3FV5A

Crystal structure of e. coli topoisomerase iv co-complexed with inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
201
structure length
180
Chain Sequence
GLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLISVVNALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA topoisomerase 4 subunit B
publication title Design and syntheses of novel C7-derived-aminobenzimidazole ureas: bacterial gyrase/topoisomerase IV inhibitors with potent Gram-positve antibacterial activity
rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 54
structure length 180
sequence length 201
chains with identical sequence B
ec nomenclature ec 5.99.1.-:
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3fv5A00
1UYKA 4O05A 2YI5A 4FCRA 4GQTA 4EM7A 2Q8GA 4B7PA 4LWFA 5CTXA 4WUCA 2JJCA 2UWDA 1ZWHA 1ZW9A 1YT1A 2WEQA 5D7CA 1EA6A 2XDXA 1JM6A 1U2OA 4KFGA 3O2FA 2CCUA 4UROA 1AJ6A 2CH4A 1THNA 2YJWA 4V26A 2IWXA 4MP2A 1QYEA 4YKZA 4P8OA 1R62A 3VHCA 4CE1A 1I5DA 2YI6A 4NH8A 4E01A 3JZ3A 1Z59A 2YEEA 2H55A 4NH7A 3R4PA 4BQJA 3DGEA 4ASFA 4CWRA 4BAEA 2BSMA 1UY8A 4MPCA 2YGAA 1UYLA 2YGEA 1Y8OA 2YK2A 2YE9A 2WI6A 1YETA 2YEGA 3QDDA 1UYDA 4WUBA 4EMVA 3EKOA 2XJJA 3A0XA 2YE6A 2JKIA 2XK2A 3T0HA 2BRCA 3TUHA 4JAUA 5FWKA 1TIDA 3O0IA 3SL2A 4LWEA 1UYIA 5GGZA 4PU9A 5M4KA 3TZ2A 3K99A 2XHTA 3B28A 2CCTA 3BMYA 4YKTA 1Z5AA 2IWSA 4CWSA 2AKPA 3RLQA 4KTNA 3T10A 2ZBKB 1BKNA 4FPPA 3OMUA 2YKCA 4ASGA 4O09A 2QF6A 4CWFA 1Y8PA 2VCIA 2FYPA 3HHUA 1AM1A 2YE8A 2Q2EB 2K5BA 1UYEA 3NMQA 2XX4A 3CGYA 2BT0A 4Q20A 2XX2A 4CWPA 2ZDYA 1UYHA 3RLPA 3OWBA 2QG0A 1US7A 3GIGA 2CCSA 3R4MA 3K97A 4HXZA 5D7DA 3OWDA 3CWVA 3U67A 3ZM7A 5CF0A 4FCQA 5C93A 4ZKIA 1YC4A 2XDLA 1UYCA 5IDJA 3D36A 3TZ4A 2YE3A 2CG9A 4YKXA 1UYGA 1YC3A 1S16A 2O1UA 3R4NA 5CTWA 2Q8IA 1U0ZA 5CTUA 3TTZA 5M4EA 2WI7A 2YGFA 2YKIA 3Q5KA 1PVGA 3EHHA 5M4MA 4AWOA 1TBWA 2QFOA 2QG2A 1L0OA 3EHJA 4U93A 2XD6A 4XKOA 3R4OA 2IORA 4BIZA 1Y8NA 1ZXNA 2O1WA 4EGHA 2XDUA 5BODA 3U2KA 4MP7A 2BREA 4JQLA 1BXDA 1B3QA 2IWUA 4H85A 2WI2A 1UYFA 4XD8A 4FMTA 3LNUA 2YE7A 1YT0A 1YS3A 1QY8A 1Z5BA 2BU5A 4KSGA 1KIJA 5BOCA 3TZ5A 4YKWA 1TC6A 4HZ5A 4MOTA 4CWOA 3HEKA 4PRXA 1YSZA 3R92A 2YEBA 1AMWA 3LPSA 2H8MA 1KZNA 3ZKDA 3CRLA 2FWYA 4O0BA 4W7TA 2YJXA 4L94A 3K60A 3C0EA 2YKBA 2XABA 3CRKA 3G7BA 2ESAA 2YEDA 4H7QA 4CWNA 2BU8A 3U2DA 3C11A 4LWHA 3FT5A 3O6OA 2YKJA 5D6PA 2WI3A 3VADA 3G75A 4AWPA 3T2SA 4YKQA 4GCZA 4MBCA 5J6AA 1NHJA 4L90A 4O07A 2IOQA 3Q5LA 2VCJA 3A0YA 3WQ9A 2IOPA 4V25A 1TILA 4AWQA 5IN9A 4U7NA 1BYQA 1I58A 2WI4A 1UY7A 2WI5A 4P7AA 2O1VA 3R91A 1H7SA 4LP0A 5F5RA 3G7EA 2YEIA 4GEEA 1EI1A 3GIEA 4HYPA 4XCJA 4XKKA 2XHRA 3RKZA 4KP4A 1NHHA 4K4OA 3RLRA 3A0ZA 3B25A 4EGKA 4AS9A 2XJGA 4JAVA 2XCMA 2ZDXA 3INWA 3ZXQA 5M4PA 1TH8A 4MB9A 4MPEA 2C2AA 1AH8A 3T1KA 3WHAA 3A0WA 2BZ5A 4XTJA 1YESA 4B6CA 4ZVIA 5D6QA 4CWTA 4BXIA 2BYIA 1I59A 5FNCA 1AH6A 4URNA 2PNRA 3B24A 4R3AA 4URMA 4EFTA 5IDMA 4E02A 5M4HA 2YECA 4LWGA 3HZ1A 3EKRA 3KE6A 1B62A 3D2RA 4XDMA 1UY6A 4CE2A 5D7RA 2BTZA 4EFUA 3VHDA 2GQPA 4DZYA 4H81A 4PRVA 3A0RA 2YEHA 3EHGA 4XIQA 2E0AA 3B26A 3GIFA 2XDSA 4GFNA 4HY6A 4R3MA 4GT8A 1GKZA 3IEDA 4X9LA 1YERA 2YK9A 1GKXA 4HYMA 5CTYA 2EXLA 2YI7A 2WEPA 4XE2A 4LPBA 4HXWA 3H80A 2YE5A 3HYZA 2FWZA 3GIGB 2FXSA 2WERA 4KSHA 4ASBA 4L91A 2XHXA 4EEHA 4R1FA 4I5SA 5M4NA 3Q5JA 4WUDA 4XIRA 3TZ0A 4XC0A 5J71A 4NH9A 1S14A 5F3KA 2HKJA 2BU7A 4CE3A 4QPJA 4KQVA 1Z5CA 3T0ZA 1I5AA 4LWIA 3OW6A 4EGIA 1ID0A 4L8ZA 4ASAA 3ZKBA 3QTFA 2YKEA 1UYMA 3HYYA 3FV5A 3PEHA 2ZKJA 2GFDA 2Q8FA 1Y4SA 1ZXMA 2BYHA 1H7UA 5CPHA 2Q8HA 2VW5A 2WI1A 4YKUA 3CGZA 4HZ0A 1I5BA 3HZ5A 1Y4UA 3A0TA 1OSFA 1UY9A 3VHAA 3EHFA 2YEFA 4HY1A 1TC0A 2YE4A 4XCLA 5FNDA 3MNRP 2YE2A 1MU5A 3PEJA 4QPKA 5L3JA 1B63A 2HCHA 1BGQA 3D0BA 4L93A 4YKYA 2YI0A 4U7OA 3K98A 1QZRA 4MPNA 4XITA 2VWCA 2XX5A 4PL9A 4XIPA 3ZXOA 3B27A 4BIUA 1YC1A 3OPDA 4I3HA 2HG1A 4URLA 1GJVA 1NHIA 2XJXA 2BU6A 4GGLA 1YSRA 4JASA 3INXA 1A4HA 2YEJA 2CGFA 1YT2A 4E00A 2XDKA 3H4LA 3FT8A 2BU2A 4XKAA 4BQGA 1MX0A 3BM9A 4CWQA 1I5CA 4DUHA 4O04A 5FNFA 2YEAA 4YKRA 4FCPA
chains in the Genus database with same CATH superfamily
1UYKA 4O05A 2YI5A 4FCRA 4GQTA 4EM7A 2Q8GA 4B7PA 4LWFA 5CTXA 4WUCA 2JJCA 2UWDA 1ZWHA 1ZW9A 3LMMA 1YT1A 2WEQA 5D7CA 1EA6A 2XDXA 1JM6A 1U2OA 4KFGA 3O2FA 2CCUA 4UROA 1AJ6A 2CH4A 1THNA 2YJWA 4V26A 2IWXA 4MP2A 1QYEA 4YKZA 4P8OA 1R62A 3VHCA 4CE1A 1I5DA 2YI6A 4NH8A 4E01A 3JZ3A 1Z59A 2YEEA 2H55A 4NH7A 3R4PA 4BQJA 3DGEA 4ASFA 4CWRA 4BAEA 2BSMA 1UY8A 4MPCA 2YGAA 1UYLA 1IXMA 2YGEA 1Y8OA 2YK2A 2YE9A 2WI6A 1YETA 2YEGA 3QDDA 1UYDA 4WUBA 4EMVA 3EKOA 2XJJA 3A0XA 2YE6A 2JKIA 2XK2A 3T0HA 2BRCA 3TUHA 4JAUA 5FWKA 1TIDA 3O0IA 3SL2A 4LWEA 1UYIA 2HHIA 5GGZA 4PU9A 5M4KA 3TZ2A 3K99A 2XHTA 3B28A 2CCTA 3BMYA 4E72A 4YKTA 1Z5AA 2IWSA 4CWSA 2AKPA 3RLQA 4KTNA 3T10A 2ZBKB 1BKNA 4FPPA 3OMUA 2YKCA 4ASGA 4O09A 2QF6A 4CWFA 1Y8PA 2VCIA 2FYPA 3HHUA 1AM1A 2YE8A 2Q2EB 2K5BA 1UYEA 3NMQA 2XX4A 3CGYA 2BT0A 4Q20A 2XX2A 4CWPA 2ZDYA 1UYHA 3RLPA 3OWBA 2QG0A 1US7A 3GIGA 2FTKA 2CCSA 3R4MA 3K97A 4HXZA 5D7DA 3OWDA 3CWVA 3U67A 3ZM7A 5CF0A 4FCQA 5C93A 4ZKIA 1YC4A 2XDLA 1UYCA 5IDJA 3D36A 3TZ4A 2YE3A 2CG9A 2C1GA 4YKXA 1UYGA 1YC3A 1S16A 2O1UA 3R4NA 5CTWA 2Q8IA 1U0ZA 5CTUA 3TTZA 5M4EA 2WI7A 2YGFA 2YKIA 3Q5KA 1PVGA 3EHHA 5M4MA 4AWOA 1TBWA 2QFOA 2QG2A 1L0OA 3EHJA 4U93A 2XD6A 4XKOA 3R4OA 2IORA 4BIZA 1Y8NA 1ZXNA 2O1WA 4EGHA 2XDUA 5BODA 3U2KA 4MP7A 2BREA 4JQLA 1BXDA 1B3QA 3CYGA 2IWUA 4H85A 2WI2A 1UYFA 4XD8A 4FMTA 3LNUA 2YE7A 1YT0A 1YS3A 1QY8A 1Z5BA 2BU5A 4KSGA 1KIJA 5BOCA 3TZ5A 4YKWA 1TC6A 4HZ5A 4MOTA 4CWOA 3HEKA 4PRXA 1YSZA 3R92A 2YEBA 1AMWA 3LPSA 2H8MA 1KZNA 3ZKDA 3CRLA 2FWYA 4O0BA 4W7TA 2YJXA 4L94A 3K60A 3C0EA 2YKBA 2XABA 3CRKA 3G7BA 2ESAA 2YEDA 4H7QA 4CWNA 2BU8A 3U2DA 3C11A 4LWHA 3FT5A 3O6OA 2YKJA 5D6PA 2WI3A 3VADA 3G75A 4AWPA 3T2SA 4YKQA 4GCZA 4MBCA 5J6AA 1NHJA 4L90A 4O07A 2IOQA 3Q5LA 2VCJA 3A0YA 3WQ9A 2IOPA 4V25A 1TILA 4AWQA 5IN9A 4U7NA 1BYQA 1I58A 2WI4A 1UY7A 2WI5A 4P7AA 2O1VA 3R91A 1H7SA 4LP0A 5F5RA 3G7EA 2YEIA 4GEEA 1EI1A 3GIEA 4HYPA 4XCJA 4XKKA 2XHRA 3RKZA 4KP4A 1NHHA 4K4OA 3RLRA 3A0ZA 3B25A 4EGKA 4AS9A 2XJGA 4JAVA 2XCMA 2ZDXA 3INWA 3ZXQA 5M4PA 1TH8A 4MB9A 4MPEA 2C2AA 1AH8A 3T1KA 3WHAA 3A0WA 2BZ5A 4XTJA 1YESA 4B6CA 4ZVIA 5D6QA 4CWTA 4BXIA 2BYIA 1I59A 5FNCA 1AH6A 4URNA 2PNRA 3B24A 4R3AA 4URMA 4EFTA 5IDMA 4E02A 5M4HA 2YECA 4LWGA 3HZ1A 3EKRA 3KE6A 1B62A 3D2RA 4XDMA 1UY6A 4CE2A 5D7RA 2BTZA 4EFUA 3VHDA 2GQPA 4DZYA 4H81A 4PRVA 3A0RA 2YEHA 3EHGA 4XIQA 2E0AA 3B26A 3GIFA 2XDSA 4GFNA 4HY6A 4R3MA 4GT8A 1GKZA 3IEDA 4X9LA 1YERA 2YK9A 1GKXA 4HYMA 5CTYA 2EXLA 2YI7A 2WEPA 4XE2A 4LPBA 4HXWA 3H80A 2YE5A 3HYZA 2FWZA 3GIGB 2FXSA 2WERA 4KSHA 4ASBA 4L91A 2XHXA 4EEHA 4R1FA 4I5SA 5JENA 5M4NA 3Q5JA 4WUDA 4XIRA 3TZ0A 4XC0A 5J71A 4NH9A 1S14A 5F3KA 2HKJA 2BU7A 4CE3A 4QPJA 4KQVA 1Z5CA 3T0ZA 1I5AA 4LWIA 3OW6A 4EGIA 1ID0A 4L8ZA 4ASAA 3ZKBA 3QTFA 2YKEA 1UYMA 3HYYA 3FV5A 3PEHA 2ZKJA 2GFDA 2Q8FA 1Y4SA 1ZXMA 2C1IA 2BYHA 1H7UA 5CPHA 2Q8HA 2VW5A 2WI1A 4YKUA 3CGZA 4HZ0A 1I5BA 3HZ5A 1Y4UA 3A0TA 1OSFA 1UY9A 3VHAA 3EHFA 2YEFA 4HY1A 1TC0A 2YE4A 4XCLA 5FNDA 3MNRP 2YE2A 1MU5A 3PEJA 4QPKA 5L3JA 1B63A 2HCHA 1BGQA 3D0BA 4L93A 4YKYA 2YI0A 4U7OA 3K98A 1QZRA 4MPNA 4XITA 2VWCA 2XX5A 4PL9A 4XIPA 3ZXOA 3B27A 4BIUA 1YC1A 3OPDA 4I3HA 2HG1A 4URLA 3S5TA 1GJVA 1NHIA 2XJXA 2BU6A 4GGLA 1YSRA 4JASA 3INXA 1A4HA 2YEJA 2CGFA 1YT2A 4E00A 2XDKA 3H4LA 3FT8A 2BU2A 4XKAA 4BQGA 1MX0A 3BM9A 4CWQA 1I5CA 4DUHA 4O04A 1F51A 5FNFA 2YEAA 4YKRA 4FCPA
chains in the Genus database with same CATH topology
1UYKA 4O05A 2YI5A 4FCRA 4GQTA 4EM7A 2Q8GA 4B7PA 4LWFA 5CTXA 4WUCA 2JJCA 2UWDA 1ZWHA 1ZW9A 1YT1A 2WEQA 5D7CA 1EA6A 2XDXA 1JM6A 1U2OA 4KFGA 3O2FA 2CCUA 4UROA 1AJ6A 2CH4A 1THNA 2YJWA 4V26A 2IWXA 4MP2A 1QYEA 4YKZA 4P8OA 1R62A 3VHCA 4CE1A 1I5DA 2YI6A 4NH8A 4E01A 3JZ3A 1Z59A 2YEEA 2H55A 4NH7A 3R4PA 4BQJA 3DGEA 4ASFA 4CWRA 4BAEA 2BSMA 1UY8A 4MPCA 2YGAA 1UYLA 2YGEA 1Y8OA 2YK2A 2YE9A 2WI6A 1YETA 2YEGA 3QDDA 1UYDA 4WUBA 4EMVA 3EKOA 2XJJA 3A0XA 2YE6A 2JKIA 2XK2A 3T0HA 2BRCA 3TUHA 4JAUA 5FWKA 1TIDA 3O0IA 3SL2A 4LWEA 1UYIA 5GGZA 4PU9A 5M4KA 3TZ2A 3K99A 2XHTA 3B28A 2CCTA 3BMYA 4YKTA 1Z5AA 2IWSA 4CWSA 2AKPA 3RLQA 4KTNA 3T10A 2ZBKB 1BKNA 4FPPA 3OMUA 2YKCA 4ASGA 4O09A 2QF6A 4CWFA 1Y8PA 2VCIA 2FYPA 3HHUA 1AM1A 2YE8A 2Q2EB 2K5BA 1UYEA 3NMQA 2XX4A 3CGYA 2BT0A 4Q20A 2XX2A 4CWPA 2ZDYA 1UYHA 3RLPA 3OWBA 2QG0A 1US7A 3GIGA 2CCSA 3R4MA 3K97A 4HXZA 5D7DA 3OWDA 3CWVA 3U67A 3ZM7A 5CF0A 4FCQA 5C93A 4ZKIA 1YC4A 2XDLA 1UYCA 5IDJA 3D36A 3TZ4A 2YE3A 2CG9A 4YKXA 1UYGA 1YC3A 1S16A 2O1UA 3R4NA 5CTWA 2Q8IA 1U0ZA 5CTUA 3TTZA 5M4EA 2WI7A 2YGFA 2YKIA 3Q5KA 1PVGA 3EHHA 5M4MA 4AWOA 1TBWA 2QFOA 2QG2A 1L0OA 3EHJA 4U93A 2XD6A 4XKOA 3R4OA 2IORA 4BIZA 1Y8NA 1ZXNA 2O1WA 4EGHA 2XDUA 5BODA 3U2KA 4MP7A 2BREA 4JQLA 1BXDA 1B3QA 2IWUA 4H85A 2WI2A 1UYFA 4XD8A 4FMTA 3LNUA 2YE7A 1YT0A 1YS3A 1QY8A 1Z5BA 2BU5A 4KSGA 1KIJA 5BOCA 3TZ5A 4YKWA 1TC6A 4HZ5A 4MOTA 4CWOA 3HEKA 4PRXA 1YSZA 3R92A 2YEBA 1AMWA 3LPSA 2H8MA 1KZNA 3ZKDA 3CRLA 2FWYA 4O0BA 4W7TA 2YJXA 4L94A 3K60A 3C0EA 2YKBA 2XABA 3CRKA 3G7BA 2ESAA 2YEDA 4H7QA 4CWNA 2BU8A 3U2DA 3C11A 4LWHA 3FT5A 3O6OA 2YKJA 5D6PA 2WI3A 3VADA 3G75A 4AWPA 3T2SA 4YKQA 4GCZA 4MBCA 5J6AA 1NHJA 4L90A 4O07A 2IOQA 3Q5LA 2VCJA 3A0YA 3WQ9A 2IOPA 4V25A 1TILA 4AWQA 5IN9A 4U7NA 1BYQA 1I58A 2WI4A 1UY7A 2WI5A 4P7AA 2O1VA 3R91A 1H7SA 4LP0A 5F5RA 3G7EA 2YEIA 4GEEA 1EI1A 3GIEA 4HYPA 4XCJA 4XKKA 2XHRA 3RKZA 4KP4A 1NHHA 4K4OA 3RLRA 3A0ZA 3B25A 4EGKA 4AS9A 2XJGA 4JAVA 2XCMA 2ZDXA 3INWA 3ZXQA 5M4PA 1TH8A 4MB9A 4MPEA 2C2AA 1AH8A 3T1KA 3WHAA 3A0WA 2BZ5A 4XTJA 1YESA 4B6CA 4ZVIA 5D6QA 4CWTA 4BXIA 2BYIA 1I59A 5FNCA 1AH6A 4URNA 2PNRA 3B24A 4R3AA 4URMA 4EFTA 5IDMA 4E02A 5M4HA 2YECA 4LWGA 3HZ1A 3EKRA 3KE6A 1B62A 3D2RA 4XDMA 1UY6A 4CE2A 5D7RA 2BTZA 4EFUA 3VHDA 2GQPA 4DZYA 4H81A 4PRVA 3A0RA 2YEHA 3EHGA 4XIQA 2E0AA 3B26A 3GIFA 2XDSA 4GFNA 4HY6A 4R3MA 4GT8A 1GKZA 3IEDA 4X9LA 1YERA 2YK9A 1GKXA 4HYMA 5CTYA 2EXLA 2YI7A 2WEPA 4XE2A 4LPBA 4HXWA 3H80A 2YE5A 3HYZA 2FWZA 3GIGB 2FXSA 2WERA 4KSHA 4ASBA 4L91A 2XHXA 4EEHA 4R1FA 4I5SA 5M4NA 3Q5JA 4WUDA 4XIRA 3TZ0A 4XC0A 5J71A 4NH9A 1S14A 5F3KA 2HKJA 2BU7A 4CE3A 4QPJA 4KQVA 1Z5CA 3T0ZA 1I5AA 4LWIA 3OW6A 4EGIA 1ID0A 4L8ZA 4ASAA 3ZKBA 3QTFA 2YKEA 1UYMA 3HYYA 3FV5A 3PEHA 2ZKJA 2GFDA 2Q8FA 1Y4SA 1ZXMA 2BYHA 1H7UA 5CPHA 2Q8HA 2VW5A 2WI1A 4YKUA 3CGZA 4HZ0A 1I5BA 3HZ5A 1Y4UA 3A0TA 1OSFA 1UY9A 3VHAA 3EHFA 2YEFA 4HY1A 1TC0A 2YE4A 4XCLA 5FNDA 3MNRP 2YE2A 1MU5A 3PEJA 4QPKA 5L3JA 1B63A 2HCHA 1BGQA 3D0BA 4L93A 4YKYA 2YI0A 4U7OA 3K98A 1QZRA 4MPNA 4XITA 2VWCA 2XX5A 4PL9A 4XIPA 3ZXOA 3B27A 4BIUA 1YC1A 3OPDA 4I3HA 2HG1A 4URLA 1GJVA 1NHIA 2XJXA 2BU6A 4GGLA 1YSRA 4JASA 3INXA 1A4HA 2YEJA 2CGFA 1YT2A 4E00A 2XDKA 3H4LA 3FT8A 2BU2A 4XKAA 4BQGA 1MX0A 3BM9A 4CWQA 1I5CA 4DUHA 4O04A 5FNFA 2YEAA 4YKRA 4FCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UYK A;  4O05 A;  2YI5 A;  4FCR A;  4GQT A;  4EM7 A;  2Q8G A;  4B7P A;  4LWF A;  5CTX A;  4WUC A;  2JJC A;  2UWD A;  1ZWH A;  1ZW9 A;  1YT1 A;  2WEQ A;  5D7C A;  1EA6 A;  2XDX A;  1JM6 A;  1U2O A;  4KFG A;  3O2F A;  2CCU A;  4URO A;  1AJ6 A;  2CH4 A;  1THN A;  2YJW A;  4V26 A;  2IWX A;  4MP2 A;  1QYE A;  4YKZ A;  4P8O A;  1R62 A;  3VHC A;  4CE1 A;  1I5D A;  2YI6 A;  4NH8 A;  4E01 A;  3JZ3 A;  1Z59 A;  2YEE A;  2H55 A;  4NH7 A;  3R4P A;  4BQJ A;  3DGE A;  4ASF A;  4CWR A;  4BAE A;  2BSM A;  1UY8 A;  4MPC A;  2YGA A;  1UYL A;  2YGE A;  1Y8O A;  2YK2 A;  2YE9 A;  2WI6 A;  1YET A;  2YEG A;  3QDD A;  1UYD A;  4WUB A;  4EMV A;  3EKO A;  2XJJ A;  3A0X A;  2YE6 A;  2JKI A;  2XK2 A;  3T0H A;  2BRC A;  3TUH A;  4JAU A;  5FWK A;  1TID A;  3O0I A;  3SL2 A;  4LWE A;  1UYI A;  5GGZ A;  4PU9 A;  5M4K A;  3TZ2 A;  3K99 A;  2XHT A;  3B28 A;  2CCT A;  3BMY A;  4YKT A;  1Z5A A;  2IWS A;  4CWS A;  2AKP A;  3RLQ A;  4KTN A;  3T10 A;  2ZBK B;  1BKN A;  4FPP A;  3OMU A;  2YKC A;  4ASG A;  4O09 A;  2QF6 A;  4CWF A;  1Y8P A;  2VCI A;  2FYP A;  3HHU A;  1AM1 A;  2YE8 A;  2Q2E B;  2K5B A;  1UYE A;  3NMQ A;  2XX4 A;  3CGY A;  2BT0 A;  4Q20 A;  2XX2 A;  4CWP A;  2ZDY A;  1UYH A;  3RLP A;  3OWB A;  2QG0 A;  1US7 A;  3GIG A;  2CCS A;  3R4M A;  3K97 A;  4HXZ A;  5D7D A;  3OWD A;  3CWV A;  3U67 A;  3ZM7 A;  5CF0 A;  4FCQ A;  5C93 A;  4ZKI A;  1YC4 A;  2XDL A;  1UYC A;  5IDJ A;  3D36 A;  3TZ4 A;  2YE3 A;  2CG9 A;  4YKX A;  1UYG A;  1YC3 A;  1S16 A;  2O1U A;  3R4N A;  5CTW A;  2Q8I A;  1U0Z A;  5CTU A;  3TTZ A;  5M4E A;  2WI7 A;  2YGF A;  2YKI A;  3Q5K A;  1PVG A;  3EHH A;  5M4M A;  4AWO A;  1TBW A;  2QFO A;  2QG2 A;  1L0O A;  3EHJ A;  4U93 A;  2XD6 A;  4XKO A;  3R4O A;  2IOR A;  4BIZ A;  1Y8N A;  1ZXN A;  2O1W A;  4EGH A;  2XDU A;  5BOD A;  3U2K A;  4MP7 A;  2BRE A;  4JQL A;  1BXD A;  1B3Q A;  2IWU A;  4H85 A;  2WI2 A;  1UYF A;  4XD8 A;  4FMT A;  3LNU A;  2YE7 A;  1YT0 A;  1YS3 A;  1QY8 A;  1Z5B A;  2BU5 A;  4KSG A;  1KIJ A;  5BOC A;  3TZ5 A;  4YKW A;  1TC6 A;  4HZ5 A;  4MOT A;  4CWO A;  3HEK A;  4PRX A;  1YSZ A;  3R92 A;  2YEB A;  1AMW A;  3LPS A;  2H8M A;  1KZN A;  3ZKD A;  3CRL A;  2FWY A;  4O0B A;  4W7T A;  2YJX A;  4L94 A;  3K60 A;  3C0E A;  2YKB A;  2XAB A;  3CRK A;  3G7B A;  2ESA A;  2YED A;  4H7Q A;  4CWN A;  2BU8 A;  3U2D A;  3C11 A;  4LWH A;  3FT5 A;  3O6O A;  2YKJ A;  5D6P A;  2WI3 A;  3VAD A;  3G75 A;  4AWP A;  3T2S A;  4YKQ A;  4GCZ A;  4MBC A;  5J6A A;  1NHJ A;  4L90 A;  4O07 A;  2IOQ A;  3Q5L A;  2VCJ A;  3A0Y A;  3WQ9 A;  2IOP A;  4V25 A;  1TIL A;  4AWQ A;  5IN9 A;  4U7N A;  1BYQ A;  1I58 A;  2WI4 A;  1UY7 A;  2WI5 A;  4P7A A;  2O1V A;  3R91 A;  1H7S A;  4LP0 A;  5F5R A;  3G7E A;  2YEI A;  4GEE A;  1EI1 A;  3GIE A;  4HYP A;  4XCJ A;  4XKK A;  2XHR A;  3RKZ A;  4KP4 A;  1NHH A;  4K4O A;  3RLR A;  3A0Z A;  3B25 A;  4EGK A;  4AS9 A;  2XJG A;  4JAV A;  2XCM A;  2ZDX A;  3INW A;  3ZXQ A;  5M4P A;  1TH8 A;  4MB9 A;  4MPE A;  2C2A A;  1AH8 A;  3T1K A;  3WHA A;  3A0W A;  2BZ5 A;  4XTJ A;  1YES A;  4B6C A;  4ZVI A;  5D6Q A;  4CWT A;  4BXI A;  2BYI A;  1I59 A;  5FNC A;  1AH6 A;  4URN A;  2PNR A;  3B24 A;  4R3A A;  4URM A;  4EFT A;  5IDM A;  4E02 A;  5M4H A;  2YEC A;  4LWG A;  3HZ1 A;  3EKR A;  3KE6 A;  1B62 A;  3D2R A;  4XDM A;  1UY6 A;  4CE2 A;  5D7R A;  2BTZ A;  4EFU A;  3VHD A;  2GQP A;  4DZY A;  4H81 A;  4PRV A;  3A0R A;  2YEH A;  3EHG A;  4XIQ A;  2E0A A;  3B26 A;  3GIF A;  2XDS A;  4GFN A;  4HY6 A;  4R3M A;  4GT8 A;  1GKZ A;  3IED A;  4X9L A;  1YER A;  2YK9 A;  1GKX A;  4HYM A;  5CTY A;  2EXL A;  2YI7 A;  2WEP A;  4XE2 A;  4LPB A;  4HXW A;  3H80 A;  2YE5 A;  3HYZ A;  2FWZ A;  3GIG B;  2FXS A;  2WER A;  4KSH A;  4ASB A;  4L91 A;  2XHX A;  4EEH A;  4R1F A;  4I5S A;  5M4N A;  3Q5J A;  4WUD A;  4XIR A;  3TZ0 A;  4XC0 A;  5J71 A;  4NH9 A;  1S14 A;  5F3K A;  2HKJ A;  2BU7 A;  4CE3 A;  4QPJ A;  4KQV A;  1Z5C A;  3T0Z A;  1I5A A;  4LWI A;  3OW6 A;  4EGI A;  1ID0 A;  4L8Z A;  4ASA A;  3ZKB A;  3QTF A;  2YKE A;  1UYM A;  3HYY A;  3FV5 A;  3PEH A;  2ZKJ A;  2GFD A;  2Q8F A;  1Y4S A;  1ZXM A;  2BYH A;  1H7U A;  5CPH A;  2Q8H A;  2VW5 A;  2WI1 A;  4YKU A;  3CGZ A;  4HZ0 A;  1I5B A;  3HZ5 A;  1Y4U A;  3A0T A;  1OSF A;  1UY9 A;  3VHA A;  3EHF A;  2YEF A;  4HY1 A;  1TC0 A;  2YE4 A;  4XCL A;  5FND A;  3MNR P;  2YE2 A;  1MU5 A;  3PEJ A;  4QPK A;  5L3J A;  1B63 A;  2HCH A;  1BGQ A;  3D0B A;  4L93 A;  4YKY A;  2YI0 A;  4U7O A;  3K98 A;  1QZR A;  4MPN A;  4XIT A;  2VWC A;  2XX5 A;  4PL9 A;  4XIP A;  3ZXO A;  3B27 A;  4BIU A;  1YC1 A;  3OPD A;  4I3H A;  2HG1 A;  4URL A;  1GJV A;  1NHI A;  2XJX A;  2BU6 A;  4GGL A;  1YSR A;  4JAS A;  3INX A;  1A4H A;  2YEJ A;  2CGF A;  1YT2 A;  4E00 A;  2XDK A;  3H4L A;  3FT8 A;  2BU2 A;  4XKA A;  4BQG A;  1MX0 A;  3BM9 A;  4CWQ A;  1I5C A;  4DUH A;  4O04 A;  5FNF A;  2YEA A;  4YKR A;  4FCP A; 
#chains in the Genus database with same CATH topology
 1UYK A;  4O05 A;  2YI5 A;  4FCR A;  4GQT A;  4EM7 A;  2Q8G A;  4B7P A;  4LWF A;  5CTX A;  4WUC A;  2JJC A;  2UWD A;  1ZWH A;  1ZW9 A;  3LMM A;  1YT1 A;  2WEQ A;  5D7C A;  1EA6 A;  2XDX A;  1JM6 A;  1U2O A;  4KFG A;  3O2F A;  2CCU A;  4URO A;  1AJ6 A;  2CH4 A;  1THN A;  2YJW A;  4V26 A;  2IWX A;  4MP2 A;  1QYE A;  4YKZ A;  4P8O A;  1R62 A;  3VHC A;  4CE1 A;  1I5D A;  2YI6 A;  4NH8 A;  4E01 A;  3JZ3 A;  1Z59 A;  2YEE A;  2H55 A;  4NH7 A;  3R4P A;  4BQJ A;  3DGE A;  4ASF A;  4CWR A;  4BAE A;  2BSM A;  1UY8 A;  4MPC A;  2YGA A;  1UYL A;  1IXM A;  2YGE A;  1Y8O A;  2YK2 A;  2YE9 A;  2WI6 A;  1YET A;  2YEG A;  3QDD A;  1UYD A;  4WUB A;  4EMV A;  3EKO A;  2XJJ A;  3A0X A;  2YE6 A;  2JKI A;  2XK2 A;  3T0H A;  2BRC A;  3TUH A;  4JAU A;  5FWK A;  1TID A;  3O0I A;  3SL2 A;  4LWE A;  1UYI A;  2HHI A;  5GGZ A;  4PU9 A;  5M4K A;  3TZ2 A;  3K99 A;  2XHT A;  3B28 A;  2CCT A;  3BMY A;  4E72 A;  4YKT A;  1Z5A A;  2IWS A;  4CWS A;  2AKP A;  3RLQ A;  4KTN A;  3T10 A;  2ZBK B;  1BKN A;  4FPP A;  3OMU A;  2YKC A;  4ASG A;  4O09 A;  2QF6 A;  4CWF A;  1Y8P A;  2VCI A;  2FYP A;  3HHU A;  1AM1 A;  2YE8 A;  2Q2E B;  2K5B A;  1UYE A;  3NMQ A;  2XX4 A;  3CGY A;  2BT0 A;  4Q20 A;  2XX2 A;  4CWP A;  2ZDY A;  1UYH A;  3RLP A;  3OWB A;  2QG0 A;  1US7 A;  3GIG A;  2FTK A;  2CCS A;  3R4M A;  3K97 A;  4HXZ A;  5D7D A;  3OWD A;  3CWV A;  3U67 A;  3ZM7 A;  5CF0 A;  4FCQ A;  5C93 A;  4ZKI A;  1YC4 A;  2XDL A;  1UYC A;  5IDJ A;  3D36 A;  3TZ4 A;  2YE3 A;  2CG9 A;  2C1G A;  4YKX A;  1UYG A;  1YC3 A;  1S16 A;  2O1U A;  3R4N A;  5CTW A;  2Q8I A;  1U0Z A;  5CTU A;  3TTZ A;  5M4E A;  2WI7 A;  2YGF A;  2YKI A;  3Q5K A;  1PVG A;  3EHH A;  5M4M A;  4AWO A;  1TBW A;  2QFO A;  2QG2 A;  1L0O A;  3EHJ A;  4U93 A;  2XD6 A;  4XKO A;  3R4O A;  2IOR A;  4BIZ A;  1Y8N A;  1ZXN A;  2O1W A;  4EGH A;  2XDU A;  5BOD A;  3U2K A;  4MP7 A;  2BRE A;  4JQL A;  1BXD A;  1B3Q A;  3CYG A;  2IWU A;  4H85 A;  2WI2 A;  1UYF A;  4XD8 A;  4FMT A;  3LNU A;  2YE7 A;  1YT0 A;  1YS3 A;  1QY8 A;  1Z5B A;  2BU5 A;  4KSG A;  1KIJ A;  5BOC A;  3TZ5 A;  4YKW A;  1TC6 A;  4HZ5 A;  4MOT A;  4CWO A;  3HEK A;  4PRX A;  1YSZ A;  3R92 A;  2YEB A;  1AMW A;  3LPS A;  2H8M A;  1KZN A;  3ZKD A;  3CRL A;  2FWY A;  4O0B A;  4W7T A;  2YJX A;  4L94 A;  3K60 A;  3C0E A;  2YKB A;  2XAB A;  3CRK A;  3G7B A;  2ESA A;  2YED A;  4H7Q A;  4CWN A;  2BU8 A;  3U2D A;  3C11 A;  4LWH A;  3FT5 A;  3O6O A;  2YKJ A;  5D6P A;  2WI3 A;  3VAD A;  3G75 A;  4AWP A;  3T2S A;  4YKQ A;  4GCZ A;  4MBC A;  5J6A A;  1NHJ A;  4L90 A;  4O07 A;  2IOQ A;  3Q5L A;  2VCJ A;  3A0Y A;  3WQ9 A;  2IOP A;  4V25 A;  1TIL A;  4AWQ A;  5IN9 A;  4U7N A;  1BYQ A;  1I58 A;  2WI4 A;  1UY7 A;  2WI5 A;  4P7A A;  2O1V A;  3R91 A;  1H7S A;  4LP0 A;  5F5R A;  3G7E A;  2YEI A;  4GEE A;  1EI1 A;  3GIE A;  4HYP A;  4XCJ A;  4XKK A;  2XHR A;  3RKZ A;  4KP4 A;  1NHH A;  4K4O A;  3RLR A;  3A0Z A;  3B25 A;  4EGK A;  4AS9 A;  2XJG A;  4JAV A;  2XCM A;  2ZDX A;  3INW A;  3ZXQ A;  5M4P A;  1TH8 A;  4MB9 A;  4MPE A;  2C2A A;  1AH8 A;  3T1K A;  3WHA A;  3A0W A;  2BZ5 A;  4XTJ A;  1YES A;  4B6C A;  4ZVI A;  5D6Q A;  4CWT A;  4BXI A;  2BYI A;  1I59 A;  5FNC A;  1AH6 A;  4URN A;  2PNR A;  3B24 A;  4R3A A;  4URM A;  4EFT A;  5IDM A;  4E02 A;  5M4H A;  2YEC A;  4LWG A;  3HZ1 A;  3EKR A;  3KE6 A;  1B62 A;  3D2R A;  4XDM A;  1UY6 A;  4CE2 A;  5D7R A;  2BTZ A;  4EFU A;  3VHD A;  2GQP A;  4DZY A;  4H81 A;  4PRV A;  3A0R A;  2YEH A;  3EHG A;  4XIQ A;  2E0A A;  3B26 A;  3GIF A;  2XDS A;  4GFN A;  4HY6 A;  4R3M A;  4GT8 A;  1GKZ A;  3IED A;  4X9L A;  1YER A;  2YK9 A;  1GKX A;  4HYM A;  5CTY A;  2EXL A;  2YI7 A;  2WEP A;  4XE2 A;  4LPB A;  4HXW A;  3H80 A;  2YE5 A;  3HYZ A;  2FWZ A;  3GIG B;  2FXS A;  2WER A;  4KSH A;  4ASB A;  4L91 A;  2XHX A;  4EEH A;  4R1F A;  4I5S A;  5JEN A;  5M4N A;  3Q5J A;  4WUD A;  4XIR A;  3TZ0 A;  4XC0 A;  5J71 A;  4NH9 A;  1S14 A;  5F3K A;  2HKJ A;  2BU7 A;  4CE3 A;  4QPJ A;  4KQV A;  1Z5C A;  3T0Z A;  1I5A A;  4LWI A;  3OW6 A;  4EGI A;  1ID0 A;  4L8Z A;  4ASA A;  3ZKB A;  3QTF A;  2YKE A;  1UYM A;  3HYY A;  3FV5 A;  3PEH A;  2ZKJ A;  2GFD A;  2Q8F A;  1Y4S A;  1ZXM A;  2C1I A;  2BYH A;  1H7U A;  5CPH A;  2Q8H A;  2VW5 A;  2WI1 A;  4YKU A;  3CGZ A;  4HZ0 A;  1I5B A;  3HZ5 A;  1Y4U A;  3A0T A;  1OSF A;  1UY9 A;  3VHA A;  3EHF A;  2YEF A;  4HY1 A;  1TC0 A;  2YE4 A;  4XCL A;  5FND A;  3MNR P;  2YE2 A;  1MU5 A;  3PEJ A;  4QPK A;  5L3J A;  1B63 A;  2HCH A;  1BGQ A;  3D0B A;  4L93 A;  4YKY A;  2YI0 A;  4U7O A;  3K98 A;  1QZR A;  4MPN A;  4XIT A;  2VWC A;  2XX5 A;  4PL9 A;  4XIP A;  3ZXO A;  3B27 A;  4BIU A;  1YC1 A;  3OPD A;  4I3H A;  2HG1 A;  4URL A;  3S5T A;  1GJV A;  1NHI A;  2XJX A;  2BU6 A;  4GGL A;  1YSR A;  4JAS A;  3INX A;  1A4H A;  2YEJ A;  2CGF A;  1YT2 A;  4E00 A;  2XDK A;  3H4L A;  3FT8 A;  2BU2 A;  4XKA A;  4BQG A;  1MX0 A;  3BM9 A;  4CWQ A;  1I5C A;  4DUH A;  4O04 A;  1F51 A;  5FNF A;  2YEA A;  4YKR A;  4FCP A; 
#chains in the Genus database with same CATH homology
 1UYK A;  4O05 A;  2YI5 A;  4FCR A;  4GQT A;  4EM7 A;  2Q8G A;  4B7P A;  4LWF A;  5CTX A;  4WUC A;  2JJC A;  2UWD A;  1ZWH A;  1ZW9 A;  1YT1 A;  2WEQ A;  5D7C A;  1EA6 A;  2XDX A;  1JM6 A;  1U2O A;  4KFG A;  3O2F A;  2CCU A;  4URO A;  1AJ6 A;  2CH4 A;  1THN A;  2YJW A;  4V26 A;  2IWX A;  4MP2 A;  1QYE A;  4YKZ A;  4P8O A;  1R62 A;  3VHC A;  4CE1 A;  1I5D A;  2YI6 A;  4NH8 A;  4E01 A;  3JZ3 A;  1Z59 A;  2YEE A;  2H55 A;  4NH7 A;  3R4P A;  4BQJ A;  3DGE A;  4ASF A;  4CWR A;  4BAE A;  2BSM A;  1UY8 A;  4MPC A;  2YGA A;  1UYL A;  2YGE A;  1Y8O A;  2YK2 A;  2YE9 A;  2WI6 A;  1YET A;  2YEG A;  3QDD A;  1UYD A;  4WUB A;  4EMV A;  3EKO A;  2XJJ A;  3A0X A;  2YE6 A;  2JKI A;  2XK2 A;  3T0H A;  2BRC A;  3TUH A;  4JAU A;  5FWK A;  1TID A;  3O0I A;  3SL2 A;  4LWE A;  1UYI A;  5GGZ A;  4PU9 A;  5M4K A;  3TZ2 A;  3K99 A;  2XHT A;  3B28 A;  2CCT A;  3BMY A;  4YKT A;  1Z5A A;  2IWS A;  4CWS A;  2AKP A;  3RLQ A;  4KTN A;  3T10 A;  2ZBK B;  1BKN A;  4FPP A;  3OMU A;  2YKC A;  4ASG A;  4O09 A;  2QF6 A;  4CWF A;  1Y8P A;  2VCI A;  2FYP A;  3HHU A;  1AM1 A;  2YE8 A;  2Q2E B;  2K5B A;  1UYE A;  3NMQ A;  2XX4 A;  3CGY A;  2BT0 A;  4Q20 A;  2XX2 A;  4CWP A;  2ZDY A;  1UYH A;  3RLP A;  3OWB A;  2QG0 A;  1US7 A;  3GIG A;  2CCS A;  3R4M A;  3K97 A;  4HXZ A;  5D7D A;  3OWD A;  3CWV A;  3U67 A;  3ZM7 A;  5CF0 A;  4FCQ A;  5C93 A;  4ZKI A;  1YC4 A;  2XDL A;  1UYC A;  5IDJ A;  3D36 A;  3TZ4 A;  2YE3 A;  2CG9 A;  4YKX A;  1UYG A;  1YC3 A;  1S16 A;  2O1U A;  3R4N A;  5CTW A;  2Q8I A;  1U0Z A;  5CTU A;  3TTZ A;  5M4E A;  2WI7 A;  2YGF A;  2YKI A;  3Q5K A;  1PVG A;  3EHH A;  5M4M A;  4AWO A;  1TBW A;  2QFO A;  2QG2 A;  1L0O A;  3EHJ A;  4U93 A;  2XD6 A;  4XKO A;  3R4O A;  2IOR A;  4BIZ A;  1Y8N A;  1ZXN A;  2O1W A;  4EGH A;  2XDU A;  5BOD A;  3U2K A;  4MP7 A;  2BRE A;  4JQL A;  1BXD A;  1B3Q A;  2IWU A;  4H85 A;  2WI2 A;  1UYF A;  4XD8 A;  4FMT A;  3LNU A;  2YE7 A;  1YT0 A;  1YS3 A;  1QY8 A;  1Z5B A;  2BU5 A;  4KSG A;  1KIJ A;  5BOC A;  3TZ5 A;  4YKW A;  1TC6 A;  4HZ5 A;  4MOT A;  4CWO A;  3HEK A;  4PRX A;  1YSZ A;  3R92 A;  2YEB A;  1AMW A;  3LPS A;  2H8M A;  1KZN A;  3ZKD A;  3CRL A;  2FWY A;  4O0B A;  4W7T A;  2YJX A;  4L94 A;  3K60 A;  3C0E A;  2YKB A;  2XAB A;  3CRK A;  3G7B A;  2ESA A;  2YED A;  4H7Q A;  4CWN A;  2BU8 A;  3U2D A;  3C11 A;  4LWH A;  3FT5 A;  3O6O A;  2YKJ A;  5D6P A;  2WI3 A;  3VAD A;  3G75 A;  4AWP A;  3T2S A;  4YKQ A;  4GCZ A;  4MBC A;  5J6A A;  1NHJ A;  4L90 A;  4O07 A;  2IOQ A;  3Q5L A;  2VCJ A;  3A0Y A;  3WQ9 A;  2IOP A;  4V25 A;  1TIL A;  4AWQ A;  5IN9 A;  4U7N A;  1BYQ A;  1I58 A;  2WI4 A;  1UY7 A;  2WI5 A;  4P7A A;  2O1V A;  3R91 A;  1H7S A;  4LP0 A;  5F5R A;  3G7E A;  2YEI A;  4GEE A;  1EI1 A;  3GIE A;  4HYP A;  4XCJ A;  4XKK A;  2XHR A;  3RKZ A;  4KP4 A;  1NHH A;  4K4O A;  3RLR A;  3A0Z A;  3B25 A;  4EGK A;  4AS9 A;  2XJG A;  4JAV A;  2XCM A;  2ZDX A;  3INW A;  3ZXQ A;  5M4P A;  1TH8 A;  4MB9 A;  4MPE A;  2C2A A;  1AH8 A;  3T1K A;  3WHA A;  3A0W A;  2BZ5 A;  4XTJ A;  1YES A;  4B6C A;  4ZVI A;  5D6Q A;  4CWT A;  4BXI A;  2BYI A;  1I59 A;  5FNC A;  1AH6 A;  4URN A;  2PNR A;  3B24 A;  4R3A A;  4URM A;  4EFT A;  5IDM A;  4E02 A;  5M4H A;  2YEC A;  4LWG A;  3HZ1 A;  3EKR A;  3KE6 A;  1B62 A;  3D2R A;  4XDM A;  1UY6 A;  4CE2 A;  5D7R A;  2BTZ A;  4EFU A;  3VHD A;  2GQP A;  4DZY A;  4H81 A;  4PRV A;  3A0R A;  2YEH A;  3EHG A;  4XIQ A;  2E0A A;  3B26 A;  3GIF A;  2XDS A;  4GFN A;  4HY6 A;  4R3M A;  4GT8 A;  1GKZ A;  3IED A;  4X9L A;  1YER A;  2YK9 A;  1GKX A;  4HYM A;  5CTY A;  2EXL A;  2YI7 A;  2WEP A;  4XE2 A;  4LPB A;  4HXW A;  3H80 A;  2YE5 A;  3HYZ A;  2FWZ A;  3GIG B;  2FXS A;  2WER A;  4KSH A;  4ASB A;  4L91 A;  2XHX A;  4EEH A;  4R1F A;  4I5S A;  5M4N A;  3Q5J A;  4WUD A;  4XIR A;  3TZ0 A;  4XC0 A;  5J71 A;  4NH9 A;  1S14 A;  5F3K A;  2HKJ A;  2BU7 A;  4CE3 A;  4QPJ A;  4KQV A;  1Z5C A;  3T0Z A;  1I5A A;  4LWI A;  3OW6 A;  4EGI A;  1ID0 A;  4L8Z A;  4ASA A;  3ZKB A;  3QTF A;  2YKE A;  1UYM A;  3HYY A;  3FV5 A;  3PEH A;  2ZKJ A;  2GFD A;  2Q8F A;  1Y4S A;  1ZXM A;  2BYH A;  1H7U A;  5CPH A;  2Q8H A;  2VW5 A;  2WI1 A;  4YKU A;  3CGZ A;  4HZ0 A;  1I5B A;  3HZ5 A;  1Y4U A;  3A0T A;  1OSF A;  1UY9 A;  3VHA A;  3EHF A;  2YEF A;  4HY1 A;  1TC0 A;  2YE4 A;  4XCL A;  5FND A;  3MNR P;  2YE2 A;  1MU5 A;  3PEJ A;  4QPK A;  5L3J A;  1B63 A;  2HCH A;  1BGQ A;  3D0B A;  4L93 A;  4YKY A;  2YI0 A;  4U7O A;  3K98 A;  1QZR A;  4MPN A;  4XIT A;  2VWC A;  2XX5 A;  4PL9 A;  4XIP A;  3ZXO A;  3B27 A;  4BIU A;  1YC1 A;  3OPD A;  4I3H A;  2HG1 A;  4URL A;  1GJV A;  1NHI A;  2XJX A;  2BU6 A;  4GGL A;  1YSR A;  4JAS A;  3INX A;  1A4H A;  2YEJ A;  2CGF A;  1YT2 A;  4E00 A;  2XDK A;  3H4L A;  3FT8 A;  2BU2 A;  4XKA A;  4BQG A;  1MX0 A;  3BM9 A;  4CWQ A;  1I5C A;  4DUH A;  4O04 A;  5FNF A;  2YEA A;  4YKR A;  4FCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...