4KP4A

Deciphering cis-trans directionality and visualizing autophosphorylation in histidine kinases.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
ADDRTLLMAGVSHDLRTPLTRIRAYAETIYNSLGELDLSTLKELAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/signaling protein
molecule keywords Osmolarity sensor protein EnvZ, Histidine kinase
publication title Visualizing autophosphorylation in histidine kinases.
pubmed doi rcsb
source organism Escherichia coli
total genus 66
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4kp4A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4kp4A02
4BQGA 4O05A 3T10A 4LWEA 2XJXA 4YKZA 1YS3A 3R4NA 4WUDA 5D6QA 2Q8IA 4AS9A 1H7UA 2WEQA 1UY8A 5FNFA 2XX2A 3ZRVA 2JJCA 3GIGA 1UY7A 2BSMA 1UYEA 1UYFA 2YI5A 4LWIA 2YKCA 4O07A 4LWFA 4URMA 1EA6A 5CTXA 2WI1A 2H8MA 3D36A 2BU7A 3OWDA 3B24A 4WUCA 2O1WA 3CGZA 1NHIA 1U2OA 4NH8A 4U7OA 2XJJA 1BXDA 4GT1A 3OWBA 5M4KA 1US7A 4MPNA 2XDXA 3T2SA 4CE2A 1YC4A 1MX0A 4FCRA 4DZYA 2ZDYA 3GIFA 2IORA 3WHAA 2XDLA 2YK2A 2ESAA 4XE2A 2CCSA 4ASGA 3FV5A 5IDJA 1THNA 2QF6A 4CWSA 4GEEA 4JAVA 4CWRA 5CPHA 1NHHA 3ZKDA 5BOCA 2WEPA 3RLQA 1UYMA 3EKRA 4YKYA 1BKNA 4PL9A 1Y8PA 1YSRA 2XDKA 1TIDA 4XKAA 4FPPA 2YK9A 1PVGA 4W7TA 2BU5A 5F3KA 4CWNA 2YEEA 2WI4A 4YKUA 5D6PA 4XCLA 2BTZA 2Q8HA 1I58A 1QY8A 2CCUA 2WERA 3H80A 3O2FA 4BIZA 3TK1A 4MB9A 1ID0A 4XKKA 2CH4A 4HZ0A 2HG1A 4O09A 2YEIA 4BQJA 1QYEA 2O1UA 4MTXA 2FWYA 2XX5A 2YEAA 4GGLA 4KQVA 2BU8A 3A0YA 2BU2A 3PEHA 3TZ0A 2CG9A 1BYQA 1QZRA 4JASA 1I5DA 1I5AA 4EM7A 3WQ9A 4EFUA 4ZVIA 4GT8A 1Z5CA 2C2AA 4V25A 4XD8A 4FCPA 4E00A 1UYIA 1YERA 1Y8NA 4BAEA 4XDMA 4MBCA 4EFTA 3O6OA 4L94A 2BYIA 1UYCA 4XIRA 3C0EA 3K99A 3EHHA 2BREA 3H4LA 4EMVA 3EKOA 3INXA 4DUHA 2FXSA 2VCJA 3LPSA 3CRLA 2IWSA 3U2KA 4ASBA 3B26A 2QG0A 3EHGA 4EEHA 4JAUA 2O1VA 3NMQA 4XIQA 3G7BA 1KIJA 3RKZA 3BM9A 4BIUA 5CF0A 3K98A 2FTKA 4XKOA 1L0OA 3HHUA 2YGEA 3OPDA 4CWQA 4MOTA 4P8OA 5IN9A 2BT0A 1YT1A 4KSHA 2YEHA 3INWA 1MU5A 3TUHA 2Q2EB 4R3MA 2YGFA 2CCTA 2EXLA 2YE9A 1IXMA 2XX4A 5GGZA 2UWDA 5FWKA 3G75A 4FMTA 2ZBKB 3QDDA 4GQTA 4B7PA 3A0XA 1A4HA 2XD6A 2YEBA 2YI0A 4R1FA 4BXIA 3EHJA 2VWCA 3HZ1A 2YE3A 3A0TA 1BGQA 1H7SA 2P67A 2WI6A 5J6AA 1UYHA 3P32A 1F51A 2Q8FA 3TZ5A 3G7EA 1UYKA 1B3QA 1JM6A 1GKZA 4KSGA 3A0WA 3HZ5A 2QM8A 5L3JA 3MD0A 3VHDA 2YE2A 4YKWA 2YE8A 5CTUA 5FNDA 5CTWA 2VW5A 4YKXA 3TZ2A 4URLA 4CWPA 4EGKA 4L91A 4YKTA 5B1OA 1UYGA 4H81A 4XIPA 2E0AA 4JYCA 2VCIA 2YEFA 2BYHA 2YE5A 3HEKA 4KP4A 4HYMA 4AWPA 1R62A 3Q5KA 1TBWA 1ZXMA 3KE6A 1I59A 3O0IA 4ASFA 2WI7A 4QPKA 1TC6A 5M4EA 3D2RA 4GCZA 4EGIA 1NHJA 4KFGA 2YJXA 3GIGB 3MNRP 4HXWA 3TZ4A 1AH8A 4E01A 5M4HA 3U67A 2YE4A 2YE7A 3IEDA 4QPJA 5B1NA 1S16A 3PEJA 4MPCA 3VHCA 4XCJA 4O0BA 3R4PA 1Z5BA 1ZW9A 2GFDA 3ZXQA 3VADA 1I5CA 3B25A 2XHXA 2FYPA 3QTFA 3NXSA 1Y4UA 1YT0A 1AMWA 4LWGA 2XJGA 2XDUA 3BMYA 4HZ5A 4JYBA 1Y8OA 4CWTA 4MP7A 3RLPA 4L90A 3B28A 3HYZA 2ZKJA 5CTYA 1ZWHA 4HXZA 4EGHA 2IWUA 3ZCCA 1OSFA 4K4OA 3D0BA 4KTNA 4O04A 2Q8GA 3LNUA 1S14A 4AWQA 1TC0A 1UY6A 4MT8A 3CWVA 1TH8A 2XHRA 4UROA 3T1KA 4YKRA 2YGAA 1YSZA 5J71A 1UY9A 2QM7A 3K60A 3SL2A 3U2DA 4NH9A 1ZXNA 2K5BA 4HY6A 2JKIA 5BODA 3OW6A 4CE1A 2YKBA 3A0RA 4URNA 5C93A 1TILA 2WWWA 4I5SA 3VHAA 3FT5A 3RLRA 5F5RA 1KZNA 2HKJA 2YEDA 1B63A 4U93A 2PNRA 2BZ5A 2WI5A 2YEJA 2YJWA 3ZXOA 2XABA 4PU9A 2ZDXA 2GQPA 3R4MA 4XITA 5D7CA 5FNCA 3T0ZA 2YI6A 1AJ6A 4ZKIA 2HCHA 3T0HA 1Z5AA 4H85A 5M4NA 5D7RA 4L93A 4CWFA 2CGFA 3R4OA 4WUBA 3GIEA 4CE3A 5M4PA 3ZRWB 3DGEA 2IOQA 4NH7A 3CRKA 4GFNA 2LFSA 3ZM7A 5M4MA 3K97A 4MPEA 2XCMA 1AM1A 4HYPA 1UYDA 4X9LA 2YKIA 2IOPA 2QFOA 4FCQA 3A0ZA 4AWOA 1AH6A 3OMUA 3TTZA 2YEGA 3Q5JA 4L8ZA 5D7DA 3CGYA 4LWHA 3ZKBA 5IDMA 1YETA 2YECA 1YC3A 2QG2A 4CWOA 3C11A 2YI7A 4XC0A 1Z59A 4PRXA 2YE6A 2FWZA 2AKPA 1I5BA 1GKXA 1UYLA 4R3AA 2BRCA 3R92A 3R91A 4XTJA 2XK2A 3HYYA 4HY1A 2XHTA 2H55A 4JQLA 4MP2A 2XDSA 4H7QA 1JOYA 2WI3A 3Q5LA 3ZRXA 4P7AA 2BU6A 1YT2A 4LC1A 3ZRWA 4LP0A 1Y4SA 4E02A 1EI1A 2YKEA 4LPBA 4I3HA 2LFRA 3B27A 1U0ZA 1B62A 1YC1A 1YESA 4U7NA 4V26A 4YKQA 4B6CA 3FT8A 4PRVA 2IWXA 4ASAA 1GJVA 2YKJA 2WI2A 4Q20A 3JZ3A 3EHFA
chains in the Genus database with same CATH superfamily
2JS5A 4LCUC 1S76D 1RSOB 3CSXA 2R9IA 5D6QA 3WG7C 1RM1B 3SPIA 3WB2A 1H7UA 1RP3B 5GW7A 1BL8A 1QQCA 3FKSG 5H9CA 2JJCA 3GIGA 1Z2GA 1UY7A 3FAVB 2ZXWB 3VQXA 1UYFA 3HR0A 2CTPA 5CTXA 4URMA 1EA6A 2YIDA 1R6NA 2Q8VA 5J9PC 2UUBB 4WBNB 4NH8A 4U7OA 2XJJA 2ZQMA 4LFBO 3CCSV 4MPNA 2VWKA 5CB4B 3E8BA 3QG5A 3ABUA 4Z1MG 4UUJC 1WP8A 4B3RO 4O2BB 3AG4C 2OCCB 4HAMA 3JYCA 2X6AA 1QCEA 4B7KA 2HP8A 4LWSA 1M56B 4XE2A 2HG5C 3ZN1A 4X62O 1THNA 1NZ6A 2YSUB 5H6RA 1KMIZ 1JCHA 5CA0B 4R8CA 4G28B 2KG7B 2JGDB 4JF3A 5CPHA 3ZKDA 1QNMA 2BE3A 5LMNB 1F7YA 3JATA 5JJNB 4D7SA 2ARHA 1URFA 3ZHUA 4YHHB 3E8FA 4Q6GA 3EKRA 3E22B 1Y8PA 2UUCB 4X1IB 1N33O 4I4TB 4CS2A 3K08A 4XKAA 1TIDA 2YK9A 1M4UA 4W7TA 5ITZA 4X20A 1WN7A 2A06H 3ASOC 3IC9A 1V55B 4YKUA 2H8PC 1YJ9V 1AI5A 4B3TB 1R73A 3ML0A 1NT2B 1I58A 2IJHA 2WERA 4KHPO 3VOUA 2Z0AA 4CH6A 3O2FA 1EN4A 5EBLC 2ZE5A 1TVKB 1VEWA 3VQYA 4UFZA 3ZHTA 4DV3O 2YEIA 1QYEA 2WLIA 1S5LZ 3E89A 4O4HA 2YICA 3ETGA 2OIGA 4JI4O 5TISZ 3A0YA 1D5NA 3TZ0A 2CG9A 4EM7A 2YEVB 3UQ8A 3T1YO 4ZVIA 3LDEA 1BZKA 1Y67A 4QGPA 4GT8A 1FD9A 3FD9A 5B5EZ 4DV5B 1UYIA 3AG3C 2UU9O 4BAEA 4UVCA 4MBCA 4EFTA 4L94A 1FS0G 3ABMB 2G38A 3C0EA 1BGYH 5IYZB 3H4LA 1SQQH 3IAYA 3THOA 2FXSA 3HKBB 3LPSA 1OCZC 1SA0A 4JI1O 2V4DA 2XUMA 4ICGA 4JTAB 3RVZA 3I55V 2IWSA 3JD3A 2GTSA 5B1BC 4ASBA 2CTQA 4QJFB 2XAHA 4JAUA 2LGQA 4XIQA 1KIJA 1KBHA 3JALA 2VQFO 4BIUA 2F66C 2FTKA 5LXTB 3SR2C 5LHIA 1XBLA 4CWQA 4P8OA 1Y76A 4KSHA 2YEHA 3INWA 3TUHA 4UB8Z 2Q2EB 2RN9A 4R3MA 2CCTA 1JJOA 1KECA 1W59A 5FWKA 1G4YB 4FMTA 2ZBKB 3QDDA 1IXBA 2EINC 4GX1A 1A4HA 4XBFA 2XD6A 3JAKA 4DV0O 4BXIA 4GX0A 1PNKA 3K0DA 3HPLC 3OT7A 1BGQA 4LFCB 1YXBA 3MDSA 1COWG 1ENVA 3E2EA 3WB0A 5DN6G 1GH6A 3X2QB 2Q8FA 1VP7A 3LDCA 3TZ5A 5JJEB 4DK0A 5B1AB 1UYKA 1N32O 1VQKV 1JM6A 4YJ3B 1O9HA 3HKCA 4KSGA 2V1DA 3BAAA 2ZE6A 4U3JB 2QWPB 4O4IB 4DW0A 1FFTB 3SYPA 1SC5B 5CTUA 3BRCA 3RT3C 5CTWA 4YKXA 4UCTA 4CWPA 4EGKA 1Q6IA 3J7AU 4YKTA 1Y74B 3W7UA 1IBMO 1UYGA 4E72A 1GRJA 1F4MA 1QU7A 2YEFA 4KP4A 4IHJB 4FLVA 4AWPA 1R62A 5LP6B 1I59A 3W7WA 4JYAO 4GKJB 4B08A 3D2RA 3S3XA 1S72V 1BCCH 5IYDO 2YJXA 2WPDG 4TUYB 3TGUH 4HXWA 4TV8A 5M4HA 5DECA 2YE4A 4QPJA 5B1NA 4DR1B 3EXAA 4OPHA 4MPCA 2WLLA 4XCJA 2OCCC 2E74B 3R4PA 1Z5BA 1ZW9A 2GFDA 3K9SA 3B25A 2XHXA 2N74A 5KUKA 2UUAB 2FYPA 4YHHO 1Y4UA 1M56C 1YT0A 1AMWA 3L70H 3TETA 3UO2A 1Y8OA 4CWTA 3EVKA 4X66O 4MP7A 3RLPA 5LOVB 3OMAB 3CCEV 4HXZA 5EZYA 4K4OA 2FKXA 2VWJA 3QTCA 1WP7A 3FYIB 1Q90D 4UVBA 3TJTA 3KG2A 4MW3A 1TC0A 1UY6A 3CWVA 2XHRA 4YKRA 2YGAA 2F43G 1KKDA 4WFHA 2Q7EA 2E76B 4KFMA 4JI6O 4JI0B 2JKIA 1BE3H 3DXRA 3OW6A 2Q6AA 3BFRA 3JASB 1FAFA 3CX5F 2PTMA 1EM1A 5IWAO 1OCOB 3ABLB 3RW0A 4C7UA 4I5SA 3VHAA 3RLRA 5F5RA 1KZNA 2EBOA 1XMOB 1VF7A 2RDCA 1YTFB 2XABA 3S5TA 5D7CA 1AI6A 3W7SA 4I7ZB 4DR2O 1AJ6A 3FX7A 2HCHA 3AG1B 3CEIA 5AG2A 2PF4E 3M99B 5D7RA 5C8YB 3R4OA 4WUBA 1XNRB 5M4PA 2EULA 1O9GA 5LMUB 3G67A 2IOQA 2PI5A 2V7QG 1W0JG 4X65B 2A0LA 2LFSA 5M4MA 2RJZA 2XCMA 1AM1A 3G4SV 4BWAA 1UYDA 2KB1A 1HNXO 1BHAA 2YS8A 2QFOA 4FCQA 3A0ZA 4UV9A 2YEGA 1RPRA 4L8ZA 4CH4A 1JFFA 3ZKBA 3JD1A 1ZL8A 1YETA 2QG2A 2HVJC 2CUGA 2DYSC 2ZR2A 2BTQA 4W4LA 1FXHA 1AILA 4X1KA 2ZD9A 2LP7A 1VQLV 4R3AA 3AK3A 4WF9V 3K59A 3CRQA 4XTJA 5LYJB 3OR7C 3K58A 4LFBB 3HYYA 4HY1A 2XHTA 4IYHA 5KHJA 4DUYO 1G8MA 4B3RB 3G80A 2QWQB 1MZEA 4DYLA 1G6UA 4LPBA 4FFBB 2LFRA 1EFRG 4FLZA 2DOSA 5EC1C 4X62B 4IIJB 2CTWA 4UCSA 4B6CA 4LF8O 4PRVA 3PJSK 4OXSA 3K5MA 1XQ8A 3CHXA 2YKJA 2WI2A 3K9AA 4JV5B 5B1AC 4ZI7B 4NR1A 5B3SB 2ATKC 3CE2A 1IDSA 4WUDA 1CPYA 2QGNA 2RMKB 4JGSA 3ETEA 3KKYA 3SYOA 3B2EE 1I5XA 1XREA 1UYEA 1E1RG 5CBHA 2R72A 1UPGA 2YKCA 1CP9A 3JD4A 4GKJO 4KHPB 3B24A 2R9AA 1KYOF 4AI8A 2QR4A 3RYCA 2JGUA 2O1WA 3JAWA 4W4KA 1K5QA 3K3WA 1YJWV 5JVDB 3KCYA 1U2OA 2JJ1G 2E75B 2HEPA 2JS3A 3BY6A 5J2UA 5BZBA 1VF5B 1GN4A 2ZDYA 4WFAV 2QDOA 2IORA 2EIJC 1FYJA 1QVGU 3T1YB 4PA3A 1K4CC 5EBMC 2CCSA 4RQEA 3ZIAG 3BCCH 2QF6A 4CS4A 4O4LB 4FLYA 1Z5WA 2C1IA 2P4KA 1RSOA 4JAVA 4WFBV 2ZKOA 5EIBC 4KL1A 2UU9B 3CD6V 1XUQA 5K1XA 3FYEB 1YZBA 4ZHQB 3FAVA 1LUWA 3FB5C 4UV8A 3QVNA 5L3DA 5F3KA 1HWYA 2F23A 2Y69B 4JI0O 3K04A 3LMMA 1KC8W 2PI4A 5FPRA 2CDYA 1NH2D 4LNUB 4WBNA 2EX3A 2YDEA 1M9NA 2DQ3A 4DO2A 3MHHC 3Q4HB 2YUAA 2EIKB 2VQFB 4N23A 5CB4A 1EN5A 1WA8B 5L3EA 2CCUA 3AG2B 1MSDA 1R1BA 1JX9A 2YIBA 3OTFA 3RYIA 1IVSA 4NB5A 4L8JA 4YJ2B 4O2BA 3SPHA 3W7XA 4J7JA 1D5AA 4DV4O 4HZ0A 2HG1A 3O9OA 2Z5UA 4Z1VA 2BU2A 5CA0A 1I94O 2KG7A 2JGDA 4FFKA 2DYRB 4X64O 2HJFC 3ASNB 2CGOA 1I5AA 1Q6UA 4MSWC 3WQ9A 2HJDA 4DV0B 1R3KC 1GKFA 4LF9B 3E22A 3FB6C 1B04A 2HHIA 1Z5CA 4X1IA 2GHYA 1NI8A 3LDDA 1BQZA 2LJ2A 3H1KH 4FVMA 3N2KB 2ADPA 4X65O 4Z2WA 3O6OA 2BYIA 3JAMN 4XDKA 3CCRV 3TXQA 3BEHA 3L9DA 1K4DC 3K99A 1N32B 2PGGA 1KP2A 3E8GA 1S5JA 5L3BA 2HLDG 2BREA 1EZJA 1PV0A 1JQ0A 4U3FH 3G71V 3INXA 1E1QG 3ZMTA 3CCQV 1TVKA 3FB7C 2XASA 1MMMA 3ZBHA 5EBWC 2EIMB 1IBMB 4EEHA 3OMNB 3NMQA 2MK3A 4H13B 4HBNA 3G7BA 3OM3B 4D6TH 2YXHA 2Z3YA 3T1HO 1A32A 1Q8IA 4XKOA 1L0OA 2ZNIA 1VQOV 4MOTA 4G2KA 1OCRC 3ZMZA 2BT0A 2YEVA 2ZDIC 4JYAB 1MU5A 4H37A 2YGFA 1PM9A 2EXLA 2HVKC 2UWDA 2L6LA 3UT5B 2ILMA 3HKDB 2BSKA 2GBOA 4GQTA 2CE4A 5BY1A 4H44B 2CK3G 1BS3A 3F5TA 4MVZA 5EYPB 1ZLZA 5IJ9B 1U97A 1R6KA 1RPOA 3EHJA 2EJRA 4R6ZA 2YE3A 4AILC 3QO5A 1BMFG 5HFLA 1H7SA 4JTDB 5LGUA 2WI6A 3I56V 3P32A 1F51A 2UXCB 3HKBA 4JV5O 2ZIMA 4DV7O 3B40A 4PDMA 1CXZB 4X66B 2IJJA 1GKZA 3EHBB 1HNWO 3MD0A 2VQEO 4DR5O 4R7CA 4YKWA 2O57A 3SYCA 2R70A 5LXTA 2VW5A 1XHZA 5JJJB 4URLA 1M5IA 3SPCA 3OFNG 4LF4O 1I7FA 5CA1B 5B1OA 1NH2B 2E0AA 2JJ2G 1VF6A 2AW9A 1SQPH 1QLNA 1Y4MA 4JI6B 2YE5A 3HEKA 5JQGB 4PD4F 1KQSU 4J10A 2Q69A 1I0HA 1ZXMA 1FKAO 1GAXA 3O0IA 5IWAB 3CJHA 1VQNV 3LNMB 4QPKA 1TC6A 1ZAUA 2M7WA 1YIJV 4GCZA 4EGIA 2UXNA 3HKEB 3JSNA 3GIGB 2K9PA 1NTZH 4HNAB 4IYIA 1OCCC 4QIWF 3ABKB 4LFAO 1TA8A 3PEJA 1PD3A 1AP6A 1G1XB 4DR2B 4YJ3A 2Q5ZA 1KB9F 3CRAA 1LR1A 1I5CA 2Q0AA 4O4IA 3T4ZA 3NXSA 4LWGA 4JI2O 4WFGA 3BMYA 2X6BA 4JYBA 4I0XB 5IY5C 1Y74A 2OTJV 2IJKA 2FYUH 2W0FC 3B28A 2ZKJA 5CTYA 3P30A 1VARA 2DMXA 2RCVA 1MABG 4KTNA 3CC4V 1R3IC 2GUZB 2JEXA 1R3JC 4P9PA 3LNUA 2X0LA 4AWQA 3KCXA 4IHJA 4YIPA 1JVMA 4K8XA 1L0LH 5LP6A 3T1KA 1JR9A 1HNXB 1YSZA 1GN2A 4UCRA 1FXKB 1L0NH 2AZ2A 2QM7A 3DTUB 1KP3A 4I55B 3JCUZ 3U2DA 1IBKO 3JATB 1ZXNA 3E86A 4XDJA 2BTOA 1FPOA 2QA4V 4TUYA 4J11A 4CE1A 1IBLO 1US6A 4WCEV 3CC2V 3AK2A 3K79A 4IT5A 4DV2O 5J2TB 1P4RA 4X20B 4ZIBA 5D5PA 2Y48A 5GONB 3FT5A 1QLEC 1CEZA 4CBCA 2XNDG 4LF9O 2YEJA 4DUYB 1QBZA 3K5OA 4XITA 4PDLA 3T0ZA 2YI6A 5LOVA 3ZEDA 4ZKIA 1JPXA 1NQTA 2CH7B 1FFXB 2ZNJA 1HR0O 4B3MB 5H6QA 4CWFA 3CCVV 2CGFA 4LF8B 3GIEA 3C3SA 4K8ZA 1H38A 5JENA 4MW8A 1VQPV 2IH1C 4NH7A 3DSQA 1OZ0A 2AGAA 2WAMA 4GFNA 3RYFB 3ZM7A 2Y0PA 2P4VA 2WLJA 3T2MA 4ABMA 1J5EB 1ORQC 1RM1C 4B3SO 4MPEA 1SETA 3JASA 5L3FA 3R66A 2IOPA 4AWOA 4BW5A 1BQ0A 5BR8B 3OMUA 3Q5JA 3UM7A 3H1JH 2ZXWC 3UCSC 3CRCA 5IDMA 2EIMC 4K35A 1GM9A 4XC0A 2CAZC 3C3TA 4PRXA 2FWZA 3AEIA 4N21A 2E3CA 2AKPA 1TUBB 3R92A 1SA0B 2DWDC 3CB2A 4XDLA 1N0NA 2FL4A 2NLJC 4EB6B 3SPGA 1ROPA 2Q9LA 4JQLA 2XDSA 4H7QA 3Q5LA 5C8YA 3ZRXA 4P7AA 2RQ6A 2XAQA 3DC6A 2BU6A 1H2NA 4NTYA 2F4VO 1Y4SA 4E02A 1EI1A 4B7EA 2UXCO 3JARB 3KZIZ 1P84F 3B27A 2GSMB 1YESA 3K06A 4U7NA 2UXDB 4V26A 4YKQA 1HP8A 4OPAA 3FT8A 4GZRB 1WJZA 3B77A 2JK5C 2IWXA 1QR8A 4JTCB 4FLXA 4RAIA 2A79B 3EHFA 4FCPA 4BQGA 4O05A 1H2LA 4DV1O 3T10A 3PN1A 4LWEA 2XJXA 3CXCU 4YKZA 1YS3A 2L35A 5F2VO 3ZJZA 3R4NA 2ZDIA 2Q8IA 4AS9A 1AROP 1V55C 1K5SA 5KX5B 1YJNV 4FLTA 3ZRVA 2XX2A 3LSSA 4FIPC 4JZ2A 4H33A 4RWUA 2YI5A 2OWOA 4TQFA 2XT9A 2WI1A 3OWDA 2RNBA 3OE7G 3GVMA 2JVDA 1V54B 2XAJA 4QNHB 4K0KO 4DV4B 1NHIA 4PI0A 4FFBA 4FZ1A 4OX9O 5KMGB 1VQMV 4X8AA 3OWBA 3VBBA 2XOKG 3MAQA 1US7A 1MZFA 2EJ7A 1I94B 4CE2A 1YC4A 4X64B 1MX0A 4CH5A 4DZYA 2NN4A 1AP5A 4PA6A 2JIZG 2UXBO 2B5UA 4LH7A 2IJIA 4LR3A 5LHGA 2YK2A 2ESAA 5IDJA 1SRYA 3FV5A 4CWSA 4ZI7A 4GEEA 3CCLV 1I5YA 4CWRA 4UVAA 5FLXN 1P49A 4RO2A 1M57B 5BOCA 1AI4A 2WEPA 3ZHRA 4NVPA 3ABMC 3CCMV 4UXNA 1UYMA 4YKYA 3N2GB 4ZOLB 3A8TA 2XHBA 2P06A 1L1FA 1N34B 3CXHF 1DGSA 1GO3F 4R50A 2BU5A 3WG7B 2HHHO 2YEEA 3OTOB 4JI8O 2WI4A 1JMKC 5JVDA 4XCLA 1P7GA 2BTZA 1X4TA 3RYHB 1FXKC 1WPXA 2Q8HA 4F4LA 1QY8A 4I9WA 4X89A 3T1HB 4WFFA 4BIZA 4MB9A 1XILA 3H1LH 1FJGB 4XKKA 5KA5A 2ZE7A 4BQJA 1PNLA 1M93A 4TQDA 1H8HG 1VF6C 2WLNA 4MTXA 4O4LA 4EKWA 1VQ9V 4KQVA 2BU8A 3CP1A 4HYOA 3PEHA 1NKDA 1BYQA 4J7ZA 2YC0A 2IU0A 1XL6A 1I5DA 1WB8A 3AG4B 4NXNB 1SESA 4YXWG 4FLUA 4EFUA 4B3MO 1AJPA 1XNQO 4ZHQA 4OGQB 3G6BA 4V25A 4JPRA 4E00A 5KA6A 4P9OA 3JSLA 1Y8NA 1K3EA 4XDMA 1SZTA 3X2QC 3TXSA 1XHXA 4DV7B 2GDSA 1J5EO 4DV6O 4LNUA 3EHHA 1SERA 4GKKO 4NYKA 3Q4HA 2VRZA 1HNWB 3BHPA 1GM7A 1WA8A 4MS2A 1GM8A 2VQEB 4DR5B 5K1PA 4DUHA 5BR8O 3E35A 4NTXA 4YJ2A 1Q5OA 2DQ0A 3U2KA 1N8RW 3ASOB 3B26A 1AR4A 4LF4B 3EHGA 4CS3A 3SJBC 5JCOC 3SYQA 3B8MA 3IC7A 4J9YB 1AJNA 5LHHA 4LF7O 3BA9A 3H9VA 3BPZA 3RKZA 2WLMA 3GB7C 1EBOA 5CF0A 2XTAA 4TWKA 4FM2A 4EFEA 3HHUA 3C90A 3I5DA 3CC7V 5LP6C 4I50B 1YT1A 2Q73A 3FB8C 4I9QA 1QR9A 2M6YA 2YE9A 1IXMA 2XX4A 5GGZA 3G75A 3BA8A 1PPJH 3N2KA 5BMVB 2GTAA 4LFAB 4MVSA 4DUZB 1DK1A 2UXDO 2BTQB 4R1FA 2YIBD 2VWCA 3HZ1A 4J42A 3ZHSA 4UB6Z 3A0TA 2P67A 3OAAG 5LA6B 2Q0OC 3EFFK 3AG3B 1DF4A 4JI2B 4NKGB 1SQVH 3OMIB 4JI7B 1YSCA 1F23A 5KLVH 3R65A 2QKAA 3T1CA 1MOFA 3JCZA 5FNVB 3ZHQA 2JDIG 3OD4A 5FNDA 3F7VC 1OCZB 4FM1A 1NU1H 4L91A 3UKMA 1K9MW 5B1BB 3U11A 2A7WA 4XIPA 1EN6A 4JYCA 1WAZA 1IBKB 2VCIA 2E5LB 2QKSA 3UT5A 4YY3O 3HKDA 4HYMA 3Q5KA 4DK1A 1YVWA 2OYQA 1IBLB 2ZE8A 3BVOA 2AZ0A 1TBWA 5IE9A 5IJ9A 5JH7B 4DV2B 4PHZA 3AG7A 1OCOC 3ABLC 3M7MX 1M90W 2OCHA 2ODMA 4TV9B 4PA4A 4KFGA 3MNRP 2IU3A 1AH8A 1N36O 2EINB 1Q3EA 3U67A 3E83A 4PA9A 3IEDA 4X1YB 4GX5A 2QM4A 4I4TA 3VHCA 3AG1C 3ZXQA 2UXXA 4J80A 3VADA 1TUEB 5D5QA 5CA3A 3A0HZ 1PNMA 3QTFA 1HR0B 3QO7A 1T5EA 2XDUA 5J2UB 1J95A 1N34O 5CA1A 4EFBA 1K7DA 4K3AA 4GYCB 4EGHA 2IWUA 3ZCCA 3D0BA 3LNNA 4NXMO 3OTOO 2Q8GA 1S14A 5JQGA 5HFMA 1LUVA 1WPBA 4B3SB 5LGNA 4DR7O 1S0VA 1TH8A 4UROA 4F6RB 5J71A 1ZUQA 1UY9A 3SL2A 4LF5O 4NH9A 3TCUA 4QE7A 1SF9A 1JA8A 1FJGO 3L73H 2LQTA 3HKEA 3CPWU 2QTSA 2ZCEA 3IGAC 4HNAA 1M1KW 4F6EA 2PUSA 2KSDA 3F5WC 2YKBA 2LO1A 3QF7A 3ZMUA 4AQYO 4LF6O 1K8AW 4URNA 3OUFA 1WLEA 3CWBH 1YHQV 2YXLA 2YI8A 1Q86W 2PZSA 3QNEA 4NXNO 5IYCO 1TILA 2WWWA 1XMQO 2YEDA 1KD1W 2PNRA 3U0ZA 5LGTA 2YJWA 2ZR3A 3ZXOA 2ZDXA 3H01A 3CYOA 2GQPA 1BSMA 4I0XA 3LUTB 5IYZA 3CYGA 2F4VB 3RYIB 4L87A 3SGIA 2WA4A 1NR1A 5EC2C 2GUZA 3CMEV 4H85A 4UCOA 4O4JB 5M4NA 1YDXA 3VQWA 4CE3A 3ZRWB 3DGEA 2OIEA 5IJ0B 4O2AB 1AR1B 5KHIA 4GX2A 1FXKA 3OR6C 4CC5A 4I55A 4NTWA 4DV1B 4DRXB 3CRKA 1S3JA 4PJ0Z 5B3SC 2HKOA 5FPOA 4TOIA 1YI2V 4HYPA 2YKIA 5J2TA 3CMAV 5EK0A 3CRRA 5D7DA 2Q7HA 3IJ4A 3UO3A 2YECA 2N05A 2ADQB 2OTLV 5GONA 1B06A 2YI7A 3JD0A 1MNGA 1RFYA 1Z59A 2YE6A 1V9PA 1I5BA 1GKXA 1UYLA 2BRCA 1SQXH 1SS3A 4K0KB 2PY5A 3R91A 2Q4PA 2ZT9B 1XEQA 1NS1A 4OX9B 1IURA 2XK2A 1H2MA 1FFXA 2CH7A 4MVQA 2H55A 4GUNA 4DUZO 2ZINA 4TSFG 4MP2A 1UJWB 1JOYA 4BIOA 4DR4B 1KU9A 3E8HA 4U3JA 5CBGA 5L3CA 2UXBB 3OEHG 2W6IG 3A0BZ 5KAFZ 1NR7A 4JI7O 1B62A 3RYFA 1E79G 4CZZA 1HNZO 2QWOB 4H0LB 2BCCH 5JCOA 5EIBD 4DR6O 3RN4A 3FFQA 2BSKB 4Q20A 3JZ3A 1AVMA 4LWSB 4ZBMA 4LP8A 1Y6XA 2H94A 2P7TC 1BHBA 3H1HH 3QO8A 2ZM6O 2Y69C 5LBQA 1PP9H 2W6JG 2E5LO 2WEQA 2HHHB 1UY8A 1TUBA 4JI8B 5FNFA 1PKXA 2AHZA 1SZXA 5FL7G 3LSUA 1AI7A 1IX9A 4CC6A 2BSMA 4EB6A 2EIKC 5GTIZ 4LWIA 3AG2C 4O07A 4LWFA 2DYSB 2H8MA 3D36A 5ITZB 2BU7A 5CMUA 1MG1A 1QVFU 4WUCA 2Q67A 4E2LA 4JAAA 1D2DA 3ZMVA 1Q82W 3G6EV 3JD2A 3CGZA 1R6TA 1B6QA 1H2SB 3ZRSA 3SJCC 3JARA 3MHSC 1BXDA 1Z5VA 3P3PA 4GT1A 5M4KA 2FB5A 3K03A 1IZ3A 1NVPD 1K33A 4KXRA 1OJHA 1K97A 2DYRC 2XDXA 3T2SA 3ASNC 3J81N 4FCRA 4JI3O 1THZA 4PA7A 3N27A 3GIFA 3WHAA 3L72H 2XDLA 1Q43A 2WLKA 1XNQB 2WLIB 4ASGA 1KUQA 1YTFD 4O4HB 2XAFA 3CJHB 1N0JA 4P30A 1OV9A 2CGNA 1NHHA 2X7RB 2HR3A 3A2FA 2PYJA 3RLQA 2WSSG 5KX5A 2YIAA 4DR3B 4RUEA 4EEQA 4DV6B 1I08A 1BKNA 4PL9A 4GKKB 2LW7A 1YSRA 2P5OA 2XDKA 3D3IA 4FPPA 3RGBA 1PVGA 2ITCC 3WB1A 4CWNA 5D6PA 3NR7A 2Y4TA 5CBFA 3OGCC 2B9ZA 5KMGA 1XDCA 4LF7B 3SJAC 3OW2U 4UCUA 2D2CB 3H80A 2IM9A 2ZIOA 3TK1A 2Q7GA 3VQVA 2QEXV 1ID0A 3SDLA 1MSWD 2UUBO 2CH4A 3K0GA 3APOA 4KUMA 4O09A 3RBZA 2ETNA 2YI9A 2NR5A 4MTFA 2EILB 5H5NA 2O1UA 3JALB 2FWYA 2ITDC 2XX5A 2YEAA 4GGLA 3SPJA 3ZX6A 1QZRA 5BXZA 4JASA 1Y76B 3U10A 2QKCA 2EIJB 2QJ1A 1ZSPA 1K73W 3N2GA 4ZOLA 2IBZH 2C2AA 2F1MA 4XD8A 2AHYA 2C1GA 2BOBC 2A9HA 1YERA 5LMNO 1F4NA 3CS5A 1NJIW 1DF5A 3JAKB 1UYCA 2W0XA 1S77D 3CRMA 4XIRA 2PYLA 5JWPA 2UUCO 1XOUA 3M8AA 3RYHA 2YXYA 4EMVA 1PL4A 3D3QA 3EKOA 2F95B 4MVRA 5E1AC 2VCJA 2QWRB 4PI2A 1VMGA 3CRLA 5LYJA 1LNQA 2QG0A 4MVOA 1ZWIC 4E4EA 5E79Z 2O1VA 3HKCB 4B3TO 5KUMA 2Y0IA 3BM9A 1SQFA 1HDJA 1X59A 1H8EG 3T4DA 3K98A 4YY3B 1VQ5V 2YGEA 3OPDA 1WB7A 5IN9A 3LSQA 4IIJA 4DR4O 2CTRA 4ASUG 4IL6Z 2B1GA 2QSAA 1K92A 3ZMSA 2EZPA 5L3GA 1QHTA 2DE0X 2Q68A 1HW7A 4MTOA 1NVPB 1ZX3A 4B7PA 3A0XA 4FLWA 1N36B 3ABKC 1GMGA 3ZS8C 2YI0A 2YEBA 3WFVA 2N04A 3ABTA 4AHCA 2D3OW 2JEUA 4DV5O 4IGGA 5J6AA 1UYHA 4DW1A 1U96A 1AJQA 4TV8B 3RFRA 3DC5A 1TAEA 4LBEC 5IT9N 2K1EA 2XAGA 3G7EA 2KKWA 1SKVA 2IW5A 1B3QA 2WLLB 2WA3A 3ETQA 4JI5B 3A0WA 3HZ5A 3OGIB 1YCIA 2QM8A 5L3JA 4NXMB 1DTOA 3VHDA 2YE2A 2YE8A 1AB3A 5KHHA 1NBMG 1EZVH 3D8CA 3TZ2A 3ETDA 3L74H 4DR7B 3CCJV 4I50A 4HZ3A 4BAYA 4H81A 1S5HC 2HFEC 1JJ2U 2AXTZ 4LF5B 5EZYB 2BYHA 3WU2Z 1P7BA 3GWOA 4JZGA 4RQFA 5BMVA 4FZ0A 4TT3G 1W0KG 3ICXA 3KE6A 1OCRB 5KHKA 4ASFA 3HB3B 4LF6B 4AQYB 2WI7A 1FXVA 5M4EA 3J80N 1YEWA 2BOCC 5LA6A 1NHJA 1L8DA 1XMQB 1GTOA 5H2FZ 1YF2A 3DXRB 3TZ4A 4E01A 4JYYA 2P6JA 3K5NA 1SQBH 2YE7A 4YIOA 2VS0A 1S16A 1Q81W 2A3QA 4O0BA 5CN0A 5FNVA 4LFCO 4A5UB 1WNSA 1GK9A 4DR3O 2XJGA 2Y4UA 4P2ZA 3S3WA 4HZ5A 4DXWA 1MA1A 4PV1B 4L90A 2H3OA 2QTOA 3HYZA 4RUFA 1ZWHA 3STLC 5KAIZ 1OSFA 4MTGA 4O04A 2DN9A 5A2QN 1OHHG 4MT8A 1Q7YW 4J9ZB 1N33B 5A9GA 1UFIA 5JH7A 1VIBA 1BT8A 3K60A 2K5BA 4HY6A 1K34A 3IFXA 4TV9A 2X6CA 5KHGA 5BODA 4D7TA 3SYAA 4X1YA 3B09A 1SQGA 1TGOA 3A0RA 1Q6HA 5C93A 3K5LA 3O65A 2DW4A 4GLXA 1JFFB 5LL6Y 1ZL8B 2OT5A 3ZHVA 2DJVA 4DV3B 2HKJA 3AK1A 1B63A 3D36C 1PL0A 1R3LC 2LGWA 2BZ5A 2EILC 2WI5A 4U93A 3GWKC 4PU9A 4X1KB 1OCCB 4JI4B 4DR1O 3R4MA 5B66Z 5FNCA 3STZC 2KQXA 1KKCA 1H2GA 4X9QA 3T0HA 4MVUA 3RVYA 1Z5AA 4CH3A 2UUAO 3B4SA 2B1IA 4L93A 1HNZB 2GV9A 2F93B 1N4CA 1VQ7V 1VQ4V 4DR6B 3ZN0A 5IY5B 4F6RA 4J41A 5GTHZ 3W7TA 4PELA 2EZOA 3OUSA 2DWEC 3K97A 4J7KA 2QWNB 4X9LA 2ZM6B 3L71H 2P22C 2R9RB 1GN6A 1XI1A 3B8NA 4LH6A 4PDRA 1AH6A 3TTZA 5IYBO 1W2BU 4JI1B 3CGYA 4LWHA 3APQA 2FMLA 1YC3A 5EYPA 4CWOA 3C11A 2WLHA 3OEEG 4UCVA 1NTKH 4QE9A 3L75H 1H2KA 4G27B 1V54C 2JRIA 3SJQC 1XL4A 4X88A 1Y66A 3F7YC 2LW1A 2IH3C 1GN3A 5DM6V 2P90A 1AR5A 3BABA 4O4JA 1XMOO 2WI3A 1QLEB 4BW9A 4BR6A 1YT2A 4LC1A 3ZRWA 3RYCB 4JI3B 1VQ6V 3P3NA 4LP0A 5IJ0A 3JAWB 4O2AA 1DLBA 4FK5C 2YKEA 5DEDA 4I3HA 1YITV 1U0ZA 1ZTEA 4DRXA 2QE7G 1VQ8V 1YC1A 4PDVA 1XNRO 1NTMH 1M57C 2MW2B 4FJCC 3RWRD 3H1IH 4MVMA 3K57A 3CCUV 2NNUA 4JI5O 4WFEA 5LMUO 4ASAA 1GJVA 4FM0A
chains in the Genus database with same CATH topology
4LCUC 1S76D 2R9IA 5D6QA 3WG7C 1RM1B 3SPIA 1H7UA 5GW7A 1BL8A 3FKSG 5H9CA 2JJCA 3GIGA 1UY7A 2ZXWB 1UYFA 5CTXA 4URMA 1EA6A 1R6NA 5J9PC 4NH8A 4U7OA 2XJJA 2ZQMA 3CCSV 4MPNA 3E8BA 3ABUA 4Z1MG 4UUJC 3AG4C 2OCCB 4HAMA 3JYCA 2X6AA 1QCEA 4XE2A 1M56B 2HG5C 3ZN1A 1THNA 2YSUB 5H6RA 1JCHA 4R8CA 4G28B 4JF3A 5CPHA 3ZKDA 3E8FA 3EKRA 1Y8PA 3K08A 4XKAA 1TIDA 2YK9A 4W7TA 3ASOC 1V55B 4YKUA 2H8PC 1YJ9V 1AI5A 1R73A 3ML0A 1I58A 2IJHA 2WERA 3VOUA 3O2FA 5EBLC 2YEIA 1QYEA 2WLIA 3E89A 3ETGA 3A0YA 3TZ0A 2CG9A 4EM7A 2YEVB 4ZVIA 3LDEA 4GT8A 1UYIA 3AG3C 4BAEA 4UVCA 4MBCA 4EFTA 4L94A 1FS0G 3ABMB 3C0EA 3H4LA 2FXSA 3LPSA 1OCZC 3RVZA 4JTAB 3I55V 2IWSA 3JD3A 5B1BC 4ASBA 4QJFB 2XAHA 4JAUA 4XIQA 1KIJA 4BIUA 2FTKA 5LHIA 4CWQA 4P8OA 4KSHA 2YEHA 3INWA 3TUHA 2Q2EB 4R3MA 2CCTA 1KECA 5FWKA 1G4YB 4FMTA 2ZBKB 3QDDA 2EINC 4GX1A 1A4HA 4XBFA 2XD6A 4BXIA 4GX0A 1PNKA 3K0DA 3HPLC 1BGQA 1COWG 1ENVA 3E2EA 5DN6G 3X2QB 2Q8FA 3LDCA 3TZ5A 5B1AB 1UYKA 1VQKV 1JM6A 4KSGA 2V1DA 1FFTB 3SYPA 5CTUA 5CTWA 4YKXA 4CWPA 4EGKA 4YKTA 3W7UA 1UYGA 1F4MA 2YEFA 4KP4A 4AWPA 1R62A 1I59A 3W7WA 3D2RA 1S72V 5IYDO 2YJXA 2WPDG 4HXWA 5M4HA 2YE4A 4QPJA 5B1NA 4MPCA 2WLLA 4XCJA 2OCCC 3R4PA 1Z5BA 1ZW9A 2GFDA 3B25A 2XHXA 5KUKA 2FYPA 1Y4UA 1M56C 1YT0A 1AMWA 3TETA 1Y8OA 4CWTA 4MP7A 3RLPA 3OMAB 3CCEV 4HXZA 4K4OA 3FYIB 4UVBA 3KG2A 4MW3A 1TC0A 1UY6A 3CWVA 2XHRA 4YKRA 2YGAA 2F43G 1KKDA 4WFHA 4KFMA 2JKIA 3OW6A 2Q6AA 1OCOB 3ABLB 3RW0A 4I5SA 3VHAA 3RLRA 5F5RA 1KZNA 2EBOA 2XABA 1YTFB 5D7CA 1AI6A 3W7SA 1AJ6A 2HCHA 3AG1B 3M99B 5D7RA 3R4OA 4WUBA 5M4PA 2IOQA 2PI5A 2V7QG 1W0JG 2A0LA 2LFSA 5M4MA 2XCMA 1AM1A 3G4SV 1UYDA 2KB1A 1BHAA 2QFOA 4FCQA 3A0ZA 4UV9A 2YEGA 1RPRA 4L8ZA 3ZKBA 3JD1A 1YETA 2QG2A 2HVJC 2DYSC 2ZR2A 1FXHA 2ZD9A 2LP7A 1VQLV 4R3AA 4WF9V 4XTJA 3OR7C 3HYYA 4HY1A 2XHTA 1G8MA 4LPBA 2LFRA 1EFRG 5EC1C 4B6CA 4PRVA 3PJSK 4OXSA 2YKJA 2WI2A 3K9AA 5B1AC 5B3SB 2ATKC 4WUDA 1CPYA 4JGSA 3ETEA 3SYOA 1I5XA 1UYEA 1E1RG 5CBHA 2YKCA 1CP9A 3JD4A 3B24A 2O1WA 1K5QA 3K3WA 1YJWV 1U2OA 2JJ1G 3BY6A 5BZBA 2ZDYA 4WFAV 2IORA 2EIJC 1QVGU 4PA3A 1K4CC 5EBMC 2CCSA 4RQEA 3ZIAG 2QF6A 4JAVA 4WFBV 3CD6V 3FYEB 3FB5C 4UV8A 5L3DA 5F3KA 1HWYA 2Y69B 3K04A 1KC8W 2PI4A 1NH2D 1M9NA 2DQ3A 4DO2A 3MHHC 2EIKB 4N23A 5L3EA 2CCUA 3AG2B 1JX9A 3SPHA 3W7XA 4HZ0A 2HG1A 2Z5UA 2BU2A 2DYRB 2HJFC 3ASNB 1I5AA 4MSWC 3WQ9A 1R3KC 1GKFA 3FB6C 1Z5CA 2GHYA 3LDDA 3O6OA 2BYIA 4XDKA 3CCRV 3BEHA 1K4DC 3K99A 1KP2A 3E8GA 5L3BA 2HLDG 2BREA 1EZJA 1JQ0A 3G71V 3INXA 1E1QG 3ZMTA 3CCQV 3FB7C 2XASA 5EBWC 2EIMB 4EEHA 3OMNB 3NMQA 2MK3A 3G7BA 3OM3B 2Z3YA 4XKOA 1L0OA 1VQOV 4MOTA 4G2KA 1OCRC 3ZMZA 2BT0A 2YEVA 2ZDIC 1MU5A 4H37A 2YGFA 2EXLA 2HVKC 2UWDA 4GQTA 2CK3G 4MVZA 1R6KA 1RPOA 3EHJA 2EJRA 4R6ZA 2YE3A 3QO5A 1BMFG 5HFLA 1H7SA 4JTDB 5LGUA 2WI6A 3I56V 3P32A 1F51A 4PDMA 2IJJA 1GKZA 3EHBB 3MD0A 4R7CA 4YKWA 3SYCA 2VW5A 4URLA 3SPCA 3OFNG 1NH2B 5B1OA 2E0AA 2JJ2G 1QLNA 1Y4MA 2YE5A 3HEKA 1KQSU 2Q69A 1ZXMA 3O0IA 1VQNV 3LNMB 4QPKA 1TC6A 2M7WA 1YIJV 4GCZA 4EGIA 2UXNA 3GIGB 1OCCC 4QIWF 3ABKB 3PEJA 1PD3A 1I5CA 3T4ZA 3NXSA 4LWGA 4WFGA 3BMYA 2X6BA 4JYBA 5IY5C 2OTJV 2IJKA 2W0FC 3B28A 2ZKJA 5CTYA 3P30A 1MABG 4KTNA 3CC4V 1R3IC 2JEXA 1R3JC 4P9PA 3LNUA 2X0LA 4AWQA 1JVMA 3T1KA 1YSZA 1FXKB 2QM7A 3DTUB 1KP3A 3U2DA 1ZXNA 3E86A 4XDJA 2QA4V 4CE1A 4WCEV 3CC2V 3K79A 1P4RA 2Y48A 3FT5A 1QLEC 1CEZA 4CBCA 2XNDG 2YEJA 1QBZA 4XITA 4PDLA 3T0ZA 2YI6A 4ZKIA 1JPXA 1NQTA 5H6QA 4CWFA 3CCVV 2CGFA 3GIEA 1H38A 4MW8A 1VQPV 2IH1C 4NH7A 1OZ0A 2WAMA 4GFNA 3ZM7A 3T2MA 2WLJA 1ORQC 1RM1C 4MPEA 1SETA 5L3FA 2IOPA 4AWOA 4BW5A 3OMUA 3Q5JA 3UM7A 2ZXWC 5IDMA 2EIMC 1GM9A 4XC0A 4PRXA 2FWZA 3AEIA 4N21A 2AKPA 3R92A 2DWDC 4XDLA 2NLJC 3SPGA 1ROPA 4JQLA 2XDSA 4H7QA 3Q5LA 3ZRXA 4P7AA 2XAQA 2BU6A 1Y4SA 4E02A 1EI1A 3B27A 2GSMB 1YESA 3K06A 4U7NA 4V26A 4YKQA 3FT8A 3B77A 2JK5C 2IWXA 1QR8A 4JTCB 4RAIA 2A79B 4FCPA 3EHFA 4BQGA 4O05A 3T10A 4LWEA 2XJXA 3CXCU 4YKZA 1YS3A 3ZJZA 3R4NA 2ZDIA 2Q8IA 4AS9A 1AROP 1V55C 1K5SA 1YJNV 2XX2A 3ZRVA 3LSSA 4FIPC 4H33A 2YI5A 2WI1A 3OWDA 3OE7G 1V54B 2XAJA 4QNHB 1NHIA 1VQMV 4X8AA 3OWBA 3VBBA 2XOKG 1US7A 4CE2A 1YC4A 1MX0A 4DZYA 4PA6A 2JIZG 2B5UA 2IJIA 5LHGA 2YK2A 2ESAA 5IDJA 1SRYA 3FV5A 4CWSA 4GEEA 3CCLV 1I5YA 4CWRA 4UVAA 4RO2A 1M57B 5BOCA 1AI4A 2WEPA 3ABMC 3CCMV 4UXNA 1UYMA 4YKYA 1L1FA 1GO3F 4R50A 2BU5A 3WG7B 2YEEA 2WI4A 4XCLA 2BTZA 1FXKC 1WPXA 2Q8HA 4F4LA 1QY8A 4I9WA 4X89A 4WFFA 4BIZA 4MB9A 4XKKA 5KA5A 4BQJA 1PNLA 1H8HG 2WLNA 4MTXA 4EKWA 1VQ9V 4KQVA 2BU8A 3CP1A 4HYOA 3PEHA 1NKDA 1BYQA 2IU0A 1XL6A 1I5DA 3AG4B 1SESA 4YXWG 4EFUA 1AJPA 4V25A 4JPRA 4E00A 5KA6A 4P9OA 1Y8NA 1K3EA 4XDMA 1SZTA 3X2QC 3EHHA 1SERA 1GM7A 4MS2A 1GM8A 4DUHA 3E35A 2DQ0A 3U2KA 1N8RW 3ASOB 3B26A 3EHGA 3SYQA 3B8MA 3IC7A 4J9YB 1AJNA 5LHHA 3RKZA 2WLMA 3GB7C 1EBOA 5CF0A 4TWKA 3HHUA 3CC7V 1YT1A 3FB8C 1QR9A 2YE9A 1IXMA 2XX4A 5GGZA 3G75A 4MVSA 4R1FA 2VWCA 3HZ1A 3A0TA 2P67A 3OAAG 3EFFK 3AG3B 1DF4A 3OMIB 1YSCA 1F23A 3R65A 3T1CA 1MOFA 3JCZA 2JDIG 5FNDA 3F7VC 1OCZB 4L91A 3UKMA 1K9MW 5B1BB 4XIPA 4JYCA 2VCIA 2QKSA 4HYMA 3Q5KA 1TBWA 1OCOC 3ABLC 1M90W 4PA4A 4KFGA 3MNRP 2IU3A 1AH8A 3U67A 2EINB 3E83A 4PA9A 3IEDA 4GX5A 3VHCA 3AG1C 3ZXQA 2UXXA 3VADA 1TUEB 5CA3A 3QTFA 1PNMA 3QO7A 2XDUA 1J95A 1K7DA 4EGHA 2IWUA 3ZCCA 3D0BA 2Q8GA 1S14A 5HFMA 5LGNA 1S0VA 1TH8A 4UROA 5J71A 1UY9A 3SL2A 4NH9A 3TCUA 4QE7A 3CPWU 3IGAC 1M1KW 3F5WC 2YKBA 4URNA 3ZMUA 1K8AW 3OUFA 1WLEA 1YHQV 1Q86W 3QNEA 5IYCO 1TILA 2WWWA 2YEDA 1KD1W 2PNRA 5LGTA 2YJWA 2ZR3A 3ZXOA 2ZDXA 3H01A 3CYOA 2GQPA 3LUTB 4L87A 1NR1A 5EC2C 4H85A 3CMEV 5M4NA 4CE3A 3ZRWB 3DGEA 1AR1B 4GX2A 1FXKA 3OR6C 3CRKA 1S3JA 5B3SC 2HKOA 1YI2V 4HYPA 2YKIA 3CMAV 5EK0A 5D7DA 2YECA 2OTLV 2YI7A 3JD0A 1Z59A 2YE6A 1I5BA 1GKXA 1UYLA 2BRCA 3R91A 2XK2A 4MVQA 2H55A 4MP2A 4TSFG 1UJWB 1JOYA 3E8HA 5CBGA 5L3CA 3OEHG 2W6IG 1NR7A 1B62A 1E79G 4CZZA 4Q20A 3JZ3A 4ZBMA 4LP8A 2H94A 2P7TC 1BHBA 3QO8A 2Y69C 5LBQA 2W6JG 2WEQA 1UY8A 5FNFA 1PKXA 2AHZA 5FL7G 1AI7A 2BSMA 2EIKC 4LWIA 3AG2C 4O07A 4LWFA 2DYSB 2H8MA 3D36A 2BU7A 5CMUA 1MG1A 1QVFU 4WUCA 2Q67A 4E2LA 3ZMVA 1Q82W 3G6EV 3JD2A 3CGZA 1B6QA 3ZRSA 3MHSC 1BXDA 4GT1A 5M4KA 3K03A 1NVPD 1K33A 2XDXA 1K97A 2DYRC 3T2SA 3ASNC 4FCRA 1THZA 4PA7A 3GIFA 3WHAA 2XDLA 2WLKA 2WLIB 4ASGA 1YTFD 2XAFA 4P30A 1NHHA 2X7RB 2HR3A 3RLQA 2WSSG 4RUEA 1BKNA 4PL9A 1YSRA 2XDKA 3D3IA 4FPPA 1PVGA 2ITCC 4CWNA 5D6PA 5CBFA 3OGCC 3OW2U 3H80A 3TK1A 2QEXV 1ID0A 1MSWD 2CH4A 3K0GA 4KUMA 4O09A 3RBZA 4MTFA 2EILB 2O1UA 2FWYA 2ITDC 2XX5A 2YEAA 4GGLA 3SPJA 1QZRA 4JASA 2EIJB 1K73W 2C2AA 4XD8A 2AHYA 2BOBC 2A9HA 1YERA 1F4NA 1NJIW 1DF5A 1UYCA 1S77D 4XIRA 4EMVA 3EKOA 4MVRA 5E1AC 2VCJA 3CRLA 1LNQA 2QG0A 4MVOA 1ZWIC 2O1VA 5KUMA 3BM9A 3K98A 1H8EG 3T4DA 1VQ5V 2YGEA 3OPDA 5IN9A 3LSQA 4ASUG 2B1GA 1K92A 3ZMSA 2EZPA 5L3GA 2Q68A 4MTOA 1NVPB 4B7PA 3A0XA 3ABKC 1GMGA 2YI0A 2YEBA 3WFVA 3ABTA 2D3OW 2JEUA 5J6AA 1UYHA 1AJQA 4LBEC 2K1EA 2XAGA 3G7EA 2IW5A 2WLLB 1B3QA 3A0WA 3HZ5A 2QM8A 5L3JA 1DTOA 3VHDA 2YE2A 2YE8A 1NBMG 3TZ2A 3ETDA 3CCJV 4HZ3A 4BAYA 4H81A 1S5HC 2HFEC 1JJ2U 2BYHA 1P7BA 3GWOA 4RQFA 4TT3G 1W0KG 3KE6A 1OCRB 4ASFA 3HB3B 2WI7A 1FXVA 5M4EA 2BOCC 1NHJA 1GTOA 3TZ4A 4E01A 2P6JA 2YE7A 1S16A 1Q81W 4O0BA 5CN0A 1GK9A 2XJGA 4P2ZA 4HZ5A 4DXWA 4L90A 2QTOA 3HYZA 4RUFA 1ZWHA 3STLC 1OSFA 4MTGA 4O04A 1OHHG 4MT8A 1Q7YW 4J9ZB 3K60A 2K5BA 4HY6A 1K34A 3IFXA 2X6CA 5BODA 3SYAA 3A0RA 5C93A 2DW4A 2OT5A 2HKJA 1B63A 1PL0A 1R3LC 4U93A 2BZ5A 2EILC 2WI5A 4PU9A 1OCCB 3R4MA 5FNCA 3STZC 1H2GA 3T0HA 4MVUA 3RVYA 1Z5AA 2B1IA 4L93A 1VQ7V 1VQ4V 3ZN0A 5IY5B 3W7TA 4PELA 2EZOA 3OUSA 2DWEC 3K97A 4X9LA 2R9RB 3B8NA 4PDRA 1AH6A 3TTZA 5IYBO 1W2BU 3CGYA 4LWHA 1YC3A 4CWOA 3C11A 2WLHA 3OEEG 4QE9A 4G27B 1V54C 3SJQC 1XL4A 4X88A 1Y66A 3F7YC 2IH3C 5DM6V 2P90A 2WI3A 1QLEB 1YT2A 4LC1A 3ZRWA 1VQ6V 4LP0A 1DLBA 4FK5C 2YKEA 4I3HA 1YITV 1U0ZA 2QE7G 1VQ8V 1YC1A 4PDVA 1M57C 4FJCC 4MVMA 3CCUV 2NNUA 4WFEA 4ASAA 1GJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQG A;  4O05 A;  3T10 A;  4LWE A;  2XJX A;  4YKZ A;  1YS3 A;  3R4N A;  4WUD A;  5D6Q A;  2Q8I A;  4AS9 A;  1H7U A;  2WEQ A;  1UY8 A;  5FNF A;  2XX2 A;  3ZRV A;  2JJC A;  3GIG A;  1UY7 A;  2BSM A;  1UYE A;  1UYF A;  2YI5 A;  4LWI A;  2YKC A;  4O07 A;  4LWF A;  4URM A;  1EA6 A;  5CTX A;  2WI1 A;  2H8M A;  3D36 A;  2BU7 A;  3OWD A;  3B24 A;  4WUC A;  2O1W A;  3CGZ A;  1NHI A;  1U2O A;  4NH8 A;  4U7O A;  2XJJ A;  1BXD A;  4GT1 A;  3OWB A;  5M4K A;  1US7 A;  4MPN A;  2XDX A;  3T2S A;  4CE2 A;  1YC4 A;  1MX0 A;  4FCR A;  4DZY A;  2ZDY A;  3GIF A;  2IOR A;  3WHA A;  2XDL A;  2YK2 A;  2ESA A;  4XE2 A;  2CCS A;  4ASG A;  3FV5 A;  5IDJ A;  1THN A;  2QF6 A;  4CWS A;  4GEE A;  4JAV A;  4CWR A;  5CPH A;  1NHH A;  3ZKD A;  5BOC A;  2WEP A;  3RLQ A;  1UYM A;  3EKR A;  4YKY A;  1BKN A;  4PL9 A;  1Y8P A;  1YSR A;  2XDK A;  1TID A;  4XKA A;  4FPP A;  2YK9 A;  1PVG A;  4W7T A;  2BU5 A;  5F3K A;  4CWN A;  2YEE A;  2WI4 A;  4YKU A;  5D6P A;  4XCL A;  2BTZ A;  2Q8H A;  1I58 A;  1QY8 A;  2CCU A;  2WER A;  3H80 A;  3O2F A;  4BIZ A;  3TK1 A;  4MB9 A;  1ID0 A;  4XKK A;  2CH4 A;  4HZ0 A;  2HG1 A;  4O09 A;  2YEI A;  4BQJ A;  1QYE A;  2O1U A;  4MTX A;  2FWY A;  2XX5 A;  2YEA A;  4GGL A;  4KQV A;  2BU8 A;  3A0Y A;  2BU2 A;  3PEH A;  3TZ0 A;  2CG9 A;  1BYQ A;  1QZR A;  4JAS A;  1I5D A;  1I5A A;  4EM7 A;  3WQ9 A;  4EFU A;  4ZVI A;  4GT8 A;  1Z5C A;  2C2A A;  4V25 A;  4XD8 A;  4FCP A;  4E00 A;  1UYI A;  1YER A;  1Y8N A;  4BAE A;  4XDM A;  4MBC A;  4EFT A;  3O6O A;  4L94 A;  2BYI A;  1UYC A;  4XIR A;  3C0E A;  3K99 A;  3EHH A;  2BRE A;  3H4L A;  4EMV A;  3EKO A;  3INX A;  4DUH A;  2FXS A;  2VCJ A;  3LPS A;  3CRL A;  2IWS A;  3U2K A;  4ASB A;  3B26 A;  2QG0 A;  3EHG A;  4EEH A;  4JAU A;  2O1V A;  3NMQ A;  4XIQ A;  3G7B A;  1KIJ A;  3RKZ A;  3BM9 A;  4BIU A;  5CF0 A;  3K98 A;  2FTK A;  4XKO A;  1L0O A;  3HHU A;  2YGE A;  3OPD A;  4CWQ A;  4MOT A;  4P8O A;  5IN9 A;  2BT0 A;  1YT1 A;  4KSH A;  2YEH A;  3INW A;  1MU5 A;  3TUH A;  2Q2E B;  4R3M A;  2YGF A;  2CCT A;  2EXL A;  2YE9 A;  1IXM A;  2XX4 A;  5GGZ A;  2UWD A;  5FWK A;  3G75 A;  4FMT A;  2ZBK B;  3QDD A;  4GQT A;  4B7P A;  3A0X A;  1A4H A;  2XD6 A;  2YEB A;  2YI0 A;  4R1F A;  4BXI A;  3EHJ A;  2VWC A;  3HZ1 A;  2YE3 A;  3A0T A;  1BGQ A;  1H7S A;  2P67 A;  2WI6 A;  5J6A A;  1UYH A;  3P32 A;  1F51 A;  2Q8F A;  3TZ5 A;  3G7E A;  1UYK A;  1B3Q A;  1JM6 A;  1GKZ A;  4KSG A;  3A0W A;  3HZ5 A;  2QM8 A;  5L3J A;  3MD0 A;  3VHD A;  2YE2 A;  4YKW A;  2YE8 A;  5CTU A;  5FND A;  5CTW A;  2VW5 A;  4YKX A;  3TZ2 A;  4URL A;  4CWP A;  4EGK A;  4L91 A;  4YKT A;  5B1O A;  1UYG A;  4H81 A;  4XIP A;  2E0A A;  4JYC A;  2VCI A;  2YEF A;  2BYH A;  2YE5 A;  3HEK A;  4KP4 A;  4HYM A;  4AWP A;  1R62 A;  3Q5K A;  1TBW A;  1ZXM A;  3KE6 A;  1I59 A;  3O0I A;  4ASF A;  2WI7 A;  4QPK A;  1TC6 A;  5M4E A;  3D2R A;  4GCZ A;  4EGI A;  1NHJ A;  4KFG A;  2YJX A;  3GIG B;  3MNR P;  4HXW A;  3TZ4 A;  1AH8 A;  4E01 A;  5M4H A;  3U67 A;  2YE4 A;  2YE7 A;  3IED A;  4QPJ A;  5B1N A;  1S16 A;  3PEJ A;  4MPC A;  3VHC A;  4XCJ A;  4O0B A;  3R4P A;  1Z5B A;  1ZW9 A;  2GFD A;  3ZXQ A;  3VAD A;  1I5C A;  3B25 A;  2XHX A;  2FYP A;  3QTF A;  3NXS A;  1Y4U A;  1YT0 A;  1AMW A;  4LWG A;  2XJG A;  2XDU A;  3BMY A;  4HZ5 A;  4JYB A;  1Y8O A;  4CWT A;  4MP7 A;  3RLP A;  4L90 A;  3B28 A;  3HYZ A;  2ZKJ A;  5CTY A;  1ZWH A;  4HXZ A;  4EGH A;  2IWU A;  3ZCC A;  1OSF A;  4K4O A;  3D0B A;  4KTN A;  4O04 A;  2Q8G A;  3LNU A;  1S14 A;  4AWQ A;  1TC0 A;  1UY6 A;  4MT8 A;  3CWV A;  1TH8 A;  2XHR A;  4URO A;  3T1K A;  4YKR A;  2YGA A;  1YSZ A;  5J71 A;  1UY9 A;  2QM7 A;  3K60 A;  3SL2 A;  3U2D A;  4NH9 A;  1ZXN A;  2K5B A;  4HY6 A;  2JKI A;  5BOD A;  3OW6 A;  4CE1 A;  2YKB A;  3A0R A;  4URN A;  5C93 A;  1TIL A;  2WWW A;  4I5S A;  3VHA A;  3FT5 A;  3RLR A;  5F5R A;  1KZN A;  2HKJ A;  2YED A;  1B63 A;  4U93 A;  2PNR A;  2BZ5 A;  2WI5 A;  2YEJ A;  2YJW A;  3ZXO A;  2XAB A;  4PU9 A;  2ZDX A;  2GQP A;  3R4M A;  4XIT A;  5D7C A;  5FNC A;  3T0Z A;  2YI6 A;  1AJ6 A;  4ZKI A;  2HCH A;  3T0H A;  1Z5A A;  4H85 A;  5M4N A;  5D7R A;  4L93 A;  4CWF A;  2CGF A;  3R4O A;  4WUB A;  3GIE A;  4CE3 A;  5M4P A;  3ZRW B;  3DGE A;  2IOQ A;  4NH7 A;  3CRK A;  4GFN A;  2LFS A;  3ZM7 A;  5M4M A;  3K97 A;  4MPE A;  2XCM A;  1AM1 A;  4HYP A;  1UYD A;  4X9L A;  2YKI A;  2IOP A;  2QFO A;  4FCQ A;  3A0Z A;  4AWO A;  1AH6 A;  3OMU A;  3TTZ A;  2YEG A;  3Q5J A;  4L8Z A;  5D7D A;  3CGY A;  4LWH A;  3ZKB A;  5IDM A;  1YET A;  2YEC A;  1YC3 A;  2QG2 A;  4CWO A;  3C11 A;  2YI7 A;  4XC0 A;  1Z59 A;  4PRX A;  2YE6 A;  2FWZ A;  2AKP A;  1I5B A;  1GKX A;  1UYL A;  4R3A A;  2BRC A;  3R92 A;  3R91 A;  4XTJ A;  2XK2 A;  3HYY A;  4HY1 A;  2XHT A;  2H55 A;  4JQL A;  4MP2 A;  2XDS A;  4H7Q A;  1JOY A;  2WI3 A;  3Q5L A;  3ZRX A;  4P7A A;  2BU6 A;  1YT2 A;  4LC1 A;  3ZRW A;  4LP0 A;  1Y4S A;  4E02 A;  1EI1 A;  2YKE A;  4LPB A;  4I3H A;  2LFR A;  3B27 A;  1U0Z A;  1B62 A;  1YC1 A;  1YES A;  4U7N A;  4V26 A;  4YKQ A;  4B6C A;  3FT8 A;  4PRV A;  2IWX A;  4ASA A;  1GJV A;  2YKJ A;  2WI2 A;  4Q20 A;  3JZ3 A;  3EHF A; 
#chains in the Genus database with same CATH topology
 2JS5 A;  4LCU C;  1S76 D;  1RSO B;  3CSX A;  2R9I A;  5D6Q A;  3WG7 C;  1RM1 B;  3SPI A;  3WB2 A;  1H7U A;  1RP3 B;  5GW7 A;  1BL8 A;  1QQC A;  3FKS G;  5H9C A;  2JJC A;  3GIG A;  1Z2G A;  1UY7 A;  3FAV B;  2ZXW B;  3VQX A;  1UYF A;  3HR0 A;  2CTP A;  5CTX A;  4URM A;  1EA6 A;  2YID A;  1R6N A;  2Q8V A;  5J9P C;  2UUB B;  4WBN B;  4NH8 A;  4U7O A;  2XJJ A;  2ZQM A;  4LFB O;  3CCS V;  4MPN A;  2VWK A;  5CB4 B;  3E8B A;  3QG5 A;  3ABU A;  4Z1M G;  4UUJ C;  1WP8 A;  4B3R O;  4O2B B;  3AG4 C;  2OCC B;  4HAM A;  3JYC A;  2X6A A;  1QCE A;  4B7K A;  2HP8 A;  4LWS A;  1M56 B;  4XE2 A;  2HG5 C;  3ZN1 A;  4X62 O;  1THN A;  1NZ6 A;  2YSU B;  5H6R A;  1KMI Z;  1JCH A;  5CA0 B;  4R8C A;  4G28 B;  2KG7 B;  2JGD B;  4JF3 A;  5CPH A;  3ZKD A;  1QNM A;  2BE3 A;  5LMN B;  1F7Y A;  3JAT A;  5JJN B;  4D7S A;  2ARH A;  1URF A;  3ZHU A;  4YHH B;  3E8F A;  4Q6G A;  3EKR A;  3E22 B;  1Y8P A;  2UUC B;  4X1I B;  1N33 O;  4I4T B;  4CS2 A;  3K08 A;  4XKA A;  1TID A;  2YK9 A;  1M4U A;  4W7T A;  5ITZ A;  4X20 A;  1WN7 A;  2A06 H;  3ASO C;  3IC9 A;  1V55 B;  4YKU A;  2H8P C;  1YJ9 V;  1AI5 A;  4B3T B;  1R73 A;  3ML0 A;  1NT2 B;  1I58 A;  2IJH A;  2WER A;  4KHP O;  3VOU A;  2Z0A A;  4CH6 A;  3O2F A;  1EN4 A;  5EBL C;  2ZE5 A;  1TVK B;  1VEW A;  3VQY A;  4UFZ A;  3ZHT A;  4DV3 O;  2YEI A;  1QYE A;  2WLI A;  1S5L Z;  3E89 A;  4O4H A;  2YIC A;  3ETG A;  2OIG A;  4JI4 O;  5TIS Z;  3A0Y A;  1D5N A;  3TZ0 A;  2CG9 A;  4EM7 A;  2YEV B;  3UQ8 A;  3T1Y O;  4ZVI A;  3LDE A;  1BZK A;  1Y67 A;  4QGP A;  4GT8 A;  1FD9 A;  3FD9 A;  5B5E Z;  4DV5 B;  1UYI A;  3AG3 C;  2UU9 O;  4BAE A;  4UVC A;  4MBC A;  4EFT A;  4L94 A;  1FS0 G;  3ABM B;  2G38 A;  3C0E A;  1BGY H;  5IYZ B;  3H4L A;  1SQQ H;  3IAY A;  3THO A;  2FXS A;  3HKB B;  3LPS A;  1OCZ C;  1SA0 A;  4JI1 O;  2V4D A;  2XUM A;  4ICG A;  4JTA B;  3RVZ A;  3I55 V;  2IWS A;  3JD3 A;  2GTS A;  5B1B C;  4ASB A;  2CTQ A;  4QJF B;  2XAH A;  4JAU A;  2LGQ A;  4XIQ A;  1KIJ A;  1KBH A;  3JAL A;  2VQF O;  4BIU A;  2F66 C;  2FTK A;  5LXT B;  3SR2 C;  5LHI A;  1XBL A;  4CWQ A;  4P8O A;  1Y76 A;  4KSH A;  2YEH A;  3INW A;  3TUH A;  4UB8 Z;  2Q2E B;  2RN9 A;  4R3M A;  2CCT A;  1JJO A;  1KEC A;  1W59 A;  5FWK A;  1G4Y B;  4FMT A;  2ZBK B;  3QDD A;  1IXB A;  2EIN C;  4GX1 A;  1A4H A;  4XBF A;  2XD6 A;  3JAK A;  4DV0 O;  4BXI A;  4GX0 A;  1PNK A;  3K0D A;  3HPL C;  3OT7 A;  1BGQ A;  4LFC B;  1YXB A;  3MDS A;  1COW G;  1ENV A;  3E2E A;  3WB0 A;  5DN6 G;  1GH6 A;  3X2Q B;  2Q8F A;  1VP7 A;  3LDC A;  3TZ5 A;  5JJE B;  4DK0 A;  5B1A B;  1UYK A;  1N32 O;  1VQK V;  1JM6 A;  4YJ3 B;  1O9H A;  3HKC A;  4KSG A;  2V1D A;  3BAA A;  2ZE6 A;  4U3J B;  2QWP B;  4O4I B;  4DW0 A;  1FFT B;  3SYP A;  1SC5 B;  5CTU A;  3BRC A;  3RT3 C;  5CTW A;  4YKX A;  4UCT A;  4CWP A;  4EGK A;  1Q6I A;  3J7A U;  4YKT A;  1Y74 B;  3W7U A;  1IBM O;  1UYG A;  4E72 A;  1GRJ A;  1F4M A;  1QU7 A;  2YEF A;  4KP4 A;  4IHJ B;  4FLV A;  4AWP A;  1R62 A;  5LP6 B;  1I59 A;  3W7W A;  4JYA O;  4GKJ B;  4B08 A;  3D2R A;  3S3X A;  1S72 V;  1BCC H;  5IYD O;  2YJX A;  2WPD G;  4TUY B;  3TGU H;  4HXW A;  4TV8 A;  5M4H A;  5DEC A;  2YE4 A;  4QPJ A;  5B1N A;  4DR1 B;  3EXA A;  4OPH A;  4MPC A;  2WLL A;  4XCJ A;  2OCC C;  2E74 B;  3R4P A;  1Z5B A;  1ZW9 A;  2GFD A;  3K9S A;  3B25 A;  2XHX A;  2N74 A;  5KUK A;  2UUA B;  2FYP A;  4YHH O;  1Y4U A;  1M56 C;  1YT0 A;  1AMW A;  3L70 H;  3TET A;  3UO2 A;  1Y8O A;  4CWT A;  3EVK A;  4X66 O;  4MP7 A;  3RLP A;  5LOV B;  3OMA B;  3CCE V;  4HXZ A;  5EZY A;  4K4O A;  2FKX A;  2VWJ A;  3QTC A;  1WP7 A;  3FYI B;  1Q90 D;  4UVB A;  3TJT A;  3KG2 A;  4MW3 A;  1TC0 A;  1UY6 A;  3CWV A;  2XHR A;  4YKR A;  2YGA A;  2F43 G;  1KKD A;  4WFH A;  2Q7E A;  2E76 B;  4KFM A;  4JI6 O;  4JI0 B;  2JKI A;  1BE3 H;  3DXR A;  3OW6 A;  2Q6A A;  3BFR A;  3JAS B;  1FAF A;  3CX5 F;  2PTM A;  1EM1 A;  5IWA O;  1OCO B;  3ABL B;  3RW0 A;  4C7U A;  4I5S A;  3VHA A;  3RLR A;  5F5R A;  1KZN A;  2EBO A;  1XMO B;  1VF7 A;  2RDC A;  1YTF B;  2XAB A;  3S5T A;  5D7C A;  1AI6 A;  3W7S A;  4I7Z B;  4DR2 O;  1AJ6 A;  3FX7 A;  2HCH A;  3AG1 B;  3CEI A;  5AG2 A;  2PF4 E;  3M99 B;  5D7R A;  5C8Y B;  3R4O A;  4WUB A;  1XNR B;  5M4P A;  2EUL A;  1O9G A;  5LMU B;  3G67 A;  2IOQ A;  2PI5 A;  2V7Q G;  1W0J G;  4X65 B;  2A0L A;  2LFS A;  5M4M A;  2RJZ A;  2XCM A;  1AM1 A;  3G4S V;  4BWA A;  1UYD A;  2KB1 A;  1HNX O;  1BHA A;  2YS8 A;  2QFO A;  4FCQ A;  3A0Z A;  4UV9 A;  2YEG A;  1RPR A;  4L8Z A;  4CH4 A;  1JFF A;  3ZKB A;  3JD1 A;  1ZL8 A;  1YET A;  2QG2 A;  2HVJ C;  2CUG A;  2DYS C;  2ZR2 A;  2BTQ A;  4W4L A;  1FXH A;  1AIL A;  4X1K A;  2ZD9 A;  2LP7 A;  1VQL V;  4R3A A;  3AK3 A;  4WF9 V;  3K59 A;  3CRQ A;  4XTJ A;  5LYJ B;  3OR7 C;  3K58 A;  4LFB B;  3HYY A;  4HY1 A;  2XHT A;  4IYH A;  5KHJ A;  4DUY O;  1G8M A;  4B3R B;  3G80 A;  2QWQ B;  1MZE A;  4DYL A;  1G6U A;  4LPB A;  4FFB B;  2LFR A;  1EFR G;  4FLZ A;  2DOS A;  5EC1 C;  4X62 B;  4IIJ B;  2CTW A;  4UCS A;  4B6C A;  4LF8 O;  4PRV A;  3PJS K;  4OXS A;  3K5M A;  1XQ8 A;  3CHX A;  2YKJ A;  2WI2 A;  3K9A A;  4JV5 B;  5B1A C;  4ZI7 B;  4NR1 A;  5B3S B;  2ATK C;  3CE2 A;  1IDS A;  4WUD A;  1CPY A;  2QGN A;  2RMK B;  4JGS A;  3ETE A;  3KKY A;  3SYO A;  3B2E E;  1I5X A;  1XRE A;  1UYE A;  1E1R G;  5CBH A;  2R72 A;  1UPG A;  2YKC A;  1CP9 A;  3JD4 A;  4GKJ O;  4KHP B;  3B24 A;  2R9A A;  1KYO F;  4AI8 A;  2QR4 A;  3RYC A;  2JGU A;  2O1W A;  3JAW A;  4W4K A;  1K5Q A;  3K3W A;  1YJW V;  5JVD B;  3KCY A;  1U2O A;  2JJ1 G;  2E75 B;  2HEP A;  2JS3 A;  3BY6 A;  5J2U A;  5BZB A;  1VF5 B;  1GN4 A;  2ZDY A;  4WFA V;  2QDO A;  2IOR A;  2EIJ C;  1FYJ A;  1QVG U;  3T1Y B;  4PA3 A;  1K4C C;  5EBM C;  2CCS A;  4RQE A;  3ZIA G;  3BCC H;  2QF6 A;  4CS4 A;  4O4L B;  4FLY A;  1Z5W A;  2C1I A;  2P4K A;  1RSO A;  4JAV A;  4WFB V;  2ZKO A;  5EIB C;  4KL1 A;  2UU9 B;  3CD6 V;  1XUQ A;  5K1X A;  3FYE B;  1YZB A;  4ZHQ B;  3FAV A;  1LUW A;  3FB5 C;  4UV8 A;  3QVN A;  5L3D A;  5F3K A;  1HWY A;  2F23 A;  2Y69 B;  4JI0 O;  3K04 A;  3LMM A;  1KC8 W;  2PI4 A;  5FPR A;  2CDY A;  1NH2 D;  4LNU B;  4WBN A;  2EX3 A;  2YDE A;  1M9N A;  2DQ3 A;  4DO2 A;  3MHH C;  3Q4H B;  2YUA A;  2EIK B;  2VQF B;  4N23 A;  5CB4 A;  1EN5 A;  1WA8 B;  5L3E A;  2CCU A;  3AG2 B;  1MSD A;  1R1B A;  1JX9 A;  2YIB A;  3OTF A;  3RYI A;  1IVS A;  4NB5 A;  4L8J A;  4YJ2 B;  4O2B A;  3SPH A;  3W7X A;  4J7J A;  1D5A A;  4DV4 O;  4HZ0 A;  2HG1 A;  3O9O A;  2Z5U A;  4Z1V A;  2BU2 A;  5CA0 A;  1I94 O;  2KG7 A;  2JGD A;  4FFK A;  2DYR B;  4X64 O;  2HJF C;  3ASN B;  2CGO A;  1I5A A;  1Q6U A;  4MSW C;  3WQ9 A;  2HJD A;  4DV0 B;  1R3K C;  1GKF A;  4LF9 B;  3E22 A;  3FB6 C;  1B04 A;  2HHI A;  1Z5C A;  4X1I A;  2GHY A;  1NI8 A;  3LDD A;  1BQZ A;  2LJ2 A;  3H1K H;  4FVM A;  3N2K B;  2ADP A;  4X65 O;  4Z2W A;  3O6O A;  2BYI A;  3JAM N;  4XDK A;  3CCR V;  3TXQ A;  3BEH A;  3L9D A;  1K4D C;  3K99 A;  1N32 B;  2PGG A;  1KP2 A;  3E8G A;  1S5J A;  5L3B A;  2HLD G;  2BRE A;  1EZJ A;  1PV0 A;  1JQ0 A;  4U3F H;  3G71 V;  3INX A;  1E1Q G;  3ZMT A;  3CCQ V;  1TVK A;  3FB7 C;  2XAS A;  1MMM A;  3ZBH A;  5EBW C;  2EIM B;  1IBM B;  4EEH A;  3OMN B;  3NMQ A;  2MK3 A;  4H13 B;  4HBN A;  3G7B A;  3OM3 B;  4D6T H;  2YXH A;  2Z3Y A;  3T1H O;  1A32 A;  1Q8I A;  4XKO A;  1L0O A;  2ZNI A;  1VQO V;  4MOT A;  4G2K A;  1OCR C;  3ZMZ A;  2BT0 A;  2YEV A;  2ZDI C;  4JYA B;  1MU5 A;  4H37 A;  2YGF A;  1PM9 A;  2EXL A;  2HVK C;  2UWD A;  2L6L A;  3UT5 B;  2ILM A;  3HKD B;  2BSK A;  2GBO A;  4GQT A;  2CE4 A;  5BY1 A;  4H44 B;  2CK3 G;  1BS3 A;  3F5T A;  4MVZ A;  5EYP B;  1ZLZ A;  5IJ9 B;  1U97 A;  1R6K A;  1RPO A;  3EHJ A;  2EJR A;  4R6Z A;  2YE3 A;  4AIL C;  3QO5 A;  1BMF G;  5HFL A;  1H7S A;  4JTD B;  5LGU A;  2WI6 A;  3I56 V;  3P32 A;  1F51 A;  2UXC B;  3HKB A;  4JV5 O;  2ZIM A;  4DV7 O;  3B40 A;  4PDM A;  1CXZ B;  4X66 B;  2IJJ A;  1GKZ A;  3EHB B;  1HNW O;  3MD0 A;  2VQE O;  4DR5 O;  4R7C A;  4YKW A;  2O57 A;  3SYC A;  2R70 A;  5LXT A;  2VW5 A;  1XHZ A;  5JJJ B;  4URL A;  1M5I A;  3SPC A;  3OFN G;  4LF4 O;  1I7F A;  5CA1 B;  5B1O A;  1NH2 B;  2E0A A;  2JJ2 G;  1VF6 A;  2AW9 A;  1SQP H;  1QLN A;  1Y4M A;  4JI6 B;  2YE5 A;  3HEK A;  5JQG B;  4PD4 F;  1KQS U;  4J10 A;  2Q69 A;  1I0H A;  1ZXM A;  1FKA O;  1GAX A;  3O0I A;  5IWA B;  3CJH A;  1VQN V;  3LNM B;  4QPK A;  1TC6 A;  1ZAU A;  2M7W A;  1YIJ V;  4GCZ A;  4EGI A;  2UXN A;  3HKE B;  3JSN A;  3GIG B;  2K9P A;  1NTZ H;  4HNA B;  4IYI A;  1OCC C;  4QIW F;  3ABK B;  4LFA O;  1TA8 A;  3PEJ A;  1PD3 A;  1AP6 A;  1G1X B;  4DR2 B;  4YJ3 A;  2Q5Z A;  1KB9 F;  3CRA A;  1LR1 A;  1I5C A;  2Q0A A;  4O4I A;  3T4Z A;  3NXS A;  4LWG A;  4JI2 O;  4WFG A;  3BMY A;  2X6B A;  4JYB A;  4I0X B;  5IY5 C;  1Y74 A;  2OTJ V;  2IJK A;  2FYU H;  2W0F C;  3B28 A;  2ZKJ A;  5CTY A;  3P30 A;  1VAR A;  2DMX A;  2RCV A;  1MAB G;  4KTN A;  3CC4 V;  1R3I C;  2GUZ B;  2JEX A;  1R3J C;  4P9P A;  3LNU A;  2X0L A;  4AWQ A;  3KCX A;  4IHJ A;  4YIP A;  1JVM A;  4K8X A;  1L0L H;  5LP6 A;  3T1K A;  1JR9 A;  1HNX B;  1YSZ A;  1GN2 A;  4UCR A;  1FXK B;  1L0N H;  2AZ2 A;  2QM7 A;  3DTU B;  1KP3 A;  4I55 B;  3JCU Z;  3U2D A;  1IBK O;  3JAT B;  1ZXN A;  3E86 A;  4XDJ A;  2BTO A;  1FPO A;  2QA4 V;  4TUY A;  4J11 A;  4CE1 A;  1IBL O;  1US6 A;  4WCE V;  3CC2 V;  3AK2 A;  3K79 A;  4IT5 A;  4DV2 O;  5J2T B;  1P4R A;  4X20 B;  4ZIB A;  5D5P A;  2Y48 A;  5GON B;  3FT5 A;  1QLE C;  1CEZ A;  4CBC A;  2XND G;  4LF9 O;  2YEJ A;  4DUY B;  1QBZ A;  3K5O A;  4XIT A;  4PDL A;  3T0Z A;  2YI6 A;  5LOV A;  3ZED A;  4ZKI A;  1JPX A;  1NQT A;  2CH7 B;  1FFX B;  2ZNJ A;  1HR0 O;  4B3M B;  5H6Q A;  4CWF A;  3CCV V;  2CGF A;  4LF8 B;  3GIE A;  3C3S A;  4K8Z A;  1H38 A;  5JEN A;  4MW8 A;  1VQP V;  2IH1 C;  4NH7 A;  3DSQ A;  1OZ0 A;  2AGA A;  2WAM A;  4GFN A;  3RYF B;  3ZM7 A;  2Y0P A;  2P4V A;  2WLJ A;  3T2M A;  4ABM A;  1J5E B;  1ORQ C;  1RM1 C;  4B3S O;  4MPE A;  1SET A;  3JAS A;  5L3F A;  3R66 A;  2IOP A;  4AWO A;  4BW5 A;  1BQ0 A;  5BR8 B;  3OMU A;  3Q5J A;  3UM7 A;  3H1J H;  2ZXW C;  3UCS C;  3CRC A;  5IDM A;  2EIM C;  4K35 A;  1GM9 A;  4XC0 A;  2CAZ C;  3C3T A;  4PRX A;  2FWZ A;  3AEI A;  4N21 A;  2E3C A;  2AKP A;  1TUB B;  3R92 A;  1SA0 B;  2DWD C;  3CB2 A;  4XDL A;  1N0N A;  2FL4 A;  2NLJ C;  4EB6 B;  3SPG A;  1ROP A;  2Q9L A;  4JQL A;  2XDS A;  4H7Q A;  3Q5L A;  5C8Y A;  3ZRX A;  4P7A A;  2RQ6 A;  2XAQ A;  3DC6 A;  2BU6 A;  1H2N A;  4NTY A;  2F4V O;  1Y4S A;  4E02 A;  1EI1 A;  4B7E A;  2UXC O;  3JAR B;  3KZI Z;  1P84 F;  3B27 A;  2GSM B;  1YES A;  3K06 A;  4U7N A;  2UXD B;  4V26 A;  4YKQ A;  1HP8 A;  4OPA A;  3FT8 A;  4GZR B;  1WJZ A;  3B77 A;  2JK5 C;  2IWX A;  1QR8 A;  4JTC B;  4FLX A;  4RAI A;  2A79 B;  3EHF A;  4FCP A;  4BQG A;  4O05 A;  1H2L A;  4DV1 O;  3T10 A;  3PN1 A;  4LWE A;  2XJX A;  3CXC U;  4YKZ A;  1YS3 A;  2L35 A;  5F2V O;  3ZJZ A;  3R4N A;  2ZDI A;  2Q8I A;  4AS9 A;  1ARO P;  1V55 C;  1K5S A;  5KX5 B;  1YJN V;  4FLT A;  3ZRV A;  2XX2 A;  3LSS A;  4FIP C;  4JZ2 A;  4H33 A;  4RWU A;  2YI5 A;  2OWO A;  4TQF A;  2XT9 A;  2WI1 A;  3OWD A;  2RNB A;  3OE7 G;  3GVM A;  2JVD A;  1V54 B;  2XAJ A;  4QNH B;  4K0K O;  4DV4 B;  1NHI A;  4PI0 A;  4FFB A;  4FZ1 A;  4OX9 O;  5KMG B;  1VQM V;  4X8A A;  3OWB A;  3VBB A;  2XOK G;  3MAQ A;  1US7 A;  1MZF A;  2EJ7 A;  1I94 B;  4CE2 A;  1YC4 A;  4X64 B;  1MX0 A;  4CH5 A;  4DZY A;  2NN4 A;  1AP5 A;  4PA6 A;  2JIZ G;  2UXB O;  2B5U A;  4LH7 A;  2IJI A;  4LR3 A;  5LHG A;  2YK2 A;  2ESA A;  5IDJ A;  1SRY A;  3FV5 A;  4CWS A;  4ZI7 A;  4GEE A;  3CCL V;  1I5Y A;  4CWR A;  4UVA A;  5FLX N;  1P49 A;  4RO2 A;  1M57 B;  5BOC A;  1AI4 A;  2WEP A;  3ZHR A;  4NVP A;  3ABM C;  3CCM V;  4UXN A;  1UYM A;  4YKY A;  3N2G B;  4ZOL B;  3A8T A;  2XHB A;  2P06 A;  1L1F A;  1N34 B;  3CXH F;  1DGS A;  1GO3 F;  4R50 A;  2BU5 A;  3WG7 B;  2HHH O;  2YEE A;  3OTO B;  4JI8 O;  2WI4 A;  1JMK C;  5JVD A;  4XCL A;  1P7G A;  2BTZ A;  1X4T A;  3RYH B;  1FXK C;  1WPX A;  2Q8H A;  4F4L A;  1QY8 A;  4I9W A;  4X89 A;  3T1H B;  4WFF A;  4BIZ A;  4MB9 A;  1XIL A;  3H1L H;  1FJG B;  4XKK A;  5KA5 A;  2ZE7 A;  4BQJ A;  1PNL A;  1M93 A;  4TQD A;  1H8H G;  1VF6 C;  2WLN A;  4MTX A;  4O4L A;  4EKW A;  1VQ9 V;  4KQV A;  2BU8 A;  3CP1 A;  4HYO A;  3PEH A;  1NKD A;  1BYQ A;  4J7Z A;  2YC0 A;  2IU0 A;  1XL6 A;  1I5D A;  1WB8 A;  3AG4 B;  4NXN B;  1SES A;  4YXW G;  4FLU A;  4EFU A;  4B3M O;  1AJP A;  1XNQ O;  4ZHQ A;  4OGQ B;  3G6B A;  4V25 A;  4JPR A;  4E00 A;  5KA6 A;  4P9O A;  3JSL A;  1Y8N A;  1K3E A;  4XDM A;  1SZT A;  3X2Q C;  3TXS A;  1XHX A;  4DV7 B;  2GDS A;  1J5E O;  4DV6 O;  4LNU A;  3EHH A;  1SER A;  4GKK O;  4NYK A;  3Q4H A;  2VRZ A;  1HNW B;  3BHP A;  1GM7 A;  1WA8 A;  4MS2 A;  1GM8 A;  2VQE B;  4DR5 B;  5K1P A;  4DUH A;  5BR8 O;  3E35 A;  4NTX A;  4YJ2 A;  1Q5O A;  2DQ0 A;  3U2K A;  1N8R W;  3ASO B;  3B26 A;  1AR4 A;  4LF4 B;  3EHG A;  4CS3 A;  3SJB C;  5JCO C;  3SYQ A;  3B8M A;  3IC7 A;  4J9Y B;  1AJN A;  5LHH A;  4LF7 O;  3BA9 A;  3H9V A;  3BPZ A;  3RKZ A;  2WLM A;  3GB7 C;  1EBO A;  5CF0 A;  2XTA A;  4TWK A;  4FM2 A;  4EFE A;  3HHU A;  3C90 A;  3I5D A;  3CC7 V;  5LP6 C;  4I50 B;  1YT1 A;  2Q73 A;  3FB8 C;  4I9Q A;  1QR9 A;  2M6Y A;  2YE9 A;  1IXM A;  2XX4 A;  5GGZ A;  3G75 A;  3BA8 A;  1PPJ H;  3N2K A;  5BMV B;  2GTA A;  4LFA B;  4MVS A;  4DUZ B;  1DK1 A;  2UXD O;  2BTQ B;  4R1F A;  2YIB D;  2VWC A;  3HZ1 A;  4J42 A;  3ZHS A;  4UB6 Z;  3A0T A;  2P67 A;  3OAA G;  5LA6 B;  2Q0O C;  3EFF K;  3AG3 B;  1DF4 A;  4JI2 B;  4NKG B;  1SQV H;  3OMI B;  4JI7 B;  1YSC A;  1F23 A;  5KLV H;  3R65 A;  2QKA A;  3T1C A;  1MOF A;  3JCZ A;  5FNV B;  3ZHQ A;  2JDI G;  3OD4 A;  5FND A;  3F7V C;  1OCZ B;  4FM1 A;  1NU1 H;  4L91 A;  3UKM A;  1K9M W;  5B1B B;  3U11 A;  2A7W A;  4XIP A;  1EN6 A;  4JYC A;  1WAZ A;  1IBK B;  2VCI A;  2E5L B;  2QKS A;  3UT5 A;  4YY3 O;  3HKD A;  4HYM A;  3Q5K A;  4DK1 A;  1YVW A;  2OYQ A;  1IBL B;  2ZE8 A;  3BVO A;  2AZ0 A;  1TBW A;  5IE9 A;  5IJ9 A;  5JH7 B;  4DV2 B;  4PHZ A;  3AG7 A;  1OCO C;  3ABL C;  3M7M X;  1M90 W;  2OCH A;  2ODM A;  4TV9 B;  4PA4 A;  4KFG A;  3MNR P;  2IU3 A;  1AH8 A;  1N36 O;  2EIN B;  1Q3E A;  3U67 A;  3E83 A;  4PA9 A;  3IED A;  4X1Y B;  4GX5 A;  2QM4 A;  4I4T A;  3VHC A;  3AG1 C;  3ZXQ A;  2UXX A;  4J80 A;  3VAD A;  1TUE B;  5D5Q A;  5CA3 A;  3A0H Z;  1PNM A;  3QTF A;  1HR0 B;  3QO7 A;  1T5E A;  2XDU A;  5J2U B;  1J95 A;  1N34 O;  5CA1 A;  4EFB A;  1K7D A;  4K3A A;  4GYC B;  4EGH A;  2IWU A;  3ZCC A;  3D0B A;  3LNN A;  4NXM O;  3OTO O;  2Q8G A;  1S14 A;  5JQG A;  5HFM A;  1LUV A;  1WPB A;  4B3S B;  5LGN A;  4DR7 O;  1S0V A;  1TH8 A;  4URO A;  4F6R B;  5J71 A;  1ZUQ A;  1UY9 A;  3SL2 A;  4LF5 O;  4NH9 A;  3TCU A;  4QE7 A;  1SF9 A;  1JA8 A;  1FJG O;  3L73 H;  2LQT A;  3HKE A;  3CPW U;  2QTS A;  2ZCE A;  3IGA C;  4HNA A;  1M1K W;  4F6E A;  2PUS A;  2KSD A;  3F5W C;  2YKB A;  2LO1 A;  3QF7 A;  3ZMU A;  4AQY O;  4LF6 O;  1K8A W;  4URN A;  3OUF A;  1WLE A;  3CWB H;  1YHQ V;  2YXL A;  2YI8 A;  1Q86 W;  2PZS A;  3QNE A;  4NXN O;  5IYC O;  1TIL A;  2WWW A;  1XMQ O;  2YED A;  1KD1 W;  2PNR A;  3U0Z A;  5LGT A;  2YJW A;  2ZR3 A;  3ZXO A;  2ZDX A;  3H01 A;  3CYO A;  2GQP A;  1BSM A;  4I0X A;  3LUT B;  5IYZ A;  3CYG A;  2F4V B;  3RYI B;  4L87 A;  3SGI A;  2WA4 A;  1NR1 A;  5EC2 C;  2GUZ A;  3CME V;  4H85 A;  4UCO A;  4O4J B;  5M4N A;  1YDX A;  3VQW A;  4CE3 A;  3ZRW B;  3DGE A;  2OIE A;  5IJ0 B;  4O2A B;  1AR1 B;  5KHI A;  4GX2 A;  1FXK A;  3OR6 C;  4CC5 A;  4I55 A;  4NTW A;  4DV1 B;  4DRX B;  3CRK A;  1S3J A;  4PJ0 Z;  5B3S C;  2HKO A;  5FPO A;  4TOI A;  1YI2 V;  4HYP A;  2YKI A;  5J2T A;  3CMA V;  5EK0 A;  3CRR A;  5D7D A;  2Q7H A;  3IJ4 A;  3UO3 A;  2YEC A;  2N05 A;  2ADQ B;  2OTL V;  5GON A;  1B06 A;  2YI7 A;  3JD0 A;  1MNG A;  1RFY A;  1Z59 A;  2YE6 A;  1V9P A;  1I5B A;  1GKX A;  1UYL A;  2BRC A;  1SQX H;  1SS3 A;  4K0K B;  2PY5 A;  3R91 A;  2Q4P A;  2ZT9 B;  1XEQ A;  1NS1 A;  4OX9 B;  1IUR A;  2XK2 A;  1H2M A;  1FFX A;  2CH7 A;  4MVQ A;  2H55 A;  4GUN A;  4DUZ O;  2ZIN A;  4TSF G;  4MP2 A;  1UJW B;  1JOY A;  4BIO A;  4DR4 B;  1KU9 A;  3E8H A;  4U3J A;  5CBG A;  5L3C A;  2UXB B;  3OEH G;  2W6I G;  3A0B Z;  5KAF Z;  1NR7 A;  4JI7 O;  1B62 A;  3RYF A;  1E79 G;  4CZZ A;  1HNZ O;  2QWO B;  4H0L B;  2BCC H;  5JCO A;  5EIB D;  4DR6 O;  3RN4 A;  3FFQ A;  2BSK B;  4Q20 A;  3JZ3 A;  1AVM A;  4LWS B;  4ZBM A;  4LP8 A;  1Y6X A;  2H94 A;  2P7T C;  1BHB A;  3H1H H;  3QO8 A;  2ZM6 O;  2Y69 C;  5LBQ A;  1PP9 H;  2W6J G;  2E5L O;  2WEQ A;  2HHH B;  1UY8 A;  1TUB A;  4JI8 B;  5FNF A;  1PKX A;  2AHZ A;  1SZX A;  5FL7 G;  3LSU A;  1AI7 A;  1IX9 A;  4CC6 A;  2BSM A;  4EB6 A;  2EIK C;  5GTI Z;  4LWI A;  3AG2 C;  4O07 A;  4LWF A;  2DYS B;  2H8M A;  3D36 A;  5ITZ B;  2BU7 A;  5CMU A;  1MG1 A;  1QVF U;  4WUC A;  2Q67 A;  4E2L A;  4JAA A;  1D2D A;  3ZMV A;  1Q82 W;  3G6E V;  3JD2 A;  3CGZ A;  1R6T A;  1B6Q A;  1H2S B;  3ZRS A;  3SJC C;  3JAR A;  3MHS C;  1BXD A;  1Z5V A;  3P3P A;  4GT1 A;  5M4K A;  2FB5 A;  3K03 A;  1IZ3 A;  1NVP D;  1K33 A;  4KXR A;  1OJH A;  1K97 A;  2DYR C;  2XDX A;  3T2S A;  3ASN C;  3J81 N;  4FCR A;  4JI3 O;  1THZ A;  4PA7 A;  3N27 A;  3GIF A;  3WHA A;  3L72 H;  2XDL A;  1Q43 A;  2WLK A;  1XNQ B;  2WLI B;  4ASG A;  1KUQ A;  1YTF D;  4O4H B;  2XAF A;  3CJH B;  1N0J A;  4P30 A;  1OV9 A;  2CGN A;  1NHH A;  2X7R B;  2HR3 A;  3A2F A;  2PYJ A;  3RLQ A;  2WSS G;  5KX5 A;  2YIA A;  4DR3 B;  4RUE A;  4EEQ A;  4DV6 B;  1I08 A;  1BKN A;  4PL9 A;  4GKK B;  2LW7 A;  1YSR A;  2P5O A;  2XDK A;  3D3I A;  4FPP A;  3RGB A;  1PVG A;  2ITC C;  3WB1 A;  4CWN A;  5D6P A;  3NR7 A;  2Y4T A;  5CBF A;  3OGC C;  2B9Z A;  5KMG A;  1XDC A;  4LF7 B;  3SJA C;  3OW2 U;  4UCU A;  2D2C B;  3H80 A;  2IM9 A;  2ZIO A;  3TK1 A;  2Q7G A;  3VQV A;  2QEX V;  1ID0 A;  3SDL A;  1MSW D;  2UUB O;  2CH4 A;  3K0G A;  3APO A;  4KUM A;  4O09 A;  3RBZ A;  2ETN A;  2YI9 A;  2NR5 A;  4MTF A;  2EIL B;  5H5N A;  2O1U A;  3JAL B;  2FWY A;  2ITD C;  2XX5 A;  2YEA A;  4GGL A;  3SPJ A;  3ZX6 A;  1QZR A;  5BXZ A;  4JAS A;  1Y76 B;  3U10 A;  2QKC A;  2EIJ B;  2QJ1 A;  1ZSP A;  1K73 W;  3N2G A;  4ZOL A;  2IBZ H;  2C2A A;  2F1M A;  4XD8 A;  2AHY A;  2C1G A;  2BOB C;  2A9H A;  1YER A;  5LMN O;  1F4N A;  3CS5 A;  1NJI W;  1DF5 A;  3JAK B;  1UYC A;  2W0X A;  1S77 D;  3CRM A;  4XIR A;  2PYL A;  5JWP A;  2UUC O;  1XOU A;  3M8A A;  3RYH A;  2YXY A;  4EMV A;  1PL4 A;  3D3Q A;  3EKO A;  2F95 B;  4MVR A;  5E1A C;  2VCJ A;  2QWR B;  4PI2 A;  1VMG A;  3CRL A;  5LYJ A;  1LNQ A;  2QG0 A;  4MVO A;  1ZWI C;  4E4E A;  5E79 Z;  2O1V A;  3HKC B;  4B3T O;  5KUM A;  2Y0I A;  3BM9 A;  1SQF A;  1HDJ A;  1X59 A;  1H8E G;  3T4D A;  3K98 A;  4YY3 B;  1VQ5 V;  2YGE A;  3OPD A;  1WB7 A;  5IN9 A;  3LSQ A;  4IIJ A;  4DR4 O;  2CTR A;  4ASU G;  4IL6 Z;  2B1G A;  2QSA A;  1K92 A;  3ZMS A;  2EZP A;  5L3G A;  1QHT A;  2DE0 X;  2Q68 A;  1HW7 A;  4MTO A;  1NVP B;  1ZX3 A;  4B7P A;  3A0X A;  4FLW A;  1N36 B;  3ABK C;  1GMG A;  3ZS8 C;  2YI0 A;  2YEB A;  3WFV A;  2N04 A;  3ABT A;  4AHC A;  2D3O W;  2JEU A;  4DV5 O;  4IGG A;  5J6A A;  1UYH A;  4DW1 A;  1U96 A;  1AJQ A;  4TV8 B;  3RFR A;  3DC5 A;  1TAE A;  4LBE C;  5IT9 N;  2K1E A;  2XAG A;  3G7E A;  2KKW A;  1SKV A;  2IW5 A;  1B3Q A;  2WLL B;  2WA3 A;  3ETQ A;  4JI5 B;  3A0W A;  3HZ5 A;  3OGI B;  1YCI A;  2QM8 A;  5L3J A;  4NXM B;  1DTO A;  3VHD A;  2YE2 A;  2YE8 A;  1AB3 A;  5KHH A;  1NBM G;  1EZV H;  3D8C A;  3TZ2 A;  3ETD A;  3L74 H;  4DR7 B;  3CCJ V;  4I50 A;  4HZ3 A;  4BAY A;  4H81 A;  1S5H C;  2HFE C;  1JJ2 U;  2AXT Z;  4LF5 B;  5EZY B;  2BYH A;  3WU2 Z;  1P7B A;  3GWO A;  4JZG A;  4RQF A;  5BMV A;  4FZ0 A;  4TT3 G;  1W0K G;  3ICX A;  3KE6 A;  1OCR B;  5KHK A;  4ASF A;  3HB3 B;  4LF6 B;  4AQY B;  2WI7 A;  1FXV A;  5M4E A;  3J80 N;  1YEW A;  2BOC C;  5LA6 A;  1NHJ A;  1L8D A;  1XMQ B;  1GTO A;  5H2F Z;  1YF2 A;  3DXR B;  3TZ4 A;  4E01 A;  4JYY A;  2P6J A;  3K5N A;  1SQB H;  2YE7 A;  4YIO A;  2VS0 A;  1S16 A;  1Q81 W;  2A3Q A;  4O0B A;  5CN0 A;  5FNV A;  4LFC O;  4A5U B;  1WNS A;  1GK9 A;  4DR3 O;  2XJG A;  2Y4U A;  4P2Z A;  3S3W A;  4HZ5 A;  4DXW A;  1MA1 A;  4PV1 B;  4L90 A;  2H3O A;  2QTO A;  3HYZ A;  4RUF A;  1ZWH A;  3STL C;  5KAI Z;  1OSF A;  4MTG A;  4O04 A;  2DN9 A;  5A2Q N;  1OHH G;  4MT8 A;  1Q7Y W;  4J9Z B;  1N33 B;  5A9G A;  1UFI A;  5JH7 A;  1VIB A;  1BT8 A;  3K60 A;  2K5B A;  4HY6 A;  1K34 A;  3IFX A;  4TV9 A;  2X6C A;  5KHG A;  5BOD A;  4D7T A;  3SYA A;  4X1Y A;  3B09 A;  1SQG A;  1TGO A;  3A0R A;  1Q6H A;  5C93 A;  3K5L A;  3O65 A;  2DW4 A;  4GLX A;  1JFF B;  5LL6 Y;  1ZL8 B;  2OT5 A;  3ZHV A;  2DJV A;  4DV3 B;  2HKJ A;  3AK1 A;  1B63 A;  3D36 C;  1PL0 A;  1R3L C;  2LGW A;  2BZ5 A;  2EIL C;  2WI5 A;  4U93 A;  3GWK C;  4PU9 A;  4X1K B;  1OCC B;  4JI4 B;  4DR1 O;  3R4M A;  5B66 Z;  5FNC A;  3STZ C;  2KQX A;  1KKC A;  1H2G A;  4X9Q A;  3T0H A;  4MVU A;  3RVY A;  1Z5A A;  4CH3 A;  2UUA O;  3B4S A;  2B1I A;  4L93 A;  1HNZ B;  2GV9 A;  2F93 B;  1N4C A;  1VQ7 V;  1VQ4 V;  4DR6 B;  3ZN0 A;  5IY5 B;  4F6R A;  4J41 A;  5GTH Z;  3W7T A;  4PEL A;  2EZO A;  3OUS A;  2DWE C;  3K97 A;  4J7K A;  2QWN B;  4X9L A;  2ZM6 B;  3L71 H;  2P22 C;  2R9R B;  1GN6 A;  1XI1 A;  3B8N A;  4LH6 A;  4PDR A;  1AH6 A;  3TTZ A;  5IYB O;  1W2B U;  4JI1 B;  3CGY A;  4LWH A;  3APQ A;  2FML A;  1YC3 A;  5EYP A;  4CWO A;  3C11 A;  2WLH A;  3OEE G;  4UCV A;  1NTK H;  4QE9 A;  3L75 H;  1H2K A;  4G27 B;  1V54 C;  2JRI A;  3SJQ C;  1XL4 A;  4X88 A;  1Y66 A;  3F7Y C;  2LW1 A;  2IH3 C;  1GN3 A;  5DM6 V;  2P90 A;  1AR5 A;  3BAB A;  4O4J A;  1XMO O;  2WI3 A;  1QLE B;  4BW9 A;  4BR6 A;  1YT2 A;  4LC1 A;  3ZRW A;  3RYC B;  4JI3 B;  1VQ6 V;  3P3N A;  4LP0 A;  5IJ0 A;  3JAW B;  4O2A A;  1DLB A;  4FK5 C;  2YKE A;  5DED A;  4I3H A;  1YIT V;  1U0Z A;  1ZTE A;  4DRX A;  2QE7 G;  1VQ8 V;  1YC1 A;  4PDV A;  1XNR O;  1NTM H;  1M57 C;  2MW2 B;  4FJC C;  3RWR D;  3H1I H;  4MVM A;  3K57 A;  3CCU V;  2NNU A;  4JI5 O;  4WFE A;  5LMU O;  4ASA A;  1GJV A;  4FM0 A; 
#chains in the Genus database with same CATH homology
 4LCU C;  1S76 D;  2R9I A;  5D6Q A;  3WG7 C;  1RM1 B;  3SPI A;  1H7U A;  5GW7 A;  1BL8 A;  3FKS G;  5H9C A;  2JJC A;  3GIG A;  1UY7 A;  2ZXW B;  1UYF A;  5CTX A;  4URM A;  1EA6 A;  1R6N A;  5J9P C;  4NH8 A;  4U7O A;  2XJJ A;  2ZQM A;  3CCS V;  4MPN A;  3E8B A;  3ABU A;  4Z1M G;  4UUJ C;  3AG4 C;  2OCC B;  4HAM A;  3JYC A;  2X6A A;  1QCE A;  4XE2 A;  1M56 B;  2HG5 C;  3ZN1 A;  1THN A;  2YSU B;  5H6R A;  1JCH A;  4R8C A;  4G28 B;  4JF3 A;  5CPH A;  3ZKD A;  3E8F A;  3EKR A;  1Y8P A;  3K08 A;  4XKA A;  1TID A;  2YK9 A;  4W7T A;  3ASO C;  1V55 B;  4YKU A;  2H8P C;  1YJ9 V;  1AI5 A;  1R73 A;  3ML0 A;  1I58 A;  2IJH A;  2WER A;  3VOU A;  3O2F A;  5EBL C;  2YEI A;  1QYE A;  2WLI A;  3E89 A;  3ETG A;  3A0Y A;  3TZ0 A;  2CG9 A;  4EM7 A;  2YEV B;  4ZVI A;  3LDE A;  4GT8 A;  1UYI A;  3AG3 C;  4BAE A;  4UVC A;  4MBC A;  4EFT A;  4L94 A;  1FS0 G;  3ABM B;  3C0E A;  3H4L A;  2FXS A;  3LPS A;  1OCZ C;  3RVZ A;  4JTA B;  3I55 V;  2IWS A;  3JD3 A;  5B1B C;  4ASB A;  4QJF B;  2XAH A;  4JAU A;  4XIQ A;  1KIJ A;  4BIU A;  2FTK A;  5LHI A;  4CWQ A;  4P8O A;  4KSH A;  2YEH A;  3INW A;  3TUH A;  2Q2E B;  4R3M A;  2CCT A;  1KEC A;  5FWK A;  1G4Y B;  4FMT A;  2ZBK B;  3QDD A;  2EIN C;  4GX1 A;  1A4H A;  4XBF A;  2XD6 A;  4BXI A;  4GX0 A;  1PNK A;  3K0D A;  3HPL C;  1BGQ A;  1COW G;  1ENV A;  3E2E A;  5DN6 G;  3X2Q B;  2Q8F A;  3LDC A;  3TZ5 A;  5B1A B;  1UYK A;  1VQK V;  1JM6 A;  4KSG A;  2V1D A;  1FFT B;  3SYP A;  5CTU A;  5CTW A;  4YKX A;  4CWP A;  4EGK A;  4YKT A;  3W7U A;  1UYG A;  1F4M A;  2YEF A;  4KP4 A;  4AWP A;  1R62 A;  1I59 A;  3W7W A;  3D2R A;  1S72 V;  5IYD O;  2YJX A;  2WPD G;  4HXW A;  5M4H A;  2YE4 A;  4QPJ A;  5B1N A;  4MPC A;  2WLL A;  4XCJ A;  2OCC C;  3R4P A;  1Z5B A;  1ZW9 A;  2GFD A;  3B25 A;  2XHX A;  5KUK A;  2FYP A;  1Y4U A;  1M56 C;  1YT0 A;  1AMW A;  3TET A;  1Y8O A;  4CWT A;  4MP7 A;  3RLP A;  3OMA B;  3CCE V;  4HXZ A;  4K4O A;  3FYI B;  4UVB A;  3KG2 A;  4MW3 A;  1TC0 A;  1UY6 A;  3CWV A;  2XHR A;  4YKR A;  2YGA A;  2F43 G;  1KKD A;  4WFH A;  4KFM A;  2JKI A;  3OW6 A;  2Q6A A;  1OCO B;  3ABL B;  3RW0 A;  4I5S A;  3VHA A;  3RLR A;  5F5R A;  1KZN A;  2EBO A;  2XAB A;  1YTF B;  5D7C A;  1AI6 A;  3W7S A;  1AJ6 A;  2HCH A;  3AG1 B;  3M99 B;  5D7R A;  3R4O A;  4WUB A;  5M4P A;  2IOQ A;  2PI5 A;  2V7Q G;  1W0J G;  2A0L A;  2LFS A;  5M4M A;  2XCM A;  1AM1 A;  3G4S V;  1UYD A;  2KB1 A;  1BHA A;  2QFO A;  4FCQ A;  3A0Z A;  4UV9 A;  2YEG A;  1RPR A;  4L8Z A;  3ZKB A;  3JD1 A;  1YET A;  2QG2 A;  2HVJ C;  2DYS C;  2ZR2 A;  1FXH A;  2ZD9 A;  2LP7 A;  1VQL V;  4R3A A;  4WF9 V;  4XTJ A;  3OR7 C;  3HYY A;  4HY1 A;  2XHT A;  1G8M A;  4LPB A;  2LFR A;  1EFR G;  5EC1 C;  4B6C A;  4PRV A;  3PJS K;  4OXS A;  2YKJ A;  2WI2 A;  3K9A A;  5B1A C;  5B3S B;  2ATK C;  4WUD A;  1CPY A;  4JGS A;  3ETE A;  3SYO A;  1I5X A;  1UYE A;  1E1R G;  5CBH A;  2YKC A;  1CP9 A;  3JD4 A;  3B24 A;  2O1W A;  1K5Q A;  3K3W A;  1YJW V;  1U2O A;  2JJ1 G;  3BY6 A;  5BZB A;  2ZDY A;  4WFA V;  2IOR A;  2EIJ C;  1QVG U;  4PA3 A;  1K4C C;  5EBM C;  2CCS A;  4RQE A;  3ZIA G;  2QF6 A;  4JAV A;  4WFB V;  3CD6 V;  3FYE B;  3FB5 C;  4UV8 A;  5L3D A;  5F3K A;  1HWY A;  2Y69 B;  3K04 A;  1KC8 W;  2PI4 A;  1NH2 D;  1M9N A;  2DQ3 A;  4DO2 A;  3MHH C;  2EIK B;  4N23 A;  5L3E A;  2CCU A;  3AG2 B;  1JX9 A;  3SPH A;  3W7X A;  4HZ0 A;  2HG1 A;  2Z5U A;  2BU2 A;  2DYR B;  2HJF C;  3ASN B;  1I5A A;  4MSW C;  3WQ9 A;  1R3K C;  1GKF A;  3FB6 C;  1Z5C A;  2GHY A;  3LDD A;  3O6O A;  2BYI A;  4XDK A;  3CCR V;  3BEH A;  1K4D C;  3K99 A;  1KP2 A;  3E8G A;  5L3B A;  2HLD G;  2BRE A;  1EZJ A;  1JQ0 A;  3G71 V;  3INX A;  1E1Q G;  3ZMT A;  3CCQ V;  3FB7 C;  2XAS A;  5EBW C;  2EIM B;  4EEH A;  3OMN B;  3NMQ A;  2MK3 A;  3G7B A;  3OM3 B;  2Z3Y A;  4XKO A;  1L0O A;  1VQO V;  4MOT A;  4G2K A;  1OCR C;  3ZMZ A;  2BT0 A;  2YEV A;  2ZDI C;  1MU5 A;  4H37 A;  2YGF A;  2EXL A;  2HVK C;  2UWD A;  4GQT A;  2CK3 G;  4MVZ A;  1R6K A;  1RPO A;  3EHJ A;  2EJR A;  4R6Z A;  2YE3 A;  3QO5 A;  1BMF G;  5HFL A;  1H7S A;  4JTD B;  5LGU A;  2WI6 A;  3I56 V;  3P32 A;  1F51 A;  4PDM A;  2IJJ A;  1GKZ A;  3EHB B;  3MD0 A;  4R7C A;  4YKW A;  3SYC A;  2VW5 A;  4URL A;  3SPC A;  3OFN G;  1NH2 B;  5B1O A;  2E0A A;  2JJ2 G;  1QLN A;  1Y4M A;  2YE5 A;  3HEK A;  1KQS U;  2Q69 A;  1ZXM A;  3O0I A;  1VQN V;  3LNM B;  4QPK A;  1TC6 A;  2M7W A;  1YIJ V;  4GCZ A;  4EGI A;  2UXN A;  3GIG B;  1OCC C;  4QIW F;  3ABK B;  3PEJ A;  1PD3 A;  1I5C A;  3T4Z A;  3NXS A;  4LWG A;  4WFG A;  3BMY A;  2X6B A;  4JYB A;  5IY5 C;  2OTJ V;  2IJK A;  2W0F C;  3B28 A;  2ZKJ A;  5CTY A;  3P30 A;  1MAB G;  4KTN A;  3CC4 V;  1R3I C;  2JEX A;  1R3J C;  4P9P A;  3LNU A;  2X0L A;  4AWQ A;  1JVM A;  3T1K A;  1YSZ A;  1FXK B;  2QM7 A;  3DTU B;  1KP3 A;  3U2D A;  1ZXN A;  3E86 A;  4XDJ A;  2QA4 V;  4CE1 A;  4WCE V;  3CC2 V;  3K79 A;  1P4R A;  2Y48 A;  3FT5 A;  1QLE C;  1CEZ A;  4CBC A;  2XND G;  2YEJ A;  1QBZ A;  4XIT A;  4PDL A;  3T0Z A;  2YI6 A;  4ZKI A;  1JPX A;  1NQT A;  5H6Q A;  4CWF A;  3CCV V;  2CGF A;  3GIE A;  1H38 A;  4MW8 A;  1VQP V;  2IH1 C;  4NH7 A;  1OZ0 A;  2WAM A;  4GFN A;  3ZM7 A;  3T2M A;  2WLJ A;  1ORQ C;  1RM1 C;  4MPE A;  1SET A;  5L3F A;  2IOP A;  4AWO A;  4BW5 A;  3OMU A;  3Q5J A;  3UM7 A;  2ZXW C;  5IDM A;  2EIM C;  1GM9 A;  4XC0 A;  4PRX A;  2FWZ A;  3AEI A;  4N21 A;  2AKP A;  3R92 A;  2DWD C;  4XDL A;  2NLJ C;  3SPG A;  1ROP A;  4JQL A;  2XDS A;  4H7Q A;  3Q5L A;  3ZRX A;  4P7A A;  2XAQ A;  2BU6 A;  1Y4S A;  4E02 A;  1EI1 A;  3B27 A;  2GSM B;  1YES A;  3K06 A;  4U7N A;  4V26 A;  4YKQ A;  3FT8 A;  3B77 A;  2JK5 C;  2IWX A;  1QR8 A;  4JTC B;  4RAI A;  2A79 B;  4FCP A;  3EHF A;  4BQG A;  4O05 A;  3T10 A;  4LWE A;  2XJX A;  3CXC U;  4YKZ A;  1YS3 A;  3ZJZ A;  3R4N A;  2ZDI A;  2Q8I A;  4AS9 A;  1ARO P;  1V55 C;  1K5S A;  1YJN V;  2XX2 A;  3ZRV A;  3LSS A;  4FIP C;  4H33 A;  2YI5 A;  2WI1 A;  3OWD A;  3OE7 G;  1V54 B;  2XAJ A;  4QNH B;  1NHI A;  1VQM V;  4X8A A;  3OWB A;  3VBB A;  2XOK G;  1US7 A;  4CE2 A;  1YC4 A;  1MX0 A;  4DZY A;  4PA6 A;  2JIZ G;  2B5U A;  2IJI A;  5LHG A;  2YK2 A;  2ESA A;  5IDJ A;  1SRY A;  3FV5 A;  4CWS A;  4GEE A;  3CCL V;  1I5Y A;  4CWR A;  4UVA A;  4RO2 A;  1M57 B;  5BOC A;  1AI4 A;  2WEP A;  3ABM C;  3CCM V;  4UXN A;  1UYM A;  4YKY A;  1L1F A;  1GO3 F;  4R50 A;  2BU5 A;  3WG7 B;  2YEE A;  2WI4 A;  4XCL A;  2BTZ A;  1FXK C;  1WPX A;  2Q8H A;  4F4L A;  1QY8 A;  4I9W A;  4X89 A;  4WFF A;  4BIZ A;  4MB9 A;  4XKK A;  5KA5 A;  4BQJ A;  1PNL A;  1H8H G;  2WLN A;  4MTX A;  4EKW A;  1VQ9 V;  4KQV A;  2BU8 A;  3CP1 A;  4HYO A;  3PEH A;  1NKD A;  1BYQ A;  2IU0 A;  1XL6 A;  1I5D A;  3AG4 B;  1SES A;  4YXW G;  4EFU A;  1AJP A;  4V25 A;  4JPR A;  4E00 A;  5KA6 A;  4P9O A;  1Y8N A;  1K3E A;  4XDM A;  1SZT A;  3X2Q C;  3EHH A;  1SER A;  1GM7 A;  4MS2 A;  1GM8 A;  4DUH A;  3E35 A;  2DQ0 A;  3U2K A;  1N8R W;  3ASO B;  3B26 A;  3EHG A;  3SYQ A;  3B8M A;  3IC7 A;  4J9Y B;  1AJN A;  5LHH A;  3RKZ A;  2WLM A;  3GB7 C;  1EBO A;  5CF0 A;  4TWK A;  3HHU A;  3CC7 V;  1YT1 A;  3FB8 C;  1QR9 A;  2YE9 A;  1IXM A;  2XX4 A;  5GGZ A;  3G75 A;  4MVS A;  4R1F A;  2VWC A;  3HZ1 A;  3A0T A;  2P67 A;  3OAA G;  3EFF K;  3AG3 B;  1DF4 A;  3OMI B;  1YSC A;  1F23 A;  3R65 A;  3T1C A;  1MOF A;  3JCZ A;  2JDI G;  5FND A;  3F7V C;  1OCZ B;  4L91 A;  3UKM A;  1K9M W;  5B1B B;  4XIP A;  4JYC A;  2VCI A;  2QKS A;  4HYM A;  3Q5K A;  1TBW A;  1OCO C;  3ABL C;  1M90 W;  4PA4 A;  4KFG A;  3MNR P;  2IU3 A;  1AH8 A;  3U67 A;  2EIN B;  3E83 A;  4PA9 A;  3IED A;  4GX5 A;  3VHC A;  3AG1 C;  3ZXQ A;  2UXX A;  3VAD A;  1TUE B;  5CA3 A;  3QTF A;  1PNM A;  3QO7 A;  2XDU A;  1J95 A;  1K7D A;  4EGH A;  2IWU A;  3ZCC A;  3D0B A;  2Q8G A;  1S14 A;  5HFM A;  5LGN A;  1S0V A;  1TH8 A;  4URO A;  5J71 A;  1UY9 A;  3SL2 A;  4NH9 A;  3TCU A;  4QE7 A;  3CPW U;  3IGA C;  1M1K W;  3F5W C;  2YKB A;  4URN A;  3ZMU A;  1K8A W;  3OUF A;  1WLE A;  1YHQ V;  1Q86 W;  3QNE A;  5IYC O;  1TIL A;  2WWW A;  2YED A;  1KD1 W;  2PNR A;  5LGT A;  2YJW A;  2ZR3 A;  3ZXO A;  2ZDX A;  3H01 A;  3CYO A;  2GQP A;  3LUT B;  4L87 A;  1NR1 A;  5EC2 C;  4H85 A;  3CME V;  5M4N A;  4CE3 A;  3ZRW B;  3DGE A;  1AR1 B;  4GX2 A;  1FXK A;  3OR6 C;  3CRK A;  1S3J A;  5B3S C;  2HKO A;  1YI2 V;  4HYP A;  2YKI A;  3CMA V;  5EK0 A;  5D7D A;  2YEC A;  2OTL V;  2YI7 A;  3JD0 A;  1Z59 A;  2YE6 A;  1I5B A;  1GKX A;  1UYL A;  2BRC A;  3R91 A;  2XK2 A;  4MVQ A;  2H55 A;  4MP2 A;  4TSF G;  1UJW B;  1JOY A;  3E8H A;  5CBG A;  5L3C A;  3OEH G;  2W6I G;  1NR7 A;  1B62 A;  1E79 G;  4CZZ A;  4Q20 A;  3JZ3 A;  4ZBM A;  4LP8 A;  2H94 A;  2P7T C;  1BHB A;  3QO8 A;  2Y69 C;  5LBQ A;  2W6J G;  2WEQ A;  1UY8 A;  5FNF A;  1PKX A;  2AHZ A;  5FL7 G;  1AI7 A;  2BSM A;  2EIK C;  4LWI A;  3AG2 C;  4O07 A;  4LWF A;  2DYS B;  2H8M A;  3D36 A;  2BU7 A;  5CMU A;  1MG1 A;  1QVF U;  4WUC A;  2Q67 A;  4E2L A;  3ZMV A;  1Q82 W;  3G6E V;  3JD2 A;  3CGZ A;  1B6Q A;  3ZRS A;  3MHS C;  1BXD A;  4GT1 A;  5M4K A;  3K03 A;  1NVP D;  1K33 A;  2XDX A;  1K97 A;  2DYR C;  3T2S A;  3ASN C;  4FCR A;  1THZ A;  4PA7 A;  3GIF A;  3WHA A;  2XDL A;  2WLK A;  2WLI B;  4ASG A;  1YTF D;  2XAF A;  4P30 A;  1NHH A;  2X7R B;  2HR3 A;  3RLQ A;  2WSS G;  4RUE A;  1BKN A;  4PL9 A;  1YSR A;  2XDK A;  3D3I A;  4FPP A;  1PVG A;  2ITC C;  4CWN A;  5D6P A;  5CBF A;  3OGC C;  3OW2 U;  3H80 A;  3TK1 A;  2QEX V;  1ID0 A;  1MSW D;  2CH4 A;  3K0G A;  4KUM A;  4O09 A;  3RBZ A;  4MTF A;  2EIL B;  2O1U A;  2FWY A;  2ITD C;  2XX5 A;  2YEA A;  4GGL A;  3SPJ A;  1QZR A;  4JAS A;  2EIJ B;  1K73 W;  2C2A A;  4XD8 A;  2AHY A;  2BOB C;  2A9H A;  1YER A;  1F4N A;  1NJI W;  1DF5 A;  1UYC A;  1S77 D;  4XIR A;  4EMV A;  3EKO A;  4MVR A;  5E1A C;  2VCJ A;  3CRL A;  1LNQ A;  2QG0 A;  4MVO A;  1ZWI C;  2O1V A;  5KUM A;  3BM9 A;  3K98 A;  1H8E G;  3T4D A;  1VQ5 V;  2YGE A;  3OPD A;  5IN9 A;  3LSQ A;  4ASU G;  2B1G A;  1K92 A;  3ZMS A;  2EZP A;  5L3G A;  2Q68 A;  4MTO A;  1NVP B;  4B7P A;  3A0X A;  3ABK C;  1GMG A;  2YI0 A;  2YEB A;  3WFV A;  3ABT A;  2D3O W;  2JEU A;  5J6A A;  1UYH A;  1AJQ A;  4LBE C;  2K1E A;  2XAG A;  3G7E A;  2IW5 A;  2WLL B;  1B3Q A;  3A0W A;  3HZ5 A;  2QM8 A;  5L3J A;  1DTO A;  3VHD A;  2YE2 A;  2YE8 A;  1NBM G;  3TZ2 A;  3ETD A;  3CCJ V;  4HZ3 A;  4BAY A;  4H81 A;  1S5H C;  2HFE C;  1JJ2 U;  2BYH A;  1P7B A;  3GWO A;  4RQF A;  4TT3 G;  1W0K G;  3KE6 A;  1OCR B;  4ASF A;  3HB3 B;  2WI7 A;  1FXV A;  5M4E A;  2BOC C;  1NHJ A;  1GTO A;  3TZ4 A;  4E01 A;  2P6J A;  2YE7 A;  1S16 A;  1Q81 W;  4O0B A;  5CN0 A;  1GK9 A;  2XJG A;  4P2Z A;  4HZ5 A;  4DXW A;  4L90 A;  2QTO A;  3HYZ A;  4RUF A;  1ZWH A;  3STL C;  1OSF A;  4MTG A;  4O04 A;  1OHH G;  4MT8 A;  1Q7Y W;  4J9Z B;  3K60 A;  2K5B A;  4HY6 A;  1K34 A;  3IFX A;  2X6C A;  5BOD A;  3SYA A;  3A0R A;  5C93 A;  2DW4 A;  2OT5 A;  2HKJ A;  1B63 A;  1PL0 A;  1R3L C;  4U93 A;  2BZ5 A;  2EIL C;  2WI5 A;  4PU9 A;  1OCC B;  3R4M A;  5FNC A;  3STZ C;  1H2G A;  3T0H A;  4MVU A;  3RVY A;  1Z5A A;  2B1I A;  4L93 A;  1VQ7 V;  1VQ4 V;  3ZN0 A;  5IY5 B;  3W7T A;  4PEL A;  2EZO A;  3OUS A;  2DWE C;  3K97 A;  4X9L A;  2R9R B;  3B8N A;  4PDR A;  1AH6 A;  3TTZ A;  5IYB O;  1W2B U;  3CGY A;  4LWH A;  1YC3 A;  4CWO A;  3C11 A;  2WLH A;  3OEE G;  4QE9 A;  4G27 B;  1V54 C;  3SJQ C;  1XL4 A;  4X88 A;  1Y66 A;  3F7Y C;  2IH3 C;  5DM6 V;  2P90 A;  2WI3 A;  1QLE B;  1YT2 A;  4LC1 A;  3ZRW A;  1VQ6 V;  4LP0 A;  1DLB A;  4FK5 C;  2YKE A;  4I3H A;  1YIT V;  1U0Z A;  2QE7 G;  1VQ8 V;  1YC1 A;  4PDV A;  1M57 C;  4FJC C;  4MVM A;  3CCU V;  2NNU A;  4WFE A;  4ASA A;  1GJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...