4M A;  4LWI A;  3INX A;  4YKR A;  3A0X A;  3EHH A;  4U7O A;  4O07 A;  1OSF A;  1AM1 A;  4AS9 A;  1Y4S A;  1YER A;  2H8M A;  4FPP A;  4EGH A;  2VW5 A;  2XX5 A;  3G7E A;  1AJ6 A;  3R4P A;  4XIP A;  1I5A A;  2YEI A;  2CCT A;  5D7R A;  2XHX A;  3CGY A;  4XKK A;  4XE2 A;  4XC0 A;  3ZXQ A;  3G7B A;  3K98 A;  4U7N A;  4HYM A;  1Y8O A;  4ZVI A;  4YKZ A;  1AH8 A;  2YKE A;  5C93 A;  3Q5J A;  3CRK A;  1TBW A;  2WI2 A;  3FV5 A;  3VHD A;  2YK2 A;  1PVG A;  2XAB A;  4EGK A;  3H80 A;  1AH6 A;  5GGZ A;  3TZ5 A;  4CE2 A;  2XDS A;  2CH4 A;  4MP2 A;  2BRC A;  2YE7 A;  4XTJ A;  2YGF A;  3K60 A;  1L0O A;  4JAS A;  3FT8 A;  5M4P A;  1YET A;  3C11 A;  3PEJ A;  4YKU A;  1UYM A;  4BXI A;  4XIR A;  3RLP A;  3A0T A;  3HZ1 A;  2ZBK B;  3VAD A;  2YEE A;  3R4N A;  4L91 A;  1NHI A;  4CWO A;  5CTY A;  1UYK A;  3VHA A;  4R1F A;  4URN A;  3R4O A;  1GKX A;  2YKB A;  3T2S A;  1QY8 A;  2BSM A;  4MPN A;  2YE2 A;  4U93 A;  4KFG A;  1U0Z A;  4XDM A;  4BQJ A;  3GIF A;  5FNC A;  3T0Z A;  4L90 A;  3O2F A;  4H85 A;  4XCL A;  2YE3 A;  2E0A A;  3IED A;  2BU6 A;  1YT2 A;  1GJV A;  1UYL A;  3OW6 A;  1YC3 A;  2IWU A;  4XCJ A;  1Z59 A;  1YS3 A;  2BYI A;  2YKI A;  3JZ3 A;  5CTU A;  4MP7 A;  2YEH A;  5M4N A;  1A4H A;  2QFO A;  2YI7 A;  2C2A A;  3OWB A;  2Q2E B;  4HXZ A;  1EA6 A;  4NH8 A;  1H7S A;  2YGE A;  4GFN A;  4GCZ A;  2FTK A;  2IWX A;  3G75 A;  4FCP A;  4MPE A;  2BU5 A;  4L8Z A;  1ZXN A;  5M4E A;  2WI3 A;  1QZR A;  4CE3 A;  4WUB A;  4HY6 A;  4P8O A;  2HHI A;  3CWV A;  3EHJ A;  4YKY A;  2CCS A;  4H7Q A;  4KP4 A;  2YI6 A;  3ZXO A;  1JM6 A;  4EFU A;  2CG9 A;  4P7A A;  4PRX A;  4YKW A;  2GFD A;  3B27 A;  4ASF A;  4B6C A;  5IDM A;  3Q5K A;  4L93 A;  4GGL A;  3B26 A;  4BQG A;  2EXL A;  4HYP A;  4LWH A;  3GIE A;  5D7C A;  5D7D A;  2YEG A;  4MBC A;  3ZKB A;  4GEE A;  4FCQ A;  5IDJ A;  2XJX A;  4PL9 A;  5D6P A;  3MNR P;  3A0R A;  2BU2 A;  1KIJ A;  2XDL A;  5BOD A;  4L94 A;  3T1K A;  2YI5 A;  2XDK A;  2IOR A;  5CPH A;  4LWG A;  3R92 A;  4AWQ A;  1UYH A;  4ASG A;  2YEA A;  2ESA A;  1AMW A;  4MB9 A;  2XCM A;  4EFT A;  2YJX A;  1TC0 A;  1UY7 A;  2FWY A;  1UY6 A;  1I59 A;  2YGA A;  3LNU A;  2Q8H A;  2UWD A;  2XHR A;  3FT5 A;  4E00 A;  3VHC A;  2JJC A;  3B28 A;  3CYG A;  3D2R A;  1U2O A;  3U67 A;  3TZ0 A;  2WI6 A;  4MOT A;  3D0B A;  4URM A;  1BKN A;  3CGZ A;  1THN A;  1UYD A;  1B3Q A;  5IN9 A;  2XX2 A;  3T10 A;  2YEF A;  3A0Z A;  5J6A A;  1NHJ A;  4PU9 A;  1TID A;  1UYG A;  1BYQ A;  2YE9 A;  4NH9 A;  4R3A A;  3TZ4 A;  3TUH A;  3K97 A;  5JEN A;  2BU8 A;  3BMY A;  4EEH A;  4B7P A;  2XHT A;  2WI7 A;  4CWN A;  4JAU A;  1IXM A;  2HCH A;  4CWQ A;  4EGI A;  1UYI A;  4URL A;  1MX0 A;  2YE6 A;  3S5T A;  2ZKJ A;  1S14 A;  1KZN A;  2WI1 A;  1Z5C A;  4E02 A;  1UYE A;  2WI5 A;  4CWP A;  2YE8 A;  4Q20 A;  3OPD A;  3HEK A;  4KSG A;  2C1G A;  1UYC A;  4KTN A;  2FWZ A;  2BZ5 A;  2BTZ A;  2BYH A;  1YSR A;  4FMT A;  1YC4 A;  4WUC A;  1Z5B A;  4CWS A;  2BU7 A;  4AWO A;  3HYZ A;  4XIQ A;  1BXD A;  1R62 A;  3OMU A;  4HZ0 A;  2YK9 A;  1EI1 A;  2Q8G A;  1TC6 A;  2BRE A;  3ZKD A;  2XDX A;  3CRL A;  4CE1 A;  4I5S A;  3OWD A;  4AWP A;  3WQ9 A;  3C0E A;  2XD6 A;  4ASA A;  2AKP A;  3RKZ A;  2XX4 A;  2YKC A;  5CTW A;  2XJG A;  1I5D A;  2HG1 A;  3GIG B;  5CTX A;  2YEC A;  3U2D A;  2QG2 A;  3B25 A;  3O6O A;  2O1W A;  2WI4 A;  4O09 A;  1Y4U A;  4LWE A;  3RLR A;  2YEJ A;  2XJJ A;  2WEP A;  3HZ5 A;  3HYY A;  3QDD A;  3INW A;  1H7U A;  5D6Q A;  4CWR A;  2Q8F A;  2H55 A;  3T0H A;  5FWK A;  4JQL A;  3K99 A;  2CGF A;  3EHF A;  3NMQ A;  2YKJ A;  3O0I A;  1B62 A;  4BIZ A;  5L3J A;  5BOC A;  1I5C A;  3KE6 A;  4V25 A;  4W7T A;  1F51 A;  1YES A;  4CWF A;  1QYE A;  4JAV A;  3A0Y A;  3U2K A;  1TIL A;  4LP0 A;  4XD8 A;  4HXW A;  4YKQ A;  2YED A;  4YKX A;  4XIT A;  4QPJ A;  5F3K A;  4V26 A;  5M4M A;  1Y8P A;  3EKR A;  2FXS A;  1ZW9 A;  1I5B A;  2YI0 A;  4XKO A;  3WHA A;  2WER A;  2IOQ A;  3H4L A;  4KQV A;  5CF0 A;  3TZ2 A;  2C1I A;  2YEB A;  4EM7 A;  4ZKI A;  1UY8 A;  2IWS A;  2JKI A;  3B24 A;  4O05 A;  3A0W A;  2O1V A;  2PNR A;  4URO A;  2QF6 A;  3EHG A;  4GQT A;  2Q8I A;  1TH8 A;  1UY9 A;  2XK2 A;  4X9L A;  2VCI A;  2BT0 A;  2YJW A;  1UYF A;  1Y8N A;  4LPB A;  3LPS A;  2YE5 A;  1Z5A A;  4O0B A;  2WEQ A;  1NHH A;  2K5B A;  3TTZ A;  2YE4 A;  4NH7 A;  2ZDY A;  1YT0 A;  2VCJ A;  2CCU A;  1YSZ A;  4MPC A;  3HHU A;  4QPK A;  1GKZ A;  4LWF A;  4GT8 A;  5M4K A;  4E72 A;  4HY1 A;  4XKA A;  4YKT A;  4PRV A;  4BIU A;  4KSH A;  3EKO A;  4ASB A;  2XDU A;  1YT1 A;  2QG0 A;  3BM9 A;  4O04 A;  4FCR A;  2IOP A;  3PEH A;  5M4H A;  3LMM A;  1US7 A;  4CWT A;  2HKJ A;  2FYP A;  2VWC A;  3R91 A;  1S16 A; 
#chains in the Genus database with same CATH homology
 4EMV A;  1I58 A;  2GQP A;  3QTF A;  4K4O A;  1BGQ A;  3RLQ A;  4R3M A;  1YC1 A;  5FND A;  3GIG A;  1MU5 A;  4DZY A;  5FNF A;  4DUH A;  1ID0 A;  3ZM7 A;  3D36 A;  4WUD A;  3SL2 A;  5J71 A;  2ZDX A;  1ZXM A;  4H81 A;  5F5R A;  1B63 A;  4BAE A;  4HZ5 A;  2O1U A;  1ZWH A;  4E01 A;  4I3H A;  3Q5L A;  3DGE A;  3R4M A;  4LWI A;  3INX A;  4YKR A;  3A0X A;  3EHH A;  4U7O A;  4O07 A;  1OSF A;  1AM1 A;  4AS9 A;  1Y4S A;  1YER A;  2H8M A;  4FPP A;  4EGH A;  2VW5 A;  2XX5 A;  3G7E A;  1AJ6 A;  3R4P A;  4XIP A;  1I5A A;  2YEI A;  2CCT A;  5D7R A;  2XHX A;  3CGY A;  4XKK A;  4XE2 A;  4XC0 A;  3ZXQ A;  3G7B A;  3K98 A;  4U7N A;  4HYM A;  1Y8O A;  4ZVI A;  4YKZ A;  1AH8 A;  2YKE A;  5C93 A;  3Q5J A;  3CRK A;  1TBW A;  2WI2 A;  3FV5 A;  3VHD A;  2YK2 A;  1PVG A;  2XAB A;  4EGK A;  3H80 A;  1AH6 A;  5GGZ A;  3TZ5 A;  4CE2 A;  2XDS A;  2CH4 A;  4MP2 A;  2BRC A;  2YE7 A;  4XTJ A;  2YGF A;  3K60 A;  1L0O A;  4JAS A;  3FT8 A;  5M4P A;  1YET A;  3C11 A;  3PEJ A;  4YKU A;  1UYM A;  4BXI A;  4XIR A;  3RLP A;  3A0T A;  3HZ1 A;  2ZBK B;  3VAD A;  2YEE A;  3R4N A;  4L91 A;  1NHI A;  4CWO A;  5CTY A;  1UYK A;  3VHA A;  4R1F A;  4URN A;  3R4O A;  1GKX A;  2YKB A;  3T2S A;  1QY8 A;  2BSM A;  4MPN A;  2YE2 A;  4U93 A;  4KFG A;  1U0Z A;  4XDM A;  4BQJ A;  3GIF A;  5FNC A;  3T0Z A;  4L90 A;  3O2F A;  4H85 A;  4XCL A;  2YE3 A;  2E0A A;  3IED A;  2BU6 A;  1YT2 A;  1GJV A;  1UYL A;  3OW6 A;  1YC3 A;  2IWU A;  4XCJ A;  1Z59 A;  1YS3 A;  2BYI A;  2YKI A;  3JZ3 A;  5CTU A;  4MP7 A;  2YEH A;  5M4N A;  1A4H A;  2QFO A;  2YI7 A;  2C2A A;  3OWB A;  2Q2E B;  4HXZ A;  1EA6 A;  4NH8 A;  1H7S A;  2YGE A;  4GFN A;  4GCZ A;  2IWX A;  3G75 A;  4FCP A;  4MPE A;  2BU5 A;  4L8Z A;  1ZXN A;  5M4E A;  2WI3 A;  1QZR A;  4CE3 A;  4WUB A;  4HY6 A;  4P8O A;  3CWV A;  3EHJ A;  4YKY A;  2CCS A;  4H7Q A;  4KP4 A;  2YI6 A;  3ZXO A;  1JM6 A;  4EFU A;  2CG9 A;  4P7A A;  4PRX A;  4YKW A;  2GFD A;  3B27 A;  4ASF A;  4B6C A;  5IDM A;  3Q5K A;  4L93 A;  4GGL A;  3B26 A;  4BQG A;  2EXL A;  4HYP A;  4LWH A;  3GIE A;  5D7C A;  5D7D A;  2YEG A;  4MBC A;  3ZKB A;  4GEE A;  4FCQ A;  5IDJ A;  2XJX A;  4PL9 A;  5D6P A;  3MNR P;  3A0R A;  2BU2 A;  1KIJ A;  2XDL A;  5BOD A;  4L94 A;  3T1K A;  2YI5 A;  2XDK A;  2IOR A;  5CPH A;  4LWG A;  3R92 A;  4AWQ A;  1UYH A;  4ASG A;  2YEA A;  2ESA A;  1AMW A;  4MB9 A;  2XCM A;  4EFT A;  2YJX A;  1TC0 A;  1UY7 A;  2FWY A;  1UY6 A;  1I59 A;  2YGA A;  3LNU A;  2Q8H A;  2UWD A;  2XHR A;  3FT5 A;  4E00 A;  3VHC A;  2JJC A;  3B28 A;  3D2R A;  1U2O A;  3U67 A;  3TZ0 A;  2WI6 A;  4MOT A;  3D0B A;  4URM A;  1BKN A;  3CGZ A;  1THN A;  1UYD A;  1B3Q A;  5IN9 A;  2XX2 A;  3T10 A;  2YEF A;  3A0Z A;  5J6A A;  1NHJ A;  4PU9 A;  1TID A;  1UYG A;  1BYQ A;  2YE9 A;  4NH9 A;  4R3A A;  3TZ4 A;  3TUH A;  3K97 A;  2BU8 A;  3BMY A;  4EEH A;  4B7P A;  2XHT A;  2WI7 A;  4CWN A;  4JAU A;  2HCH A;  4CWQ A;  4EGI A;  1UYI A;  4URL A;  1MX0 A;  2YE6 A;  2ZKJ A;  1S14 A;  1KZN A;  2WI1 A;  1Z5C A;  4E02 A;  1UYE A;  2WI5 A;  4CWP A;  2YE8 A;  4Q20 A;  3OPD A;  3HEK A;  4KSG A;  1UYC A;  4KTN A;  2FWZ A;  2BZ5 A;  2BTZ A;  2BYH A;  1YSR A;  4FMT A;  1YC4 A;  4WUC A;  1Z5B A;  4CWS A;  2BU7 A;  4AWO A;  3HYZ A;  4XIQ A;  1BXD A;  1R62 A;  3OMU A;  4HZ0 A;  2YK9 A;  1EI1 A;  2Q8G A;  1TC6 A;  2BRE A;  3ZKD A;  2XDX A;  3CRL A;  4CE1 A;  4I5S A;  3OWD A;  4AWP A;  3WQ9 A;  3C0E A;  2XD6 A;  4ASA A;  2AKP A;  3RKZ A;  2XX4 A;  2YKC A;  5CTW A;  2XJG A;  1I5D A;  2HG1 A;  3GIG B;  5CTX A;  2YEC A;  3U2D A;  2QG2 A;  3B25 A;  3O6O A;  2O1W A;  2WI4 A;  4O09 A;  1Y4U A;  4LWE A;  3RLR A;  2YEJ A;  2XJJ A;  2WEP A;  3HZ5 A;  3HYY A;  3QDD A;  3INW A;  1H7U A;  5D6Q A;  4CWR A;  2Q8F A;  2H55 A;  3T0H A;  5FWK A;  4JQL A;  3K99 A;  2CGF A;  3EHF A;  3NMQ A;  2YKJ A;  3O0I A;  1B62 A;  4BIZ A;  5L3J A;  5BOC A;  1I5C A;  3KE6 A;  4V25 A;  4W7T A;  1YES A;  4CWF A;  1QYE A;  4JAV A;  3A0Y A;  3U2K A;  1TIL A;  4LP0 A;  4XD8 A;  4HXW A;  4YKQ A;  2YED A;  4YKX A;  4XIT A;  4QPJ A;  5F3K A;  4V26 A;  5M4M A;  1Y8P A;  3EKR A;  2FXS A;  1ZW9 A;  1I5B A;  2YI0 A;  4XKO A;  3WHA A;  2WER A;  2IOQ A;  3H4L A;  4KQV A;  5CF0 A;  3TZ2 A;  2YEB A;  4EM7 A;  4ZKI A;  1UY8 A;  2IWS A;  2JKI A;  3B24 A;  4O05 A;  3A0W A;  2O1V A;  2PNR A;  4URO A;  2QF6 A;  3EHG A;  4GQT A;  2Q8I A;  1TH8 A;  1UY9 A;  2XK2 A;  4X9L A;  2VCI A;  2BT0 A;  2YJW A;  1UYF A;  1Y8N A;  4LPB A;  3LPS A;  2YE5 A;  1Z5A A;  4O0B A;  2WEQ A;  1NHH A;  2K5B A;  3TTZ A;  2YE4 A;  4NH7 A;  2ZDY A;  1YT0 A;  2VCJ A;  2CCU A;  1YSZ A;  4MPC A;  3HHU A;  4QPK A;  1GKZ A;  4LWF A;  4GT8 A;  5M4K A;  4HY1 A;  4XKA A;  4YKT A;  4PRV A;  4BIU A;  4KSH A;  3EKO A;  4ASB A;  2XDU A;  1YT1 A;  2QG0 A;  3BM9 A;  4O04 A;  4FCR A;  2IOP A;  3PEH A;  5M4H A;  1US7 A;  4CWT A;  2HKJ A;  2FYP A;  2VWC A;  3R91 A;  1S16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...