4KP4A

Deciphering cis-trans directionality and visualizing autophosphorylation in histidine kinases.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
ADDRTLLMAGVSHDLRTPLTRIRAYAETIYNSLGELDLSTLKELAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Osmolarity sensor protein EnvZ, Histidine kinase
publication title Visualizing autophosphorylation in histidine kinases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/signaling protein
total genus 66
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4kp4A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4kp4A02
4FMTA 1UYMA 4R1FA 2YECA 1PVGA 2WI4A 1YS3A 3MD0A 2YK9A 2YEBA 1NHIA 2IWXA 1KZNA 3SL2A 3PEJA 5F5RA 1JM6A 4YKRA 4P8OA 3WHAA 4XCJA 2Q8GA 1YESA 3EHHA 4MTXA 4O09A 4WUCA 1UYIA 1BYQA 3QTFA 1IXMA 1B63A 5CTYA 2XDLA 3B26A 5D6PA 4MPCA 5C93A 3MNRP 4MP2A 2GQPA 3O0IA 4E01A 3H4LA 1UYLA 3ZRVA 4E00A 2XJJA 5CPHA 3TUHA 3CGZA 2XK2A 5IDMA 3GIEA 4LC1A 2YKCA 4FCPA 2IORA 3DGEA 4ASBA 4CWOA 2YE2A 2CCTA 2QF6A 1AJ6A 4PU9A 2XHTA 2BU2A 4BXIA 3TK1A 2BT0A 4XITA 5J6AA 2YKBA 2XD6A 1F51A 4BIUA 2BU5A 4JAVA 2LFRA 3C11A 4KQVA 4MPNA 1UYHA 3U2KA 2BZ5A 4KP4A 4XKAA 4DUHA 3Q5LA 2ZDXA 4YKTA 3T0HA 1Z5BA 2BU6A 2EXLA 2JKIA 5CTXA 4E02A 1YSZA 2BU8A 3D2RA 3A0RA 2QFOA 4H81A 4XE2A 4CWSA 5D7DA 2YEAA 2YJWA 3A0WA 1UYFA 3TZ5A 4EM7A 1THNA 3TZ0A 2WI7A 4EFTA 3K60A 4HZ5A 3ZKDA 3O2FA 3ZRWB 2YE7A 5FNDA 4MT8A 3HHUA 3TZ2A 2XX5A 2QG0A 3C0EA 2BREA 4JASA 4URNA 3WQ9A 4O04A 1H7SA 4P7AA 1ID0A 4EGIA 2YE5A 3LNUA 3VHAA 2YK2A 3A0TA 4MP7A 4L91A 1YT1A 3R92A 4GEEA 4W7TA 2YI7A 2XJXA 4HY1A 2BRCA 5FNFA 3ZKBA 2XDSA 3OPDA 2FYPA 4PRXA 1H7UA 4UROA 4WUDA 4L90A 3RKZA 2YJXA 5FWKA 3R4PA 4HZ0A 5M4KA 4MB9A 2XHXA 5CTWA 4MBCA 2GFDA 1TIDA 2WI6A 4BQGA 1ZWHA 1UY8A 4XIRA 3VHCA 2UWDA 1I5BA 2E0AA 2YE3A 3ZM7A 2BYHA 3EKRA 5M4MA 3ZCCA 2VCJA 2BSMA 3LPSA 1B3QA 4BQJA 5L3JA 4LWEA 3Q5KA 1Z5AA 4URMA 1U2OA 1UY7A 4GCZA 4JAUA 1B62A 2QM7A 3T2SA 5M4NA 2CH4A 4QPJA 4CWRA 4CWPA 4R3AA 2ZBKB 1ZXMA 4LWHA 3INXA 4KTNA 3TZ4A 2YI6A 5F3KA 2HCHA 4CWFA 2QG2A 4U93A 3GIGB 3RLPA 2BTZA 5IDJA 3R4OA 1UYEA 2PNRA 1GKZA 4X9LA 1S16A 4H7QA 4L8ZA 4XTJA 4LWGA 2WWWA 1YSRA 1Y8NA 4HYPA 1I5CA 4CWTA 1QYEA 2ZKJA 3Q5JA 4FPPA 2BU7A 4YKQA 2FWYA 5D7CA 3A0YA 2HG1A 1I5AA 1BKNA 1OSFA 4H85A 1Y4SA 3T0ZA 2YKJA 2BYIA 1Y8OA 4R3MA 1NHJA 2O1UA 1YETA 1TC6A 4YKWA 4GFNA 1QZRA 1UYKA 4CE1A 3HYYA 4YKYA 3TTZA 1AMWA 3A0XA 4NH8A 4CE3A 3T10A 2K5BA 2XCMA 4LWIA 3D36A 3B27A 2IWUA 1TH8A 3EHJA 2WERA 2VCIA 4XC0A 1TBWA 4CE2A 3FV5A 3H80A 2IWSA 3JZ3A 4V25A 1BXDA 2JJCA 1US7A 3NMQA 2YEEA 2YEHA 1AM1A 4NH7A 1YERA 3U2DA 5M4PA 5D7RA 4MOTA 2CCUA 3OW6A 4B6CA 4I5SA 2YEJA 2YKIA 4L94A 4O0BA 3ZXQA 3CRLA 3FT8A 2XABA 3HYZA 4KFGA 1Z59A 3T1KA 4AWPA 4PL9A 3B25A 4HY6A 3NXSA 1UYDA 3VADA 4YKXA 1I59A 2VWCA 3EKOA 1KIJA 2WEPA 2CG9A 1S14A 4QPKA 1A4HA 1EA6A 3ZRWA 3OWDA 1GKXA 4MPEA 2Q8IA 2YE6A 2H8MA 1AH6A 2WEQA 4LPBA 3K99A 4URLA 3OMUA 5IN9A 3D0BA 4EFUA 1AH8A 1YC3A 2WI1A 4K4OA 1YT0A 2FXSA 5CTUA 1BGQA 1TILA 2CCSA 3B24A 1UYGA 4O07A 3P32A 5M4EA 5M4HA 3K97A 4ZKIA 3KE6A 4XKKA 2XJGA 2FWZA 2YE4A 2CGFA 2C2AA 4PRVA 3R4NA 3ZXOA 4XKOA 2QM8A 2YE8A 5BODA 4V26A 2YKEA 2FTKA 3CWVA 3RLQA 5BOCA 1JOYA 3BMYA 2P67A 4B7PA 2Q8HA 1MU5A 1MX0A 4BAEA 3K98A 4FCQA 3HZ5A 1EI1A 3B28A 3BM9A 3VHDA 2O1WA 1ZW9A 4YKZA 4EGKA 2XX2A 4ASGA 4JYCA 5GGZA 2ZDYA 4U7OA 2YEIA 4HXWA 2YE9A 4ASAA 3FT5A 3U67A 4GQTA 4LWFA 4WUBA 1Y4UA 4U7NA 2Q2EB 3G7BA 2XDXA 4NH9A 4CWQA 4FCRA 1U0ZA 4GT8A 2XDKA 1I58A 1Z5CA 1ZXNA 3G7EA 2ESAA 4GGLA 4GT1A 3GIGA 4HXZA 4AWQA 4AWOA 3O6OA 4YKUA 2H55A 3EHFA 4XDMA 4XD8A 1YT2A 3A0ZA 2YGEA 1NHHA 4XIPA 4L93A 3GIFA 5B1OA 2Q8FA 2WI2A 4JQLA 3HZ1A 3ZRXA 2O1VA 3R4MA 2YEGA 3INWA 4Q20A 1YC1A 4ZVIA 5CF0A 2IOQA 3R91A 1I5DA 4LP0A 1YC4A 4ASFA 3IEDA 1GJVA 5J71A 2XX4A 1UYCA 3OWBA 3HEKA 4DZYA 3QDDA 2YI5A 1TC0A 3RLRA 1R62A 3G75A 3PEHA 4EEHA 5B1NA 2YEDA 4AS9A 4O05A 2YI0A 2YGAA 3CGYA 2AKPA 4CWNA 2YGFA 4I3HA 1Y8PA 4KSHA 4EGHA 1UY6A 2XDUA 4KSGA 3CRKA 2IOPA 4BIZA 2LFSA 2HKJA 2YEFA 5FNCA 1UY9A 2WI3A 2VW5A 2WI5A 3EHGA 4XIQA 5D6QA 4HYMA 1L0OA 4JYBA 2XHRA 4XCLA 4EMVA 1QY8A
chains in the Genus database with same CATH superfamily
4FMTA 2YECA 3AK1A 3MD0A 5BMVB 5FNVA 3JCUZ 4PDMA 3SL2A 4YKRA 5EBMC 1BHAA 3OMIB 2BE3A 1Y76A 3F7YC 3IJ4A 4GLXA 5LP6B 1QCEA 1UYIA 1MA1A 1BYQA 2GUZA 4U3FH 2QKAA 2XDLA 5D6PA 2YUAA 3RYFA 1YIJV 1NJIW 2LQTA 3L72H 2BOBC 1HNWO 5CPHA 1MSDA 1M57C 2HKOA 3BHPA 3CJHA 4XDKA 4EFBA 3CGZA 1Z2GA 3ZN0A 1AR5A 1VQPV 4CWOA 2YE2A 2CCTA 4LFBO 3CX5F 2YC0A 2QDOA 2HP8A 2XHTA 2BU2A 4BXIA 2HLDG 3QG5A 5CBHA 1AJNA 4XITA 4JZGA 3L73H 5GONB 2P4VA 4BIUA 4MPNA 2PI4A 2R70A 2KG7A 4DR1B 3CRRA 5KX5B 5KA6A 3QO8A 2XNDG 2ZDXA 4YKTA 2P5OA 4UVBA 2EXLA 2BU6A 2JKIA 4E02A 1QNMA 2BU8A 3P3NA 2QFOA 2WA3A 2CH7A 3ETQA 2QA4V 5KMGA 3TZ5A 4DUZB 2HVJC 1THNA 5BR8O 3CC4V 1BL8A 4J7KA 2JEXA 3ZKDA 3CCSV 4TOIA 1DLBA 1HR0B 4PV1B 1LUVA 4NTYA 1HNXO 1DF5A 3AG4B 5GTHZ 5KHKA 2PUSA 5IJ9B 5FNDA 4MT8A 3TZ2A 1RP3B 3C0EA 1FS0G 2BREA 3WQ9A 5B3SB 4OGQB 5JJJB 1ID0A 4EFEA 1SQVH 3VOUA 1AI4A 4LF8B 2XAJA 4O2AA 3FD9A 4BW5A 2XUMA 5IYDO 1MOFA 4YHHO 3A0TA 3E83A 4LF9O 4LF5B 5LGNA 3RT3C 4CZZA 1JCHA 2YI7A 4PA4A 3MHHC 4DUYO 4B3TB 3FB5C 1DF4A 2MK3A 3BA8A 4DV0B 4C7UA 3FYEB 2XDSA 3OPDA 3J7AU 2ZXWC 2QEXV 2R9AA 2ATKC 1RM1C 1H7UA 4WUDA 4JTDB 2YJXA 3RKZA 3R4PA 5M4KA 2XAQA 4PDLA 5CTWA 1IX9A 4MBCA 3A0HZ 3K58A 3ZHVA 1UY8A 2Q0OC 4DV2B 3ZMSA 2UWDA 4AQYB 3ABMC 4DR2O 2YE3A 3JD2A 3W7TA 1WB8A 5IYZA 5M4MA 4QNHB 2VCJA 1VF7A 3LPSA 1J95A 2UXDB 1ZX3A 4GX2A 3WU2Z 4HNAB 2QKSA 3ZIAG 1B62A 1MABG 4PDRA 2EX3A 2QM7A 5M4NA 1YTFB 4QPJA 2CH4A 4CWRA 3D3QA 1RPRA 2C1IA 1G8MA 5LP6C 2GDSA 3CE2A 2MW2B 1I08A 2N74A 4LWSB 3EXAA 5A9GA 3ASOC 3K04A 1K5SA 4X88A 2QG2A 1K97A 4UXNA 1Q81W 1N8RW 4DV7O 2BSKA 1F4NA 2GBOA 4DV5B 2CK3G 3RN4A 3QO7A 3ZMVA 2VWKA 3VQVA 2IJHA 2CGOA 2Y48A 2OT5A 4XTJA 1N34O 2WWWA 4UB6Z 4JI2O 1YSRA 1KECA 2ZNIA 1HDJA 5IT9N 4CWTA 1OCRB 3UKMA 2BU7A 4YKQA 5D7CA 1H2KA 1M9NA 3B77A 2UU9B 1I5AA 1BKNA 3WFVA 1R3LC 1OSFA 1TUBA 3DTUB 2YKJA 4UB8Z 2LO1A 1Y8OA 5HFLA 2W6JG 1NHJA 1GM8A 1FFTB 1MZEA 3CCLV 1GMGA 1KP3A 4DR3O 1TC6A 4GFNA 1QZRA 1UYKA 3CP1A 4U3JA 1AMWA 3A0XA 3SJBC 4PA9A 3T10A 2K5BA 1SQBH 2Q67A 1PV0A 4FVMA 2RCVA 3N2KB 2Q7HA 2XHBA 2YXHA 2IWUA 3K3WA 1TH8A 1SQXH 2YICA 4YIOA 4I9WA 2WERA 4XC0A 4DV4B 2QGNA 2ZD9A 3FV5A 1NTZH 4YJ3B 3ZHSA 2IWSA 1SA0A 2P06A 4F4LA 2UXCB 5JCOC 2JJCA 5CA1A 5M4PA 3R66A 1S5JA 3PJSK 3CMAV 1NVPB 4D6TH 4QIWF 2YKIA 5FPRA 3OR6C 3AG4C 1LUWA 3T1KA 1Z59A 3B25A 4I4TA 1VF6C 2NR5A 1UYDA 1FXHA 2VWCA 3G80A 3RBZA 4QPKA 3ZRWA 1FXKC 5EYPA 4PA3A 2Z5UA 1AH6A 5ITZB 2CTRA 5FNVB 1GO3F 1WJZA 4K8XA 3FKSG 3WB1A 3LDDA 1I94B 1Q82W 5IN9A 4LNUA 4NXMB 5C8YA 1VQ7V 1AH8A 4GKKO 2WI1A 3LMMA 2ZR3A 1YT0A 2VQEO 3TXQA 1TILA 2CCSA 2HHIA 1YDXA 1UYGA 3P32A 3B24A 1G4YB 1M4UA 1WP7A 4O07A 5M4HA 4YJ2A 3E8FA 5IJ0A 2WLLA 3JD4A 4XKKA 2VRZA 3F5WC 3RYFB 2Q7GA 2Q8VA 1EN5A 2CE4A 5BODA 4JI3B 2FTKA 3RYIB 1IURA 2YKEA 3K06A 3TJTA 1JR9A 1XNRO 3CJHB 3SJCC 3UO3A 1MU5A 3OAAG 3SPHA 4BAEA 4FCQA 3HZ5A 5LOVA 4X65B 3K08A 4MTGA 3BM9A 4B3MO 3OUSA 3OEEG 5AG2A 1K7DA 3J80N 4EGKA 2UUCB 3CCRV 3FFQA 4ASGA 1Q43A 3EHBB 2ZDYA 3M7MX 4PI2A 2HHHO 2YE9A 2YI8A 3CPWU 5FL7G 3U67A 4GKJB 2Q2EB 2OIGA 4JZ2A 3G7BA 1Q6UA 2WLJA 4IT5A 3QO5A 2B1IA 4TQDA 4H0LB 5EK0A 2CTPA 4FCRA 4CWQA 1U0ZA 4X1YA 2XDKA 5EC1C 1F7YA 3T1HO 5LA6A 1L1FA 5LYJB 4GT1A 1NH2B 4GGLA 1E1RG 3L74H 3GIGA 3ML0A 4AWQA 2CH7B 3O6OA 1N36B 1P7GA 1JPXA 4YKUA 4RWUA 2IW5A 3CCUV 4B3SB 4G28B 3D36C 3CCQV 4GYCB 2DYRC 4LFAO 3JATB 1Z5VA 5L3BA 3A2FA 1SETA 4FFBB 4WFEA 2YGEA 1NHHA 1B04A 3GIFA 2OCCB 5H6QA 1Q5OA 2HJDA 2PF4E 4JQLA 3R4MA 1R3IC 3ZRXA 5CB4A 3INWA 4K35A 4Q20A 2O57A 1YC1A 4DR7O 4ZVIA 2YSUB 2IOQA 3R91A 2QWNB 5CA0A 4XDJA 1GN2A 3IEDA 2YI9A 1YSCA 1M90W 3E8GA 4KHPO 5F2VO 4WF9V 4EB6B 4GX5A 2YI5A 4LF7O 4X66O 4IYIA 2F93B 3E8BA 4NTWA 1TC0A 1SQPH 5J9PC 1L0NH 1AP5A 2B9ZA 3HKBA 2UXBB 1VMGA 4H13B 3U11A 4J11A 2YEDA 4AS9A 2YI0A 2JJ1G 3H01A 4CWNA 1KQSU 1WN7A 4MVOA 3LDEA 1KMIZ 1AP6A 3T1YO 5H2FZ 4J41A 1K92A 3BEHA 1FD9A 5LMUO 3HPLC 1J5EB 4NVPA 2Q5ZA 1SESA 1SS3A 2IOPA 3CC7V 4UFZA 5IYZB 3ABKC 3TCUA 5EZYA 2WI3A 3ZHQA 5IWAO 3BPZA 2GTSA 4HYMA 2VQFB 4EMVA 1QY8A 4R1FA 1NQTA 1VF6A 2ZT9B 3FB6C 1IBMB 1YS3A 5CN0A 1MG1A 5KHHA 2QR4A 3JALA 2YK9A 4DW0A 2A7WA 2AXTZ 1NHIA 2IWXA 4JPRA 4HYOA 5JQGB 3WHAA 2P90A 1VQOV 2PGGA 1KBHA 1MZFA 2JGUA 1VQ6V 4LR3A 3IC7A 4BIOA 2YDEA 3GVMA 1JMKC 5KHGA 4OX9O 1MNGA 4X20A 5CTYA 2IH3C 4UCUA 3ZX6A 3B26A 3JAKA 4MPCA 3JARA 5L3GA 1GN3A 2GQPA 3O0IA 4E01A 2EIKB 3CRCA 3H1HH 3ZRVA 3K0DA 1AR4A 5LXTA 4NR1A 4EEQA 2XK2A 5IDMA 3GIEA 1N0JA 1GTOA 4FCPA 3DGEA 2HVKC 2EINC 1RFYA 2QTSA 2ZKOA 4P9OA 4PU9A 2P22C 1VQMV 3ZS8C 4U3JB 4QE7A 3VQWA 1QLEB 2JJ2G 3SYCA 2IJKA 3JD1A 2XD6A 2BU5A 1W2BU 4TV9B 2EZOA 1KP2A 1XL6A 3ZMZA 4JAVA 1UYHA 3U2KA 4ZHQB 3BA9A 4DUHA 2YEVA 3SYQA 4W4LA 1HNWB 2XOKG 1SA0B 3T0HA 3P3PA 5D5PA 1Z5BA 2C1GA 4AHCA 1YSZA 3P30A 2Y4TA 4HZ3A 4XE2A 2OYQA 4LFBB 1EZJA 1UYFA 1YZBA 4EM7A 1LR1A 3JASA 2WI7A 4HZ5A 4BAYA 1QQCA 4JYAO 1FJGB 1D5NA 4CH4A 3ZRWB 1YF2A 2EJRA 3CB2A 5EYPB 4CBCA 1U97A 4FLUA 4HBNA 4WFBV 3HHUA 4LFCO 1YTFD 3WB2A 3U10A 1OCCB 2OIEA 3BAAA 3AG1C 3FX7A 1M1KW 5C8YB 1H7SA 2ZINA 2HJFC 3FB8C 1S5LZ 1UPGA 4QJFB 2YE5A 1KUQA 4H37A 2YK2A 3VHAA 2ETNA 4TUYA 2X0LA 4UVAA 4L91A 1YT1A 3R92A 4W7TA 1NU1H 4YJ2B 5IJ0B 1Q6HA 3E22A 2XJXA 1XDCA 3ASNB 4R7CA 4OPHA 1XREA 4B7EA 4JGSA 5BR8B 4YY3O 3OR7C 3G6BA 3OTFA 2ZE7A 3BFRA 5L3CA 4UROA 3T1CA 1HNXB 2IBZH 4JI8B 2XHXA 3OTOB 3TGUH 1R3KC 4Z1MG 3PN1A 3ETDA 4O4LA 5LOVB 4BQGA 4CS4A 2LW7A 4A5UB 2IU3A 5JVDA 1SF9A 5L3FA 1HNZO 3QF7A 2ZE5A 2QWOB 4B7KA 3K9SA 4YHHB 4I50A 2BSMA 4LF9B 4UV8A 4GUNA 1Y74A 3RYHA 4FLZA 4DR4O 4JI6B 1P49A 1M56B 1XHXA 1U2OA 2CDYA 4GCZA 3OM3B 1QR9A 4RUFA 1RSOA 2QTOA 3SYOA 5LMNO 2UXXA 1XMQO 1R3JC 2V7QG 2LW1A 4LWHA 4KTNA 5LA6B 2QWQB 3TZ4A 1TGOA 4I0XA 3CCJV 5BY1A 2CGNA 3GIGB 5HFMA 2WLKA 3OT7A 2F23A 1UYEA 3SJQC 2Q7EA 4B3RO 2GSMB 5FPOA 2EIKC 3STZC 3W7UA 4LWGA 2GHYA 1Y8NA 1G6UA 1S77D 4O4JA 1V54B 1I5CA 4FLYA 3Q5JA 2XAFA 1FFXA 1OV9A 4LCUC 4JI4O 3A0YA 4D7SA 3ZEDA 2E5LO 4H85A 1KB9F 2D3OW 1Y4SA 3ICXA 2CUGA 5GTIZ 1EZVH 2L35A 1YETA 2RN9A 4L8JA 1T5EA 4YKYA 1JFFB 3TTZA 1KKCA 4DV7B 4NH8A 4CE3A 3FYIB 4IGGA 3LSUA 4J9YB 2HEPA 4ZBMA 4LF6B 3EHJA 4KUMA 3E35A 1TBWA 1WA8B 1H38A 3OGIB 2ADQB 4DR6B 1FKAO 3JCZA 1H2MA 1R6TA 5KA5A 5DM6V 2YEEA 1AM1A 5A2QN 2HFEC 1YERA 3U2DA 4CH5A 2CCUA 3OW6A 4BW9A 1N33O 5KAIZ 3M8AA 4B6CA 1AI7A 1DGSA 4DR3B 3ZXQA 4R50A 4N21A 5EZYB 3CWBH 4HY6A 2F1MA 5LL6Y 3L9DA 3VADA 4YKXA 3JSNA 2WEPA 2CTQA 3Q4HA 1OCCC 4LF4O 1S14A 2CG9A 1GKXA 2QE7G 2H8MA 3JALB 2DWDC 2ARHA 2UUBO 4LPBA 3CYGA 4PHZA 4XDLA 4J42A 3CMEV 3D0BA 3CXHF 1BCCH 1ZAUA 1WLEA 1QBZA 3GWOA 3UO2A 1QU7A 3ZHTA 5LGTA 4X8AA 4ASUG 2ZIOA 4O4HA 1YITV 4X20B 4TT3G 2P6JA 2XJGA 3JAKB 1KU9A 1NI8A 1PM9A 4QGPA 4JV5B 2JGDA 2A79B 1F4MA 2YE8A 3C3TA 3W7WA 1AR1B 5BOCA 2AHZA 2QWPB 5KLVH 1QR8A 2LGWA 2E75B 3T4ZA 5LBQA 1BZKA 5B5EZ 4JI7O 1GRJA 1AILA 1W0KG 4PD4F 5B1BB 4PA6A 3B28A 1CP9A 2O1WA 3ABLB 4FM0A 3X2QB 3KKYA 4RO2A 2VQEB 4K0KO 3SYAA 5GGZA 3L71H 2LGQA 2R9IA 2YEIA 3UQ8A 4HXWA 3KZIZ 1V55B 3FT5A 3W7XA 4NB5A 1ZUQA 4WUBA 1COWG 4ZOLB 1R73A 1BS3A 4CH6A 4NH9A 2YEVB 4MTOA 1L0LH 4P9PA 3A0BZ 1XNRB 1I58A 1P4RA 3G7EA 2ESAA 2ZM6O 4DUZO 1Q7YW 4TV8A 4HXZA 4X64O 4X1KB 4F6RA 4B3MB 2ZR2A 3JASB 2H55A 1AROP 3EHFA 1CEZA 3H1JH 1XI1A 1YT2A 1SQQH 2DQ3A 1XNQO 3L70H 1QVGU 1IBKO 4D7TA 4LF8O 2O1VA 2PI5A 5H9CA 4ASFA 2PYJA 4B3TO 3T1HB 2XX4A 4DV0O 4TUYB 2YIBD 5K1PA 1M93A 4MVMA 2EIJB 1M5IA 5H5NA 4GX1A 4MS2A 4DK0A 1Y66A 2P4KA 4AILC 3HKDA 3UT5A 1R62A 2ZCEA 2X6BA 4EEHA 3LNNA 3QTCA 5B1NA 1BQ0A 1NS1A 4O05A 4DXWA 2AKPA 5B3SC 2QKCA 4DV2O 2YGFA 4AQYO 1SZXA 3OD4A 4O4LB 4JYYA 2PY5A 1TAEA 1UY6A 2XDUA 3AK2A 2RMKB 1Y76B 1EN4A 3WB0A 2UXDO 1VQ5V 1VARA 1A32A 1VF5B 2N05A 3ZBHA 1OCZB 4I50B 5B1AB 2PYLA 2GUZB 4KHPB 5KHIA 5D6QA 1HP8A 1L0OA 2XHRA 2B5UA 4LF7B 1UYMA 4X66B 1PVGA 2XTAA 2WI4A 2XT9A 5GW7A 1WP8A 4FLWA 4FZ0A 4UCTA 1S0VA 1KZNA 4PA7A 3SPCA 3PEJA 1RPOA 5F5RA 4I9QA 1BMFG 1JM6A 1YESA 3K57A 4DV5O 5D5QA 4MTXA 2EZPA 1K33A 4JI5O 2KSDA 1GM9A 3I55V 3IGAC 4X1IA 3JAWA 3QTFA 2RNBA 1XMOO 2W0FC 2Q0AA 5LMUB 4CC6A 1IXMA 1Q86W 1B63A 1PKXA 1Z5WA 1O9HA 2H3OA 2UU9O 4MP2A 1SQGA 4O4JB 1YCIA 5IWAB 1O9GA 5BMVA 1FFXB 4K3AA 2XJJA 3ETEA 2FMLA 4JI1O 1SC5B 3NR7A 1U96A 1XEQA 2KG7B 1XOUA 4DR5O 2HG5C 4JI0B 2IORA 2Q4PA 3X2QC 4ASBA 4FK5C 5LP6A 2QF6A 1AJ6A 2E76B 3TK1A 3LSQA 5J6AA 2V4DA 5KMGB 1B06A 3EFFK 2YKBA 1OCRC 1GH6A 3HB3B 4JTAB 2A9HA 3KCXA 4DV4O 1ZLZA 2YIAA 4OX9B 3CXCU 4MVSA 2Q68A 2Q73A 4KP4A 5CMUA 4MTFA 5JJNB 5J2TA 3E89A 5CTXA 3D2RA 3OUFA 4H81A 2WLIA 5DECA 5D7DA 2YJWA 1BGYH 4O2AB 4UV9A 2ZDIC 2A06H 3TZ0A 2F66C 2E74B 3AG2B 3OE7G 5IE9A 3O2FA 1XL4A 2Y69B 3Q4HB 1QLNA 2N04A 3DSQA 1VIBA 2KB1A 1I94O 4J7JA 3H1KH 2M6YA 3B8NA 1GN6A 2XAHA 1NTMH 2WAMA 4FJCC 1BE3H 3N27A 2QG0A 2ZNJA 4DV3O 4FLXA 2EIJC 1H2SB 2QM4A 4P7AA 4TWKA 4RQFA 4KXRA 2X6AA 3LNUA 1JQ0A 4MP7A 5JCOA 2R9RB 4O4HB 4BWAA 4JI3O 1AB3A 3ZMTA 2BRCA 1K34A 3K03A 4X89A 2JGDB 3RFRA 3AK3A 2FYPA 1Q8IA 3F7VC 4PRXA 4JYAB 1E1QG 2DW4A 1VQKV 4H33A 4HZ0A 1FXKA 4MB9A 3WG7B 5EBWC 4W4KA 2GFDA 4Q6GA 4LFCB 4YXWG 3BY6A 3BRCA 2M7WA 5TISZ 2NNUA 4X62O 5IYCO 2E0AA 3ZM7A 1LNQA 3EKRA 2BSKB 3RYCA 1I5XA 3VQXA 1KKDA 3ZCCA 1GAXA 1B3QA 5L3JA 4DYLA 3Q5KA 3MAQA 1VEWA 4URMA 1TVKA 4YY3B 4IYHA 4CWPA 4RUEA 4R3AA 1JVMA 1ZXMA 5LGUA 1N36O 4DV1O 4XBFA 1M57B 2YI6A 1TUBB 2HCHA 1X59A 4TV8B 3DC5A 2E3CA 1OHHG 5IYBO 1B6QA 3R4OA 5EC2C 1PP9H 1GKZA 3RVYA 2UUAO 4X9LA 4L8ZA 4CH3A 1BSMA 5CBGA 1H2LA 4HYPA 1YXBA 2KKWA 1GKFA 1QYEA 2FKXA 4DR4B 1SRYA 2PTMA 2EULA 3CCEV 4LWSA 1AI6A 4GZRB 5LMNB 2BYIA 4FZ1A 5CBFA 5CA1B 2F4VO 2O1UA 2Z3YA 3K9AA 4YKWA 3H1LH 1XHZA 4CE1A 1NR1A 3HYYA 1QVFU 1VQLV 3DXRA 2IM9A 4B3RB 5J2UA 3F5TA 2XCMA 1NT2B 4I4TB 4H44B 2OCCC 4NYKA 3D36A 2OTJV 3QNEA 3B27A 4L87A 4UCSA 3CD6V 4P30A 4JI4B 1D5AA 3G67A 2JEUA 3NMQA 4ZI7A 2E5LB 1H2GA 5K1XA 4LNUB 1N32O 4MOTA 2JRIA 3TETA 4BR6A 3UCSC 1SERA 2VQFO 4E72A 4WFAV 4O0BA 1K3EA 3AG3B 1IBMO 3CRLA 4AWPA 4KFGA 3S3WA 3G4SV 2DYSB 2WLLB 4G2KA 4UCRA 3EKOA 5DEDA 1EA6A 1N4CA 2W6IG 2Q8IA 2YE6A 3OGCC 4YJ3A 1BQZA 3K99A 4UCVA 2IU0A 2QWRB 1IBLO 1RM1B 2FB5A 4URLA 2ZE6A 4R8CA 1BHBA 4EFUA 3D8CA 1US6A 3O9OA 3ZMUA 4K4OA 4X9QA 4X1IB 3N2GA 4I55A 1BGQA 3B40A 5M4EA 3K97A 3FAVA 1FXVA 4ZKIA 2EJ7A 1XUQA 3ABMB 2FWZA 2CGFA 2C2AA 4UUJC 3R4NA 2Q9LA 2QM8A 4ICGA 4WFFA 3WG7C 4DUYB 3RLQA 2ZQMA 1IZ3A 5ITZA 3BMYA 3K5NA 4LF4B 3SPGA 3LUTB 1MX0A 4X1YB 2UUBB 3K98A 2FYUH 1X4TA 3ASOB 1ZW9A 5B66Z 4DV6O 1WAZA 2XX2A 4P2ZA 4DRXA 4FM2A 2QJ1A 4WBNA 1FYJA 4JYCA 1VQ9V 4WCEV 1PPJH 4DW1A 2NN4A 3K0GA 4NXNO 4MSWC 1NVPD 4DR2B 3B09A 4O4IA 3RYIA 4U7OA 3K5OA 4ASAA 1I5YA 1K4CC 1OZ0A 1D2DA 3FB7C 4GQTA 4LWFA 5LHHA 3IAYA 4ABMA 3ETGA 4E4EA 4GT8A 5CB4B 5J2TB 1ZXNA 3CCVV 2ADPA 2ITDC 2WLIB 1QLEC 5CA0B 4JI7B 2CAZC 4KL1A 1KC8W 1FJGO 5E79Z 4Z2WA 2BTQA 1TA8A 2XASA 3THOA 5CA3A 4AI8A 4JTCB 4XDMA 4XD8A 2ILMA 3E8HA 4UVCA 4K0KB 3OMNB 1MSWD 3A0ZA 4MVZA 1N34B 4XIPA 1EN6A 3BCCH 4L93A 3HKBB 1ZL8A 2Q8FA 2WI2A 4JI2B 1GN4A 1MMMA 2EBOA 5LYJA 5L3EA 1I7FA 2JDIG 2ODMA 3QVNA 2AZ2A 2JVDA 1I5DA 1YC4A 2Z0AA 4R6ZA 3E2EA 5J71A 2X6CA 2ZM6B 4X64B 3OWBA 4DZYA 1AJPA 3QDDA 3BVOA 4N23A 3JATA 3IFXA 4OXSA 4JI8O 3G75A 4FFBA 1UFIA 3OTOO 5JJEB 1YJ9V 1YJWV 1GM7A 1XNQB 1FXKB 3CGYA 2YXLA 4MVRA 1IBKB 4I3HA 1I0HA 1YJNV 3VQYA 2BCCH 1W0JG 3AG3C 1BT8A 1AVMA 2DYSC 1YEWA 2WLHA 4FLTA 3ASNC 1K73W 4NKGB 1NH2D 4EB6A 1NTKH 3JD3A 4JI6O 2HKJA 2YEFA 3RYCB 5FNCA 3JSLA 4PJ0Z 4K8ZA 2VW5A 2RQ6A 3EHGA 4XIQA 5EBLC 3B2EE 4JYBA 1S5HC 3CRQA 4XCLA 3KG2A 1TVKB 2LP7A 3JARB 2B1GA 1DTOA 5KUMA 1ORQC 2YEBA 5LXTB 4FM1A 4P8OA 2WSSG 4PI0A 4XCJA 2Q8GA 3EHHA 1ENVA 4O09A 2GTAA 1R1BA 1SZTA 4WUCA 2XAGA 3MHSC 3CHXA 3K79A 2AHYA 2QSAA 1N0NA 1FPOA 4GKKB 1M56C 2VS0A 5C93A 3MNRP 4FFKA 2RJZA 1NKDA 4DR1O 3OEHG 2EILB 1UYLA 3H4LA 1CPYA 4E00A 3TUHA 4QE9A 3HKCA 4LC1A 5JQGA 2YKCA 2JK5C 1VQNV 4IIJA 4J9ZB 2AW9A 2YIBA 3SYPA 3E86A 1JA8A 5LHIA 2Y0PA 4FIPC 1R6NA 2BT0A 2K1EA 4JI5B 4LF6O 1SQFA 1V54C 3RVZA 3DXRB 2R72A 1HR0O 1F51A 1K9MW 5J2UB 5JH7A 1XMOB 5BXZA 2LFRA 3C11A 4KQVA 2DN9A 4DR6O 2DYRB 2BZ5A 3L75H 1S3JA 4O2BA 3SR2C 4XKAA 2HHHB 3Q5LA 3ABUA 4JI1B 1VQ8V 3RW0A 1VP7A 3I56V 4DR5B 4ZI7B 4LF5O 3CCMV 3A0RA 1AJQA 4CWSA 2YEAA 3A0WA 1V9PA 4LH6A 1XBLA 4TV9A 4MW3A 4EFTA 3K60A 3E22B 3K59A 1XQ8A 4ZHQA 4HAMA 2Y4UA 2YE7A 3APQA 3ZRSA 3HKEA 2Y0IA 3W7SA 4LFAB 2H94A 2XX5A 1OCOB 3ZHRA 4IHJA 4WFHA 4CC5A 4JASA 3G6EV 4URNA 2YS8A 2LJ2A 4DK1A 4O04A 1CXZB 3LNMB 2GV9A 4EGIA 3KCYA 2BTOA 4LBEC 2RDCA 3N2GB 4I55B 4DR7B 4JV5O 2X7RB 5JVDB 3I5DA 4GEEA 3FAVB 1H8HG 2FL4A 4JF3A 4HY1A 5FNFA 3T4DA 3ZKBA 2VWJA 1Y74B 3RYHB 3ABKB 1ZTEA 4PDVA 1E79G 1HW7A 1Y67A 4FLVA 2OCHA 1S72V 4L90A 5FWKA 1RSOB 2ZIMA 3JD0A 2F95B 2DWEC 3STLC 1TIDA 2WI6A 1ZWHA 4I0XB 5FLXN 4XIRA 3VHCA 4DV3B 3J81N 4ZIBA 1I5BA 1FAFA 2BYHA 4DRXB 4WBNB 3T1YB 4O4IB 4BQJA 4LWEA 1Z5AA 1UY7A 2HR3A 2YIDA 4JAUA 3JYCA 3T2SA 1S76D 2DMXA 3BABA 5EIBC 3CSXA 3GB7C 4CS3A 4EKWA 2YXYA 4JAAA 4PELA 2ZBKB 1TUEB 5B1BC 3INXA 4OPAA 5F3KA 4MVQA 3ABLC 4CWFA 4U93A 4J7ZA 3RLPA 3M99B 5KUKA 2BTZA 5IDJA 2EINB 2UXNA 5KHJA 2PNRA 2BTQB 4CS2A 1S16A 2EILC 4H7QA 1PD3A 4X62B 1V55C 2ITCC 2EIMB 2ZKJA 4FPPA 2F43G 2FWYA 1ZL8B 1P7BA 2PZSA 3GWKC 2HG1A 1PNKA 2UXCO 1KYOF 1QHTA 3T0ZA 4KFMA 3TXSA 1Q90D 4R3MA 3K5LA 4DV1B 3ZJZA 1K4DC 4I7ZB 3SPIA 4UCOA 4NTXA 1Y6XA 3CEIA 3S5TA 1PL0A 5GONA 5DN6G 2UUAB 4LWIA 3H1IH 4Z1VA 3CC2V 1YHQV 1PL4A 5KX5A 2VCIA 3RGBA 3C90A 4IL6Z 3C3SA 4CE2A 4NXMO 3H80A 4LH7A 3JZ3A 4V25A 2JIZG 1BXDA 1US7A 2YEHA 5JWPA 4NH7A 3EVKA 2AGAA 2A0LA 5D7RA 2ZE8A 3AG1B 1Q3EA 2BOCC 1JFFA 1ZSPA 5L3DA 2L6LA 2F4VB 4I5SA 2YEJA 3CRAA 4MVUA 4J80A 4L94A 5IY5B 1THZA 2NLJC 2XABA 3FT8A 4F6EA 3HYZA 4PL9A 2JS3A 3NXSA 1I59A 1KIJA 3OWDA 1OCOC 1A4HA 1OJHA 4MPEA 1EM1A 4TQFA 3VBBA 1WA8A 5IJ9A 1IVSA 3A8TA 2WEQA 2H8PC 4X65O 3CRMA 3OMUA 3B4SA 1URFA 1WPXA 5BZBA 2KQXA 1YC3A 2WLNA 3RWRD 1OCZC 5B1AC 2UUCO 2FXSA 2WA4A 3SJAC 1K8AW 5CTUA 2W0XA 3H9VA 3JAMN 1N32B 5E1AC 4LP8A 3KE6A 2AZ0A 4GX0A 2V1DA 2A3QA 2YE4A 3LSSA 4G27B 2OWOA 4GKJO 4PRVA 1JX9A 3ZXOA 4XKOA 4V26A 4JI0O 2Q69A 3OW2U 3CWVA 2G38A 1JOYA 3ABTA 1UJWB 2P67A 3LDCA 4B7PA 4DO2A 2CTWA 3HKCB 1NR7A 1G1XB 1WB7A 2Q8HA 1IXBA 1EFRG 1Y4MA 4IIJB 4WFGA 1YVWA 1IBLB 3OMAB 2DJVA 3IC9A 1EI1A 3SPJA 4B3SO 1NZ6A 3VHDA 3T2MA 1JJOA 5KAFZ 4YKZA 1H8EG 5LHGA 4F6RB 1R6KA 1WPBA 4J10A 3B8MA 1GK9A 5JH7B 3U0ZA 1HNZB 3APOA 1YI2V 4E2LA 4HNAA 4MW8A 3S3XA 1Y4UA 4U7NA 3K5MA 2XDXA 4O2BB 2JS5A 1P84F 1Z5CA 3UM7A 1L8DA 1XMQB 1ROPA 3CS5A 4AWOA 2EIMC 1H2NA 1K5QA 1DK1A 2IH1C 1F23A 4DV6B 2IJIA 2UXBO 2WPDG 2DOSA 3HKDB 4ZOLA 2K9PA 4NXNB 3UT5B 2IJJA 3HR0A 3HKEB 1SKVA 4TSFG 5B1OA 1WNSA 3HZ1A 3O65A 2YEGA 4YIPA 4IHJB 2Q6AA 2DE0X 1XILA 1EBOA 5CF0A 4RAIA 4LP0A 1J5EO 5JENA 4X1KA 1AI5A 1GJVA 1ZWIC 3AG2C 5EIBD 2DQ0A 1UYCA 1JJ2U 1KD1W 1IDSA 3HEKA 3OFNG 1HWYA 3G71V 2Y69C 3R65A 2P7TC 3ZHUA 3AG7A 1VQ4V 2ZDIA 3N2KA 3RLRA 3PEHA 2WLMA 1W59A 1NBMG 3DC6A 2YGAA 2ZXWB 1Y8PA 4KSHA 5IY5C 4EGHA 4KSGA 3AEIA 3CRKA 4BIZA 2LFSA 5H6RA 1PNMA 3ZN1A 3SGIA 2OTLV 3JAWB 3MDSA 1PNLA 4B08A 3CYOA 3D3IA 1UY9A 2WI5A 1Q6IA 3SDLA 1N33B 4RQEA 2D2CB
chains in the Genus database with same CATH topology
4FMTA 2YECA 3MD0A 4PDMA 3SL2A 4YKRA 5EBMC 1BHAA 3OMIB 3F7YC 1QCEA 1UYIA 1BYQA 2XDLA 5D6PA 1YIJV 1NJIW 2BOBC 5CPHA 1M57C 2HKOA 4XDKA 3CGZA 3ZN0A 1VQPV 4CWOA 2YE2A 2CCTA 2XHTA 2BU2A 4BXIA 2HLDG 5CBHA 1AJNA 4XITA 4BIUA 4MPNA 2PI4A 5KA6A 3QO8A 2XNDG 2ZDXA 4YKTA 4UVBA 2EXLA 2BU6A 2JKIA 4E02A 2BU8A 2QFOA 2QA4V 3TZ5A 2HVJC 1THNA 3CC4V 1BL8A 2JEXA 3ZKDA 3CCSV 1DLBA 1DF5A 3AG4B 5FNDA 4MT8A 3TZ2A 3C0EA 1FS0G 2BREA 3WQ9A 5B3SB 1ID0A 3VOUA 1AI4A 2XAJA 4BW5A 5IYDO 3A0TA 1MOFA 3E83A 5LGNA 4CZZA 1JCHA 2YI7A 4PA4A 3MHHC 3FB5C 1DF4A 2MK3A 3FYEB 2XDSA 3OPDA 2ZXWC 2QEXV 2ATKC 1RM1C 1H7UA 4WUDA 3RKZA 4JTDB 2YJXA 3R4PA 5M4KA 2XAQA 4PDLA 5CTWA 4MBCA 1UY8A 3ZMSA 2UWDA 3ABMC 2YE3A 3JD2A 3W7TA 5M4MA 4QNHB 2VCJA 3LPSA 1J95A 4GX2A 2QKSA 3ZIAG 1B62A 1MABG 4PDRA 2QM7A 5M4NA 1YTFB 4QPJA 2CH4A 4CWRA 1RPRA 1G8MA 3ASOC 3K04A 1K5SA 4X88A 2QG2A 1K97A 4UXNA 1Q81W 1N8RW 1F4NA 2CK3G 3QO7A 3ZMVA 2IJHA 2Y48A 2OT5A 4XTJA 2WWWA 1YSRA 1KECA 4CWTA 1OCRB 3UKMA 2BU7A 4YKQA 5D7CA 1M9NA 3B77A 1I5AA 1BKNA 3WFVA 1R3LC 1OSFA 3DTUB 2YKJA 1Y8OA 5HFLA 2W6JG 1NHJA 1GM8A 1FFTB 3CCLV 1GMGA 1KP3A 1TC6A 4GFNA 1QZRA 1UYKA 3CP1A 1AMWA 3A0XA 4PA9A 3T10A 2K5BA 2Q67A 2IWUA 3K3WA 1TH8A 4I9WA 2WERA 4XC0A 2ZD9A 3FV5A 2IWSA 4F4LA 2JJCA 5M4PA 3PJSK 3CMAV 1NVPB 4QIWF 2YKIA 3OR6C 3AG4C 3T1KA 1Z59A 3B25A 1UYDA 1FXHA 2VWCA 3RBZA 4QPKA 3ZRWA 1FXKC 4PA3A 2Z5UA 1AH6A 1GO3F 3FKSG 3LDDA 1Q82W 5IN9A 1VQ7V 1AH8A 2WI1A 2ZR3A 1YT0A 1TILA 2CCSA 3B24A 1UYGA 4O07A 3P32A 5M4HA 1G4YB 3E8FA 2WLLA 3JD4A 4XKKA 3F5WC 5BODA 2YKEA 2FTKA 3K06A 1MU5A 3OAAG 3SPHA 4BAEA 4FCQA 3HZ5A 3K08A 4MTGA 3BM9A 3OUSA 3OEEG 1K7DA 4EGKA 3CCRV 4ASGA 3EHBB 2ZDYA 2YE9A 3CPWU 5FL7G 3U67A 2Q2EB 3G7BA 2WLJA 3QO5A 2B1IA 5EK0A 4CWQA 4FCRA 1U0ZA 2XDKA 5EC1C 1L1FA 4GGLA 4GT1A 1NH2B 1E1RG 3GIGA 3ML0A 4AWQA 3O6OA 1JPXA 4YKUA 2IW5A 3CCUV 4G28B 3CCQV 2DYRC 5L3BA 4WFEA 1SETA 2YGEA 1NHHA 3GIFA 2OCCB 5H6QA 4JQLA 3R4MA 1R3IC 3ZRXA 3INWA 4Q20A 1YC1A 4ZVIA 2YSUB 2IOQA 3R91A 4XDJA 3IEDA 1YSCA 1M90W 3E8GA 4WF9V 4GX5A 2YI5A 3E8BA 1TC0A 5J9PC 2YEDA 4AS9A 2YI0A 2JJ1G 3H01A 4CWNA 1KQSU 4MVOA 3LDEA 1K92A 3BEHA 3HPLC 1SESA 2IOPA 3CC7V 3ABKC 3TCUA 2WI3A 4HYMA 4EMVA 1QY8A 4R1FA 1NQTA 3FB6C 1YS3A 5CN0A 1MG1A 2YK9A 1NHIA 2IWXA 4JPRA 4HYOA 3WHAA 2P90A 1VQOV 1VQ6V 3IC7A 5CTYA 2IH3C 3B26A 4MPCA 5L3GA 2GQPA 3O0IA 4E01A 2EIKB 3ZRVA 3K0DA 2XK2A 5IDMA 3GIEA 1GTOA 4FCPA 3DGEA 2HVKC 2EINC 4P9OA 4PU9A 1VQMV 4QE7A 1QLEB 2JJ2G 3SYCA 2IJKA 3JD1A 2XD6A 2BU5A 1W2BU 2EZOA 1KP2A 1XL6A 3ZMZA 4JAVA 1UYHA 3U2KA 4DUHA 2YEVA 3SYQA 2XOKG 3T0HA 1Z5BA 1YSZA 3P30A 4HZ3A 4XE2A 1EZJA 1UYFA 4EM7A 2WI7A 4HZ5A 4BAYA 3ZRWB 2EJRA 4CBCA 4WFBV 3HHUA 1YTFD 1OCCB 3AG1C 1M1KW 1H7SA 2HJFC 3FB8C 2YE5A 4QJFB 4H37A 2YK2A 3VHAA 2X0LA 4UVAA 4L91A 1YT1A 3R92A 4W7TA 2XJXA 3ASNB 4R7CA 4JGSA 3OR7C 5L3CA 4UROA 3T1CA 2XHXA 1R3KC 4Z1MG 3ETDA 4BQGA 2IU3A 5L3FA 2BSMA 4UV8A 1M56B 1U2OA 4GCZA 3OM3B 1QR9A 4RUFA 2QTOA 3SYOA 2UXXA 1R3JC 2V7QG 4LWHA 4KTNA 3TZ4A 3CCJV 3GIGB 5HFMA 2WLKA 1UYEA 3SJQC 2GSMB 2EIKC 3STZC 3W7UA 4LWGA 2GHYA 1Y8NA 1S77D 1V54B 1I5CA 3Q5JA 2XAFA 4LCUC 3A0YA 4H85A 2D3OW 1Y4SA 1YETA 4YKYA 3TTZA 4NH8A 4CE3A 3FYIB 4J9YB 4ZBMA 3EHJA 4KUMA 3E35A 1TBWA 1H38A 3JCZA 5KA5A 5DM6V 2YEEA 1AM1A 2HFEC 1YERA 3U2DA 2CCUA 3OW6A 4B6CA 1AI7A 3ZXQA 4R50A 4N21A 4HY6A 3VADA 4YKXA 2WEPA 2CG9A 1S14A 1OCCC 1GKXA 2QE7G 2H8MA 2DWDC 4LPBA 4XDLA 3CMEV 3D0BA 1WLEA 1QBZA 3GWOA 5LGTA 4X8AA 4ASUG 1YITV 4TT3G 2P6JA 2XJGA 2A79B 1F4MA 2YE8A 3W7WA 1AR1B 5BOCA 2AHZA 1QR8A 5LBQA 3T4ZA 1W0KG 5B1BB 4PA6A 3B28A 1CP9A 2O1WA 3ABLB 3X2QB 4RO2A 3SYAA 5GGZA 2R9IA 2YEIA 4HXWA 1V55B 3FT5A 3W7XA 4WUBA 1COWG 1R73A 4NH9A 2YEVB 4MTOA 4P9PA 1I58A 1P4RA 3G7EA 2ESAA 1Q7YW 4HXZA 2ZR2A 2H55A 1AROP 3EHFA 1CEZA 1YT2A 2DQ3A 1QVGU 2O1VA 2PI5A 5H9CA 4ASFA 2XX4A 4MVMA 2EIJB 4GX1A 4MS2A 1Y66A 1R62A 2X6BA 4EEHA 5B1NA 4O05A 4DXWA 2AKPA 5B3SC 2YGFA 1UY6A 2XDUA 1VQ5V 1OCZB 5B1AB 5D6QA 1L0OA 2XHRA 2B5UA 1UYMA 1PVGA 2WI4A 5GW7A 1S0VA 1KZNA 4PA7A 3SPCA 3PEJA 1RPOA 5F5RA 1BMFG 1JM6A 1YESA 4MTXA 2EZPA 1K33A 1GM9A 3I55V 3IGAC 3QTFA 2W0FC 1IXMA 1Q86W 1B63A 1PKXA 4MP2A 2XJJA 3ETEA 2HG5C 2IORA 3X2QC 4ASBA 4FK5C 2QF6A 1AJ6A 3TK1A 3LSQA 5J6AA 3EFFK 2YKBA 1OCRC 3HB3B 4JTAB 2A9HA 3CXCU 4MVSA 2Q68A 4KP4A 5CMUA 4MTFA 3E89A 5CTXA 3D2RA 3OUFA 4H81A 2WLIA 5D7DA 2YJWA 4UV9A 2ZDIC 3TZ0A 3AG2B 3OE7G 3O2FA 1XL4A 2Y69B 1QLNA 2KB1A 3B8NA 2XAHA 2WAMA 4FJCC 2QG0A 2EIJC 4P7AA 4TWKA 4RQFA 2X6AA 3LNUA 1JQ0A 4MP7A 2R9RB 3ZMTA 2BRCA 1K34A 3K03A 4X89A 2FYPA 3F7VC 4PRXA 1E1QG 2DW4A 1VQKV 4H33A 4HZ0A 1FXKA 4MB9A 3WG7B 5EBWC 2GFDA 4YXWG 3BY6A 2M7WA 2NNUA 5IYCO 2E0AA 3ZM7A 1LNQA 3EKRA 1I5XA 1KKDA 3ZCCA 1B3QA 5L3JA 3Q5KA 4URMA 4CWPA 4RUEA 4R3AA 1JVMA 1ZXMA 5LGUA 4XBFA 1M57B 2YI6A 2HCHA 1OHHG 5IYBO 1B6QA 3R4OA 5EC2C 1GKZA 3RVYA 4X9LA 4L8ZA 5CBGA 4HYPA 1GKFA 1QYEA 1SRYA 3CCEV 1AI6A 2BYIA 5CBFA 2O1UA 2Z3YA 3K9AA 4YKWA 4CE1A 1NR1A 3HYYA 1QVFU 1VQLV 2XCMA 2OCCC 3D36A 2OTJV 3QNEA 3B27A 4L87A 3CD6V 4P30A 2JEUA 3NMQA 1H2GA 4MOTA 3TETA 1SERA 4WFAV 4O0BA 1K3EA 3CRLA 3AG3B 4AWPA 4KFGA 3G4SV 2DYSB 2WLLB 4G2KA 3EKOA 1EA6A 2W6IG 2Q8IA 2YE6A 3OGCC 3K99A 2IU0A 1RM1B 4URLA 4R8CA 1BHBA 4EFUA 3ZMUA 4K4OA 1BGQA 5M4EA 3K97A 4ZKIA 1FXVA 3ABMB 2FWZA 2CGFA 2C2AA 4UUJC 3R4NA 2QM8A 4WFFA 3WG7C 3RLQA 2ZQMA 3BMYA 3SPGA 3LUTB 1MX0A 3K98A 3ASOB 1ZW9A 2XX2A 4P2ZA 4JYCA 1VQ9V 4WCEV 3K0GA 4MSWC 1NVPD 4U7OA 4ASAA 1I5YA 1K4CC 1OZ0A 3FB7C 4GQTA 4LWFA 5LHHA 3ETGA 4GT8A 1ZXNA 3CCVV 2ITDC 2WLIB 1QLEC 1KC8W 2XASA 5CA3A 4JTCB 4XDMA 4XD8A 3E8HA 4UVCA 3OMNB 1MSWD 3A0ZA 4MVZA 4XIPA 4L93A 2Q8FA 2WI2A 2EBOA 5L3EA 2JDIG 1I5DA 1YC4A 4R6ZA 3E2EA 5J71A 2X6CA 3OWBA 4DZYA 1AJPA 3QDDA 4N23A 3IFXA 4OXSA 3G75A 1YJ9V 1YJWV 1GM7A 1FXKB 3CGYA 4MVRA 4I3HA 1YJNV 1W0JG 3AG3C 2DYSC 2WLHA 1K73W 3ASNC 1NH2D 3JD3A 2HKJA 2YEFA 5FNCA 2VW5A 3EHGA 4XIQA 5EBLC 4JYBA 1S5HC 4XCLA 3KG2A 2LP7A 2B1GA 1DTOA 5KUMA 1ORQC 2YEBA 4P8OA 2WSSG 4XCJA 2Q8GA 3EHHA 1ENVA 4O09A 1SZTA 4WUCA 2XAGA 3MHSC 3K79A 2AHYA 1M56C 5C93A 3MNRP 1NKDA 3OEHG 2EILB 1UYLA 3H4LA 1CPYA 4E00A 3TUHA 4QE9A 4LC1A 2YKCA 2JK5C 1VQNV 4J9ZB 3SYPA 3E86A 5LHIA 4FIPC 1R6NA 2BT0A 2K1EA 1V54C 3RVZA 1F51A 1K9MW 2LFRA 3C11A 4KQVA 2DYRB 2BZ5A 1S3JA 4XKAA 3Q5LA 3ABUA 1VQ8V 3RW0A 3I56V 3CCMV 3A0RA 1AJQA 4CWSA 2YEAA 3A0WA 4MW3A 4EFTA 3K60A 4HAMA 2YE7A 3ZRSA 3W7SA 2H94A 2XX5A 1OCOB 4WFHA 3G6EV 4JASA 4URNA 4O04A 3LNMB 4EGIA 4LBEC 2X7RB 4GEEA 1H8HG 4JF3A 4HY1A 5FNFA 3T4DA 3ZKBA 3ABKB 4PDVA 1E79G 1S72V 4L90A 5FWKA 3JD0A 2DWEC 3STLC 1TIDA 2WI6A 1ZWHA 4XIRA 3VHCA 1I5BA 2BYHA 4BQJA 4LWEA 1Z5AA 1UY7A 2HR3A 4JAUA 3JYCA 3T2SA 1S76D 3GB7C 4EKWA 2ZBKB 4PELA 1TUEB 5B1BC 3INXA 5F3KA 4MVQA 4CWFA 3ABLC 4U93A 3RLPA 3M99B 5KUKA 2BTZA 5IDJA 2EINB 2UXNA 2PNRA 1S16A 4H7QA 2EILC 1PD3A 1V55C 2ITCC 2EIMB 2ZKJA 4FPPA 2F43G 2FWYA 1P7BA 2HG1A 1PNKA 3T0ZA 4KFMA 4R3MA 3ZJZA 1K4DC 3SPIA 1PL0A 5DN6G 4LWIA 3CC2V 1YHQV 2VCIA 4CE2A 3H80A 3JZ3A 4V25A 2JIZG 1BXDA 1US7A 2YEHA 4NH7A 2A0LA 5D7RA 3AG1B 2BOCC 5L3DA 4I5SA 2YEJA 4MVUA 4L94A 5IY5B 1THZA 2NLJC 3HYZA 2XABA 3FT8A 4PL9A 3NXSA 1I59A 1KIJA 3OWDA 1OCOC 1A4HA 4MPEA 3VBBA 2WEQA 2H8PC 3OMUA 1WPXA 5BZBA 1YC3A 2WLNA 1OCZC 5B1AC 2FXSA 1K8AW 5CTUA 5E1AC 4LP8A 3KE6A 4GX0A 2V1DA 2YE4A 3LSSA 4G27B 4PRVA 1JX9A 3ZXOA 4XKOA 4V26A 2Q69A 3OW2U 3CWVA 1JOYA 3ABTA 1UJWB 2P67A 3LDCA 4B7PA 4DO2A 1NR7A 2Q8HA 1EFRG 1Y4MA 4WFGA 3OMAB 1EI1A 3SPJA 3VHDA 3T2MA 4YKZA 1H8EG 5LHGA 1R6KA 3B8MA 1GK9A 1YI2V 4E2LA 4MW8A 1Y4UA 4U7NA 2XDXA 1Z5CA 3UM7A 1ROPA 4AWOA 2EIMC 1K5QA 2IH1C 1F23A 2IJIA 2WPDG 2IJJA 4TSFG 5B1OA 3HZ1A 2YEGA 2Q6AA 5CF0A 1EBOA 4RAIA 4LP0A 1AI5A 1GJVA 1ZWIC 3AG2C 2DQ0A 1UYCA 1JJ2U 1KD1W 3HEKA 3OFNG 1HWYA 3G71V 2Y69C 3R65A 2P7TC 1VQ4V 2ZDIA 3RLRA 3PEHA 2WLMA 1NBMG 2YGAA 2ZXWB 1Y8PA 4KSHA 5IY5C 4EGHA 4KSGA 3AEIA 3CRKA 4BIZA 2LFSA 5H6RA 1PNMA 3ZN1A 2OTLV 1PNLA 3CYOA 3D3IA 1UY9A 2WI5A 4RQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMT A;  1UYM A;  4R1F A;  2YEC A;  1PVG A;  2WI4 A;  1YS3 A;  3MD0 A;  2YK9 A;  2YEB A;  1NHI A;  2IWX A;  1KZN A;  3SL2 A;  3PEJ A;  5F5R A;  1JM6 A;  4YKR A;  4P8O A;  3WHA A;  4XCJ A;  2Q8G A;  1YES A;  3EHH A;  4MTX A;  4O09 A;  4WUC A;  1UYI A;  1BYQ A;  3QTF A;  1IXM A;  1B63 A;  5CTY A;  2XDL A;  3B26 A;  5D6P A;  4MPC A;  5C93 A;  3MNR P;  4MP2 A;  2GQP A;  3O0I A;  4E01 A;  3H4L A;  1UYL A;  3ZRV A;  4E00 A;  2XJJ A;  5CPH A;  3TUH A;  3CGZ A;  2XK2 A;  5IDM A;  3GIE A;  4LC1 A;  2YKC A;  4FCP A;  2IOR A;  3DGE A;  4ASB A;  4CWO A;  2YE2 A;  2CCT A;  2QF6 A;  1AJ6 A;  4PU9 A;  2XHT A;  2BU2 A;  4BXI A;  3TK1 A;  2BT0 A;  4XIT A;  5J6A A;  2YKB A;  2XD6 A;  1F51 A;  4BIU A;  2BU5 A;  4JAV A;  2LFR A;  3C11 A;  4KQV A;  4MPN A;  1UYH A;  3U2K A;  2BZ5 A;  4KP4 A;  4XKA A;  4DUH A;  3Q5L A;  2ZDX A;  4YKT A;  3T0H A;  1Z5B A;  2BU6 A;  2EXL A;  2JKI A;  5CTX A;  4E02 A;  1YSZ A;  2BU8 A;  3D2R A;  3A0R A;  2QFO A;  4H81 A;  4XE2 A;  4CWS A;  5D7D A;  2YEA A;  2YJW A;  3A0W A;  1UYF A;  3TZ5 A;  4EM7 A;  1THN A;  3TZ0 A;  2WI7 A;  4EFT A;  3K60 A;  4HZ5 A;  3ZKD A;  3O2F A;  3ZRW B;  2YE7 A;  5FND A;  4MT8 A;  3HHU A;  3TZ2 A;  2XX5 A;  2QG0 A;  3C0E A;  2BRE A;  4JAS A;  4URN A;  3WQ9 A;  4O04 A;  1H7S A;  4P7A A;  1ID0 A;  4EGI A;  2YE5 A;  3LNU A;  3VHA A;  2YK2 A;  3A0T A;  4MP7 A;  4L91 A;  1YT1 A;  3R92 A;  4GEE A;  4W7T A;  2YI7 A;  2XJX A;  4HY1 A;  2BRC A;  5FNF A;  3ZKB A;  2XDS A;  3OPD A;  2FYP A;  4PRX A;  1H7U A;  4URO A;  4WUD A;  4L90 A;  3RKZ A;  2YJX A;  5FWK A;  3R4P A;  4HZ0 A;  5M4K A;  4MB9 A;  2XHX A;  5CTW A;  4MBC A;  2GFD A;  1TID A;  2WI6 A;  4BQG A;  1ZWH A;  1UY8 A;  4XIR A;  3VHC A;  2UWD A;  1I5B A;  2E0A A;  2YE3 A;  3ZM7 A;  2BYH A;  3EKR A;  5M4M A;  3ZCC A;  2VCJ A;  2BSM A;  3LPS A;  1B3Q A;  4BQJ A;  5L3J A;  4LWE A;  3Q5K A;  1Z5A A;  4URM A;  1U2O A;  1UY7 A;  4GCZ A;  4JAU A;  1B62 A;  2QM7 A;  3T2S A;  5M4N A;  2CH4 A;  4QPJ A;  4CWR A;  4CWP A;  4R3A A;  2ZBK B;  1ZXM A;  4LWH A;  3INX A;  4KTN A;  3TZ4 A;  2YI6 A;  5F3K A;  2HCH A;  4CWF A;  2QG2 A;  4U93 A;  3GIG B;  3RLP A;  2BTZ A;  5IDJ A;  3R4O A;  1UYE A;  2PNR A;  1GKZ A;  4X9L A;  1S16 A;  4H7Q A;  4L8Z A;  4XTJ A;  4LWG A;  2WWW A;  1YSR A;  1Y8N A;  4HYP A;  1I5C A;  4CWT A;  1QYE A;  2ZKJ A;  3Q5J A;  4FPP A;  2BU7 A;  4YKQ A;  2FWY A;  5D7C A;  3A0Y A;  2HG1 A;  1I5A A;  1BKN A;  1OSF A;  4H85 A;  1Y4S A;  3T0Z A;  2YKJ A;  2BYI A;  1Y8O A;  4R3M A;  1NHJ A;  2O1U A;  1YET A;  1TC6 A;  4YKW A;  4GFN A;  1QZR A;  1UYK A;  4CE1 A;  3HYY A;  4YKY A;  3TTZ A;  1AMW A;  3A0X A;  4NH8 A;  4CE3 A;  3T10 A;  2K5B A;  2XCM A;  4LWI A;  3D36 A;  3B27 A;  2IWU A;  1TH8 A;  3EHJ A;  2WER A;  2VCI A;  4XC0 A;  1TBW A;  4CE2 A;  3FV5 A;  3H80 A;  2IWS A;  3JZ3 A;  4V25 A;  1BXD A;  2JJC A;  1US7 A;  3NMQ A;  2YEE A;  2YEH A;  1AM1 A;  4NH7 A;  1YER A;  3U2D A;  5M4P A;  5D7R A;  4MOT A;  2CCU A;  3OW6 A;  4B6C A;  4I5S A;  2YEJ A;  2YKI A;  4L94 A;  4O0B A;  3ZXQ A;  3CRL A;  3FT8 A;  2XAB A;  3HYZ A;  4KFG A;  1Z59 A;  3T1K A;  4AWP A;  4PL9 A;  3B25 A;  4HY6 A;  3NXS A;  1UYD A;  3VAD A;  4YKX A;  1I59 A;  2VWC A;  3EKO A;  1KIJ A;  2WEP A;  2CG9 A;  1S14 A;  4QPK A;  1A4H A;  1EA6 A;  3ZRW A;  3OWD A;  1GKX A;  4MPE A;  2Q8I A;  2YE6 A;  2H8M A;  1AH6 A;  2WEQ A;  4LPB A;  3K99 A;  4URL A;  3OMU A;  5IN9 A;  3D0B A;  4EFU A;  1AH8 A;  1YC3 A;  2WI1 A;  4K4O A;  1YT0 A;  2FXS A;  5CTU A;  1BGQ A;  1TIL A;  2CCS A;  3B24 A;  1UYG A;  4O07 A;  3P32 A;  5M4E A;  5M4H A;  3K97 A;  4ZKI A;  3KE6 A;  4XKK A;  2XJG A;  2FWZ A;  2YE4 A;  2CGF A;  2C2A A;  4PRV A;  3R4N A;  3ZXO A;  4XKO A;  2QM8 A;  2YE8 A;  5BOD A;  4V26 A;  2YKE A;  2FTK A;  3CWV A;  3RLQ A;  5BOC A;  1JOY A;  3BMY A;  2P67 A;  4B7P A;  2Q8H A;  1MU5 A;  1MX0 A;  4BAE A;  3K98 A;  4FCQ A;  3HZ5 A;  1EI1 A;  3B28 A;  3BM9 A;  3VHD A;  2O1W A;  1ZW9 A;  4YKZ A;  4EGK A;  2XX2 A;  4ASG A;  4JYC A;  5GGZ A;  2ZDY A;  4U7O A;  2YEI A;  4HXW A;  2YE9 A;  4ASA A;  3FT5 A;  3U67 A;  4GQT A;  4LWF A;  4WUB A;  1Y4U A;  4U7N A;  2Q2E B;  3G7B A;  2XDX A;  4NH9 A;  4CWQ A;  4FCR A;  1U0Z A;  4GT8 A;  2XDK A;  1I58 A;  1Z5C A;  1ZXN A;  3G7E A;  2ESA A;  4GGL A;  4GT1 A;  3GIG A;  4HXZ A;  4AWQ A;  4AWO A;  3O6O A;  4YKU A;  2H55 A;  3EHF A;  4XDM A;  4XD8 A;  1YT2 A;  3A0Z A;  2YGE A;  1NHH A;  4XIP A;  4L93 A;  3GIF A;  5B1O A;  2Q8F A;  2WI2 A;  4JQL A;  3HZ1 A;  3ZRX A;  2O1V A;  3R4M A;  2YEG A;  3INW A;  4Q20 A;  1YC1 A;  4ZVI A;  5CF0 A;  2IOQ A;  3R91 A;  1I5D A;  4LP0 A;  1YC4 A;  4ASF A;  3IED A;  1GJV A;  5J71 A;  2XX4 A;  1UYC A;  3OWB A;  3HEK A;  4DZY A;  3QDD A;  2YI5 A;  1TC0 A;  3RLR A;  1R62 A;  3G75 A;  3PEH A;  4EEH A;  5B1N A;  2YED A;  4AS9 A;  4O05 A;  2YI0 A;  2YGA A;  3CGY A;  2AKP A;  4CWN A;  2YGF A;  4I3H A;  1Y8P A;  4KSH A;  4EGH A;  1UY6 A;  2XDU A;  4KSG A;  3CRK A;  2IOP A;  4BIZ A;  2LFS A;  2HKJ A;  2YEF A;  5FNC A;  1UY9 A;  2WI3 A;  2VW5 A;  2WI5 A;  3EHG A;  4XIQ A;  5D6Q A;  4HYM A;  1L0O A;  4JYB A;  2XHR A;  4XCL A;  4EMV A;  1QY8 A; 
#chains in the Genus database with same CATH topology
 4FMT A;  2YEC A;  3AK1 A;  3MD0 A;  5BMV B;  5FNV A;  3JCU Z;  4PDM A;  3SL2 A;  4YKR A;  5EBM C;  1BHA A;  3OMI B;  2BE3 A;  1Y76 A;  3F7Y C;  3IJ4 A;  4GLX A;  5LP6 B;  1QCE A;  1UYI A;  1MA1 A;  1BYQ A;  2GUZ A;  4U3F H;  2QKA A;  2XDL A;  5D6P A;  2YUA A;  3RYF A;  1YIJ V;  1NJI W;  2LQT A;  3L72 H;  2BOB C;  1HNW O;  5CPH A;  1MSD A;  1M57 C;  2HKO A;  3BHP A;  3CJH A;  4XDK A;  4EFB A;  3CGZ A;  1Z2G A;  3ZN0 A;  1AR5 A;  1VQP V;  4CWO A;  2YE2 A;  2CCT A;  4LFB O;  3CX5 F;  2YC0 A;  2QDO A;  2HP8 A;  2XHT A;  2BU2 A;  4BXI A;  2HLD G;  3QG5 A;  5CBH A;  1AJN A;  4XIT A;  4JZG A;  3L73 H;  5GON B;  2P4V A;  4BIU A;  4MPN A;  2PI4 A;  2R70 A;  2KG7 A;  4DR1 B;  3CRR A;  5KX5 B;  5KA6 A;  3QO8 A;  2XND G;  2ZDX A;  4YKT A;  2P5O A;  4UVB A;  2EXL A;  2BU6 A;  2JKI A;  4E02 A;  1QNM A;  2BU8 A;  3P3N A;  2QFO A;  2WA3 A;  2CH7 A;  3ETQ A;  2QA4 V;  5KMG A;  3TZ5 A;  4DUZ B;  2HVJ C;  1THN A;  5BR8 O;  3CC4 V;  1BL8 A;  4J7K A;  2JEX A;  3ZKD A;  3CCS V;  4TOI A;  1DLB A;  1HR0 B;  4PV1 B;  1LUV A;  4NTY A;  1HNX O;  1DF5 A;  3AG4 B;  5GTH Z;  5KHK A;  2PUS A;  5IJ9 B;  5FND A;  4MT8 A;  3TZ2 A;  1RP3 B;  3C0E A;  1FS0 G;  2BRE A;  3WQ9 A;  5B3S B;  4OGQ B;  5JJJ B;  1ID0 A;  4EFE A;  1SQV H;  3VOU A;  1AI4 A;  4LF8 B;  2XAJ A;  4O2A A;  3FD9 A;  4BW5 A;  2XUM A;  5IYD O;  1MOF A;  4YHH O;  3A0T A;  3E83 A;  4LF9 O;  4LF5 B;  5LGN A;  3RT3 C;  4CZZ A;  1JCH A;  2YI7 A;  4PA4 A;  3MHH C;  4DUY O;  4B3T B;  3FB5 C;  1DF4 A;  2MK3 A;  3BA8 A;  4DV0 B;  4C7U A;  3FYE B;  2XDS A;  3OPD A;  3J7A U;  2ZXW C;  2QEX V;  2R9A A;  2ATK C;  1RM1 C;  1H7U A;  4WUD A;  4JTD B;  2YJX A;  3RKZ A;  3R4P A;  5M4K A;  2XAQ A;  4PDL A;  5CTW A;  1IX9 A;  4MBC A;  3A0H Z;  3K58 A;  3ZHV A;  1UY8 A;  2Q0O C;  4DV2 B;  3ZMS A;  2UWD A;  4AQY B;  3ABM C;  4DR2 O;  2YE3 A;  3JD2 A;  3W7T A;  1WB8 A;  5IYZ A;  5M4M A;  4QNH B;  2VCJ A;  1VF7 A;  3LPS A;  1J95 A;  2UXD B;  1ZX3 A;  4GX2 A;  3WU2 Z;  4HNA B;  2QKS A;  3ZIA G;  1B62 A;  1MAB G;  4PDR A;  2EX3 A;  2QM7 A;  5M4N A;  1YTF B;  4QPJ A;  2CH4 A;  4CWR A;  3D3Q A;  1RPR A;  2C1I A;  1G8M A;  5LP6 C;  2GDS A;  3CE2 A;  2MW2 B;  1I08 A;  2N74 A;  4LWS B;  3EXA A;  5A9G A;  3ASO C;  3K04 A;  1K5S A;  4X88 A;  2QG2 A;  1K97 A;  4UXN A;  1Q81 W;  1N8R W;  4DV7 O;  2BSK A;  1F4N A;  2GBO A;  4DV5 B;  2CK3 G;  3RN4 A;  3QO7 A;  3ZMV A;  2VWK A;  3VQV A;  2IJH A;  2CGO A;  2Y48 A;  2OT5 A;  4XTJ A;  1N34 O;  2WWW A;  4UB6 Z;  4JI2 O;  1YSR A;  1KEC A;  2ZNI A;  1HDJ A;  5IT9 N;  4CWT A;  1OCR B;  3UKM A;  2BU7 A;  4YKQ A;  5D7C A;  1H2K A;  1M9N A;  3B77 A;  2UU9 B;  1I5A A;  1BKN A;  3WFV A;  1R3L C;  1OSF A;  1TUB A;  3DTU B;  2YKJ A;  4UB8 Z;  2LO1 A;  1Y8O A;  5HFL A;  2W6J G;  1NHJ A;  1GM8 A;  1FFT B;  1MZE A;  3CCL V;  1GMG A;  1KP3 A;  4DR3 O;  1TC6 A;  4GFN A;  1QZR A;  1UYK A;  3CP1 A;  4U3J A;  1AMW A;  3A0X A;  3SJB C;  4PA9 A;  3T10 A;  2K5B A;  1SQB H;  2Q67 A;  1PV0 A;  4FVM A;  2RCV A;  3N2K B;  2Q7H A;  2XHB A;  2YXH A;  2IWU A;  3K3W A;  1TH8 A;  1SQX H;  2YIC A;  4YIO A;  4I9W A;  2WER A;  4XC0 A;  4DV4 B;  2QGN A;  2ZD9 A;  3FV5 A;  1NTZ H;  4YJ3 B;  3ZHS A;  2IWS A;  1SA0 A;  2P06 A;  4F4L A;  2UXC B;  5JCO C;  2JJC A;  5CA1 A;  5M4P A;  3R66 A;  1S5J A;  3PJS K;  3CMA V;  1NVP B;  4D6T H;  4QIW F;  2YKI A;  5FPR A;  3OR6 C;  3AG4 C;  1LUW A;  3T1K A;  1Z59 A;  3B25 A;  4I4T A;  1VF6 C;  2NR5 A;  1UYD A;  1FXH A;  2VWC A;  3G80 A;  3RBZ A;  4QPK A;  3ZRW A;  1FXK C;  5EYP A;  4PA3 A;  2Z5U A;  1AH6 A;  5ITZ B;  2CTR A;  5FNV B;  1GO3 F;  1WJZ A;  4K8X A;  3FKS G;  3WB1 A;  3LDD A;  1I94 B;  1Q82 W;  5IN9 A;  4LNU A;  4NXM B;  5C8Y A;  1VQ7 V;  1AH8 A;  4GKK O;  2WI1 A;  3LMM A;  2ZR3 A;  1YT0 A;  2VQE O;  3TXQ A;  1TIL A;  2CCS A;  2HHI A;  1YDX A;  1UYG A;  3P32 A;  3B24 A;  1G4Y B;  1M4U A;  1WP7 A;  4O07 A;  5M4H A;  4YJ2 A;  3E8F A;  5IJ0 A;  2WLL A;  3JD4 A;  4XKK A;  2VRZ A;  3F5W C;  3RYF B;  2Q7G A;  2Q8V A;  1EN5 A;  2CE4 A;  5BOD A;  4JI3 B;  2FTK A;  3RYI B;  1IUR A;  2YKE A;  3K06 A;  3TJT A;  1JR9 A;  1XNR O;  3CJH B;  3SJC C;  3UO3 A;  1MU5 A;  3OAA G;  3SPH A;  4BAE A;  4FCQ A;  3HZ5 A;  5LOV A;  4X65 B;  3K08 A;  4MTG A;  3BM9 A;  4B3M O;  3OUS A;  3OEE G;  5AG2 A;  1K7D A;  3J80 N;  4EGK A;  2UUC B;  3CCR V;  3FFQ A;  4ASG A;  1Q43 A;  3EHB B;  2ZDY A;  3M7M X;  4PI2 A;  2HHH O;  2YE9 A;  2YI8 A;  3CPW U;  5FL7 G;  3U67 A;  4GKJ B;  2Q2E B;  2OIG A;  4JZ2 A;  3G7B A;  1Q6U A;  2WLJ A;  4IT5 A;  3QO5 A;  2B1I A;  4TQD A;  4H0L B;  5EK0 A;  2CTP A;  4FCR A;  4CWQ A;  1U0Z A;  4X1Y A;  2XDK A;  5EC1 C;  1F7Y A;  3T1H O;  5LA6 A;  1L1F A;  5LYJ B;  4GT1 A;  1NH2 B;  4GGL A;  1E1R G;  3L74 H;  3GIG A;  3ML0 A;  4AWQ A;  2CH7 B;  3O6O A;  1N36 B;  1P7G A;  1JPX A;  4YKU A;  4RWU A;  2IW5 A;  3CCU V;  4B3S B;  4G28 B;  3D36 C;  3CCQ V;  4GYC B;  2DYR C;  4LFA O;  3JAT B;  1Z5V A;  5L3B A;  3A2F A;  1SET A;  4FFB B;  4WFE A;  2YGE A;  1NHH A;  1B04 A;  3GIF A;  2OCC B;  5H6Q A;  1Q5O A;  2HJD A;  2PF4 E;  4JQL A;  3R4M A;  1R3I C;  3ZRX A;  5CB4 A;  3INW A;  4K35 A;  4Q20 A;  2O57 A;  1YC1 A;  4DR7 O;  4ZVI A;  2YSU B;  2IOQ A;  3R91 A;  2QWN B;  5CA0 A;  4XDJ A;  1GN2 A;  3IED A;  2YI9 A;  1YSC A;  1M90 W;  3E8G A;  4KHP O;  5F2V O;  4WF9 V;  4EB6 B;  4GX5 A;  2YI5 A;  4LF7 O;  4X66 O;  4IYI A;  2F93 B;  3E8B A;  4NTW A;  1TC0 A;  1SQP H;  5J9P C;  1L0N H;  1AP5 A;  2B9Z A;  3HKB A;  2UXB B;  1VMG A;  4H13 B;  3U11 A;  4J11 A;  2YED A;  4AS9 A;  2YI0 A;  2JJ1 G;  3H01 A;  4CWN A;  1KQS U;  1WN7 A;  4MVO A;  3LDE A;  1KMI Z;  1AP6 A;  3T1Y O;  5H2F Z;  4J41 A;  1K92 A;  3BEH A;  1FD9 A;  5LMU O;  3HPL C;  1J5E B;  4NVP A;  2Q5Z A;  1SES A;  1SS3 A;  2IOP A;  3CC7 V;  4UFZ A;  5IYZ B;  3ABK C;  3TCU A;  5EZY A;  2WI3 A;  3ZHQ A;  5IWA O;  3BPZ A;  2GTS A;  4HYM A;  2VQF B;  4EMV A;  1QY8 A;  4R1F A;  1NQT A;  1VF6 A;  2ZT9 B;  3FB6 C;  1IBM B;  1YS3 A;  5CN0 A;  1MG1 A;  5KHH A;  2QR4 A;  3JAL A;  2YK9 A;  4DW0 A;  2A7W A;  2AXT Z;  1NHI A;  2IWX A;  4JPR A;  4HYO A;  5JQG B;  3WHA A;  2P90 A;  1VQO V;  2PGG A;  1KBH A;  1MZF A;  2JGU A;  1VQ6 V;  4LR3 A;  3IC7 A;  4BIO A;  2YDE A;  3GVM A;  1JMK C;  5KHG A;  4OX9 O;  1MNG A;  4X20 A;  5CTY A;  2IH3 C;  4UCU A;  3ZX6 A;  3B26 A;  3JAK A;  4MPC A;  3JAR A;  5L3G A;  1GN3 A;  2GQP A;  3O0I A;  4E01 A;  2EIK B;  3CRC A;  3H1H H;  3ZRV A;  3K0D A;  1AR4 A;  5LXT A;  4NR1 A;  4EEQ A;  2XK2 A;  5IDM A;  3GIE A;  1N0J A;  1GTO A;  4FCP A;  3DGE A;  2HVK C;  2EIN C;  1RFY A;  2QTS A;  2ZKO A;  4P9O A;  4PU9 A;  2P22 C;  1VQM V;  3ZS8 C;  4U3J B;  4QE7 A;  3VQW A;  1QLE B;  2JJ2 G;  3SYC A;  2IJK A;  3JD1 A;  2XD6 A;  2BU5 A;  1W2B U;  4TV9 B;  2EZO A;  1KP2 A;  1XL6 A;  3ZMZ A;  4JAV A;  1UYH A;  3U2K A;  4ZHQ B;  3BA9 A;  4DUH A;  2YEV A;  3SYQ A;  4W4L A;  1HNW B;  2XOK G;  1SA0 B;  3T0H A;  3P3P A;  5D5P A;  1Z5B A;  2C1G A;  4AHC A;  1YSZ A;  3P30 A;  2Y4T A;  4HZ3 A;  4XE2 A;  2OYQ A;  4LFB B;  1EZJ A;  1UYF A;  1YZB A;  4EM7 A;  1LR1 A;  3JAS A;  2WI7 A;  4HZ5 A;  4BAY A;  1QQC A;  4JYA O;  1FJG B;  1D5N A;  4CH4 A;  3ZRW B;  1YF2 A;  2EJR A;  3CB2 A;  5EYP B;  4CBC A;  1U97 A;  4FLU A;  4HBN A;  4WFB V;  3HHU A;  4LFC O;  1YTF D;  3WB2 A;  3U10 A;  1OCC B;  2OIE A;  3BAA A;  3AG1 C;  3FX7 A;  1M1K W;  5C8Y B;  1H7S A;  2ZIN A;  2HJF C;  3FB8 C;  1S5L Z;  1UPG A;  4QJF B;  2YE5 A;  1KUQ A;  4H37 A;  2YK2 A;  3VHA A;  2ETN A;  4TUY A;  2X0L A;  4UVA A;  4L91 A;  1YT1 A;  3R92 A;  4W7T A;  1NU1 H;  4YJ2 B;  5IJ0 B;  1Q6H A;  3E22 A;  2XJX A;  1XDC A;  3ASN B;  4R7C A;  4OPH A;  1XRE A;  4B7E A;  4JGS A;  5BR8 B;  4YY3 O;  3OR7 C;  3G6B A;  3OTF A;  2ZE7 A;  3BFR A;  5L3C A;  4URO A;  3T1C A;  1HNX B;  2IBZ H;  4JI8 B;  2XHX A;  3OTO B;  3TGU H;  1R3K C;  4Z1M G;  3PN1 A;  3ETD A;  4O4L A;  5LOV B;  4BQG A;  4CS4 A;  2LW7 A;  4A5U B;  2IU3 A;  5JVD A;  1SF9 A;  5L3F A;  1HNZ O;  3QF7 A;  2ZE5 A;  2QWO B;  4B7K A;  3K9S A;  4YHH B;  4I50 A;  2BSM A;  4LF9 B;  4UV8 A;  4GUN A;  1Y74 A;  3RYH A;  4FLZ A;  4DR4 O;  4JI6 B;  1P49 A;  1M56 B;  1XHX A;  1U2O A;  2CDY A;  4GCZ A;  3OM3 B;  1QR9 A;  4RUF A;  1RSO A;  2QTO A;  3SYO A;  5LMN O;  2UXX A;  1XMQ O;  1R3J C;  2V7Q G;  2LW1 A;  4LWH A;  4KTN A;  5LA6 B;  2QWQ B;  3TZ4 A;  1TGO A;  4I0X A;  3CCJ V;  5BY1 A;  2CGN A;  3GIG B;  5HFM A;  2WLK A;  3OT7 A;  2F23 A;  1UYE A;  3SJQ C;  2Q7E A;  4B3R O;  2GSM B;  5FPO A;  2EIK C;  3STZ C;  3W7U A;  4LWG A;  2GHY A;  1Y8N A;  1G6U A;  1S77 D;  4O4J A;  1V54 B;  1I5C A;  4FLY A;  3Q5J A;  2XAF A;  1FFX A;  1OV9 A;  4LCU C;  4JI4 O;  3A0Y A;  4D7S A;  3ZED A;  2E5L O;  4H85 A;  1KB9 F;  2D3O W;  1Y4S A;  3ICX A;  2CUG A;  5GTI Z;  1EZV H;  2L35 A;  1YET A;  2RN9 A;  4L8J A;  1T5E A;  4YKY A;  1JFF B;  3TTZ A;  1KKC A;  4DV7 B;  4NH8 A;  4CE3 A;  3FYI B;  4IGG A;  3LSU A;  4J9Y B;  2HEP A;  4ZBM A;  4LF6 B;  3EHJ A;  4KUM A;  3E35 A;  1TBW A;  1WA8 B;  1H38 A;  3OGI B;  2ADQ B;  4DR6 B;  1FKA O;  3JCZ A;  1H2M A;  1R6T A;  5KA5 A;  5DM6 V;  2YEE A;  1AM1 A;  5A2Q N;  2HFE C;  1YER A;  3U2D A;  4CH5 A;  2CCU A;  3OW6 A;  4BW9 A;  1N33 O;  5KAI Z;  3M8A A;  4B6C A;  1AI7 A;  1DGS A;  4DR3 B;  3ZXQ A;  4R50 A;  4N21 A;  5EZY B;  3CWB H;  4HY6 A;  2F1M A;  5LL6 Y;  3L9D A;  3VAD A;  4YKX A;  3JSN A;  2WEP A;  2CTQ A;  3Q4H A;  1OCC C;  4LF4 O;  1S14 A;  2CG9 A;  1GKX A;  2QE7 G;  2H8M A;  3JAL B;  2DWD C;  2ARH A;  2UUB O;  4LPB A;  3CYG A;  4PHZ A;  4XDL A;  4J42 A;  3CME V;  3D0B A;  3CXH F;  1BCC H;  1ZAU A;  1WLE A;  1QBZ A;  3GWO A;  3UO2 A;  1QU7 A;  3ZHT A;  5LGT A;  4X8A A;  4ASU G;  2ZIO A;  4O4H A;  1YIT V;  4X20 B;  4TT3 G;  2P6J A;  2XJG A;  3JAK B;  1KU9 A;  1NI8 A;  1PM9 A;  4QGP A;  4JV5 B;  2JGD A;  2A79 B;  1F4M A;  2YE8 A;  3C3T A;  3W7W A;  1AR1 B;  5BOC A;  2AHZ A;  2QWP B;  5KLV H;  1QR8 A;  2LGW A;  2E75 B;  3T4Z A;  5LBQ A;  1BZK A;  5B5E Z;  4JI7 O;  1GRJ A;  1AIL A;  1W0K G;  4PD4 F;  5B1B B;  4PA6 A;  3B28 A;  1CP9 A;  2O1W A;  3ABL B;  4FM0 A;  3X2Q B;  3KKY A;  4RO2 A;  2VQE B;  4K0K O;  3SYA A;  5GGZ A;  3L71 H;  2LGQ A;  2R9I A;  2YEI A;  3UQ8 A;  4HXW A;  3KZI Z;  1V55 B;  3FT5 A;  3W7X A;  4NB5 A;  1ZUQ A;  4WUB A;  1COW G;  4ZOL B;  1R73 A;  1BS3 A;  4CH6 A;  4NH9 A;  2YEV B;  4MTO A;  1L0L H;  4P9P A;  3A0B Z;  1XNR B;  1I58 A;  1P4R A;  3G7E A;  2ESA A;  2ZM6 O;  4DUZ O;  1Q7Y W;  4TV8 A;  4HXZ A;  4X64 O;  4X1K B;  4F6R A;  4B3M B;  2ZR2 A;  3JAS B;  2H55 A;  1ARO P;  3EHF A;  1CEZ A;  3H1J H;  1XI1 A;  1YT2 A;  1SQQ H;  2DQ3 A;  1XNQ O;  3L70 H;  1QVG U;  1IBK O;  4D7T A;  4LF8 O;  2O1V A;  2PI5 A;  5H9C A;  4ASF A;  2PYJ A;  4B3T O;  3T1H B;  2XX4 A;  4DV0 O;  4TUY B;  2YIB D;  5K1P A;  1M93 A;  4MVM A;  2EIJ B;  1M5I A;  5H5N A;  4GX1 A;  4MS2 A;  4DK0 A;  1Y66 A;  2P4K A;  4AIL C;  3HKD A;  3UT5 A;  1R62 A;  2ZCE A;  2X6B A;  4EEH A;  3LNN A;  3QTC A;  5B1N A;  1BQ0 A;  1NS1 A;  4O05 A;  4DXW A;  2AKP A;  5B3S C;  2QKC A;  4DV2 O;  2YGF A;  4AQY O;  1SZX A;  3OD4 A;  4O4L B;  4JYY A;  2PY5 A;  1TAE A;  1UY6 A;  2XDU A;  3AK2 A;  2RMK B;  1Y76 B;  1EN4 A;  3WB0 A;  2UXD O;  1VQ5 V;  1VAR A;  1A32 A;  1VF5 B;  2N05 A;  3ZBH A;  1OCZ B;  4I50 B;  5B1A B;  2PYL A;  2GUZ B;  4KHP B;  5KHI A;  5D6Q A;  1HP8 A;  1L0O A;  2XHR A;  2B5U A;  4LF7 B;  1UYM A;  4X66 B;  1PVG A;  2XTA A;  2WI4 A;  2XT9 A;  5GW7 A;  1WP8 A;  4FLW A;  4FZ0 A;  4UCT A;  1S0V A;  1KZN A;  4PA7 A;  3SPC A;  3PEJ A;  1RPO A;  5F5R A;  4I9Q A;  1BMF G;  1JM6 A;  1YES A;  3K57 A;  4DV5 O;  5D5Q A;  4MTX A;  2EZP A;  1K33 A;  4JI5 O;  2KSD A;  1GM9 A;  3I55 V;  3IGA C;  4X1I A;  3JAW A;  3QTF A;  2RNB A;  1XMO O;  2W0F C;  2Q0A A;  5LMU B;  4CC6 A;  1IXM A;  1Q86 W;  1B63 A;  1PKX A;  1Z5W A;  1O9H A;  2H3O A;  2UU9 O;  4MP2 A;  1SQG A;  4O4J B;  1YCI A;  5IWA B;  1O9G A;  5BMV A;  1FFX B;  4K3A A;  2XJJ A;  3ETE A;  2FML A;  4JI1 O;  1SC5 B;  3NR7 A;  1U96 A;  1XEQ A;  2KG7 B;  1XOU A;  4DR5 O;  2HG5 C;  4JI0 B;  2IOR A;  2Q4P A;  3X2Q C;  4ASB A;  4FK5 C;  5LP6 A;  2QF6 A;  1AJ6 A;  2E76 B;  3TK1 A;  3LSQ A;  5J6A A;  2V4D A;  5KMG B;  1B06 A;  3EFF K;  2YKB A;  1OCR C;  1GH6 A;  3HB3 B;  4JTA B;  2A9H A;  3KCX A;  4DV4 O;  1ZLZ A;  2YIA A;  4OX9 B;  3CXC U;  4MVS A;  2Q68 A;  2Q73 A;  4KP4 A;  5CMU A;  4MTF A;  5JJN B;  5J2T A;  3E89 A;  5CTX A;  3D2R A;  3OUF A;  4H81 A;  2WLI A;  5DEC A;  5D7D A;  2YJW A;  1BGY H;  4O2A B;  4UV9 A;  2ZDI C;  2A06 H;  3TZ0 A;  2F66 C;  2E74 B;  3AG2 B;  3OE7 G;  5IE9 A;  3O2F A;  1XL4 A;  2Y69 B;  3Q4H B;  1QLN A;  2N04 A;  3DSQ A;  1VIB A;  2KB1 A;  1I94 O;  4J7J A;  3H1K H;  2M6Y A;  3B8N A;  1GN6 A;  2XAH A;  1NTM H;  2WAM A;  4FJC C;  1BE3 H;  3N27 A;  2QG0 A;  2ZNJ A;  4DV3 O;  4FLX A;  2EIJ C;  1H2S B;  2QM4 A;  4P7A A;  4TWK A;  4RQF A;  4KXR A;  2X6A A;  3LNU A;  1JQ0 A;  4MP7 A;  5JCO A;  2R9R B;  4O4H B;  4BWA A;  4JI3 O;  1AB3 A;  3ZMT A;  2BRC A;  1K34 A;  3K03 A;  4X89 A;  2JGD B;  3RFR A;  3AK3 A;  2FYP A;  1Q8I A;  3F7V C;  4PRX A;  4JYA B;  1E1Q G;  2DW4 A;  1VQK V;  4H33 A;  4HZ0 A;  1FXK A;  4MB9 A;  3WG7 B;  5EBW C;  4W4K A;  2GFD A;  4Q6G A;  4LFC B;  4YXW G;  3BY6 A;  3BRC A;  2M7W A;  5TIS Z;  2NNU A;  4X62 O;  5IYC O;  2E0A A;  3ZM7 A;  1LNQ A;  3EKR A;  2BSK B;  3RYC A;  1I5X A;  3VQX A;  1KKD A;  3ZCC A;  1GAX A;  1B3Q A;  5L3J A;  4DYL A;  3Q5K A;  3MAQ A;  1VEW A;  4URM A;  1TVK A;  4YY3 B;  4IYH A;  4CWP A;  4RUE A;  4R3A A;  1JVM A;  1ZXM A;  5LGU A;  1N36 O;  4DV1 O;  4XBF A;  1M57 B;  2YI6 A;  1TUB B;  2HCH A;  1X59 A;  4TV8 B;  3DC5 A;  2E3C A;  1OHH G;  5IYB O;  1B6Q A;  3R4O A;  5EC2 C;  1PP9 H;  1GKZ A;  3RVY A;  2UUA O;  4X9L A;  4L8Z A;  4CH3 A;  1BSM A;  5CBG A;  1H2L A;  4HYP A;  1YXB A;  2KKW A;  1GKF A;  1QYE A;  2FKX A;  4DR4 B;  1SRY A;  2PTM A;  2EUL A;  3CCE V;  4LWS A;  1AI6 A;  4GZR B;  5LMN B;  2BYI A;  4FZ1 A;  5CBF A;  5CA1 B;  2F4V O;  2O1U A;  2Z3Y A;  3K9A A;  4YKW A;  3H1L H;  1XHZ A;  4CE1 A;  1NR1 A;  3HYY A;  1QVF U;  1VQL V;  3DXR A;  2IM9 A;  4B3R B;  5J2U A;  3F5T A;  2XCM A;  1NT2 B;  4I4T B;  4H44 B;  2OCC C;  4NYK A;  3D36 A;  2OTJ V;  3QNE A;  3B27 A;  4L87 A;  4UCS A;  3CD6 V;  4P30 A;  4JI4 B;  1D5A A;  3G67 A;  2JEU A;  3NMQ A;  4ZI7 A;  2E5L B;  1H2G A;  5K1X A;  4LNU B;  1N32 O;  4MOT A;  2JRI A;  3TET A;  4BR6 A;  3UCS C;  1SER A;  2VQF O;  4E72 A;  4WFA V;  4O0B A;  1K3E A;  3AG3 B;  1IBM O;  3CRL A;  4AWP A;  4KFG A;  3S3W A;  3G4S V;  2DYS B;  2WLL B;  4G2K A;  4UCR A;  3EKO A;  5DED A;  1EA6 A;  1N4C A;  2W6I G;  2Q8I A;  2YE6 A;  3OGC C;  4YJ3 A;  1BQZ A;  3K99 A;  4UCV A;  2IU0 A;  2QWR B;  1IBL O;  1RM1 B;  2FB5 A;  4URL A;  2ZE6 A;  4R8C A;  1BHB A;  4EFU A;  3D8C A;  1US6 A;  3O9O A;  3ZMU A;  4K4O A;  4X9Q A;  4X1I B;  3N2G A;  4I55 A;  1BGQ A;  3B40 A;  5M4E A;  3K97 A;  3FAV A;  1FXV A;  4ZKI A;  2EJ7 A;  1XUQ A;  3ABM B;  2FWZ A;  2CGF A;  2C2A A;  4UUJ C;  3R4N A;  2Q9L A;  2QM8 A;  4ICG A;  4WFF A;  3WG7 C;  4DUY B;  3RLQ A;  2ZQM A;  1IZ3 A;  5ITZ A;  3BMY A;  3K5N A;  4LF4 B;  3SPG A;  3LUT B;  1MX0 A;  4X1Y B;  2UUB B;  3K98 A;  2FYU H;  1X4T A;  3ASO B;  1ZW9 A;  5B66 Z;  4DV6 O;  1WAZ A;  2XX2 A;  4P2Z A;  4DRX A;  4FM2 A;  2QJ1 A;  4WBN A;  1FYJ A;  4JYC A;  1VQ9 V;  4WCE V;  1PPJ H;  4DW1 A;  2NN4 A;  3K0G A;  4NXN O;  4MSW C;  1NVP D;  4DR2 B;  3B09 A;  4O4I A;  3RYI A;  4U7O A;  3K5O A;  4ASA A;  1I5Y A;  1K4C C;  1OZ0 A;  1D2D A;  3FB7 C;  4GQT A;  4LWF A;  5LHH A;  3IAY A;  4ABM A;  3ETG A;  4E4E A;  4GT8 A;  5CB4 B;  5J2T B;  1ZXN A;  3CCV V;  2ADP A;  2ITD C;  2WLI B;  1QLE C;  5CA0 B;  4JI7 B;  2CAZ C;  4KL1 A;  1KC8 W;  1FJG O;  5E79 Z;  4Z2W A;  2BTQ A;  1TA8 A;  2XAS A;  3THO A;  5CA3 A;  4AI8 A;  4JTC B;  4XDM A;  4XD8 A;  2ILM A;  3E8H A;  4UVC A;  4K0K B;  3OMN B;  1MSW D;  3A0Z A;  4MVZ A;  1N34 B;  4XIP A;  1EN6 A;  3BCC H;  4L93 A;  3HKB B;  1ZL8 A;  2Q8F A;  2WI2 A;  4JI2 B;  1GN4 A;  1MMM A;  2EBO A;  5LYJ A;  5L3E A;  1I7F A;  2JDI G;  2ODM A;  3QVN A;  2AZ2 A;  2JVD A;  1I5D A;  1YC4 A;  2Z0A A;  4R6Z A;  3E2E A;  5J71 A;  2X6C A;  2ZM6 B;  4X64 B;  3OWB A;  4DZY A;  1AJP A;  3QDD A;  3BVO A;  4N23 A;  3JAT A;  3IFX A;  4OXS A;  4JI8 O;  3G75 A;  4FFB A;  1UFI A;  3OTO O;  5JJE B;  1YJ9 V;  1YJW V;  1GM7 A;  1XNQ B;  1FXK B;  3CGY A;  2YXL A;  4MVR A;  1IBK B;  4I3H A;  1I0H A;  1YJN V;  3VQY A;  2BCC H;  1W0J G;  3AG3 C;  1BT8 A;  1AVM A;  2DYS C;  1YEW A;  2WLH A;  4FLT A;  3ASN C;  1K73 W;  4NKG B;  1NH2 D;  4EB6 A;  1NTK H;  3JD3 A;  4JI6 O;  2HKJ A;  2YEF A;  3RYC B;  5FNC A;  3JSL A;  4PJ0 Z;  4K8Z A;  2VW5 A;  2RQ6 A;  3EHG A;  4XIQ A;  5EBL C;  3B2E E;  4JYB A;  1S5H C;  3CRQ A;  4XCL A;  3KG2 A;  1TVK B;  2LP7 A;  3JAR B;  2B1G A;  1DTO A;  5KUM A;  1ORQ C;  2YEB A;  5LXT B;  4FM1 A;  4P8O A;  2WSS G;  4PI0 A;  4XCJ A;  2Q8G A;  3EHH A;  1ENV A;  4O09 A;  2GTA A;  1R1B A;  1SZT A;  4WUC A;  2XAG A;  3MHS C;  3CHX A;  3K79 A;  2AHY A;  2QSA A;  1N0N A;  1FPO A;  4GKK B;  1M56 C;  2VS0 A;  5C93 A;  3MNR P;  4FFK A;  2RJZ A;  1NKD A;  4DR1 O;  3OEH G;  2EIL B;  1UYL A;  3H4L A;  1CPY A;  4E00 A;  3TUH A;  4QE9 A;  3HKC A;  4LC1 A;  5JQG A;  2YKC A;  2JK5 C;  1VQN V;  4IIJ A;  4J9Z B;  2AW9 A;  2YIB A;  3SYP A;  3E86 A;  1JA8 A;  5LHI A;  2Y0P A;  4FIP C;  1R6N A;  2BT0 A;  2K1E A;  4JI5 B;  4LF6 O;  1SQF A;  1V54 C;  3RVZ A;  3DXR B;  2R72 A;  1HR0 O;  1F51 A;  1K9M W;  5J2U B;  5JH7 A;  1XMO B;  5BXZ A;  2LFR A;  3C11 A;  4KQV A;  2DN9 A;  4DR6 O;  2DYR B;  2BZ5 A;  3L75 H;  1S3J A;  4O2B A;  3SR2 C;  4XKA A;  2HHH B;  3Q5L A;  3ABU A;  4JI1 B;  1VQ8 V;  3RW0 A;  1VP7 A;  3I56 V;  4DR5 B;  4ZI7 B;  4LF5 O;  3CCM V;  3A0R A;  1AJQ A;  4CWS A;  2YEA A;  3A0W A;  1V9P A;  4LH6 A;  1XBL A;  4TV9 A;  4MW3 A;  4EFT A;  3K60 A;  3E22 B;  3K59 A;  1XQ8 A;  4ZHQ A;  4HAM A;  2Y4U A;  2YE7 A;  3APQ A;  3ZRS A;  3HKE A;  2Y0I A;  3W7S A;  4LFA B;  2H94 A;  2XX5 A;  1OCO B;  3ZHR A;  4IHJ A;  4WFH A;  4CC5 A;  4JAS A;  3G6E V;  4URN A;  2YS8 A;  2LJ2 A;  4DK1 A;  4O04 A;  1CXZ B;  3LNM B;  2GV9 A;  4EGI A;  3KCY A;  2BTO A;  4LBE C;  2RDC A;  3N2G B;  4I55 B;  4DR7 B;  4JV5 O;  2X7R B;  5JVD B;  3I5D A;  4GEE A;  3FAV B;  1H8H G;  2FL4 A;  4JF3 A;  4HY1 A;  5FNF A;  3T4D A;  3ZKB A;  2VWJ A;  1Y74 B;  3RYH B;  3ABK B;  1ZTE A;  4PDV A;  1E79 G;  1HW7 A;  1Y67 A;  4FLV A;  2OCH A;  1S72 V;  4L90 A;  5FWK A;  1RSO B;  2ZIM A;  3JD0 A;  2F95 B;  2DWE C;  3STL C;  1TID A;  2WI6 A;  1ZWH A;  4I0X B;  5FLX N;  4XIR A;  3VHC A;  4DV3 B;  3J81 N;  4ZIB A;  1I5B A;  1FAF A;  2BYH A;  4DRX B;  4WBN B;  3T1Y B;  4O4I B;  4BQJ A;  4LWE A;  1Z5A A;  1UY7 A;  2HR3 A;  2YID A;  4JAU A;  3JYC A;  3T2S A;  1S76 D;  2DMX A;  3BAB A;  5EIB C;  3CSX A;  3GB7 C;  4CS3 A;  4EKW A;  2YXY A;  4JAA A;  4PEL A;  2ZBK B;  1TUE B;  5B1B C;  3INX A;  4OPA A;  5F3K A;  4MVQ A;  3ABL C;  4CWF A;  4U93 A;  4J7Z A;  3RLP A;  3M99 B;  5KUK A;  2BTZ A;  5IDJ A;  2EIN B;  2UXN A;  5KHJ A;  2PNR A;  2BTQ B;  4CS2 A;  1S16 A;  2EIL C;  4H7Q A;  1PD3 A;  4X62 B;  1V55 C;  2ITC C;  2EIM B;  2ZKJ A;  4FPP A;  2F43 G;  2FWY A;  1ZL8 B;  1P7B A;  2PZS A;  3GWK C;  2HG1 A;  1PNK A;  2UXC O;  1KYO F;  1QHT A;  3T0Z A;  4KFM A;  3TXS A;  1Q90 D;  4R3M A;  3K5L A;  4DV1 B;  3ZJZ A;  1K4D C;  4I7Z B;  3SPI A;  4UCO A;  4NTX A;  1Y6X A;  3CEI A;  3S5T A;  1PL0 A;  5GON A;  5DN6 G;  2UUA B;  4LWI A;  3H1I H;  4Z1V A;  3CC2 V;  1YHQ V;  1PL4 A;  5KX5 A;  2VCI A;  3RGB A;  3C90 A;  4IL6 Z;  3C3S A;  4CE2 A;  4NXM O;  3H80 A;  4LH7 A;  3JZ3 A;  4V25 A;  2JIZ G;  1BXD A;  1US7 A;  2YEH A;  5JWP A;  4NH7 A;  3EVK A;  2AGA A;  2A0L A;  5D7R A;  2ZE8 A;  3AG1 B;  1Q3E A;  2BOC C;  1JFF A;  1ZSP A;  5L3D A;  2L6L A;  2F4V B;  4I5S A;  2YEJ A;  3CRA A;  4MVU A;  4J80 A;  4L94 A;  5IY5 B;  1THZ A;  2NLJ C;  2XAB A;  3FT8 A;  4F6E A;  3HYZ A;  4PL9 A;  2JS3 A;  3NXS A;  1I59 A;  1KIJ A;  3OWD A;  1OCO C;  1A4H A;  1OJH A;  4MPE A;  1EM1 A;  4TQF A;  3VBB A;  1WA8 A;  5IJ9 A;  1IVS A;  3A8T A;  2WEQ A;  2H8P C;  4X65 O;  3CRM A;  3OMU A;  3B4S A;  1URF A;  1WPX A;  5BZB A;  2KQX A;  1YC3 A;  2WLN A;  3RWR D;  1OCZ C;  5B1A C;  2UUC O;  2FXS A;  2WA4 A;  3SJA C;  1K8A W;  5CTU A;  2W0X A;  3H9V A;  3JAM N;  1N32 B;  5E1A C;  4LP8 A;  3KE6 A;  2AZ0 A;  4GX0 A;  2V1D A;  2A3Q A;  2YE4 A;  3LSS A;  4G27 B;  2OWO A;  4GKJ O;  4PRV A;  1JX9 A;  3ZXO A;  4XKO A;  4V26 A;  4JI0 O;  2Q69 A;  3OW2 U;  3CWV A;  2G38 A;  1JOY A;  3ABT A;  1UJW B;  2P67 A;  3LDC A;  4B7P A;  4DO2 A;  2CTW A;  3HKC B;  1NR7 A;  1G1X B;  1WB7 A;  2Q8H A;  1IXB A;  1EFR G;  1Y4M A;  4IIJ B;  4WFG A;  1YVW A;  1IBL B;  3OMA B;  2DJV A;  3IC9 A;  1EI1 A;  3SPJ A;  4B3S O;  1NZ6 A;  3VHD A;  3T2M A;  1JJO A;  5KAF Z;  4YKZ A;  1H8E G;  5LHG A;  4F6R B;  1R6K A;  1WPB A;  4J10 A;  3B8M A;  1GK9 A;  5JH7 B;  3U0Z A;  1HNZ B;  3APO A;  1YI2 V;  4E2L A;  4HNA A;  4MW8 A;  3S3X A;  1Y4U A;  4U7N A;  3K5M A;  2XDX A;  4O2B B;  2JS5 A;  1P84 F;  1Z5C A;  3UM7 A;  1L8D A;  1XMQ B;  1ROP A;  3CS5 A;  4AWO A;  2EIM C;  1H2N A;  1K5Q A;  1DK1 A;  2IH1 C;  1F23 A;  4DV6 B;  2IJI A;  2UXB O;  2WPD G;  2DOS A;  3HKD B;  4ZOL A;  2K9P A;  4NXN B;  3UT5 B;  2IJJ A;  3HR0 A;  3HKE B;  1SKV A;  4TSF G;  5B1O A;  1WNS A;  3HZ1 A;  3O65 A;  2YEG A;  4YIP A;  4IHJ B;  2Q6A A;  2DE0 X;  1XIL A;  1EBO A;  5CF0 A;  4RAI A;  4LP0 A;  1J5E O;  5JEN A;  4X1K A;  1AI5 A;  1GJV A;  1ZWI C;  3AG2 C;  5EIB D;  2DQ0 A;  1UYC A;  1JJ2 U;  1KD1 W;  1IDS A;  3HEK A;  3OFN G;  1HWY A;  3G71 V;  2Y69 C;  3R65 A;  2P7T C;  3ZHU A;  3AG7 A;  1VQ4 V;  2ZDI A;  3N2K A;  3RLR A;  3PEH A;  2WLM A;  1W59 A;  1NBM G;  3DC6 A;  2YGA A;  2ZXW B;  1Y8P A;  4KSH A;  5IY5 C;  4EGH A;  4KSG A;  3AEI A;  3CRK A;  4BIZ A;  2LFS A;  5H6R A;  1PNM A;  3ZN1 A;  3SGI A;  2OTL V;  3JAW B;  3MDS A;  1PNL A;  4B08 A;  3CYO A;  3D3I A;  1UY9 A;  2WI5 A;  1Q6I A;  3SDL A;  1N33 B;  4RQE A;  2D2C B; 
#chains in the Genus database with same CATH homology
 4FMT A;  2YEC A;  3MD0 A;  4PDM A;  3SL2 A;  4YKR A;  5EBM C;  1BHA A;  3OMI B;  3F7Y C;  1QCE A;  1UYI A;  1BYQ A;  2XDL A;  5D6P A;  1YIJ V;  1NJI W;  2BOB C;  5CPH A;  1M57 C;  2HKO A;  4XDK A;  3CGZ A;  3ZN0 A;  1VQP V;  4CWO A;  2YE2 A;  2CCT A;  2XHT A;  2BU2 A;  4BXI A;  2HLD G;  5CBH A;  1AJN A;  4XIT A;  4BIU A;  4MPN A;  2PI4 A;  5KA6 A;  3QO8 A;  2XND G;  2ZDX A;  4YKT A;  4UVB A;  2EXL A;  2BU6 A;  2JKI A;  4E02 A;  2BU8 A;  2QFO A;  2QA4 V;  3TZ5 A;  2HVJ C;  1THN A;  3CC4 V;  1BL8 A;  2JEX A;  3ZKD A;  3CCS V;  1DLB A;  1DF5 A;  3AG4 B;  5FND A;  4MT8 A;  3TZ2 A;  3C0E A;  1FS0 G;  2BRE A;  3WQ9 A;  5B3S B;  1ID0 A;  3VOU A;  1AI4 A;  2XAJ A;  4BW5 A;  5IYD O;  3A0T A;  1MOF A;  3E83 A;  5LGN A;  4CZZ A;  1JCH A;  2YI7 A;  4PA4 A;  3MHH C;  3FB5 C;  1DF4 A;  2MK3 A;  3FYE B;  2XDS A;  3OPD A;  2ZXW C;  2QEX V;  2ATK C;  1RM1 C;  1H7U A;  4WUD A;  3RKZ A;  4JTD B;  2YJX A;  3R4P A;  5M4K A;  2XAQ A;  4PDL A;  5CTW A;  4MBC A;  1UY8 A;  3ZMS A;  2UWD A;  3ABM C;  2YE3 A;  3JD2 A;  3W7T A;  5M4M A;  4QNH B;  2VCJ A;  3LPS A;  1J95 A;  4GX2 A;  2QKS A;  3ZIA G;  1B62 A;  1MAB G;  4PDR A;  2QM7 A;  5M4N A;  1YTF B;  4QPJ A;  2CH4 A;  4CWR A;  1RPR A;  1G8M A;  3ASO C;  3K04 A;  1K5S A;  4X88 A;  2QG2 A;  1K97 A;  4UXN A;  1Q81 W;  1N8R W;  1F4N A;  2CK3 G;  3QO7 A;  3ZMV A;  2IJH A;  2Y48 A;  2OT5 A;  4XTJ A;  2WWW A;  1YSR A;  1KEC A;  4CWT A;  1OCR B;  3UKM A;  2BU7 A;  4YKQ A;  5D7C A;  1M9N A;  3B77 A;  1I5A A;  1BKN A;  3WFV A;  1R3L C;  1OSF A;  3DTU B;  2YKJ A;  1Y8O A;  5HFL A;  2W6J G;  1NHJ A;  1GM8 A;  1FFT B;  3CCL V;  1GMG A;  1KP3 A;  1TC6 A;  4GFN A;  1QZR A;  1UYK A;  3CP1 A;  1AMW A;  3A0X A;  4PA9 A;  3T10 A;  2K5B A;  2Q67 A;  2IWU A;  3K3W A;  1TH8 A;  4I9W A;  2WER A;  4XC0 A;  2ZD9 A;  3FV5 A;  2IWS A;  4F4L A;  2JJC A;  5M4P A;  3PJS K;  3CMA V;  1NVP B;  4QIW F;  2YKI A;  3OR6 C;  3AG4 C;  3T1K A;  1Z59 A;  3B25 A;  1UYD A;  1FXH A;  2VWC A;  3RBZ A;  4QPK A;  3ZRW A;  1FXK C;  4PA3 A;  2Z5U A;  1AH6 A;  1GO3 F;  3FKS G;  3LDD A;  1Q82 W;  5IN9 A;  1VQ7 V;  1AH8 A;  2WI1 A;  2ZR3 A;  1YT0 A;  1TIL A;  2CCS A;  3B24 A;  1UYG A;  4O07 A;  3P32 A;  5M4H A;  1G4Y B;  3E8F A;  2WLL A;  3JD4 A;  4XKK A;  3F5W C;  5BOD A;  2YKE A;  2FTK A;  3K06 A;  1MU5 A;  3OAA G;  3SPH A;  4BAE A;  4FCQ A;  3HZ5 A;  3K08 A;  4MTG A;  3BM9 A;  3OUS A;  3OEE G;  1K7D A;  4EGK A;  3CCR V;  4ASG A;  3EHB B;  2ZDY A;  2YE9 A;  3CPW U;  5FL7 G;  3U67 A;  2Q2E B;  3G7B A;  2WLJ A;  3QO5 A;  2B1I A;  5EK0 A;  4CWQ A;  4FCR A;  1U0Z A;  2XDK A;  5EC1 C;  1L1F A;  4GGL A;  4GT1 A;  1NH2 B;  1E1R G;  3GIG A;  3ML0 A;  4AWQ A;  3O6O A;  1JPX A;  4YKU A;  2IW5 A;  3CCU V;  4G28 B;  3CCQ V;  2DYR C;  5L3B A;  4WFE A;  1SET A;  2YGE A;  1NHH A;  3GIF A;  2OCC B;  5H6Q A;  4JQL A;  3R4M A;  1R3I C;  3ZRX A;  3INW A;  4Q20 A;  1YC1 A;  4ZVI A;  2YSU B;  2IOQ A;  3R91 A;  4XDJ A;  3IED A;  1YSC A;  1M90 W;  3E8G A;  4WF9 V;  4GX5 A;  2YI5 A;  3E8B A;  1TC0 A;  5J9P C;  2YED A;  4AS9 A;  2YI0 A;  2JJ1 G;  3H01 A;  4CWN A;  1KQS U;  4MVO A;  3LDE A;  1K92 A;  3BEH A;  3HPL C;  1SES A;  2IOP A;  3CC7 V;  3ABK C;  3TCU A;  2WI3 A;  4HYM A;  4EMV A;  1QY8 A;  4R1F A;  1NQT A;  3FB6 C;  1YS3 A;  5CN0 A;  1MG1 A;  2YK9 A;  1NHI A;  2IWX A;  4JPR A;  4HYO A;  3WHA A;  2P90 A;  1VQO V;  1VQ6 V;  3IC7 A;  5CTY A;  2IH3 C;  3B26 A;  4MPC A;  5L3G A;  2GQP A;  3O0I A;  4E01 A;  2EIK B;  3ZRV A;  3K0D A;  2XK2 A;  5IDM A;  3GIE A;  1GTO A;  4FCP A;  3DGE A;  2HVK C;  2EIN C;  4P9O A;  4PU9 A;  1VQM V;  4QE7 A;  1QLE B;  2JJ2 G;  3SYC A;  2IJK A;  3JD1 A;  2XD6 A;  2BU5 A;  1W2B U;  2EZO A;  1KP2 A;  1XL6 A;  3ZMZ A;  4JAV A;  1UYH A;  3U2K A;  4DUH A;  2YEV A;  3SYQ A;  2XOK G;  3T0H A;  1Z5B A;  1YSZ A;  3P30 A;  4HZ3 A;  4XE2 A;  1EZJ A;  1UYF A;  4EM7 A;  2WI7 A;  4HZ5 A;  4BAY A;  3ZRW B;  2EJR A;  4CBC A;  4WFB V;  3HHU A;  1YTF D;  1OCC B;  3AG1 C;  1M1K W;  1H7S A;  2HJF C;  3FB8 C;  2YE5 A;  4QJF B;  4H37 A;  2YK2 A;  3VHA A;  2X0L A;  4UVA A;  4L91 A;  1YT1 A;  3R92 A;  4W7T A;  2XJX A;  3ASN B;  4R7C A;  4JGS A;  3OR7 C;  5L3C A;  4URO A;  3T1C A;  2XHX A;  1R3K C;  4Z1M G;  3ETD A;  4BQG A;  2IU3 A;  5L3F A;  2BSM A;  4UV8 A;  1M56 B;  1U2O A;  4GCZ A;  3OM3 B;  1QR9 A;  4RUF A;  2QTO A;  3SYO A;  2UXX A;  1R3J C;  2V7Q G;  4LWH A;  4KTN A;  3TZ4 A;  3CCJ V;  3GIG B;  5HFM A;  2WLK A;  1UYE A;  3SJQ C;  2GSM B;  2EIK C;  3STZ C;  3W7U A;  4LWG A;  2GHY A;  1Y8N A;  1S77 D;  1V54 B;  1I5C A;  3Q5J A;  2XAF A;  4LCU C;  3A0Y A;  4H85 A;  2D3O W;  1Y4S A;  1YET A;  4YKY A;  3TTZ A;  4NH8 A;  4CE3 A;  3FYI B;  4J9Y B;  4ZBM A;  3EHJ A;  4KUM A;  3E35 A;  1TBW A;  1H38 A;  3JCZ A;  5KA5 A;  5DM6 V;  2YEE A;  1AM1 A;  2HFE C;  1YER A;  3U2D A;  2CCU A;  3OW6 A;  4B6C A;  1AI7 A;  3ZXQ A;  4R50 A;  4N21 A;  4HY6 A;  3VAD A;  4YKX A;  2WEP A;  2CG9 A;  1S14 A;  1OCC C;  1GKX A;  2QE7 G;  2H8M A;  2DWD C;  4LPB A;  4XDL A;  3CME V;  3D0B A;  1WLE A;  1QBZ A;  3GWO A;  5LGT A;  4X8A A;  4ASU G;  1YIT V;  4TT3 G;  2P6J A;  2XJG A;  2A79 B;  1F4M A;  2YE8 A;  3W7W A;  1AR1 B;  5BOC A;  2AHZ A;  1QR8 A;  5LBQ A;  3T4Z A;  1W0K G;  5B1B B;  4PA6 A;  3B28 A;  1CP9 A;  2O1W A;  3ABL B;  3X2Q B;  4RO2 A;  3SYA A;  5GGZ A;  2R9I A;  2YEI A;  4HXW A;  1V55 B;  3FT5 A;  3W7X A;  4WUB A;  1COW G;  1R73 A;  4NH9 A;  2YEV B;  4MTO A;  4P9P A;  1I58 A;  1P4R A;  3G7E A;  2ESA A;  1Q7Y W;  4HXZ A;  2ZR2 A;  2H55 A;  1ARO P;  3EHF A;  1CEZ A;  1YT2 A;  2DQ3 A;  1QVG U;  2O1V A;  2PI5 A;  5H9C A;  4ASF A;  2XX4 A;  4MVM A;  2EIJ B;  4GX1 A;  4MS2 A;  1Y66 A;  1R62 A;  2X6B A;  4EEH A;  5B1N A;  4O05 A;  4DXW A;  2AKP A;  5B3S C;  2YGF A;  1UY6 A;  2XDU A;  1VQ5 V;  1OCZ B;  5B1A B;  5D6Q A;  1L0O A;  2XHR A;  2B5U A;  1UYM A;  1PVG A;  2WI4 A;  5GW7 A;  1S0V A;  1KZN A;  4PA7 A;  3SPC A;  3PEJ A;  1RPO A;  5F5R A;  1BMF G;  1JM6 A;  1YES A;  4MTX A;  2EZP A;  1K33 A;  1GM9 A;  3I55 V;  3IGA C;  3QTF A;  2W0F C;  1IXM A;  1Q86 W;  1B63 A;  1PKX A;  4MP2 A;  2XJJ A;  3ETE A;  2HG5 C;  2IOR A;  3X2Q C;  4ASB A;  4FK5 C;  2QF6 A;  1AJ6 A;  3TK1 A;  3LSQ A;  5J6A A;  3EFF K;  2YKB A;  1OCR C;  3HB3 B;  4JTA B;  2A9H A;  3CXC U;  4MVS A;  2Q68 A;  4KP4 A;  5CMU A;  4MTF A;  3E89 A;  5CTX A;  3D2R A;  3OUF A;  4H81 A;  2WLI A;  5D7D A;  2YJW A;  4UV9 A;  2ZDI C;  3TZ0 A;  3AG2 B;  3OE7 G;  3O2F A;  1XL4 A;  2Y69 B;  1QLN A;  2KB1 A;  3B8N A;  2XAH A;  2WAM A;  4FJC C;  2QG0 A;  2EIJ C;  4P7A A;  4TWK A;  4RQF A;  2X6A A;  3LNU A;  1JQ0 A;  4MP7 A;  2R9R B;  3ZMT A;  2BRC A;  1K34 A;  3K03 A;  4X89 A;  2FYP A;  3F7V C;  4PRX A;  1E1Q G;  2DW4 A;  1VQK V;  4H33 A;  4HZ0 A;  1FXK A;  4MB9 A;  3WG7 B;  5EBW C;  2GFD A;  4YXW G;  3BY6 A;  2M7W A;  2NNU A;  5IYC O;  2E0A A;  3ZM7 A;  1LNQ A;  3EKR A;  1I5X A;  1KKD A;  3ZCC A;  1B3Q A;  5L3J A;  3Q5K A;  4URM A;  4CWP A;  4RUE A;  4R3A A;  1JVM A;  1ZXM A;  5LGU A;  4XBF A;  1M57 B;  2YI6 A;  2HCH A;  1OHH G;  5IYB O;  1B6Q A;  3R4O A;  5EC2 C;  1GKZ A;  3RVY A;  4X9L A;  4L8Z A;  5CBG A;  4HYP A;  1GKF A;  1QYE A;  1SRY A;  3CCE V;  1AI6 A;  2BYI A;  5CBF A;  2O1U A;  2Z3Y A;  3K9A A;  4YKW A;  4CE1 A;  1NR1 A;  3HYY A;  1QVF U;  1VQL V;  2XCM A;  2OCC C;  3D36 A;  2OTJ V;  3QNE A;  3B27 A;  4L87 A;  3CD6 V;  4P30 A;  2JEU A;  3NMQ A;  1H2G A;  4MOT A;  3TET A;  1SER A;  4WFA V;  4O0B A;  1K3E A;  3CRL A;  3AG3 B;  4AWP A;  4KFG A;  3G4S V;  2DYS B;  2WLL B;  4G2K A;  3EKO A;  1EA6 A;  2W6I G;  2Q8I A;  2YE6 A;  3OGC C;  3K99 A;  2IU0 A;  1RM1 B;  4URL A;  4R8C A;  1BHB A;  4EFU A;  3ZMU A;  4K4O A;  1BGQ A;  5M4E A;  3K97 A;  4ZKI A;  1FXV A;  3ABM B;  2FWZ A;  2CGF A;  2C2A A;  4UUJ C;  3R4N A;  2QM8 A;  4WFF A;  3WG7 C;  3RLQ A;  2ZQM A;  3BMY A;  3SPG A;  3LUT B;  1MX0 A;  3K98 A;  3ASO B;  1ZW9 A;  2XX2 A;  4P2Z A;  4JYC A;  1VQ9 V;  4WCE V;  3K0G A;  4MSW C;  1NVP D;  4U7O A;  4ASA A;  1I5Y A;  1K4C C;  1OZ0 A;  3FB7 C;  4GQT A;  4LWF A;  5LHH A;  3ETG A;  4GT8 A;  1ZXN A;  3CCV V;  2ITD C;  2WLI B;  1QLE C;  1KC8 W;  2XAS A;  5CA3 A;  4JTC B;  4XDM A;  4XD8 A;  3E8H A;  4UVC A;  3OMN B;  1MSW D;  3A0Z A;  4MVZ A;  4XIP A;  4L93 A;  2Q8F A;  2WI2 A;  2EBO A;  5L3E A;  2JDI G;  1I5D A;  1YC4 A;  4R6Z A;  3E2E A;  5J71 A;  2X6C A;  3OWB A;  4DZY A;  1AJP A;  3QDD A;  4N23 A;  3IFX A;  4OXS A;  3G75 A;  1YJ9 V;  1YJW V;  1GM7 A;  1FXK B;  3CGY A;  4MVR A;  4I3H A;  1YJN V;  1W0J G;  3AG3 C;  2DYS C;  2WLH A;  1K73 W;  3ASN C;  1NH2 D;  3JD3 A;  2HKJ A;  2YEF A;  5FNC A;  2VW5 A;  3EHG A;  4XIQ A;  5EBL C;  4JYB A;  1S5H C;  4XCL A;  3KG2 A;  2LP7 A;  2B1G A;  1DTO A;  5KUM A;  1ORQ C;  2YEB A;  4P8O A;  2WSS G;  4XCJ A;  2Q8G A;  3EHH A;  1ENV A;  4O09 A;  1SZT A;  4WUC A;  2XAG A;  3MHS C;  3K79 A;  2AHY A;  1M56 C;  5C93 A;  3MNR P;  1NKD A;  3OEH G;  2EIL B;  1UYL A;  3H4L A;  1CPY A;  4E00 A;  3TUH A;  4QE9 A;  4LC1 A;  2YKC A;  2JK5 C;  1VQN V;  4J9Z B;  3SYP A;  3E86 A;  5LHI A;  4FIP C;  1R6N A;  2BT0 A;  2K1E A;  1V54 C;  3RVZ A;  1F51 A;  1K9M W;  2LFR A;  3C11 A;  4KQV A;  2DYR B;  2BZ5 A;  1S3J A;  4XKA A;  3Q5L A;  3ABU A;  1VQ8 V;  3RW0 A;  3I56 V;  3CCM V;  3A0R A;  1AJQ A;  4CWS A;  2YEA A;  3A0W A;  4MW3 A;  4EFT A;  3K60 A;  4HAM A;  2YE7 A;  3ZRS A;  3W7S A;  2H94 A;  2XX5 A;  1OCO B;  4WFH A;  3G6E V;  4JAS A;  4URN A;  4O04 A;  3LNM B;  4EGI A;  4LBE C;  2X7R B;  4GEE A;  1H8H G;  4JF3 A;  4HY1 A;  5FNF A;  3T4D A;  3ZKB A;  3ABK B;  4PDV A;  1E79 G;  1S72 V;  4L90 A;  5FWK A;  3JD0 A;  2DWE C;  3STL C;  1TID A;  2WI6 A;  1ZWH A;  4XIR A;  3VHC A;  1I5B A;  2BYH A;  4BQJ A;  4LWE A;  1Z5A A;  1UY7 A;  2HR3 A;  4JAU A;  3JYC A;  3T2S A;  1S76 D;  3GB7 C;  4EKW A;  2ZBK B;  4PEL A;  1TUE B;  5B1B C;  3INX A;  5F3K A;  4MVQ A;  4CWF A;  3ABL C;  4U93 A;  3RLP A;  3M99 B;  5KUK A;  2BTZ A;  5IDJ A;  2EIN B;  2UXN A;  2PNR A;  1S16 A;  4H7Q A;  2EIL C;  1PD3 A;  1V55 C;  2ITC C;  2EIM B;  2ZKJ A;  4FPP A;  2F43 G;  2FWY A;  1P7B A;  2HG1 A;  1PNK A;  3T0Z A;  4KFM A;  4R3M A;  3ZJZ A;  1K4D C;  3SPI A;  1PL0 A;  5DN6 G;  4LWI A;  3CC2 V;  1YHQ V;  2VCI A;  4CE2 A;  3H80 A;  3JZ3 A;  4V25 A;  2JIZ G;  1BXD A;  1US7 A;  2YEH A;  4NH7 A;  2A0L A;  5D7R A;  3AG1 B;  2BOC C;  5L3D A;  4I5S A;  2YEJ A;  4MVU A;  4L94 A;  5IY5 B;  1THZ A;  2NLJ C;  3HYZ A;  2XAB A;  3FT8 A;  4PL9 A;  3NXS A;  1I59 A;  1KIJ A;  3OWD A;  1OCO C;  1A4H A;  4MPE A;  3VBB A;  2WEQ A;  2H8P C;  3OMU A;  1WPX A;  5BZB A;  1YC3 A;  2WLN A;  1OCZ C;  5B1A C;  2FXS A;  1K8A W;  5CTU A;  5E1A C;  4LP8 A;  3KE6 A;  4GX0 A;  2V1D A;  2YE4 A;  3LSS A;  4G27 B;  4PRV A;  1JX9 A;  3ZXO A;  4XKO A;  4V26 A;  2Q69 A;  3OW2 U;  3CWV A;  1JOY A;  3ABT A;  1UJW B;  2P67 A;  3LDC A;  4B7P A;  4DO2 A;  1NR7 A;  2Q8H A;  1EFR G;  1Y4M A;  4WFG A;  3OMA B;  1EI1 A;  3SPJ A;  3VHD A;  3T2M A;  4YKZ A;  1H8E G;  5LHG A;  1R6K A;  3B8M A;  1GK9 A;  1YI2 V;  4E2L A;  4MW8 A;  1Y4U A;  4U7N A;  2XDX A;  1Z5C A;  3UM7 A;  1ROP A;  4AWO A;  2EIM C;  1K5Q A;  2IH1 C;  1F23 A;  2IJI A;  2WPD G;  2IJJ A;  4TSF G;  5B1O A;  3HZ1 A;  2YEG A;  2Q6A A;  5CF0 A;  1EBO A;  4RAI A;  4LP0 A;  1AI5 A;  1GJV A;  1ZWI C;  3AG2 C;  2DQ0 A;  1UYC A;  1JJ2 U;  1KD1 W;  3HEK A;  3OFN G;  1HWY A;  3G71 V;  2Y69 C;  3R65 A;  2P7T C;  1VQ4 V;  2ZDI A;  3RLR A;  3PEH A;  2WLM A;  1NBM G;  2YGA A;  2ZXW B;  1Y8P A;  4KSH A;  5IY5 C;  4EGH A;  4KSG A;  3AEI A;  3CRK A;  4BIZ A;  2LFS A;  5H6R A;  1PNM A;  3ZN1 A;  2OTL V;  1PNL A;  3CYO A;  3D3I A;  1UY9 A;  2WI5 A;  4RQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...