4KP4A

Deciphering cis-trans directionality and visualizing autophosphorylation in histidine kinases.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
ADDRTLLMAGVSHDLRTPLTRIRAYAETIYNSLGELDLSTLKELAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Visualizing autophosphorylation in histidine kinases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/signaling protein
molecule keywords Osmolarity sensor protein EnvZ, Histidine kinase
total genus 66
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4kp4A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4kp4A02
4FCQA 3GIFA 3R4NA 4L93A 4KQVA 1YETA 2WEQA 3OW6A 4BQJA 3CRLA 1Y8OA 3NMQA 2BYHA 1AMWA 3VADA 2JJCA 1GKXA 5BOCA 4ASFA 1H7SA 2BRCA 1YC3A 1YSRA 4XE2A 1YERA 4H81A 2IOQA 2WEPA 1UY7A 3C11A 1UYFA 2FWYA 4LWFA 4WUBA 2YEHA 4E02A 4CWOA 4R3AA 2YE8A 2H55A 3LPSA 4AS9A 4HY6A 3WHAA 1Z59A 4GQTA 4MTXA 5F3KA 4WUDA 2WI5A 2YJWA 4JYBA 1S14A 4HYMA 5D7RA 2BU6A 4U93A 3ZM7A 3D36A 1UYMA 2PNRA 2WI2A 4PRXA 2ESAA 3TZ4A 4DUHA 5M4MA 3A0RA 3D2RA 4XIPA 4EMVA 2YK2A 4LPBA 4XCLA 4E00A 5M4NA 3HHUA 4GT8A 4YKXA 4E01A 1NHIA 2VCIA 3A0ZA 4NH7A 3G7BA 5B1NA 4CWPA 1QYEA 3Q5LA 3GIGB 3B28A 4KP4A 4L94A 3HEKA 4YKZA 4MPCA 3IEDA 4W7TA 2ZDYA 3MNRP 2XABA 4FCRA 3JZ3A 4BAEA 5J71A 3B25A 4XKKA 2VCJA 2QM7A 4URNA 3CGZA 1B3QA 4XCJA 2XDXA 2YEDA 2YGAA 3GIEA 4LC1A 2HKJA 4XTJA 5CPHA 4ZVIA 2YEFA 4I3HA 2XD6A 3K98A 4PL9A 4B6CA 5CTWA 3EKOA 2YEIA 3B27A 3CWVA 5IDMA 2YE2A 2XDLA 2YI6A 1AJ6A 2YI0A 3G75A 2Q8IA 4FMTA 4XKOA 2YEBA 4JASA 1US7A 5CTUA 1JOYA 1TBWA 4KSHA 4YKRA 2IWXA 4MPNA 1UYGA 3BM9A 4MOTA 1TH8A 4PRVA 2WI4A 4XIRA 3OMUA 3T1KA 2YGFA 3TK1A 2JKIA 2QM8A 2YEJA 1TC0A 3FT8A 3P32A 4MT8A 1EI1A 4R1FA 3EHJA 4GT1A 2FXSA 4U7OA 3INWA 1L0OA 1UYCA 1I5CA 3T10A 2EXLA 3Q5JA 3B26A 2UWDA 4P8OA 4KFGA 3OWDA 2GFDA 1UYHA 3HYZA 2BU8A 2QG2A 1QY8A 4UROA 1BGQA 1BKNA 1UYIA 1Y8NA 2IORA 2XX4A 2WI1A 1UYLA 3ZKBA 5GGZA 2YK9A 1YSZA 5CTYA 2XJGA 4EEHA 4CE3A 2LFSA 3ZRXA 2IWUA 1UYKA 4P7AA 3QTFA 4MPEA 3R4OA 2YI5A 3GIGA 2E0AA 4BXIA 4HXZA 2XDSA 1TC6A 3TZ5A 3OPDA 1YS3A 3EKRA 1B62A 3VHAA 4Q20A 4CWQA 1YT0A 2H8MA 3FV5A 3HYYA 1ZXNA 3T2SA 2BU2A 2QFOA 3K99A 2XK2A 2YI7A 4EGHA 2CCUA 3ZRVA 2YE9A 4V26A 1F51A 5FNFA 3VHCA 4B7PA 3ZXOA 3HZ5A 2YGEA 1I5AA 2YKJA 4I5SA 2BU5A 3T0HA 3R91A 1AH8A 1UY6A 5D7DA 5M4EA 2BZ5A 4BQGA 3A0TA 2CCSA 1UY9A 3INXA 1R62A 3KE6A 4CE1A 5IN9A 3K97A 4MP7A 3EHGA 4YKQA 4GEEA 3R4PA 3WQ9A 5C93A 3R4MA 5J6AA 5FNCA 1Z5BA 4MP2A 4XC0A 2ZDXA 4CWFA 4NH9A 1ID0A 1NHHA 5IDJA 4GGLA 4FPPA 1Z5CA 2XHTA 4JAUA 2YECA 4XIQA 4LWHA 4EFTA 2XDUA 1ZW9A 4R3MA 4XITA 4H85A 1UYDA 1U0ZA 2XHRA 4LWIA 1ZWHA 2WWWA 2XCMA 3OWBA 4U7NA 2YEEA 3H4LA 4KSGA 4HYPA 5D6QA 2IWSA 4AWOA 3DGEA 1YESA 3ZRWB 4L8ZA 2Q8FA 3B24A 3ZKDA 5F5RA 3RLPA 1ZXMA 4XD8A 4CWNA 5FWKA 1OSFA 3A0XA 1IXMA 2YEAA 1Y4SA 2XHXA 2ZBKB 2LFRA 4EM7A 5M4KA 4GCZA 4LP0A 3K60A 2Q8GA 2FTKA 2VW5A 1KZNA 1BYQA 4K4OA 3TZ2A 2YE7A 1I59A 1NHJA 1MX0A 5CTXA 4CWSA 2BREA 4XDMA 2XX5A 4CE2A 4EFUA 3H80A 4URMA 1MU5A 4JQLA 2BYIA 4HZ5A 4URLA 4PU9A 1YT1A 4CWTA 2IOPA 1YC1A 1UYEA 3O2FA 1PVGA 4AWPA 2YKCA 3ZRWA 2GQPA 2QG0A 2WI7A 2WERA 3ZXQA 2YJXA 2XX2A 2WI3A 2HG1A 5BODA 2C2AA 3D0BA 1KIJA 1YT2A 4BIUA 3LNUA 2VWCA 3TTZA 2O1VA 4L91A 2QF6A 4JAVA 1B63A 2HCHA 5L3JA 2K5BA 2BTZA 4HZ0A 4QPJA 4HXWA 4O07A 3T0ZA 1EA6A 4ASGA 4L90A 3R92A 3EHFA 1U2OA 1BXDA 1GJVA 3ZCCA 2CH4A 4X9LA 2YEGA 1AM1A 4ASAA 3CGYA 2Q2EB 4MBCA 3EHHA 4KTNA 1I58A 2XDKA 2WI6A 3RLQA 5D6PA 2YKBA 1TILA 4FCPA 3RKZA 3VHDA 3FT5A 3TUHA 4NH8A 4HY1A 5D7CA 2Q8HA 2O1UA 4JYCA 5CF0A 3MD0A 4YKWA 3TZ0A 4CWRA 4LWGA 1S16A 1QZRA 1I5DA 2YKIA 1YC4A 1JM6A 2CG9A 3O6OA 5FNDA 1I5BA 2P67A 4MB9A 1H7UA 4YKYA 3RLRA 4O09A 5M4PA 2CCTA 3PEHA 2YKEA 3BMYA 4O0BA 4XKAA 1THNA 3Q5KA 5M4HA 2YE6A 3O0IA 2CGFA 2BU7A 4YKUA 4ASBA 4BIZA 3SL2A 3CRKA 1Y8PA 4ZKIA 3G7EA 4EGKA 3U2DA 3C0EA 2XJJA 5B1OA 4EGIA 3HZ1A 2O1WA 2YE5A 1UY8A 2FWZA 2YE4A 3A0YA 3PEJA 4H7QA 1TIDA 4LWEA 4YKTA 2YE3A 1GKZA 1Z5AA 3QDDA 2ZKJA 3NXSA 4AWQA 4O05A 3U2KA 2BT0A 1AH6A 3U67A 4DZYA 4O04A 4WUCA 1Y4UA 2FYPA 4GFNA 2AKPA 2BSMA 1A4HA 4V25A 2XJXA 4QPKA 3A0WA
chains in the Genus database with same CATH superfamily
4FCQA 1JX9A 4CZZA 4CH4A 1YETA 1VEWA 2ZD9A 4KHPB 4BQJA 1Y8OA 3H1HH 1HNZB 4H33A 3JD4A 4IHJB 1NR7A 3M7MX 3TJTA 3KCYA 1AMWA 1EN6A 3FB7C 5IWAO 2JJCA 5LYJB 3G71V 2Q5ZA 1PL0A 5B5EZ 4XE2A 3AG2B 1YERA 1FFXA 1H2NA 1NVPD 3FX7A 1JJ2U 3DC6A 1KKCA 2IU0A 1KC8W 2FWYA 4LWFA 4WUBA 4E02A 4CWOA 1IURA 2YXLA 1K8AW 2HKOA 1M57B 2WAMA 1HNXB 2XTAA 2YE8A 2CH7A 4EEQA 4GQTA 1H38A 2WLLA 5BMVA 2H94A 4O4JA 1NQTA 1S14A 1AB3A 2CGOA 5FPOA 4U93A 3IC7A 3QO5A 4MSWC 2R70A 2PNRA 4UCUA 4TSFG 2ESAA 4E72A 3TZ4A 2CH7B 1FPOA 1BHBA 1NTZH 3A0RA 3D2RA 2B1GA 2YK2A 4LPBA 1WB7A 4JYAB 4DO2A 2Q6AA 3HKEA 4GT8A 3ZX6A 4PDVA 3G67A 2JS5A 3OMIB 3STLC 4UCVA 3K9SA 4NTYA 4FLYA 5KX5A 4L94A 2LJ2A 4YKZA 4NB5A 3IEDA 3J80N 4YJ2B 5J71A 5LHHA 2EINC 3UO3A 4DUYO 2QM7A 3JAKA 1YF2A 2IH3C 4RO2A 1AILA 2LW1A 1GM9A 5LBQA 4XCJA 3CSXA 4EFEA 2YEDA 1S5HC 1JA8A 2UUAO 2P22C 2JK5C 3ZRSA 2QM4A 4I3HA 4X20B 2XD6A 3CWBH 3K98A 4JI8O 3ASOC 1IBLO 5CTWA 3B27A 2ZQMA 3HPLC 1OCZB 2JGDB 3RVYA 2XDLA 4ZIBA 3S3WA 5H6RA 3G75A 1CPYA 1SS3A 4X1KA 2YEBA 4X1IA 2HLDG 1MSWD 1YJ9V 2NLJC 1OCOC 1TBWA 2Q4PA 1YITV 4ZHQB 1IBKB 2WA4A 3X2QC 1VQ7V 2QKSA 1TH8A 1BQZA 4XIRA 5K1PA 3OMUA 3T1KA 1MZFA 1SQXH 2JJ1G 5LA6B 2DN9A 3CE2A 4FLTA 1Q8IA 5B1BB 3GWOA 4OPHA 4DV1O 3WB1A 3APQA 3TCUA 2KSDA 1E79G 2ZIOA 1OCZC 3OWDA 4I4TB 1CEZA 3HYZA 1QY8A 1KU9A 1VF6C 1VQMV 2HJFC 1BKNA 1UYIA 2IORA 5LYJA 2XX4A 2XT9A 1GN3A 2OWOA 1MSDA 3ZKBA 1FKAO 1RSOB 1HWYA 1Y4MA 2F66C 2OTJV 2XJGA 3ZMVA 1M5IA 1XUQA 4IYHA 4CE3A 3ZRXA 1F23A 2EZPA 5B1BC 4MPEA 3R4OA 5BZBA 2E0AA 3DXRB 5GONB 4CC6A 1TC6A 3BEHA 1ZL8B 5B3SB 5CBFA 2BOBC 1NT2B 4B7EA 1TVKA 4CWQA 4JTDB 2YI9A 1ZSPA 4LF4O 4O2AA 5LMNB 2H8MA 3FV5A 3HYYA 4TUYB 2Y0IA 2YIBD 3UT5B 2YXYA 2QFOA 1VF7A 5E1AC 3OEHG 2XK2A 2WLJA 4LFCO 4JI4B 5K1XA 4FJCC 3CC4V 1VQPV 4V26A 2GTSA 3OR7C 5CN0A 1EZJA 1FXKC 2YKJA 2PGGA 4I5SA 5D7DA 2C1IA 2ZE6A 4UXNA 4K0KB 1UJWB 3A0TA 5H9CA 1E1QG 1WB8A 3P3PA 4YHHO 3RWRD 2F43G 1FJGO 3B8MA 4YJ2A 2BTQA 5C93A 3K5LA 1URFA 2YICA 2VQEO 4X1YB 5IDJA 3CXHF 4O2AB 4GGLA 1GK9A 4YIPA 1MZEA 1XNRO 2YECA 1N33O 2XDUA 3AK1A 2P4VA 3RT3C 4O4LA 4B3MO 2YEVA 1PPJH 3DTUB 1VF5B 3JALA 3ABKB 2WWWA 1V55C 2YEEA 1AJNA 5D6QA 4TV9B 4I9QA 4GKKB 4CWNA 1IX9A 3A0XA 3A0BZ 5DM6V 2XHXA 2AXTZ 4PA4A 5M4KA 3U11A 2Z0AA 5LMUO 2E5LB 5IYZA 4O4IA 5IT9N 2DMXA 2YE7A 2QEXV 3AK2A 1WPBA 1WP8A 1K97A 2BREA 4XDMA 1DTOA 4H0LB 1NS1A 2XX5A 2WLKA 2P06A 3CRCA 3VQVA 3CJHA 3JAKB 4LWSA 1ENVA 1VQNV 2XNDG 5J2UA 4HZ5A 1JFFB 1YT1A 1Y76A 1AROP 1Y74A 3L70H 3O2FA 4IIJB 1TGOA 4AWPA 3H1IH 1BS3A 3ZXQA 3M8AA 2XX2A 2HVKC 2WI3A 3SGIA 1KB9F 1HNWB 3CRRA 4MTOA 2CDYA 5EIBD 1G1XB 2GUZB 2FYUH 1XMOO 3TTZA 2O1VA 4IIJA 1IZ3A 4G27B 4TV8B 2G38A 1PM9A 4MVZA 4TOIA 2HCHA 4HZ0A 1Q90D 3CRAA 3CB2A 4GKJO 2RMKB 5CMUA 4FIPC 4C7UA 1H2SB 1XHZA 5EYPB 2GUZA 1GJVA 2HHHB 1NTKH 3L71H 2YEGA 3ZHUA 4ASAA 2E5LO 2Q7HA 3EHHA 1B04A 2H8PC 2EJ7A 1FAFA 5IWAB 3ABMC 3K59A 2VWKA 2Q0AA 3F7VC 3BCCH 3RLQA 4FCPA 1VQ6V 4NH8A 2Q8HA 4DR2O 4JYYA 5CF0A 2AZ2A 4YKWA 4QGPA 3TZ0A 4CWRA 1SA0A 3ABKC 3FKSG 4R50A 2UU9O 4LF8O 1I5DA 4DR3B 5D5PA 2B5UA 1YC4A 3K5MA 5LOVA 1JM6A 3O6OA 4TV8A 2P67A 3L75H 2XAQA 1Q6UA 3CYOA 2CCTA 2YKEA 2W6JG 1JMKC 4L87A 2XUMA 3Q5KA 5M4HA 1I0HA 4J7JA 4CH6A 5J2TB 1GKFA 3T4DA 4BIZA 1V55B 3NR7A 5LOVB 1Y8PA 4ZKIA 4EGKA 5HFLA 2DW4A 3C0EA 2XJJA 5B1OA 3HZ1A 4GX2A 2KQXA 1VIBA 1NVPB 1OCRC 2ARHA 2YE5A 1UY8A 2FWZA 3JATB 2UXBO 1YJWV 3S3XA 2FB5A 4YKTA 1DF5A 2PTMA 1S3JA 2ZR3A 2Q68A 3TETA 4IL6Z 1PNMA 1K9MW 1GKZA 1XOUA 1AJPA 2KG7B 1ORQC 3OR6C 4DZYA 1QHTA 4O04A 4NXMB 3EFFK 1YSCA 2AKPA 4B3TB 3HKBA 2GDSA 1TA8A 1V54C 2E76B 3N2KB 1W0KG 3T1HO 1QLEB 4PDRA 4KQVA 3OW6A 1BCCH 2Q7EA 2BYHA 4F6RB 2UXXA 5BOCA 1XMQB 3ZS8C 1WA8A 2BRCA 2Q73A 3K06A 2P6JA 2PI4A 5LP6C 1RM1B 2YIAA 4ZOLA 4X1YA 4FLVA 2WEPA 4H81A 5JH7B 1XMQO 3JARA 1UYFA 4I7ZB 2IM9A 1NBMG 3DC5A 4J80A 3LPSA 2B1IA 1DGSA 2QR4A 4B3RO 4HY6A 3ZN0A 3WHAA 3BAAA 4R7CA 5F3KA 4MTXA 2WI5A 1SERA 4LF6B 3WG7B 5KHKA 3KKYA 4HYMA 1K4CC 3JALB 2WLMA 1PNKA 3CCQV 4TWKA 2PI5A 3SPHA 1JVMA 2WI2A 3ABLB 4BR6A 3JYCA 1M1KW 4BIOA 4DV7O 4XIPA 4E00A 3G6BA 4BW9A 4MVOA 2F93B 5FNVA 3PN1A 4PDMA 2R72A 3SR2C 1NHIA 3E22A 5EC2C 1GTOA 2BCCH 1XMOB 3G7BA 5B1NA 4CWPA 1GAXA 3LDCA 4U3FH 2EIMB 4YIOA 2OCHA 3Q5LA 2X0LA 3JARB 3GIGB 1HNWO 2BE3A 1N34B 4NXNO 4DV2B 4KP4A 3HEKA 4MPCA 1BT8A 3SPGA 5FNVB 3MNRP 4FCRA 2K1EA 2LW7A 3JZ3A 4BAEA 3B25A 2P90A 2XDXA 3K9AA 4TUYA 4A5UB 2LO1A 2MW2B 3GIEA 4J42A 1TAEA 2F23A 2YUAA 2HKJA 3K03A 4B08A 3E2EA 2Y48A 2YEFA 4ZVIA 1K5SA 5BXZA 1MMMA 3ZHTA 5CB4B 4PL9A 4DRXB 2IH1C 4B6CA 4JI6B 4AQYO 1HNZO 2YI0A 2WLIA 1OZ0A 4UVBA 4FMTA 4XKOA 4JASA 4DUYB 2QJ1A 3CP1A 3PJSK 1Q81W 1AI4A 4DV6B 3UM7A 4PA6A 4MOTA 2X7RB 3TXQA 3AG2C 2WI4A 2QSAA 5DEDA 3GVMA 4P30A 2YGFA 3VQXA 3D36C 2UUCO 2JKIA 1MNGA 1QBZA 3Q4HB 4MTGA 2XAGA 2RNBA 4GZRB 2BTOA 1TC0A 1SQPH 2KG7A 3APOA 4R1FA 4GT1A 1SETA 1AVMA 1M57C 4U7OA 1JCHA 2FXSA 3INWA 1N36O 2EULA 3ZMUA 5A9GA 2VQFO 5H6QA 2ZT9B 4X65O 1EZVH 5GTIZ 3Q4HA 2UWDA 4KFGA 4X62B 1GM7A 1UYHA 1QQCA 4UROA 1G4YB 4JI0O 1BGQA 3AG4B 1FXHA 4XDJA 4O2BB 4EB6B 1QR9A 2FL4A 5GTHZ 1TUBA 2XOKG 2ATKC 4G28B 3HKBB 5JWPA 2EIMC 1LUWA 4EEHA 2EZOA 2JIZG 1UYKA 4X20A 3QTFA 1VP7A 4BXIA 3B77A 4O4HB 1M93A 3ZN1A 2Y0PA 4DV0O 3WU2Z 3EKRA 1W59A 3OUSA 3VHAA 1RSOA 2GBOA 2X6BA 3AG7A 4WBNB 4Z2WA 1YT0A 1XILA 4JI6O 4PA3A 3BA8A 4I0XA 2BU2A 4JI2B 5IJ9A 3U10A 3IC9A 3DXRA 5GONA 4EFBA 2CCUA 2YE9A 1XEQA 1JR9A 4X65B 1RPRA 3UQ8A 4B7PA 4JF3A 3ZXOA 4FLUA 1NH2D 2YGEA 1BQ0A 1N36B 5CBHA 3T0HA 1Y74B 1N33B 3LSQA 3N2GB 5LGUA 4X1KB 4MVQA 2CCSA 1FS0G 3AG3B 2X6AA 2Z3YA 3KE6A 2V1DA 4UV8A 1W2BU 4MP7A 4ABMA 4YKQA 4GEEA 3R4PA 2PYLA 3G4SV 3R4MA 5JJNB 3JSLA 3HKDB 4MP2A 3SJQC 4DXWA 4NH9A 1ID0A 4QE9A 2RCVA 3H1JH 4FPPA 2ZM6O 1IDSA 3LDEA 4B3RB 4K0KO 3CC7V 4NYKA 5EC1C 4JTCB 1N4CA 3FB6C 4MS2A 1MABG 3HKDA 1XBLA 2A79B 4MVUA 4O4IB 3T2MA 3G6EV 3RGBA 1N8RW 2XAHA 3ZBHA 1K34A 1K5QA 4JI3B 2L35A 2XCMA 3OWBA 3HB3B 1K4DC 4KSGA 1J5EO 1ZTEA 3DGEA 1RPOA 3ZRWB 2DQ3A 4L8ZA 2Q8FA 3E89A 3B24A 2Y69C 5F5RA 3CMAV 5FWKA 1P7BA 3J81N 3FB5C 1FFTB 3OUFA 1Y4SA 3B4SA 3QTCA 2LFRA 4GCZA 5EBWC 1NKDA 4LP0A 2HP8A 5CA1A 5KA5A 3IJ4A 2FTKA 3QG5A 2VW5A 1CXZB 5TISZ 1P84F 1I59A 1XREA 4FVMA 1Z5WA 1OCOB 1IBMB 5CTXA 4PI2A 3B09A 1LR1A 4CE2A 2WPDG 2ZXWC 4QIWF 5IJ0B 4G2KA 2ZIMA 3WFVA 4RQEA 4URLA 2PUSA 4PU9A 1BMFG 4CWTA 2L6LA 3BA9A 1UYEA 1PVGA 4CS4A 3CCEV 2YKCA 3ZRWA 2GQPA 2QG0A 1KP3A 3E8HA 1EBOA 3WB0A 2DYSB 3RYHB 1XNQO 2YJXA 3S5TA 4Q6GA 4K35A 3D0BA 1KIJA 1SF9A 4BIUA 2EILB 2VWCA 2OCCC 3T4ZA 4R8CA 5FLXN 4MW3A 4JAVA 4UUJC 1B63A 4HYOA 3E86A 4JPRA 3CYGA 3RFRA 4O4HA 4PI0A 4O07A 3T0ZA 2JEUA 1EA6A 3QNEA 3CC2V 3R92A 3EHFA 1QU7A 2CH4A 2HG5C 4W4KA 1H2GA 4X9LA 1JQ0A 3CGYA 2Q2EB 4MBCA 1M9NA 1Q3EA 3MAQA 1I5YA 3G80A 4FLZA 4JV5O 2CTWA 1HNXO 2M6YA 1GN6A 2YKBA 1TILA 2DYSC 4LNUB 3FT5A 3RYFA 4JYCA 4UCRA 3FB8C 4WCEV 3MD0A 4LH6A 4IGGA 5KUMA 1I94O 4LF8B 3SYQA 2F4VB 4KFMA 1IBLB 4FM2A 3ICXA 2CG9A 3N2GA 3CCSV 4DR2B 3JD0A 1EFRG 4I55A 1NTMH 4MB9A 3RLRA 1EN4A 3CRMA 4I0XB 5A2QN 2AHZA 4O0BA 1H2LA 4ASUG 4XKAA 4KHPO 1V9PA 3UCSC 2ZM6B 4JI7O 3K0GA 2YE6A 3O0IA 4YKUA 4ASBA 1M56B 1SA0B 4LFBO 3SL2A 3CRKA 1YJNV 2DWEC 2UXDO 4UCSA 1XL6A 2PYJA 3ZHVA 4Z1VA 5KHJA 1Q7YW 2DYRC 4B3MB 2CK3G 4EGIA 1Y67A 2O1WA 5JENA 2UXNA 2F95B 4CH5A 3PEJA 1TVKB 4LF7O 5B66Z 2HR3A 4WF9V 2YE3A 1KD1W 2E75B 3QDDA 3NXSA 4AWQA 1S5LZ 3U2KA 3OEEG 2C1GA 4JTAB 1Q6HA 2ZXWB 3QO8A 4WUCA 3AG1B 4DR3O 1IVSA 2WLLB 2BSMA 3E8BA 4JAAA 1A4HA 1MOFA 2B9ZA 2VS0A 1M56C 2HHIA 1NR1A 5LGTA 1JPXA 3D8CA 2KB1A 2WEQA 3NMQA 3VADA 4YJ3A 2BSKB 1OJHA 3BHPA 3QO7A 1H7SA 2VRZA 1PNLA 2E3CA 1B06A 1YSRA 1S0VA 4O4JB 3RYIA 2QWPB 4N23A 3WB2A 5LMNO 1UY7A 2DJVA 3C11A 4X9QA 5KAFZ 2DQ0A 1N0JA 4W4LA 2YIBA 1ROPA 1XL4A 4PHZA 3RYCA 1GN2A 1SQVH 1WP7A 4JI1B 1FYJA 2W0FC 2UXCO 2JRIA 5L3GA 2ZINA 1RM1C 1GM8A 3OGCC 4O4LB 5IJ0A 4B3SB 1Z5VA 4P9PA 1UYMA 2EX3A 2IJHA 4PRXA 3R65A 3JSNA 1Q82W 4IHJA 4DUHA 2BTQB 4EMVA 5JCOC 1VQLV 5M4NA 3MHSC 5BMVB 4RUFA 1NU1H 5CA1B 2VCIA 2P7TC 4J9YB 3A0ZA 4X66O 1YTFB 3VQWA 3E8GA 1OCCC 3T1YO 3OM3B 3B28A 2Q9LA 4WFHA 4LFCB 2UXDB 1Y66A 1B6QA 2ODMA 3RYFB 3KG2A 5DN6G 1CP9A 3OTOO 5LMUB 4DV1B 2HEPA 1D2DA 1B3QA 4LF4B 5J2UB 2OTLV 4RAIA 1YTFD 1ZUQA 4AILC 4LC1A 4X8AA 4XTJA 5CPHA 4KUMA 4I55B 5L3BA 3ETEA 3CMEV 2N04A 2OIGA 4BW5A 2V7QG 1Q86W 3K57A 1IBKO 1ZAUA 3EKOA 2PZSA 2OYQA 3K5NA 3HKEB 4NVPA 1SQQH 2YEVB 4D7TA 1V54B 2JEXA 3GWKC 3KZIZ 4X89A 2YI6A 4HZ3A 3T1HB 2ZDIC 5KAIZ 5CTUA 2GV9A 1JOYA 1XNRB 3EXAA 2P4KA 1Q6IA 4KSHA 2BOCC 3K04A 4NXMO 2ILMA 1SZTA 1UYGA 3IGAC 2IWXA 4MPNA 1YVWA 5BR8O 2EJRA 3ETQA 4PRVA 2VQEB 3FYIB 5LP6B 1L0NH 2IW5A 2UUAB 4H37A 3ZJZA 4DYLA 2WLHA 2UXBB 1G8MA 3FT8A 2O57A 2JGUA 3P32A 2Q67A 1OV9A 4HNAB 5KHGA 1HR0B 3RBZA 1L0OA 1TUBB 1UYCA 3T10A 2CGNA 2D3OW 3EHBB 1PV0A 4HAMA 4F4LA 2EIJB 5LHIA 3B26A 4P8OA 4DR7O 4DUZO 5C8YB 4ZBMA 1L1FA 1I5XA 2GFDA 1PL4A 2NN4A 3SJCC 2EIKB 3RN4A 4X66B 1N0NA 5IYBO 2WI1A 2R9RB 2N05A 1YCIA 1UYLA 5GGZA 2M7WA 1M4UA 2EBOA 1K73W 1YSZA 3OW2U 3SYAA 4J9ZB 2YSUB 1F4MA 5B1AB 4QNHB 4P7AA 4U3JB 3KCXA 5IJ9B 3GIGA 2K9PA 3K0DA 1F7YA 4FLXA 3W7WA 2P5OA 2XDSA 4JI1O 4DK0A 1YS3A 1B62A 3M99B 4NTWA 3D3IA 4PD4F 4J7ZA 2ZE8A 3OAAG 2JDIG 4UCOA 1QLEC 1OCCB 4LF9B 3OTOB 3CCVV 3ETGA 2ZDIA 4JGSA 2HHHO 3K99A 1R3KC 1KMIZ 4PV1B 1YDXA 4EGHA 3LNMB 3ZRVA 4WFAV 4DR4B 3CEIA 2A7WA 4JZ2A 4TQDA 4GKJB 3W7SA 5FNFA 3VHCA 4FFKA 3C90A 3HZ5A 3THOA 4UV9A 5H5NA 1AH8A 1UY6A 5M4EA 3H1KH 1X4TA 1GMGA 2RQ6A 2Y4TA 4GX1A 3CS5A 4LH7A 1GRJA 1UY9A 4U3JA 3A8TA 1R62A 4CE1A 5IN9A 2YDEA 2QWQB 1R1BA 3WQ9A 5J6AA 1O9GA 3I55V 1Z5BA 2DWDC 5J2TA 5FNCA 2ZDXA 1EN5A 1RFYA 4CWFA 4J7KA 3L72H 3F5WC 1HDJA 5L3DA 1D5AA 5CA0B 2UXCB 5ITZA 3ETDA 5LHGA 3W7UA 1VQ4V 3RYCB 1XHXA 3JCUZ 4DR5B 1U97A 1ZW9A 4R3MA 4ICGA 5IYDO 4XITA 1DLBA 1MA1A 3I5DA 2HFEC 3K08A 2H3OA 2EIJC 5L3CA 5KLVH 1ZWHA 4I50B 2V4DA 3ABTA 3H4LA 3OTFA 5KMGA 1LNQA 4YXWG 4AWOA 4UFZA 4E4EA 4DK1A 1US6A 4DW1A 2VWJA 4JI2O 1UPGA 1UFIA 4JI7B 1W0JG 3RLPA 2GSMB 3BPZA 1ZXMA 5IY5B 2WLNA 1OSFA 1IXMA 3ZHRA 1K7DA 4WFFA 3K60A 1FXVA 2Q8GA 3LMMA 2A3QA 1BYQA 5JJEB 2W0XA 4DV0B 3I56V 2CUGA 5LA6A 3O9OA 5KX5B 4F6RA 4I9WA 3FAVB 5KHIA 2QKCA 4TT3G 3SDLA 3H80A 4URMA 2ADPA 2BYIA 2A9HA 1FXKA 4FK5C 2CE4A 2IOPA 1P4RA 3ASNC 5B1AC 4BAYA 3ZHQA 4DV4B 1QCEA 5J9PC 5KMGB 4J11A 4LCUC 3FAVA 1R6TA 2WI7A 3OT7A 4PJ0Z 1AI5A 5IY5C 1WPXA 4AI8A 2C2AA 1BHAA 2EINB 4ZI7B 2Y4UA 3FFQA 1Y76B 4L91A 4CS3A 3SPIA 3SJBC 2VQFB 4LF7B 4YJ3B 2BTZA 5GW7A 1VMGA 4HXWA 3E8FA 1XNQB 4L90A 3ZCCA 5FPRA 4UB8Z 1X59A 1AM1A 2Q8VA 1I94B 1JFFA 1K33A 3AEIA 4DV6O 4QJFB 1D5NA 4KTNA 4BWAA 4UB6Z 3SYOA 4Z1MG 2WI6A 2BSKA 5D6PA 4XBFA 3TUHA 5JCOA 1WN7A 2R9IA 5D7CA 4AQYB 2F1MA 4CS2A 4I4TA 3ZMZA 3VBBA 3VOUA 1QVGU 4PDLA 5FNDA 1H8EG 4WFBV 3E35A 4LF5B 4YKYA 5JJJB 1WJZA 3JAMN 3CD6V 4JV5B 1ZWIC 3F7YC 2CTQA 2IJIA 3H9VA 1SQGA 2CGFA 2BU7A 5JQGA 3LSSA 5CA0A 1SRYA 3RVZA 2AZ0A 3AK3A 4DV2O 2GHYA 1FJGB 2HJDA 4FZ0A 1JJOA 4FFBA 5JQGB 3A0YA 3UO2A 4F6EA 1AR4A 4LWEA 2NNUA 4DV5B 5D5QA 2AHYA 4WBNA 1Z5AA 3U0ZA 4K8XA 1KECA 4TV9A 2DOSA 4DV3O 4O05A 2QTSA 1TUEB 4NTXA 4WFGA 2BT0A 5IYCO 3U67A 1K92A 1Y4UA 2F4VO 1FFXB 5HFMA 3OGIB 2XJXA 4LF6O 4GX5A 4D6TH 5IYZB 3ASNB 3A0WA 3GIFA 3R4NA 4L93A 2A0LA 4J10A 5JH7A 3CRLA 1ZX3A 3MHHC 3LDDA 3O65A 4XDKA 2Q69A 2QE7G 3ABMB 3A2FA 1GKXA 4NKGB 4ASFA 3C3TA 5B3SC 4MVRA 4LWSB 1YC3A 3H01A 1KP2A 3A0HZ 1AR1B 2IOQA 3N27A 2CTRA 5ITZB 2YEHA 3B2EE 2OIEA 4R3AA 2H55A 4AS9A 4WFEA 1Z59A 3C3SA 4WUDA 2YJWA 4JYBA 2E74B 4DUZB 2XHBA 1LUVA 5D7RA 2IJJA 3L9DA 2BU6A 4I50A 3RYIB 5H2FZ 3UKMA 3ZM7A 3D36A 1NH2B 2YI8A 5IE9A 1R3JC 4XDLA 3CCMV 5CA3A 1BE3H 3RW0A 5M4MA 1Z2GA 2UUBB 4MVSA 1IXBA 1AI6A 3W7XA 4XCLA 3OD4A 2YC0A 1VQ8V 1KKDA 5LL6Y 3HHUA 4YKXA 4E01A 3CPWU 1I7FA 1OHHG 5F2VO 1OCRB 2WA3A 1WNSA 4NH7A 4J41A 3K58A 4FM1A 4JI5B 4CH3A 1QYEA 1MG1A 1IBMO 5BY1A 4W7TA 3ASOB 2ZDYA 5FL7G 2XABA 1G6UA 3E22B 4XKKA 2VCJA 3ZEDA 2EILC 4URNA 3CGZA 2ADQB 1EM1A 3ZMTA 5LXTB 1I08A 1R73A 2YGAA 3T1CA 3JASA 4X1IB 1SC5B 1SZXA 4OXSA 4IYIA 4YY3O 1GH6A 3CCJV 2FMLA 3STZC 4ZI7A 1XQ8A 4K3AA 2YEIA 3CWVA 1VQOV 1DK1A 1AP5A 3K5OA 5LP6A 5IDMA 3IFXA 2YE2A 3CCUV 5KUKA 1AJ6A 4UVAA 4X88A 2Q8IA 1US7A 1R3LC 1NZ6A 3BVOA 5JVDB 1N32O 5CB4A 4YKRA 4GKKO 1Q43A 5EBMC 5E79Z 3BM9A 1K3EA 1P49A 2ZR2A 2RN9A 1YZBA 1YXBA 1R3IC 4LBEC 4DR1B 1AI7A 4DW0A 3JD2A 2XAJA 3JD3A 3TK1A 2YXHA 2QM8A 2YEJA 3JASB 1J95A 1PD3A 3AG3C 2DYRB 4MT8A 1EI1A 3EHJA 4L8JA 1L8DA 1SQBH 4DRXA 1U96A 1I5CA 2EXLA 4X64B 3Q5JA 3K79A 4B3SO 1NI8A 4JI5O 2RDCA 2BU8A 4E2LA 2QG2A 2JVDA 4D7SA 1Y8NA 1VQ9V 2IU3A 2QWOB 2N74A 3EVKA 4HBNA 1QLNA 3P30A 3AG1C 3SYCA 2QA4V 3LSUA 4NR1A 3HKCB 2YK9A 2ZKOA 1YI2V 4GUNA 5CTYA 4ZOLB 3CRQA 2AW9A 4GYCB 1QR8A 3N2KA 2LFSA 2IWUA 3D3QA 2CTPA 2Y69B 4LNUA 2YI5A 2QWNB 4JI4O 1Y6XA 4YY3B 4HXZA 2JJ2G 2A06H 3TZ5A 3DSQA 3OPDA 4FFBB 2MK3A 2Q0OC 1WA8B 2WSSG 2JGDA 4Q20A 2HVJC 1FXKB 5EK0A 3JAWB 2GTAA 3JD1A 3OE7G 3W7TA 1ZXNA 2PF4E 3T2SA 4OX9B 4JI0B 4GX0A 2D2CB 4TQFA 3TGUH 4ZHQA 2YI7A 2DE0X 5LGNA 4R6ZA 3CXCU 2ZE7A 1F51A 4X64O 4LR3A 3CCLV 1H2KA 3SYPA 3LUTB 1F4NA 1I5AA 2BU5A 3R91A 4DR5O 4OGQB 3SPJA 2X6CA 1BZKA 2BZ5A 4FZ1A 4BQGA 3OFNG 1ZLZA 2NR5A 3F5TA 3INXA 2ZCEA 4HNAA 4DV7B 3OMNB 2UUBO 3K97A 1HW7A 3EHGA 2UUCB 3BRCA 1VQKV 2LQTA 1KUQA 1H8HG 2Z5UA 4XC0A 1THZA 4MW8A 4LFBB 4DV3B 3JAWA 1NHHA 4AHCA 4EKWA 4DR6O 4KL1A 4YHHB 1N32B 1HR0O 1Z5CA 4JAUA 2XHTA 1BL8A 2ZE5A 4P9OA 1O9HA 4XIQA 4LWHA 4EFTA 3IAYA 1WAZA 3VQYA 4CBCA 4PELA 2XASA 4H85A 2W6IG 1UYDA 1U0ZA 2XHRA 2YS8A 1NJIW 2LGQA 4LWIA 2Q7GA 2ZNIA 4DR4O 4RQFA 1R6KA 4U7NA 4HYPA 3E83A 1WLEA 2IWSA 5BR8B 1YESA 3BABA 5C8YA 2ZNJA 2EIKC 1S77D 3FD9A 4PA7A 3ZKDA 3BY6A 4XD8A 1ZL8A 1AR5A 4LF9O 1HP8A 2YEAA 1VQ5V 2ZBKB 4EM7A 3WG7C 1S72V 4UCTA 1KZNA 1J5EB 2QKAA 4K4OA 3TZ2A 3ZHSA 1NHJA 3UT5A 1VF6A 3LNNA 1N34O 4NXNB 1MX0A 4CWSA 3ABLC 3FYEB 4FM0A 1XI1A 4EFUA 1MU5A 3SPCA 3P3NA 3J7AU 4JQLA 5LXTA 4QE7A 4LFAB 1M90W 1PP9H 2QGNA 1YC1A 4DR6B 4B3TO 3L73H 3H1LH 2KKWA 3R66A 2OT5A 1RP3B 2WERA 4DR7B 2HG1A 5BODA 5EZYA 3HR0A 3HKCA 5L3FA 1YT2A 1E1RG 2RJZA 3LNUA 4DV5O 4LFAO 1QNMA 5KA6A 2QF6A 2FKXA 1S5JA 3L74H 3GB7C 4RWUA 1S76D 5L3JA 1GN4A 5JVDA 3ZMSA 2K5BA 2YIDA 2CAZC 4QPJA 2R9AA 4K8ZA 5EZYB 2LP7A 5EBLC 1KQSU 4ASGA 1R6NA 1SESA 5KHHA 4O2BA 4EB6A 1U2OA 1BXDA 3BFRA 1SKVA 2UU9B 1P7GA 3CHXA 4GLXA 2QWRB 4IT5A 2IBZH 1QVFU 2QTOA 1T5EA 2PY5A 1YEWA 1I58A 2XDKA 4RUEA 1KYOF 1GO3F 3RKZA 2ITDC 4LF5O 1KBHA 3VHDA 3RYHA 4JZGA 3CX5F 4HY1A 5EIBC 5CBGA 2O1UA 1PKXA 4KXRA 4JI3O 3QVNA 4LWGA 1S16A 1QZRA 2YKIA 4B7KA 1A32A 2JS3A 1SQFA 1L0LH 4JI8B 1AP6A 3JCZA 2ITCC 1I5BA 2XAFA 1Q5OA 1H7UA 3ZIAG 4OPAA 4O09A 5M4PA 3PEHA 3BMYA 3CCRV 3B8NA 3CJHB 2IJKA 4FLWA 4PA9A 5DECA 1XDCA 4MTFA 1THNA 2ETNA 3QF7A 1VARA 3G7EA 4X62O 1YHQV 3U2DA 2QDOA 4MVMA 2LGWA 3AG4C 3ML0A 1BGYH 3T1YB 4DV4O 2YE4A 4H7QA 1TIDA 4H44B 3ABUA 3B40A 3K3WA 3OMAB 1H2MA 2OCCB 4JYAO 3SJAC 2ZKJA 4CC5A 2AGAA 4DR1O 1DF4A 1YIJV 1AH6A 4P2ZA 4N21A 1FD9A 1AJQA 2FYPA 3TXSA 4GFNA 5EYPA 4OX9O 5L3EA 1COWG 4V25A 4LP8A 3X2QB 4H13B 5AG2A 4UVCA 3JATA 1BSMA 4QPKA 2WLIB 3MDSA
chains in the Genus database with same CATH topology
4FCQA 3GIFA 3R4NA 1W0KG 2KB1A 1QLEB 2A0LA 1JX9A 4PDRA 4CZZA 4L93A 4KQVA 1YETA 2WEQA 2ZD9A 3OW6A 4BQJA 3CRLA 1Y8OA 3NMQA 3MHHC 4H33A 3JD4A 3LDDA 1NR7A 1AMWA 4XDKA 2BYHA 3VADA 3FB7C 2JJCA 2UXXA 2Q69A 2QE7G 3ABMB 1GKXA 3G71V 5BOCA 3QO7A 4ASFA 1H7SA 2BRCA 5B3SC 1PNLA 1PL0A 4MVRA 3K06A 2P6JA 2PI4A 1YC3A 3AG2B 3H01A 1KP2A 1RM1B 1YERA 1YSRA 4XE2A 1S0VA 1AR1B 4H81A 2IOQA 1NVPD 2WEPA 4N23A 1JJ2U 1UY7A 3C11A 2IU0A 1KC8W 1UYFA 2FWYA 2DQ0A 2YEHA 4LWFA 4WUBA 4E02A 4CWOA 1NBMG 4R3AA 1K8AW 2HKOA 1M57B 2WAMA 1ROPA 1XL4A 2H55A 2YE8A 3LPSA 2B1IA 3OWBA 4WFEA 1Z59A 4HY6A 3ZN0A 3WHAA 4R7CA 4GQTA 4MTXA 5F3KA 1H38A 4WUDA 2W0FC 1SERA 4JYBA 2WI5A 2WLLA 2YJWA 2H94A 3WG7B 1NQTA 5L3GA 1S14A 4HYMA 1RM1C 1GM8A 3OGCC 2IJJA 5D7RA 1K4CC 2BU6A 4U93A 2WLMA 1PNKA 3ZM7A 3UKMA 4P9PA 3D36A 3IC7A 3CCQV 1NH2B 1UYMA 3QO5A 4TWKA 4MSWC 2PI5A 2IJHA 3SPHA 2PNRA 1JVMA 2WI2A 3H4LA 1R3JC 4XDLA 3CCMV 4TSFG 4PRXA 3R65A 2ESAA 5CA3A 3ABLB 3TZ4A 1Q82W 3JYCA 4DUHA 1M1KW 3RW0A 5M4MA 1BHBA 3A0RA 4MVSA 3D2RA 1AI6A 3W7XA 2B1GA 1VQLV 2YK2A 4LPBA 4XCLA 4DO2A 4XIPA 3MHSC 4E00A 5M4NA 4MVOA 2Q6AA 4RUFA 1VQ8V 1KKDA 4PDMA 3HHUA 4GT8A 4YKXA 4E01A 1NHIA 4PDVA 3CPWU 2VCIA 2P7TC 1OHHG 4J9YB 3OMIB 1OCRB 1GTOA 5EC2C 3STLC 3A0ZA 4NH7A 3G7BA 5B1NA 1YTFB 4CWPA 3LDCA 2EIMB 1QYEA 3E8GA 1OCCC 3Q5LA 2X0LA 3OM3B 3GIGB 1MG1A 3B28A 4KP4A 4L94A 3HEKA 4WFHA 4YKZA 4MPCA 3IEDA 3ASOB 2ZDYA 5FL7G 4W7TA 3SPGA 2XABA 3MNRP 4FCRA 2K1EA 3JZ3A 4BAEA 5J71A 3B25A 1Y66A 5LHHA 1B6QA 2EINC 2VCJA 4XKKA 2P90A 3KG2A 5DN6G 2QM7A 2EILC 1CP9A 4URNA 3CGZA 3ZMTA 2IH3C 4RO2A 1B3QA 1GM9A 5LBQA 2XDXA 4XCJA 3K9AA 2OTLV 4RAIA 1R73A 2YEDA 1S5HC 3T1CA 2YGAA 1YTFD 3GIEA 4LC1A 2JK5C 3ZRSA 2HKJA 4X8AA 3K03A 4XTJA 5CPHA 3E2EA 4KUMA 2Y48A 4OXSA 5L3BA 1K5SA 2YEFA 2XD6A 4ZVIA 3ETEA 3K98A 4I3HA 3CMEV 4BW5A 2V7QG 1Q86W 3ASOC 3CCJV 4PL9A 3STZC 2IH1C 4B6CA 5CTWA 3EKOA 2YEIA 3B27A 3CWVA 2ZQMA 1VQOV 3HPLC 2YEVB 1OCZB 1V54B 2JEXA 3IFXA 3RVYA 3CCUV 2XDLA 2YE2A 5KUKA 4X89A 5H6RA 2YI6A 1AJ6A 2WLIA 2YI0A 4UVAA 4X88A 4HZ3A 3G75A 1CPYA 1OZ0A 4UVBA 2ZDIC 4FMTA 4XKOA 2YEBA 4JASA 1US7A 1R3LC 2HLDG 3CP1A 1YJ9V 1MSWD 3PJSK 5CTUA 2NLJC 1OCOC 1Q81W 1JOYA 1TBWA 1YITV 1AI4A 4KSHA 2BOCC 4YKRA 3K04A 5EBMC 2IWXA 1SZTA 1UYGA 3IGAC 3UM7A 4MPNA 4PA6A 1VQ7V 3X2QC 3BM9A 1K3EA 2ZR2A 2QKSA 4MOTA 2EJRA 1TH8A 4LBEC 1R3IC 4PRVA 2X7RB 2WI4A 3AG2C 3FYIB 1AI7A 4XIRA 2IW5A 3OMUA 3JD2A 4P30A 3T1KA 2YGFA 2XAJA 3JD3A 3TK1A 4H37A 2JKIA 1QBZA 2JJ1G 2QM8A 4MTGA 2XAGA 2YEJA 3ZJZA 1TC0A 1J95A 1PD3A 2WLHA 3AG3C 1G8MA 3GWOA 2DYRB 5B1BB 3FT8A 3P32A 4MT8A 1EI1A 4R1FA 2Q67A 3EHJA 4GT1A 1SETA 1M57C 4U7OA 1JCHA 2FXSA 3TCUA 3INWA 4KSGA 3ZMUA 3RBZA 1L0OA 1UYCA 1E79G 1I5CA 3T10A 5H6QA 2EXLA 1OCZC 3EHBB 2D3OW 4HAMA 4F4LA 2EIJB 3Q5JA 3K79A 5LHIA 2UWDA 3B26A 4KFGA 4P8OA 3OWDA 1GM7A 1CEZA 4ZBMA 1L1FA 1I5XA 2GFDA 1UYHA 3HYZA 2BU8A 4E2LA 2QG2A 1QY8A 2EIKB 4UROA 1G4YB 1VQMV 2HJFC 1BGQA 1BKNA 3AG4B 1UYIA 1FXHA 4XDJA 1VQ9V 2IU3A 1Y8NA 5IYBO 2IORA 2R9RB 1QR9A 2WI1A 1QLNA 2XX4A 1UYLA 3ZKBA 3P30A 5GGZA 3AG1C 3SYCA 2M7WA 2EBOA 2QA4V 2XOKG 2YK9A 1K73W 2ATKC 1YI2V 1YSZA 3OW2U 1Y4MA 1HWYA 5CTYA 2OTJV 2XJGA 4G28B 3SYAA 4J9ZB 3ZMVA 2EIMC 2YSUB 1QR8A 4EEHA 4CE3A 2LFSA 1F4MA 2EZOA 1F23A 3ZRXA 2IWUA 2EZPA 2JIZG 5B1AB 4QNHB 1UYKA 2Y69B 3QTFA 5B1BC 4P7AA 4MPEA 3R4OA 5BZBA 2YI5A 3GIGA 3K0DA 2E0AA 4BXIA 3B77A 2YEEA 4HXZA 3W7WA 2JJ2G 2XDSA 3ZN1A 1TC6A 3TZ5A 3OPDA 1YS3A 3BEHA 5B3SB 3EKRA 1B62A 5CBFA 2BOBC 3M99B 4CE1A 2MK3A 3OUSA 3VHAA 3D3IA 2WSSG 4Q20A 4CWQA 2HVJC 4JTDB 1FXKB 5EK0A 3OAAG 2JDIG 2X6BA 1QLEC 1OCCB 1YT0A 3JD1A 3OE7G 2H8MA 3FV5A 3HYYA 3CCVV 3ETGA 3W7TA 2ZDIA 4JGSA 4PA3A 1ZXNA 3T2SA 2BU2A 2QFOA 4GX0A 3K99A 1R3KC 5E1AC 3OEHG 2XK2A 2WLJA 2YI7A 2CCUA 4EGHA 3LNMB 3ZRVA 4WFAV 5LGNA 2YE9A 4R6ZA 3CXCU 4FJCC 3CC4V 1VQPV 4V26A 1F51A 3OR7C 3W7SA 1RPRA 1EZJA 5CN0A 3SYPA 3CCLV 4JF3A 3VHCA 3ZXOA 4B7PA 3LUTB 1NH2D 3HZ5A 1FXKC 2YGEA 1F4NA 1I5AA 2YKJA 4I5SA 4UV9A 5CBHA 2BU5A 1AH8A 1UY6A 3R91A 3T0HA 5D7DA 5M4EA 3LSQA 3SPJA 2X6CA 2BZ5A 5LGUA 4BQGA 3OFNG 1GMGA 4MVQA 4GX1A 4UXNA 1UJWB 5H9CA 2CCSA 1UY9A 3A0TA 1FS0G 1E1QG 3INXA 3AG3B 2X6AA 2Z3YA 2F43G 2V1DA 3OMNB 4UV8A 3B8MA 1W2BU 1R62A 3K97A 3EHGA 3KE6A 4MP7A 4GEEA 4YKQA 3R4PA 1VQKV 3WQ9A 5C93A 3G4SV 3R4MA 5J6AA 1H8HG 2Z5UA 3I55V 2DWDC 1Z5BA 4MP2A 2ZDXA 3SJQC 4XC0A 5FNCA 1THZA 4CWFA 4MW8A 4DXWA 4NH9A 3F5WC 5L3DA 1ID0A 4EKWA 1NHHA 4QE9A 5IDJA 4GGLA 4FPPA 1GK9A 1Z5CA 3ETDA 4JAUA 5LHGA 3W7UA 1VQ4V 2XHTA 4EMVA 1BL8A 3LDEA 2XCMA 2YECA 4P9OA 4XIQA 3CC7V 4LWHA 4EFTA 5EC1C 5IN9A 4JTCB 2XDUA 3FB6C 4MS2A 1ZW9A 4R3MA 1MABG 5IYDO 4CBCA 4XITA 1DLBA 2XASA 4PELA 4H85A 2HFEC 2W6IG 3K08A 1UYDA 2YEVA 1U0ZA 2XHRA 2EIJC 5L3CA 1NJIW 4LWIA 3DTUB 2A79B 4MVUA 3T2MA 3G6EV 1ZWHA 3ABKB 1N8RW 2WWWA 2XAHA 3ABTA 1K34A 1K5QA 1R6KA 1V55C 1AJNA 4U7NA 3HB3B 1K4DC 4RQFA 3E83A 1LNQA 1WLEA 4YXWG 2IWSA 4HYPA 3DGEA 1YESA 5D6QA 4AWOA 1RPOA 3ZRWB 2DQ3A 2EIKC 4L8ZA 2Q8FA 3E89A 3B24A 1S77D 2Y69C 4PA7A 5F5RA 3ZKDA 1W0JG 3RLPA 2GSMB 3BY6A 1ZXMA 3CMAV 4XD8A 4CWNA 5FWKA 5IY5B 2WLNA 1P7BA 1IXMA 3FB5C 1OSFA 2YEAA 1FFTB 3A0XA 3OUFA 5DM6V 1VQ5V 1Y4SA 2XHXA 2ZBKB 2LFRA 1K7DA 4PA4A 4GCZA 5EBWC 1NKDA 4LP0A 4EM7A 4WFFA 3WG7C 3K60A 5KA5A 1FXVA 1S72V 2Q8GA 2FTKA 2VW5A 1KZNA 1BYQA 4K4OA 5FNFA 3TZ2A 3I56V 2YE7A 2QEXV 1I59A 1NHJA 1OCOB 1MX0A 1K97A 5CTXA 2BREA 3ABLC 4CWSA 4I9WA 4XDMA 1DTOA 2XX5A 2WLKA 4CE2A 2WPDG 2ZXWC 3FYEB 1ENVA 4QIWF 4TT3G 4EFUA 4G2KA 1VQNV 3H80A 4URMA 3WFVA 4RQEA 1MU5A 3SPCA 4JQLA 2BYIA 2XNDG 2A9HA 4HZ5A 4URLA 4QE7A 4PU9A 1YT1A 1M90W 1BMFG 1AROP 1FXKA 4FK5C 4CWTA 2IOPA 1P4RA 3ASNC 5B1AC 4BAYA 1UYEA 1YC1A 3O2FA 1PVGA 4AWPA 1QCEA 5J9PC 3CCEV 4AS9A 4LCUC 3ZRWA 2GQPA 2QG0A 2YKCA 2WI7A 1KP3A 2OT5A 2WERA 3ZXQA 3E8HA 1EBOA 2YJXA 2DYSB 2XX2A 2HVKC 2WI3A 1AI5A 5IY5C 1WPXA 2HG1A 2C2AA 5BODA 1BHAA 4MTOA 2EINB 1KIJA 3D0BA 5L3FA 1YT2A 1E1RG 4BIUA 2EILB 3LNUA 2VWCA 2OCCC 3T4ZA 2O1VA 4R8CA 4L91A 3TTZA 4MW3A 4JAVA 4UUJC 3SPIA 5KA6A 2QF6A 1B63A 3GB7C 4G27B 4HYOA 1S76D 2HCHA 4MVZA 3E86A 5L3JA 3ZMSA 2K5BA 2BTZA 4HZ0A 5GW7A 4JPRA 4QPJA 4HXWA 5CMUA 4FIPC 3E8FA 2LP7A 4O07A 3T0ZA 5EBLC 2JEUA 1KQSU 1EA6A 1R6NA 1SESA 3QNEA 4ASGA 4L90A 3CC2V 3R92A 3EHFA 1U2OA 1BXDA 1GJVA 3ZCCA 2CH4A 2HG5C 1H2GA 4X9LA 2YEGA 1AM1A 1JQ0A 4ASAA 3CGYA 2Q2EB 1K33A 1M9NA 3AEIA 3EHHA 4MBCA 4QJFB 4KTNA 1QVFU 1I5YA 2H8PC 3ABMC 2QTOA 3SYOA 1I58A 2XDKA 4Z1MG 3F7VC 2WI6A 3RLQA 4RUEA 4XBFA 2YKBA 1GO3F 1TILA 4FCPA 2DYSC 2ITDC 1VQ6V 3FT5A 3RKZA 3VHDA 3TUHA 4NH8A 2R9IA 4HY1A 5D7CA 2Q8HA 5CBGA 2O1UA 1PKXA 4JYCA 3FB8C 4WCEV 5CF0A 3MD0A 5KUMA 4YKWA 3TZ0A 4CWRA 3ABKC 3FKSG 4R50A 3SYQA 1S16A 1QZRA 1I5DA 2YKIA 4LWGA 4KFMA 2B5UA 1YC4A 3ZMZA 3VBBA 1JM6A 2CG9A 3VOUA 1QVGU 4PDLA 3O6OA 5FNDA 3CCSV 3JCZA 1H8EG 2ITCC 2XAFA 3E35A 3JD0A 2P67A 1EFRG 4WFBV 1I5BA 2XAQA 4MB9A 1H7UA 4YKYA 3RLRA 3ZIAG 4O09A 3CYOA 5M4PA 2CCTA 3PEHA 3CD6V 2YKEA 3BMYA 3CCRV 1ZWIC 3F7YC 3B8NA 2AHZA 2IJKA 2W6JG 4PA9A 4O0BA 2IJIA 4ASUG 4XKAA 4MTFA 4L87A 1THNA 3Q5KA 5M4HA 3K0GA 2YE6A 3O0IA 2CGFA 1GKFA 2BU7A 4YKUA 1M56B 3T4DA 4ASBA 4BIZA 1V55B 3LSSA 3SL2A 3CRKA 1YJNV 2DWEC 1Y8PA 4ZKIA 3G7EA 4EGKA 1XL6A 5HFLA 1YHQV 3U2DA 1SRYA 3RVZA 2DW4A 1Q7YW 2DYRC 4MVMA 2CK3G 2XJJA 2GHYA 5B1OA 3C0EA 4EGIA 3HZ1A 3AG4C 4GX2A 3ML0A 2O1WA 2UXNA 1NVPB 1OCRC 2YE5A 1UY8A 2FWZA 2YE4A 3A0YA 3PEJA 4H7QA 5IDMA 1TIDA 1YJWV 4LWEA 3ABUA 2HR3A 1DF5A 2NNUA 3K3WA 4WF9V 4YKTA 1S3JA 3OMAB 2YE3A 2ZR3A 2AHYA 2Q68A 3TETA 1PNMA 2OCCB 1K9MW 1KD1W 1GKZA 1Z5AA 2ZKJA 3QDDA 5D6PA 3NXSA 1KECA 4AWQA 1AJPA 4O05A 3U2KA 5M4KA 3OEEG 1TUEB 4WFGA 2BT0A 1ORQC 3OR6C 1DF4A 1YIJV 5IYCO 4JTAB 1AH6A 3U67A 4P2ZA 4DZYA 2ZXWB 1K92A 3QO8A 4N21A 4O04A 1Y4UA 3AG1B 3EFFK 1AJQA 2FYPA 4GFNA 4WUCA 1YSCA 2WLLB 2AKPA 2BSMA 2Q8IA 3E8BA 5L3EA 1COWG 1MOFA 1A4HA 4LP8A 3X2QB 1V54C 5HFMA 4UVCA 4V25A 2XJXA 4QPKA 2WLIB 1M56C 4GX5A 1NR1A 5LGTA 1JPXA 3ASNB 3A0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FCQ A;  3GIF A;  3R4N A;  4L93 A;  4KQV A;  1YET A;  2WEQ A;  3OW6 A;  4BQJ A;  3CRL A;  1Y8O A;  3NMQ A;  2BYH A;  1AMW A;  3VAD A;  2JJC A;  1GKX A;  5BOC A;  4ASF A;  1H7S A;  2BRC A;  1YC3 A;  1YSR A;  4XE2 A;  1YER A;  4H81 A;  2IOQ A;  2WEP A;  1UY7 A;  3C11 A;  1UYF A;  2FWY A;  4LWF A;  4WUB A;  2YEH A;  4E02 A;  4CWO A;  4R3A A;  2YE8 A;  2H55 A;  3LPS A;  4AS9 A;  4HY6 A;  3WHA A;  1Z59 A;  4GQT A;  4MTX A;  5F3K A;  4WUD A;  2WI5 A;  2YJW A;  4JYB A;  1S14 A;  4HYM A;  5D7R A;  2BU6 A;  4U93 A;  3ZM7 A;  3D36 A;  1UYM A;  2PNR A;  2WI2 A;  4PRX A;  2ESA A;  3TZ4 A;  4DUH A;  5M4M A;  3A0R A;  3D2R A;  4XIP A;  4EMV A;  2YK2 A;  4LPB A;  4XCL A;  4E00 A;  5M4N A;  3HHU A;  4GT8 A;  4YKX A;  4E01 A;  1NHI A;  2VCI A;  3A0Z A;  4NH7 A;  3G7B A;  5B1N A;  4CWP A;  1QYE A;  3Q5L A;  3GIG B;  3B28 A;  4KP4 A;  4L94 A;  3HEK A;  4YKZ A;  4MPC A;  3IED A;  4W7T A;  2ZDY A;  3MNR P;  2XAB A;  4FCR A;  3JZ3 A;  4BAE A;  5J71 A;  3B25 A;  4XKK A;  2VCJ A;  2QM7 A;  4URN A;  3CGZ A;  1B3Q A;  4XCJ A;  2XDX A;  2YED A;  2YGA A;  3GIE A;  4LC1 A;  2HKJ A;  4XTJ A;  5CPH A;  4ZVI A;  2YEF A;  4I3H A;  2XD6 A;  3K98 A;  4PL9 A;  4B6C A;  5CTW A;  3EKO A;  2YEI A;  3B27 A;  3CWV A;  5IDM A;  2YE2 A;  2XDL A;  2YI6 A;  1AJ6 A;  2YI0 A;  3G75 A;  2Q8I A;  4FMT A;  4XKO A;  2YEB A;  4JAS A;  1US7 A;  5CTU A;  1JOY A;  1TBW A;  4KSH A;  4YKR A;  2IWX A;  4MPN A;  1UYG A;  3BM9 A;  4MOT A;  1TH8 A;  4PRV A;  2WI4 A;  4XIR A;  3OMU A;  3T1K A;  2YGF A;  3TK1 A;  2JKI A;  2QM8 A;  2YEJ A;  1TC0 A;  3FT8 A;  3P32 A;  4MT8 A;  1EI1 A;  4R1F A;  3EHJ A;  4GT1 A;  2FXS A;  4U7O A;  3INW A;  1L0O A;  1UYC A;  1I5C A;  3T10 A;  2EXL A;  3Q5J A;  3B26 A;  2UWD A;  4P8O A;  4KFG A;  3OWD A;  2GFD A;  1UYH A;  3HYZ A;  2BU8 A;  2QG2 A;  1QY8 A;  4URO A;  1BGQ A;  1BKN A;  1UYI A;  1Y8N A;  2IOR A;  2XX4 A;  2WI1 A;  1UYL A;  3ZKB A;  5GGZ A;  2YK9 A;  1YSZ A;  5CTY A;  2XJG A;  4EEH A;  4CE3 A;  2LFS A;  3ZRX A;  2IWU A;  1UYK A;  4P7A A;  3QTF A;  4MPE A;  3R4O A;  2YI5 A;  3GIG A;  2E0A A;  4BXI A;  4HXZ A;  2XDS A;  1TC6 A;  3TZ5 A;  3OPD A;  1YS3 A;  3EKR A;  1B62 A;  3VHA A;  4Q20 A;  4CWQ A;  1YT0 A;  2H8M A;  3FV5 A;  3HYY A;  1ZXN A;  3T2S A;  2BU2 A;  2QFO A;  3K99 A;  2XK2 A;  2YI7 A;  4EGH A;  2CCU A;  3ZRV A;  2YE9 A;  4V26 A;  1F51 A;  5FNF A;  3VHC A;  4B7P A;  3ZXO A;  3HZ5 A;  2YGE A;  1I5A A;  2YKJ A;  4I5S A;  2BU5 A;  3T0H A;  3R91 A;  1AH8 A;  1UY6 A;  5D7D A;  5M4E A;  2BZ5 A;  4BQG A;  3A0T A;  2CCS A;  1UY9 A;  3INX A;  1R62 A;  3KE6 A;  4CE1 A;  5IN9 A;  3K97 A;  4MP7 A;  3EHG A;  4YKQ A;  4GEE A;  3R4P A;  3WQ9 A;  5C93 A;  3R4M A;  5J6A A;  5FNC A;  1Z5B A;  4MP2 A;  4XC0 A;  2ZDX A;  4CWF A;  4NH9 A;  1ID0 A;  1NHH A;  5IDJ A;  4GGL A;  4FPP A;  1Z5C A;  2XHT A;  4JAU A;  2YEC A;  4XIQ A;  4LWH A;  4EFT A;  2XDU A;  1ZW9 A;  4R3M A;  4XIT A;  4H85 A;  1UYD A;  1U0Z A;  2XHR A;  4LWI A;  1ZWH A;  2WWW A;  2XCM A;  3OWB A;  4U7N A;  2YEE A;  3H4L A;  4KSG A;  4HYP A;  5D6Q A;  2IWS A;  4AWO A;  3DGE A;  1YES A;  3ZRW B;  4L8Z A;  2Q8F A;  3B24 A;  3ZKD A;  5F5R A;  3RLP A;  1ZXM A;  4XD8 A;  4CWN A;  5FWK A;  1OSF A;  3A0X A;  1IXM A;  2YEA A;  1Y4S A;  2XHX A;  2ZBK B;  2LFR A;  4EM7 A;  5M4K A;  4GCZ A;  4LP0 A;  3K60 A;  2Q8G A;  2FTK A;  2VW5 A;  1KZN A;  1BYQ A;  4K4O A;  3TZ2 A;  2YE7 A;  1I59 A;  1NHJ A;  1MX0 A;  5CTX A;  4CWS A;  2BRE A;  4XDM A;  2XX5 A;  4CE2 A;  4EFU A;  3H80 A;  4URM A;  1MU5 A;  4JQL A;  2BYI A;  4HZ5 A;  4URL A;  4PU9 A;  1YT1 A;  4CWT A;  2IOP A;  1YC1 A;  1UYE A;  3O2F A;  1PVG A;  4AWP A;  2YKC A;  3ZRW A;  2GQP A;  2QG0 A;  2WI7 A;  2WER A;  3ZXQ A;  2YJX A;  2XX2 A;  2WI3 A;  2HG1 A;  5BOD A;  2C2A A;  3D0B A;  1KIJ A;  1YT2 A;  4BIU A;  3LNU A;  2VWC A;  3TTZ A;  2O1V A;  4L91 A;  2QF6 A;  4JAV A;  1B63 A;  2HCH A;  5L3J A;  2K5B A;  2BTZ A;  4HZ0 A;  4QPJ A;  4HXW A;  4O07 A;  3T0Z A;  1EA6 A;  4ASG A;  4L90 A;  3R92 A;  3EHF A;  1U2O A;  1BXD A;  1GJV A;  3ZCC A;  2CH4 A;  4X9L A;  2YEG A;  1AM1 A;  4ASA A;  3CGY A;  2Q2E B;  4MBC A;  3EHH A;  4KTN A;  1I58 A;  2XDK A;  2WI6 A;  3RLQ A;  5D6P A;  2YKB A;  1TIL A;  4FCP A;  3RKZ A;  3VHD A;  3FT5 A;  3TUH A;  4NH8 A;  4HY1 A;  5D7C A;  2Q8H A;  2O1U A;  4JYC A;  5CF0 A;  3MD0 A;  4YKW A;  3TZ0 A;  4CWR A;  4LWG A;  1S16 A;  1QZR A;  1I5D A;  2YKI A;  1YC4 A;  1JM6 A;  2CG9 A;  3O6O A;  5FND A;  1I5B A;  2P67 A;  4MB9 A;  1H7U A;  4YKY A;  3RLR A;  4O09 A;  5M4P A;  2CCT A;  3PEH A;  2YKE A;  3BMY A;  4O0B A;  4XKA A;  1THN A;  3Q5K A;  5M4H A;  2YE6 A;  3O0I A;  2CGF A;  2BU7 A;  4YKU A;  4ASB A;  4BIZ A;  3SL2 A;  3CRK A;  1Y8P A;  4ZKI A;  3G7E A;  4EGK A;  3U2D A;  3C0E A;  2XJJ A;  5B1O A;  4EGI A;  3HZ1 A;  2O1W A;  2YE5 A;  1UY8 A;  2FWZ A;  2YE4 A;  3A0Y A;  3PEJ A;  4H7Q A;  1TID A;  4LWE A;  4YKT A;  2YE3 A;  1GKZ A;  1Z5A A;  3QDD A;  2ZKJ A;  3NXS A;  4AWQ A;  4O05 A;  3U2K A;  2BT0 A;  1AH6 A;  3U67 A;  4DZY A;  4O04 A;  4WUC A;  1Y4U A;  2FYP A;  4GFN A;  2AKP A;  2BSM A;  1A4H A;  4V25 A;  2XJX A;  4QPK A;  3A0W A; 
#chains in the Genus database with same CATH topology
 4FCQ A;  1JX9 A;  4CZZ A;  4CH4 A;  1YET A;  1VEW A;  2ZD9 A;  4KHP B;  4BQJ A;  1Y8O A;  3H1H H;  1HNZ B;  4H33 A;  3JD4 A;  4IHJ B;  1NR7 A;  3M7M X;  3TJT A;  3KCY A;  1AMW A;  1EN6 A;  3FB7 C;  5IWA O;  2JJC A;  5LYJ B;  3G71 V;  2Q5Z A;  1PL0 A;  5B5E Z;  4XE2 A;  3AG2 B;  1YER A;  1FFX A;  1H2N A;  1NVP D;  3FX7 A;  1JJ2 U;  3DC6 A;  1KKC A;  2IU0 A;  1KC8 W;  2FWY A;  4LWF A;  4WUB A;  4E02 A;  4CWO A;  1IUR A;  2YXL A;  1K8A W;  2HKO A;  1M57 B;  2WAM A;  1HNX B;  2XTA A;  2YE8 A;  2CH7 A;  4EEQ A;  4GQT A;  1H38 A;  2WLL A;  5BMV A;  2H94 A;  4O4J A;  1NQT A;  1S14 A;  1AB3 A;  2CGO A;  5FPO A;  4U93 A;  3IC7 A;  3QO5 A;  4MSW C;  2R70 A;  2PNR A;  4UCU A;  4TSF G;  2ESA A;  4E72 A;  3TZ4 A;  2CH7 B;  1FPO A;  1BHB A;  1NTZ H;  3A0R A;  3D2R A;  2B1G A;  2YK2 A;  4LPB A;  1WB7 A;  4JYA B;  4DO2 A;  2Q6A A;  3HKE A;  4GT8 A;  3ZX6 A;  4PDV A;  3G67 A;  2JS5 A;  3OMI B;  3STL C;  4UCV A;  3K9S A;  4NTY A;  4FLY A;  5KX5 A;  4L94 A;  2LJ2 A;  4YKZ A;  4NB5 A;  3IED A;  3J80 N;  4YJ2 B;  5J71 A;  5LHH A;  2EIN C;  3UO3 A;  4DUY O;  2QM7 A;  3JAK A;  1YF2 A;  2IH3 C;  4RO2 A;  1AIL A;  2LW1 A;  1GM9 A;  5LBQ A;  4XCJ A;  3CSX A;  4EFE A;  2YED A;  1S5H C;  1JA8 A;  2UUA O;  2P22 C;  2JK5 C;  3ZRS A;  2QM4 A;  4I3H A;  4X20 B;  2XD6 A;  3CWB H;  3K98 A;  4JI8 O;  3ASO C;  1IBL O;  5CTW A;  3B27 A;  2ZQM A;  3HPL C;  1OCZ B;  2JGD B;  3RVY A;  2XDL A;  4ZIB A;  3S3W A;  5H6R A;  3G75 A;  1CPY A;  1SS3 A;  4X1K A;  2YEB A;  4X1I A;  2HLD G;  1MSW D;  1YJ9 V;  2NLJ C;  1OCO C;  1TBW A;  2Q4P A;  1YIT V;  4ZHQ B;  1IBK B;  2WA4 A;  3X2Q C;  1VQ7 V;  2QKS A;  1TH8 A;  1BQZ A;  4XIR A;  5K1P A;  3OMU A;  3T1K A;  1MZF A;  1SQX H;  2JJ1 G;  5LA6 B;  2DN9 A;  3CE2 A;  4FLT A;  1Q8I A;  5B1B B;  3GWO A;  4OPH A;  4DV1 O;  3WB1 A;  3APQ A;  3TCU A;  2KSD A;  1E79 G;  2ZIO A;  1OCZ C;  3OWD A;  4I4T B;  1CEZ A;  3HYZ A;  1QY8 A;  1KU9 A;  1VF6 C;  1VQM V;  2HJF C;  1BKN A;  1UYI A;  2IOR A;  5LYJ A;  2XX4 A;  2XT9 A;  1GN3 A;  2OWO A;  1MSD A;  3ZKB A;  1FKA O;  1RSO B;  1HWY A;  1Y4M A;  2F66 C;  2OTJ V;  2XJG A;  3ZMV A;  1M5I A;  1XUQ A;  4IYH A;  4CE3 A;  3ZRX A;  1F23 A;  2EZP A;  5B1B C;  4MPE A;  3R4O A;  5BZB A;  2E0A A;  3DXR B;  5GON B;  4CC6 A;  1TC6 A;  3BEH A;  1ZL8 B;  5B3S B;  5CBF A;  2BOB C;  1NT2 B;  4B7E A;  1TVK A;  4CWQ A;  4JTD B;  2YI9 A;  1ZSP A;  4LF4 O;  4O2A A;  5LMN B;  2H8M A;  3FV5 A;  3HYY A;  4TUY B;  2Y0I A;  2YIB D;  3UT5 B;  2YXY A;  2QFO A;  1VF7 A;  5E1A C;  3OEH G;  2XK2 A;  2WLJ A;  4LFC O;  4JI4 B;  5K1X A;  4FJC C;  3CC4 V;  1VQP V;  4V26 A;  2GTS A;  3OR7 C;  5CN0 A;  1EZJ A;  1FXK C;  2YKJ A;  2PGG A;  4I5S A;  5D7D A;  2C1I A;  2ZE6 A;  4UXN A;  4K0K B;  1UJW B;  3A0T A;  5H9C A;  1E1Q G;  1WB8 A;  3P3P A;  4YHH O;  3RWR D;  2F43 G;  1FJG O;  3B8M A;  4YJ2 A;  2BTQ A;  5C93 A;  3K5L A;  1URF A;  2YIC A;  2VQE O;  4X1Y B;  5IDJ A;  3CXH F;  4O2A B;  4GGL A;  1GK9 A;  4YIP A;  1MZE A;  1XNR O;  2YEC A;  1N33 O;  2XDU A;  3AK1 A;  2P4V A;  3RT3 C;  4O4L A;  4B3M O;  2YEV A;  1PPJ H;  3DTU B;  1VF5 B;  3JAL A;  3ABK B;  2WWW A;  1V55 C;  2YEE A;  1AJN A;  5D6Q A;  4TV9 B;  4I9Q A;  4GKK B;  4CWN A;  1IX9 A;  3A0X A;  3A0B Z;  5DM6 V;  2XHX A;  2AXT Z;  4PA4 A;  5M4K A;  3U11 A;  2Z0A A;  5LMU O;  2E5L B;  5IYZ A;  4O4I A;  5IT9 N;  2DMX A;  2YE7 A;  2QEX V;  3AK2 A;  1WPB A;  1WP8 A;  1K97 A;  2BRE A;  4XDM A;  1DTO A;  4H0L B;  1NS1 A;  2XX5 A;  2WLK A;  2P06 A;  3CRC A;  3VQV A;  3CJH A;  3JAK B;  4LWS A;  1ENV A;  1VQN V;  2XND G;  5J2U A;  4HZ5 A;  1JFF B;  1YT1 A;  1Y76 A;  1ARO P;  1Y74 A;  3L70 H;  3O2F A;  4IIJ B;  1TGO A;  4AWP A;  3H1I H;  1BS3 A;  3ZXQ A;  3M8A A;  2XX2 A;  2HVK C;  2WI3 A;  3SGI A;  1KB9 F;  1HNW B;  3CRR A;  4MTO A;  2CDY A;  5EIB D;  1G1X B;  2GUZ B;  2FYU H;  1XMO O;  3TTZ A;  2O1V A;  4IIJ A;  1IZ3 A;  4G27 B;  4TV8 B;  2G38 A;  1PM9 A;  4MVZ A;  4TOI A;  2HCH A;  4HZ0 A;  1Q90 D;  3CRA A;  3CB2 A;  4GKJ O;  2RMK B;  5CMU A;  4FIP C;  4C7U A;  1H2S B;  1XHZ A;  5EYP B;  2GUZ A;  1GJV A;  2HHH B;  1NTK H;  3L71 H;  2YEG A;  3ZHU A;  4ASA A;  2E5L O;  2Q7H A;  3EHH A;  1B04 A;  2H8P C;  2EJ7 A;  1FAF A;  5IWA B;  3ABM C;  3K59 A;  2VWK A;  2Q0A A;  3F7V C;  3BCC H;  3RLQ A;  4FCP A;  1VQ6 V;  4NH8 A;  2Q8H A;  4DR2 O;  4JYY A;  5CF0 A;  2AZ2 A;  4YKW A;  4QGP A;  3TZ0 A;  4CWR A;  1SA0 A;  3ABK C;  3FKS G;  4R50 A;  2UU9 O;  4LF8 O;  1I5D A;  4DR3 B;  5D5P A;  2B5U A;  1YC4 A;  3K5M A;  5LOV A;  1JM6 A;  3O6O A;  4TV8 A;  2P67 A;  3L75 H;  2XAQ A;  1Q6U A;  3CYO A;  2CCT A;  2YKE A;  2W6J G;  1JMK C;  4L87 A;  2XUM A;  3Q5K A;  5M4H A;  1I0H A;  4J7J A;  4CH6 A;  5J2T B;  1GKF A;  3T4D A;  4BIZ A;  1V55 B;  3NR7 A;  5LOV B;  1Y8P A;  4ZKI A;  4EGK A;  5HFL A;  2DW4 A;  3C0E A;  2XJJ A;  5B1O A;  3HZ1 A;  4GX2 A;  2KQX A;  1VIB A;  1NVP B;  1OCR C;  2ARH A;  2YE5 A;  1UY8 A;  2FWZ A;  3JAT B;  2UXB O;  1YJW V;  3S3X A;  2FB5 A;  4YKT A;  1DF5 A;  2PTM A;  1S3J A;  2ZR3 A;  2Q68 A;  3TET A;  4IL6 Z;  1PNM A;  1K9M W;  1GKZ A;  1XOU A;  1AJP A;  2KG7 B;  1ORQ C;  3OR6 C;  4DZY A;  1QHT A;  4O04 A;  4NXM B;  3EFF K;  1YSC A;  2AKP A;  4B3T B;  3HKB A;  2GDS A;  1TA8 A;  1V54 C;  2E76 B;  3N2K B;  1W0K G;  3T1H O;  1QLE B;  4PDR A;  4KQV A;  3OW6 A;  1BCC H;  2Q7E A;  2BYH A;  4F6R B;  2UXX A;  5BOC A;  1XMQ B;  3ZS8 C;  1WA8 A;  2BRC A;  2Q73 A;  3K06 A;  2P6J A;  2PI4 A;  5LP6 C;  1RM1 B;  2YIA A;  4ZOL A;  4X1Y A;  4FLV A;  2WEP A;  4H81 A;  5JH7 B;  1XMQ O;  3JAR A;  1UYF A;  4I7Z B;  2IM9 A;  1NBM G;  3DC5 A;  4J80 A;  3LPS A;  2B1I A;  1DGS A;  2QR4 A;  4B3R O;  4HY6 A;  3ZN0 A;  3WHA A;  3BAA A;  4R7C A;  5F3K A;  4MTX A;  2WI5 A;  1SER A;  4LF6 B;  3WG7 B;  5KHK A;  3KKY A;  4HYM A;  1K4C C;  3JAL B;  2WLM A;  1PNK A;  3CCQ V;  4TWK A;  2PI5 A;  3SPH A;  1JVM A;  2WI2 A;  3ABL B;  4BR6 A;  3JYC A;  1M1K W;  4BIO A;  4DV7 O;  4XIP A;  4E00 A;  3G6B A;  4BW9 A;  4MVO A;  2F93 B;  5FNV A;  3PN1 A;  4PDM A;  2R72 A;  3SR2 C;  1NHI A;  3E22 A;  5EC2 C;  1GTO A;  2BCC H;  1XMO B;  3G7B A;  5B1N A;  4CWP A;  1GAX A;  3LDC A;  4U3F H;  2EIM B;  4YIO A;  2OCH A;  3Q5L A;  2X0L A;  3JAR B;  3GIG B;  1HNW O;  2BE3 A;  1N34 B;  4NXN O;  4DV2 B;  4KP4 A;  3HEK A;  4MPC A;  1BT8 A;  3SPG A;  5FNV B;  3MNR P;  4FCR A;  2K1E A;  2LW7 A;  3JZ3 A;  4BAE A;  3B25 A;  2P90 A;  2XDX A;  3K9A A;  4TUY A;  4A5U B;  2LO1 A;  2MW2 B;  3GIE A;  4J42 A;  1TAE A;  2F23 A;  2YUA A;  2HKJ A;  3K03 A;  4B08 A;  3E2E A;  2Y48 A;  2YEF A;  4ZVI A;  1K5S A;  5BXZ A;  1MMM A;  3ZHT A;  5CB4 B;  4PL9 A;  4DRX B;  2IH1 C;  4B6C A;  4JI6 B;  4AQY O;  1HNZ O;  2YI0 A;  2WLI A;  1OZ0 A;  4UVB A;  4FMT A;  4XKO A;  4JAS A;  4DUY B;  2QJ1 A;  3CP1 A;  3PJS K;  1Q81 W;  1AI4 A;  4DV6 B;  3UM7 A;  4PA6 A;  4MOT A;  2X7R B;  3TXQ A;  3AG2 C;  2WI4 A;  2QSA A;  5DED A;  3GVM A;  4P30 A;  2YGF A;  3VQX A;  3D36 C;  2UUC O;  2JKI A;  1MNG A;  1QBZ A;  3Q4H B;  4MTG A;  2XAG A;  2RNB A;  4GZR B;  2BTO A;  1TC0 A;  1SQP H;  2KG7 A;  3APO A;  4R1F A;  4GT1 A;  1SET A;  1AVM A;  1M57 C;  4U7O A;  1JCH A;  2FXS A;  3INW A;  1N36 O;  2EUL A;  3ZMU A;  5A9G A;  2VQF O;  5H6Q A;  2ZT9 B;  4X65 O;  1EZV H;  5GTI Z;  3Q4H A;  2UWD A;  4KFG A;  4X62 B;  1GM7 A;  1UYH A;  1QQC A;  4URO A;  1G4Y B;  4JI0 O;  1BGQ A;  3AG4 B;  1FXH A;  4XDJ A;  4O2B B;  4EB6 B;  1QR9 A;  2FL4 A;  5GTH Z;  1TUB A;  2XOK G;  2ATK C;  4G28 B;  3HKB B;  5JWP A;  2EIM C;  1LUW A;  4EEH A;  2EZO A;  2JIZ G;  1UYK A;  4X20 A;  3QTF A;  1VP7 A;  4BXI A;  3B77 A;  4O4H B;  1M93 A;  3ZN1 A;  2Y0P A;  4DV0 O;  3WU2 Z;  3EKR A;  1W59 A;  3OUS A;  3VHA A;  1RSO A;  2GBO A;  2X6B A;  3AG7 A;  4WBN B;  4Z2W A;  1YT0 A;  1XIL A;  4JI6 O;  4PA3 A;  3BA8 A;  4I0X A;  2BU2 A;  4JI2 B;  5IJ9 A;  3U10 A;  3IC9 A;  3DXR A;  5GON A;  4EFB A;  2CCU A;  2YE9 A;  1XEQ A;  1JR9 A;  4X65 B;  1RPR A;  3UQ8 A;  4B7P A;  4JF3 A;  3ZXO A;  4FLU A;  1NH2 D;  2YGE A;  1BQ0 A;  1N36 B;  5CBH A;  3T0H A;  1Y74 B;  1N33 B;  3LSQ A;  3N2G B;  5LGU A;  4X1K B;  4MVQ A;  2CCS A;  1FS0 G;  3AG3 B;  2X6A A;  2Z3Y A;  3KE6 A;  2V1D A;  4UV8 A;  1W2B U;  4MP7 A;  4ABM A;  4YKQ A;  4GEE A;  3R4P A;  2PYL A;  3G4S V;  3R4M A;  5JJN B;  3JSL A;  3HKD B;  4MP2 A;  3SJQ C;  4DXW A;  4NH9 A;  1ID0 A;  4QE9 A;  2RCV A;  3H1J H;  4FPP A;  2ZM6 O;  1IDS A;  3LDE A;  4B3R B;  4K0K O;  3CC7 V;  4NYK A;  5EC1 C;  4JTC B;  1N4C A;  3FB6 C;  4MS2 A;  1MAB G;  3HKD A;  1XBL A;  2A79 B;  4MVU A;  4O4I B;  3T2M A;  3G6E V;  3RGB A;  1N8R W;  2XAH A;  3ZBH A;  1K34 A;  1K5Q A;  4JI3 B;  2L35 A;  2XCM A;  3OWB A;  3HB3 B;  1K4D C;  4KSG A;  1J5E O;  1ZTE A;  3DGE A;  1RPO A;  3ZRW B;  2DQ3 A;  4L8Z A;  2Q8F A;  3E89 A;  3B24 A;  2Y69 C;  5F5R A;  3CMA V;  5FWK A;  1P7B A;  3J81 N;  3FB5 C;  1FFT B;  3OUF A;  1Y4S A;  3B4S A;  3QTC A;  2LFR A;  4GCZ A;  5EBW C;  1NKD A;  4LP0 A;  2HP8 A;  5CA1 A;  5KA5 A;  3IJ4 A;  2FTK A;  3QG5 A;  2VW5 A;  1CXZ B;  5TIS Z;  1P84 F;  1I59 A;  1XRE A;  4FVM A;  1Z5W A;  1OCO B;  1IBM B;  5CTX A;  4PI2 A;  3B09 A;  1LR1 A;  4CE2 A;  2WPD G;  2ZXW C;  4QIW F;  5IJ0 B;  4G2K A;  2ZIM A;  3WFV A;  4RQE A;  4URL A;  2PUS A;  4PU9 A;  1BMF G;  4CWT A;  2L6L A;  3BA9 A;  1UYE A;  1PVG A;  4CS4 A;  3CCE V;  2YKC A;  3ZRW A;  2GQP A;  2QG0 A;  1KP3 A;  3E8H A;  1EBO A;  3WB0 A;  2DYS B;  3RYH B;  1XNQ O;  2YJX A;  3S5T A;  4Q6G A;  4K35 A;  3D0B A;  1KIJ A;  1SF9 A;  4BIU A;  2EIL B;  2VWC A;  2OCC C;  3T4Z A;  4R8C A;  5FLX N;  4MW3 A;  4JAV A;  4UUJ C;  1B63 A;  4HYO A;  3E86 A;  4JPR A;  3CYG A;  3RFR A;  4O4H A;  4PI0 A;  4O07 A;  3T0Z A;  2JEU A;  1EA6 A;  3QNE A;  3CC2 V;  3R92 A;  3EHF A;  1QU7 A;  2CH4 A;  2HG5 C;  4W4K A;  1H2G A;  4X9L A;  1JQ0 A;  3CGY A;  2Q2E B;  4MBC A;  1M9N A;  1Q3E A;  3MAQ A;  1I5Y A;  3G80 A;  4FLZ A;  4JV5 O;  2CTW A;  1HNX O;  2M6Y A;  1GN6 A;  2YKB A;  1TIL A;  2DYS C;  4LNU B;  3FT5 A;  3RYF A;  4JYC A;  4UCR A;  3FB8 C;  4WCE V;  3MD0 A;  4LH6 A;  4IGG A;  5KUM A;  1I94 O;  4LF8 B;  3SYQ A;  2F4V B;  4KFM A;  1IBL B;  4FM2 A;  3ICX A;  2CG9 A;  3N2G A;  3CCS V;  4DR2 B;  3JD0 A;  1EFR G;  4I55 A;  1NTM H;  4MB9 A;  3RLR A;  1EN4 A;  3CRM A;  4I0X B;  5A2Q N;  2AHZ A;  4O0B A;  1H2L A;  4ASU G;  4XKA A;  4KHP O;  1V9P A;  3UCS C;  2ZM6 B;  4JI7 O;  3K0G A;  2YE6 A;  3O0I A;  4YKU A;  4ASB A;  1M56 B;  1SA0 B;  4LFB O;  3SL2 A;  3CRK A;  1YJN V;  2DWE C;  2UXD O;  4UCS A;  1XL6 A;  2PYJ A;  3ZHV A;  4Z1V A;  5KHJ A;  1Q7Y W;  2DYR C;  4B3M B;  2CK3 G;  4EGI A;  1Y67 A;  2O1W A;  5JEN A;  2UXN A;  2F95 B;  4CH5 A;  3PEJ A;  1TVK B;  4LF7 O;  5B66 Z;  2HR3 A;  4WF9 V;  2YE3 A;  1KD1 W;  2E75 B;  3QDD A;  3NXS A;  4AWQ A;  1S5L Z;  3U2K A;  3OEE G;  2C1G A;  4JTA B;  1Q6H A;  2ZXW B;  3QO8 A;  4WUC A;  3AG1 B;  4DR3 O;  1IVS A;  2WLL B;  2BSM A;  3E8B A;  4JAA A;  1A4H A;  1MOF A;  2B9Z A;  2VS0 A;  1M56 C;  2HHI A;  1NR1 A;  5LGT A;  1JPX A;  3D8C A;  2KB1 A;  2WEQ A;  3NMQ A;  3VAD A;  4YJ3 A;  2BSK B;  1OJH A;  3BHP A;  3QO7 A;  1H7S A;  2VRZ A;  1PNL A;  2E3C A;  1B06 A;  1YSR A;  1S0V A;  4O4J B;  3RYI A;  2QWP B;  4N23 A;  3WB2 A;  5LMN O;  1UY7 A;  2DJV A;  3C11 A;  4X9Q A;  5KAF Z;  2DQ0 A;  1N0J A;  4W4L A;  2YIB A;  1ROP A;  1XL4 A;  4PHZ A;  3RYC A;  1GN2 A;  1SQV H;  1WP7 A;  4JI1 B;  1FYJ A;  2W0F C;  2UXC O;  2JRI A;  5L3G A;  2ZIN A;  1RM1 C;  1GM8 A;  3OGC C;  4O4L B;  5IJ0 A;  4B3S B;  1Z5V A;  4P9P A;  1UYM A;  2EX3 A;  2IJH A;  4PRX A;  3R65 A;  3JSN A;  1Q82 W;  4IHJ A;  4DUH A;  2BTQ B;  4EMV A;  5JCO C;  1VQL V;  5M4N A;  3MHS C;  5BMV B;  4RUF A;  1NU1 H;  5CA1 B;  2VCI A;  2P7T C;  4J9Y B;  3A0Z A;  4X66 O;  1YTF B;  3VQW A;  3E8G A;  1OCC C;  3T1Y O;  3OM3 B;  3B28 A;  2Q9L A;  4WFH A;  4LFC B;  2UXD B;  1Y66 A;  1B6Q A;  2ODM A;  3RYF B;  3KG2 A;  5DN6 G;  1CP9 A;  3OTO O;  5LMU B;  4DV1 B;  2HEP A;  1D2D A;  1B3Q A;  4LF4 B;  5J2U B;  2OTL V;  4RAI A;  1YTF D;  1ZUQ A;  4AIL C;  4LC1 A;  4X8A A;  4XTJ A;  5CPH A;  4KUM A;  4I55 B;  5L3B A;  3ETE A;  3CME V;  2N04 A;  2OIG A;  4BW5 A;  2V7Q G;  1Q86 W;  3K57 A;  1IBK O;  1ZAU A;  3EKO A;  2PZS A;  2OYQ A;  3K5N A;  3HKE B;  4NVP A;  1SQQ H;  2YEV B;  4D7T A;  1V54 B;  2JEX A;  3GWK C;  3KZI Z;  4X89 A;  2YI6 A;  4HZ3 A;  3T1H B;  2ZDI C;  5KAI Z;  5CTU A;  2GV9 A;  1JOY A;  1XNR B;  3EXA A;  2P4K A;  1Q6I A;  4KSH A;  2BOC C;  3K04 A;  4NXM O;  2ILM A;  1SZT A;  1UYG A;  3IGA C;  2IWX A;  4MPN A;  1YVW A;  5BR8 O;  2EJR A;  3ETQ A;  4PRV A;  2VQE B;  3FYI B;  5LP6 B;  1L0N H;  2IW5 A;  2UUA B;  4H37 A;  3ZJZ A;  4DYL A;  2WLH A;  2UXB B;  1G8M A;  3FT8 A;  2O57 A;  2JGU A;  3P32 A;  2Q67 A;  1OV9 A;  4HNA B;  5KHG A;  1HR0 B;  3RBZ A;  1L0O A;  1TUB B;  1UYC A;  3T10 A;  2CGN A;  2D3O W;  3EHB B;  1PV0 A;  4HAM A;  4F4L A;  2EIJ B;  5LHI A;  3B26 A;  4P8O A;  4DR7 O;  4DUZ O;  5C8Y B;  4ZBM A;  1L1F A;  1I5X A;  2GFD A;  1PL4 A;  2NN4 A;  3SJC C;  2EIK B;  3RN4 A;  4X66 B;  1N0N A;  5IYB O;  2WI1 A;  2R9R B;  2N05 A;  1YCI A;  1UYL A;  5GGZ A;  2M7W A;  1M4U A;  2EBO A;  1K73 W;  1YSZ A;  3OW2 U;  3SYA A;  4J9Z B;  2YSU B;  1F4M A;  5B1A B;  4QNH B;  4P7A A;  4U3J B;  3KCX A;  5IJ9 B;  3GIG A;  2K9P A;  3K0D A;  1F7Y A;  4FLX A;  3W7W A;  2P5O A;  2XDS A;  4JI1 O;  4DK0 A;  1YS3 A;  1B62 A;  3M99 B;  4NTW A;  3D3I A;  4PD4 F;  4J7Z A;  2ZE8 A;  3OAA G;  2JDI G;  4UCO A;  1QLE C;  1OCC B;  4LF9 B;  3OTO B;  3CCV V;  3ETG A;  2ZDI A;  4JGS A;  2HHH O;  3K99 A;  1R3K C;  1KMI Z;  4PV1 B;  1YDX A;  4EGH A;  3LNM B;  3ZRV A;  4WFA V;  4DR4 B;  3CEI A;  2A7W A;  4JZ2 A;  4TQD A;  4GKJ B;  3W7S A;  5FNF A;  3VHC A;  4FFK A;  3C90 A;  3HZ5 A;  3THO A;  4UV9 A;  5H5N A;  1AH8 A;  1UY6 A;  5M4E A;  3H1K H;  1X4T A;  1GMG A;  2RQ6 A;  2Y4T A;  4GX1 A;  3CS5 A;  4LH7 A;  1GRJ A;  1UY9 A;  4U3J A;  3A8T A;  1R62 A;  4CE1 A;  5IN9 A;  2YDE A;  2QWQ B;  1R1B A;  3WQ9 A;  5J6A A;  1O9G A;  3I55 V;  1Z5B A;  2DWD C;  5J2T A;  5FNC A;  2ZDX A;  1EN5 A;  1RFY A;  4CWF A;  4J7K A;  3L72 H;  3F5W C;  1HDJ A;  5L3D A;  1D5A A;  5CA0 B;  2UXC B;  5ITZ A;  3ETD A;  5LHG A;  3W7U A;  1VQ4 V;  3RYC B;  1XHX A;  3JCU Z;  4DR5 B;  1U97 A;  1ZW9 A;  4R3M A;  4ICG A;  5IYD O;  4XIT A;  1DLB A;  1MA1 A;  3I5D A;  2HFE C;  3K08 A;  2H3O A;  2EIJ C;  5L3C A;  5KLV H;  1ZWH A;  4I50 B;  2V4D A;  3ABT A;  3H4L A;  3OTF A;  5KMG A;  1LNQ A;  4YXW G;  4AWO A;  4UFZ A;  4E4E A;  4DK1 A;  1US6 A;  4DW1 A;  2VWJ A;  4JI2 O;  1UPG A;  1UFI A;  4JI7 B;  1W0J G;  3RLP A;  2GSM B;  3BPZ A;  1ZXM A;  5IY5 B;  2WLN A;  1OSF A;  1IXM A;  3ZHR A;  1K7D A;  4WFF A;  3K60 A;  1FXV A;  2Q8G A;  3LMM A;  2A3Q A;  1BYQ A;  5JJE B;  2W0X A;  4DV0 B;  3I56 V;  2CUG A;  5LA6 A;  3O9O A;  5KX5 B;  4F6R A;  4I9W A;  3FAV B;  5KHI A;  2QKC A;  4TT3 G;  3SDL A;  3H80 A;  4URM A;  2ADP A;  2BYI A;  2A9H A;  1FXK A;  4FK5 C;  2CE4 A;  2IOP A;  1P4R A;  3ASN C;  5B1A C;  4BAY A;  3ZHQ A;  4DV4 B;  1QCE A;  5J9P C;  5KMG B;  4J11 A;  4LCU C;  3FAV A;  1R6T A;  2WI7 A;  3OT7 A;  4PJ0 Z;  1AI5 A;  5IY5 C;  1WPX A;  4AI8 A;  2C2A A;  1BHA A;  2EIN B;  4ZI7 B;  2Y4U A;  3FFQ A;  1Y76 B;  4L91 A;  4CS3 A;  3SPI A;  3SJB C;  2VQF B;  4LF7 B;  4YJ3 B;  2BTZ A;  5GW7 A;  1VMG A;  4HXW A;  3E8F A;  1XNQ B;  4L90 A;  3ZCC A;  5FPR A;  4UB8 Z;  1X59 A;  1AM1 A;  2Q8V A;  1I94 B;  1JFF A;  1K33 A;  3AEI A;  4DV6 O;  4QJF B;  1D5N A;  4KTN A;  4BWA A;  4UB6 Z;  3SYO A;  4Z1M G;  2WI6 A;  2BSK A;  5D6P A;  4XBF A;  3TUH A;  5JCO A;  1WN7 A;  2R9I A;  5D7C A;  4AQY B;  2F1M A;  4CS2 A;  4I4T A;  3ZMZ A;  3VBB A;  3VOU A;  1QVG U;  4PDL A;  5FND A;  1H8E G;  4WFB V;  3E35 A;  4LF5 B;  4YKY A;  5JJJ B;  1WJZ A;  3JAM N;  3CD6 V;  4JV5 B;  1ZWI C;  3F7Y C;  2CTQ A;  2IJI A;  3H9V A;  1SQG A;  2CGF A;  2BU7 A;  5JQG A;  3LSS A;  5CA0 A;  1SRY A;  3RVZ A;  2AZ0 A;  3AK3 A;  4DV2 O;  2GHY A;  1FJG B;  2HJD A;  4FZ0 A;  1JJO A;  4FFB A;  5JQG B;  3A0Y A;  3UO2 A;  4F6E A;  1AR4 A;  4LWE A;  2NNU A;  4DV5 B;  5D5Q A;  2AHY A;  4WBN A;  1Z5A A;  3U0Z A;  4K8X A;  1KEC A;  4TV9 A;  2DOS A;  4DV3 O;  4O05 A;  2QTS A;  1TUE B;  4NTX A;  4WFG A;  2BT0 A;  5IYC O;  3U67 A;  1K92 A;  1Y4U A;  2F4V O;  1FFX B;  5HFM A;  3OGI B;  2XJX A;  4LF6 O;  4GX5 A;  4D6T H;  5IYZ B;  3ASN B;  3A0W A;  3GIF A;  3R4N A;  4L93 A;  2A0L A;  4J10 A;  5JH7 A;  3CRL A;  1ZX3 A;  3MHH C;  3LDD A;  3O65 A;  4XDK A;  2Q69 A;  2QE7 G;  3ABM B;  3A2F A;  1GKX A;  4NKG B;  4ASF A;  3C3T A;  5B3S C;  4MVR A;  4LWS B;  1YC3 A;  3H01 A;  1KP2 A;  3A0H Z;  1AR1 B;  2IOQ A;  3N27 A;  2CTR A;  5ITZ B;  2YEH A;  3B2E E;  2OIE A;  4R3A A;  2H55 A;  4AS9 A;  4WFE A;  1Z59 A;  3C3S A;  4WUD A;  2YJW A;  4JYB A;  2E74 B;  4DUZ B;  2XHB A;  1LUV A;  5D7R A;  2IJJ A;  3L9D A;  2BU6 A;  4I50 A;  3RYI B;  5H2F Z;  3UKM A;  3ZM7 A;  3D36 A;  1NH2 B;  2YI8 A;  5IE9 A;  1R3J C;  4XDL A;  3CCM V;  5CA3 A;  1BE3 H;  3RW0 A;  5M4M A;  1Z2G A;  2UUB B;  4MVS A;  1IXB A;  1AI6 A;  3W7X A;  4XCL A;  3OD4 A;  2YC0 A;  1VQ8 V;  1KKD A;  5LL6 Y;  3HHU A;  4YKX A;  4E01 A;  3CPW U;  1I7F A;  1OHH G;  5F2V O;  1OCR B;  2WA3 A;  1WNS A;  4NH7 A;  4J41 A;  3K58 A;  4FM1 A;  4JI5 B;  4CH3 A;  1QYE A;  1MG1 A;  1IBM O;  5BY1 A;  4W7T A;  3ASO B;  2ZDY A;  5FL7 G;  2XAB A;  1G6U A;  3E22 B;  4XKK A;  2VCJ A;  3ZED A;  2EIL C;  4URN A;  3CGZ A;  2ADQ B;  1EM1 A;  3ZMT A;  5LXT B;  1I08 A;  1R73 A;  2YGA A;  3T1C A;  3JAS A;  4X1I B;  1SC5 B;  1SZX A;  4OXS A;  4IYI A;  4YY3 O;  1GH6 A;  3CCJ V;  2FML A;  3STZ C;  4ZI7 A;  1XQ8 A;  4K3A A;  2YEI A;  3CWV A;  1VQO V;  1DK1 A;  1AP5 A;  3K5O A;  5LP6 A;  5IDM A;  3IFX A;  2YE2 A;  3CCU V;  5KUK A;  1AJ6 A;  4UVA A;  4X88 A;  2Q8I A;  1US7 A;  1R3L C;  1NZ6 A;  3BVO A;  5JVD B;  1N32 O;  5CB4 A;  4YKR A;  4GKK O;  1Q43 A;  5EBM C;  5E79 Z;  3BM9 A;  1K3E A;  1P49 A;  2ZR2 A;  2RN9 A;  1YZB A;  1YXB A;  1R3I C;  4LBE C;  4DR1 B;  1AI7 A;  4DW0 A;  3JD2 A;  2XAJ A;  3JD3 A;  3TK1 A;  2YXH A;  2QM8 A;  2YEJ A;  3JAS B;  1J95 A;  1PD3 A;  3AG3 C;  2DYR B;  4MT8 A;  1EI1 A;  3EHJ A;  4L8J A;  1L8D A;  1SQB H;  4DRX A;  1U96 A;  1I5C A;  2EXL A;  4X64 B;  3Q5J A;  3K79 A;  4B3S O;  1NI8 A;  4JI5 O;  2RDC A;  2BU8 A;  4E2L A;  2QG2 A;  2JVD A;  4D7S A;  1Y8N A;  1VQ9 V;  2IU3 A;  2QWO B;  2N74 A;  3EVK A;  4HBN A;  1QLN A;  3P30 A;  3AG1 C;  3SYC A;  2QA4 V;  3LSU A;  4NR1 A;  3HKC B;  2YK9 A;  2ZKO A;  1YI2 V;  4GUN A;  5CTY A;  4ZOL B;  3CRQ A;  2AW9 A;  4GYC B;  1QR8 A;  3N2K A;  2LFS A;  2IWU A;  3D3Q A;  2CTP A;  2Y69 B;  4LNU A;  2YI5 A;  2QWN B;  4JI4 O;  1Y6X A;  4YY3 B;  4HXZ A;  2JJ2 G;  2A06 H;  3TZ5 A;  3DSQ A;  3OPD A;  4FFB B;  2MK3 A;  2Q0O C;  1WA8 B;  2WSS G;  2JGD A;  4Q20 A;  2HVJ C;  1FXK B;  5EK0 A;  3JAW B;  2GTA A;  3JD1 A;  3OE7 G;  3W7T A;  1ZXN A;  2PF4 E;  3T2S A;  4OX9 B;  4JI0 B;  4GX0 A;  2D2C B;  4TQF A;  3TGU H;  4ZHQ A;  2YI7 A;  2DE0 X;  5LGN A;  4R6Z A;  3CXC U;  2ZE7 A;  1F51 A;  4X64 O;  4LR3 A;  3CCL V;  1H2K A;  3SYP A;  3LUT B;  1F4N A;  1I5A A;  2BU5 A;  3R91 A;  4DR5 O;  4OGQ B;  3SPJ A;  2X6C A;  1BZK A;  2BZ5 A;  4FZ1 A;  4BQG A;  3OFN G;  1ZLZ A;  2NR5 A;  3F5T A;  3INX A;  2ZCE A;  4HNA A;  4DV7 B;  3OMN B;  2UUB O;  3K97 A;  1HW7 A;  3EHG A;  2UUC B;  3BRC A;  1VQK V;  2LQT A;  1KUQ A;  1H8H G;  2Z5U A;  4XC0 A;  1THZ A;  4MW8 A;  4LFB B;  4DV3 B;  3JAW A;  1NHH A;  4AHC A;  4EKW A;  4DR6 O;  4KL1 A;  4YHH B;  1N32 B;  1HR0 O;  1Z5C A;  4JAU A;  2XHT A;  1BL8 A;  2ZE5 A;  4P9O A;  1O9H A;  4XIQ A;  4LWH A;  4EFT A;  3IAY A;  1WAZ A;  3VQY A;  4CBC A;  4PEL A;  2XAS A;  4H85 A;  2W6I G;  1UYD A;  1U0Z A;  2XHR A;  2YS8 A;  1NJI W;  2LGQ A;  4LWI A;  2Q7G A;  2ZNI A;  4DR4 O;  4RQF A;  1R6K A;  4U7N A;  4HYP A;  3E83 A;  1WLE A;  2IWS A;  5BR8 B;  1YES A;  3BAB A;  5C8Y A;  2ZNJ A;  2EIK C;  1S77 D;  3FD9 A;  4PA7 A;  3ZKD A;  3BY6 A;  4XD8 A;  1ZL8 A;  1AR5 A;  4LF9 O;  1HP8 A;  2YEA A;  1VQ5 V;  2ZBK B;  4EM7 A;  3WG7 C;  1S72 V;  4UCT A;  1KZN A;  1J5E B;  2QKA A;  4K4O A;  3TZ2 A;  3ZHS A;  1NHJ A;  3UT5 A;  1VF6 A;  3LNN A;  1N34 O;  4NXN B;  1MX0 A;  4CWS A;  3ABL C;  3FYE B;  4FM0 A;  1XI1 A;  4EFU A;  1MU5 A;  3SPC A;  3P3N A;  3J7A U;  4JQL A;  5LXT A;  4QE7 A;  4LFA B;  1M90 W;  1PP9 H;  2QGN A;  1YC1 A;  4DR6 B;  4B3T O;  3L73 H;  3H1L H;  2KKW A;  3R66 A;  2OT5 A;  1RP3 B;  2WER A;  4DR7 B;  2HG1 A;  5BOD A;  5EZY A;  3HR0 A;  3HKC A;  5L3F A;  1YT2 A;  1E1R G;  2RJZ A;  3LNU A;  4DV5 O;  4LFA O;  1QNM A;  5KA6 A;  2QF6 A;  2FKX A;  1S5J A;  3L74 H;  3GB7 C;  4RWU A;  1S76 D;  5L3J A;  1GN4 A;  5JVD A;  3ZMS A;  2K5B A;  2YID A;  2CAZ C;  4QPJ A;  2R9A A;  4K8Z A;  5EZY B;  2LP7 A;  5EBL C;  1KQS U;  4ASG A;  1R6N A;  1SES A;  5KHH A;  4O2B A;  4EB6 A;  1U2O A;  1BXD A;  3BFR A;  1SKV A;  2UU9 B;  1P7G A;  3CHX A;  4GLX A;  2QWR B;  4IT5 A;  2IBZ H;  1QVF U;  2QTO A;  1T5E A;  2PY5 A;  1YEW A;  1I58 A;  2XDK A;  4RUE A;  1KYO F;  1GO3 F;  3RKZ A;  2ITD C;  4LF5 O;  1KBH A;  3VHD A;  3RYH A;  4JZG A;  3CX5 F;  4HY1 A;  5EIB C;  5CBG A;  2O1U A;  1PKX A;  4KXR A;  4JI3 O;  3QVN A;  4LWG A;  1S16 A;  1QZR A;  2YKI A;  4B7K A;  1A32 A;  2JS3 A;  1SQF A;  1L0L H;  4JI8 B;  1AP6 A;  3JCZ A;  2ITC C;  1I5B A;  2XAF A;  1Q5O A;  1H7U A;  3ZIA G;  4OPA A;  4O09 A;  5M4P A;  3PEH A;  3BMY A;  3CCR V;  3B8N A;  3CJH B;  2IJK A;  4FLW A;  4PA9 A;  5DEC A;  1XDC A;  4MTF A;  1THN A;  2ETN A;  3QF7 A;  1VAR A;  3G7E A;  4X62 O;  1YHQ V;  3U2D A;  2QDO A;  4MVM A;  2LGW A;  3AG4 C;  3ML0 A;  1BGY H;  3T1Y B;  4DV4 O;  2YE4 A;  4H7Q A;  1TID A;  4H44 B;  3ABU A;  3B40 A;  3K3W A;  3OMA B;  1H2M A;  2OCC B;  4JYA O;  3SJA C;  2ZKJ A;  4CC5 A;  2AGA A;  4DR1 O;  1DF4 A;  1YIJ V;  1AH6 A;  4P2Z A;  4N21 A;  1FD9 A;  1AJQ A;  2FYP A;  3TXS A;  4GFN A;  5EYP A;  4OX9 O;  5L3E A;  1COW G;  4V25 A;  4LP8 A;  3X2Q B;  4H13 B;  5AG2 A;  4UVC A;  3JAT A;  1BSM A;  4QPK A;  2WLI B;  3MDS A; 
#chains in the Genus database with same CATH homology
 4FCQ A;  3GIF A;  3R4N A;  1W0K G;  2KB1 A;  1QLE B;  2A0L A;  1JX9 A;  4PDR A;  4CZZ A;  4L93 A;  4KQV A;  1YET A;  2WEQ A;  2ZD9 A;  3OW6 A;  4BQJ A;  3CRL A;  1Y8O A;  3NMQ A;  3MHH C;  4H33 A;  3JD4 A;  3LDD A;  1NR7 A;  1AMW A;  4XDK A;  2BYH A;  3VAD A;  3FB7 C;  2JJC A;  2UXX A;  2Q69 A;  2QE7 G;  3ABM B;  1GKX A;  3G71 V;  5BOC A;  3QO7 A;  4ASF A;  1H7S A;  2BRC A;  5B3S C;  1PNL A;  1PL0 A;  4MVR A;  3K06 A;  2P6J A;  2PI4 A;  1YC3 A;  3AG2 B;  3H01 A;  1KP2 A;  1RM1 B;  1YER A;  1YSR A;  4XE2 A;  1S0V A;  1AR1 B;  4H81 A;  2IOQ A;  1NVP D;  2WEP A;  4N23 A;  1JJ2 U;  1UY7 A;  3C11 A;  2IU0 A;  1KC8 W;  1UYF A;  2FWY A;  2DQ0 A;  2YEH A;  4LWF A;  4WUB A;  4E02 A;  4CWO A;  1NBM G;  4R3A A;  1K8A W;  2HKO A;  1M57 B;  2WAM A;  1ROP A;  1XL4 A;  2H55 A;  2YE8 A;  3LPS A;  2B1I A;  3OWB A;  4WFE A;  1Z59 A;  4HY6 A;  3ZN0 A;  3WHA A;  4R7C A;  4GQT A;  4MTX A;  5F3K A;  1H38 A;  4WUD A;  2W0F C;  1SER A;  4JYB A;  2WI5 A;  2WLL A;  2YJW A;  2H94 A;  3WG7 B;  1NQT A;  5L3G A;  1S14 A;  4HYM A;  1RM1 C;  1GM8 A;  3OGC C;  2IJJ A;  5D7R A;  1K4C C;  2BU6 A;  4U93 A;  2WLM A;  1PNK A;  3ZM7 A;  3UKM A;  4P9P A;  3D36 A;  3IC7 A;  3CCQ V;  1NH2 B;  1UYM A;  3QO5 A;  4TWK A;  4MSW C;  2PI5 A;  2IJH A;  3SPH A;  2PNR A;  1JVM A;  2WI2 A;  3H4L A;  1R3J C;  4XDL A;  3CCM V;  4TSF G;  4PRX A;  3R65 A;  2ESA A;  5CA3 A;  3ABL B;  3TZ4 A;  1Q82 W;  3JYC A;  4DUH A;  1M1K W;  3RW0 A;  5M4M A;  1BHB A;  3A0R A;  4MVS A;  3D2R A;  1AI6 A;  3W7X A;  2B1G A;  1VQL V;  2YK2 A;  4LPB A;  4XCL A;  4DO2 A;  4XIP A;  3MHS C;  4E00 A;  5M4N A;  4MVO A;  2Q6A A;  4RUF A;  1VQ8 V;  1KKD A;  4PDM A;  3HHU A;  4GT8 A;  4YKX A;  4E01 A;  1NHI A;  4PDV A;  3CPW U;  2VCI A;  2P7T C;  1OHH G;  4J9Y B;  3OMI B;  1OCR B;  1GTO A;  5EC2 C;  3STL C;  3A0Z A;  4NH7 A;  3G7B A;  5B1N A;  1YTF B;  4CWP A;  3LDC A;  2EIM B;  1QYE A;  3E8G A;  1OCC C;  3Q5L A;  2X0L A;  3OM3 B;  3GIG B;  1MG1 A;  3B28 A;  4KP4 A;  4L94 A;  3HEK A;  4WFH A;  4YKZ A;  4MPC A;  3IED A;  3ASO B;  2ZDY A;  5FL7 G;  4W7T A;  3SPG A;  2XAB A;  3MNR P;  4FCR A;  2K1E A;  3JZ3 A;  4BAE A;  5J71 A;  3B25 A;  1Y66 A;  5LHH A;  1B6Q A;  2EIN C;  2VCJ A;  4XKK A;  2P90 A;  3KG2 A;  5DN6 G;  2QM7 A;  2EIL C;  1CP9 A;  4URN A;  3CGZ A;  3ZMT A;  2IH3 C;  4RO2 A;  1B3Q A;  1GM9 A;  5LBQ A;  2XDX A;  4XCJ A;  3K9A A;  2OTL V;  4RAI A;  1R73 A;  2YED A;  1S5H C;  3T1C A;  2YGA A;  1YTF D;  3GIE A;  4LC1 A;  2JK5 C;  3ZRS A;  2HKJ A;  4X8A A;  3K03 A;  4XTJ A;  5CPH A;  3E2E A;  4KUM A;  2Y48 A;  4OXS A;  5L3B A;  1K5S A;  2YEF A;  2XD6 A;  4ZVI A;  3ETE A;  3K98 A;  4I3H A;  3CME V;  4BW5 A;  2V7Q G;  1Q86 W;  3ASO C;  3CCJ V;  4PL9 A;  3STZ C;  2IH1 C;  4B6C A;  5CTW A;  3EKO A;  2YEI A;  3B27 A;  3CWV A;  2ZQM A;  1VQO V;  3HPL C;  2YEV B;  1OCZ B;  1V54 B;  2JEX A;  3IFX A;  3RVY A;  3CCU V;  2XDL A;  2YE2 A;  5KUK A;  4X89 A;  5H6R A;  2YI6 A;  1AJ6 A;  2WLI A;  2YI0 A;  4UVA A;  4X88 A;  4HZ3 A;  3G75 A;  1CPY A;  1OZ0 A;  4UVB A;  2ZDI C;  4FMT A;  4XKO A;  2YEB A;  4JAS A;  1US7 A;  1R3L C;  2HLD G;  3CP1 A;  1YJ9 V;  1MSW D;  3PJS K;  5CTU A;  2NLJ C;  1OCO C;  1Q81 W;  1JOY A;  1TBW A;  1YIT V;  1AI4 A;  4KSH A;  2BOC C;  4YKR A;  3K04 A;  5EBM C;  2IWX A;  1SZT A;  1UYG A;  3IGA C;  3UM7 A;  4MPN A;  4PA6 A;  1VQ7 V;  3X2Q C;  3BM9 A;  1K3E A;  2ZR2 A;  2QKS A;  4MOT A;  2EJR A;  1TH8 A;  4LBE C;  1R3I C;  4PRV A;  2X7R B;  2WI4 A;  3AG2 C;  3FYI B;  1AI7 A;  4XIR A;  2IW5 A;  3OMU A;  3JD2 A;  4P30 A;  3T1K A;  2YGF A;  2XAJ A;  3JD3 A;  3TK1 A;  4H37 A;  2JKI A;  1QBZ A;  2JJ1 G;  2QM8 A;  4MTG A;  2XAG A;  2YEJ A;  3ZJZ A;  1TC0 A;  1J95 A;  1PD3 A;  2WLH A;  3AG3 C;  1G8M A;  3GWO A;  2DYR B;  5B1B B;  3FT8 A;  3P32 A;  4MT8 A;  1EI1 A;  4R1F A;  2Q67 A;  3EHJ A;  4GT1 A;  1SET A;  1M57 C;  4U7O A;  1JCH A;  2FXS A;  3TCU A;  3INW A;  4KSG A;  3ZMU A;  3RBZ A;  1L0O A;  1UYC A;  1E79 G;  1I5C A;  3T10 A;  5H6Q A;  2EXL A;  1OCZ C;  3EHB B;  2D3O W;  4HAM A;  4F4L A;  2EIJ B;  3Q5J A;  3K79 A;  5LHI A;  2UWD A;  3B26 A;  4KFG A;  4P8O A;  3OWD A;  1GM7 A;  1CEZ A;  4ZBM A;  1L1F A;  1I5X A;  2GFD A;  1UYH A;  3HYZ A;  2BU8 A;  4E2L A;  2QG2 A;  1QY8 A;  2EIK B;  4URO A;  1G4Y B;  1VQM V;  2HJF C;  1BGQ A;  1BKN A;  3AG4 B;  1UYI A;  1FXH A;  4XDJ A;  1VQ9 V;  2IU3 A;  1Y8N A;  5IYB O;  2IOR A;  2R9R B;  1QR9 A;  2WI1 A;  1QLN A;  2XX4 A;  1UYL A;  3ZKB A;  3P30 A;  5GGZ A;  3AG1 C;  3SYC A;  2M7W A;  2EBO A;  2QA4 V;  2XOK G;  2YK9 A;  1K73 W;  2ATK C;  1YI2 V;  1YSZ A;  3OW2 U;  1Y4M A;  1HWY A;  5CTY A;  2OTJ V;  2XJG A;  4G28 B;  3SYA A;  4J9Z B;  3ZMV A;  2EIM C;  2YSU B;  1QR8 A;  4EEH A;  4CE3 A;  2LFS A;  1F4M A;  2EZO A;  1F23 A;  3ZRX A;  2IWU A;  2EZP A;  2JIZ G;  5B1A B;  4QNH B;  1UYK A;  2Y69 B;  3QTF A;  5B1B C;  4P7A A;  4MPE A;  3R4O A;  5BZB A;  2YI5 A;  3GIG A;  3K0D A;  2E0A A;  4BXI A;  3B77 A;  2YEE A;  4HXZ A;  3W7W A;  2JJ2 G;  2XDS A;  3ZN1 A;  1TC6 A;  3TZ5 A;  3OPD A;  1YS3 A;  3BEH A;  5B3S B;  3EKR A;  1B62 A;  5CBF A;  2BOB C;  3M99 B;  4CE1 A;  2MK3 A;  3OUS A;  3VHA A;  3D3I A;  2WSS G;  4Q20 A;  4CWQ A;  2HVJ C;  4JTD B;  1FXK B;  5EK0 A;  3OAA G;  2JDI G;  2X6B A;  1QLE C;  1OCC B;  1YT0 A;  3JD1 A;  3OE7 G;  2H8M A;  3FV5 A;  3HYY A;  3CCV V;  3ETG A;  3W7T A;  2ZDI A;  4JGS A;  4PA3 A;  1ZXN A;  3T2S A;  2BU2 A;  2QFO A;  4GX0 A;  3K99 A;  1R3K C;  5E1A C;  3OEH G;  2XK2 A;  2WLJ A;  2YI7 A;  2CCU A;  4EGH A;  3LNM B;  3ZRV A;  4WFA V;  5LGN A;  2YE9 A;  4R6Z A;  3CXC U;  4FJC C;  3CC4 V;  1VQP V;  4V26 A;  1F51 A;  3OR7 C;  3W7S A;  1RPR A;  1EZJ A;  5CN0 A;  3SYP A;  3CCL V;  4JF3 A;  3VHC A;  3ZXO A;  4B7P A;  3LUT B;  1NH2 D;  3HZ5 A;  1FXK C;  2YGE A;  1F4N A;  1I5A A;  2YKJ A;  4I5S A;  4UV9 A;  5CBH A;  2BU5 A;  1AH8 A;  1UY6 A;  3R91 A;  3T0H A;  5D7D A;  5M4E A;  3LSQ A;  3SPJ A;  2X6C A;  2BZ5 A;  5LGU A;  4BQG A;  3OFN G;  1GMG A;  4MVQ A;  4GX1 A;  4UXN A;  1UJW B;  5H9C A;  2CCS A;  1UY9 A;  3A0T A;  1FS0 G;  1E1Q G;  3INX A;  3AG3 B;  2X6A A;  2Z3Y A;  2F43 G;  2V1D A;  3OMN B;  4UV8 A;  3B8M A;  1W2B U;  1R62 A;  3K97 A;  3EHG A;  3KE6 A;  4MP7 A;  4GEE A;  4YKQ A;  3R4P A;  1VQK V;  3WQ9 A;  5C93 A;  3G4S V;  3R4M A;  5J6A A;  1H8H G;  2Z5U A;  3I55 V;  2DWD C;  1Z5B A;  4MP2 A;  2ZDX A;  3SJQ C;  4XC0 A;  5FNC A;  1THZ A;  4CWF A;  4MW8 A;  4DXW A;  4NH9 A;  3F5W C;  5L3D A;  1ID0 A;  4EKW A;  1NHH A;  4QE9 A;  5IDJ A;  4GGL A;  4FPP A;  1GK9 A;  1Z5C A;  3ETD A;  4JAU A;  5LHG A;  3W7U A;  1VQ4 V;  2XHT A;  4EMV A;  1BL8 A;  3LDE A;  2XCM A;  2YEC A;  4P9O A;  4XIQ A;  3CC7 V;  4LWH A;  4EFT A;  5EC1 C;  5IN9 A;  4JTC B;  2XDU A;  3FB6 C;  4MS2 A;  1ZW9 A;  4R3M A;  1MAB G;  5IYD O;  4CBC A;  4XIT A;  1DLB A;  2XAS A;  4PEL A;  4H85 A;  2HFE C;  2W6I G;  3K08 A;  1UYD A;  2YEV A;  1U0Z A;  2XHR A;  2EIJ C;  5L3C A;  1NJI W;  4LWI A;  3DTU B;  2A79 B;  4MVU A;  3T2M A;  3G6E V;  1ZWH A;  3ABK B;  1N8R W;  2WWW A;  2XAH A;  3ABT A;  1K34 A;  1K5Q A;  1R6K A;  1V55 C;  1AJN A;  4U7N A;  3HB3 B;  1K4D C;  4RQF A;  3E83 A;  1LNQ A;  1WLE A;  4YXW G;  2IWS A;  4HYP A;  3DGE A;  1YES A;  5D6Q A;  4AWO A;  1RPO A;  3ZRW B;  2DQ3 A;  2EIK C;  4L8Z A;  2Q8F A;  3E89 A;  3B24 A;  1S77 D;  2Y69 C;  4PA7 A;  5F5R A;  3ZKD A;  1W0J G;  3RLP A;  2GSM B;  3BY6 A;  1ZXM A;  3CMA V;  4XD8 A;  4CWN A;  5FWK A;  5IY5 B;  2WLN A;  1P7B A;  1IXM A;  3FB5 C;  1OSF A;  2YEA A;  1FFT B;  3A0X A;  3OUF A;  5DM6 V;  1VQ5 V;  1Y4S A;  2XHX A;  2ZBK B;  2LFR A;  1K7D A;  4PA4 A;  4GCZ A;  5EBW C;  1NKD A;  4LP0 A;  4EM7 A;  4WFF A;  3WG7 C;  3K60 A;  5KA5 A;  1FXV A;  1S72 V;  2Q8G A;  2FTK A;  2VW5 A;  1KZN A;  1BYQ A;  4K4O A;  5FNF A;  3TZ2 A;  3I56 V;  2YE7 A;  2QEX V;  1I59 A;  1NHJ A;  1OCO B;  1MX0 A;  1K97 A;  5CTX A;  2BRE A;  3ABL C;  4CWS A;  4I9W A;  4XDM A;  1DTO A;  2XX5 A;  2WLK A;  4CE2 A;  2WPD G;  2ZXW C;  3FYE B;  1ENV A;  4QIW F;  4TT3 G;  4EFU A;  4G2K A;  1VQN V;  3H80 A;  4URM A;  3WFV A;  4RQE A;  1MU5 A;  3SPC A;  4JQL A;  2BYI A;  2XND G;  2A9H A;  4HZ5 A;  4URL A;  4QE7 A;  4PU9 A;  1YT1 A;  1M90 W;  1BMF G;  1ARO P;  1FXK A;  4FK5 C;  4CWT A;  2IOP A;  1P4R A;  3ASN C;  5B1A C;  4BAY A;  1UYE A;  1YC1 A;  3O2F A;  1PVG A;  4AWP A;  1QCE A;  5J9P C;  3CCE V;  4AS9 A;  4LCU C;  3ZRW A;  2GQP A;  2QG0 A;  2YKC A;  2WI7 A;  1KP3 A;  2OT5 A;  2WER A;  3ZXQ A;  3E8H A;  1EBO A;  2YJX A;  2DYS B;  2XX2 A;  2HVK C;  2WI3 A;  1AI5 A;  5IY5 C;  1WPX A;  2HG1 A;  2C2A A;  5BOD A;  1BHA A;  4MTO A;  2EIN B;  1KIJ A;  3D0B A;  5L3F A;  1YT2 A;  1E1R G;  4BIU A;  2EIL B;  3LNU A;  2VWC A;  2OCC C;  3T4Z A;  2O1V A;  4R8C A;  4L91 A;  3TTZ A;  4MW3 A;  4JAV A;  4UUJ C;  3SPI A;  5KA6 A;  2QF6 A;  1B63 A;  3GB7 C;  4G27 B;  4HYO A;  1S76 D;  2HCH A;  4MVZ A;  3E86 A;  5L3J A;  3ZMS A;  2K5B A;  2BTZ A;  4HZ0 A;  5GW7 A;  4JPR A;  4QPJ A;  4HXW A;  5CMU A;  4FIP C;  3E8F A;  2LP7 A;  4O07 A;  3T0Z A;  5EBL C;  2JEU A;  1KQS U;  1EA6 A;  1R6N A;  1SES A;  3QNE A;  4ASG A;  4L90 A;  3CC2 V;  3R92 A;  3EHF A;  1U2O A;  1BXD A;  1GJV A;  3ZCC A;  2CH4 A;  2HG5 C;  1H2G A;  4X9L A;  2YEG A;  1AM1 A;  1JQ0 A;  4ASA A;  3CGY A;  2Q2E B;  1K33 A;  1M9N A;  3AEI A;  3EHH A;  4MBC A;  4QJF B;  4KTN A;  1QVF U;  1I5Y A;  2H8P C;  3ABM C;  2QTO A;  3SYO A;  1I58 A;  2XDK A;  4Z1M G;  3F7V C;  2WI6 A;  3RLQ A;  4RUE A;  4XBF A;  2YKB A;  1GO3 F;  1TIL A;  4FCP A;  2DYS C;  2ITD C;  1VQ6 V;  3FT5 A;  3RKZ A;  3VHD A;  3TUH A;  4NH8 A;  2R9I A;  4HY1 A;  5D7C A;  2Q8H A;  5CBG A;  2O1U A;  1PKX A;  4JYC A;  3FB8 C;  4WCE V;  5CF0 A;  3MD0 A;  5KUM A;  4YKW A;  3TZ0 A;  4CWR A;  3ABK C;  3FKS G;  4R50 A;  3SYQ A;  1S16 A;  1QZR A;  1I5D A;  2YKI A;  4LWG A;  4KFM A;  2B5U A;  1YC4 A;  3ZMZ A;  3VBB A;  1JM6 A;  2CG9 A;  3VOU A;  1QVG U;  4PDL A;  3O6O A;  5FND A;  3CCS V;  3JCZ A;  1H8E G;  2ITC C;  2XAF A;  3E35 A;  3JD0 A;  2P67 A;  1EFR G;  4WFB V;  1I5B A;  2XAQ A;  4MB9 A;  1H7U A;  4YKY A;  3RLR A;  3ZIA G;  4O09 A;  3CYO A;  5M4P A;  2CCT A;  3PEH A;  3CD6 V;  2YKE A;  3BMY A;  3CCR V;  1ZWI C;  3F7Y C;  3B8N A;  2AHZ A;  2IJK A;  2W6J G;  4PA9 A;  4O0B A;  2IJI A;  4ASU G;  4XKA A;  4MTF A;  4L87 A;  1THN A;  3Q5K A;  5M4H A;  3K0G A;  2YE6 A;  3O0I A;  2CGF A;  1GKF A;  2BU7 A;  4YKU A;  1M56 B;  3T4D A;  4ASB A;  4BIZ A;  1V55 B;  3LSS A;  3SL2 A;  3CRK A;  1YJN V;  2DWE C;  1Y8P A;  4ZKI A;  3G7E A;  4EGK A;  1XL6 A;  5HFL A;  1YHQ V;  3U2D A;  1SRY A;  3RVZ A;  2DW4 A;  1Q7Y W;  2DYR C;  4MVM A;  2CK3 G;  2XJJ A;  2GHY A;  5B1O A;  3C0E A;  4EGI A;  3HZ1 A;  3AG4 C;  4GX2 A;  3ML0 A;  2O1W A;  2UXN A;  1NVP B;  1OCR C;  2YE5 A;  1UY8 A;  2FWZ A;  2YE4 A;  3A0Y A;  3PEJ A;  4H7Q A;  5IDM A;  1TID A;  1YJW V;  4LWE A;  3ABU A;  2HR3 A;  1DF5 A;  2NNU A;  3K3W A;  4WF9 V;  4YKT A;  1S3J A;  3OMA B;  2YE3 A;  2ZR3 A;  2AHY A;  2Q68 A;  3TET A;  1PNM A;  2OCC B;  1K9M W;  1KD1 W;  1GKZ A;  1Z5A A;  2ZKJ A;  3QDD A;  5D6P A;  3NXS A;  1KEC A;  4AWQ A;  1AJP A;  4O05 A;  3U2K A;  5M4K A;  3OEE G;  1TUE B;  4WFG A;  2BT0 A;  1ORQ C;  3OR6 C;  1DF4 A;  1YIJ V;  5IYC O;  4JTA B;  1AH6 A;  3U67 A;  4P2Z A;  4DZY A;  2ZXW B;  1K92 A;  3QO8 A;  4N21 A;  4O04 A;  1Y4U A;  3AG1 B;  3EFF K;  1AJQ A;  2FYP A;  4GFN A;  4WUC A;  1YSC A;  2WLL B;  2AKP A;  2BSM A;  2Q8I A;  3E8B A;  5L3E A;  1COW G;  1MOF A;  1A4H A;  4LP8 A;  3X2Q B;  1V54 C;  5HFM A;  4UVC A;  4V25 A;  2XJX A;  4QPK A;  2WLI B;  1M56 C;  4GX5 A;  1NR1 A;  5LGT A;  1JPX A;  3ASN B;  3A0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...