3TTZA

Crystal structure of a topoisomerase atpase inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
194
structure length
194
Chain Sequence
b'YGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Pyrrolamide DNA gyrase inhibitors: Optimization of antibacterial activity and efficacy.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
total genus 62
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3ttzA00
4KSGA 4CWOA 1YC3A 1AMWA 2BYHA 2XDSA 2BREA 1QZRA 5M4MA 4LWIA 4L8ZA 4XKOA 4CWTA 4Q20A 4P7AA 2Q2EB 5BODA 5CTXA 2YI6A 4MPCA 4PRVA 2WEQA 3FV5A 2HCHA 2EXLA 4XIPA 4QPKA 2WI3A 2FWYA 1BYQA 1YC1A 3B24A 1NHIA 5CTUA 4URLA 4AS9A 3Q5KA 4YKWA 2XJXA 2ESAA 4YKZA 3ZXOA 4FMTA 2YI7A 4CWFA 1QYEA 4MP2A 3T10A 2YEBA 2IWXA 1GJVA 4YKUA 2YE3A 3EHHA 3HYYA 1UY9A 2YE8A 2GQPA 3QDDA 4GQTA 2XHRA 3FT5A 4E01A 4ZKIA 4MPNA 3U2KA 4PRXA 4XKKA 3KE6A 5J71A 4LWFA 4XDMA 3G7EA 4YKQA 5M4PA 3R4MA 3K97A 3TZ5A 4DZYA 4NH9A 2YEIA 3BM9A 2WEPA 4I5SA 1YS3A 2IWUA 2IOQA 3OMUA 2ZDXA 3RLPA 5D7CA 2WI4A 3WQ9A 4E00A 1UYFA 1YETA 5IDJA 2CCTA 4PL9A 4ASFA 2YE9A 2VWCA 1EI1A 2XABA 1YT1A 2YJXA 2XDUA 4R3MA 3BMYA 1Z5AA 4XIRA 3K60A 4LWEA 5D7RA 2YEGA 2YKJA 4KP4A 3TZ0A 3R4OA 3EKOA 2K5BA 3D2RA 1UYKA 4DUHA 3PEHA 4URMA 1AM1A 3QTFA 1Y4UA 4BIZA 3CRLA 1B62A 4U93A 1UYDA 4YKRA 2XDLA 1U2OA 2BSMA 3HZ1A 4XCLA 1UYHA 4K4OA 5FNFA 4L91A 2XHTA 2XDXA 3K99A 2VCJA 3D0BA 3VHCA 3VADA 2BU5A 4BXIA 2CCUA 4KTNA 3GIGB 4HY6A 5M4EA 3CGYA 2BZ5A 4L90A 3INWA 4CWQA 1BXDA 4JAVA 2YGFA 2FWZA 5IN9A 5J6AA 2IORA 3RLQA 4MOTA 1NHJA 4FCQA 1Y8PA 2HG1A 2XCMA 4I3HA 1H7SA 4O07A 4PU9A 4XC0A 2YGEA 1BKNA 4P8OA 4BQGA 4YKXA 1JM6A 1UY8A 4LWGA 3OW6A 1YC4A 1S16A 1UYLA 1PVGA 3HEKA 3T1KA 2BU8A 4EGIA 2O1VA 3B25A 4JASA 5FNDA 2XX4A 4H7QA 5FWKA 2YE4A 2YI5A 1MX0A 2YE5A 4L94A 4YKTA 1Y4SA 2JKIA 4EEHA 1B3QA 4XIQA 4AWOA 1UYCA 3H4LA 4L93A 4MB9A 2FYPA 1THNA 2YJWA 1AH6A 1UYMA 4CWNA 2BRCA 2XDKA 3CGZA 3WHAA 4H81A 3OWDA 2BU7A 3A0WA 3LPSA 4HXZA 4EM7A 4HY1A 4UROA 4CE2A 3A0TA 4HZ0A 3R92A 1B63A 2BU6A 4R3AA 4ZVIA 2BU2A 4FCRA 5IDMA 4FCPA 1ZWHA 3Q5JA 5CTYA 2QG2A 2YE7A 3G75A 3FT8A 3VHAA 5FNCA 2YEJA 3HYZA 3T0HA 4CWSA 2XJJA 1YT0A 1U0ZA 1TC0A 2WI2A 2UWDA 2YGAA 3T2SA 4KFGA 3NMQA 1NHHA 1YERA 3CRKA 2BT0A 4X9LA 2XX5A 2AKPA 1Z5BA 2HKJA 4ASBA 5F3KA 3O0IA 1OSFA 2CGFA 4GEEA 2ZKJA 4HZ5A 3Q5LA 1H7UA 1TBWA 2YE6A 3IEDA 2JJCA 5GGZA 2VW5A 4CE3A 4AWPA 2XD6A 3K98A 4W7TA 4ASAA 3B28A 2E0AA 3ZKDA 4O0BA 1UYGA 3A0XA 3U67A 1US7A 5M4HA 4WUBA 1I5AA 2H8MA 2YKCA 4U7NA 5BOCA 3TUHA 3EHGA 4H85A 3C0EA 3RKZA 2YI0A 2ZBKB 2WI7A 1S14A 1TH8A 1GKXA 2WI1A 2YEAA 4ASGA 1I5CA 2Q8GA 2BYIA 3C11A 3O2FA 2YECA 4CWPA 4YKYA 2CH4A 4JAUA 1BGQA 1GKZA 3MNRP 4NH7A 3JZ3A 1I59A 4CE1A 5CTWA 4AWQA 1TILA 4U7OA 2Q8HA 3SL2A 1TC6A 1KIJA 2YKBA 4BQJA 4BAEA 2QFOA 4URNA 3OWBA 1YSZA 1UY6A 3EKRA 4QPJA 1ZW9A 4GFNA 5CF0A 4EFUA 1Z59A 4EMVA 3CWVA 4CWRA 2XX2A 1AJ6A 3PEJA 2Q8FA 2GFDA 3A0ZA 2WERA 4NH8A 2QF6A 3EHJA 4GT8A 3B27A 2O1WA 4HYMA 4KQVA 2O1UA 2XK2A 2ZDYA 1L0OA 2H55A 4JQLA 3EHFA 2VCIA 1Y8NA 1TIDA 4V25A 1R62A 3B26A 4WUCA 3DGEA 3D36A 2Q8IA 3TZ4A 3ZKBA 3R4PA 2IWSA 4XTJA 1EA6A 3R91A 2YEDA 1UYEA 4MPEA 1ZXNA 1YSRA 4WUDA 3ZXQA 5M4NA 3GIFA 4EFTA 4R1FA 1I5BA 3INXA 5D7DA 4GCZA 1I58A 2YK2A 1I5DA 4O09A 3G7BA 5F5RA 5L3JA 4LP0A 1AH8A 4EGHA 3GIEA 4MBCA 2BTZA 2YKEA 2C2AA 3TZ2A 4EGKA 5C93A 2YEFA 1UY7A 1QY8A 3T0ZA 1A4HA 3HHUA 2YEEA 2YE2A 2PNRA 4XE2A 5CPHA 1YESA 4XD8A 1MU5A 4GGLA 3A0RA 3TTZA 4LPBA 2QG0A 3GIGA 3H80A 3HZ5A 1KZNA 4B6CA 2YKIA 3OPDA 4MP7A 2XHXA 3VHDA 2CCSA 4O05A 4XKAA 2YK9A 2IOPA 4O04A 4HYPA 5D6QA 4BIUA 2XJGA 3RLRA 3LNUA 2WI5A 4HXWA 5D6PA 3ZM7A 2YEHA 2CG9A 5M4KA 4B7PA 1YT2A 1ID0A 4XCJA 2FXSA 4LWHA 3U2DA 4E02A 3O6OA 4V26A 4FPPA 4KSHA 4XITA 1UYIA 1Z5CA 3A0YA 3R4NA 1Y8OA 1ZXMA 2WI6A
chains in the Genus database with same CATH superfamily
4KSGA 4CWOA 1YC3A 1AMWA 2BYHA 2XDSA 2BREA 1QZRA 5M4MA 4LWIA 4L8ZA 4XKOA 4CWTA 4Q20A 4P7AA 2Q2EB 5BODA 5CTXA 2YI6A 4MPCA 4PRVA 2WEQA 3FV5A 2HCHA 2EXLA 4XIPA 4QPKA 2WI3A 2FWYA 1BYQA 1YC1A 3B24A 1NHIA 5CTUA 4URLA 4AS9A 3Q5KA 4YKWA 2XJXA 2ESAA 4YKZA 3ZXOA 4FMTA 2YI7A 4CWFA 1QYEA 4MP2A 3T10A 2YEBA 2IWXA 1GJVA 4YKUA 2YE3A 3EHHA 3HYYA 1UY9A 2YE8A 2GQPA 3QDDA 4GQTA 2XHRA 3FT5A 4E01A 4ZKIA 4MPNA 3U2KA 4PRXA 4XKKA 3KE6A 5J71A 4LWFA 4XDMA 3G7EA 4YKQA 5M4PA 3R4MA 3K97A 3TZ5A 4DZYA 4NH9A 2YEIA 3BM9A 2WEPA 4I5SA 1YS3A 2IWUA 2IOQA 3OMUA 2ZDXA 3RLPA 5D7CA 2WI4A 3WQ9A 4E00A 1UYFA 1YETA 5IDJA 2CCTA 4PL9A 3CYGA 2YE9A 2VWCA 4ASFA 1EI1A 2XABA 1YT1A 2YJXA 2XDUA 4R3MA 3BMYA 1Z5AA 4XIRA 3K60A 4LWEA 5D7RA 2YEGA 2YKJA 4KP4A 3TZ0A 3R4OA 3EKOA 2K5BA 3D2RA 1UYKA 4DUHA 3PEHA 4URMA 1AM1A 3QTFA 1Y4UA 4BIZA 3CRLA 1B62A 4U93A 1UYDA 4YKRA 2XDLA 1U2OA 2BSMA 3HZ1A 4XCLA 1UYHA 4K4OA 5FNFA 4L91A 2XHTA 2XDXA 3K99A 2VCJA 3D0BA 3VHCA 3VADA 2BU5A 4BXIA 2CCUA 4KTNA 3GIGB 4HY6A 5M4EA 3CGYA 2BZ5A 4L90A 3INWA 4CWQA 1BXDA 4JAVA 2YGFA 2FWZA 5IN9A 5J6AA 2IORA 3RLQA 4MOTA 1NHJA 4FCQA 1Y8PA 2HG1A 2XCMA 4I3HA 1H7SA 4O07A 4PU9A 4XC0A 2YGEA 1BKNA 2C1IA 4P8OA 4BQGA 4YKXA 1JM6A 1UY8A 4LWGA 3S5TA 3OW6A 1YC4A 1S16A 1UYLA 1PVGA 3HEKA 3T1KA 2BU8A 4EGIA 2O1VA 3B25A 4JASA 5FNDA 2XX4A 4H7QA 5FWKA 2YE4A 2YI5A 1MX0A 2YE5A 4L94A 4YKTA 1Y4SA 2JKIA 4EEHA 1B3QA 4XIQA 4AWOA 1UYCA 3H4LA 4L93A 4MB9A 2FYPA 1THNA 2YJWA 1AH6A 1UYMA 4CWNA 2BRCA 2XDKA 3CGZA 3WHAA 4H81A 3OWDA 2BU7A 3A0WA 3LPSA 4HXZA 4EM7A 4HY1A 4UROA 4CE2A 3A0TA 4HZ0A 3R92A 1B63A 2BU6A 4R3AA 4ZVIA 2BU2A 4FCRA 5IDMA 4FCPA 1ZWHA 3Q5JA 5CTYA 2QG2A 2YE7A 3G75A 3FT8A 3VHAA 5FNCA 2YEJA 3HYZA 3T0HA 4CWSA 2XJJA 1YT0A 1U0ZA 1TC0A 2WI2A 2UWDA 2YGAA 3T2SA 4KFGA 3NMQA 1NHHA 1YERA 3CRKA 2BT0A 4X9LA 2XX5A 2AKPA 1Z5BA 2HKJA 4ASBA 5F3KA 3O0IA 1OSFA 2CGFA 4GEEA 2ZKJA 4HZ5A 3Q5LA 1H7UA 1TBWA 2YE6A 3IEDA 2JJCA 5GGZA 2VW5A 4CE3A 4AWPA 2XD6A 3K98A 4W7TA 4ASAA 3B28A 2E0AA 3ZKDA 4O0BA 1UYGA 3A0XA 3U67A 1US7A 5M4HA 4WUBA 1I5AA 2H8MA 2YKCA 4U7NA 3LMMA 5BOCA 3TUHA 3EHGA 4H85A 3C0EA 3RKZA 2YI0A 2ZBKB 2C1GA 2WI7A 1S14A 1TH8A 1GKXA 2WI1A 2YEAA 4ASGA 1I5CA 2Q8GA 2BYIA 3C11A 3O2FA 2YECA 4CWPA 4YKYA 2CH4A 4JAUA 1BGQA 1GKZA 3MNRP 4NH7A 3JZ3A 1I59A 4CE1A 5CTWA 4AWQA 1TILA 4U7OA 2Q8HA 3SL2A 1TC6A 1KIJA 2YKBA 4BQJA 4BAEA 2QFOA 4URNA 3OWBA 1YSZA 1UY6A 3EKRA 4QPJA 1ZW9A 4GFNA 5CF0A 4EFUA 1Z59A 4EMVA 3CWVA 4CWRA 2XX2A 1AJ6A 3PEJA 2Q8FA 2GFDA 3A0ZA 2WERA 4NH8A 2FTKA 2QF6A 3EHJA 4GT8A 3B27A 2O1WA 4HYMA 4KQVA 2O1UA 2XK2A 2ZDYA 1L0OA 2H55A 4JQLA 3EHFA 2VCIA 1Y8NA 1TIDA 4V25A 1R62A 3B26A 4WUCA 3DGEA 3D36A 2Q8IA 3TZ4A 3ZKBA 3R4PA 2IWSA 4XTJA 1EA6A 3R91A 2YEDA 1UYEA 4MPEA 1ZXNA 1YSRA 4WUDA 3ZXQA 5M4NA 3GIFA 4EFTA 4R1FA 1I5BA 3INXA 5D7DA 4GCZA 1I58A 2YK2A 1I5DA 4O09A 3G7BA 5F5RA 5L3JA 4LP0A 1AH8A 4EGHA 3GIEA 4MBCA 2BTZA 2YKEA 2C2AA 3TZ2A 4EGKA 5C93A 2YEFA 1UY7A 1QY8A 3T0ZA 1A4HA 3HHUA 2YEEA 2YE2A 2PNRA 4XE2A 5CPHA 1YESA 4XD8A 1MU5A 1F51A 4GGLA 3A0RA 3TTZA 4LPBA 2QG0A 3GIGA 3H80A 3HZ5A 1KZNA 4B6CA 2YKIA 3OPDA 4MP7A 2XHXA 3VHDA 2CCSA 4O05A 1IXMA 4XKAA 2YK9A 2IOPA 4E72A 4O04A 4HYPA 5D6QA 4BIUA 2XJGA 3RLRA 3LNUA 5JENA 2WI5A 4HXWA 5D6PA 3ZM7A 2YEHA 2CG9A 5M4KA 4B7PA 1YT2A 1ID0A 4XCJA 2FXSA 4LWHA 3U2DA 4E02A 3O6OA 4V26A 4FPPA 4KSHA 4XITA 1UYIA 1Z5CA 3A0YA 3R4NA 1Y8OA 1ZXMA 2WI6A 2HHIA
chains in the Genus database with same CATH topology
4KSGA 4CWOA 1YC3A 1AMWA 2BYHA 2XDSA 2BREA 1QZRA 5M4MA 4LWIA 4L8ZA 4XKOA 4CWTA 4Q20A 4P7AA 2Q2EB 5BODA 5CTXA 2YI6A 4MPCA 4PRVA 2WEQA 3FV5A 2HCHA 2EXLA 4XIPA 4QPKA 2WI3A 2FWYA 1BYQA 1YC1A 3B24A 1NHIA 5CTUA 4URLA 4AS9A 3Q5KA 4YKWA 2XJXA 2ESAA 4YKZA 3ZXOA 4FMTA 2YI7A 4CWFA 1QYEA 4MP2A 3T10A 2YEBA 2IWXA 1GJVA 4YKUA 2YE3A 3EHHA 3HYYA 1UY9A 2YE8A 2GQPA 3QDDA 4GQTA 2XHRA 3FT5A 4E01A 4ZKIA 4MPNA 3U2KA 4PRXA 4XKKA 3KE6A 5J71A 4LWFA 4XDMA 3G7EA 4YKQA 5M4PA 3R4MA 3K97A 3TZ5A 4DZYA 4NH9A 2YEIA 3BM9A 2WEPA 4I5SA 1YS3A 2IWUA 2IOQA 3OMUA 2ZDXA 3RLPA 5D7CA 2WI4A 3WQ9A 4E00A 1UYFA 1YETA 5IDJA 2CCTA 4PL9A 4ASFA 2YE9A 2VWCA 1EI1A 2XABA 1YT1A 2YJXA 2XDUA 4R3MA 3BMYA 1Z5AA 4XIRA 3K60A 4LWEA 5D7RA 2YEGA 2YKJA 4KP4A 3TZ0A 3R4OA 3EKOA 2K5BA 3D2RA 1UYKA 4DUHA 3PEHA 4URMA 1AM1A 3QTFA 1Y4UA 4BIZA 3CRLA 1B62A 4U93A 1UYDA 4YKRA 2XDLA 1U2OA 2BSMA 3HZ1A 4XCLA 1UYHA 4K4OA 5FNFA 4L91A 2XHTA 2XDXA 3K99A 2VCJA 3D0BA 3VHCA 3VADA 2BU5A 4BXIA 2CCUA 4KTNA 3GIGB 4HY6A 5M4EA 3CGYA 2BZ5A 4L90A 3INWA 4CWQA 1BXDA 4JAVA 2YGFA 2FWZA 5IN9A 5J6AA 2IORA 3RLQA 4MOTA 1NHJA 4FCQA 1Y8PA 2HG1A 2XCMA 4I3HA 1H7SA 4O07A 4PU9A 4XC0A 2YGEA 1BKNA 4P8OA 4BQGA 4YKXA 1JM6A 1UY8A 4LWGA 3OW6A 1YC4A 1S16A 1UYLA 1PVGA 3HEKA 3T1KA 2BU8A 4EGIA 2O1VA 3B25A 4JASA 5FNDA 2XX4A 4H7QA 5FWKA 2YE4A 2YI5A 1MX0A 2YE5A 4L94A 4YKTA 1Y4SA 2JKIA 4EEHA 1B3QA 4XIQA 4AWOA 1UYCA 3H4LA 4L93A 4MB9A 2FYPA 1THNA 2YJWA 1AH6A 1UYMA 4CWNA 2BRCA 2XDKA 3CGZA 3WHAA 4H81A 3OWDA 2BU7A 3A0WA 3LPSA 4HXZA 4EM7A 4HY1A 4UROA 4CE2A 3A0TA 4HZ0A 3R92A 1B63A 2BU6A 4R3AA 4ZVIA 2BU2A 4FCRA 5IDMA 4FCPA 1ZWHA 3Q5JA 5CTYA 2QG2A 2YE7A 3G75A 3FT8A 3VHAA 5FNCA 2YEJA 3HYZA 3T0HA 4CWSA 2XJJA 1YT0A 1U0ZA 1TC0A 2WI2A 2UWDA 2YGAA 3T2SA 4KFGA 3NMQA 1NHHA 1YERA 3CRKA 2BT0A 4X9LA 2XX5A 2AKPA 1Z5BA 2HKJA 4ASBA 5F3KA 3O0IA 1OSFA 2CGFA 4GEEA 2ZKJA 4HZ5A 3Q5LA 1H7UA 1TBWA 2YE6A 3IEDA 2JJCA 5GGZA 2VW5A 4CE3A 4AWPA 2XD6A 3K98A 4W7TA 4ASAA 3B28A 2E0AA 3ZKDA 4O0BA 1UYGA 3A0XA 3U67A 1US7A 5M4HA 4WUBA 1I5AA 2H8MA 2YKCA 4U7NA 5BOCA 3TUHA 3EHGA 4H85A 3C0EA 3RKZA 2YI0A 2ZBKB 2WI7A 1S14A 1TH8A 1GKXA 2WI1A 2YEAA 4ASGA 1I5CA 2Q8GA 2BYIA 3C11A 3O2FA 2YECA 4CWPA 4YKYA 2CH4A 4JAUA 1BGQA 1GKZA 3MNRP 4NH7A 3JZ3A 1I59A 4CE1A 5CTWA 4AWQA 1TILA 4U7OA 2Q8HA 3SL2A 1TC6A 1KIJA 2YKBA 4BQJA 4BAEA 2QFOA 4URNA 3OWBA 1YSZA 1UY6A 3EKRA 4QPJA 1ZW9A 4GFNA 5CF0A 4EFUA 1Z59A 4EMVA 3CWVA 4CWRA 2XX2A 1AJ6A 3PEJA 2Q8FA 2GFDA 3A0ZA 2WERA 4NH8A 2QF6A 3EHJA 4GT8A 3B27A 2O1WA 4HYMA 4KQVA 2O1UA 2XK2A 2ZDYA 1L0OA 2H55A 4JQLA 3EHFA 2VCIA 1Y8NA 1TIDA 4V25A 1R62A 3B26A 4WUCA 3DGEA 3D36A 2Q8IA 3TZ4A 3ZKBA 3R4PA 2IWSA 4XTJA 1EA6A 3R91A 2YEDA 1UYEA 4MPEA 1ZXNA 1YSRA 4WUDA 3ZXQA 5M4NA 3GIFA 4EFTA 4R1FA 1I5BA 3INXA 5D7DA 4GCZA 1I58A 2YK2A 1I5DA 4O09A 3G7BA 5F5RA 5L3JA 4LP0A 1AH8A 4EGHA 3GIEA 4MBCA 2BTZA 2YKEA 2C2AA 3TZ2A 4EGKA 5C93A 2YEFA 1UY7A 1QY8A 3T0ZA 1A4HA 3HHUA 2YEEA 2YE2A 2PNRA 4XE2A 5CPHA 1YESA 4XD8A 1MU5A 4GGLA 3A0RA 3TTZA 4LPBA 2QG0A 3GIGA 3H80A 3HZ5A 1KZNA 4B6CA 2YKIA 3OPDA 4MP7A 2XHXA 3VHDA 2CCSA 4O05A 4XKAA 2YK9A 2IOPA 4O04A 4HYPA 5D6QA 4BIUA 2XJGA 3RLRA 3LNUA 2WI5A 4HXWA 5D6PA 3ZM7A 2YEHA 2CG9A 5M4KA 4B7PA 1YT2A 1ID0A 4XCJA 2FXSA 4LWHA 3U2DA 4E02A 3O6OA 4V26A 4FPPA 4KSHA 4XITA 1UYIA 1Z5CA 3A0YA 3R4NA 1Y8OA 1ZXMA 2WI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSG A;  4CWO A;  1YC3 A;  1AMW A;  2BYH A;  2XDS A;  2BRE A;  1QZR A;  5M4M A;  4LWI A;  4L8Z A;  4XKO A;  4CWT A;  4Q20 A;  4P7A A;  2Q2E B;  5BOD A;  5CTX A;  2YI6 A;  4MPC A;  4PRV A;  2WEQ A;  3FV5 A;  2HCH A;  2EXL A;  4XIP A;  4QPK A;  2WI3 A;  2FWY A;  1BYQ A;  1YC1 A;  3B24 A;  1NHI A;  5CTU A;  4URL A;  4AS9 A;  3Q5K A;  4YKW A;  2XJX A;  2ESA A;  4YKZ A;  3ZXO A;  4FMT A;  2YI7 A;  4CWF A;  1QYE A;  4MP2 A;  3T10 A;  2YEB A;  2IWX A;  1GJV A;  4YKU A;  2YE3 A;  3EHH A;  3HYY A;  1UY9 A;  2YE8 A;  2GQP A;  3QDD A;  4GQT A;  2XHR A;  3FT5 A;  4E01 A;  4ZKI A;  4MPN A;  3U2K A;  4PRX A;  4XKK A;  3KE6 A;  5J71 A;  4LWF A;  4XDM A;  3G7E A;  4YKQ A;  5M4P A;  3R4M A;  3K97 A;  3TZ5 A;  4DZY A;  4NH9 A;  2YEI A;  3BM9 A;  2WEP A;  4I5S A;  1YS3 A;  2IWU A;  2IOQ A;  3OMU A;  2ZDX A;  3RLP A;  5D7C A;  2WI4 A;  3WQ9 A;  4E00 A;  1UYF A;  1YET A;  5IDJ A;  2CCT A;  4PL9 A;  4ASF A;  2YE9 A;  2VWC A;  1EI1 A;  2XAB A;  1YT1 A;  2YJX A;  2XDU A;  4R3M A;  3BMY A;  1Z5A A;  4XIR A;  3K60 A;  4LWE A;  5D7R A;  2YEG A;  2YKJ A;  4KP4 A;  3TZ0 A;  3R4O A;  3EKO A;  2K5B A;  3D2R A;  1UYK A;  4DUH A;  3PEH A;  4URM A;  1AM1 A;  3QTF A;  1Y4U A;  4BIZ A;  3CRL A;  1B62 A;  4U93 A;  1UYD A;  4YKR A;  2XDL A;  1U2O A;  2BSM A;  3HZ1 A;  4XCL A;  1UYH A;  4K4O A;  5FNF A;  4L91 A;  2XHT A;  2XDX A;  3K99 A;  2VCJ A;  3D0B A;  3VHC A;  3VAD A;  2BU5 A;  4BXI A;  2CCU A;  4KTN A;  3GIG B;  4HY6 A;  5M4E A;  3CGY A;  2BZ5 A;  4L90 A;  3INW A;  4CWQ A;  1BXD A;  4JAV A;  2YGF A;  2FWZ A;  5IN9 A;  5J6A A;  2IOR A;  3RLQ A;  4MOT A;  1NHJ A;  4FCQ A;  1Y8P A;  2HG1 A;  2XCM A;  4I3H A;  1H7S A;  4O07 A;  4PU9 A;  4XC0 A;  2YGE A;  1BKN A;  4P8O A;  4BQG A;  4YKX A;  1JM6 A;  1UY8 A;  4LWG A;  3OW6 A;  1YC4 A;  1S16 A;  1UYL A;  1PVG A;  3HEK A;  3T1K A;  2BU8 A;  4EGI A;  2O1V A;  3B25 A;  4JAS A;  5FND A;  2XX4 A;  4H7Q A;  5FWK A;  2YE4 A;  2YI5 A;  1MX0 A;  2YE5 A;  4L94 A;  4YKT A;  1Y4S A;  2JKI A;  4EEH A;  1B3Q A;  4XIQ A;  4AWO A;  1UYC A;  3H4L A;  4L93 A;  4MB9 A;  2FYP A;  1THN A;  2YJW A;  1AH6 A;  1UYM A;  4CWN A;  2BRC A;  2XDK A;  3CGZ A;  3WHA A;  4H81 A;  3OWD A;  2BU7 A;  3A0W A;  3LPS A;  4HXZ A;  4EM7 A;  4HY1 A;  4URO A;  4CE2 A;  3A0T A;  4HZ0 A;  3R92 A;  1B63 A;  2BU6 A;  4R3A A;  4ZVI A;  2BU2 A;  4FCR A;  5IDM A;  4FCP A;  1ZWH A;  3Q5J A;  5CTY A;  2QG2 A;  2YE7 A;  3G75 A;  3FT8 A;  3VHA A;  5FNC A;  2YEJ A;  3HYZ A;  3T0H A;  4CWS A;  2XJJ A;  1YT0 A;  1U0Z A;  1TC0 A;  2WI2 A;  2UWD A;  2YGA A;  3T2S A;  4KFG A;  3NMQ A;  1NHH A;  1YER A;  3CRK A;  2BT0 A;  4X9L A;  2XX5 A;  2AKP A;  1Z5B A;  2HKJ A;  4ASB A;  5F3K A;  3O0I A;  1OSF A;  2CGF A;  4GEE A;  2ZKJ A;  4HZ5 A;  3Q5L A;  1H7U A;  1TBW A;  2YE6 A;  3IED A;  2JJC A;  5GGZ A;  2VW5 A;  4CE3 A;  4AWP A;  2XD6 A;  3K98 A;  4W7T A;  4ASA A;  3B28 A;  2E0A A;  3ZKD A;  4O0B A;  1UYG A;  3A0X A;  3U67 A;  1US7 A;  5M4H A;  4WUB A;  1I5A A;  2H8M A;  2YKC A;  4U7N A;  5BOC A;  3TUH A;  3EHG A;  4H85 A;  3C0E A;  3RKZ A;  2YI0 A;  2ZBK B;  2WI7 A;  1S14 A;  1TH8 A;  1GKX A;  2WI1 A;  2YEA A;  4ASG A;  1I5C A;  2Q8G A;  2BYI A;  3C11 A;  3O2F A;  2YEC A;  4CWP A;  4YKY A;  2CH4 A;  4JAU A;  1BGQ A;  1GKZ A;  3MNR P;  4NH7 A;  3JZ3 A;  1I59 A;  4CE1 A;  5CTW A;  4AWQ A;  1TIL A;  4U7O A;  2Q8H A;  3SL2 A;  1TC6 A;  1KIJ A;  2YKB A;  4BQJ A;  4BAE A;  2QFO A;  4URN A;  3OWB A;  1YSZ A;  1UY6 A;  3EKR A;  4QPJ A;  1ZW9 A;  4GFN A;  5CF0 A;  4EFU A;  1Z59 A;  4EMV A;  3CWV A;  4CWR A;  2XX2 A;  1AJ6 A;  3PEJ A;  2Q8F A;  2GFD A;  3A0Z A;  2WER A;  4NH8 A;  2QF6 A;  3EHJ A;  4GT8 A;  3B27 A;  2O1W A;  4HYM A;  4KQV A;  2O1U A;  2XK2 A;  2ZDY A;  1L0O A;  2H55 A;  4JQL A;  3EHF A;  2VCI A;  1Y8N A;  1TID A;  4V25 A;  1R62 A;  3B26 A;  4WUC A;  3DGE A;  3D36 A;  2Q8I A;  3TZ4 A;  3ZKB A;  3R4P A;  2IWS A;  4XTJ A;  1EA6 A;  3R91 A;  2YED A;  1UYE A;  4MPE A;  1ZXN A;  1YSR A;  4WUD A;  3ZXQ A;  5M4N A;  3GIF A;  4EFT A;  4R1F A;  1I5B A;  3INX A;  5D7D A;  4GCZ A;  1I58 A;  2YK2 A;  1I5D A;  4O09 A;  3G7B A;  5F5R A;  5L3J A;  4LP0 A;  1AH8 A;  4EGH A;  3GIE A;  4MBC A;  2BTZ A;  2YKE A;  2C2A A;  3TZ2 A;  4EGK A;  5C93 A;  2YEF A;  1UY7 A;  1QY8 A;  3T0Z A;  1A4H A;  3HHU A;  2YEE A;  2YE2 A;  2PNR A;  4XE2 A;  5CPH A;  1YES A;  4XD8 A;  1MU5 A;  4GGL A;  3A0R A;  3TTZ A;  4LPB A;  2QG0 A;  3GIG A;  3H80 A;  3HZ5 A;  1KZN A;  4B6C A;  2YKI A;  3OPD A;  4MP7 A;  2XHX A;  3VHD A;  2CCS A;  4O05 A;  4XKA A;  2YK9 A;  2IOP A;  4O04 A;  4HYP A;  5D6Q A;  4BIU A;  2XJG A;  3RLR A;  3LNU A;  2WI5 A;  4HXW A;  5D6P A;  3ZM7 A;  2YEH A;  2CG9 A;  5M4K A;  4B7P A;  1YT2 A;  1ID0 A;  4XCJ A;  2FXS A;  4LWH A;  3U2D A;  4E02 A;  3O6O A;  4V26 A;  4FPP A;  4KSH A;  4XIT A;  1UYI A;  1Z5C A;  3A0Y A;  3R4N A;  1Y8O A;  1ZXM A;  2WI6 A; 
#chains in the Genus database with same CATH topology
 4KSG A;  4CWO A;  1YC3 A;  1AMW A;  2BYH A;  2XDS A;  2BRE A;  1QZR A;  5M4M A;  4LWI A;  4L8Z A;  4XKO A;  4CWT A;  4Q20 A;  4P7A A;  2Q2E B;  5BOD A;  5CTX A;  2YI6 A;  4MPC A;  4PRV A;  2WEQ A;  3FV5 A;  2HCH A;  2EXL A;  4XIP A;  4QPK A;  2WI3 A;  2FWY A;  1BYQ A;  1YC1 A;  3B24 A;  1NHI A;  5CTU A;  4URL A;  4AS9 A;  3Q5K A;  4YKW A;  2XJX A;  2ESA A;  4YKZ A;  3ZXO A;  4FMT A;  2YI7 A;  4CWF A;  1QYE A;  4MP2 A;  3T10 A;  2YEB A;  2IWX A;  1GJV A;  4YKU A;  2YE3 A;  3EHH A;  3HYY A;  1UY9 A;  2YE8 A;  2GQP A;  3QDD A;  4GQT A;  2XHR A;  3FT5 A;  4E01 A;  4ZKI A;  4MPN A;  3U2K A;  4PRX A;  4XKK A;  3KE6 A;  5J71 A;  4LWF A;  4XDM A;  3G7E A;  4YKQ A;  5M4P A;  3R4M A;  3K97 A;  3TZ5 A;  4DZY A;  4NH9 A;  2YEI A;  3BM9 A;  2WEP A;  4I5S A;  1YS3 A;  2IWU A;  2IOQ A;  3OMU A;  2ZDX A;  3RLP A;  5D7C A;  2WI4 A;  3WQ9 A;  4E00 A;  1UYF A;  1YET A;  5IDJ A;  2CCT A;  4PL9 A;  3CYG A;  2YE9 A;  2VWC A;  4ASF A;  1EI1 A;  2XAB A;  1YT1 A;  2YJX A;  2XDU A;  4R3M A;  3BMY A;  1Z5A A;  4XIR A;  3K60 A;  4LWE A;  5D7R A;  2YEG A;  2YKJ A;  4KP4 A;  3TZ0 A;  3R4O A;  3EKO A;  2K5B A;  3D2R A;  1UYK A;  4DUH A;  3PEH A;  4URM A;  1AM1 A;  3QTF A;  1Y4U A;  4BIZ A;  3CRL A;  1B62 A;  4U93 A;  1UYD A;  4YKR A;  2XDL A;  1U2O A;  2BSM A;  3HZ1 A;  4XCL A;  1UYH A;  4K4O A;  5FNF A;  4L91 A;  2XHT A;  2XDX A;  3K99 A;  2VCJ A;  3D0B A;  3VHC A;  3VAD A;  2BU5 A;  4BXI A;  2CCU A;  4KTN A;  3GIG B;  4HY6 A;  5M4E A;  3CGY A;  2BZ5 A;  4L90 A;  3INW A;  4CWQ A;  1BXD A;  4JAV A;  2YGF A;  2FWZ A;  5IN9 A;  5J6A A;  2IOR A;  3RLQ A;  4MOT A;  1NHJ A;  4FCQ A;  1Y8P A;  2HG1 A;  2XCM A;  4I3H A;  1H7S A;  4O07 A;  4PU9 A;  4XC0 A;  2YGE A;  1BKN A;  2C1I A;  4P8O A;  4BQG A;  4YKX A;  1JM6 A;  1UY8 A;  4LWG A;  3S5T A;  3OW6 A;  1YC4 A;  1S16 A;  1UYL A;  1PVG A;  3HEK A;  3T1K A;  2BU8 A;  4EGI A;  2O1V A;  3B25 A;  4JAS A;  5FND A;  2XX4 A;  4H7Q A;  5FWK A;  2YE4 A;  2YI5 A;  1MX0 A;  2YE5 A;  4L94 A;  4YKT A;  1Y4S A;  2JKI A;  4EEH A;  1B3Q A;  4XIQ A;  4AWO A;  1UYC A;  3H4L A;  4L93 A;  4MB9 A;  2FYP A;  1THN A;  2YJW A;  1AH6 A;  1UYM A;  4CWN A;  2BRC A;  2XDK A;  3CGZ A;  3WHA A;  4H81 A;  3OWD A;  2BU7 A;  3A0W A;  3LPS A;  4HXZ A;  4EM7 A;  4HY1 A;  4URO A;  4CE2 A;  3A0T A;  4HZ0 A;  3R92 A;  1B63 A;  2BU6 A;  4R3A A;  4ZVI A;  2BU2 A;  4FCR A;  5IDM A;  4FCP A;  1ZWH A;  3Q5J A;  5CTY A;  2QG2 A;  2YE7 A;  3G75 A;  3FT8 A;  3VHA A;  5FNC A;  2YEJ A;  3HYZ A;  3T0H A;  4CWS A;  2XJJ A;  1YT0 A;  1U0Z A;  1TC0 A;  2WI2 A;  2UWD A;  2YGA A;  3T2S A;  4KFG A;  3NMQ A;  1NHH A;  1YER A;  3CRK A;  2BT0 A;  4X9L A;  2XX5 A;  2AKP A;  1Z5B A;  2HKJ A;  4ASB A;  5F3K A;  3O0I A;  1OSF A;  2CGF A;  4GEE A;  2ZKJ A;  4HZ5 A;  3Q5L A;  1H7U A;  1TBW A;  2YE6 A;  3IED A;  2JJC A;  5GGZ A;  2VW5 A;  4CE3 A;  4AWP A;  2XD6 A;  3K98 A;  4W7T A;  4ASA A;  3B28 A;  2E0A A;  3ZKD A;  4O0B A;  1UYG A;  3A0X A;  3U67 A;  1US7 A;  5M4H A;  4WUB A;  1I5A A;  2H8M A;  2YKC A;  4U7N A;  3LMM A;  5BOC A;  3TUH A;  3EHG A;  4H85 A;  3C0E A;  3RKZ A;  2YI0 A;  2ZBK B;  2C1G A;  2WI7 A;  1S14 A;  1TH8 A;  1GKX A;  2WI1 A;  2YEA A;  4ASG A;  1I5C A;  2Q8G A;  2BYI A;  3C11 A;  3O2F A;  2YEC A;  4CWP A;  4YKY A;  2CH4 A;  4JAU A;  1BGQ A;  1GKZ A;  3MNR P;  4NH7 A;  3JZ3 A;  1I59 A;  4CE1 A;  5CTW A;  4AWQ A;  1TIL A;  4U7O A;  2Q8H A;  3SL2 A;  1TC6 A;  1KIJ A;  2YKB A;  4BQJ A;  4BAE A;  2QFO A;  4URN A;  3OWB A;  1YSZ A;  1UY6 A;  3EKR A;  4QPJ A;  1ZW9 A;  4GFN A;  5CF0 A;  4EFU A;  1Z59 A;  4EMV A;  3CWV A;  4CWR A;  2XX2 A;  1AJ6 A;  3PEJ A;  2Q8F A;  2GFD A;  3A0Z A;  2WER A;  4NH8 A;  2FTK A;  2QF6 A;  3EHJ A;  4GT8 A;  3B27 A;  2O1W A;  4HYM A;  4KQV A;  2O1U A;  2XK2 A;  2ZDY A;  1L0O A;  2H55 A;  4JQL A;  3EHF A;  2VCI A;  1Y8N A;  1TID A;  4V25 A;  1R62 A;  3B26 A;  4WUC A;  3DGE A;  3D36 A;  2Q8I A;  3TZ4 A;  3ZKB A;  3R4P A;  2IWS A;  4XTJ A;  1EA6 A;  3R91 A;  2YED A;  1UYE A;  4MPE A;  1ZXN A;  1YSR A;  4WUD A;  3ZXQ A;  5M4N A;  3GIF A;  4EFT A;  4R1F A;  1I5B A;  3INX A;  5D7D A;  4GCZ A;  1I58 A;  2YK2 A;  1I5D A;  4O09 A;  3G7B A;  5F5R A;  5L3J A;  4LP0 A;  1AH8 A;  4EGH A;  3GIE A;  4MBC A;  2BTZ A;  2YKE A;  2C2A A;  3TZ2 A;  4EGK A;  5C93 A;  2YEF A;  1UY7 A;  1QY8 A;  3T0Z A;  1A4H A;  3HHU A;  2YEE A;  2YE2 A;  2PNR A;  4XE2 A;  5CPH A;  1YES A;  4XD8 A;  1MU5 A;  1F51 A;  4GGL A;  3A0R A;  3TTZ A;  4LPB A;  2QG0 A;  3GIG A;  3H80 A;  3HZ5 A;  1KZN A;  4B6C A;  2YKI A;  3OPD A;  4MP7 A;  2XHX A;  3VHD A;  2CCS A;  4O05 A;  1IXM A;  4XKA A;  2YK9 A;  2IOP A;  4E72 A;  4O04 A;  4HYP A;  5D6Q A;  4BIU A;  2XJG A;  3RLR A;  3LNU A;  5JEN A;  2WI5 A;  4HXW A;  5D6P A;  3ZM7 A;  2YEH A;  2CG9 A;  5M4K A;  4B7P A;  1YT2 A;  1ID0 A;  4XCJ A;  2FXS A;  4LWH A;  3U2D A;  4E02 A;  3O6O A;  4V26 A;  4FPP A;  4KSH A;  4XIT A;  1UYI A;  1Z5C A;  3A0Y A;  3R4N A;  1Y8O A;  1ZXM A;  2WI6 A;  2HHI A; 
#chains in the Genus database with same CATH homology
 4KSG A;  4CWO A;  1YC3 A;  1AMW A;  2BYH A;  2XDS A;  2BRE A;  1QZR A;  5M4M A;  4LWI A;  4L8Z A;  4XKO A;  4CWT A;  4Q20 A;  4P7A A;  2Q2E B;  5BOD A;  5CTX A;  2YI6 A;  4MPC A;  4PRV A;  2WEQ A;  3FV5 A;  2HCH A;  2EXL A;  4XIP A;  4QPK A;  2WI3 A;  2FWY A;  1BYQ A;  1YC1 A;  3B24 A;  1NHI A;  5CTU A;  4URL A;  4AS9 A;  3Q5K A;  4YKW A;  2XJX A;  2ESA A;  4YKZ A;  3ZXO A;  4FMT A;  2YI7 A;  4CWF A;  1QYE A;  4MP2 A;  3T10 A;  2YEB A;  2IWX A;  1GJV A;  4YKU A;  2YE3 A;  3EHH A;  3HYY A;  1UY9 A;  2YE8 A;  2GQP A;  3QDD A;  4GQT A;  2XHR A;  3FT5 A;  4E01 A;  4ZKI A;  4MPN A;  3U2K A;  4PRX A;  4XKK A;  3KE6 A;  5J71 A;  4LWF A;  4XDM A;  3G7E A;  4YKQ A;  5M4P A;  3R4M A;  3K97 A;  3TZ5 A;  4DZY A;  4NH9 A;  2YEI A;  3BM9 A;  2WEP A;  4I5S A;  1YS3 A;  2IWU A;  2IOQ A;  3OMU A;  2ZDX A;  3RLP A;  5D7C A;  2WI4 A;  3WQ9 A;  4E00 A;  1UYF A;  1YET A;  5IDJ A;  2CCT A;  4PL9 A;  4ASF A;  2YE9 A;  2VWC A;  1EI1 A;  2XAB A;  1YT1 A;  2YJX A;  2XDU A;  4R3M A;  3BMY A;  1Z5A A;  4XIR A;  3K60 A;  4LWE A;  5D7R A;  2YEG A;  2YKJ A;  4KP4 A;  3TZ0 A;  3R4O A;  3EKO A;  2K5B A;  3D2R A;  1UYK A;  4DUH A;  3PEH A;  4URM A;  1AM1 A;  3QTF A;  1Y4U A;  4BIZ A;  3CRL A;  1B62 A;  4U93 A;  1UYD A;  4YKR A;  2XDL A;  1U2O A;  2BSM A;  3HZ1 A;  4XCL A;  1UYH A;  4K4O A;  5FNF A;  4L91 A;  2XHT A;  2XDX A;  3K99 A;  2VCJ A;  3D0B A;  3VHC A;  3VAD A;  2BU5 A;  4BXI A;  2CCU A;  4KTN A;  3GIG B;  4HY6 A;  5M4E A;  3CGY A;  2BZ5 A;  4L90 A;  3INW A;  4CWQ A;  1BXD A;  4JAV A;  2YGF A;  2FWZ A;  5IN9 A;  5J6A A;  2IOR A;  3RLQ A;  4MOT A;  1NHJ A;  4FCQ A;  1Y8P A;  2HG1 A;  2XCM A;  4I3H A;  1H7S A;  4O07 A;  4PU9 A;  4XC0 A;  2YGE A;  1BKN A;  4P8O A;  4BQG A;  4YKX A;  1JM6 A;  1UY8 A;  4LWG A;  3OW6 A;  1YC4 A;  1S16 A;  1UYL A;  1PVG A;  3HEK A;  3T1K A;  2BU8 A;  4EGI A;  2O1V A;  3B25 A;  4JAS A;  5FND A;  2XX4 A;  4H7Q A;  5FWK A;  2YE4 A;  2YI5 A;  1MX0 A;  2YE5 A;  4L94 A;  4YKT A;  1Y4S A;  2JKI A;  4EEH A;  1B3Q A;  4XIQ A;  4AWO A;  1UYC A;  3H4L A;  4L93 A;  4MB9 A;  2FYP A;  1THN A;  2YJW A;  1AH6 A;  1UYM A;  4CWN A;  2BRC A;  2XDK A;  3CGZ A;  3WHA A;  4H81 A;  3OWD A;  2BU7 A;  3A0W A;  3LPS A;  4HXZ A;  4EM7 A;  4HY1 A;  4URO A;  4CE2 A;  3A0T A;  4HZ0 A;  3R92 A;  1B63 A;  2BU6 A;  4R3A A;  4ZVI A;  2BU2 A;  4FCR A;  5IDM A;  4FCP A;  1ZWH A;  3Q5J A;  5CTY A;  2QG2 A;  2YE7 A;  3G75 A;  3FT8 A;  3VHA A;  5FNC A;  2YEJ A;  3HYZ A;  3T0H A;  4CWS A;  2XJJ A;  1YT0 A;  1U0Z A;  1TC0 A;  2WI2 A;  2UWD A;  2YGA A;  3T2S A;  4KFG A;  3NMQ A;  1NHH A;  1YER A;  3CRK A;  2BT0 A;  4X9L A;  2XX5 A;  2AKP A;  1Z5B A;  2HKJ A;  4ASB A;  5F3K A;  3O0I A;  1OSF A;  2CGF A;  4GEE A;  2ZKJ A;  4HZ5 A;  3Q5L A;  1H7U A;  1TBW A;  2YE6 A;  3IED A;  2JJC A;  5GGZ A;  2VW5 A;  4CE3 A;  4AWP A;  2XD6 A;  3K98 A;  4W7T A;  4ASA A;  3B28 A;  2E0A A;  3ZKD A;  4O0B A;  1UYG A;  3A0X A;  3U67 A;  1US7 A;  5M4H A;  4WUB A;  1I5A A;  2H8M A;  2YKC A;  4U7N A;  5BOC A;  3TUH A;  3EHG A;  4H85 A;  3C0E A;  3RKZ A;  2YI0 A;  2ZBK B;  2WI7 A;  1S14 A;  1TH8 A;  1GKX A;  2WI1 A;  2YEA A;  4ASG A;  1I5C A;  2Q8G A;  2BYI A;  3C11 A;  3O2F A;  2YEC A;  4CWP A;  4YKY A;  2CH4 A;  4JAU A;  1BGQ A;  1GKZ A;  3MNR P;  4NH7 A;  3JZ3 A;  1I59 A;  4CE1 A;  5CTW A;  4AWQ A;  1TIL A;  4U7O A;  2Q8H A;  3SL2 A;  1TC6 A;  1KIJ A;  2YKB A;  4BQJ A;  4BAE A;  2QFO A;  4URN A;  3OWB A;  1YSZ A;  1UY6 A;  3EKR A;  4QPJ A;  1ZW9 A;  4GFN A;  5CF0 A;  4EFU A;  1Z59 A;  4EMV A;  3CWV A;  4CWR A;  2XX2 A;  1AJ6 A;  3PEJ A;  2Q8F A;  2GFD A;  3A0Z A;  2WER A;  4NH8 A;  2QF6 A;  3EHJ A;  4GT8 A;  3B27 A;  2O1W A;  4HYM A;  4KQV A;  2O1U A;  2XK2 A;  2ZDY A;  1L0O A;  2H55 A;  4JQL A;  3EHF A;  2VCI A;  1Y8N A;  1TID A;  4V25 A;  1R62 A;  3B26 A;  4WUC A;  3DGE A;  3D36 A;  2Q8I A;  3TZ4 A;  3ZKB A;  3R4P A;  2IWS A;  4XTJ A;  1EA6 A;  3R91 A;  2YED A;  1UYE A;  4MPE A;  1ZXN A;  1YSR A;  4WUD A;  3ZXQ A;  5M4N A;  3GIF A;  4EFT A;  4R1F A;  1I5B A;  3INX A;  5D7D A;  4GCZ A;  1I58 A;  2YK2 A;  1I5D A;  4O09 A;  3G7B A;  5F5R A;  5L3J A;  4LP0 A;  1AH8 A;  4EGH A;  3GIE A;  4MBC A;  2BTZ A;  2YKE A;  2C2A A;  3TZ2 A;  4EGK A;  5C93 A;  2YEF A;  1UY7 A;  1QY8 A;  3T0Z A;  1A4H A;  3HHU A;  2YEE A;  2YE2 A;  2PNR A;  4XE2 A;  5CPH A;  1YES A;  4XD8 A;  1MU5 A;  4GGL A;  3A0R A;  3TTZ A;  4LPB A;  2QG0 A;  3GIG A;  3H80 A;  3HZ5 A;  1KZN A;  4B6C A;  2YKI A;  3OPD A;  4MP7 A;  2XHX A;  3VHD A;  2CCS A;  4O05 A;  4XKA A;  2YK9 A;  2IOP A;  4O04 A;  4HYP A;  5D6Q A;  4BIU A;  2XJG A;  3RLR A;  3LNU A;  2WI5 A;  4HXW A;  5D6P A;  3ZM7 A;  2YEH A;  2CG9 A;  5M4K A;  4B7P A;  1YT2 A;  1ID0 A;  4XCJ A;  2FXS A;  4LWH A;  3U2D A;  4E02 A;  3O6O A;  4V26 A;  4FPP A;  4KSH A;  4XIT A;  1UYI A;  1Z5C A;  3A0Y A;  3R4N A;  1Y8O A;  1ZXM A;  2WI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...