4PRXA

E. coli gyrb 43-kda n-terminal fragment in complex with adp+pi
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
374
structure length
363
Chain Sequence
SYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEGGIKAFVEYLNKNKTPIHPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKIID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GyrB
publication title Structure of the N-Terminal Gyrase B Fragment in Complex with ADPPi Reveals Rigid-Body Motion Induced by ATP Hydrolysis
pubmed doi rcsb
source organism Escherichia coli
total genus 108
structure length 363
sequence length 374
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4prxA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4prxA01
3T1HI 4LF7I 2V8PA 4DV3E 1THNA 3OPDA 1ZXMA 5FLXC 2XDSA 4MPCA 1WUUA 1MU5A 1IBKE 1IBME 1MG7A 2IORA 4LF8I 1I58A 4O04A 4CWRA 3M6AA 2YE2A 4AS9A 2XHTA 1UYHA 4O09A 4DV6E 3T1YI 2GFDA 2VW5A 1N32I 4O05A 1UYLA 5LMUI 4EMDA 2UUBE 2YK2A 2A2CA 3SL2A 4HY1A 4KTNA 3TZ5A 3Q5JA 2V2ZA 2IWUA 1I5BA 3EHGA 3GIFA 3TZ2A 4ASFA 4FPPA 5F3KA 4DR7E 5M4EA 4WUDA 2XDUA 2YKIA 5CTYA 1QYEA 4AWPA 4JI1I 2YJWA 1HNZI 2VQEE 4JI6I 2WI4A 4PRVA 2YEDA 1S14A 2YKEA 3OWBA 4MBCA 4DV1I 4JI7I 3B28A 2YE3A 1S16A 1Z0GA 2Q2EB 1TC6A 2XX2A 2VCJA 4XDMA 4JI0I 4B3ME 3A0RA 3WU3A 4DR1E 1YSRA 4DXLA 2JJCA 4HY6A 1Y8OA 4XC0A 4E02A 1I59A 3CWVA 2UXDE 3HZ5A 4ASAA 4EFUA 1YS3A 1UYKA 2FXSA 4B3TE 4YY3I 4MB9A 3IEDA 4DR6E 2YI6A 2H8MA 1FI4A 1Y8PA 5IDMA 3QTFA 4UTGA 4PL9A 2QFOA 4P7AA 4P8OA 3NMQA 2BT0A 3HHUA 4X65E 1HR0E 4L94A 4LWGA 4NH8A 3D4JA 5CPHA 4DV2I 1NHIA 2YGEA 2UXBI 4X64E 3CGZA 3K60A 4LFCI 4USMA 1YESA 4LF9E 4FCRA 5FNFA 3GONA 3R91A 4YY3E 3K1JA 4XTJA 4JI4I 1S4EA 5CTWA 2YI7A 4NH7A 1KIJA 1N33I 4JI5E 4I5SA 2VQFE 4X66I 4QPJA 4DR4I 4U93A 4XD8A 3JAMQ 3HZ1A 4NH9A 2E5LE 4LF4I 4H7QA 3JZ3A 1ZM9A 4BAEA 4YHHE 2UXBE 1FKAE 4HXZA 5BR8E 4DV4E 1ID0A 3Q5LA 5C93A 4DV7E 3GIGB 4YKYA 2AJ4A 2V34A 2HKJA 4OX9I 3OW6A 1FJGI 4MP7A 1Z5AA 2EXLA 4JV5I 3A0ZA 4CWNA 1UY6A 2O1WA 4URLA 1YT1A 2J7KA 3LTOA 4JYAE 4FMTA 4KP4A 1I5DA 4JI3E 4ASGA 4LFAI 4KHPE 1UY9A 4NXNE 4V26A 3T0ZA 1OJ4A 2CCTA 2HK3A 2F4VE 2AKPA 3GIEA 5FNDA 5GMEA 4DUYI 4DR3I 4XKKA 1NHHA 2ZDXA 2CG9A 2DEJA 1UYDA 3WQ9A 4EGHA 4LWHA 2CH4A 4R3AA 4LF5I 2IWXA 4YKTA 1YERA 2XDXA 1UY7A 4B3RI 1BGQA 4Q20A 1XMOE 4GKJI 2UXCE 2YEFA 2GS8A 5FNCA 4O07A 3CGYA 3ZXOA 4JI8I 1IBLE 2Q8HA 1N36I 4L8ZA 3C11A 4Z7YA 1ZW9A 1R62A 3Q1QA 4NXME 2XDKA 4X62E 1XNQE 4DPTA 2YK9A 3PEHA 5A2QQ 5CTXA 3ZZ0A 1AH8A 3CRLA 4XIRA 4JAVA 3DGEA 4B3SI 2YEBA 5M4NA 5D7DA 2UU9E 1GKZA 4HZ0A 3B78A 1TIDA 4DR5I 1I5AA 3INXA 1XHKA 2FYPA 1XNRE 1Z0BA 5LMNE 4DUZI 5CTUA 2CZ9A 3ZKDA 1ZWHA 2PNRA 3RLQA 2OI2A 1U2OA 4DR2I 4DV5E 3TTZA 4LF8E 5GGZA 1TILA 2YGAA 3T1HE 3ZXQA 3J80C 4LF7E 4H81A 3GIGA 4DPUA 3HYYA 1K47A 4L91A 1AMWA 2K5BA 1B62A 2UUAI 4EM7A 3OMUA 3R4PA 4M1KA 1N34I 1U0ZA 3PYEA 2BU6A 4CWFA 2YEIA 4GQTA 1OSFA 2H55A 3T1YE 1MX0A 1EI1A 2WERA 4DR2E 1KZNA 4JG4A 1N32E 3D36A 3G75A 1I94I 4U7OA 5LMUE 3B25A 2XJGA 2BM0A 2UUCI 2HKEA 4QPKA 2WI2A 4XKAA 3BMYA 5J71A 3LPSA 3FV5A 1KTVA 3A0WA 1Z0WA 3FT5A 4JI1E 2BU8A 2YE8A 2CCUA 1HNZE 3U2KA 4JI6E 3J7AG 2QG2A 3R4OA 2ZM6I 4DV0I 4DV1E 4YKRA 4JI7E 4MYUA 4WUBA 2FWYA 2Q8FA 1YC3A 4GT8A 4JI2I 4ZVIA 4HYPA 4JI0E 3VHDA 4JQLA 4JAUA 4CWQA 4CE2A 1VISA 2XEXA 1HNWI 1ZM4A 3VADA 4MYTA 5M4MA 4U7NA 5IN9A 2E0AA 2VWCA 5IWAI 1Z5CA 2BU7A 2ZBKB 2JKIA 4KSGA 4GCZA 3ZM7A 3FT8A 4CWSA 1PIEA 1ZXNA 4LFBI 2R3VA 1KKHA 3G7BA 4EEHA 4JI2E 3OTOI 4GKKI 4MPNA 1FNMA 5BODA 1J5EI 2YE4A 3V2UC 4DV2E 5D7RA 4USKA 3LNUA 4LFCE 4LF6I 4BQGA 1UYMA 2V2VA 4YKXA 2YEEA 4UROA 2XJJA 4JI4E 1N33E 4X66E 4GFNA 1QZRA 4DR4E 3Q5KA 1TH8A 2YI0A 4CWTA 5FLXQ 3EKRA 1N0UA 4LF4E 3EKOA 2XDLA 4FCPA 4AWQA 1J5EE 3RLRA 2BTZA 4EGKA 4XCJA 2DEIA 1YT2A 2BU5A 4V25A 2YKCA 3INWA 4DUHA 2V2QA 4K0KI 1Y4UA 4W7TA 5M4HA 3QDDA 4GEEA 4XIPA 4OX9E 4XITA 4DPXA 3B27A 4R3MA 3VHCA 1FJGE 2XK2A 3MNRP 2HHHI 2YEJA 4JV5E 3B8HA 2BSMA 4O0BA 4AWOA 3RLPA 1DARA 1D6TA 4HZ5A 5D6PA 4EFTA 3J81C 5L3JA 3B26A 4KFGA 1TBWA 2QG0A 4E00A 2XCMA 4BIZA 4LFAE 3BM9A 4MPEA 2WI3A 5IDJA 1ZM3A 2YGFA 4DUYE 3D2RA 4PRXA 4FN5A 4DR3E 2ESAA 3PEJA 1XMQI 4BXIA 3HULA 4HACA 3RKZA 1GKXA 2BREA 4RPFA 4LF5E 3QT6A 4PU9A 4B3RE 3ZZTA 4DV3I 4GGLA 4GKJE 3R4MA 2WI1A 3EHFA 1IBKI 1IBMI 4JI8E 1U2RA 1Z0EA 1N36E 1YETA 2YEGA 5BOCA 4B7PA 5FWKA 4UT4A 1FWLA 1RREA 5LL6R 5D7CA 2WW4A 4HYMA 4DPWA 3H4LA 2EFGA 4DV6I 3K98A 4WUCA 4DPYA 2HCHA 4XE2A 2UUBI 4B3SE 1UEKA 3O2FA 4H85A 2O1UA 2HK2A 3CRKA 2YI5A 4DR5E 4B6CA 3QT5A 4BQJA 4DR7I 5M4KA 3OWDA 1H7UA 2WI7A 4EGIA 2HFSA 4DUZE 3T10A 1ELOA 3K97A 2BZ5A 3WU5A 2BV3A 2VQEI 4AQYI 5D6QA 3K99A 4YKWA 4E01A 2UWDA 1YT0A 2YE5A 2E1RA 2BRCA 2YE7A 4P52A 3KE6A 3R4NA 4DZYA 1Z0CA 5CF0A 4HXWA 4B3MI 1UYFA 2BU2A 1A4HA 2BYIA 4CE1A 2HG1A 2UUAE 2YEAA 3EHHA 4DR1I 3A0XA 2XJXA 2WI6A 1H7SA 4Z7CA 4L93A 1N34E 4KSHA 1Y8NA 2IOQA 2UXDI 1JM6A 4B3TI 2XD6A 4AQYE 1AH6A 4DR6I 1I94E 2C2AA 4CWPA 3V5RA 4L90A 5IT9C 1TC0A 3HYZA 2UUCE 1UYCA 4XKOA 3U67A 1BYQA 2YECA 2YEHA 4FCQA 5A2QC 3B24A 4MOTA 4X65I 1HR0I 4EMVA 3ZZUA 4HACB 2LJPA 1GJVA 2BYHA 2XABA 4X64I 4LP0A 3ZKBA 1UYEA 4FWHA 4LPBA 4KQVA 4LF9I 1HNXI 3C0EA 1Z59A 4FWDA 2ZM6E 2A2DA 4DV0E 2CGFA 3H80A 1US7A 2WI5A 2ZITA 4JI5I 4R1FA 3J81Q 2VQFI 2O1VA 3G7EA 4YKUA 3R92A 1NZ0A 2E5LI 2YJXA 1FWKA 1H74A 4YHHI 1HNWE 1BXDA 2VF3A 4DV4I 1H73A 5BR8I 4XIQA 4DV7I 1HNXE 2Q8IA 5IWAE 2YE9A 1UYGA 5GMDA 4ASBA 4URNA 4LFBE 3TUHA 3WU6A 2XHRA 3OTOE 4GKKE 3EHJA 1YSZA 1Z0TA 2IOPA 4LWEA 3K17A 4JYAI 3B82A 4JI3I 4KHPI 2ZDYA 4LF6E 2X36A 4NXNI 2VCIA 4DU8A 3T1KA 2GQPA 3QT8A 4FW9A 1QY8A 2F4VI 2YKJA 3TZ4A 4FWGA 3J80Q 1UY8A 2ZKJA 1BKNA 3WHAA 3WU4A 1YC1A 1ZM2A 2R42A 1AJ6A 2Q8GA 2NPFA 1A6FA 1H72C 1KVKA 1Y4SA 4YKZA 2YKBA 1Z0VA 4JASA 3U2DA 1N0VC 2CCSA 3T0HA 1XMOI 3O0IA 4CE3A 2FWZA 2UXCI 1YC4A 3F0NA 1B3QA 4K0KE 5J6AA 2X7IA 1RR9A 1NHJA 1IBLI 1B63A 3PYGA 4NXMI 2HHHE 4CWOA 1AM1A 4X62I 1XNQI 3PYFA 3A0YA 4K4OA 4XCLA 5M4PA 2HFUA 2XX4A 4X9LA 2XHXA 4MP2A 2BM1A 3PYDA 2WEQA 1L0OA 2UU9I 2WEPA 4I3HA 4YKQA 3JAMC 2YE6A 4LWFA 1Z5BA 5F5RA 3J7AM 1UYIA 3VHAA 4ZKIA 2IWSA 1EA6A 2XX5A 3A0TA 3HEKA 4BIUA 1XNRI 1PKPA 5LMNI 3O6OA 4URMA 5IT9Q 2QF6A 1XMQE 3TZ0A 3T2SA 1I5CA 3D0BA 4DV5I 1PVGA 4LWIA 4DU7A 3QT7A 4ED4A
chains in the Genus database with same CATH superfamily
4IS9A 3T1HI 4LF7I 2V8PA 4DV3E 1THNA 3OPDA 1ZXMA 5FLXC 2XDSA 4MPCA 1WUUA 1MU5A 2PO1A 1IBKE 1IBME 1MG7A 2IORA 4LP0A 4LF8I 1I58A 4O04A 2JEAB 4CWRA 3M6AA 2YE2A 4AS9A 3GCMA 1OYRA 2XHTA 2C37A 1UYHA 4O09A 2PNZB 4DV6E 3T1YI 2GFDA 2VW5A 1N32I 2PO2A 4O05A 1UYLA 5LMUI 2NN6F 4MU4A 4EMDA 3NZKA 2A2CA 1YH8A 4HY1A 2UUBE 2YK2A 3Q5JA 4KTNA 3SL2A 3TZ5A 2V2ZA 2IWUA 1I5BA 3EHGA 3GIFA 3TZ2A 4ASFA 4FPPA 5F3KA 4DR7E 5ELWA 5M4EA 4WUDA 4OO1D 2XDUA 2YKIA 5CTYA 1QYEA 4AWPA 4JI1I 2YJWA 1IXMA 2BA0D 1HNZI 2VQEE 4JI6I 2WI4A 4PRVA 2YEDA 1S14A 2YKEA 3OWBA 4MBCA 4DV1I 5C0XF 4JI7I 2GO3A 3B28A 2YE3A 1S16A 1Z0GA 2Q2EB 1TC6A 2XX2A 2VCJA 4XDMA 1UDQA 4JI0I 4B3ME 3A0RA 2IESA 2VESA 3WU3A 4DR1E 1YSRA 4DXLA 2C39B 4IFDD 2JJCA 4HY6A 1Y8OA 4XC0A 4E02A 2Z5BA 1I59A 3CWVA 2UXDE 3HZ5A 4ASAA 4EFUA 1YS3A 1UYKA 2FXSA 4B3TE 4YY3I 4MB9A 1R6MA 3IEDA 4DR6E 2YI6A 2H8MA 1FI4A 4GQUA 5JEAF 1Y8PA 1Y5YA 5IDMA 3QTFA 2JEBB 4UTGA 4PL9A 2QFOA 4P7AA 4P8OA 3NMQA 2BT0A 2NN6E 3HHUA 4FW6A 4X65E 1HR0E 4L94A 4LWGA 4NH8A 3D4JA 5CPHA 4OO1A 1NHIA 4DV2I 4BA2A 2YGEA 2UXBI 4X64E 3CGZA 3K60A 3UHMA 4LFCI 4USMA 1YESA 4LF9E 4FCRA 5FNFA 3GONA 3R91A 4MU3A 4YY3E 3K1JA 4XTJA 3DD6A 1S4EA 4JI4I 5CTWA 2YI7A 4NH7A 1KIJA 1N33I 4JI5E 4I5SA 2VQFE 4X66I 2PO1B 3P3GA 4OO1C 4QPJA 4DR4I 4U93A 4XD8A 3JAMQ 3HZ1A 2Z5EA 4NH9A 2E5LE 3M7NG 4LF4I 2C37B 3GMEA 4IFDA 4H7QA 2PNZA 3JZ3A 1ZM9A 4BAEA 2PO2B 4YHHE 2UXBE 1FKAE 4HXZA 5BR8E 4DV4E 1ID0A 3Q5LA 5C93A 4DV7E 3GIGB 4YKYA 2AJ4A 2V34A 3P3EA 2HKJA 4OX9I 5K36F 3OW6A 4IFDC 1FJGI 4MP7A 1Z5AA 4LCGA 2EXLA 4JV5I 3A0ZA 4FW7A 3GLLA 4CWNA 1UY6A 2O1WA 4URLA 1YT1A 2J7KA 3LTOA 4JYAE 4FMTA 4KP4A 2BA1G 3LMMA 1I5DA 5JENA 4JI3E 4ASGA 4LFAI 4KHPE 1UY9A 4NXNE 4V26A 3T0ZA 1OJ4A 2CCTA 3PS3A 2HK3A 2F4VE 2AKPA 4LPFA 3GIEA 5FNDA 5GMEA 4DUYI 4DR3I 4XKKA 1NHHA 2ZDXA 4E72A 2CG9A 4IZJD 2DEJA 1UYDA 2Z5BB 3WQ9A 4EGHA 4LWHA 3P06A 2CH4A 4R3AA 4LF5I 2BR2A 2IWXA 4YKTA 1YERA 2XDXA 1UY7A 4B3RI 1BGQA 2J65A 1XMOE 4Q20A 4GKJI 2UXCE 2YEFA 2GS8A 5FNCA 4O07A 3CGYA 3ZXOA 3CDIA 4JI8I 1IBLE 1N36I 4L8ZA 3C11A 2Q8HA 4Z7YA 1ZW9A 1R62A 3Q1QA 4NXME 4OO1B 2XDKA 4X62E 1XNQE 4DPTA 4BA2B 2YK9A 3PEHA 5A2QQ 5CTXA 3ZZ0A 1AH8A 3CRLA 4XIRA 4JAVA 3DGEA 4B3SI 2YEBA 5M4NA 5D7DA 2UU9E 1GKZA 4HZ0A 3B78A 1TIDA 4DR5I 1I5AA 3M85G 3INXA 2C1GA 1XHKA 2FYPA 1XNRE 1Z0BA 5LMNE 4DUZI 5CTUA 2CZ9A 3ZKDA 4IFDB 1ZWHA 4IZJA 2PNRA 2OI2A 3RLQA 1U2OA 4DR2I 4DV5E 5DRQA 3TTZA 4LF8E 3HKMA 5GGZA 1TILA 2YGAA 2WNRA 3T1HE 3ZXQA 3J80C 4LF7E 4H81A 3GIGA 4DPUA 3HYYA 1K47A 4L91A 1AMWA 2K5BA 1B62A 4QNJA 3KRNA 2UUAI 4MQYA 4EM7A 4OO1E 3OMUA 3R4PA 2JT2A 4M1KA 1N34I 1U0ZA 3PYEA 2BU6A 4CWFA 2YEIA 1E3HA 4GQTA 1OSFA 2H55A 3T1YE 1MX0A 1EI1A 2WERA 4DR2E 1KZNA 4JG4A 1N32E 3D36A 3G75A 1I94I 4U7OA 5LMUE 4MDTA 3B25A 2XJGA 2BM0A 2UUCI 2HKEA 4QPKA 1E3PA 2WI2A 4XKAA 3BMYA 5J71A 3LPSA 4IFDE 3FV5A 3B4TA 1KTVA 3A0WA 1Z0WA 2BA0G 3CDJA 4OZEA 2PO0A 1F51A 2CGEA 3FT5A 2BR2B 4JI1E 2BU8A 1USVA 2CCUA 2YE8A 1HNZE 3U2KA 4JI6E 3J7AG 1USUA 2QG2A 3R4OA 3U1YA 4AM3A 2ZM6I 4DV0I 4DV1E 4YKRA 5K36A 4JI7E 4MYUA 4WUBA 2FWYA 2Q8FA 1YC3A 4GT8A 4JI2I 4ZVIA 4HYPA 4JI0E 3VHDA 4JQLA 4U3DA 4JAUA 4CWQA 4CE2A 4N3OA 1VISA 2PNLA 4QNKA 2XEXA 1Y6ZA 1HNWI 1UDOA 1ZM4A 2GO4A 3VADA 4MYTA 3U1KA 5M4MA 4U7NA 5IN9A 2E0AA 2VWCA 5IWAI 1Z5CA 2BU7A 2ZBKB 2FTKA 2JKIA 4KSGA 4GCZA 3ZM7A 3FT8A 4CWSA 1PIEA 1ZXNA 4LFBI 2R3VA 1KKHA 3G7BA 4U3BA 4JI2E 4EEHA 3OTOI 4GKKI 4MPNA 1FNMA 4BA1A 4IZJB 3P3CA 1J5EI 2YE4A 5BODA 3V2UC 3Q6MA 4DV2E 5D7RA 4USKA 3LNUA 2WNRB 4LFCE 4LF6I 4BQGA 1UYMA 2V2VA 4YKXA 2YEEA 4UROA 3PS2A 4MU0A 2XJJA 4JI4E 1N33E 4X66E 4GFNA 3VHCA 1QZRA 4DR4E 3Q5KA 1TH8A 2YI0A 1YHCA 4CWTA 5FLXQ 3EKRA 1N0UA 4LF4E 3EKOA 2XDLA 4FCPA 4AWQA 1J5EE 3RLRA 2BTZA 4EGKA 4XCJA 2DEIA 1YT2A 2BU5A 4V25A 2YKCA 3INWA 4DUHA 1Y4UA 2V2QA 4K0KI 4W7TA 2BA1D 5M4HA 3QDDA 4GEEA 4XIPA 2O1TA 4OX9E 4DPXA 3B27A 4R3MA 4XITA 1FJGE 2AE8A 2XK2A 2HHHI 2YEJA 3MNRP 4JV5E 3B8HA 2BSMA 4O0BA 4AWOA 3RLPA 1DARA 2PO0B 1D6TA 3CYGA 4HZ5A 5D6PA 4EFTA 2NN6A 5JEAD 3J81C 5L3JA 3B26A 4KFGA 4OO1F 1TBWA 2QG0A 4E00A 2XCMA 4BIZA 4LFAE 5K36B 3BM9A 4FW3A 1P42A 4MPEA 2WI3A 5IDJA 1ZM3A 2YGFA 4DUYE 3D2RA 4PRXA 4FN5A 4DR3E 2ESAA 3PEJA 1XMQI 4BXIA 3HULA 4HACA 3RKZA 5DRPA 1GKXA 5C0XA 2O3ZA 2BREA 4RPFA 4LF5E 3QT6A 4PU9A 4IFDF 4B3RE 3ZZTA 4DV3I 4GGLA 4GKJE 3R4MA 5EL9A 2WI1A 3EHFA 1IBKI 1IBMI 4JI8E 1Z0EA 1U2RA 5FWKA 1N36E 1YETA 2YEGA 5BOCA 4B7PA 5DROA 1FWLA 4BA1B 4UT4A 1RREA 3Q6NA 5LL6R 5D7CA 2WW4A 4HYMA 2GQ0A 4DPWA 2CVEA 1OYSA 5EKWA 3H4LA 2EFGA 4DV6I 3K98A 4WUCA 2IERA 4DPYA 5K36D 2HCHA 5JEAA 4XE2A 3H1CA 2UUBI 4B3SE 1UEKA 3O2FA 4H85A 2O1UA 2HK2A 4OKGA 3CRKA 3PS1A 2YI5A 4DR5E 4B6CA 3QT5A 4BQJA 4DR7I 1HK7A 5M4KA 3OWDA 1H7UA 2WI7A 4LOMA 5JEAC 4EGIA 2HFSA 4J3DA 4DUZE 3T10A 1ELOA 3K97A 2BZ5A 4IZKA 3WU5A 2BV3A 2VQEI 4AQYI 5D6QA 3K99A 4YKWA 4E01A 2UWDA 2F1DA 4FW4A 1YT0A 2YE5A 2E1RA 2BRCA 2YE7A 4P52A 3KE6A 3R4NA 4DZYA 1Z0CA 5CF0A 4HXWA 4B3MI 1UYFA 2BU2A 1A4HA 2BYIA 4CE1A 2HG1A 2UUAE 2YEAA 3EHHA 4DR1I 4AIDA 3A0XA 1XXEA 2XJXA 2WI6A 1H7SA 4Z7CA 4L93A 1N34E 4ISAA 2NN6B 2IOQA 1Y8NA 2UXDI 4KSHA 1JM6A 3P76A 2JE6A 3HJCA 4B3TI 2XD6A 4AQYE 1AH6A 4DR6I 1I94E 2C2AA 4CWPA 3V5RA 4L90A 5IT9C 1TC0A 3HYZA 2UUCE 1UYCA 4XKOA 3U67A 5DRRA 1BYQA 2YECA 2YEHA 4FCQA 1OYPA 5A2QC 3B24A 4MOTA 4X65I 5DNLA 1HR0I 4EMVA 3ZZUA 4HACB 2LJPA 5K36C 1GJVA 5C0XB 2Z5CA 4X64I 2BYHA 3ZKBA 3L7ZA 4FWHA 1UYEA 2XABA 4KQVA 4LPBA 4LF9I 1HNXI 3C0EA 1Z59A 4FWDA 2ZM6E 2A2DA 4DV0E 2CGFA 3H80A 1US7A 2WI5A 2ZITA 4JI5I 4R1FA 3J81Q 2VQFI 2O1VA 3G7EA 4YKUA 3R92A 2C38A 1NZ0A 2NN6D 2E5LI 2YJXA 4LCHA 1FWKA 4LCFA 1H74A 4YHHI 3M7ND 5JEAB 4NBQA 1HNWE 2WP8A 1BXDA 2VF3A 4DV4I 1H73A 5BR8I 4XIQA 4DV7I 1HNXE 1RHYA 4AIMA 2Q8IA 5IWAE 2YE9A 1UYGA 5GMDA 4ASBA 4URNA 4LFBE 1Y60A 3S5TA 3WU6A 3TUHA 2XHRA 3OTOE 4GKKE 2JEAA 3EHJA 5C0XD 5C0XE 1YSZA 2HHIA 4IZKB 1Z0TA 2IOPA 4LWEA 3K17A 4JYAI 3B82A 4JI3I 4KHPI 2ZDYA 4LF6E 2X36A 4NXNI 2VCIA 4DU8A 3T1KA 2GQPA 3QT8A 4FW9A 1QY8A 2F4VI 2YKJA 3TZ4A 4FWGA 3J80Q 1UY8A 2ZKJA 1BKNA 3WHAA 3WU4A 1UDNA 1YC1A 1ZM2A 4MU1A 2R42A 1AJ6A 2Q8GA 1R6LA 2NPFA 1A6FA 1H72C 1KVKA 2JE6B 5JEAE 1Y4SA 4YKZA 2YKBA 1Z0VA 4JASA 3U2DA 3PRYA 1N0VC 2CCSA 3T0HA 1XMOI 3O0IA 4CE3A 2FWZA 2C1IA 2UXCI 1YC4A 3F0NA 1B3QA 4K0KE 5J6AA 2X7IA 1RR9A 1NHJA 1VI7A 1IBLI 2NN6C 2PNMA 1B63A 1UDSA 3PYGA 4NXMI 2HHHE 4CWOA 1AM1A 4X62I 1XNQI 3PYFA 3A0YA 4K4OA 4XCLA 5M4PA 2HFUA 2Z5CB 2C39A 2XX4A 3L7ZB 4X9LA 2XHXA 4MP2A 2BM1A 3K85A 3PYDA 2WEQA 1L0OA 2UU9I 2WEPA 4I3HA 4YKQA 3JAMC 2YE6A 4LWFA 1Z5BA 5F5RA 3J7AM 1UYIA 3VHAA 4ZKIA 2IWSA 1EA6A 2XX5A 3A0TA 5C0XC 2JEBA 3HEKA 2C38B 4BIUA 3M85D 1XNRI 1PKPA 5LMNI 4FW5A 3O6OA 4URMA 5IT9Q 2QF6A 1XMQE 3TZ0A 3T2SA 1I5CA 3D0BA 5DNXA 4DV5I 1PVGA 2WP8B 5K36E 4LWIA 4DU7A 3QT7A 4ED4A
chains in the Genus database with same CATH topology
3T1HI 4LF7I 2V8PA 4DV3E 1THNA 3OPDA 1ZXMA 5FLXC 2XDSA 4MPCA 1WUUA 1MU5A 1IBKE 1IBME 1MG7A 2IORA 4LF8I 1I58A 4O04A 4CWRA 3M6AA 2YE2A 4AS9A 2XHTA 1UYHA 4O09A 4DV6E 3T1YI 2GFDA 2VW5A 1N32I 4O05A 1UYLA 5LMUI 4EMDA 2UUBE 2YK2A 2A2CA 3SL2A 4HY1A 4KTNA 3TZ5A 3Q5JA 2V2ZA 2IWUA 1I5BA 3EHGA 3GIFA 3TZ2A 4ASFA 4FPPA 5F3KA 4DR7E 5M4EA 4WUDA 2XDUA 2YKIA 5CTYA 1QYEA 4AWPA 4JI1I 2YJWA 1HNZI 2VQEE 4JI6I 2WI4A 4PRVA 2YEDA 1S14A 2YKEA 3OWBA 4MBCA 4DV1I 4JI7I 3B28A 2YE3A 1S16A 1Z0GA 2Q2EB 1TC6A 2XX2A 2VCJA 4XDMA 4JI0I 4B3ME 3A0RA 3WU3A 4DR1E 1YSRA 4DXLA 2JJCA 4HY6A 1Y8OA 4XC0A 4E02A 2Z5BA 1I59A 3CWVA 2UXDE 3HZ5A 4ASAA 4EFUA 1YS3A 1UYKA 2FXSA 4B3TE 4YY3I 4MB9A 3IEDA 4DR6E 2YI6A 2H8MA 1FI4A 1Y8PA 5IDMA 3QTFA 4UTGA 4PL9A 2QFOA 4P7AA 4P8OA 3NMQA 2BT0A 3HHUA 4X65E 1HR0E 4L94A 4LWGA 4NH8A 3D4JA 5CPHA 4DV2I 1NHIA 2YGEA 2UXBI 4X64E 3CGZA 3K60A 4LFCI 4USMA 1YESA 4LF9E 4FCRA 5FNFA 3GONA 3R91A 4YY3E 3K1JA 4XTJA 4JI4I 1S4EA 5CTWA 2YI7A 4NH7A 1KIJA 1N33I 4JI5E 4I5SA 2VQFE 4X66I 4QPJA 4DR4I 4U93A 4XD8A 3JAMQ 3HZ1A 2Z5EA 4NH9A 2E5LE 4LF4I 4H7QA 3JZ3A 1ZM9A 4BAEA 4YHHE 2UXBE 1FKAE 4HXZA 5BR8E 4DV4E 1ID0A 3Q5LA 5C93A 4DV7E 3GIGB 4YKYA 2AJ4A 2V34A 2HKJA 4OX9I 3OW6A 1FJGI 4MP7A 1Z5AA 2EXLA 4JV5I 3A0ZA 4CWNA 1UY6A 2O1WA 4URLA 1YT1A 2J7KA 3LTOA 4JYAE 4FMTA 4KP4A 1I5DA 4JI3E 4ASGA 4LFAI 4KHPE 1UY9A 4NXNE 4V26A 3T0ZA 1OJ4A 2CCTA 2HK3A 2F4VE 2AKPA 3GIEA 5FNDA 5GMEA 4DUYI 4DR3I 4XKKA 1NHHA 2ZDXA 2CG9A 4IZJD 2DEJA 1UYDA 2Z5BB 3WQ9A 4EGHA 4LWHA 3P06A 2CH4A 4R3AA 4LF5I 2IWXA 4YKTA 1YERA 2XDXA 1UY7A 4B3RI 1BGQA 4Q20A 1XMOE 4GKJI 2UXCE 2YEFA 2GS8A 5FNCA 4O07A 3CGYA 3ZXOA 4JI8I 1IBLE 2Q8HA 1N36I 4L8ZA 3C11A 4Z7YA 1ZW9A 1R62A 3Q1QA 4NXME 2XDKA 4X62E 1XNQE 4DPTA 2YK9A 3PEHA 5A2QQ 5CTXA 3ZZ0A 1AH8A 3CRLA 4XIRA 4JAVA 3DGEA 4B3SI 2YEBA 5M4NA 5D7DA 2UU9E 1GKZA 4HZ0A 3B78A 1TIDA 4DR5I 1I5AA 3INXA 1XHKA 2FYPA 1XNRE 1Z0BA 5LMNE 4DUZI 5CTUA 2CZ9A 3ZKDA 1ZWHA 2PNRA 4IZJA 3RLQA 2OI2A 1U2OA 4DR2I 4DV5E 3TTZA 4LF8E 5GGZA 1TILA 2YGAA 3T1HE 3ZXQA 3J80C 4LF7E 4H81A 3GIGA 4DPUA 3HYYA 1K47A 4L91A 1AMWA 2K5BA 1B62A 2UUAI 4EM7A 3OMUA 3R4PA 4M1KA 1N34I 1U0ZA 3PYEA 2BU6A 4CWFA 2YEIA 4GQTA 1OSFA 2H55A 3T1YE 1MX0A 1EI1A 2WERA 4DR2E 1KZNA 4JG4A 1N32E 3D36A 3G75A 1I94I 4U7OA 5LMUE 3B25A 2XJGA 2BM0A 2UUCI 2HKEA 4QPKA 2WI2A 4XKAA 3BMYA 5J71A 3LPSA 3FV5A 1KTVA 3A0WA 1Z0WA 2CGEA 3FT5A 4JI1E 2BU8A 1USVA 2CCUA 2YE8A 1HNZE 3U2KA 4JI6E 3J7AG 1USUA 2QG2A 3R4OA 2ZM6I 4DV0I 4DV1E 4YKRA 4JI7E 4MYUA 4WUBA 2FWYA 2Q8FA 1YC3A 4GT8A 4JI2I 4ZVIA 4HYPA 4JI0E 3VHDA 4JQLA 4JAUA 4CWQA 4CE2A 4N3OA 1VISA 2PNLA 2XEXA 1Y6ZA 1HNWI 1ZM4A 3VADA 4MYTA 5M4MA 4U7NA 5IN9A 2E0AA 2VWCA 5IWAI 1Z5CA 2BU7A 2ZBKB 2JKIA 4KSGA 4GCZA 3ZM7A 3FT8A 4CWSA 1PIEA 1ZXNA 4LFBI 2R3VA 1KKHA 3G7BA 4EEHA 4JI2E 3OTOI 4GKKI 4MPNA 1FNMA 4IZJB 1J5EI 5BODA 2YE4A 3V2UC 3Q6MA 4DV2E 5D7RA 4USKA 3LNUA 4LFCE 4LF6I 4BQGA 1UYMA 2V2VA 4YKXA 2YEEA 4UROA 2XJJA 4JI4E 1N33E 4X66E 4GFNA 1QZRA 4DR4E 3Q5KA 1TH8A 2YI0A 4CWTA 5FLXQ 3EKRA 1N0UA 4LF4E 3EKOA 2XDLA 4FCPA 4AWQA 1J5EE 3RLRA 2BTZA 4EGKA 4XCJA 2DEIA 1YT2A 2BU5A 4V25A 2YKCA 3INWA 4DUHA 1Y4UA 2V2QA 4K0KI 4W7TA 5M4HA 3QDDA 4GEEA 4XIPA 2O1TA 4OX9E 4DPXA 3B27A 4R3MA 4XITA 1FJGE 2XK2A 3MNRP 2HHHI 2YEJA 3VHCA 4JV5E 3B8HA 2BSMA 4O0BA 4AWOA 3RLPA 1DARA 1D6TA 4HZ5A 5D6PA 4EFTA 3J81C 5L3JA 3B26A 4KFGA 1TBWA 2QG0A 4E00A 2XCMA 4BIZA 4LFAE 3BM9A 4MPEA 2WI3A 5IDJA 1ZM3A 2YGFA 4DUYE 3D2RA 4PRXA 4FN5A 4DR3E 2ESAA 3PEJA 1XMQI 4BXIA 3HULA 4HACA 3RKZA 1GKXA 2BREA 4RPFA 4LF5E 3QT6A 4PU9A 4B3RE 3ZZTA 4DV3I 4GGLA 4GKJE 3R4MA 2WI1A 3EHFA 1IBKI 1IBMI 4JI8E 1U2RA 1Z0EA 5FWKA 1N36E 1YETA 2YEGA 5BOCA 4B7PA 4UT4A 1FWLA 1RREA 3Q6NA 5LL6R 5D7CA 2WW4A 4HYMA 2GQ0A 4DPWA 3H4LA 2EFGA 4DV6I 3K98A 4WUCA 4DPYA 2HCHA 4XE2A 2UUBI 4B3SE 1UEKA 3O2FA 4H85A 2O1UA 2HK2A 3CRKA 2YI5A 4DR5E 4B6CA 3QT5A 4BQJA 4DR7I 1HK7A 5M4KA 3OWDA 1H7UA 2WI7A 4EGIA 2HFSA 4DUZE 3T10A 1ELOA 3K97A 2BZ5A 4IZKA 3WU5A 2BV3A 2VQEI 4AQYI 5D6QA 3K99A 4YKWA 4E01A 2UWDA 1YT0A 2YE5A 2E1RA 2BRCA 2YE7A 4P52A 3KE6A 3R4NA 4DZYA 1Z0CA 5CF0A 4HXWA 4B3MI 1UYFA 2BU2A 1A4HA 2BYIA 4CE1A 2HG1A 2UUAE 2YEAA 3EHHA 4DR1I 3A0XA 2XJXA 2WI6A 1H7SA 4Z7CA 4L93A 1N34E 4KSHA 1Y8NA 2IOQA 2UXDI 1JM6A 3HJCA 4B3TI 2XD6A 4AQYE 1AH6A 4DR6I 1I94E 2C2AA 4CWPA 3V5RA 4L90A 5IT9C 1TC0A 3HYZA 2UUCE 1UYCA 4XKOA 3U67A 1BYQA 2YECA 2YEHA 4FCQA 5A2QC 3B24A 4MOTA 4X65I 1HR0I 4EMVA 3ZZUA 4HACB 2LJPA 1GJVA 2BYHA 2Z5CA 4X64I 2XABA 3ZKBA 1UYEA 4FWHA 4LPBA 4LP0A 4KQVA 4LF9I 1HNXI 3C0EA 1Z59A 4FWDA 2ZM6E 2A2DA 4DV0E 2CGFA 3H80A 1US7A 2WI5A 2ZITA 4JI5I 4R1FA 3J81Q 2VQFI 2O1VA 3G7EA 4YKUA 3R92A 1NZ0A 2E5LI 2YJXA 1FWKA 1H74A 4YHHI 1HNWE 1BXDA 2VF3A 4DV4I 1H73A 5BR8I 4XIQA 4DV7I 1HNXE 2Q8IA 5IWAE 2YE9A 1UYGA 5GMDA 4ASBA 4URNA 4LFBE 3TUHA 3WU6A 2XHRA 3OTOE 4GKKE 3EHJA 1YSZA 4IZKB 1Z0TA 2IOPA 4LWEA 3K17A 4JYAI 3B82A 4JI3I 4KHPI 2ZDYA 4LF6E 2X36A 4NXNI 2VCIA 4DU8A 3T1KA 2GQPA 3QT8A 4FW9A 1QY8A 2F4VI 2YKJA 3TZ4A 4FWGA 3J80Q 1UY8A 2ZKJA 1BKNA 3WHAA 3WU4A 1YC1A 1ZM2A 2R42A 1AJ6A 2Q8GA 2NPFA 1A6FA 1H72C 1KVKA 1Y4SA 4YKZA 2YKBA 1Z0VA 4JASA 3U2DA 3PRYA 1N0VC 2CCSA 3T0HA 1XMOI 3O0IA 4CE3A 2FWZA 2UXCI 1YC4A 3F0NA 1B3QA 4K0KE 5J6AA 2X7IA 1RR9A 1NHJA 1IBLI 2PNMA 1B63A 3PYGA 4NXMI 2HHHE 4CWOA 1AM1A 4X62I 1XNQI 3PYFA 3A0YA 4K4OA 4XCLA 5M4PA 2HFUA 2Z5CB 2XX4A 4X9LA 2XHXA 4MP2A 2BM1A 3K85A 3PYDA 2WEQA 1L0OA 2UU9I 2WEPA 4I3HA 4YKQA 3JAMC 2YE6A 4LWFA 1Z5BA 5F5RA 3J7AM 1UYIA 3VHAA 4ZKIA 2IWSA 1EA6A 2XX5A 3A0TA 3HEKA 4BIUA 1XNRI 1PKPA 5LMNI 3O6OA 4URMA 5IT9Q 2QF6A 1XMQE 3TZ0A 3T2SA 1I5CA 3D0BA 4DV5I 1PVGA 4LWIA 4DU7A 3QT7A 4ED4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H I;  4LF7 I;  2V8P A;  4DV3 E;  1THN A;  3OPD A;  1ZXM A;  5FLX C;  2XDS A;  4MPC A;  1WUU A;  1MU5 A;  1IBK E;  1IBM E;  1MG7 A;  2IOR A;  4LF8 I;  1I58 A;  4O04 A;  4CWR A;  3M6A A;  2YE2 A;  4AS9 A;  2XHT A;  1UYH A;  4O09 A;  4DV6 E;  3T1Y I;  2GFD A;  2VW5 A;  1N32 I;  4O05 A;  1UYL A;  5LMU I;  4EMD A;  2UUB E;  2YK2 A;  2A2C A;  3SL2 A;  4HY1 A;  4KTN A;  3TZ5 A;  3Q5J A;  2V2Z A;  2IWU A;  1I5B A;  3EHG A;  3GIF A;  3TZ2 A;  4ASF A;  4FPP A;  5F3K A;  4DR7 E;  5M4E A;  4WUD A;  2XDU A;  2YKI A;  5CTY A;  1QYE A;  4AWP A;  4JI1 I;  2YJW A;  1HNZ I;  2VQE E;  4JI6 I;  2WI4 A;  4PRV A;  2YED A;  1S14 A;  2YKE A;  3OWB A;  4MBC A;  4DV1 I;  4JI7 I;  3B28 A;  2YE3 A;  1S16 A;  1Z0G A;  2Q2E B;  1TC6 A;  2XX2 A;  2VCJ A;  4XDM A;  4JI0 I;  4B3M E;  3A0R A;  3WU3 A;  4DR1 E;  1YSR A;  4DXL A;  2JJC A;  4HY6 A;  1Y8O A;  4XC0 A;  4E02 A;  1I59 A;  3CWV A;  2UXD E;  3HZ5 A;  4ASA A;  4EFU A;  1YS3 A;  1UYK A;  2FXS A;  4B3T E;  4YY3 I;  4MB9 A;  3IED A;  4DR6 E;  2YI6 A;  2H8M A;  1FI4 A;  1Y8P A;  5IDM A;  3QTF A;  4UTG A;  4PL9 A;  2QFO A;  4P7A A;  4P8O A;  3NMQ A;  2BT0 A;  3HHU A;  4X65 E;  1HR0 E;  4L94 A;  4LWG A;  4NH8 A;  3D4J A;  5CPH A;  4DV2 I;  1NHI A;  2YGE A;  2UXB I;  4X64 E;  3CGZ A;  3K60 A;  4LFC I;  4USM A;  1YES A;  4LF9 E;  4FCR A;  5FNF A;  3GON A;  3R91 A;  4YY3 E;  3K1J A;  4XTJ A;  4JI4 I;  1S4E A;  5CTW A;  2YI7 A;  4NH7 A;  1KIJ A;  1N33 I;  4JI5 E;  4I5S A;  2VQF E;  4X66 I;  4QPJ A;  4DR4 I;  4U93 A;  4XD8 A;  3JAM Q;  3HZ1 A;  4NH9 A;  2E5L E;  4LF4 I;  4H7Q A;  3JZ3 A;  1ZM9 A;  4BAE A;  4YHH E;  2UXB E;  1FKA E;  4HXZ A;  5BR8 E;  4DV4 E;  1ID0 A;  3Q5L A;  5C93 A;  4DV7 E;  3GIG B;  4YKY A;  2AJ4 A;  2V34 A;  2HKJ A;  4OX9 I;  3OW6 A;  1FJG I;  4MP7 A;  1Z5A A;  2EXL A;  4JV5 I;  3A0Z A;  4CWN A;  1UY6 A;  2O1W A;  4URL A;  1YT1 A;  2J7K A;  3LTO A;  4JYA E;  4FMT A;  4KP4 A;  1I5D A;  4JI3 E;  4ASG A;  4LFA I;  4KHP E;  1UY9 A;  4NXN E;  4V26 A;  3T0Z A;  1OJ4 A;  2CCT A;  2HK3 A;  2F4V E;  2AKP A;  3GIE A;  5FND A;  5GME A;  4DUY I;  4DR3 I;  4XKK A;  1NHH A;  2ZDX A;  2CG9 A;  2DEJ A;  1UYD A;  3WQ9 A;  4EGH A;  4LWH A;  2CH4 A;  4R3A A;  4LF5 I;  2IWX A;  4YKT A;  1YER A;  2XDX A;  1UY7 A;  4B3R I;  1BGQ A;  4Q20 A;  1XMO E;  4GKJ I;  2UXC E;  2YEF A;  2GS8 A;  5FNC A;  4O07 A;  3CGY A;  3ZXO A;  4JI8 I;  1IBL E;  2Q8H A;  1N36 I;  4L8Z A;  3C11 A;  4Z7Y A;  1ZW9 A;  1R62 A;  3Q1Q A;  4NXM E;  2XDK A;  4X62 E;  1XNQ E;  4DPT A;  2YK9 A;  3PEH A;  5A2Q Q;  5CTX A;  3ZZ0 A;  1AH8 A;  3CRL A;  4XIR A;  4JAV A;  3DGE A;  4B3S I;  2YEB A;  5M4N A;  5D7D A;  2UU9 E;  1GKZ A;  4HZ0 A;  3B78 A;  1TID A;  4DR5 I;  1I5A A;  3INX A;  1XHK A;  2FYP A;  1XNR E;  1Z0B A;  5LMN E;  4DUZ I;  5CTU A;  2CZ9 A;  3ZKD A;  1ZWH A;  2PNR A;  3RLQ A;  2OI2 A;  1U2O A;  4DR2 I;  4DV5 E;  3TTZ A;  4LF8 E;  5GGZ A;  1TIL A;  2YGA A;  3T1H E;  3ZXQ A;  3J80 C;  4LF7 E;  4H81 A;  3GIG A;  4DPU A;  3HYY A;  1K47 A;  4L91 A;  1AMW A;  2K5B A;  1B62 A;  2UUA I;  4EM7 A;  3OMU A;  3R4P A;  4M1K A;  1N34 I;  1U0Z A;  3PYE A;  2BU6 A;  4CWF A;  2YEI A;  4GQT A;  1OSF A;  2H55 A;  3T1Y E;  1MX0 A;  1EI1 A;  2WER A;  4DR2 E;  1KZN A;  4JG4 A;  1N32 E;  3D36 A;  3G75 A;  1I94 I;  4U7O A;  5LMU E;  3B25 A;  2XJG A;  2BM0 A;  2UUC I;  2HKE A;  4QPK A;  2WI2 A;  4XKA A;  3BMY A;  5J71 A;  3LPS A;  3FV5 A;  1KTV A;  3A0W A;  1Z0W A;  3FT5 A;  4JI1 E;  2BU8 A;  2YE8 A;  2CCU A;  1HNZ E;  3U2K A;  4JI6 E;  3J7A G;  2QG2 A;  3R4O A;  2ZM6 I;  4DV0 I;  4DV1 E;  4YKR A;  4JI7 E;  4MYU A;  4WUB A;  2FWY A;  2Q8F A;  1YC3 A;  4GT8 A;  4JI2 I;  4ZVI A;  4HYP A;  4JI0 E;  3VHD A;  4JQL A;  4JAU A;  4CWQ A;  4CE2 A;  1VIS A;  2XEX A;  1HNW I;  1ZM4 A;  3VAD A;  4MYT A;  5M4M A;  4U7N A;  5IN9 A;  2E0A A;  2VWC A;  5IWA I;  1Z5C A;  2BU7 A;  2ZBK B;  2JKI A;  4KSG A;  4GCZ A;  3ZM7 A;  3FT8 A;  4CWS A;  1PIE A;  1ZXN A;  4LFB I;  2R3V A;  1KKH A;  3G7B A;  4EEH A;  4JI2 E;  3OTO I;  4GKK I;  4MPN A;  1FNM A;  5BOD A;  1J5E I;  2YE4 A;  3V2U C;  4DV2 E;  5D7R A;  4USK A;  3LNU A;  4LFC E;  4LF6 I;  4BQG A;  1UYM A;  2V2V A;  4YKX A;  2YEE A;  4URO A;  2XJJ A;  4JI4 E;  1N33 E;  4X66 E;  4GFN A;  1QZR A;  4DR4 E;  3Q5K A;  1TH8 A;  2YI0 A;  4CWT A;  5FLX Q;  3EKR A;  1N0U A;  4LF4 E;  3EKO A;  2XDL A;  4FCP A;  4AWQ A;  1J5E E;  3RLR A;  2BTZ A;  4EGK A;  4XCJ A;  2DEI A;  1YT2 A;  2BU5 A;  4V25 A;  2YKC A;  3INW A;  4DUH A;  2V2Q A;  4K0K I;  1Y4U A;  4W7T A;  5M4H A;  3QDD A;  4GEE A;  4XIP A;  4OX9 E;  4XIT A;  4DPX A;  3B27 A;  4R3M A;  3VHC A;  1FJG E;  2XK2 A;  3MNR P;  2HHH I;  2YEJ A;  4JV5 E;  3B8H A;  2BSM A;  4O0B A;  4AWO A;  3RLP A;  1DAR A;  1D6T A;  4HZ5 A;  5D6P A;  4EFT A;  3J81 C;  5L3J A;  3B26 A;  4KFG A;  1TBW A;  2QG0 A;  4E00 A;  2XCM A;  4BIZ A;  4LFA E;  3BM9 A;  4MPE A;  2WI3 A;  5IDJ A;  1ZM3 A;  2YGF A;  4DUY E;  3D2R A;  4PRX A;  4FN5 A;  4DR3 E;  2ESA A;  3PEJ A;  1XMQ I;  4BXI A;  3HUL A;  4HAC A;  3RKZ A;  1GKX A;  2BRE A;  4RPF A;  4LF5 E;  3QT6 A;  4PU9 A;  4B3R E;  3ZZT A;  4DV3 I;  4GGL A;  4GKJ E;  3R4M A;  2WI1 A;  3EHF A;  1IBK I;  1IBM I;  4JI8 E;  1U2R A;  1Z0E A;  1N36 E;  1YET A;  2YEG A;  5BOC A;  4B7P A;  5FWK A;  4UT4 A;  1FWL A;  1RRE A;  5LL6 R;  5D7C A;  2WW4 A;  4HYM A;  4DPW A;  3H4L A;  2EFG A;  4DV6 I;  3K98 A;  4WUC A;  4DPY A;  2HCH A;  4XE2 A;  2UUB I;  4B3S E;  1UEK A;  3O2F A;  4H85 A;  2O1U A;  2HK2 A;  3CRK A;  2YI5 A;  4DR5 E;  4B6C A;  3QT5 A;  4BQJ A;  4DR7 I;  5M4K A;  3OWD A;  1H7U A;  2WI7 A;  4EGI A;  2HFS A;  4DUZ E;  3T10 A;  1ELO A;  3K97 A;  2BZ5 A;  3WU5 A;  2BV3 A;  2VQE I;  4AQY I;  5D6Q A;  3K99 A;  4YKW A;  4E01 A;  2UWD A;  1YT0 A;  2YE5 A;  2E1R A;  2BRC A;  2YE7 A;  4P52 A;  3KE6 A;  3R4N A;  4DZY A;  1Z0C A;  5CF0 A;  4HXW A;  4B3M I;  1UYF A;  2BU2 A;  1A4H A;  2BYI A;  4CE1 A;  2HG1 A;  2UUA E;  2YEA A;  3EHH A;  4DR1 I;  3A0X A;  2XJX A;  2WI6 A;  1H7S A;  4Z7C A;  4L93 A;  1N34 E;  4KSH A;  1Y8N A;  2IOQ A;  2UXD I;  1JM6 A;  4B3T I;  2XD6 A;  4AQY E;  1AH6 A;  4DR6 I;  1I94 E;  2C2A A;  4CWP A;  3V5R A;  4L90 A;  5IT9 C;  1TC0 A;  3HYZ A;  2UUC E;  1UYC A;  4XKO A;  3U67 A;  1BYQ A;  2YEC A;  2YEH A;  4FCQ A;  5A2Q C;  3B24 A;  4MOT A;  4X65 I;  1HR0 I;  4EMV A;  3ZZU A;  4HAC B;  2LJP A;  1GJV A;  2BYH A;  2XAB A;  4X64 I;  4LP0 A;  3ZKB A;  1UYE A;  4FWH A;  4LPB A;  4KQV A;  4LF9 I;  1HNX I;  3C0E A;  1Z59 A;  4FWD A;  2ZM6 E;  2A2D A;  4DV0 E;  2CGF A;  3H80 A;  1US7 A;  2WI5 A;  2ZIT A;  4JI5 I;  4R1F A;  3J81 Q;  2VQF I;  2O1V A;  3G7E A;  4YKU A;  3R92 A;  1NZ0 A;  2E5L I;  2YJX A;  1FWK A;  1H74 A;  4YHH I;  1HNW E;  1BXD A;  2VF3 A;  4DV4 I;  1H73 A;  5BR8 I;  4XIQ A;  4DV7 I;  1HNX E;  2Q8I A;  5IWA E;  2YE9 A;  1UYG A;  5GMD A;  4ASB A;  4URN A;  4LFB E;  3TUH A;  3WU6 A;  2XHR A;  3OTO E;  4GKK E;  3EHJ A;  1YSZ A;  1Z0T A;  2IOP A;  4LWE A;  3K17 A;  4JYA I;  3B82 A;  4JI3 I;  4KHP I;  2ZDY A;  4LF6 E;  2X36 A;  4NXN I;  2VCI A;  4DU8 A;  3T1K A;  2GQP A;  3QT8 A;  4FW9 A;  1QY8 A;  2F4V I;  2YKJ A;  3TZ4 A;  4FWG A;  3J80 Q;  1UY8 A;  2ZKJ A;  1BKN A;  3WHA A;  3WU4 A;  1YC1 A;  1ZM2 A;  2R42 A;  1AJ6 A;  2Q8G A;  2NPF A;  1A6F A;  1H72 C;  1KVK A;  1Y4S A;  4YKZ A;  2YKB A;  1Z0V A;  4JAS A;  3U2D A;  1N0V C;  2CCS A;  3T0H A;  1XMO I;  3O0I A;  4CE3 A;  2FWZ A;  2UXC I;  1YC4 A;  3F0N A;  1B3Q A;  4K0K E;  5J6A A;  2X7I A;  1RR9 A;  1NHJ A;  1IBL I;  1B63 A;  3PYG A;  4NXM I;  2HHH E;  4CWO A;  1AM1 A;  4X62 I;  1XNQ I;  3PYF A;  3A0Y A;  4K4O A;  4XCL A;  5M4P A;  2HFU A;  2XX4 A;  4X9L A;  2XHX A;  4MP2 A;  2BM1 A;  3PYD A;  2WEQ A;  1L0O A;  2UU9 I;  2WEP A;  4I3H A;  4YKQ A;  3JAM C;  2YE6 A;  4LWF A;  1Z5B A;  5F5R A;  3J7A M;  1UYI A;  3VHA A;  4ZKI A;  2IWS A;  1EA6 A;  2XX5 A;  3A0T A;  3HEK A;  4BIU A;  1XNR I;  1PKP A;  5LMN I;  3O6O A;  4URM A;  5IT9 Q;  2QF6 A;  1XMQ E;  3TZ0 A;  3T2S A;  1I5C A;  3D0B A;  4DV5 I;  1PVG A;  4LWI A;  4DU7 A;  3QT7 A;  4ED4 A; 
#chains in the Genus database with same CATH topology
 4IS9 A;  3T1H I;  4LF7 I;  2V8P A;  4DV3 E;  1THN A;  3OPD A;  1ZXM A;  5FLX C;  2XDS A;  4MPC A;  1WUU A;  1MU5 A;  2PO1 A;  1IBK E;  1IBM E;  1MG7 A;  2IOR A;  4LP0 A;  4LF8 I;  1I58 A;  4O04 A;  2JEA B;  4CWR A;  3M6A A;  2YE2 A;  4AS9 A;  3GCM A;  1OYR A;  2XHT A;  2C37 A;  1UYH A;  4O09 A;  2PNZ B;  4DV6 E;  3T1Y I;  2GFD A;  2VW5 A;  1N32 I;  2PO2 A;  4O05 A;  1UYL A;  5LMU I;  2NN6 F;  4MU4 A;  4EMD A;  3NZK A;  2A2C A;  1YH8 A;  4HY1 A;  2UUB E;  2YK2 A;  3Q5J A;  4KTN A;  3SL2 A;  3TZ5 A;  2V2Z A;  2IWU A;  1I5B A;  3EHG A;  3GIF A;  3TZ2 A;  4ASF A;  4FPP A;  5F3K A;  4DR7 E;  5ELW A;  5M4E A;  4WUD A;  4OO1 D;  2XDU A;  2YKI A;  5CTY A;  1QYE A;  4AWP A;  4JI1 I;  2YJW A;  1IXM A;  2BA0 D;  1HNZ I;  2VQE E;  4JI6 I;  2WI4 A;  4PRV A;  2YED A;  1S14 A;  2YKE A;  3OWB A;  4MBC A;  4DV1 I;  5C0X F;  4JI7 I;  2GO3 A;  3B28 A;  2YE3 A;  1S16 A;  1Z0G A;  2Q2E B;  1TC6 A;  2XX2 A;  2VCJ A;  4XDM A;  1UDQ A;  4JI0 I;  4B3M E;  3A0R A;  2IES A;  2VES A;  3WU3 A;  4DR1 E;  1YSR A;  4DXL A;  2C39 B;  4IFD D;  2JJC A;  4HY6 A;  1Y8O A;  4XC0 A;  4E02 A;  2Z5B A;  1I59 A;  3CWV A;  2UXD E;  3HZ5 A;  4ASA A;  4EFU A;  1YS3 A;  1UYK A;  2FXS A;  4B3T E;  4YY3 I;  4MB9 A;  1R6M A;  3IED A;  4DR6 E;  2YI6 A;  2H8M A;  1FI4 A;  4GQU A;  5JEA F;  1Y8P A;  1Y5Y A;  5IDM A;  3QTF A;  2JEB B;  4UTG A;  4PL9 A;  2QFO A;  4P7A A;  4P8O A;  3NMQ A;  2BT0 A;  2NN6 E;  3HHU A;  4FW6 A;  4X65 E;  1HR0 E;  4L94 A;  4LWG A;  4NH8 A;  3D4J A;  5CPH A;  4OO1 A;  1NHI A;  4DV2 I;  4BA2 A;  2YGE A;  2UXB I;  4X64 E;  3CGZ A;  3K60 A;  3UHM A;  4LFC I;  4USM A;  1YES A;  4LF9 E;  4FCR A;  5FNF A;  3GON A;  3R91 A;  4MU3 A;  4YY3 E;  3K1J A;  4XTJ A;  3DD6 A;  1S4E A;  4JI4 I;  5CTW A;  2YI7 A;  4NH7 A;  1KIJ A;  1N33 I;  4JI5 E;  4I5S A;  2VQF E;  4X66 I;  2PO1 B;  3P3G A;  4OO1 C;  4QPJ A;  4DR4 I;  4U93 A;  4XD8 A;  3JAM Q;  3HZ1 A;  2Z5E A;  4NH9 A;  2E5L E;  3M7N G;  4LF4 I;  2C37 B;  3GME A;  4IFD A;  4H7Q A;  2PNZ A;  3JZ3 A;  1ZM9 A;  4BAE A;  2PO2 B;  4YHH E;  2UXB E;  1FKA E;  4HXZ A;  5BR8 E;  4DV4 E;  1ID0 A;  3Q5L A;  5C93 A;  4DV7 E;  3GIG B;  4YKY A;  2AJ4 A;  2V34 A;  3P3E A;  2HKJ A;  4OX9 I;  5K36 F;  3OW6 A;  4IFD C;  1FJG I;  4MP7 A;  1Z5A A;  4LCG A;  2EXL A;  4JV5 I;  3A0Z A;  4FW7 A;  3GLL A;  4CWN A;  1UY6 A;  2O1W A;  4URL A;  1YT1 A;  2J7K A;  3LTO A;  4JYA E;  4FMT A;  4KP4 A;  2BA1 G;  3LMM A;  1I5D A;  5JEN A;  4JI3 E;  4ASG A;  4LFA I;  4KHP E;  1UY9 A;  4NXN E;  4V26 A;  3T0Z A;  1OJ4 A;  2CCT A;  3PS3 A;  2HK3 A;  2F4V E;  2AKP A;  4LPF A;  3GIE A;  5FND A;  5GME A;  4DUY I;  4DR3 I;  4XKK A;  1NHH A;  2ZDX A;  4E72 A;  2CG9 A;  4IZJ D;  2DEJ A;  1UYD A;  2Z5B B;  3WQ9 A;  4EGH A;  4LWH A;  3P06 A;  2CH4 A;  4R3A A;  4LF5 I;  2BR2 A;  2IWX A;  4YKT A;  1YER A;  2XDX A;  1UY7 A;  4B3R I;  1BGQ A;  2J65 A;  1XMO E;  4Q20 A;  4GKJ I;  2UXC E;  2YEF A;  2GS8 A;  5FNC A;  4O07 A;  3CGY A;  3ZXO A;  3CDI A;  4JI8 I;  1IBL E;  1N36 I;  4L8Z A;  3C11 A;  2Q8H A;  4Z7Y A;  1ZW9 A;  1R62 A;  3Q1Q A;  4NXM E;  4OO1 B;  2XDK A;  4X62 E;  1XNQ E;  4DPT A;  4BA2 B;  2YK9 A;  3PEH A;  5A2Q Q;  5CTX A;  3ZZ0 A;  1AH8 A;  3CRL A;  4XIR A;  4JAV A;  3DGE A;  4B3S I;  2YEB A;  5M4N A;  5D7D A;  2UU9 E;  1GKZ A;  4HZ0 A;  3B78 A;  1TID A;  4DR5 I;  1I5A A;  3M85 G;  3INX A;  2C1G A;  1XHK A;  2FYP A;  1XNR E;  1Z0B A;  5LMN E;  4DUZ I;  5CTU A;  2CZ9 A;  3ZKD A;  4IFD B;  1ZWH A;  4IZJ A;  2PNR A;  2OI2 A;  3RLQ A;  1U2O A;  4DR2 I;  4DV5 E;  5DRQ A;  3TTZ A;  4LF8 E;  3HKM A;  5GGZ A;  1TIL A;  2YGA A;  2WNR A;  3T1H E;  3ZXQ A;  3J80 C;  4LF7 E;  4H81 A;  3GIG A;  4DPU A;  3HYY A;  1K47 A;  4L91 A;  1AMW A;  2K5B A;  1B62 A;  4QNJ A;  3KRN A;  2UUA I;  4MQY A;  4EM7 A;  4OO1 E;  3OMU A;  3R4P A;  2JT2 A;  4M1K A;  1N34 I;  1U0Z A;  3PYE A;  2BU6 A;  4CWF A;  2YEI A;  1E3H A;  4GQT A;  1OSF A;  2H55 A;  3T1Y E;  1MX0 A;  1EI1 A;  2WER A;  4DR2 E;  1KZN A;  4JG4 A;  1N32 E;  3D36 A;  3G75 A;  1I94 I;  4U7O A;  5LMU E;  4MDT A;  3B25 A;  2XJG A;  2BM0 A;  2UUC I;  2HKE A;  4QPK A;  1E3P A;  2WI2 A;  4XKA A;  3BMY A;  5J71 A;  3LPS A;  4IFD E;  3FV5 A;  3B4T A;  1KTV A;  3A0W A;  1Z0W A;  2BA0 G;  3CDJ A;  4OZE A;  2PO0 A;  1F51 A;  2CGE A;  3FT5 A;  2BR2 B;  4JI1 E;  2BU8 A;  1USV A;  2CCU A;  2YE8 A;  1HNZ E;  3U2K A;  4JI6 E;  3J7A G;  1USU A;  2QG2 A;  3R4O A;  3U1Y A;  4AM3 A;  2ZM6 I;  4DV0 I;  4DV1 E;  4YKR A;  5K36 A;  4JI7 E;  4MYU A;  4WUB A;  2FWY A;  2Q8F A;  1YC3 A;  4GT8 A;  4JI2 I;  4ZVI A;  4HYP A;  4JI0 E;  3VHD A;  4JQL A;  4U3D A;  4JAU A;  4CWQ A;  4CE2 A;  4N3O A;  1VIS A;  2PNL A;  4QNK A;  2XEX A;  1Y6Z A;  1HNW I;  1UDO A;  1ZM4 A;  2GO4 A;  3VAD A;  4MYT A;  3U1K A;  5M4M A;  4U7N A;  5IN9 A;  2E0A A;  2VWC A;  5IWA I;  1Z5C A;  2BU7 A;  2ZBK B;  2FTK A;  2JKI A;  4KSG A;  4GCZ A;  3ZM7 A;  3FT8 A;  4CWS A;  1PIE A;  1ZXN A;  4LFB I;  2R3V A;  1KKH A;  3G7B A;  4U3B A;  4JI2 E;  4EEH A;  3OTO I;  4GKK I;  4MPN A;  1FNM A;  4BA1 A;  4IZJ B;  3P3C A;  1J5E I;  2YE4 A;  5BOD A;  3V2U C;  3Q6M A;  4DV2 E;  5D7R A;  4USK A;  3LNU A;  2WNR B;  4LFC E;  4LF6 I;  4BQG A;  1UYM A;  2V2V A;  4YKX A;  2YEE A;  4URO A;  3PS2 A;  4MU0 A;  2XJJ A;  4JI4 E;  1N33 E;  4X66 E;  4GFN A;  3VHC A;  1QZR A;  4DR4 E;  3Q5K A;  1TH8 A;  2YI0 A;  1YHC A;  4CWT A;  5FLX Q;  3EKR A;  1N0U A;  4LF4 E;  3EKO A;  2XDL A;  4FCP A;  4AWQ A;  1J5E E;  3RLR A;  2BTZ A;  4EGK A;  4XCJ A;  2DEI A;  1YT2 A;  2BU5 A;  4V25 A;  2YKC A;  3INW A;  4DUH A;  1Y4U A;  2V2Q A;  4K0K I;  4W7T A;  2BA1 D;  5M4H A;  3QDD A;  4GEE A;  4XIP A;  2O1T A;  4OX9 E;  4DPX A;  3B27 A;  4R3M A;  4XIT A;  1FJG E;  2AE8 A;  2XK2 A;  2HHH I;  2YEJ A;  3MNR P;  4JV5 E;  3B8H A;  2BSM A;  4O0B A;  4AWO A;  3RLP A;  1DAR A;  2PO0 B;  1D6T A;  3CYG A;  4HZ5 A;  5D6P A;  4EFT A;  2NN6 A;  5JEA D;  3J81 C;  5L3J A;  3B26 A;  4KFG A;  4OO1 F;  1TBW A;  2QG0 A;  4E00 A;  2XCM A;  4BIZ A;  4LFA E;  5K36 B;  3BM9 A;  4FW3 A;  1P42 A;  4MPE A;  2WI3 A;  5IDJ A;  1ZM3 A;  2YGF A;  4DUY E;  3D2R A;  4PRX A;  4FN5 A;  4DR3 E;  2ESA A;  3PEJ A;  1XMQ I;  4BXI A;  3HUL A;  4HAC A;  3RKZ A;  5DRP A;  1GKX A;  5C0X A;  2O3Z A;  2BRE A;  4RPF A;  4LF5 E;  3QT6 A;  4PU9 A;  4IFD F;  4B3R E;  3ZZT A;  4DV3 I;  4GGL A;  4GKJ E;  3R4M A;  5EL9 A;  2WI1 A;  3EHF A;  1IBK I;  1IBM I;  4JI8 E;  1Z0E A;  1U2R A;  5FWK A;  1N36 E;  1YET A;  2YEG A;  5BOC A;  4B7P A;  5DRO A;  1FWL A;  4BA1 B;  4UT4 A;  1RRE A;  3Q6N A;  5LL6 R;  5D7C A;  2WW4 A;  4HYM A;  2GQ0 A;  4DPW A;  2CVE A;  1OYS A;  5EKW A;  3H4L A;  2EFG A;  4DV6 I;  3K98 A;  4WUC A;  2IER A;  4DPY A;  5K36 D;  2HCH A;  5JEA A;  4XE2 A;  3H1C A;  2UUB I;  4B3S E;  1UEK A;  3O2F A;  4H85 A;  2O1U A;  2HK2 A;  4OKG A;  3CRK A;  3PS1 A;  2YI5 A;  4DR5 E;  4B6C A;  3QT5 A;  4BQJ A;  4DR7 I;  1HK7 A;  5M4K A;  3OWD A;  1H7U A;  2WI7 A;  4LOM A;  5JEA C;  4EGI A;  2HFS A;  4J3D A;  4DUZ E;  3T10 A;  1ELO A;  3K97 A;  2BZ5 A;  4IZK A;  3WU5 A;  2BV3 A;  2VQE I;  4AQY I;  5D6Q A;  3K99 A;  4YKW A;  4E01 A;  2UWD A;  2F1D A;  4FW4 A;  1YT0 A;  2YE5 A;  2E1R A;  2BRC A;  2YE7 A;  4P52 A;  3KE6 A;  3R4N A;  4DZY A;  1Z0C A;  5CF0 A;  4HXW A;  4B3M I;  1UYF A;  2BU2 A;  1A4H A;  2BYI A;  4CE1 A;  2HG1 A;  2UUA E;  2YEA A;  3EHH A;  4DR1 I;  4AID A;  3A0X A;  1XXE A;  2XJX A;  2WI6 A;  1H7S A;  4Z7C A;  4L93 A;  1N34 E;  4ISA A;  2NN6 B;  2IOQ A;  1Y8N A;  2UXD I;  4KSH A;  1JM6 A;  3P76 A;  2JE6 A;  3HJC A;  4B3T I;  2XD6 A;  4AQY E;  1AH6 A;  4DR6 I;  1I94 E;  2C2A A;  4CWP A;  3V5R A;  4L90 A;  5IT9 C;  1TC0 A;  3HYZ A;  2UUC E;  1UYC A;  4XKO A;  3U67 A;  5DRR A;  1BYQ A;  2YEC A;  2YEH A;  4FCQ A;  1OYP A;  5A2Q C;  3B24 A;  4MOT A;  4X65 I;  5DNL A;  1HR0 I;  4EMV A;  3ZZU A;  4HAC B;  2LJP A;  5K36 C;  1GJV A;  5C0X B;  2Z5C A;  4X64 I;  2BYH A;  3ZKB A;  3L7Z A;  4FWH A;  1UYE A;  2XAB A;  4KQV A;  4LPB A;  4LF9 I;  1HNX I;  3C0E A;  1Z59 A;  4FWD A;  2ZM6 E;  2A2D A;  4DV0 E;  2CGF A;  3H80 A;  1US7 A;  2WI5 A;  2ZIT A;  4JI5 I;  4R1F A;  3J81 Q;  2VQF I;  2O1V A;  3G7E A;  4YKU A;  3R92 A;  2C38 A;  1NZ0 A;  2NN6 D;  2E5L I;  2YJX A;  4LCH A;  1FWK A;  4LCF A;  1H74 A;  4YHH I;  3M7N D;  5JEA B;  4NBQ A;  1HNW E;  2WP8 A;  1BXD A;  2VF3 A;  4DV4 I;  1H73 A;  5BR8 I;  4XIQ A;  4DV7 I;  1HNX E;  1RHY A;  4AIM A;  2Q8I A;  5IWA E;  2YE9 A;  1UYG A;  5GMD A;  4ASB A;  4URN A;  4LFB E;  1Y60 A;  3S5T A;  3WU6 A;  3TUH A;  2XHR A;  3OTO E;  4GKK E;  2JEA A;  3EHJ A;  5C0X D;  5C0X E;  1YSZ A;  2HHI A;  4IZK B;  1Z0T A;  2IOP A;  4LWE A;  3K17 A;  4JYA I;  3B82 A;  4JI3 I;  4KHP I;  2ZDY A;  4LF6 E;  2X36 A;  4NXN I;  2VCI A;  4DU8 A;  3T1K A;  2GQP A;  3QT8 A;  4FW9 A;  1QY8 A;  2F4V I;  2YKJ A;  3TZ4 A;  4FWG A;  3J80 Q;  1UY8 A;  2ZKJ A;  1BKN A;  3WHA A;  3WU4 A;  1UDN A;  1YC1 A;  1ZM2 A;  4MU1 A;  2R42 A;  1AJ6 A;  2Q8G A;  1R6L A;  2NPF A;  1A6F A;  1H72 C;  1KVK A;  2JE6 B;  5JEA E;  1Y4S A;  4YKZ A;  2YKB A;  1Z0V A;  4JAS A;  3U2D A;  3PRY A;  1N0V C;  2CCS A;  3T0H A;  1XMO I;  3O0I A;  4CE3 A;  2FWZ A;  2C1I A;  2UXC I;  1YC4 A;  3F0N A;  1B3Q A;  4K0K E;  5J6A A;  2X7I A;  1RR9 A;  1NHJ A;  1VI7 A;  1IBL I;  2NN6 C;  2PNM A;  1B63 A;  1UDS A;  3PYG A;  4NXM I;  2HHH E;  4CWO A;  1AM1 A;  4X62 I;  1XNQ I;  3PYF A;  3A0Y A;  4K4O A;  4XCL A;  5M4P A;  2HFU A;  2Z5C B;  2C39 A;  2XX4 A;  3L7Z B;  4X9L A;  2XHX A;  4MP2 A;  2BM1 A;  3K85 A;  3PYD A;  2WEQ A;  1L0O A;  2UU9 I;  2WEP A;  4I3H A;  4YKQ A;  3JAM C;  2YE6 A;  4LWF A;  1Z5B A;  5F5R A;  3J7A M;  1UYI A;  3VHA A;  4ZKI A;  2IWS A;  1EA6 A;  2XX5 A;  3A0T A;  5C0X C;  2JEB A;  3HEK A;  2C38 B;  4BIU A;  3M85 D;  1XNR I;  1PKP A;  5LMN I;  4FW5 A;  3O6O A;  4URM A;  5IT9 Q;  2QF6 A;  1XMQ E;  3TZ0 A;  3T2S A;  1I5C A;  3D0B A;  5DNX A;  4DV5 I;  1PVG A;  2WP8 B;  5K36 E;  4LWI A;  4DU7 A;  3QT7 A;  4ED4 A; 
#chains in the Genus database with same CATH homology
 3T1H I;  4LF7 I;  2V8P A;  4DV3 E;  1THN A;  3OPD A;  1ZXM A;  5FLX C;  2XDS A;  4MPC A;  1WUU A;  1MU5 A;  1IBK E;  1IBM E;  1MG7 A;  2IOR A;  4LF8 I;  1I58 A;  4O04 A;  4CWR A;  3M6A A;  2YE2 A;  4AS9 A;  2XHT A;  1UYH A;  4O09 A;  4DV6 E;  3T1Y I;  2GFD A;  2VW5 A;  1N32 I;  4O05 A;  1UYL A;  5LMU I;  4EMD A;  2UUB E;  2YK2 A;  2A2C A;  3SL2 A;  4HY1 A;  4KTN A;  3TZ5 A;  3Q5J A;  2V2Z A;  2IWU A;  1I5B A;  3EHG A;  3GIF A;  3TZ2 A;  4ASF A;  4FPP A;  5F3K A;  4DR7 E;  5M4E A;  4WUD A;  2XDU A;  2YKI A;  5CTY A;  1QYE A;  4AWP A;  4JI1 I;  2YJW A;  1HNZ I;  2VQE E;  4JI6 I;  2WI4 A;  4PRV A;  2YED A;  1S14 A;  2YKE A;  3OWB A;  4MBC A;  4DV1 I;  4JI7 I;  3B28 A;  2YE3 A;  1S16 A;  1Z0G A;  2Q2E B;  1TC6 A;  2XX2 A;  2VCJ A;  4XDM A;  4JI0 I;  4B3M E;  3A0R A;  3WU3 A;  4DR1 E;  1YSR A;  4DXL A;  2JJC A;  4HY6 A;  1Y8O A;  4XC0 A;  4E02 A;  2Z5B A;  1I59 A;  3CWV A;  2UXD E;  3HZ5 A;  4ASA A;  4EFU A;  1YS3 A;  1UYK A;  2FXS A;  4B3T E;  4YY3 I;  4MB9 A;  3IED A;  4DR6 E;  2YI6 A;  2H8M A;  1FI4 A;  1Y8P A;  5IDM A;  3QTF A;  4UTG A;  4PL9 A;  2QFO A;  4P7A A;  4P8O A;  3NMQ A;  2BT0 A;  3HHU A;  4X65 E;  1HR0 E;  4L94 A;  4LWG A;  4NH8 A;  3D4J A;  5CPH A;  4DV2 I;  1NHI A;  2YGE A;  2UXB I;  4X64 E;  3CGZ A;  3K60 A;  4LFC I;  4USM A;  1YES A;  4LF9 E;  4FCR A;  5FNF A;  3GON A;  3R91 A;  4YY3 E;  3K1J A;  4XTJ A;  4JI4 I;  1S4E A;  5CTW A;  2YI7 A;  4NH7 A;  1KIJ A;  1N33 I;  4JI5 E;  4I5S A;  2VQF E;  4X66 I;  4QPJ A;  4DR4 I;  4U93 A;  4XD8 A;  3JAM Q;  3HZ1 A;  2Z5E A;  4NH9 A;  2E5L E;  4LF4 I;  4H7Q A;  3JZ3 A;  1ZM9 A;  4BAE A;  4YHH E;  2UXB E;  1FKA E;  4HXZ A;  5BR8 E;  4DV4 E;  1ID0 A;  3Q5L A;  5C93 A;  4DV7 E;  3GIG B;  4YKY A;  2AJ4 A;  2V34 A;  2HKJ A;  4OX9 I;  3OW6 A;  1FJG I;  4MP7 A;  1Z5A A;  2EXL A;  4JV5 I;  3A0Z A;  4CWN A;  1UY6 A;  2O1W A;  4URL A;  1YT1 A;  2J7K A;  3LTO A;  4JYA E;  4FMT A;  4KP4 A;  1I5D A;  4JI3 E;  4ASG A;  4LFA I;  4KHP E;  1UY9 A;  4NXN E;  4V26 A;  3T0Z A;  1OJ4 A;  2CCT A;  2HK3 A;  2F4V E;  2AKP A;  3GIE A;  5FND A;  5GME A;  4DUY I;  4DR3 I;  4XKK A;  1NHH A;  2ZDX A;  2CG9 A;  4IZJ D;  2DEJ A;  1UYD A;  2Z5B B;  3WQ9 A;  4EGH A;  4LWH A;  3P06 A;  2CH4 A;  4R3A A;  4LF5 I;  2IWX A;  4YKT A;  1YER A;  2XDX A;  1UY7 A;  4B3R I;  1BGQ A;  4Q20 A;  1XMO E;  4GKJ I;  2UXC E;  2YEF A;  2GS8 A;  5FNC A;  4O07 A;  3CGY A;  3ZXO A;  4JI8 I;  1IBL E;  2Q8H A;  1N36 I;  4L8Z A;  3C11 A;  4Z7Y A;  1ZW9 A;  1R62 A;  3Q1Q A;  4NXM E;  2XDK A;  4X62 E;  1XNQ E;  4DPT A;  2YK9 A;  3PEH A;  5A2Q Q;  5CTX A;  3ZZ0 A;  1AH8 A;  3CRL A;  4XIR A;  4JAV A;  3DGE A;  4B3S I;  2YEB A;  5M4N A;  5D7D A;  2UU9 E;  1GKZ A;  4HZ0 A;  3B78 A;  1TID A;  4DR5 I;  1I5A A;  3INX A;  1XHK A;  2FYP A;  1XNR E;  1Z0B A;  5LMN E;  4DUZ I;  5CTU A;  2CZ9 A;  3ZKD A;  1ZWH A;  2PNR A;  4IZJ A;  3RLQ A;  2OI2 A;  1U2O A;  4DR2 I;  4DV5 E;  3TTZ A;  4LF8 E;  5GGZ A;  1TIL A;  2YGA A;  3T1H E;  3ZXQ A;  3J80 C;  4LF7 E;  4H81 A;  3GIG A;  4DPU A;  3HYY A;  1K47 A;  4L91 A;  1AMW A;  2K5B A;  1B62 A;  2UUA I;  4EM7 A;  3OMU A;  3R4P A;  4M1K A;  1N34 I;  1U0Z A;  3PYE A;  2BU6 A;  4CWF A;  2YEI A;  4GQT A;  1OSF A;  2H55 A;  3T1Y E;  1MX0 A;  1EI1 A;  2WER A;  4DR2 E;  1KZN A;  4JG4 A;  1N32 E;  3D36 A;  3G75 A;  1I94 I;  4U7O A;  5LMU E;  3B25 A;  2XJG A;  2BM0 A;  2UUC I;  2HKE A;  4QPK A;  2WI2 A;  4XKA A;  3BMY A;  5J71 A;  3LPS A;  3FV5 A;  1KTV A;  3A0W A;  1Z0W A;  2CGE A;  3FT5 A;  4JI1 E;  2BU8 A;  1USV A;  2CCU A;  2YE8 A;  1HNZ E;  3U2K A;  4JI6 E;  3J7A G;  1USU A;  2QG2 A;  3R4O A;  2ZM6 I;  4DV0 I;  4DV1 E;  4YKR A;  4JI7 E;  4MYU A;  4WUB A;  2FWY A;  2Q8F A;  1YC3 A;  4GT8 A;  4JI2 I;  4ZVI A;  4HYP A;  4JI0 E;  3VHD A;  4JQL A;  4JAU A;  4CWQ A;  4CE2 A;  4N3O A;  1VIS A;  2PNL A;  2XEX A;  1Y6Z A;  1HNW I;  1ZM4 A;  3VAD A;  4MYT A;  5M4M A;  4U7N A;  5IN9 A;  2E0A A;  2VWC A;  5IWA I;  1Z5C A;  2BU7 A;  2ZBK B;  2JKI A;  4KSG A;  4GCZ A;  3ZM7 A;  3FT8 A;  4CWS A;  1PIE A;  1ZXN A;  4LFB I;  2R3V A;  1KKH A;  3G7B A;  4EEH A;  4JI2 E;  3OTO I;  4GKK I;  4MPN A;  1FNM A;  4IZJ B;  1J5E I;  5BOD A;  2YE4 A;  3V2U C;  3Q6M A;  4DV2 E;  5D7R A;  4USK A;  3LNU A;  4LFC E;  4LF6 I;  4BQG A;  1UYM A;  2V2V A;  4YKX A;  2YEE A;  4URO A;  2XJJ A;  4JI4 E;  1N33 E;  4X66 E;  4GFN A;  1QZR A;  4DR4 E;  3Q5K A;  1TH8 A;  2YI0 A;  4CWT A;  5FLX Q;  3EKR A;  1N0U A;  4LF4 E;  3EKO A;  2XDL A;  4FCP A;  4AWQ A;  1J5E E;  3RLR A;  2BTZ A;  4EGK A;  4XCJ A;  2DEI A;  1YT2 A;  2BU5 A;  4V25 A;  2YKC A;  3INW A;  4DUH A;  1Y4U A;  2V2Q A;  4K0K I;  4W7T A;  5M4H A;  3QDD A;  4GEE A;  4XIP A;  2O1T A;  4OX9 E;  4DPX A;  3B27 A;  4R3M A;  4XIT A;  1FJG E;  2XK2 A;  3MNR P;  2HHH I;  2YEJ A;  3VHC A;  4JV5 E;  3B8H A;  2BSM A;  4O0B A;  4AWO A;  3RLP A;  1DAR A;  1D6T A;  4HZ5 A;  5D6P A;  4EFT A;  3J81 C;  5L3J A;  3B26 A;  4KFG A;  1TBW A;  2QG0 A;  4E00 A;  2XCM A;  4BIZ A;  4LFA E;  3BM9 A;  4MPE A;  2WI3 A;  5IDJ A;  1ZM3 A;  2YGF A;  4DUY E;  3D2R A;  4PRX A;  4FN5 A;  4DR3 E;  2ESA A;  3PEJ A;  1XMQ I;  4BXI A;  3HUL A;  4HAC A;  3RKZ A;  1GKX A;  2BRE A;  4RPF A;  4LF5 E;  3QT6 A;  4PU9 A;  4B3R E;  3ZZT A;  4DV3 I;  4GGL A;  4GKJ E;  3R4M A;  2WI1 A;  3EHF A;  1IBK I;  1IBM I;  4JI8 E;  1U2R A;  1Z0E A;  5FWK A;  1N36 E;  1YET A;  2YEG A;  5BOC A;  4B7P A;  4UT4 A;  1FWL A;  1RRE A;  3Q6N A;  5LL6 R;  5D7C A;  2WW4 A;  4HYM A;  2GQ0 A;  4DPW A;  3H4L A;  2EFG A;  4DV6 I;  3K98 A;  4WUC A;  4DPY A;  2HCH A;  4XE2 A;  2UUB I;  4B3S E;  1UEK A;  3O2F A;  4H85 A;  2O1U A;  2HK2 A;  3CRK A;  2YI5 A;  4DR5 E;  4B6C A;  3QT5 A;  4BQJ A;  4DR7 I;  1HK7 A;  5M4K A;  3OWD A;  1H7U A;  2WI7 A;  4EGI A;  2HFS A;  4DUZ E;  3T10 A;  1ELO A;  3K97 A;  2BZ5 A;  4IZK A;  3WU5 A;  2BV3 A;  2VQE I;  4AQY I;  5D6Q A;  3K99 A;  4YKW A;  4E01 A;  2UWD A;  1YT0 A;  2YE5 A;  2E1R A;  2BRC A;  2YE7 A;  4P52 A;  3KE6 A;  3R4N A;  4DZY A;  1Z0C A;  5CF0 A;  4HXW A;  4B3M I;  1UYF A;  2BU2 A;  1A4H A;  2BYI A;  4CE1 A;  2HG1 A;  2UUA E;  2YEA A;  3EHH A;  4DR1 I;  3A0X A;  2XJX A;  2WI6 A;  1H7S A;  4Z7C A;  4L93 A;  1N34 E;  4KSH A;  1Y8N A;  2IOQ A;  2UXD I;  1JM6 A;  3HJC A;  4B3T I;  2XD6 A;  4AQY E;  1AH6 A;  4DR6 I;  1I94 E;  2C2A A;  4CWP A;  3V5R A;  4L90 A;  5IT9 C;  1TC0 A;  3HYZ A;  2UUC E;  1UYC A;  4XKO A;  3U67 A;  1BYQ A;  2YEC A;  2YEH A;  4FCQ A;  5A2Q C;  3B24 A;  4MOT A;  4X65 I;  1HR0 I;  4EMV A;  3ZZU A;  4HAC B;  2LJP A;  1GJV A;  2BYH A;  2Z5C A;  4X64 I;  2XAB A;  3ZKB A;  1UYE A;  4FWH A;  4LPB A;  4LP0 A;  4KQV A;  4LF9 I;  1HNX I;  3C0E A;  1Z59 A;  4FWD A;  2ZM6 E;  2A2D A;  4DV0 E;  2CGF A;  3H80 A;  1US7 A;  2WI5 A;  2ZIT A;  4JI5 I;  4R1F A;  3J81 Q;  2VQF I;  2O1V A;  3G7E A;  4YKU A;  3R92 A;  1NZ0 A;  2E5L I;  2YJX A;  1FWK A;  1H74 A;  4YHH I;  1HNW E;  1BXD A;  2VF3 A;  4DV4 I;  1H73 A;  5BR8 I;  4XIQ A;  4DV7 I;  1HNX E;  2Q8I A;  5IWA E;  2YE9 A;  1UYG A;  5GMD A;  4ASB A;  4URN A;  4LFB E;  3TUH A;  3WU6 A;  2XHR A;  3OTO E;  4GKK E;  3EHJ A;  1YSZ A;  4IZK B;  1Z0T A;  2IOP A;  4LWE A;  3K17 A;  4JYA I;  3B82 A;  4JI3 I;  4KHP I;  2ZDY A;  4LF6 E;  2X36 A;  4NXN I;  2VCI A;  4DU8 A;  3T1K A;  2GQP A;  3QT8 A;  4FW9 A;  1QY8 A;  2F4V I;  2YKJ A;  3TZ4 A;  4FWG A;  3J80 Q;  1UY8 A;  2ZKJ A;  1BKN A;  3WHA A;  3WU4 A;  1YC1 A;  1ZM2 A;  2R42 A;  1AJ6 A;  2Q8G A;  2NPF A;  1A6F A;  1H72 C;  1KVK A;  1Y4S A;  4YKZ A;  2YKB A;  1Z0V A;  4JAS A;  3U2D A;  3PRY A;  1N0V C;  2CCS A;  3T0H A;  1XMO I;  3O0I A;  4CE3 A;  2FWZ A;  2UXC I;  1YC4 A;  3F0N A;  1B3Q A;  4K0K E;  5J6A A;  2X7I A;  1RR9 A;  1NHJ A;  1IBL I;  2PNM A;  1B63 A;  3PYG A;  4NXM I;  2HHH E;  4CWO A;  1AM1 A;  4X62 I;  1XNQ I;  3PYF A;  3A0Y A;  4K4O A;  4XCL A;  5M4P A;  2HFU A;  2Z5C B;  2XX4 A;  4X9L A;  2XHX A;  4MP2 A;  2BM1 A;  3K85 A;  3PYD A;  2WEQ A;  1L0O A;  2UU9 I;  2WEP A;  4I3H A;  4YKQ A;  3JAM C;  2YE6 A;  4LWF A;  1Z5B A;  5F5R A;  3J7A M;  1UYI A;  3VHA A;  4ZKI A;  2IWS A;  1EA6 A;  2XX5 A;  3A0T A;  3HEK A;  4BIU A;  1XNR I;  1PKP A;  5LMN I;  3O6O A;  4URM A;  5IT9 Q;  2QF6 A;  1XMQ E;  3TZ0 A;  3T2S A;  1I5C A;  3D0B A;  4DV5 I;  1PVG A;  4LWI A;  4DU7 A;  3QT7 A;  4ED4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...