4KP4A

Deciphering cis-trans directionality and visualizing autophosphorylation in histidine kinases.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
b'ADDRTLLMAGVSHDLRTPLTRIRAYAETIYNSLGELDLSTLKELAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Osmolarity sensor protein EnvZ, Histidine kinase
molecule tags Transferase/signaling protein
source organism Escherichia coli
publication title Visualizing autophosphorylation in histidine kinases.
pubmed doi rcsb
total genus 66
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4kp4A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4kp4A02
4JYBA 2XDXA 1TBWA 4BIUA 3B28A 5D6QA 3Q5JA 1Y4UA 1YETA 4MB9A 1U2OA 2XABA 4H7QA 1KZNA 1Y8PA 5FWKA 1BXDA 2YKCA 1YERA 4BQJA 3T2SA 2WI7A 5D7DA 3KE6A 3TZ4A 2WI1A 4BAEA 4DUHA 2CCUA 4FPPA 1B62A 4L8ZA 3CGZA 4YKXA 1BGQA 4MP2A 2ZBKB 4ASFA 4KSHA 3NMQA 2WI5A 4URLA 3H80A 4HYPA 4DZYA 1I58A 1I5CA 2YE8A 1YSRA 2YECA 5IDMA 3EKOA 4MT8A 2YE3A 4EGKA 1YSZA 5D7CA 2UWDA 3ZXOA 2YE7A 3OWBA 3MNRP 4ASBA 3RLRA 5B1NA 1NHHA 3C11A 3EHJA 1TC6A 4EGHA 2QM8A 5M4KA 1BYQA 4ASGA 4CWRA 5CTUA 1EA6A 5CTXA 4CWQA 3K97A 4NH7A 1UY6A 4W7TA 3HZ5A 2YEIA 2JJCA 2C2AA 2BZ5A 3GIEA 4XIQA 4XC0A 5GGZA 5L3JA 5FNCA 1Z5CA 3QDDA 4O09A 3EHFA 4YKWA 5CTYA 2HCHA 3A0ZA 4XCLA 1UYCA 4FMTA 2IOPA 2CCSA 4HZ5A 2IWXA 3R92A 5BOCA 4Q20A 2BYHA 3R91A 1ZXNA 2YKEA 1Y8OA 2YKJA 4WUCA 2AKPA 3A0WA 1TC0A 2BSMA 4O05A 4KTNA 5M4EA 2WWWA 4QPKA 2VCIA 4BIZA 4GQTA 4URNA 1ZW9A 2LFRA 1UY7A 3OWDA 4O07A 4CWNA 1QYEA 3ZM7A 4XIRA 2QM7A 1TILA 2BU6A 2Q8IA 2HG1A 4R3MA 2BU7A 3A0XA 3B26A 4O0BA 3RLQA 3T0ZA 4U7NA 2XHTA 2Q2EB 2LFSA 1UYDA 1R62A 3O6OA 2YI5A 1U0ZA 2BU5A 2XHRA 2QF6A 4XITA 4LC1A 5CTWA 4CE1A 3T0HA 2YGEA 2BU2A 4I5SA 4CWFA 5BODA 5B1OA 5C93A 3ZXQA 2ZDYA 4ZKIA 3D2RA 1AM1A 2YEFA 4L91A 3WQ9A 3ZRWA 2WEQA 2GQPA 3K60A 3VHCA 1NHJA 2YK9A 3A0YA 4MPEA 1YT0A 4HYMA 2XK2A 3G75A 4GT8A 3R4MA 3BMYA 4FCPA 1QZRA 3K98A 1UYFA 2XX4A 3FT8A 3CRKA 4UROA 5FNDA 4EFTA 1YC4A 2VWCA 4GGLA 1TIDA 4K4OA 3U67A 2CGFA 5M4NA 3OW6A 2PNRA 3INXA 3HZ1A 4P8OA 4U93A 3GIGA 2XJGA 2ESAA 4MPNA 2BT0A 4MBCA 3ZRXA 1H7UA 2WEPA 4HXWA 4HXZA 2XX2A 4EGIA 1ID0A 1AH8A 4LWHA 4JAVA 2WI6A 3LPSA 3DGEA 1PVGA 1QY8A 1S14A 2QG2A 2WERA 3Q5KA 4XDMA 4AS9A 2XDLA 2XHXA 4MP7A 3Q5LA 4KSGA 1UYGA 3FV5A 2BRCA 3T10A 3IEDA 1BKNA 4WUBA 4YKUA 2H55A 3C0EA 4LWIA 3B25A 5IN9A 4V26A 1GJVA 2IORA 2YEJA 2XCMA 3P32A 4LPBA 2WI3A 1UY8A 1F51A 2YEAA 4PRVA 4E00A 4YKRA 4NH9A 4CE3A 3CWVA 4H81A 3CRLA 3ZCCA 3G7EA 2YJWA 2YE9A 4FCRA 2FTKA 3TZ2A 1EI1A 3ZRVA 3EHHA 3GIGB 2YE5A 1L0OA 3R4NA 2IOQA 3EHGA 2YJXA 2CCTA 4E01A 3TZ0A 3GIFA 4H85A 5M4PA 3VHAA 1UYLA 2XDSA 4WUDA 3U2DA 3TTZA 3HYZA 5F3KA 1ZWHA 5J71A 4JYCA 4YKTA 2YI6A 3T1KA 5CF0A 2XD6A 2FXSA 2Q8HA 1Z5AA 4AWQA 4EEHA 2YKBA 2FWZA 3D0BA 3PEHA 1KIJA 1YT2A 4HZ0A 3ZKBA 3EKRA 2FYPA 1Z5BA 4URMA 5M4MA 4CWSA 3U2KA 1US7A 1MU5A 4LWEA 4EFUA 2YEEA 2XDKA 4PU9A 1AJ6A 4EMVA 4LWGA 3CGYA 4R1FA 2YI7A 4MPCA 3B24A 2Q8FA 1YT1A 1A4HA 4XD8A 3D36A 2XX5A 3WHAA 1UYHA 2P67A 2BREA 1B3QA 4NH8A 3HYYA 2WI4A 2YGFA 4ZVIA 2O1UA 4B7PA 4PL9A 1OSFA 2HKJA 4L94A 4KQVA 4CWPA 4YKZA 1AMWA 4I3HA 4JASA 1MX0A 4CE2A 5J6AA 4L93A 1YC1A 1Z59A 3SL2A 3O0IA 3HHUA 2Q8GA 2YE2A 3RKZA 3NXSA 3ZRWB 2JKIA 2GFDA 3FT5A 1NHIA 1YESA 5D6PA 2ZKJA 2K5BA 3A0TA 5CPHA 1UYKA 4XE2A 1UY9A 4E02A 3MD0A 5D7RA 1YS3A 1I5DA 2BU8A 4U7OA 1IXMA 2CH4A 1GKZA 1Y4SA 4XTJA 3OPDA 4R3AA 2BYIA 4ASAA 4XKAA 1JOYA 4GFNA 1YC3A 1THNA 4HY6A 5F5RA 4GCZA 3TZ5A 1TH8A 1ZXMA 4QPJA 4JAUA 4XCJA 1B63A 4V25A 5IDJA 3A0RA 2CG9A 3HEKA 4AWPA 2YE4A 3G7BA 2XJXA 2EXLA 4B6CA 3TUHA 4CWTA 4XIPA 2BTZA 3K99A 4CWOA 3B27A 3BM9A 2E0AA 4MTXA 4AWOA 4GT1A 4O04A 1GKXA 4HY1A 1I5AA 2IWSA 3LNUA 3QTFA 3R4PA 2XJJA 2YEDA 2VCJA 5FNFA 4LWFA 1I59A 4KP4A 3TK1A 4BQGA 4LP0A 1I5BA 4YKYA 3VHDA 2YEHA 1H7SA 2IWUA 1UYMA 3VADA 3H4LA 1Y8NA 4GEEA 4L90A 2YEGA 3OMUA 4KFGA 2YEBA 1S16A 4EM7A 2QFOA 2O1WA 4X9LA 2VW5A 4P7AA 1AH6A 3INWA 1JM6A 5M4HA 3ZKDA 2QG0A 2YGAA 1UYEA 2WI2A 4PRXA 3O2FA 2XDUA 4BXIA 2O1VA 2YKIA 2YE6A 4YKQA 4FCQA 4MOTA 3RLPA 3R4OA 2H8MA 3JZ3A 4JQLA 4XKKA 4XKOA 2FWYA 2ZDXA 2YK2A 3PEJA 2YI0A 1UYIA
chains in the Genus database with same CATH superfamily
2ZT9B 2WSSG 4K0KO 2UU9B 2DQ0A 4BW5A 1W0KG 4K3AA 5JVDB 4BIUA 3AK2A 5D6QA 3Q5JA 4FLXA 3MHHC 1AR4A 2XTAA 3AG7A 1U2OA 2HLDG 2XABA 4H7QA 4DXWA 1YI2V 1BXDA 4O4IB 3RYHB 1LNQA 1RM1B 1JVMA 5FLXN 4DV2B 4O4HB 3T4ZA 2Q7HA 1ZAUA 1Q3EA 1U97A 3WB2A 1I94O 1F7YA 4DUHA 3ABLC 4MW8A 2HG5C 1N33B 1UPGA 3UT5A 3A8TA 4YKXA 5FNVA 1EBOA 4X62B 3KG2A 3NMQA 1KC8W 2VQEO 4AQYO 3ETEA 4PDMA 1SQGA 2YE8A 3EKOA 2EIKB 4KHPO 3RBZA 3GB7C 2YE3A 4YJ2A 2GDSA 2KB1A 1YSZA 3K06A 3KKYA 3JYCA 4PHZA 3ZHRA 1MZEA 1TUBA 3HKDB 2EINB 4J7JA 1X4TA 4JI0B 1AP5A 1D5NA 3ZN0A 3MNRP 4ASBA 1NHHA 3RFRA 4D7TA 1TC6A 2RCVA 3AG2B 4KL1A 2EBOA 1AB3A 1EA6A 2ZKOA 1KQSU 5CTXA 3ML0A 4JYAO 4DR1O 1UY6A 3ZN1A 2E75B 3WG7C 2C2AA 3J7AU 5IJ9A 5IY5C 5LXTB 2BZ5A 3GIEA 1EZVH 4XDKA 1S5HC 4TSFG 3G4SV 4XC0A 1N33O 4H13B 4B3MB 5L3JA 4B3MO 1BGYH 1GKFA 2CTQA 3QDDA 4GKKB 2JDIG 3A0ZA 2ZD9A 3JCZA 2IOPA 2CCSA 4DUYB 4LP8A 3WG7B 1XDCA 4Q20A 3R91A 1ZXNA 2NNUA 4JYAB 2YKEA 2QWQB 3KZIZ 3CRMA 1Y8OA 1OCZB 3CRRA 3BAAA 2YXHA 5CBGA 1TC0A 3MHSC 4KTNA 2EIJC 4BIZA 4X66O 4URNA 4RAIA 3J80N 5LGTA 4HYOA 4R50A 4DR5O 4RWUA 4CWNA 3ZM7A 3U11A 4DK1A 3GVMA 2BU6A 5LHIA 3E8GA 5JH7B 2Q2EB 1GN2A 3THOA 3O6OA 4WBNA 1U0ZA 2XHRA 1PNLA 5JJNB 4IIJA 4B3TB 4LC1A 5CTWA 1Q6HA 1PKXA 4CE1A 3T0HA 1BQ0A 5IT9N 2IJKA 5GTIZ 1QVGU 3IC9A 3CWBH 2DJVA 2KG7B 5KHJA 3ZXQA 1M56C 1AM1A 2HEPA 4L91A 2GQPA 5DN6G 1QLEC 3VHCA 4YXWG 2LQTA 2DN9A 5CBFA 4I9QA 4LWSB 1NHJA 1YT0A 4B3TO 1ZSPA 4DR2O 1O9HA 2GSMB 2LJ2A 1MNGA 2QEXV 1AVMA 4I55A 2FKXA 4EFTA 1ZL8A 2VWCA 4DV0B 2N74A 3N2GA 2AXTZ 4K4OA 3X2QC 5LMUB 4BW9A 3B40A 4JI2O 5GW7A 4MPNA 4HBNA 1P4RA 3RYFA 1H7UA 1P7BA 3HB3B 2F4VO 4HXZA 2XX2A 3LSQA 1JJ2U 3A2FA 3CPWU 4X1KA 1MOFA 3IJ4A 1PVGA 4I0XA 1NZ6A 1W0JG 4XDMA 3JATA 4RQFA 1I5YA 2N04A 2IU0A 3Q5LA 4QNHB 4R8CA 1K97A 1UYGA 4WF9V 1GTOA 3IEDA 4WUBA 4FJCC 4YKUA 2LW7A 3C0EA 3UQ8A 3B25A 5EK0A 3CE2A 1FKAO 2EZPA 1GJVA 5FPRA 1HNWB 3P32A 4LPBA 2WI3A 2DE0X 1WNSA 1DK1A 4PRVA 3H01A 1OCOB 1VF7A 3CS5A 3QG5A 3G7EA 5B1BC 1IXBA 4UVBA 4FCRA 2JS5A 1EI1A 3ZRVA 1E1RG 1TAEA 2GBOA 1SS3A 1ROPA 1KB9F 2RMKB 2JJ1G 2IOQA 4JI1O 3JD3A 2VRZA 3SYQA 2YJXA 2P6JA 1OCOC 1B6QA 1YJ9V 5M4PA 3OR6C 3ZHQA 1JMKC 2QWPB 4WUDA 3TTZA 1XQ8A 2A3QA 2IJIA 3CX5F 4LH7A 4JYCA 2PI4A 2R72A 3T1KA 5CF0A 5K1PA 1Q86W 3UT5B 1J5EB 2Q8HA 3H1IH 1US6A 1VF6C 5F2VO 3PEHA 1KIJA 1YT2A 4B3RB 2GUZA 2B1GA 3A0BZ 2E5LO 3BEHA 1US7A 2DYRC 1HDJA 4PJ0Z 2PYLA 3VBBA 2IM9A 2ILMA 4H44B 4EEQA 3SJQC 3CGYA 1Q82W 1P49A 4UV8A 3K9SA 4J9YB 2Q8FA 1J5EO 4XD8A 1CPYA 2YI8A 3A0HZ 4WFEA 3J81N 3O65A 1IDSA 1K5SA 3E83A 1KMIZ 4QIWF 1OCRC 4P9PA 2DYRB 2Q7GA 2BREA 2B1IA 2LGWA 3JASB 4NH8A 2BOBC 4FZ0A 5KMGB 2Y69B 1AP6A 5LA6B 2B5UA 1NJIW 1U96A 1OSFA 2JEUA 2HKJA 2ZIMA 3E22A 4DV1B 3CJHA 4UCUA 3BVOA 1I08A 1OCRB 5H2FZ 5BY1A 3EHBB 1LR1A 3BABA 4L93A 1KUQA 3SL2A 3W7TA 3RKZA 3SGIA 1S77D 1TUEB 4IL6Z 3H1KH 5JQGB 3RW0A 1AILA 1AJQA 2Q5ZA 5D6PA 3L71H 2X6AA 2DMXA 2ZE8A 5CPHA 3OMNB 1FFXA 2Q6AA 1K7DA 3R66A 3W7UA 4O2BB 4U3JA 1YS3A 4LNUB 4JF3A 1YSCA 2BTQB 5C8YB 1Y4SA 4B3RO 4R3AA 1KP2A 1NH2B 4ASAA 4GFNA 4Z2WA 4X20B 1DGSA 1THNA 5LGNA 4HY6A 5F5RA 4QPJA 4JI8O 4DK0A 2ZXWB 3EVKA 2D2CB 1Y6XA 1YITV 3L9DA 3NR7A 3HEKA 1Z5VA 1YXBA 5FNVB 3G7BA 2EZOA 2XJXA 2E76B 2Z5UA 2EXLA 5GONA 4I55B 1XNRO 2NN4A 1FXVA 2XNDG 2VWKA 4LF8O 5IWAB 4KUMA 3CHXA 2E0AA 2P06A 4MTXA 4GT1A 1IBKB 2F1MA 3K5LA 5JH7A 2P4VA 2YXYA 4RO2A 2XASA 3LNUA 3KCXA 2OWOA 3F7VC 2VCJA 1O9GA 4RQEA 4JTDB 4TOIA 3JASA 2NLJC 4BQGA 4LP0A 4X65B 1I5BA 3VHDA 1XOUA 1UYMA 4HZ3A 2UU9O 3L73H 3C90A 4L90A 2F43G 3ZHUA 1AI6A 3ZMZA 1SRYA 4P30A 1QHTA 1AH6A 3ZKDA 2QG0A 3K03A 1HR0O 2QA4V 4JPRA 1Q90D 4BXIA 1XNQO 3VQYA 4DR3B 4DV6B 1HP8A 5BMVB 2YKIA 3WFVA 2YE6A 4JI4O 4FCQA 4MOTA 3RLPA 1BL8A 3R4OA 2A06H 4XKKA 3LNMB 4DW1A 3HKEB 4LH6A 4Z1MG 2Z0AA 3E2EA 1M4UA 1MSWD 3JD2A 3EXAA 1L1FA 1SESA 2ZDXA 3PEJA 2UUBB 3ZHTA 5J2UB 1M9NA 5IYCO 2XDXA 1NH2D 3AG1B 1URFA 3CCEV 3B28A 2WAMA 2EX3A 4DR6O 1YETA 3D8CA 4PA9A 3SDLA 2W0FC 2W6JG 3BRCA 5KLVH 1KKDA 1YERA 3K57A 4LF9O 2OTJV 4BQJA 5LXTA 5EBLC 3T2SA 3KE6A 3HKBA 1IBMO 4WCEV 5JCOA 4TV9A 2Y4TA 3QO5A 3CGZA 4PA6A 1KU9A 4EFBA 3K3WA 2HJDA 1V55B 4IT5A 4XDLA 3S3XA 2ZBKB 4X9QA 1J95A 4URLA 2Y48A 4HYPA 4TT3G 2QKAA 4H37A 3SJCC 3SYOA 1Q6IA 1I5CA 3CCQV 2ZE5A 3CCVV 2IJJA 4JI7O 2OYQA 1JQ0A 1V55C 3JCUZ 1IBLO 1NBMG 5D7CA 2QGNA 2FB5A 2UWDA 3N2KB 4IGGA 3OWBA 5DECA 2ZR2A 5B1NA 1G1XB 5J2TB 1Y74B 3H1HH 3I55V 1PM9A 5CN0A 5M4KA 4CWRA 4ASGA 1FXKA 4DV0O 3ETQA 4PDVA 1PL0A 5LP6C 4W7TA 2MW2B 1N0JA 1IURA 3BCCH 2JJCA 1YVWA 3D3QA 1WPXA 4AHCA 4PA7A 1XUQA 3G80A 4PI0A 5HFMA 4JI5O 4DV7B 5LBQA 5GGZA 5FNCA 3DC6A 1Z5CA 1QR8A 2ZIOA 3EHFA 3G6BA 2WLJA 3JAMN 2ZM6B 3B8NA 5KMGA 4XCLA 3DTUB 4X1KB 1QCEA 5LOVA 2YEVB 4HZ5A 4F6RA 4DV2O 3Q4HA 1NT2B 2CH7B 2DQ3A 1N32O 4WUCA 4JI6O 2Q0AA 3ASOB 2AKPA 2F4VB 3CRQA 2ZE7A 3BY6A 4QPKA 2VCIA 2HHHO 5KX5B 2LFRA 1UY7A 2CK3G 4JI3O 1TILA 2Q8IA 3BPZA 2HG1A 2BU7A 3A0XA 3B26A 4O0BA 3RLQA 1MZFA 4YIPA 4U7NA 2O57A 2XHTA 1WA8B 3RT3C 1RM1C 1JX9A 2YIAA 4PDLA 3RYIA 4I4TA 1H38A 1VQ4V 2QF6A 4XITA 2BU2A 4I5SA 2C1GA 3AG3B 4FM1A 4FM2A 4CWFA 3HKCA 2ZDYA 4ZKIA 3DXRA 2YEFA 3OTOO 3CD6V 2HHIA 3ZRWA 1AI4A 4HNAA 5LYJA 5E79Z 2IJHA 2YK9A 4IYHA 4CC5A 3CXHF 4HYMA 2XK2A 2FL4A 3FB6C 3CCUV 3AG3C 1FJGB 3BMYA 1Q6UA 4FCPA 5J9PC 3P3NA 3FAVB 2H3OA 2CH7A 1KP3A 3E89A 4UROA 2OIEA 2X6CA 1TIDA 3U67A 3T1HB 1AJNA 1BSMA 1HNZB 3HZ1A 3ABMB 3GIGA 3N2GB 2ESAA 2XJGA 4O2AB 2V7QG 1OJHA 2YI9A 1VF6A 4NVPA 5K1XA 4HXWA 1H8HG 1ID0A 1V54B 2IH1C 1QY8A 1SKVA 4NR1A 3CC2V 3RYHA 4MVSA 3ABMC 3Q5KA 3OM3B 4D6TH 2XDLA 2QR4A 5IY5B 2ZDIC 4KSGA 2YSUB 1GMGA 4I0XB 1XNQB 4DRXB 2ZNJA 4NXMO 3FV5A 2BRCA 5EIBC 2Q69A 1BKNA 1F4MA 1R1BA 1G6UA 1K5QA 2UXNA 4LF5B 5KA5A 1RSOB 5IN9A 3RN4A 4OX9O 1JFFA 1CEZA 2XCMA 2D3OW 3OEHG 4DR7B 1F51A 3W7XA 1ENVA 5CA0B 1FYJA 5KAIZ 4OGQB 2RNBA 5HFLA 4E00A 1BS3A 3PN1A 1ORQC 3HKDA 4PDRA 4H81A 3CRLA 5CA0A 3ZCCA 2YJWA 4IYIA 4JI0O 4CH6A 2FTKA 2YUAA 5DM6V 3TZ2A 4ZI7B 1QLNA 5IYBO 3CYOA 2YE5A 4MVZA 1L0OA 3ZRSA 4U3JB 5JCOC 1XNRB 1SQPH 1Y76A 2CCTA 4E01A 5B3SC 2PYJA 4F4LA 4H85A 5B1BB 4X20A 3U2DA 4GKJB 2XAQA 1DLBA 1TVKB 1NVPD 4YKTA 1R6NA 3SJAC 4ICGA 2R9IA 2P22C 4ZBMA 2WLIB 4BAYA 3S3WA 1GK9A 5B3SB 2YKBA 4GX2A 1GN3A 3PJSK 4WFGA 4PELA 3ZKBA 4URMA 1K92A 1GAXA 1NTMH 3AK1A 1I5XA 2ZINA 3Q4HB 4CWSA 3CCLV 1FXKB 3BA8A 5CMUA 3ZHVA 2Q73A 1GO3F 4EFUA 4EMVA 4R1FA 1Y66A 1HNWO 4MPCA 4EB6A 4B7KA 1A4HA 5KX5A 1R6TA 4JTCB 4JZ2A 1H8EG 4LF5O 3VQWA 3CRCA 2P67A 2CAZC 1B3QA 1FXKC 5EC1C 1RPOA 3CCSV 2YGFA 1WA8A 3C3TA 2YIDA 2L6LA 2G38A 3QF7A 2E3CA 1GH6A 4AI8A 4CWPA 3G67A 4ZOLA 4J7KA 3QTCA 4GKJO 1M1KW 4JASA 4CE2A 2ZNIA 1VEWA 5J6AA 1NTZH 2Q8GA 3NXSA 3M8AA 5BMVA 2QDOA 4J11A 4W4LA 4FFBB 2YIBA 1FFXB 3TXSA 2JKIA 3HKEA 4A5UB 1NHIA 1YESA 4CBCA 1B04A 4X66B 4X64B 3A0TA 3GWOA 3CRAA 1SQQH 1VMGA 3BFRA 1UYKA 1QNMA 3E86A 1UY9A 2WLLA 1QU7A 2BU8A 4GYCB 4YJ3B 4PV1B 4XTJA 3OPDA 2QWOB 2BYIA 2XUMA 1JOYA 1KECA 3TXQA 4DR4B 5KHHA 3OTFA 3ICXA 3TZ5A 1TH8A 1VQOV 2R9AA 1B63A 4O4JA 2EIMC 4V25A 1XMQO 1IZ3A 2GUZB 2EIKC 3SPIA 4DV5O 3DSQA 4B6CA 1EZJA 2YI0A 1SZTA 3TUHA 5J2UA 3LDCA 4DUZB 2LW1A 3B27A 4PA4A 2N05A 4B3SO 5D5PA 2WPDG 1G8MA 2K9PA 4HY1A 3OMIB 2XJJA 2YEDA 1FS0G 1Q8IA 1L0LH 2IU3A 2IW5A 3TK1A 5BZBA 2UUBO 1RP3B 4X89A 2DW4A 4K8ZA 1VQ7V 2YEGA 1CP9A 2YEBA 1XL4A 3CXCU 2OTLV 3FD9A 4XDJA 2QFOA 4X9LA 2CTPA 2RDCA 4ZI7A 1UYEA 2WI2A 1NU1H 2JGUA 2HKOA 4PRXA 1M93A 1SQBH 3SPJA 1K34A 3STZC 2ITCC 1D2DA 4JQLA 2BTOA 4IHJB 5H5NA 3N27A 1BMFG 2EJRA 1WN7A 2DWEC 4U3FH 3APQA 2Q68A 3OFNG 1HNXO 4LFBO 4R7CA 5EBWC 4CWQA 3K08A 4X65O 3K0GA 3T2MA 5CB4A 1EM1A 4JTAB 1PNMA 2BSKB 2PGGA 1YJNV 4FLYA 4NTXA 5FWKA 1SQXH 4X1YB 4LFCO 2YKCA 1PV0A 4UXNA 2WI7A 2HVKC 1FD9A 1EN6A 1R3IC 2PUSA 2F95B 2UXCO 4J10A 4BAEA 1GRJA 1B62A 5ITZA 4L8ZA 2Z3YA 4X62O 1VQLV 3OE7G 1BGQA 1QLEB 1WJZA 4JYYA 4ASFA 1BZKA 1R3JC 3F5WC 1NKDA 3OR7C 2WI5A 5L3CA 3H80A 1AJPA 4OPAA 4DZYA 4LR3A 1NQTA 3JD1A 3E22B 4RUFA 2YECA 1SETA 1K4DC 3JSLA 3ZBHA 3SYCA 4DV3O 1OCCB 3TGUH 1E79G 1M57C 3WU2Z 3ZXOA 2YE7A 4LF7B 2E5LB 3WB1A 3UO3A 4GX0A 1JR9A 4MVOA 4I7ZB 3QO7A 2FMLA 3EHJA 5CB4B 1OCCC 3IFXA 2P90A 5CTUA 1SC5B 1VQ5V 1Y4MA 3JSNA 3TCUA 4AILC 2H94A 3JARB 4MVMA 1H2NA 3K97A 2ZDIA 5LMNO 2ADPA 3OTOB 4YHHO 1XMOB 2HR3A 3HZ5A 1GN6A 2YEIA 2AZ2A 5JENA 1V9PA 4NXNB 4LNUA 3RYFB 5LOVB 1LUWA 2JGDB 4YKWA 5CTYA 2HCHA 1YDXA 5LP6B 3ABKB 1UYCA 1Q43A 4FMTA 3E35A 3QNEA 3DC5A 3RGBA 2IWXA 2WLHA 1EFRG 4LFAO 3R92A 4G27B 4CS3A 2BYHA 2XT9A 3CCRV 3JAKB 2F93B 3IGAC 4TWKA 3SJBC 1VQ8V 1JCHA 2QWRB 3K5OA 5M4EA 3SPHA 4O2AA 4GQTA 4GUNA 4FLTA 3LSUA 3ZMUA 1N34B 4LF9B 3T4DA 1QYEA 4YJ2B 1SF9A 3L74H 3STLC 3R65A 4JI6B 4XIRA 4LF6O 4R3MA 5LHGA 3T0ZA 5LGUA 4MW3A 5L3GA 1R62A 3FB7C 2YI5A 2BU5A 1EN5A 4QJFB 3SYPA 4ZHQB 5L3FA 4L8JA 5B66Z 5GONB 4HNAB 3ZEDA 5BODA 5B1OA 3ABLB 2XAGA 3D2RA 2XAJA 2EULA 1VQMV 3WQ9A 4P9OA 3VQVA 4FFBA 2WEQA 3B4SA 1JFFB 4MPEA 1BQZA 3ASNC 5LP6A 4JI2B 4LFCB 1QZRA 5H6QA 3K98A 1UYFA 2XX4A 3FT8A 1FFTB 3OD4A 4ZIBA 5J2TA 3JALA 1MA1A 1B06A 1BE3H 1N34O 4B3SB 3K5MA 2EINC 3CB2A 3S5TA 4J41A 3ASNB 1FJGO 3OW6A 4DR7O 4JI7B 4OXSA 1TA8A 3CCMV 1NVPB 3F5TA 3ZX6A 5LL6Y 2BT0A 2UUAB 3FYEB 4MBCA 3ZRXA 2EILB 2WEPA 1PNKA 1N36B 1W59A 4EB6B 2YS8A 1H2MA 1IBKO 5EBMC 4LWHA 4JAVA 3LPSA 3DGEA 4BR6A 4QE7A 4IHJA 2RQ6A 2XHXA 4MP7A 1VF5B 2YDEA 4I4TB 2XOKG 3D36C 2Q8VA 3HKBB 1H2KA 2VQEB 3T10A 2C1IA 2CE4A 1SQFA 5BR8B 2H55A 4LWIA 1MMMA 4NB5A 3FFQA 2YEJA 3OT7A 3ZJZA 4ZOLB 1AR1B 4UCVA 2KKWA 5LYJB 3ABUA 3L72H 3CCJV 4UUJC 2JK5C 2Q9LA 1UY8A 4LWSA 2F23A 4WFFA 1TGOA 2QSAA 4R6ZA 1COWG 4YKRA 2BOCC 4G2KA 1A32A 1N32B 4WFBV 4CE3A 2X7RB 4G28B 3OMAB 3W7SA 3N2KA 4LF7O 2ODMA 2YE9A 2UXDO 1UFIA 2PI5A 3EHHA 2B9ZA 5EZYA 1OV9A 3GIGB 5IYZB 3R4NA 2Y4UA 3LDDA 5TISZ 3L75H 1UYLA 3HR0A 3UKMA 4DR4O 4FIPC 4K8XA 5F3KA 5J71A 1YEWA 2XD6A 2V4DA 3RVYA 1HWYA 3VOUA 4AWQA 4EEHA 3I5DA 2FWZA 4DRXA 1AI5A 3U10A 2ATKC 1K3EA 4OPHA 3RYCB 2FYPA 1WPBA 1VP7A 4FLVA 1I0HA 4X88A 4DR5B 1MU5A 1K9MW 1NI8A 4LWEA 3WB0A 3HPLC 2XDKA 1DTOA 2CDYA 4TUYB 2YI7A 4TV8B 2W6IG 1YT1A 2JS3A 3D36A 3CMAV 3K04A 1FAFA 2R9RB 4TV9B 3WHAA 1UYHA 2X6BA 3HYYA 2WI4A 4ZVIA 4B7PA 1T5EA 2F66C 2YXLA 4UB8Z 4DV3B 4X8AA 2CUGA 1V54C 4X1IB 4DO2A 4L94A 1I94B 4KQVA 5EIBD 1AMWA 2XAHA 2HVJC 3G71V 4FZ1A 5H9CA 3BA9A 1MX0A 3M7MX 1BHBA 1Z59A 3O9OA 3O0IA 2NR5A 4MVRA 2YE2A 3ZRWB 5IJ0A 3FT5A 1D5AA 2GFDA 2AW9A 1K4CC 1ZUQA 3LNNA 2LP7A 3UM7A 2UXBB 1MABG 4JGSA 1Z2GA 2XHBA 1VQKV 2YICA 4YIOA 5D7RA 1I5DA 4U7OA 1WP8A 1S5JA 1YJWV 2CH4A 2OCHA 2HHHB 3K9AA 2A7WA 4DV5B 4XKAA 3ZIAG 1YC3A 1TVKA 1HR0B 3CC4V 4K35A 2ZCEA 3F7YC 4GCZA 1W2BU 1ZXMA 4NXNO 4JAUA 2Q67A 4LF4B 5IDJA 3RYIB 2ZM6O 2YE4A 3EFFK 4O4JB 1YTFD 5ITZB 2PZSA 2X0LA 1ZWIC 3K99A 1WP7A 3BM9A 2A9HA 4EKWA 1H2LA 4AWOA 1JJOA 5IYDO 3CYGA 4O04A 1GKXA 2ETNA 5H6RA 3RVZA 4ASUG 1S76D 2QJ1A 1I5AA 2IWSA 4O4HA 3AG2C 3R4PA 4TV8A 3E8HA 2QM4A 5FNFA 4DR6B 3AK3A 4L87A 4B7EA 4K0KB 1HNZO 1LUVA 3FB5C 4YKYA 1R73A 1H7SA 2IWUA 4DV4O 4ZHQA 1KYOF 1KKCA 4UV9A 5BR8O 2Y0IA 4GEEA 2LO1A 4DUYO 4EM7A 2VW5A 3INWA 3JARA 4UVAA 1H2GA 5M4HA 1QR9A 4DV6O 1BT8A 2AHYA 3ZS8C 1L0NH 1YF2A 2ZR3A 4MTFA 4YKQA 2ZQMA 1R6KA 2GHYA 1XMQB 3JZ3A 2M6YA 3BHPA 5A2QN 1M90W 2FWYA 4PA3A 1MG1A 2YEVA 2YK2A 3SPGA 2L35A 1WAZA 2Q7EA 1AR5A 5L3EA 1DF4A 2DYSC 4JYBA 1SERA 2AGAA 3JD4A 1TBWA 3RWRD 1NR1A 1JA8A 1Y4UA 1YCIA 1HNXB 4MB9A 3W7WA 4OX9B 4UVCA 3FKSG 1KZNA 1Y8PA 1ZX3A 1QBZA 5E1AC 4LF8B 4H33A 2DYSB 2K1EA 5D7DA 4UCTA 3TZ4A 5IWAO 3H9VA 4E4EA 1XHZA 2WI1A 1DF5A 4J80A 1G4YB 2CCUA 4FPPA 3SYAA 5GTHZ 4MP2A 1BHAA 4KSHA 4YHHB 1WLEA 1OZ0A 5CA1A 2ZXWC 5DEDA 4DV4B 5JJEB 1I58A 1I7FA 1YSRA 3TETA 5IDMA 4MT8A 3U0ZA 4EGKA 1K73W 3X2QB 1Q5OA 2VS0A 3OGCC 1N36O 4BIOA 3RLRA 1PP9H 2UUAO 4NTYA 3C11A 4MS2A 1H2SB 1GM9A 4EGHA 2EJ7A 2KSDA 4RUEA 1Q81W 5EZYB 2QM8A 1BYQA 3H1JH 1M57B 5KHGA 4NH7A 1BCCH 5LHHA 2GTAA 4LFAB 3CJHB 1AI7A 4J9ZB 3B8MA 1E1QG 3H1LH 3APOA 2KG7A 1AROP 3QVNA 4XIQA 1Y67A 5IE9A 1OCZC 4MTOA 3B77A 5KHIA 4O09A 2QE7G 1VQ9V 4UCSA 2EIJB 3JATB 1NR7A 4MTGA 1XMOO 5BOCA 4YY3O 1PPJH 1ZL8B 1XHXA 4JI8B 5JVDA 5KUMA 2YKJA 4CH5A 3K79A 1K33A 1JPXA 2CGNA 3UCSC 2UXXA 4DYLA 1KD1W 4GX5A 5CA1B 4TUYA 2PY5A 2BSMA 4NYKA 3A0WA 4O05A 1XEQA 1Z5WA 2WWWA 3ABKC 4X64O 3VQXA 3UO2A 1ZW9A 1VIBA 2ARHA 1SA0A 2UXDB 3OWDA 4O07A 3CP1A 2WA3A 4X1YA 3T1HO 2QM7A 1FPOA 2V1DA 3B09A 4WFHA 1S72V 3B2EE 4JZGA 5JJJB 4JV5O 2LFSA 1M56B 1FXHA 4JI4B 1UYDA 3D3IA 1SQVH 2DWDC 1X59A 2RN9A 2WLKA 4N21A 4I9WA 2YGEA 1R3LC 4BWAA 4YJ3A 1VQNV 4FM0A 4LF4O 4MVUA 5C93A 2PTMA 3K5NA 4HAMA 2A79B 1VQPV 4KXRA 5KUKA 4JI1B 4P2ZA 5JQGA 1EN4A 3HKCB 2UXCB 1HW7A 3K60A 2MK3A 3A0YA 1P84F 3LSSA 2OT5A 4MSWC 3G75A 4GT8A 3R4MA 2JIZG 3CRKA 1F4NA 3KCYA 1RPRA 5FNDA 1YC4A 2CTWA 4GGLA 1S0VA 1GM8A 2CGFA 5M4NA 4N23A 1M5IA 1XI1A 2JJ2G 2PNRA 3INXA 4P8OA 4TQDA 4U93A 3TJTA 3I56V 3AG4C 3AEIA 4KFMA 5KAFZ 2Y69C 1Y76B 4EGIA 2WLNA 1AH8A 3OUFA 2WI6A 1YTFB 1S14A 2WERA 2QG2A 2QKSA 3SR2C 2ZE6A 2QKCA 1VQ6V 3G6EV 5AG2A 4O4LA 4UCRA 4WFAV 4AS9A 3AG4B 4F6RB 4JI5B 2JRIA 2EILC 3LUTB 2Q4PA 4FLWA 3K59A 1S5LZ 3ABTA 4H0LB 5L3DA 1F23A 4DV7O 5JWPA 3ETDA 4PD4F 4V26A 2IORA 1OHHG 4XBFA 3ETGA 4J42A 2IBZH 1UJWB 1PL4A 4FVMA 2YEAA 3ASOC 1XL6A 3FAVA 2YC0A 4NH9A 4Z1VA 2FYUH 3CWVA 1VARA 4DR2B 3T1CA 3FX7A 4DUZO 2P5OA 4YY3B 4UCOA 2A0LA 2LGQA 3GWKC 3OUSA 3T1YO 4DR3O 1ZTEA 1K8AW 3DXRB 2VWJA 2Y0PA 2EIMB 3MAQA 1QVFU 3EHGA 3TZ0A 3GIFA 3VHAA 2XDSA 4FK5C 4FLUA 1ZWHA 3HYZA 4NXMB 4C7UA 2YI6A 5IJ0B 1QQCA 3OGIB 4DR1B 2GV9A 4NKGB 2WLMA 3T1YB 2FXSA 4O4LB 1Z5AA 1R3KC 2HJFC 1XREA 5L3BA 3CSXA 1GN4A 3D0BA 4HZ0A 1S3JA 2E74B 1GM7A 4DW0A 2UUCB 1Q7YW 3EKRA 3OW2U 2AZ0A 1Z5BA 2QTOA 3CMEV 5M4MA 4O4IA 3U2KA 3SPCA 3LDEA 4I50B 3RYCA 3FYIB 4NTWA 2ITDC 5D5QA 3CEIA 4W4KA 2YEEA 4PU9A 4CC6A 1AJ6A 3L70H 4KHPB 4LWGA 5CA3A 3B24A 4CH4A 1SA0B 2XX5A 4LFBB 5FL7G 1WB8A 1NS1A 4X1IA 1N4CA 3FB8C 4LCUC 4JAAA 2O1UA 1WB7A 5BXZA 3P30A 4GKKO 2AHZA 4PL9A 2PF4E 3OAAG 2M7WA 4IIJB 2JEXA 3CC7V 1N8RW 5LA6A 4YKZA 5A9GA 3JAWA 2IH3C 2JVDA 4I3HA 2Q0OC 1IVSA 4EFEA 2RJZA 3JD0A 4D7SA 1YC1A 4GZRB 3M99B 3HHUA 5B1AB 3AG1C 1Y74A 4E2LA 2QWNB 3P3PA 5EYPB 1L8DA 4J7ZA 3IAYA 4FFKA 2ZKJA 2HFEC 3OEEG 2K5BA 1NTKH 3ZMVA 4QGPA 2R70A 5EYPA 3JALB 4MVQA 4WBNB 4XE2A 5C8YA 2BTQA 1IX9A 2OCCB 5B1AC 2XAFA 2GTSA 3MD0A 1XILA 4I50A 3ZHSA 4B08A 4E02A 2BE3A 5IYZA 4Q6GA 2BSKA 1IXMA 1GKZA 4O2BA 2OIGA 2WLLB 2DOSA 4DV1O 3E8FA 1CXZB 2JGDA 5KHKA 4QE9A 1N0NA 2OCCC 2VQFB 4E72A 4CS4A 4XCJA 2VQFO 2WLIA 3A0RA 1ZLZA 2CGOA 5EC2C 2CG9A 3JAKA 1SZXA 4AWPA 4LBEC 2CTRA 4GLXA 1YIJV 3IC7A 1PD3A 1YZBA 4CWTA 1YHQV 1MSDA 4XIPA 2BTZA 4CWOA 1P7GA 4LF6B 4JV5B 1KBHA 3QTFA 1TUBB 3K58A 3K0DA 2UUCO 2H8PC 4LWFA 2QTSA 5LMUO 1I59A 4KP4A 4UB6Z 3ZMSA 4CZZA 3E8BA 4UFZA 4GX1A 2YEHA 4TQFA 5CBHA 3VADA 2HP8A 1Y8NA 3H4LA 4F6EA 2WA4A 1THZA 4CH3A 1XBLA 2BCCH 3OMUA 4KFGA 1S16A 5KA6A 1IBLB 3C3SA 2O1WA 4P7AA 3LMMA 1JM6A 2YIBD 5FPOA 3JAWB 4ABMA 2YGAA 1RSOA 4PI2A 1RFYA 3O2FA 1IBMB 4AQYB 2XDUA 2O1VA 3MDSA 5IJ9B 2P7TC 5B5EZ 2W0XA 2H8MA 4XKOA 5LMNB 2ADQB 4FLZA 2P4KA 4CS2A 3QO8A 4JI3B 2UXBO 1UYIA 3ZMTA 2KQXA
chains in the Genus database with same CATH topology
3K0GA 3T2MA 2WSSG 5L3EA 2DQ0A 4XCLA 1DF4A 4BW5A 2DYSC 1M9NA 4JYBA 1W0KG 5IYCO 1SERA 3JD4A 4JTAB 1PNMA 1NH2D 3AG1B 1TBWA 2XDXA 1YJNV 3CCEV 4BIUA 3B28A 5D6QA 2WAMA 1NR1A 3Q5JA 1Y4UA 3MHHC 1YETA 4MB9A 3W7WA 4UVCA 2HLDG 3FKSG 1U2OA 2XABA 4DXWA 1YI2V 1KZNA 4H7QA 1Y8PA 4PA9A 5FWKA 1BXDA 1QBZA 2W0FC 5E1AC 1LNQA 2W6JG 1KKDA 2YKCA 1RM1B 1YERA 1JVMA 2OTJV 4BQJA 4H33A 2DYSB 2K1EA 5EBLC 4UXNA 3T4ZA 3T2SA 2WI7A 2HVKC 5D7DA 1R3IC 3KE6A 3TZ4A 4WCEV 2WI1A 1DF5A 4BAEA 4DUHA 1G4YB 3ABLC 4MW8A 2CCUA 4FPPA 3SYAA 1B62A 2HG5C 3QO5A 4L8ZA 2Z3YA 3CGZA 4PA6A 1VQLV 4YKXA 3K3WA 1EBOA 1V55B 3OE7G 1BGQA 1BHAA 4MP2A 3KG2A 4XDLA 1QLEB 2ZBKB 4ASFA 1R3JC 3F5WC 4KSHA 1J95A 1NKDA 3OR7C 3NMQA 1KC8W 5L3CA 1WLEA 1OZ0A 2Y48A 2WI5A 3H80A 4URLA 4HYPA 1AJPA 4TT3G 2ZXWC 4DZYA 4H37A 3ETEA 1NQTA 3JD1A 3SYOA 1I58A 4PDMA 1I5CA 4RUFA 3CCQV 1YSRA 3TETA 2YE8A 1SETA 2YECA 2EIKB 3EKOA 1K4DC 4MT8A 3CCVV 5IDMA 2IJJA 3RBZA 3GB7C 3SYCA 2YE3A 1OCCB 1JQ0A 1V55C 4EGKA 2KB1A 1YSZA 3K06A 1NBMG 3JYCA 1E79G 1M57C 1K73W 2UWDA 5D7CA 2EINB 3ZXOA 3X2QB 2YE7A 3OGCC 3ZN0A 3OWBA 3MNRP 4ASBA 2ZR2A 3RLRA 5B1NA 1NHHA 3C11A 4GX0A 4MS2A 4MVOA 1GM9A 3QO7A 3EHJA 1TC6A 4EGHA 4RUEA 1OCCC 3AG2B 3IFXA 2P90A 3I55V 1Q81W 2QM8A 5CN0A 1BYQA 4ASGA 4CWRA 1M57B 2EBOA 1Y4MA 3TCUA 1VQ5V 5CTUA 2H94A 1EA6A 1FXKA 4MVMA 1KQSU 3ML0A 5CTXA 4CWQA 4PDVA 2ZDIA 3K97A 4NH7A 1PL0A 5LHHA 3ZN1A 1UY6A 4W7TA 2HR3A 1AI7A 3HZ5A 4J9ZB 2YEIA 3B8MA 3WG7C 2JJCA 1E1QG 2C2AA 2BZ5A 5IY5C 3GIEA 1AROP 1WPXA 4XIQA 4XDKA 1S5HC 4TSFG 3G4SV 4PA7A 4XC0A 5HFMA 5GGZA 5L3JA 5LBQA 1OCZC 4MTOA 1Z5CA 5FNCA 1QR8A 1GKFA 3B77A 3QDDA 3EHFA 4O09A 4YKWA 2WLJA 5CTYA 2JDIG 2HCHA 2QE7G 2ZD9A 3B8NA 1VQ9V 3A0ZA 3DTUB 3ABKB 2EIJB 3JCZA 4FMTA 1NR7A 1QCEA 3E35A 2YEVB 3QNEA 1UYCA 4MTGA 2CCSA 2WLHA 2IWXA 4LP8A 1EFRG 3WG7B 3R92A 4G27B 5BOCA 4Q20A 2BYHA 3R91A 1ZXNA 2NNUA 3CCRV 2YI5A 2YKEA 2DQ3A 5KUMA 3IGAC 1Y8OA 4TWKA 2YKJA 4WUCA 1OCZB 3K79A 1K33A 1JPXA 3ASOB 2AKPA 2UXXA 1KD1W 3A0WA 4GX5A 5CBGA 1TC0A 2BSMA 1VQ8V 1JCHA 3BY6A 3MHSC 4O05A 4KTNA 5M4EA 2WWWA 3ABKC 2EIJC 4QPKA 3SPHA 4BIZA 2VCIA 4RAIA 4GQTA 5LGTA 4URNA 1ZW9A 2LFRA 3ZMUA 3T4DA 4HYOA 1UY7A 3OWDA 4R50A 4O07A 4CWNA 3CP1A 2CK3G 1QYEA 3ZM7A 3STLC 3R65A 4HZ5A 4XIRA 2QM7A 2V1DA 1TILA 2BU6A 5LHIA 2Q8IA 2HG1A 4R3MA 2BU7A 3A0XA 3E8GA 5LHGA 3B26A 4WFHA 1S72V 4O0BA 3RLQA 5LGUA 3T0ZA 4MW3A 4U7NA 2XHTA 2Q2EB 5L3GA 2LFSA 1M56B 1FXHA 1UYDA 3D3IA 1R62A 3O6OA 3T10A 2DWDC 3FB7C 2WLKA 1U0ZA 2BU5A 2XHRA 1PNLA 4N21A 1RM1C 1JX9A 3SYPA 4QJFB 4PDLA 2QF6A 4I9WA 5L3FA 1H38A 1VQ4V 4LC1A 4XITA 5CTWA 1PKXA 4CE1A 3T0HA 2YGEA 1R3LC 2IJKA 2BU2A 1QVGU 1VQNV 4I5SA 3AG3B 4CWFA 5BODA 5B1OA 4MVUA 3ABLB 5C93A 3ZXQA 2XAGA 2ZDYA 4ZKIA 1M56C 2A79B 2XAJA 4HAMA 5KUKA 1VQMV 1VQPV 1AM1A 4P9OA 3CD6V 2YEFA 1AI4A 4P2ZA 3ZRWA 4L91A 3WQ9A 2IJHA 2WEQA 2GQPA 5DN6G 1QLEC 3K60A 2MK3A 3VHCA 4YXWG 5CBFA 1NHJA 2YK9A 3A0YA 3LSSA 1YT0A 4HYMA 4MPEA 2OT5A 2XK2A 3FB6C 3ASNC 4MSWC 3ZMTA 3G75A 3CCUV 4GT8A 3AG3C 3R4MA 2JIZG 2IOPA 3BMYA 4FCPA 1QZRA 2GSMB 5H6QA 1UYFA 5J9PC 2QEXV 2XX4A 3K98A 3FT8A 1FFTB 3CRKA 1F4NA 1KP3A 3E89A 4UROA 1RPRA 5FNDA 4EFTA 1YC4A 2VWCA 2X6CA 4GGLA 1S0VA 1TIDA 2EINC 1GM8A 4K4OA 3U67A 3X2QC 2CGFA 3ASNB 4N23A 5M4NA 3OW6A 1AJNA 2JJ2G 4OXSA 2PNRA 3HZ1A 3INXA 4P8OA 4U93A 3ABMB 3CCMV 3GIGA 1NVPB 2ESAA 2XJGA 3I56V 2V7QG 3AG4C 5GW7A 4MPNA 1P4RA 3AEIA 4KFMA 2BT0A 3FYEB 4MBCA 3ZRXA 1H7UA 2EILB 1P7BA 3HB3B 2WEPA 1PNKA 2Y69C 4HXWA 4HXZA 2XX2A 1H8HG 3LSQA 4EGIA 1ID0A 2WLNA 5EBMC 1V54B 1JJ2U 1AH8A 4LWHA 2IH1C 3OUFA 4JAVA 3CPWU 2WI6A 3LPSA 3DGEA 1MOFA 1YTFB 3CC2V 1PVGA 1QY8A 1S14A 2QKSA 4QE7A 2QG2A 2WERA 4MVSA 3ABMC 1VQ6V 1W0JG 3OM3B 3G6EV 3Q5KA 4WFAV 4XDMA 2XDLA 4RQFA 2XHXA 3AG4B 4AS9A 4MP7A 1I5YA 5IY5B 3Q5LA 2ZDIC 2IU0A 4KSGA 4QNHB 2XOKG 1GMGA 2EILC 2YSUB 4R8CA 1K97A 3LUTB 1UYGA 4WF9V 3FV5A 1GTOA 2BRCA 3ABTA 2Q69A 3IEDA 5L3DA 1BKNA 1F23A 4FJCC 4WUBA 4YKUA 1F4MA 3ETDA 1K5QA 2UXNA 2H55A 3C0EA 4LWIA 5KA5A 3B25A 5IN9A 5EK0A 4V26A 2EZPA 1GJVA 2IORA 2YEJA 1OHHG 3ZJZA 1AR1B 1CEZA 2XCMA 4XBFA 2D3OW 3ETGA 3P32A 4LPBA 2WI3A 3OEHG 1UJWB 3ABUA 3CCJV 4UUJC 2JK5C 1UY8A 1F51A 3W7XA 2YEAA 4WFFA 3ASOC 1ENVA 1XL6A 4R6ZA 4PRVA 1COWG 5HFLA 4YKRA 4E00A 2BOCC 4G2KA 4NH9A 1ORQC 3H01A 1OCOB 4WFBV 4CE3A 4PDRA 3CWVA 2X7RB 4G28B 4H81A 3OMAB 3CRLA 3T1CA 3W7SA 3ZCCA 3G7EA 5B1BC 2YJWA 2YE9A 4UVBA 4FCRA 2FTKA 5DM6V 3TZ2A 1QLNA 1EI1A 3ZRVA 5IYBO 2A0LA 1E1RG 2PI5A 3EHHA 3OUSA 3CYOA 3GIGB 1ROPA 4MVZA 2YE5A 1L0OA 2JJ1G 1K8AW 3R4NA 3ZRSA 2IOQA 3JD3A 2EIMB 3SYQA 1QVFU 3EHGA 2YJXA 2P6JA 1OCOC 2CCTA 3LDDA 5B3SC 4E01A 1B6QA 3TZ0A 4F4LA 1YJ9V 3GIFA 4H85A 5M4PA 5B1BB 3OR6C 1UYLA 3VHAA 2XDSA 3UKMA 4WUDA 3U2DA 3TTZA 2XAQA 4FIPC 2IJIA 4FK5C 1ZWHA 3HYZA 5F3KA 5J71A 1DLBA 4JYCA 1NVPD 2PI4A 2YI6A 4YKTA 3T1KA 1R6NA 5CF0A 2R9IA 2XD6A 2WLMA 4ZBMA 2WLIB 1Q86W 3RVYA 2FXSA 1HWYA 2Q8HA 3VOUA 4BAYA 1Z5AA 1GK9A 1R3KC 2HJFC 1UYIA 4AWQA 4EEHA 5B3SB 5L3BA 2YKBA 2FWZA 4GX2A 3D0BA 3PEHA 1KIJA 3PJSK 1AI5A 4PELA 1S3JA 4WFGA 1YT2A 1GM7A 4HZ0A 2ATKC 3ZKBA 1Q7YW 3EKRA 1K3EA 3OW2U 2FYPA 2B1GA 1Z5BA 2QTOA 1K92A 3CMEV 4URMA 5M4MA 1I5XA 4CWSA 3U2KA 4X88A 3BEHA 1US7A 3CCLV 2DYRC 3SPCA 1MU5A 1FXKB 3LDEA 5CMUA 1K9MW 4LWEA 1GO3F 4EFUA 3VBBA 3FYIB 2ITDC 3HPLC 2XDKA 1DTOA 2YEEA 4PU9A 1AJ6A 4EMVA 3SJQC 4LWGA 3CGYA 1Q82W 4UV8A 4R1FA 4J9YB 1Y66A 5CA3A 2YI7A 4MPCA 2W6IG 3B24A 1YT1A 2Q8FA 1A4HA 4XD8A 1CPYA 3D36A 4WFEA 3CMAV 3K04A 2XX5A 4JTCB 1K5SA 3E83A 1H8EG 2R9RB 3WHAA 4QIWF 1OCRC 2DYRB 4P9PA 2X6BA 2P67A 1FXKC 2B1IA 5FL7G 1B3QA 2BOBC 1UYHA 5EC1C 2BREA 3HYYA 4NH8A 1RPOA 3CCSV 2WI4A 4LCUC 3FB8C 2YGFA 2O1UA 4ZVIA 4B7PA 2Y69B 2B5UA 1NJIW 3P30A 2AHZA 4X8AA 4PL9A 1OSFA 2JEUA 3OAAG 1V54C 2HKJA 2M7WA 4DO2A 2JEXA 4L94A 3CC7V 4KQVA 1N8RW 4CWPA 4YKZA 1AMWA 1OCRB 2XAHA 2IH3C 2HVJC 4I3HA 3EHBB 3G71V 1M1KW 4JASA 5H9CA 1MX0A 4CE2A 5J6AA 3JD0A 4L93A 1BHBA 1YC1A 1Z59A 3SL2A 3O0IA 3M99B 3HHUA 3W7TA 2Q8GA 4MVRA 2YE2A 3NXSA 3RKZA 5B1AB 1S77D 1TUEB 3AG1C 4E2LA 3ZRWB 3RW0A 1AJQA 2JKIA 2GFDA 3FT5A 1NHIA 1YESA 4CBCA 5D6PA 1K4CC 2ZKJA 2X6AA 2HFEC 3OEEG 2K5BA 3A0TA 5CPHA 2LP7A 3OMNB 3ZMVA 3GWOA 2Q6AA 3UM7A 3D2RA 1K7DA 4MVQA 1MABG 3RLPA 4JGSA 3W7UA 1UYKA 4XE2A 3E86A 1VQKV 2OCCB 2WLLA 2XAFA 3MD0A 5B1AC 1UY9A 5D7RA 4E02A 1YS3A 1I5DA 2BU8A 4U7OA 1YJWV 1IXMA 4JF3A 2CH4A 1YSCA 1GKZA 1Y4SA 4XTJA 3OPDA 3K9AA 2WLLB 4R3AA 1KP2A 1NH2B 2BYIA 4ASAA 4XKAA 1JOYA 4GFNA 3ZIAG 1YC3A 1THNA 3E8FA 5LGNA 1KECA 3CC4V 4HY6A 4QE9A 5F5RA 2OCCC 3F7YC 4GCZA 1W2BU 3TZ5A 1TH8A 1ZXMA 4QPJA 1VQOV 4JAUA 2Q67A 4XCJA 1B63A 2EIMC 2ZXWB 4V25A 5IDJA 2WLIA 3A0RA 1YITV 5EC2C 2CG9A 3HEKA 4AWPA 2EIKC 4LBEC 3EFFK 2YE4A 3SPIA 3G7BA 2EZOA 1YTFD 1YIJV 2XJXA 3IC7A 2Z5UA 2EXLA 4B6CA 1EZJA 1PD3A 1FXVA 1SZTA 2X0LA 5M4KA 4CWTA 3TUHA 1ZWIC 2XNDG 1YHQV 3LDCA 4KUMA 4XIPA 2BTZA 3K99A 4CWOA 3B27A 3BM9A 2A9HA 4EKWA 4PA4A 2E0AA 4MTXA 4AWOA 4GT1A 5IYDO 4O04A 1GKXA 5H6RA 3RVZA 2WPDG 1G8MA 4ASUG 1S76D 4HY1A 4RO2A 1I5AA 2XASA 2IWSA 3LNUA 3AG2C 3OMIB 3QTFA 3R4PA 2XJJA 3E8HA 3F7VC 3K0DA 1FS0G 2VCJA 2YEDA 2H8PC 4L87A 4RQEA 4JTDB 4LWFA 5FNFA 1I59A 2NLJC 4KP4A 3ZMSA 2IU3A 2IW5A 3FB5C 3TK1A 5BZBA 4LP0A 4BQGA 4CZZA 1I5BA 3E8BA 1R73A 4X89A 4YKYA 2YEHA 4GX1A 1H7SA 3VHDA 2IWUA 1UYMA 4HZ3A 2DW4A 5CBHA 3VADA 3H4LA 1Y8NA 4UV9A 1VQ7V 4GEEA 2YEGA 1THZA 4L90A 3OMUA 1CP9A 2F43G 1XL4A 3CXCU 2YEBA 4KFGA 1AI6A 1S16A 5KA6A 2OTLV 3ZMZA 4XDJA 1SRYA 2QFOA 4EM7A 2O1WA 4X9LA 4P30A 2VW5A 4P7AA 1AH6A 3INWA 1JM6A 4UVAA 1H2GA 5M4HA 3ZKDA 2QG0A 2YGAA 3K03A 1UYEA 2WI2A 2QA4V 2HKOA 4JPRA 3O2FA 4PRXA 1QR9A 2XDUA 4BXIA 2AHYA 2O1VA 2YKIA 2ZR3A 4MTFA 3WFVA 2YE6A 4YKQA 4FCQA 3SPJA 1K34A 2P7TC 4MOTA 1BL8A 2ZQMA 1R6KA 2GHYA 2ITCC 3STZC 3R4OA 2H8MA 3JZ3A 4JQLA 4XKKA 4XKOA 3LNMB 1BMFG 2EJRA 1M90W 2DWEC 4PA3A 2FWYA 3E2EA 4Z1MG 1MSWD 1MG1A 2YEVA 3JD2A 3QO8A 1L1FA 1SESA 2ZDXA 2YK2A 2Q68A 3OFNG 3SPGA 2YI0A 4R7CA 5EBWC 3PEJA 3K08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYB A;  2XDX A;  1TBW A;  4BIU A;  3B28 A;  5D6Q A;  3Q5J A;  1Y4U A;  1YET A;  4MB9 A;  1U2O A;  2XAB A;  4H7Q A;  1KZN A;  1Y8P A;  5FWK A;  1BXD A;  2YKC A;  1YER A;  4BQJ A;  3T2S A;  2WI7 A;  5D7D A;  3KE6 A;  3TZ4 A;  2WI1 A;  4BAE A;  4DUH A;  2CCU A;  4FPP A;  1B62 A;  4L8Z A;  3CGZ A;  4YKX A;  1BGQ A;  4MP2 A;  2ZBK B;  4ASF A;  4KSH A;  3NMQ A;  2WI5 A;  4URL A;  3H80 A;  4HYP A;  4DZY A;  1I58 A;  1I5C A;  2YE8 A;  1YSR A;  2YEC A;  5IDM A;  3EKO A;  4MT8 A;  2YE3 A;  4EGK A;  1YSZ A;  5D7C A;  2UWD A;  3ZXO A;  2YE7 A;  3OWB A;  3MNR P;  4ASB A;  3RLR A;  5B1N A;  1NHH A;  3C11 A;  3EHJ A;  1TC6 A;  4EGH A;  2QM8 A;  5M4K A;  1BYQ A;  4ASG A;  4CWR A;  5CTU A;  1EA6 A;  5CTX A;  4CWQ A;  3K97 A;  4NH7 A;  1UY6 A;  4W7T A;  3HZ5 A;  2YEI A;  2JJC A;  2C2A A;  2BZ5 A;  3GIE A;  4XIQ A;  4XC0 A;  5GGZ A;  5L3J A;  5FNC A;  1Z5C A;  3QDD A;  4O09 A;  3EHF A;  4YKW A;  5CTY A;  2HCH A;  3A0Z A;  4XCL A;  1UYC A;  4FMT A;  2IOP A;  2CCS A;  4HZ5 A;  2IWX A;  3R92 A;  5BOC A;  4Q20 A;  2BYH A;  3R91 A;  1ZXN A;  2YKE A;  1Y8O A;  2YKJ A;  4WUC A;  2AKP A;  3A0W A;  1TC0 A;  2BSM A;  4O05 A;  4KTN A;  5M4E A;  2WWW A;  4QPK A;  2VCI A;  4BIZ A;  4GQT A;  4URN A;  1ZW9 A;  2LFR A;  1UY7 A;  3OWD A;  4O07 A;  4CWN A;  1QYE A;  3ZM7 A;  4XIR A;  2QM7 A;  1TIL A;  2BU6 A;  2Q8I A;  2HG1 A;  4R3M A;  2BU7 A;  3A0X A;  3B26 A;  4O0B A;  3RLQ A;  3T0Z A;  4U7N A;  2XHT A;  2Q2E B;  2LFS A;  1UYD A;  1R62 A;  3O6O A;  2YI5 A;  1U0Z A;  2BU5 A;  2XHR A;  2QF6 A;  4XIT A;  4LC1 A;  5CTW A;  4CE1 A;  3T0H A;  2YGE A;  2BU2 A;  4I5S A;  4CWF A;  5BOD A;  5B1O A;  5C93 A;  3ZXQ A;  2ZDY A;  4ZKI A;  3D2R A;  1AM1 A;  2YEF A;  4L91 A;  3WQ9 A;  3ZRW A;  2WEQ A;  2GQP A;  3K60 A;  3VHC A;  1NHJ A;  2YK9 A;  3A0Y A;  4MPE A;  1YT0 A;  4HYM A;  2XK2 A;  3G75 A;  4GT8 A;  3R4M A;  3BMY A;  4FCP A;  1QZR A;  3K98 A;  1UYF A;  2XX4 A;  3FT8 A;  3CRK A;  4URO A;  5FND A;  4EFT A;  1YC4 A;  2VWC A;  4GGL A;  1TID A;  4K4O A;  3U67 A;  2CGF A;  5M4N A;  3OW6 A;  2PNR A;  3INX A;  3HZ1 A;  4P8O A;  4U93 A;  3GIG A;  2XJG A;  2ESA A;  4MPN A;  2BT0 A;  4MBC A;  3ZRX A;  1H7U A;  2WEP A;  4HXW A;  4HXZ A;  2XX2 A;  4EGI A;  1ID0 A;  1AH8 A;  4LWH A;  4JAV A;  2WI6 A;  3LPS A;  3DGE A;  1PVG A;  1QY8 A;  1S14 A;  2QG2 A;  2WER A;  3Q5K A;  4XDM A;  4AS9 A;  2XDL A;  2XHX A;  4MP7 A;  3Q5L A;  4KSG A;  1UYG A;  3FV5 A;  2BRC A;  3T10 A;  3IED A;  1BKN A;  4WUB A;  4YKU A;  2H55 A;  3C0E A;  4LWI A;  3B25 A;  5IN9 A;  4V26 A;  1GJV A;  2IOR A;  2YEJ A;  2XCM A;  3P32 A;  4LPB A;  2WI3 A;  1UY8 A;  1F51 A;  2YEA A;  4PRV A;  4E00 A;  4YKR A;  4NH9 A;  4CE3 A;  3CWV A;  4H81 A;  3CRL A;  3ZCC A;  3G7E A;  2YJW A;  2YE9 A;  4FCR A;  2FTK A;  3TZ2 A;  1EI1 A;  3ZRV A;  3EHH A;  3GIG B;  2YE5 A;  1L0O A;  3R4N A;  2IOQ A;  3EHG A;  2YJX A;  2CCT A;  4E01 A;  3TZ0 A;  3GIF A;  4H85 A;  5M4P A;  3VHA A;  1UYL A;  2XDS A;  4WUD A;  3U2D A;  3TTZ A;  3HYZ A;  5F3K A;  1ZWH A;  5J71 A;  4JYC A;  4YKT A;  2YI6 A;  3T1K A;  5CF0 A;  2XD6 A;  2FXS A;  2Q8H A;  1Z5A A;  4AWQ A;  4EEH A;  2YKB A;  2FWZ A;  3D0B A;  3PEH A;  1KIJ A;  1YT2 A;  4HZ0 A;  3ZKB A;  3EKR A;  2FYP A;  1Z5B A;  4URM A;  5M4M A;  4CWS A;  3U2K A;  1US7 A;  1MU5 A;  4LWE A;  4EFU A;  2YEE A;  2XDK A;  4PU9 A;  1AJ6 A;  4EMV A;  4LWG A;  3CGY A;  4R1F A;  2YI7 A;  4MPC A;  3B24 A;  2Q8F A;  1YT1 A;  1A4H A;  4XD8 A;  3D36 A;  2XX5 A;  3WHA A;  1UYH A;  2P67 A;  2BRE A;  1B3Q A;  4NH8 A;  3HYY A;  2WI4 A;  2YGF A;  4ZVI A;  2O1U A;  4B7P A;  4PL9 A;  1OSF A;  2HKJ A;  4L94 A;  4KQV A;  4CWP A;  4YKZ A;  1AMW A;  4I3H A;  4JAS A;  1MX0 A;  4CE2 A;  5J6A A;  4L93 A;  1YC1 A;  1Z59 A;  3SL2 A;  3O0I A;  3HHU A;  2Q8G A;  2YE2 A;  3RKZ A;  3NXS A;  3ZRW B;  2JKI A;  2GFD A;  3FT5 A;  1NHI A;  1YES A;  5D6P A;  2ZKJ A;  2K5B A;  3A0T A;  5CPH A;  1UYK A;  4XE2 A;  1UY9 A;  4E02 A;  3MD0 A;  5D7R A;  1YS3 A;  1I5D A;  2BU8 A;  4U7O A;  1IXM A;  2CH4 A;  1GKZ A;  1Y4S A;  4XTJ A;  3OPD A;  4R3A A;  2BYI A;  4ASA A;  4XKA A;  1JOY A;  4GFN A;  1YC3 A;  1THN A;  4HY6 A;  5F5R A;  4GCZ A;  3TZ5 A;  1TH8 A;  1ZXM A;  4QPJ A;  4JAU A;  4XCJ A;  1B63 A;  4V25 A;  5IDJ A;  3A0R A;  2CG9 A;  3HEK A;  4AWP A;  2YE4 A;  3G7B A;  2XJX A;  2EXL A;  4B6C A;  3TUH A;  4CWT A;  4XIP A;  2BTZ A;  3K99 A;  4CWO A;  3B27 A;  3BM9 A;  2E0A A;  4MTX A;  4AWO A;  4GT1 A;  4O04 A;  1GKX A;  4HY1 A;  1I5A A;  2IWS A;  3LNU A;  3QTF A;  3R4P A;  2XJJ A;  2YED A;  2VCJ A;  5FNF A;  4LWF A;  1I59 A;  4KP4 A;  3TK1 A;  4BQG A;  4LP0 A;  1I5B A;  4YKY A;  3VHD A;  2YEH A;  1H7S A;  2IWU A;  1UYM A;  3VAD A;  3H4L A;  1Y8N A;  4GEE A;  4L90 A;  2YEG A;  3OMU A;  4KFG A;  2YEB A;  1S16 A;  4EM7 A;  2QFO A;  2O1W A;  4X9L A;  2VW5 A;  4P7A A;  1AH6 A;  3INW A;  1JM6 A;  5M4H A;  3ZKD A;  2QG0 A;  2YGA A;  1UYE A;  2WI2 A;  4PRX A;  3O2F A;  2XDU A;  4BXI A;  2O1V A;  2YKI A;  2YE6 A;  4YKQ A;  4FCQ A;  4MOT A;  3RLP A;  3R4O A;  2H8M A;  3JZ3 A;  4JQL A;  4XKK A;  4XKO A;  2FWY A;  2ZDX A;  2YK2 A;  3PEJ A;  2YI0 A;  1UYI A; 
#chains in the Genus database with same CATH topology
 2ZT9 B;  2WSS G;  4K0K O;  2UU9 B;  2DQ0 A;  4BW5 A;  1W0K G;  4K3A A;  5JVD B;  4BIU A;  3AK2 A;  5D6Q A;  3Q5J A;  4FLX A;  3MHH C;  1AR4 A;  2XTA A;  3AG7 A;  1U2O A;  2HLD G;  2XAB A;  4H7Q A;  4DXW A;  1YI2 V;  1BXD A;  4O4I B;  3RYH B;  1LNQ A;  1RM1 B;  1JVM A;  5FLX N;  4DV2 B;  4O4H B;  3T4Z A;  2Q7H A;  1ZAU A;  1Q3E A;  1U97 A;  3WB2 A;  1I94 O;  1F7Y A;  4DUH A;  3ABL C;  4MW8 A;  2HG5 C;  1N33 B;  1UPG A;  3UT5 A;  3A8T A;  4YKX A;  5FNV A;  1EBO A;  4X62 B;  3KG2 A;  3NMQ A;  1KC8 W;  2VQE O;  4AQY O;  3ETE A;  4PDM A;  1SQG A;  2YE8 A;  3EKO A;  2EIK B;  4KHP O;  3RBZ A;  3GB7 C;  2YE3 A;  4YJ2 A;  2GDS A;  2KB1 A;  1YSZ A;  3K06 A;  3KKY A;  3JYC A;  4PHZ A;  3ZHR A;  1MZE A;  1TUB A;  3HKD B;  2EIN B;  4J7J A;  1X4T A;  4JI0 B;  1AP5 A;  1D5N A;  3ZN0 A;  3MNR P;  4ASB A;  1NHH A;  3RFR A;  4D7T A;  1TC6 A;  2RCV A;  3AG2 B;  4KL1 A;  2EBO A;  1AB3 A;  1EA6 A;  2ZKO A;  1KQS U;  5CTX A;  3ML0 A;  4JYA O;  4DR1 O;  1UY6 A;  3ZN1 A;  2E75 B;  3WG7 C;  2C2A A;  3J7A U;  5IJ9 A;  5IY5 C;  5LXT B;  2BZ5 A;  3GIE A;  1EZV H;  4XDK A;  1S5H C;  4TSF G;  3G4S V;  4XC0 A;  1N33 O;  4H13 B;  4B3M B;  5L3J A;  4B3M O;  1BGY H;  1GKF A;  2CTQ A;  3QDD A;  4GKK B;  2JDI G;  3A0Z A;  2ZD9 A;  3JCZ A;  2IOP A;  2CCS A;  4DUY B;  4LP8 A;  3WG7 B;  1XDC A;  4Q20 A;  3R91 A;  1ZXN A;  2NNU A;  4JYA B;  2YKE A;  2QWQ B;  3KZI Z;  3CRM A;  1Y8O A;  1OCZ B;  3CRR A;  3BAA A;  2YXH A;  5CBG A;  1TC0 A;  3MHS C;  4KTN A;  2EIJ C;  4BIZ A;  4X66 O;  4URN A;  4RAI A;  3J80 N;  5LGT A;  4HYO A;  4R50 A;  4DR5 O;  4RWU A;  4CWN A;  3ZM7 A;  3U11 A;  4DK1 A;  3GVM A;  2BU6 A;  5LHI A;  3E8G A;  5JH7 B;  2Q2E B;  1GN2 A;  3THO A;  3O6O A;  4WBN A;  1U0Z A;  2XHR A;  1PNL A;  5JJN B;  4IIJ A;  4B3T B;  4LC1 A;  5CTW A;  1Q6H A;  1PKX A;  4CE1 A;  3T0H A;  1BQ0 A;  5IT9 N;  2IJK A;  5GTI Z;  1QVG U;  3IC9 A;  3CWB H;  2DJV A;  2KG7 B;  5KHJ A;  3ZXQ A;  1M56 C;  1AM1 A;  2HEP A;  4L91 A;  2GQP A;  5DN6 G;  1QLE C;  3VHC A;  4YXW G;  2LQT A;  2DN9 A;  5CBF A;  4I9Q A;  4LWS B;  1NHJ A;  1YT0 A;  4B3T O;  1ZSP A;  4DR2 O;  1O9H A;  2GSM B;  2LJ2 A;  1MNG A;  2QEX V;  1AVM A;  4I55 A;  2FKX A;  4EFT A;  1ZL8 A;  2VWC A;  4DV0 B;  2N74 A;  3N2G A;  2AXT Z;  4K4O A;  3X2Q C;  5LMU B;  4BW9 A;  3B40 A;  4JI2 O;  5GW7 A;  4MPN A;  4HBN A;  1P4R A;  3RYF A;  1H7U A;  1P7B A;  3HB3 B;  2F4V O;  4HXZ A;  2XX2 A;  3LSQ A;  1JJ2 U;  3A2F A;  3CPW U;  4X1K A;  1MOF A;  3IJ4 A;  1PVG A;  4I0X A;  1NZ6 A;  1W0J G;  4XDM A;  3JAT A;  4RQF A;  1I5Y A;  2N04 A;  2IU0 A;  3Q5L A;  4QNH B;  4R8C A;  1K97 A;  1UYG A;  4WF9 V;  1GTO A;  3IED A;  4WUB A;  4FJC C;  4YKU A;  2LW7 A;  3C0E A;  3UQ8 A;  3B25 A;  5EK0 A;  3CE2 A;  1FKA O;  2EZP A;  1GJV A;  5FPR A;  1HNW B;  3P32 A;  4LPB A;  2WI3 A;  2DE0 X;  1WNS A;  1DK1 A;  4PRV A;  3H01 A;  1OCO B;  1VF7 A;  3CS5 A;  3QG5 A;  3G7E A;  5B1B C;  1IXB A;  4UVB A;  4FCR A;  2JS5 A;  1EI1 A;  3ZRV A;  1E1R G;  1TAE A;  2GBO A;  1SS3 A;  1ROP A;  1KB9 F;  2RMK B;  2JJ1 G;  2IOQ A;  4JI1 O;  3JD3 A;  2VRZ A;  3SYQ A;  2YJX A;  2P6J A;  1OCO C;  1B6Q A;  1YJ9 V;  5M4P A;  3OR6 C;  3ZHQ A;  1JMK C;  2QWP B;  4WUD A;  3TTZ A;  1XQ8 A;  2A3Q A;  2IJI A;  3CX5 F;  4LH7 A;  4JYC A;  2PI4 A;  2R72 A;  3T1K A;  5CF0 A;  5K1P A;  1Q86 W;  3UT5 B;  1J5E B;  2Q8H A;  3H1I H;  1US6 A;  1VF6 C;  5F2V O;  3PEH A;  1KIJ A;  1YT2 A;  4B3R B;  2GUZ A;  2B1G A;  3A0B Z;  2E5L O;  3BEH A;  1US7 A;  2DYR C;  1HDJ A;  4PJ0 Z;  2PYL A;  3VBB A;  2IM9 A;  2ILM A;  4H44 B;  4EEQ A;  3SJQ C;  3CGY A;  1Q82 W;  1P49 A;  4UV8 A;  3K9S A;  4J9Y B;  2Q8F A;  1J5E O;  4XD8 A;  1CPY A;  2YI8 A;  3A0H Z;  4WFE A;  3J81 N;  3O65 A;  1IDS A;  1K5S A;  3E83 A;  1KMI Z;  4QIW F;  1OCR C;  4P9P A;  2DYR B;  2Q7G A;  2BRE A;  2B1I A;  2LGW A;  3JAS B;  4NH8 A;  2BOB C;  4FZ0 A;  5KMG B;  2Y69 B;  1AP6 A;  5LA6 B;  2B5U A;  1NJI W;  1U96 A;  1OSF A;  2JEU A;  2HKJ A;  2ZIM A;  3E22 A;  4DV1 B;  3CJH A;  4UCU A;  3BVO A;  1I08 A;  1OCR B;  5H2F Z;  5BY1 A;  3EHB B;  1LR1 A;  3BAB A;  4L93 A;  1KUQ A;  3SL2 A;  3W7T A;  3RKZ A;  3SGI A;  1S77 D;  1TUE B;  4IL6 Z;  3H1K H;  5JQG B;  3RW0 A;  1AIL A;  1AJQ A;  2Q5Z A;  5D6P A;  3L71 H;  2X6A A;  2DMX A;  2ZE8 A;  5CPH A;  3OMN B;  1FFX A;  2Q6A A;  1K7D A;  3R66 A;  3W7U A;  4O2B B;  4U3J A;  1YS3 A;  4LNU B;  4JF3 A;  1YSC A;  2BTQ B;  5C8Y B;  1Y4S A;  4B3R O;  4R3A A;  1KP2 A;  1NH2 B;  4ASA A;  4GFN A;  4Z2W A;  4X20 B;  1DGS A;  1THN A;  5LGN A;  4HY6 A;  5F5R A;  4QPJ A;  4JI8 O;  4DK0 A;  2ZXW B;  3EVK A;  2D2C B;  1Y6X A;  1YIT V;  3L9D A;  3NR7 A;  3HEK A;  1Z5V A;  1YXB A;  5FNV B;  3G7B A;  2EZO A;  2XJX A;  2E76 B;  2Z5U A;  2EXL A;  5GON A;  4I55 B;  1XNR O;  2NN4 A;  1FXV A;  2XND G;  2VWK A;  4LF8 O;  5IWA B;  4KUM A;  3CHX A;  2E0A A;  2P06 A;  4MTX A;  4GT1 A;  1IBK B;  2F1M A;  3K5L A;  5JH7 A;  2P4V A;  2YXY A;  4RO2 A;  2XAS A;  3LNU A;  3KCX A;  2OWO A;  3F7V C;  2VCJ A;  1O9G A;  4RQE A;  4JTD B;  4TOI A;  3JAS A;  2NLJ C;  4BQG A;  4LP0 A;  4X65 B;  1I5B A;  3VHD A;  1XOU A;  1UYM A;  4HZ3 A;  2UU9 O;  3L73 H;  3C90 A;  4L90 A;  2F43 G;  3ZHU A;  1AI6 A;  3ZMZ A;  1SRY A;  4P30 A;  1QHT A;  1AH6 A;  3ZKD A;  2QG0 A;  3K03 A;  1HR0 O;  2QA4 V;  4JPR A;  1Q90 D;  4BXI A;  1XNQ O;  3VQY A;  4DR3 B;  4DV6 B;  1HP8 A;  5BMV B;  2YKI A;  3WFV A;  2YE6 A;  4JI4 O;  4FCQ A;  4MOT A;  3RLP A;  1BL8 A;  3R4O A;  2A06 H;  4XKK A;  3LNM B;  4DW1 A;  3HKE B;  4LH6 A;  4Z1M G;  2Z0A A;  3E2E A;  1M4U A;  1MSW D;  3JD2 A;  3EXA A;  1L1F A;  1SES A;  2ZDX A;  3PEJ A;  2UUB B;  3ZHT A;  5J2U B;  1M9N A;  5IYC O;  2XDX A;  1NH2 D;  3AG1 B;  1URF A;  3CCE V;  3B28 A;  2WAM A;  2EX3 A;  4DR6 O;  1YET A;  3D8C A;  4PA9 A;  3SDL A;  2W0F C;  2W6J G;  3BRC A;  5KLV H;  1KKD A;  1YER A;  3K57 A;  4LF9 O;  2OTJ V;  4BQJ A;  5LXT A;  5EBL C;  3T2S A;  3KE6 A;  3HKB A;  1IBM O;  4WCE V;  5JCO A;  4TV9 A;  2Y4T A;  3QO5 A;  3CGZ A;  4PA6 A;  1KU9 A;  4EFB A;  3K3W A;  2HJD A;  1V55 B;  4IT5 A;  4XDL A;  3S3X A;  2ZBK B;  4X9Q A;  1J95 A;  4URL A;  2Y48 A;  4HYP A;  4TT3 G;  2QKA A;  4H37 A;  3SJC C;  3SYO A;  1Q6I A;  1I5C A;  3CCQ V;  2ZE5 A;  3CCV V;  2IJJ A;  4JI7 O;  2OYQ A;  1JQ0 A;  1V55 C;  3JCU Z;  1IBL O;  1NBM G;  5D7C A;  2QGN A;  2FB5 A;  2UWD A;  3N2K B;  4IGG A;  3OWB A;  5DEC A;  2ZR2 A;  5B1N A;  1G1X B;  5J2T B;  1Y74 B;  3H1H H;  3I55 V;  1PM9 A;  5CN0 A;  5M4K A;  4CWR A;  4ASG A;  1FXK A;  4DV0 O;  3ETQ A;  4PDV A;  1PL0 A;  5LP6 C;  4W7T A;  2MW2 B;  1N0J A;  1IUR A;  3BCC H;  2JJC A;  1YVW A;  3D3Q A;  1WPX A;  4AHC A;  4PA7 A;  1XUQ A;  3G80 A;  4PI0 A;  5HFM A;  4JI5 O;  4DV7 B;  5LBQ A;  5GGZ A;  5FNC A;  3DC6 A;  1Z5C A;  1QR8 A;  2ZIO A;  3EHF A;  3G6B A;  2WLJ A;  3JAM N;  2ZM6 B;  3B8N A;  5KMG A;  4XCL A;  3DTU B;  4X1K B;  1QCE A;  5LOV A;  2YEV B;  4HZ5 A;  4F6R A;  4DV2 O;  3Q4H A;  1NT2 B;  2CH7 B;  2DQ3 A;  1N32 O;  4WUC A;  4JI6 O;  2Q0A A;  3ASO B;  2AKP A;  2F4V B;  3CRQ A;  2ZE7 A;  3BY6 A;  4QPK A;  2VCI A;  2HHH O;  5KX5 B;  2LFR A;  1UY7 A;  2CK3 G;  4JI3 O;  1TIL A;  2Q8I A;  3BPZ A;  2HG1 A;  2BU7 A;  3A0X A;  3B26 A;  4O0B A;  3RLQ A;  1MZF A;  4YIP A;  4U7N A;  2O57 A;  2XHT A;  1WA8 B;  3RT3 C;  1RM1 C;  1JX9 A;  2YIA A;  4PDL A;  3RYI A;  4I4T A;  1H38 A;  1VQ4 V;  2QF6 A;  4XIT A;  2BU2 A;  4I5S A;  2C1G A;  3AG3 B;  4FM1 A;  4FM2 A;  4CWF A;  3HKC A;  2ZDY A;  4ZKI A;  3DXR A;  2YEF A;  3OTO O;  3CD6 V;  2HHI A;  3ZRW A;  1AI4 A;  4HNA A;  5LYJ A;  5E79 Z;  2IJH A;  2YK9 A;  4IYH A;  4CC5 A;  3CXH F;  4HYM A;  2XK2 A;  2FL4 A;  3FB6 C;  3CCU V;  3AG3 C;  1FJG B;  3BMY A;  1Q6U A;  4FCP A;  5J9P C;  3P3N A;  3FAV B;  2H3O A;  2CH7 A;  1KP3 A;  3E89 A;  4URO A;  2OIE A;  2X6C A;  1TID A;  3U67 A;  3T1H B;  1AJN A;  1BSM A;  1HNZ B;  3HZ1 A;  3ABM B;  3GIG A;  3N2G B;  2ESA A;  2XJG A;  4O2A B;  2V7Q G;  1OJH A;  2YI9 A;  1VF6 A;  4NVP A;  5K1X A;  4HXW A;  1H8H G;  1ID0 A;  1V54 B;  2IH1 C;  1QY8 A;  1SKV A;  4NR1 A;  3CC2 V;  3RYH A;  4MVS A;  3ABM C;  3Q5K A;  3OM3 B;  4D6T H;  2XDL A;  2QR4 A;  5IY5 B;  2ZDI C;  4KSG A;  2YSU B;  1GMG A;  4I0X B;  1XNQ B;  4DRX B;  2ZNJ A;  4NXM O;  3FV5 A;  2BRC A;  5EIB C;  2Q69 A;  1BKN A;  1F4M A;  1R1B A;  1G6U A;  1K5Q A;  2UXN A;  4LF5 B;  5KA5 A;  1RSO B;  5IN9 A;  3RN4 A;  4OX9 O;  1JFF A;  1CEZ A;  2XCM A;  2D3O W;  3OEH G;  4DR7 B;  1F51 A;  3W7X A;  1ENV A;  5CA0 B;  1FYJ A;  5KAI Z;  4OGQ B;  2RNB A;  5HFL A;  4E00 A;  1BS3 A;  3PN1 A;  1ORQ C;  3HKD A;  4PDR A;  4H81 A;  3CRL A;  5CA0 A;  3ZCC A;  2YJW A;  4IYI A;  4JI0 O;  4CH6 A;  2FTK A;  2YUA A;  5DM6 V;  3TZ2 A;  4ZI7 B;  1QLN A;  5IYB O;  3CYO A;  2YE5 A;  4MVZ A;  1L0O A;  3ZRS A;  4U3J B;  5JCO C;  1XNR B;  1SQP H;  1Y76 A;  2CCT A;  4E01 A;  5B3S C;  2PYJ A;  4F4L A;  4H85 A;  5B1B B;  4X20 A;  3U2D A;  4GKJ B;  2XAQ A;  1DLB A;  1TVK B;  1NVP D;  4YKT A;  1R6N A;  3SJA C;  4ICG A;  2R9I A;  2P22 C;  4ZBM A;  2WLI B;  4BAY A;  3S3W A;  1GK9 A;  5B3S B;  2YKB A;  4GX2 A;  1GN3 A;  3PJS K;  4WFG A;  4PEL A;  3ZKB A;  4URM A;  1K92 A;  1GAX A;  1NTM H;  3AK1 A;  1I5X A;  2ZIN A;  3Q4H B;  4CWS A;  3CCL V;  1FXK B;  3BA8 A;  5CMU A;  3ZHV A;  2Q73 A;  1GO3 F;  4EFU A;  4EMV A;  4R1F A;  1Y66 A;  1HNW O;  4MPC A;  4EB6 A;  4B7K A;  1A4H A;  5KX5 A;  1R6T A;  4JTC B;  4JZ2 A;  1H8E G;  4LF5 O;  3VQW A;  3CRC A;  2P67 A;  2CAZ C;  1B3Q A;  1FXK C;  5EC1 C;  1RPO A;  3CCS V;  2YGF A;  1WA8 A;  3C3T A;  2YID A;  2L6L A;  2G38 A;  3QF7 A;  2E3C A;  1GH6 A;  4AI8 A;  4CWP A;  3G67 A;  4ZOL A;  4J7K A;  3QTC A;  4GKJ O;  1M1K W;  4JAS A;  4CE2 A;  2ZNI A;  1VEW A;  5J6A A;  1NTZ H;  2Q8G A;  3NXS A;  3M8A A;  5BMV A;  2QDO A;  4J11 A;  4W4L A;  4FFB B;  2YIB A;  1FFX B;  3TXS A;  2JKI A;  3HKE A;  4A5U B;  1NHI A;  1YES A;  4CBC A;  1B04 A;  4X66 B;  4X64 B;  3A0T A;  3GWO A;  3CRA A;  1SQQ H;  1VMG A;  3BFR A;  1UYK A;  1QNM A;  3E86 A;  1UY9 A;  2WLL A;  1QU7 A;  2BU8 A;  4GYC B;  4YJ3 B;  4PV1 B;  4XTJ A;  3OPD A;  2QWO B;  2BYI A;  2XUM A;  1JOY A;  1KEC A;  3TXQ A;  4DR4 B;  5KHH A;  3OTF A;  3ICX A;  3TZ5 A;  1TH8 A;  1VQO V;  2R9A A;  1B63 A;  4O4J A;  2EIM C;  4V25 A;  1XMQ O;  1IZ3 A;  2GUZ B;  2EIK C;  3SPI A;  4DV5 O;  3DSQ A;  4B6C A;  1EZJ A;  2YI0 A;  1SZT A;  3TUH A;  5J2U A;  3LDC A;  4DUZ B;  2LW1 A;  3B27 A;  4PA4 A;  2N05 A;  4B3S O;  5D5P A;  2WPD G;  1G8M A;  2K9P A;  4HY1 A;  3OMI B;  2XJJ A;  2YED A;  1FS0 G;  1Q8I A;  1L0L H;  2IU3 A;  2IW5 A;  3TK1 A;  5BZB A;  2UUB O;  1RP3 B;  4X89 A;  2DW4 A;  4K8Z A;  1VQ7 V;  2YEG A;  1CP9 A;  2YEB A;  1XL4 A;  3CXC U;  2OTL V;  3FD9 A;  4XDJ A;  2QFO A;  4X9L A;  2CTP A;  2RDC A;  4ZI7 A;  1UYE A;  2WI2 A;  1NU1 H;  2JGU A;  2HKO A;  4PRX A;  1M93 A;  1SQB H;  3SPJ A;  1K34 A;  3STZ C;  2ITC C;  1D2D A;  4JQL A;  2BTO A;  4IHJ B;  5H5N A;  3N27 A;  1BMF G;  2EJR A;  1WN7 A;  2DWE C;  4U3F H;  3APQ A;  2Q68 A;  3OFN G;  1HNX O;  4LFB O;  4R7C A;  5EBW C;  4CWQ A;  3K08 A;  4X65 O;  3K0G A;  3T2M A;  5CB4 A;  1EM1 A;  4JTA B;  1PNM A;  2BSK B;  2PGG A;  1YJN V;  4FLY A;  4NTX A;  5FWK A;  1SQX H;  4X1Y B;  4LFC O;  2YKC A;  1PV0 A;  4UXN A;  2WI7 A;  2HVK C;  1FD9 A;  1EN6 A;  1R3I C;  2PUS A;  2F95 B;  2UXC O;  4J10 A;  4BAE A;  1GRJ A;  1B62 A;  5ITZ A;  4L8Z A;  2Z3Y A;  4X62 O;  1VQL V;  3OE7 G;  1BGQ A;  1QLE B;  1WJZ A;  4JYY A;  4ASF A;  1BZK A;  1R3J C;  3F5W C;  1NKD A;  3OR7 C;  2WI5 A;  5L3C A;  3H80 A;  1AJP A;  4OPA A;  4DZY A;  4LR3 A;  1NQT A;  3JD1 A;  3E22 B;  4RUF A;  2YEC A;  1SET A;  1K4D C;  3JSL A;  3ZBH A;  3SYC A;  4DV3 O;  1OCC B;  3TGU H;  1E79 G;  1M57 C;  3WU2 Z;  3ZXO A;  2YE7 A;  4LF7 B;  2E5L B;  3WB1 A;  3UO3 A;  4GX0 A;  1JR9 A;  4MVO A;  4I7Z B;  3QO7 A;  2FML A;  3EHJ A;  5CB4 B;  1OCC C;  3IFX A;  2P90 A;  5CTU A;  1SC5 B;  1VQ5 V;  1Y4M A;  3JSN A;  3TCU A;  4AIL C;  2H94 A;  3JAR B;  4MVM A;  1H2N A;  3K97 A;  2ZDI A;  5LMN O;  2ADP A;  3OTO B;  4YHH O;  1XMO B;  2HR3 A;  3HZ5 A;  1GN6 A;  2YEI A;  2AZ2 A;  5JEN A;  1V9P A;  4NXN B;  4LNU A;  3RYF B;  5LOV B;  1LUW A;  2JGD B;  4YKW A;  5CTY A;  2HCH A;  1YDX A;  5LP6 B;  3ABK B;  1UYC A;  1Q43 A;  4FMT A;  3E35 A;  3QNE A;  3DC5 A;  3RGB A;  2IWX A;  2WLH A;  1EFR G;  4LFA O;  3R92 A;  4G27 B;  4CS3 A;  2BYH A;  2XT9 A;  3CCR V;  3JAK B;  2F93 B;  3IGA C;  4TWK A;  3SJB C;  1VQ8 V;  1JCH A;  2QWR B;  3K5O A;  5M4E A;  3SPH A;  4O2A A;  4GQT A;  4GUN A;  4FLT A;  3LSU A;  3ZMU A;  1N34 B;  4LF9 B;  3T4D A;  1QYE A;  4YJ2 B;  1SF9 A;  3L74 H;  3STL C;  3R65 A;  4JI6 B;  4XIR A;  4LF6 O;  4R3M A;  5LHG A;  3T0Z A;  5LGU A;  4MW3 A;  5L3G A;  1R62 A;  3FB7 C;  2YI5 A;  2BU5 A;  1EN5 A;  4QJF B;  3SYP A;  4ZHQ B;  5L3F A;  4L8J A;  5B66 Z;  5GON B;  4HNA B;  3ZED A;  5BOD A;  5B1O A;  3ABL B;  2XAG A;  3D2R A;  2XAJ A;  2EUL A;  1VQM V;  3WQ9 A;  4P9O A;  3VQV A;  4FFB A;  2WEQ A;  3B4S A;  1JFF B;  4MPE A;  1BQZ A;  3ASN C;  5LP6 A;  4JI2 B;  4LFC B;  1QZR A;  5H6Q A;  3K98 A;  1UYF A;  2XX4 A;  3FT8 A;  1FFT B;  3OD4 A;  4ZIB A;  5J2T A;  3JAL A;  1MA1 A;  1B06 A;  1BE3 H;  1N34 O;  4B3S B;  3K5M A;  2EIN C;  3CB2 A;  3S5T A;  4J41 A;  3ASN B;  1FJG O;  3OW6 A;  4DR7 O;  4JI7 B;  4OXS A;  1TA8 A;  3CCM V;  1NVP B;  3F5T A;  3ZX6 A;  5LL6 Y;  2BT0 A;  2UUA B;  3FYE B;  4MBC A;  3ZRX A;  2EIL B;  2WEP A;  1PNK A;  1N36 B;  1W59 A;  4EB6 B;  2YS8 A;  1H2M A;  1IBK O;  5EBM C;  4LWH A;  4JAV A;  3LPS A;  3DGE A;  4BR6 A;  4QE7 A;  4IHJ A;  2RQ6 A;  2XHX A;  4MP7 A;  1VF5 B;  2YDE A;  4I4T B;  2XOK G;  3D36 C;  2Q8V A;  3HKB B;  1H2K A;  2VQE B;  3T10 A;  2C1I A;  2CE4 A;  1SQF A;  5BR8 B;  2H55 A;  4LWI A;  1MMM A;  4NB5 A;  3FFQ A;  2YEJ A;  3OT7 A;  3ZJZ A;  4ZOL B;  1AR1 B;  4UCV A;  2KKW A;  5LYJ B;  3ABU A;  3L72 H;  3CCJ V;  4UUJ C;  2JK5 C;  2Q9L A;  1UY8 A;  4LWS A;  2F23 A;  4WFF A;  1TGO A;  2QSA A;  4R6Z A;  1COW G;  4YKR A;  2BOC C;  4G2K A;  1A32 A;  1N32 B;  4WFB V;  4CE3 A;  2X7R B;  4G28 B;  3OMA B;  3W7S A;  3N2K A;  4LF7 O;  2ODM A;  2YE9 A;  2UXD O;  1UFI A;  2PI5 A;  3EHH A;  2B9Z A;  5EZY A;  1OV9 A;  3GIG B;  5IYZ B;  3R4N A;  2Y4U A;  3LDD A;  5TIS Z;  3L75 H;  1UYL A;  3HR0 A;  3UKM A;  4DR4 O;  4FIP C;  4K8X A;  5F3K A;  5J71 A;  1YEW A;  2XD6 A;  2V4D A;  3RVY A;  1HWY A;  3VOU A;  4AWQ A;  4EEH A;  3I5D A;  2FWZ A;  4DRX A;  1AI5 A;  3U10 A;  2ATK C;  1K3E A;  4OPH A;  3RYC B;  2FYP A;  1WPB A;  1VP7 A;  4FLV A;  1I0H A;  4X88 A;  4DR5 B;  1MU5 A;  1K9M W;  1NI8 A;  4LWE A;  3WB0 A;  3HPL C;  2XDK A;  1DTO A;  2CDY A;  4TUY B;  2YI7 A;  4TV8 B;  2W6I G;  1YT1 A;  2JS3 A;  3D36 A;  3CMA V;  3K04 A;  1FAF A;  2R9R B;  4TV9 B;  3WHA A;  1UYH A;  2X6B A;  3HYY A;  2WI4 A;  4ZVI A;  4B7P A;  1T5E A;  2F66 C;  2YXL A;  4UB8 Z;  4DV3 B;  4X8A A;  2CUG A;  1V54 C;  4X1I B;  4DO2 A;  4L94 A;  1I94 B;  4KQV A;  5EIB D;  1AMW A;  2XAH A;  2HVJ C;  3G71 V;  4FZ1 A;  5H9C A;  3BA9 A;  1MX0 A;  3M7M X;  1BHB A;  1Z59 A;  3O9O A;  3O0I A;  2NR5 A;  4MVR A;  2YE2 A;  3ZRW B;  5IJ0 A;  3FT5 A;  1D5A A;  2GFD A;  2AW9 A;  1K4C C;  1ZUQ A;  3LNN A;  2LP7 A;  3UM7 A;  2UXB B;  1MAB G;  4JGS A;  1Z2G A;  2XHB A;  1VQK V;  2YIC A;  4YIO A;  5D7R A;  1I5D A;  4U7O A;  1WP8 A;  1S5J A;  1YJW V;  2CH4 A;  2OCH A;  2HHH B;  3K9A A;  2A7W A;  4DV5 B;  4XKA A;  3ZIA G;  1YC3 A;  1TVK A;  1HR0 B;  3CC4 V;  4K35 A;  2ZCE A;  3F7Y C;  4GCZ A;  1W2B U;  1ZXM A;  4NXN O;  4JAU A;  2Q67 A;  4LF4 B;  5IDJ A;  3RYI B;  2ZM6 O;  2YE4 A;  3EFF K;  4O4J B;  1YTF D;  5ITZ B;  2PZS A;  2X0L A;  1ZWI C;  3K99 A;  1WP7 A;  3BM9 A;  2A9H A;  4EKW A;  1H2L A;  4AWO A;  1JJO A;  5IYD O;  3CYG A;  4O04 A;  1GKX A;  2ETN A;  5H6R A;  3RVZ A;  4ASU G;  1S76 D;  2QJ1 A;  1I5A A;  2IWS A;  4O4H A;  3AG2 C;  3R4P A;  4TV8 A;  3E8H A;  2QM4 A;  5FNF A;  4DR6 B;  3AK3 A;  4L87 A;  4B7E A;  4K0K B;  1HNZ O;  1LUV A;  3FB5 C;  4YKY A;  1R73 A;  1H7S A;  2IWU A;  4DV4 O;  4ZHQ A;  1KYO F;  1KKC A;  4UV9 A;  5BR8 O;  2Y0I A;  4GEE A;  2LO1 A;  4DUY O;  4EM7 A;  2VW5 A;  3INW A;  3JAR A;  4UVA A;  1H2G A;  5M4H A;  1QR9 A;  4DV6 O;  1BT8 A;  2AHY A;  3ZS8 C;  1L0N H;  1YF2 A;  2ZR3 A;  4MTF A;  4YKQ A;  2ZQM A;  1R6K A;  2GHY A;  1XMQ B;  3JZ3 A;  2M6Y A;  3BHP A;  5A2Q N;  1M90 W;  2FWY A;  4PA3 A;  1MG1 A;  2YEV A;  2YK2 A;  3SPG A;  2L35 A;  1WAZ A;  2Q7E A;  1AR5 A;  5L3E A;  1DF4 A;  2DYS C;  4JYB A;  1SER A;  2AGA A;  3JD4 A;  1TBW A;  3RWR D;  1NR1 A;  1JA8 A;  1Y4U A;  1YCI A;  1HNX B;  4MB9 A;  3W7W A;  4OX9 B;  4UVC A;  3FKS G;  1KZN A;  1Y8P A;  1ZX3 A;  1QBZ A;  5E1A C;  4LF8 B;  4H33 A;  2DYS B;  2K1E A;  5D7D A;  4UCT A;  3TZ4 A;  5IWA O;  3H9V A;  4E4E A;  1XHZ A;  2WI1 A;  1DF5 A;  4J80 A;  1G4Y B;  2CCU A;  4FPP A;  3SYA A;  5GTH Z;  4MP2 A;  1BHA A;  4KSH A;  4YHH B;  1WLE A;  1OZ0 A;  5CA1 A;  2ZXW C;  5DED A;  4DV4 B;  5JJE B;  1I58 A;  1I7F A;  1YSR A;  3TET A;  5IDM A;  4MT8 A;  3U0Z A;  4EGK A;  1K73 W;  3X2Q B;  1Q5O A;  2VS0 A;  3OGC C;  1N36 O;  4BIO A;  3RLR A;  1PP9 H;  2UUA O;  4NTY A;  3C11 A;  4MS2 A;  1H2S B;  1GM9 A;  4EGH A;  2EJ7 A;  2KSD A;  4RUE A;  1Q81 W;  5EZY B;  2QM8 A;  1BYQ A;  3H1J H;  1M57 B;  5KHG A;  4NH7 A;  1BCC H;  5LHH A;  2GTA A;  4LFA B;  3CJH B;  1AI7 A;  4J9Z B;  3B8M A;  1E1Q G;  3H1L H;  3APO A;  2KG7 A;  1ARO P;  3QVN A;  4XIQ A;  1Y67 A;  5IE9 A;  1OCZ C;  4MTO A;  3B77 A;  5KHI A;  4O09 A;  2QE7 G;  1VQ9 V;  4UCS A;  2EIJ B;  3JAT B;  1NR7 A;  4MTG A;  1XMO O;  5BOC A;  4YY3 O;  1PPJ H;  1ZL8 B;  1XHX A;  4JI8 B;  5JVD A;  5KUM A;  2YKJ A;  4CH5 A;  3K79 A;  1K33 A;  1JPX A;  2CGN A;  3UCS C;  2UXX A;  4DYL A;  1KD1 W;  4GX5 A;  5CA1 B;  4TUY A;  2PY5 A;  2BSM A;  4NYK A;  3A0W A;  4O05 A;  1XEQ A;  1Z5W A;  2WWW A;  3ABK C;  4X64 O;  3VQX A;  3UO2 A;  1ZW9 A;  1VIB A;  2ARH A;  1SA0 A;  2UXD B;  3OWD A;  4O07 A;  3CP1 A;  2WA3 A;  4X1Y A;  3T1H O;  2QM7 A;  1FPO A;  2V1D A;  3B09 A;  4WFH A;  1S72 V;  3B2E E;  4JZG A;  5JJJ B;  4JV5 O;  2LFS A;  1M56 B;  1FXH A;  4JI4 B;  1UYD A;  3D3I A;  1SQV H;  2DWD C;  1X59 A;  2RN9 A;  2WLK A;  4N21 A;  4I9W A;  2YGE A;  1R3L C;  4BWA A;  4YJ3 A;  1VQN V;  4FM0 A;  4LF4 O;  4MVU A;  5C93 A;  2PTM A;  3K5N A;  4HAM A;  2A79 B;  1VQP V;  4KXR A;  5KUK A;  4JI1 B;  4P2Z A;  5JQG A;  1EN4 A;  3HKC B;  2UXC B;  1HW7 A;  3K60 A;  2MK3 A;  3A0Y A;  1P84 F;  3LSS A;  2OT5 A;  4MSW C;  3G75 A;  4GT8 A;  3R4M A;  2JIZ G;  3CRK A;  1F4N A;  3KCY A;  1RPR A;  5FND A;  1YC4 A;  2CTW A;  4GGL A;  1S0V A;  1GM8 A;  2CGF A;  5M4N A;  4N23 A;  1M5I A;  1XI1 A;  2JJ2 G;  2PNR A;  3INX A;  4P8O A;  4TQD A;  4U93 A;  3TJT A;  3I56 V;  3AG4 C;  3AEI A;  4KFM A;  5KAF Z;  2Y69 C;  1Y76 B;  4EGI A;  2WLN A;  1AH8 A;  3OUF A;  2WI6 A;  1YTF B;  1S14 A;  2WER A;  2QG2 A;  2QKS A;  3SR2 C;  2ZE6 A;  2QKC A;  1VQ6 V;  3G6E V;  5AG2 A;  4O4L A;  4UCR A;  4WFA V;  4AS9 A;  3AG4 B;  4F6R B;  4JI5 B;  2JRI A;  2EIL C;  3LUT B;  2Q4P A;  4FLW A;  3K59 A;  1S5L Z;  3ABT A;  4H0L B;  5L3D A;  1F23 A;  4DV7 O;  5JWP A;  3ETD A;  4PD4 F;  4V26 A;  2IOR A;  1OHH G;  4XBF A;  3ETG A;  4J42 A;  2IBZ H;  1UJW B;  1PL4 A;  4FVM A;  2YEA A;  3ASO C;  1XL6 A;  3FAV A;  2YC0 A;  4NH9 A;  4Z1V A;  2FYU H;  3CWV A;  1VAR A;  4DR2 B;  3T1C A;  3FX7 A;  4DUZ O;  2P5O A;  4YY3 B;  4UCO A;  2A0L A;  2LGQ A;  3GWK C;  3OUS A;  3T1Y O;  4DR3 O;  1ZTE A;  1K8A W;  3DXR B;  2VWJ A;  2Y0P A;  2EIM B;  3MAQ A;  1QVF U;  3EHG A;  3TZ0 A;  3GIF A;  3VHA A;  2XDS A;  4FK5 C;  4FLU A;  1ZWH A;  3HYZ A;  4NXM B;  4C7U A;  2YI6 A;  5IJ0 B;  1QQC A;  3OGI B;  4DR1 B;  2GV9 A;  4NKG B;  2WLM A;  3T1Y B;  2FXS A;  4O4L B;  1Z5A A;  1R3K C;  2HJF C;  1XRE A;  5L3B A;  3CSX A;  1GN4 A;  3D0B A;  4HZ0 A;  1S3J A;  2E74 B;  1GM7 A;  4DW0 A;  2UUC B;  1Q7Y W;  3EKR A;  3OW2 U;  2AZ0 A;  1Z5B A;  2QTO A;  3CME V;  5M4M A;  4O4I A;  3U2K A;  3SPC A;  3LDE A;  4I50 B;  3RYC A;  3FYI B;  4NTW A;  2ITD C;  5D5Q A;  3CEI A;  4W4K A;  2YEE A;  4PU9 A;  4CC6 A;  1AJ6 A;  3L70 H;  4KHP B;  4LWG A;  5CA3 A;  3B24 A;  4CH4 A;  1SA0 B;  2XX5 A;  4LFB B;  5FL7 G;  1WB8 A;  1NS1 A;  4X1I A;  1N4C A;  3FB8 C;  4LCU C;  4JAA A;  2O1U A;  1WB7 A;  5BXZ A;  3P30 A;  4GKK O;  2AHZ A;  4PL9 A;  2PF4 E;  3OAA G;  2M7W A;  4IIJ B;  2JEX A;  3CC7 V;  1N8R W;  5LA6 A;  4YKZ A;  5A9G A;  3JAW A;  2IH3 C;  2JVD A;  4I3H A;  2Q0O C;  1IVS A;  4EFE A;  2RJZ A;  3JD0 A;  4D7S A;  1YC1 A;  4GZR B;  3M99 B;  3HHU A;  5B1A B;  3AG1 C;  1Y74 A;  4E2L A;  2QWN B;  3P3P A;  5EYP B;  1L8D A;  4J7Z A;  3IAY A;  4FFK A;  2ZKJ A;  2HFE C;  3OEE G;  2K5B A;  1NTK H;  3ZMV A;  4QGP A;  2R70 A;  5EYP A;  3JAL B;  4MVQ A;  4WBN B;  4XE2 A;  5C8Y A;  2BTQ A;  1IX9 A;  2OCC B;  5B1A C;  2XAF A;  2GTS A;  3MD0 A;  1XIL A;  4I50 A;  3ZHS A;  4B08 A;  4E02 A;  2BE3 A;  5IYZ A;  4Q6G A;  2BSK A;  1IXM A;  1GKZ A;  4O2B A;  2OIG A;  2WLL B;  2DOS A;  4DV1 O;  3E8F A;  1CXZ B;  2JGD A;  5KHK A;  4QE9 A;  1N0N A;  2OCC C;  2VQF B;  4E72 A;  4CS4 A;  4XCJ A;  2VQF O;  2WLI A;  3A0R A;  1ZLZ A;  2CGO A;  5EC2 C;  2CG9 A;  3JAK A;  1SZX A;  4AWP A;  4LBE C;  2CTR A;  4GLX A;  1YIJ V;  3IC7 A;  1PD3 A;  1YZB A;  4CWT A;  1YHQ V;  1MSD A;  4XIP A;  2BTZ A;  4CWO A;  1P7G A;  4LF6 B;  4JV5 B;  1KBH A;  3QTF A;  1TUB B;  3K58 A;  3K0D A;  2UUC O;  2H8P C;  4LWF A;  2QTS A;  5LMU O;  1I59 A;  4KP4 A;  4UB6 Z;  3ZMS A;  4CZZ A;  3E8B A;  4UFZ A;  4GX1 A;  2YEH A;  4TQF A;  5CBH A;  3VAD A;  2HP8 A;  1Y8N A;  3H4L A;  4F6E A;  2WA4 A;  1THZ A;  4CH3 A;  1XBL A;  2BCC H;  3OMU A;  4KFG A;  1S16 A;  5KA6 A;  1IBL B;  3C3S A;  2O1W A;  4P7A A;  3LMM A;  1JM6 A;  2YIB D;  5FPO A;  3JAW B;  4ABM A;  2YGA A;  1RSO A;  4PI2 A;  1RFY A;  3O2F A;  1IBM B;  4AQY B;  2XDU A;  2O1V A;  3MDS A;  5IJ9 B;  2P7T C;  5B5E Z;  2W0X A;  2H8M A;  4XKO A;  5LMN B;  2ADQ B;  4FLZ A;  2P4K A;  4CS2 A;  3QO8 A;  4JI3 B;  2UXB O;  1UYI A;  3ZMT A;  2KQX A; 
#chains in the Genus database with same CATH homology
 3K0G A;  3T2M A;  2WSS G;  5L3E A;  2DQ0 A;  4XCL A;  1DF4 A;  4BW5 A;  2DYS C;  1M9N A;  4JYB A;  1W0K G;  5IYC O;  1SER A;  3JD4 A;  4JTA B;  1PNM A;  1NH2 D;  3AG1 B;  1TBW A;  2XDX A;  1YJN V;  3CCE V;  4BIU A;  3B28 A;  5D6Q A;  2WAM A;  1NR1 A;  3Q5J A;  1Y4U A;  3MHH C;  1YET A;  4MB9 A;  3W7W A;  4UVC A;  2HLD G;  3FKS G;  1U2O A;  2XAB A;  4DXW A;  1YI2 V;  1KZN A;  4H7Q A;  1Y8P A;  4PA9 A;  5FWK A;  1BXD A;  1QBZ A;  2W0F C;  5E1A C;  1LNQ A;  2W6J G;  1KKD A;  2YKC A;  1RM1 B;  1YER A;  1JVM A;  2OTJ V;  4BQJ A;  4H33 A;  2DYS B;  2K1E A;  5EBL C;  4UXN A;  3T4Z A;  3T2S A;  2WI7 A;  2HVK C;  5D7D A;  1R3I C;  3KE6 A;  3TZ4 A;  4WCE V;  2WI1 A;  1DF5 A;  4BAE A;  4DUH A;  1G4Y B;  3ABL C;  4MW8 A;  2CCU A;  4FPP A;  3SYA A;  1B62 A;  2HG5 C;  3QO5 A;  4L8Z A;  2Z3Y A;  3CGZ A;  4PA6 A;  1VQL V;  4YKX A;  3K3W A;  1EBO A;  1V55 B;  3OE7 G;  1BGQ A;  1BHA A;  4MP2 A;  3KG2 A;  4XDL A;  1QLE B;  2ZBK B;  4ASF A;  1R3J C;  3F5W C;  4KSH A;  1J95 A;  1NKD A;  3OR7 C;  3NMQ A;  1KC8 W;  5L3C A;  1WLE A;  1OZ0 A;  2Y48 A;  2WI5 A;  3H80 A;  4URL A;  4HYP A;  1AJP A;  4TT3 G;  2ZXW C;  4DZY A;  4H37 A;  3ETE A;  1NQT A;  3JD1 A;  3SYO A;  1I58 A;  4PDM A;  1I5C A;  4RUF A;  3CCQ V;  1YSR A;  3TET A;  2YE8 A;  1SET A;  2YEC A;  2EIK B;  3EKO A;  1K4D C;  4MT8 A;  3CCV V;  5IDM A;  2IJJ A;  3RBZ A;  3GB7 C;  3SYC A;  2YE3 A;  1OCC B;  1JQ0 A;  1V55 C;  4EGK A;  2KB1 A;  1YSZ A;  3K06 A;  1NBM G;  3JYC A;  1E79 G;  1M57 C;  1K73 W;  2UWD A;  5D7C A;  2EIN B;  3ZXO A;  3X2Q B;  2YE7 A;  3OGC C;  3ZN0 A;  3OWB A;  3MNR P;  4ASB A;  2ZR2 A;  3RLR A;  5B1N A;  1NHH A;  3C11 A;  4GX0 A;  4MS2 A;  4MVO A;  1GM9 A;  3QO7 A;  3EHJ A;  1TC6 A;  4EGH A;  4RUE A;  1OCC C;  3AG2 B;  3IFX A;  2P90 A;  3I55 V;  1Q81 W;  2QM8 A;  5CN0 A;  1BYQ A;  4ASG A;  4CWR A;  1M57 B;  2EBO A;  1Y4M A;  3TCU A;  1VQ5 V;  5CTU A;  2H94 A;  1EA6 A;  1FXK A;  4MVM A;  1KQS U;  3ML0 A;  5CTX A;  4CWQ A;  4PDV A;  2ZDI A;  3K97 A;  4NH7 A;  1PL0 A;  5LHH A;  3ZN1 A;  1UY6 A;  4W7T A;  2HR3 A;  1AI7 A;  3HZ5 A;  4J9Z B;  2YEI A;  3B8M A;  3WG7 C;  2JJC A;  1E1Q G;  2C2A A;  2BZ5 A;  5IY5 C;  3GIE A;  1ARO P;  1WPX A;  4XIQ A;  4XDK A;  1S5H C;  4TSF G;  3G4S V;  4PA7 A;  4XC0 A;  5HFM A;  5GGZ A;  5L3J A;  5LBQ A;  1OCZ C;  4MTO A;  1Z5C A;  5FNC A;  1QR8 A;  1GKF A;  3B77 A;  3QDD A;  3EHF A;  4O09 A;  4YKW A;  2WLJ A;  5CTY A;  2JDI G;  2HCH A;  2QE7 G;  2ZD9 A;  3B8N A;  1VQ9 V;  3A0Z A;  3DTU B;  3ABK B;  2EIJ B;  3JCZ A;  4FMT A;  1NR7 A;  1QCE A;  3E35 A;  2YEV B;  3QNE A;  1UYC A;  4MTG A;  2CCS A;  2WLH A;  2IWX A;  4LP8 A;  1EFR G;  3WG7 B;  3R92 A;  4G27 B;  5BOC A;  4Q20 A;  2BYH A;  3R91 A;  1ZXN A;  2NNU A;  3CCR V;  2YI5 A;  2YKE A;  2DQ3 A;  5KUM A;  3IGA C;  1Y8O A;  4TWK A;  2YKJ A;  4WUC A;  1OCZ B;  3K79 A;  1K33 A;  1JPX A;  3ASO B;  2AKP A;  2UXX A;  1KD1 W;  3A0W A;  4GX5 A;  5CBG A;  1TC0 A;  2BSM A;  1VQ8 V;  1JCH A;  3BY6 A;  3MHS C;  4O05 A;  4KTN A;  5M4E A;  2WWW A;  3ABK C;  2EIJ C;  4QPK A;  3SPH A;  4BIZ A;  2VCI A;  4RAI A;  4GQT A;  5LGT A;  4URN A;  1ZW9 A;  2LFR A;  3ZMU A;  3T4D A;  4HYO A;  1UY7 A;  3OWD A;  4R50 A;  4O07 A;  4CWN A;  3CP1 A;  2CK3 G;  1QYE A;  3ZM7 A;  3STL C;  3R65 A;  4HZ5 A;  4XIR A;  2QM7 A;  2V1D A;  1TIL A;  2BU6 A;  5LHI A;  2Q8I A;  2HG1 A;  4R3M A;  2BU7 A;  3A0X A;  3E8G A;  5LHG A;  3B26 A;  4WFH A;  1S72 V;  4O0B A;  3RLQ A;  5LGU A;  3T0Z A;  4MW3 A;  4U7N A;  2XHT A;  2Q2E B;  5L3G A;  2LFS A;  1M56 B;  1FXH A;  1UYD A;  3D3I A;  1R62 A;  3O6O A;  3T10 A;  2DWD C;  3FB7 C;  2WLK A;  1U0Z A;  2BU5 A;  2XHR A;  1PNL A;  4N21 A;  1RM1 C;  1JX9 A;  3SYP A;  4QJF B;  4PDL A;  2QF6 A;  4I9W A;  5L3F A;  1H38 A;  1VQ4 V;  4LC1 A;  4XIT A;  5CTW A;  1PKX A;  4CE1 A;  3T0H A;  2YGE A;  1R3L C;  2IJK A;  2BU2 A;  1QVG U;  1VQN V;  4I5S A;  3AG3 B;  4CWF A;  5BOD A;  5B1O A;  4MVU A;  3ABL B;  5C93 A;  3ZXQ A;  2XAG A;  2ZDY A;  4ZKI A;  1M56 C;  2A79 B;  2XAJ A;  4HAM A;  5KUK A;  1VQM V;  1VQP V;  1AM1 A;  4P9O A;  3CD6 V;  2YEF A;  1AI4 A;  4P2Z A;  3ZRW A;  4L91 A;  3WQ9 A;  2IJH A;  2WEQ A;  2GQP A;  5DN6 G;  1QLE C;  3K60 A;  2MK3 A;  3VHC A;  4YXW G;  5CBF A;  1NHJ A;  2YK9 A;  3A0Y A;  3LSS A;  1YT0 A;  4HYM A;  4MPE A;  2OT5 A;  2XK2 A;  3FB6 C;  3ASN C;  4MSW C;  3ZMT A;  3G75 A;  3CCU V;  4GT8 A;  3AG3 C;  3R4M A;  2JIZ G;  2IOP A;  3BMY A;  4FCP A;  1QZR A;  2GSM B;  5H6Q A;  1UYF A;  5J9P C;  2QEX V;  2XX4 A;  3K98 A;  3FT8 A;  1FFT B;  3CRK A;  1F4N A;  1KP3 A;  3E89 A;  4URO A;  1RPR A;  5FND A;  4EFT A;  1YC4 A;  2VWC A;  2X6C A;  4GGL A;  1S0V A;  1TID A;  2EIN C;  1GM8 A;  4K4O A;  3U67 A;  3X2Q C;  2CGF A;  3ASN B;  4N23 A;  5M4N A;  3OW6 A;  1AJN A;  2JJ2 G;  4OXS A;  2PNR A;  3HZ1 A;  3INX A;  4P8O A;  4U93 A;  3ABM B;  3CCM V;  3GIG A;  1NVP B;  2ESA A;  2XJG A;  3I56 V;  2V7Q G;  3AG4 C;  5GW7 A;  4MPN A;  1P4R A;  3AEI A;  4KFM A;  2BT0 A;  3FYE B;  4MBC A;  3ZRX A;  1H7U A;  2EIL B;  1P7B A;  3HB3 B;  2WEP A;  1PNK A;  2Y69 C;  4HXW A;  4HXZ A;  2XX2 A;  1H8H G;  3LSQ A;  4EGI A;  1ID0 A;  2WLN A;  5EBM C;  1V54 B;  1JJ2 U;  1AH8 A;  4LWH A;  2IH1 C;  3OUF A;  4JAV A;  3CPW U;  2WI6 A;  3LPS A;  3DGE A;  1MOF A;  1YTF B;  3CC2 V;  1PVG A;  1QY8 A;  1S14 A;  2QKS A;  4QE7 A;  2QG2 A;  2WER A;  4MVS A;  3ABM C;  1VQ6 V;  1W0J G;  3OM3 B;  3G6E V;  3Q5K A;  4WFA V;  4XDM A;  2XDL A;  4RQF A;  2XHX A;  3AG4 B;  4AS9 A;  4MP7 A;  1I5Y A;  5IY5 B;  3Q5L A;  2ZDI C;  2IU0 A;  4KSG A;  4QNH B;  2XOK G;  1GMG A;  2EIL C;  2YSU B;  4R8C A;  1K97 A;  3LUT B;  1UYG A;  4WF9 V;  3FV5 A;  1GTO A;  2BRC A;  3ABT A;  2Q69 A;  3IED A;  5L3D A;  1BKN A;  1F23 A;  4FJC C;  4WUB A;  4YKU A;  1F4M A;  3ETD A;  1K5Q A;  2UXN A;  2H55 A;  3C0E A;  4LWI A;  5KA5 A;  3B25 A;  5IN9 A;  5EK0 A;  4V26 A;  2EZP A;  1GJV A;  2IOR A;  2YEJ A;  1OHH G;  3ZJZ A;  1AR1 B;  1CEZ A;  2XCM A;  4XBF A;  2D3O W;  3ETG A;  3P32 A;  4LPB A;  2WI3 A;  3OEH G;  1UJW B;  3ABU A;  3CCJ V;  4UUJ C;  2JK5 C;  1UY8 A;  1F51 A;  3W7X A;  2YEA A;  4WFF A;  3ASO C;  1ENV A;  1XL6 A;  4R6Z A;  4PRV A;  1COW G;  5HFL A;  4YKR A;  4E00 A;  2BOC C;  4G2K A;  4NH9 A;  1ORQ C;  3H01 A;  1OCO B;  4WFB V;  4CE3 A;  4PDR A;  3CWV A;  2X7R B;  4G28 B;  4H81 A;  3OMA B;  3CRL A;  3T1C A;  3W7S A;  3ZCC A;  3G7E A;  5B1B C;  2YJW A;  2YE9 A;  4UVB A;  4FCR A;  2FTK A;  5DM6 V;  3TZ2 A;  1QLN A;  1EI1 A;  3ZRV A;  5IYB O;  2A0L A;  1E1R G;  2PI5 A;  3EHH A;  3OUS A;  3CYO A;  3GIG B;  1ROP A;  4MVZ A;  2YE5 A;  1L0O A;  2JJ1 G;  1K8A W;  3R4N A;  3ZRS A;  2IOQ A;  3JD3 A;  2EIM B;  3SYQ A;  1QVF U;  3EHG A;  2YJX A;  2P6J A;  1OCO C;  2CCT A;  3LDD A;  5B3S C;  4E01 A;  1B6Q A;  3TZ0 A;  4F4L A;  1YJ9 V;  3GIF A;  4H85 A;  5M4P A;  5B1B B;  3OR6 C;  1UYL A;  3VHA A;  2XDS A;  3UKM A;  4WUD A;  3U2D A;  3TTZ A;  2XAQ A;  4FIP C;  2IJI A;  4FK5 C;  1ZWH A;  3HYZ A;  5F3K A;  5J71 A;  1DLB A;  4JYC A;  1NVP D;  2PI4 A;  2YI6 A;  4YKT A;  3T1K A;  1R6N A;  5CF0 A;  2R9I A;  2XD6 A;  2WLM A;  4ZBM A;  2WLI B;  1Q86 W;  3RVY A;  2FXS A;  1HWY A;  2Q8H A;  3VOU A;  4BAY A;  1Z5A A;  1GK9 A;  1R3K C;  2HJF C;  1UYI A;  4AWQ A;  4EEH A;  5B3S B;  5L3B A;  2YKB A;  2FWZ A;  4GX2 A;  3D0B A;  3PEH A;  1KIJ A;  3PJS K;  1AI5 A;  4PEL A;  1S3J A;  4WFG A;  1YT2 A;  1GM7 A;  4HZ0 A;  2ATK C;  3ZKB A;  1Q7Y W;  3EKR A;  1K3E A;  3OW2 U;  2FYP A;  2B1G A;  1Z5B A;  2QTO A;  1K92 A;  3CME V;  4URM A;  5M4M A;  1I5X A;  4CWS A;  3U2K A;  4X88 A;  3BEH A;  1US7 A;  3CCL V;  2DYR C;  3SPC A;  1MU5 A;  1FXK B;  3LDE A;  5CMU A;  1K9M W;  4LWE A;  1GO3 F;  4EFU A;  3VBB A;  3FYI B;  2ITD C;  3HPL C;  2XDK A;  1DTO A;  2YEE A;  4PU9 A;  1AJ6 A;  4EMV A;  3SJQ C;  4LWG A;  3CGY A;  1Q82 W;  4UV8 A;  4R1F A;  4J9Y B;  1Y66 A;  5CA3 A;  2YI7 A;  4MPC A;  2W6I G;  3B24 A;  1YT1 A;  2Q8F A;  1A4H A;  4XD8 A;  1CPY A;  3D36 A;  4WFE A;  3CMA V;  3K04 A;  2XX5 A;  4JTC B;  1K5S A;  3E83 A;  1H8E G;  2R9R B;  3WHA A;  4QIW F;  1OCR C;  2DYR B;  4P9P A;  2X6B A;  2P67 A;  1FXK C;  2B1I A;  5FL7 G;  1B3Q A;  2BOB C;  1UYH A;  5EC1 C;  2BRE A;  3HYY A;  4NH8 A;  1RPO A;  3CCS V;  2WI4 A;  4LCU C;  3FB8 C;  2YGF A;  2O1U A;  4ZVI A;  4B7P A;  2Y69 B;  2B5U A;  1NJI W;  3P30 A;  2AHZ A;  4X8A A;  4PL9 A;  1OSF A;  2JEU A;  3OAA G;  1V54 C;  2HKJ A;  2M7W A;  4DO2 A;  2JEX A;  4L94 A;  3CC7 V;  4KQV A;  1N8R W;  4CWP A;  4YKZ A;  1AMW A;  1OCR B;  2XAH A;  2IH3 C;  2HVJ C;  4I3H A;  3EHB B;  3G71 V;  1M1K W;  4JAS A;  5H9C A;  1MX0 A;  4CE2 A;  5J6A A;  3JD0 A;  4L93 A;  1BHB A;  1YC1 A;  1Z59 A;  3SL2 A;  3O0I A;  3M99 B;  3HHU A;  3W7T A;  2Q8G A;  4MVR A;  2YE2 A;  3NXS A;  3RKZ A;  5B1A B;  1S77 D;  1TUE B;  3AG1 C;  4E2L A;  3ZRW B;  3RW0 A;  1AJQ A;  2JKI A;  2GFD A;  3FT5 A;  1NHI A;  1YES A;  4CBC A;  5D6P A;  1K4C C;  2ZKJ A;  2X6A A;  2HFE C;  3OEE G;  2K5B A;  3A0T A;  5CPH A;  2LP7 A;  3OMN B;  3ZMV A;  3GWO A;  2Q6A A;  3UM7 A;  3D2R A;  1K7D A;  4MVQ A;  1MAB G;  3RLP A;  4JGS A;  3W7U A;  1UYK A;  4XE2 A;  3E86 A;  1VQK V;  2OCC B;  2WLL A;  2XAF A;  3MD0 A;  5B1A C;  1UY9 A;  5D7R A;  4E02 A;  1YS3 A;  1I5D A;  2BU8 A;  4U7O A;  1YJW V;  1IXM A;  4JF3 A;  2CH4 A;  1YSC A;  1GKZ A;  1Y4S A;  4XTJ A;  3OPD A;  3K9A A;  2WLL B;  4R3A A;  1KP2 A;  1NH2 B;  2BYI A;  4ASA A;  4XKA A;  1JOY A;  4GFN A;  3ZIA G;  1YC3 A;  1THN A;  3E8F A;  5LGN A;  1KEC A;  3CC4 V;  4HY6 A;  4QE9 A;  5F5R A;  2OCC C;  3F7Y C;  4GCZ A;  1W2B U;  3TZ5 A;  1TH8 A;  1ZXM A;  4QPJ A;  1VQO V;  4JAU A;  2Q67 A;  4XCJ A;  1B63 A;  2EIM C;  2ZXW B;  4V25 A;  5IDJ A;  2WLI A;  3A0R A;  1YIT V;  5EC2 C;  2CG9 A;  3HEK A;  4AWP A;  2EIK C;  4LBE C;  3EFF K;  2YE4 A;  3SPI A;  3G7B A;  2EZO A;  1YTF D;  1YIJ V;  2XJX A;  3IC7 A;  2Z5U A;  2EXL A;  4B6C A;  1EZJ A;  1PD3 A;  1FXV A;  1SZT A;  2X0L A;  5M4K A;  4CWT A;  3TUH A;  1ZWI C;  2XND G;  1YHQ V;  3LDC A;  4KUM A;  4XIP A;  2BTZ A;  3K99 A;  4CWO A;  3B27 A;  3BM9 A;  2A9H A;  4EKW A;  4PA4 A;  2E0A A;  4MTX A;  4AWO A;  4GT1 A;  5IYD O;  4O04 A;  1GKX A;  5H6R A;  3RVZ A;  2WPD G;  1G8M A;  4ASU G;  1S76 D;  4HY1 A;  4RO2 A;  1I5A A;  2XAS A;  2IWS A;  3LNU A;  3AG2 C;  3OMI B;  3QTF A;  3R4P A;  2XJJ A;  3E8H A;  3F7V C;  3K0D A;  1FS0 G;  2VCJ A;  2YED A;  2H8P C;  4L87 A;  4RQE A;  4JTD B;  4LWF A;  5FNF A;  1I59 A;  2NLJ C;  4KP4 A;  3ZMS A;  2IU3 A;  2IW5 A;  3FB5 C;  3TK1 A;  5BZB A;  4LP0 A;  4BQG A;  4CZZ A;  1I5B A;  3E8B A;  1R73 A;  4X89 A;  4YKY A;  2YEH A;  4GX1 A;  1H7S A;  3VHD A;  2IWU A;  1UYM A;  4HZ3 A;  2DW4 A;  5CBH A;  3VAD A;  3H4L A;  1Y8N A;  4UV9 A;  1VQ7 V;  4GEE A;  2YEG A;  1THZ A;  4L90 A;  3OMU A;  1CP9 A;  2F43 G;  1XL4 A;  3CXC U;  2YEB A;  4KFG A;  1AI6 A;  1S16 A;  5KA6 A;  2OTL V;  3ZMZ A;  4XDJ A;  1SRY A;  2QFO A;  4EM7 A;  2O1W A;  4X9L A;  4P30 A;  2VW5 A;  4P7A A;  1AH6 A;  3INW A;  1JM6 A;  4UVA A;  1H2G A;  5M4H A;  3ZKD A;  2QG0 A;  2YGA A;  3K03 A;  1UYE A;  2WI2 A;  2QA4 V;  2HKO A;  4JPR A;  3O2F A;  4PRX A;  1QR9 A;  2XDU A;  4BXI A;  2AHY A;  2O1V A;  2YKI A;  2ZR3 A;  4MTF A;  3WFV A;  2YE6 A;  4YKQ A;  4FCQ A;  3SPJ A;  1K34 A;  2P7T C;  4MOT A;  1BL8 A;  2ZQM A;  1R6K A;  2GHY A;  2ITC C;  3STZ C;  3R4O A;  2H8M A;  3JZ3 A;  4JQL A;  4XKK A;  4XKO A;  3LNM B;  1BMF G;  2EJR A;  1M90 W;  2DWE C;  4PA3 A;  2FWY A;  3E2E A;  4Z1M G;  1MSW D;  1MG1 A;  2YEV A;  3JD2 A;  3QO8 A;  1L1F A;  1SES A;  2ZDX A;  2YK2 A;  2Q68 A;  3OFN G;  3SPG A;  2YI0 A;  4R7C A;  5EBW C;  3PEJ A;  3K08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...