3TTZA

Crystal structure of a topoisomerase atpase inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
194
structure length
194
Chain Sequence
YGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
publication title Pyrrolamide DNA gyrase inhibitors: Optimization of antibacterial activity and efficacy.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 62
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3ttzA00
2YECA 4V26A 2WI7A 1UYDA 4WUBA 4LWEA 4NH9A 4W7TA 1R62A 2ZKJA 3PEHA 5FNDA 5D6QA 2BREA 4QPKA 1GKXA 3BMYA 2AKPA 2YKEA 1Y4SA 2CCTA 2VCJA 4E02A 3K98A 1A4HA 2H8MA 1YC1A 3CGYA 3R4PA 3OWDA 2BYIA 5FNFA 2YE9A 4R1FA 5CF0A 1Z5CA 2ZDXA 5IDMA 1UYMA 3A0TA 4O04A 4LWIA 4YKUA 3ZKDA 3C0EA 3TZ4A 4KSHA 3R91A 2XHXA 2WI3A 1EA6A 1YT1A 1Z5AA 2XJJA 4XKOA 2YEJA 1UYCA 3T0HA 4ASBA 5M4KA 3R92A 1YC3A 1BKNA 4L91A 1L0OA 1AJ6A 4BXIA 3B27A 2BTZA 4I3HA 1YS3A 2YGFA 2XX2A 4WUDA 4NH7A 4CWOA 4H85A 3A0RA 1YESA 1UYHA 3A0XA 4L93A 4HY6A 5D7CA 4LP0A 4LWHA 2VW5A 2YI5A 2WI2A 4MPEA 2YKJA 5GGZA 4MBCA 4XITA 5BOCA 4MB9A 2H55A 5J71A 2YEDA 4GEEA 2XCMA 2YE4A 4U7NA 4DZYA 2HCHA 1ZW9A 2BRCA 4EMVA 4YKXA 4ZKIA 4JASA 5D7DA 3T10A 3B24A 2XDKA 4CWSA 4EGIA 4GGLA 1B63A 1UYIA 1UY7A 1YERA 2XDUA 3EKRA 3JZ3A 2Q2EB 3G7BA 4PRXA 2YEEA 3ZXOA 4O09A 4KSGA 3O2FA 3HEKA 3EHGA 2YEHA 3D0BA 3R4OA 1THNA 1TIDA 3K99A 3FT5A 4BQJA 2IWUA 3G7EA 1I5BA 4WUCA 1UYKA 3VHAA 1U0ZA 2O1WA 4CWQA 4XCLA 1GKZA 2YEBA 2GFDA 3RKZA 4CE3A 3PEJA 1B3QA 3BM9A 2HKJA 4H7QA 3FT8A 5J6AA 1AH8A 4AS9A 3A0YA 5CPHA 1EI1A 2Q8GA 3RLPA 4UROA 2K5BA 1UYFA 4K4OA 2GQPA 1QY8A 4EGHA 4L8ZA 4DUHA 3T1KA 4AWOA 5CTUA 3TTZA 5M4MA 4MP7A 1UY9A 1BXDA 2BU7A 3TZ0A 2BU5A 4QPJA 2XK2A 1Z5BA 2CGFA 3VHCA 4L90A 1UYLA 3OMUA 2HG1A 1YSZA 2YE5A 3VADA 4ASFA 3GIGA 2BSMA 4HYPA 2Q8FA 4CE1A 2QG0A 3TZ2A 3ZM7A 4X9LA 3RLQA 2XJGA 2Q8IA 2Q8HA 2BT0A 1NHJA 4EM7A 3D2RA 3R4NA 1NHHA 1ID0A 2YGEA 3B28A 4R3AA 2VWCA 5F3KA 3HZ5A 3WQ9A 4YKRA 4P7AA 4URLA 5CTYA 4U7OA 1Z59A 1AH6A 1I5DA 3A0ZA 3ZKBA 1ZWHA 4EFUA 3CRKA 1UYGA 3INWA 3FV5A 2YEGA 3TZ5A 2XDLA 4URMA 4B6CA 2O1UA 3U2DA 4CE2A 2YEIA 3QDDA 3INXA 4V25A 4AWQA 3QTFA 2XDXA 4CWNA 5F5RA 1NHIA 5D7RA 4L94A 1AMWA 1KZNA 2YE8A 2IORA 4YKZA 3Q5KA 1MU5A 4ASGA 2YE7A 5C93A 2PNRA 4HY1A 1KIJA 1Y8PA 2XX5A 5BODA 2VCIA 4MPCA 4XC0A 4LPBA 2IWSA 2WI1A 3B26A 1QZRA 1PVGA 4O05A 4XKAA 4BAEA 4GCZA 2BYHA 3K60A 2YE6A 1Y8NA 3GIGB 4CWPA 3T2SA 4URNA 4KFGA 4JAVA 1I5AA 2IOQA 2XJXA 1TC0A 4I5SA 2WEQA 1I58A 4YKWA 2YJWA 4E00A 3G75A 3LNUA 2WEPA 2BU8A 2XHTA 5D6PA 4MP2A 5M4NA 4B7PA 1MX0A 5IDJA 1S14A 2WERA 1YT0A 4XE2A 2YGAA 4U93A 3EHFA 4XTJA 4FCPA 1YT2A 2YI6A 3T0ZA 4AWPA 1I5CA 3A0WA 4CWRA 1ZXMA 4FMTA 4R3MA 2FYPA 1TC6A 2E0AA 4MPNA 2XD6A 4YKYA 3TUHA 2XDSA 3DGEA 2EXLA 2CG9A 2YEAA 2QF6A 1GJVA 1BGQA 3C11A 3R4MA 3EHHA 1UY8A 2XHRA 2C2AA 3LPSA 4GT8A 3OPDA 2CCSA 3H80A 3Q5LA 5CTWA 1TBWA 4BIZA 3B25A 3K97A 4Q20A 2YE2A 1YETA 3U67A 2YKCA 4EEHA 4CWTA 3HHUA 1I59A 1B62A 3NMQA 4BIUA 3ZXQA 2YJXA 3MNRP 4YKTA 2FXSA 3HYYA 1JM6A 5FNCA 2CCUA 2JKIA 3OW6A 2BU6A 5CTXA 3Q5JA 2WI6A 2YEFA 3KE6A 2YKIA 4PL9A 4EGKA 3EHJA 2FWYA 4FCRA 4LWGA 3U2KA 4ASAA 2QG2A 4HYMA 3O0IA 4O07A 1BYQA 5M4EA 4PU9A 3IEDA 2XX4A 1YSRA 2YKBA 2WI5A 5M4HA 3EKOA 4XIPA 4FCQA 4NH8A 4YKQA 2WI4A 4XKKA 2ZBKB 2YK2A 4XCJA 1S16A 4KTNA 4EFTA 5L3JA 3GIEA 3H4LA 4JAUA 1YC4A 5IN9A 2ZDYA 3HZ1A 2CH4A 3VHDA 3O6OA 3CRLA 4GFNA 4PRVA 2BU2A 2FWZA 2YI0A 1TILA 4XIQA 4KQVA 2JJCA 3CGZA 4P8OA 1AM1A 3HYZA 2UWDA 3SL2A 2BZ5A 3OWBA 2YK9A 4XIRA 1H7UA 4CWFA 5FWKA 2QFOA 4LWFA 1ZXNA 2IWXA 4BQGA 4KP4A 3D36A 1UYEA 1US7A 3CWVA 2XABA 4XDMA 4ZVIA 2IOPA 4HXZA 1UY6A 3RLRA 4GQTA 4H81A 4O0BA 2O1VA 4XD8A 1U2OA 2YE3A 1TH8A 1Y8OA 4JQLA 1QYEA 3WHAA 1H7SA 4HZ5A 1OSFA 4MOTA 4E01A 4FPPA 5M4PA 2YI7A 3GIFA 2ESAA 4HXWA 4HZ0A 1Y4UA
chains in the Genus database with same CATH superfamily
2YECA 4V26A 2WI7A 1UYDA 4WUBA 4LWEA 4NH9A 4W7TA 1R62A 2ZKJA 3PEHA 5FNDA 5D6QA 2BREA 4QPKA 1GKXA 3BMYA 2AKPA 2YKEA 1Y4SA 2CCTA 2VCJA 4E02A 3K98A 1A4HA 2H8MA 1YC1A 3CGYA 3R4PA 3OWDA 2BYIA 5FNFA 2YE9A 4R1FA 5CF0A 1Z5CA 2ZDXA 5IDMA 5JENA 1UYMA 3A0TA 4O04A 4LWIA 4YKUA 3ZKDA 3C0EA 3TZ4A 4KSHA 3R91A 2XHXA 2WI3A 1EA6A 1YT1A 1Z5AA 2XJJA 4XKOA 2YEJA 1UYCA 3T0HA 4ASBA 5M4KA 3R92A 1YC3A 1BKNA 4L91A 1L0OA 1AJ6A 4BXIA 3B27A 2BTZA 4I3HA 1YS3A 2YGFA 2XX2A 4WUDA 4NH7A 4CWOA 4H85A 3A0RA 1YESA 1UYHA 3A0XA 4L93A 4HY6A 5D7CA 4LP0A 4LWHA 2VW5A 2YI5A 2WI2A 4MPEA 2YKJA 5GGZA 4MBCA 4XITA 5BOCA 4MB9A 2H55A 5J71A 2YEDA 4GEEA 2XCMA 2YE4A 4U7NA 4DZYA 2HCHA 1ZW9A 2BRCA 4EMVA 4YKXA 4ZKIA 4JASA 5D7DA 3LMMA 3T10A 3B24A 2XDKA 4CWSA 4EGIA 4GGLA 1B63A 1UYIA 1YERA 1UY7A 2XDUA 3EKRA 3JZ3A 2Q2EB 3G7BA 4PRXA 2YEEA 3ZXOA 4O09A 4KSGA 3O2FA 3HEKA 3EHGA 2YEHA 3D0BA 3R4OA 1THNA 1TIDA 3K99A 3FT5A 4BQJA 2IWUA 3G7EA 1I5BA 4WUCA 1UYKA 3VHAA 1U0ZA 2O1WA 4CWQA 4XCLA 1GKZA 2YEBA 2GFDA 3RKZA 4CE3A 3PEJA 1B3QA 3BM9A 2HKJA 4H7QA 3FT8A 5J6AA 1AH8A 4AS9A 3A0YA 5CPHA 1EI1A 2Q8GA 3RLPA 4UROA 2K5BA 1UYFA 4K4OA 2GQPA 1QY8A 4EGHA 4L8ZA 4DUHA 3T1KA 4AWOA 5CTUA 3TTZA 5M4MA 4MP7A 1UY9A 1BXDA 2BU7A 3TZ0A 2BU5A 4QPJA 2XK2A 1Z5BA 2CGFA 3VHCA 4L90A 1UYLA 3OMUA 2HG1A 1YSZA 2YE5A 3VADA 4ASFA 3GIGA 2BSMA 4HYPA 2Q8FA 4CE1A 2QG0A 3S5TA 3TZ2A 3ZM7A 4X9LA 3RLQA 2XJGA 2Q8IA 2Q8HA 2BT0A 1NHJA 4EM7A 3D2RA 3R4NA 1NHHA 1ID0A 2YGEA 3B28A 1F51A 2VWCA 4R3AA 5F3KA 3HZ5A 3WQ9A 4YKRA 4P7AA 4URLA 5CTYA 4U7OA 1Z59A 1AH6A 1I5DA 3A0ZA 3ZKBA 1ZWHA 4EFUA 3CRKA 1UYGA 3INWA 3FV5A 2YEGA 3TZ5A 2XDLA 4URMA 4B6CA 2O1UA 3U2DA 4CE2A 2YEIA 3QDDA 3INXA 4V25A 4AWQA 3QTFA 2XDXA 4CWNA 5F5RA 1NHIA 5D7RA 4L94A 1AMWA 1KZNA 2YE8A 2IORA 4YKZA 3Q5KA 1MU5A 4ASGA 2YE7A 5C93A 2PNRA 4HY1A 1IXMA 1KIJA 1Y8PA 2XX5A 5BODA 2VCIA 4MPCA 4XC0A 4LPBA 2IWSA 2WI1A 3B26A 1QZRA 1PVGA 4O05A 4XKAA 4BAEA 4GCZA 2BYHA 3K60A 2YE6A 1Y8NA 3GIGB 4CWPA 3T2SA 4URNA 4KFGA 4JAVA 1I5AA 2IOQA 2XJXA 1TC0A 4I5SA 2WEQA 1I58A 4YKWA 2YJWA 4E00A 3G75A 3LNUA 2WEPA 2BU8A 2XHTA 5D6PA 4MP2A 5M4NA 4B7PA 1MX0A 5IDJA 1S14A 2WERA 3CYGA 1YT0A 4XE2A 2YGAA 4U93A 3EHFA 4XTJA 4FCPA 1YT2A 2YI6A 3T0ZA 4AWPA 2C1IA 1I5CA 3A0WA 4CWRA 1ZXMA 4FMTA 4R3MA 2FYPA 1TC6A 2E0AA 4MPNA 2XD6A 4YKYA 3TUHA 2XDSA 3DGEA 2EXLA 2CG9A 2YEAA 2QF6A 1GJVA 1BGQA 3C11A 3R4MA 3EHHA 1UY8A 2XHRA 2C2AA 3LPSA 4GT8A 3OPDA 2CCSA 3H80A 3Q5LA 5CTWA 4E72A 1TBWA 4BIZA 3B25A 3K97A 4Q20A 2YE2A 1YETA 3U67A 2YKCA 4EEHA 4CWTA 3HHUA 1I59A 1B62A 3NMQA 4BIUA 3ZXQA 2YJXA 3MNRP 4YKTA 2FXSA 3HYYA 1JM6A 5FNCA 2CCUA 2JKIA 3OW6A 2BU6A 5CTXA 3Q5JA 2WI6A 2YEFA 3KE6A 2YKIA 4PL9A 4EGKA 3EHJA 2FWYA 4FCRA 4LWGA 3U2KA 4ASAA 2QG2A 4HYMA 3O0IA 2FTKA 4O07A 1BYQA 5M4EA 4PU9A 3IEDA 2XX4A 1YSRA 2YKBA 2WI5A 5M4HA 3EKOA 4XIPA 4FCQA 4NH8A 4YKQA 2WI4A 4XKKA 2ZBKB 2YK2A 4XCJA 1S16A 4KTNA 4EFTA 5L3JA 3GIEA 3H4LA 4JAUA 1YC4A 2C1GA 5IN9A 2ZDYA 3HZ1A 2CH4A 3VHDA 3O6OA 3CRLA 4GFNA 4PRVA 2BU2A 2FWZA 2YI0A 1TILA 2HHIA 4KQVA 4XIQA 2JJCA 3CGZA 4P8OA 1AM1A 3HYZA 2UWDA 3SL2A 2BZ5A 3OWBA 2YK9A 4XIRA 1H7UA 4CWFA 5FWKA 2QFOA 4LWFA 1ZXNA 2IWXA 4BQGA 4KP4A 3D36A 1UYEA 1US7A 3CWVA 2XABA 4XDMA 4ZVIA 2IOPA 4HXZA 1UY6A 3RLRA 4GQTA 4H81A 4O0BA 2O1VA 4XD8A 1U2OA 2YE3A 1TH8A 1Y8OA 4JQLA 1QYEA 3WHAA 1H7SA 4HZ5A 1OSFA 4MOTA 4E01A 4FPPA 5M4PA 2YI7A 3GIFA 2ESAA 4HXWA 4HZ0A 1Y4UA
chains in the Genus database with same CATH topology
2YECA 4V26A 2WI7A 1UYDA 4WUBA 4LWEA 4NH9A 4W7TA 1R62A 2ZKJA 3PEHA 5FNDA 5D6QA 2BREA 4QPKA 1GKXA 3BMYA 2AKPA 2YKEA 1Y4SA 2CCTA 2VCJA 4E02A 3K98A 1A4HA 2H8MA 1YC1A 3CGYA 3R4PA 3OWDA 2BYIA 5FNFA 2YE9A 4R1FA 5CF0A 1Z5CA 2ZDXA 5IDMA 1UYMA 3A0TA 4O04A 4LWIA 4YKUA 3ZKDA 3C0EA 3TZ4A 4KSHA 3R91A 2XHXA 2WI3A 1EA6A 1YT1A 1Z5AA 2XJJA 4XKOA 2YEJA 1UYCA 3T0HA 4ASBA 5M4KA 3R92A 1YC3A 1BKNA 4L91A 1L0OA 1AJ6A 4BXIA 3B27A 2BTZA 4I3HA 1YS3A 2YGFA 2XX2A 4WUDA 4NH7A 4CWOA 4H85A 3A0RA 1YESA 1UYHA 3A0XA 4L93A 4HY6A 5D7CA 4LP0A 4LWHA 2VW5A 2YI5A 2WI2A 4MPEA 2YKJA 5GGZA 4MBCA 4XITA 5BOCA 4MB9A 2H55A 5J71A 2YEDA 4GEEA 2XCMA 2YE4A 4U7NA 4DZYA 2HCHA 1ZW9A 2BRCA 4EMVA 4YKXA 4ZKIA 4JASA 5D7DA 3T10A 3B24A 2XDKA 4CWSA 4EGIA 4GGLA 1B63A 1UYIA 1UY7A 1YERA 2XDUA 3EKRA 3JZ3A 2Q2EB 3G7BA 4PRXA 2YEEA 3ZXOA 4O09A 4KSGA 3O2FA 3HEKA 3EHGA 2YEHA 3D0BA 3R4OA 1THNA 1TIDA 3K99A 3FT5A 4BQJA 2IWUA 3G7EA 1I5BA 4WUCA 1UYKA 3VHAA 1U0ZA 2O1WA 4CWQA 4XCLA 1GKZA 2YEBA 2GFDA 3RKZA 4CE3A 3PEJA 1B3QA 3BM9A 2HKJA 4H7QA 3FT8A 5J6AA 1AH8A 4AS9A 3A0YA 5CPHA 1EI1A 2Q8GA 3RLPA 4UROA 2K5BA 1UYFA 4K4OA 2GQPA 1QY8A 4EGHA 4L8ZA 4DUHA 3T1KA 4AWOA 5CTUA 3TTZA 5M4MA 4MP7A 1UY9A 1BXDA 2BU7A 3TZ0A 2BU5A 4QPJA 2XK2A 1Z5BA 2CGFA 3VHCA 4L90A 1UYLA 3OMUA 2HG1A 1YSZA 2YE5A 3VADA 4ASFA 3GIGA 2BSMA 4HYPA 2Q8FA 4CE1A 2QG0A 3TZ2A 3ZM7A 4X9LA 3RLQA 2XJGA 2Q8IA 2Q8HA 2BT0A 1NHJA 4EM7A 3D2RA 3R4NA 1NHHA 1ID0A 2YGEA 3B28A 4R3AA 2VWCA 5F3KA 3HZ5A 3WQ9A 4YKRA 4P7AA 4URLA 5CTYA 4U7OA 1Z59A 1AH6A 1I5DA 3A0ZA 3ZKBA 1ZWHA 4EFUA 3CRKA 1UYGA 3INWA 3FV5A 2YEGA 3TZ5A 2XDLA 4URMA 4B6CA 2O1UA 3U2DA 4CE2A 2YEIA 3QDDA 3INXA 4V25A 4AWQA 3QTFA 2XDXA 4CWNA 5F5RA 1NHIA 5D7RA 4L94A 1AMWA 1KZNA 2YE8A 2IORA 4YKZA 3Q5KA 1MU5A 4ASGA 2YE7A 5C93A 2PNRA 4HY1A 1KIJA 1Y8PA 2XX5A 5BODA 2VCIA 4MPCA 4XC0A 4LPBA 2IWSA 2WI1A 3B26A 1QZRA 1PVGA 4O05A 4XKAA 4BAEA 4GCZA 2BYHA 3K60A 2YE6A 1Y8NA 3GIGB 4CWPA 3T2SA 4URNA 4KFGA 4JAVA 1I5AA 2IOQA 2XJXA 1TC0A 4I5SA 2WEQA 1I58A 4YKWA 2YJWA 4E00A 3G75A 3LNUA 2WEPA 2BU8A 2XHTA 5D6PA 4MP2A 5M4NA 4B7PA 1MX0A 5IDJA 1S14A 2WERA 1YT0A 4XE2A 2YGAA 4U93A 3EHFA 4XTJA 4FCPA 1YT2A 2YI6A 3T0ZA 4AWPA 1I5CA 3A0WA 4CWRA 1ZXMA 4FMTA 4R3MA 2FYPA 1TC6A 2E0AA 4MPNA 2XD6A 4YKYA 3TUHA 2XDSA 3DGEA 2EXLA 2CG9A 2YEAA 2QF6A 1GJVA 1BGQA 3C11A 3R4MA 3EHHA 1UY8A 2XHRA 2C2AA 3LPSA 4GT8A 3OPDA 2CCSA 3H80A 3Q5LA 5CTWA 1TBWA 4BIZA 3B25A 3K97A 4Q20A 2YE2A 1YETA 3U67A 2YKCA 4EEHA 4CWTA 3HHUA 1I59A 1B62A 3NMQA 4BIUA 3ZXQA 2YJXA 3MNRP 4YKTA 2FXSA 3HYYA 1JM6A 5FNCA 2CCUA 2JKIA 3OW6A 2BU6A 5CTXA 3Q5JA 2WI6A 2YEFA 3KE6A 2YKIA 4PL9A 4EGKA 3EHJA 2FWYA 4FCRA 4LWGA 3U2KA 4ASAA 2QG2A 4HYMA 3O0IA 4O07A 1BYQA 5M4EA 4PU9A 3IEDA 2XX4A 1YSRA 2YKBA 2WI5A 5M4HA 3EKOA 4XIPA 4FCQA 4NH8A 4YKQA 2WI4A 4XKKA 2ZBKB 2YK2A 4XCJA 1S16A 4KTNA 4EFTA 5L3JA 3GIEA 3H4LA 4JAUA 1YC4A 5IN9A 2ZDYA 3HZ1A 2CH4A 3VHDA 3O6OA 3CRLA 4GFNA 4PRVA 2BU2A 2FWZA 2YI0A 1TILA 4XIQA 4KQVA 2JJCA 3CGZA 4P8OA 1AM1A 3HYZA 2UWDA 3SL2A 2BZ5A 3OWBA 2YK9A 4XIRA 1H7UA 4CWFA 5FWKA 2QFOA 4LWFA 1ZXNA 2IWXA 4BQGA 4KP4A 3D36A 1UYEA 1US7A 3CWVA 2XABA 4XDMA 4ZVIA 2IOPA 4HXZA 1UY6A 3RLRA 4GQTA 4H81A 4O0BA 2O1VA 4XD8A 1U2OA 2YE3A 1TH8A 1Y8OA 4JQLA 1QYEA 3WHAA 1H7SA 4HZ5A 1OSFA 4MOTA 4E01A 4FPPA 5M4PA 2YI7A 3GIFA 2ESAA 4HXWA 4HZ0A 1Y4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEC A;  4V26 A;  2WI7 A;  1UYD A;  4WUB A;  4LWE A;  4NH9 A;  4W7T A;  1R62 A;  2ZKJ A;  3PEH A;  5FND A;  5D6Q A;  2BRE A;  4QPK A;  1GKX A;  3BMY A;  2AKP A;  2YKE A;  1Y4S A;  2CCT A;  2VCJ A;  4E02 A;  3K98 A;  1A4H A;  2H8M A;  1YC1 A;  3CGY A;  3R4P A;  3OWD A;  2BYI A;  5FNF A;  2YE9 A;  4R1F A;  5CF0 A;  1Z5C A;  2ZDX A;  5IDM A;  1UYM A;  3A0T A;  4O04 A;  4LWI A;  4YKU A;  3ZKD A;  3C0E A;  3TZ4 A;  4KSH A;  3R91 A;  2XHX A;  2WI3 A;  1EA6 A;  1YT1 A;  1Z5A A;  2XJJ A;  4XKO A;  2YEJ A;  1UYC A;  3T0H A;  4ASB A;  5M4K A;  3R92 A;  1YC3 A;  1BKN A;  4L91 A;  1L0O A;  1AJ6 A;  4BXI A;  3B27 A;  2BTZ A;  4I3H A;  1YS3 A;  2YGF A;  2XX2 A;  4WUD A;  4NH7 A;  4CWO A;  4H85 A;  3A0R A;  1YES A;  1UYH A;  3A0X A;  4L93 A;  4HY6 A;  5D7C A;  4LP0 A;  4LWH A;  2VW5 A;  2YI5 A;  2WI2 A;  4MPE A;  2YKJ A;  5GGZ A;  4MBC A;  4XIT A;  5BOC A;  4MB9 A;  2H55 A;  5J71 A;  2YED A;  4GEE A;  2XCM A;  2YE4 A;  4U7N A;  4DZY A;  2HCH A;  1ZW9 A;  2BRC A;  4EMV A;  4YKX A;  4ZKI A;  4JAS A;  5D7D A;  3T10 A;  3B24 A;  2XDK A;  4CWS A;  4EGI A;  4GGL A;  1B63 A;  1UYI A;  1UY7 A;  1YER A;  2XDU A;  3EKR A;  3JZ3 A;  2Q2E B;  3G7B A;  4PRX A;  2YEE A;  3ZXO A;  4O09 A;  4KSG A;  3O2F A;  3HEK A;  3EHG A;  2YEH A;  3D0B A;  3R4O A;  1THN A;  1TID A;  3K99 A;  3FT5 A;  4BQJ A;  2IWU A;  3G7E A;  1I5B A;  4WUC A;  1UYK A;  3VHA A;  1U0Z A;  2O1W A;  4CWQ A;  4XCL A;  1GKZ A;  2YEB A;  2GFD A;  3RKZ A;  4CE3 A;  3PEJ A;  1B3Q A;  3BM9 A;  2HKJ A;  4H7Q A;  3FT8 A;  5J6A A;  1AH8 A;  4AS9 A;  3A0Y A;  5CPH A;  1EI1 A;  2Q8G A;  3RLP A;  4URO A;  2K5B A;  1UYF A;  4K4O A;  2GQP A;  1QY8 A;  4EGH A;  4L8Z A;  4DUH A;  3T1K A;  4AWO A;  5CTU A;  3TTZ A;  5M4M A;  4MP7 A;  1UY9 A;  1BXD A;  2BU7 A;  3TZ0 A;  2BU5 A;  4QPJ A;  2XK2 A;  1Z5B A;  2CGF A;  3VHC A;  4L90 A;  1UYL A;  3OMU A;  2HG1 A;  1YSZ A;  2YE5 A;  3VAD A;  4ASF A;  3GIG A;  2BSM A;  4HYP A;  2Q8F A;  4CE1 A;  2QG0 A;  3TZ2 A;  3ZM7 A;  4X9L A;  3RLQ A;  2XJG A;  2Q8I A;  2Q8H A;  2BT0 A;  1NHJ A;  4EM7 A;  3D2R A;  3R4N A;  1NHH A;  1ID0 A;  2YGE A;  3B28 A;  4R3A A;  2VWC A;  5F3K A;  3HZ5 A;  3WQ9 A;  4YKR A;  4P7A A;  4URL A;  5CTY A;  4U7O A;  1Z59 A;  1AH6 A;  1I5D A;  3A0Z A;  3ZKB A;  1ZWH A;  4EFU A;  3CRK A;  1UYG A;  3INW A;  3FV5 A;  2YEG A;  3TZ5 A;  2XDL A;  4URM A;  4B6C A;  2O1U A;  3U2D A;  4CE2 A;  2YEI A;  3QDD A;  3INX A;  4V25 A;  4AWQ A;  3QTF A;  2XDX A;  4CWN A;  5F5R A;  1NHI A;  5D7R A;  4L94 A;  1AMW A;  1KZN A;  2YE8 A;  2IOR A;  4YKZ A;  3Q5K A;  1MU5 A;  4ASG A;  2YE7 A;  5C93 A;  2PNR A;  4HY1 A;  1KIJ A;  1Y8P A;  2XX5 A;  5BOD A;  2VCI A;  4MPC A;  4XC0 A;  4LPB A;  2IWS A;  2WI1 A;  3B26 A;  1QZR A;  1PVG A;  4O05 A;  4XKA A;  4BAE A;  4GCZ A;  2BYH A;  3K60 A;  2YE6 A;  1Y8N A;  3GIG B;  4CWP A;  3T2S A;  4URN A;  4KFG A;  4JAV A;  1I5A A;  2IOQ A;  2XJX A;  1TC0 A;  4I5S A;  2WEQ A;  1I58 A;  4YKW A;  2YJW A;  4E00 A;  3G75 A;  3LNU A;  2WEP A;  2BU8 A;  2XHT A;  5D6P A;  4MP2 A;  5M4N A;  4B7P A;  1MX0 A;  5IDJ A;  1S14 A;  2WER A;  1YT0 A;  4XE2 A;  2YGA A;  4U93 A;  3EHF A;  4XTJ A;  4FCP A;  1YT2 A;  2YI6 A;  3T0Z A;  4AWP A;  1I5C A;  3A0W A;  4CWR A;  1ZXM A;  4FMT A;  4R3M A;  2FYP A;  1TC6 A;  2E0A A;  4MPN A;  2XD6 A;  4YKY A;  3TUH A;  2XDS A;  3DGE A;  2EXL A;  2CG9 A;  2YEA A;  2QF6 A;  1GJV A;  1BGQ A;  3C11 A;  3R4M A;  3EHH A;  1UY8 A;  2XHR A;  2C2A A;  3LPS A;  4GT8 A;  3OPD A;  2CCS A;  3H80 A;  3Q5L A;  5CTW A;  1TBW A;  4BIZ A;  3B25 A;  3K97 A;  4Q20 A;  2YE2 A;  1YET A;  3U67 A;  2YKC A;  4EEH A;  4CWT A;  3HHU A;  1I59 A;  1B62 A;  3NMQ A;  4BIU A;  3ZXQ A;  2YJX A;  3MNR P;  4YKT A;  2FXS A;  3HYY A;  1JM6 A;  5FNC A;  2CCU A;  2JKI A;  3OW6 A;  2BU6 A;  5CTX A;  3Q5J A;  2WI6 A;  2YEF A;  3KE6 A;  2YKI A;  4PL9 A;  4EGK A;  3EHJ A;  2FWY A;  4FCR A;  4LWG A;  3U2K A;  4ASA A;  2QG2 A;  4HYM A;  3O0I A;  4O07 A;  1BYQ A;  5M4E A;  4PU9 A;  3IED A;  2XX4 A;  1YSR A;  2YKB A;  2WI5 A;  5M4H A;  3EKO A;  4XIP A;  4FCQ A;  4NH8 A;  4YKQ A;  2WI4 A;  4XKK A;  2ZBK B;  2YK2 A;  4XCJ A;  1S16 A;  4KTN A;  4EFT A;  5L3J A;  3GIE A;  3H4L A;  4JAU A;  1YC4 A;  5IN9 A;  2ZDY A;  3HZ1 A;  2CH4 A;  3VHD A;  3O6O A;  3CRL A;  4GFN A;  4PRV A;  2BU2 A;  2FWZ A;  2YI0 A;  1TIL A;  4XIQ A;  4KQV A;  2JJC A;  3CGZ A;  4P8O A;  1AM1 A;  3HYZ A;  2UWD A;  3SL2 A;  2BZ5 A;  3OWB A;  2YK9 A;  4XIR A;  1H7U A;  4CWF A;  5FWK A;  2QFO A;  4LWF A;  1ZXN A;  2IWX A;  4BQG A;  4KP4 A;  3D36 A;  1UYE A;  1US7 A;  3CWV A;  2XAB A;  4XDM A;  4ZVI A;  2IOP A;  4HXZ A;  1UY6 A;  3RLR A;  4GQT A;  4H81 A;  4O0B A;  2O1V A;  4XD8 A;  1U2O A;  2YE3 A;  1TH8 A;  1Y8O A;  4JQL A;  1QYE A;  3WHA A;  1H7S A;  4HZ5 A;  1OSF A;  4MOT A;  4E01 A;  4FPP A;  5M4P A;  2YI7 A;  3GIF A;  2ESA A;  4HXW A;  4HZ0 A;  1Y4U A; 
#chains in the Genus database with same CATH topology
 2YEC A;  4V26 A;  2WI7 A;  1UYD A;  4WUB A;  4LWE A;  4NH9 A;  4W7T A;  1R62 A;  2ZKJ A;  3PEH A;  5FND A;  5D6Q A;  2BRE A;  4QPK A;  1GKX A;  3BMY A;  2AKP A;  2YKE A;  1Y4S A;  2CCT A;  2VCJ A;  4E02 A;  3K98 A;  1A4H A;  2H8M A;  1YC1 A;  3CGY A;  3R4P A;  3OWD A;  2BYI A;  5FNF A;  2YE9 A;  4R1F A;  5CF0 A;  1Z5C A;  2ZDX A;  5IDM A;  5JEN A;  1UYM A;  3A0T A;  4O04 A;  4LWI A;  4YKU A;  3ZKD A;  3C0E A;  3TZ4 A;  4KSH A;  3R91 A;  2XHX A;  2WI3 A;  1EA6 A;  1YT1 A;  1Z5A A;  2XJJ A;  4XKO A;  2YEJ A;  1UYC A;  3T0H A;  4ASB A;  5M4K A;  3R92 A;  1YC3 A;  1BKN A;  4L91 A;  1L0O A;  1AJ6 A;  4BXI A;  3B27 A;  2BTZ A;  4I3H A;  1YS3 A;  2YGF A;  2XX2 A;  4WUD A;  4NH7 A;  4CWO A;  4H85 A;  3A0R A;  1YES A;  1UYH A;  3A0X A;  4L93 A;  4HY6 A;  5D7C A;  4LP0 A;  4LWH A;  2VW5 A;  2YI5 A;  2WI2 A;  4MPE A;  2YKJ A;  5GGZ A;  4MBC A;  4XIT A;  5BOC A;  4MB9 A;  2H55 A;  5J71 A;  2YED A;  4GEE A;  2XCM A;  2YE4 A;  4U7N A;  4DZY A;  2HCH A;  1ZW9 A;  2BRC A;  4EMV A;  4YKX A;  4ZKI A;  4JAS A;  5D7D A;  3LMM A;  3T10 A;  3B24 A;  2XDK A;  4CWS A;  4EGI A;  4GGL A;  1B63 A;  1UYI A;  1YER A;  1UY7 A;  2XDU A;  3EKR A;  3JZ3 A;  2Q2E B;  3G7B A;  4PRX A;  2YEE A;  3ZXO A;  4O09 A;  4KSG A;  3O2F A;  3HEK A;  3EHG A;  2YEH A;  3D0B A;  3R4O A;  1THN A;  1TID A;  3K99 A;  3FT5 A;  4BQJ A;  2IWU A;  3G7E A;  1I5B A;  4WUC A;  1UYK A;  3VHA A;  1U0Z A;  2O1W A;  4CWQ A;  4XCL A;  1GKZ A;  2YEB A;  2GFD A;  3RKZ A;  4CE3 A;  3PEJ A;  1B3Q A;  3BM9 A;  2HKJ A;  4H7Q A;  3FT8 A;  5J6A A;  1AH8 A;  4AS9 A;  3A0Y A;  5CPH A;  1EI1 A;  2Q8G A;  3RLP A;  4URO A;  2K5B A;  1UYF A;  4K4O A;  2GQP A;  1QY8 A;  4EGH A;  4L8Z A;  4DUH A;  3T1K A;  4AWO A;  5CTU A;  3TTZ A;  5M4M A;  4MP7 A;  1UY9 A;  1BXD A;  2BU7 A;  3TZ0 A;  2BU5 A;  4QPJ A;  2XK2 A;  1Z5B A;  2CGF A;  3VHC A;  4L90 A;  1UYL A;  3OMU A;  2HG1 A;  1YSZ A;  2YE5 A;  3VAD A;  4ASF A;  3GIG A;  2BSM A;  4HYP A;  2Q8F A;  4CE1 A;  2QG0 A;  3S5T A;  3TZ2 A;  3ZM7 A;  4X9L A;  3RLQ A;  2XJG A;  2Q8I A;  2Q8H A;  2BT0 A;  1NHJ A;  4EM7 A;  3D2R A;  3R4N A;  1NHH A;  1ID0 A;  2YGE A;  3B28 A;  1F51 A;  2VWC A;  4R3A A;  5F3K A;  3HZ5 A;  3WQ9 A;  4YKR A;  4P7A A;  4URL A;  5CTY A;  4U7O A;  1Z59 A;  1AH6 A;  1I5D A;  3A0Z A;  3ZKB A;  1ZWH A;  4EFU A;  3CRK A;  1UYG A;  3INW A;  3FV5 A;  2YEG A;  3TZ5 A;  2XDL A;  4URM A;  4B6C A;  2O1U A;  3U2D A;  4CE2 A;  2YEI A;  3QDD A;  3INX A;  4V25 A;  4AWQ A;  3QTF A;  2XDX A;  4CWN A;  5F5R A;  1NHI A;  5D7R A;  4L94 A;  1AMW A;  1KZN A;  2YE8 A;  2IOR A;  4YKZ A;  3Q5K A;  1MU5 A;  4ASG A;  2YE7 A;  5C93 A;  2PNR A;  4HY1 A;  1IXM A;  1KIJ A;  1Y8P A;  2XX5 A;  5BOD A;  2VCI A;  4MPC A;  4XC0 A;  4LPB A;  2IWS A;  2WI1 A;  3B26 A;  1QZR A;  1PVG A;  4O05 A;  4XKA A;  4BAE A;  4GCZ A;  2BYH A;  3K60 A;  2YE6 A;  1Y8N A;  3GIG B;  4CWP A;  3T2S A;  4URN A;  4KFG A;  4JAV A;  1I5A A;  2IOQ A;  2XJX A;  1TC0 A;  4I5S A;  2WEQ A;  1I58 A;  4YKW A;  2YJW A;  4E00 A;  3G75 A;  3LNU A;  2WEP A;  2BU8 A;  2XHT A;  5D6P A;  4MP2 A;  5M4N A;  4B7P A;  1MX0 A;  5IDJ A;  1S14 A;  2WER A;  3CYG A;  1YT0 A;  4XE2 A;  2YGA A;  4U93 A;  3EHF A;  4XTJ A;  4FCP A;  1YT2 A;  2YI6 A;  3T0Z A;  4AWP A;  2C1I A;  1I5C A;  3A0W A;  4CWR A;  1ZXM A;  4FMT A;  4R3M A;  2FYP A;  1TC6 A;  2E0A A;  4MPN A;  2XD6 A;  4YKY A;  3TUH A;  2XDS A;  3DGE A;  2EXL A;  2CG9 A;  2YEA A;  2QF6 A;  1GJV A;  1BGQ A;  3C11 A;  3R4M A;  3EHH A;  1UY8 A;  2XHR A;  2C2A A;  3LPS A;  4GT8 A;  3OPD A;  2CCS A;  3H80 A;  3Q5L A;  5CTW A;  4E72 A;  1TBW A;  4BIZ A;  3B25 A;  3K97 A;  4Q20 A;  2YE2 A;  1YET A;  3U67 A;  2YKC A;  4EEH A;  4CWT A;  3HHU A;  1I59 A;  1B62 A;  3NMQ A;  4BIU A;  3ZXQ A;  2YJX A;  3MNR P;  4YKT A;  2FXS A;  3HYY A;  1JM6 A;  5FNC A;  2CCU A;  2JKI A;  3OW6 A;  2BU6 A;  5CTX A;  3Q5J A;  2WI6 A;  2YEF A;  3KE6 A;  2YKI A;  4PL9 A;  4EGK A;  3EHJ A;  2FWY A;  4FCR A;  4LWG A;  3U2K A;  4ASA A;  2QG2 A;  4HYM A;  3O0I A;  2FTK A;  4O07 A;  1BYQ A;  5M4E A;  4PU9 A;  3IED A;  2XX4 A;  1YSR A;  2YKB A;  2WI5 A;  5M4H A;  3EKO A;  4XIP A;  4FCQ A;  4NH8 A;  4YKQ A;  2WI4 A;  4XKK A;  2ZBK B;  2YK2 A;  4XCJ A;  1S16 A;  4KTN A;  4EFT A;  5L3J A;  3GIE A;  3H4L A;  4JAU A;  1YC4 A;  2C1G A;  5IN9 A;  2ZDY A;  3HZ1 A;  2CH4 A;  3VHD A;  3O6O A;  3CRL A;  4GFN A;  4PRV A;  2BU2 A;  2FWZ A;  2YI0 A;  1TIL A;  2HHI A;  4KQV A;  4XIQ A;  2JJC A;  3CGZ A;  4P8O A;  1AM1 A;  3HYZ A;  2UWD A;  3SL2 A;  2BZ5 A;  3OWB A;  2YK9 A;  4XIR A;  1H7U A;  4CWF A;  5FWK A;  2QFO A;  4LWF A;  1ZXN A;  2IWX A;  4BQG A;  4KP4 A;  3D36 A;  1UYE A;  1US7 A;  3CWV A;  2XAB A;  4XDM A;  4ZVI A;  2IOP A;  4HXZ A;  1UY6 A;  3RLR A;  4GQT A;  4H81 A;  4O0B A;  2O1V A;  4XD8 A;  1U2O A;  2YE3 A;  1TH8 A;  1Y8O A;  4JQL A;  1QYE A;  3WHA A;  1H7S A;  4HZ5 A;  1OSF A;  4MOT A;  4E01 A;  4FPP A;  5M4P A;  2YI7 A;  3GIF A;  2ESA A;  4HXW A;  4HZ0 A;  1Y4U A; 
#chains in the Genus database with same CATH homology
 2YEC A;  4V26 A;  2WI7 A;  1UYD A;  4WUB A;  4LWE A;  4NH9 A;  4W7T A;  1R62 A;  2ZKJ A;  3PEH A;  5FND A;  5D6Q A;  2BRE A;  4QPK A;  1GKX A;  3BMY A;  2AKP A;  2YKE A;  1Y4S A;  2CCT A;  2VCJ A;  4E02 A;  3K98 A;  1A4H A;  2H8M A;  1YC1 A;  3CGY A;  3R4P A;  3OWD A;  2BYI A;  5FNF A;  2YE9 A;  4R1F A;  5CF0 A;  1Z5C A;  2ZDX A;  5IDM A;  1UYM A;  3A0T A;  4O04 A;  4LWI A;  4YKU A;  3ZKD A;  3C0E A;  3TZ4 A;  4KSH A;  3R91 A;  2XHX A;  2WI3 A;  1EA6 A;  1YT1 A;  1Z5A A;  2XJJ A;  4XKO A;  2YEJ A;  1UYC A;  3T0H A;  4ASB A;  5M4K A;  3R92 A;  1YC3 A;  1BKN A;  4L91 A;  1L0O A;  1AJ6 A;  4BXI A;  3B27 A;  2BTZ A;  4I3H A;  1YS3 A;  2YGF A;  2XX2 A;  4WUD A;  4NH7 A;  4CWO A;  4H85 A;  3A0R A;  1YES A;  1UYH A;  3A0X A;  4L93 A;  4HY6 A;  5D7C A;  4LP0 A;  4LWH A;  2VW5 A;  2YI5 A;  2WI2 A;  4MPE A;  2YKJ A;  5GGZ A;  4MBC A;  4XIT A;  5BOC A;  4MB9 A;  2H55 A;  5J71 A;  2YED A;  4GEE A;  2XCM A;  2YE4 A;  4U7N A;  4DZY A;  2HCH A;  1ZW9 A;  2BRC A;  4EMV A;  4YKX A;  4ZKI A;  4JAS A;  5D7D A;  3T10 A;  3B24 A;  2XDK A;  4CWS A;  4EGI A;  4GGL A;  1B63 A;  1UYI A;  1UY7 A;  1YER A;  2XDU A;  3EKR A;  3JZ3 A;  2Q2E B;  3G7B A;  4PRX A;  2YEE A;  3ZXO A;  4O09 A;  4KSG A;  3O2F A;  3HEK A;  3EHG A;  2YEH A;  3D0B A;  3R4O A;  1THN A;  1TID A;  3K99 A;  3FT5 A;  4BQJ A;  2IWU A;  3G7E A;  1I5B A;  4WUC A;  1UYK A;  3VHA A;  1U0Z A;  2O1W A;  4CWQ A;  4XCL A;  1GKZ A;  2YEB A;  2GFD A;  3RKZ A;  4CE3 A;  3PEJ A;  1B3Q A;  3BM9 A;  2HKJ A;  4H7Q A;  3FT8 A;  5J6A A;  1AH8 A;  4AS9 A;  3A0Y A;  5CPH A;  1EI1 A;  2Q8G A;  3RLP A;  4URO A;  2K5B A;  1UYF A;  4K4O A;  2GQP A;  1QY8 A;  4EGH A;  4L8Z A;  4DUH A;  3T1K A;  4AWO A;  5CTU A;  3TTZ A;  5M4M A;  4MP7 A;  1UY9 A;  1BXD A;  2BU7 A;  3TZ0 A;  2BU5 A;  4QPJ A;  2XK2 A;  1Z5B A;  2CGF A;  3VHC A;  4L90 A;  1UYL A;  3OMU A;  2HG1 A;  1YSZ A;  2YE5 A;  3VAD A;  4ASF A;  3GIG A;  2BSM A;  4HYP A;  2Q8F A;  4CE1 A;  2QG0 A;  3TZ2 A;  3ZM7 A;  4X9L A;  3RLQ A;  2XJG A;  2Q8I A;  2Q8H A;  2BT0 A;  1NHJ A;  4EM7 A;  3D2R A;  3R4N A;  1NHH A;  1ID0 A;  2YGE A;  3B28 A;  4R3A A;  2VWC A;  5F3K A;  3HZ5 A;  3WQ9 A;  4YKR A;  4P7A A;  4URL A;  5CTY A;  4U7O A;  1Z59 A;  1AH6 A;  1I5D A;  3A0Z A;  3ZKB A;  1ZWH A;  4EFU A;  3CRK A;  1UYG A;  3INW A;  3FV5 A;  2YEG A;  3TZ5 A;  2XDL A;  4URM A;  4B6C A;  2O1U A;  3U2D A;  4CE2 A;  2YEI A;  3QDD A;  3INX A;  4V25 A;  4AWQ A;  3QTF A;  2XDX A;  4CWN A;  5F5R A;  1NHI A;  5D7R A;  4L94 A;  1AMW A;  1KZN A;  2YE8 A;  2IOR A;  4YKZ A;  3Q5K A;  1MU5 A;  4ASG A;  2YE7 A;  5C93 A;  2PNR A;  4HY1 A;  1KIJ A;  1Y8P A;  2XX5 A;  5BOD A;  2VCI A;  4MPC A;  4XC0 A;  4LPB A;  2IWS A;  2WI1 A;  3B26 A;  1QZR A;  1PVG A;  4O05 A;  4XKA A;  4BAE A;  4GCZ A;  2BYH A;  3K60 A;  2YE6 A;  1Y8N A;  3GIG B;  4CWP A;  3T2S A;  4URN A;  4KFG A;  4JAV A;  1I5A A;  2IOQ A;  2XJX A;  1TC0 A;  4I5S A;  2WEQ A;  1I58 A;  4YKW A;  2YJW A;  4E00 A;  3G75 A;  3LNU A;  2WEP A;  2BU8 A;  2XHT A;  5D6P A;  4MP2 A;  5M4N A;  4B7P A;  1MX0 A;  5IDJ A;  1S14 A;  2WER A;  1YT0 A;  4XE2 A;  2YGA A;  4U93 A;  3EHF A;  4XTJ A;  4FCP A;  1YT2 A;  2YI6 A;  3T0Z A;  4AWP A;  1I5C A;  3A0W A;  4CWR A;  1ZXM A;  4FMT A;  4R3M A;  2FYP A;  1TC6 A;  2E0A A;  4MPN A;  2XD6 A;  4YKY A;  3TUH A;  2XDS A;  3DGE A;  2EXL A;  2CG9 A;  2YEA A;  2QF6 A;  1GJV A;  1BGQ A;  3C11 A;  3R4M A;  3EHH A;  1UY8 A;  2XHR A;  2C2A A;  3LPS A;  4GT8 A;  3OPD A;  2CCS A;  3H80 A;  3Q5L A;  5CTW A;  1TBW A;  4BIZ A;  3B25 A;  3K97 A;  4Q20 A;  2YE2 A;  1YET A;  3U67 A;  2YKC A;  4EEH A;  4CWT A;  3HHU A;  1I59 A;  1B62 A;  3NMQ A;  4BIU A;  3ZXQ A;  2YJX A;  3MNR P;  4YKT A;  2FXS A;  3HYY A;  1JM6 A;  5FNC A;  2CCU A;  2JKI A;  3OW6 A;  2BU6 A;  5CTX A;  3Q5J A;  2WI6 A;  2YEF A;  3KE6 A;  2YKI A;  4PL9 A;  4EGK A;  3EHJ A;  2FWY A;  4FCR A;  4LWG A;  3U2K A;  4ASA A;  2QG2 A;  4HYM A;  3O0I A;  4O07 A;  1BYQ A;  5M4E A;  4PU9 A;  3IED A;  2XX4 A;  1YSR A;  2YKB A;  2WI5 A;  5M4H A;  3EKO A;  4XIP A;  4FCQ A;  4NH8 A;  4YKQ A;  2WI4 A;  4XKK A;  2ZBK B;  2YK2 A;  4XCJ A;  1S16 A;  4KTN A;  4EFT A;  5L3J A;  3GIE A;  3H4L A;  4JAU A;  1YC4 A;  5IN9 A;  2ZDY A;  3HZ1 A;  2CH4 A;  3VHD A;  3O6O A;  3CRL A;  4GFN A;  4PRV A;  2BU2 A;  2FWZ A;  2YI0 A;  1TIL A;  4XIQ A;  4KQV A;  2JJC A;  3CGZ A;  4P8O A;  1AM1 A;  3HYZ A;  2UWD A;  3SL2 A;  2BZ5 A;  3OWB A;  2YK9 A;  4XIR A;  1H7U A;  4CWF A;  5FWK A;  2QFO A;  4LWF A;  1ZXN A;  2IWX A;  4BQG A;  4KP4 A;  3D36 A;  1UYE A;  1US7 A;  3CWV A;  2XAB A;  4XDM A;  4ZVI A;  2IOP A;  4HXZ A;  1UY6 A;  3RLR A;  4GQT A;  4H81 A;  4O0B A;  2O1V A;  4XD8 A;  1U2O A;  2YE3 A;  1TH8 A;  1Y8O A;  4JQL A;  1QYE A;  3WHA A;  1H7S A;  4HZ5 A;  1OSF A;  4MOT A;  4E01 A;  4FPP A;  5M4P A;  2YI7 A;  3GIF A;  2ESA A;  4HXW A;  4HZ0 A;  1Y4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...