4PRXA

E. coli gyrb 43-kda n-terminal fragment in complex with adp+pi
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
374
structure length
363
Chain Sequence
SYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEGGIKAFVEYLNKNKTPIHPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKIID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GyrB
publication title Structure of the N-Terminal Gyrase B Fragment in Complex with ADPPi Reveals Rigid-Body Motion Induced by ATP Hydrolysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 108
structure length 363
sequence length 374
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4prxA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4prxA01
4JV5I 1ZXNA 2BU5A 3PYFA 5F5RA 3PYEA 3ZZTA 5IWAI 1N32E 1OJ4A 2HK3A 4DR5I 1D6TA 3A0TA 4BIZA 5FWKA 1Z5BA 5M4KA 3HULA 4NXMI 4AWQA 2HFSA 2VF3A 1A4HA 3HYZA 4LF4E 3K60A 2XDKA 2XD6A 2ESAA 4CE3A 4UTGA 4EFUA 2ZM6I 2Q2EB 3A0XA 4AWOA 1UYFA 1Z0CA 4YKRA 1HNWI 4DU8A 4FCQA 2Q8IA 2UU9I 1QY8A 1I5CA 1XMOI 2E1RA 4DUYI 2CG9A 4GCZA 4B7PA 2YEDA 3T0ZA 1N32I 4X66E 4DR2I 2XDSA 2UXCE 3FT8A 2XEXA 2V2ZA 1TBWA 3VHAA 2PNRA 1U2OA 4LF4I 1FWLA 2XDXA 3NMQA 1H72C 2YEAA 3EHJA 5D6QA 4B3SE 2DEJA 2HHHE 3EHGA 3QTFA 2FXSA 2JJCA 2YE6A 5D7CA 4MP2A 5FNFA 1YT0A 1S4EA 2YK9A 5IDMA 4X62I 4X66I 3D4JA 3B26A 4R3AA 3B78A 2UXCI 1YT2A 2IOPA 3PEHA 1S16A 2YKCA 2HKJA 5D7RA 4ASAA 3IEDA 5FLXQ 3G75A 4AS9A 1FKAE 5CF0A 2XJGA 1N0VC 3R92A 4B3SI 3B25A 4CWRA 4P8OA 1THNA 4LP0A 2WI3A 3WU4A 2GFDA 2BM1A 2Q8HA 3T1HI 4NH8A 4XCLA 1ZM4A 4HYMA 1H7UA 1KVKA 2DEIA 1XMQE 3C11A 1U2RA 3EHFA 2O1VA 4XCJA 5F3KA 5L3JA 3TZ0A 1YC4A 3R4MA 1NHHA 4XKKA 4DUZI 1Y8PA 4PRVA 4YHHE 4FCRA 3U2DA 3VADA 1KZNA 4XDMA 2YE3A 4JI2E 3J7AM 1Z0VA 1AH6A 3OPDA 3M6AA 3J81Q 3JAMC 1S14A 5IDJA 4BAEA 5GMDA 4DPUA 3J7AG 1UYEA 5CPHA 1IBME 1YSZA 2WI4A 1B3QA 1RREA 2WEQA 4JQLA 4CWFA 4DPYA 3J80C 1DARA 3OMUA 3V5RA 1I5DA 1PVGA 4B3ME 1H73A 1ZXMA 4XIQA 1OSFA 4LFBE 4PU9A 4YKTA 4ED4A 4HZ0A 4FN5A 3H4LA 4DR6E 4UT4A 3G7BA 1GKXA 4YKUA 4L8ZA 1YETA 2WI7A 2ZDXA 1TC0A 1IBMI 3WHAA 1ZW9A 1Y8NA 2BREA 2CCSA 3WU5A 4DV4E 4LF8E 1TC6A 1UYGA 2QG2A 4XIRA 1UYHA 1EA6A 4JI6I 3LTOA 2IOQA 1AM1A 1XNQE 4DR1I 4KSHA 2FWYA 4DV2I 4L90A 4LFBI 4W7TA 1HNZE 3D2RA 4DV1E 4O05A 4B3TE 4MYTA 4KP4A 4NH7A 2HFUA 4JYAE 2BU6A 3RLQA 2WI5A 3K98A 4DR7E 4YY3E 2YE8A 1N0UA 1UY8A 2UUCE 4JI4I 1UY9A 3HZ1A 2YGFA 3CGZA 1XNQI 3TZ5A 3GIEA 1AJ6A 2YE5A 2YEBA 2LJPA 2WI1A 4FWGA 1BXDA 1I94E 4B3TI 3EKOA 1NHIA 2WW4A 2YI5A 4DV0E 4EGKA 2GQPA 1GKZA 2GS8A 2ZBKB 1YC3A 4JAUA 3INXA 1YESA 4DR7I 4FWDA 4YY3I 2IWSA 3Q5LA 3H80A 4JI8E 2UUCI 2WERA 3K97A 4KFGA 2CH4A 2UXDE 4MPEA 2UXBE 2VWCA 3O0IA 4XC0A 3OWBA 2BU8A 4GKKE 1Y4SA 2ZDYA 3U2KA 1KIJA 3QT8A 5IN9A 2BM0A 1Z59A 4JI7E 1JM6A 5J71A 5D7DA 4R3MA 3F0NA 3GONA 2BT0A 3PYDA 3VHDA 3INWA 4KHPE 4GKJE 4HYPA 5CTWA 3ZZUA 4CE2A 1RR9A 2V2QA 4JI8I 2E0AA 2UXDI 4EMDA 3OW6A 2UXBI 3FT5A 1TILA 1FWKA 2ZKJA 4DXLA 4GKKI 3RLRA 3R4PA 4JI7I 1I58A 4YKYA 3G7EA 1VISA 4O07A 4Z7YA 2CCUA 2CZ9A 4I5SA 2AJ4A 3LPSA 4XKAA 4H7QA 3R4NA 3VHCA 4HACA 3TZ4A 2FWZA 4LFAE 3ZKBA 3B82A 4KTNA 1ZM3A 1FI4A 2HHHI 3C0EA 2FYPA 5BOCA 1FNMA 2XDUA 4GQTA 3T2SA 4WUDA 3QT6A 4JI5E 2BRCA 2V2VA 3RLPA 5BR8E 4CE1A 4NXNE 4V25A 5LMUE 5GGZA 4WUBA 4CWPA 4RPFA 1UYCA 1Z5AA 2BU7A 4DV5E 1YT1A 4LPBA 3B28A 4WUCA 4OX9E 4ZKIA 1PKPA 4ASBA 4CWQA 4LFAI 4K0KE 3O2FA 1GJVA 2HK2A 1AH8A 4ASFA 4YKZA 3K17A 4R1FA 2WI6A 2V8PA 1HR0E 3B8HA 1BKNA 4PRXA 2R3VA 2YI6A 3BMYA 3FV5A 4YKXA 3D36A 5CTYA 4JI5I 2V34A 4ZVIA 1N36E 1KKHA 1UYKA 1XMQI 1N33E 3D0BA 3EKRA 3HZ5A 5BR8I 4XE2A 4PL9A 5LMUI 2X36A 3WU3A 2YE7A 1HNXE 4L93A 4CWSA 4DV5I 2YE4A 2ZITA 2WEPA 4OX9I 2BU2A 4YHHI 4YKQA 1ID0A 2BV3A 4LFCE 2YEEA 4K0KI 2YKJA 4JI2I 1ELOA 3CRKA 2IWXA 5M4MA 4O0BA 4DV7E 3KE6A 2YE9A 5A2QQ 1J5EE 2XX5A 3A0RA 4JAVA 1A6FA 3TUHA 1Y4UA 1N36I 2UUAE 1N33I 2VCJA 3CRLA 3ZXQA 5IT9Q 2YGEA 2BSMA 1HNXI 5LMNE 3CWVA 1UEKA 2VCIA 3HEKA 4DR3E 4P7AA 4USKA 3LNUA 4LFCI 2BTZA 3A0ZA 5CTXA 4FCPA 4B3MI 4Z7CA 4E00A 2YGAA 2A2DA 1J5EI 4EFTA 2F4VE 2Q8FA 4DR6I 4CWTA 1R62A 4XITA 2YE2A 3R4OA 4MYUA 4LF5E 3V2UC 3QT7A 5M4PA 4DV4I 4LF8I 2OI2A 2R42A 4HACB 3J81C 5BODA 1QZRA 4KQVA 5GMEA 1BGQA 4X64E 4LF9E 1NZ0A 1H74A 3Q1QA 1TIDA 1Z0WA 4DPXA 4JI0E 3O6OA 1XNRE 1HNZI 2O1WA 3TZ2A 4DV1I 4JG4A 2XK2A 4M1KA 2XHXA 4B3RE 1QYEA 4LF5I 1UYIA 4MPNA 4XIPA 2EXLA 4JYAI 3OTOE 3QT5A 1N34E 4LWEA 3R91A 4EGIA 5CTUA 4NH9A 4GGLA 1UYMA 2HKEA 4MBCA 1XHKA 4EM7A 4X64I 4LF9I 2K5BA 2BZ5A 1Z5CA 3SL2A 1AMWA 4JI0I 1XNRI 4L91A 1WUUA 1Z0TA 4Q20A 4JASA 3GIGA 3ZXOA 1XMOE 1ZM9A 1YSRA 1I94I 2X7IA 3TTZA 1B63A 3ZKDA 3HHUA 4DR2E 4B3RI 1MU5A 4DV0I 4DUHA 1ZM2A 5FNDA 3HYYA 3OTOI 4X65E 1N34I 2YECA 2YJXA 3ZM7A 4LWFA 1TH8A 3ZZ0A 4MPCA 1FJGE 1I59A 3EHHA 3JZ3A 3QDDA 1Y8OA 4MB9A 5C93A 1YS3A 4XKOA 5D6PA 4DR4E 4YKWA 1I5AA 3CGYA 2YEGA 2VQFE 3K99A 4LWGA 1UYLA 1EI1A 4AQYE 4K4OA 2CGFA 5M4EA 4X62E 4P52A 4USMA 2UUBE 2BYIA 3JAMQ 2XJXA 4X65I 1MX0A 4KHPI 2JKIA 4GKJI 3Q5KA 2YI7A 3MNRP 4GT8A 4H81A 4X9LA 4I3HA 1FJGI 4E02A 4ASGA 2XHTA 4U7OA 1IBKE 2XX2A 3B24A 4U93A 4DR4I 3J80Q 3Q5JA 3T1HE 3T10A 1Z0GA 2VQFI 2H8MA 2XDLA 4AQYI 3PYGA 4U7NA 4DPTA 4O04A 2UUBI 4DV6E 2O1UA 3BM9A 4LWHA 2YEJA 4MP7A 4BIUA 4FW9A 4DUZE 2YKIA 4DZYA 2YEHA 3T1YE 1H7SA 1YC1A 2WI2A 1L0OA 4V26A 1UY7A 3K1JA 3B27A 4GFNA 4UROA 4FPPA 1IBKI 1UYDA 4B6CA 2H55A 5FNCA 2IORA 2XX4A 3OWDA 4NXNI 1K47A 2HCHA 5M4NA 1MG7A 2J7KA 2NPFA 1B62A 1ZWHA 2YEIA 5M4HA 2IWUA 4DU7A 4DV6I 4HY1A 1IBLE 2YEFA 1BYQA 1NHJA 3A0WA 4GEEA 2YKEA 3T1YI 3WU6A 1KTVA 3U67A 4MOTA 1HR0I 1US7A 4DPWA 3GIGB 2QG0A 4LF7E 5FLXC 4JI3E 2YKBA 2QFOA 4QPKA 4EMVA 2XHRA 1UY6A 4L94A 1IBLI 4CWNA 4HXWA 3DGEA 5LL6R 4JI6E 2E5LE 4DR1E 4DV7I 4LF6E 4XTJA 4DV2E 3RKZA 5J6AA 4FWHA 1U0ZA 3WQ9A 2CCTA 2YJWA 4BXIA 1I5BA 4DV3E 2UUAI 4LF7I 4XD8A 2QF6A 4JI3I 4HZ5A 4AWPA 2AKPA 2HG1A 2XABA 4EGHA 2XCMA 5LMNI 4LWIA 3T1KA 4URLA 2VQEE 4DR3I 3T0HA 4JI1E 4EEHA 1Z0EA 4KSGA 1Z0BA 4JI4E 3PEJA 2E5LI 2A2CA 4LF6I 2BYHA 2F4VI 1PIEA 4BQJA 4JV5E 4CWOA 4H85A 4BQGA 4DV3I 4O09A 5IWAE 4HXZA 3A0YA 2XJJA 4DR5E 4URMA 5A2QC 4NXME 2UWDA 2VQEI 2YK2A 4URNA 1YERA 4FMTA 4JI1I 4E01A 2C2AA 2ZM6E 2EFGA 5IT9C 2VW5A 1HNWE 2YI0A 3GIFA 2UU9E 4QPJA 2Q8GA 4HY6A 4DUYE
chains in the Genus database with same CATH superfamily
4JV5I 1ZXNA 2BU5A 3PYFA 5F5RA 3PYEA 3ZZTA 5IWAI 1N32E 1OJ4A 2HK3A 5FWKA 4DR5I 4IFDD 1D6TA 3A0TA 1Z5BA 4BIZA 5M4KA 2PNLA 3PS1A 3HULA 1UDSA 4NXMI 4AWQA 2HFSA 2VF3A 1A4HA 3HYZA 4LF4E 1R6LA 2XDKA 3K60A 4MU3A 2XD6A 2ESAA 4CE3A 4UTGA 4EFUA 2ZM6I 2Q2EB 2C39A 3M85D 3A0XA 4AWOA 1UYFA 1Z0CA 4YKRA 1HNWI 4DU8A 4FCQA 2Q8IA 2UU9I 1QY8A 1I5CA 1XMOI 4IZKB 2E1RA 3PRYA 4DUYI 2CG9A 4GCZA 4B7PA 2YEDA 3T0ZA 3U1KA 1N32I 4X66E 4DR2I 5DRPA 1XXEA 3GCMA 2XDSA 2UXCE 3FT8A 2XEXA 2V2ZA 1TBWA 3VHAA 2PNRA 4OO1D 1U2OA 4LF4I 1FWLA 2XDXA 3NMQA 1H72C 1R6MA 2NN6E 2YEAA 3EHJA 1VI7A 4ISAA 4BA1A 4B3SE 2DEJA 2HHHE 3EHGA 2C37B 3QTFA 2FXSA 2JJCA 4U3BA 2YE6A 5D7CA 2GO3A 4MP2A 4IS9A 5FNFA 1YT0A 2NN6A 1S4EA 3HJCA 2YK9A 2FTKA 4X62I 4X66I 3D4JA 1YH8A 3B26A 4R3AA 5IDMA 3B78A 2UXCI 4IZJB 2IOPA 1YT2A 3PEHA 1S16A 2YKCA 2HKJA 5D7RA 1UDNA 4ASAA 4MU0A 5FLXQ 3IEDA 3G75A 4AS9A 4QNKA 1FKAE 5CF0A 2XJGA 1N0VC 3R92A 4B3SI 3B25A 4CWRA 4P8OA 1THNA 4LP0A 2WI3A 3WU4A 2GFDA 2BM1A 2Q8HA 3T1HI 4NH8A 4XCLA 4HYMA 1ZM4A 1H7UA 1KVKA 1Y6ZA 2DEIA 1XMQE 3C11A 4FW3A 1U2RA 2PO2A 2O1VA 3EHFA 2JE6A 4XCJA 5F3KA 5L3JA 3TZ0A 1YC4A 3R4MA 1NHHA 4XKKA 4DUZI 1Y8PA 4PRVA 4YHHE 5DROA 4FCRA 3U2DA 3VADA 1KZNA 5K36C 4MDTA 2YE3A 4XDMA 4JI2E 3K85A 3J7AM 1Z0VA 3CDJA 1AH6A 4OKGA 3OPDA 3M6AA 3J81Q 3JAMC 1S14A 5IDJA 4BAEA 3P3CA 5GMDA 4DPUA 4MQYA 3J7AG 1UYEA 5CPHA 1IBME 2PO1A 3Q6MA 1YSZA 2WI4A 3L7ZA 1B3QA 1RREA 2WEQA 4JQLA 1HK7A 4CWFA 4DPYA 3J80C 5DRRA 1DARA 3H1CA 3OMUA 3V5RA 1I5DA 1PVGA 4B3ME 1H73A 1ZXMA 4XIQA 1OSFA 4LFBE 4PU9A 4YKTA 4ED4A 4HZ0A 4FN5A 3H4LA 4DR6E 4UT4A 3G7BA 1GKXA 4YKUA 4L8ZA 1YETA 2WI7A 2ZDXA 5JEAE 1IXMA 1TC0A 1IBMI 3WHAA 1ZW9A 2BR2A 1Y8NA 2BREA 5EL9A 3GLLA 3WU5A 2CCSA 4LPFA 4DV4E 4LCHA 4LF8E 1TC6A 1UYGA 2QG2A 4XIRA 1UYHA 1EA6A 4JI6I 3LTOA 2IOQA 1AM1A 1XNQE 4DR1I 4BA1B 4KSHA 3U1YA 5DNLA 5ELWA 4DV2I 3M7ND 4IFDE 2FWYA 4L90A 3M85G 4LFBI 4W7TA 1HNZE 3D2RA 4DV1E 4O05A 4HY6A 4GQUA 4B3TE 4MYTA 2NN6B 5K36E 4KP4A 4LOMA 4NH7A 2HFUA 4JYAE 2BU6A 3RLQA 2WI5A 3K98A 4DR7E 4YY3E 2YE8A 5K36A 1N0UA 1UY8A 2UUCE 4JI4I 1UY9A 3HZ1A 2YGFA 3CGZA 1XNQI 2VESA 4U3DA 3TZ5A 3GIEA 1AJ6A 2YE5A 2YEBA 3P3EA 2LJPA 2WI1A 4FWGA 1BXDA 1I94E 4B3TI 2PO0A 3EKOA 1NHIA 2WW4A 2YI5A 2PO2B 4DV0E 2JE6B 4EGKA 2GQPA 4IZJD 1GKZA 2GS8A 2ZBKB 1YC3A 4JAUA 3INXA 1YESA 4DR7I 2BA1D 4FWDA 4YY3I 2IWSA 3Q5LA 3H80A 4JI8E 2UUCI 2WERA 3K97A 1UDQA 4KFGA 2CH4A 2UXDE 4MPEA 1OYPA 2UXBE 2VWCA 3O0IA 4XC0A 3OWBA 2Z5BA 2BU8A 1Y4SA 4GKKE 4OO1F 2ZDYA 1KIJA 3QT8A 3U2KA 5IN9A 2BM0A 1RHYA 1Z59A 4JI7E 1JM6A 5J71A 5D7DA 2PO1B 4R3MA 1F51A 3F0NA 3GONA 2BT0A 5EKWA 3PYDA 3VHDA 3CDIA 3INWA 4KHPE 4GKJE 4HYPA 5CTWA 3ZZUA 4CE2A 1RR9A 2CGEA 2V2QA 4JI8I 2E0AA 2UXDI 4EMDA 3OW6A 4QNJA 2UXBI 4LCFA 1TILA 1FWKA 2ZKJA 3FT5A 4DXLA 4GKKI 3RLRA 2Z5CA 3R4PA 4JI7I 1I58A 4YKYA 1E3HA 3G7EA 4E72A 1VISA 4O07A 2BR2B 4Z7YA 4MU4A 2CCUA 2CZ9A 2JEBA 2AJ4A 3LPSA 4I5SA 4H7QA 4XKAA 3R4NA 3VHCA 4HACA 3TZ4A 2FWZA 3P06A 5JEAC 4LFAE 3KRNA 3ZKBA 3B82A 2JEAA 4KTNA 1ZM3A 1FI4A 2HHHI 3C0EA 2FYPA 5BOCA 1FNMA 2XDUA 4GQTA 3T2SA 4WUDA 3QT6A 4JI5E 2BRCA 2V2VA 3RLPA 4AIMA 5BR8E 4CE1A 5C0XB 4NXNE 5LMUE 4V25A 4WUBA 5GGZA 4CWPA 4RPFA 4IFDC 1UYCA 1Z5AA 2BU7A 4DV5E 1YT1A 4LPBA 5DNXA 3B28A 4WUCA 4OX9E 5D6QA 4ZKIA 1PKPA 2PNZA 4ASBA 4CWQA 5K36B 4LFAI 4K0KE 3O2FA 1GJVA 2HK2A 1AH8A 4ASFA 4YKZA 4R1FA 3K17A 2WI6A 2V8PA 1HR0E 3B8HA 1BKNA 4PRXA 2R3VA 2YI6A 3BMYA 3FV5A 4YKXA 3M7NG 3D36A 5CTYA 3HKMA 4JI5I 2V34A 4ZVIA 1N36E 1KKHA 1OYRA 1XMQI 1N33E 1UYKA 3D0BA 3EKRA 5BR8I 2NN6D 2PO0B 3HZ5A 4PL9A 5LMUI 4XE2A 2X36A 3WU3A 2YE7A 1HNXE 4L93A 4CWSA 4DV5I 2YE4A 2ZITA 2WEPA 1Y5YA 4OX9I 2BU2A 4YHHI 4YKQA 1ID0A 2BV3A 4LFCE 4OO1C 1YHCA 4K0KI 4JI2I 1ELOA 2YEEA 2IWXA 2YKJA 2C39B 3CRKA 5M4MA 4O0BA 4DV7E 3KE6A 2YE9A 5A2QQ 1J5EE 2XX5A 3A0RA 4JAVA 2Z5BB 1A6FA 3TUHA 1Y4UA 1N36I 2UUAE 1N33I 2VCJA 3CRLA 3ZXQA 3S5TA 5IT9Q 2YGEA 2BSMA 1HNXI 5LMNE 2JT2A 3CWVA 1UEKA 2VCIA 3HEKA 4DR3E 4P7AA 5JEAA 4USKA 3LNUA 4LFCI 2BTZA 3A0ZA 5CTXA 2BA1G 4B3MI 4FCPA 4Z7CA 4E00A 2YGAA 2A2DA 1J5EI 2GO4A 4EFTA 2F4VE 2Q8FA 4DR6I 4CWTA 1R62A 4XITA 2YE2A 3R4OA 4MYUA 4LF5E 4IFDA 4FW4A 3V2UC 3QT7A 5M4PA 4OZEA 4AM3A 4DV4I 4LF8I 2OI2A 4NBQA 2R42A 4HACB 3J81C 5BODA 1QZRA 4KQVA 5GMEA 1BGQA 4X64E 4LF9E 1NZ0A 1H74A 3Q1QA 1TIDA 3P3GA 1Z0WA 4DPXA 4JI0E 3O6OA 1XNRE 2O1WA 1HNZI 3TZ2A 4DV1I 4JG4A 2XK2A 4OO1E 4M1KA 2XHXA 4B3RE 3PS3A 3PS2A 4LF5I 5DRQA 1QYEA 1UYIA 2EXLA 3P76A 4JYAI 3OTOE 4MPNA 4XIPA 3QT5A 1N34E 4LWEA 2C1GA 3R91A 4EGIA 5CTUA 4MU1A 4NH9A 2AE8A 2BA0G 4GGLA 2PNZB 1UYMA 5C0XF 2HKEA 4OO1A 4MBCA 1XHKA 4EM7A 4X64I 4LF9I 2K5BA 2BZ5A 1Z5CA 3SL2A 1AMWA 4JI0I 1XNRI 4L91A 1WUUA 1Z0TA 4Q20A 4JASA 3GIGA 3ZXOA 1XMOE 1ZM9A 1YSRA 1I94I 2X7IA 5C0XD 3TTZA 1B63A 3ZKDA 3HHUA 4DR2E 4B3RI 1MU5A 3L7ZB 4DV0I 4DUHA 1ZM2A 5FNDA 3HYYA 3OTOI 4X65E 1N34I 2YECA 2YJXA 2WP8A 2IESA 3GMEA 3NZKA 3ZM7A 5K36D 3ZZ0A 1TH8A 4LWFA 4MPCA 2PNMA 1FJGE 1I59A 3EHHA 3JZ3A 3QDDA 1Y8OA 4MB9A 5C93A 1YS3A 4XKOA 5D6PA 2O3ZA 4DR4E 4YKWA 1I5AA 3CGYA 2YEGA 2IERA 2VQFE 3K99A 4LWGA 1UYLA 1EI1A 4AQYE 4K4OA 2CGFA 5M4EA 4X62E 2BA0D 4P52A 4USMA 2UUBE 2BYIA 3JAMQ 2XJXA 4X65I 3CYGA 1MX0A 4KHPI 2JKIA 4GKJI 5JEAB 2YI7A 3Q5KA 4FW7A 3MNRP 4GT8A 4H81A 4X9LA 4I3HA 1FJGI 4E02A 4ASGA 2XHTA 4U7OA 1IBKE 2XX2A 3B24A 4U93A 4DR4I 3J80Q 3Q5JA 3T1HE 2C38A 3T10A 4BA2A 2F1DA 1Z0GA 2VQFI 2H8MA 2XDLA 4IFDB 4AQYI 3PYGA 4U7NA 4DPTA 4LCGA 4O04A 2O1UA 4DV6E 2UUBI 3BM9A 3UHMA 2WNRA 2YEJA 4LWHA 4MP7A 4FW9A 2NN6F 4BIUA 4DUZE 2YKIA 4DZYA 2YEHA 3T1YE 1H7SA 1YC1A 2WI2A 1L0OA 4V26A 1UY7A 3K1JA 3B27A 4GFNA 4UROA 4FPPA 1IBKI 1UYDA 4B6CA 2H55A 5FNCA 2IORA 2XX4A 3OWDA 4NXNI 2J65A 1K47A 2HCHA 5M4NA 1MG7A 5C0XC 1P42A 2J7KA 2NPFA 1B62A 1ZWHA 2YEIA 5M4HA 2IWUA 4DU7A 4DV6I 4HY1A 1IBLE 2YEFA 1BYQA 1NHJA 4OO1B 3A0WA 4GEEA 2YKEA 1OYSA 3T1YI 3WU6A 1KTVA 3U67A 4MOTA 1HR0I 1US7A 4DPWA 3GIGB 4IZKA 2QG0A 4LF7E 5FLXC 4JI3E 2YKBA 2QFOA 3LMMA 2GQ0A 4QPKA 4EMVA 2XHRA 1UY6A 4L94A 1IBLI 4CWNA 4HXWA 3DGEA 5LL6R 2WP8B 2Z5EA 4JI6E 2E5LE 4DR1E 4DV7I 4LF6E 4XTJA 4DV2E 2C37A 3RKZA 5J6AA 4FWHA 1U0ZA 3WQ9A 2Z5CB 2CCTA 2YJWA 4BXIA 1I5BA 4DV3E 4N3OA 2UUAI 4LF7I 4XD8A 2QF6A 4JI3I 4HZ5A 4AWPA 2AKPA 2HG1A 2JEBB 2XABA 2XCMA 4EGHA 5LMNI 4LWIA 3T1KA 4URLA 5JENA 4IZJA 2VQEE 4DR3I 3T0HA 4JI1E 4EEHA 1Z0EA 4KSGA 1Z0BA 1USVA 3B4TA 4JI4E 2JEAB 3PEJA 2E5LI 3DD6A 5C0XE 2A2CA 4LF6I 2BYHA 2HHIA 5JEAF 2F4VI 1PIEA 4BQJA 2C38B 4JV5E 4CWOA 4H85A 4BA2B 1Y60A 4BQGA 4DV3I 4O09A 5IWAE 4HXZA 3A0YA 2XJJA 4DR5E 5C0XA 2NN6C 4URMA 2CVEA 5A2QC 1USUA 4NXME 2VQEI 2WNRB 4FW5A 1YERA 2UWDA 2YK2A 4URNA 5JEAD 1UDOA 4FMTA 4JI1I 4IFDF 2O1TA 4E01A 2C1IA 4J3DA 4AIDA 2C2AA 2ZM6E 2EFGA 4FW6A 5IT9C 1HNWE 2VW5A 2YI0A 3GIFA 2UU9E 4QPJA 2Q8GA 5K36F 3Q6NA 1E3PA 4DUYE
chains in the Genus database with same CATH topology
4JV5I 1ZXNA 2BU5A 3PYFA 5F5RA 3PYEA 3ZZTA 5IWAI 1N32E 1OJ4A 2HK3A 5FWKA 4DR5I 1D6TA 3A0TA 4BIZA 1Z5BA 5M4KA 2PNLA 3HULA 4NXMI 4AWQA 2HFSA 2VF3A 1A4HA 3HYZA 4LF4E 3K60A 2XDKA 2XD6A 2ESAA 4CE3A 4UTGA 4EFUA 2ZM6I 2Q2EB 3A0XA 4AWOA 1UYFA 1Z0CA 4YKRA 1HNWI 4DU8A 4FCQA 2Q8IA 2UU9I 1QY8A 1I5CA 1XMOI 4IZKB 2E1RA 3PRYA 4DUYI 2CG9A 4GCZA 4B7PA 2YEDA 3T0ZA 1N32I 4X66E 4DR2I 2XDSA 2UXCE 3FT8A 2XEXA 2V2ZA 1TBWA 3VHAA 2PNRA 1U2OA 4LF4I 1FWLA 2XDXA 3NMQA 1H72C 2YEAA 3EHJA 5D6QA 4B3SE 2DEJA 2HHHE 3EHGA 3QTFA 2FXSA 2JJCA 2YE6A 5D7CA 4MP2A 5FNFA 1YT0A 1S4EA 3HJCA 2YK9A 5IDMA 4X62I 4X66I 3D4JA 3B26A 4R3AA 3B78A 2UXCI 4IZJB 2IOPA 1YT2A 3PEHA 1S16A 2YKCA 2HKJA 5D7RA 4ASAA 3IEDA 5FLXQ 3G75A 4AS9A 1FKAE 5CF0A 2XJGA 1N0VC 3R92A 4B3SI 3B25A 4CWRA 4P8OA 1THNA 4LP0A 2WI3A 3WU4A 2GFDA 2BM1A 2Q8HA 3T1HI 4NH8A 4XCLA 1ZM4A 4HYMA 1H7UA 1KVKA 1Y6ZA 2DEIA 1XMQE 3C11A 1U2RA 3EHFA 2O1VA 4XCJA 5F3KA 5L3JA 3TZ0A 1YC4A 3R4MA 1NHHA 4XKKA 4DUZI 1Y8PA 4PRVA 4YHHE 4FCRA 3U2DA 3VADA 1KZNA 4XDMA 2YE3A 4JI2E 3K85A 3J7AM 1Z0VA 1AH6A 3OPDA 3M6AA 3J81Q 3JAMC 1S14A 5IDJA 4BAEA 5GMDA 4DPUA 3J7AG 1UYEA 5CPHA 1IBME 3Q6MA 1YSZA 2WI4A 1B3QA 1RREA 2WEQA 4JQLA 1HK7A 4CWFA 4DPYA 3J80C 1DARA 3OMUA 3V5RA 1I5DA 1PVGA 4B3ME 1H73A 1ZXMA 4XIQA 1OSFA 4LFBE 4PU9A 4YKTA 4ED4A 4HZ0A 4FN5A 3H4LA 4DR6E 4UT4A 3G7BA 1GKXA 4YKUA 4L8ZA 1YETA 2WI7A 2ZDXA 1TC0A 1IBMI 3WHAA 1ZW9A 1Y8NA 2BREA 2CCSA 3WU5A 4DV4E 4LF8E 1TC6A 1UYGA 2QG2A 4XIRA 1UYHA 1EA6A 4JI6I 3LTOA 2IOQA 1AM1A 1XNQE 4DR1I 4KSHA 2FWYA 4DV2I 4L90A 4LFBI 4W7TA 1HNZE 3D2RA 4DV1E 4O05A 4B3TE 4MYTA 4KP4A 4NH7A 2HFUA 4JYAE 2BU6A 3RLQA 2WI5A 3K98A 4DR7E 4YY3E 2YE8A 1N0UA 1UY8A 2UUCE 4JI4I 1UY9A 3HZ1A 2YGFA 3CGZA 1XNQI 3TZ5A 3GIEA 1AJ6A 2YE5A 2YEBA 2LJPA 2WI1A 4FWGA 1BXDA 1I94E 4B3TI 3EKOA 1NHIA 2WW4A 2YI5A 4DV0E 4EGKA 2GQPA 4IZJD 1GKZA 2GS8A 2ZBKB 1YC3A 4JAUA 3INXA 1YESA 4DR7I 4FWDA 4YY3I 2IWSA 3Q5LA 3H80A 4JI8E 2UUCI 2WERA 3K97A 4KFGA 2CH4A 2UXDE 4MPEA 2UXBE 2VWCA 3O0IA 4XC0A 3OWBA 2Z5BA 2BU8A 1Y4SA 4GKKE 2ZDYA 3U2KA 1KIJA 3QT8A 5IN9A 2BM0A 1Z59A 4JI7E 1JM6A 5J71A 5D7DA 4R3MA 3F0NA 3GONA 2BT0A 3PYDA 3VHDA 3INWA 4KHPE 4GKJE 4HYPA 5CTWA 3ZZUA 4CE2A 1RR9A 2CGEA 2V2QA 4JI8I 2E0AA 2UXDI 4EMDA 3OW6A 2UXBI 3FT5A 1TILA 1FWKA 2ZKJA 4DXLA 4GKKI 3RLRA 2Z5CA 3R4PA 4JI7I 1I58A 4YKYA 3G7EA 1VISA 4O07A 4Z7YA 2CCUA 2CZ9A 4I5SA 2AJ4A 3LPSA 4XKAA 4H7QA 3R4NA 3VHCA 4HACA 3TZ4A 2FWZA 3P06A 4LFAE 3ZKBA 3B82A 4KTNA 1ZM3A 1FI4A 2HHHI 3C0EA 2FYPA 5BOCA 1FNMA 2XDUA 4GQTA 3T2SA 4WUDA 3QT6A 4JI5E 2BRCA 2V2VA 3RLPA 5BR8E 4CE1A 4NXNE 4V25A 5LMUE 5GGZA 4WUBA 4CWPA 4RPFA 1UYCA 1Z5AA 2BU7A 4DV5E 1YT1A 4LPBA 3B28A 4WUCA 4OX9E 4ZKIA 1PKPA 4ASBA 4CWQA 4LFAI 4K0KE 3O2FA 1GJVA 2HK2A 1AH8A 4ASFA 4YKZA 3K17A 4R1FA 2WI6A 2V8PA 1HR0E 3B8HA 1BKNA 4PRXA 2R3VA 2YI6A 3BMYA 3FV5A 4YKXA 3D36A 5CTYA 4JI5I 2V34A 4ZVIA 1N36E 1KKHA 1UYKA 1XMQI 1N33E 3D0BA 3EKRA 3HZ5A 5BR8I 4XE2A 4PL9A 5LMUI 2X36A 3WU3A 2YE7A 1HNXE 4L93A 4CWSA 4DV5I 2YE4A 2ZITA 2WEPA 4OX9I 2BU2A 4YHHI 4YKQA 1ID0A 2BV3A 4LFCE 2YEEA 4K0KI 2YKJA 4JI2I 1ELOA 3CRKA 2IWXA 5M4MA 4O0BA 4DV7E 3KE6A 2YE9A 5A2QQ 1J5EE 2XX5A 3A0RA 4JAVA 2Z5BB 1A6FA 3TUHA 1Y4UA 1N36I 2UUAE 1N33I 2VCJA 3CRLA 3ZXQA 5IT9Q 2YGEA 2BSMA 1HNXI 5LMNE 3CWVA 1UEKA 2VCIA 3HEKA 4DR3E 4P7AA 4USKA 3LNUA 4LFCI 2BTZA 3A0ZA 5CTXA 4FCPA 4B3MI 4Z7CA 4E00A 2YGAA 2A2DA 1J5EI 4EFTA 2F4VE 2Q8FA 4DR6I 4CWTA 1R62A 4XITA 2YE2A 3R4OA 4MYUA 4LF5E 3V2UC 3QT7A 5M4PA 4DV4I 4LF8I 2OI2A 2R42A 4HACB 3J81C 5BODA 1QZRA 4KQVA 5GMEA 1BGQA 4X64E 4LF9E 1NZ0A 1H74A 3Q1QA 1TIDA 1Z0WA 4DPXA 4JI0E 3O6OA 1XNRE 2O1WA 1HNZI 3TZ2A 4DV1I 4JG4A 2XK2A 4M1KA 2XHXA 4B3RE 1QYEA 4LF5I 1UYIA 4MPNA 4XIPA 2EXLA 4JYAI 3OTOE 3QT5A 1N34E 4LWEA 3R91A 4EGIA 5CTUA 4NH9A 4GGLA 1UYMA 2HKEA 4MBCA 1XHKA 4EM7A 4X64I 4LF9I 2K5BA 2BZ5A 1Z5CA 3SL2A 1AMWA 4JI0I 1XNRI 4L91A 1WUUA 1Z0TA 4Q20A 4JASA 3GIGA 3ZXOA 1XMOE 1ZM9A 1YSRA 1I94I 2X7IA 3TTZA 1B63A 3ZKDA 3HHUA 4DR2E 4B3RI 1MU5A 4DV0I 4DUHA 1ZM2A 5FNDA 3HYYA 3OTOI 4X65E 1N34I 2YECA 2YJXA 3ZM7A 4LWFA 1TH8A 3ZZ0A 4MPCA 2PNMA 1FJGE 1I59A 3EHHA 3JZ3A 3QDDA 1Y8OA 4MB9A 5C93A 1YS3A 4XKOA 5D6PA 4DR4E 4YKWA 1I5AA 3CGYA 2YEGA 2VQFE 3K99A 4LWGA 1UYLA 1EI1A 4AQYE 4K4OA 2CGFA 5M4EA 4X62E 4P52A 4USMA 2UUBE 2BYIA 3JAMQ 2XJXA 4X65I 1MX0A 4KHPI 2JKIA 4GKJI 3Q5KA 2YI7A 3MNRP 4GT8A 4H81A 4X9LA 4I3HA 1FJGI 4E02A 4ASGA 2XHTA 4U7OA 1IBKE 2XX2A 3B24A 4U93A 4DR4I 3J80Q 3Q5JA 3T1HE 3T10A 1Z0GA 2VQFI 2H8MA 2XDLA 4AQYI 3PYGA 4U7NA 4DPTA 4O04A 2O1UA 4DV6E 2UUBI 3BM9A 4LWHA 2YEJA 4MP7A 4BIUA 4FW9A 4DUZE 2YKIA 4DZYA 2YEHA 3T1YE 1H7SA 1YC1A 2WI2A 1L0OA 4V26A 1UY7A 3K1JA 3B27A 4GFNA 4UROA 4FPPA 1IBKI 1UYDA 4B6CA 2H55A 5FNCA 2IORA 2XX4A 3OWDA 4NXNI 1K47A 2HCHA 5M4NA 1MG7A 2J7KA 2NPFA 1B62A 1ZWHA 2YEIA 5M4HA 2IWUA 4DU7A 4DV6I 4HY1A 1IBLE 2YEFA 1BYQA 1NHJA 3A0WA 4GEEA 2YKEA 3T1YI 3WU6A 1KTVA 3U67A 4MOTA 1HR0I 1US7A 4DPWA 3GIGB 4IZKA 2QG0A 4LF7E 5FLXC 4JI3E 2YKBA 2QFOA 2GQ0A 4QPKA 4EMVA 2XHRA 1UY6A 4L94A 1IBLI 4CWNA 4HXWA 3DGEA 5LL6R 2Z5EA 4JI6E 2E5LE 4DR1E 4DV7I 4LF6E 4XTJA 4DV2E 3RKZA 5J6AA 4FWHA 1U0ZA 3WQ9A 2Z5CB 2CCTA 2YJWA 4BXIA 1I5BA 4DV3E 4N3OA 2UUAI 4LF7I 4XD8A 2QF6A 4JI3I 4HZ5A 4AWPA 2AKPA 2HG1A 2XABA 4EGHA 2XCMA 5LMNI 4LWIA 3T1KA 4URLA 4IZJA 2VQEE 4DR3I 3T0HA 4JI1E 4EEHA 1Z0EA 4KSGA 1Z0BA 1USVA 4JI4E 3PEJA 2E5LI 2A2CA 4LF6I 2BYHA 2F4VI 1PIEA 4BQJA 4JV5E 4CWOA 4H85A 4BQGA 4DV3I 4O09A 5IWAE 4HXZA 3A0YA 2XJJA 4DR5E 4URMA 5A2QC 1USUA 4NXME 2VQEI 2UWDA 2YK2A 1YERA 4URNA 4FMTA 4JI1I 2O1TA 4E01A 2C2AA 2ZM6E 2EFGA 5IT9C 2VW5A 1HNWE 2YI0A 3GIFA 2UU9E 4QPJA 2Q8GA 3Q6NA 4HY6A 4DUYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 I;  1ZXN A;  2BU5 A;  3PYF A;  5F5R A;  3PYE A;  3ZZT A;  5IWA I;  1N32 E;  1OJ4 A;  2HK3 A;  4DR5 I;  1D6T A;  3A0T A;  4BIZ A;  5FWK A;  1Z5B A;  5M4K A;  3HUL A;  4NXM I;  4AWQ A;  2HFS A;  2VF3 A;  1A4H A;  3HYZ A;  4LF4 E;  3K60 A;  2XDK A;  2XD6 A;  2ESA A;  4CE3 A;  4UTG A;  4EFU A;  2ZM6 I;  2Q2E B;  3A0X A;  4AWO A;  1UYF A;  1Z0C A;  4YKR A;  1HNW I;  4DU8 A;  4FCQ A;  2Q8I A;  2UU9 I;  1QY8 A;  1I5C A;  1XMO I;  2E1R A;  4DUY I;  2CG9 A;  4GCZ A;  4B7P A;  2YED A;  3T0Z A;  1N32 I;  4X66 E;  4DR2 I;  2XDS A;  2UXC E;  3FT8 A;  2XEX A;  2V2Z A;  1TBW A;  3VHA A;  2PNR A;  1U2O A;  4LF4 I;  1FWL A;  2XDX A;  3NMQ A;  1H72 C;  2YEA A;  3EHJ A;  5D6Q A;  4B3S E;  2DEJ A;  2HHH E;  3EHG A;  3QTF A;  2FXS A;  2JJC A;  2YE6 A;  5D7C A;  4MP2 A;  5FNF A;  1YT0 A;  1S4E A;  2YK9 A;  5IDM A;  4X62 I;  4X66 I;  3D4J A;  3B26 A;  4R3A A;  3B78 A;  2UXC I;  1YT2 A;  2IOP A;  3PEH A;  1S16 A;  2YKC A;  2HKJ A;  5D7R A;  4ASA A;  3IED A;  5FLX Q;  3G75 A;  4AS9 A;  1FKA E;  5CF0 A;  2XJG A;  1N0V C;  3R92 A;  4B3S I;  3B25 A;  4CWR A;  4P8O A;  1THN A;  4LP0 A;  2WI3 A;  3WU4 A;  2GFD A;  2BM1 A;  2Q8H A;  3T1H I;  4NH8 A;  4XCL A;  1ZM4 A;  4HYM A;  1H7U A;  1KVK A;  2DEI A;  1XMQ E;  3C11 A;  1U2R A;  3EHF A;  2O1V A;  4XCJ A;  5F3K A;  5L3J A;  3TZ0 A;  1YC4 A;  3R4M A;  1NHH A;  4XKK A;  4DUZ I;  1Y8P A;  4PRV A;  4YHH E;  4FCR A;  3U2D A;  3VAD A;  1KZN A;  4XDM A;  2YE3 A;  4JI2 E;  3J7A M;  1Z0V A;  1AH6 A;  3OPD A;  3M6A A;  3J81 Q;  3JAM C;  1S14 A;  5IDJ A;  4BAE A;  5GMD A;  4DPU A;  3J7A G;  1UYE A;  5CPH A;  1IBM E;  1YSZ A;  2WI4 A;  1B3Q A;  1RRE A;  2WEQ A;  4JQL A;  4CWF A;  4DPY A;  3J80 C;  1DAR A;  3OMU A;  3V5R A;  1I5D A;  1PVG A;  4B3M E;  1H73 A;  1ZXM A;  4XIQ A;  1OSF A;  4LFB E;  4PU9 A;  4YKT A;  4ED4 A;  4HZ0 A;  4FN5 A;  3H4L A;  4DR6 E;  4UT4 A;  3G7B A;  1GKX A;  4YKU A;  4L8Z A;  1YET A;  2WI7 A;  2ZDX A;  1TC0 A;  1IBM I;  3WHA A;  1ZW9 A;  1Y8N A;  2BRE A;  2CCS A;  3WU5 A;  4DV4 E;  4LF8 E;  1TC6 A;  1UYG A;  2QG2 A;  4XIR A;  1UYH A;  1EA6 A;  4JI6 I;  3LTO A;  2IOQ A;  1AM1 A;  1XNQ E;  4DR1 I;  4KSH A;  2FWY A;  4DV2 I;  4L90 A;  4LFB I;  4W7T A;  1HNZ E;  3D2R A;  4DV1 E;  4O05 A;  4B3T E;  4MYT A;  4KP4 A;  4NH7 A;  2HFU A;  4JYA E;  2BU6 A;  3RLQ A;  2WI5 A;  3K98 A;  4DR7 E;  4YY3 E;  2YE8 A;  1N0U A;  1UY8 A;  2UUC E;  4JI4 I;  1UY9 A;  3HZ1 A;  2YGF A;  3CGZ A;  1XNQ I;  3TZ5 A;  3GIE A;  1AJ6 A;  2YE5 A;  2YEB A;  2LJP A;  2WI1 A;  4FWG A;  1BXD A;  1I94 E;  4B3T I;  3EKO A;  1NHI A;  2WW4 A;  2YI5 A;  4DV0 E;  4EGK A;  2GQP A;  1GKZ A;  2GS8 A;  2ZBK B;  1YC3 A;  4JAU A;  3INX A;  1YES A;  4DR7 I;  4FWD A;  4YY3 I;  2IWS A;  3Q5L A;  3H80 A;  4JI8 E;  2UUC I;  2WER A;  3K97 A;  4KFG A;  2CH4 A;  2UXD E;  4MPE A;  2UXB E;  2VWC A;  3O0I A;  4XC0 A;  3OWB A;  2BU8 A;  4GKK E;  1Y4S A;  2ZDY A;  3U2K A;  1KIJ A;  3QT8 A;  5IN9 A;  2BM0 A;  1Z59 A;  4JI7 E;  1JM6 A;  5J71 A;  5D7D A;  4R3M A;  3F0N A;  3GON A;  2BT0 A;  3PYD A;  3VHD A;  3INW A;  4KHP E;  4GKJ E;  4HYP A;  5CTW A;  3ZZU A;  4CE2 A;  1RR9 A;  2V2Q A;  4JI8 I;  2E0A A;  2UXD I;  4EMD A;  3OW6 A;  2UXB I;  3FT5 A;  1TIL A;  1FWK A;  2ZKJ A;  4DXL A;  4GKK I;  3RLR A;  3R4P A;  4JI7 I;  1I58 A;  4YKY A;  3G7E A;  1VIS A;  4O07 A;  4Z7Y A;  2CCU A;  2CZ9 A;  4I5S A;  2AJ4 A;  3LPS A;  4XKA A;  4H7Q A;  3R4N A;  3VHC A;  4HAC A;  3TZ4 A;  2FWZ A;  4LFA E;  3ZKB A;  3B82 A;  4KTN A;  1ZM3 A;  1FI4 A;  2HHH I;  3C0E A;  2FYP A;  5BOC A;  1FNM A;  2XDU A;  4GQT A;  3T2S A;  4WUD A;  3QT6 A;  4JI5 E;  2BRC A;  2V2V A;  3RLP A;  5BR8 E;  4CE1 A;  4NXN E;  4V25 A;  5LMU E;  5GGZ A;  4WUB A;  4CWP A;  4RPF A;  1UYC A;  1Z5A A;  2BU7 A;  4DV5 E;  1YT1 A;  4LPB A;  3B28 A;  4WUC A;  4OX9 E;  4ZKI A;  1PKP A;  4ASB A;  4CWQ A;  4LFA I;  4K0K E;  3O2F A;  1GJV A;  2HK2 A;  1AH8 A;  4ASF A;  4YKZ A;  3K17 A;  4R1F A;  2WI6 A;  2V8P A;  1HR0 E;  3B8H A;  1BKN A;  4PRX A;  2R3V A;  2YI6 A;  3BMY A;  3FV5 A;  4YKX A;  3D36 A;  5CTY A;  4JI5 I;  2V34 A;  4ZVI A;  1N36 E;  1KKH A;  1UYK A;  1XMQ I;  1N33 E;  3D0B A;  3EKR A;  3HZ5 A;  5BR8 I;  4XE2 A;  4PL9 A;  5LMU I;  2X36 A;  3WU3 A;  2YE7 A;  1HNX E;  4L93 A;  4CWS A;  4DV5 I;  2YE4 A;  2ZIT A;  2WEP A;  4OX9 I;  2BU2 A;  4YHH I;  4YKQ A;  1ID0 A;  2BV3 A;  4LFC E;  2YEE A;  4K0K I;  2YKJ A;  4JI2 I;  1ELO A;  3CRK A;  2IWX A;  5M4M A;  4O0B A;  4DV7 E;  3KE6 A;  2YE9 A;  5A2Q Q;  1J5E E;  2XX5 A;  3A0R A;  4JAV A;  1A6F A;  3TUH A;  1Y4U A;  1N36 I;  2UUA E;  1N33 I;  2VCJ A;  3CRL A;  3ZXQ A;  5IT9 Q;  2YGE A;  2BSM A;  1HNX I;  5LMN E;  3CWV A;  1UEK A;  2VCI A;  3HEK A;  4DR3 E;  4P7A A;  4USK A;  3LNU A;  4LFC I;  2BTZ A;  3A0Z A;  5CTX A;  4FCP A;  4B3M I;  4Z7C A;  4E00 A;  2YGA A;  2A2D A;  1J5E I;  4EFT A;  2F4V E;  2Q8F A;  4DR6 I;  4CWT A;  1R62 A;  4XIT A;  2YE2 A;  3R4O A;  4MYU A;  4LF5 E;  3V2U C;  3QT7 A;  5M4P A;  4DV4 I;  4LF8 I;  2OI2 A;  2R42 A;  4HAC B;  3J81 C;  5BOD A;  1QZR A;  4KQV A;  5GME A;  1BGQ A;  4X64 E;  4LF9 E;  1NZ0 A;  1H74 A;  3Q1Q A;  1TID A;  1Z0W A;  4DPX A;  4JI0 E;  3O6O A;  1XNR E;  1HNZ I;  2O1W A;  3TZ2 A;  4DV1 I;  4JG4 A;  2XK2 A;  4M1K A;  2XHX A;  4B3R E;  1QYE A;  4LF5 I;  1UYI A;  4MPN A;  4XIP A;  2EXL A;  4JYA I;  3OTO E;  3QT5 A;  1N34 E;  4LWE A;  3R91 A;  4EGI A;  5CTU A;  4NH9 A;  4GGL A;  1UYM A;  2HKE A;  4MBC A;  1XHK A;  4EM7 A;  4X64 I;  4LF9 I;  2K5B A;  2BZ5 A;  1Z5C A;  3SL2 A;  1AMW A;  4JI0 I;  1XNR I;  4L91 A;  1WUU A;  1Z0T A;  4Q20 A;  4JAS A;  3GIG A;  3ZXO A;  1XMO E;  1ZM9 A;  1YSR A;  1I94 I;  2X7I A;  3TTZ A;  1B63 A;  3ZKD A;  3HHU A;  4DR2 E;  4B3R I;  1MU5 A;  4DV0 I;  4DUH A;  1ZM2 A;  5FND A;  3HYY A;  3OTO I;  4X65 E;  1N34 I;  2YEC A;  2YJX A;  3ZM7 A;  4LWF A;  1TH8 A;  3ZZ0 A;  4MPC A;  1FJG E;  1I59 A;  3EHH A;  3JZ3 A;  3QDD A;  1Y8O A;  4MB9 A;  5C93 A;  1YS3 A;  4XKO A;  5D6P A;  4DR4 E;  4YKW A;  1I5A A;  3CGY A;  2YEG A;  2VQF E;  3K99 A;  4LWG A;  1UYL A;  1EI1 A;  4AQY E;  4K4O A;  2CGF A;  5M4E A;  4X62 E;  4P52 A;  4USM A;  2UUB E;  2BYI A;  3JAM Q;  2XJX A;  4X65 I;  1MX0 A;  4KHP I;  2JKI A;  4GKJ I;  3Q5K A;  2YI7 A;  3MNR P;  4GT8 A;  4H81 A;  4X9L A;  4I3H A;  1FJG I;  4E02 A;  4ASG A;  2XHT A;  4U7O A;  1IBK E;  2XX2 A;  3B24 A;  4U93 A;  4DR4 I;  3J80 Q;  3Q5J A;  3T1H E;  3T10 A;  1Z0G A;  2VQF I;  2H8M A;  2XDL A;  4AQY I;  3PYG A;  4U7N A;  4DPT A;  4O04 A;  2UUB I;  4DV6 E;  2O1U A;  3BM9 A;  4LWH A;  2YEJ A;  4MP7 A;  4BIU A;  4FW9 A;  4DUZ E;  2YKI A;  4DZY A;  2YEH A;  3T1Y E;  1H7S A;  1YC1 A;  2WI2 A;  1L0O A;  4V26 A;  1UY7 A;  3K1J A;  3B27 A;  4GFN A;  4URO A;  4FPP A;  1IBK I;  1UYD A;  4B6C A;  2H55 A;  5FNC A;  2IOR A;  2XX4 A;  3OWD A;  4NXN I;  1K47 A;  2HCH A;  5M4N A;  1MG7 A;  2J7K A;  2NPF A;  1B62 A;  1ZWH A;  2YEI A;  5M4H A;  2IWU A;  4DU7 A;  4DV6 I;  4HY1 A;  1IBL E;  2YEF A;  1BYQ A;  1NHJ A;  3A0W A;  4GEE A;  2YKE A;  3T1Y I;  3WU6 A;  1KTV A;  3U67 A;  4MOT A;  1HR0 I;  1US7 A;  4DPW A;  3GIG B;  2QG0 A;  4LF7 E;  5FLX C;  4JI3 E;  2YKB A;  2QFO A;  4QPK A;  4EMV A;  2XHR A;  1UY6 A;  4L94 A;  1IBL I;  4CWN A;  4HXW A;  3DGE A;  5LL6 R;  4JI6 E;  2E5L E;  4DR1 E;  4DV7 I;  4LF6 E;  4XTJ A;  4DV2 E;  3RKZ A;  5J6A A;  4FWH A;  1U0Z A;  3WQ9 A;  2CCT A;  2YJW A;  4BXI A;  1I5B A;  4DV3 E;  2UUA I;  4LF7 I;  4XD8 A;  2QF6 A;  4JI3 I;  4HZ5 A;  4AWP A;  2AKP A;  2HG1 A;  2XAB A;  4EGH A;  2XCM A;  5LMN I;  4LWI A;  3T1K A;  4URL A;  2VQE E;  4DR3 I;  3T0H A;  4JI1 E;  4EEH A;  1Z0E A;  4KSG A;  1Z0B A;  4JI4 E;  3PEJ A;  2E5L I;  2A2C A;  4LF6 I;  2BYH A;  2F4V I;  1PIE A;  4BQJ A;  4JV5 E;  4CWO A;  4H85 A;  4BQG A;  4DV3 I;  4O09 A;  5IWA E;  4HXZ A;  3A0Y A;  2XJJ A;  4DR5 E;  4URM A;  5A2Q C;  4NXM E;  2UWD A;  2VQE I;  2YK2 A;  4URN A;  1YER A;  4FMT A;  4JI1 I;  4E01 A;  2C2A A;  2ZM6 E;  2EFG A;  5IT9 C;  2VW5 A;  1HNW E;  2YI0 A;  3GIF A;  2UU9 E;  4QPJ A;  2Q8G A;  4HY6 A;  4DUY E; 
#chains in the Genus database with same CATH topology
 4JV5 I;  1ZXN A;  2BU5 A;  3PYF A;  5F5R A;  3PYE A;  3ZZT A;  5IWA I;  1N32 E;  1OJ4 A;  2HK3 A;  5FWK A;  4DR5 I;  4IFD D;  1D6T A;  3A0T A;  1Z5B A;  4BIZ A;  5M4K A;  2PNL A;  3PS1 A;  3HUL A;  1UDS A;  4NXM I;  4AWQ A;  2HFS A;  2VF3 A;  1A4H A;  3HYZ A;  4LF4 E;  1R6L A;  2XDK A;  3K60 A;  4MU3 A;  2XD6 A;  2ESA A;  4CE3 A;  4UTG A;  4EFU A;  2ZM6 I;  2Q2E B;  2C39 A;  3M85 D;  3A0X A;  4AWO A;  1UYF A;  1Z0C A;  4YKR A;  1HNW I;  4DU8 A;  4FCQ A;  2Q8I A;  2UU9 I;  1QY8 A;  1I5C A;  1XMO I;  4IZK B;  2E1R A;  3PRY A;  4DUY I;  2CG9 A;  4GCZ A;  4B7P A;  2YED A;  3T0Z A;  3U1K A;  1N32 I;  4X66 E;  4DR2 I;  5DRP A;  1XXE A;  3GCM A;  2XDS A;  2UXC E;  3FT8 A;  2XEX A;  2V2Z A;  1TBW A;  3VHA A;  2PNR A;  4OO1 D;  1U2O A;  4LF4 I;  1FWL A;  2XDX A;  3NMQ A;  1H72 C;  1R6M A;  2NN6 E;  2YEA A;  3EHJ A;  1VI7 A;  4ISA A;  4BA1 A;  4B3S E;  2DEJ A;  2HHH E;  3EHG A;  2C37 B;  3QTF A;  2FXS A;  2JJC A;  4U3B A;  2YE6 A;  5D7C A;  2GO3 A;  4MP2 A;  4IS9 A;  5FNF A;  1YT0 A;  2NN6 A;  1S4E A;  3HJC A;  2YK9 A;  2FTK A;  4X62 I;  4X66 I;  3D4J A;  1YH8 A;  3B26 A;  4R3A A;  5IDM A;  3B78 A;  2UXC I;  4IZJ B;  2IOP A;  1YT2 A;  3PEH A;  1S16 A;  2YKC A;  2HKJ A;  5D7R A;  1UDN A;  4ASA A;  4MU0 A;  5FLX Q;  3IED A;  3G75 A;  4AS9 A;  4QNK A;  1FKA E;  5CF0 A;  2XJG A;  1N0V C;  3R92 A;  4B3S I;  3B25 A;  4CWR A;  4P8O A;  1THN A;  4LP0 A;  2WI3 A;  3WU4 A;  2GFD A;  2BM1 A;  2Q8H A;  3T1H I;  4NH8 A;  4XCL A;  4HYM A;  1ZM4 A;  1H7U A;  1KVK A;  1Y6Z A;  2DEI A;  1XMQ E;  3C11 A;  4FW3 A;  1U2R A;  2PO2 A;  2O1V A;  3EHF A;  2JE6 A;  4XCJ A;  5F3K A;  5L3J A;  3TZ0 A;  1YC4 A;  3R4M A;  1NHH A;  4XKK A;  4DUZ I;  1Y8P A;  4PRV A;  4YHH E;  5DRO A;  4FCR A;  3U2D A;  3VAD A;  1KZN A;  5K36 C;  4MDT A;  2YE3 A;  4XDM A;  4JI2 E;  3K85 A;  3J7A M;  1Z0V A;  3CDJ A;  1AH6 A;  4OKG A;  3OPD A;  3M6A A;  3J81 Q;  3JAM C;  1S14 A;  5IDJ A;  4BAE A;  3P3C A;  5GMD A;  4DPU A;  4MQY A;  3J7A G;  1UYE A;  5CPH A;  1IBM E;  2PO1 A;  3Q6M A;  1YSZ A;  2WI4 A;  3L7Z A;  1B3Q A;  1RRE A;  2WEQ A;  4JQL A;  1HK7 A;  4CWF A;  4DPY A;  3J80 C;  5DRR A;  1DAR A;  3H1C A;  3OMU A;  3V5R A;  1I5D A;  1PVG A;  4B3M E;  1H73 A;  1ZXM A;  4XIQ A;  1OSF A;  4LFB E;  4PU9 A;  4YKT A;  4ED4 A;  4HZ0 A;  4FN5 A;  3H4L A;  4DR6 E;  4UT4 A;  3G7B A;  1GKX A;  4YKU A;  4L8Z A;  1YET A;  2WI7 A;  2ZDX A;  5JEA E;  1IXM A;  1TC0 A;  1IBM I;  3WHA A;  1ZW9 A;  2BR2 A;  1Y8N A;  2BRE A;  5EL9 A;  3GLL A;  3WU5 A;  2CCS A;  4LPF A;  4DV4 E;  4LCH A;  4LF8 E;  1TC6 A;  1UYG A;  2QG2 A;  4XIR A;  1UYH A;  1EA6 A;  4JI6 I;  3LTO A;  2IOQ A;  1AM1 A;  1XNQ E;  4DR1 I;  4BA1 B;  4KSH A;  3U1Y A;  5DNL A;  5ELW A;  4DV2 I;  3M7N D;  4IFD E;  2FWY A;  4L90 A;  3M85 G;  4LFB I;  4W7T A;  1HNZ E;  3D2R A;  4DV1 E;  4O05 A;  4HY6 A;  4GQU A;  4B3T E;  4MYT A;  2NN6 B;  5K36 E;  4KP4 A;  4LOM A;  4NH7 A;  2HFU A;  4JYA E;  2BU6 A;  3RLQ A;  2WI5 A;  3K98 A;  4DR7 E;  4YY3 E;  2YE8 A;  5K36 A;  1N0U A;  1UY8 A;  2UUC E;  4JI4 I;  1UY9 A;  3HZ1 A;  2YGF A;  3CGZ A;  1XNQ I;  2VES A;  4U3D A;  3TZ5 A;  3GIE A;  1AJ6 A;  2YE5 A;  2YEB A;  3P3E A;  2LJP A;  2WI1 A;  4FWG A;  1BXD A;  1I94 E;  4B3T I;  2PO0 A;  3EKO A;  1NHI A;  2WW4 A;  2YI5 A;  2PO2 B;  4DV0 E;  2JE6 B;  4EGK A;  2GQP A;  4IZJ D;  1GKZ A;  2GS8 A;  2ZBK B;  1YC3 A;  4JAU A;  3INX A;  1YES A;  4DR7 I;  2BA1 D;  4FWD A;  4YY3 I;  2IWS A;  3Q5L A;  3H80 A;  4JI8 E;  2UUC I;  2WER A;  3K97 A;  1UDQ A;  4KFG A;  2CH4 A;  2UXD E;  4MPE A;  1OYP A;  2UXB E;  2VWC A;  3O0I A;  4XC0 A;  3OWB A;  2Z5B A;  2BU8 A;  1Y4S A;  4GKK E;  4OO1 F;  2ZDY A;  1KIJ A;  3QT8 A;  3U2K A;  5IN9 A;  2BM0 A;  1RHY A;  1Z59 A;  4JI7 E;  1JM6 A;  5J71 A;  5D7D A;  2PO1 B;  4R3M A;  1F51 A;  3F0N A;  3GON A;  2BT0 A;  5EKW A;  3PYD A;  3VHD A;  3CDI A;  3INW A;  4KHP E;  4GKJ E;  4HYP A;  5CTW A;  3ZZU A;  4CE2 A;  1RR9 A;  2CGE A;  2V2Q A;  4JI8 I;  2E0A A;  2UXD I;  4EMD A;  3OW6 A;  4QNJ A;  2UXB I;  4LCF A;  1TIL A;  1FWK A;  2ZKJ A;  3FT5 A;  4DXL A;  4GKK I;  3RLR A;  2Z5C A;  3R4P A;  4JI7 I;  1I58 A;  4YKY A;  1E3H A;  3G7E A;  4E72 A;  1VIS A;  4O07 A;  2BR2 B;  4Z7Y A;  4MU4 A;  2CCU A;  2CZ9 A;  2JEB A;  2AJ4 A;  3LPS A;  4I5S A;  4H7Q A;  4XKA A;  3R4N A;  3VHC A;  4HAC A;  3TZ4 A;  2FWZ A;  3P06 A;  5JEA C;  4LFA E;  3KRN A;  3ZKB A;  3B82 A;  2JEA A;  4KTN A;  1ZM3 A;  1FI4 A;  2HHH I;  3C0E A;  2FYP A;  5BOC A;  1FNM A;  2XDU A;  4GQT A;  3T2S A;  4WUD A;  3QT6 A;  4JI5 E;  2BRC A;  2V2V A;  3RLP A;  4AIM A;  5BR8 E;  4CE1 A;  5C0X B;  4NXN E;  5LMU E;  4V25 A;  4WUB A;  5GGZ A;  4CWP A;  4RPF A;  4IFD C;  1UYC A;  1Z5A A;  2BU7 A;  4DV5 E;  1YT1 A;  4LPB A;  5DNX A;  3B28 A;  4WUC A;  4OX9 E;  5D6Q A;  4ZKI A;  1PKP A;  2PNZ A;  4ASB A;  4CWQ A;  5K36 B;  4LFA I;  4K0K E;  3O2F A;  1GJV A;  2HK2 A;  1AH8 A;  4ASF A;  4YKZ A;  4R1F A;  3K17 A;  2WI6 A;  2V8P A;  1HR0 E;  3B8H A;  1BKN A;  4PRX A;  2R3V A;  2YI6 A;  3BMY A;  3FV5 A;  4YKX A;  3M7N G;  3D36 A;  5CTY A;  3HKM A;  4JI5 I;  2V34 A;  4ZVI A;  1N36 E;  1KKH A;  1OYR A;  1XMQ I;  1N33 E;  1UYK A;  3D0B A;  3EKR A;  5BR8 I;  2NN6 D;  2PO0 B;  3HZ5 A;  4PL9 A;  5LMU I;  4XE2 A;  2X36 A;  3WU3 A;  2YE7 A;  1HNX E;  4L93 A;  4CWS A;  4DV5 I;  2YE4 A;  2ZIT A;  2WEP A;  1Y5Y A;  4OX9 I;  2BU2 A;  4YHH I;  4YKQ A;  1ID0 A;  2BV3 A;  4LFC E;  4OO1 C;  1YHC A;  4K0K I;  4JI2 I;  1ELO A;  2YEE A;  2IWX A;  2YKJ A;  2C39 B;  3CRK A;  5M4M A;  4O0B A;  4DV7 E;  3KE6 A;  2YE9 A;  5A2Q Q;  1J5E E;  2XX5 A;  3A0R A;  4JAV A;  2Z5B B;  1A6F A;  3TUH A;  1Y4U A;  1N36 I;  2UUA E;  1N33 I;  2VCJ A;  3CRL A;  3ZXQ A;  3S5T A;  5IT9 Q;  2YGE A;  2BSM A;  1HNX I;  5LMN E;  2JT2 A;  3CWV A;  1UEK A;  2VCI A;  3HEK A;  4DR3 E;  4P7A A;  5JEA A;  4USK A;  3LNU A;  4LFC I;  2BTZ A;  3A0Z A;  5CTX A;  2BA1 G;  4B3M I;  4FCP A;  4Z7C A;  4E00 A;  2YGA A;  2A2D A;  1J5E I;  2GO4 A;  4EFT A;  2F4V E;  2Q8F A;  4DR6 I;  4CWT A;  1R62 A;  4XIT A;  2YE2 A;  3R4O A;  4MYU A;  4LF5 E;  4IFD A;  4FW4 A;  3V2U C;  3QT7 A;  5M4P A;  4OZE A;  4AM3 A;  4DV4 I;  4LF8 I;  2OI2 A;  4NBQ A;  2R42 A;  4HAC B;  3J81 C;  5BOD A;  1QZR A;  4KQV A;  5GME A;  1BGQ A;  4X64 E;  4LF9 E;  1NZ0 A;  1H74 A;  3Q1Q A;  1TID A;  3P3G A;  1Z0W A;  4DPX A;  4JI0 E;  3O6O A;  1XNR E;  2O1W A;  1HNZ I;  3TZ2 A;  4DV1 I;  4JG4 A;  2XK2 A;  4OO1 E;  4M1K A;  2XHX A;  4B3R E;  3PS3 A;  3PS2 A;  4LF5 I;  5DRQ A;  1QYE A;  1UYI A;  2EXL A;  3P76 A;  4JYA I;  3OTO E;  4MPN A;  4XIP A;  3QT5 A;  1N34 E;  4LWE A;  2C1G A;  3R91 A;  4EGI A;  5CTU A;  4MU1 A;  4NH9 A;  2AE8 A;  2BA0 G;  4GGL A;  2PNZ B;  1UYM A;  5C0X F;  2HKE A;  4OO1 A;  4MBC A;  1XHK A;  4EM7 A;  4X64 I;  4LF9 I;  2K5B A;  2BZ5 A;  1Z5C A;  3SL2 A;  1AMW A;  4JI0 I;  1XNR I;  4L91 A;  1WUU A;  1Z0T A;  4Q20 A;  4JAS A;  3GIG A;  3ZXO A;  1XMO E;  1ZM9 A;  1YSR A;  1I94 I;  2X7I A;  5C0X D;  3TTZ A;  1B63 A;  3ZKD A;  3HHU A;  4DR2 E;  4B3R I;  1MU5 A;  3L7Z B;  4DV0 I;  4DUH A;  1ZM2 A;  5FND A;  3HYY A;  3OTO I;  4X65 E;  1N34 I;  2YEC A;  2YJX A;  2WP8 A;  2IES A;  3GME A;  3NZK A;  3ZM7 A;  5K36 D;  3ZZ0 A;  1TH8 A;  4LWF A;  4MPC A;  2PNM A;  1FJG E;  1I59 A;  3EHH A;  3JZ3 A;  3QDD A;  1Y8O A;  4MB9 A;  5C93 A;  1YS3 A;  4XKO A;  5D6P A;  2O3Z A;  4DR4 E;  4YKW A;  1I5A A;  3CGY A;  2YEG A;  2IER A;  2VQF E;  3K99 A;  4LWG A;  1UYL A;  1EI1 A;  4AQY E;  4K4O A;  2CGF A;  5M4E A;  4X62 E;  2BA0 D;  4P52 A;  4USM A;  2UUB E;  2BYI A;  3JAM Q;  2XJX A;  4X65 I;  3CYG A;  1MX0 A;  4KHP I;  2JKI A;  4GKJ I;  5JEA B;  2YI7 A;  3Q5K A;  4FW7 A;  3MNR P;  4GT8 A;  4H81 A;  4X9L A;  4I3H A;  1FJG I;  4E02 A;  4ASG A;  2XHT A;  4U7O A;  1IBK E;  2XX2 A;  3B24 A;  4U93 A;  4DR4 I;  3J80 Q;  3Q5J A;  3T1H E;  2C38 A;  3T10 A;  4BA2 A;  2F1D A;  1Z0G A;  2VQF I;  2H8M A;  2XDL A;  4IFD B;  4AQY I;  3PYG A;  4U7N A;  4DPT A;  4LCG A;  4O04 A;  2O1U A;  4DV6 E;  2UUB I;  3BM9 A;  3UHM A;  2WNR A;  2YEJ A;  4LWH A;  4MP7 A;  4FW9 A;  2NN6 F;  4BIU A;  4DUZ E;  2YKI A;  4DZY A;  2YEH A;  3T1Y E;  1H7S A;  1YC1 A;  2WI2 A;  1L0O A;  4V26 A;  1UY7 A;  3K1J A;  3B27 A;  4GFN A;  4URO A;  4FPP A;  1IBK I;  1UYD A;  4B6C A;  2H55 A;  5FNC A;  2IOR A;  2XX4 A;  3OWD A;  4NXN I;  2J65 A;  1K47 A;  2HCH A;  5M4N A;  1MG7 A;  5C0X C;  1P42 A;  2J7K A;  2NPF A;  1B62 A;  1ZWH A;  2YEI A;  5M4H A;  2IWU A;  4DU7 A;  4DV6 I;  4HY1 A;  1IBL E;  2YEF A;  1BYQ A;  1NHJ A;  4OO1 B;  3A0W A;  4GEE A;  2YKE A;  1OYS A;  3T1Y I;  3WU6 A;  1KTV A;  3U67 A;  4MOT A;  1HR0 I;  1US7 A;  4DPW A;  3GIG B;  4IZK A;  2QG0 A;  4LF7 E;  5FLX C;  4JI3 E;  2YKB A;  2QFO A;  3LMM A;  2GQ0 A;  4QPK A;  4EMV A;  2XHR A;  1UY6 A;  4L94 A;  1IBL I;  4CWN A;  4HXW A;  3DGE A;  5LL6 R;  2WP8 B;  2Z5E A;  4JI6 E;  2E5L E;  4DR1 E;  4DV7 I;  4LF6 E;  4XTJ A;  4DV2 E;  2C37 A;  3RKZ A;  5J6A A;  4FWH A;  1U0Z A;  3WQ9 A;  2Z5C B;  2CCT A;  2YJW A;  4BXI A;  1I5B A;  4DV3 E;  4N3O A;  2UUA I;  4LF7 I;  4XD8 A;  2QF6 A;  4JI3 I;  4HZ5 A;  4AWP A;  2AKP A;  2HG1 A;  2JEB B;  2XAB A;  2XCM A;  4EGH A;  5LMN I;  4LWI A;  3T1K A;  4URL A;  5JEN A;  4IZJ A;  2VQE E;  4DR3 I;  3T0H A;  4JI1 E;  4EEH A;  1Z0E A;  4KSG A;  1Z0B A;  1USV A;  3B4T A;  4JI4 E;  2JEA B;  3PEJ A;  2E5L I;  3DD6 A;  5C0X E;  2A2C A;  4LF6 I;  2BYH A;  2HHI A;  5JEA F;  2F4V I;  1PIE A;  4BQJ A;  2C38 B;  4JV5 E;  4CWO A;  4H85 A;  4BA2 B;  1Y60 A;  4BQG A;  4DV3 I;  4O09 A;  5IWA E;  4HXZ A;  3A0Y A;  2XJJ A;  4DR5 E;  5C0X A;  2NN6 C;  4URM A;  2CVE A;  5A2Q C;  1USU A;  4NXM E;  2VQE I;  2WNR B;  4FW5 A;  1YER A;  2UWD A;  2YK2 A;  4URN A;  5JEA D;  1UDO A;  4FMT A;  4JI1 I;  4IFD F;  2O1T A;  4E01 A;  2C1I A;  4J3D A;  4AID A;  2C2A A;  2ZM6 E;  2EFG A;  4FW6 A;  5IT9 C;  1HNW E;  2VW5 A;  2YI0 A;  3GIF A;  2UU9 E;  4QPJ A;  2Q8G A;  5K36 F;  3Q6N A;  1E3P A;  4DUY E; 
#chains in the Genus database with same CATH homology
 4JV5 I;  1ZXN A;  2BU5 A;  3PYF A;  5F5R A;  3PYE A;  3ZZT A;  5IWA I;  1N32 E;  1OJ4 A;  2HK3 A;  5FWK A;  4DR5 I;  1D6T A;  3A0T A;  4BIZ A;  1Z5B A;  5M4K A;  2PNL A;  3HUL A;  4NXM I;  4AWQ A;  2HFS A;  2VF3 A;  1A4H A;  3HYZ A;  4LF4 E;  3K60 A;  2XDK A;  2XD6 A;  2ESA A;  4CE3 A;  4UTG A;  4EFU A;  2ZM6 I;  2Q2E B;  3A0X A;  4AWO A;  1UYF A;  1Z0C A;  4YKR A;  1HNW I;  4DU8 A;  4FCQ A;  2Q8I A;  2UU9 I;  1QY8 A;  1I5C A;  1XMO I;  4IZK B;  2E1R A;  3PRY A;  4DUY I;  2CG9 A;  4GCZ A;  4B7P A;  2YED A;  3T0Z A;  1N32 I;  4X66 E;  4DR2 I;  2XDS A;  2UXC E;  3FT8 A;  2XEX A;  2V2Z A;  1TBW A;  3VHA A;  2PNR A;  1U2O A;  4LF4 I;  1FWL A;  2XDX A;  3NMQ A;  1H72 C;  2YEA A;  3EHJ A;  5D6Q A;  4B3S E;  2DEJ A;  2HHH E;  3EHG A;  3QTF A;  2FXS A;  2JJC A;  2YE6 A;  5D7C A;  4MP2 A;  5FNF A;  1YT0 A;  1S4E A;  3HJC A;  2YK9 A;  5IDM A;  4X62 I;  4X66 I;  3D4J A;  3B26 A;  4R3A A;  3B78 A;  2UXC I;  4IZJ B;  2IOP A;  1YT2 A;  3PEH A;  1S16 A;  2YKC A;  2HKJ A;  5D7R A;  4ASA A;  3IED A;  5FLX Q;  3G75 A;  4AS9 A;  1FKA E;  5CF0 A;  2XJG A;  1N0V C;  3R92 A;  4B3S I;  3B25 A;  4CWR A;  4P8O A;  1THN A;  4LP0 A;  2WI3 A;  3WU4 A;  2GFD A;  2BM1 A;  2Q8H A;  3T1H I;  4NH8 A;  4XCL A;  1ZM4 A;  4HYM A;  1H7U A;  1KVK A;  1Y6Z A;  2DEI A;  1XMQ E;  3C11 A;  1U2R A;  3EHF A;  2O1V A;  4XCJ A;  5F3K A;  5L3J A;  3TZ0 A;  1YC4 A;  3R4M A;  1NHH A;  4XKK A;  4DUZ I;  1Y8P A;  4PRV A;  4YHH E;  4FCR A;  3U2D A;  3VAD A;  1KZN A;  4XDM A;  2YE3 A;  4JI2 E;  3K85 A;  3J7A M;  1Z0V A;  1AH6 A;  3OPD A;  3M6A A;  3J81 Q;  3JAM C;  1S14 A;  5IDJ A;  4BAE A;  5GMD A;  4DPU A;  3J7A G;  1UYE A;  5CPH A;  1IBM E;  3Q6M A;  1YSZ A;  2WI4 A;  1B3Q A;  1RRE A;  2WEQ A;  4JQL A;  1HK7 A;  4CWF A;  4DPY A;  3J80 C;  1DAR A;  3OMU A;  3V5R A;  1I5D A;  1PVG A;  4B3M E;  1H73 A;  1ZXM A;  4XIQ A;  1OSF A;  4LFB E;  4PU9 A;  4YKT A;  4ED4 A;  4HZ0 A;  4FN5 A;  3H4L A;  4DR6 E;  4UT4 A;  3G7B A;  1GKX A;  4YKU A;  4L8Z A;  1YET A;  2WI7 A;  2ZDX A;  1TC0 A;  1IBM I;  3WHA A;  1ZW9 A;  1Y8N A;  2BRE A;  2CCS A;  3WU5 A;  4DV4 E;  4LF8 E;  1TC6 A;  1UYG A;  2QG2 A;  4XIR A;  1UYH A;  1EA6 A;  4JI6 I;  3LTO A;  2IOQ A;  1AM1 A;  1XNQ E;  4DR1 I;  4KSH A;  2FWY A;  4DV2 I;  4L90 A;  4LFB I;  4W7T A;  1HNZ E;  3D2R A;  4DV1 E;  4O05 A;  4B3T E;  4MYT A;  4KP4 A;  4NH7 A;  2HFU A;  4JYA E;  2BU6 A;  3RLQ A;  2WI5 A;  3K98 A;  4DR7 E;  4YY3 E;  2YE8 A;  1N0U A;  1UY8 A;  2UUC E;  4JI4 I;  1UY9 A;  3HZ1 A;  2YGF A;  3CGZ A;  1XNQ I;  3TZ5 A;  3GIE A;  1AJ6 A;  2YE5 A;  2YEB A;  2LJP A;  2WI1 A;  4FWG A;  1BXD A;  1I94 E;  4B3T I;  3EKO A;  1NHI A;  2WW4 A;  2YI5 A;  4DV0 E;  4EGK A;  2GQP A;  4IZJ D;  1GKZ A;  2GS8 A;  2ZBK B;  1YC3 A;  4JAU A;  3INX A;  1YES A;  4DR7 I;  4FWD A;  4YY3 I;  2IWS A;  3Q5L A;  3H80 A;  4JI8 E;  2UUC I;  2WER A;  3K97 A;  4KFG A;  2CH4 A;  2UXD E;  4MPE A;  2UXB E;  2VWC A;  3O0I A;  4XC0 A;  3OWB A;  2Z5B A;  2BU8 A;  1Y4S A;  4GKK E;  2ZDY A;  3U2K A;  1KIJ A;  3QT8 A;  5IN9 A;  2BM0 A;  1Z59 A;  4JI7 E;  1JM6 A;  5J71 A;  5D7D A;  4R3M A;  3F0N A;  3GON A;  2BT0 A;  3PYD A;  3VHD A;  3INW A;  4KHP E;  4GKJ E;  4HYP A;  5CTW A;  3ZZU A;  4CE2 A;  1RR9 A;  2CGE A;  2V2Q A;  4JI8 I;  2E0A A;  2UXD I;  4EMD A;  3OW6 A;  2UXB I;  3FT5 A;  1TIL A;  1FWK A;  2ZKJ A;  4DXL A;  4GKK I;  3RLR A;  2Z5C A;  3R4P A;  4JI7 I;  1I58 A;  4YKY A;  3G7E A;  1VIS A;  4O07 A;  4Z7Y A;  2CCU A;  2CZ9 A;  4I5S A;  2AJ4 A;  3LPS A;  4XKA A;  4H7Q A;  3R4N A;  3VHC A;  4HAC A;  3TZ4 A;  2FWZ A;  3P06 A;  4LFA E;  3ZKB A;  3B82 A;  4KTN A;  1ZM3 A;  1FI4 A;  2HHH I;  3C0E A;  2FYP A;  5BOC A;  1FNM A;  2XDU A;  4GQT A;  3T2S A;  4WUD A;  3QT6 A;  4JI5 E;  2BRC A;  2V2V A;  3RLP A;  5BR8 E;  4CE1 A;  4NXN E;  4V25 A;  5LMU E;  5GGZ A;  4WUB A;  4CWP A;  4RPF A;  1UYC A;  1Z5A A;  2BU7 A;  4DV5 E;  1YT1 A;  4LPB A;  3B28 A;  4WUC A;  4OX9 E;  4ZKI A;  1PKP A;  4ASB A;  4CWQ A;  4LFA I;  4K0K E;  3O2F A;  1GJV A;  2HK2 A;  1AH8 A;  4ASF A;  4YKZ A;  3K17 A;  4R1F A;  2WI6 A;  2V8P A;  1HR0 E;  3B8H A;  1BKN A;  4PRX A;  2R3V A;  2YI6 A;  3BMY A;  3FV5 A;  4YKX A;  3D36 A;  5CTY A;  4JI5 I;  2V34 A;  4ZVI A;  1N36 E;  1KKH A;  1UYK A;  1XMQ I;  1N33 E;  3D0B A;  3EKR A;  3HZ5 A;  5BR8 I;  4XE2 A;  4PL9 A;  5LMU I;  2X36 A;  3WU3 A;  2YE7 A;  1HNX E;  4L93 A;  4CWS A;  4DV5 I;  2YE4 A;  2ZIT A;  2WEP A;  4OX9 I;  2BU2 A;  4YHH I;  4YKQ A;  1ID0 A;  2BV3 A;  4LFC E;  2YEE A;  4K0K I;  2YKJ A;  4JI2 I;  1ELO A;  3CRK A;  2IWX A;  5M4M A;  4O0B A;  4DV7 E;  3KE6 A;  2YE9 A;  5A2Q Q;  1J5E E;  2XX5 A;  3A0R A;  4JAV A;  2Z5B B;  1A6F A;  3TUH A;  1Y4U A;  1N36 I;  2UUA E;  1N33 I;  2VCJ A;  3CRL A;  3ZXQ A;  5IT9 Q;  2YGE A;  2BSM A;  1HNX I;  5LMN E;  3CWV A;  1UEK A;  2VCI A;  3HEK A;  4DR3 E;  4P7A A;  4USK A;  3LNU A;  4LFC I;  2BTZ A;  3A0Z A;  5CTX A;  4FCP A;  4B3M I;  4Z7C A;  4E00 A;  2YGA A;  2A2D A;  1J5E I;  4EFT A;  2F4V E;  2Q8F A;  4DR6 I;  4CWT A;  1R62 A;  4XIT A;  2YE2 A;  3R4O A;  4MYU A;  4LF5 E;  3V2U C;  3QT7 A;  5M4P A;  4DV4 I;  4LF8 I;  2OI2 A;  2R42 A;  4HAC B;  3J81 C;  5BOD A;  1QZR A;  4KQV A;  5GME A;  1BGQ A;  4X64 E;  4LF9 E;  1NZ0 A;  1H74 A;  3Q1Q A;  1TID A;  1Z0W A;  4DPX A;  4JI0 E;  3O6O A;  1XNR E;  2O1W A;  1HNZ I;  3TZ2 A;  4DV1 I;  4JG4 A;  2XK2 A;  4M1K A;  2XHX A;  4B3R E;  1QYE A;  4LF5 I;  1UYI A;  4MPN A;  4XIP A;  2EXL A;  4JYA I;  3OTO E;  3QT5 A;  1N34 E;  4LWE A;  3R91 A;  4EGI A;  5CTU A;  4NH9 A;  4GGL A;  1UYM A;  2HKE A;  4MBC A;  1XHK A;  4EM7 A;  4X64 I;  4LF9 I;  2K5B A;  2BZ5 A;  1Z5C A;  3SL2 A;  1AMW A;  4JI0 I;  1XNR I;  4L91 A;  1WUU A;  1Z0T A;  4Q20 A;  4JAS A;  3GIG A;  3ZXO A;  1XMO E;  1ZM9 A;  1YSR A;  1I94 I;  2X7I A;  3TTZ A;  1B63 A;  3ZKD A;  3HHU A;  4DR2 E;  4B3R I;  1MU5 A;  4DV0 I;  4DUH A;  1ZM2 A;  5FND A;  3HYY A;  3OTO I;  4X65 E;  1N34 I;  2YEC A;  2YJX A;  3ZM7 A;  4LWF A;  1TH8 A;  3ZZ0 A;  4MPC A;  2PNM A;  1FJG E;  1I59 A;  3EHH A;  3JZ3 A;  3QDD A;  1Y8O A;  4MB9 A;  5C93 A;  1YS3 A;  4XKO A;  5D6P A;  4DR4 E;  4YKW A;  1I5A A;  3CGY A;  2YEG A;  2VQF E;  3K99 A;  4LWG A;  1UYL A;  1EI1 A;  4AQY E;  4K4O A;  2CGF A;  5M4E A;  4X62 E;  4P52 A;  4USM A;  2UUB E;  2BYI A;  3JAM Q;  2XJX A;  4X65 I;  1MX0 A;  4KHP I;  2JKI A;  4GKJ I;  3Q5K A;  2YI7 A;  3MNR P;  4GT8 A;  4H81 A;  4X9L A;  4I3H A;  1FJG I;  4E02 A;  4ASG A;  2XHT A;  4U7O A;  1IBK E;  2XX2 A;  3B24 A;  4U93 A;  4DR4 I;  3J80 Q;  3Q5J A;  3T1H E;  3T10 A;  1Z0G A;  2VQF I;  2H8M A;  2XDL A;  4AQY I;  3PYG A;  4U7N A;  4DPT A;  4O04 A;  2O1U A;  4DV6 E;  2UUB I;  3BM9 A;  4LWH A;  2YEJ A;  4MP7 A;  4BIU A;  4FW9 A;  4DUZ E;  2YKI A;  4DZY A;  2YEH A;  3T1Y E;  1H7S A;  1YC1 A;  2WI2 A;  1L0O A;  4V26 A;  1UY7 A;  3K1J A;  3B27 A;  4GFN A;  4URO A;  4FPP A;  1IBK I;  1UYD A;  4B6C A;  2H55 A;  5FNC A;  2IOR A;  2XX4 A;  3OWD A;  4NXN I;  1K47 A;  2HCH A;  5M4N A;  1MG7 A;  2J7K A;  2NPF A;  1B62 A;  1ZWH A;  2YEI A;  5M4H A;  2IWU A;  4DU7 A;  4DV6 I;  4HY1 A;  1IBL E;  2YEF A;  1BYQ A;  1NHJ A;  3A0W A;  4GEE A;  2YKE A;  3T1Y I;  3WU6 A;  1KTV A;  3U67 A;  4MOT A;  1HR0 I;  1US7 A;  4DPW A;  3GIG B;  4IZK A;  2QG0 A;  4LF7 E;  5FLX C;  4JI3 E;  2YKB A;  2QFO A;  2GQ0 A;  4QPK A;  4EMV A;  2XHR A;  1UY6 A;  4L94 A;  1IBL I;  4CWN A;  4HXW A;  3DGE A;  5LL6 R;  2Z5E A;  4JI6 E;  2E5L E;  4DR1 E;  4DV7 I;  4LF6 E;  4XTJ A;  4DV2 E;  3RKZ A;  5J6A A;  4FWH A;  1U0Z A;  3WQ9 A;  2Z5C B;  2CCT A;  2YJW A;  4BXI A;  1I5B A;  4DV3 E;  4N3O A;  2UUA I;  4LF7 I;  4XD8 A;  2QF6 A;  4JI3 I;  4HZ5 A;  4AWP A;  2AKP A;  2HG1 A;  2XAB A;  4EGH A;  2XCM A;  5LMN I;  4LWI A;  3T1K A;  4URL A;  4IZJ A;  2VQE E;  4DR3 I;  3T0H A;  4JI1 E;  4EEH A;  1Z0E A;  4KSG A;  1Z0B A;  1USV A;  4JI4 E;  3PEJ A;  2E5L I;  2A2C A;  4LF6 I;  2BYH A;  2F4V I;  1PIE A;  4BQJ A;  4JV5 E;  4CWO A;  4H85 A;  4BQG A;  4DV3 I;  4O09 A;  5IWA E;  4HXZ A;  3A0Y A;  2XJJ A;  4DR5 E;  4URM A;  5A2Q C;  1USU A;  4NXM E;  2VQE I;  2UWD A;  2YK2 A;  1YER A;  4URN A;  4FMT A;  4JI1 I;  2O1T A;  4E01 A;  2C2A A;  2ZM6 E;  2EFG A;  5IT9 C;  2VW5 A;  1HNW E;  2YI0 A;  3GIF A;  2UU9 E;  4QPJ A;  2Q8G A;  3Q6N A;  4HY6 A;  4DUY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...