3EHFA

Crystal structure of deskc in complex with amp-pcp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
186
structure length
179
Chain Sequence
RIARDLHDTLGQKLSLIGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEVRKIVSSMKGIRLKDELINIKQILEAADIMFIYEEEKWPENISLLNENILSMCLKEAVTNVVKHSQAKTCRVDIQQLWKEVVITVSDDGTFKGEHGLLGMRERLEFANGSLHIDTENGTKLTMAIPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor kinase (YocF protein)
publication title Structural plasticity and catalysis regulation of a thermosensor histidine kinase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 52
structure length 179
sequence length 186
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07730 HisKA_3 Histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3ehfA02
2VWCA 2YK9A 1ID0A 2XJXA 4ASFA 4EFUA 4LWHA 1TBWA 1QZRA 2O1VA 3TTZA 2Q8FA 4XKAA 1BYQA 4AWPA 2WI4A 4HYMA 3U2DA 4HXZA 4XD8A 1YC1A 4LPBA 2WEPA 4L94A 4HY6A 2YI7A 2XDUA 4O07A 4YKQA 4L8ZA 3CRLA 4CWNA 2YEEA 3DGEA 1Y4UA 4FMTA 3R91A 4BAEA 2YI0A 1I5CA 5J71A 3Q5KA 3PEHA 1YC3A 3ZXOA 1B63A 3GIGA 1TC0A 1S14A 1YERA 4GT8A 4QPJA 1OSFA 3GIGB 3G7EA 1Z59A 2XK2A 1Y4SA 2YJXA 4R3MA 2HKJA 3HYYA 3B27A 5L3JA 2XHXA 4YKTA 4MPEA 1BKNA 1Y8PA 4EM7A 3K60A 2WI7A 4X9LA 5FWKA 1BGQA 3EKOA 4HY1A 1I5DA 1UYFA 3TZ2A 1GKZA 1EA6A 4CE1A 4WUCA 2BT0A 2Q8IA 4U7OA 2BREA 4CWFA 4XKKA 3HZ5A 5CTUA 4AWOA 1H7SA 2XABA 1L0OA 5IN9A 3T0HA 2XDLA 4FCRA 4FPPA 4K4OA 3WQ9A 3G75A 3VHCA 3Q5JA 1QYEA 4V26A 3CGZA 3WHAA 3RKZA 1S16A 4MP7A 1YSZA 2K5BA 3O6OA 4FCPA 2IORA 4LP0A 4EFTA 5M4MA 3BMYA 4HYPA 1AMWA 2FYPA 2BSMA 2IOPA 3TZ4A 3KE6A 5M4NA 4B6CA 1YC4A 4ASGA 2HCHA 5CTXA 1TH8A 1R62A 1UYHA 2ZDXA 4KFGA 3Q5LA 3A0TA 3HEKA 4R1FA 3D0BA 2CCUA 4L93A 4I3HA 3T2SA 3R4PA 2JJCA 3MNRP 3H80A 3BM9A 5J6AA 1UY6A 4JQLA 4LWGA 4JASA 4URLA 1ZWHA 2IOQA 1UYCA 1B62A 2YI5A 4NH9A 3K97A 4H81A 1YT0A 3R4MA 3B25A 4PRXA 1UYMA 2XDXA 1AM1A 4HZ0A 2YEHA 4XCLA 2YEGA 2XCMA 1U2OA 1H7UA 1KIJA 4XC0A 1GKXA 5IDJA 4ZVIA 1PVGA 3QTFA 5F5RA 4BQGA 2WI2A 3TZ5A 3H4LA 4LWFA 2YEJA 3EHGA 3U67A 5FNCA 1UYEA 4EEHA 4BXIA 5M4PA 4URMA 4R3AA 1Z5AA 2BU7A 1Z5CA 1UY8A 5CPHA 3G7BA 1TIDA 4E02A 5IDMA 4XIQA 4KSGA 4GCZA 5F3KA 4MPCA 2YGFA 4L90A 2YE8A 3RLRA 3VHAA 3T1KA 2BU6A 4GQTA 2CGFA 3CRKA 2VW5A 2YGAA 4ASAA 4YKUA 2XD6A 2XX5A 4B7PA 3CGYA 4BIUA 1B3QA 1GJVA 2ZKJA 3HYZA 1NHIA 1EI1A 4YKRA 3FV5A 2XDSA 3O0IA 4V25A 2WERA 1YETA 5CF0A 3RLQA 3ZKBA 2YE9A 4XITA 1YSRA 3EHHA 2YECA 1YESA 2C2AA 2QF6A 3R4OA 4ZKIA 2IWUA 4HZ5A 4YKXA 2CH4A 2Q8HA 4JAVA 4DUHA 2XJJA 1ZW9A 4XTJA 1THNA 1U0ZA 4XKOA 2GQPA 5D7RA 4CWTA 3ZM7A 2Q2EB 1UYKA 2YEBA 4NH8A 3CWVA 3VHDA 2XJGA 5FNDA 4CWQA 2XX4A 3TZ0A 4EGHA 4KSHA 4UROA 1AJ6A 2GFDA 2XX2A 2YKJA 1NHHA 3T10A 3IEDA 2YE2A 5M4HA 3A0YA 4O05A 2O1UA 3OPDA 2H55A 2IWSA 1ZXMA 2YE3A 3ZKDA 2YEFA 5BOCA 1QY8A 4ASBA 2UWDA 4CWPA 4EGIA 4KP4A 4MPNA 4YKWA 4XIRA 1Z5BA 4QPKA 2PNRA 3D36A 4EMVA 1Y8NA 4O04A 1UY7A 4XE2A 2XHRA 5GGZA 4EGKA 4XIPA 4PU9A 2BU5A 3A0XA 4KQVA 4O0BA 2YJWA 1MX0A 2YE5A 2CG9A 3LNUA 2AKPA 4NH7A 3PEJA 1BXDA 3NMQA 4E01A 2XHTA 4AWQA 5M4EA 3A0ZA 5CTWA 4CE3A 3B24A 4LWEA 1I5AA 2QG0A 4CWRA 2BU8A 2WI6A 4XCJA 2E0AA 4PRVA 3EKRA 5FNFA 3EHJA 4LWIA 1TILA 2ZDYA 1YS3A 3SL2A 4AS9A 1YT1A 3OW6A 4DZYA 2QG2A 2BU2A 5D7CA 3A0RA 1UY9A 2CCSA 2YI6A 4GEEA 3B26A 4HXWA 2EXLA 3GIEA 3OMUA 4MB9A 1ZXNA 2XDKA 2YKCA 3QDDA 3FT8A 4GGLA 5CTYA 1AH8A 2WI1A 2YKIA 3INXA 1NHJA 1AH6A 3K99A 4O09A 2YE4A 5C93A 4P8OA 2YEDA 3TUHA 1TC6A 4W7TA 2BYIA 1JM6A 1Y8OA 2BRCA 3EHFA 4FCQA 1I59A 4Q20A 2H8MA 1I5BA 2WEQA 1YT2A 2YE6A 3VADA 4CE2A 4CWOA 4E00A 2YKBA 3RLPA 2WI5A 3FT5A 3R4NA 4JAUA 3K98A 5D6QA 2VCIA 1UYGA 3OWDA 3R92A 2HG1A 4U93A 2BTZA 3HHUA 4YKYA 4KTNA 4H85A 2IWXA 4BQJA 4H7QA 2Q8GA 2FWYA 2FWZA 3C0EA 2YK2A 3A0WA 2BZ5A 4MOTA 3JZ3A 4GFNA 3HZ1A 2ZBKB 1US7A 5D7DA 4CWSA 4P7AA 2YEIA 3O2FA 2YGEA 1MU5A 4I5SA 2WI3A 2BYHA 4MBCA 1A4HA 2YE7A 2JKIA 3INWA 4L91A 4WUDA 3D2RA 2FXSA 2QFOA 2O1WA 5D6PA 3T0ZA 3C11A 2ESAA 3OWBA 5M4KA 1UYDA 1UYLA 1KZNA 4BIZA 4WUBA 2CCTA 4U7NA 4URNA 1I58A 4XDMA 5BODA 2YEAA 4YKZA 2YKEA 4PL9A 2VCJA 3LPSA 3GIFA 3B28A 3ZXQA 1UYIA 4MP2A 3U2KA
chains in the Genus database with same CATH superfamily
2VWCA 2YK9A 1ID0A 2XJXA 4ASFA 4EFUA 4LWHA 1TBWA 1QZRA 2O1VA 3TTZA 2Q8FA 4XKAA 1BYQA 4AWPA 2WI4A 4HYMA 3U2DA 4HXZA 4XD8A 1YC1A 4LPBA 2WEPA 4L94A 4HY6A 2YI7A 5JENA 2XDUA 4O07A 4YKQA 4L8ZA 3CRLA 4CWNA 2YEEA 3DGEA 1Y4UA 4FMTA 3R91A 4BAEA 2YI0A 1I5CA 5J71A 3Q5KA 3PEHA 1YC3A 3ZXOA 1B63A 3GIGA 1TC0A 1S14A 1YERA 4GT8A 4QPJA 1OSFA 3GIGB 3S5TA 3G7EA 1Z59A 2XK2A 1Y4SA 2YJXA 4R3MA 2HKJA 3HYYA 3B27A 5L3JA 2XHXA 4YKTA 4MPEA 1BKNA 1Y8PA 4EM7A 3K60A 2WI7A 4X9LA 5FWKA 1BGQA 3EKOA 4HY1A 1I5DA 1UYFA 3TZ2A 1GKZA 1EA6A 4CE1A 4WUCA 2BT0A 2Q8IA 4U7OA 2BREA 4CWFA 4XKKA 3HZ5A 5CTUA 4AWOA 1H7SA 2XABA 1L0OA 5IN9A 3T0HA 2XDLA 4FCRA 4FPPA 4K4OA 3WQ9A 3G75A 3VHCA 3Q5JA 1QYEA 4V26A 3CGZA 3WHAA 3RKZA 1S16A 4MP7A 1YSZA 2K5BA 3O6OA 4FCPA 2IORA 4LP0A 4EFTA 5M4MA 3BMYA 4HYPA 1AMWA 2FYPA 2BSMA 2IOPA 3TZ4A 3KE6A 5M4NA 4B6CA 1YC4A 4ASGA 2HCHA 5CTXA 1TH8A 1R62A 1UYHA 2ZDXA 4KFGA 3Q5LA 3A0TA 3HEKA 4R1FA 3D0BA 2CCUA 4L93A 4I3HA 3T2SA 3R4PA 2JJCA 3MNRP 3H80A 3BM9A 5J6AA 1UY6A 4JQLA 4LWGA 4JASA 4URLA 1ZWHA 2IOQA 1UYCA 1B62A 2YI5A 4NH9A 3K97A 4H81A 1YT0A 3R4MA 3B25A 4PRXA 1F51A 1UYMA 2XDXA 1AM1A 4HZ0A 2YEHA 4XCLA 2YEGA 2XCMA 1U2OA 1H7UA 1KIJA 4XC0A 1GKXA 5IDJA 4ZVIA 1PVGA 3QTFA 5F5RA 4BQGA 2WI2A 3TZ5A 3H4LA 4LWFA 2YEJA 3EHGA 3U67A 5FNCA 1UYEA 4EEHA 4BXIA 5M4PA 4URMA 4R3AA 1Z5AA 2BU7A 1Z5CA 1UY8A 5CPHA 3G7BA 1TIDA 3CYGA 4E02A 5IDMA 4XIQA 4KSGA 4GCZA 5F3KA 4MPCA 3LMMA 2YGFA 4L90A 2YE8A 3RLRA 3VHAA 3T1KA 2BU6A 4GQTA 2CGFA 3CRKA 2VW5A 2YGAA 4ASAA 4YKUA 2XD6A 2XX5A 4B7PA 3CGYA 4BIUA 1B3QA 1GJVA 2ZKJA 3HYZA 1NHIA 1EI1A 4YKRA 3FV5A 1IXMA 2XDSA 3O0IA 4V25A 2WERA 1YETA 5CF0A 3RLQA 3ZKBA 2YE9A 4XITA 1YSRA 3EHHA 2YECA 1YESA 2C2AA 2QF6A 3R4OA 4ZKIA 2IWUA 4HZ5A 4YKXA 2CH4A 2Q8HA 4JAVA 4DUHA 2XJJA 1ZW9A 4XTJA 1THNA 1U0ZA 4XKOA 2GQPA 5D7RA 4CWTA 3ZM7A 2Q2EB 1UYKA 2YEBA 4NH8A 3CWVA 3VHDA 2XJGA 5FNDA 4CWQA 2XX4A 3TZ0A 4EGHA 4KSHA 4UROA 1AJ6A 2GFDA 2XX2A 2YKJA 1NHHA 3T10A 3IEDA 2YE2A 5M4HA 3A0YA 4O05A 2O1UA 3OPDA 2H55A 2IWSA 4E72A 1ZXMA 2YE3A 3ZKDA 2YEFA 5BOCA 1QY8A 4ASBA 2UWDA 4CWPA 4EGIA 4KP4A 4MPNA 4YKWA 4XIRA 1Z5BA 4QPKA 2PNRA 3D36A 4EMVA 1Y8NA 4O04A 1UY7A 4XE2A 2XHRA 5GGZA 4EGKA 4XIPA 4PU9A 2BU5A 3A0XA 2FTKA 4KQVA 4O0BA 2YJWA 1MX0A 2YE5A 2CG9A 3LNUA 2AKPA 4NH7A 3PEJA 1BXDA 3NMQA 4E01A 2XHTA 4AWQA 5M4EA 3A0ZA 5CTWA 4CE3A 3B24A 4LWEA 1I5AA 2QG0A 4CWRA 2C1GA 2BU8A 2WI6A 4XCJA 2E0AA 4PRVA 3EKRA 5FNFA 3EHJA 4LWIA 1TILA 2ZDYA 1YS3A 3SL2A 4AS9A 1YT1A 3OW6A 4DZYA 2QG2A 2BU2A 5D7CA 3A0RA 1UY9A 2CCSA 2YI6A 4GEEA 3B26A 4HXWA 2EXLA 3GIEA 3OMUA 4MB9A 1ZXNA 2XDKA 2YKCA 3QDDA 3FT8A 4GGLA 5CTYA 1AH8A 2WI1A 2YKIA 3INXA 1NHJA 1AH6A 2C1IA 3K99A 4O09A 2YE4A 5C93A 4P8OA 2YEDA 3TUHA 1TC6A 4W7TA 2BYIA 1JM6A 1Y8OA 2BRCA 3EHFA 4FCQA 1I59A 4Q20A 2H8MA 1I5BA 2WEQA 1YT2A 2YE6A 3VADA 4CE2A 4CWOA 4E00A 2YKBA 3RLPA 2WI5A 3FT5A 3R4NA 4JAUA 3K98A 5D6QA 2VCIA 1UYGA 3OWDA 3R92A 2HG1A 4U93A 2BTZA 3HHUA 4YKYA 4KTNA 4H85A 2IWXA 4BQJA 4H7QA 2Q8GA 2FWYA 2FWZA 3C0EA 2YK2A 3A0WA 2BZ5A 4MOTA 3JZ3A 4GFNA 3HZ1A 2ZBKB 1US7A 5D7DA 4CWSA 4P7AA 2YEIA 3O2FA 2YGEA 1MU5A 4I5SA 2WI3A 2BYHA 4MBCA 1A4HA 2YE7A 2JKIA 3INWA 4L91A 4WUDA 3D2RA 2FXSA 2QFOA 2O1WA 5D6PA 3T0ZA 3C11A 2ESAA 3OWBA 5M4KA 1UYDA 1UYLA 1KZNA 4BIZA 4WUBA 2CCTA 4U7NA 4URNA 1I58A 4XDMA 5BODA 2YEAA 4YKZA 2YKEA 4PL9A 2VCJA 3LPSA 3GIFA 2HHIA 3B28A 3ZXQA 1UYIA 4MP2A 3U2KA
chains in the Genus database with same CATH topology
2VWCA 2YK9A 1ID0A 2XJXA 4ASFA 4EFUA 4LWHA 1TBWA 1QZRA 2O1VA 3TTZA 2Q8FA 4XKAA 1BYQA 4AWPA 2WI4A 4HYMA 3U2DA 4HXZA 4XD8A 1YC1A 4LPBA 2WEPA 4L94A 4HY6A 2YI7A 2XDUA 4O07A 4YKQA 4L8ZA 3CRLA 4CWNA 2YEEA 3DGEA 1Y4UA 4FMTA 3R91A 4BAEA 2YI0A 1I5CA 5J71A 3Q5KA 3PEHA 1YC3A 3ZXOA 1B63A 3GIGA 1TC0A 1S14A 1YERA 4GT8A 4QPJA 1OSFA 3GIGB 3G7EA 1Z59A 2XK2A 1Y4SA 2YJXA 4R3MA 2HKJA 3HYYA 3B27A 5L3JA 2XHXA 4YKTA 4MPEA 1BKNA 1Y8PA 4EM7A 3K60A 2WI7A 4X9LA 5FWKA 1BGQA 3EKOA 4HY1A 1I5DA 1UYFA 3TZ2A 1GKZA 1EA6A 4CE1A 4WUCA 2BT0A 2Q8IA 4U7OA 2BREA 4CWFA 4XKKA 3HZ5A 5CTUA 4AWOA 1H7SA 2XABA 1L0OA 5IN9A 3T0HA 2XDLA 4FCRA 4FPPA 4K4OA 3WQ9A 3G75A 3VHCA 3Q5JA 1QYEA 4V26A 3CGZA 3WHAA 3RKZA 1S16A 4MP7A 1YSZA 2K5BA 3O6OA 4FCPA 2IORA 4LP0A 4EFTA 5M4MA 3BMYA 4HYPA 1AMWA 2FYPA 2BSMA 2IOPA 3TZ4A 3KE6A 5M4NA 4B6CA 1YC4A 4ASGA 2HCHA 5CTXA 1TH8A 1R62A 1UYHA 2ZDXA 4KFGA 3Q5LA 3A0TA 3HEKA 4R1FA 3D0BA 2CCUA 4L93A 4I3HA 3T2SA 3R4PA 2JJCA 3MNRP 3H80A 3BM9A 5J6AA 1UY6A 4JQLA 4LWGA 4JASA 4URLA 1ZWHA 2IOQA 1UYCA 1B62A 2YI5A 4NH9A 3K97A 4H81A 1YT0A 3R4MA 3B25A 4PRXA 1UYMA 2XDXA 1AM1A 4HZ0A 2YEHA 4XCLA 2YEGA 2XCMA 1U2OA 1H7UA 1KIJA 4XC0A 1GKXA 5IDJA 4ZVIA 1PVGA 3QTFA 5F5RA 4BQGA 2WI2A 3TZ5A 3H4LA 4LWFA 2YEJA 3EHGA 3U67A 5FNCA 1UYEA 4EEHA 4BXIA 5M4PA 4URMA 4R3AA 1Z5AA 2BU7A 1Z5CA 1UY8A 5CPHA 3G7BA 1TIDA 4E02A 5IDMA 4XIQA 4KSGA 4GCZA 5F3KA 4MPCA 2YGFA 4L90A 2YE8A 3RLRA 3VHAA 3T1KA 2BU6A 4GQTA 2CGFA 3CRKA 2VW5A 2YGAA 4ASAA 4YKUA 2XD6A 2XX5A 4B7PA 3CGYA 4BIUA 1B3QA 1GJVA 2ZKJA 3HYZA 1NHIA 1EI1A 4YKRA 3FV5A 2XDSA 3O0IA 4V25A 2WERA 1YETA 5CF0A 3RLQA 3ZKBA 2YE9A 4XITA 1YSRA 3EHHA 2YECA 1YESA 2C2AA 2QF6A 3R4OA 4ZKIA 2IWUA 4HZ5A 4YKXA 2CH4A 2Q8HA 4JAVA 4DUHA 2XJJA 1ZW9A 4XTJA 1THNA 1U0ZA 4XKOA 2GQPA 5D7RA 4CWTA 3ZM7A 2Q2EB 1UYKA 2YEBA 4NH8A 3CWVA 3VHDA 2XJGA 5FNDA 4CWQA 2XX4A 3TZ0A 4EGHA 4KSHA 4UROA 1AJ6A 2GFDA 2XX2A 2YKJA 1NHHA 3T10A 3IEDA 2YE2A 5M4HA 3A0YA 4O05A 2O1UA 3OPDA 2H55A 2IWSA 1ZXMA 2YE3A 3ZKDA 2YEFA 5BOCA 1QY8A 4ASBA 2UWDA 4CWPA 4EGIA 4KP4A 4MPNA 4YKWA 4XIRA 1Z5BA 4QPKA 2PNRA 3D36A 4EMVA 1Y8NA 4O04A 1UY7A 4XE2A 2XHRA 5GGZA 4EGKA 4XIPA 4PU9A 2BU5A 3A0XA 4KQVA 4O0BA 2YJWA 1MX0A 2YE5A 2CG9A 3LNUA 2AKPA 4NH7A 3PEJA 1BXDA 3NMQA 4E01A 2XHTA 4AWQA 5M4EA 3A0ZA 5CTWA 4CE3A 3B24A 4LWEA 1I5AA 2QG0A 4CWRA 2BU8A 2WI6A 4XCJA 2E0AA 4PRVA 3EKRA 5FNFA 3EHJA 4LWIA 1TILA 2ZDYA 1YS3A 3SL2A 4AS9A 1YT1A 3OW6A 4DZYA 2QG2A 2BU2A 5D7CA 3A0RA 1UY9A 2CCSA 2YI6A 4GEEA 3B26A 4HXWA 2EXLA 3GIEA 3OMUA 4MB9A 1ZXNA 2XDKA 2YKCA 3QDDA 3FT8A 4GGLA 5CTYA 1AH8A 2WI1A 2YKIA 3INXA 1NHJA 1AH6A 3K99A 4O09A 2YE4A 5C93A 4P8OA 2YEDA 3TUHA 1TC6A 4W7TA 2BYIA 1JM6A 1Y8OA 2BRCA 3EHFA 4FCQA 1I59A 4Q20A 2H8MA 1I5BA 2WEQA 1YT2A 2YE6A 3VADA 4CE2A 4CWOA 4E00A 2YKBA 3RLPA 2WI5A 3FT5A 3R4NA 4JAUA 3K98A 5D6QA 2VCIA 1UYGA 3OWDA 3R92A 2HG1A 4U93A 2BTZA 3HHUA 4YKYA 4KTNA 4H85A 2IWXA 4BQJA 4H7QA 2Q8GA 2FWYA 2FWZA 3C0EA 2YK2A 3A0WA 2BZ5A 4MOTA 3JZ3A 4GFNA 3HZ1A 2ZBKB 1US7A 5D7DA 4CWSA 4P7AA 2YEIA 3O2FA 2YGEA 1MU5A 4I5SA 2WI3A 2BYHA 4MBCA 1A4HA 2YE7A 2JKIA 3INWA 4L91A 4WUDA 3D2RA 2FXSA 2QFOA 2O1WA 5D6PA 3T0ZA 3C11A 2ESAA 3OWBA 5M4KA 1UYDA 1UYLA 1KZNA 4BIZA 4WUBA 2CCTA 4U7NA 4URNA 1I58A 4XDMA 5BODA 2YEAA 4YKZA 2YKEA 4PL9A 2VCJA 3LPSA 3GIFA 3B28A 3ZXQA 1UYIA 4MP2A 3U2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VWC A;  2YK9 A;  1ID0 A;  2XJX A;  4ASF A;  4EFU A;  4LWH A;  1TBW A;  1QZR A;  2O1V A;  3TTZ A;  2Q8F A;  4XKA A;  1BYQ A;  4AWP A;  2WI4 A;  4HYM A;  3U2D A;  4HXZ A;  4XD8 A;  1YC1 A;  4LPB A;  2WEP A;  4L94 A;  4HY6 A;  2YI7 A;  2XDU A;  4O07 A;  4YKQ A;  4L8Z A;  3CRL A;  4CWN A;  2YEE A;  3DGE A;  1Y4U A;  4FMT A;  3R91 A;  4BAE A;  2YI0 A;  1I5C A;  5J71 A;  3Q5K A;  3PEH A;  1YC3 A;  3ZXO A;  1B63 A;  3GIG A;  1TC0 A;  1S14 A;  1YER A;  4GT8 A;  4QPJ A;  1OSF A;  3GIG B;  3G7E A;  1Z59 A;  2XK2 A;  1Y4S A;  2YJX A;  4R3M A;  2HKJ A;  3HYY A;  3B27 A;  5L3J A;  2XHX A;  4YKT A;  4MPE A;  1BKN A;  1Y8P A;  4EM7 A;  3K60 A;  2WI7 A;  4X9L A;  5FWK A;  1BGQ A;  3EKO A;  4HY1 A;  1I5D A;  1UYF A;  3TZ2 A;  1GKZ A;  1EA6 A;  4CE1 A;  4WUC A;  2BT0 A;  2Q8I A;  4U7O A;  2BRE A;  4CWF A;  4XKK A;  3HZ5 A;  5CTU A;  4AWO A;  1H7S A;  2XAB A;  1L0O A;  5IN9 A;  3T0H A;  2XDL A;  4FCR A;  4FPP A;  4K4O A;  3WQ9 A;  3G75 A;  3VHC A;  3Q5J A;  1QYE A;  4V26 A;  3CGZ A;  3WHA A;  3RKZ A;  1S16 A;  4MP7 A;  1YSZ A;  2K5B A;  3O6O A;  4FCP A;  2IOR A;  4LP0 A;  4EFT A;  5M4M A;  3BMY A;  4HYP A;  1AMW A;  2FYP A;  2BSM A;  2IOP A;  3TZ4 A;  3KE6 A;  5M4N A;  4B6C A;  1YC4 A;  4ASG A;  2HCH A;  5CTX A;  1TH8 A;  1R62 A;  1UYH A;  2ZDX A;  4KFG A;  3Q5L A;  3A0T A;  3HEK A;  4R1F A;  3D0B A;  2CCU A;  4L93 A;  4I3H A;  3T2S A;  3R4P A;  2JJC A;  3MNR P;  3H80 A;  3BM9 A;  5J6A A;  1UY6 A;  4JQL A;  4LWG A;  4JAS A;  4URL A;  1ZWH A;  2IOQ A;  1UYC A;  1B62 A;  2YI5 A;  4NH9 A;  3K97 A;  4H81 A;  1YT0 A;  3R4M A;  3B25 A;  4PRX A;  1UYM A;  2XDX A;  1AM1 A;  4HZ0 A;  2YEH A;  4XCL A;  2YEG A;  2XCM A;  1U2O A;  1H7U A;  1KIJ A;  4XC0 A;  1GKX A;  5IDJ A;  4ZVI A;  1PVG A;  3QTF A;  5F5R A;  4BQG A;  2WI2 A;  3TZ5 A;  3H4L A;  4LWF A;  2YEJ A;  3EHG A;  3U67 A;  5FNC A;  1UYE A;  4EEH A;  4BXI A;  5M4P A;  4URM A;  4R3A A;  1Z5A A;  2BU7 A;  1Z5C A;  1UY8 A;  5CPH A;  3G7B A;  1TID A;  4E02 A;  5IDM A;  4XIQ A;  4KSG A;  4GCZ A;  5F3K A;  4MPC A;  2YGF A;  4L90 A;  2YE8 A;  3RLR A;  3VHA A;  3T1K A;  2BU6 A;  4GQT A;  2CGF A;  3CRK A;  2VW5 A;  2YGA A;  4ASA A;  4YKU A;  2XD6 A;  2XX5 A;  4B7P A;  3CGY A;  4BIU A;  1B3Q A;  1GJV A;  2ZKJ A;  3HYZ A;  1NHI A;  1EI1 A;  4YKR A;  3FV5 A;  2XDS A;  3O0I A;  4V25 A;  2WER A;  1YET A;  5CF0 A;  3RLQ A;  3ZKB A;  2YE9 A;  4XIT A;  1YSR A;  3EHH A;  2YEC A;  1YES A;  2C2A A;  2QF6 A;  3R4O A;  4ZKI A;  2IWU A;  4HZ5 A;  4YKX A;  2CH4 A;  2Q8H A;  4JAV A;  4DUH A;  2XJJ A;  1ZW9 A;  4XTJ A;  1THN A;  1U0Z A;  4XKO A;  2GQP A;  5D7R A;  4CWT A;  3ZM7 A;  2Q2E B;  1UYK A;  2YEB A;  4NH8 A;  3CWV A;  3VHD A;  2XJG A;  5FND A;  4CWQ A;  2XX4 A;  3TZ0 A;  4EGH A;  4KSH A;  4URO A;  1AJ6 A;  2GFD A;  2XX2 A;  2YKJ A;  1NHH A;  3T10 A;  3IED A;  2YE2 A;  5M4H A;  3A0Y A;  4O05 A;  2O1U A;  3OPD A;  2H55 A;  2IWS A;  1ZXM A;  2YE3 A;  3ZKD A;  2YEF A;  5BOC A;  1QY8 A;  4ASB A;  2UWD A;  4CWP A;  4EGI A;  4KP4 A;  4MPN A;  4YKW A;  4XIR A;  1Z5B A;  4QPK A;  2PNR A;  3D36 A;  4EMV A;  1Y8N A;  4O04 A;  1UY7 A;  4XE2 A;  2XHR A;  5GGZ A;  4EGK A;  4XIP A;  4PU9 A;  2BU5 A;  3A0X A;  4KQV A;  4O0B A;  2YJW A;  1MX0 A;  2YE5 A;  2CG9 A;  3LNU A;  2AKP A;  4NH7 A;  3PEJ A;  1BXD A;  3NMQ A;  4E01 A;  2XHT A;  4AWQ A;  5M4E A;  3A0Z A;  5CTW A;  4CE3 A;  3B24 A;  4LWE A;  1I5A A;  2QG0 A;  4CWR A;  2BU8 A;  2WI6 A;  4XCJ A;  2E0A A;  4PRV A;  3EKR A;  5FNF A;  3EHJ A;  4LWI A;  1TIL A;  2ZDY A;  1YS3 A;  3SL2 A;  4AS9 A;  1YT1 A;  3OW6 A;  4DZY A;  2QG2 A;  2BU2 A;  5D7C A;  3A0R A;  1UY9 A;  2CCS A;  2YI6 A;  4GEE A;  3B26 A;  4HXW A;  2EXL A;  3GIE A;  3OMU A;  4MB9 A;  1ZXN A;  2XDK A;  2YKC A;  3QDD A;  3FT8 A;  4GGL A;  5CTY A;  1AH8 A;  2WI1 A;  2YKI A;  3INX A;  1NHJ A;  1AH6 A;  3K99 A;  4O09 A;  2YE4 A;  5C93 A;  4P8O A;  2YED A;  3TUH A;  1TC6 A;  4W7T A;  2BYI A;  1JM6 A;  1Y8O A;  2BRC A;  3EHF A;  4FCQ A;  1I59 A;  4Q20 A;  2H8M A;  1I5B A;  2WEQ A;  1YT2 A;  2YE6 A;  3VAD A;  4CE2 A;  4CWO A;  4E00 A;  2YKB A;  3RLP A;  2WI5 A;  3FT5 A;  3R4N A;  4JAU A;  3K98 A;  5D6Q A;  2VCI A;  1UYG A;  3OWD A;  3R92 A;  2HG1 A;  4U93 A;  2BTZ A;  3HHU A;  4YKY A;  4KTN A;  4H85 A;  2IWX A;  4BQJ A;  4H7Q A;  2Q8G A;  2FWY A;  2FWZ A;  3C0E A;  2YK2 A;  3A0W A;  2BZ5 A;  4MOT A;  3JZ3 A;  4GFN A;  3HZ1 A;  2ZBK B;  1US7 A;  5D7D A;  4CWS A;  4P7A A;  2YEI A;  3O2F A;  2YGE A;  1MU5 A;  4I5S A;  2WI3 A;  2BYH A;  4MBC A;  1A4H A;  2YE7 A;  2JKI A;  3INW A;  4L91 A;  4WUD A;  3D2R A;  2FXS A;  2QFO A;  2O1W A;  5D6P A;  3T0Z A;  3C11 A;  2ESA A;  3OWB A;  5M4K A;  1UYD A;  1UYL A;  1KZN A;  4BIZ A;  4WUB A;  2CCT A;  4U7N A;  4URN A;  1I58 A;  4XDM A;  5BOD A;  2YEA A;  4YKZ A;  2YKE A;  4PL9 A;  2VCJ A;  3LPS A;  3GIF A;  3B28 A;  3ZXQ A;  1UYI A;  4MP2 A;  3U2K A; 
#chains in the Genus database with same CATH topology
 2VWC A;  2YK9 A;  1ID0 A;  2XJX A;  4ASF A;  4EFU A;  4LWH A;  1TBW A;  1QZR A;  2O1V A;  3TTZ A;  2Q8F A;  4XKA A;  1BYQ A;  4AWP A;  2WI4 A;  4HYM A;  3U2D A;  4HXZ A;  4XD8 A;  1YC1 A;  4LPB A;  2WEP A;  4L94 A;  4HY6 A;  2YI7 A;  5JEN A;  2XDU A;  4O07 A;  4YKQ A;  4L8Z A;  3CRL A;  4CWN A;  2YEE A;  3DGE A;  1Y4U A;  4FMT A;  3R91 A;  4BAE A;  2YI0 A;  1I5C A;  5J71 A;  3Q5K A;  3PEH A;  1YC3 A;  3ZXO A;  1B63 A;  3GIG A;  1TC0 A;  1S14 A;  1YER A;  4GT8 A;  4QPJ A;  1OSF A;  3GIG B;  3S5T A;  3G7E A;  1Z59 A;  2XK2 A;  1Y4S A;  2YJX A;  4R3M A;  2HKJ A;  3HYY A;  3B27 A;  5L3J A;  2XHX A;  4YKT A;  4MPE A;  1BKN A;  1Y8P A;  4EM7 A;  3K60 A;  2WI7 A;  4X9L A;  5FWK A;  1BGQ A;  3EKO A;  4HY1 A;  1I5D A;  1UYF A;  3TZ2 A;  1GKZ A;  1EA6 A;  4CE1 A;  4WUC A;  2BT0 A;  2Q8I A;  4U7O A;  2BRE A;  4CWF A;  4XKK A;  3HZ5 A;  5CTU A;  4AWO A;  1H7S A;  2XAB A;  1L0O A;  5IN9 A;  3T0H A;  2XDL A;  4FCR A;  4FPP A;  4K4O A;  3WQ9 A;  3G75 A;  3VHC A;  3Q5J A;  1QYE A;  4V26 A;  3CGZ A;  3WHA A;  3RKZ A;  1S16 A;  4MP7 A;  1YSZ A;  2K5B A;  3O6O A;  4FCP A;  2IOR A;  4LP0 A;  4EFT A;  5M4M A;  3BMY A;  4HYP A;  1AMW A;  2FYP A;  2BSM A;  2IOP A;  3TZ4 A;  3KE6 A;  5M4N A;  4B6C A;  1YC4 A;  4ASG A;  2HCH A;  5CTX A;  1TH8 A;  1R62 A;  1UYH A;  2ZDX A;  4KFG A;  3Q5L A;  3A0T A;  3HEK A;  4R1F A;  3D0B A;  2CCU A;  4L93 A;  4I3H A;  3T2S A;  3R4P A;  2JJC A;  3MNR P;  3H80 A;  3BM9 A;  5J6A A;  1UY6 A;  4JQL A;  4LWG A;  4JAS A;  4URL A;  1ZWH A;  2IOQ A;  1UYC A;  1B62 A;  2YI5 A;  4NH9 A;  3K97 A;  4H81 A;  1YT0 A;  3R4M A;  3B25 A;  4PRX A;  1F51 A;  1UYM A;  2XDX A;  1AM1 A;  4HZ0 A;  2YEH A;  4XCL A;  2YEG A;  2XCM A;  1U2O A;  1H7U A;  1KIJ A;  4XC0 A;  1GKX A;  5IDJ A;  4ZVI A;  1PVG A;  3QTF A;  5F5R A;  4BQG A;  2WI2 A;  3TZ5 A;  3H4L A;  4LWF A;  2YEJ A;  3EHG A;  3U67 A;  5FNC A;  1UYE A;  4EEH A;  4BXI A;  5M4P A;  4URM A;  4R3A A;  1Z5A A;  2BU7 A;  1Z5C A;  1UY8 A;  5CPH A;  3G7B A;  1TID A;  3CYG A;  4E02 A;  5IDM A;  4XIQ A;  4KSG A;  4GCZ A;  5F3K A;  4MPC A;  3LMM A;  2YGF A;  4L90 A;  2YE8 A;  3RLR A;  3VHA A;  3T1K A;  2BU6 A;  4GQT A;  2CGF A;  3CRK A;  2VW5 A;  2YGA A;  4ASA A;  4YKU A;  2XD6 A;  2XX5 A;  4B7P A;  3CGY A;  4BIU A;  1B3Q A;  1GJV A;  2ZKJ A;  3HYZ A;  1NHI A;  1EI1 A;  4YKR A;  3FV5 A;  1IXM A;  2XDS A;  3O0I A;  4V25 A;  2WER A;  1YET A;  5CF0 A;  3RLQ A;  3ZKB A;  2YE9 A;  4XIT A;  1YSR A;  3EHH A;  2YEC A;  1YES A;  2C2A A;  2QF6 A;  3R4O A;  4ZKI A;  2IWU A;  4HZ5 A;  4YKX A;  2CH4 A;  2Q8H A;  4JAV A;  4DUH A;  2XJJ A;  1ZW9 A;  4XTJ A;  1THN A;  1U0Z A;  4XKO A;  2GQP A;  5D7R A;  4CWT A;  3ZM7 A;  2Q2E B;  1UYK A;  2YEB A;  4NH8 A;  3CWV A;  3VHD A;  2XJG A;  5FND A;  4CWQ A;  2XX4 A;  3TZ0 A;  4EGH A;  4KSH A;  4URO A;  1AJ6 A;  2GFD A;  2XX2 A;  2YKJ A;  1NHH A;  3T10 A;  3IED A;  2YE2 A;  5M4H A;  3A0Y A;  4O05 A;  2O1U A;  3OPD A;  2H55 A;  2IWS A;  4E72 A;  1ZXM A;  2YE3 A;  3ZKD A;  2YEF A;  5BOC A;  1QY8 A;  4ASB A;  2UWD A;  4CWP A;  4EGI A;  4KP4 A;  4MPN A;  4YKW A;  4XIR A;  1Z5B A;  4QPK A;  2PNR A;  3D36 A;  4EMV A;  1Y8N A;  4O04 A;  1UY7 A;  4XE2 A;  2XHR A;  5GGZ A;  4EGK A;  4XIP A;  4PU9 A;  2BU5 A;  3A0X A;  2FTK A;  4KQV A;  4O0B A;  2YJW A;  1MX0 A;  2YE5 A;  2CG9 A;  3LNU A;  2AKP A;  4NH7 A;  3PEJ A;  1BXD A;  3NMQ A;  4E01 A;  2XHT A;  4AWQ A;  5M4E A;  3A0Z A;  5CTW A;  4CE3 A;  3B24 A;  4LWE A;  1I5A A;  2QG0 A;  4CWR A;  2C1G A;  2BU8 A;  2WI6 A;  4XCJ A;  2E0A A;  4PRV A;  3EKR A;  5FNF A;  3EHJ A;  4LWI A;  1TIL A;  2ZDY A;  1YS3 A;  3SL2 A;  4AS9 A;  1YT1 A;  3OW6 A;  4DZY A;  2QG2 A;  2BU2 A;  5D7C A;  3A0R A;  1UY9 A;  2CCS A;  2YI6 A;  4GEE A;  3B26 A;  4HXW A;  2EXL A;  3GIE A;  3OMU A;  4MB9 A;  1ZXN A;  2XDK A;  2YKC A;  3QDD A;  3FT8 A;  4GGL A;  5CTY A;  1AH8 A;  2WI1 A;  2YKI A;  3INX A;  1NHJ A;  1AH6 A;  2C1I A;  3K99 A;  4O09 A;  2YE4 A;  5C93 A;  4P8O A;  2YED A;  3TUH A;  1TC6 A;  4W7T A;  2BYI A;  1JM6 A;  1Y8O A;  2BRC A;  3EHF A;  4FCQ A;  1I59 A;  4Q20 A;  2H8M A;  1I5B A;  2WEQ A;  1YT2 A;  2YE6 A;  3VAD A;  4CE2 A;  4CWO A;  4E00 A;  2YKB A;  3RLP A;  2WI5 A;  3FT5 A;  3R4N A;  4JAU A;  3K98 A;  5D6Q A;  2VCI A;  1UYG A;  3OWD A;  3R92 A;  2HG1 A;  4U93 A;  2BTZ A;  3HHU A;  4YKY A;  4KTN A;  4H85 A;  2IWX A;  4BQJ A;  4H7Q A;  2Q8G A;  2FWY A;  2FWZ A;  3C0E A;  2YK2 A;  3A0W A;  2BZ5 A;  4MOT A;  3JZ3 A;  4GFN A;  3HZ1 A;  2ZBK B;  1US7 A;  5D7D A;  4CWS A;  4P7A A;  2YEI A;  3O2F A;  2YGE A;  1MU5 A;  4I5S A;  2WI3 A;  2BYH A;  4MBC A;  1A4H A;  2YE7 A;  2JKI A;  3INW A;  4L91 A;  4WUD A;  3D2R A;  2FXS A;  2QFO A;  2O1W A;  5D6P A;  3T0Z A;  3C11 A;  2ESA A;  3OWB A;  5M4K A;  1UYD A;  1UYL A;  1KZN A;  4BIZ A;  4WUB A;  2CCT A;  4U7N A;  4URN A;  1I58 A;  4XDM A;  5BOD A;  2YEA A;  4YKZ A;  2YKE A;  4PL9 A;  2VCJ A;  3LPS A;  3GIF A;  2HHI A;  3B28 A;  3ZXQ A;  1UYI A;  4MP2 A;  3U2K A; 
#chains in the Genus database with same CATH homology
 2VWC A;  2YK9 A;  1ID0 A;  2XJX A;  4ASF A;  4EFU A;  4LWH A;  1TBW A;  1QZR A;  2O1V A;  3TTZ A;  2Q8F A;  4XKA A;  1BYQ A;  4AWP A;  2WI4 A;  4HYM A;  3U2D A;  4HXZ A;  4XD8 A;  1YC1 A;  4LPB A;  2WEP A;  4L94 A;  4HY6 A;  2YI7 A;  2XDU A;  4O07 A;  4YKQ A;  4L8Z A;  3CRL A;  4CWN A;  2YEE A;  3DGE A;  1Y4U A;  4FMT A;  3R91 A;  4BAE A;  2YI0 A;  1I5C A;  5J71 A;  3Q5K A;  3PEH A;  1YC3 A;  3ZXO A;  1B63 A;  3GIG A;  1TC0 A;  1S14 A;  1YER A;  4GT8 A;  4QPJ A;  1OSF A;  3GIG B;  3G7E A;  1Z59 A;  2XK2 A;  1Y4S A;  2YJX A;  4R3M A;  2HKJ A;  3HYY A;  3B27 A;  5L3J A;  2XHX A;  4YKT A;  4MPE A;  1BKN A;  1Y8P A;  4EM7 A;  3K60 A;  2WI7 A;  4X9L A;  5FWK A;  1BGQ A;  3EKO A;  4HY1 A;  1I5D A;  1UYF A;  3TZ2 A;  1GKZ A;  1EA6 A;  4CE1 A;  4WUC A;  2BT0 A;  2Q8I A;  4U7O A;  2BRE A;  4CWF A;  4XKK A;  3HZ5 A;  5CTU A;  4AWO A;  1H7S A;  2XAB A;  1L0O A;  5IN9 A;  3T0H A;  2XDL A;  4FCR A;  4FPP A;  4K4O A;  3WQ9 A;  3G75 A;  3VHC A;  3Q5J A;  1QYE A;  4V26 A;  3CGZ A;  3WHA A;  3RKZ A;  1S16 A;  4MP7 A;  1YSZ A;  2K5B A;  3O6O A;  4FCP A;  2IOR A;  4LP0 A;  4EFT A;  5M4M A;  3BMY A;  4HYP A;  1AMW A;  2FYP A;  2BSM A;  2IOP A;  3TZ4 A;  3KE6 A;  5M4N A;  4B6C A;  1YC4 A;  4ASG A;  2HCH A;  5CTX A;  1TH8 A;  1R62 A;  1UYH A;  2ZDX A;  4KFG A;  3Q5L A;  3A0T A;  3HEK A;  4R1F A;  3D0B A;  2CCU A;  4L93 A;  4I3H A;  3T2S A;  3R4P A;  2JJC A;  3MNR P;  3H80 A;  3BM9 A;  5J6A A;  1UY6 A;  4JQL A;  4LWG A;  4JAS A;  4URL A;  1ZWH A;  2IOQ A;  1UYC A;  1B62 A;  2YI5 A;  4NH9 A;  3K97 A;  4H81 A;  1YT0 A;  3R4M A;  3B25 A;  4PRX A;  1UYM A;  2XDX A;  1AM1 A;  4HZ0 A;  2YEH A;  4XCL A;  2YEG A;  2XCM A;  1U2O A;  1H7U A;  1KIJ A;  4XC0 A;  1GKX A;  5IDJ A;  4ZVI A;  1PVG A;  3QTF A;  5F5R A;  4BQG A;  2WI2 A;  3TZ5 A;  3H4L A;  4LWF A;  2YEJ A;  3EHG A;  3U67 A;  5FNC A;  1UYE A;  4EEH A;  4BXI A;  5M4P A;  4URM A;  4R3A A;  1Z5A A;  2BU7 A;  1Z5C A;  1UY8 A;  5CPH A;  3G7B A;  1TID A;  4E02 A;  5IDM A;  4XIQ A;  4KSG A;  4GCZ A;  5F3K A;  4MPC A;  2YGF A;  4L90 A;  2YE8 A;  3RLR A;  3VHA A;  3T1K A;  2BU6 A;  4GQT A;  2CGF A;  3CRK A;  2VW5 A;  2YGA A;  4ASA A;  4YKU A;  2XD6 A;  2XX5 A;  4B7P A;  3CGY A;  4BIU A;  1B3Q A;  1GJV A;  2ZKJ A;  3HYZ A;  1NHI A;  1EI1 A;  4YKR A;  3FV5 A;  2XDS A;  3O0I A;  4V25 A;  2WER A;  1YET A;  5CF0 A;  3RLQ A;  3ZKB A;  2YE9 A;  4XIT A;  1YSR A;  3EHH A;  2YEC A;  1YES A;  2C2A A;  2QF6 A;  3R4O A;  4ZKI A;  2IWU A;  4HZ5 A;  4YKX A;  2CH4 A;  2Q8H A;  4JAV A;  4DUH A;  2XJJ A;  1ZW9 A;  4XTJ A;  1THN A;  1U0Z A;  4XKO A;  2GQP A;  5D7R A;  4CWT A;  3ZM7 A;  2Q2E B;  1UYK A;  2YEB A;  4NH8 A;  3CWV A;  3VHD A;  2XJG A;  5FND A;  4CWQ A;  2XX4 A;  3TZ0 A;  4EGH A;  4KSH A;  4URO A;  1AJ6 A;  2GFD A;  2XX2 A;  2YKJ A;  1NHH A;  3T10 A;  3IED A;  2YE2 A;  5M4H A;  3A0Y A;  4O05 A;  2O1U A;  3OPD A;  2H55 A;  2IWS A;  1ZXM A;  2YE3 A;  3ZKD A;  2YEF A;  5BOC A;  1QY8 A;  4ASB A;  2UWD A;  4CWP A;  4EGI A;  4KP4 A;  4MPN A;  4YKW A;  4XIR A;  1Z5B A;  4QPK A;  2PNR A;  3D36 A;  4EMV A;  1Y8N A;  4O04 A;  1UY7 A;  4XE2 A;  2XHR A;  5GGZ A;  4EGK A;  4XIP A;  4PU9 A;  2BU5 A;  3A0X A;  4KQV A;  4O0B A;  2YJW A;  1MX0 A;  2YE5 A;  2CG9 A;  3LNU A;  2AKP A;  4NH7 A;  3PEJ A;  1BXD A;  3NMQ A;  4E01 A;  2XHT A;  4AWQ A;  5M4E A;  3A0Z A;  5CTW A;  4CE3 A;  3B24 A;  4LWE A;  1I5A A;  2QG0 A;  4CWR A;  2BU8 A;  2WI6 A;  4XCJ A;  2E0A A;  4PRV A;  3EKR A;  5FNF A;  3EHJ A;  4LWI A;  1TIL A;  2ZDY A;  1YS3 A;  3SL2 A;  4AS9 A;  1YT1 A;  3OW6 A;  4DZY A;  2QG2 A;  2BU2 A;  5D7C A;  3A0R A;  1UY9 A;  2CCS A;  2YI6 A;  4GEE A;  3B26 A;  4HXW A;  2EXL A;  3GIE A;  3OMU A;  4MB9 A;  1ZXN A;  2XDK A;  2YKC A;  3QDD A;  3FT8 A;  4GGL A;  5CTY A;  1AH8 A;  2WI1 A;  2YKI A;  3INX A;  1NHJ A;  1AH6 A;  3K99 A;  4O09 A;  2YE4 A;  5C93 A;  4P8O A;  2YED A;  3TUH A;  1TC6 A;  4W7T A;  2BYI A;  1JM6 A;  1Y8O A;  2BRC A;  3EHF A;  4FCQ A;  1I59 A;  4Q20 A;  2H8M A;  1I5B A;  2WEQ A;  1YT2 A;  2YE6 A;  3VAD A;  4CE2 A;  4CWO A;  4E00 A;  2YKB A;  3RLP A;  2WI5 A;  3FT5 A;  3R4N A;  4JAU A;  3K98 A;  5D6Q A;  2VCI A;  1UYG A;  3OWD A;  3R92 A;  2HG1 A;  4U93 A;  2BTZ A;  3HHU A;  4YKY A;  4KTN A;  4H85 A;  2IWX A;  4BQJ A;  4H7Q A;  2Q8G A;  2FWY A;  2FWZ A;  3C0E A;  2YK2 A;  3A0W A;  2BZ5 A;  4MOT A;  3JZ3 A;  4GFN A;  3HZ1 A;  2ZBK B;  1US7 A;  5D7D A;  4CWS A;  4P7A A;  2YEI A;  3O2F A;  2YGE A;  1MU5 A;  4I5S A;  2WI3 A;  2BYH A;  4MBC A;  1A4H A;  2YE7 A;  2JKI A;  3INW A;  4L91 A;  4WUD A;  3D2R A;  2FXS A;  2QFO A;  2O1W A;  5D6P A;  3T0Z A;  3C11 A;  2ESA A;  3OWB A;  5M4K A;  1UYD A;  1UYL A;  1KZN A;  4BIZ A;  4WUB A;  2CCT A;  4U7N A;  4URN A;  1I58 A;  4XDM A;  5BOD A;  2YEA A;  4YKZ A;  2YKE A;  4PL9 A;  2VCJ A;  3LPS A;  3GIF A;  3B28 A;  3ZXQ A;  1UYI A;  4MP2 A;  3U2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...