4KP4A

Deciphering cis-trans directionality and visualizing autophosphorylation in histidine kinases.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
b'ADDRTLLMAGVSHDLRTPLTRIRAYAETIYNSLGELDLSTLKELAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Osmolarity sensor protein EnvZ, Histidine kinase
publication title Visualizing autophosphorylation in histidine kinases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/signaling protein
total genus 66
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4kp4A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4kp4A02
4EGKA 5CPHA 3PEHA 4LWFA 4R3MA 1Z5BA 1YC1A 4YKUA 5CTWA 1Y8NA 4MPNA 2WI6A 4AS9A 4O09A 2E0AA 3R4NA 3K97A 1MX0A 4FCRA 1H7UA 1AH8A 3INWA 2XDLA 3FT8A 4B7PA 4L8ZA 4KTNA 2YE6A 2Q2EB 2BU2A 2YJWA 5F3KA 1H7SA 4ASBA 2XDUA 4KQVA 3Q5JA 4XD8A 4GCZA 4PRXA 4Q20A 4EEHA 4KFGA 4WUDA 4BAEA 2XHXA 2WI2A 3OWDA 4CE1A 5J71A 1I59A 2O1VA 3CWVA 2H55A 4GT1A 5IN9A 4P8OA 1TH8A 3HZ1A 5BOCA 1EA6A 1I58A 2JKIA 3O6OA 4CWPA 1KZNA 3GIGA 3NMQA 3OPDA 4PU9A 3IEDA 4L94A 4W7TA 4EFUA 5M4EA 1A4HA 3EHHA 3R4OA 2YEAA 4GQTA 5D7DA 1TIDA 3A0RA 3VHDA 4JAUA 4LWIA 3EKOA 4L91A 4O04A 4UROA 2XCMA 2Q8GA 1F51A 3U2KA 1UY8A 4GGLA 3D36A 1YETA 4XKKA 2WEPA 4P7AA 3OW6A 4EFTA 5GGZA 4HYMA 2BU5A 4HY1A 2YJXA 1THNA 1BXDA 4CE3A 3LNUA 4DUHA 3U67A 3G7EA 2AKPA 4O05A 4BIUA 2UWDA 3C11A 3GIGB 4FCQA 3B28A 3ZRXA 1Y8OA 1GJVA 1Y4SA 2BYIA 1UYDA 2YE4A 4YKRA 3GIEA 3EHFA 4GFNA 2IOPA 4XKAA 2BRCA 4YKXA 4BQJA 2O1UA 4EGHA 3H4LA 2CGFA 1TILA 3HEKA 2ZKJA 1YT1A 4LWHA 2QG2A 3O2FA 5M4NA 4HXZA 2YGEA 3K99A 1UY6A 4HXWA 1I5AA 2YKEA 2YI5A 2Q8HA 1GKZA 4HY6A 3WQ9A 3CGYA 5CTYA 1UYKA 1UYFA 1U0ZA 4XIRA 2YK2A 3ZKDA 1UY9A 4L90A 4I3HA 2YEIA 2Q8FA 4XITA 3EKRA 4CWOA 4MPEA 2WI3A 2BZ5A 3D0BA 2BU6A 3U2DA 3A0ZA 4JQLA 2YK9A 4MPCA 2YE8A 2IWXA 2FTKA 1I5DA 3T1KA 2VWCA 4HYPA 3G75A 2YEBA 3VHCA 2CCUA 3TZ4A 2WI5A 1BGQA 5C93A 2PNRA 2LFSA 3B26A 4MTXA 3RLQA 4FMTA 2ZBKB 2GFDA 1YC3A 3TZ5A 3TK1A 2YEGA 4FPPA 3R4PA 4R1FA 3T0HA 3A0YA 4H81A 1AJ6A 5D7CA 2YKCA 4BQGA 4WUBA 2YKBA 4FCPA 5CTXA 1AMWA 3A0WA 4NH9A 4H7QA 2Q8IA 1YSRA 2QG0A 3K60A 5B1OA 2C2AA 3T0ZA 2YE7A 2YI6A 4AWOA 2WI7A 4MOTA 5IDJA 2XX5A 4CWRA 1QZRA 4HZ5A 3R4MA 4V26A 5F5RA 2CCTA 4CE2A 1UYIA 3R91A 2EXLA 2YE2A 2QF6A 3EHGA 4K4OA 4CWSA 1AH6A 4GT8A 1Z59A 2P67A 5FNDA 4BXIA 4YKQA 2FYPA 4I5SA 1Y8PA 1QYEA 3HYZA 2XABA 3P32A 2YEEA 5M4MA 2BTZA 3T2SA 1UYEA 2BSMA 2YI0A 2O1WA 4HZ0A 4U7NA 3EHJA 4ZKIA 3TZ2A 1U2OA 2QM8A 2XDSA 2YGAA 2QFOA 2IWSA 4U93A 4MB9A 4KP4A 3RLPA 1QY8A 1AM1A 4PL9A 2XDKA 2XK2A 3ZRVA 4U7OA 3KE6A 4WUCA 3ZKBA 3CRKA 2XHRA 1JOYA 1ZW9A 1UYMA 2H8MA 4H85A 4YKZA 4O07A 1B63A 4XE2A 1Y4UA 2YE5A 3A0XA 3LPSA 1S16A 2VCJA 1YS3A 1ZXMA 4QPKA 3HYYA 4URMA 2QM7A 3ZCCA 4URLA 4EGIA 3ZRWA 4XCJA 3CRLA 4XIQA 4NH8A 5FNFA 2XJXA 2WI4A 2XX4A 4LWGA 1BYQA 1L0OA 4XKOA 2GQPA 1IXMA 5D7RA 3SL2A 4DZYA 3BMYA 5J6AA 4E00A 5D6QA 5CF0A 1TC0A 1GKXA 3B25A 3VHAA 2YE3A 4KSHA 4CWTA 5CTUA 5B1NA 3HZ5A 4URNA 3Q5LA 4XIPA 4EM7A 1NHHA 4YKYA 2ZDYA 4MT8A 3NXSA 4JYCA 1MU5A 5M4KA 4E02A 1OSFA 2K5BA 3JZ3A 4AWQA 2BYHA 2IWUA 3Q5KA 4O0BA 1UYGA 3ZRWB 3GIFA 2YECA 2VCIA 2LFRA 1BKNA 2XHTA 3ZXOA 3D2RA 2VW5A 4XDMA 4YKTA 4NH7A 4LWEA 2IOQA 3MNRP 1NHIA 1KIJA 4EMVA 3RLRA 2BU8A 3QDDA 2FWZA 3TUHA 1I5BA 1PVGA 2YE9A 2JJCA 2HKJA 3OWBA 3O0IA 4AWPA 2YKJA 4PRVA 2IORA 3B27A 1Z5CA 2YGFA 4LC1A 2BT0A 3HHUA 5FWKA 2CG9A 2HCHA 4V25A 1TC6A 4KSGA 4CWFA 1YC4A 1YT2A 4B6CA 4BIZA 2CH4A 3A0TA 2XX2A 3FT5A 1YERA 1UYHA 3DGEA 5IDMA 1I5CA 1B62A 2YEHA 4LPBA 4LP0A 1JM6A 5D6PA 2XJGA 3T10A 3CGZA 1Z5AA 3QTFA 3FV5A 2ZDXA 1B3QA 1UYCA 5M4HA 3WHAA 4ASGA 3H80A 1R62A 1YT0A 4CWNA 4CWQA 5BODA 4ASFA 3TZ0A 3BM9A 3OMUA 4XC0A 2WWWA 4GEEA 4JAVA 3ZXQA 1NHJA 2XD6A 1US7A 2CCSA 2WERA 2FXSA 2ESAA 2YKIA 4MBCA 1UYLA 2YI7A 3G7BA 5M4PA 4ASAA 1TBWA 2YEDA 3MD0A 1ZWHA 4YKWA 2WEQA 2WI1A 2XDXA 2YEFA 3PEJA 1ZXNA 2YEJA 4XTJA 3K98A 3B24A 4MP7A 3C0EA 1YSZA 4JYBA 4E01A 4ZVIA 1EI1A 4R3AA 3TTZA 2BU7A 4X9LA 4QPJA 2XJJA 3VADA 3R92A 5L3JA 4XCLA 2FWYA 2BREA 3INXA 4MP2A 1S14A 2HG1A 3RKZA 5FNCA 1YESA 1ID0A 3ZM7A 4L93A 4JASA 1UY7A
chains in the Genus database with same CATH superfamily
4CS2A 3LSSA 3CCJV 1VQMV 4LWFA 1Z5BA 1L8DA 5CTWA 2UUCO 4O09A 2E0AA 1F23A 1FYJA 4FFBB 2A3QA 3ZMVA 3FB6C 2YC0A 2K9PA 3S3WA 5LMNB 1IZ3A 2QWOB 5JJNB 2YE6A 3FYEB 5IYCO 2YJWA 4MW8A 1N33B 4GCZA 2N05A 1Q3EA 4ZOLB 4EEHA 3MAQA 1N34O 1K9MW 2XNDG 2P5OA 4LBEC 1J5EO 4FZ1A 2YEVB 4PJ0Z 1I59A 3E86A 3OMNB 4PA4A 5H6RA 2H55A 4GT1A 4P8OA 4LF7O 5BOCA 5BMVA 1VQ5V 1EA6A 4MVZA 1JMKC 1YF2A 1KZNA 3GIGA 3NMQA 4K8XA 4L94A 4EFUA 4UXNA 4BAYA 5M4EA 3EHHA 4GQTA 4JV5B 1COWG 3KKYA 1NJIW 4MSWC 4TV9A 1WP8A 2DYRB 3AK2A 4KUMA 3D36A 1HNZB 1H2SB 3OW6A 2HHHO 1AI7A 5GGZA 5JVDB 2HP8A 1XNRB 4YJ2A 1X4TA 4H33A 4JPRA 1TGOA 5A2QN 3RYFA 5BMVB 2UWDA 1QU7A 1K92A 4F6EA 3GIGB 3E22A 1LUWA 3K04A 3B28A 2QWNB 2YXYA 2CE4A 2BYIA 4JZGA 1UYDA 3CCUV 3OEEG 3GIEA 1N8RW 4GFNA 5H6QA 2IOPA 4XKAA 4YHHB 1SA0A 4YKXA 4X1IB 4XDLA 4TV9B 5J2TA 5GTHZ 4EKWA 4O4IA 1FPOA 2GTSA 1N36B 2UXXA 3OGIB 4TT3G 4HXZA 1ZWIC 1SF9A 1QHTA 3K99A 2Q9LA 4HXWA 4K3AA 4B7KA 2CUGA 2Q0OC 4DV7O 4UCUA 2YI5A 1GKZA 1S5LZ 2EINC 3CCEV 2YK2A 3ZKDA 2Z0AA 4LF6B 3H1HH 3RYFB 1VQ8V 3K08A 3ZMSA 4PA3A 3EKRA 3E22B 3OW2U 1QNMA 2WI3A 3D0BA 3B8NA 3LMMA 2RN9A 2ZQMA 2ZE8A 2Y69B 1ZL8B 1ZSPA 4NR1A 4TQFA 3A0ZA 3ZJZA 4JQLA 2GSMB 3QO8A 3BCCH 4O4IB 1XILA 1F7YA 3T1KA 2RQ6A 5DN6G 2YEBA 4JTAB 1N33O 4B3RO 1BGQA 2PNRA 2WI5A 2LFSA 5JQGA 3E83A 1Q81W 4MTXA 1M5IA 1PD3A 5IJ9A 1MABG 2GFDA 3B40A 1E79G 1YC3A 2NLJC 3TZ5A 2R72A 2YEGA 4FPPA 2XAQA 2QGNA 3JAKB 3T0HA 4JI0B 1AJ6A 4BQGA 5CTXA 2XOKG 1URFA 3A0WA 4NH9A 3UCSC 4JI4B 5LGNA 4Z2WA 3CCSV 5LA6A 5B1OA 1V54B 3KCYA 3TJTA 2YE7A 1D2DA 2YIDA 1YXBA 4DO2A 2V4DA 1YTFB 4PDRA 1MSDA 2DWEC 4CWRA 5LHGA 3R4MA 4DUZB 3W7SA 1BCCH 4UCRA 2ZCEA 2IH1C 3LDEA 4QGPA 3R91A 2YE2A 2QF6A 5EZYB 1T5EA 2B1GA 3CXHF 1CEZA 1Z59A 3W7UA 1VQOV 5EYPA 5LGTA 2B9ZA 4BXIA 4I5SA 4O2BA 1QYEA 1GH6A 1QR9A 3CX5F 4DR4O 3P32A 1K5QA 4LFCO 4CH4A 3EHJA 1VQ9V 1U2OA 4YHHO 5LMUB 2D2CB 3RLPA 4ZI7A 1BQ0A 2XDKA 4JI1B 1M4UA 1N36O 3CWBH 5D5QA 1AJNA 3ZRVA 4DR2O 5K1PA 2JEXA 1M93A 1YVWA 1GM8A 4YKZA 3SYCA 4UVAA 1B63A 3T2MA 1XMQB 1Y4UA 2PGGA 2RDCA 4RO2A 3HKBA 4LF6O 3LPSA 2QWRB 3ZHUA 1S16A 2VCJA 1YS3A 1NQTA 3M99B 4FLTA 3HYYA 1KP2A 2QM7A 2ZNIA 3R66A 3SR2C 5ITZB 4XCJA 2F66C 2WSSG 3D3QA 5B1AC 2Q7EA 3UO2A 1JA8A 4P2ZA 1YCIA 2F93B 4DV5B 1BHBA 2Y0PA 2UU9B 1IXMA 4KXRA 4ZI7B 2C1IA 4JYYA 2AHYA 4EFBA 3B25A 2ETNA 1UJWB 3OTOO 5CTUA 2PY5A 4X8AA 4EB6A 1I94B 4GKJO 2WLJA 1Z2GA 4MVOA 2HR3A 1R3IC 1U96A 1XEQA 3HKBB 1OSFA 4E02A 2K5BA 3I56V 3W7WA 2BYHA 2VRZA 3Q5KA 2P6JA 2EBOA 4WF9V 4IHJA 1UYGA 4PELA 1I08A 4J11A 2JEUA 3H1LH 4E4EA 5BR8B 3GIFA 4JI4O 1MZFA 1XBLA 1Q90D 1XREA 3WB1A 3JAMN 2LFRA 4FLXA 1BKNA 1KMIZ 2ZE5A 4QJFB 4DW0A 1Z5WA 4J10A 4WBNB 4ASUG 2IOQA 4EMVA 3L70H 2UXBB 4LF4O 4DUZO 1MOFA 1H2NA 3ZHQA 3QVNA 3T4DA 2YE9A 1WPBA 2N04A 3OWBA 1XQ8A 2E75B 4PRVA 3JASA 3OM3B 1H8EG 2F4VB 3ZEDA 3M8AA 2XAJA 4KSGA 4R8CA 4CWFA 4B3TB 4IHJB 4B6CA 2G38A 4BIZA 3SPIA 2GBOA 5KA5A 1YIJV 3A0TA 5CA1A 3FT5A 1G8MA 1K34A 4FK5C 5IDMA 1KUQA 1BS3A 1W59A 4BWAA 1B62A 2YEHA 3LSUA 4LPBA 3UQ8A 5E79Z 3CD6V 1W0KG 4Z1VA 1H38A 3T10A 4MVQA 3EXAA 3QTFA 4GX1A 4LF5O 4J9ZB 4DUYB 3B8MA 3WHAA 2QJ1A 5LP6A 1NR1A 3H80A 1TA8A 1KB9F 1SQQH 5JCOA 1HR0O 4K8ZA 3JASB 4PV1B 2Y4TA 2CTPA 1AR1B 4C7UA 3CCRV 2L6LA 3BM9A 1TUEB 3B77A 2WWWA 3LDDA 2Q8VA 3CJHA 3K5OA 3N2GA 4H37A 4P9PA 3X2QC 4LFAB 1P7GA 4MBCA 5JENA 4I55B 3G7BA 2ZIMA 5M4PA 1NU1H 1QLNA 1WJZA 2AGAA 5IYBO 4JI3O 3KZIZ 3ETGA 5LP6B 3VOUA 4UUJC 2YEFA 5EIBC 4E72A 3J7AU 3AG1B 1XHXA 2P4VA 5FLXN 3F5TA 1THZA 1BL8A 3JCUZ 3KCXA 1FJGB 1YSZA 5KAFZ 3KG2A 4HBNA 1NTMH 1LNQA 3WG7B 3RYCA 1TAEA 3CJHB 2JJ2G 3ZX6A 1EI1A 2EZPA 3VADA 4QPJA 3QF7A 4AI8A 2E3CA 3R92A 3RVYA 4J7KA 2HEPA 4X89A 1HP8A 3INXA 5FNCA 4X66O 1P49A 3SJQC 4JASA 1S3JA 3PEHA 2EIJC 2UXBO 1YC1A 4X20B 2WLKA 4MPNA 2WI6A 4AS9A 1OCCC 1IXBA 3R4NA 3SPJA 3K97A 1K8AW 4NKGB 1MX0A 1H7UA 1AH8A 4RWUA 4JYAB 1OCZB 2UXCO 1R6NA 4R50A 4KTNA 2RNBA 3RYCB 2UUCB 5L3BA 1NH2D 4OGQB 5F3KA 1OCOC 1WA8B 1Y4MA 4DRXA 5CA0B 2OCCB 1FXHA 1VF6A 5JH7A 3BEHA 2CTQA 1NR7A 4CH5A 4BAEA 1OCRC 2P06A 2HLDG 4X1YA 1XDCA 4FLUA 2Z3YA 4LH7A 1RM1C 3JAWA 1DTOA 3HZ1A 1I58A 1B04A 4LNUA 4CWPA 5B3SC 3OPDA 4W7TA 3IEDA 1FXKC 1JFFA 1NTZH 3OUSA 4OX9O 1JVMA 5KUMA 1CP9A 3A0RA 2WLMA 4JAUA 4LWIA 4RUEA 4UROA 3RYIA 5E1AC 4X9QA 1O9HA 1K73W 1YI2V 3DSQA 1S72V 2KG7A 3U0ZA 4YIPA 3FB5C 2WLHA 2CGNA 4EFTA 4X1YB 2YJXA 1AJPA 1K4CC 4CE3A 3LNUA 4DUHA 1VIBA 3G7EA 1FXVA 3JALB 4UCSA 1S5JA 1U97A 2DE0X 2DJVA 1TUBA 3OUFA 1Y76B 3C11A 3QG5A 2HHHB 3L74H 3T1HO 2E76B 5EC2C 3ZRXA 1JFFB 5KHIA 3SJBC 1Y8OA 2V7QG 1D5AA 4WFEA 1Y66A 2BSKA 2YE4A 4YKRA 4LF8O 4W4KA 1G4YB 3RYIB 2BRCA 4BQJA 2QWPB 4PA6A 2O1UA 2CGFA 3H4LA 1TILA 3HEKA 2ZKJA 1YT1A 5FPRA 5DM6V 1E1QG 2QE7G 2QA4V 4LCUC 1N4CA 2IU0A 2X6BA 1HWYA 4MVSA 2YKEA 2OIGA 5HFMA 2EILC 2RJZA 3BPZA 3TGUH 2YXHA 4PA7A 3CGYA 3WQ9A 5CTYA 2M7WA 1DF5A 1U0ZA 2MW2B 2YXLA 1TUBB 4L90A 4XITA 5DECA 5KLVH 1I5YA 2N74A 4DV7B 5LXTA 1FS0G 4IIJB 3APOA 4FZ0A 2EIKC 4JI7O 2BU6A 1NI8A 2BSKB 2K1EA 1BT8A 1AI5A 4JYAO 2H94A 1HNWO 2IWXA 3HKDB 1I5DA 4WFHA 1S77D 2CCUA 3CCVV 4CS4A 4DV3O 5C93A 2YS8A 4HNAA 3K3WA 4B3SO 5LL6Y 3K9AA 2HHIA 2ZBKB 4JI2O 1MMMA 1R73A 3TK1A 4KL1A 5GONA 3ZIAG 4LF9O 1PM9A 4B3RB 4DR1O 4TUYB 1R3KC 3T1CA 3A0YA 5L3GA 4H81A 2YKCA 1ZUQA 3OFNG 4DR6B 4IT5A 3RT3C 5LXTB 5JVDA 1M1KW 1EFRG 2X6AA 4H7QA 1L1FA 3BABA 3OE7G 1YSRA 3CCQV 2PUSA 3RGBA 1SRYA 2LP7A 5KHJA 4MOTA 1PL0A 3ASNC 1IBLO 1QZRA 4HZ5A 4HNAB 4V26A 1Z5VA 3QO5A 1EM1A 5KHKA 4X1IA 3CRAA 1AVMA 2NNUA 2EXLA 3WFVA 5GONB 4K4OA 2JRIA 2AZ0A 1AH6A 2DYRC 4GT8A 1Q7YW 4PDMA 4JI8O 5EBMC 4YKQA 2FYPA 1Y8PA 4I4TB 4NTYA 5IWAO 1H2KA 1UYEA 2O1WA 1KKCA 2Q5ZA 4ZKIA 3TZ2A 2IWSA 4ZIBA 5IT9N 4DR4B 2ADQB 4X1KA 4LFCB 3FFQA 4JF3A 1ZL8A 1IX9A 1SQPH 1ZW9A 1UYMA 2H8MA 1GM9A 3L71H 5HFLA 4PDVA 2CK3G 3D3IA 2FL4A 5IYZA 4DR2B 1V9PA 4QPKA 2DQ0A 1PV0A 3D36C 3DXRB 1FFXA 3SDLA 3J80N 3E8BA 4N21A 4URLA 3ZRWA 4IGGA 2JDIG 3C3SA 5FNFA 2AZ2A 5J9PC 1BSMA 1Q6IA 1RSOA 4LP8A 1YSCA 2XX4A 4LWGA 3JAKA 1L0NH 3GVMA 1B06A 2RCVA 4CH6A 4DZYA 3ABMB 4E00A 5D6QA 1ZTEA 1GN4A 4X1KB 3VHAA 2YE3A 5EBWC 2FMLA 5B1NA 1OJHA 2Y69C 2F23A 4YKYA 1Q6UA 4N23A 3N2KB 1MU5A 3CRQA 5M4KA 1XL4A 5H2FZ 5IYZB 2R70A 3OTOB 3JZ3A 4RUFA 1SERA 1FFXB 2IWUA 4DR6O 3CHXA 4O0BA 3ZRWB 3ABKB 4GKJB 1RSOB 5EZYA 4J80A 2HVKC 3VQVA 2V1DA 4DV6O 1D5NA 2UXNA 1KBHA 4JI6O 2XHTA 3D2RA 2E5LB 1GK9A 4WFGA 4XDMA 4B7EA 5IE9A 1Q82W 2WA3A 3MNRP 2Q68A 1NHIA 1KIJA 2W6JG 1EN4A 2BU8A 3OMAB 3ETEA 1V54C 3VQYA 4AWPA 2UUBO 5BY1A 1JJ2U 5AG2A 3B27A 1US6A 4H44B 5F2VO 2BT0A 3HHUA 4YIOA 4LF4B 2CG9A 2HCHA 4TV8B 1TC6A 2IU3A 1PP9H 1YDXA 3Q4HA 1YC4A 2HFEC 3IAYA 2YIAA 1H2MA 2GTAA 3OAAG 4AHCA 2ITCC 3K57A 5LYJB 2BOBC 2YI8A 3IFXA 3THOA 4DV2B 5H5NA 4MS2A 4LWSA 1Y67A 4LP0A 3O65A 2P7TC 5ITZA 2RMKB 3SYPA 4GKKO 1Z5AA 2ZKOA 5LHIA 1NH2B 2QR4A 4O2AA 1Q86W 2HG5C 4EEQA 4ASGA 3L75H 3B09A 2XASA 1K3EA 1GO3F 1ZX3A 3H1JH 1R62A 4LF5B 4ASFA 3TZ0A 1XUQA 3OMUA 4XC0A 1M57B 2EJ7A 3Q4HB 1WN7A 4JTCB 4I9QA 4GEEA 3RFRA 4JAVA 1AB3A 2OCHA 1HR0B 1DGSA 3FB7C 4DV0O 1US7A 4JGSA 2WERA 3H1IH 2ZXWC 2EZOA 5KUKA 4LWSB 2ESAA 2YKIA 3PN1A 3WB0A 1X59A 1NVPD 1TBWA 2YEDA 4X64O 4YKWA 4J7ZA 4O2AB 1XL6A 1NT2B 2IJKA 3E2EA 1K33A 4L8JA 2XDXA 5JJJB 2EJRA 4DV1O 1ZXNA 5L3EA 3HKCA 3IC7A 4WBNA 3K98A 3B24A 1EZJA 4AILC 3UM7A 4MP7A 1MSWD 3C0EA 4JI3B 3W7TA 3RWRD 1GAXA 3AG2C 1XI1A 1KD1W 1QLEC 4E01A 1Q43A 1YHQV 5BXZA 5A9GA 4R3AA 3TTZA 2BU7A 4XBFA 2IH3C 3SPCA 3WB2A 1E1RG 4DXWA 2FWYA 3SYOA 2BREA 3HKEA 1S14A 3RKZA 2E5LO 2UXDO 1ID0A 1A32A 1XHZA 3OD4A 4EGKA 3CSXA 4R3MA 4OPAA 3JCZA 5C8YB 5CBGA 1Y8NA 4BW9A 2X7RB 5B5EZ 1AROP 3HKCB 2Q6AA 4X66B 2OTLV 2Q73A 3K0GA 4FCRA 2JK5C 2AHZA 3INWA 1M56B 3PJSK 4L8ZA 5CN0A 2Q2EB 2FKXA 4ASBA 2OTJV 2QWQB 4KQVA 3Q5JA 4XD8A 3ZRSA 4PRXA 4Q20A 5IYDO 1K97A 1SESA 4DV2O 1BQZA 1FFTB 2UXCB 4KFGA 4I50B 2ZT9B 4DV4B 4WUDA 4QE9A 2WI2A 3HKEB 3STZC 3OWDA 2O1VA 2QKCA 3CWVA 1YEWA 2EIMC 5J2UB 5IN9A 2YUAA 3IJ4A 2YIBD 1P7BA 1B6QA 3CYGA 1SQBH 4KFMA 5IJ0A 2WA4A 3JSLA 3QTCA 1H2GA 3CC2V 5D7DA 2BE3A 4I55A 4CC5A 1TIDA 1TVKA 3VHDA 1XMOB 4L91A 2H3OA 1FKAO 4O04A 2A7WA 4GLXA 2XCMA 1V55B 1F51A 2PZSA 3U2KA 1N32B 4OX9B 1UY8A 4GGLA 1YJNV 1YETA 3NR7A 2WEPA 1NS1A 1RP3B 2BU5A 4HY1A 1JR9A 1BXDA 2R9RB 4YY3B 2IM9A 2AKPA 3AK3A 4O05A 1UFIA 3EHBB 3WU2Z 3BVOA 3BAAA 2VQEO 5IJ0B 4FCQA 4AQYB 1FD9A 2P22C 4I0XA 1TVKB 1R1BA 3ASOC 3EHFA 1XNQO 4OPHA 3GWOA 4DW1A 3GB7C 1SS3A 2ZDIA 3T1HB 4RQEA 2Y0IA 4EGHA 1QBZA 2LW7A 4X20A 4LFBB 2QG2A 4FVMA 1OV9A 5LP6C 5M4NA 1RFYA 2YGEA 4LF8B 1UY6A 4FM1A 3HPLC 3AG1C 5JCOC 2Q8HA 4HY6A 5B1BB 4D7TA 3QO7A 1UYKA 1DF4A 3JD4A 1WA8A 2OIEA 5CA0A 1UY9A 4I3HA 2ZM6O 2YEIA 1R3LC 3S3XA 5JWPA 4Z1MG 4CWOA 3MDSA 2HKOA 1GTOA 1VP7A 1AJQA 4I0XB 3U2DA 1LR1A 2DWDC 1CXZB 1N0NA 4GYCB 4BR6A 3ZN1A 2Z5UA 3ETQA 2YK9A 4JI5O 4LH6A 1BGYH 2FTKA 1KYOF 4WCEV 1M90W 2VWCA 4HYPA 4JI7B 3VHCA 3SJCC 3T1YB 3C3TA 4NXNO 1L0LH 1R6KA 3AG7A 3OT7A 4FMTA 4DV4O 1HNWB 2PYJA 1OCZC 5CB4A 2QKSA 4X88A 2OYQA 3R4PA 4DV3B 4R1FA 3ZMUA 1OCCB 2DYSB 1JPXA 2ZE7A 5FNVA 4WUBA 4B3SB 4FCPA 2OCCC 1SQFA 3DC5A 3JATB 2FB5A 1GN2A 4JI2B 4GX2A 3H01A 3JALA 4LF9B 2VWJA 3K60A 4DR1B 1XMOO 3T0ZA 3ZHSA 3UT5B 1Y76A 1J95A 1PNLA 1KECA 1IBMO 2WI7A 4MTFA 1N32O 2XX5A 5EK0A 2ZR2A 4O4HB 4TQDA 5EBLC 4CE2A 4FLVA 1QCEA 1UYIA 5KX5A 1WB8A 5CB4B 3EHGA 4YY3O 3BY6A 3U10A 1IBKB 1FXKB 4CWSA 4JZ2A 3RYHB 1IBLB 5FNVB 2A79B 1VF6C 4G2KA 5LOVB 3ML0A 3HYZA 4I9WA 4AQYO 2XABA 4XDJA 1ROPA 5M4MA 2BTZA 2YI0A 4HZ0A 5FPOA 3QNEA 2XDSA 4JI8B 3K06A 3LNNA 4DR7O 3AG4C 1SETA 4MB9A 1QY8A 1VQ4V 3JARA 4IIJA 5IWAB 4LFBO 4PL9A 4J42A 3ABLC 3CS5A 5CBHA 1PNMA 1Y74B 2OT5A 3KE6A 3ZKBA 4X62B 3BFRA 3P30A 1PL4A 1JOYA 3AG3C 5H9CA 4U3JA 5KX5B 1YJWV 4B3MB 4O07A 3HKDA 4XE2A 2YE5A 3G80A 3E8HA 1AILA 1ZXMA 3K58A 3ZCCA 1PPJH 4EGIA 3CRLA 3CB2A 4GUNA 2CTWA 3MHHC 1IURA 2XJXA 1W2BU 1MNGA 2CTRA 4BIOA 1AR4A 2KKWA 2PF4E 1BYQA 4XKOA 4TUYA 2R9IA 3ZMTA 3ZHTA 4MTOA 5GTIZ 5D7RA 5KAIZ 3JARB 3SJAC 2A9HA 5J6AA 1SKVA 3CXCU 2EILB 1K7DA 3FYIB 4KSHA 3T1YO 1HW7A 4HYOA 3RN4A 4DR5B 3Q5LA 4U3JB 2ZDYA 4MT8A 3NXSA 4UCTA 4JTDB 3K79A 4JYCA 5IY5B 4AWQA 3CMAV 1S0VA 1NVPB 1HNXB 4O4JB 5KHGA 4FJCC 4NVPA 4UCVA 1I5XA 2LGQA 2QEXV 4U3FH 3CC4V 2Q7HA 4D7SA 2YECA 2VCIA 3ZXOA 5L3DA 2VW5A 4YKTA 4I4TA 4NH7A 3RLRA 2CGOA 3TUHA 4DV6B 1I5BA 1PVGA 4JI6B 2NR5A 2Q69A 3K03A 2HKJA 2QDOA 1ORQC 2IORA 2XHBA 3L72H 1IBKO 4LC1A 4H0LB 4J7JA 4TSFG 5FWKA 4V25A 4NTWA 2R9AA 3LDCA 2CH4A 2UUBB 3OEHG 2XX2A 2YIBA 1RPOA 1YERA 1UYHA 3DGEA 4NXMO 2WLIA 4FIPC 3F7VC 3ASNB 3FB8C 3DXRA 3LSQA 1JM6A 3ZHVA 5D6PA 2XJGA 4DR3B 3T4ZA 1LUVA 3FV5A 3CE2A 2D3OW 2IBZH 2ZDXA 2VWKA 1B3QA 4X62O 1KP3A 3DTUB 2Q67A 4KHPB 4MVRA 4J41A 2F95B 1R3JC 5EIBD 1P84F 3EFFK 2A06H 1GRJA 4B3MO 4UB8Z 1IVSA 4GKKB 1YT0A 5BZBA 2YICA 4CWNA 4CWQA 5BODA 2P90A 3FAVA 1WP7A 1AP5A 2JVDA 3ZXQA 3TXQA 3N2KA 1NHJA 2WLIB 2ZR3A 4F6RA 2LGWA 1PNKA 5KA6A 4UV8A 5JJEB 2E74B 3TXSA 4WFAV 4HZ3A 1EN6A 1UYLA 3FX7A 4ASAA 2VS0A 1QQCA 1ZWHA 4O4LA 4DV0B 2JS3A 3SYAA 4IYHA 1HDJA 4TWKA 4DR5O 3B2EE 3BA9A 1BE3H 2BTOA 2PTMA 3PEJA 2YEJA 5K1XA 1Q8IA 4PD4F 4X64B 5L3FA 3ABMC 3A0BZ 2EINB 4GX0A 4YJ2B 2Q4PA 3FAVB 2QKAA 4HAMA 1HNXO 3I55V 1H8HG 3B4SA 3CRRA 4DV1B 3MHSC 4X9LA 1F4NA 3GWKC 4XDKA 4K0KB 4F6RB 1BMFG 4TV8A 3ZMZA 2W0FC 3J81N 3AEIA 1EZVH 3FKSG 1UY7A 4O4LB 5LYJA 5CPHA 5LMNO 4H13B 1SA0B 3ABKC 1VQLV 4UCOA 5J2TB 3U11A 4YKUA 2WLNA 4X65B 2Q0AA 2UXDB 4YJ3A 1AR5A 4W4LA 3P3PA 3EVKA 2LJ2A 2XDLA 3L9DA 2F1MA 3FT8A 4B7PA 1VQ6V 1KQSU 2BU2A 2GUZA 1H7SA 3SPGA 2XDUA 3N27A 2MK3A 3APQA 3A0HZ 3K5LA 3JYCA 3O9OA 3OR7C 1VMGA 4NTXA 4R7CA 4ZBMA 3C90A 2XHXA 2HJDA 4CE1A 5J71A 3OMIB 2W6IG 3CYOA 3E8FA 1WPXA 4JV5O 1W0JG 4DR3O 1WAZA 4QE7A 4WFBV 4DK0A 3CPWU 2X6CA 1TH8A 1Q5OA 2JKIA 4CH3A 3O6OA 2ZIOA 3AK1A 4PU9A 2GV9A 2BTQA 4KHPO 1A4HA 2ATKC 3R4OA 3BA8A 2YEAA 4FFKA 4YJ3B 1F4MA 5JQGB 1HNZO 3EKOA 4MW3A 1MZEA 2Q8GA 5IJ9B 1VARA 1XNRO 4DYLA 1EN5A 2GUZB 1P4RA 4JAAA 4PI0A 3ABTA 3H9VA 4XKKA 2BOCC 4Q6GA 4P7AA 1SZXA 4PA9A 5FL7G 4HYMA 4QNHB 1THNA 2B5UA 4PDLA 3U67A 3LUTB 2P4KA 4J9YB 5LA6B 1M57C 4BIUA 3CCLV 1I0HA 4LR3A 3S5TA 3JD1A 4P9OA 2BTQB 4GX5A 3R65A 1GJVA 1Y4SA 2IJHA 1NBMG 1S76D 2VQEB 1N0JA 2XTAA 4IL6Z 1RPRA 5DEDA 3OR6C 5C8YA 4LWHA 2UUAB 3K9SA 2ARHA 2ZXWB 3RBZA 3O2FA 5EYPB 1MA1A 1XNQB 4K0KO 4F4LA 5B1AB 1I5AA 4O2BB 1S5HC 3K59A 3ZHRA 2GHYA 1UYFA 3JD0A 4XIRA 4I7ZB 3FD9A 4FM2A 2LW1A 5LHHA 2Q8FA 2PI5A 2L35A 1YZBA 2M6YA 3ICXA 4I50A 5CBFA 4MPEA 3HB3B 4DK1A 2F43G 4X65O 2BZ5A 3AG2B 4L87A 1QLEB 4R6ZA 4P30A 2ZM6B 3UO3A 1UPGA 5J2UA 2ODMA 4CS3A 1H2LA 1R6TA 3CEIA 3G6EV 4MPCA 2XAHA 2YE8A 3IGAC 3G75A 3TZ4A 3B26A 1WNSA 4JI0O 5KMGA 1WLEA 1MG1A 1KKDA 3RLQA 2EULA 3G67A 4JI5B 4WFFA 2QSAA 1M56C 1DK1A 1GKFA 1G6UA 3CRMA 5D7CA 4NXNB 1BZKA 3F7YC 2YKBA 3D8CA 1G1XB 1AMWA 4UV9A 3CRCA 2Q8IA 3VQWA 2QG0A 2GDSA 1VEWA 2C2AA 1ENVA 4EB6B 2YI6A 4AWOA 2ZE6A 2NN4A 3K0DA 5IDJA 5KMGB 4A5UB 5F5RA 2CCTA 4UFZA 2EIMB 2OWOA 1IBMB 5D5PA 3SYQA 1V55C 2DN9A 4MVMA 2ILMA 2IW5A 2XT9A 2P67A 1QVGU 5FNDA 4UB6Z 5LMUO 1AI4A 1SQGA 1PKXA 1NTKH 2YEEA 1VF7A 3T2SA 4JI1O 2BSMA 2JGUA 3P3NA 4U7NA 2Q7GA 2WAMA 2WPDG 2QM8A 2YGAA 2QFOA 4U93A 4KP4A 2O57A 4MTGA 1AM1A 4CC6A 2UUAO 1SC5B 1XMQO 1K4DC 4CZZA 4ABMA 2XK2A 2Y4UA 4U7OA 4WUCA 1I7FA 4NYKA 3CC7V 4DR7B 3CRKA 1VQKV 2XHRA 4H85A 4EFEA 5GW7A 5KHHA 3X2QB 5CA1B 4E2LA 5B66Z 1VQPV 3K5MA 1O9GA 3A0XA 3SPHA 3VQXA 3CMEV 4DV5O 4K35A 2UU9O 3ASOB 4URMA 4FLZA 2Y48A 2VQFB 1GMGA 2H8PC 4XIQA 3E35A 5EC1C 4NH8A 4TOIA 4UVBA 1AI6A 3LNMB 4FM0A 1FAFA 3TETA 3WG7C 5B1BC 2WI4A 1L0OA 3W7XA 2GQPA 3CCMV 3M7MX 4RAIA 1JCHA 1I94O 4L93A 3JATA 3BMYA 3SL2A 1QVFU 1SQXH 5CF0A 1YJ9V 1TC0A 1GKXA 3K5NA 2AW9A 1KU9A 2FYUH 4CWTA 4ICGA 1ZLZA 3UT5A 3HZ5A 4URNA 4XIPA 4EM7A 4QIWF 1NHHA 5LBQA 3BRCA 4YXWG 3N2GB 5BR8O 2ZDIC 3OGCC 4G28B 1YITV 4IYIA 2AXTZ 1YTFD 2PYLA 1ZAUA 2CH7A 2KSDA 2LO1A 4O4HA 1WB7A 3JD3A 4CBCA 5L3CA 2EIJB 2DMXA 2ITDC 1FXKA 1XOUA 3RYHA 5CA3A 4UVCA 3SGIA 3RVZA 3OTFA 4RQFA 3STLC 2DYSC 2IJIA 3CP1A 5LOVA 3RW0A 3BHPA 2CDYA 2X0LA 3ZN0A 4LWEA 1EBOA 2DW4A 2F4VO 1OCOB 3QDDA 1KC8W 3G71V 2FWZA 2DOSA 4MVUA 4ZHQA 4B3TO 1NKDA 2JJCA 1AP6A 1SQVH 3F5WC 2XAFA 3O0IA 2C1GA 2YKJA 1GM7A 2EX3A 4PI2A 5LGUA 1OCRB 1Z5CA 3E8GA 4FLWA 2YGFA 3ZS8C 2HJFC 1Y74A 3UKMA 2CH7B 5TISZ 1RM1B 2QM4A 1YT2A 4PHZA 2BCCH 1IDSA 2ZINA 2ZNJA 5B3SB 1N34B 1VF5B 4DUYO 1QR8A 1I5CA 2KQXA 1J5EB 2XUMA 4B08A 3A8TA 1VQ7V 2PI4A 1GN3A 2DQ3A 3CGZA 2WLLA 4LF7B 4NXMB 1K5SA 1JX9A 3G4SV 1UYCA 5M4HA 4ZHQB 3HR0A 3A2FA 4DRXB 1Y6XA 2JGDA 2CAZC 3TCUA 5JH7B 3ETDA 1NZ6A 2JIZG 2LQTA 4LFAO 2IJJA 2B1IA 3DC6A 1CPYA 4FLYA 3IC9A 1Q6HA 2VQFO 3H1KH 3JAWB 3AG4B 2XD6A 1DLBA 4GZRB 2KB1A 1OZ0A 2JS5A 4LNUB 2CCSA 3ABLB 2ADPA 2YSUB 5CMUA 2FXSA 2YI9A 1VQNV 1SZTA 4BW5A 2YI7A 3I5DA 4O4JA 2WLLB 3AG3B 2QTSA 3MD0A 1JJOA 1GN6A 3E89A 1FJGO 3L73H 4OXSA 1BHAA 2WEQA 2WI1A 2A0LA 2ZD9A 1OHHG 2JGDB 3VBBA 4FFBA 4XTJA 2KG7B 3JD2A 2QTOA 2XAGA 3JSNA 3G6BA 4JYBA 4G27B 2JJ1G 4ZVIA 2HVJC 2XJJA 4ZOLA 5L3JA 3ABUA 2EIKB 4XCLA 1JQ0A 3ZBHA 4MP2A 4NB5A 2YEVA 5IY5C 2HG1A 2YDEA 2W0XA 1YESA 3ZM7A 4D6TH 1M9NA
chains in the Genus database with same CATH topology
3LSSA 3CCJV 1VQMV 4LWFA 1Z5BA 5CTWA 4O09A 2E0AA 1F23A 3ZMVA 3FB6C 2YE6A 3FYEB 5IYCO 2YJWA 4MW8A 4GCZA 4EEHA 1K9MW 2XNDG 4LBEC 2YEVB 1I59A 3E86A 3OMNB 4PA4A 5H6RA 2H55A 4GT1A 4P8OA 5BOCA 1VQ5V 1EA6A 4MVZA 1KZNA 3GIGA 3NMQA 4L94A 4EFUA 4UXNA 4BAYA 5M4EA 3EHHA 4GQTA 1COWG 1NJIW 4MSWC 2DYRB 4KUMA 3D36A 3OW6A 1AI7A 5GGZA 4H33A 4JPRA 2UWDA 1K92A 3GIGB 3K04A 3B28A 2BYIA 1UYDA 3CCUV 3OEEG 3GIEA 1N8RW 4GFNA 5H6QA 2IOPA 4XKAA 4YKXA 4XDLA 4EKWA 2UXXA 4TT3G 4HXZA 1ZWIC 3K99A 4HXWA 2YI5A 1GKZA 2EINC 3CCEV 2YK2A 3ZKDA 1VQ8V 3K08A 3ZMSA 4PA3A 3EKRA 3OW2U 2WI3A 3D0BA 3B8NA 2ZQMA 2Y69B 3A0ZA 3ZJZA 4JQLA 2GSMB 3QO8A 3T1KA 5DN6G 2YEBA 4JTAB 2WI5A 1BGQA 2PNRA 2LFSA 3E83A 1Q81W 4MTXA 1PD3A 1MABG 2GFDA 1E79G 1YC3A 2NLJC 3TZ5A 2YEGA 4FPPA 2XAQA 3T0HA 1AJ6A 4BQGA 5CTXA 2XOKG 3A0WA 4NH9A 5LGNA 3CCSV 5B1OA 1V54B 2YE7A 4DO2A 1YTFB 4PDRA 2DWEC 4CWRA 5LHGA 3R4MA 3W7SA 2IH1C 3LDEA 3R91A 2YE2A 2QF6A 2B1GA 1CEZA 1Z59A 3W7UA 1VQOV 5LGTA 4BXIA 4I5SA 1QYEA 1QR9A 3P32A 1K5QA 3EHJA 1VQ9V 1U2OA 3RLPA 2XDKA 1AJNA 3ZRVA 2JEXA 1GM8A 4YKZA 3SYCA 4UVAA 1B63A 3T2MA 1Y4UA 4RO2A 3LPSA 1S16A 2VCJA 1YS3A 1NQTA 3M99B 3HYYA 1KP2A 2QM7A 4XCJA 2WSSG 5B1AC 4P2ZA 1BHBA 1IXMA 2AHYA 3B25A 1UJWB 5CTUA 4X8AA 2WLJA 4MVOA 2HR3A 1R3IC 1OSFA 4E02A 2K5BA 3I56V 3W7WA 2BYHA 3Q5KA 2P6JA 2EBOA 4WF9V 1UYGA 4PELA 2JEUA 3GIFA 2LFRA 1BKNA 4QJFB 4ASUG 2IOQA 4EMVA 1MOFA 3T4DA 2YE9A 3OWBA 4PRVA 3OM3B 1H8EG 2XAJA 4KSGA 4R8CA 4CWFA 4B6CA 4BIZA 3SPIA 5KA5A 3A0TA 1YIJV 3FT5A 1G8MA 1K34A 4FK5C 5IDMA 1B62A 2YEHA 4LPBA 3CD6V 1W0KG 1H38A 3T10A 4MVQA 3QTFA 4GX1A 4J9ZB 3B8MA 3WHAA 1NR1A 3H80A 1AR1B 3CCRV 3BM9A 1TUEB 3B77A 2WWWA 3LDDA 4H37A 4P9PA 3X2QC 4MBCA 3G7BA 5M4PA 1QLNA 5IYBO 3ETGA 3VOUA 4UUJC 2YEFA 3AG1B 1THZA 1BL8A 1YSZA 3KG2A 1LNQA 3WG7B 2JJ2G 1EI1A 2EZPA 3VADA 4QPJA 3R92A 3RVYA 4X89A 3INXA 5FNCA 3SJQC 4JASA 1S3JA 3PEHA 2EIJC 1YC1A 2WLKA 4MPNA 2WI6A 4AS9A 1OCCC 3R4NA 3SPJA 3K97A 1K8AW 1MX0A 1H7UA 1AH8A 1OCZB 1R6NA 4R50A 4KTNA 5L3BA 1NH2D 5F3KA 1OCOC 1Y4MA 2OCCB 1FXHA 3BEHA 1NR7A 4BAEA 1OCRC 2HLDG 2Z3YA 1RM1C 1DTOA 3HZ1A 1I58A 4CWPA 5B3SC 3OPDA 4W7TA 3IEDA 1FXKC 3OUSA 1JVMA 5KUMA 1CP9A 3A0RA 2WLMA 4JAUA 4LWIA 4RUEA 4UROA 5E1AC 1K73W 1YI2V 1S72V 3FB5C 2WLHA 4EFTA 2YJXA 1AJPA 1K4CC 4CE3A 3LNUA 4DUHA 3G7EA 1FXVA 3OUFA 3C11A 5EC2C 3ZRXA 1Y8OA 2V7QG 4WFEA 1Y66A 2YE4A 4YKRA 1G4YB 2BRCA 4BQJA 4PA6A 2O1UA 2CGFA 3H4LA 1TILA 3HEKA 2ZKJA 1YT1A 5DM6V 1E1QG 2QE7G 2QA4V 4LCUC 2IU0A 2X6BA 1HWYA 4MVSA 2YKEA 5HFMA 2EILC 4PA7A 3CGYA 3WQ9A 5CTYA 2M7WA 1DF5A 1U0ZA 4L90A 4XITA 1I5YA 1FS0G 2EIKC 2BU6A 2K1EA 1AI5A 2H94A 2IWXA 1I5DA 4WFHA 1S77D 2CCUA 3CCVV 5C93A 3K3WA 3K9AA 2ZBKB 1R73A 3TK1A 3ZIAG 3A0YA 4H81A 1R3KC 3T1CA 5L3GA 2YKCA 3OFNG 1M1KW 1EFRG 2X6AA 4H7QA 1L1FA 3OE7G 1YSRA 3CCQV 1SRYA 2LP7A 4MOTA 1PL0A 3ASNC 1QZRA 4HZ5A 4V26A 3QO5A 2NNUA 2EXLA 3WFVA 4K4OA 1AH6A 4GT8A 2DYRC 1Q7YW 4PDMA 5EBMC 4YKQA 2FYPA 1Y8PA 1UYEA 2O1WA 4ZKIA 3TZ2A 2IWSA 4JF3A 2H8MA 1ZW9A 1UYMA 1GM9A 5HFLA 4PDVA 2CK3G 3D3IA 4QPKA 2DQ0A 3E8BA 4N21A 4URLA 3ZRWA 2JDIG 5FNFA 5J9PC 4LP8A 1YSCA 2XX4A 4LWGA 4DZYA 3ABMB 4E00A 5D6QA 3VHAA 2YE3A 5EBWC 5B1NA 2Y69C 4YKYA 4N23A 1MU5A 5M4KA 1XL4A 3JZ3A 4RUFA 1SERA 2IWUA 4O0BA 3ZRWB 3ABKB 2HVKC 2V1DA 2UXNA 2XHTA 3D2RA 1GK9A 4WFGA 4XDMA 1Q82W 3MNRP 2Q68A 1NHIA 1KIJA 2W6JG 2BU8A 3OMAB 3ETEA 1V54C 4AWPA 1JJ2U 3B27A 2BT0A 3HHUA 2CG9A 2HCHA 1TC6A 2IU3A 1YC4A 2HFEC 3OAAG 2ITCC 2BOBC 3IFXA 4MS2A 4LP0A 2P7TC 3SYPA 1Z5AA 5LHIA 1NH2B 1Q86W 2HG5C 4ASGA 2XASA 1K3EA 1GO3F 1R62A 4ASFA 3TZ0A 3OMUA 4XC0A 1M57B 4JTCB 4GEEA 4JAVA 3FB7C 1US7A 4JGSA 2WERA 2ZXWC 2EZOA 5KUKA 2ESAA 2YKIA 1NVPD 1TBWA 2YEDA 4YKWA 1XL6A 2IJKA 3E2EA 1K33A 2XDXA 2EJRA 1ZXNA 5L3EA 3IC7A 3K98A 3B24A 1EZJA 3UM7A 4MP7A 1MSWD 3C0EA 3W7TA 3AG2C 1KD1W 1QLEC 4E01A 1YHQV 4R3AA 3TTZA 2BU7A 4XBFA 2IH3C 3SPCA 1E1RG 4DXWA 2FWYA 3SYOA 2BREA 1S14A 3RKZA 1ID0A 4EGKA 4R3MA 3JCZA 5CBGA 1Y8NA 2X7RB 1AROP 2Q6AA 2OTLV 3K0GA 4FCRA 2JK5C 2AHZA 3INWA 1M56B 3PJSK 4L8ZA 5CN0A 2Q2EB 4ASBA 2OTJV 4KQVA 3Q5JA 4XD8A 3ZRSA 4PRXA 4Q20A 5IYDO 1K97A 1SESA 4KFGA 1FFTB 4WUDA 4QE9A 2WI2A 3STZC 3OWDA 2O1VA 3CWVA 2EIMC 5IN9A 1P7BA 1B6QA 4KFMA 1H2GA 3CC2V 5D7DA 1TIDA 3VHDA 4L91A 4O04A 2XCMA 1V55B 1F51A 3U2KA 1UY8A 4GGLA 1YJNV 1YETA 2WEPA 2BU5A 4HY1A 1BXDA 2R9RB 2AKPA 4O05A 3EHBB 4FCQA 3ASOC 3EHFA 3GWOA 3GB7C 2ZDIA 4RQEA 4EGHA 1QBZA 2QG2A 5M4NA 2YGEA 1UY6A 3HPLC 3AG1C 2Q8HA 4HY6A 5B1BB 3QO7A 1UYKA 1DF4A 3JD4A 1UY9A 4I3HA 2YEIA 1R3LC 4Z1MG 4CWOA 2HKOA 1GTOA 1AJQA 3U2DA 2DWDC 3ZN1A 2Z5UA 2YK9A 2FTKA 4WCEV 1M90W 2VWCA 4HYPA 3VHCA 1R6KA 4FMTA 1OCZC 2QKSA 4X88A 3R4PA 4R1FA 3ZMUA 1OCCB 2DYSB 1JPXA 4WUBA 4FCPA 2OCCC 4GX2A 3H01A 3K60A 3T0ZA 1J95A 1PNLA 1KECA 2WI7A 4MTFA 2XX5A 5EK0A 2ZR2A 5EBLC 4CE2A 1QCEA 1UYIA 3EHGA 3BY6A 1FXKB 4CWSA 2A79B 4G2KA 3ML0A 3HYZA 4I9WA 2XABA 4XDJA 1ROPA 5M4MA 2BTZA 2YI0A 4HZ0A 3QNEA 2XDSA 3K06A 3AG4C 1SETA 4MB9A 1QY8A 1VQ4V 4PL9A 3ABLC 5CBHA 1PNMA 2OT5A 3KE6A 3ZKBA 3P30A 1JOYA 3AG3C 5H9CA 1YJWV 4O07A 4XE2A 2YE5A 3E8HA 1ZXMA 3ZCCA 4EGIA 3CRLA 3MHHC 2XJXA 1W2BU 1BYQA 4XKOA 2R9IA 3ZMTA 4MTOA 5D7RA 2A9HA 5J6AA 3CXCU 2EILB 1K7DA 3FYIB 4KSHA 4HYOA 3Q5LA 2ZDYA 4MT8A 3NXSA 4JTDB 3K79A 4JYCA 5IY5B 4AWQA 3CMAV 1S0VA 1NVPB 4FJCC 1I5XA 2QEXV 3CC4V 2YECA 2VCIA 3ZXOA 5L3DA 2VW5A 4YKTA 4NH7A 3RLRA 3TUHA 1I5BA 1PVGA 2Q69A 3K03A 2HKJA 1ORQC 2IORA 4LC1A 5FWKA 4TSFG 4V25A 3LDCA 2CH4A 3OEHG 2XX2A 1RPOA 1YERA 1UYHA 3DGEA 2WLIA 4FIPC 3F7VC 3ASNB 3FB8C 3LSQA 1JM6A 5D6PA 2XJGA 3T4ZA 3FV5A 2D3OW 2ZDXA 1B3QA 1KP3A 3DTUB 2Q67A 4MVRA 3EFFK 1R3JC 1YT0A 5BZBA 4CWNA 4CWQA 5BODA 2P90A 3ZXQA 1NHJA 2WLIB 2ZR3A 1PNKA 5KA6A 4UV8A 4WFAV 4HZ3A 1UYLA 4ASAA 1ZWHA 3SYAA 4TWKA 3PEJA 2YEJA 5L3FA 3ABMC 2EINB 4GX0A 4HAMA 3I55V 1H8HG 3MHSC 4X9LA 1F4NA 4XDKA 1BMFG 3ZMZA 2W0FC 3AEIA 1UY7A 3FKSG 5CPHA 3ABKC 1VQLV 4YKUA 2WLNA 2XDLA 3FT8A 4B7PA 1VQ6V 1KQSU 2BU2A 1H7SA 3SPGA 2XDUA 2MK3A 3JYCA 3OR7C 4R7CA 4ZBMA 2XHXA 4CE1A 5J71A 3OMIB 2W6IG 3CYOA 3E8FA 1WPXA 1W0JG 4QE7A 4WFBV 3CPWU 2X6CA 1TH8A 2JKIA 3O6OA 4PU9A 1A4HA 2ATKC 3R4OA 2YEAA 1F4MA 3EKOA 4MW3A 2Q8GA 1P4RA 3ABTA 4XKKA 2BOCC 4P7AA 4PA9A 5FL7G 4HYMA 4QNHB 1THNA 2B5UA 4PDLA 3U67A 3LUTB 4J9YB 1M57C 4BIUA 3CCLV 3JD1A 4P9OA 4GX5A 3R65A 1GJVA 1Y4SA 2IJHA 1NBMG 1S76D 1RPRA 3OR6C 4LWHA 3O2FA 2ZXWB 3RBZA 1I5AA 4F4LA 5B1AB 1S5HC 2GHYA 1UYFA 3JD0A 4XIRA 5LHHA 2Q8FA 2PI5A 4MPEA 5CBFA 3HB3B 2F43G 2BZ5A 3AG2B 4L87A 1QLEB 4R6ZA 4P30A 3G6EV 4MPCA 2XAHA 2YE8A 3IGAC 3G75A 3TZ4A 3B26A 1WLEA 1MG1A 1KKDA 3RLQA 4WFFA 1M56C 1GKFA 5D7CA 2YKBA 3F7YC 1AMWA 4UV9A 2Q8IA 2QG0A 2C2AA 1ENVA 2YI6A 4AWOA 3K0DA 5IDJA 5F5RA 2CCTA 2EIMB 3SYQA 1V55C 4MVMA 2IW5A 2P67A 1QVGU 5FNDA 1AI4A 1PKXA 2YEEA 3T2SA 2BSMA 4U7NA 2WAMA 2WPDG 2QM8A 2YGAA 2QFOA 4U93A 4KP4A 4MTGA 1AM1A 1K4DC 4CZZA 2XK2A 4U7OA 4WUCA 3CC7V 3CRKA 1VQKV 2XHRA 4H85A 5GW7A 3X2QB 4E2LA 1VQPV 3A0XA 3SPHA 3CMEV 3ASOB 4URMA 2Y48A 1GMGA 2H8PC 4XIQA 3E35A 5EC1C 4NH8A 4UVBA 1AI6A 3LNMB 3TETA 3WG7C 5B1BC 2WI4A 1L0OA 3W7XA 2GQPA 3CCMV 4RAIA 1JCHA 3SL2A 3BMYA 1QVFU 5CF0A 1YJ9V 1TC0A 1GKXA 4CWTA 3HZ5A 4URNA 4XIPA 4EM7A 4QIWF 1NHHA 5LBQA 4YXWG 2ZDIC 3OGCC 4G28B 1YITV 1YTFD 3JD3A 4CBCA 5L3CA 2EIJB 2ITDC 1FXKA 5CA3A 4UVCA 3RVZA 4RQFA 3STLC 2DYSC 2IJIA 3CP1A 3RW0A 2X0LA 3ZN0A 4LWEA 1EBOA 2DW4A 1OCOB 3QDDA 1KC8W 3G71V 2FWZA 4MVUA 1NKDA 2JJCA 3F5WC 2XAFA 3O0IA 2YKJA 1GM7A 5LGUA 1Z5CA 1OCRB 3E8GA 2YGFA 2HJFC 3UKMA 1RM1B 1YT2A 5B3SB 1QR8A 1I5CA 1VQ7V 2PI4A 2DQ3A 3CGZA 2WLLA 1K5SA 1JX9A 3G4SV 1UYCA 5M4HA 3TCUA 3ETDA 2JIZG 2IJJA 2B1IA 1CPYA 3AG4B 2XD6A 1DLBA 2KB1A 1OZ0A 2CCSA 3ABLB 2YSUB 5CMUA 2FXSA 1VQNV 1SZTA 4BW5A 2YI7A 2WLLB 3AG3B 3MD0A 3E89A 4OXSA 1BHAA 2WEQA 2WI1A 2A0LA 2ZD9A 1OHHG 3VBBA 4XTJA 3JD2A 2QTOA 2XAGA 4JYBA 4G27B 2JJ1G 4ZVIA 2HVJC 2XJJA 5L3JA 3ABUA 2EIKB 4XCLA 1JQ0A 4MP2A 2YEVA 5IY5C 2HG1A 1YESA 3ZM7A 4L93A 1M9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EGK A;  5CPH A;  3PEH A;  4LWF A;  4R3M A;  1Z5B A;  1YC1 A;  4YKU A;  5CTW A;  1Y8N A;  4MPN A;  2WI6 A;  4AS9 A;  4O09 A;  2E0A A;  3R4N A;  3K97 A;  1MX0 A;  4FCR A;  1H7U A;  1AH8 A;  3INW A;  2XDL A;  3FT8 A;  4B7P A;  4L8Z A;  4KTN A;  2YE6 A;  2Q2E B;  2BU2 A;  2YJW A;  5F3K A;  1H7S A;  4ASB A;  2XDU A;  4KQV A;  3Q5J A;  4XD8 A;  4GCZ A;  4PRX A;  4Q20 A;  4EEH A;  4KFG A;  4WUD A;  4BAE A;  2XHX A;  2WI2 A;  3OWD A;  4CE1 A;  5J71 A;  1I59 A;  2O1V A;  3CWV A;  2H55 A;  4GT1 A;  5IN9 A;  4P8O A;  1TH8 A;  3HZ1 A;  5BOC A;  1EA6 A;  1I58 A;  2JKI A;  3O6O A;  4CWP A;  1KZN A;  3GIG A;  3NMQ A;  3OPD A;  4PU9 A;  3IED A;  4L94 A;  4W7T A;  4EFU A;  5M4E A;  1A4H A;  3EHH A;  3R4O A;  2YEA A;  4GQT A;  5D7D A;  1TID A;  3A0R A;  3VHD A;  4JAU A;  4LWI A;  3EKO A;  4L91 A;  4O04 A;  4URO A;  2XCM A;  2Q8G A;  1F51 A;  3U2K A;  1UY8 A;  4GGL A;  3D36 A;  1YET A;  4XKK A;  2WEP A;  4P7A A;  3OW6 A;  4EFT A;  5GGZ A;  4HYM A;  2BU5 A;  4HY1 A;  2YJX A;  1THN A;  1BXD A;  4CE3 A;  3LNU A;  4DUH A;  3U67 A;  3G7E A;  2AKP A;  4O05 A;  4BIU A;  2UWD A;  3C11 A;  3GIG B;  4FCQ A;  3B28 A;  3ZRX A;  1Y8O A;  1GJV A;  1Y4S A;  2BYI A;  1UYD A;  2YE4 A;  4YKR A;  3GIE A;  3EHF A;  4GFN A;  2IOP A;  4XKA A;  2BRC A;  4YKX A;  4BQJ A;  2O1U A;  4EGH A;  3H4L A;  2CGF A;  1TIL A;  3HEK A;  2ZKJ A;  1YT1 A;  4LWH A;  2QG2 A;  3O2F A;  5M4N A;  4HXZ A;  2YGE A;  3K99 A;  1UY6 A;  4HXW A;  1I5A A;  2YKE A;  2YI5 A;  2Q8H A;  1GKZ A;  4HY6 A;  3WQ9 A;  3CGY A;  5CTY A;  1UYK A;  1UYF A;  1U0Z A;  4XIR A;  2YK2 A;  3ZKD A;  1UY9 A;  4L90 A;  4I3H A;  2YEI A;  2Q8F A;  4XIT A;  3EKR A;  4CWO A;  4MPE A;  2WI3 A;  2BZ5 A;  3D0B A;  2BU6 A;  3U2D A;  3A0Z A;  4JQL A;  2YK9 A;  4MPC A;  2YE8 A;  2IWX A;  2FTK A;  1I5D A;  3T1K A;  2VWC A;  4HYP A;  3G75 A;  2YEB A;  3VHC A;  2CCU A;  3TZ4 A;  2WI5 A;  1BGQ A;  5C93 A;  2PNR A;  2LFS A;  3B26 A;  4MTX A;  3RLQ A;  4FMT A;  2ZBK B;  2GFD A;  1YC3 A;  3TZ5 A;  3TK1 A;  2YEG A;  4FPP A;  3R4P A;  4R1F A;  3T0H A;  3A0Y A;  4H81 A;  1AJ6 A;  5D7C A;  2YKC A;  4BQG A;  4WUB A;  2YKB A;  4FCP A;  5CTX A;  1AMW A;  3A0W A;  4NH9 A;  4H7Q A;  2Q8I A;  1YSR A;  2QG0 A;  3K60 A;  5B1O A;  2C2A A;  3T0Z A;  2YE7 A;  2YI6 A;  4AWO A;  2WI7 A;  4MOT A;  5IDJ A;  2XX5 A;  4CWR A;  1QZR A;  4HZ5 A;  3R4M A;  4V26 A;  5F5R A;  2CCT A;  4CE2 A;  1UYI A;  3R91 A;  2EXL A;  2YE2 A;  2QF6 A;  3EHG A;  4K4O A;  4CWS A;  1AH6 A;  4GT8 A;  1Z59 A;  2P67 A;  5FND A;  4BXI A;  4YKQ A;  2FYP A;  4I5S A;  1Y8P A;  1QYE A;  3HYZ A;  2XAB A;  3P32 A;  2YEE A;  5M4M A;  2BTZ A;  3T2S A;  1UYE A;  2BSM A;  2YI0 A;  2O1W A;  4HZ0 A;  4U7N A;  3EHJ A;  4ZKI A;  3TZ2 A;  1U2O A;  2QM8 A;  2XDS A;  2YGA A;  2QFO A;  2IWS A;  4U93 A;  4MB9 A;  4KP4 A;  3RLP A;  1QY8 A;  1AM1 A;  4PL9 A;  2XDK A;  2XK2 A;  3ZRV A;  4U7O A;  3KE6 A;  4WUC A;  3ZKB A;  3CRK A;  2XHR A;  1JOY A;  1ZW9 A;  1UYM A;  2H8M A;  4H85 A;  4YKZ A;  4O07 A;  1B63 A;  4XE2 A;  1Y4U A;  2YE5 A;  3A0X A;  3LPS A;  1S16 A;  2VCJ A;  1YS3 A;  1ZXM A;  4QPK A;  3HYY A;  4URM A;  2QM7 A;  3ZCC A;  4URL A;  4EGI A;  3ZRW A;  4XCJ A;  3CRL A;  4XIQ A;  4NH8 A;  5FNF A;  2XJX A;  2WI4 A;  2XX4 A;  4LWG A;  1BYQ A;  1L0O A;  4XKO A;  2GQP A;  1IXM A;  5D7R A;  3SL2 A;  4DZY A;  3BMY A;  5J6A A;  4E00 A;  5D6Q A;  5CF0 A;  1TC0 A;  1GKX A;  3B25 A;  3VHA A;  2YE3 A;  4KSH A;  4CWT A;  5CTU A;  5B1N A;  3HZ5 A;  4URN A;  3Q5L A;  4XIP A;  4EM7 A;  1NHH A;  4YKY A;  2ZDY A;  4MT8 A;  3NXS A;  4JYC A;  1MU5 A;  5M4K A;  4E02 A;  1OSF A;  2K5B A;  3JZ3 A;  4AWQ A;  2BYH A;  2IWU A;  3Q5K A;  4O0B A;  1UYG A;  3ZRW B;  3GIF A;  2YEC A;  2VCI A;  2LFR A;  1BKN A;  2XHT A;  3ZXO A;  3D2R A;  2VW5 A;  4XDM A;  4YKT A;  4NH7 A;  4LWE A;  2IOQ A;  3MNR P;  1NHI A;  1KIJ A;  4EMV A;  3RLR A;  2BU8 A;  3QDD A;  2FWZ A;  3TUH A;  1I5B A;  1PVG A;  2YE9 A;  2JJC A;  2HKJ A;  3OWB A;  3O0I A;  4AWP A;  2YKJ A;  4PRV A;  2IOR A;  3B27 A;  1Z5C A;  2YGF A;  4LC1 A;  2BT0 A;  3HHU A;  5FWK A;  2CG9 A;  2HCH A;  4V25 A;  1TC6 A;  4KSG A;  4CWF A;  1YC4 A;  1YT2 A;  4B6C A;  4BIZ A;  2CH4 A;  3A0T A;  2XX2 A;  3FT5 A;  1YER A;  1UYH A;  3DGE A;  5IDM A;  1I5C A;  1B62 A;  2YEH A;  4LPB A;  4LP0 A;  1JM6 A;  5D6P A;  2XJG A;  3T10 A;  3CGZ A;  1Z5A A;  3QTF A;  3FV5 A;  2ZDX A;  1B3Q A;  1UYC A;  5M4H A;  3WHA A;  4ASG A;  3H80 A;  1R62 A;  1YT0 A;  4CWN A;  4CWQ A;  5BOD A;  4ASF A;  3TZ0 A;  3BM9 A;  3OMU A;  4XC0 A;  2WWW A;  4GEE A;  4JAV A;  3ZXQ A;  1NHJ A;  2XD6 A;  1US7 A;  2CCS A;  2WER A;  2FXS A;  2ESA A;  2YKI A;  4MBC A;  1UYL A;  2YI7 A;  3G7B A;  5M4P A;  4ASA A;  1TBW A;  2YED A;  3MD0 A;  1ZWH A;  4YKW A;  2WEQ A;  2WI1 A;  2XDX A;  2YEF A;  3PEJ A;  1ZXN A;  2YEJ A;  4XTJ A;  3K98 A;  3B24 A;  4MP7 A;  3C0E A;  1YSZ A;  4JYB A;  4E01 A;  4ZVI A;  1EI1 A;  4R3A A;  3TTZ A;  2BU7 A;  4X9L A;  4QPJ A;  2XJJ A;  3VAD A;  3R92 A;  5L3J A;  4XCL A;  2FWY A;  2BRE A;  3INX A;  4MP2 A;  1S14 A;  2HG1 A;  3RKZ A;  5FNC A;  1YES A;  1ID0 A;  3ZM7 A;  4L93 A;  4JAS A;  1UY7 A; 
#chains in the Genus database with same CATH topology
 4CS2 A;  3LSS A;  3CCJ V;  1VQM V;  4LWF A;  1Z5B A;  1L8D A;  5CTW A;  2UUC O;  4O09 A;  2E0A A;  1F23 A;  1FYJ A;  4FFB B;  2A3Q A;  3ZMV A;  3FB6 C;  2YC0 A;  2K9P A;  3S3W A;  5LMN B;  1IZ3 A;  2QWO B;  5JJN B;  2YE6 A;  3FYE B;  5IYC O;  2YJW A;  4MW8 A;  1N33 B;  4GCZ A;  2N05 A;  1Q3E A;  4ZOL B;  4EEH A;  3MAQ A;  1N34 O;  1K9M W;  2XND G;  2P5O A;  4LBE C;  1J5E O;  4FZ1 A;  2YEV B;  4PJ0 Z;  1I59 A;  3E86 A;  3OMN B;  4PA4 A;  5H6R A;  2H55 A;  4GT1 A;  4P8O A;  4LF7 O;  5BOC A;  5BMV A;  1VQ5 V;  1EA6 A;  4MVZ A;  1JMK C;  1YF2 A;  1KZN A;  3GIG A;  3NMQ A;  4K8X A;  4L94 A;  4EFU A;  4UXN A;  4BAY A;  5M4E A;  3EHH A;  4GQT A;  4JV5 B;  1COW G;  3KKY A;  1NJI W;  4MSW C;  4TV9 A;  1WP8 A;  2DYR B;  3AK2 A;  4KUM A;  3D36 A;  1HNZ B;  1H2S B;  3OW6 A;  2HHH O;  1AI7 A;  5GGZ A;  5JVD B;  2HP8 A;  1XNR B;  4YJ2 A;  1X4T A;  4H33 A;  4JPR A;  1TGO A;  5A2Q N;  3RYF A;  5BMV B;  2UWD A;  1QU7 A;  1K92 A;  4F6E A;  3GIG B;  3E22 A;  1LUW A;  3K04 A;  3B28 A;  2QWN B;  2YXY A;  2CE4 A;  2BYI A;  4JZG A;  1UYD A;  3CCU V;  3OEE G;  3GIE A;  1N8R W;  4GFN A;  5H6Q A;  2IOP A;  4XKA A;  4YHH B;  1SA0 A;  4YKX A;  4X1I B;  4XDL A;  4TV9 B;  5J2T A;  5GTH Z;  4EKW A;  4O4I A;  1FPO A;  2GTS A;  1N36 B;  2UXX A;  3OGI B;  4TT3 G;  4HXZ A;  1ZWI C;  1SF9 A;  1QHT A;  3K99 A;  2Q9L A;  4HXW A;  4K3A A;  4B7K A;  2CUG A;  2Q0O C;  4DV7 O;  4UCU A;  2YI5 A;  1GKZ A;  1S5L Z;  2EIN C;  3CCE V;  2YK2 A;  3ZKD A;  2Z0A A;  4LF6 B;  3H1H H;  3RYF B;  1VQ8 V;  3K08 A;  3ZMS A;  4PA3 A;  3EKR A;  3E22 B;  3OW2 U;  1QNM A;  2WI3 A;  3D0B A;  3B8N A;  3LMM A;  2RN9 A;  2ZQM A;  2ZE8 A;  2Y69 B;  1ZL8 B;  1ZSP A;  4NR1 A;  4TQF A;  3A0Z A;  3ZJZ A;  4JQL A;  2GSM B;  3QO8 A;  3BCC H;  4O4I B;  1XIL A;  1F7Y A;  3T1K A;  2RQ6 A;  5DN6 G;  2YEB A;  4JTA B;  1N33 O;  4B3R O;  1BGQ A;  2PNR A;  2WI5 A;  2LFS A;  5JQG A;  3E83 A;  1Q81 W;  4MTX A;  1M5I A;  1PD3 A;  5IJ9 A;  1MAB G;  2GFD A;  3B40 A;  1E79 G;  1YC3 A;  2NLJ C;  3TZ5 A;  2R72 A;  2YEG A;  4FPP A;  2XAQ A;  2QGN A;  3JAK B;  3T0H A;  4JI0 B;  1AJ6 A;  4BQG A;  5CTX A;  2XOK G;  1URF A;  3A0W A;  4NH9 A;  3UCS C;  4JI4 B;  5LGN A;  4Z2W A;  3CCS V;  5LA6 A;  5B1O A;  1V54 B;  3KCY A;  3TJT A;  2YE7 A;  1D2D A;  2YID A;  1YXB A;  4DO2 A;  2V4D A;  1YTF B;  4PDR A;  1MSD A;  2DWE C;  4CWR A;  5LHG A;  3R4M A;  4DUZ B;  3W7S A;  1BCC H;  4UCR A;  2ZCE A;  2IH1 C;  3LDE A;  4QGP A;  3R91 A;  2YE2 A;  2QF6 A;  5EZY B;  1T5E A;  2B1G A;  3CXH F;  1CEZ A;  1Z59 A;  3W7U A;  1VQO V;  5EYP A;  5LGT A;  2B9Z A;  4BXI A;  4I5S A;  4O2B A;  1QYE A;  1GH6 A;  1QR9 A;  3CX5 F;  4DR4 O;  3P32 A;  1K5Q A;  4LFC O;  4CH4 A;  3EHJ A;  1VQ9 V;  1U2O A;  4YHH O;  5LMU B;  2D2C B;  3RLP A;  4ZI7 A;  1BQ0 A;  2XDK A;  4JI1 B;  1M4U A;  1N36 O;  3CWB H;  5D5Q A;  1AJN A;  3ZRV A;  4DR2 O;  5K1P A;  2JEX A;  1M93 A;  1YVW A;  1GM8 A;  4YKZ A;  3SYC A;  4UVA A;  1B63 A;  3T2M A;  1XMQ B;  1Y4U A;  2PGG A;  2RDC A;  4RO2 A;  3HKB A;  4LF6 O;  3LPS A;  2QWR B;  3ZHU A;  1S16 A;  2VCJ A;  1YS3 A;  1NQT A;  3M99 B;  4FLT A;  3HYY A;  1KP2 A;  2QM7 A;  2ZNI A;  3R66 A;  3SR2 C;  5ITZ B;  4XCJ A;  2F66 C;  2WSS G;  3D3Q A;  5B1A C;  2Q7E A;  3UO2 A;  1JA8 A;  4P2Z A;  1YCI A;  2F93 B;  4DV5 B;  1BHB A;  2Y0P A;  2UU9 B;  1IXM A;  4KXR A;  4ZI7 B;  2C1I A;  4JYY A;  2AHY A;  4EFB A;  3B25 A;  2ETN A;  1UJW B;  3OTO O;  5CTU A;  2PY5 A;  4X8A A;  4EB6 A;  1I94 B;  4GKJ O;  2WLJ A;  1Z2G A;  4MVO A;  2HR3 A;  1R3I C;  1U96 A;  1XEQ A;  3HKB B;  1OSF A;  4E02 A;  2K5B A;  3I56 V;  3W7W A;  2BYH A;  2VRZ A;  3Q5K A;  2P6J A;  2EBO A;  4WF9 V;  4IHJ A;  1UYG A;  4PEL A;  1I08 A;  4J11 A;  2JEU A;  3H1L H;  4E4E A;  5BR8 B;  3GIF A;  4JI4 O;  1MZF A;  1XBL A;  1Q90 D;  1XRE A;  3WB1 A;  3JAM N;  2LFR A;  4FLX A;  1BKN A;  1KMI Z;  2ZE5 A;  4QJF B;  4DW0 A;  1Z5W A;  4J10 A;  4WBN B;  4ASU G;  2IOQ A;  4EMV A;  3L70 H;  2UXB B;  4LF4 O;  4DUZ O;  1MOF A;  1H2N A;  3ZHQ A;  3QVN A;  3T4D A;  2YE9 A;  1WPB A;  2N04 A;  3OWB A;  1XQ8 A;  2E75 B;  4PRV A;  3JAS A;  3OM3 B;  1H8E G;  2F4V B;  3ZED A;  3M8A A;  2XAJ A;  4KSG A;  4R8C A;  4CWF A;  4B3T B;  4IHJ B;  4B6C A;  2G38 A;  4BIZ A;  3SPI A;  2GBO A;  5KA5 A;  1YIJ V;  3A0T A;  5CA1 A;  3FT5 A;  1G8M A;  1K34 A;  4FK5 C;  5IDM A;  1KUQ A;  1BS3 A;  1W59 A;  4BWA A;  1B62 A;  2YEH A;  3LSU A;  4LPB A;  3UQ8 A;  5E79 Z;  3CD6 V;  1W0K G;  4Z1V A;  1H38 A;  3T10 A;  4MVQ A;  3EXA A;  3QTF A;  4GX1 A;  4LF5 O;  4J9Z B;  4DUY B;  3B8M A;  3WHA A;  2QJ1 A;  5LP6 A;  1NR1 A;  3H80 A;  1TA8 A;  1KB9 F;  1SQQ H;  5JCO A;  1HR0 O;  4K8Z A;  3JAS B;  4PV1 B;  2Y4T A;  2CTP A;  1AR1 B;  4C7U A;  3CCR V;  2L6L A;  3BM9 A;  1TUE B;  3B77 A;  2WWW A;  3LDD A;  2Q8V A;  3CJH A;  3K5O A;  3N2G A;  4H37 A;  4P9P A;  3X2Q C;  4LFA B;  1P7G A;  4MBC A;  5JEN A;  4I55 B;  3G7B A;  2ZIM A;  5M4P A;  1NU1 H;  1QLN A;  1WJZ A;  2AGA A;  5IYB O;  4JI3 O;  3KZI Z;  3ETG A;  5LP6 B;  3VOU A;  4UUJ C;  2YEF A;  5EIB C;  4E72 A;  3J7A U;  3AG1 B;  1XHX A;  2P4V A;  5FLX N;  3F5T A;  1THZ A;  1BL8 A;  3JCU Z;  3KCX A;  1FJG B;  1YSZ A;  5KAF Z;  3KG2 A;  4HBN A;  1NTM H;  1LNQ A;  3WG7 B;  3RYC A;  1TAE A;  3CJH B;  2JJ2 G;  3ZX6 A;  1EI1 A;  2EZP A;  3VAD A;  4QPJ A;  3QF7 A;  4AI8 A;  2E3C A;  3R92 A;  3RVY A;  4J7K A;  2HEP A;  4X89 A;  1HP8 A;  3INX A;  5FNC A;  4X66 O;  1P49 A;  3SJQ C;  4JAS A;  1S3J A;  3PEH A;  2EIJ C;  2UXB O;  1YC1 A;  4X20 B;  2WLK A;  4MPN A;  2WI6 A;  4AS9 A;  1OCC C;  1IXB A;  3R4N A;  3SPJ A;  3K97 A;  1K8A W;  4NKG B;  1MX0 A;  1H7U A;  1AH8 A;  4RWU A;  4JYA B;  1OCZ B;  2UXC O;  1R6N A;  4R50 A;  4KTN A;  2RNB A;  3RYC B;  2UUC B;  5L3B A;  1NH2 D;  4OGQ B;  5F3K A;  1OCO C;  1WA8 B;  1Y4M A;  4DRX A;  5CA0 B;  2OCC B;  1FXH A;  1VF6 A;  5JH7 A;  3BEH A;  2CTQ A;  1NR7 A;  4CH5 A;  4BAE A;  1OCR C;  2P06 A;  2HLD G;  4X1Y A;  1XDC A;  4FLU A;  2Z3Y A;  4LH7 A;  1RM1 C;  3JAW A;  1DTO A;  3HZ1 A;  1I58 A;  1B04 A;  4LNU A;  4CWP A;  5B3S C;  3OPD A;  4W7T A;  3IED A;  1FXK C;  1JFF A;  1NTZ H;  3OUS A;  4OX9 O;  1JVM A;  5KUM A;  1CP9 A;  3A0R A;  2WLM A;  4JAU A;  4LWI A;  4RUE A;  4URO A;  3RYI A;  5E1A C;  4X9Q A;  1O9H A;  1K73 W;  1YI2 V;  3DSQ A;  1S72 V;  2KG7 A;  3U0Z A;  4YIP A;  3FB5 C;  2WLH A;  2CGN A;  4EFT A;  4X1Y B;  2YJX A;  1AJP A;  1K4C C;  4CE3 A;  3LNU A;  4DUH A;  1VIB A;  3G7E A;  1FXV A;  3JAL B;  4UCS A;  1S5J A;  1U97 A;  2DE0 X;  2DJV A;  1TUB A;  3OUF A;  1Y76 B;  3C11 A;  3QG5 A;  2HHH B;  3L74 H;  3T1H O;  2E76 B;  5EC2 C;  3ZRX A;  1JFF B;  5KHI A;  3SJB C;  1Y8O A;  2V7Q G;  1D5A A;  4WFE A;  1Y66 A;  2BSK A;  2YE4 A;  4YKR A;  4LF8 O;  4W4K A;  1G4Y B;  3RYI B;  2BRC A;  4BQJ A;  2QWP B;  4PA6 A;  2O1U A;  2CGF A;  3H4L A;  1TIL A;  3HEK A;  2ZKJ A;  1YT1 A;  5FPR A;  5DM6 V;  1E1Q G;  2QE7 G;  2QA4 V;  4LCU C;  1N4C A;  2IU0 A;  2X6B A;  1HWY A;  4MVS A;  2YKE A;  2OIG A;  5HFM A;  2EIL C;  2RJZ A;  3BPZ A;  3TGU H;  2YXH A;  4PA7 A;  3CGY A;  3WQ9 A;  5CTY A;  2M7W A;  1DF5 A;  1U0Z A;  2MW2 B;  2YXL A;  1TUB B;  4L90 A;  4XIT A;  5DEC A;  5KLV H;  1I5Y A;  2N74 A;  4DV7 B;  5LXT A;  1FS0 G;  4IIJ B;  3APO A;  4FZ0 A;  2EIK C;  4JI7 O;  2BU6 A;  1NI8 A;  2BSK B;  2K1E A;  1BT8 A;  1AI5 A;  4JYA O;  2H94 A;  1HNW O;  2IWX A;  3HKD B;  1I5D A;  4WFH A;  1S77 D;  2CCU A;  3CCV V;  4CS4 A;  4DV3 O;  5C93 A;  2YS8 A;  4HNA A;  3K3W A;  4B3S O;  5LL6 Y;  3K9A A;  2HHI A;  2ZBK B;  4JI2 O;  1MMM A;  1R73 A;  3TK1 A;  4KL1 A;  5GON A;  3ZIA G;  4LF9 O;  1PM9 A;  4B3R B;  4DR1 O;  4TUY B;  1R3K C;  3T1C A;  3A0Y A;  5L3G A;  4H81 A;  2YKC A;  1ZUQ A;  3OFN G;  4DR6 B;  4IT5 A;  3RT3 C;  5LXT B;  5JVD A;  1M1K W;  1EFR G;  2X6A A;  4H7Q A;  1L1F A;  3BAB A;  3OE7 G;  1YSR A;  3CCQ V;  2PUS A;  3RGB A;  1SRY A;  2LP7 A;  5KHJ A;  4MOT A;  1PL0 A;  3ASN C;  1IBL O;  1QZR A;  4HZ5 A;  4HNA B;  4V26 A;  1Z5V A;  3QO5 A;  1EM1 A;  5KHK A;  4X1I A;  3CRA A;  1AVM A;  2NNU A;  2EXL A;  3WFV A;  5GON B;  4K4O A;  2JRI A;  2AZ0 A;  1AH6 A;  2DYR C;  4GT8 A;  1Q7Y W;  4PDM A;  4JI8 O;  5EBM C;  4YKQ A;  2FYP A;  1Y8P A;  4I4T B;  4NTY A;  5IWA O;  1H2K A;  1UYE A;  2O1W A;  1KKC A;  2Q5Z A;  4ZKI A;  3TZ2 A;  2IWS A;  4ZIB A;  5IT9 N;  4DR4 B;  2ADQ B;  4X1K A;  4LFC B;  3FFQ A;  4JF3 A;  1ZL8 A;  1IX9 A;  1SQP H;  1ZW9 A;  1UYM A;  2H8M A;  1GM9 A;  3L71 H;  5HFL A;  4PDV A;  2CK3 G;  3D3I A;  2FL4 A;  5IYZ A;  4DR2 B;  1V9P A;  4QPK A;  2DQ0 A;  1PV0 A;  3D36 C;  3DXR B;  1FFX A;  3SDL A;  3J80 N;  3E8B A;  4N21 A;  4URL A;  3ZRW A;  4IGG A;  2JDI G;  3C3S A;  5FNF A;  2AZ2 A;  5J9P C;  1BSM A;  1Q6I A;  1RSO A;  4LP8 A;  1YSC A;  2XX4 A;  4LWG A;  3JAK A;  1L0N H;  3GVM A;  1B06 A;  2RCV A;  4CH6 A;  4DZY A;  3ABM B;  4E00 A;  5D6Q A;  1ZTE A;  1GN4 A;  4X1K B;  3VHA A;  2YE3 A;  5EBW C;  2FML A;  5B1N A;  1OJH A;  2Y69 C;  2F23 A;  4YKY A;  1Q6U A;  4N23 A;  3N2K B;  1MU5 A;  3CRQ A;  5M4K A;  1XL4 A;  5H2F Z;  5IYZ B;  2R70 A;  3OTO B;  3JZ3 A;  4RUF A;  1SER A;  1FFX B;  2IWU A;  4DR6 O;  3CHX A;  4O0B A;  3ZRW B;  3ABK B;  4GKJ B;  1RSO B;  5EZY A;  4J80 A;  2HVK C;  3VQV A;  2V1D A;  4DV6 O;  1D5N A;  2UXN A;  1KBH A;  4JI6 O;  2XHT A;  3D2R A;  2E5L B;  1GK9 A;  4WFG A;  4XDM A;  4B7E A;  5IE9 A;  1Q82 W;  2WA3 A;  3MNR P;  2Q68 A;  1NHI A;  1KIJ A;  2W6J G;  1EN4 A;  2BU8 A;  3OMA B;  3ETE A;  1V54 C;  3VQY A;  4AWP A;  2UUB O;  5BY1 A;  1JJ2 U;  5AG2 A;  3B27 A;  1US6 A;  4H44 B;  5F2V O;  2BT0 A;  3HHU A;  4YIO A;  4LF4 B;  2CG9 A;  2HCH A;  4TV8 B;  1TC6 A;  2IU3 A;  1PP9 H;  1YDX A;  3Q4H A;  1YC4 A;  2HFE C;  3IAY A;  2YIA A;  1H2M A;  2GTA A;  3OAA G;  4AHC A;  2ITC C;  3K57 A;  5LYJ B;  2BOB C;  2YI8 A;  3IFX A;  3THO A;  4DV2 B;  5H5N A;  4MS2 A;  4LWS A;  1Y67 A;  4LP0 A;  3O65 A;  2P7T C;  5ITZ A;  2RMK B;  3SYP A;  4GKK O;  1Z5A A;  2ZKO A;  5LHI A;  1NH2 B;  2QR4 A;  4O2A A;  1Q86 W;  2HG5 C;  4EEQ A;  4ASG A;  3L75 H;  3B09 A;  2XAS A;  1K3E A;  1GO3 F;  1ZX3 A;  3H1J H;  1R62 A;  4LF5 B;  4ASF A;  3TZ0 A;  1XUQ A;  3OMU A;  4XC0 A;  1M57 B;  2EJ7 A;  3Q4H B;  1WN7 A;  4JTC B;  4I9Q A;  4GEE A;  3RFR A;  4JAV A;  1AB3 A;  2OCH A;  1HR0 B;  1DGS A;  3FB7 C;  4DV0 O;  1US7 A;  4JGS A;  2WER A;  3H1I H;  2ZXW C;  2EZO A;  5KUK A;  4LWS B;  2ESA A;  2YKI A;  3PN1 A;  3WB0 A;  1X59 A;  1NVP D;  1TBW A;  2YED A;  4X64 O;  4YKW A;  4J7Z A;  4O2A B;  1XL6 A;  1NT2 B;  2IJK A;  3E2E A;  1K33 A;  4L8J A;  2XDX A;  5JJJ B;  2EJR A;  4DV1 O;  1ZXN A;  5L3E A;  3HKC A;  3IC7 A;  4WBN A;  3K98 A;  3B24 A;  1EZJ A;  4AIL C;  3UM7 A;  4MP7 A;  1MSW D;  3C0E A;  4JI3 B;  3W7T A;  3RWR D;  1GAX A;  3AG2 C;  1XI1 A;  1KD1 W;  1QLE C;  4E01 A;  1Q43 A;  1YHQ V;  5BXZ A;  5A9G A;  4R3A A;  3TTZ A;  2BU7 A;  4XBF A;  2IH3 C;  3SPC A;  3WB2 A;  1E1R G;  4DXW A;  2FWY A;  3SYO A;  2BRE A;  3HKE A;  1S14 A;  3RKZ A;  2E5L O;  2UXD O;  1ID0 A;  1A32 A;  1XHZ A;  3OD4 A;  4EGK A;  3CSX A;  4R3M A;  4OPA A;  3JCZ A;  5C8Y B;  5CBG A;  1Y8N A;  4BW9 A;  2X7R B;  5B5E Z;  1ARO P;  3HKC B;  2Q6A A;  4X66 B;  2OTL V;  2Q73 A;  3K0G A;  4FCR A;  2JK5 C;  2AHZ A;  3INW A;  1M56 B;  3PJS K;  4L8Z A;  5CN0 A;  2Q2E B;  2FKX A;  4ASB A;  2OTJ V;  2QWQ B;  4KQV A;  3Q5J A;  4XD8 A;  3ZRS A;  4PRX A;  4Q20 A;  5IYD O;  1K97 A;  1SES A;  4DV2 O;  1BQZ A;  1FFT B;  2UXC B;  4KFG A;  4I50 B;  2ZT9 B;  4DV4 B;  4WUD A;  4QE9 A;  2WI2 A;  3HKE B;  3STZ C;  3OWD A;  2O1V A;  2QKC A;  3CWV A;  1YEW A;  2EIM C;  5J2U B;  5IN9 A;  2YUA A;  3IJ4 A;  2YIB D;  1P7B A;  1B6Q A;  3CYG A;  1SQB H;  4KFM A;  5IJ0 A;  2WA4 A;  3JSL A;  3QTC A;  1H2G A;  3CC2 V;  5D7D A;  2BE3 A;  4I55 A;  4CC5 A;  1TID A;  1TVK A;  3VHD A;  1XMO B;  4L91 A;  2H3O A;  1FKA O;  4O04 A;  2A7W A;  4GLX A;  2XCM A;  1V55 B;  1F51 A;  2PZS A;  3U2K A;  1N32 B;  4OX9 B;  1UY8 A;  4GGL A;  1YJN V;  1YET A;  3NR7 A;  2WEP A;  1NS1 A;  1RP3 B;  2BU5 A;  4HY1 A;  1JR9 A;  1BXD A;  2R9R B;  4YY3 B;  2IM9 A;  2AKP A;  3AK3 A;  4O05 A;  1UFI A;  3EHB B;  3WU2 Z;  3BVO A;  3BAA A;  2VQE O;  5IJ0 B;  4FCQ A;  4AQY B;  1FD9 A;  2P22 C;  4I0X A;  1TVK B;  1R1B A;  3ASO C;  3EHF A;  1XNQ O;  4OPH A;  3GWO A;  4DW1 A;  3GB7 C;  1SS3 A;  2ZDI A;  3T1H B;  4RQE A;  2Y0I A;  4EGH A;  1QBZ A;  2LW7 A;  4X20 A;  4LFB B;  2QG2 A;  4FVM A;  1OV9 A;  5LP6 C;  5M4N A;  1RFY A;  2YGE A;  4LF8 B;  1UY6 A;  4FM1 A;  3HPL C;  3AG1 C;  5JCO C;  2Q8H A;  4HY6 A;  5B1B B;  4D7T A;  3QO7 A;  1UYK A;  1DF4 A;  3JD4 A;  1WA8 A;  2OIE A;  5CA0 A;  1UY9 A;  4I3H A;  2ZM6 O;  2YEI A;  1R3L C;  3S3X A;  5JWP A;  4Z1M G;  4CWO A;  3MDS A;  2HKO A;  1GTO A;  1VP7 A;  1AJQ A;  4I0X B;  3U2D A;  1LR1 A;  2DWD C;  1CXZ B;  1N0N A;  4GYC B;  4BR6 A;  3ZN1 A;  2Z5U A;  3ETQ A;  2YK9 A;  4JI5 O;  4LH6 A;  1BGY H;  2FTK A;  1KYO F;  4WCE V;  1M90 W;  2VWC A;  4HYP A;  4JI7 B;  3VHC A;  3SJC C;  3T1Y B;  3C3T A;  4NXN O;  1L0L H;  1R6K A;  3AG7 A;  3OT7 A;  4FMT A;  4DV4 O;  1HNW B;  2PYJ A;  1OCZ C;  5CB4 A;  2QKS A;  4X88 A;  2OYQ A;  3R4P A;  4DV3 B;  4R1F A;  3ZMU A;  1OCC B;  2DYS B;  1JPX A;  2ZE7 A;  5FNV A;  4WUB A;  4B3S B;  4FCP A;  2OCC C;  1SQF A;  3DC5 A;  3JAT B;  2FB5 A;  1GN2 A;  4JI2 B;  4GX2 A;  3H01 A;  3JAL A;  4LF9 B;  2VWJ A;  3K60 A;  4DR1 B;  1XMO O;  3T0Z A;  3ZHS A;  3UT5 B;  1Y76 A;  1J95 A;  1PNL A;  1KEC A;  1IBM O;  2WI7 A;  4MTF A;  1N32 O;  2XX5 A;  5EK0 A;  2ZR2 A;  4O4H B;  4TQD A;  5EBL C;  4CE2 A;  4FLV A;  1QCE A;  1UYI A;  5KX5 A;  1WB8 A;  5CB4 B;  3EHG A;  4YY3 O;  3BY6 A;  3U10 A;  1IBK B;  1FXK B;  4CWS A;  4JZ2 A;  3RYH B;  1IBL B;  5FNV B;  2A79 B;  1VF6 C;  4G2K A;  5LOV B;  3ML0 A;  3HYZ A;  4I9W A;  4AQY O;  2XAB A;  4XDJ A;  1ROP A;  5M4M A;  2BTZ A;  2YI0 A;  4HZ0 A;  5FPO A;  3QNE A;  2XDS A;  4JI8 B;  3K06 A;  3LNN A;  4DR7 O;  3AG4 C;  1SET A;  4MB9 A;  1QY8 A;  1VQ4 V;  3JAR A;  4IIJ A;  5IWA B;  4LFB O;  4PL9 A;  4J42 A;  3ABL C;  3CS5 A;  5CBH A;  1PNM A;  1Y74 B;  2OT5 A;  3KE6 A;  3ZKB A;  4X62 B;  3BFR A;  3P30 A;  1PL4 A;  1JOY A;  3AG3 C;  5H9C A;  4U3J A;  5KX5 B;  1YJW V;  4B3M B;  4O07 A;  3HKD A;  4XE2 A;  2YE5 A;  3G80 A;  3E8H A;  1AIL A;  1ZXM A;  3K58 A;  3ZCC A;  1PPJ H;  4EGI A;  3CRL A;  3CB2 A;  4GUN A;  2CTW A;  3MHH C;  1IUR A;  2XJX A;  1W2B U;  1MNG A;  2CTR A;  4BIO A;  1AR4 A;  2KKW A;  2PF4 E;  1BYQ A;  4XKO A;  4TUY A;  2R9I A;  3ZMT A;  3ZHT A;  4MTO A;  5GTI Z;  5D7R A;  5KAI Z;  3JAR B;  3SJA C;  2A9H A;  5J6A A;  1SKV A;  3CXC U;  2EIL B;  1K7D A;  3FYI B;  4KSH A;  3T1Y O;  1HW7 A;  4HYO A;  3RN4 A;  4DR5 B;  3Q5L A;  4U3J B;  2ZDY A;  4MT8 A;  3NXS A;  4UCT A;  4JTD B;  3K79 A;  4JYC A;  5IY5 B;  4AWQ A;  3CMA V;  1S0V A;  1NVP B;  1HNX B;  4O4J B;  5KHG A;  4FJC C;  4NVP A;  4UCV A;  1I5X A;  2LGQ A;  2QEX V;  4U3F H;  3CC4 V;  2Q7H A;  4D7S A;  2YEC A;  2VCI A;  3ZXO A;  5L3D A;  2VW5 A;  4YKT A;  4I4T A;  4NH7 A;  3RLR A;  2CGO A;  3TUH A;  4DV6 B;  1I5B A;  1PVG A;  4JI6 B;  2NR5 A;  2Q69 A;  3K03 A;  2HKJ A;  2QDO A;  1ORQ C;  2IOR A;  2XHB A;  3L72 H;  1IBK O;  4LC1 A;  4H0L B;  4J7J A;  4TSF G;  5FWK A;  4V25 A;  4NTW A;  2R9A A;  3LDC A;  2CH4 A;  2UUB B;  3OEH G;  2XX2 A;  2YIB A;  1RPO A;  1YER A;  1UYH A;  3DGE A;  4NXM O;  2WLI A;  4FIP C;  3F7V C;  3ASN B;  3FB8 C;  3DXR A;  3LSQ A;  1JM6 A;  3ZHV A;  5D6P A;  2XJG A;  4DR3 B;  3T4Z A;  1LUV A;  3FV5 A;  3CE2 A;  2D3O W;  2IBZ H;  2ZDX A;  2VWK A;  1B3Q A;  4X62 O;  1KP3 A;  3DTU B;  2Q67 A;  4KHP B;  4MVR A;  4J41 A;  2F95 B;  1R3J C;  5EIB D;  1P84 F;  3EFF K;  2A06 H;  1GRJ A;  4B3M O;  4UB8 Z;  1IVS A;  4GKK B;  1YT0 A;  5BZB A;  2YIC A;  4CWN A;  4CWQ A;  5BOD A;  2P90 A;  3FAV A;  1WP7 A;  1AP5 A;  2JVD A;  3ZXQ A;  3TXQ A;  3N2K A;  1NHJ A;  2WLI B;  2ZR3 A;  4F6R A;  2LGW A;  1PNK A;  5KA6 A;  4UV8 A;  5JJE B;  2E74 B;  3TXS A;  4WFA V;  4HZ3 A;  1EN6 A;  1UYL A;  3FX7 A;  4ASA A;  2VS0 A;  1QQC A;  1ZWH A;  4O4L A;  4DV0 B;  2JS3 A;  3SYA A;  4IYH A;  1HDJ A;  4TWK A;  4DR5 O;  3B2E E;  3BA9 A;  1BE3 H;  2BTO A;  2PTM A;  3PEJ A;  2YEJ A;  5K1X A;  1Q8I A;  4PD4 F;  4X64 B;  5L3F A;  3ABM C;  3A0B Z;  2EIN B;  4GX0 A;  4YJ2 B;  2Q4P A;  3FAV B;  2QKA A;  4HAM A;  1HNX O;  3I55 V;  1H8H G;  3B4S A;  3CRR A;  4DV1 B;  3MHS C;  4X9L A;  1F4N A;  3GWK C;  4XDK A;  4K0K B;  4F6R B;  1BMF G;  4TV8 A;  3ZMZ A;  2W0F C;  3J81 N;  3AEI A;  1EZV H;  3FKS G;  1UY7 A;  4O4L B;  5LYJ A;  5CPH A;  5LMN O;  4H13 B;  1SA0 B;  3ABK C;  1VQL V;  4UCO A;  5J2T B;  3U11 A;  4YKU A;  2WLN A;  4X65 B;  2Q0A A;  2UXD B;  4YJ3 A;  1AR5 A;  4W4L A;  3P3P A;  3EVK A;  2LJ2 A;  2XDL A;  3L9D A;  2F1M A;  3FT8 A;  4B7P A;  1VQ6 V;  1KQS U;  2BU2 A;  2GUZ A;  1H7S A;  3SPG A;  2XDU A;  3N27 A;  2MK3 A;  3APQ A;  3A0H Z;  3K5L A;  3JYC A;  3O9O A;  3OR7 C;  1VMG A;  4NTX A;  4R7C A;  4ZBM A;  3C90 A;  2XHX A;  2HJD A;  4CE1 A;  5J71 A;  3OMI B;  2W6I G;  3CYO A;  3E8F A;  1WPX A;  4JV5 O;  1W0J G;  4DR3 O;  1WAZ A;  4QE7 A;  4WFB V;  4DK0 A;  3CPW U;  2X6C A;  1TH8 A;  1Q5O A;  2JKI A;  4CH3 A;  3O6O A;  2ZIO A;  3AK1 A;  4PU9 A;  2GV9 A;  2BTQ A;  4KHP O;  1A4H A;  2ATK C;  3R4O A;  3BA8 A;  2YEA A;  4FFK A;  4YJ3 B;  1F4M A;  5JQG B;  1HNZ O;  3EKO A;  4MW3 A;  1MZE A;  2Q8G A;  5IJ9 B;  1VAR A;  1XNR O;  4DYL A;  1EN5 A;  2GUZ B;  1P4R A;  4JAA A;  4PI0 A;  3ABT A;  3H9V A;  4XKK A;  2BOC C;  4Q6G A;  4P7A A;  1SZX A;  4PA9 A;  5FL7 G;  4HYM A;  4QNH B;  1THN A;  2B5U A;  4PDL A;  3U67 A;  3LUT B;  2P4K A;  4J9Y B;  5LA6 B;  1M57 C;  4BIU A;  3CCL V;  1I0H A;  4LR3 A;  3S5T A;  3JD1 A;  4P9O A;  2BTQ B;  4GX5 A;  3R65 A;  1GJV A;  1Y4S A;  2IJH A;  1NBM G;  1S76 D;  2VQE B;  1N0J A;  2XTA A;  4IL6 Z;  1RPR A;  5DED A;  3OR6 C;  5C8Y A;  4LWH A;  2UUA B;  3K9S A;  2ARH A;  2ZXW B;  3RBZ A;  3O2F A;  5EYP B;  1MA1 A;  1XNQ B;  4K0K O;  4F4L A;  5B1A B;  1I5A A;  4O2B B;  1S5H C;  3K59 A;  3ZHR A;  2GHY A;  1UYF A;  3JD0 A;  4XIR A;  4I7Z B;  3FD9 A;  4FM2 A;  2LW1 A;  5LHH A;  2Q8F A;  2PI5 A;  2L35 A;  1YZB A;  2M6Y A;  3ICX A;  4I50 A;  5CBF A;  4MPE A;  3HB3 B;  4DK1 A;  2F43 G;  4X65 O;  2BZ5 A;  3AG2 B;  4L87 A;  1QLE B;  4R6Z A;  4P30 A;  2ZM6 B;  3UO3 A;  1UPG A;  5J2U A;  2ODM A;  4CS3 A;  1H2L A;  1R6T A;  3CEI A;  3G6E V;  4MPC A;  2XAH A;  2YE8 A;  3IGA C;  3G75 A;  3TZ4 A;  3B26 A;  1WNS A;  4JI0 O;  5KMG A;  1WLE A;  1MG1 A;  1KKD A;  3RLQ A;  2EUL A;  3G67 A;  4JI5 B;  4WFF A;  2QSA A;  1M56 C;  1DK1 A;  1GKF A;  1G6U A;  3CRM A;  5D7C A;  4NXN B;  1BZK A;  3F7Y C;  2YKB A;  3D8C A;  1G1X B;  1AMW A;  4UV9 A;  3CRC A;  2Q8I A;  3VQW A;  2QG0 A;  2GDS A;  1VEW A;  2C2A A;  1ENV A;  4EB6 B;  2YI6 A;  4AWO A;  2ZE6 A;  2NN4 A;  3K0D A;  5IDJ A;  5KMG B;  4A5U B;  5F5R A;  2CCT A;  4UFZ A;  2EIM B;  2OWO A;  1IBM B;  5D5P A;  3SYQ A;  1V55 C;  2DN9 A;  4MVM A;  2ILM A;  2IW5 A;  2XT9 A;  2P67 A;  1QVG U;  5FND A;  4UB6 Z;  5LMU O;  1AI4 A;  1SQG A;  1PKX A;  1NTK H;  2YEE A;  1VF7 A;  3T2S A;  4JI1 O;  2BSM A;  2JGU A;  3P3N A;  4U7N A;  2Q7G A;  2WAM A;  2WPD G;  2QM8 A;  2YGA A;  2QFO A;  4U93 A;  4KP4 A;  2O57 A;  4MTG A;  1AM1 A;  4CC6 A;  2UUA O;  1SC5 B;  1XMQ O;  1K4D C;  4CZZ A;  4ABM A;  2XK2 A;  2Y4U A;  4U7O A;  4WUC A;  1I7F A;  4NYK A;  3CC7 V;  4DR7 B;  3CRK A;  1VQK V;  2XHR A;  4H85 A;  4EFE A;  5GW7 A;  5KHH A;  3X2Q B;  5CA1 B;  4E2L A;  5B66 Z;  1VQP V;  3K5M A;  1O9G A;  3A0X A;  3SPH A;  3VQX A;  3CME V;  4DV5 O;  4K35 A;  2UU9 O;  3ASO B;  4URM A;  4FLZ A;  2Y48 A;  2VQF B;  1GMG A;  2H8P C;  4XIQ A;  3E35 A;  5EC1 C;  4NH8 A;  4TOI A;  4UVB A;  1AI6 A;  3LNM B;  4FM0 A;  1FAF A;  3TET A;  3WG7 C;  5B1B C;  2WI4 A;  1L0O A;  3W7X A;  2GQP A;  3CCM V;  3M7M X;  4RAI A;  1JCH A;  1I94 O;  4L93 A;  3JAT A;  3BMY A;  3SL2 A;  1QVF U;  1SQX H;  5CF0 A;  1YJ9 V;  1TC0 A;  1GKX A;  3K5N A;  2AW9 A;  1KU9 A;  2FYU H;  4CWT A;  4ICG A;  1ZLZ A;  3UT5 A;  3HZ5 A;  4URN A;  4XIP A;  4EM7 A;  4QIW F;  1NHH A;  5LBQ A;  3BRC A;  4YXW G;  3N2G B;  5BR8 O;  2ZDI C;  3OGC C;  4G28 B;  1YIT V;  4IYI A;  2AXT Z;  1YTF D;  2PYL A;  1ZAU A;  2CH7 A;  2KSD A;  2LO1 A;  4O4H A;  1WB7 A;  3JD3 A;  4CBC A;  5L3C A;  2EIJ B;  2DMX A;  2ITD C;  1FXK A;  1XOU A;  3RYH A;  5CA3 A;  4UVC A;  3SGI A;  3RVZ A;  3OTF A;  4RQF A;  3STL C;  2DYS C;  2IJI A;  3CP1 A;  5LOV A;  3RW0 A;  3BHP A;  2CDY A;  2X0L A;  3ZN0 A;  4LWE A;  1EBO A;  2DW4 A;  2F4V O;  1OCO B;  3QDD A;  1KC8 W;  3G71 V;  2FWZ A;  2DOS A;  4MVU A;  4ZHQ A;  4B3T O;  1NKD A;  2JJC A;  1AP6 A;  1SQV H;  3F5W C;  2XAF A;  3O0I A;  2C1G A;  2YKJ A;  1GM7 A;  2EX3 A;  4PI2 A;  5LGU A;  1OCR B;  1Z5C A;  3E8G A;  4FLW A;  2YGF A;  3ZS8 C;  2HJF C;  1Y74 A;  3UKM A;  2CH7 B;  5TIS Z;  1RM1 B;  2QM4 A;  1YT2 A;  4PHZ A;  2BCC H;  1IDS A;  2ZIN A;  2ZNJ A;  5B3S B;  1N34 B;  1VF5 B;  4DUY O;  1QR8 A;  1I5C A;  2KQX A;  1J5E B;  2XUM A;  4B08 A;  3A8T A;  1VQ7 V;  2PI4 A;  1GN3 A;  2DQ3 A;  3CGZ A;  2WLL A;  4LF7 B;  4NXM B;  1K5S A;  1JX9 A;  3G4S V;  1UYC A;  5M4H A;  4ZHQ B;  3HR0 A;  3A2F A;  4DRX B;  1Y6X A;  2JGD A;  2CAZ C;  3TCU A;  5JH7 B;  3ETD A;  1NZ6 A;  2JIZ G;  2LQT A;  4LFA O;  2IJJ A;  2B1I A;  3DC6 A;  1CPY A;  4FLY A;  3IC9 A;  1Q6H A;  2VQF O;  3H1K H;  3JAW B;  3AG4 B;  2XD6 A;  1DLB A;  4GZR B;  2KB1 A;  1OZ0 A;  2JS5 A;  4LNU B;  2CCS A;  3ABL B;  2ADP A;  2YSU B;  5CMU A;  2FXS A;  2YI9 A;  1VQN V;  1SZT A;  4BW5 A;  2YI7 A;  3I5D A;  4O4J A;  2WLL B;  3AG3 B;  2QTS A;  3MD0 A;  1JJO A;  1GN6 A;  3E89 A;  1FJG O;  3L73 H;  4OXS A;  1BHA A;  2WEQ A;  2WI1 A;  2A0L A;  2ZD9 A;  1OHH G;  2JGD B;  3VBB A;  4FFB A;  4XTJ A;  2KG7 B;  3JD2 A;  2QTO A;  2XAG A;  3JSN A;  3G6B A;  4JYB A;  4G27 B;  2JJ1 G;  4ZVI A;  2HVJ C;  2XJJ A;  4ZOL A;  5L3J A;  3ABU A;  2EIK B;  4XCL A;  1JQ0 A;  3ZBH A;  4MP2 A;  4NB5 A;  2YEV A;  5IY5 C;  2HG1 A;  2YDE A;  2W0X A;  1YES A;  3ZM7 A;  4D6T H;  1M9N A; 
#chains in the Genus database with same CATH homology
 3LSS A;  3CCJ V;  1VQM V;  4LWF A;  1Z5B A;  5CTW A;  4O09 A;  2E0A A;  1F23 A;  3ZMV A;  3FB6 C;  2YE6 A;  3FYE B;  5IYC O;  2YJW A;  4MW8 A;  4GCZ A;  4EEH A;  1K9M W;  2XND G;  4LBE C;  2YEV B;  1I59 A;  3E86 A;  3OMN B;  4PA4 A;  5H6R A;  2H55 A;  4GT1 A;  4P8O A;  5BOC A;  1VQ5 V;  1EA6 A;  4MVZ A;  1KZN A;  3GIG A;  3NMQ A;  4L94 A;  4EFU A;  4UXN A;  4BAY A;  5M4E A;  3EHH A;  4GQT A;  1COW G;  1NJI W;  4MSW C;  2DYR B;  4KUM A;  3D36 A;  3OW6 A;  1AI7 A;  5GGZ A;  4H33 A;  4JPR A;  2UWD A;  1K92 A;  3GIG B;  3K04 A;  3B28 A;  2BYI A;  1UYD A;  3CCU V;  3OEE G;  3GIE A;  1N8R W;  4GFN A;  5H6Q A;  2IOP A;  4XKA A;  4YKX A;  4XDL A;  4EKW A;  2UXX A;  4TT3 G;  4HXZ A;  1ZWI C;  3K99 A;  4HXW A;  2YI5 A;  1GKZ A;  2EIN C;  3CCE V;  2YK2 A;  3ZKD A;  1VQ8 V;  3K08 A;  3ZMS A;  4PA3 A;  3EKR A;  3OW2 U;  2WI3 A;  3D0B A;  3B8N A;  2ZQM A;  2Y69 B;  3A0Z A;  3ZJZ A;  4JQL A;  2GSM B;  3QO8 A;  3T1K A;  5DN6 G;  2YEB A;  4JTA B;  2WI5 A;  1BGQ A;  2PNR A;  2LFS A;  3E83 A;  1Q81 W;  4MTX A;  1PD3 A;  1MAB G;  2GFD A;  1E79 G;  1YC3 A;  2NLJ C;  3TZ5 A;  2YEG A;  4FPP A;  2XAQ A;  3T0H A;  1AJ6 A;  4BQG A;  5CTX A;  2XOK G;  3A0W A;  4NH9 A;  5LGN A;  3CCS V;  5B1O A;  1V54 B;  2YE7 A;  4DO2 A;  1YTF B;  4PDR A;  2DWE C;  4CWR A;  5LHG A;  3R4M A;  3W7S A;  2IH1 C;  3LDE A;  3R91 A;  2YE2 A;  2QF6 A;  2B1G A;  1CEZ A;  1Z59 A;  3W7U A;  1VQO V;  5LGT A;  4BXI A;  4I5S A;  1QYE A;  1QR9 A;  3P32 A;  1K5Q A;  3EHJ A;  1VQ9 V;  1U2O A;  3RLP A;  2XDK A;  1AJN A;  3ZRV A;  2JEX A;  1GM8 A;  4YKZ A;  3SYC A;  4UVA A;  1B63 A;  3T2M A;  1Y4U A;  4RO2 A;  3LPS A;  1S16 A;  2VCJ A;  1YS3 A;  1NQT A;  3M99 B;  3HYY A;  1KP2 A;  2QM7 A;  4XCJ A;  2WSS G;  5B1A C;  4P2Z A;  1BHB A;  1IXM A;  2AHY A;  3B25 A;  1UJW B;  5CTU A;  4X8A A;  2WLJ A;  4MVO A;  2HR3 A;  1R3I C;  1OSF A;  4E02 A;  2K5B A;  3I56 V;  3W7W A;  2BYH A;  3Q5K A;  2P6J A;  2EBO A;  4WF9 V;  1UYG A;  4PEL A;  2JEU A;  3GIF A;  2LFR A;  1BKN A;  4QJF B;  4ASU G;  2IOQ A;  4EMV A;  1MOF A;  3T4D A;  2YE9 A;  3OWB A;  4PRV A;  3OM3 B;  1H8E G;  2XAJ A;  4KSG A;  4R8C A;  4CWF A;  4B6C A;  4BIZ A;  3SPI A;  5KA5 A;  3A0T A;  1YIJ V;  3FT5 A;  1G8M A;  1K34 A;  4FK5 C;  5IDM A;  1B62 A;  2YEH A;  4LPB A;  3CD6 V;  1W0K G;  1H38 A;  3T10 A;  4MVQ A;  3QTF A;  4GX1 A;  4J9Z B;  3B8M A;  3WHA A;  1NR1 A;  3H80 A;  1AR1 B;  3CCR V;  3BM9 A;  1TUE B;  3B77 A;  2WWW A;  3LDD A;  4H37 A;  4P9P A;  3X2Q C;  4MBC A;  3G7B A;  5M4P A;  1QLN A;  5IYB O;  3ETG A;  3VOU A;  4UUJ C;  2YEF A;  3AG1 B;  1THZ A;  1BL8 A;  1YSZ A;  3KG2 A;  1LNQ A;  3WG7 B;  2JJ2 G;  1EI1 A;  2EZP A;  3VAD A;  4QPJ A;  3R92 A;  3RVY A;  4X89 A;  3INX A;  5FNC A;  3SJQ C;  4JAS A;  1S3J A;  3PEH A;  2EIJ C;  1YC1 A;  2WLK A;  4MPN A;  2WI6 A;  4AS9 A;  1OCC C;  3R4N A;  3SPJ A;  3K97 A;  1K8A W;  1MX0 A;  1H7U A;  1AH8 A;  1OCZ B;  1R6N A;  4R50 A;  4KTN A;  5L3B A;  1NH2 D;  5F3K A;  1OCO C;  1Y4M A;  2OCC B;  1FXH A;  3BEH A;  1NR7 A;  4BAE A;  1OCR C;  2HLD G;  2Z3Y A;  1RM1 C;  1DTO A;  3HZ1 A;  1I58 A;  4CWP A;  5B3S C;  3OPD A;  4W7T A;  3IED A;  1FXK C;  3OUS A;  1JVM A;  5KUM A;  1CP9 A;  3A0R A;  2WLM A;  4JAU A;  4LWI A;  4RUE A;  4URO A;  5E1A C;  1K73 W;  1YI2 V;  1S72 V;  3FB5 C;  2WLH A;  4EFT A;  2YJX A;  1AJP A;  1K4C C;  4CE3 A;  3LNU A;  4DUH A;  3G7E A;  1FXV A;  3OUF A;  3C11 A;  5EC2 C;  3ZRX A;  1Y8O A;  2V7Q G;  4WFE A;  1Y66 A;  2YE4 A;  4YKR A;  1G4Y B;  2BRC A;  4BQJ A;  4PA6 A;  2O1U A;  2CGF A;  3H4L A;  1TIL A;  3HEK A;  2ZKJ A;  1YT1 A;  5DM6 V;  1E1Q G;  2QE7 G;  2QA4 V;  4LCU C;  2IU0 A;  2X6B A;  1HWY A;  4MVS A;  2YKE A;  5HFM A;  2EIL C;  4PA7 A;  3CGY A;  3WQ9 A;  5CTY A;  2M7W A;  1DF5 A;  1U0Z A;  4L90 A;  4XIT A;  1I5Y A;  1FS0 G;  2EIK C;  2BU6 A;  2K1E A;  1AI5 A;  2H94 A;  2IWX A;  1I5D A;  4WFH A;  1S77 D;  2CCU A;  3CCV V;  5C93 A;  3K3W A;  3K9A A;  2ZBK B;  1R73 A;  3TK1 A;  3ZIA G;  3A0Y A;  4H81 A;  1R3K C;  3T1C A;  5L3G A;  2YKC A;  3OFN G;  1M1K W;  1EFR G;  2X6A A;  4H7Q A;  1L1F A;  3OE7 G;  1YSR A;  3CCQ V;  1SRY A;  2LP7 A;  4MOT A;  1PL0 A;  3ASN C;  1QZR A;  4HZ5 A;  4V26 A;  3QO5 A;  2NNU A;  2EXL A;  3WFV A;  4K4O A;  1AH6 A;  4GT8 A;  2DYR C;  1Q7Y W;  4PDM A;  5EBM C;  4YKQ A;  2FYP A;  1Y8P A;  1UYE A;  2O1W A;  4ZKI A;  3TZ2 A;  2IWS A;  4JF3 A;  2H8M A;  1ZW9 A;  1UYM A;  1GM9 A;  5HFL A;  4PDV A;  2CK3 G;  3D3I A;  4QPK A;  2DQ0 A;  3E8B A;  4N21 A;  4URL A;  3ZRW A;  2JDI G;  5FNF A;  5J9P C;  4LP8 A;  1YSC A;  2XX4 A;  4LWG A;  4DZY A;  3ABM B;  4E00 A;  5D6Q A;  3VHA A;  2YE3 A;  5EBW C;  5B1N A;  2Y69 C;  4YKY A;  4N23 A;  1MU5 A;  5M4K A;  1XL4 A;  3JZ3 A;  4RUF A;  1SER A;  2IWU A;  4O0B A;  3ZRW B;  3ABK B;  2HVK C;  2V1D A;  2UXN A;  2XHT A;  3D2R A;  1GK9 A;  4WFG A;  4XDM A;  1Q82 W;  3MNR P;  2Q68 A;  1NHI A;  1KIJ A;  2W6J G;  2BU8 A;  3OMA B;  3ETE A;  1V54 C;  4AWP A;  1JJ2 U;  3B27 A;  2BT0 A;  3HHU A;  2CG9 A;  2HCH A;  1TC6 A;  2IU3 A;  1YC4 A;  2HFE C;  3OAA G;  2ITC C;  2BOB C;  3IFX A;  4MS2 A;  4LP0 A;  2P7T C;  3SYP A;  1Z5A A;  5LHI A;  1NH2 B;  1Q86 W;  2HG5 C;  4ASG A;  2XAS A;  1K3E A;  1GO3 F;  1R62 A;  4ASF A;  3TZ0 A;  3OMU A;  4XC0 A;  1M57 B;  4JTC B;  4GEE A;  4JAV A;  3FB7 C;  1US7 A;  4JGS A;  2WER A;  2ZXW C;  2EZO A;  5KUK A;  2ESA A;  2YKI A;  1NVP D;  1TBW A;  2YED A;  4YKW A;  1XL6 A;  2IJK A;  3E2E A;  1K33 A;  2XDX A;  2EJR A;  1ZXN A;  5L3E A;  3IC7 A;  3K98 A;  3B24 A;  1EZJ A;  3UM7 A;  4MP7 A;  1MSW D;  3C0E A;  3W7T A;  3AG2 C;  1KD1 W;  1QLE C;  4E01 A;  1YHQ V;  4R3A A;  3TTZ A;  2BU7 A;  4XBF A;  2IH3 C;  3SPC A;  1E1R G;  4DXW A;  2FWY A;  3SYO A;  2BRE A;  1S14 A;  3RKZ A;  1ID0 A;  4EGK A;  4R3M A;  3JCZ A;  5CBG A;  1Y8N A;  2X7R B;  1ARO P;  2Q6A A;  2OTL V;  3K0G A;  4FCR A;  2JK5 C;  2AHZ A;  3INW A;  1M56 B;  3PJS K;  4L8Z A;  5CN0 A;  2Q2E B;  4ASB A;  2OTJ V;  4KQV A;  3Q5J A;  4XD8 A;  3ZRS A;  4PRX A;  4Q20 A;  5IYD O;  1K97 A;  1SES A;  4KFG A;  1FFT B;  4WUD A;  4QE9 A;  2WI2 A;  3STZ C;  3OWD A;  2O1V A;  3CWV A;  2EIM C;  5IN9 A;  1P7B A;  1B6Q A;  4KFM A;  1H2G A;  3CC2 V;  5D7D A;  1TID A;  3VHD A;  4L91 A;  4O04 A;  2XCM A;  1V55 B;  1F51 A;  3U2K A;  1UY8 A;  4GGL A;  1YJN V;  1YET A;  2WEP A;  2BU5 A;  4HY1 A;  1BXD A;  2R9R B;  2AKP A;  4O05 A;  3EHB B;  4FCQ A;  3ASO C;  3EHF A;  3GWO A;  3GB7 C;  2ZDI A;  4RQE A;  4EGH A;  1QBZ A;  2QG2 A;  5M4N A;  2YGE A;  1UY6 A;  3HPL C;  3AG1 C;  2Q8H A;  4HY6 A;  5B1B B;  3QO7 A;  1UYK A;  1DF4 A;  3JD4 A;  1UY9 A;  4I3H A;  2YEI A;  1R3L C;  4Z1M G;  4CWO A;  2HKO A;  1GTO A;  1AJQ A;  3U2D A;  2DWD C;  3ZN1 A;  2Z5U A;  2YK9 A;  2FTK A;  4WCE V;  1M90 W;  2VWC A;  4HYP A;  3VHC A;  1R6K A;  4FMT A;  1OCZ C;  2QKS A;  4X88 A;  3R4P A;  4R1F A;  3ZMU A;  1OCC B;  2DYS B;  1JPX A;  4WUB A;  4FCP A;  2OCC C;  4GX2 A;  3H01 A;  3K60 A;  3T0Z A;  1J95 A;  1PNL A;  1KEC A;  2WI7 A;  4MTF A;  2XX5 A;  5EK0 A;  2ZR2 A;  5EBL C;  4CE2 A;  1QCE A;  1UYI A;  3EHG A;  3BY6 A;  1FXK B;  4CWS A;  2A79 B;  4G2K A;  3ML0 A;  3HYZ A;  4I9W A;  2XAB A;  4XDJ A;  1ROP A;  5M4M A;  2BTZ A;  2YI0 A;  4HZ0 A;  3QNE A;  2XDS A;  3K06 A;  3AG4 C;  1SET A;  4MB9 A;  1QY8 A;  1VQ4 V;  4PL9 A;  3ABL C;  5CBH A;  1PNM A;  2OT5 A;  3KE6 A;  3ZKB A;  3P30 A;  1JOY A;  3AG3 C;  5H9C A;  1YJW V;  4O07 A;  4XE2 A;  2YE5 A;  3E8H A;  1ZXM A;  3ZCC A;  4EGI A;  3CRL A;  3MHH C;  2XJX A;  1W2B U;  1BYQ A;  4XKO A;  2R9I A;  3ZMT A;  4MTO A;  5D7R A;  2A9H A;  5J6A A;  3CXC U;  2EIL B;  1K7D A;  3FYI B;  4KSH A;  4HYO A;  3Q5L A;  2ZDY A;  4MT8 A;  3NXS A;  4JTD B;  3K79 A;  4JYC A;  5IY5 B;  4AWQ A;  3CMA V;  1S0V A;  1NVP B;  4FJC C;  1I5X A;  2QEX V;  3CC4 V;  2YEC A;  2VCI A;  3ZXO A;  5L3D A;  2VW5 A;  4YKT A;  4NH7 A;  3RLR A;  3TUH A;  1I5B A;  1PVG A;  2Q69 A;  3K03 A;  2HKJ A;  1ORQ C;  2IOR A;  4LC1 A;  5FWK A;  4TSF G;  4V25 A;  3LDC A;  2CH4 A;  3OEH G;  2XX2 A;  1RPO A;  1YER A;  1UYH A;  3DGE A;  2WLI A;  4FIP C;  3F7V C;  3ASN B;  3FB8 C;  3LSQ A;  1JM6 A;  5D6P A;  2XJG A;  3T4Z A;  3FV5 A;  2D3O W;  2ZDX A;  1B3Q A;  1KP3 A;  3DTU B;  2Q67 A;  4MVR A;  3EFF K;  1R3J C;  1YT0 A;  5BZB A;  4CWN A;  4CWQ A;  5BOD A;  2P90 A;  3ZXQ A;  1NHJ A;  2WLI B;  2ZR3 A;  1PNK A;  5KA6 A;  4UV8 A;  4WFA V;  4HZ3 A;  1UYL A;  4ASA A;  1ZWH A;  3SYA A;  4TWK A;  3PEJ A;  2YEJ A;  5L3F A;  3ABM C;  2EIN B;  4GX0 A;  4HAM A;  3I55 V;  1H8H G;  3MHS C;  4X9L A;  1F4N A;  4XDK A;  1BMF G;  3ZMZ A;  2W0F C;  3AEI A;  1UY7 A;  3FKS G;  5CPH A;  3ABK C;  1VQL V;  4YKU A;  2WLN A;  2XDL A;  3FT8 A;  4B7P A;  1VQ6 V;  1KQS U;  2BU2 A;  1H7S A;  3SPG A;  2XDU A;  2MK3 A;  3JYC A;  3OR7 C;  4R7C A;  4ZBM A;  2XHX A;  4CE1 A;  5J71 A;  3OMI B;  2W6I G;  3CYO A;  3E8F A;  1WPX A;  1W0J G;  4QE7 A;  4WFB V;  3CPW U;  2X6C A;  1TH8 A;  2JKI A;  3O6O A;  4PU9 A;  1A4H A;  2ATK C;  3R4O A;  2YEA A;  1F4M A;  3EKO A;  4MW3 A;  2Q8G A;  1P4R A;  3ABT A;  4XKK A;  2BOC C;  4P7A A;  4PA9 A;  5FL7 G;  4HYM A;  4QNH B;  1THN A;  2B5U A;  4PDL A;  3U67 A;  3LUT B;  4J9Y B;  1M57 C;  4BIU A;  3CCL V;  3JD1 A;  4P9O A;  4GX5 A;  3R65 A;  1GJV A;  1Y4S A;  2IJH A;  1NBM G;  1S76 D;  1RPR A;  3OR6 C;  4LWH A;  3O2F A;  2ZXW B;  3RBZ A;  1I5A A;  4F4L A;  5B1A B;  1S5H C;  2GHY A;  1UYF A;  3JD0 A;  4XIR A;  5LHH A;  2Q8F A;  2PI5 A;  4MPE A;  5CBF A;  3HB3 B;  2F43 G;  2BZ5 A;  3AG2 B;  4L87 A;  1QLE B;  4R6Z A;  4P30 A;  3G6E V;  4MPC A;  2XAH A;  2YE8 A;  3IGA C;  3G75 A;  3TZ4 A;  3B26 A;  1WLE A;  1MG1 A;  1KKD A;  3RLQ A;  4WFF A;  1M56 C;  1GKF A;  5D7C A;  2YKB A;  3F7Y C;  1AMW A;  4UV9 A;  2Q8I A;  2QG0 A;  2C2A A;  1ENV A;  2YI6 A;  4AWO A;  3K0D A;  5IDJ A;  5F5R A;  2CCT A;  2EIM B;  3SYQ A;  1V55 C;  4MVM A;  2IW5 A;  2P67 A;  1QVG U;  5FND A;  1AI4 A;  1PKX A;  2YEE A;  3T2S A;  2BSM A;  4U7N A;  2WAM A;  2WPD G;  2QM8 A;  2YGA A;  2QFO A;  4U93 A;  4KP4 A;  4MTG A;  1AM1 A;  1K4D C;  4CZZ A;  2XK2 A;  4U7O A;  4WUC A;  3CC7 V;  3CRK A;  1VQK V;  2XHR A;  4H85 A;  5GW7 A;  3X2Q B;  4E2L A;  1VQP V;  3A0X A;  3SPH A;  3CME V;  3ASO B;  4URM A;  2Y48 A;  1GMG A;  2H8P C;  4XIQ A;  3E35 A;  5EC1 C;  4NH8 A;  4UVB A;  1AI6 A;  3LNM B;  3TET A;  3WG7 C;  5B1B C;  2WI4 A;  1L0O A;  3W7X A;  2GQP A;  3CCM V;  4RAI A;  1JCH A;  3SL2 A;  3BMY A;  1QVF U;  5CF0 A;  1YJ9 V;  1TC0 A;  1GKX A;  4CWT A;  3HZ5 A;  4URN A;  4XIP A;  4EM7 A;  4QIW F;  1NHH A;  5LBQ A;  4YXW G;  2ZDI C;  3OGC C;  4G28 B;  1YIT V;  1YTF D;  3JD3 A;  4CBC A;  5L3C A;  2EIJ B;  2ITD C;  1FXK A;  5CA3 A;  4UVC A;  3RVZ A;  4RQF A;  3STL C;  2DYS C;  2IJI A;  3CP1 A;  3RW0 A;  2X0L A;  3ZN0 A;  4LWE A;  1EBO A;  2DW4 A;  1OCO B;  3QDD A;  1KC8 W;  3G71 V;  2FWZ A;  4MVU A;  1NKD A;  2JJC A;  3F5W C;  2XAF A;  3O0I A;  2YKJ A;  1GM7 A;  5LGU A;  1Z5C A;  1OCR B;  3E8G A;  2YGF A;  2HJF C;  3UKM A;  1RM1 B;  1YT2 A;  5B3S B;  1QR8 A;  1I5C A;  1VQ7 V;  2PI4 A;  2DQ3 A;  3CGZ A;  2WLL A;  1K5S A;  1JX9 A;  3G4S V;  1UYC A;  5M4H A;  3TCU A;  3ETD A;  2JIZ G;  2IJJ A;  2B1I A;  1CPY A;  3AG4 B;  2XD6 A;  1DLB A;  2KB1 A;  1OZ0 A;  2CCS A;  3ABL B;  2YSU B;  5CMU A;  2FXS A;  1VQN V;  1SZT A;  4BW5 A;  2YI7 A;  2WLL B;  3AG3 B;  3MD0 A;  3E89 A;  4OXS A;  1BHA A;  2WEQ A;  2WI1 A;  2A0L A;  2ZD9 A;  1OHH G;  3VBB A;  4XTJ A;  3JD2 A;  2QTO A;  2XAG A;  4JYB A;  4G27 B;  2JJ1 G;  4ZVI A;  2HVJ C;  2XJJ A;  5L3J A;  3ABU A;  2EIK B;  4XCL A;  1JQ0 A;  4MP2 A;  2YEV A;  5IY5 C;  2HG1 A;  1YES A;  3ZM7 A;  4L93 A;  1M9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...