3TTZA

Crystal structure of a topoisomerase atpase inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
194
structure length
194
Chain Sequence
YGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrrolamide DNA gyrase inhibitors: Optimization of antibacterial activity and efficacy.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 62
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3ttzA00
2XX2A 4WUCA 3O0IA 2BSMA 2IWXA 3VADA 5J6AA 2WEPA 1AMWA 1ID0A 3T10A 1U0ZA 4E02A 3K97A 2O1VA 4H85A 3TZ0A 5M4NA 5M4MA 3CGYA 2BU7A 2XHXA 2YEEA 1TBWA 1ZWHA 2YJXA 3R91A 4XKAA 3H4LA 1UY9A 2XABA 4CWOA 3G75A 4KSGA 4XKKA 4AS9A 4FCPA 2BZ5A 4YKXA 2IOQA 2JKIA 4DZYA 3Q5KA 4EGHA 4ZKIA 3RKZA 1TIDA 2WERA 1R62A 2WI1A 4KFGA 4EFTA 4YKYA 2C2AA 2Q8IA 3EKOA 4CWSA 4KQVA 3A0WA 4XIQA 4LP0A 2Q2EB 4EEHA 3U67A 2VCJA 4O0BA 3OWBA 3T0HA 1L0OA 3G7EA 2YE3A 4CE3A 5M4EA 2BRCA 1I5AA 4HYPA 2YE2A 2CCSA 2HKJA 1S14A 3B26A 3HZ5A 1YC1A 4V25A 4O07A 1GKXA 4B6CA 2YKJA 3O2FA 1KZNA 4GQTA 2XX5A 4XDMA 1B63A 2QF6A 5CTXA 3WHAA 3BM9A 1I59A 1YERA 2QFOA 3A0RA 1MU5A 1MX0A 2VW5A 3RLRA 2YE6A 4HY1A 1Z5BA 4LPBA 1TC0A 4ASAA 1NHJA 1BXDA 4XKOA 4L8ZA 3DGEA 2YGEA 3K98A 4FCQA 4GEEA 4V26A 2YK9A 3FT5A 2XHRA 2H55A 1NHHA 4O09A 2JJCA 4WUDA 5CTYA 3TTZA 4HYMA 2YEBA 1TILA 2CGFA 4XCJA 4AWOA 1EI1A 3O6OA 4FPPA 2E0AA 2YE5A 4XD8A 4XIRA 1Z5CA 4BXIA 3HHUA 1UY8A 4H7QA 2BYIA 4K4OA 2QG0A 3EHFA 1BGQA 1YC3A 2GFDA 5D7DA 1YT2A 4DUHA 2CH4A 5M4KA 4JAUA 1YT0A 2ZKJA 4NH7A 2XX4A 1UYGA 4P7AA 2IWSA 2YI7A 3INXA 3PEHA 4U7NA 4HZ0A 3Q5LA 1AM1A 2BU5A 3VHDA 4BIZA 5L3JA 2ZDXA 4CWRA 3LNUA 4EM7A 3T2SA 3ZXQA 4XIPA 2Q8FA 4FMTA 5D6QA 4EMVA 1ZW9A 3ZKBA 4XITA 3ZXOA 3C0EA 4WUBA 5F3KA 1AJ6A 4QPKA 1UYCA 1B3QA 1YESA 3B24A 1UYEA 2YI0A 2BU2A 2YEIA 4UROA 2YI6A 5J71A 4EGKA 2IORA 2ZBKB 2XDLA 4XTJA 3FT8A 4BQGA 4MPCA 3TUHA 4I5SA 2XK2A 2O1UA 1AH6A 2ZDYA 3A0ZA 2YE9A 2YI5A 4MBCA 3TZ5A 1Y8OA 1QZRA 4PRVA 3OMUA 3CRKA 1UY7A 2XDSA 1YSRA 3H80A 2BREA 4ASFA 2VWCA 3K99A 2YGFA 1YETA 5GGZA 3Q5JA 2YEDA 2WI3A 1UYDA 5FWKA 1GJVA 1I58A 2YEJA 2HG1A 4Q20A 5FNFA 1UYKA 1TH8A 3GIGA 2H8MA 4E01A 1BKNA 4PL9A 4ASGA 2YKBA 2BU6A 4FCRA 2BTZA 2IWUA 3INWA 3B28A 3TZ2A 4L90A 5FNDA 4KSHA 2YGAA 4L91A 1Y4UA 2CCTA 2AKPA 2CG9A 3IEDA 3QDDA 3EHHA 3R4MA 4LWFA 1YSZA 1UYFA 2GQPA 4NH9A 3T1KA 4PRXA 4QPJA 4YKWA 3GIEA 4BIUA 1Y4SA 4LWEA 5CPHA 3OW6A 4CE1A 5CF0A 4AWPA 5IN9A 2CCUA 1GKZA 1PVGA 3RLQA 2ESAA 2XHTA 1A4HA 1AH8A 5D7RA 4ZVIA 2EXLA 4GCZA 3JZ3A 3R4PA 5D6PA 1YT1A 1Y8NA 2WI7A 4JQLA 4YKQA 1THNA 1U2OA 1S16A 2FWZA 1KIJA 3R4OA 4MB9A 1UYHA 3EHGA 4U93A 4YKTA 4YKZA 5FNCA 3OPDA 4XE2A 4CWFA 2PNRA 3HZ1A 3ZKDA 2WI6A 1JM6A 5BODA 3NMQA 3A0TA 2YEFA 3HYYA 4LWGA 2XDKA 4CWQA 1YS3A 2YE8A 4URNA 1US7A 4U7OA 3WQ9A 3GIGB 2WI4A 2IOPA 2YEGA 3C11A 1Z59A 2BU8A 2K5BA 2O1WA 4EGIA 2HCHA 2YKCA 4KTNA 4LWHA 2XD6A 1UY6A 3EKRA 3RLPA 3U2DA 1I5CA 2YK2A 2UWDA 2WEQA 4CWPA 1H7UA 3CRLA 3ZM7A 4YKRA 2XJGA 3D0BA 3BMYA 2BT0A 4GFNA 2VCIA 4W7TA 3U2KA 4I3HA 5CTUA 4YKUA 4GGLA 2XDXA 2WI5A 4CE2A 5IDJA 3D2RA 2YKIA 4PU9A 4GT8A 4P8OA 4X9LA 2XCMA 4ASBA 3B25A 1QYEA 3A0XA 4AWQA 3EHJA 4MP7A 2Q8GA 1EA6A 3B27A 3OWDA 1UYLA 2FXSA 4HXWA 5M4PA 4HZ5A 2WI2A 4O05A 3R4NA 4MPEA 1I5BA 3R92A 4XC0A 4URMA 4HY6A 3CWVA 3VHCA 1Y8PA 3A0YA 4XCLA 2YJWA 3MNRP 3K60A 3TZ4A 4E00A 4CWNA 2FWYA 1ZXNA 4L94A 2YECA 1TC6A 3FV5A 3T0ZA 2FYPA 5M4HA 1I5DA 3HYZA 1OSFA 3HEKA 1BYQA 5F5RA 5C93A 1NHIA 2Q8HA 3VHAA 2YE7A 3QTFA 2XDUA 3G7BA 1YC4A 4R3AA 3LPSA 2BYHA 4MPNA 4O04A 4R1FA 4HXZA 3PEJA 1UYMA 4LWIA 2YE4A 5D7CA 4BAEA 5CTWA 2YEHA 4JASA 5IDMA 3GIFA 2XJJA 3CGZA 4CWTA 2QG2A 2YKEA 1ZXMA 1B62A 4KP4A 4MP2A 4R3MA 4MOTA 2XJXA 4NH8A 4URLA 2YEAA 5BOCA 4H81A 4BQJA 3SL2A 4B7PA 1QY8A 3KE6A 1H7SA 4JAVA 4L93A 3D36A 1UYIA 1Z5AA 4EFUA
chains in the Genus database with same CATH superfamily
2XX2A 4WUCA 3O0IA 2BSMA 2IWXA 3VADA 5J6AA 2WEPA 1AMWA 1ID0A 3T10A 1U0ZA 4E02A 3K97A 2O1VA 4H85A 3TZ0A 5M4NA 5M4MA 3CGYA 2BU7A 2XHXA 2YEEA 1TBWA 1ZWHA 2C1GA 2YJXA 3R91A 4XKAA 3H4LA 1UY9A 2XABA 4CWOA 3G75A 4KSGA 4XKKA 4AS9A 4FCPA 2BZ5A 4YKXA 5JENA 2IOQA 2JKIA 4DZYA 3Q5KA 4EGHA 4ZKIA 3RKZA 1TIDA 2WERA 1R62A 2WI1A 4KFGA 4EFTA 4YKYA 2C2AA 2Q8IA 3EKOA 4CWSA 4KQVA 3A0WA 4XIQA 4LP0A 2Q2EB 4EEHA 3U67A 2VCJA 4O0BA 3OWBA 3T0HA 1L0OA 3G7EA 2YE3A 4CE3A 5M4EA 2BRCA 1I5AA 4HYPA 2YE2A 2CCSA 2HKJA 1S14A 3B26A 3HZ5A 1YC1A 4V25A 4O07A 1GKXA 4B6CA 2YKJA 3O2FA 1KZNA 4GQTA 2XX5A 4XDMA 1B63A 2QF6A 5CTXA 3WHAA 3BM9A 1I59A 1YERA 2QFOA 3A0RA 1MU5A 1MX0A 2VW5A 3RLRA 2YE6A 4HY1A 1Z5BA 4LPBA 1TC0A 4ASAA 1NHJA 1BXDA 4XKOA 4L8ZA 3DGEA 2YGEA 3K98A 4FCQA 4GEEA 4V26A 2YK9A 3FT5A 2XHRA 2H55A 1NHHA 1F51A 4O09A 2JJCA 4WUDA 5CTYA 3TTZA 4HYMA 2YEBA 1TILA 2CGFA 4XCJA 4AWOA 1EI1A 3O6OA 4FPPA 2E0AA 2YE5A 4XD8A 4XIRA 1Z5CA 4BXIA 3HHUA 1UY8A 4H7QA 2BYIA 4K4OA 2QG0A 3EHFA 1BGQA 1YC3A 2GFDA 5D7DA 1YT2A 4DUHA 2CH4A 5M4KA 4JAUA 1YT0A 2ZKJA 4NH7A 2C1IA 2XX4A 1UYGA 4P7AA 2IWSA 2YI7A 3INXA 3PEHA 4U7NA 4HZ0A 3Q5LA 1AM1A 2BU5A 3VHDA 4BIZA 5L3JA 2ZDXA 4CWRA 3LNUA 4EM7A 3T2SA 3ZXQA 4XIPA 2Q8FA 4FMTA 5D6QA 4EMVA 1ZW9A 3ZKBA 4XITA 3ZXOA 3C0EA 4WUBA 5F3KA 1AJ6A 4QPKA 1UYCA 1B3QA 1YESA 3B24A 1UYEA 2YI0A 2BU2A 2YEIA 4UROA 2YI6A 5J71A 4EGKA 2IORA 2ZBKB 2XDLA 4XTJA 3FT8A 4BQGA 4MPCA 3TUHA 4I5SA 2XK2A 2O1UA 1AH6A 2ZDYA 3A0ZA 2YE9A 2YI5A 4MBCA 3TZ5A 1Y8OA 1QZRA 4PRVA 3OMUA 3CRKA 1UY7A 2XDSA 1YSRA 3H80A 2BREA 4ASFA 2VWCA 3K99A 2YGFA 1YETA 5GGZA 3Q5JA 2YEDA 2WI3A 1UYDA 5FWKA 1GJVA 1I58A 2YEJA 2HG1A 4Q20A 5FNFA 1UYKA 1TH8A 3GIGA 2H8MA 4E01A 1BKNA 4PL9A 4ASGA 2YKBA 2BU6A 4FCRA 2BTZA 2IWUA 1IXMA 3INWA 3B28A 3TZ2A 4L90A 5FNDA 4KSHA 2YGAA 1Y4UA 2CCTA 2AKPA 2CG9A 3IEDA 4L91A 3QDDA 3EHHA 3R4MA 4LWFA 1YSZA 1UYFA 2GQPA 4NH9A 3T1KA 4PRXA 4QPJA 4YKWA 3GIEA 4BIUA 1Y4SA 4LWEA 5CPHA 3OW6A 4CE1A 5CF0A 4AWPA 5IN9A 3S5TA 2CCUA 1GKZA 1PVGA 3RLQA 2ESAA 2XHTA 1A4HA 1AH8A 5D7RA 4E72A 4ZVIA 2EXLA 4GCZA 3JZ3A 3R4PA 5D6PA 1YT1A 1Y8NA 2WI7A 4JQLA 4YKQA 1THNA 1U2OA 1S16A 2FWZA 1KIJA 3R4OA 4MB9A 1UYHA 3EHGA 4U93A 4YKTA 4YKZA 5FNCA 3OPDA 4XE2A 4CWFA 2PNRA 3HZ1A 3ZKDA 2WI6A 1JM6A 5BODA 3NMQA 3A0TA 2YEFA 3HYYA 4LWGA 2XDKA 4CWQA 1YS3A 2YE8A 4URNA 1US7A 4U7OA 3WQ9A 3GIGB 2WI4A 2IOPA 2YEGA 3C11A 1Z59A 2BU8A 2K5BA 2O1WA 4EGIA 2HCHA 2YKCA 4KTNA 4LWHA 2XD6A 1UY6A 3EKRA 3RLPA 3U2DA 1I5CA 2YK2A 2UWDA 2WEQA 4CWPA 1H7UA 3CRLA 3ZM7A 4YKRA 2XJGA 3D0BA 3BMYA 2BT0A 4GFNA 2VCIA 4W7TA 3U2KA 4I3HA 5CTUA 4YKUA 4GGLA 2XDXA 2WI5A 4CE2A 5IDJA 3D2RA 2YKIA 4PU9A 4GT8A 4P8OA 4X9LA 2XCMA 4ASBA 3B25A 2HHIA 1QYEA 3A0XA 4AWQA 3EHJA 4MP7A 2Q8GA 1EA6A 3B27A 3OWDA 1UYLA 2FXSA 4HXWA 5M4PA 4HZ5A 2WI2A 4O05A 3R4NA 4MPEA 1I5BA 3R92A 4XC0A 4URMA 4HY6A 3CWVA 3VHCA 1Y8PA 3A0YA 4XCLA 2YJWA 3MNRP 3K60A 3TZ4A 4E00A 4CWNA 2FWYA 1ZXNA 4L94A 2YECA 1TC6A 3FV5A 3T0ZA 2FYPA 5M4HA 1I5DA 3HYZA 1OSFA 3HEKA 1BYQA 5F5RA 5C93A 1NHIA 2Q8HA 3VHAA 2YE7A 3CYGA 3QTFA 3LMMA 2XDUA 3G7BA 1YC4A 4R3AA 3LPSA 2BYHA 4MPNA 4O04A 4R1FA 4HXZA 3PEJA 1UYMA 4LWIA 2YE4A 2FTKA 5D7CA 4BAEA 5CTWA 2YEHA 4JASA 5IDMA 3GIFA 2XJJA 3CGZA 4CWTA 2QG2A 2YKEA 1ZXMA 1B62A 4KP4A 4MP2A 4R3MA 4MOTA 2XJXA 4NH8A 4URLA 2YEAA 5BOCA 4H81A 4BQJA 3SL2A 4B7PA 1QY8A 3KE6A 1H7SA 4JAVA 4L93A 3D36A 1UYIA 1Z5AA 4EFUA
chains in the Genus database with same CATH topology
2XX2A 4WUCA 3O0IA 2BSMA 2IWXA 3VADA 5J6AA 2WEPA 1AMWA 1ID0A 3T10A 1U0ZA 4E02A 3K97A 2O1VA 4H85A 3TZ0A 5M4NA 5M4MA 3CGYA 2BU7A 2XHXA 2YEEA 1TBWA 1ZWHA 2YJXA 3R91A 4XKAA 3H4LA 1UY9A 2XABA 4CWOA 3G75A 4KSGA 4XKKA 4AS9A 4FCPA 2BZ5A 4YKXA 2IOQA 2JKIA 4DZYA 3Q5KA 4EGHA 4ZKIA 3RKZA 1TIDA 2WERA 1R62A 2WI1A 4KFGA 4EFTA 4YKYA 2C2AA 2Q8IA 3EKOA 4CWSA 4KQVA 3A0WA 4XIQA 4LP0A 2Q2EB 4EEHA 3U67A 2VCJA 4O0BA 3OWBA 3T0HA 1L0OA 3G7EA 2YE3A 4CE3A 5M4EA 2BRCA 1I5AA 4HYPA 2YE2A 2CCSA 2HKJA 1S14A 3B26A 3HZ5A 1YC1A 4V25A 4O07A 1GKXA 4B6CA 2YKJA 3O2FA 1KZNA 4GQTA 2XX5A 4XDMA 1B63A 2QF6A 5CTXA 3WHAA 3BM9A 1I59A 1YERA 2QFOA 3A0RA 1MU5A 1MX0A 2VW5A 3RLRA 2YE6A 4HY1A 1Z5BA 4LPBA 1TC0A 4ASAA 1NHJA 1BXDA 4XKOA 4L8ZA 3DGEA 2YGEA 3K98A 4FCQA 4GEEA 4V26A 2YK9A 3FT5A 2XHRA 2H55A 1NHHA 4O09A 2JJCA 4WUDA 5CTYA 3TTZA 4HYMA 2YEBA 1TILA 2CGFA 4XCJA 4AWOA 1EI1A 3O6OA 4FPPA 2E0AA 2YE5A 4XD8A 4XIRA 1Z5CA 4BXIA 3HHUA 1UY8A 4H7QA 2BYIA 4K4OA 2QG0A 3EHFA 1BGQA 1YC3A 2GFDA 5D7DA 1YT2A 4DUHA 2CH4A 5M4KA 4JAUA 1YT0A 2ZKJA 4NH7A 2XX4A 1UYGA 4P7AA 2IWSA 2YI7A 3INXA 3PEHA 4U7NA 4HZ0A 3Q5LA 1AM1A 2BU5A 3VHDA 4BIZA 5L3JA 2ZDXA 4CWRA 3LNUA 4EM7A 3T2SA 3ZXQA 4XIPA 2Q8FA 4FMTA 5D6QA 4EMVA 1ZW9A 3ZKBA 4XITA 3ZXOA 3C0EA 4WUBA 5F3KA 1AJ6A 4QPKA 1UYCA 1B3QA 1YESA 3B24A 1UYEA 2YI0A 2BU2A 2YEIA 4UROA 2YI6A 5J71A 4EGKA 2IORA 2ZBKB 2XDLA 4XTJA 3FT8A 4BQGA 4MPCA 3TUHA 4I5SA 2XK2A 2O1UA 1AH6A 2ZDYA 3A0ZA 2YE9A 2YI5A 4MBCA 3TZ5A 1Y8OA 1QZRA 4PRVA 3OMUA 3CRKA 1UY7A 2XDSA 1YSRA 3H80A 2BREA 4ASFA 2VWCA 3K99A 2YGFA 1YETA 5GGZA 3Q5JA 2YEDA 2WI3A 1UYDA 5FWKA 1GJVA 1I58A 2YEJA 2HG1A 4Q20A 5FNFA 1UYKA 1TH8A 3GIGA 2H8MA 4E01A 1BKNA 4PL9A 4ASGA 2YKBA 2BU6A 4FCRA 2BTZA 2IWUA 3INWA 3B28A 3TZ2A 4L90A 5FNDA 4KSHA 2YGAA 4L91A 1Y4UA 2CCTA 2AKPA 2CG9A 3IEDA 3QDDA 3EHHA 3R4MA 4LWFA 1YSZA 1UYFA 2GQPA 4NH9A 3T1KA 4PRXA 4QPJA 4YKWA 3GIEA 4BIUA 1Y4SA 4LWEA 5CPHA 3OW6A 4CE1A 5CF0A 4AWPA 5IN9A 2CCUA 1GKZA 1PVGA 3RLQA 2ESAA 2XHTA 1A4HA 1AH8A 5D7RA 4ZVIA 2EXLA 4GCZA 3JZ3A 3R4PA 5D6PA 1YT1A 1Y8NA 2WI7A 4JQLA 4YKQA 1THNA 1U2OA 1S16A 2FWZA 1KIJA 3R4OA 4MB9A 1UYHA 3EHGA 4U93A 4YKTA 4YKZA 5FNCA 3OPDA 4XE2A 4CWFA 2PNRA 3HZ1A 3ZKDA 2WI6A 1JM6A 5BODA 3NMQA 3A0TA 2YEFA 3HYYA 4LWGA 2XDKA 4CWQA 1YS3A 2YE8A 4URNA 1US7A 4U7OA 3WQ9A 3GIGB 2WI4A 2IOPA 2YEGA 3C11A 1Z59A 2BU8A 2K5BA 2O1WA 4EGIA 2HCHA 2YKCA 4KTNA 4LWHA 2XD6A 1UY6A 3EKRA 3RLPA 3U2DA 1I5CA 2YK2A 2UWDA 2WEQA 4CWPA 1H7UA 3CRLA 3ZM7A 4YKRA 2XJGA 3D0BA 3BMYA 2BT0A 4GFNA 2VCIA 4W7TA 3U2KA 4I3HA 5CTUA 4YKUA 4GGLA 2XDXA 2WI5A 4CE2A 5IDJA 3D2RA 2YKIA 4PU9A 4GT8A 4P8OA 4X9LA 2XCMA 4ASBA 3B25A 1QYEA 3A0XA 4AWQA 3EHJA 4MP7A 2Q8GA 1EA6A 3B27A 3OWDA 1UYLA 2FXSA 4HXWA 5M4PA 4HZ5A 2WI2A 4O05A 3R4NA 4MPEA 1I5BA 3R92A 4XC0A 4URMA 4HY6A 3CWVA 3VHCA 1Y8PA 3A0YA 4XCLA 2YJWA 3MNRP 3K60A 3TZ4A 4E00A 4CWNA 2FWYA 1ZXNA 4L94A 2YECA 1TC6A 3FV5A 3T0ZA 2FYPA 5M4HA 1I5DA 3HYZA 1OSFA 3HEKA 1BYQA 5F5RA 5C93A 1NHIA 2Q8HA 3VHAA 2YE7A 3QTFA 2XDUA 3G7BA 1YC4A 4R3AA 3LPSA 2BYHA 4MPNA 4O04A 4R1FA 4HXZA 3PEJA 1UYMA 4LWIA 2YE4A 5D7CA 4BAEA 5CTWA 2YEHA 4JASA 5IDMA 3GIFA 2XJJA 3CGZA 4CWTA 2QG2A 2YKEA 1ZXMA 1B62A 4KP4A 4MP2A 4R3MA 4MOTA 2XJXA 4NH8A 4URLA 2YEAA 5BOCA 4H81A 4BQJA 3SL2A 4B7PA 1QY8A 3KE6A 1H7SA 4JAVA 4L93A 3D36A 1UYIA 1Z5AA 4EFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XX2 A;  4WUC A;  3O0I A;  2BSM A;  2IWX A;  3VAD A;  5J6A A;  2WEP A;  1AMW A;  1ID0 A;  3T10 A;  1U0Z A;  4E02 A;  3K97 A;  2O1V A;  4H85 A;  3TZ0 A;  5M4N A;  5M4M A;  3CGY A;  2BU7 A;  2XHX A;  2YEE A;  1TBW A;  1ZWH A;  2YJX A;  3R91 A;  4XKA A;  3H4L A;  1UY9 A;  2XAB A;  4CWO A;  3G75 A;  4KSG A;  4XKK A;  4AS9 A;  4FCP A;  2BZ5 A;  4YKX A;  2IOQ A;  2JKI A;  4DZY A;  3Q5K A;  4EGH A;  4ZKI A;  3RKZ A;  1TID A;  2WER A;  1R62 A;  2WI1 A;  4KFG A;  4EFT A;  4YKY A;  2C2A A;  2Q8I A;  3EKO A;  4CWS A;  4KQV A;  3A0W A;  4XIQ A;  4LP0 A;  2Q2E B;  4EEH A;  3U67 A;  2VCJ A;  4O0B A;  3OWB A;  3T0H A;  1L0O A;  3G7E A;  2YE3 A;  4CE3 A;  5M4E A;  2BRC A;  1I5A A;  4HYP A;  2YE2 A;  2CCS A;  2HKJ A;  1S14 A;  3B26 A;  3HZ5 A;  1YC1 A;  4V25 A;  4O07 A;  1GKX A;  4B6C A;  2YKJ A;  3O2F A;  1KZN A;  4GQT A;  2XX5 A;  4XDM A;  1B63 A;  2QF6 A;  5CTX A;  3WHA A;  3BM9 A;  1I59 A;  1YER A;  2QFO A;  3A0R A;  1MU5 A;  1MX0 A;  2VW5 A;  3RLR A;  2YE6 A;  4HY1 A;  1Z5B A;  4LPB A;  1TC0 A;  4ASA A;  1NHJ A;  1BXD A;  4XKO A;  4L8Z A;  3DGE A;  2YGE A;  3K98 A;  4FCQ A;  4GEE A;  4V26 A;  2YK9 A;  3FT5 A;  2XHR A;  2H55 A;  1NHH A;  4O09 A;  2JJC A;  4WUD A;  5CTY A;  3TTZ A;  4HYM A;  2YEB A;  1TIL A;  2CGF A;  4XCJ A;  4AWO A;  1EI1 A;  3O6O A;  4FPP A;  2E0A A;  2YE5 A;  4XD8 A;  4XIR A;  1Z5C A;  4BXI A;  3HHU A;  1UY8 A;  4H7Q A;  2BYI A;  4K4O A;  2QG0 A;  3EHF A;  1BGQ A;  1YC3 A;  2GFD A;  5D7D A;  1YT2 A;  4DUH A;  2CH4 A;  5M4K A;  4JAU A;  1YT0 A;  2ZKJ A;  4NH7 A;  2XX4 A;  1UYG A;  4P7A A;  2IWS A;  2YI7 A;  3INX A;  3PEH A;  4U7N A;  4HZ0 A;  3Q5L A;  1AM1 A;  2BU5 A;  3VHD A;  4BIZ A;  5L3J A;  2ZDX A;  4CWR A;  3LNU A;  4EM7 A;  3T2S A;  3ZXQ A;  4XIP A;  2Q8F A;  4FMT A;  5D6Q A;  4EMV A;  1ZW9 A;  3ZKB A;  4XIT A;  3ZXO A;  3C0E A;  4WUB A;  5F3K A;  1AJ6 A;  4QPK A;  1UYC A;  1B3Q A;  1YES A;  3B24 A;  1UYE A;  2YI0 A;  2BU2 A;  2YEI A;  4URO A;  2YI6 A;  5J71 A;  4EGK A;  2IOR A;  2ZBK B;  2XDL A;  4XTJ A;  3FT8 A;  4BQG A;  4MPC A;  3TUH A;  4I5S A;  2XK2 A;  2O1U A;  1AH6 A;  2ZDY A;  3A0Z A;  2YE9 A;  2YI5 A;  4MBC A;  3TZ5 A;  1Y8O A;  1QZR A;  4PRV A;  3OMU A;  3CRK A;  1UY7 A;  2XDS A;  1YSR A;  3H80 A;  2BRE A;  4ASF A;  2VWC A;  3K99 A;  2YGF A;  1YET A;  5GGZ A;  3Q5J A;  2YED A;  2WI3 A;  1UYD A;  5FWK A;  1GJV A;  1I58 A;  2YEJ A;  2HG1 A;  4Q20 A;  5FNF A;  1UYK A;  1TH8 A;  3GIG A;  2H8M A;  4E01 A;  1BKN A;  4PL9 A;  4ASG A;  2YKB A;  2BU6 A;  4FCR A;  2BTZ A;  2IWU A;  3INW A;  3B28 A;  3TZ2 A;  4L90 A;  5FND A;  4KSH A;  2YGA A;  4L91 A;  1Y4U A;  2CCT A;  2AKP A;  2CG9 A;  3IED A;  3QDD A;  3EHH A;  3R4M A;  4LWF A;  1YSZ A;  1UYF A;  2GQP A;  4NH9 A;  3T1K A;  4PRX A;  4QPJ A;  4YKW A;  3GIE A;  4BIU A;  1Y4S A;  4LWE A;  5CPH A;  3OW6 A;  4CE1 A;  5CF0 A;  4AWP A;  5IN9 A;  2CCU A;  1GKZ A;  1PVG A;  3RLQ A;  2ESA A;  2XHT A;  1A4H A;  1AH8 A;  5D7R A;  4ZVI A;  2EXL A;  4GCZ A;  3JZ3 A;  3R4P A;  5D6P A;  1YT1 A;  1Y8N A;  2WI7 A;  4JQL A;  4YKQ A;  1THN A;  1U2O A;  1S16 A;  2FWZ A;  1KIJ A;  3R4O A;  4MB9 A;  1UYH A;  3EHG A;  4U93 A;  4YKT A;  4YKZ A;  5FNC A;  3OPD A;  4XE2 A;  4CWF A;  2PNR A;  3HZ1 A;  3ZKD A;  2WI6 A;  1JM6 A;  5BOD A;  3NMQ A;  3A0T A;  2YEF A;  3HYY A;  4LWG A;  2XDK A;  4CWQ A;  1YS3 A;  2YE8 A;  4URN A;  1US7 A;  4U7O A;  3WQ9 A;  3GIG B;  2WI4 A;  2IOP A;  2YEG A;  3C11 A;  1Z59 A;  2BU8 A;  2K5B A;  2O1W A;  4EGI A;  2HCH A;  2YKC A;  4KTN A;  4LWH A;  2XD6 A;  1UY6 A;  3EKR A;  3RLP A;  3U2D A;  1I5C A;  2YK2 A;  2UWD A;  2WEQ A;  4CWP A;  1H7U A;  3CRL A;  3ZM7 A;  4YKR A;  2XJG A;  3D0B A;  3BMY A;  2BT0 A;  4GFN A;  2VCI A;  4W7T A;  3U2K A;  4I3H A;  5CTU A;  4YKU A;  4GGL A;  2XDX A;  2WI5 A;  4CE2 A;  5IDJ A;  3D2R A;  2YKI A;  4PU9 A;  4GT8 A;  4P8O A;  4X9L A;  2XCM A;  4ASB A;  3B25 A;  1QYE A;  3A0X A;  4AWQ A;  3EHJ A;  4MP7 A;  2Q8G A;  1EA6 A;  3B27 A;  3OWD A;  1UYL A;  2FXS A;  4HXW A;  5M4P A;  4HZ5 A;  2WI2 A;  4O05 A;  3R4N A;  4MPE A;  1I5B A;  3R92 A;  4XC0 A;  4URM A;  4HY6 A;  3CWV A;  3VHC A;  1Y8P A;  3A0Y A;  4XCL A;  2YJW A;  3MNR P;  3K60 A;  3TZ4 A;  4E00 A;  4CWN A;  2FWY A;  1ZXN A;  4L94 A;  2YEC A;  1TC6 A;  3FV5 A;  3T0Z A;  2FYP A;  5M4H A;  1I5D A;  3HYZ A;  1OSF A;  3HEK A;  1BYQ A;  5F5R A;  5C93 A;  1NHI A;  2Q8H A;  3VHA A;  2YE7 A;  3QTF A;  2XDU A;  3G7B A;  1YC4 A;  4R3A A;  3LPS A;  2BYH A;  4MPN A;  4O04 A;  4R1F A;  4HXZ A;  3PEJ A;  1UYM A;  4LWI A;  2YE4 A;  5D7C A;  4BAE A;  5CTW A;  2YEH A;  4JAS A;  5IDM A;  3GIF A;  2XJJ A;  3CGZ A;  4CWT A;  2QG2 A;  2YKE A;  1ZXM A;  1B62 A;  4KP4 A;  4MP2 A;  4R3M A;  4MOT A;  2XJX A;  4NH8 A;  4URL A;  2YEA A;  5BOC A;  4H81 A;  4BQJ A;  3SL2 A;  4B7P A;  1QY8 A;  3KE6 A;  1H7S A;  4JAV A;  4L93 A;  3D36 A;  1UYI A;  1Z5A A;  4EFU A; 
#chains in the Genus database with same CATH topology
 2XX2 A;  4WUC A;  3O0I A;  2BSM A;  2IWX A;  3VAD A;  5J6A A;  2WEP A;  1AMW A;  1ID0 A;  3T10 A;  1U0Z A;  4E02 A;  3K97 A;  2O1V A;  4H85 A;  3TZ0 A;  5M4N A;  5M4M A;  3CGY A;  2BU7 A;  2XHX A;  2YEE A;  1TBW A;  1ZWH A;  2C1G A;  2YJX A;  3R91 A;  4XKA A;  3H4L A;  1UY9 A;  2XAB A;  4CWO A;  3G75 A;  4KSG A;  4XKK A;  4AS9 A;  4FCP A;  2BZ5 A;  4YKX A;  5JEN A;  2IOQ A;  2JKI A;  4DZY A;  3Q5K A;  4EGH A;  4ZKI A;  3RKZ A;  1TID A;  2WER A;  1R62 A;  2WI1 A;  4KFG A;  4EFT A;  4YKY A;  2C2A A;  2Q8I A;  3EKO A;  4CWS A;  4KQV A;  3A0W A;  4XIQ A;  4LP0 A;  2Q2E B;  4EEH A;  3U67 A;  2VCJ A;  4O0B A;  3OWB A;  3T0H A;  1L0O A;  3G7E A;  2YE3 A;  4CE3 A;  5M4E A;  2BRC A;  1I5A A;  4HYP A;  2YE2 A;  2CCS A;  2HKJ A;  1S14 A;  3B26 A;  3HZ5 A;  1YC1 A;  4V25 A;  4O07 A;  1GKX A;  4B6C A;  2YKJ A;  3O2F A;  1KZN A;  4GQT A;  2XX5 A;  4XDM A;  1B63 A;  2QF6 A;  5CTX A;  3WHA A;  3BM9 A;  1I59 A;  1YER A;  2QFO A;  3A0R A;  1MU5 A;  1MX0 A;  2VW5 A;  3RLR A;  2YE6 A;  4HY1 A;  1Z5B A;  4LPB A;  1TC0 A;  4ASA A;  1NHJ A;  1BXD A;  4XKO A;  4L8Z A;  3DGE A;  2YGE A;  3K98 A;  4FCQ A;  4GEE A;  4V26 A;  2YK9 A;  3FT5 A;  2XHR A;  2H55 A;  1NHH A;  1F51 A;  4O09 A;  2JJC A;  4WUD A;  5CTY A;  3TTZ A;  4HYM A;  2YEB A;  1TIL A;  2CGF A;  4XCJ A;  4AWO A;  1EI1 A;  3O6O A;  4FPP A;  2E0A A;  2YE5 A;  4XD8 A;  4XIR A;  1Z5C A;  4BXI A;  3HHU A;  1UY8 A;  4H7Q A;  2BYI A;  4K4O A;  2QG0 A;  3EHF A;  1BGQ A;  1YC3 A;  2GFD A;  5D7D A;  1YT2 A;  4DUH A;  2CH4 A;  5M4K A;  4JAU A;  1YT0 A;  2ZKJ A;  4NH7 A;  2C1I A;  2XX4 A;  1UYG A;  4P7A A;  2IWS A;  2YI7 A;  3INX A;  3PEH A;  4U7N A;  4HZ0 A;  3Q5L A;  1AM1 A;  2BU5 A;  3VHD A;  4BIZ A;  5L3J A;  2ZDX A;  4CWR A;  3LNU A;  4EM7 A;  3T2S A;  3ZXQ A;  4XIP A;  2Q8F A;  4FMT A;  5D6Q A;  4EMV A;  1ZW9 A;  3ZKB A;  4XIT A;  3ZXO A;  3C0E A;  4WUB A;  5F3K A;  1AJ6 A;  4QPK A;  1UYC A;  1B3Q A;  1YES A;  3B24 A;  1UYE A;  2YI0 A;  2BU2 A;  2YEI A;  4URO A;  2YI6 A;  5J71 A;  4EGK A;  2IOR A;  2ZBK B;  2XDL A;  4XTJ A;  3FT8 A;  4BQG A;  4MPC A;  3TUH A;  4I5S A;  2XK2 A;  2O1U A;  1AH6 A;  2ZDY A;  3A0Z A;  2YE9 A;  2YI5 A;  4MBC A;  3TZ5 A;  1Y8O A;  1QZR A;  4PRV A;  3OMU A;  3CRK A;  1UY7 A;  2XDS A;  1YSR A;  3H80 A;  2BRE A;  4ASF A;  2VWC A;  3K99 A;  2YGF A;  1YET A;  5GGZ A;  3Q5J A;  2YED A;  2WI3 A;  1UYD A;  5FWK A;  1GJV A;  1I58 A;  2YEJ A;  2HG1 A;  4Q20 A;  5FNF A;  1UYK A;  1TH8 A;  3GIG A;  2H8M A;  4E01 A;  1BKN A;  4PL9 A;  4ASG A;  2YKB A;  2BU6 A;  4FCR A;  2BTZ A;  2IWU A;  1IXM A;  3INW A;  3B28 A;  3TZ2 A;  4L90 A;  5FND A;  4KSH A;  2YGA A;  1Y4U A;  2CCT A;  2AKP A;  2CG9 A;  3IED A;  4L91 A;  3QDD A;  3EHH A;  3R4M A;  4LWF A;  1YSZ A;  1UYF A;  2GQP A;  4NH9 A;  3T1K A;  4PRX A;  4QPJ A;  4YKW A;  3GIE A;  4BIU A;  1Y4S A;  4LWE A;  5CPH A;  3OW6 A;  4CE1 A;  5CF0 A;  4AWP A;  5IN9 A;  3S5T A;  2CCU A;  1GKZ A;  1PVG A;  3RLQ A;  2ESA A;  2XHT A;  1A4H A;  1AH8 A;  5D7R A;  4E72 A;  4ZVI A;  2EXL A;  4GCZ A;  3JZ3 A;  3R4P A;  5D6P A;  1YT1 A;  1Y8N A;  2WI7 A;  4JQL A;  4YKQ A;  1THN A;  1U2O A;  1S16 A;  2FWZ A;  1KIJ A;  3R4O A;  4MB9 A;  1UYH A;  3EHG A;  4U93 A;  4YKT A;  4YKZ A;  5FNC A;  3OPD A;  4XE2 A;  4CWF A;  2PNR A;  3HZ1 A;  3ZKD A;  2WI6 A;  1JM6 A;  5BOD A;  3NMQ A;  3A0T A;  2YEF A;  3HYY A;  4LWG A;  2XDK A;  4CWQ A;  1YS3 A;  2YE8 A;  4URN A;  1US7 A;  4U7O A;  3WQ9 A;  3GIG B;  2WI4 A;  2IOP A;  2YEG A;  3C11 A;  1Z59 A;  2BU8 A;  2K5B A;  2O1W A;  4EGI A;  2HCH A;  2YKC A;  4KTN A;  4LWH A;  2XD6 A;  1UY6 A;  3EKR A;  3RLP A;  3U2D A;  1I5C A;  2YK2 A;  2UWD A;  2WEQ A;  4CWP A;  1H7U A;  3CRL A;  3ZM7 A;  4YKR A;  2XJG A;  3D0B A;  3BMY A;  2BT0 A;  4GFN A;  2VCI A;  4W7T A;  3U2K A;  4I3H A;  5CTU A;  4YKU A;  4GGL A;  2XDX A;  2WI5 A;  4CE2 A;  5IDJ A;  3D2R A;  2YKI A;  4PU9 A;  4GT8 A;  4P8O A;  4X9L A;  2XCM A;  4ASB A;  3B25 A;  2HHI A;  1QYE A;  3A0X A;  4AWQ A;  3EHJ A;  4MP7 A;  2Q8G A;  1EA6 A;  3B27 A;  3OWD A;  1UYL A;  2FXS A;  4HXW A;  5M4P A;  4HZ5 A;  2WI2 A;  4O05 A;  3R4N A;  4MPE A;  1I5B A;  3R92 A;  4XC0 A;  4URM A;  4HY6 A;  3CWV A;  3VHC A;  1Y8P A;  3A0Y A;  4XCL A;  2YJW A;  3MNR P;  3K60 A;  3TZ4 A;  4E00 A;  4CWN A;  2FWY A;  1ZXN A;  4L94 A;  2YEC A;  1TC6 A;  3FV5 A;  3T0Z A;  2FYP A;  5M4H A;  1I5D A;  3HYZ A;  1OSF A;  3HEK A;  1BYQ A;  5F5R A;  5C93 A;  1NHI A;  2Q8H A;  3VHA A;  2YE7 A;  3CYG A;  3QTF A;  3LMM A;  2XDU A;  3G7B A;  1YC4 A;  4R3A A;  3LPS A;  2BYH A;  4MPN A;  4O04 A;  4R1F A;  4HXZ A;  3PEJ A;  1UYM A;  4LWI A;  2YE4 A;  2FTK A;  5D7C A;  4BAE A;  5CTW A;  2YEH A;  4JAS A;  5IDM A;  3GIF A;  2XJJ A;  3CGZ A;  4CWT A;  2QG2 A;  2YKE A;  1ZXM A;  1B62 A;  4KP4 A;  4MP2 A;  4R3M A;  4MOT A;  2XJX A;  4NH8 A;  4URL A;  2YEA A;  5BOC A;  4H81 A;  4BQJ A;  3SL2 A;  4B7P A;  1QY8 A;  3KE6 A;  1H7S A;  4JAV A;  4L93 A;  3D36 A;  1UYI A;  1Z5A A;  4EFU A; 
#chains in the Genus database with same CATH homology
 2XX2 A;  4WUC A;  3O0I A;  2BSM A;  2IWX A;  3VAD A;  5J6A A;  2WEP A;  1AMW A;  1ID0 A;  3T10 A;  1U0Z A;  4E02 A;  3K97 A;  2O1V A;  4H85 A;  3TZ0 A;  5M4N A;  5M4M A;  3CGY A;  2BU7 A;  2XHX A;  2YEE A;  1TBW A;  1ZWH A;  2YJX A;  3R91 A;  4XKA A;  3H4L A;  1UY9 A;  2XAB A;  4CWO A;  3G75 A;  4KSG A;  4XKK A;  4AS9 A;  4FCP A;  2BZ5 A;  4YKX A;  2IOQ A;  2JKI A;  4DZY A;  3Q5K A;  4EGH A;  4ZKI A;  3RKZ A;  1TID A;  2WER A;  1R62 A;  2WI1 A;  4KFG A;  4EFT A;  4YKY A;  2C2A A;  2Q8I A;  3EKO A;  4CWS A;  4KQV A;  3A0W A;  4XIQ A;  4LP0 A;  2Q2E B;  4EEH A;  3U67 A;  2VCJ A;  4O0B A;  3OWB A;  3T0H A;  1L0O A;  3G7E A;  2YE3 A;  4CE3 A;  5M4E A;  2BRC A;  1I5A A;  4HYP A;  2YE2 A;  2CCS A;  2HKJ A;  1S14 A;  3B26 A;  3HZ5 A;  1YC1 A;  4V25 A;  4O07 A;  1GKX A;  4B6C A;  2YKJ A;  3O2F A;  1KZN A;  4GQT A;  2XX5 A;  4XDM A;  1B63 A;  2QF6 A;  5CTX A;  3WHA A;  3BM9 A;  1I59 A;  1YER A;  2QFO A;  3A0R A;  1MU5 A;  1MX0 A;  2VW5 A;  3RLR A;  2YE6 A;  4HY1 A;  1Z5B A;  4LPB A;  1TC0 A;  4ASA A;  1NHJ A;  1BXD A;  4XKO A;  4L8Z A;  3DGE A;  2YGE A;  3K98 A;  4FCQ A;  4GEE A;  4V26 A;  2YK9 A;  3FT5 A;  2XHR A;  2H55 A;  1NHH A;  4O09 A;  2JJC A;  4WUD A;  5CTY A;  3TTZ A;  4HYM A;  2YEB A;  1TIL A;  2CGF A;  4XCJ A;  4AWO A;  1EI1 A;  3O6O A;  4FPP A;  2E0A A;  2YE5 A;  4XD8 A;  4XIR A;  1Z5C A;  4BXI A;  3HHU A;  1UY8 A;  4H7Q A;  2BYI A;  4K4O A;  2QG0 A;  3EHF A;  1BGQ A;  1YC3 A;  2GFD A;  5D7D A;  1YT2 A;  4DUH A;  2CH4 A;  5M4K A;  4JAU A;  1YT0 A;  2ZKJ A;  4NH7 A;  2XX4 A;  1UYG A;  4P7A A;  2IWS A;  2YI7 A;  3INX A;  3PEH A;  4U7N A;  4HZ0 A;  3Q5L A;  1AM1 A;  2BU5 A;  3VHD A;  4BIZ A;  5L3J A;  2ZDX A;  4CWR A;  3LNU A;  4EM7 A;  3T2S A;  3ZXQ A;  4XIP A;  2Q8F A;  4FMT A;  5D6Q A;  4EMV A;  1ZW9 A;  3ZKB A;  4XIT A;  3ZXO A;  3C0E A;  4WUB A;  5F3K A;  1AJ6 A;  4QPK A;  1UYC A;  1B3Q A;  1YES A;  3B24 A;  1UYE A;  2YI0 A;  2BU2 A;  2YEI A;  4URO A;  2YI6 A;  5J71 A;  4EGK A;  2IOR A;  2ZBK B;  2XDL A;  4XTJ A;  3FT8 A;  4BQG A;  4MPC A;  3TUH A;  4I5S A;  2XK2 A;  2O1U A;  1AH6 A;  2ZDY A;  3A0Z A;  2YE9 A;  2YI5 A;  4MBC A;  3TZ5 A;  1Y8O A;  1QZR A;  4PRV A;  3OMU A;  3CRK A;  1UY7 A;  2XDS A;  1YSR A;  3H80 A;  2BRE A;  4ASF A;  2VWC A;  3K99 A;  2YGF A;  1YET A;  5GGZ A;  3Q5J A;  2YED A;  2WI3 A;  1UYD A;  5FWK A;  1GJV A;  1I58 A;  2YEJ A;  2HG1 A;  4Q20 A;  5FNF A;  1UYK A;  1TH8 A;  3GIG A;  2H8M A;  4E01 A;  1BKN A;  4PL9 A;  4ASG A;  2YKB A;  2BU6 A;  4FCR A;  2BTZ A;  2IWU A;  3INW A;  3B28 A;  3TZ2 A;  4L90 A;  5FND A;  4KSH A;  2YGA A;  4L91 A;  1Y4U A;  2CCT A;  2AKP A;  2CG9 A;  3IED A;  3QDD A;  3EHH A;  3R4M A;  4LWF A;  1YSZ A;  1UYF A;  2GQP A;  4NH9 A;  3T1K A;  4PRX A;  4QPJ A;  4YKW A;  3GIE A;  4BIU A;  1Y4S A;  4LWE A;  5CPH A;  3OW6 A;  4CE1 A;  5CF0 A;  4AWP A;  5IN9 A;  2CCU A;  1GKZ A;  1PVG A;  3RLQ A;  2ESA A;  2XHT A;  1A4H A;  1AH8 A;  5D7R A;  4ZVI A;  2EXL A;  4GCZ A;  3JZ3 A;  3R4P A;  5D6P A;  1YT1 A;  1Y8N A;  2WI7 A;  4JQL A;  4YKQ A;  1THN A;  1U2O A;  1S16 A;  2FWZ A;  1KIJ A;  3R4O A;  4MB9 A;  1UYH A;  3EHG A;  4U93 A;  4YKT A;  4YKZ A;  5FNC A;  3OPD A;  4XE2 A;  4CWF A;  2PNR A;  3HZ1 A;  3ZKD A;  2WI6 A;  1JM6 A;  5BOD A;  3NMQ A;  3A0T A;  2YEF A;  3HYY A;  4LWG A;  2XDK A;  4CWQ A;  1YS3 A;  2YE8 A;  4URN A;  1US7 A;  4U7O A;  3WQ9 A;  3GIG B;  2WI4 A;  2IOP A;  2YEG A;  3C11 A;  1Z59 A;  2BU8 A;  2K5B A;  2O1W A;  4EGI A;  2HCH A;  2YKC A;  4KTN A;  4LWH A;  2XD6 A;  1UY6 A;  3EKR A;  3RLP A;  3U2D A;  1I5C A;  2YK2 A;  2UWD A;  2WEQ A;  4CWP A;  1H7U A;  3CRL A;  3ZM7 A;  4YKR A;  2XJG A;  3D0B A;  3BMY A;  2BT0 A;  4GFN A;  2VCI A;  4W7T A;  3U2K A;  4I3H A;  5CTU A;  4YKU A;  4GGL A;  2XDX A;  2WI5 A;  4CE2 A;  5IDJ A;  3D2R A;  2YKI A;  4PU9 A;  4GT8 A;  4P8O A;  4X9L A;  2XCM A;  4ASB A;  3B25 A;  1QYE A;  3A0X A;  4AWQ A;  3EHJ A;  4MP7 A;  2Q8G A;  1EA6 A;  3B27 A;  3OWD A;  1UYL A;  2FXS A;  4HXW A;  5M4P A;  4HZ5 A;  2WI2 A;  4O05 A;  3R4N A;  4MPE A;  1I5B A;  3R92 A;  4XC0 A;  4URM A;  4HY6 A;  3CWV A;  3VHC A;  1Y8P A;  3A0Y A;  4XCL A;  2YJW A;  3MNR P;  3K60 A;  3TZ4 A;  4E00 A;  4CWN A;  2FWY A;  1ZXN A;  4L94 A;  2YEC A;  1TC6 A;  3FV5 A;  3T0Z A;  2FYP A;  5M4H A;  1I5D A;  3HYZ A;  1OSF A;  3HEK A;  1BYQ A;  5F5R A;  5C93 A;  1NHI A;  2Q8H A;  3VHA A;  2YE7 A;  3QTF A;  2XDU A;  3G7B A;  1YC4 A;  4R3A A;  3LPS A;  2BYH A;  4MPN A;  4O04 A;  4R1F A;  4HXZ A;  3PEJ A;  1UYM A;  4LWI A;  2YE4 A;  5D7C A;  4BAE A;  5CTW A;  2YEH A;  4JAS A;  5IDM A;  3GIF A;  2XJJ A;  3CGZ A;  4CWT A;  2QG2 A;  2YKE A;  1ZXM A;  1B62 A;  4KP4 A;  4MP2 A;  4R3M A;  4MOT A;  2XJX A;  4NH8 A;  4URL A;  2YEA A;  5BOC A;  4H81 A;  4BQJ A;  3SL2 A;  4B7P A;  1QY8 A;  3KE6 A;  1H7S A;  4JAV A;  4L93 A;  3D36 A;  1UYI A;  1Z5A A;  4EFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...