4PRXA

E. coli gyrb 43-kda n-terminal fragment in complex with adp+pi
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
374
structure length
363
Chain Sequence
SYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEGGIKAFVEYLNKNKTPIHPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKIID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GyrB
publication title Structure of the N-Terminal Gyrase B Fragment in Complex with ADPPi Reveals Rigid-Body Motion Induced by ATP Hydrolysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 108
structure length 363
sequence length 374
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4prxA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4prxA01
2YI0A 1B63A 5IDJA 2BYHA 3QDDA 1TILA 3B24A 5IWAE 2IOQA 3R4NA 2OI2A 4JAUA 3ZXOA 2YECA 3QT8A 3RLPA 5BODA 1RR9A 2C2AA 4CWQA 4X62I 2H8MA 4XDMA 1YC3A 4YKYA 4LF7E 1NHHA 1Y8NA 4MOTA 2FWZA 4HXZA 3R92A 1I58A 1QZRA 1HNWI 2BU5A 3VHDA 4NXNI 2UUAE 1N33I 2IWXA 1Y8OA 2CGFA 4B3RI 4DPUA 1US7A 3A0YA 3EKOA 4JV5I 4CE1A 1YT0A 5CTUA 1I59A 4O0BA 4B3ME 3T0HA 3QT5A 1ZW9A 4R3MA 5FNFA 1AMWA 4DU8A 4DR5I 2YGEA 3R4PA 3WU3A 3GIFA 1YESA 4LF5I 1H73A 1HR0E 3JAMQ 4EGHA 5LL6R 3PYFA 4GFNA 4EMDA 1GKXA 1Z59A 4HZ5A 4U7OA 4GKJI 2FYPA 2YKCA 4CE2A 4XC0A 3RLRA 4XD8A 3HYZA 1UYKA 1I94I 3HEKA 3HZ5A 3OTOE 4O04A 1HNXE 3J7AM 1Z0WA 3U67A 4HY6A 4LF4I 1GKZA 5IN9A 2VWCA 2YEFA 1TH8A 1IBKI 4P8OA 4ASAA 1OSFA 1KKHA 2ZKJA 4MYTA 2GQPA 3B25A 1J5EE 2WI2A 2E5LI 3OWBA 1XMOI 3U2DA 1IBLE 1S16A 1NHIA 3D0BA 3K97A 1NZ0A 4YKRA 3VHCA 1KVKA 1YSRA 2QG0A 4UROA 1UY7A 4YKTA 5J6AA 2WI3A 1JM6A 1XHKA 5F3KA 4ED4A 4LF9E 1TC0A 4KSGA 2X36A 4PU9A 4DR4E 4QPKA 1I5DA 1XNQI 4DUYE 4LF8I 2HKEA 1Z0TA 4DV4E 5M4MA 3Q5JA 4O07A 4BIZA 3DGEA 3HHUA 2VCJA 4GT8A 3R4OA 4AWOA 5LMNI 2HHHE 4LF6E 2V2VA 2ZM6E 5M4KA 1B3QA 1Z0CA 1N36E 3Q5KA 3SL2A 4NH8A 4MPEA 2ZITA 1FWLA 3ZZ0A 1YC1A 1UYFA 3INWA 2BV3A 4DR7I 2O1WA 4HACB 3C0EA 4NXMI 4JYAI 1UY6A 3B28A 3EKRA 2VF3A 4BQJA 4EMVA 4URMA 4Q20A 4X65E 2Q2EB 5LMUE 4LFCI 3OWDA 4YY3E 5FLXC 3J80C 4YKQA 5GGZA 1FI4A 1N32I 2CG9A 1YT2A 1UYIA 3K17A 2O1VA 2WEPA 2WW4A 3RKZA 1U2OA 4GQTA 4L94A 4AS9A 2WI7A 3GONA 1N34I 2YGAA 4EGKA 3PEHA 5F5RA 3JZ3A 2YEHA 2UXCE 2BSMA 5CF0A 1NHJA 1D6TA 3J81C 3A0ZA 4JI1E 2HFSA 4I5SA 4JG4A 4B3SE 1ZM4A 2ZDXA 2VQFE 4CE3A 3RLQA 4LFBI 2XEXA 4M1KA 3LTOA 1Y4UA 2FWYA 4K0KE 1XNRE 3HYYA 3T1YI 4LWIA 1AJ6A 1Y4SA 5C93A 2BU8A 2QF6A 2WEQA 2CH4A 2DEJA 1MU5A 2UUCE 2XHTA 2XX2A 4FCQA 1PKPA 4HXWA 2CCUA 4DV6E 2QG2A 3K1JA 4NH7A 1S4EA 3OMUA 3FV5A 1UYDA 1H7UA 4DPYA 4JI3E 5CTXA 4DV2E 4WUDA 1RREA 4DV1I 3WU5A 1YS3A 4FMTA 5GMDA 4XKKA 4H85A 4FWDA 4DR2I 3H4LA 4JI4I 4KP4A 4R3AA 2CZ9A 3INXA 2LJPA 4LFAI 3G7BA 4MPCA 1EA6A 2IOPA 4KQVA 2WERA 3B8HA 4X62E 2YKBA 4RPFA 1VISA 5A2QC 1GJVA 4FW9A 2XX4A 5FNCA 1BKNA 1MX0A 4CWOA 2R3VA 1HNWE 1QYEA 2YEEA 3J7AG 1Z0EA 4NXNE 1PIEA 1N33E 1S14A 4DUZI 5IT9C 2Q8HA 4B3RE 2UXDI 2V2ZA 2A2DA 4JV5E 2GFDA 1FWKA 2QFOA 2BU7A 3CRLA 4E00A 4JI2I 2YI5A 1ID0A 4ASFA 1DARA 4L93A 4DR5E 4LPBA 2Q8IA 3BMYA 2A2CA 4LF5E 4DXLA 4PL9A 2BU2A 2CCSA 3TZ0A 2XD6A 1R62A 1MG7A 1UYHA 2V8PA 4GKJE 3Q1QA 3B26A 1FKAE 2XHXA 2YE3A 1THNA 3WQ9A 3G7EA 4BAEA 1I94E 4DV5I 2O1UA 2F4VI 4AQYI 3O2FA 4LF4E 4KHPI 5FLXQ 1IBKE 2YEBA 2YI6A 2XX5A 1A6FA 2YKIA 4JAVA 1H7SA 4CWFA 2YK2A 2E5LE 4QPJA 4URNA 1XMQI 1XMOE 2YE6A 1TIDA 3TTZA 2YE9A 4BXIA 4DPWA 1IBMI 4AWQA 5D6QA 1HNZI 4BQGA 3ZM7A 1BYQA 2H55A 4XKOA 1YETA 4FWGA 5FWKA 4CWTA 1XNQE 1FJGI 2XDSA 4LF8E 4DR1I 4DPTA 4DV3I 4JQLA 4MYUA 1AM1A 3GIGB 4MPNA 4JI5I 2Q8GA 4X64I 2YEJA 5BR8I 4KSHA 5LMNE 2BU6A 1UYGA 2DEIA 3OPDA 4XTJA 4X66I 3PEJA 2BREA 4ZKIA 3T1HI 2UWDA 4GKKI 4DR7E 4FPPA 3T1KA 4JI0I 2ZBKB 1U2RA 3PYDA 4NXME 4JYAE 1Y8PA 3QTFA 5M4NA 5CTWA 3JAMC 2ZDYA 4XKAA 4CWRA 2ESAA 4P52A 2VW5A 3A0XA 4E02A 4XIQA 2UUBI 2YI7A 3ZZTA 2XK2A 4GEEA 4DV7I 4LFCE 2YEAA 2YE5A 4FCPA 5GMEA 4X9LA 2WI5A 1KZNA 3ZKBA 4USMA 1N32E 4DU7A 2BRCA 2YE4A 4U93A 3T2SA 1N34E 2E1RA 4E01A 1A4HA 4YKUA 2YJXA 5A2QQ 1Z5CA 1I5CA 4DV0I 2IWSA 3KE6A 3HULA 1UYEA 3K98A 4B3TI 5IT9Q 2WI6A 4LFBE 2UXBI 1QY8A 2WI4A 1I5BA 2GS8A 2JKIA 3VADA 5M4EA 3T1YE 2XJGA 4JI6I 2YKEA 2YE7A 4JI8I 4EGIA 4XCLA 4MB9A 3A0RA 3QT6A 3WU4A 3T10A 2VQEI 1N0UA 4HZ0A 1WUUA 3Q5LA 2UU9I 3O0IA 3R4MA 1TC6A 3A0WA 2V2QA 4H7QA 3A0TA 2XDKA 1BXDA 4Z7YA 2HFUA 4DR6I 3EHHA 4AWPA 3D2RA 5IDMA 4DV1E 4YKXA 4P7AA 3QT7A 2YEDA 5D7RA 4W7TA 1Z5AA 4DR2E 4JI7I 1I5AA 4MBCA 3B82A 4JI4E 1U0ZA 3LPSA 4HY1A 1UYMA 4USKA 2IWUA 4O05A 4YKZA 4CWNA 4LFAE 4OX9I 4LWFA 4YHHI 4K4OA 3EHGA 4HACA 4GGLA 2NPFA 3V2UC 5IWAI 4PRXA 3R91A 1ZXNA 3PYEA 3U2KA 1Z0GA 4DUZE 1Z5BA 4LF7I 2UXDE 3C11A 4YKWA 2V34A 1ZWHA 1K47A 4JI2E 3GIEA 3F0NA 4ZVIA 2UUAI 2AKPA 4ASGA 4DPXA 4B6CA 4Z7CA 4DUHA 4B3MI 3T0ZA 4URLA 2K5BA 2R42A 2PNRA 3O6OA 1H74A 1HR0I 1ZM2A 4XE2A 1L0OA 3MNRP 4FN5A 4WUCA 5BOCA 2WI1A 4DV5E 4UT4A 2E0AA 1ELOA 3J80Q 4DR3I 2F4VE 4AQYE 3EHFA 5D7DA 4UTGA 1UY9A 4KHPE 4DR3E 4HYPA 3OTOI 1ZM9A 1HNXI 4U7NA 2YKJA 1UYCA 4ASBA 1XMQE 4XCJA 2XDLA 2X7IA 1ZXMA 2XDUA 1N0VC 1IBME 1KTVA 1HNZE 2BM1A 3J81Q 1J5EI 2VCIA 3OW6A 3IEDA 4H81A 3D36A 4EEHA 4FCRA 1IBLI 1H72C 3WHAA 2XJJA 3ZXQA 3NMQA 1FJGE 2IORA 1YSZA 4CWPA 3TZ2A 3CRKA 4DR1E 4JASA 1TBWA 4LP0A 4DV3E 1YC4A 2YGFA 4EFTA 4LF9I 4JI5E 4DR4I 4X64E 2JJCA 5BR8E 3BM9A 2BYIA 4DUYI 3K99A 4XIPA 2XDXA 2HK2A 4DV4I 5L3JA 4X66E 3TZ5A 3B27A 1YT1A 4WUBA 3T1HE 3CGZA 4GKKE 2HCHA 3EHJA 3FT5A 3M6AA 4BIUA 2BT0A 4LWGA 5M4HA 2HHHI 4JI0E 4LF6I 4LWHA 2ZM6I 5J71A 4L90A 3TUHA 2AJ4A 1N36I 3B78A 4LWEA 1KIJA 4CWSA 2YEIA 2HKJA 2UUBE 2BM0A 4KTNA 5CTYA 3HZ1A 4DV7E 3VHAA 3LNUA 1FNMA 1Z0VA 3WU6A 4MP7A 4O09A 2YE8A 2EFGA 4X65I 5LMUI 3FT8A 2YE2A 4MP2A 4YY3I 4R1FA 2XHRA 2HK3A 1EI1A 4HYMA 4DZYA 3TZ4A 4EM7A 4I3HA 2XABA 5CPHA 1OJ4A 1BGQA 5D7CA 1AH6A 2J7KA 3ZKDA 2FXSA 4KFGA 4NH9A 4V25A 4DV0E 3G75A 4B7PA 4B3TE 2BZ5A 2UXBE 2YJWA 2UXCI 4XIRA 4XITA 4PRVA 1B62A 4V26A 2Q8FA 4JI1I 4JI6E 4B3SI 5M4PA 2VQFI 4FWHA 3V5RA 4JI8E 3ZZUA 2XCMA 3PYGA 5FNDA 2VQEE 2EXLA 4K0KI 1XNRI 2UU9E 4EFUA 1PVGA 4L8ZA 3H80A 1UEKA 2HG1A 3D4JA 2UUCI 3CWVA 4DR6E 4GCZA 5D6PA 4L91A 2XJXA 4DV6I 3CGYA 2CCTA 3GIGA 3K60A 1Z0BA 1UY8A 1ZM3A 2YEGA 4JI7E 4JI3I 2BTZA 4DV2I 1AH8A 1UYLA 4OX9E 1YERA 4YHHE 2YK9A
chains in the Genus database with same CATH superfamily
2YI0A 1B63A 5IDJA 4OO1B 2BYHA 3CYGA 3QDDA 1TILA 1USUA 2IOQA 2JE6B 5IWAE 3B24A 2OI2A 2HHIA 3R4NA 2C37B 5C0XA 4JAUA 3ZXOA 2YECA 3QT8A 3RLPA 5BODA 1RR9A 2C2AA 4CWQA 4X62I 2H8MA 4XDMA 1YC3A 4YKYA 4NBQA 1NHHA 4LF7E 4U3DA 2JEAB 1Y8NA 2FWZA 4MOTA 4HXZA 3R92A 1I58A 1QZRA 1HNWI 2BU5A 3VHDA 4NXNI 2UUAE 1N33I 2IWXA 1Y8OA 2CGFA 4B3RI 4DPUA 1US7A 3A0YA 3EKOA 4JV5I 4CE1A 1YT0A 5CTUA 1I59A 4O0BA 2Z5CA 4B3ME 2CVEA 3T0HA 5K36B 2E0AA 3QT5A 2F1DA 1ZW9A 4R3MA 1AMWA 5FNFA 4DU8A 4DR5I 2YGEA 3R4PA 3WU3A 3GIFA 1YESA 4LF5I 1H73A 1HR0E 3JAMQ 4EGHA 5LL6R 2PNZA 3PYFA 4GFNA 4EMDA 1GKXA 1Z59A 4HZ5A 4U7OA 1E3HA 4GKJI 2FYPA 2YKCA 4CE2A 3GCMA 4XC0A 3S5TA 4ISAA 3RLRA 4XD8A 3HYZA 1UYKA 3HJCA 4MU1A 1I94I 2WP8B 3NZKA 3HEKA 3HZ5A 3OTOE 4O04A 1HNXE 3J7AM 1Z0WA 3U67A 4HY6A 4LF4I 5JENA 1GKZA 5IN9A 2VWCA 2PO2A 2YEFA 1TH8A 1IBKI 2O3ZA 4P8OA 4ASAA 1OSFA 1KKHA 3H1CA 4MYTA 2GQPA 2ZKJA 3B25A 1J5EE 2WI2A 3GLLA 2E5LI 3OWBA 1XMOI 3U2DA 1IBLE 1S16A 1NHIA 3D0BA 4LCHA 1NZ0A 2Z5BB 3K97A 1KVKA 4YKRA 3VHCA 1YSRA 2QG0A 4UROA 1UY7A 4YKTA 5J6AA 3U1KA 2WI3A 1JM6A 1XHKA 5F3KA 4ED4A 4LF9E 1TC0A 4KSGA 2X36A 4PU9A 4DR4E 3PS1A 4QPKA 1I5DA 2Z5EA 1XNQI 4IZKA 5DNXA 4DUYE 4LF8I 2HKEA 1Z0TA 4DV4E 5M4MA 3Q5JA 2C39A 4O07A 4BIZA 1OYSA 3DGEA 5C0XF 2NN6B 3HHUA 4FW4A 2VCJA 4GT8A 3R4OA 4AWOA 5LMNI 2HHHE 4LF6E 2V2VA 2ZM6E 5M4KA 1B3QA 4IFDB 1Z0CA 1N36E 3Q5KA 3M85G 4NH8A 4MPEA 3SL2A 2ZITA 1FWLA 4MDTA 3ZZ0A 1YC1A 1UYFA 1UDQA 3INWA 2BV3A 4DR7I 2O1WA 4HACB 3C0EA 1UDOA 4NXMI 3L7ZB 5JEAD 4JYAI 1UY6A 2VF3A 3B28A 3EKRA 4BQJA 4IZJA 4EMVA 4URMA 5C0XC 4Q20A 4X65E 2Q2EB 5LMUE 4LFCI 3OWDA 4YY3E 5FLXC 3J80C 4YKQA 5GGZA 1FI4A 3P3CA 1N32I 2CG9A 1YT2A 1UYIA 3K17A 2O1VA 2WEPA 2WW4A 3RKZA 3B4TA 1U2OA 4GQTA 4L94A 4AS9A 2WI7A 3GONA 1N34I 2YGAA 4EGKA 5C0XD 3PEHA 4MU4A 5F5RA 2JEBA 3JZ3A 2YEHA 2UXCE 2BSMA 5CF0A 4BA1B 1NHJA 1D6TA 3J81C 3A0ZA 4JI1E 2HFSA 4FW5A 4JG4A 4B3SE 1ZM4A 2ZDXA 2VQFE 4I5SA 4CE3A 3RLQA 4LFBI 2GO4A 2GQ0A 2XEXA 4M1KA 2IESA 3LTOA 1Y4UA 2FWYA 4K0KE 5K36D 1XNRE 3HYYA 3T1YI 4LWIA 1Y4SA 1AJ6A 5C93A 2BU8A 2QF6A 1Y5YA 2WEQA 1Y6ZA 2CH4A 2DEJA 1MU5A 2UUCE 2PO0A 3EHJA 2XHTA 2XX2A 4FCQA 1PKPA 4HXWA 2JT2A 4E72A 2CCUA 4DV6E 2QG2A 3K1JA 4NH7A 4OKGA 2BA0G 1S4EA 4OO1E 3OMUA 3FV5A 1UYDA 1H7UA 1R6MA 4DPYA 4JI3E 5CTXA 4DV2E 4WUDA 1RREA 4DV1I 3WU5A 1YS3A 4FMTA 5GMDA 4BIUA 4XKKA 4H85A 4FWDA 4DR2I 3H4LA 4JI4I 2BR2A 4KP4A 3P3GA 4R3AA 2CZ9A 3INXA 2LJPA 4LFAI 3G7BA 4MPCA 1EA6A 2IOPA 4KQVA 2WERA 3B8HA 4X62E 2YKBA 4RPFA 1VISA 5A2QC 1GJVA 4FW9A 2XX4A 5FNCA 1BKNA 1MX0A 4QNJA 4CWOA 2R3VA 1HNWE 1QYEA 2YEEA 5K36E 3J7AG 1Z0EA 4NXNE 1PIEA 1N33E 1S14A 4DUZI 2WNRA 2C38B 5IT9C 2Q8HA 4B3RE 2UXDI 1R6LA 2V2ZA 2A2DA 4JV5E 2GFDA 1FWKA 2QFOA 2BU7A 3CRLA 4E00A 4JI2I 2YI5A 1ID0A 4ASFA 1DARA 4L93A 4DR5E 4LPBA 4MU3A 4QNKA 2Q8IA 4BA2B 3BMYA 2A2CA 4LF5E 4DXLA 4PL9A 2BU2A 2CCSA 3TZ0A 2XD6A 3CDIA 5ELWA 1R62A 1MG7A 1UYHA 2V8PA 3PS2A 4GKJE 3Q1QA 3B26A 1FKAE 2XHXA 2YE3A 1THNA 3WQ9A 3G7EA 4FW6A 5DRPA 4IZJD 4BAEA 1I94E 4DV5I 2O1UA 2F4VI 4AQYI 3O2FA 4LF4E 4KHPI 5FLXQ 1IBKE 2YEBA 2YI6A 2XX5A 1A6FA 2YKIA 1RHYA 4JAVA 3U1YA 1H7SA 4CWFA 2YK2A 2BA1D 2E5LE 3UHMA 4QPJA 4URNA 1XMQI 1XMOE 2YE6A 1TIDA 3TTZA 2YE9A 4BXIA 4DPWA 1IBMI 4AWQA 5D6QA 1HNZI 4BQGA 2PO1B 3ZM7A 2NN6E 1BYQA 2H55A 5FWKA 1YETA 4FWGA 4XKOA 4CWTA 4U3BA 4OO1A 1XNQE 1FJGI 2J65A 4IFDE 2XDSA 2JE6A 4LF8E 2C37A 4DR1I 4DPTA 5JEAB 4DV3I 3CDJA 4MYUA 1AM1A 3GIGB 4JI5I 4JQLA 4MPNA 4X64I 4OZEA 2YEJA 5BR8I 2JEAA 4KSHA 5LMNE 2PNLA 2BU6A 3P06A 1UYGA 2DEIA 3OPDA 4XTJA 4X66I 3PEJA 2BREA 4ZKIA 4MQYA 3T1HI 4GKKI 2UWDA 4AIDA 4DR7E 4FPPA 3T1KA 4JI0I 2ZBKB 3DD6A 1U2RA 3PYDA 5DNLA 4NXME 4JYAE 1Y8PA 3QTFA 5CTWA 5M4NA 4FW7A 3JAMC 2ZDYA 4XKAA 4CWRA 2ESAA 4P52A 5K36A 5C0XB 2VW5A 3A0XA 4E02A 4XIQA 2UUBI 2YI7A 3ZZTA 1IXMA 2XK2A 4GEEA 4DV7I 4LFCE 2YEAA 2YE5A 4FCPA 5GMEA 4X9LA 2WI5A 1KZNA 3ZKBA 4USMA 1N32E 4DU7A 2BRCA 2YE4A 4U93A 3T2SA 1N34E 2E1RA 4E01A 1A4HA 4YKUA 2Z5CB 2YJXA 5A2QQ 3PS3A 1Z5CA 1I5CA 2WP8A 4DV0I 2IWSA 3KE6A 3HULA 3Q6MA 1UDSA 4LCFA 1UYEA 4B3TI 3K98A 5IT9Q 2WI6A 3HKMA 4LFBE 2UXBI 1QY8A 2PNZB 2WI4A 1I5BA 3LMMA 2GS8A 2JKIA 3VADA 5M4EA 3T1YE 2XJGA 4JI6I 2YKEA 2YE7A 3PRYA 4JI8I 2BA1G 4EGIA 4XCLA 4MB9A 4LOMA 1YH8A 3QT6A 2Z5BA 3WU4A 3A0RA 2VQEI 1N0UA 3K85A 1WUUA 4HZ0A 3T10A 3Q5LA 2UU9I 3O0IA 3R4MA 1TC6A 4FW3A 3A0WA 2O1TA 2V2QA 4H7QA 2PO2B 3A0TA 2XDKA 1BXDA 4J3DA 4Z7YA 2HFUA 4DR6I 2AE8A 3KRNA 5EKWA 4OO1F 2C1GA 3D2RA 3EHHA 4AWPA 5IDMA 2NN6A 3GMEA 4DV1E 4YKXA 4P7AA 3QT7A 2YEDA 5D7RA 4W7TA 1Z5AA 4DR2E 4JI7I 1XXEA 4IFDA 1I5AA 2GO3A 3B82A 4JI4E 1U0ZA 4MBCA 3LPSA 4HY1A 1UYMA 4USKA 2IWUA 4O05A 4YKZA 4CWNA 4LFAE 4OX9I 4LWFA 4YHHI 4K4OA 3EHGA 4HACA 3L7ZA 4GGLA 2NPFA 3V2UC 4IZKB 4OO1C 1F51A 5IWAI 2C1IA 4PRXA 3R91A 1ZXNA 3PYEA 2C39B 3U2KA 1Z0GA 4DUZE 5K36F 1Z5BA 4LF7I 3M7ND 2UXDE 3C11A 4YKWA 2V34A 1ZWHA 1K47A 4JI2E 3GIEA 3F0NA 4ZVIA 2UUAI 4OO1D 2AKPA 3M85D 4ASGA 4DPXA 2PNMA 4Z7CA 4B6CA 4DUHA 1UDNA 4B3MI 4IZJB 2VESA 3T0ZA 4URLA 5K36C 2K5BA 4BA1A 2R42A 2PNRA 3O6OA 1H74A 1HR0I 1USVA 1ZM2A 4XE2A 1L0OA 3MNRP 4FN5A 4WUCA 5BOCA 2WI1A 4GQUA 4UT4A 5DRQA 1ELOA 3Q6NA 3J80Q 4DV5E 4DR3I 4AQYE 3P3EA 2JEBB 2F4VE 2FTKA 3EHFA 5D7DA 4UTGA 1UY9A 4KHPE 4DR3E 4HYPA 3OTOI 1ZM9A 1HNXI 4U7NA 1OYRA 2YKJA 1UYCA 4ASBA 1XMQE 4XCJA 2XDLA 2X7IA 1ZXMA 2XDUA 4N3OA 1N0VC 1IBME 1KTVA 1HNZE 2BM1A 3J81Q 1J5EI 2VCIA 3OW6A 3IEDA 5JEAE 4H81A 3D36A 4EEHA 4FCRA 1IBLI 1H72C 2NN6F 2XJJA 3WHAA 3ZXQA 3NMQA 1FJGE 2IORA 1YSZA 4CWPA 2PO0B 3TZ2A 5JEAF 4AM3A 4IFDF 3CRKA 4DR1E 4JASA 1TBWA 4LP0A 4IS9A 4LCGA 4DV3E 1YC4A 2YGFA 4EFTA 4LF9I 4JI5E 4DR4I 4X64E 2JJCA 5BR8E 3BM9A 2BYIA 1VI7A 4DUYI 3K99A 4XIPA 2XDXA 2CGEA 2BA0D 2HK2A 4DV4I 5L3JA 4X66E 5C0XE 1P42A 3TZ5A 3B27A 1YT1A 4WUBA 1OYPA 1Y60A 2NN6C 2C38A 3T1HE 4GKKE 3M6AA 2HCHA 3FT5A 2BT0A 4LWGA 5M4HA 2HHHI 4JI0E 4LF6I 4LWHA 5DRRA 2ZM6I 5JEAC 3M7NG 4L90A 4IFDC 2AJ4A 5J71A 1N36I 3B78A 3TUHA 2BR2B 5EL9A 4LWEA 1KIJA 4CWSA 2YEIA 2HKJA 2UUBE 2BM0A 4KTNA 5CTYA 3HZ1A 4DV7E 3VHAA 4BA2A 3LNUA 1FNMA 2NN6D 1Z0VA 3WU6A 4MP7A 4O09A 2YE8A 2EFGA 4X65I 5DROA 4IFDD 5LMUI 3FT8A 2IERA 2WNRB 2YE2A 4MP2A 4YY3I 4R1FA 2XHRA 2HK3A 1EI1A 4HYMA 4DZYA 3TZ4A 4EM7A 4I3HA 2XABA 5CPHA 1OJ4A 1BGQA 5D7CA 1AH6A 2J7KA 3ZKDA 2FXSA 4KFGA 4NH9A 4V25A 4AIMA 4DV0E 3G75A 4B7PA 4B3TE 2BZ5A 2UXBE 2YJWA 2UXCI 4XIRA 4XITA 1E3PA 4PRVA 1B62A 4V26A 2Q8GA 2Q8FA 4JI1I 4JI6E 4B3SI 5M4PA 2VQFI 4FWHA 4LPFA 4JI8E 3V5RA 3ZZUA 2XCMA 3PYGA 5FNDA 2VQEE 2EXLA 4K0KI 1XNRI 3CGZA 2UU9E 2PO1A 4EFUA 1PVGA 4L8ZA 3H80A 1UEKA 2HG1A 3D4JA 2UUCI 3CWVA 4DR6E 4GCZA 5D6PA 5JEAA 4L91A 2XJXA 4DV6I 3CGYA 2CCTA 3GIGA 3K60A 1Z0BA 1UY8A 1ZM3A 4MU0A 2YEGA 4JI7E 4JI3I 2BTZA 1YHCA 4DV2I 1HK7A 1AH8A 3P76A 1UYLA 4OX9E 1YERA 4YHHE 2YK9A
chains in the Genus database with same CATH topology
2YI0A 1B63A 5IDJA 2BYHA 3QDDA 1TILA 1USUA 2IOQA 5IWAE 3B24A 3R4NA 2OI2A 4JAUA 3ZXOA 2YECA 3QT8A 3RLPA 5BODA 1RR9A 2C2AA 4CWQA 4X62I 2H8MA 4XDMA 1YC3A 4YKYA 4LF7E 1NHHA 1Y8NA 4MOTA 2FWZA 4HXZA 3R92A 1I58A 1QZRA 1HNWI 2BU5A 3VHDA 4NXNI 2UUAE 1N33I 2IWXA 1Y8OA 2CGFA 4B3RI 4DPUA 1US7A 3A0YA 3EKOA 4JV5I 4CE1A 1YT0A 5CTUA 1I59A 4O0BA 2Z5CA 4B3ME 3T0HA 3QT5A 1ZW9A 4R3MA 5FNFA 1AMWA 4DU8A 4DR5I 2YGEA 3R4PA 3WU3A 3GIFA 1YESA 4LF5I 1H73A 1HR0E 3JAMQ 4EGHA 5LL6R 3PYFA 4GFNA 4EMDA 1GKXA 1Z59A 4HZ5A 4U7OA 4GKJI 2FYPA 2YKCA 4CE2A 4XC0A 3RLRA 4XD8A 3HYZA 1UYKA 3HJCA 1I94I 3HEKA 3HZ5A 3OTOE 4O04A 1HNXE 3J7AM 1Z0WA 3U67A 4HY6A 4LF4I 1GKZA 5IN9A 2VWCA 2YEFA 1TH8A 1IBKI 4P8OA 4ASAA 1OSFA 1KKHA 2ZKJA 4MYTA 2GQPA 3B25A 1J5EE 2WI2A 2E5LI 3OWBA 1XMOI 3U2DA 1IBLE 1S16A 1NHIA 3D0BA 3K97A 1NZ0A 2Z5BB 4YKRA 1KVKA 3VHCA 1YSRA 2QG0A 4UROA 1UY7A 4YKTA 5J6AA 2WI3A 1JM6A 1XHKA 5F3KA 4ED4A 4LF9E 1TC0A 4KSGA 2X36A 4PU9A 4DR4E 4QPKA 1I5DA 2Z5EA 1XNQI 4IZKA 4DUYE 4LF8I 2HKEA 1Z0TA 4DV4E 5M4MA 3Q5JA 4O07A 4BIZA 3DGEA 3HHUA 2VCJA 4GT8A 3R4OA 4AWOA 5LMNI 2HHHE 4LF6E 2V2VA 2ZM6E 5M4KA 1B3QA 1Z0CA 1N36E 3Q5KA 3SL2A 4NH8A 4MPEA 2ZITA 1FWLA 3ZZ0A 1YC1A 1UYFA 3INWA 2BV3A 4DR7I 2O1WA 4HACB 3C0EA 4NXMI 4JYAI 1UY6A 3B28A 3EKRA 2VF3A 4BQJA 4IZJA 4EMVA 4URMA 4Q20A 4X65E 2Q2EB 5LMUE 4LFCI 3OWDA 4YY3E 5FLXC 3J80C 4YKQA 5GGZA 1FI4A 1N32I 2CG9A 1YT2A 1UYIA 3K17A 2O1VA 2WEPA 2WW4A 3RKZA 1U2OA 4GQTA 4L94A 4AS9A 2WI7A 3GONA 1N34I 2YGAA 4EGKA 3PEHA 5F5RA 3JZ3A 2YEHA 2UXCE 2BSMA 5CF0A 1NHJA 1D6TA 3J81C 3A0ZA 4JI1E 2HFSA 4I5SA 4JG4A 4B3SE 1ZM4A 2ZDXA 2VQFE 4CE3A 3RLQA 4LFBI 2XEXA 2GQ0A 4M1KA 3LTOA 1Y4UA 2FWYA 4K0KE 1XNRE 3HYYA 3T1YI 4LWIA 1Y4SA 1AJ6A 5C93A 2BU8A 2QF6A 2WEQA 1Y6ZA 2CH4A 2DEJA 1MU5A 2UUCE 2XHTA 2XX2A 4FCQA 1PKPA 4HXWA 2CCUA 4DV6E 2QG2A 3K1JA 4NH7A 1S4EA 3OMUA 3FV5A 1UYDA 1H7UA 4DPYA 4JI3E 5CTXA 4DV2E 4WUDA 1RREA 4DV1I 3WU5A 1YS3A 4FMTA 5GMDA 4XKKA 4H85A 4FWDA 4DR2I 3H4LA 4JI4I 4KP4A 4R3AA 2CZ9A 3INXA 2LJPA 4LFAI 3G7BA 4MPCA 1EA6A 2IOPA 4KQVA 2WERA 3B8HA 4X62E 2YKBA 4RPFA 1VISA 5A2QC 1GJVA 4FW9A 2XX4A 5FNCA 1BKNA 1MX0A 4CWOA 2R3VA 1HNWE 1QYEA 2YEEA 3J7AG 1Z0EA 4NXNE 1PIEA 1N33E 1S14A 4DUZI 5IT9C 2Q8HA 4B3RE 2UXDI 2V2ZA 2A2DA 4JV5E 2GFDA 1FWKA 2QFOA 2BU7A 3CRLA 4E00A 4JI2I 2YI5A 1ID0A 4ASFA 1DARA 4L93A 4DR5E 4LPBA 2Q8IA 3BMYA 2A2CA 4LF5E 4DXLA 4PL9A 2BU2A 2CCSA 3TZ0A 2XD6A 1R62A 1MG7A 1UYHA 2V8PA 4GKJE 3Q1QA 3B26A 1FKAE 2XHXA 2YE3A 1THNA 3WQ9A 3G7EA 4IZJD 4BAEA 1I94E 4DV5I 2O1UA 2F4VI 4AQYI 3O2FA 4LF4E 4KHPI 5FLXQ 1IBKE 2YEBA 2YI6A 2XX5A 1A6FA 2YKIA 4JAVA 1H7SA 4CWFA 2YK2A 2E5LE 4QPJA 4URNA 1XMQI 1XMOE 2YE6A 1TIDA 3TTZA 2YE9A 4BXIA 4DPWA 1IBMI 4AWQA 5D6QA 1HNZI 4BQGA 3ZM7A 1BYQA 2H55A 5FWKA 1YETA 4FWGA 4XKOA 4CWTA 1XNQE 1FJGI 2XDSA 4LF8E 4DR1I 4DPTA 4DV3I 4JQLA 4MYUA 1AM1A 3GIGB 4MPNA 4JI5I 2Q8GA 4X64I 2YEJA 5BR8I 4KSHA 5LMNE 2PNLA 2BU6A 3P06A 1UYGA 2DEIA 3OPDA 4XTJA 4X66I 3PEJA 2BREA 4ZKIA 3T1HI 2UWDA 4GKKI 4DR7E 4FPPA 3T1KA 4JI0I 2ZBKB 1U2RA 3PYDA 4NXME 4JYAE 1Y8PA 3QTFA 5M4NA 5CTWA 3JAMC 2ZDYA 4XKAA 4CWRA 2ESAA 4P52A 2VW5A 3A0XA 4E02A 4XIQA 2UUBI 2YI7A 3ZZTA 2XK2A 4GEEA 4DV7I 4LFCE 2YEAA 2YE5A 4FCPA 5GMEA 4X9LA 2WI5A 1KZNA 3ZKBA 4USMA 1N32E 4DU7A 2BRCA 2YE4A 4U93A 3T2SA 1N34E 2E1RA 4E01A 1A4HA 4YKUA 2Z5CB 2YJXA 5A2QQ 1Z5CA 1I5CA 4DV0I 2IWSA 3KE6A 3HULA 3Q6MA 1UYEA 3K98A 4B3TI 5IT9Q 2WI6A 4LFBE 2UXBI 1QY8A 2WI4A 1I5BA 2GS8A 2JKIA 3VADA 5M4EA 3T1YE 2XJGA 4JI6I 2YKEA 2YE7A 3PRYA 4JI8I 4EGIA 4XCLA 4MB9A 3A0RA 2Z5BA 3QT6A 3WU4A 3T10A 2VQEI 1N0UA 3K85A 1WUUA 4HZ0A 3Q5LA 2UU9I 3O0IA 3R4MA 1TC6A 3A0WA 2O1TA 2V2QA 4H7QA 3A0TA 2XDKA 1BXDA 4Z7YA 2HFUA 4DR6I 3EHHA 4AWPA 3D2RA 5IDMA 4DV1E 4YKXA 4P7AA 3QT7A 2YEDA 5D7RA 4W7TA 1Z5AA 4DR2E 4JI7I 1I5AA 4MBCA 3B82A 4JI4E 1U0ZA 3LPSA 4HY1A 1UYMA 4USKA 2IWUA 4O05A 4YKZA 4CWNA 4LFAE 4OX9I 4LWFA 4YHHI 4K4OA 3EHGA 4HACA 4GGLA 2NPFA 3V2UC 4IZKB 5IWAI 4PRXA 3R91A 1ZXNA 3PYEA 3U2KA 1Z0GA 4DUZE 1Z5BA 4LF7I 2UXDE 3C11A 4YKWA 2V34A 1ZWHA 1K47A 4JI2E 3GIEA 3F0NA 4ZVIA 2UUAI 2AKPA 4ASGA 4DPXA 2PNMA 4Z7CA 4B6CA 4DUHA 4B3MI 4IZJB 3T0ZA 4URLA 2K5BA 2R42A 2PNRA 3O6OA 1H74A 1HR0I 1USVA 1ZM2A 4XE2A 1L0OA 3MNRP 4FN5A 4WUCA 5BOCA 2WI1A 4DV5E 4UT4A 2E0AA 1ELOA 3Q6NA 3J80Q 4DR3I 2F4VE 4AQYE 3EHFA 5D7DA 4UTGA 1UY9A 4KHPE 4DR3E 4HYPA 3OTOI 1ZM9A 1HNXI 4U7NA 2YKJA 1UYCA 4ASBA 1XMQE 4XCJA 2XDLA 2X7IA 1ZXMA 2XDUA 4N3OA 1N0VC 1IBME 1KTVA 1HNZE 2BM1A 3J81Q 1J5EI 2VCIA 3OW6A 3IEDA 4H81A 3D36A 4EEHA 4FCRA 1IBLI 1H72C 3WHAA 2XJJA 3ZXQA 3NMQA 1FJGE 2IORA 1YSZA 4CWPA 3TZ2A 3CRKA 4DR1E 4JASA 1TBWA 4LP0A 4DV3E 1YC4A 2YGFA 4EFTA 4LF9I 4JI5E 4DR4I 4X64E 2JJCA 5BR8E 3BM9A 2BYIA 4DUYI 3K99A 4XIPA 2XDXA 2CGEA 2HK2A 4DV4I 5L3JA 4X66E 3TZ5A 3B27A 1YT1A 4WUBA 3T1HE 3CGZA 4GKKE 2HCHA 3EHJA 3FT5A 3M6AA 4BIUA 2BT0A 4LWGA 5M4HA 2HHHI 4JI0E 4LF6I 4LWHA 2ZM6I 5J71A 4L90A 3TUHA 2AJ4A 1N36I 3B78A 4LWEA 1KIJA 4CWSA 2YEIA 2HKJA 2UUBE 2BM0A 4KTNA 5CTYA 3HZ1A 4DV7E 3VHAA 3LNUA 1FNMA 1Z0VA 3WU6A 4MP7A 4O09A 2YE8A 2EFGA 4X65I 5LMUI 3FT8A 2YE2A 4MP2A 4YY3I 4R1FA 2XHRA 2HK3A 1EI1A 4HYMA 4DZYA 3TZ4A 4EM7A 4I3HA 2XABA 5CPHA 1OJ4A 1BGQA 5D7CA 1AH6A 2J7KA 3ZKDA 2FXSA 4KFGA 4NH9A 4V25A 4DV0E 3G75A 4B7PA 4B3TE 2BZ5A 2UXBE 2YJWA 2UXCI 4XIRA 4XITA 4PRVA 1B62A 4V26A 2Q8FA 4JI1I 4JI6E 4B3SI 5M4PA 2VQFI 4FWHA 3V5RA 4JI8E 3ZZUA 2XCMA 3PYGA 5FNDA 2VQEE 2EXLA 4K0KI 1XNRI 2UU9E 4EFUA 1PVGA 4L8ZA 3H80A 1UEKA 2HG1A 3D4JA 2UUCI 3CWVA 4DR6E 4GCZA 5D6PA 4L91A 2XJXA 4DV6I 3CGYA 2CCTA 3GIGA 3K60A 1Z0BA 1UY8A 1ZM3A 2YEGA 4JI7E 4JI3I 2BTZA 4DV2I 1HK7A 1AH8A 1UYLA 4OX9E 1YERA 4YHHE 2YK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YI0 A;  1B63 A;  5IDJ A;  2BYH A;  3QDD A;  1TIL A;  3B24 A;  5IWA E;  2IOQ A;  3R4N A;  2OI2 A;  4JAU A;  3ZXO A;  2YEC A;  3QT8 A;  3RLP A;  5BOD A;  1RR9 A;  2C2A A;  4CWQ A;  4X62 I;  2H8M A;  4XDM A;  1YC3 A;  4YKY A;  4LF7 E;  1NHH A;  1Y8N A;  4MOT A;  2FWZ A;  4HXZ A;  3R92 A;  1I58 A;  1QZR A;  1HNW I;  2BU5 A;  3VHD A;  4NXN I;  2UUA E;  1N33 I;  2IWX A;  1Y8O A;  2CGF A;  4B3R I;  4DPU A;  1US7 A;  3A0Y A;  3EKO A;  4JV5 I;  4CE1 A;  1YT0 A;  5CTU A;  1I59 A;  4O0B A;  4B3M E;  3T0H A;  3QT5 A;  1ZW9 A;  4R3M A;  5FNF A;  1AMW A;  4DU8 A;  4DR5 I;  2YGE A;  3R4P A;  3WU3 A;  3GIF A;  1YES A;  4LF5 I;  1H73 A;  1HR0 E;  3JAM Q;  4EGH A;  5LL6 R;  3PYF A;  4GFN A;  4EMD A;  1GKX A;  1Z59 A;  4HZ5 A;  4U7O A;  4GKJ I;  2FYP A;  2YKC A;  4CE2 A;  4XC0 A;  3RLR A;  4XD8 A;  3HYZ A;  1UYK A;  1I94 I;  3HEK A;  3HZ5 A;  3OTO E;  4O04 A;  1HNX E;  3J7A M;  1Z0W A;  3U67 A;  4HY6 A;  4LF4 I;  1GKZ A;  5IN9 A;  2VWC A;  2YEF A;  1TH8 A;  1IBK I;  4P8O A;  4ASA A;  1OSF A;  1KKH A;  2ZKJ A;  4MYT A;  2GQP A;  3B25 A;  1J5E E;  2WI2 A;  2E5L I;  3OWB A;  1XMO I;  3U2D A;  1IBL E;  1S16 A;  1NHI A;  3D0B A;  3K97 A;  1NZ0 A;  4YKR A;  3VHC A;  1KVK A;  1YSR A;  2QG0 A;  4URO A;  1UY7 A;  4YKT A;  5J6A A;  2WI3 A;  1JM6 A;  1XHK A;  5F3K A;  4ED4 A;  4LF9 E;  1TC0 A;  4KSG A;  2X36 A;  4PU9 A;  4DR4 E;  4QPK A;  1I5D A;  1XNQ I;  4DUY E;  4LF8 I;  2HKE A;  1Z0T A;  4DV4 E;  5M4M A;  3Q5J A;  4O07 A;  4BIZ A;  3DGE A;  3HHU A;  2VCJ A;  4GT8 A;  3R4O A;  4AWO A;  5LMN I;  2HHH E;  4LF6 E;  2V2V A;  2ZM6 E;  5M4K A;  1B3Q A;  1Z0C A;  1N36 E;  3Q5K A;  3SL2 A;  4NH8 A;  4MPE A;  2ZIT A;  1FWL A;  3ZZ0 A;  1YC1 A;  1UYF A;  3INW A;  2BV3 A;  4DR7 I;  2O1W A;  4HAC B;  3C0E A;  4NXM I;  4JYA I;  1UY6 A;  3B28 A;  3EKR A;  2VF3 A;  4BQJ A;  4EMV A;  4URM A;  4Q20 A;  4X65 E;  2Q2E B;  5LMU E;  4LFC I;  3OWD A;  4YY3 E;  5FLX C;  3J80 C;  4YKQ A;  5GGZ A;  1FI4 A;  1N32 I;  2CG9 A;  1YT2 A;  1UYI A;  3K17 A;  2O1V A;  2WEP A;  2WW4 A;  3RKZ A;  1U2O A;  4GQT A;  4L94 A;  4AS9 A;  2WI7 A;  3GON A;  1N34 I;  2YGA A;  4EGK A;  3PEH A;  5F5R A;  3JZ3 A;  2YEH A;  2UXC E;  2BSM A;  5CF0 A;  1NHJ A;  1D6T A;  3J81 C;  3A0Z A;  4JI1 E;  2HFS A;  4I5S A;  4JG4 A;  4B3S E;  1ZM4 A;  2ZDX A;  2VQF E;  4CE3 A;  3RLQ A;  4LFB I;  2XEX A;  4M1K A;  3LTO A;  1Y4U A;  2FWY A;  4K0K E;  1XNR E;  3HYY A;  3T1Y I;  4LWI A;  1AJ6 A;  1Y4S A;  5C93 A;  2BU8 A;  2QF6 A;  2WEQ A;  2CH4 A;  2DEJ A;  1MU5 A;  2UUC E;  2XHT A;  2XX2 A;  4FCQ A;  1PKP A;  4HXW A;  2CCU A;  4DV6 E;  2QG2 A;  3K1J A;  4NH7 A;  1S4E A;  3OMU A;  3FV5 A;  1UYD A;  1H7U A;  4DPY A;  4JI3 E;  5CTX A;  4DV2 E;  4WUD A;  1RRE A;  4DV1 I;  3WU5 A;  1YS3 A;  4FMT A;  5GMD A;  4XKK A;  4H85 A;  4FWD A;  4DR2 I;  3H4L A;  4JI4 I;  4KP4 A;  4R3A A;  2CZ9 A;  3INX A;  2LJP A;  4LFA I;  3G7B A;  4MPC A;  1EA6 A;  2IOP A;  4KQV A;  2WER A;  3B8H A;  4X62 E;  2YKB A;  4RPF A;  1VIS A;  5A2Q C;  1GJV A;  4FW9 A;  2XX4 A;  5FNC A;  1BKN A;  1MX0 A;  4CWO A;  2R3V A;  1HNW E;  1QYE A;  2YEE A;  3J7A G;  1Z0E A;  4NXN E;  1PIE A;  1N33 E;  1S14 A;  4DUZ I;  5IT9 C;  2Q8H A;  4B3R E;  2UXD I;  2V2Z A;  2A2D A;  4JV5 E;  2GFD A;  1FWK A;  2QFO A;  2BU7 A;  3CRL A;  4E00 A;  4JI2 I;  2YI5 A;  1ID0 A;  4ASF A;  1DAR A;  4L93 A;  4DR5 E;  4LPB A;  2Q8I A;  3BMY A;  2A2C A;  4LF5 E;  4DXL A;  4PL9 A;  2BU2 A;  2CCS A;  3TZ0 A;  2XD6 A;  1R62 A;  1MG7 A;  1UYH A;  2V8P A;  4GKJ E;  3Q1Q A;  3B26 A;  1FKA E;  2XHX A;  2YE3 A;  1THN A;  3WQ9 A;  3G7E A;  4BAE A;  1I94 E;  4DV5 I;  2O1U A;  2F4V I;  4AQY I;  3O2F A;  4LF4 E;  4KHP I;  5FLX Q;  1IBK E;  2YEB A;  2YI6 A;  2XX5 A;  1A6F A;  2YKI A;  4JAV A;  1H7S A;  4CWF A;  2YK2 A;  2E5L E;  4QPJ A;  4URN A;  1XMQ I;  1XMO E;  2YE6 A;  1TID A;  3TTZ A;  2YE9 A;  4BXI A;  4DPW A;  1IBM I;  4AWQ A;  5D6Q A;  1HNZ I;  4BQG A;  3ZM7 A;  1BYQ A;  2H55 A;  4XKO A;  1YET A;  4FWG A;  5FWK A;  4CWT A;  1XNQ E;  1FJG I;  2XDS A;  4LF8 E;  4DR1 I;  4DPT A;  4DV3 I;  4JQL A;  4MYU A;  1AM1 A;  3GIG B;  4MPN A;  4JI5 I;  2Q8G A;  4X64 I;  2YEJ A;  5BR8 I;  4KSH A;  5LMN E;  2BU6 A;  1UYG A;  2DEI A;  3OPD A;  4XTJ A;  4X66 I;  3PEJ A;  2BRE A;  4ZKI A;  3T1H I;  2UWD A;  4GKK I;  4DR7 E;  4FPP A;  3T1K A;  4JI0 I;  2ZBK B;  1U2R A;  3PYD A;  4NXM E;  4JYA E;  1Y8P A;  3QTF A;  5M4N A;  5CTW A;  3JAM C;  2ZDY A;  4XKA A;  4CWR A;  2ESA A;  4P52 A;  2VW5 A;  3A0X A;  4E02 A;  4XIQ A;  2UUB I;  2YI7 A;  3ZZT A;  2XK2 A;  4GEE A;  4DV7 I;  4LFC E;  2YEA A;  2YE5 A;  4FCP A;  5GME A;  4X9L A;  2WI5 A;  1KZN A;  3ZKB A;  4USM A;  1N32 E;  4DU7 A;  2BRC A;  2YE4 A;  4U93 A;  3T2S A;  1N34 E;  2E1R A;  4E01 A;  1A4H A;  4YKU A;  2YJX A;  5A2Q Q;  1Z5C A;  1I5C A;  4DV0 I;  2IWS A;  3KE6 A;  3HUL A;  1UYE A;  3K98 A;  4B3T I;  5IT9 Q;  2WI6 A;  4LFB E;  2UXB I;  1QY8 A;  2WI4 A;  1I5B A;  2GS8 A;  2JKI A;  3VAD A;  5M4E A;  3T1Y E;  2XJG A;  4JI6 I;  2YKE A;  2YE7 A;  4JI8 I;  4EGI A;  4XCL A;  4MB9 A;  3A0R A;  3QT6 A;  3WU4 A;  3T10 A;  2VQE I;  1N0U A;  4HZ0 A;  1WUU A;  3Q5L A;  2UU9 I;  3O0I A;  3R4M A;  1TC6 A;  3A0W A;  2V2Q A;  4H7Q A;  3A0T A;  2XDK A;  1BXD A;  4Z7Y A;  2HFU A;  4DR6 I;  3EHH A;  4AWP A;  3D2R A;  5IDM A;  4DV1 E;  4YKX A;  4P7A A;  3QT7 A;  2YED A;  5D7R A;  4W7T A;  1Z5A A;  4DR2 E;  4JI7 I;  1I5A A;  4MBC A;  3B82 A;  4JI4 E;  1U0Z A;  3LPS A;  4HY1 A;  1UYM A;  4USK A;  2IWU A;  4O05 A;  4YKZ A;  4CWN A;  4LFA E;  4OX9 I;  4LWF A;  4YHH I;  4K4O A;  3EHG A;  4HAC A;  4GGL A;  2NPF A;  3V2U C;  5IWA I;  4PRX A;  3R91 A;  1ZXN A;  3PYE A;  3U2K A;  1Z0G A;  4DUZ E;  1Z5B A;  4LF7 I;  2UXD E;  3C11 A;  4YKW A;  2V34 A;  1ZWH A;  1K47 A;  4JI2 E;  3GIE A;  3F0N A;  4ZVI A;  2UUA I;  2AKP A;  4ASG A;  4DPX A;  4B6C A;  4Z7C A;  4DUH A;  4B3M I;  3T0Z A;  4URL A;  2K5B A;  2R42 A;  2PNR A;  3O6O A;  1H74 A;  1HR0 I;  1ZM2 A;  4XE2 A;  1L0O A;  3MNR P;  4FN5 A;  4WUC A;  5BOC A;  2WI1 A;  4DV5 E;  4UT4 A;  2E0A A;  1ELO A;  3J80 Q;  4DR3 I;  2F4V E;  4AQY E;  3EHF A;  5D7D A;  4UTG A;  1UY9 A;  4KHP E;  4DR3 E;  4HYP A;  3OTO I;  1ZM9 A;  1HNX I;  4U7N A;  2YKJ A;  1UYC A;  4ASB A;  1XMQ E;  4XCJ A;  2XDL A;  2X7I A;  1ZXM A;  2XDU A;  1N0V C;  1IBM E;  1KTV A;  1HNZ E;  2BM1 A;  3J81 Q;  1J5E I;  2VCI A;  3OW6 A;  3IED A;  4H81 A;  3D36 A;  4EEH A;  4FCR A;  1IBL I;  1H72 C;  3WHA A;  2XJJ A;  3ZXQ A;  3NMQ A;  1FJG E;  2IOR A;  1YSZ A;  4CWP A;  3TZ2 A;  3CRK A;  4DR1 E;  4JAS A;  1TBW A;  4LP0 A;  4DV3 E;  1YC4 A;  2YGF A;  4EFT A;  4LF9 I;  4JI5 E;  4DR4 I;  4X64 E;  2JJC A;  5BR8 E;  3BM9 A;  2BYI A;  4DUY I;  3K99 A;  4XIP A;  2XDX A;  2HK2 A;  4DV4 I;  5L3J A;  4X66 E;  3TZ5 A;  3B27 A;  1YT1 A;  4WUB A;  3T1H E;  3CGZ A;  4GKK E;  2HCH A;  3EHJ A;  3FT5 A;  3M6A A;  4BIU A;  2BT0 A;  4LWG A;  5M4H A;  2HHH I;  4JI0 E;  4LF6 I;  4LWH A;  2ZM6 I;  5J71 A;  4L90 A;  3TUH A;  2AJ4 A;  1N36 I;  3B78 A;  4LWE A;  1KIJ A;  4CWS A;  2YEI A;  2HKJ A;  2UUB E;  2BM0 A;  4KTN A;  5CTY A;  3HZ1 A;  4DV7 E;  3VHA A;  3LNU A;  1FNM A;  1Z0V A;  3WU6 A;  4MP7 A;  4O09 A;  2YE8 A;  2EFG A;  4X65 I;  5LMU I;  3FT8 A;  2YE2 A;  4MP2 A;  4YY3 I;  4R1F A;  2XHR A;  2HK3 A;  1EI1 A;  4HYM A;  4DZY A;  3TZ4 A;  4EM7 A;  4I3H A;  2XAB A;  5CPH A;  1OJ4 A;  1BGQ A;  5D7C A;  1AH6 A;  2J7K A;  3ZKD A;  2FXS A;  4KFG A;  4NH9 A;  4V25 A;  4DV0 E;  3G75 A;  4B7P A;  4B3T E;  2BZ5 A;  2UXB E;  2YJW A;  2UXC I;  4XIR A;  4XIT A;  4PRV A;  1B62 A;  4V26 A;  2Q8F A;  4JI1 I;  4JI6 E;  4B3S I;  5M4P A;  2VQF I;  4FWH A;  3V5R A;  4JI8 E;  3ZZU A;  2XCM A;  3PYG A;  5FND A;  2VQE E;  2EXL A;  4K0K I;  1XNR I;  2UU9 E;  4EFU A;  1PVG A;  4L8Z A;  3H80 A;  1UEK A;  2HG1 A;  3D4J A;  2UUC I;  3CWV A;  4DR6 E;  4GCZ A;  5D6P A;  4L91 A;  2XJX A;  4DV6 I;  3CGY A;  2CCT A;  3GIG A;  3K60 A;  1Z0B A;  1UY8 A;  1ZM3 A;  2YEG A;  4JI7 E;  4JI3 I;  2BTZ A;  4DV2 I;  1AH8 A;  1UYL A;  4OX9 E;  1YER A;  4YHH E;  2YK9 A; 
#chains in the Genus database with same CATH topology
 2YI0 A;  1B63 A;  5IDJ A;  4OO1 B;  2BYH A;  3CYG A;  3QDD A;  1TIL A;  1USU A;  2IOQ A;  2JE6 B;  5IWA E;  3B24 A;  2OI2 A;  2HHI A;  3R4N A;  2C37 B;  5C0X A;  4JAU A;  3ZXO A;  2YEC A;  3QT8 A;  3RLP A;  5BOD A;  1RR9 A;  2C2A A;  4CWQ A;  4X62 I;  2H8M A;  4XDM A;  1YC3 A;  4YKY A;  4NBQ A;  1NHH A;  4LF7 E;  4U3D A;  2JEA B;  1Y8N A;  2FWZ A;  4MOT A;  4HXZ A;  3R92 A;  1I58 A;  1QZR A;  1HNW I;  2BU5 A;  3VHD A;  4NXN I;  2UUA E;  1N33 I;  2IWX A;  1Y8O A;  2CGF A;  4B3R I;  4DPU A;  1US7 A;  3A0Y A;  3EKO A;  4JV5 I;  4CE1 A;  1YT0 A;  5CTU A;  1I59 A;  4O0B A;  2Z5C A;  4B3M E;  2CVE A;  3T0H A;  5K36 B;  2E0A A;  3QT5 A;  2F1D A;  1ZW9 A;  4R3M A;  1AMW A;  5FNF A;  4DU8 A;  4DR5 I;  2YGE A;  3R4P A;  3WU3 A;  3GIF A;  1YES A;  4LF5 I;  1H73 A;  1HR0 E;  3JAM Q;  4EGH A;  5LL6 R;  2PNZ A;  3PYF A;  4GFN A;  4EMD A;  1GKX A;  1Z59 A;  4HZ5 A;  4U7O A;  1E3H A;  4GKJ I;  2FYP A;  2YKC A;  4CE2 A;  3GCM A;  4XC0 A;  3S5T A;  4ISA A;  3RLR A;  4XD8 A;  3HYZ A;  1UYK A;  3HJC A;  4MU1 A;  1I94 I;  2WP8 B;  3NZK A;  3HEK A;  3HZ5 A;  3OTO E;  4O04 A;  1HNX E;  3J7A M;  1Z0W A;  3U67 A;  4HY6 A;  4LF4 I;  5JEN A;  1GKZ A;  5IN9 A;  2VWC A;  2PO2 A;  2YEF A;  1TH8 A;  1IBK I;  2O3Z A;  4P8O A;  4ASA A;  1OSF A;  1KKH A;  3H1C A;  4MYT A;  2GQP A;  2ZKJ A;  3B25 A;  1J5E E;  2WI2 A;  3GLL A;  2E5L I;  3OWB A;  1XMO I;  3U2D A;  1IBL E;  1S16 A;  1NHI A;  3D0B A;  4LCH A;  1NZ0 A;  2Z5B B;  3K97 A;  1KVK A;  4YKR A;  3VHC A;  1YSR A;  2QG0 A;  4URO A;  1UY7 A;  4YKT A;  5J6A A;  3U1K A;  2WI3 A;  1JM6 A;  1XHK A;  5F3K A;  4ED4 A;  4LF9 E;  1TC0 A;  4KSG A;  2X36 A;  4PU9 A;  4DR4 E;  3PS1 A;  4QPK A;  1I5D A;  2Z5E A;  1XNQ I;  4IZK A;  5DNX A;  4DUY E;  4LF8 I;  2HKE A;  1Z0T A;  4DV4 E;  5M4M A;  3Q5J A;  2C39 A;  4O07 A;  4BIZ A;  1OYS A;  3DGE A;  5C0X F;  2NN6 B;  3HHU A;  4FW4 A;  2VCJ A;  4GT8 A;  3R4O A;  4AWO A;  5LMN I;  2HHH E;  4LF6 E;  2V2V A;  2ZM6 E;  5M4K A;  1B3Q A;  4IFD B;  1Z0C A;  1N36 E;  3Q5K A;  3M85 G;  4NH8 A;  4MPE A;  3SL2 A;  2ZIT A;  1FWL A;  4MDT A;  3ZZ0 A;  1YC1 A;  1UYF A;  1UDQ A;  3INW A;  2BV3 A;  4DR7 I;  2O1W A;  4HAC B;  3C0E A;  1UDO A;  4NXM I;  3L7Z B;  5JEA D;  4JYA I;  1UY6 A;  2VF3 A;  3B28 A;  3EKR A;  4BQJ A;  4IZJ A;  4EMV A;  4URM A;  5C0X C;  4Q20 A;  4X65 E;  2Q2E B;  5LMU E;  4LFC I;  3OWD A;  4YY3 E;  5FLX C;  3J80 C;  4YKQ A;  5GGZ A;  1FI4 A;  3P3C A;  1N32 I;  2CG9 A;  1YT2 A;  1UYI A;  3K17 A;  2O1V A;  2WEP A;  2WW4 A;  3RKZ A;  3B4T A;  1U2O A;  4GQT A;  4L94 A;  4AS9 A;  2WI7 A;  3GON A;  1N34 I;  2YGA A;  4EGK A;  5C0X D;  3PEH A;  4MU4 A;  5F5R A;  2JEB A;  3JZ3 A;  2YEH A;  2UXC E;  2BSM A;  5CF0 A;  4BA1 B;  1NHJ A;  1D6T A;  3J81 C;  3A0Z A;  4JI1 E;  2HFS A;  4FW5 A;  4JG4 A;  4B3S E;  1ZM4 A;  2ZDX A;  2VQF E;  4I5S A;  4CE3 A;  3RLQ A;  4LFB I;  2GO4 A;  2GQ0 A;  2XEX A;  4M1K A;  2IES A;  3LTO A;  1Y4U A;  2FWY A;  4K0K E;  5K36 D;  1XNR E;  3HYY A;  3T1Y I;  4LWI A;  1Y4S A;  1AJ6 A;  5C93 A;  2BU8 A;  2QF6 A;  1Y5Y A;  2WEQ A;  1Y6Z A;  2CH4 A;  2DEJ A;  1MU5 A;  2UUC E;  2PO0 A;  3EHJ A;  2XHT A;  2XX2 A;  4FCQ A;  1PKP A;  4HXW A;  2JT2 A;  4E72 A;  2CCU A;  4DV6 E;  2QG2 A;  3K1J A;  4NH7 A;  4OKG A;  2BA0 G;  1S4E A;  4OO1 E;  3OMU A;  3FV5 A;  1UYD A;  1H7U A;  1R6M A;  4DPY A;  4JI3 E;  5CTX A;  4DV2 E;  4WUD A;  1RRE A;  4DV1 I;  3WU5 A;  1YS3 A;  4FMT A;  5GMD A;  4BIU A;  4XKK A;  4H85 A;  4FWD A;  4DR2 I;  3H4L A;  4JI4 I;  2BR2 A;  4KP4 A;  3P3G A;  4R3A A;  2CZ9 A;  3INX A;  2LJP A;  4LFA I;  3G7B A;  4MPC A;  1EA6 A;  2IOP A;  4KQV A;  2WER A;  3B8H A;  4X62 E;  2YKB A;  4RPF A;  1VIS A;  5A2Q C;  1GJV A;  4FW9 A;  2XX4 A;  5FNC A;  1BKN A;  1MX0 A;  4QNJ A;  4CWO A;  2R3V A;  1HNW E;  1QYE A;  2YEE A;  5K36 E;  3J7A G;  1Z0E A;  4NXN E;  1PIE A;  1N33 E;  1S14 A;  4DUZ I;  2WNR A;  2C38 B;  5IT9 C;  2Q8H A;  4B3R E;  2UXD I;  1R6L A;  2V2Z A;  2A2D A;  4JV5 E;  2GFD A;  1FWK A;  2QFO A;  2BU7 A;  3CRL A;  4E00 A;  4JI2 I;  2YI5 A;  1ID0 A;  4ASF A;  1DAR A;  4L93 A;  4DR5 E;  4LPB A;  4MU3 A;  4QNK A;  2Q8I A;  4BA2 B;  3BMY A;  2A2C A;  4LF5 E;  4DXL A;  4PL9 A;  2BU2 A;  2CCS A;  3TZ0 A;  2XD6 A;  3CDI A;  5ELW A;  1R62 A;  1MG7 A;  1UYH A;  2V8P A;  3PS2 A;  4GKJ E;  3Q1Q A;  3B26 A;  1FKA E;  2XHX A;  2YE3 A;  1THN A;  3WQ9 A;  3G7E A;  4FW6 A;  5DRP A;  4IZJ D;  4BAE A;  1I94 E;  4DV5 I;  2O1U A;  2F4V I;  4AQY I;  3O2F A;  4LF4 E;  4KHP I;  5FLX Q;  1IBK E;  2YEB A;  2YI6 A;  2XX5 A;  1A6F A;  2YKI A;  1RHY A;  4JAV A;  3U1Y A;  1H7S A;  4CWF A;  2YK2 A;  2BA1 D;  2E5L E;  3UHM A;  4QPJ A;  4URN A;  1XMQ I;  1XMO E;  2YE6 A;  1TID A;  3TTZ A;  2YE9 A;  4BXI A;  4DPW A;  1IBM I;  4AWQ A;  5D6Q A;  1HNZ I;  4BQG A;  2PO1 B;  3ZM7 A;  2NN6 E;  1BYQ A;  2H55 A;  5FWK A;  1YET A;  4FWG A;  4XKO A;  4CWT A;  4U3B A;  4OO1 A;  1XNQ E;  1FJG I;  2J65 A;  4IFD E;  2XDS A;  2JE6 A;  4LF8 E;  2C37 A;  4DR1 I;  4DPT A;  5JEA B;  4DV3 I;  3CDJ A;  4MYU A;  1AM1 A;  3GIG B;  4JI5 I;  4JQL A;  4MPN A;  4X64 I;  4OZE A;  2YEJ A;  5BR8 I;  2JEA A;  4KSH A;  5LMN E;  2PNL A;  2BU6 A;  3P06 A;  1UYG A;  2DEI A;  3OPD A;  4XTJ A;  4X66 I;  3PEJ A;  2BRE A;  4ZKI A;  4MQY A;  3T1H I;  4GKK I;  2UWD A;  4AID A;  4DR7 E;  4FPP A;  3T1K A;  4JI0 I;  2ZBK B;  3DD6 A;  1U2R A;  3PYD A;  5DNL A;  4NXM E;  4JYA E;  1Y8P A;  3QTF A;  5CTW A;  5M4N A;  4FW7 A;  3JAM C;  2ZDY A;  4XKA A;  4CWR A;  2ESA A;  4P52 A;  5K36 A;  5C0X B;  2VW5 A;  3A0X A;  4E02 A;  4XIQ A;  2UUB I;  2YI7 A;  3ZZT A;  1IXM A;  2XK2 A;  4GEE A;  4DV7 I;  4LFC E;  2YEA A;  2YE5 A;  4FCP A;  5GME A;  4X9L A;  2WI5 A;  1KZN A;  3ZKB A;  4USM A;  1N32 E;  4DU7 A;  2BRC A;  2YE4 A;  4U93 A;  3T2S A;  1N34 E;  2E1R A;  4E01 A;  1A4H A;  4YKU A;  2Z5C B;  2YJX A;  5A2Q Q;  3PS3 A;  1Z5C A;  1I5C A;  2WP8 A;  4DV0 I;  2IWS A;  3KE6 A;  3HUL A;  3Q6M A;  1UDS A;  4LCF A;  1UYE A;  4B3T I;  3K98 A;  5IT9 Q;  2WI6 A;  3HKM A;  4LFB E;  2UXB I;  1QY8 A;  2PNZ B;  2WI4 A;  1I5B A;  3LMM A;  2GS8 A;  2JKI A;  3VAD A;  5M4E A;  3T1Y E;  2XJG A;  4JI6 I;  2YKE A;  2YE7 A;  3PRY A;  4JI8 I;  2BA1 G;  4EGI A;  4XCL A;  4MB9 A;  4LOM A;  1YH8 A;  3QT6 A;  2Z5B A;  3WU4 A;  3A0R A;  2VQE I;  1N0U A;  3K85 A;  1WUU A;  4HZ0 A;  3T10 A;  3Q5L A;  2UU9 I;  3O0I A;  3R4M A;  1TC6 A;  4FW3 A;  3A0W A;  2O1T A;  2V2Q A;  4H7Q A;  2PO2 B;  3A0T A;  2XDK A;  1BXD A;  4J3D A;  4Z7Y A;  2HFU A;  4DR6 I;  2AE8 A;  3KRN A;  5EKW A;  4OO1 F;  2C1G A;  3D2R A;  3EHH A;  4AWP A;  5IDM A;  2NN6 A;  3GME A;  4DV1 E;  4YKX A;  4P7A A;  3QT7 A;  2YED A;  5D7R A;  4W7T A;  1Z5A A;  4DR2 E;  4JI7 I;  1XXE A;  4IFD A;  1I5A A;  2GO3 A;  3B82 A;  4JI4 E;  1U0Z A;  4MBC A;  3LPS A;  4HY1 A;  1UYM A;  4USK A;  2IWU A;  4O05 A;  4YKZ A;  4CWN A;  4LFA E;  4OX9 I;  4LWF A;  4YHH I;  4K4O A;  3EHG A;  4HAC A;  3L7Z A;  4GGL A;  2NPF A;  3V2U C;  4IZK B;  4OO1 C;  1F51 A;  5IWA I;  2C1I A;  4PRX A;  3R91 A;  1ZXN A;  3PYE A;  2C39 B;  3U2K A;  1Z0G A;  4DUZ E;  5K36 F;  1Z5B A;  4LF7 I;  3M7N D;  2UXD E;  3C11 A;  4YKW A;  2V34 A;  1ZWH A;  1K47 A;  4JI2 E;  3GIE A;  3F0N A;  4ZVI A;  2UUA I;  4OO1 D;  2AKP A;  3M85 D;  4ASG A;  4DPX A;  2PNM A;  4Z7C A;  4B6C A;  4DUH A;  1UDN A;  4B3M I;  4IZJ B;  2VES A;  3T0Z A;  4URL A;  5K36 C;  2K5B A;  4BA1 A;  2R42 A;  2PNR A;  3O6O A;  1H74 A;  1HR0 I;  1USV A;  1ZM2 A;  4XE2 A;  1L0O A;  3MNR P;  4FN5 A;  4WUC A;  5BOC A;  2WI1 A;  4GQU A;  4UT4 A;  5DRQ A;  1ELO A;  3Q6N A;  3J80 Q;  4DV5 E;  4DR3 I;  4AQY E;  3P3E A;  2JEB B;  2F4V E;  2FTK A;  3EHF A;  5D7D A;  4UTG A;  1UY9 A;  4KHP E;  4DR3 E;  4HYP A;  3OTO I;  1ZM9 A;  1HNX I;  4U7N A;  1OYR A;  2YKJ A;  1UYC A;  4ASB A;  1XMQ E;  4XCJ A;  2XDL A;  2X7I A;  1ZXM A;  2XDU A;  4N3O A;  1N0V C;  1IBM E;  1KTV A;  1HNZ E;  2BM1 A;  3J81 Q;  1J5E I;  2VCI A;  3OW6 A;  3IED A;  5JEA E;  4H81 A;  3D36 A;  4EEH A;  4FCR A;  1IBL I;  1H72 C;  2NN6 F;  2XJJ A;  3WHA A;  3ZXQ A;  3NMQ A;  1FJG E;  2IOR A;  1YSZ A;  4CWP A;  2PO0 B;  3TZ2 A;  5JEA F;  4AM3 A;  4IFD F;  3CRK A;  4DR1 E;  4JAS A;  1TBW A;  4LP0 A;  4IS9 A;  4LCG A;  4DV3 E;  1YC4 A;  2YGF A;  4EFT A;  4LF9 I;  4JI5 E;  4DR4 I;  4X64 E;  2JJC A;  5BR8 E;  3BM9 A;  2BYI A;  1VI7 A;  4DUY I;  3K99 A;  4XIP A;  2XDX A;  2CGE A;  2BA0 D;  2HK2 A;  4DV4 I;  5L3J A;  4X66 E;  5C0X E;  1P42 A;  3TZ5 A;  3B27 A;  1YT1 A;  4WUB A;  1OYP A;  1Y60 A;  2NN6 C;  2C38 A;  3T1H E;  4GKK E;  3M6A A;  2HCH A;  3FT5 A;  2BT0 A;  4LWG A;  5M4H A;  2HHH I;  4JI0 E;  4LF6 I;  4LWH A;  5DRR A;  2ZM6 I;  5JEA C;  3M7N G;  4L90 A;  4IFD C;  2AJ4 A;  5J71 A;  1N36 I;  3B78 A;  3TUH A;  2BR2 B;  5EL9 A;  4LWE A;  1KIJ A;  4CWS A;  2YEI A;  2HKJ A;  2UUB E;  2BM0 A;  4KTN A;  5CTY A;  3HZ1 A;  4DV7 E;  3VHA A;  4BA2 A;  3LNU A;  1FNM A;  2NN6 D;  1Z0V A;  3WU6 A;  4MP7 A;  4O09 A;  2YE8 A;  2EFG A;  4X65 I;  5DRO A;  4IFD D;  5LMU I;  3FT8 A;  2IER A;  2WNR B;  2YE2 A;  4MP2 A;  4YY3 I;  4R1F A;  2XHR A;  2HK3 A;  1EI1 A;  4HYM A;  4DZY A;  3TZ4 A;  4EM7 A;  4I3H A;  2XAB A;  5CPH A;  1OJ4 A;  1BGQ A;  5D7C A;  1AH6 A;  2J7K A;  3ZKD A;  2FXS A;  4KFG A;  4NH9 A;  4V25 A;  4AIM A;  4DV0 E;  3G75 A;  4B7P A;  4B3T E;  2BZ5 A;  2UXB E;  2YJW A;  2UXC I;  4XIR A;  4XIT A;  1E3P A;  4PRV A;  1B62 A;  4V26 A;  2Q8G A;  2Q8F A;  4JI1 I;  4JI6 E;  4B3S I;  5M4P A;  2VQF I;  4FWH A;  4LPF A;  4JI8 E;  3V5R A;  3ZZU A;  2XCM A;  3PYG A;  5FND A;  2VQE E;  2EXL A;  4K0K I;  1XNR I;  3CGZ A;  2UU9 E;  2PO1 A;  4EFU A;  1PVG A;  4L8Z A;  3H80 A;  1UEK A;  2HG1 A;  3D4J A;  2UUC I;  3CWV A;  4DR6 E;  4GCZ A;  5D6P A;  5JEA A;  4L91 A;  2XJX A;  4DV6 I;  3CGY A;  2CCT A;  3GIG A;  3K60 A;  1Z0B A;  1UY8 A;  1ZM3 A;  4MU0 A;  2YEG A;  4JI7 E;  4JI3 I;  2BTZ A;  1YHC A;  4DV2 I;  1HK7 A;  1AH8 A;  3P76 A;  1UYL A;  4OX9 E;  1YER A;  4YHH E;  2YK9 A; 
#chains in the Genus database with same CATH homology
 2YI0 A;  1B63 A;  5IDJ A;  2BYH A;  3QDD A;  1TIL A;  1USU A;  2IOQ A;  5IWA E;  3B24 A;  3R4N A;  2OI2 A;  4JAU A;  3ZXO A;  2YEC A;  3QT8 A;  3RLP A;  5BOD A;  1RR9 A;  2C2A A;  4CWQ A;  4X62 I;  2H8M A;  4XDM A;  1YC3 A;  4YKY A;  4LF7 E;  1NHH A;  1Y8N A;  4MOT A;  2FWZ A;  4HXZ A;  3R92 A;  1I58 A;  1QZR A;  1HNW I;  2BU5 A;  3VHD A;  4NXN I;  2UUA E;  1N33 I;  2IWX A;  1Y8O A;  2CGF A;  4B3R I;  4DPU A;  1US7 A;  3A0Y A;  3EKO A;  4JV5 I;  4CE1 A;  1YT0 A;  5CTU A;  1I59 A;  4O0B A;  2Z5C A;  4B3M E;  3T0H A;  3QT5 A;  1ZW9 A;  4R3M A;  5FNF A;  1AMW A;  4DU8 A;  4DR5 I;  2YGE A;  3R4P A;  3WU3 A;  3GIF A;  1YES A;  4LF5 I;  1H73 A;  1HR0 E;  3JAM Q;  4EGH A;  5LL6 R;  3PYF A;  4GFN A;  4EMD A;  1GKX A;  1Z59 A;  4HZ5 A;  4U7O A;  4GKJ I;  2FYP A;  2YKC A;  4CE2 A;  4XC0 A;  3RLR A;  4XD8 A;  3HYZ A;  1UYK A;  3HJC A;  1I94 I;  3HEK A;  3HZ5 A;  3OTO E;  4O04 A;  1HNX E;  3J7A M;  1Z0W A;  3U67 A;  4HY6 A;  4LF4 I;  1GKZ A;  5IN9 A;  2VWC A;  2YEF A;  1TH8 A;  1IBK I;  4P8O A;  4ASA A;  1OSF A;  1KKH A;  2ZKJ A;  4MYT A;  2GQP A;  3B25 A;  1J5E E;  2WI2 A;  2E5L I;  3OWB A;  1XMO I;  3U2D A;  1IBL E;  1S16 A;  1NHI A;  3D0B A;  3K97 A;  1NZ0 A;  2Z5B B;  4YKR A;  1KVK A;  3VHC A;  1YSR A;  2QG0 A;  4URO A;  1UY7 A;  4YKT A;  5J6A A;  2WI3 A;  1JM6 A;  1XHK A;  5F3K A;  4ED4 A;  4LF9 E;  1TC0 A;  4KSG A;  2X36 A;  4PU9 A;  4DR4 E;  4QPK A;  1I5D A;  2Z5E A;  1XNQ I;  4IZK A;  4DUY E;  4LF8 I;  2HKE A;  1Z0T A;  4DV4 E;  5M4M A;  3Q5J A;  4O07 A;  4BIZ A;  3DGE A;  3HHU A;  2VCJ A;  4GT8 A;  3R4O A;  4AWO A;  5LMN I;  2HHH E;  4LF6 E;  2V2V A;  2ZM6 E;  5M4K A;  1B3Q A;  1Z0C A;  1N36 E;  3Q5K A;  3SL2 A;  4NH8 A;  4MPE A;  2ZIT A;  1FWL A;  3ZZ0 A;  1YC1 A;  1UYF A;  3INW A;  2BV3 A;  4DR7 I;  2O1W A;  4HAC B;  3C0E A;  4NXM I;  4JYA I;  1UY6 A;  3B28 A;  3EKR A;  2VF3 A;  4BQJ A;  4IZJ A;  4EMV A;  4URM A;  4Q20 A;  4X65 E;  2Q2E B;  5LMU E;  4LFC I;  3OWD A;  4YY3 E;  5FLX C;  3J80 C;  4YKQ A;  5GGZ A;  1FI4 A;  1N32 I;  2CG9 A;  1YT2 A;  1UYI A;  3K17 A;  2O1V A;  2WEP A;  2WW4 A;  3RKZ A;  1U2O A;  4GQT A;  4L94 A;  4AS9 A;  2WI7 A;  3GON A;  1N34 I;  2YGA A;  4EGK A;  3PEH A;  5F5R A;  3JZ3 A;  2YEH A;  2UXC E;  2BSM A;  5CF0 A;  1NHJ A;  1D6T A;  3J81 C;  3A0Z A;  4JI1 E;  2HFS A;  4I5S A;  4JG4 A;  4B3S E;  1ZM4 A;  2ZDX A;  2VQF E;  4CE3 A;  3RLQ A;  4LFB I;  2XEX A;  2GQ0 A;  4M1K A;  3LTO A;  1Y4U A;  2FWY A;  4K0K E;  1XNR E;  3HYY A;  3T1Y I;  4LWI A;  1Y4S A;  1AJ6 A;  5C93 A;  2BU8 A;  2QF6 A;  2WEQ A;  1Y6Z A;  2CH4 A;  2DEJ A;  1MU5 A;  2UUC E;  2XHT A;  2XX2 A;  4FCQ A;  1PKP A;  4HXW A;  2CCU A;  4DV6 E;  2QG2 A;  3K1J A;  4NH7 A;  1S4E A;  3OMU A;  3FV5 A;  1UYD A;  1H7U A;  4DPY A;  4JI3 E;  5CTX A;  4DV2 E;  4WUD A;  1RRE A;  4DV1 I;  3WU5 A;  1YS3 A;  4FMT A;  5GMD A;  4XKK A;  4H85 A;  4FWD A;  4DR2 I;  3H4L A;  4JI4 I;  4KP4 A;  4R3A A;  2CZ9 A;  3INX A;  2LJP A;  4LFA I;  3G7B A;  4MPC A;  1EA6 A;  2IOP A;  4KQV A;  2WER A;  3B8H A;  4X62 E;  2YKB A;  4RPF A;  1VIS A;  5A2Q C;  1GJV A;  4FW9 A;  2XX4 A;  5FNC A;  1BKN A;  1MX0 A;  4CWO A;  2R3V A;  1HNW E;  1QYE A;  2YEE A;  3J7A G;  1Z0E A;  4NXN E;  1PIE A;  1N33 E;  1S14 A;  4DUZ I;  5IT9 C;  2Q8H A;  4B3R E;  2UXD I;  2V2Z A;  2A2D A;  4JV5 E;  2GFD A;  1FWK A;  2QFO A;  2BU7 A;  3CRL A;  4E00 A;  4JI2 I;  2YI5 A;  1ID0 A;  4ASF A;  1DAR A;  4L93 A;  4DR5 E;  4LPB A;  2Q8I A;  3BMY A;  2A2C A;  4LF5 E;  4DXL A;  4PL9 A;  2BU2 A;  2CCS A;  3TZ0 A;  2XD6 A;  1R62 A;  1MG7 A;  1UYH A;  2V8P A;  4GKJ E;  3Q1Q A;  3B26 A;  1FKA E;  2XHX A;  2YE3 A;  1THN A;  3WQ9 A;  3G7E A;  4IZJ D;  4BAE A;  1I94 E;  4DV5 I;  2O1U A;  2F4V I;  4AQY I;  3O2F A;  4LF4 E;  4KHP I;  5FLX Q;  1IBK E;  2YEB A;  2YI6 A;  2XX5 A;  1A6F A;  2YKI A;  4JAV A;  1H7S A;  4CWF A;  2YK2 A;  2E5L E;  4QPJ A;  4URN A;  1XMQ I;  1XMO E;  2YE6 A;  1TID A;  3TTZ A;  2YE9 A;  4BXI A;  4DPW A;  1IBM I;  4AWQ A;  5D6Q A;  1HNZ I;  4BQG A;  3ZM7 A;  1BYQ A;  2H55 A;  5FWK A;  1YET A;  4FWG A;  4XKO A;  4CWT A;  1XNQ E;  1FJG I;  2XDS A;  4LF8 E;  4DR1 I;  4DPT A;  4DV3 I;  4JQL A;  4MYU A;  1AM1 A;  3GIG B;  4MPN A;  4JI5 I;  2Q8G A;  4X64 I;  2YEJ A;  5BR8 I;  4KSH A;  5LMN E;  2PNL A;  2BU6 A;  3P06 A;  1UYG A;  2DEI A;  3OPD A;  4XTJ A;  4X66 I;  3PEJ A;  2BRE A;  4ZKI A;  3T1H I;  2UWD A;  4GKK I;  4DR7 E;  4FPP A;  3T1K A;  4JI0 I;  2ZBK B;  1U2R A;  3PYD A;  4NXM E;  4JYA E;  1Y8P A;  3QTF A;  5M4N A;  5CTW A;  3JAM C;  2ZDY A;  4XKA A;  4CWR A;  2ESA A;  4P52 A;  2VW5 A;  3A0X A;  4E02 A;  4XIQ A;  2UUB I;  2YI7 A;  3ZZT A;  2XK2 A;  4GEE A;  4DV7 I;  4LFC E;  2YEA A;  2YE5 A;  4FCP A;  5GME A;  4X9L A;  2WI5 A;  1KZN A;  3ZKB A;  4USM A;  1N32 E;  4DU7 A;  2BRC A;  2YE4 A;  4U93 A;  3T2S A;  1N34 E;  2E1R A;  4E01 A;  1A4H A;  4YKU A;  2Z5C B;  2YJX A;  5A2Q Q;  1Z5C A;  1I5C A;  4DV0 I;  2IWS A;  3KE6 A;  3HUL A;  3Q6M A;  1UYE A;  3K98 A;  4B3T I;  5IT9 Q;  2WI6 A;  4LFB E;  2UXB I;  1QY8 A;  2WI4 A;  1I5B A;  2GS8 A;  2JKI A;  3VAD A;  5M4E A;  3T1Y E;  2XJG A;  4JI6 I;  2YKE A;  2YE7 A;  3PRY A;  4JI8 I;  4EGI A;  4XCL A;  4MB9 A;  3A0R A;  2Z5B A;  3QT6 A;  3WU4 A;  3T10 A;  2VQE I;  1N0U A;  3K85 A;  1WUU A;  4HZ0 A;  3Q5L A;  2UU9 I;  3O0I A;  3R4M A;  1TC6 A;  3A0W A;  2O1T A;  2V2Q A;  4H7Q A;  3A0T A;  2XDK A;  1BXD A;  4Z7Y A;  2HFU A;  4DR6 I;  3EHH A;  4AWP A;  3D2R A;  5IDM A;  4DV1 E;  4YKX A;  4P7A A;  3QT7 A;  2YED A;  5D7R A;  4W7T A;  1Z5A A;  4DR2 E;  4JI7 I;  1I5A A;  4MBC A;  3B82 A;  4JI4 E;  1U0Z A;  3LPS A;  4HY1 A;  1UYM A;  4USK A;  2IWU A;  4O05 A;  4YKZ A;  4CWN A;  4LFA E;  4OX9 I;  4LWF A;  4YHH I;  4K4O A;  3EHG A;  4HAC A;  4GGL A;  2NPF A;  3V2U C;  4IZK B;  5IWA I;  4PRX A;  3R91 A;  1ZXN A;  3PYE A;  3U2K A;  1Z0G A;  4DUZ E;  1Z5B A;  4LF7 I;  2UXD E;  3C11 A;  4YKW A;  2V34 A;  1ZWH A;  1K47 A;  4JI2 E;  3GIE A;  3F0N A;  4ZVI A;  2UUA I;  2AKP A;  4ASG A;  4DPX A;  2PNM A;  4Z7C A;  4B6C A;  4DUH A;  4B3M I;  4IZJ B;  3T0Z A;  4URL A;  2K5B A;  2R42 A;  2PNR A;  3O6O A;  1H74 A;  1HR0 I;  1USV A;  1ZM2 A;  4XE2 A;  1L0O A;  3MNR P;  4FN5 A;  4WUC A;  5BOC A;  2WI1 A;  4DV5 E;  4UT4 A;  2E0A A;  1ELO A;  3Q6N A;  3J80 Q;  4DR3 I;  2F4V E;  4AQY E;  3EHF A;  5D7D A;  4UTG A;  1UY9 A;  4KHP E;  4DR3 E;  4HYP A;  3OTO I;  1ZM9 A;  1HNX I;  4U7N A;  2YKJ A;  1UYC A;  4ASB A;  1XMQ E;  4XCJ A;  2XDL A;  2X7I A;  1ZXM A;  2XDU A;  4N3O A;  1N0V C;  1IBM E;  1KTV A;  1HNZ E;  2BM1 A;  3J81 Q;  1J5E I;  2VCI A;  3OW6 A;  3IED A;  4H81 A;  3D36 A;  4EEH A;  4FCR A;  1IBL I;  1H72 C;  3WHA A;  2XJJ A;  3ZXQ A;  3NMQ A;  1FJG E;  2IOR A;  1YSZ A;  4CWP A;  3TZ2 A;  3CRK A;  4DR1 E;  4JAS A;  1TBW A;  4LP0 A;  4DV3 E;  1YC4 A;  2YGF A;  4EFT A;  4LF9 I;  4JI5 E;  4DR4 I;  4X64 E;  2JJC A;  5BR8 E;  3BM9 A;  2BYI A;  4DUY I;  3K99 A;  4XIP A;  2XDX A;  2CGE A;  2HK2 A;  4DV4 I;  5L3J A;  4X66 E;  3TZ5 A;  3B27 A;  1YT1 A;  4WUB A;  3T1H E;  3CGZ A;  4GKK E;  2HCH A;  3EHJ A;  3FT5 A;  3M6A A;  4BIU A;  2BT0 A;  4LWG A;  5M4H A;  2HHH I;  4JI0 E;  4LF6 I;  4LWH A;  2ZM6 I;  5J71 A;  4L90 A;  3TUH A;  2AJ4 A;  1N36 I;  3B78 A;  4LWE A;  1KIJ A;  4CWS A;  2YEI A;  2HKJ A;  2UUB E;  2BM0 A;  4KTN A;  5CTY A;  3HZ1 A;  4DV7 E;  3VHA A;  3LNU A;  1FNM A;  1Z0V A;  3WU6 A;  4MP7 A;  4O09 A;  2YE8 A;  2EFG A;  4X65 I;  5LMU I;  3FT8 A;  2YE2 A;  4MP2 A;  4YY3 I;  4R1F A;  2XHR A;  2HK3 A;  1EI1 A;  4HYM A;  4DZY A;  3TZ4 A;  4EM7 A;  4I3H A;  2XAB A;  5CPH A;  1OJ4 A;  1BGQ A;  5D7C A;  1AH6 A;  2J7K A;  3ZKD A;  2FXS A;  4KFG A;  4NH9 A;  4V25 A;  4DV0 E;  3G75 A;  4B7P A;  4B3T E;  2BZ5 A;  2UXB E;  2YJW A;  2UXC I;  4XIR A;  4XIT A;  4PRV A;  1B62 A;  4V26 A;  2Q8F A;  4JI1 I;  4JI6 E;  4B3S I;  5M4P A;  2VQF I;  4FWH A;  3V5R A;  4JI8 E;  3ZZU A;  2XCM A;  3PYG A;  5FND A;  2VQE E;  2EXL A;  4K0K I;  1XNR I;  2UU9 E;  4EFU A;  1PVG A;  4L8Z A;  3H80 A;  1UEK A;  2HG1 A;  3D4J A;  2UUC I;  3CWV A;  4DR6 E;  4GCZ A;  5D6P A;  4L91 A;  2XJX A;  4DV6 I;  3CGY A;  2CCT A;  3GIG A;  3K60 A;  1Z0B A;  1UY8 A;  1ZM3 A;  2YEG A;  4JI7 E;  4JI3 I;  2BTZ A;  4DV2 I;  1HK7 A;  1AH8 A;  1UYL A;  4OX9 E;  1YER A;  4YHH E;  2YK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...