3EHFA

Crystal structure of deskc in complex with amp-pcp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
186
structure length
179
Chain Sequence
RIARDLHDTLGQKLSLIGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEVRKIVSSMKGIRLKDELINIKQILEAADIMFIYEEEKWPENISLLNENILSMCLKEAVTNVVKHSQAKTCRVDIQQLWKEVVITVSDDGTFKGEHGLLGMRERLEFANGSLHIDTENGTKLTMAIPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor kinase (YocF protein)
publication title Structural plasticity and catalysis regulation of a thermosensor histidine kinase
pubmed doi rcsb
source organism Bacillus subtilis
total genus 52
structure length 179
sequence length 186
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07730 HisKA_3 Histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3ehfA02
2GQPA 2WI3A 3SL2A 2VCIA 2YI0A 1US7A 4MP7A 5D7DA 3ZKBA 2XX4A 4MBCA 5M4EA 1I59A 4EGKA 2YKIA 2YKBA 2XCMA 3CGZA 2XHTA 2O1WA 2YGFA 3G7EA 4URMA 5IN9A 3GIEA 3A0ZA 1ZXMA 3RKZA 3LPSA 3G75A 1AM1A 4LPBA 4BQJA 5C93A 4O07A 2BU6A 2ZKJA 2QF6A 2XDKA 4EM7A 4DUHA 1L0OA 4PL9A 3RLRA 2XDXA 2IOQA 4B7PA 3G7BA 1BYQA 4NH9A 1B63A 1YERA 4GGLA 2XJGA 1BKNA 3HYZA 2GFDA 1UYMA 3RLQA 4FCPA 3HZ5A 4WUDA 4YKTA 1BGQA 2YEJA 3BMYA 1UY8A 2XHRA 1JM6A 3TTZA 2YEAA 2WERA 4UROA 4XC0A 1I58A 5CTWA 2BU2A 4YKQA 1UYKA 2BU5A 1MX0A 2WI7A 2YE3A 4U7NA 2H55A 3T0ZA 4CWRA 1Z5BA 3R4PA 2E0AA 1Y4SA 1S14A 3U2KA 2XD6A 2YI6A 4FPPA 1UY7A 3TZ0A 5CTYA 1AH6A 3WHAA 2YJXA 5M4HA 1U2OA 1UYFA 2H8MA 3EHGA 2K5BA 4O04A 4V25A 5D7RA 3TZ4A 2BU7A 4CWPA 1GJVA 1Y8NA 3O0IA 2YEIA 4HY1A 4CE1A 3INXA 3VADA 2VCJA 4HZ5A 2YE5A 3B24A 4HYPA 2BTZA 4L93A 4K4OA 5J71A 4KSHA 1YSZA 5CTUA 2XHXA 1TIDA 1QZRA 4XDMA 4LP0A 4O09A 2YE7A 1UYLA 4KTNA 3EHHA 2AKPA 1EA6A 1YESA 1MU5A 1YETA 3GIGA 2YEBA 4LWHA 2BYHA 4ASAA 4GCZA 3A0TA 3K97A 2YJWA 4LWEA 3B25A 2ESAA 2XJJA 4GQTA 2WI5A 1U0ZA 1Y8OA 2FYPA 1A4HA 4KFGA 1BXDA 2WI4A 3ZXOA 4YKYA 4FCQA 4XIRA 4CE2A 1YC3A 4V26A 4H7QA 2C2AA 3OWBA 5CF0A 4MPEA 3QDDA 2BSMA 3WQ9A 4AWOA 5IDJA 2CCSA 4WUCA 3U67A 4HY6A 2Q8HA 4JAVA 1YC1A 2Q8GA 4E00A 2YE4A 4MB9A 5M4MA 3OMUA 2IWSA 4P8OA 4L94A 4DZYA 4X9LA 4PRXA 3FV5A 3FT8A 1NHHA 3DGEA 2XX2A 1Z59A 3VHDA 4BXIA 4JASA 4H85A 1Z5AA 4ASBA 1AH8A 3FT5A 3INWA 3CWVA 3R4NA 5D6QA 4EFTA 2JJCA 5FNCA 4CWSA 3O6OA 3A0WA 5J6AA 2VWCA 1NHIA 1Y4UA 2CH4A 3BM9A 3MNRP 4GT8A 4JQLA 4ASGA 2WEQA 1ZXNA 4YKZA 3D0BA 3Q5JA 3RLPA 5FNDA 3R4MA 2ZBKB 1B62A 1KZNA 1UYGA 2YEFA 4P7AA 4AWQA 2YK9A 5BOCA 4AS9A 2CCUA 1YT0A 4LWIA 2BRCA 2YEGA 3B28A 1YSRA 4XIQA 4CWTA 1Z5CA 1I5AA 4HZ0A 4Q20A 1ZW9A 2JKIA 4KP4A 4L8ZA 4R3AA 4LWFA 2Q2EB 2BT0A 4MPNA 2YKEA 2BREA 1YT2A 2YGAA 4EMVA 1ID0A 4L91A 4XE2A 2ZDYA 1UYEA 1TILA 2CG9A 5L3JA 2YI5A 1GKXA 2YGEA 3HHUA 2WI6A 3LNUA 2FWYA 4HXWA 3A0YA 1UYIA 3OWDA 5IDMA 3A0XA 1TC0A 3H80A 1TBWA 4U93A 2YE2A 2EXLA 2XABA 3IEDA 4MOTA 2FXSA 4KSGA 4XKOA 3ZXQA 4E01A 2WEPA 4XTJA 1THNA 2O1UA 4O0BA 5CTXA 1TC6A 4EGIA 4CWNA 4EEHA 2YKJA 3HEKA 1B3QA 3OPDA 2YECA 4QPKA 5CPHA 4I3HA 3H4LA 1NHJA 3Q5LA 2CCTA 2CGFA 3OW6A 3PEJA 2XDSA 5F3KA 4O05A 3T2SA 3U2DA 2YEDA 4ZKIA 4MPCA 3R91A 4XCJA 3T0HA 1GKZA 4YKRA 4I5SA 4GEEA 4FCRA 4QPJA 3T10A 3O2FA 4EGHA 3ZM7A 2IWXA 4NH8A 2YEHA 4GFNA 1R62A 2VW5A 1I5CA 3CGYA 1I5BA 1PVGA 4URNA 2ZDXA 4FMTA 1UYDA 2FWZA 1UYHA 3VHCA 1I5DA 4CWOA 1QYEA 4AWPA 2BZ5A 5M4KA 3A0RA 1ZWHA 2QG0A 5BODA 3C0EA 4CE3A 2QFOA 4NH7A 3EHJA 2O1VA 3B26A 2YE9A 3TZ5A 4URLA 4ASFA 1H7SA 4H81A 2XK2A 2XDLA 1YS3A 4W7TA 1KIJA 2XX5A 4U7OA 4XITA 4YKWA 3NMQA 4BQGA 4CWQA 5M4NA 5GGZA 3QTFA 4BAEA 4ZVIA 4XD8A 2QG2A 2UWDA 2YI7A 4BIZA 2IORA 5FWKA 3EKOA 2YE6A 4HYMA 3B27A 4XIPA 1AMWA 2YE8A 1QY8A 2Q8FA 4LWGA 4B6CA 4JAUA 1S16A 4WUBA 5D7CA 1OSFA 3C11A 3CRKA 3T1KA 2HG1A 4CWFA 3K98A 2HKJA 2Q8IA 1H7UA 4L90A 3ZKDA 3EKRA 1Y8PA 4YKXA 4EFUA 5M4PA 3GIGB 3CRLA 2IWUA 4HXZA 3GIFA 3TUHA 4BIUA 4PU9A 4XCLA 4E02A 3K60A 1UYCA 1UY6A 3HYYA 1EI1A 2XJXA 3HZ1A 3KE6A 2WI1A 3D36A 4KQVA 3EHFA 3K99A 5F5RA 4XKAA 3VHAA 1YC4A 1AJ6A 2YK2A 3D2RA 3JZ3A 5FNFA 2BYIA 2HCHA 2WI2A 4PRVA 2YKCA 3Q5KA 4R3MA 4R1FA 1UY9A 3R92A 2YEEA 3TZ2A 4MP2A 4XKKA 2XDUA 2PNRA 3PEHA 1YT1A 4YKUA 1TH8A 2IOPA 2BU8A 3R4OA 5D6PA
chains in the Genus database with same CATH superfamily
2GQPA 2WI3A 3SL2A 2VCIA 2YI0A 1US7A 4MP7A 5D7DA 3ZKBA 2XX4A 4MBCA 5M4EA 1I59A 4EGKA 2YKIA 2YKBA 2XCMA 3CGZA 2XHTA 2O1WA 2YGFA 3G7EA 4URMA 5IN9A 3GIEA 3A0ZA 1ZXMA 3RKZA 3LPSA 3G75A 1AM1A 4LPBA 4BQJA 5C93A 4O07A 2BU6A 2ZKJA 2QF6A 2XDKA 4EM7A 4DUHA 1L0OA 4PL9A 3RLRA 2XDXA 2IOQA 4B7PA 3G7BA 1BYQA 4NH9A 1B63A 1YERA 4GGLA 2XJGA 4E72A 1BKNA 3HYZA 2GFDA 1UYMA 3RLQA 4FCPA 3HZ5A 4WUDA 4YKTA 1BGQA 2YEJA 3BMYA 5JENA 1UY8A 2XHRA 1JM6A 3TTZA 2YEAA 2WERA 4UROA 4XC0A 1I58A 2C1IA 2C1GA 2BU2A 4YKQA 5CTWA 1UYKA 2BU5A 1MX0A 2WI7A 2YE3A 4U7NA 2H55A 3T0ZA 4CWRA 1Z5BA 3R4PA 2E0AA 1Y4SA 1S14A 3U2KA 2XD6A 2YI6A 4FPPA 1UY7A 3TZ0A 5CTYA 1AH6A 3WHAA 2YJXA 5M4HA 1U2OA 1UYFA 2H8MA 3EHGA 2K5BA 1F51A 4O04A 4V25A 5D7RA 3TZ4A 2BU7A 4CWPA 1GJVA 1Y8NA 3O0IA 2YEIA 4HY1A 4CE1A 3INXA 3VADA 2VCJA 4HZ5A 2YE5A 3B24A 4HYPA 2BTZA 4L93A 4K4OA 5J71A 4KSHA 1YSZA 5CTUA 2XHXA 1TIDA 1QZRA 4XDMA 4LP0A 4O09A 2HHIA 2YE7A 1UYLA 4KTNA 3EHHA 2AKPA 1EA6A 1YESA 1MU5A 1YETA 3GIGA 2YEBA 4LWHA 2BYHA 4ASAA 4GCZA 3A0TA 3K97A 2YJWA 4LWEA 3B25A 2ESAA 2XJJA 4GQTA 2WI5A 1U0ZA 1Y8OA 2FYPA 1A4HA 4KFGA 2FTKA 1BXDA 2WI4A 3ZXOA 4YKYA 4FCQA 4XIRA 4CE2A 1YC3A 4V26A 4H7QA 2C2AA 3OWBA 5CF0A 4MPEA 3QDDA 2BSMA 3WQ9A 4AWOA 5IDJA 2CCSA 4WUCA 3U67A 4HY6A 2Q8HA 4JAVA 1YC1A 2Q8GA 4E00A 2YE4A 4MB9A 5M4MA 3OMUA 2IWSA 4P8OA 4L94A 4DZYA 4X9LA 4PRXA 3FV5A 3FT8A 1NHHA 3DGEA 2XX2A 1Z59A 3VHDA 4BXIA 4JASA 4H85A 1Z5AA 4ASBA 1AH8A 3FT5A 3INWA 3CWVA 3R4NA 5D6QA 4EFTA 2JJCA 5FNCA 4CWSA 3O6OA 3A0WA 5J6AA 2VWCA 1NHIA 1Y4UA 2CH4A 3BM9A 3MNRP 4GT8A 4JQLA 4ASGA 2WEQA 1ZXNA 4YKZA 3D0BA 3Q5JA 3RLPA 5FNDA 3R4MA 2ZBKB 1B62A 1KZNA 1UYGA 2YEFA 4P7AA 4AWQA 2YK9A 5BOCA 4AS9A 2CCUA 1YT0A 4LWIA 2BRCA 2YEGA 3B28A 1YSRA 3S5TA 4XIQA 4CWTA 1Z5CA 1I5AA 4HZ0A 4Q20A 1ZW9A 2JKIA 4KP4A 4L8ZA 4R3AA 4LWFA 2Q2EB 2BT0A 4MPNA 2YKEA 2BREA 1YT2A 2YGAA 4EMVA 1ID0A 4L91A 4XE2A 2ZDYA 1UYEA 1TILA 2CG9A 5L3JA 2YI5A 1GKXA 2YGEA 3HHUA 2WI6A 3LNUA 2FWYA 4HXWA 3A0YA 1UYIA 3OWDA 5IDMA 3A0XA 1TC0A 3H80A 1TBWA 4U93A 2YE2A 2EXLA 2XABA 3IEDA 4MOTA 2FXSA 4KSGA 4XKOA 3ZXQA 4E01A 2WEPA 4XTJA 1THNA 2O1UA 4O0BA 5CTXA 1TC6A 4EGIA 4CWNA 4EEHA 2YKJA 3HEKA 1B3QA 3OPDA 2YECA 4QPKA 5CPHA 4I3HA 3H4LA 1NHJA 3Q5LA 2CCTA 2CGFA 3OW6A 3PEJA 2XDSA 5F3KA 4O05A 3T2SA 3U2DA 2YEDA 4ZKIA 4MPCA 3R91A 4XCJA 3T0HA 1GKZA 4YKRA 4I5SA 4GEEA 4FCRA 4QPJA 3T10A 3O2FA 4EGHA 3ZM7A 2IWXA 4NH8A 2YEHA 4GFNA 1R62A 2VW5A 1I5CA 3CGYA 1I5BA 1PVGA 4URNA 2ZDXA 4FMTA 1UYDA 2FWZA 1UYHA 3VHCA 1I5DA 3CYGA 4CWOA 1QYEA 4AWPA 2BZ5A 5M4KA 3A0RA 1ZWHA 2QG0A 5BODA 3C0EA 4CE3A 2QFOA 4NH7A 3EHJA 2O1VA 3B26A 2YE9A 3TZ5A 4URLA 4ASFA 1H7SA 4H81A 2XK2A 2XDLA 1YS3A 4W7TA 1KIJA 2XX5A 4U7OA 4XITA 4YKWA 3NMQA 4BQGA 4CWQA 5M4NA 5GGZA 3QTFA 4BAEA 4ZVIA 4XD8A 2QG2A 2UWDA 2YI7A 4BIZA 2IORA 5FWKA 3EKOA 1IXMA 2YE6A 4HYMA 3B27A 4XIPA 1AMWA 2YE8A 3LMMA 1QY8A 2Q8FA 4LWGA 4B6CA 4JAUA 1S16A 4WUBA 5D7CA 1OSFA 3C11A 3CRKA 3T1KA 2HG1A 4CWFA 3K98A 2HKJA 2Q8IA 1H7UA 4L90A 3ZKDA 3EKRA 1Y8PA 4YKXA 4EFUA 5M4PA 3GIGB 3CRLA 2IWUA 4HXZA 3GIFA 3TUHA 4BIUA 4PU9A 4XCLA 4E02A 3K60A 1UYCA 1UY6A 3HYYA 1EI1A 2XJXA 3HZ1A 3KE6A 2WI1A 3D36A 4KQVA 3EHFA 3K99A 5F5RA 4XKAA 3VHAA 1YC4A 1AJ6A 2YK2A 3D2RA 3JZ3A 5FNFA 2BYIA 2HCHA 2WI2A 4PRVA 2YKCA 3Q5KA 4R3MA 4R1FA 1UY9A 3R92A 2YEEA 3TZ2A 4MP2A 4XKKA 2XDUA 2PNRA 3PEHA 1YT1A 4YKUA 1TH8A 2IOPA 2BU8A 3R4OA 5D6PA
chains in the Genus database with same CATH topology
2GQPA 2WI3A 3SL2A 2VCIA 2YI0A 1US7A 4MP7A 5D7DA 3ZKBA 2XX4A 4MBCA 5M4EA 1I59A 4EGKA 2YKIA 2YKBA 2XCMA 3CGZA 2XHTA 2O1WA 2YGFA 3G7EA 4URMA 5IN9A 3GIEA 3A0ZA 1ZXMA 3RKZA 3LPSA 3G75A 1AM1A 4LPBA 4BQJA 5C93A 4O07A 2BU6A 2ZKJA 2QF6A 2XDKA 4EM7A 4DUHA 1L0OA 4PL9A 3RLRA 2XDXA 2IOQA 4B7PA 3G7BA 1BYQA 4NH9A 1B63A 1YERA 4GGLA 2XJGA 1BKNA 3HYZA 2GFDA 1UYMA 3RLQA 4FCPA 3HZ5A 4WUDA 4YKTA 1BGQA 2YEJA 3BMYA 1UY8A 2XHRA 1JM6A 3TTZA 2YEAA 2WERA 4UROA 4XC0A 1I58A 5CTWA 2BU2A 4YKQA 1UYKA 2BU5A 1MX0A 2WI7A 2YE3A 4U7NA 2H55A 3T0ZA 4CWRA 1Z5BA 3R4PA 2E0AA 1Y4SA 1S14A 3U2KA 2XD6A 2YI6A 4FPPA 1UY7A 3TZ0A 5CTYA 1AH6A 3WHAA 2YJXA 5M4HA 1U2OA 1UYFA 2H8MA 3EHGA 2K5BA 4O04A 4V25A 5D7RA 3TZ4A 2BU7A 4CWPA 1GJVA 1Y8NA 3O0IA 2YEIA 4HY1A 4CE1A 3INXA 3VADA 2VCJA 4HZ5A 2YE5A 3B24A 4HYPA 2BTZA 4L93A 4K4OA 5J71A 4KSHA 1YSZA 5CTUA 2XHXA 1TIDA 1QZRA 4XDMA 4LP0A 4O09A 2YE7A 1UYLA 4KTNA 3EHHA 2AKPA 1EA6A 1YESA 1MU5A 1YETA 3GIGA 2YEBA 4LWHA 2BYHA 4ASAA 4GCZA 3A0TA 3K97A 2YJWA 4LWEA 3B25A 2ESAA 2XJJA 4GQTA 2WI5A 1U0ZA 1Y8OA 2FYPA 1A4HA 4KFGA 1BXDA 2WI4A 3ZXOA 4YKYA 4FCQA 4XIRA 4CE2A 1YC3A 4V26A 4H7QA 2C2AA 3OWBA 5CF0A 4MPEA 3QDDA 2BSMA 3WQ9A 4AWOA 5IDJA 2CCSA 4WUCA 3U67A 4HY6A 2Q8HA 4JAVA 1YC1A 2Q8GA 4E00A 2YE4A 4MB9A 5M4MA 3OMUA 2IWSA 4P8OA 4L94A 4DZYA 4X9LA 4PRXA 3FV5A 3FT8A 1NHHA 3DGEA 2XX2A 1Z59A 3VHDA 4BXIA 4JASA 4H85A 1Z5AA 4ASBA 1AH8A 3FT5A 3INWA 3CWVA 3R4NA 5D6QA 4EFTA 2JJCA 5FNCA 4CWSA 3O6OA 3A0WA 5J6AA 2VWCA 1NHIA 1Y4UA 2CH4A 3BM9A 3MNRP 4GT8A 4JQLA 4ASGA 2WEQA 1ZXNA 4YKZA 3D0BA 3Q5JA 3RLPA 5FNDA 3R4MA 2ZBKB 1B62A 1KZNA 1UYGA 2YEFA 4P7AA 4AWQA 2YK9A 5BOCA 4AS9A 2CCUA 1YT0A 4LWIA 2BRCA 2YEGA 3B28A 1YSRA 4XIQA 4CWTA 1Z5CA 1I5AA 4HZ0A 4Q20A 1ZW9A 2JKIA 4KP4A 4L8ZA 4R3AA 4LWFA 2Q2EB 2BT0A 4MPNA 2YKEA 2BREA 1YT2A 2YGAA 4EMVA 1ID0A 4L91A 4XE2A 2ZDYA 1UYEA 1TILA 2CG9A 5L3JA 2YI5A 1GKXA 2YGEA 3HHUA 2WI6A 3LNUA 2FWYA 4HXWA 3A0YA 1UYIA 3OWDA 5IDMA 3A0XA 1TC0A 3H80A 1TBWA 4U93A 2YE2A 2EXLA 2XABA 3IEDA 4MOTA 2FXSA 4KSGA 4XKOA 3ZXQA 4E01A 2WEPA 4XTJA 1THNA 2O1UA 4O0BA 5CTXA 1TC6A 4EGIA 4CWNA 4EEHA 2YKJA 3HEKA 1B3QA 3OPDA 2YECA 4QPKA 5CPHA 4I3HA 3H4LA 1NHJA 3Q5LA 2CCTA 2CGFA 3OW6A 3PEJA 2XDSA 5F3KA 4O05A 3T2SA 3U2DA 2YEDA 4ZKIA 4MPCA 3R91A 4XCJA 3T0HA 1GKZA 4YKRA 4I5SA 4GEEA 4FCRA 4QPJA 3T10A 3O2FA 4EGHA 3ZM7A 2IWXA 4NH8A 2YEHA 4GFNA 1R62A 2VW5A 1I5CA 3CGYA 1I5BA 1PVGA 4URNA 2ZDXA 4FMTA 1UYDA 2FWZA 1UYHA 3VHCA 1I5DA 4CWOA 1QYEA 4AWPA 2BZ5A 5M4KA 3A0RA 1ZWHA 2QG0A 5BODA 3C0EA 4CE3A 2QFOA 4NH7A 3EHJA 2O1VA 3B26A 2YE9A 3TZ5A 4URLA 4ASFA 1H7SA 4H81A 2XK2A 2XDLA 1YS3A 4W7TA 1KIJA 2XX5A 4U7OA 4XITA 4YKWA 3NMQA 4BQGA 4CWQA 5M4NA 5GGZA 3QTFA 4BAEA 4ZVIA 4XD8A 2QG2A 2UWDA 2YI7A 4BIZA 2IORA 5FWKA 3EKOA 2YE6A 4HYMA 3B27A 4XIPA 1AMWA 2YE8A 1QY8A 2Q8FA 4LWGA 4B6CA 4JAUA 1S16A 4WUBA 5D7CA 1OSFA 3C11A 3CRKA 3T1KA 2HG1A 4CWFA 3K98A 2HKJA 2Q8IA 1H7UA 4L90A 3ZKDA 3EKRA 1Y8PA 4YKXA 4EFUA 5M4PA 3GIGB 3CRLA 2IWUA 4HXZA 3GIFA 3TUHA 4BIUA 4PU9A 4XCLA 4E02A 3K60A 1UYCA 1UY6A 3HYYA 1EI1A 2XJXA 3HZ1A 3KE6A 2WI1A 3D36A 4KQVA 3EHFA 3K99A 5F5RA 4XKAA 3VHAA 1YC4A 1AJ6A 2YK2A 3D2RA 3JZ3A 5FNFA 2BYIA 2HCHA 2WI2A 4PRVA 2YKCA 3Q5KA 4R3MA 4R1FA 1UY9A 3R92A 2YEEA 3TZ2A 4MP2A 4XKKA 2XDUA 2PNRA 3PEHA 1YT1A 4YKUA 1TH8A 2IOPA 2BU8A 3R4OA 5D6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQP A;  2WI3 A;  3SL2 A;  2VCI A;  2YI0 A;  1US7 A;  4MP7 A;  5D7D A;  3ZKB A;  2XX4 A;  4MBC A;  5M4E A;  1I59 A;  4EGK A;  2YKI A;  2YKB A;  2XCM A;  3CGZ A;  2XHT A;  2O1W A;  2YGF A;  3G7E A;  4URM A;  5IN9 A;  3GIE A;  3A0Z A;  1ZXM A;  3RKZ A;  3LPS A;  3G75 A;  1AM1 A;  4LPB A;  4BQJ A;  5C93 A;  4O07 A;  2BU6 A;  2ZKJ A;  2QF6 A;  2XDK A;  4EM7 A;  4DUH A;  1L0O A;  4PL9 A;  3RLR A;  2XDX A;  2IOQ A;  4B7P A;  3G7B A;  1BYQ A;  4NH9 A;  1B63 A;  1YER A;  4GGL A;  2XJG A;  1BKN A;  3HYZ A;  2GFD A;  1UYM A;  3RLQ A;  4FCP A;  3HZ5 A;  4WUD A;  4YKT A;  1BGQ A;  2YEJ A;  3BMY A;  1UY8 A;  2XHR A;  1JM6 A;  3TTZ A;  2YEA A;  2WER A;  4URO A;  4XC0 A;  1I58 A;  5CTW A;  2BU2 A;  4YKQ A;  1UYK A;  2BU5 A;  1MX0 A;  2WI7 A;  2YE3 A;  4U7N A;  2H55 A;  3T0Z A;  4CWR A;  1Z5B A;  3R4P A;  2E0A A;  1Y4S A;  1S14 A;  3U2K A;  2XD6 A;  2YI6 A;  4FPP A;  1UY7 A;  3TZ0 A;  5CTY A;  1AH6 A;  3WHA A;  2YJX A;  5M4H A;  1U2O A;  1UYF A;  2H8M A;  3EHG A;  2K5B A;  4O04 A;  4V25 A;  5D7R A;  3TZ4 A;  2BU7 A;  4CWP A;  1GJV A;  1Y8N A;  3O0I A;  2YEI A;  4HY1 A;  4CE1 A;  3INX A;  3VAD A;  2VCJ A;  4HZ5 A;  2YE5 A;  3B24 A;  4HYP A;  2BTZ A;  4L93 A;  4K4O A;  5J71 A;  4KSH A;  1YSZ A;  5CTU A;  2XHX A;  1TID A;  1QZR A;  4XDM A;  4LP0 A;  4O09 A;  2YE7 A;  1UYL A;  4KTN A;  3EHH A;  2AKP A;  1EA6 A;  1YES A;  1MU5 A;  1YET A;  3GIG A;  2YEB A;  4LWH A;  2BYH A;  4ASA A;  4GCZ A;  3A0T A;  3K97 A;  2YJW A;  4LWE A;  3B25 A;  2ESA A;  2XJJ A;  4GQT A;  2WI5 A;  1U0Z A;  1Y8O A;  2FYP A;  1A4H A;  4KFG A;  1BXD A;  2WI4 A;  3ZXO A;  4YKY A;  4FCQ A;  4XIR A;  4CE2 A;  1YC3 A;  4V26 A;  4H7Q A;  2C2A A;  3OWB A;  5CF0 A;  4MPE A;  3QDD A;  2BSM A;  3WQ9 A;  4AWO A;  5IDJ A;  2CCS A;  4WUC A;  3U67 A;  4HY6 A;  2Q8H A;  4JAV A;  1YC1 A;  2Q8G A;  4E00 A;  2YE4 A;  4MB9 A;  5M4M A;  3OMU A;  2IWS A;  4P8O A;  4L94 A;  4DZY A;  4X9L A;  4PRX A;  3FV5 A;  3FT8 A;  1NHH A;  3DGE A;  2XX2 A;  1Z59 A;  3VHD A;  4BXI A;  4JAS A;  4H85 A;  1Z5A A;  4ASB A;  1AH8 A;  3FT5 A;  3INW A;  3CWV A;  3R4N A;  5D6Q A;  4EFT A;  2JJC A;  5FNC A;  4CWS A;  3O6O A;  3A0W A;  5J6A A;  2VWC A;  1NHI A;  1Y4U A;  2CH4 A;  3BM9 A;  3MNR P;  4GT8 A;  4JQL A;  4ASG A;  2WEQ A;  1ZXN A;  4YKZ A;  3D0B A;  3Q5J A;  3RLP A;  5FND A;  3R4M A;  2ZBK B;  1B62 A;  1KZN A;  1UYG A;  2YEF A;  4P7A A;  4AWQ A;  2YK9 A;  5BOC A;  4AS9 A;  2CCU A;  1YT0 A;  4LWI A;  2BRC A;  2YEG A;  3B28 A;  1YSR A;  4XIQ A;  4CWT A;  1Z5C A;  1I5A A;  4HZ0 A;  4Q20 A;  1ZW9 A;  2JKI A;  4KP4 A;  4L8Z A;  4R3A A;  4LWF A;  2Q2E B;  2BT0 A;  4MPN A;  2YKE A;  2BRE A;  1YT2 A;  2YGA A;  4EMV A;  1ID0 A;  4L91 A;  4XE2 A;  2ZDY A;  1UYE A;  1TIL A;  2CG9 A;  5L3J A;  2YI5 A;  1GKX A;  2YGE A;  3HHU A;  2WI6 A;  3LNU A;  2FWY A;  4HXW A;  3A0Y A;  1UYI A;  3OWD A;  5IDM A;  3A0X A;  1TC0 A;  3H80 A;  1TBW A;  4U93 A;  2YE2 A;  2EXL A;  2XAB A;  3IED A;  4MOT A;  2FXS A;  4KSG A;  4XKO A;  3ZXQ A;  4E01 A;  2WEP A;  4XTJ A;  1THN A;  2O1U A;  4O0B A;  5CTX A;  1TC6 A;  4EGI A;  4CWN A;  4EEH A;  2YKJ A;  3HEK A;  1B3Q A;  3OPD A;  2YEC A;  4QPK A;  5CPH A;  4I3H A;  3H4L A;  1NHJ A;  3Q5L A;  2CCT A;  2CGF A;  3OW6 A;  3PEJ A;  2XDS A;  5F3K A;  4O05 A;  3T2S A;  3U2D A;  2YED A;  4ZKI A;  4MPC A;  3R91 A;  4XCJ A;  3T0H A;  1GKZ A;  4YKR A;  4I5S A;  4GEE A;  4FCR A;  4QPJ A;  3T10 A;  3O2F A;  4EGH A;  3ZM7 A;  2IWX A;  4NH8 A;  2YEH A;  4GFN A;  1R62 A;  2VW5 A;  1I5C A;  3CGY A;  1I5B A;  1PVG A;  4URN A;  2ZDX A;  4FMT A;  1UYD A;  2FWZ A;  1UYH A;  3VHC A;  1I5D A;  4CWO A;  1QYE A;  4AWP A;  2BZ5 A;  5M4K A;  3A0R A;  1ZWH A;  2QG0 A;  5BOD A;  3C0E A;  4CE3 A;  2QFO A;  4NH7 A;  3EHJ A;  2O1V A;  3B26 A;  2YE9 A;  3TZ5 A;  4URL A;  4ASF A;  1H7S A;  4H81 A;  2XK2 A;  2XDL A;  1YS3 A;  4W7T A;  1KIJ A;  2XX5 A;  4U7O A;  4XIT A;  4YKW A;  3NMQ A;  4BQG A;  4CWQ A;  5M4N A;  5GGZ A;  3QTF A;  4BAE A;  4ZVI A;  4XD8 A;  2QG2 A;  2UWD A;  2YI7 A;  4BIZ A;  2IOR A;  5FWK A;  3EKO A;  2YE6 A;  4HYM A;  3B27 A;  4XIP A;  1AMW A;  2YE8 A;  1QY8 A;  2Q8F A;  4LWG A;  4B6C A;  4JAU A;  1S16 A;  4WUB A;  5D7C A;  1OSF A;  3C11 A;  3CRK A;  3T1K A;  2HG1 A;  4CWF A;  3K98 A;  2HKJ A;  2Q8I A;  1H7U A;  4L90 A;  3ZKD A;  3EKR A;  1Y8P A;  4YKX A;  4EFU A;  5M4P A;  3GIG B;  3CRL A;  2IWU A;  4HXZ A;  3GIF A;  3TUH A;  4BIU A;  4PU9 A;  4XCL A;  4E02 A;  3K60 A;  1UYC A;  1UY6 A;  3HYY A;  1EI1 A;  2XJX A;  3HZ1 A;  3KE6 A;  2WI1 A;  3D36 A;  4KQV A;  3EHF A;  3K99 A;  5F5R A;  4XKA A;  3VHA A;  1YC4 A;  1AJ6 A;  2YK2 A;  3D2R A;  3JZ3 A;  5FNF A;  2BYI A;  2HCH A;  2WI2 A;  4PRV A;  2YKC A;  3Q5K A;  4R3M A;  4R1F A;  1UY9 A;  3R92 A;  2YEE A;  3TZ2 A;  4MP2 A;  4XKK A;  2XDU A;  2PNR A;  3PEH A;  1YT1 A;  4YKU A;  1TH8 A;  2IOP A;  2BU8 A;  3R4O A;  5D6P A; 
#chains in the Genus database with same CATH topology
 2GQP A;  2WI3 A;  3SL2 A;  2VCI A;  2YI0 A;  1US7 A;  4MP7 A;  5D7D A;  3ZKB A;  2XX4 A;  4MBC A;  5M4E A;  1I59 A;  4EGK A;  2YKI A;  2YKB A;  2XCM A;  3CGZ A;  2XHT A;  2O1W A;  2YGF A;  3G7E A;  4URM A;  5IN9 A;  3GIE A;  3A0Z A;  1ZXM A;  3RKZ A;  3LPS A;  3G75 A;  1AM1 A;  4LPB A;  4BQJ A;  5C93 A;  4O07 A;  2BU6 A;  2ZKJ A;  2QF6 A;  2XDK A;  4EM7 A;  4DUH A;  1L0O A;  4PL9 A;  3RLR A;  2XDX A;  2IOQ A;  4B7P A;  3G7B A;  1BYQ A;  4NH9 A;  1B63 A;  1YER A;  4GGL A;  2XJG A;  4E72 A;  1BKN A;  3HYZ A;  2GFD A;  1UYM A;  3RLQ A;  4FCP A;  3HZ5 A;  4WUD A;  4YKT A;  1BGQ A;  2YEJ A;  3BMY A;  5JEN A;  1UY8 A;  2XHR A;  1JM6 A;  3TTZ A;  2YEA A;  2WER A;  4URO A;  4XC0 A;  1I58 A;  2C1I A;  2C1G A;  2BU2 A;  4YKQ A;  5CTW A;  1UYK A;  2BU5 A;  1MX0 A;  2WI7 A;  2YE3 A;  4U7N A;  2H55 A;  3T0Z A;  4CWR A;  1Z5B A;  3R4P A;  2E0A A;  1Y4S A;  1S14 A;  3U2K A;  2XD6 A;  2YI6 A;  4FPP A;  1UY7 A;  3TZ0 A;  5CTY A;  1AH6 A;  3WHA A;  2YJX A;  5M4H A;  1U2O A;  1UYF A;  2H8M A;  3EHG A;  2K5B A;  1F51 A;  4O04 A;  4V25 A;  5D7R A;  3TZ4 A;  2BU7 A;  4CWP A;  1GJV A;  1Y8N A;  3O0I A;  2YEI A;  4HY1 A;  4CE1 A;  3INX A;  3VAD A;  2VCJ A;  4HZ5 A;  2YE5 A;  3B24 A;  4HYP A;  2BTZ A;  4L93 A;  4K4O A;  5J71 A;  4KSH A;  1YSZ A;  5CTU A;  2XHX A;  1TID A;  1QZR A;  4XDM A;  4LP0 A;  4O09 A;  2HHI A;  2YE7 A;  1UYL A;  4KTN A;  3EHH A;  2AKP A;  1EA6 A;  1YES A;  1MU5 A;  1YET A;  3GIG A;  2YEB A;  4LWH A;  2BYH A;  4ASA A;  4GCZ A;  3A0T A;  3K97 A;  2YJW A;  4LWE A;  3B25 A;  2ESA A;  2XJJ A;  4GQT A;  2WI5 A;  1U0Z A;  1Y8O A;  2FYP A;  1A4H A;  4KFG A;  2FTK A;  1BXD A;  2WI4 A;  3ZXO A;  4YKY A;  4FCQ A;  4XIR A;  4CE2 A;  1YC3 A;  4V26 A;  4H7Q A;  2C2A A;  3OWB A;  5CF0 A;  4MPE A;  3QDD A;  2BSM A;  3WQ9 A;  4AWO A;  5IDJ A;  2CCS A;  4WUC A;  3U67 A;  4HY6 A;  2Q8H A;  4JAV A;  1YC1 A;  2Q8G A;  4E00 A;  2YE4 A;  4MB9 A;  5M4M A;  3OMU A;  2IWS A;  4P8O A;  4L94 A;  4DZY A;  4X9L A;  4PRX A;  3FV5 A;  3FT8 A;  1NHH A;  3DGE A;  2XX2 A;  1Z59 A;  3VHD A;  4BXI A;  4JAS A;  4H85 A;  1Z5A A;  4ASB A;  1AH8 A;  3FT5 A;  3INW A;  3CWV A;  3R4N A;  5D6Q A;  4EFT A;  2JJC A;  5FNC A;  4CWS A;  3O6O A;  3A0W A;  5J6A A;  2VWC A;  1NHI A;  1Y4U A;  2CH4 A;  3BM9 A;  3MNR P;  4GT8 A;  4JQL A;  4ASG A;  2WEQ A;  1ZXN A;  4YKZ A;  3D0B A;  3Q5J A;  3RLP A;  5FND A;  3R4M A;  2ZBK B;  1B62 A;  1KZN A;  1UYG A;  2YEF A;  4P7A A;  4AWQ A;  2YK9 A;  5BOC A;  4AS9 A;  2CCU A;  1YT0 A;  4LWI A;  2BRC A;  2YEG A;  3B28 A;  1YSR A;  3S5T A;  4XIQ A;  4CWT A;  1Z5C A;  1I5A A;  4HZ0 A;  4Q20 A;  1ZW9 A;  2JKI A;  4KP4 A;  4L8Z A;  4R3A A;  4LWF A;  2Q2E B;  2BT0 A;  4MPN A;  2YKE A;  2BRE A;  1YT2 A;  2YGA A;  4EMV A;  1ID0 A;  4L91 A;  4XE2 A;  2ZDY A;  1UYE A;  1TIL A;  2CG9 A;  5L3J A;  2YI5 A;  1GKX A;  2YGE A;  3HHU A;  2WI6 A;  3LNU A;  2FWY A;  4HXW A;  3A0Y A;  1UYI A;  3OWD A;  5IDM A;  3A0X A;  1TC0 A;  3H80 A;  1TBW A;  4U93 A;  2YE2 A;  2EXL A;  2XAB A;  3IED A;  4MOT A;  2FXS A;  4KSG A;  4XKO A;  3ZXQ A;  4E01 A;  2WEP A;  4XTJ A;  1THN A;  2O1U A;  4O0B A;  5CTX A;  1TC6 A;  4EGI A;  4CWN A;  4EEH A;  2YKJ A;  3HEK A;  1B3Q A;  3OPD A;  2YEC A;  4QPK A;  5CPH A;  4I3H A;  3H4L A;  1NHJ A;  3Q5L A;  2CCT A;  2CGF A;  3OW6 A;  3PEJ A;  2XDS A;  5F3K A;  4O05 A;  3T2S A;  3U2D A;  2YED A;  4ZKI A;  4MPC A;  3R91 A;  4XCJ A;  3T0H A;  1GKZ A;  4YKR A;  4I5S A;  4GEE A;  4FCR A;  4QPJ A;  3T10 A;  3O2F A;  4EGH A;  3ZM7 A;  2IWX A;  4NH8 A;  2YEH A;  4GFN A;  1R62 A;  2VW5 A;  1I5C A;  3CGY A;  1I5B A;  1PVG A;  4URN A;  2ZDX A;  4FMT A;  1UYD A;  2FWZ A;  1UYH A;  3VHC A;  1I5D A;  3CYG A;  4CWO A;  1QYE A;  4AWP A;  2BZ5 A;  5M4K A;  3A0R A;  1ZWH A;  2QG0 A;  5BOD A;  3C0E A;  4CE3 A;  2QFO A;  4NH7 A;  3EHJ A;  2O1V A;  3B26 A;  2YE9 A;  3TZ5 A;  4URL A;  4ASF A;  1H7S A;  4H81 A;  2XK2 A;  2XDL A;  1YS3 A;  4W7T A;  1KIJ A;  2XX5 A;  4U7O A;  4XIT A;  4YKW A;  3NMQ A;  4BQG A;  4CWQ A;  5M4N A;  5GGZ A;  3QTF A;  4BAE A;  4ZVI A;  4XD8 A;  2QG2 A;  2UWD A;  2YI7 A;  4BIZ A;  2IOR A;  5FWK A;  3EKO A;  1IXM A;  2YE6 A;  4HYM A;  3B27 A;  4XIP A;  1AMW A;  2YE8 A;  3LMM A;  1QY8 A;  2Q8F A;  4LWG A;  4B6C A;  4JAU A;  1S16 A;  4WUB A;  5D7C A;  1OSF A;  3C11 A;  3CRK A;  3T1K A;  2HG1 A;  4CWF A;  3K98 A;  2HKJ A;  2Q8I A;  1H7U A;  4L90 A;  3ZKD A;  3EKR A;  1Y8P A;  4YKX A;  4EFU A;  5M4P A;  3GIG B;  3CRL A;  2IWU A;  4HXZ A;  3GIF A;  3TUH A;  4BIU A;  4PU9 A;  4XCL A;  4E02 A;  3K60 A;  1UYC A;  1UY6 A;  3HYY A;  1EI1 A;  2XJX A;  3HZ1 A;  3KE6 A;  2WI1 A;  3D36 A;  4KQV A;  3EHF A;  3K99 A;  5F5R A;  4XKA A;  3VHA A;  1YC4 A;  1AJ6 A;  2YK2 A;  3D2R A;  3JZ3 A;  5FNF A;  2BYI A;  2HCH A;  2WI2 A;  4PRV A;  2YKC A;  3Q5K A;  4R3M A;  4R1F A;  1UY9 A;  3R92 A;  2YEE A;  3TZ2 A;  4MP2 A;  4XKK A;  2XDU A;  2PNR A;  3PEH A;  1YT1 A;  4YKU A;  1TH8 A;  2IOP A;  2BU8 A;  3R4O A;  5D6P A; 
#chains in the Genus database with same CATH homology
 2GQP A;  2WI3 A;  3SL2 A;  2VCI A;  2YI0 A;  1US7 A;  4MP7 A;  5D7D A;  3ZKB A;  2XX4 A;  4MBC A;  5M4E A;  1I59 A;  4EGK A;  2YKI A;  2YKB A;  2XCM A;  3CGZ A;  2XHT A;  2O1W A;  2YGF A;  3G7E A;  4URM A;  5IN9 A;  3GIE A;  3A0Z A;  1ZXM A;  3RKZ A;  3LPS A;  3G75 A;  1AM1 A;  4LPB A;  4BQJ A;  5C93 A;  4O07 A;  2BU6 A;  2ZKJ A;  2QF6 A;  2XDK A;  4EM7 A;  4DUH A;  1L0O A;  4PL9 A;  3RLR A;  2XDX A;  2IOQ A;  4B7P A;  3G7B A;  1BYQ A;  4NH9 A;  1B63 A;  1YER A;  4GGL A;  2XJG A;  1BKN A;  3HYZ A;  2GFD A;  1UYM A;  3RLQ A;  4FCP A;  3HZ5 A;  4WUD A;  4YKT A;  1BGQ A;  2YEJ A;  3BMY A;  1UY8 A;  2XHR A;  1JM6 A;  3TTZ A;  2YEA A;  2WER A;  4URO A;  4XC0 A;  1I58 A;  5CTW A;  2BU2 A;  4YKQ A;  1UYK A;  2BU5 A;  1MX0 A;  2WI7 A;  2YE3 A;  4U7N A;  2H55 A;  3T0Z A;  4CWR A;  1Z5B A;  3R4P A;  2E0A A;  1Y4S A;  1S14 A;  3U2K A;  2XD6 A;  2YI6 A;  4FPP A;  1UY7 A;  3TZ0 A;  5CTY A;  1AH6 A;  3WHA A;  2YJX A;  5M4H A;  1U2O A;  1UYF A;  2H8M A;  3EHG A;  2K5B A;  4O04 A;  4V25 A;  5D7R A;  3TZ4 A;  2BU7 A;  4CWP A;  1GJV A;  1Y8N A;  3O0I A;  2YEI A;  4HY1 A;  4CE1 A;  3INX A;  3VAD A;  2VCJ A;  4HZ5 A;  2YE5 A;  3B24 A;  4HYP A;  2BTZ A;  4L93 A;  4K4O A;  5J71 A;  4KSH A;  1YSZ A;  5CTU A;  2XHX A;  1TID A;  1QZR A;  4XDM A;  4LP0 A;  4O09 A;  2YE7 A;  1UYL A;  4KTN A;  3EHH A;  2AKP A;  1EA6 A;  1YES A;  1MU5 A;  1YET A;  3GIG A;  2YEB A;  4LWH A;  2BYH A;  4ASA A;  4GCZ A;  3A0T A;  3K97 A;  2YJW A;  4LWE A;  3B25 A;  2ESA A;  2XJJ A;  4GQT A;  2WI5 A;  1U0Z A;  1Y8O A;  2FYP A;  1A4H A;  4KFG A;  1BXD A;  2WI4 A;  3ZXO A;  4YKY A;  4FCQ A;  4XIR A;  4CE2 A;  1YC3 A;  4V26 A;  4H7Q A;  2C2A A;  3OWB A;  5CF0 A;  4MPE A;  3QDD A;  2BSM A;  3WQ9 A;  4AWO A;  5IDJ A;  2CCS A;  4WUC A;  3U67 A;  4HY6 A;  2Q8H A;  4JAV A;  1YC1 A;  2Q8G A;  4E00 A;  2YE4 A;  4MB9 A;  5M4M A;  3OMU A;  2IWS A;  4P8O A;  4L94 A;  4DZY A;  4X9L A;  4PRX A;  3FV5 A;  3FT8 A;  1NHH A;  3DGE A;  2XX2 A;  1Z59 A;  3VHD A;  4BXI A;  4JAS A;  4H85 A;  1Z5A A;  4ASB A;  1AH8 A;  3FT5 A;  3INW A;  3CWV A;  3R4N A;  5D6Q A;  4EFT A;  2JJC A;  5FNC A;  4CWS A;  3O6O A;  3A0W A;  5J6A A;  2VWC A;  1NHI A;  1Y4U A;  2CH4 A;  3BM9 A;  3MNR P;  4GT8 A;  4JQL A;  4ASG A;  2WEQ A;  1ZXN A;  4YKZ A;  3D0B A;  3Q5J A;  3RLP A;  5FND A;  3R4M A;  2ZBK B;  1B62 A;  1KZN A;  1UYG A;  2YEF A;  4P7A A;  4AWQ A;  2YK9 A;  5BOC A;  4AS9 A;  2CCU A;  1YT0 A;  4LWI A;  2BRC A;  2YEG A;  3B28 A;  1YSR A;  4XIQ A;  4CWT A;  1Z5C A;  1I5A A;  4HZ0 A;  4Q20 A;  1ZW9 A;  2JKI A;  4KP4 A;  4L8Z A;  4R3A A;  4LWF A;  2Q2E B;  2BT0 A;  4MPN A;  2YKE A;  2BRE A;  1YT2 A;  2YGA A;  4EMV A;  1ID0 A;  4L91 A;  4XE2 A;  2ZDY A;  1UYE A;  1TIL A;  2CG9 A;  5L3J A;  2YI5 A;  1GKX A;  2YGE A;  3HHU A;  2WI6 A;  3LNU A;  2FWY A;  4HXW A;  3A0Y A;  1UYI A;  3OWD A;  5IDM A;  3A0X A;  1TC0 A;  3H80 A;  1TBW A;  4U93 A;  2YE2 A;  2EXL A;  2XAB A;  3IED A;  4MOT A;  2FXS A;  4KSG A;  4XKO A;  3ZXQ A;  4E01 A;  2WEP A;  4XTJ A;  1THN A;  2O1U A;  4O0B A;  5CTX A;  1TC6 A;  4EGI A;  4CWN A;  4EEH A;  2YKJ A;  3HEK A;  1B3Q A;  3OPD A;  2YEC A;  4QPK A;  5CPH A;  4I3H A;  3H4L A;  1NHJ A;  3Q5L A;  2CCT A;  2CGF A;  3OW6 A;  3PEJ A;  2XDS A;  5F3K A;  4O05 A;  3T2S A;  3U2D A;  2YED A;  4ZKI A;  4MPC A;  3R91 A;  4XCJ A;  3T0H A;  1GKZ A;  4YKR A;  4I5S A;  4GEE A;  4FCR A;  4QPJ A;  3T10 A;  3O2F A;  4EGH A;  3ZM7 A;  2IWX A;  4NH8 A;  2YEH A;  4GFN A;  1R62 A;  2VW5 A;  1I5C A;  3CGY A;  1I5B A;  1PVG A;  4URN A;  2ZDX A;  4FMT A;  1UYD A;  2FWZ A;  1UYH A;  3VHC A;  1I5D A;  4CWO A;  1QYE A;  4AWP A;  2BZ5 A;  5M4K A;  3A0R A;  1ZWH A;  2QG0 A;  5BOD A;  3C0E A;  4CE3 A;  2QFO A;  4NH7 A;  3EHJ A;  2O1V A;  3B26 A;  2YE9 A;  3TZ5 A;  4URL A;  4ASF A;  1H7S A;  4H81 A;  2XK2 A;  2XDL A;  1YS3 A;  4W7T A;  1KIJ A;  2XX5 A;  4U7O A;  4XIT A;  4YKW A;  3NMQ A;  4BQG A;  4CWQ A;  5M4N A;  5GGZ A;  3QTF A;  4BAE A;  4ZVI A;  4XD8 A;  2QG2 A;  2UWD A;  2YI7 A;  4BIZ A;  2IOR A;  5FWK A;  3EKO A;  2YE6 A;  4HYM A;  3B27 A;  4XIP A;  1AMW A;  2YE8 A;  1QY8 A;  2Q8F A;  4LWG A;  4B6C A;  4JAU A;  1S16 A;  4WUB A;  5D7C A;  1OSF A;  3C11 A;  3CRK A;  3T1K A;  2HG1 A;  4CWF A;  3K98 A;  2HKJ A;  2Q8I A;  1H7U A;  4L90 A;  3ZKD A;  3EKR A;  1Y8P A;  4YKX A;  4EFU A;  5M4P A;  3GIG B;  3CRL A;  2IWU A;  4HXZ A;  3GIF A;  3TUH A;  4BIU A;  4PU9 A;  4XCL A;  4E02 A;  3K60 A;  1UYC A;  1UY6 A;  3HYY A;  1EI1 A;  2XJX A;  3HZ1 A;  3KE6 A;  2WI1 A;  3D36 A;  4KQV A;  3EHF A;  3K99 A;  5F5R A;  4XKA A;  3VHA A;  1YC4 A;  1AJ6 A;  2YK2 A;  3D2R A;  3JZ3 A;  5FNF A;  2BYI A;  2HCH A;  2WI2 A;  4PRV A;  2YKC A;  3Q5K A;  4R3M A;  4R1F A;  1UY9 A;  3R92 A;  2YEE A;  3TZ2 A;  4MP2 A;  4XKK A;  2XDU A;  2PNR A;  3PEH A;  1YT1 A;  4YKU A;  1TH8 A;  2IOP A;  2BU8 A;  3R4O A;  5D6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...