4KP4A

Deciphering cis-trans directionality and visualizing autophosphorylation in histidine kinases.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
ADDRTLLMAGVSHDLRTPLTRIRAYAETIYNSLGELDLSTLKELAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Visualizing autophosphorylation in histidine kinases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/signaling protein
molecule keywords Osmolarity sensor protein EnvZ, Histidine kinase
total genus 66
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4kp4A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4kp4A02
4XDMA 2Q8HA 5FNCA 3QTFA 3T1KA 5BODA 3EHHA 1OSFA 1TIDA 4ZVIA 4BQGA 2IWUA 3RLPA 2QM8A 4FCPA 2FTKA 3FT5A 2Q8FA 4L8ZA 2WI1A 2PNRA 5M4HA 4L94A 4HXZA 2YGFA 1YC4A 1I58A 3INWA 2IOPA 2YKEA 4XIRA 2XJXA 1U2OA 3RLQA 3G7EA 5M4MA 2GFDA 4XKOA 4NH8A 3BM9A 1YS3A 2BU2A 4YKXA 1THNA 5D6PA 3GIEA 4URNA 3ZM7A 4ASAA 2O1WA 4LWGA 1ZXMA 1MX0A 2XX5A 2YE7A 2H55A 2O1UA 3IEDA 2YJWA 4LWIA 2H8MA 1BYQA 1UYEA 3CGZA 4YKUA 2BZ5A 2FXSA 4URLA 2EXLA 4U93A 3HZ1A 2JKIA 2O1VA 4GT1A 4NH7A 2YI5A 1F51A 3VADA 4JASA 1UY9A 1GKZA 4O09A 1UY8A 3K97A 2ZDXA 2XK2A 2BU6A 2XHXA 4FPPA 4AS9A 2XDSA 4O0BA 2E0AA 4GGLA 4ASBA 1UY6A 4LP0A 5CTUA 4URMA 3TUHA 3OPDA 2YI6A 4HY1A 4E02A 2YK2A 5D7CA 2QM7A 3R4OA 4E01A 2BU5A 5M4EA 2WEQA 4BXIA 2WI2A 1BGQA 4Q20A 5C93A 4R1FA 1B62A 4YKYA 2XJJA 1QYEA 2QFOA 5M4PA 3BMYA 4GEEA 4HZ5A 3D0BA 3SL2A 3G75A 3VHCA 3T0HA 1AM1A 4YKTA 3CRLA 3ZRXA 4L93A 4MP7A 4YKRA 1R62A 2XDLA 3R91A 3LNUA 2LFRA 2YE9A 3A0YA 4HY6A 4XE2A 2WI7A 3TZ5A 4JAVA 2HCHA 3Q5LA 3MNRP 3KE6A 5J6AA 2YGAA 5FWKA 4XCJA 4MTXA 5B1NA 1U0ZA 1YC1A 5CF0A 2WWWA 4KSGA 4EFUA 2XX4A 4I5SA 4U7NA 4R3AA 1TILA 4HYMA 4FCRA 1IXMA 1YESA 3EHGA 3U67A 3B27A 3P32A 1I5CA 2WI4A 3CGYA 1TC0A 5CTXA 2XDXA 3EKRA 3HHUA 4CWSA 2WI5A 2XHRA 4XTJA 4PRVA 1Y4SA 2XDUA 2YKJA 1AMWA 4H7QA 4HZ0A 4O07A 3PEJA 4HXWA 5F3KA 3ZXQA 4O05A 4MBCA 4CE1A 4CWFA 2YKBA 3GIGA 4CE2A 4MB9A 3ZCCA 4KP4A 2VW5A 4KTNA 5FNFA 3WQ9A 1H7SA 1YERA 2BRCA 2IWSA 3ZRWB 2YEGA 3RLRA 4GFNA 3Q5KA 4EGHA 2YEEA 4BQJA 4WUCA 3HYYA 2YE8A 5BOCA 2ZDYA 3B28A 4U7OA 4K4OA 4MOTA 4HYPA 4CWTA 4GT8A 2AKPA 5IN9A 5D7DA 3A0XA 2QG0A 1A4HA 2WEPA 1NHJA 2QG2A 3TTZA 2UWDA 5D7RA 2ZKJA 3R4MA 2IWXA 2CCTA 1PVGA 2YEBA 2YKIA 3A0WA 1MU5A 2YE2A 5J71A 3RKZA 3PEHA 3FT8A 1S16A 4XKAA 4QPKA 3U2KA 1AH6A 3C0EA 1UYCA 4H85A 1L0OA 2IOQA 4PRXA 4P8OA 3TZ2A 4XKKA 1UYGA 3T0ZA 4JYCA 4EGIA 1UYHA 4PL9A 3LPSA 1JOYA 3INXA 4CWRA 1I59A 5IDJA 3O6OA 3ZRWA 4O04A 3O2FA 4KQVA 4EGKA 2YEAA 2YE6A 3VHDA 4BIZA 2Q2EB 4V25A 1NHHA 1YT1A 2YI7A 4WUDA 1H7UA 3ZXOA 1UYFA 1Z5AA 4MP2A 3OWDA 1KIJA 4AWQA 3QDDA 3NXSA 1UYLA 1TBWA 1Y8OA 2BYIA 3HEKA 2YECA 4JAUA 1I5DA 4B6CA 2P67A 1I5BA 4I3HA 1KZNA 3D36A 4W7TA 1ZXNA 2YE4A 2VCIA 2YI0A 1ZW9A 2XJGA 1BXDA 2YGEA 1ID0A 2BREA 2BSMA 3K98A 1UYKA 2YEIA 3HYZA 2BT0A 2CH4A 3OW6A 1NHIA 4XC0A 1YSRA 3CWVA 1UYMA 3GIGB 2FWYA 3O0IA 4XITA 2Q8IA 2VCJA 2JJCA 3EKOA 4B7PA 1ZWHA 4EM7A 2YEFA 2FWZA 4EEHA 1BKNA 2IORA 2BU8A 5M4NA 4LPBA 3CRKA 4GCZA 3R4PA 4MPNA 2K5BA 2Q8GA 2YE3A 5M4KA 5FNDA 1I5AA 3HZ5A 1EA6A 2BYHA 3G7BA 1YSZA 2C2AA 2FYPA 2HKJA 3T10A 3D2RA 1UYDA 2YE5A 4YKZA 4KFGA 2XDKA 3R4NA 1QY8A 4BAEA 3TZ4A 3JZ3A 4LC1A 3K99A 3ZKDA 4LWHA 4E00A 4MPCA 4PU9A 1TH8A 1GJVA 1UYIA 5B1OA 2BTZA 4YKQA 1B63A 2GQPA 4NH9A 1AH8A 3WHAA 2YK9A 4EMVA 2CCUA 4XIPA 4CWNA 1JM6A 1S14A 5CPHA 4GQTA 1YT0A 4L90A 4AWOA 3TZ0A 4X9LA 1AJ6A 4XD8A 4CWQA 2ZBKB 4CWOA 3A0ZA 4CWPA 2QF6A 3TK1A 3B26A 3C11A 3NMQA 2XX2A 1EI1A 5D6QA 4KSHA 4JQLA 2BU7A 1QZRA 4V26A 1GKXA 1YT2A 4BIUA 2YEDA 3U2DA 5F5RA 3DGEA 4ZKIA 3GIFA 3OMUA 5GGZA 2YKCA 4EFTA 1YC3A 4DUHA 5IDMA 2WERA 2YJXA 4FMTA 2XABA 3EHJA 4UROA 4AWPA 4FCQA 3ZRVA 3R92A 3B24A 2CG9A 2WI3A 4WUBA 4XCLA 2WI6A 2HG1A 2CCSA 4P7AA 1UY7A 1Z5BA 3FV5A 1B3QA 2XCMA 2VWCA 4H81A 5CTYA 4LWFA 4MPEA 1Z5CA 1US7A 3H80A 4QPJA 3K60A 3T2SA 1Y8NA 4XIQA 1Z59A 1Y4UA 2XD6A 3EHFA 4DZYA 3A0RA 5CTWA 4ASFA 4JYBA 3Q5JA 4LWEA 4R3MA 3B25A 3MD0A 1Y8PA 2ESAA 2CGFA 5L3JA 1YETA 3OWBA 2YEHA 3H4LA 3ZKBA 3A0TA 4YKWA 4ASGA 2XHTA 2YEJA 4L91A 2LFSA 1TC6A 3VHAA 4CE3A 4MT8A
chains in the Genus database with same CATH superfamily
1NH2B 2Q8HA 4DR3B 2WLIA 3QTFA 3UKMA 5LP6C 1TIDA 2P22C 3PN1A 3CWBH 4IHJB 3VQYA 1SQBH 3C3TA 2WI1A 2ZXWC 1K3EA 3FB7C 2HFEC 4L94A 1LR1A 3FAVA 1YC4A 3OGCC 1P84F 4G27B 5KHIA 2ZCEA 3AG1B 1VQLV 1VF5B 3SPHA 2IOPA 2YIAA 3UT5B 5IYZA 4XIRA 1U2OA 3RLQA 1Z5VA 4DV0B 1OCZC 3A2FA 4XKOA 1OCOC 3CP1A 3H1IH 1FFXA 2XAFA 1IVSA 4FLVA 4H33A 3CCLV 4YKXA 4CZZA 2EZOA 2LW1A 4EKWA 3ZMUA 1ZXMA 3K79A 3D36C 4QE7A 5EC2C 2BZ5A 4O4HA 1IZ3A 2JKIA 1HNXO 3FYIB 4EFEA 5DECA 5LA6A 2IU0A 4Z1VA 4GT1A 3JD3A 1VF6C 4K8XA 3VADA 2Q8VA 3ZHQA 4IGGA 1SQQH 3C90A 3FB6C 2XHXA 4FPPA 1TAEA 5CMUA 4JGSA 4FJCC 3CSXA 4O0BA 4GGLA 3S3WA 3CC2V 3ABLB 2IJKA 1M57C 2E75B 2YI8A 2BCCH 2YK2A 5D7CA 1WP7A 4E01A 4BXIA 4RUFA 4A5UB 2WI2A 3GWKC 5GW7A 4ZI7A 4GKJO 1B62A 4R1FA 2JRIA 2XJJA 3GB7C 1MZFA 3BHPA 3BMYA 4HZ5A 3D0BA 2EJRA 1XL6A 1TGOA 3FD9A 3CRLA 3T1HO 4L93A 4ZIBA 2FL4A 4YKRA 4LF4B 1R62A 2XDLA 2WLNA 1NTKH 1BMFG 1BHBA 2YE9A 2FB5A 2QWQB 1OHHG 2MK3A 1DTOA 1XHXA 3HKEA 2WI7A 4X88A 1K8AW 2EIKB 4LFAB 4JAVA 1YZBA 1OCOB 2HP8A 1V54B 4R6ZA 2EILB 3F7VC 1AI6A 3OW2U 3ABTA 2EBOA 4EB6B 4LWSB 1YC1A 4UVCA 4ZI7B 2N04A 1TUBA 5CF0A 1S5HC 4DV4O 4KSGA 4I0XB 4EFUA 3OR7C 1KP3A 2ZQMA 4MW3A 4FCRA 2QR4A 3BAAA 3G80A 5KA5A 4JI8O 1IXBA 1XEQA 1I5CA 1L0LH 4NYKA 3RW0A 3EKRA 1JQ0A 1U97A 4QJFB 4JI2O 2HVJC 2EJ7A 4PRVA 1YITV 2P4VA 1EN5A 2HHIA 4H7QA 1SQFA 3ZHSA 3S3XA 4X20B 2A79B 2DYSB 1CP9A 3F5WC 2QGNA 4EB6A 1KQSU 4O05A 2Q9LA 4NB5A 2ZM6B 5ITZA 5JQGA 3B8NA 4KP4A 1VQ6V 1H2GA 5FNFA 1AI7A 3WQ9A 1H7SA 4NTXA 4FFBA 3ZRWB 1Y67A 4TV9A 3E89A 2R9IA 1BQ0A 2X6AA 2WLIB 4MW8A 4TOIA 5LGNA 3OEHG 4PI2A 3OUSA 3E8GA 4MOTA 3ICXA 5CA1B 2AKPA 4Z2WA 4TWKA 1SRYA 4G2KA 2XT9A 3CPWU 3A0XA 4E4EA 4DO2A 1A4HA 5LGUA 3E86A 3SJBC 2NN4A 3SYPA 4W4LA 2UWDA 1YTFD 2GDSA 1GN6A 2HHHO 2BTQA 4X64O 3Q4HB 3WB0A 2M6YA 4LF8O 1PVGA 2YEBA 1FFXB 2WA3A 4JZGA 5EK0A 3JAKB 4JI1O 3T4ZA 1N34O 3PEHA 1PV0A 3FT8A 3JAMN 4XKAA 3JD4A 4JYYA 3RGBA 1PP9H 2ZT9B 4ABMA 4JTDB 4B3TO 1A32A 4P8OA 1US6A 4TQFA 3MDSA 4X65O 3SPCA 1RP3B 3GVMA 3INXA 4CWRA 1I59A 2LJ2A 1M93A 1NBMG 1AB3A 5DEDA 4DUYB 3ZN1A 1NHHA 1FS0G 1YT1A 2JEUA 1YDXA 1RSOB 2QE7G 2BTQB 4MP2A 4P2ZA 3BY6A 3ETDA 3E35A 3SYQA 4DV0O 2Q0OC 1N34B 3QDDA 3SJAC 1V9PA 1O9GA 2ZDIA 3K5LA 5B3SC 4NVPA 4X66B 3LSUA 4WFAV 1MZEA 2IBZH 2NR5A 4JAUA 2UXDO 4Z1MG 5JJJB 4W7TA 1RM1C 1ZW9A 3IC9A 1GTOA 1ID0A 4DV3O 2N74A 2BSMA 1UYKA 1AR1B 3K5MA 2EX3A 2M7WA 3CWVA 1UYMA 3GIGB 2FWYA 3O0IA 4XITA 4LH7A 2P6JA 2JJCA 1F4NA 5DN6G 1ZWHA 4QIWF 2JJ1G 2YEVA 4IHJA 2E76B 2E74B 3B09A 5LMNB 4NXNB 4MVSA 3OR6C 4MPNA 3R4PA 4O4HB 1OCRC 4DV3B 2K5BA 4JI6B 1I5AA 5LOVB 5J2TA 1EA6A 2JIZG 4DYLA 3AG3C 3UT5A 3UQ8A 2C2AA 2FYPA 2QWRB 4AQYO 3ABUA 2JGUA 2HKJA 1ZAUA 1K92A 1J5EO 3KKYA 2Q6AA 2D2CB 5KHHA 4CH3A 2YE5A 4KFGA 5FLXN 3K58A 3ZKDA 4LCUC 4LWHA 2Y4TA 4GKKB 2ILMA 1GN2A 1QU7A 3A8TA 4Q6GA 2P4KA 1AH8A 2EINB 4EMVA 3WG7C 3BA8A 4WFBV 2PYLA 4J11A 4LP8A 3K04A 1ZL8A 2XTAA 4GQTA 3T4DA 4WCEV 1SZTA 4IIJB 1AJ6A 4XD8A 1WA8A 3ZMTA 3BABA 4CH6A 2QF6A 3ASNC 5GTHZ 5CA1A 5BMVA 5L3BA 4DK1A 4QE9A 5D6QA 4KSHA 1K5QA 1R3KC 1GKXA 1XUQA 2RMKB 1XMOB 3RYIB 1H2SB 5B5EZ 5F5RA 2YS8A 1BE3H 3AK3A 3OMUA 2KG7A 3TJTA 4EFTA 1YC3A 3JD1A 3BCCH 1LUWA 5IYCO 2EIKC 4FMTA 2XABA 2WLLA 4DV4B 5LMUB 4NXMO 3ZRVA 5KX5A 3G67A 4FIPC 4WUBA 4J7JA 2QWNB 1UY7A 2ZDIC 1HNWO 2QKAA 1XDCA 2VWCA 4DRXA 4LWFA 1MA1A 4GLXA 2F93B 2LW7A 4BIOA 3T2SA 4YJ2A 3S5TA 4IYHA 1Y4UA 1I0HA 3A0RA 4DV5O 3CJHA 4X1IA 4JYAB 2F43G 4JYBA 3Q5JA 4LWEA 4R3MA 2VWKA 5JH7B 3E8HA 1BL8A 4XDLA 1YEWA 1NTZH 2DMXA 4B3RO 3OWBA 3K3WA 4AQYB 4ASGA 2XHTA 1K4DC 3JASB 2HKOA 3OTOB 2YEJA 2KKWA 5LHHA 1WB7A 4KXRA 4O4JA 4L91A 4LR3A 1BCCH 4ZOLA 4AILC 1PM9A 1XMQB 3BEHA 4HAMA 5BODA 2W0XA 4BQGA 2QM8A 2JS3A 1NKDA 4WFHA 2OWOA 1I5YA 5KHGA 4J7ZA 5IWAO 2YEVB 1FD9A 3OD4A 4LNUA 2DWDC 2PNRA 5M4HA 4BW9A 2X7RB 2OCCC 4UCSA 4HXZA 2YGFA 1I58A 3INWA 5LXTA 2QKSA 1WB8A 3A0BZ 4DR3O 4TSFG 3K0GA 4PDRA 1Q7YW 5EBMC 1V54C 1NVPB 2AZ0A 4CS3A 4NH8A 3BM9A 1YS3A 2BU2A 1THNA 2Y69C 4D6TH 4O4JB 4LFCO 4LWGA 4B08A 3ZMZA 3G4SV 2YE7A 5BR8B 4BAYA 2O1UA 1BYQA 3O65A 3RYHA 4FZ1A 1SQXH 1N32B 2EXLA 3LNMB 4U93A 3HZ1A 5E79Z 4NH7A 2YI5A 1UY9A 1GKZA 1YHQV 1N36B 3IAYA 3FB8C 1I5XA 4QGPA 1K73W 4JI8B 3K97A 2F4VB 2WPDG 4JI5O 2XK2A 1XQ8A 3B8MA 3TGUH 1P7BA 4XBFA 1RSOA 4P9PA 1TVKA 4U3JA 4LFCB 2ZINA 1R3JC 1YJNV 1H38A 1GM8A 1UFIA 4URMA 3OPDA 2RNBA 1JJOA 3DTUB 3LDCA 1VEWA 1MSDA 4PA4A 2YI6A 1QBZA 1PNMA 4R8CA 2BU5A 2IU3A 5M4EA 2DYRB 3L74H 2Y0PA 5C93A 3UM7A 1HNZO 5IY5B 4X65B 5M4PA 1QYEA 2UUAO 3H1LH 4MVUA 3SL2A 3G75A 1PD3A 2UXDB 1Z5WA 1WA8B 3IC7A 3ZRXA 4MP7A 3U11A 4JF3A 4PDMA 1FXVA 2LFRA 2AHZA 2OT5A 1SQVH 3P3PA 4XDJA 3A0YA 2DN9A 3M8AA 1W0KG 3K57A 1BSMA 3MHHC 4DV1B 3MNRP 1IBKB 4CC6A 5D5QA 2YGAA 5FWKA 4XCJA 2Q67A 4GX2A 4PA6A 3L71H 2OIEA 2Y48A 5JCOA 2WWWA 2Q0AA 2HG5C 1Q8IA 1QVFU 4X1YB 4GX1A 1GO3F 2ZKOA 1WJZA 2UXCB 4LBEC 3CGYA 1TC0A 2CAZC 3T1CA 4UCVA 4J41A 2LP7A 3HHUA 2WI5A 2WA4A 2XHRA 3CCVV 1URFA 2ZNJA 3DC6A 2XDUA 2YKJA 2L6LA 4HZ0A 2ZM6O 3AG4B 1M1KW 3K9SA 4IIJA 5HFMA 3OMNB 5F3KA 1EBOA 2MW2B 2BSKA 3EVKA 4DR1O 4O4IA 4MBCA 3GIGA 2NNUA 4CE2A 1YTFB 4EEQA 3U0ZA 2Q73A 4KTNA 1N0NA 2JK5C 1BGYH 2BRCA 4LH6A 2CE4A 4OGQB 3I56V 3N27A 3OMAB 5LMNO 3HKCA 4DR6O 4W4KA 4EGHA 5IYZB 4RUEA 5JQGB 4U7OA 4K4OA 4LWSA 2EZPA 4DR4O 1JFFB 3B40A 4CWTA 5JVDB 4F6RA 5IWAB 3K5NA 1U96A 2RCVA 3HKDB 4X8AA 2LGQA 4EFBA 4FM2A 2UU9B 4J42A 3CMAV 2WEPA 4ASUG 3CB2A 1BS3A 2QG2A 4PDLA 2JGDB 1VP7A 1WP8A 3R4MA 1MNGA 2QA4V 3SYOA 2YKIA 2QTSA 3HKBA 4JI0O 2OIGA 4DV2B 3RKZA 1RFYA 2WSSG 1S16A 1R73A 2JDIG 1EM1A 3EHBB 4FFKA 3U2KA 3OEEG 1Z2GA 1QHTA 2PZSA 2V4DA 4O4LB 2QSAA 1Y76A 2R9RB 2C1IA 1GH6A 1OZ0A 3T0ZA 4EGIA 4FZ0A 4PL9A 4X1KB 4DUYO 2XUMA 3H1HH 3I5DA 1Q82W 3BA9A 3ZRWA 3HKEB 1RM1B 2A3QA 4U3JB 3VBBA 2YE6A 2P06A 4NXNO 4WUDA 4N23A 3CHXA 3K03A 1Z5AA 4IL6Z 1JJ2U 1ZWIC 3OWDA 4J80A 4O4IB 1M5IA 2JS5A 2XAHA 4L8JA 3AG2C 2JEXA 1NVPD 5B1AC 4DW1A 4H37A 1DK1A 4B6CA 2P67A 1FAFA 1KZNA 2ITDC 1ZXNA 2H3OA 4DV1O 3F5TA 1NJIW 4AI8A 4GKJB 1BXDA 5IYBO 4UFZA 4I55A 4KL1A 3AEIA 2Q5ZA 2BREA 3BVOA 2YEIA 3L70H 4ZOLB 2CH4A 3OW6A 4JV5B 4XC0A 5EZYB 1Q43A 5ITZB 1IX9A 2HVKC 5A9GA 3LDDA 4B3SO 2P5OA 4DR4B 2OCCB 2QEXV 1JPXA 2CDYA 2ZR3A 1K97A 3KCYA 4UVAA 3CRKA 4HBNA 2YE3A 5M4KA 4KHPB 1I7FA 2ATKC 4JV5O 1WPBA 2AXTZ 4NXMB 2AHYA 3OE7G 4GX0A 1VQ8V 3L73H 3AK2A 3T10A 2XAGA 1UYDA 5BY1A 2XDKA 4OPAA 3R4NA 4BAEA 1X59A 2OTJV 1WLEA 1SS3A 3P3NA 3TXQA 2QWPB 4MPCA 4PI0A 1F23A 4RO2A 3DXRA 1AI4A 5CBHA 1VF7A 4J9YB 2UUBB 1KMIZ 4DRXB 2PGGA 2LO1A 1B63A 4NH9A 1YSCA 2B1GA 2BOBC 4JYAO 4X62B 3RYCA 4XIPA 3STLC 3W7WA 4CWNA 2PI5A 2E3CA 3HB3B 2KB1A 1YT0A 2AW9A 3TZ0A 5LHGA 1IBLO 1XHZA 4CWOA 3J7AU 4DV7B 1Q6UA 3C11A 5CA3A 2Q68A 3NMQA 4LF7O 1JA8A 4F6RB 3JAKA 5FPRA 2DWEC 4JQLA 5KHKA 4B3SB 4CC5A 4BIUA 2JGDA 4JI5B 3SPGA 3K06A 5B1BC 3ZX6A 1IDSA 4GX5A 1BHAA 2CUGA 3R65A 5IDMA 2WERA 1YF2A 2ZE5A 4O2AB 2YJXA 4PA3A 1EFRG 1JCHA 4AWPA 2VQFO 2CG9A 1THZA 5L3DA 3UCSC 4XCLA 4DV6O 2HG1A 2Y0IA 2CCSA 3FV5A 1K4CC 2XASA 4JI7O 1VQOV 1US7A 3UO3A 3C3SA 3K60A 5H2FZ 1Q81W 4XIQA 2XHBA 3MHSC 1N0JA 4LF5B 1MG1A 3ZHUA 1PKXA 3SJQC 5L3EA 3CMEV 2H8PC 4X20A 3W7TA 1Y8PA 2CGFA 1XOUA 1GRJA 2YEHA 3ZKBA 1PNLA 2CH7B 1OCZB 1IBLB 4YKWA 3O9OA 3OFNG 4YIPA 1K7DA 3SPIA 1TC6A 2UXBB 2Y69B 4OXSA 4IYIA 2VQFB 4MT8A 4R50A 4TV8B 3T1KA 2HLDG 3EHHA 5FL7G 1SA0B 1F7YA 3BFRA 4G28B 2DW4A 4YJ3A 4FCPA 3VQWA 3ASOB 3SR2C 2FTKA 3FT5A 2Q8FA 2ODMA 1YJ9V 4ICGA 4JTCB 2WLLB 1B06A 3CCUV 1VQ4V 3SGIA 2YKEA 1MOFA 1S76D 2XJXA 2LQTA 5JH7A 3G7EA 2W0FC 5M4MA 2GFDA 4H44B 5BZBA 2XNDG 5D6PA 3GIEA 4YJ2B 3N2GB 4ASAA 2O1WA 1MX0A 2YIBA 1L1FA 2XX5A 2EIJC 3JSNA 1XMQO 3IEDA 1XI1A 3VQVA 1UYEA 2IW5A 2Q69A 2BE3A 2O1VA 3ZMSA 5J2UA 4DR5B 4JASA 2WLMA 2DQ3A 1H2KA 1UY8A 1S5LZ 4PDVA 4NTYA 4WBNB 3E2EA 2ZDXA 2BU6A 1BZKA 1D5NA 3LMMA 3E8FA 1AP5A 1Q90D 3THOA 4YY3B 4AS9A 3JARB 2E0AA 5IJ9B 1UY6A 4LP0A 3TUHA 3B4SA 4HY1A 1CPYA 2QM7A 1V55B 3SJCC 2ZE6A 3FKSG 2CGNA 3R66A 2WEQA 3UO2A 3L9DA 1BGQA 4Q20A 3CYOA 4YKYA 2QFOA 5C8YB 5K1XA 3VHCA 5IT9N 2YI9A 5LA6B 3D3IA 5LXTB 3T0HA 1AM1A 4YKTA 2KSDA 2IJHA 1H2LA 2LGWA 2C1GA 1GKFA 1W0JG 3CRQA 2CTPA 4FK5C 4FVMA 3LNUA 4UV9A 3WB2A 5B3SB 4PA7A 4WFEA 4ZBMA 5B1AB 1KC8W 1JX9A 1NI8A 4GKKO 3TXSA 2ZD9A 4CS4A 1VQ5V 4XE2A 1FXHA 3ABKB 3TZ5A 5IJ9A 2HCHA 3Q5LA 3AG4C 5H6QA 4DXWA 1RPRA 2IH3C 4UCUA 3RVZA 1K34A 3PJSK 3JYCA 4I4TB 1CEZA 1U0ZA 1QLNA 2RDCA 4GZRB 2R72A 2O57A 4MTFA 4YY3O 1SERA 1OCCB 1HDJA 4MS2A 3ZN0A 2QM4A 4GUNA 5LYJA 2XX4A 4H0LB 3BRCA 1TILA 4KHPO 1IXMA 1YESA 1XREA 4YHHO 4FM1A 3LSSA 3EHGA 3U67A 1PPJH 3B27A 3P32A 2WI4A 2YDEA 5CTXA 5DM6V 2ITCC 3RN4A 4CWSA 2FKXA 3J81N 1Q86W 1VQNV 3ABKC 4XTJA 1Y4SA 4X1YA 1AMWA 4OX9O 1LUVA 4O07A 4LFBB 3STZC 4UV8A 2YIBD 1CXZB 1AROP 4CE1A 4MB9A 3GWOA 3ZCCA 3H1KH 4CH5A 4DR2O 3IFXA 2VW5A 1I94B 2F66C 3CCMV 3ZRSA 2F4VO 1YVWA 4MVRA 3JATA 1N8RW 4GFNA 3RBZA 3CRAA 5EC1C 4DUZB 2YEEA 2GUZA 4UB8Z 4TV8A 1SQGA 4MSWC 2Z0AA 2G38A 2YE8A 3HYYA 4MVMA 1DGSA 3QG5A 5EBLC 4WUCA 4L87A 1G6UA 2VQEO 4HYPA 4GT8A 3M7MX 5D7DA 1EZVH 5LBQA 1KP2A 3E22B 1NHJA 3RYHB 2WLJA 4DV7O 2Q7HA 5D7RA 2YXLA 4KUMA 3RYFB 3J80N 1DF4A 5FNVB 5GONA 1S77D 3A0WA 3JATB 1MU5A 2YE2A 3JD0A 1S72V 1XL4A 1SESA 3CCQV 2DE0X 1R3IC 4QPKA 4DR6B 3SPJA 1AH6A 4UXNA 1TVKB 3C0EA 4H85A 2ZNIA 1L0OA 4JI1B 1PL0A 3TZ2A 3QVNA 5J2UB 4XKKA 4NKGB 3KZIZ 3CCRV 4MTOA 4DR5O 1ZX3A 3LPSA 4HZ3A 1BT8A 1JOYA 5EBWC 3ZHTA 2DYSC 5BR8O 5IDJA 3BPZA 1D5AA 3O6OA 4O04A 4MVQA 3O2FA 4KQVA 4EGKA 1N33B 2OTLV 2YEAA 4UCRA 4BIZA 5JCOC 2BOCC 3Q4HA 2YI7A 3T1YB 1SETA 1H7UA 2WAMA 2Z5UA 1I08A 2BTOA 1UYFA 3JSLA 5IJ0A 1KIJA 4AWQA 4B7KA 1AVMA 3NXSA 5B1BB 4JTAB 1R6TA 2UXCO 1EN4A 1Y8OA 4ZHQA 3JALB 1HNZB 5EIBD 1XNQB 3HEKA 3H01A 2F23A 5L3GA 1I5DA 4I9WA 2PI4A 3ZS8C 5BXZA 2YE4A 1AR4A 2AZ2A 2YI0A 2EILC 2XJGA 4O2BB 2PF4E 3OTFA 2YIDA 2DQ0A 4RAIA 3K98A 3HYZA 1AP6A 1P4RA 5CB4B 3TCUA 2JJ2G 1M56B 4RWUA 4X66O 3ASOC 1Y76B 3RFRA 1GAXA 2ZE7A 1YJWV 2VCJA 1NT2B 3OAAG 3EKOA 4B7PA 1E1RG 4O4LA 5KMGB 4EM7A 5EYPA 4EEHA 5KHJA 1BKNA 2IORA 1YIJV 4YJ3B 2BU8A 5M4NA 2Q4PA 4DV5B 4LPBA 1LNQA 3TETA 2Q8GA 5CBFA 1L8DA 1S0VA 3HZ5A 4B7EA 5LHIA 2V1DA 1QQCA 2WLHA 1YSZA 4AHCA 3ZMVA 2UU9O 2IM9A 3N2KA 4K0KB 1QLEB 1R6KA 4YKZA 5BMVB 1NQTA 3L72H 5FPOA 1IURA 2PUSA 4B3MO 3SDLA 4R7CA 3H1JH 5JJEB 3EXAA 3L75H 3K99A 4XDKA 2X6BA 3K5OA 1GJVA 5B1OA 2BTZA 2VWJA 3CE2A 2D3OW 4HNAA 4J10A 4BR6A 1VQ9V 1Q3EA 2H94A 1AR5A 3T1HB 1W2BU 3WHAA 5CBGA 1W59A 2YK9A 4I55B 1PL4A 2CCUA 3CRMA 1S14A 4WBNA 1J5EB 1R1BA 3E8BA 4FFBB 2Y4UA 2HEPA 4PHZA 5KAFZ 3T2MA 4DR1B 1Y74A 4L90A 2GTAA 4ZHQB 2IJIA 1Q6IA 2ADQB 4CWQA 1MMMA 4FLXA 4DR7B 2CH7A 3TK1A 3B26A 4K0KO 2WLKA 3E83A 2XX2A 1EI1A 1JFFA 5LP6A 3VOUA 2CGOA 4UVBA 2UUCO 2AGAA 1QZRA 4BWAA 4X1IB 4LFAO 2YEDA 3U2DA 3W7UA 1E79G 1QR9A 2EINC 1VQKV 3DXRB 4X62O 1XILA 5GGZA 3QO8A 3RT3C 2YXHA 3KCXA 4DUHA 3JD2A 3CCEV 4X9QA 1NZ6A 5JVDA 1KYOF 4FCQA 1HWYA 2ETNA 2JVDA 3X2QC 2E5LB 3R92A 2HHHB 2WI3A 2GV9A 3D3QA 3ABMB 2WI6A 1SA0A 4P7AA 2YUAA 3U10A 1Z5BA 1S3JA 2ADPA 2XCMA 4I50A 5CTYA 4H81A 5KUKA 3RYCB 1FPOA 3CCJV 4BW5A 4QPJA 4LF6O 1EZJA 1Y8NA 1Z59A 2F1MA 3EHFA 1FFTB 2F95B 5LYJB 4ASFA 1SQPH 2L35A 3B25A 3WG7B 5D5PA 3MD0A 3CCSV 5L3JA 5IJ0B 1YETA 4GYCB 1X4TA 5KA6A 3CX5F 3H4LA 3LSQA 1H2NA 2GHYA 1ZLZA 3A0TA 1S5JA 1OV9A 3X2QB 3SYAA 5CA0A 4D7TA 5GTIZ 2GUZB 3T1YO 1WAZA 3K59A 2Q7EA 4XDMA 4DV6B 1DF5A 2K1EA 5FNCA 3CD6V 3SYCA 4LF9B 1OSFA 4I50B 4ZVIA 1NU1H 2IWUA 3RLPA 1VARA 2VQEB 1YCIA 3CRRA 3D8CA 4UB6Z 3HKDA 3QTCA 4L8ZA 2OYQA 1FYJA 2DJVA 4O2AA 5J9PC 4PD4F 5LL6Y 2EIMB 4RQEA 4X64B 4PA9A 2B5UA 2RN9A 4YXWG 4LF7B 1AILA 4URNA 3ZM7A 3QO5A 5CA0B 2QKCA 2H55A 2DYRC 2YJWA 3ETGA 2H8MA 4LWIA 3CGZA 1VF6A 4YKUA 4JI3B 3JCZA 4URLA 2FXSA 2P7TC 4JI4B 1H2MA 4I7ZB 1HW7A 4P30A 1F51A 1IBMB 2HR3A 2VRZA 4O09A 2UUCB 2QTOA 1ROPA 3CYGA 2ZR2A 1FJGO 1GN4A 2XDSA 2FYUH 3RWRD 4ASBA 4K8ZA 5CTUA 1Y6XA 5KUMA 2PY5A 5EIBC 1N32O 3B2EE 4E02A 3OUFA 4FLYA 1FXKA 1GM7A 1I94O 3H9VA 4JAAA 3R4OA 1H8HG 1K9MW 1KKCA 2ZE8A 2E5LO 1P7GA 2RJZA 5LP6B 4YIOA 3CS5A 3K0DA 1OCCC 1KD1W 4GEEA 3AG7A 1XNRO 3FFQA 1FJGB 1R6NA 3LNNA 1NS1A 1WPXA 2ZXWB 2IJJA 3R91A 4J7KA 3ZBHA 3N2GA 2CTWA 3ETQA 4FLTA 4JI4O 4HY6A 1HNWB 5H6RA 3KG2A 1SF9A 3JARA 1OJHA 3OM3B 3A0HZ 2N05A 2YXYA 1DLBA 3KE6A 5J6AA 4MTXA 3FB5C 1GN3A 1JVMA 2UXNA 5B1NA 1WN7A 2IH1C 1IBKO 5E1AC 1MABG 2X6CA 2QWOB 2R9AA 4I5SA 4U7NA 1KBHA 4R3AA 4HYMA 4B3RB 3P30A 3I55V 3FYEB 1N36O 3JAWA 4DUZO 4JI2B 4HNAB 2W6IG 1P49A 5FNVA 2CTRA 5GONB 2XDXA 3B77A 1Q6HA 5IYDO 1L0NH 3OGIB 4CH4A 4DK0A 5HFLA 5KLVH 3CC4V 4B3MB 3WU2Z 2XAJA 4C7UA 5C8YA 3PEJA 1N4CA 1HR0O 1YXBA 4HXWA 2B9ZA 5H5NA 2FMLA 1BQZA 3ZXQA 2HJFC 3FX7A 1M90W 4CWFA 2YKBA 2EIJB 3LDEA 3CC7V 3G71V 2QJ1A 1ZL8B 3QF7A 1YERA 2IWSA 2X0LA 3CEIA 2YEGA 3RLRA 1M9NA 2A06H 4YHHB 3Q5KA 1K33A 2Z3YA 4BQJA 4NTWA 5BOCA 2ZDYA 3B28A 2UXXA 2K9PA 4I4TA 3HR0A 4TUYA 1OCRB 2VS0A 5TISZ 2KQXA 3DC5A 3ZJZA 1WNSA 1SZXA 3CXCU 4LNUB 2W6JG 3LUTB 5IN9A 3JALA 1FXKC 1M57B 2QG0A 2PYJA 4NR1A 1KKDA 4LF9O 2UUAB 1V55C 3TTZA 1QLEC 3ZEDA 2ZKJA 1XBLA 4TT3G 1FKAO 5IY5C 1NTMH 1K5SA 2IWXA 5LGTA 5H9CA 2CCTA 4OX9B 1NH2D 1ORQC 5J71A 3WB1A 1T5EA 1HP8A 1ZSPA 1UYCA 3W7SA 1VMGA 4LF5O 5CB4A 1UPGA 2YC0A 3FAVB 2IOQA 5AG2A 4PRXA 1GK9A 2XAQA 4D7SA 2GTSA 4PELA 4TUYB 1HNXB 3IGAC 1COWG 1UYGA 1AJPA 4JYCA 2A0LA 1FXKB 1G8MA 2ZIMA 3ZHVA 1XNRB 1UYHA 3K08A 1ZUQA 4LF6B 4DR7O 4JZ2A 4UCTA 4WFFA 2QDOA 3AG3B 1EN6A 3ABMC 3RVYA 3EFFK 3VHDA 4OPHA 3F7YC 2Q2EB 4V25A 5LOVA 5J2TB 1SC5B 1J95A 1NR7A 5JJNB 1QNMA 3ZXOA 1MSWD 4CBCA 2BSKB 3RYFA 4JI6O 2CK3G 1ENVA 4J9ZB 3JASA 4FM0A 2V7QG 5CN0A 2Q7GA 3N2KB 4I0XA 3IJ4A 4PJ0Z 3E22A 4N21A 1UYLA 4K35A 1TBWA 5L3CA 4MTGA 1E1QG 2ZIOA 3CXHF 1IBMO 3QNEA 2BYIA 4TQDA 2YECA 1I5BA 4I3HA 3D36A 4JI3O 4HYOA 4X1KA 2VCIA 3ETEA 1VQMV 1NR1A 4LFBO 5KMGA 1AJNA 4JI7B 2YGEA 4WF9V 3OT7A 1GM9A 1HR0B 3MAQA 2YICA 5LMUO 2BT0A 2ARHA 1NHIA 4CS2A 1VQ7V 1YSRA 1JR9A 2Q8IA 1UJWB 1AI5A 4O2BA 2XOKG 2UUBO 4IT5A 2FWZA 2YEFA 1GMGA 2CTQA 2R70A 3AG1C 3HKBB 4GCZA 1Q5OA 4TV9B 5B66Z 1G4YB 4E2LA 3G6EV 3RYIA 4I9QA 5FNDA 4P9OA 4DW0A 2BYHA 2NLJC 1B6QA 5F2VO 2UXBO 4FLZA 1ZTEA 5L3FA 3G7BA 2EULA 4JPRA 4K3AA 2PTMA 1G1XB 4KFMA 1JMKC 3D2RA 5KX5B 1QY8A 3TZ4A 3JZ3A 1QR8A 4LC1A 3ZHRA 3HKCB 4E00A 5EZYA 4PU9A 4QNHB 2A7WA 1TH8A 4F4LA 4B3TB 4U3FH 1UYIA 2KG7B 4YKQA 2GQPA 3OMIB 1TA8A 2EIMC 4UUJC 2P90A 1JM6A 5CPHA 3HPLC 3JCUZ 4LF8B 3VQXA 4AWOA 1TUEB 4X9LA 3W7XA 2ZBKB 3A0ZA 3OTOO 1M4UA 4CWPA 1KU9A 1Y66A 1R3LC 1KB9F 3K9AA 1YI2V 1B04A 1Y74B 2BU7A 4V26A 1KECA 1YT2A 4DV2O 4JI0B 1XNQO 3APQA 3DGEA 1D2DA 4ZKIA 3G6BA 3GIFA 3AG2B 1F4MA 4WFGA 1RPOA 3ML0A 2GSMB 2YKCA 4F6EA 5IE9A 2HJDA 2OCHA 3ABLC 1TUBB 5A2QN 3EHJA 4UROA 5JENA 4RQFA 3B24A 3ZIAG 1QCEA 3APOA 1N33O 2A9HA 4H13B 1KUQA 1B3QA 1VIBA 1AJQA 4MPEA 1Z5CA 3H80A 1M56C 4FLWA 4UCOA 2B1IA 1SKVA 4LF4O 4FLUA 2XD6A 4DZYA 5K1PA 4MVZA 3AK1A 3WFVA 5CTWA 1O9HA 1Y4MA 5KAIZ 5JWPA 3NR7A 1XMOO 3JAWB 2DOSA 4X89A 2RQ6A 2ESAA 1H8EG 1QVGU 3M99B 5EYPB 2GBOA 1PNKA 1VQPV 4DR2B 3DSQA 3QO7A 4PV1B 3CRCA 4MVOA 3CJHB 4E72A 2LFSA 3VHAA 4CE3A 2YSUB 3ASNB
chains in the Genus database with same CATH topology
4R50A 1NH2B 4XDMA 5FNCA 1DF5A 2K1EA 2Q8HA 3BEHA 2WLIA 4HAMA 3SYCA 3CD6V 3UKMA 3QTFA 2HLDG 3EHHA 3T1KA 1OSFA 5BODA 1TIDA 4ZVIA 4BQGA 2IWUA 5FL7G 3RLPA 2QM8A 1NKDA 4WFHA 4G28B 2DW4A 1I5YA 4FCPA 3ASOB 2FTKA 2YEVB 3FT5A 2Q8FA 2DWDC 4L8ZA 1YJ9V 2WI1A 2PNRA 5M4HA 2ZXWC 1K3EA 3FB7C 2HFEC 2X7RB 2OCCC 5J9PC 4JTCB 4HXZA 4L94A 2YGFA 2EIMB 2WLLB 3OGCC 4G27B 1I58A 4RQEA 1YC4A 3IEDA 3CCUV 3AG1B 1VQLV 1VQ4V 3INWA 2QKSA 3SPHA 2IOPA 2YKEA 1MOFA 4PA9A 1S76D 4XIRA 2XJXA 1U2OA 3RLQA 2B5UA 3G7EA 2W0FC 4TSFG 1OCZC 5M4MA 2GFDA 3K0GA 4PDRA 4XKOA 1OCOC 1Q7YW 3CP1A 2XAFA 5EBMC 1V54C 1NVPB 4YXWG 4NH8A 4H33A 3CCLV 5BZBA 2XNDG 1YS3A 2BU2A 1THNA 3BM9A 2Y69C 4CZZA 4YKXA 2EZOA 3GIEA 5D6PA 3ZM7A 3QO5A 4URNA 4ASAA 2O1WA 4LWGA 1UYGA 4EKWA 3ZMUA 1MX0A 3ZMZA 3K79A 1L1FA 2EIJC 3G4SV 1ZXMA 2H55A 2XX5A 4BAYA 2DYRC 2O1UA 2YE7A 3ETGA 2H8MA 1BYQA 1UYEA 2YJWA 2IW5A 4QE7A 5EC2C 3CGZA 4YKUA 2Q69A 3JCZA 2BZ5A 2FXSA 4URLA 2P7TC 2EXLA 3LNMB 4U93A 3HZ1A 2JKIA 3FYIB 2O1VA 2IU0A 4GT1A 3ZMSA 4NH7A 3JD3A 4P30A 2YI5A 1F51A 3VADA 4JASA 1UY9A 1GKZA 1YHQV 2WLMA 2HR3A 2DQ3A 3FB8C 1UY8A 4O09A 1I5XA 1ROPA 2QTOA 1K73W 3K97A 4PDVA 2ZR2A 2ZDXA 2WPDG 3E2EA 2XK2A 2BU6A 5CTUA 3FB6C 3B8MA 3E8FA 1P7BA 4XBFA 4FPPA 2XHXA 2XDSA 4AS9A 4P9PA 5CMUA 4JGSA 4FJCC 2E0AA 4O0BA 4GGLA 4ASBA 1R3JC 3ABLB 1YJNV 1GM8A 1H38A 3CC2V 1UY6A 5KUMA 3OPDA 4LP0A 4URMA 3DTUB 3TUHA 2IJKA 1M57C 3LDCA 2YI6A 3OUFA 4PA4A 4HY1A 1FXKA 1CPYA 1GM7A 1PNMA 1QBZA 4R8CA 2YK2A 5D7CA 2QM7A 3R4OA 1H8HG 1V55B 4E01A 3FKSG 2IU3A 2BU5A 1K9MW 2WEQA 2DYRB 4BXIA 5M4EA 4RUFA 2WI2A 5GW7A 4Q20A 5C93A 3CYOA 3UM7A 5IY5B 1B62A 1BGQA 4R1FA 4YKYA 2XJJA 1QYEA 2QFOA 3GB7C 3K0DA 3BMYA 1OCCC 1KD1W 4GEEA 5M4PA 4HZ5A 3D0BA 4MVUA 3SL2A 3G75A 3VHCA 2EJRA 1PD3A 3D3IA 1R6NA 1XL6A 3T0HA 1AM1A 4YKTA 2IJHA 3IC7A 3CRLA 1GKFA 1W0JG 3ZRXA 4L93A 4MP7A 1WPXA 2ZXWB 2IJJA 4YKRA 4JF3A 4PDMA 4FK5C 1R62A 2XDLA 2WLNA 3R91A 3LNUA 4UV9A 5B3SB 4PA7A 4WFEA 4ZBMA 1FXVA 5B1AB 1BMFG 1JX9A 2LFRA 1KC8W 1BHBA 2YE9A 2AHZA 2OT5A 1OHHG 4XDJA 3A0YA 4HY6A 2ZD9A 2MK3A 1VQ5V 4XE2A 1W0KG 1DTOA 3KG2A 1FXHA 3ABKB 4X88A 5H6RA 2EIKB 1K8AW 4JAVA 2WI7A 3TZ5A 1OCOB 3OM3B 2HCHA 1V54B 3MHHC 3Q5LA 3MNRP 4R6ZA 3AG4C 5H6QA 2EILB 4DXWA 1DLBA 3F7VC 1AI6A 3KE6A 5J6AA 1RPRA 2IH3C 3OW2U 2YGAA 4MTXA 4XCJA 3ABTA 3FB5C 5FWKA 1JVMA 2EBOA 2UXNA 2Q67A 3RVZA 1K34A 3PJSK 3JYCA 5B1NA 1CEZA 2IH1C 4GX2A 4PA6A 4UVCA 1QLNA 1U0ZA 1YC1A 1SERA 4MTFA 1OCCB 1MABG 2X6CA 2WWWA 2Y48A 1S5HC 4MS2A 5E1AC 3ZN0A 5CF0A 4KSGA 4EFUA 2HG5C 3OR7C 2XX4A 1KP3A 4I5SA 4U7NA 1QVFU 4R3AA 1TILA 4HYMA 2ZQMA 4GX1A 1GO3F 4MW3A 3P30A 3I55V 3FYEB 4FCRA 1IXMA 1YESA 5KA5A 4LBEC 3LSSA 3EHGA 3U67A 3B27A 3P32A 1I5CA 2WI4A 3CGYA 1TC0A 2W6IG 5CTXA 3RW0A 5DM6V 2XDXA 3EKRA 1JQ0A 2ITCC 3B77A 3T1CA 4QJFB 2LP7A 3HHUA 4CWSA 2WI5A 2HVJC 2XHRA 1Q86W 5IYDO 1VQNV 3ABKC 3CCVV 4XTJA 4PRVA 1Y4SA 1YITV 2XDUA 2YKJA 1AMWA 5HFLA 3CC4V 4H7QA 4HZ0A 2XAJA 4O07A 3AG4B 1M1KW 3STZC 5HFMA 3OMNB 4UV8A 3PEJA 4HXWA 2A79B 2DYSB 1CP9A 3F5WC 5F3KA 1EBOA 3ZXQA 2HJFC 1M90W 1KQSU 4O05A 4MBCA 1AROP 4CE1A 4CWFA 2YKBA 3GIGA 2NNUA 2EIJB 3LDEA 4CE2A 4MB9A 1YTFB 3B8NA 3GWOA 4KP4A 3ZCCA 3CC7V 1VQ6V 3G71V 1H2GA 3IFXA 2VW5A 4KTNA 5FNFA 1AI7A 2JK5C 1H7SA 3WQ9A 3CCMV 3ZRSA 1YERA 2BRCA 2IWSA 2X0LA 4MVRA 3ZRWB 2YEGA 3I56V 3RLRA 3OMAB 1N8RW 4GFNA 1M9NA 3E89A 3RBZA 3Q5KA 4EGHA 2R9IA 5EC1C 2X6AA 1K33A 2YEEA 2Z3YA 4BQJA 2WLIB 4MW8A 4RUEA 5LGNA 4MSWC 4WUCA 3HYYA 2YE8A 4MVMA 3OEHG 5BOCA 5EBLC 2ZDYA 3OUSA 3B28A 3E8GA 4L87A 2UXXA 4U7OA 4K4OA 4MOTA 1OCRB 2EZPA 4HYPA 4CWTA 3ZJZA 4GT8A 3CXCU 2AKPA 2W6JG 3LUTB 1SRYA 4TWKA 4X8AA 4G2KA 5IN9A 3CPWU 5D7DA 3A0XA 1FXKC 1M57B 4DO2A 3CMAV 5LBQA 4ASUG 1A4HA 5LGUA 1KP2A 2QG0A 2WEPA 3E86A 1NHJA 2QG2A 1KKDA 3TTZA 1V55C 2WLJA 4PDLA 3SYPA 2UWDA 1YTFD 1QLEC 5D7RA 2ZKJA 4TT3G 4KUMA 5IY5C 1K5SA 3R4MA 2IWXA 1DF4A 1S77D 5LGTA 2QA4V 5H9CA 2CCTA 1PVGA 3SYOA 2YEBA 2YKIA 1NH2D 3A0WA 1MU5A 2YE2A 3JD0A 5EK0A 1ORQC 3T4ZA 3RKZA 1S72V 3PEHA 5J71A 3FT8A 1XL4A 1SESA 2WSSG 1S16A 4XKAA 1R73A 2JDIG 3JD4A 3EHBB 1R3IC 4QPKA 3OEEG 3CCQV 3SPJA 1AH6A 4UXNA 3U2KA 1UYCA 3C0EA 3W7SA 4H85A 1L0OA 4JTDB 2IOQA 1PL0A 4PRXA 1GK9A 2XAQA 4P8OA 4PELA 3TZ2A 4XKKA 2R9RB 3IGAC 1COWG 1OZ0A 3CCRV 1AJPA 4JYCA 2A0LA 1FXKB 1G8MA 4MTOA 3SPCA 1UYHA 4PL9A 4EGIA 3LPSA 3K08A 4EFTA 4HZ3A 1JOYA 3T0ZA 5EBWC 2DYSC 3INXA 1Q82W 1I59A 3AG3B 4WFFA 5IDJA 3O6OA 1NBMG 3ZRWA 4O04A 1RM1B 3ABMC 4MVQA 3O2FA 3VBBA 4KQVA 4EGKA 3RVYA 2OTLV 2YE6A 3EFFK 4BIZA 2YEAA 3VHDA 3F7YC 2BOCC 2Q2EB 3ZN1A 1NHHA 1FS0G 1YT1A 2YI7A 4V25A 4WUDA 2JEUA 1SETA 4N23A 1J95A 1H7UA 2WAMA 1NR7A 2QE7G 2Z5UA 3K03A 1MSWD 3ZXOA 1UYFA 4CBCA 1JJ2U 1Z5AA 1ZWIC 3OWDA 4MP2A 2CK3G 1ENVA 4J9ZB 4P2ZA 3BY6A 2V7QG 3ETDA 3E35A 5CN0A 1KIJA 4AWQA 3SYQA 2XAHA 3QDDA 3NXSA 5B1BB 4JTAB 4N21A 2ZDIA 1UYLA 1TBWA 5L3CA 4MTGA 3AG2C 1Y8OA 1E1QG 5B3SC 2JEXA 1NVPD 5B1AC 4H37A 4WFAV 3QNEA 2BYIA 3HEKA 3H01A 2YECA 4JAUA 5L3GA 1I5DA 4B6CA 2P67A 4I9WA 1I5BA 4I3HA 2PI4A 4Z1MG 1KZNA 3D36A 4W7TA 2ITDC 1ZXNA 4HYOA 2YE4A 1NJIW 2VCIA 1RM1C 3ETEA 1VQMV 2EILC 1ZW9A 2XJGA 1NR1A 2YI0A 1BXDA 5IYBO 2YGEA 1AJNA 1GTOA 4WF9V 1ID0A 2DQ0A 1GM9A 3AEIA 2BREA 4RAIA 2BSMA 3K98A 1UYKA 2YEIA 3HYZA 1P4RA 2BT0A 2CH4A 1AR1B 3OW6A 3TCUA 2M7WA 1NHIA 2JJ2G 1VQ7V 1M56B 1YSRA 3CWVA 3ASOC 1UYMA 3GIGB 4XC0A 2FWYA 3O0IA 4XITA 1YJWV 2Q8IA 2VCJA 2HVKC 2P6JA 2JJCA 1UJWB 3OAAG 1AI5A 1F4NA 3EKOA 5DN6G 3LDDA 4B7PA 1E1RG 1ZWHA 4EM7A 2XOKG 2JJ1G 2YEVA 4QIWF 2FWZA 2YEFA 4EEHA 2OCCB 1GMGA 2QEXV 1BKNA 2IORA 1YIJV 1JPXA 4E02A 2ZR3A 2BU8A 1K97A 3AG1C 4UVAA 5M4NA 4MVSA 4LPBA 3OR6C 3CRKA 4GCZA 3R4PA 4MPNA 1LNQA 1G4YB 1OCRC 3TETA 4E2LA 2K5BA 2Q8GA 3G6EV 2YE3A 5M4KA 5CBFA 5FNDA 4P9OA 1I5AA 1S0VA 3HZ5A 1EA6A 2JIZG 2BYHA 5LHIA 2ATKC 2NLJC 1B6QA 2V1DA 4LWIA 3AG3C 5L3FA 2WLHA 3G7BA 1YSZA 4JPRA 2AHYA 2C2AA 3OE7G 4GX0A 3ZMVA 2FYPA 1VQ8V 4KFMA 3ABUA 1QLEB 2HKJA 1K92A 1R6KA 2XAGA 3D2RA 3T10A 2Q6AA 1UYDA 2YE5A 4YKZA 4KFGA 1NQTA 2XDKA 3R4NA 1QY8A 4BAEA 2OTJV 4R7CA 3JZ3A 3TZ4A 1QR8A 1WLEA 4LC1A 3K99A 4LCUC 4XDKA 3ZKDA 4LWHA 4E00A 2X6BA 4MPCA 4PU9A 4QNHB 1TH8A 4F4LA 1GJVA 1F23A 4RO2A 1UYIA 5B1OA 1AI4A 2BTZA 5CBHA 4YKQA 2D3OW 4J9YB 1VQ9V 1B63A 2GQPA 4NH9A 2H94A 1YSCA 2B1GA 2BOBC 3OMIB 2EIMC 2EINB 5CBGA 4UUJC 1W2BU 1AH8A 2YK9A 3WHAA 4EMVA 3WG7C 2CCUA 4XIPA 3STLC 2P90A 4WFBV 3W7WA 4CWNA 2PI5A 1JM6A 1S14A 4LP8A 3K04A 5CPHA 3E8BA 3HB3B 3HPLC 4GQTA 3T4DA 4WCEV 2KB1A 3T2MA 1YT0A 4L90A 1SZTA 4AWOA 3TZ0A 5LHGA 1TUEB 4X9LA 2IJIA 1AJ6A 4XD8A 3W7XA 4CWQA 2ZBKB 4CWOA 3A0ZA 3ZMTA 4CWPA 2QF6A 3ASNC 3TK1A 3B26A 3C11A 5CA3A 2Q68A 3NMQA 5L3BA 1Y66A 1R3LC 2WLKA 3E83A 2XX2A 4QE9A 1EI1A 5D6QA 3K9AA 3VOUA 4KSHA 1YI2V 2DWEC 4UVBA 1K5QA 4JQLA 2BU7A 1QZRA 4V26A 1KECA 1R3KC 1GKXA 1YT2A 4BIUA 2YEDA 3SPGA 3U2DA 3K06A 3W7UA 5F5RA 1E79G 5B1BC 1QR9A 2EINC 3DGEA 1VQKV 4GX5A 4ZKIA 1BHAA 3GIFA 3AG2B 3OMUA 1F4MA 4WFGA 5GGZA 1RPOA 3ML0A 2GSMB 3QO8A 3JD1A 1YC3A 2YKCA 3R65A 5IYCO 3JD2A 4DUHA 2WERA 3CCEV 5IDMA 2EIKC 3ABLC 2YJXA 4FMTA 2XABA 2WLLA 4PA3A 3EHJA 4UROA 1EFRG 1JCHA 4FCQA 4AWPA 1HWYA 3ZRVA 4RQFA 4FIPC 3X2QC 3R92A 3B24A 2CG9A 2WI3A 3ZIAG 1THZA 4WUBA 1QCEA 5L3DA 4XCLA 3ABMB 2WI6A 2HG1A 2CCSA 4P7AA 1UY7A 2ZDIC 1Z5BA 2A9HA 3FV5A 2XASA 1K4CC 1S3JA 1B3QA 1VQOV 2XCMA 2VWCA 4H81A 1AJQA 5CTYA 5KUKA 4LWFA 4MPEA 3CCJV 1Z5CA 4BW5A 1US7A 3H80A 4CWRA 4QPJA 1M56C 3K60A 1Q81W 2B1IA 1EZJA 3T2SA 1Y8NA 4XIQA 4MT8A 1Z59A 3MHSC 1Y4UA 2XD6A 3EHFA 4DZYA 3A0RA 4MVZA 1FFTB 1MG1A 3WFVA 5CTWA 1PKXA 3SJQC 5L3EA 1Y4MA 3CMEV 2F43G 2H8PC 4ASFA 4JYBA 3W7TA 4X89A 3Q5JA 4LWEA 4R3MA 3E8HA 3B25A 3WG7B 1BL8A 3MD0A 4XDLA 3CCSV 1Y8PA 2CGFA 2ESAA 1H8EG 1QVGU 5L3JA 3M99B 1YETA 1PNKA 1VQPV 3OWBA 5KA6A 2YEHA 3K3WA 3QO7A 3H4LA 3ZKBA 1PNLA 3LSQA 2GHYA 1OCZB 3A0TA 4MVOA 4YKWA 4ASGA 2XHTA 3X2QB 1K4DC 3SYAA 2HKOA 2YEJA 5LHHA 4L91A 3OFNG 2LFSA 1K7DA 3SPIA 1TC6A 3VHAA 4CE3A 2YSUB 2Y69B 4OXSA 3ASNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XDM A;  2Q8H A;  5FNC A;  3QTF A;  3T1K A;  5BOD A;  3EHH A;  1OSF A;  1TID A;  4ZVI A;  4BQG A;  2IWU A;  3RLP A;  2QM8 A;  4FCP A;  2FTK A;  3FT5 A;  2Q8F A;  4L8Z A;  2WI1 A;  2PNR A;  5M4H A;  4L94 A;  4HXZ A;  2YGF A;  1YC4 A;  1I58 A;  3INW A;  2IOP A;  2YKE A;  4XIR A;  2XJX A;  1U2O A;  3RLQ A;  3G7E A;  5M4M A;  2GFD A;  4XKO A;  4NH8 A;  3BM9 A;  1YS3 A;  2BU2 A;  4YKX A;  1THN A;  5D6P A;  3GIE A;  4URN A;  3ZM7 A;  4ASA A;  2O1W A;  4LWG A;  1ZXM A;  1MX0 A;  2XX5 A;  2YE7 A;  2H55 A;  2O1U A;  3IED A;  2YJW A;  4LWI A;  2H8M A;  1BYQ A;  1UYE A;  3CGZ A;  4YKU A;  2BZ5 A;  2FXS A;  4URL A;  2EXL A;  4U93 A;  3HZ1 A;  2JKI A;  2O1V A;  4GT1 A;  4NH7 A;  2YI5 A;  1F51 A;  3VAD A;  4JAS A;  1UY9 A;  1GKZ A;  4O09 A;  1UY8 A;  3K97 A;  2ZDX A;  2XK2 A;  2BU6 A;  2XHX A;  4FPP A;  4AS9 A;  2XDS A;  4O0B A;  2E0A A;  4GGL A;  4ASB A;  1UY6 A;  4LP0 A;  5CTU A;  4URM A;  3TUH A;  3OPD A;  2YI6 A;  4HY1 A;  4E02 A;  2YK2 A;  5D7C A;  2QM7 A;  3R4O A;  4E01 A;  2BU5 A;  5M4E A;  2WEQ A;  4BXI A;  2WI2 A;  1BGQ A;  4Q20 A;  5C93 A;  4R1F A;  1B62 A;  4YKY A;  2XJJ A;  1QYE A;  2QFO A;  5M4P A;  3BMY A;  4GEE A;  4HZ5 A;  3D0B A;  3SL2 A;  3G75 A;  3VHC A;  3T0H A;  1AM1 A;  4YKT A;  3CRL A;  3ZRX A;  4L93 A;  4MP7 A;  4YKR A;  1R62 A;  2XDL A;  3R91 A;  3LNU A;  2LFR A;  2YE9 A;  3A0Y A;  4HY6 A;  4XE2 A;  2WI7 A;  3TZ5 A;  4JAV A;  2HCH A;  3Q5L A;  3MNR P;  3KE6 A;  5J6A A;  2YGA A;  5FWK A;  4XCJ A;  4MTX A;  5B1N A;  1U0Z A;  1YC1 A;  5CF0 A;  2WWW A;  4KSG A;  4EFU A;  2XX4 A;  4I5S A;  4U7N A;  4R3A A;  1TIL A;  4HYM A;  4FCR A;  1IXM A;  1YES A;  3EHG A;  3U67 A;  3B27 A;  3P32 A;  1I5C A;  2WI4 A;  3CGY A;  1TC0 A;  5CTX A;  2XDX A;  3EKR A;  3HHU A;  4CWS A;  2WI5 A;  2XHR A;  4XTJ A;  4PRV A;  1Y4S A;  2XDU A;  2YKJ A;  1AMW A;  4H7Q A;  4HZ0 A;  4O07 A;  3PEJ A;  4HXW A;  5F3K A;  3ZXQ A;  4O05 A;  4MBC A;  4CE1 A;  4CWF A;  2YKB A;  3GIG A;  4CE2 A;  4MB9 A;  3ZCC A;  4KP4 A;  2VW5 A;  4KTN A;  5FNF A;  3WQ9 A;  1H7S A;  1YER A;  2BRC A;  2IWS A;  3ZRW B;  2YEG A;  3RLR A;  4GFN A;  3Q5K A;  4EGH A;  2YEE A;  4BQJ A;  4WUC A;  3HYY A;  2YE8 A;  5BOC A;  2ZDY A;  3B28 A;  4U7O A;  4K4O A;  4MOT A;  4HYP A;  4CWT A;  4GT8 A;  2AKP A;  5IN9 A;  5D7D A;  3A0X A;  2QG0 A;  1A4H A;  2WEP A;  1NHJ A;  2QG2 A;  3TTZ A;  2UWD A;  5D7R A;  2ZKJ A;  3R4M A;  2IWX A;  2CCT A;  1PVG A;  2YEB A;  2YKI A;  3A0W A;  1MU5 A;  2YE2 A;  5J71 A;  3RKZ A;  3PEH A;  3FT8 A;  1S16 A;  4XKA A;  4QPK A;  3U2K A;  1AH6 A;  3C0E A;  1UYC A;  4H85 A;  1L0O A;  2IOQ A;  4PRX A;  4P8O A;  3TZ2 A;  4XKK A;  1UYG A;  3T0Z A;  4JYC A;  4EGI A;  1UYH A;  4PL9 A;  3LPS A;  1JOY A;  3INX A;  4CWR A;  1I59 A;  5IDJ A;  3O6O A;  3ZRW A;  4O04 A;  3O2F A;  4KQV A;  4EGK A;  2YEA A;  2YE6 A;  3VHD A;  4BIZ A;  2Q2E B;  4V25 A;  1NHH A;  1YT1 A;  2YI7 A;  4WUD A;  1H7U A;  3ZXO A;  1UYF A;  1Z5A A;  4MP2 A;  3OWD A;  1KIJ A;  4AWQ A;  3QDD A;  3NXS A;  1UYL A;  1TBW A;  1Y8O A;  2BYI A;  3HEK A;  2YEC A;  4JAU A;  1I5D A;  4B6C A;  2P67 A;  1I5B A;  4I3H A;  1KZN A;  3D36 A;  4W7T A;  1ZXN A;  2YE4 A;  2VCI A;  2YI0 A;  1ZW9 A;  2XJG A;  1BXD A;  2YGE A;  1ID0 A;  2BRE A;  2BSM A;  3K98 A;  1UYK A;  2YEI A;  3HYZ A;  2BT0 A;  2CH4 A;  3OW6 A;  1NHI A;  4XC0 A;  1YSR A;  3CWV A;  1UYM A;  3GIG B;  2FWY A;  3O0I A;  4XIT A;  2Q8I A;  2VCJ A;  2JJC A;  3EKO A;  4B7P A;  1ZWH A;  4EM7 A;  2YEF A;  2FWZ A;  4EEH A;  1BKN A;  2IOR A;  2BU8 A;  5M4N A;  4LPB A;  3CRK A;  4GCZ A;  3R4P A;  4MPN A;  2K5B A;  2Q8G A;  2YE3 A;  5M4K A;  5FND A;  1I5A A;  3HZ5 A;  1EA6 A;  2BYH A;  3G7B A;  1YSZ A;  2C2A A;  2FYP A;  2HKJ A;  3T10 A;  3D2R A;  1UYD A;  2YE5 A;  4YKZ A;  4KFG A;  2XDK A;  3R4N A;  1QY8 A;  4BAE A;  3TZ4 A;  3JZ3 A;  4LC1 A;  3K99 A;  3ZKD A;  4LWH A;  4E00 A;  4MPC A;  4PU9 A;  1TH8 A;  1GJV A;  1UYI A;  5B1O A;  2BTZ A;  4YKQ A;  1B63 A;  2GQP A;  4NH9 A;  1AH8 A;  3WHA A;  2YK9 A;  4EMV A;  2CCU A;  4XIP A;  4CWN A;  1JM6 A;  1S14 A;  5CPH A;  4GQT A;  1YT0 A;  4L90 A;  4AWO A;  3TZ0 A;  4X9L A;  1AJ6 A;  4XD8 A;  4CWQ A;  2ZBK B;  4CWO A;  3A0Z A;  4CWP A;  2QF6 A;  3TK1 A;  3B26 A;  3C11 A;  3NMQ A;  2XX2 A;  1EI1 A;  5D6Q A;  4KSH A;  4JQL A;  2BU7 A;  1QZR A;  4V26 A;  1GKX A;  1YT2 A;  4BIU A;  2YED A;  3U2D A;  5F5R A;  3DGE A;  4ZKI A;  3GIF A;  3OMU A;  5GGZ A;  2YKC A;  4EFT A;  1YC3 A;  4DUH A;  5IDM A;  2WER A;  2YJX A;  4FMT A;  2XAB A;  3EHJ A;  4URO A;  4AWP A;  4FCQ A;  3ZRV A;  3R92 A;  3B24 A;  2CG9 A;  2WI3 A;  4WUB A;  4XCL A;  2WI6 A;  2HG1 A;  2CCS A;  4P7A A;  1UY7 A;  1Z5B A;  3FV5 A;  1B3Q A;  2XCM A;  2VWC A;  4H81 A;  5CTY A;  4LWF A;  4MPE A;  1Z5C A;  1US7 A;  3H80 A;  4QPJ A;  3K60 A;  3T2S A;  1Y8N A;  4XIQ A;  1Z59 A;  1Y4U A;  2XD6 A;  3EHF A;  4DZY A;  3A0R A;  5CTW A;  4ASF A;  4JYB A;  3Q5J A;  4LWE A;  4R3M A;  3B25 A;  3MD0 A;  1Y8P A;  2ESA A;  2CGF A;  5L3J A;  1YET A;  3OWB A;  2YEH A;  3H4L A;  3ZKB A;  3A0T A;  4YKW A;  4ASG A;  2XHT A;  2YEJ A;  4L91 A;  2LFS A;  1TC6 A;  3VHA A;  4CE3 A;  4MT8 A; 
#chains in the Genus database with same CATH topology
 1NH2 B;  2Q8H A;  4DR3 B;  2WLI A;  3QTF A;  3UKM A;  5LP6 C;  1TID A;  2P22 C;  3PN1 A;  3CWB H;  4IHJ B;  3VQY A;  1SQB H;  3C3T A;  2WI1 A;  2ZXW C;  1K3E A;  3FB7 C;  2HFE C;  4L94 A;  1LR1 A;  3FAV A;  1YC4 A;  3OGC C;  1P84 F;  4G27 B;  5KHI A;  2ZCE A;  3AG1 B;  1VQL V;  1VF5 B;  3SPH A;  2IOP A;  2YIA A;  3UT5 B;  5IYZ A;  4XIR A;  1U2O A;  3RLQ A;  1Z5V A;  4DV0 B;  1OCZ C;  3A2F A;  4XKO A;  1OCO C;  3CP1 A;  3H1I H;  1FFX A;  2XAF A;  1IVS A;  4FLV A;  4H33 A;  3CCL V;  4YKX A;  4CZZ A;  2EZO A;  2LW1 A;  4EKW A;  3ZMU A;  1ZXM A;  3K79 A;  3D36 C;  4QE7 A;  5EC2 C;  2BZ5 A;  4O4H A;  1IZ3 A;  2JKI A;  1HNX O;  3FYI B;  4EFE A;  5DEC A;  5LA6 A;  2IU0 A;  4Z1V A;  4GT1 A;  3JD3 A;  1VF6 C;  4K8X A;  3VAD A;  2Q8V A;  3ZHQ A;  4IGG A;  1SQQ H;  3C90 A;  3FB6 C;  2XHX A;  4FPP A;  1TAE A;  5CMU A;  4JGS A;  4FJC C;  3CSX A;  4O0B A;  4GGL A;  3S3W A;  3CC2 V;  3ABL B;  2IJK A;  1M57 C;  2E75 B;  2YI8 A;  2BCC H;  2YK2 A;  5D7C A;  1WP7 A;  4E01 A;  4BXI A;  4RUF A;  4A5U B;  2WI2 A;  3GWK C;  5GW7 A;  4ZI7 A;  4GKJ O;  1B62 A;  4R1F A;  2JRI A;  2XJJ A;  3GB7 C;  1MZF A;  3BHP A;  3BMY A;  4HZ5 A;  3D0B A;  2EJR A;  1XL6 A;  1TGO A;  3FD9 A;  3CRL A;  3T1H O;  4L93 A;  4ZIB A;  2FL4 A;  4YKR A;  4LF4 B;  1R62 A;  2XDL A;  2WLN A;  1NTK H;  1BMF G;  1BHB A;  2YE9 A;  2FB5 A;  2QWQ B;  1OHH G;  2MK3 A;  1DTO A;  1XHX A;  3HKE A;  2WI7 A;  4X88 A;  1K8A W;  2EIK B;  4LFA B;  4JAV A;  1YZB A;  1OCO B;  2HP8 A;  1V54 B;  4R6Z A;  2EIL B;  3F7V C;  1AI6 A;  3OW2 U;  3ABT A;  2EBO A;  4EB6 B;  4LWS B;  1YC1 A;  4UVC A;  4ZI7 B;  2N04 A;  1TUB A;  5CF0 A;  1S5H C;  4DV4 O;  4KSG A;  4I0X B;  4EFU A;  3OR7 C;  1KP3 A;  2ZQM A;  4MW3 A;  4FCR A;  2QR4 A;  3BAA A;  3G80 A;  5KA5 A;  4JI8 O;  1IXB A;  1XEQ A;  1I5C A;  1L0L H;  4NYK A;  3RW0 A;  3EKR A;  1JQ0 A;  1U97 A;  4QJF B;  4JI2 O;  2HVJ C;  2EJ7 A;  4PRV A;  1YIT V;  2P4V A;  1EN5 A;  2HHI A;  4H7Q A;  1SQF A;  3ZHS A;  3S3X A;  4X20 B;  2A79 B;  2DYS B;  1CP9 A;  3F5W C;  2QGN A;  4EB6 A;  1KQS U;  4O05 A;  2Q9L A;  4NB5 A;  2ZM6 B;  5ITZ A;  5JQG A;  3B8N A;  4KP4 A;  1VQ6 V;  1H2G A;  5FNF A;  1AI7 A;  3WQ9 A;  1H7S A;  4NTX A;  4FFB A;  3ZRW B;  1Y67 A;  4TV9 A;  3E89 A;  2R9I A;  1BQ0 A;  2X6A A;  2WLI B;  4MW8 A;  4TOI A;  5LGN A;  3OEH G;  4PI2 A;  3OUS A;  3E8G A;  4MOT A;  3ICX A;  5CA1 B;  2AKP A;  4Z2W A;  4TWK A;  1SRY A;  4G2K A;  2XT9 A;  3CPW U;  3A0X A;  4E4E A;  4DO2 A;  1A4H A;  5LGU A;  3E86 A;  3SJB C;  2NN4 A;  3SYP A;  4W4L A;  2UWD A;  1YTF D;  2GDS A;  1GN6 A;  2HHH O;  2BTQ A;  4X64 O;  3Q4H B;  3WB0 A;  2M6Y A;  4LF8 O;  1PVG A;  2YEB A;  1FFX B;  2WA3 A;  4JZG A;  5EK0 A;  3JAK B;  4JI1 O;  3T4Z A;  1N34 O;  3PEH A;  1PV0 A;  3FT8 A;  3JAM N;  4XKA A;  3JD4 A;  4JYY A;  3RGB A;  1PP9 H;  2ZT9 B;  4ABM A;  4JTD B;  4B3T O;  1A32 A;  4P8O A;  1US6 A;  4TQF A;  3MDS A;  4X65 O;  3SPC A;  1RP3 B;  3GVM A;  3INX A;  4CWR A;  1I59 A;  2LJ2 A;  1M93 A;  1NBM G;  1AB3 A;  5DED A;  4DUY B;  3ZN1 A;  1NHH A;  1FS0 G;  1YT1 A;  2JEU A;  1YDX A;  1RSO B;  2QE7 G;  2BTQ B;  4MP2 A;  4P2Z A;  3BY6 A;  3ETD A;  3E35 A;  3SYQ A;  4DV0 O;  2Q0O C;  1N34 B;  3QDD A;  3SJA C;  1V9P A;  1O9G A;  2ZDI A;  3K5L A;  5B3S C;  4NVP A;  4X66 B;  3LSU A;  4WFA V;  1MZE A;  2IBZ H;  2NR5 A;  4JAU A;  2UXD O;  4Z1M G;  5JJJ B;  4W7T A;  1RM1 C;  1ZW9 A;  3IC9 A;  1GTO A;  1ID0 A;  4DV3 O;  2N74 A;  2BSM A;  1UYK A;  1AR1 B;  3K5M A;  2EX3 A;  2M7W A;  3CWV A;  1UYM A;  3GIG B;  2FWY A;  3O0I A;  4XIT A;  4LH7 A;  2P6J A;  2JJC A;  1F4N A;  5DN6 G;  1ZWH A;  4QIW F;  2JJ1 G;  2YEV A;  4IHJ A;  2E76 B;  2E74 B;  3B09 A;  5LMN B;  4NXN B;  4MVS A;  3OR6 C;  4MPN A;  3R4P A;  4O4H B;  1OCR C;  4DV3 B;  2K5B A;  4JI6 B;  1I5A A;  5LOV B;  5J2T A;  1EA6 A;  2JIZ G;  4DYL A;  3AG3 C;  3UT5 A;  3UQ8 A;  2C2A A;  2FYP A;  2QWR B;  4AQY O;  3ABU A;  2JGU A;  2HKJ A;  1ZAU A;  1K92 A;  1J5E O;  3KKY A;  2Q6A A;  2D2C B;  5KHH A;  4CH3 A;  2YE5 A;  4KFG A;  5FLX N;  3K58 A;  3ZKD A;  4LCU C;  4LWH A;  2Y4T A;  4GKK B;  2ILM A;  1GN2 A;  1QU7 A;  3A8T A;  4Q6G A;  2P4K A;  1AH8 A;  2EIN B;  4EMV A;  3WG7 C;  3BA8 A;  4WFB V;  2PYL A;  4J11 A;  4LP8 A;  3K04 A;  1ZL8 A;  2XTA A;  4GQT A;  3T4D A;  4WCE V;  1SZT A;  4IIJ B;  1AJ6 A;  4XD8 A;  1WA8 A;  3ZMT A;  3BAB A;  4CH6 A;  2QF6 A;  3ASN C;  5GTH Z;  5CA1 A;  5BMV A;  5L3B A;  4DK1 A;  4QE9 A;  5D6Q A;  4KSH A;  1K5Q A;  1R3K C;  1GKX A;  1XUQ A;  2RMK B;  1XMO B;  3RYI B;  1H2S B;  5B5E Z;  5F5R A;  2YS8 A;  1BE3 H;  3AK3 A;  3OMU A;  2KG7 A;  3TJT A;  4EFT A;  1YC3 A;  3JD1 A;  3BCC H;  1LUW A;  5IYC O;  2EIK C;  4FMT A;  2XAB A;  2WLL A;  4DV4 B;  5LMU B;  4NXM O;  3ZRV A;  5KX5 A;  3G67 A;  4FIP C;  4WUB A;  4J7J A;  2QWN B;  1UY7 A;  2ZDI C;  1HNW O;  2QKA A;  1XDC A;  2VWC A;  4DRX A;  4LWF A;  1MA1 A;  4GLX A;  2F93 B;  2LW7 A;  4BIO A;  3T2S A;  4YJ2 A;  3S5T A;  4IYH A;  1Y4U A;  1I0H A;  3A0R A;  4DV5 O;  3CJH A;  4X1I A;  4JYA B;  2F43 G;  4JYB A;  3Q5J A;  4LWE A;  4R3M A;  2VWK A;  5JH7 B;  3E8H A;  1BL8 A;  4XDL A;  1YEW A;  1NTZ H;  2DMX A;  4B3R O;  3OWB A;  3K3W A;  4AQY B;  4ASG A;  2XHT A;  1K4D C;  3JAS B;  2HKO A;  3OTO B;  2YEJ A;  2KKW A;  5LHH A;  1WB7 A;  4KXR A;  4O4J A;  4L91 A;  4LR3 A;  1BCC H;  4ZOL A;  4AIL C;  1PM9 A;  1XMQ B;  3BEH A;  4HAM A;  5BOD A;  2W0X A;  4BQG A;  2QM8 A;  2JS3 A;  1NKD A;  4WFH A;  2OWO A;  1I5Y A;  5KHG A;  4J7Z A;  5IWA O;  2YEV B;  1FD9 A;  3OD4 A;  4LNU A;  2DWD C;  2PNR A;  5M4H A;  4BW9 A;  2X7R B;  2OCC C;  4UCS A;  4HXZ A;  2YGF A;  1I58 A;  3INW A;  5LXT A;  2QKS A;  1WB8 A;  3A0B Z;  4DR3 O;  4TSF G;  3K0G A;  4PDR A;  1Q7Y W;  5EBM C;  1V54 C;  1NVP B;  2AZ0 A;  4CS3 A;  4NH8 A;  3BM9 A;  1YS3 A;  2BU2 A;  1THN A;  2Y69 C;  4D6T H;  4O4J B;  4LFC O;  4LWG A;  4B08 A;  3ZMZ A;  3G4S V;  2YE7 A;  5BR8 B;  4BAY A;  2O1U A;  1BYQ A;  3O65 A;  3RYH A;  4FZ1 A;  1SQX H;  1N32 B;  2EXL A;  3LNM B;  4U93 A;  3HZ1 A;  5E79 Z;  4NH7 A;  2YI5 A;  1UY9 A;  1GKZ A;  1YHQ V;  1N36 B;  3IAY A;  3FB8 C;  1I5X A;  4QGP A;  1K73 W;  4JI8 B;  3K97 A;  2F4V B;  2WPD G;  4JI5 O;  2XK2 A;  1XQ8 A;  3B8M A;  3TGU H;  1P7B A;  4XBF A;  1RSO A;  4P9P A;  1TVK A;  4U3J A;  4LFC B;  2ZIN A;  1R3J C;  1YJN V;  1H38 A;  1GM8 A;  1UFI A;  4URM A;  3OPD A;  2RNB A;  1JJO A;  3DTU B;  3LDC A;  1VEW A;  1MSD A;  4PA4 A;  2YI6 A;  1QBZ A;  1PNM A;  4R8C A;  2BU5 A;  2IU3 A;  5M4E A;  2DYR B;  3L74 H;  2Y0P A;  5C93 A;  3UM7 A;  1HNZ O;  5IY5 B;  4X65 B;  5M4P A;  1QYE A;  2UUA O;  3H1L H;  4MVU A;  3SL2 A;  3G75 A;  1PD3 A;  2UXD B;  1Z5W A;  1WA8 B;  3IC7 A;  3ZRX A;  4MP7 A;  3U11 A;  4JF3 A;  4PDM A;  1FXV A;  2LFR A;  2AHZ A;  2OT5 A;  1SQV H;  3P3P A;  4XDJ A;  3A0Y A;  2DN9 A;  3M8A A;  1W0K G;  3K57 A;  1BSM A;  3MHH C;  4DV1 B;  3MNR P;  1IBK B;  4CC6 A;  5D5Q A;  2YGA A;  5FWK A;  4XCJ A;  2Q67 A;  4GX2 A;  4PA6 A;  3L71 H;  2OIE A;  2Y48 A;  5JCO A;  2WWW A;  2Q0A A;  2HG5 C;  1Q8I A;  1QVF U;  4X1Y B;  4GX1 A;  1GO3 F;  2ZKO A;  1WJZ A;  2UXC B;  4LBE C;  3CGY A;  1TC0 A;  2CAZ C;  3T1C A;  4UCV A;  4J41 A;  2LP7 A;  3HHU A;  2WI5 A;  2WA4 A;  2XHR A;  3CCV V;  1URF A;  2ZNJ A;  3DC6 A;  2XDU A;  2YKJ A;  2L6L A;  4HZ0 A;  2ZM6 O;  3AG4 B;  1M1K W;  3K9S A;  4IIJ A;  5HFM A;  3OMN B;  5F3K A;  1EBO A;  2MW2 B;  2BSK A;  3EVK A;  4DR1 O;  4O4I A;  4MBC A;  3GIG A;  2NNU A;  4CE2 A;  1YTF B;  4EEQ A;  3U0Z A;  2Q73 A;  4KTN A;  1N0N A;  2JK5 C;  1BGY H;  2BRC A;  4LH6 A;  2CE4 A;  4OGQ B;  3I56 V;  3N27 A;  3OMA B;  5LMN O;  3HKC A;  4DR6 O;  4W4K A;  4EGH A;  5IYZ B;  4RUE A;  5JQG B;  4U7O A;  4K4O A;  4LWS A;  2EZP A;  4DR4 O;  1JFF B;  3B40 A;  4CWT A;  5JVD B;  4F6R A;  5IWA B;  3K5N A;  1U96 A;  2RCV A;  3HKD B;  4X8A A;  2LGQ A;  4EFB A;  4FM2 A;  2UU9 B;  4J42 A;  3CMA V;  2WEP A;  4ASU G;  3CB2 A;  1BS3 A;  2QG2 A;  4PDL A;  2JGD B;  1VP7 A;  1WP8 A;  3R4M A;  1MNG A;  2QA4 V;  3SYO A;  2YKI A;  2QTS A;  3HKB A;  4JI0 O;  2OIG A;  4DV2 B;  3RKZ A;  1RFY A;  2WSS G;  1S16 A;  1R73 A;  2JDI G;  1EM1 A;  3EHB B;  4FFK A;  3U2K A;  3OEE G;  1Z2G A;  1QHT A;  2PZS A;  2V4D A;  4O4L B;  2QSA A;  1Y76 A;  2R9R B;  2C1I A;  1GH6 A;  1OZ0 A;  3T0Z A;  4EGI A;  4FZ0 A;  4PL9 A;  4X1K B;  4DUY O;  2XUM A;  3H1H H;  3I5D A;  1Q82 W;  3BA9 A;  3ZRW A;  3HKE B;  1RM1 B;  2A3Q A;  4U3J B;  3VBB A;  2YE6 A;  2P06 A;  4NXN O;  4WUD A;  4N23 A;  3CHX A;  3K03 A;  1Z5A A;  4IL6 Z;  1JJ2 U;  1ZWI C;  3OWD A;  4J80 A;  4O4I B;  1M5I A;  2JS5 A;  2XAH A;  4L8J A;  3AG2 C;  2JEX A;  1NVP D;  5B1A C;  4DW1 A;  4H37 A;  1DK1 A;  4B6C A;  2P67 A;  1FAF A;  1KZN A;  2ITD C;  1ZXN A;  2H3O A;  4DV1 O;  3F5T A;  1NJI W;  4AI8 A;  4GKJ B;  1BXD A;  5IYB O;  4UFZ A;  4I55 A;  4KL1 A;  3AEI A;  2Q5Z A;  2BRE A;  3BVO A;  2YEI A;  3L70 H;  4ZOL B;  2CH4 A;  3OW6 A;  4JV5 B;  4XC0 A;  5EZY B;  1Q43 A;  5ITZ B;  1IX9 A;  2HVK C;  5A9G A;  3LDD A;  4B3S O;  2P5O A;  4DR4 B;  2OCC B;  2QEX V;  1JPX A;  2CDY A;  2ZR3 A;  1K97 A;  3KCY A;  4UVA A;  3CRK A;  4HBN A;  2YE3 A;  5M4K A;  4KHP B;  1I7F A;  2ATK C;  4JV5 O;  1WPB A;  2AXT Z;  4NXM B;  2AHY A;  3OE7 G;  4GX0 A;  1VQ8 V;  3L73 H;  3AK2 A;  3T10 A;  2XAG A;  1UYD A;  5BY1 A;  2XDK A;  4OPA A;  3R4N A;  4BAE A;  1X59 A;  2OTJ V;  1WLE A;  1SS3 A;  3P3N A;  3TXQ A;  2QWP B;  4MPC A;  4PI0 A;  1F23 A;  4RO2 A;  3DXR A;  1AI4 A;  5CBH A;  1VF7 A;  4J9Y B;  2UUB B;  1KMI Z;  4DRX B;  2PGG A;  2LO1 A;  1B63 A;  4NH9 A;  1YSC A;  2B1G A;  2BOB C;  4JYA O;  4X62 B;  3RYC A;  4XIP A;  3STL C;  3W7W A;  4CWN A;  2PI5 A;  2E3C A;  3HB3 B;  2KB1 A;  1YT0 A;  2AW9 A;  3TZ0 A;  5LHG A;  1IBL O;  1XHZ A;  4CWO A;  3J7A U;  4DV7 B;  1Q6U A;  3C11 A;  5CA3 A;  2Q68 A;  3NMQ A;  4LF7 O;  1JA8 A;  4F6R B;  3JAK A;  5FPR A;  2DWE C;  4JQL A;  5KHK A;  4B3S B;  4CC5 A;  4BIU A;  2JGD A;  4JI5 B;  3SPG A;  3K06 A;  5B1B C;  3ZX6 A;  1IDS A;  4GX5 A;  1BHA A;  2CUG A;  3R65 A;  5IDM A;  2WER A;  1YF2 A;  2ZE5 A;  4O2A B;  2YJX A;  4PA3 A;  1EFR G;  1JCH A;  4AWP A;  2VQF O;  2CG9 A;  1THZ A;  5L3D A;  3UCS C;  4XCL A;  4DV6 O;  2HG1 A;  2Y0I A;  2CCS A;  3FV5 A;  1K4C C;  2XAS A;  4JI7 O;  1VQO V;  1US7 A;  3UO3 A;  3C3S A;  3K60 A;  5H2F Z;  1Q81 W;  4XIQ A;  2XHB A;  3MHS C;  1N0J A;  4LF5 B;  1MG1 A;  3ZHU A;  1PKX A;  3SJQ C;  5L3E A;  3CME V;  2H8P C;  4X20 A;  3W7T A;  1Y8P A;  2CGF A;  1XOU A;  1GRJ A;  2YEH A;  3ZKB A;  1PNL A;  2CH7 B;  1OCZ B;  1IBL B;  4YKW A;  3O9O A;  3OFN G;  4YIP A;  1K7D A;  3SPI A;  1TC6 A;  2UXB B;  2Y69 B;  4OXS A;  4IYI A;  2VQF B;  4MT8 A;  4R50 A;  4TV8 B;  3T1K A;  2HLD G;  3EHH A;  5FL7 G;  1SA0 B;  1F7Y A;  3BFR A;  4G28 B;  2DW4 A;  4YJ3 A;  4FCP A;  3VQW A;  3ASO B;  3SR2 C;  2FTK A;  3FT5 A;  2Q8F A;  2ODM A;  1YJ9 V;  4ICG A;  4JTC B;  2WLL B;  1B06 A;  3CCU V;  1VQ4 V;  3SGI A;  2YKE A;  1MOF A;  1S76 D;  2XJX A;  2LQT A;  5JH7 A;  3G7E A;  2W0F C;  5M4M A;  2GFD A;  4H44 B;  5BZB A;  2XND G;  5D6P A;  3GIE A;  4YJ2 B;  3N2G B;  4ASA A;  2O1W A;  1MX0 A;  2YIB A;  1L1F A;  2XX5 A;  2EIJ C;  3JSN A;  1XMQ O;  3IED A;  1XI1 A;  3VQV A;  1UYE A;  2IW5 A;  2Q69 A;  2BE3 A;  2O1V A;  3ZMS A;  5J2U A;  4DR5 B;  4JAS A;  2WLM A;  2DQ3 A;  1H2K A;  1UY8 A;  1S5L Z;  4PDV A;  4NTY A;  4WBN B;  3E2E A;  2ZDX A;  2BU6 A;  1BZK A;  1D5N A;  3LMM A;  3E8F A;  1AP5 A;  1Q90 D;  3THO A;  4YY3 B;  4AS9 A;  3JAR B;  2E0A A;  5IJ9 B;  1UY6 A;  4LP0 A;  3TUH A;  3B4S A;  4HY1 A;  1CPY A;  2QM7 A;  1V55 B;  3SJC C;  2ZE6 A;  3FKS G;  2CGN A;  3R66 A;  2WEQ A;  3UO2 A;  3L9D A;  1BGQ A;  4Q20 A;  3CYO A;  4YKY A;  2QFO A;  5C8Y B;  5K1X A;  3VHC A;  5IT9 N;  2YI9 A;  5LA6 B;  3D3I A;  5LXT B;  3T0H A;  1AM1 A;  4YKT A;  2KSD A;  2IJH A;  1H2L A;  2LGW A;  2C1G A;  1GKF A;  1W0J G;  3CRQ A;  2CTP A;  4FK5 C;  4FVM A;  3LNU A;  4UV9 A;  3WB2 A;  5B3S B;  4PA7 A;  4WFE A;  4ZBM A;  5B1A B;  1KC8 W;  1JX9 A;  1NI8 A;  4GKK O;  3TXS A;  2ZD9 A;  4CS4 A;  1VQ5 V;  4XE2 A;  1FXH A;  3ABK B;  3TZ5 A;  5IJ9 A;  2HCH A;  3Q5L A;  3AG4 C;  5H6Q A;  4DXW A;  1RPR A;  2IH3 C;  4UCU A;  3RVZ A;  1K34 A;  3PJS K;  3JYC A;  4I4T B;  1CEZ A;  1U0Z A;  1QLN A;  2RDC A;  4GZR B;  2R72 A;  2O57 A;  4MTF A;  4YY3 O;  1SER A;  1OCC B;  1HDJ A;  4MS2 A;  3ZN0 A;  2QM4 A;  4GUN A;  5LYJ A;  2XX4 A;  4H0L B;  3BRC A;  1TIL A;  4KHP O;  1IXM A;  1YES A;  1XRE A;  4YHH O;  4FM1 A;  3LSS A;  3EHG A;  3U67 A;  1PPJ H;  3B27 A;  3P32 A;  2WI4 A;  2YDE A;  5CTX A;  5DM6 V;  2ITC C;  3RN4 A;  4CWS A;  2FKX A;  3J81 N;  1Q86 W;  1VQN V;  3ABK C;  4XTJ A;  1Y4S A;  4X1Y A;  1AMW A;  4OX9 O;  1LUV A;  4O07 A;  4LFB B;  3STZ C;  4UV8 A;  2YIB D;  1CXZ B;  1ARO P;  4CE1 A;  4MB9 A;  3GWO A;  3ZCC A;  3H1K H;  4CH5 A;  4DR2 O;  3IFX A;  2VW5 A;  1I94 B;  2F66 C;  3CCM V;  3ZRS A;  2F4V O;  1YVW A;  4MVR A;  3JAT A;  1N8R W;  4GFN A;  3RBZ A;  3CRA A;  5EC1 C;  4DUZ B;  2YEE A;  2GUZ A;  4UB8 Z;  4TV8 A;  1SQG A;  4MSW C;  2Z0A A;  2G38 A;  2YE8 A;  3HYY A;  4MVM A;  1DGS A;  3QG5 A;  5EBL C;  4WUC A;  4L87 A;  1G6U A;  2VQE O;  4HYP A;  4GT8 A;  3M7M X;  5D7D A;  1EZV H;  5LBQ A;  1KP2 A;  3E22 B;  1NHJ A;  3RYH B;  2WLJ A;  4DV7 O;  2Q7H A;  5D7R A;  2YXL A;  4KUM A;  3RYF B;  3J80 N;  1DF4 A;  5FNV B;  5GON A;  1S77 D;  3A0W A;  3JAT B;  1MU5 A;  2YE2 A;  3JD0 A;  1S72 V;  1XL4 A;  1SES A;  3CCQ V;  2DE0 X;  1R3I C;  4QPK A;  4DR6 B;  3SPJ A;  1AH6 A;  4UXN A;  1TVK B;  3C0E A;  4H85 A;  2ZNI A;  1L0O A;  4JI1 B;  1PL0 A;  3TZ2 A;  3QVN A;  5J2U B;  4XKK A;  4NKG B;  3KZI Z;  3CCR V;  4MTO A;  4DR5 O;  1ZX3 A;  3LPS A;  4HZ3 A;  1BT8 A;  1JOY A;  5EBW C;  3ZHT A;  2DYS C;  5BR8 O;  5IDJ A;  3BPZ A;  1D5A A;  3O6O A;  4O04 A;  4MVQ A;  3O2F A;  4KQV A;  4EGK A;  1N33 B;  2OTL V;  2YEA A;  4UCR A;  4BIZ A;  5JCO C;  2BOC C;  3Q4H A;  2YI7 A;  3T1Y B;  1SET A;  1H7U A;  2WAM A;  2Z5U A;  1I08 A;  2BTO A;  1UYF A;  3JSL A;  5IJ0 A;  1KIJ A;  4AWQ A;  4B7K A;  1AVM A;  3NXS A;  5B1B B;  4JTA B;  1R6T A;  2UXC O;  1EN4 A;  1Y8O A;  4ZHQ A;  3JAL B;  1HNZ B;  5EIB D;  1XNQ B;  3HEK A;  3H01 A;  2F23 A;  5L3G A;  1I5D A;  4I9W A;  2PI4 A;  3ZS8 C;  5BXZ A;  2YE4 A;  1AR4 A;  2AZ2 A;  2YI0 A;  2EIL C;  2XJG A;  4O2B B;  2PF4 E;  3OTF A;  2YID A;  2DQ0 A;  4RAI A;  3K98 A;  3HYZ A;  1AP6 A;  1P4R A;  5CB4 B;  3TCU A;  2JJ2 G;  1M56 B;  4RWU A;  4X66 O;  3ASO C;  1Y76 B;  3RFR A;  1GAX A;  2ZE7 A;  1YJW V;  2VCJ A;  1NT2 B;  3OAA G;  3EKO A;  4B7P A;  1E1R G;  4O4L A;  5KMG B;  4EM7 A;  5EYP A;  4EEH A;  5KHJ A;  1BKN A;  2IOR A;  1YIJ V;  4YJ3 B;  2BU8 A;  5M4N A;  2Q4P A;  4DV5 B;  4LPB A;  1LNQ A;  3TET A;  2Q8G A;  5CBF A;  1L8D A;  1S0V A;  3HZ5 A;  4B7E A;  5LHI A;  2V1D A;  1QQC A;  2WLH A;  1YSZ A;  4AHC A;  3ZMV A;  2UU9 O;  2IM9 A;  3N2K A;  4K0K B;  1QLE B;  1R6K A;  4YKZ A;  5BMV B;  1NQT A;  3L72 H;  5FPO A;  1IUR A;  2PUS A;  4B3M O;  3SDL A;  4R7C A;  3H1J H;  5JJE B;  3EXA A;  3L75 H;  3K99 A;  4XDK A;  2X6B A;  3K5O A;  1GJV A;  5B1O A;  2BTZ A;  2VWJ A;  3CE2 A;  2D3O W;  4HNA A;  4J10 A;  4BR6 A;  1VQ9 V;  1Q3E A;  2H94 A;  1AR5 A;  3T1H B;  1W2B U;  3WHA A;  5CBG A;  1W59 A;  2YK9 A;  4I55 B;  1PL4 A;  2CCU A;  3CRM A;  1S14 A;  4WBN A;  1J5E B;  1R1B A;  3E8B A;  4FFB B;  2Y4U A;  2HEP A;  4PHZ A;  5KAF Z;  3T2M A;  4DR1 B;  1Y74 A;  4L90 A;  2GTA A;  4ZHQ B;  2IJI A;  1Q6I A;  2ADQ B;  4CWQ A;  1MMM A;  4FLX A;  4DR7 B;  2CH7 A;  3TK1 A;  3B26 A;  4K0K O;  2WLK A;  3E83 A;  2XX2 A;  1EI1 A;  1JFF A;  5LP6 A;  3VOU A;  2CGO A;  4UVB A;  2UUC O;  2AGA A;  1QZR A;  4BWA A;  4X1I B;  4LFA O;  2YED A;  3U2D A;  3W7U A;  1E79 G;  1QR9 A;  2EIN C;  1VQK V;  3DXR B;  4X62 O;  1XIL A;  5GGZ A;  3QO8 A;  3RT3 C;  2YXH A;  3KCX A;  4DUH A;  3JD2 A;  3CCE V;  4X9Q A;  1NZ6 A;  5JVD A;  1KYO F;  4FCQ A;  1HWY A;  2ETN A;  2JVD A;  3X2Q C;  2E5L B;  3R92 A;  2HHH B;  2WI3 A;  2GV9 A;  3D3Q A;  3ABM B;  2WI6 A;  1SA0 A;  4P7A A;  2YUA A;  3U10 A;  1Z5B A;  1S3J A;  2ADP A;  2XCM A;  4I50 A;  5CTY A;  4H81 A;  5KUK A;  3RYC B;  1FPO A;  3CCJ V;  4BW5 A;  4QPJ A;  4LF6 O;  1EZJ A;  1Y8N A;  1Z59 A;  2F1M A;  3EHF A;  1FFT B;  2F95 B;  5LYJ B;  4ASF A;  1SQP H;  2L35 A;  3B25 A;  3WG7 B;  5D5P A;  3MD0 A;  3CCS V;  5L3J A;  5IJ0 B;  1YET A;  4GYC B;  1X4T A;  5KA6 A;  3CX5 F;  3H4L A;  3LSQ A;  1H2N A;  2GHY A;  1ZLZ A;  3A0T A;  1S5J A;  1OV9 A;  3X2Q B;  3SYA A;  5CA0 A;  4D7T A;  5GTI Z;  2GUZ B;  3T1Y O;  1WAZ A;  3K59 A;  2Q7E A;  4XDM A;  4DV6 B;  1DF5 A;  2K1E A;  5FNC A;  3CD6 V;  3SYC A;  4LF9 B;  1OSF A;  4I50 B;  4ZVI A;  1NU1 H;  2IWU A;  3RLP A;  1VAR A;  2VQE B;  1YCI A;  3CRR A;  3D8C A;  4UB6 Z;  3HKD A;  3QTC A;  4L8Z A;  2OYQ A;  1FYJ A;  2DJV A;  4O2A A;  5J9P C;  4PD4 F;  5LL6 Y;  2EIM B;  4RQE A;  4X64 B;  4PA9 A;  2B5U A;  2RN9 A;  4YXW G;  4LF7 B;  1AIL A;  4URN A;  3ZM7 A;  3QO5 A;  5CA0 B;  2QKC A;  2H55 A;  2DYR C;  2YJW A;  3ETG A;  2H8M A;  4LWI A;  3CGZ A;  1VF6 A;  4YKU A;  4JI3 B;  3JCZ A;  4URL A;  2FXS A;  2P7T C;  4JI4 B;  1H2M A;  4I7Z B;  1HW7 A;  4P30 A;  1F51 A;  1IBM B;  2HR3 A;  2VRZ A;  4O09 A;  2UUC B;  2QTO A;  1ROP A;  3CYG A;  2ZR2 A;  1FJG O;  1GN4 A;  2XDS A;  2FYU H;  3RWR D;  4ASB A;  4K8Z A;  5CTU A;  1Y6X A;  5KUM A;  2PY5 A;  5EIB C;  1N32 O;  3B2E E;  4E02 A;  3OUF A;  4FLY A;  1FXK A;  1GM7 A;  1I94 O;  3H9V A;  4JAA A;  3R4O A;  1H8H G;  1K9M W;  1KKC A;  2ZE8 A;  2E5L O;  1P7G A;  2RJZ A;  5LP6 B;  4YIO A;  3CS5 A;  3K0D A;  1OCC C;  1KD1 W;  4GEE A;  3AG7 A;  1XNR O;  3FFQ A;  1FJG B;  1R6N A;  3LNN A;  1NS1 A;  1WPX A;  2ZXW B;  2IJJ A;  3R91 A;  4J7K A;  3ZBH A;  3N2G A;  2CTW A;  3ETQ A;  4FLT A;  4JI4 O;  4HY6 A;  1HNW B;  5H6R A;  3KG2 A;  1SF9 A;  3JAR A;  1OJH A;  3OM3 B;  3A0H Z;  2N05 A;  2YXY A;  1DLB A;  3KE6 A;  5J6A A;  4MTX A;  3FB5 C;  1GN3 A;  1JVM A;  2UXN A;  5B1N A;  1WN7 A;  2IH1 C;  1IBK O;  5E1A C;  1MAB G;  2X6C A;  2QWO B;  2R9A A;  4I5S A;  4U7N A;  1KBH A;  4R3A A;  4HYM A;  4B3R B;  3P30 A;  3I55 V;  3FYE B;  1N36 O;  3JAW A;  4DUZ O;  4JI2 B;  4HNA B;  2W6I G;  1P49 A;  5FNV A;  2CTR A;  5GON B;  2XDX A;  3B77 A;  1Q6H A;  5IYD O;  1L0N H;  3OGI B;  4CH4 A;  4DK0 A;  5HFL A;  5KLV H;  3CC4 V;  4B3M B;  3WU2 Z;  2XAJ A;  4C7U A;  5C8Y A;  3PEJ A;  1N4C A;  1HR0 O;  1YXB A;  4HXW A;  2B9Z A;  5H5N A;  2FML A;  1BQZ A;  3ZXQ A;  2HJF C;  3FX7 A;  1M90 W;  4CWF A;  2YKB A;  2EIJ B;  3LDE A;  3CC7 V;  3G71 V;  2QJ1 A;  1ZL8 B;  3QF7 A;  1YER A;  2IWS A;  2X0L A;  3CEI A;  2YEG A;  3RLR A;  1M9N A;  2A06 H;  4YHH B;  3Q5K A;  1K33 A;  2Z3Y A;  4BQJ A;  4NTW A;  5BOC A;  2ZDY A;  3B28 A;  2UXX A;  2K9P A;  4I4T A;  3HR0 A;  4TUY A;  1OCR B;  2VS0 A;  5TIS Z;  2KQX A;  3DC5 A;  3ZJZ A;  1WNS A;  1SZX A;  3CXC U;  4LNU B;  2W6J G;  3LUT B;  5IN9 A;  3JAL A;  1FXK C;  1M57 B;  2QG0 A;  2PYJ A;  4NR1 A;  1KKD A;  4LF9 O;  2UUA B;  1V55 C;  3TTZ A;  1QLE C;  3ZED A;  2ZKJ A;  1XBL A;  4TT3 G;  1FKA O;  5IY5 C;  1NTM H;  1K5S A;  2IWX A;  5LGT A;  5H9C A;  2CCT A;  4OX9 B;  1NH2 D;  1ORQ C;  5J71 A;  3WB1 A;  1T5E A;  1HP8 A;  1ZSP A;  1UYC A;  3W7S A;  1VMG A;  4LF5 O;  5CB4 A;  1UPG A;  2YC0 A;  3FAV B;  2IOQ A;  5AG2 A;  4PRX A;  1GK9 A;  2XAQ A;  4D7S A;  2GTS A;  4PEL A;  4TUY B;  1HNX B;  3IGA C;  1COW G;  1UYG A;  1AJP A;  4JYC A;  2A0L A;  1FXK B;  1G8M A;  2ZIM A;  3ZHV A;  1XNR B;  1UYH A;  3K08 A;  1ZUQ A;  4LF6 B;  4DR7 O;  4JZ2 A;  4UCT A;  4WFF A;  2QDO A;  3AG3 B;  1EN6 A;  3ABM C;  3RVY A;  3EFF K;  3VHD A;  4OPH A;  3F7Y C;  2Q2E B;  4V25 A;  5LOV A;  5J2T B;  1SC5 B;  1J95 A;  1NR7 A;  5JJN B;  1QNM A;  3ZXO A;  1MSW D;  4CBC A;  2BSK B;  3RYF A;  4JI6 O;  2CK3 G;  1ENV A;  4J9Z B;  3JAS A;  4FM0 A;  2V7Q G;  5CN0 A;  2Q7G A;  3N2K B;  4I0X A;  3IJ4 A;  4PJ0 Z;  3E22 A;  4N21 A;  1UYL A;  4K35 A;  1TBW A;  5L3C A;  4MTG A;  1E1Q G;  2ZIO A;  3CXH F;  1IBM O;  3QNE A;  2BYI A;  4TQD A;  2YEC A;  1I5B A;  4I3H A;  3D36 A;  4JI3 O;  4HYO A;  4X1K A;  2VCI A;  3ETE A;  1VQM V;  1NR1 A;  4LFB O;  5KMG A;  1AJN A;  4JI7 B;  2YGE A;  4WF9 V;  3OT7 A;  1GM9 A;  1HR0 B;  3MAQ A;  2YIC A;  5LMU O;  2BT0 A;  2ARH A;  1NHI A;  4CS2 A;  1VQ7 V;  1YSR A;  1JR9 A;  2Q8I A;  1UJW B;  1AI5 A;  4O2B A;  2XOK G;  2UUB O;  4IT5 A;  2FWZ A;  2YEF A;  1GMG A;  2CTQ A;  2R70 A;  3AG1 C;  3HKB B;  4GCZ A;  1Q5O A;  4TV9 B;  5B66 Z;  1G4Y B;  4E2L A;  3G6E V;  3RYI A;  4I9Q A;  5FND A;  4P9O A;  4DW0 A;  2BYH A;  2NLJ C;  1B6Q A;  5F2V O;  2UXB O;  4FLZ A;  1ZTE A;  5L3F A;  3G7B A;  2EUL A;  4JPR A;  4K3A A;  2PTM A;  1G1X B;  4KFM A;  1JMK C;  3D2R A;  5KX5 B;  1QY8 A;  3TZ4 A;  3JZ3 A;  1QR8 A;  4LC1 A;  3ZHR A;  3HKC B;  4E00 A;  5EZY A;  4PU9 A;  4QNH B;  2A7W A;  1TH8 A;  4F4L A;  4B3T B;  4U3F H;  1UYI A;  2KG7 B;  4YKQ A;  2GQP A;  3OMI B;  1TA8 A;  2EIM C;  4UUJ C;  2P90 A;  1JM6 A;  5CPH A;  3HPL C;  3JCU Z;  4LF8 B;  3VQX A;  4AWO A;  1TUE B;  4X9L A;  3W7X A;  2ZBK B;  3A0Z A;  3OTO O;  1M4U A;  4CWP A;  1KU9 A;  1Y66 A;  1R3L C;  1KB9 F;  3K9A A;  1YI2 V;  1B04 A;  1Y74 B;  2BU7 A;  4V26 A;  1KEC A;  1YT2 A;  4DV2 O;  4JI0 B;  1XNQ O;  3APQ A;  3DGE A;  1D2D A;  4ZKI A;  3G6B A;  3GIF A;  3AG2 B;  1F4M A;  4WFG A;  1RPO A;  3ML0 A;  2GSM B;  2YKC A;  4F6E A;  5IE9 A;  2HJD A;  2OCH A;  3ABL C;  1TUB B;  5A2Q N;  3EHJ A;  4URO A;  5JEN A;  4RQF A;  3B24 A;  3ZIA G;  1QCE A;  3APO A;  1N33 O;  2A9H A;  4H13 B;  1KUQ A;  1B3Q A;  1VIB A;  1AJQ A;  4MPE A;  1Z5C A;  3H80 A;  1M56 C;  4FLW A;  4UCO A;  2B1I A;  1SKV A;  4LF4 O;  4FLU A;  2XD6 A;  4DZY A;  5K1P A;  4MVZ A;  3AK1 A;  3WFV A;  5CTW A;  1O9H A;  1Y4M A;  5KAI Z;  5JWP A;  3NR7 A;  1XMO O;  3JAW B;  2DOS A;  4X89 A;  2RQ6 A;  2ESA A;  1H8E G;  1QVG U;  3M99 B;  5EYP B;  2GBO A;  1PNK A;  1VQP V;  4DR2 B;  3DSQ A;  3QO7 A;  4PV1 B;  3CRC A;  4MVO A;  3CJH B;  4E72 A;  2LFS A;  3VHA A;  4CE3 A;  2YSU B;  3ASN B; 
#chains in the Genus database with same CATH homology
 4R50 A;  1NH2 B;  4XDM A;  5FNC A;  1DF5 A;  2K1E A;  2Q8H A;  3BEH A;  2WLI A;  4HAM A;  3SYC A;  3CD6 V;  3UKM A;  3QTF A;  2HLD G;  3EHH A;  3T1K A;  1OSF A;  5BOD A;  1TID A;  4ZVI A;  4BQG A;  2IWU A;  5FL7 G;  3RLP A;  2QM8 A;  1NKD A;  4WFH A;  4G28 B;  2DW4 A;  1I5Y A;  4FCP A;  3ASO B;  2FTK A;  2YEV B;  3FT5 A;  2Q8F A;  2DWD C;  4L8Z A;  1YJ9 V;  2WI1 A;  2PNR A;  5M4H A;  2ZXW C;  1K3E A;  3FB7 C;  2HFE C;  2X7R B;  2OCC C;  5J9P C;  4JTC B;  4HXZ A;  4L94 A;  2YGF A;  2EIM B;  2WLL B;  3OGC C;  4G27 B;  1I58 A;  4RQE A;  1YC4 A;  3IED A;  3CCU V;  3AG1 B;  1VQL V;  1VQ4 V;  3INW A;  2QKS A;  3SPH A;  2IOP A;  2YKE A;  1MOF A;  4PA9 A;  1S76 D;  4XIR A;  2XJX A;  1U2O A;  3RLQ A;  2B5U A;  3G7E A;  2W0F C;  4TSF G;  1OCZ C;  5M4M A;  2GFD A;  3K0G A;  4PDR A;  4XKO A;  1OCO C;  1Q7Y W;  3CP1 A;  2XAF A;  5EBM C;  1V54 C;  1NVP B;  4YXW G;  4NH8 A;  4H33 A;  3CCL V;  5BZB A;  2XND G;  1YS3 A;  2BU2 A;  1THN A;  3BM9 A;  2Y69 C;  4CZZ A;  4YKX A;  2EZO A;  3GIE A;  5D6P A;  3ZM7 A;  3QO5 A;  4URN A;  4ASA A;  2O1W A;  4LWG A;  1UYG A;  4EKW A;  3ZMU A;  1MX0 A;  3ZMZ A;  3K79 A;  1L1F A;  2EIJ C;  3G4S V;  1ZXM A;  2H55 A;  2XX5 A;  4BAY A;  2DYR C;  2O1U A;  2YE7 A;  3ETG A;  2H8M A;  1BYQ A;  1UYE A;  2YJW A;  2IW5 A;  4QE7 A;  5EC2 C;  3CGZ A;  4YKU A;  2Q69 A;  3JCZ A;  2BZ5 A;  2FXS A;  4URL A;  2P7T C;  2EXL A;  3LNM B;  4U93 A;  3HZ1 A;  2JKI A;  3FYI B;  2O1V A;  2IU0 A;  4GT1 A;  3ZMS A;  4NH7 A;  3JD3 A;  4P30 A;  2YI5 A;  1F51 A;  3VAD A;  4JAS A;  1UY9 A;  1GKZ A;  1YHQ V;  2WLM A;  2HR3 A;  2DQ3 A;  3FB8 C;  1UY8 A;  4O09 A;  1I5X A;  1ROP A;  2QTO A;  1K73 W;  3K97 A;  4PDV A;  2ZR2 A;  2ZDX A;  2WPD G;  3E2E A;  2XK2 A;  2BU6 A;  5CTU A;  3FB6 C;  3B8M A;  3E8F A;  1P7B A;  4XBF A;  4FPP A;  2XHX A;  2XDS A;  4AS9 A;  4P9P A;  5CMU A;  4JGS A;  4FJC C;  2E0A A;  4O0B A;  4GGL A;  4ASB A;  1R3J C;  3ABL B;  1YJN V;  1GM8 A;  1H38 A;  3CC2 V;  1UY6 A;  5KUM A;  3OPD A;  4LP0 A;  4URM A;  3DTU B;  3TUH A;  2IJK A;  1M57 C;  3LDC A;  2YI6 A;  3OUF A;  4PA4 A;  4HY1 A;  1FXK A;  1CPY A;  1GM7 A;  1PNM A;  1QBZ A;  4R8C A;  2YK2 A;  5D7C A;  2QM7 A;  3R4O A;  1H8H G;  1V55 B;  4E01 A;  3FKS G;  2IU3 A;  2BU5 A;  1K9M W;  2WEQ A;  2DYR B;  4BXI A;  5M4E A;  4RUF A;  2WI2 A;  5GW7 A;  4Q20 A;  5C93 A;  3CYO A;  3UM7 A;  5IY5 B;  1B62 A;  1BGQ A;  4R1F A;  4YKY A;  2XJJ A;  1QYE A;  2QFO A;  3GB7 C;  3K0D A;  3BMY A;  1OCC C;  1KD1 W;  4GEE A;  5M4P A;  4HZ5 A;  3D0B A;  4MVU A;  3SL2 A;  3G75 A;  3VHC A;  2EJR A;  1PD3 A;  3D3I A;  1R6N A;  1XL6 A;  3T0H A;  1AM1 A;  4YKT A;  2IJH A;  3IC7 A;  3CRL A;  1GKF A;  1W0J G;  3ZRX A;  4L93 A;  4MP7 A;  1WPX A;  2ZXW B;  2IJJ A;  4YKR A;  4JF3 A;  4PDM A;  4FK5 C;  1R62 A;  2XDL A;  2WLN A;  3R91 A;  3LNU A;  4UV9 A;  5B3S B;  4PA7 A;  4WFE A;  4ZBM A;  1FXV A;  5B1A B;  1BMF G;  1JX9 A;  2LFR A;  1KC8 W;  1BHB A;  2YE9 A;  2AHZ A;  2OT5 A;  1OHH G;  4XDJ A;  3A0Y A;  4HY6 A;  2ZD9 A;  2MK3 A;  1VQ5 V;  4XE2 A;  1W0K G;  1DTO A;  3KG2 A;  1FXH A;  3ABK B;  4X88 A;  5H6R A;  2EIK B;  1K8A W;  4JAV A;  2WI7 A;  3TZ5 A;  1OCO B;  3OM3 B;  2HCH A;  1V54 B;  3MHH C;  3Q5L A;  3MNR P;  4R6Z A;  3AG4 C;  5H6Q A;  2EIL B;  4DXW A;  1DLB A;  3F7V C;  1AI6 A;  3KE6 A;  5J6A A;  1RPR A;  2IH3 C;  3OW2 U;  2YGA A;  4MTX A;  4XCJ A;  3ABT A;  3FB5 C;  5FWK A;  1JVM A;  2EBO A;  2UXN A;  2Q67 A;  3RVZ A;  1K34 A;  3PJS K;  3JYC A;  5B1N A;  1CEZ A;  2IH1 C;  4GX2 A;  4PA6 A;  4UVC A;  1QLN A;  1U0Z A;  1YC1 A;  1SER A;  4MTF A;  1OCC B;  1MAB G;  2X6C A;  2WWW A;  2Y48 A;  1S5H C;  4MS2 A;  5E1A C;  3ZN0 A;  5CF0 A;  4KSG A;  4EFU A;  2HG5 C;  3OR7 C;  2XX4 A;  1KP3 A;  4I5S A;  4U7N A;  1QVF U;  4R3A A;  1TIL A;  4HYM A;  2ZQM A;  4GX1 A;  1GO3 F;  4MW3 A;  3P30 A;  3I55 V;  3FYE B;  4FCR A;  1IXM A;  1YES A;  5KA5 A;  4LBE C;  3LSS A;  3EHG A;  3U67 A;  3B27 A;  3P32 A;  1I5C A;  2WI4 A;  3CGY A;  1TC0 A;  2W6I G;  5CTX A;  3RW0 A;  5DM6 V;  2XDX A;  3EKR A;  1JQ0 A;  2ITC C;  3B77 A;  3T1C A;  4QJF B;  2LP7 A;  3HHU A;  4CWS A;  2WI5 A;  2HVJ C;  2XHR A;  1Q86 W;  5IYD O;  1VQN V;  3ABK C;  3CCV V;  4XTJ A;  4PRV A;  1Y4S A;  1YIT V;  2XDU A;  2YKJ A;  1AMW A;  5HFL A;  3CC4 V;  4H7Q A;  4HZ0 A;  2XAJ A;  4O07 A;  3AG4 B;  1M1K W;  3STZ C;  5HFM A;  3OMN B;  4UV8 A;  3PEJ A;  4HXW A;  2A79 B;  2DYS B;  1CP9 A;  3F5W C;  5F3K A;  1EBO A;  3ZXQ A;  2HJF C;  1M90 W;  1KQS U;  4O05 A;  4MBC A;  1ARO P;  4CE1 A;  4CWF A;  2YKB A;  3GIG A;  2NNU A;  2EIJ B;  3LDE A;  4CE2 A;  4MB9 A;  1YTF B;  3B8N A;  3GWO A;  4KP4 A;  3ZCC A;  3CC7 V;  1VQ6 V;  3G71 V;  1H2G A;  3IFX A;  2VW5 A;  4KTN A;  5FNF A;  1AI7 A;  2JK5 C;  1H7S A;  3WQ9 A;  3CCM V;  3ZRS A;  1YER A;  2BRC A;  2IWS A;  2X0L A;  4MVR A;  3ZRW B;  2YEG A;  3I56 V;  3RLR A;  3OMA B;  1N8R W;  4GFN A;  1M9N A;  3E89 A;  3RBZ A;  3Q5K A;  4EGH A;  2R9I A;  5EC1 C;  2X6A A;  1K33 A;  2YEE A;  2Z3Y A;  4BQJ A;  2WLI B;  4MW8 A;  4RUE A;  5LGN A;  4MSW C;  4WUC A;  3HYY A;  2YE8 A;  4MVM A;  3OEH G;  5BOC A;  5EBL C;  2ZDY A;  3OUS A;  3B28 A;  3E8G A;  4L87 A;  2UXX A;  4U7O A;  4K4O A;  4MOT A;  1OCR B;  2EZP A;  4HYP A;  4CWT A;  3ZJZ A;  4GT8 A;  3CXC U;  2AKP A;  2W6J G;  3LUT B;  1SRY A;  4TWK A;  4X8A A;  4G2K A;  5IN9 A;  3CPW U;  5D7D A;  3A0X A;  1FXK C;  1M57 B;  4DO2 A;  3CMA V;  5LBQ A;  4ASU G;  1A4H A;  5LGU A;  1KP2 A;  2QG0 A;  2WEP A;  3E86 A;  1NHJ A;  2QG2 A;  1KKD A;  3TTZ A;  1V55 C;  2WLJ A;  4PDL A;  3SYP A;  2UWD A;  1YTF D;  1QLE C;  5D7R A;  2ZKJ A;  4TT3 G;  4KUM A;  5IY5 C;  1K5S A;  3R4M A;  2IWX A;  1DF4 A;  1S77 D;  5LGT A;  2QA4 V;  5H9C A;  2CCT A;  1PVG A;  3SYO A;  2YEB A;  2YKI A;  1NH2 D;  3A0W A;  1MU5 A;  2YE2 A;  3JD0 A;  5EK0 A;  1ORQ C;  3T4Z A;  3RKZ A;  1S72 V;  3PEH A;  5J71 A;  3FT8 A;  1XL4 A;  1SES A;  2WSS G;  1S16 A;  4XKA A;  1R73 A;  2JDI G;  3JD4 A;  3EHB B;  1R3I C;  4QPK A;  3OEE G;  3CCQ V;  3SPJ A;  1AH6 A;  4UXN A;  3U2K A;  1UYC A;  3C0E A;  3W7S A;  4H85 A;  1L0O A;  4JTD B;  2IOQ A;  1PL0 A;  4PRX A;  1GK9 A;  2XAQ A;  4P8O A;  4PEL A;  3TZ2 A;  4XKK A;  2R9R B;  3IGA C;  1COW G;  1OZ0 A;  3CCR V;  1AJP A;  4JYC A;  2A0L A;  1FXK B;  1G8M A;  4MTO A;  3SPC A;  1UYH A;  4PL9 A;  4EGI A;  3LPS A;  3K08 A;  4EFT A;  4HZ3 A;  1JOY A;  3T0Z A;  5EBW C;  2DYS C;  3INX A;  1Q82 W;  1I59 A;  3AG3 B;  4WFF A;  5IDJ A;  3O6O A;  1NBM G;  3ZRW A;  4O04 A;  1RM1 B;  3ABM C;  4MVQ A;  3O2F A;  3VBB A;  4KQV A;  4EGK A;  3RVY A;  2OTL V;  2YE6 A;  3EFF K;  4BIZ A;  2YEA A;  3VHD A;  3F7Y C;  2BOC C;  2Q2E B;  3ZN1 A;  1NHH A;  1FS0 G;  1YT1 A;  2YI7 A;  4V25 A;  4WUD A;  2JEU A;  1SET A;  4N23 A;  1J95 A;  1H7U A;  2WAM A;  1NR7 A;  2QE7 G;  2Z5U A;  3K03 A;  1MSW D;  3ZXO A;  1UYF A;  4CBC A;  1JJ2 U;  1Z5A A;  1ZWI C;  3OWD A;  4MP2 A;  2CK3 G;  1ENV A;  4J9Z B;  4P2Z A;  3BY6 A;  2V7Q G;  3ETD A;  3E35 A;  5CN0 A;  1KIJ A;  4AWQ A;  3SYQ A;  2XAH A;  3QDD A;  3NXS A;  5B1B B;  4JTA B;  4N21 A;  2ZDI A;  1UYL A;  1TBW A;  5L3C A;  4MTG A;  3AG2 C;  1Y8O A;  1E1Q G;  5B3S C;  2JEX A;  1NVP D;  5B1A C;  4H37 A;  4WFA V;  3QNE A;  2BYI A;  3HEK A;  3H01 A;  2YEC A;  4JAU A;  5L3G A;  1I5D A;  4B6C A;  2P67 A;  4I9W A;  1I5B A;  4I3H A;  2PI4 A;  4Z1M G;  1KZN A;  3D36 A;  4W7T A;  2ITD C;  1ZXN A;  4HYO A;  2YE4 A;  1NJI W;  2VCI A;  1RM1 C;  3ETE A;  1VQM V;  2EIL C;  1ZW9 A;  2XJG A;  1NR1 A;  2YI0 A;  1BXD A;  5IYB O;  2YGE A;  1AJN A;  1GTO A;  4WF9 V;  1ID0 A;  2DQ0 A;  1GM9 A;  3AEI A;  2BRE A;  4RAI A;  2BSM A;  3K98 A;  1UYK A;  2YEI A;  3HYZ A;  1P4R A;  2BT0 A;  2CH4 A;  1AR1 B;  3OW6 A;  3TCU A;  2M7W A;  1NHI A;  2JJ2 G;  1VQ7 V;  1M56 B;  1YSR A;  3CWV A;  3ASO C;  1UYM A;  3GIG B;  4XC0 A;  2FWY A;  3O0I A;  4XIT A;  1YJW V;  2Q8I A;  2VCJ A;  2HVK C;  2P6J A;  2JJC A;  1UJW B;  3OAA G;  1AI5 A;  1F4N A;  3EKO A;  5DN6 G;  3LDD A;  4B7P A;  1E1R G;  1ZWH A;  4EM7 A;  2XOK G;  2JJ1 G;  2YEV A;  4QIW F;  2FWZ A;  2YEF A;  4EEH A;  2OCC B;  1GMG A;  2QEX V;  1BKN A;  2IOR A;  1YIJ V;  1JPX A;  4E02 A;  2ZR3 A;  2BU8 A;  1K97 A;  3AG1 C;  4UVA A;  5M4N A;  4MVS A;  4LPB A;  3OR6 C;  3CRK A;  4GCZ A;  3R4P A;  4MPN A;  1LNQ A;  1G4Y B;  1OCR C;  3TET A;  4E2L A;  2K5B A;  2Q8G A;  3G6E V;  2YE3 A;  5M4K A;  5CBF A;  5FND A;  4P9O A;  1I5A A;  1S0V A;  3HZ5 A;  1EA6 A;  2JIZ G;  2BYH A;  5LHI A;  2ATK C;  2NLJ C;  1B6Q A;  2V1D A;  4LWI A;  3AG3 C;  5L3F A;  2WLH A;  3G7B A;  1YSZ A;  4JPR A;  2AHY A;  2C2A A;  3OE7 G;  4GX0 A;  3ZMV A;  2FYP A;  1VQ8 V;  4KFM A;  3ABU A;  1QLE B;  2HKJ A;  1K92 A;  1R6K A;  2XAG A;  3D2R A;  3T10 A;  2Q6A A;  1UYD A;  2YE5 A;  4YKZ A;  4KFG A;  1NQT A;  2XDK A;  3R4N A;  1QY8 A;  4BAE A;  2OTJ V;  4R7C A;  3JZ3 A;  3TZ4 A;  1QR8 A;  1WLE A;  4LC1 A;  3K99 A;  4LCU C;  4XDK A;  3ZKD A;  4LWH A;  4E00 A;  2X6B A;  4MPC A;  4PU9 A;  4QNH B;  1TH8 A;  4F4L A;  1GJV A;  1F23 A;  4RO2 A;  1UYI A;  5B1O A;  1AI4 A;  2BTZ A;  5CBH A;  4YKQ A;  2D3O W;  4J9Y B;  1VQ9 V;  1B63 A;  2GQP A;  4NH9 A;  2H94 A;  1YSC A;  2B1G A;  2BOB C;  3OMI B;  2EIM C;  2EIN B;  5CBG A;  4UUJ C;  1W2B U;  1AH8 A;  2YK9 A;  3WHA A;  4EMV A;  3WG7 C;  2CCU A;  4XIP A;  3STL C;  2P90 A;  4WFB V;  3W7W A;  4CWN A;  2PI5 A;  1JM6 A;  1S14 A;  4LP8 A;  3K04 A;  5CPH A;  3E8B A;  3HB3 B;  3HPL C;  4GQT A;  3T4D A;  4WCE V;  2KB1 A;  3T2M A;  1YT0 A;  4L90 A;  1SZT A;  4AWO A;  3TZ0 A;  5LHG A;  1TUE B;  4X9L A;  2IJI A;  1AJ6 A;  4XD8 A;  3W7X A;  4CWQ A;  2ZBK B;  4CWO A;  3A0Z A;  3ZMT A;  4CWP A;  2QF6 A;  3ASN C;  3TK1 A;  3B26 A;  3C11 A;  5CA3 A;  2Q68 A;  3NMQ A;  5L3B A;  1Y66 A;  1R3L C;  2WLK A;  3E83 A;  2XX2 A;  4QE9 A;  1EI1 A;  5D6Q A;  3K9A A;  3VOU A;  4KSH A;  1YI2 V;  2DWE C;  4UVB A;  1K5Q A;  4JQL A;  2BU7 A;  1QZR A;  4V26 A;  1KEC A;  1R3K C;  1GKX A;  1YT2 A;  4BIU A;  2YED A;  3SPG A;  3U2D A;  3K06 A;  3W7U A;  5F5R A;  1E79 G;  5B1B C;  1QR9 A;  2EIN C;  3DGE A;  1VQK V;  4GX5 A;  4ZKI A;  1BHA A;  3GIF A;  3AG2 B;  3OMU A;  1F4M A;  4WFG A;  5GGZ A;  1RPO A;  3ML0 A;  2GSM B;  3QO8 A;  3JD1 A;  1YC3 A;  2YKC A;  3R65 A;  5IYC O;  3JD2 A;  4DUH A;  2WER A;  3CCE V;  5IDM A;  2EIK C;  3ABL C;  2YJX A;  4FMT A;  2XAB A;  2WLL A;  4PA3 A;  3EHJ A;  4URO A;  1EFR G;  1JCH A;  4FCQ A;  4AWP A;  1HWY A;  3ZRV A;  4RQF A;  4FIP C;  3X2Q C;  3R92 A;  3B24 A;  2CG9 A;  2WI3 A;  3ZIA G;  1THZ A;  4WUB A;  1QCE A;  5L3D A;  4XCL A;  3ABM B;  2WI6 A;  2HG1 A;  2CCS A;  4P7A A;  1UY7 A;  2ZDI C;  1Z5B A;  2A9H A;  3FV5 A;  2XAS A;  1K4C C;  1S3J A;  1B3Q A;  1VQO V;  2XCM A;  2VWC A;  4H81 A;  1AJQ A;  5CTY A;  5KUK A;  4LWF A;  4MPE A;  3CCJ V;  1Z5C A;  4BW5 A;  1US7 A;  3H80 A;  4CWR A;  4QPJ A;  1M56 C;  3K60 A;  1Q81 W;  2B1I A;  1EZJ A;  3T2S A;  1Y8N A;  4XIQ A;  4MT8 A;  1Z59 A;  3MHS C;  1Y4U A;  2XD6 A;  3EHF A;  4DZY A;  3A0R A;  4MVZ A;  1FFT B;  1MG1 A;  3WFV A;  5CTW A;  1PKX A;  3SJQ C;  5L3E A;  1Y4M A;  3CME V;  2F43 G;  2H8P C;  4ASF A;  4JYB A;  3W7T A;  4X89 A;  3Q5J A;  4LWE A;  4R3M A;  3E8H A;  3B25 A;  3WG7 B;  1BL8 A;  3MD0 A;  4XDL A;  3CCS V;  1Y8P A;  2CGF A;  2ESA A;  1H8E G;  1QVG U;  5L3J A;  3M99 B;  1YET A;  1PNK A;  1VQP V;  3OWB A;  5KA6 A;  2YEH A;  3K3W A;  3QO7 A;  3H4L A;  3ZKB A;  1PNL A;  3LSQ A;  2GHY A;  1OCZ B;  3A0T A;  4MVO A;  4YKW A;  4ASG A;  2XHT A;  3X2Q B;  1K4D C;  3SYA A;  2HKO A;  2YEJ A;  5LHH A;  4L91 A;  3OFN G;  2LFS A;  1K7D A;  3SPI A;  1TC6 A;  3VHA A;  4CE3 A;  2YSU B;  2Y69 B;  4OXS A;  3ASN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...