4PRXA

E. coli gyrb 43-kda n-terminal fragment in complex with adp+pi
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
374
structure length
363
Chain Sequence
SYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEGGIKAFVEYLNKNKTPIHPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKIID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-Terminal Gyrase B Fragment in Complex with ADPPi Reveals Rigid-Body Motion Induced by ATP Hydrolysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords GyrB
total genus 108
structure length 363
sequence length 374
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4prxA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4prxA01
1N33E 4URMA 4DU7A 2HG1A 3FT5A 1UYIA 4GT8A 4DR3E 4B3RE 1YS3A 2V34A 2CG9A 5IWAE 2YGAA 5LMUI 4PRXA 3MNRP 3K1JA 3U2DA 3M6AA 5A2QQ 1QYEA 2DEJA 2VF3A 4DV2I 2BU2A 2BU8A 2YKJA 4EGKA 2YE6A 2UXDI 2HFUA 1KIJA 4LWHA 3C0EA 2LJPA 5M4HA 5FLXC 4X9LA 1AJ6A 2YKBA 2VCJA 4DV4E 4LWGA 4PRVA 1B3QA 2YK2A 4H85A 4GEEA 1AH8A 2QG2A 5L3JA 4DR4I 4CE1A 4X65I 4JYAE 4E02A 2WI1A 3OWBA 5J71A 2XJXA 4GQTA 3QT8A 1BKNA 4LF8I 2YKEA 1S4EA 4B3TI 3R91A 5FNDA 4URNA 4HACB 4O05A 4DR7I 4DV5E 2V8PA 5GMEA 4E00A 4DV3E 3WU5A 1Y4UA 1XNRI 4XCLA 2ZBKB 4B3TE 2BU7A 4XD8A 3SL2A 1FWKA 4CWNA 3B26A 4JYAI 4KSGA 2CCSA 1HNZE 4AWOA 3B78A 2QG0A 1K47A 4DR4E 3HHUA 4CWRA 4XKKA 4DV4I 1HNXI 5IDMA 4LF8E 3WU6A 1ZWHA 5M4PA 1FI4A 1Z0TA 4CWOA 1PVGA 5D7DA 4JG4A 4DR6I 3BMYA 4HY6A 1THNA 4UT4A 4P52A 4QPJA 4B3SE 1AMWA 3B82A 4AS9A 3A0WA 1N33I 2XX5A 3H80A 1ZM3A 4V25A 3O2FA 1XHKA 3QDDA 1Z5BA 4ZVIA 4MYUA 5IWAI 3A0YA 3TZ5A 1Z0EA 3PYDA 4DR3I 4B3RI 4Q20A 1HNZI 3HZ1A 1I94E 4DUZE 1US7A 4O04A 3WQ9A 3ZXOA 2E1RA 1UYFA 4XKOA 4K0KI 4WUBA 2E0AA 2A2DA 2HHHE 3EKRA 2YJWA 4URLA 4FWHA 2O1UA 1U2OA 3J81Q 5FNCA 2YI5A 4CE2A 4NH8A 2OI2A 1ZM2A 3RLQA 3T1KA 1YSRA 4XCJA 4YHHE 2ZDYA 3JAMQ 4FPPA 1ZM4A 2EFGA 1HNWE 2IOPA 4L8ZA 2XDLA 5FNFA 5IT9Q 1R62A 4LWFA 4DPWA 4FMTA 4CWFA 4CWPA 4NH9A 2WEQA 2UXDE 2V2QA 2YKCA 1Z0GA 1YC4A 5D7CA 4EEHA 2YJXA 3RLPA 3C11A 3JZ3A 2Q2EB 5LMUE 5D6PA 4DUHA 3K99A 4XIRA 3GONA 5IN9A 4HXWA 2HHHI 4DV6I 1GKXA 3R4OA 2CZ9A 3OPDA 3G7EA 1DARA 4NXNI 1NHIA 2CGFA 4R3MA 2YI7A 4GCZA 3GIFA 4FWDA 4DV3I 2VQEE 4LPBA 1Z0WA 4DV5I 3A0RA 4R1FA 4YKZA 5CTWA 4EM7A 4X64E 1N34E 4KHPI 5FLXQ 4RPFA 4EGIA 2UXCI 2YECA 2XABA 1TH8A 4LF6I 2FWYA 4BIZA 2YI0A 1YT2A 1IBME 3QT5A 2XX2A 2AKPA 2E5LE 3B8HA 4XIPA 4BXIA 3ZM7A 1IBLE 2XHXA 2UUAE 4DR2I 2IWSA 2YEIA 5GGZA 1ZXNA 4FN5A 5IT9C 1KZNA 4JASA 4B3MI 1Z5CA 4DV1I 3OTOI 4CWSA 2YEHA 4DUYE 3EHFA 4UROA 4U7OA 1HR0E 1XMQE 2YE2A 4JI8I 3TZ4A 4DV7E 2FWZA 3F0NA 1J5EI 1YT1A 3R4NA 4YKXA 2UU9I 4ZKIA 2WI3A 3PEJA 3EKOA 4DR1I 3CRLA 4JI4I 4ASAA 3ZZUA 2UXBE 2ZM6I 3T1YI 3A0ZA 4EFTA 1BYQA 1RR9A 3CRKA 3J80Q 2YE5A 2YEEA 4U93A 3HYYA 2F4VI 4DR5I 5GMDA 4JI1I 4USKA 3D2RA 4YKWA 2BU6A 4ED4A 4NXMI 3BM9A 1H73A 3FV5A 4DPYA 4KP4A 3RKZA 2H8MA 3PYFA 1TC0A 4LFBI 2HCHA 3Q5KA 2BT0A 2HK3A 3T1HE 1MX0A 4MOTA 4M1KA 3EHHA 3U67A 2BREA 4DV2E 2JKIA 1KKHA 2CH4A 4WUDA 1XNQE 4LWEA 2QFOA 5LMNI 1NHJA 3O0IA 1GJVA 4YKTA 2VQFE 4JI6E 5BODA 1EA6A 2XDUA 4LF4E 2XX4A 5CPHA 2UUBE 3ZZ0A 1FJGI 1WUUA 4LFCI 1UY9A 4L94A 4R3AA 1IBKI 1ID0A 4JI3E 5M4KA 4LF7E 4KTNA 2XDSA 2YK9A 4JI5E 3J7AM 2YEDA 1H7SA 4FCPA 1XMOI 2ESAA 1EI1A 5BR8E 1YT0A 2ZM6E 3T1YE 2XHRA 3OW6A 4HZ0A 3K60A 4JAVA 4LP0A 1D6TA 4JI2I 1KTVA 1UYKA 2HK2A 4MBCA 3ZXQA 1Z5AA 1FJGE 4X66E 4ASBA 2R3VA 1UYLA 2XD6A 1BXDA 4HXZA 1PKPA 3Q1QA 4GKJE 4JI8E 1UYCA 3B27A 1N32E 3GIGA 1YC1A 2VQFI 3CWVA 1HR0I 1N36I 2GQPA 4DUYI 2EXLA 4BQJA 3OTOE 1QZRA 2X7IA 2JJCA 2XJGA 3RLRA 1YETA 4L90A 3T0ZA 4HYPA 4YKYA 4KFGA 1N36E 3JAMC 3LPSA 1Y8NA 4LWIA 4HYMA 4DV0I 5A2QC 3CGZA 4BIUA 3ZKDA 2E5LI 2WEPA 4JI0I 1Y4SA 1OSFA 3K98A 3J80C 4P8OA 5D7RA 4NXME 4DZYA 3D0BA 4LF6E 3D4JA 4DR5E 4LF5I 2C2AA 3B28A 2BZ5A 4YY3I 3EHJA 4XE2A 1H7UA 2Q8GA 2CCUA 4X64I 3GIGB 4B6CA 2WI5A 2YE4A 2VQEI 3TZ2A 2BM0A 4DR1E 3LNUA 1TILA 4OX9E 2QF6A 2UU9E 1I59A 2YE3A 4FW9A 2YEGA 3O6OA 3A0XA 4AQYE 4KQVA 3HULA 1JM6A 5C93A 4DV6E 4L93A 2A2CA 1N0VC 4HZ5A 1XMQI 3PYGA 2VW5A 5CF0A 2AJ4A 1I58A 4B3ME 1I5CA 2UUCE 4JV5I 2IWXA 3U2KA 2BU5A 2V2ZA 4FCQA 4NH7A 4HACA 4Z7YA 1Y8OA 1NHHA 3PYEA 3Q5LA 1N0UA 3B24A 1HNWI 1UY6A 1B63A 1OJ4A 2UUCI 4I3HA 1NZ0A 4JV5E 5D6QA 2YE8A 4JI7I 2GFDA 2GS8A 3G7BA 1ZM9A 2WI4A 3VHDA 4U7NA 3R4MA 4JI2E 2BYHA 2YKIA 1BGQA 3VHCA 4GKJI 4QPKA 1FNMA 4DU8A 4AQYI 2XEXA 4JI4E 4H7QA 4YKQA 3KE6A 4JI3I 4OX9I 1I5AA 2BTZA 1ZW9A 4LFCE 1UYMA 4O0BA 1YERA 4KSHA 2V2VA 3PEHA 4K4OA 1I94I 5M4EA 1I5DA 2UUBI 3INWA 4GGLA 1J5EE 3ZKBA 4GKKE 1H72C 3WU3A 2IOQA 3TUHA 3G75A 3K17A 4LF7I 4I5SA 1UY7A 4LFAE 1U0ZA 2IORA 4W7TA 2YE9A 1UEKA 1A6FA 4JI7E 1A4HA 5CTUA 3IEDA 4XC0A 2X36A 2YE7A 2UUAI 3OMUA 4DV0E 2BM1A 4B3SI 1S16A 4V26A 2ZITA 4EMDA 1B62A 1Z0CA 3R4PA 4EFUA 1XNQI 4USMA 4DR6E 2YGFA 4LFAI 2Q8HA 4O09A 4E01A 2F4VE 2DEIA 2XDKA 1UYHA 4DPTA 1N34I 1ZXMA 4GKKI 2ZDXA 4O07A 1QY8A 2HFSA 3WU4A 3V5RA 4X66I 1GKZA 4EGHA 5CTXA 4DXLA 4HY1A 4P7AA 2FXSA 3T10A 5LL6R 4DPXA 1UYEA 5J6AA 2UWDA 3LTOA 3V2UC 1XNRE 1S14A 5BR8I 2WI6A 2UXBI 4Z7CA 4ASFA 4AWQA 4LF5E 3D36A 3TZ0A 5M4MA 4WUCA 1UYDA 2XDXA 4JI0E 4XKAA 4H81A 3CGYA 4X65E 4BAEA 3OWDA 4DV7I 4CE3A 4LF4I 1PIEA 4MPEA 3WHAA 1FWLA 3EHGA 2FYPA 4ASGA 2CCTA 1MU5A 3R92A 4MB9A 3GIEA 4MPCA 4JQLA 4GFNA 3QT7A 2VCIA 5M4NA 1FKAE 1N32I 2WERA 4JAUA 2R42A 5BOCA 4MPNA 2WI2A 1MG7A 1I5BA 2WW4A 2YEJA 3TTZA 4LFBE 2O1WA 1Z0VA 2XJJA 2XHTA 2VWCA 2Q8FA 3HYZA 1UYGA 2BV3A 1VISA 2J7KA 4DUZI 2BYIA 2WI7A 4KHPE 1TIDA 3QT6A 1YESA 3DGEA 4PL9A 4YKRA 4MYTA 5F5RA 2Q8IA 1XMOE 5IDJA 4JI5I 2HKJA 3K97A 4YY3E 4DR7E 4FWGA 1IBKE 1TC6A 3T0HA 2XCMA 4DPUA 4XDMA 4B7PA 1U2RA 4CWQA 2BSMA 2YEBA 4X62I 3QTFA 3J7AG 2H55A 1UY8A 2NPFA 4JI6I 4MP7A 1Z59A 4BQGA 3ZZTA 2BRCA 5LMNE 3B25A 4EMVA 4XIQA 1L0OA 3A0TA 3INXA 1AH6A 4DV1E 5CTYA 4XITA 3FT8A 4DR2E 1YC3A 3HZ5A 2IWUA 2HKEA 3T1HI 1TBWA 1IBLI 2K5BA 3J81C 4MP2A 5F3KA 3VHAA 4AWPA 5FWKA 1HNXE 1RREA 4YKUA 1YSZA 2ZKJA 2YEAA 2XK2A 4UTGA 4XTJA 4YHHI 3T2SA 4L91A 1IBMI 2O1VA 4X62E 4K0KE 2PNRA 2YI6A 1H74A 4JI1E 3Q5JA 3H4LA 4LF9E 3NMQA 2UXCE 1ELOA 1Y8PA 1Z0BA 3HEKA 4CWTA 4FCRA 2YGEA 1AM1A 2YEFA 3VADA 1KVKA 4NXNE 4PU9A 4LF9I
chains in the Genus database with same CATH superfamily
1N33E 4URMA 5D6QA 2O3ZA 4DU7A 2HG1A 3FT5A 1UYIA 4GT8A 4DR3E 4B3RE 1YS3A 2V34A 2CG9A 4QNKA 5IWAE 2BA0G 2YGAA 5LMUI 4PRXA 3MNRP 3K1JA 3U2DA 3M6AA 2PNZA 5A2QQ 2O1TA 1QYEA 2DEJA 2VF3A 4DV2I 4IFDB 2BU2A 2BU8A 2YKJA 5GGZA 4EGKA 2Z5EA 2YE6A 2UXDI 5K36C 2HFUA 1KIJA 4LWHA 3C0EA 2LJPA 5M4HA 5FLXC 4X9LA 1AJ6A 2YKBA 2VCJA 4DV4E 4LWGA 4PRVA 5ELWA 1B3QA 2NN6A 5EL9A 2YK2A 4GEEA 4QNJA 1AH8A 2QG2A 2J65A 3GMEA 1UDSA 5L3JA 4DR4I 4CE1A 4X65I 4JYAE 4E02A 2WI1A 3OWBA 5J71A 2XJXA 4GQTA 3QT8A 1BKNA 4LF8I 2GO4A 1S4EA 4B3TI 2YKEA 3R91A 5FNDA 4URNA 1E3HA 4CWFA 4HACB 4O05A 4DR7I 4DV5E 2V8PA 5GMEA 4E00A 4DV3E 3WU5A 1Y4UA 1XNRI 4XCLA 3Q6MA 3LMMA 2ZBKB 4B3TE 2BU7A 4LCGA 4XD8A 1RHYA 4MQYA 3SL2A 1FWKA 4CWNA 1OYSA 3B26A 3PS1A 4JYAI 4KSGA 2CCSA 2CVEA 1HNZE 5C0XB 3B78A 2C1GA 1K47A 2QG0A 4DR4E 4AWOA 5JENA 4MU0A 2HHIA 3P3EA 3HHUA 4CWRA 4XKKA 4MU1A 5DNXA 4DV4I 1HNXI 3GLLA 4LF8E 5IDMA 1UDOA 3WU6A 1ZWHA 5M4PA 1FI4A 1Z0TA 3M85D 4IFDC 4CWOA 1PVGA 5D7DA 4JG4A 1E3PA 4DR6I 2C39B 2WP8A 3BMYA 4HY6A 5C0XE 1THNA 4UT4A 4P52A 2NN6B 4QPJA 4B3SE 3M7ND 1AMWA 3B82A 4AS9A 3A0WA 1N33I 2XX5A 3H80A 1ZM3A 4MDTA 4V25A 3O2FA 1XHKA 2F1DA 3QDDA 1Z5BA 4AIMA 4ZVIA 4MYUA 5IWAI 3A0YA 3TZ5A 1Z0EA 3PYDA 4DR3I 4B3RI 4Q20A 1HNZI 2PO0A 3HZ1A 1I94E 4DUZE 1US7A 4O04A 3WQ9A 3ZXOA 2E1RA 1UYFA 4XKOA 4K0KI 4WUBA 2E0AA 2A2DA 2HHHE 3EKRA 2YJWA 4URLA 4FWHA 4LCFA 2IERA 2O1UA 1U2OA 3J81Q 3CYGA 2YI5A 5FNCA 4CE2A 4NH8A 2OI2A 1ZM2A 2Z5CA 3RLQA 3T1KA 1YSRA 2NN6F 3PS2A 4XCJA 4YHHE 2ZDYA 3JAMQ 4FPPA 1ZM4A 2EFGA 2IOPA 1HNWE 4L8ZA 4AM3A 5JEAE 1UDQA 5IT9Q 1R62A 5DRPA 2XDLA 4LWFA 4DPWA 3CDJA 4U3BA 4FW4A 4FMTA 2WEQA 2UXDE 2V2QA 2YKCA 4NH9A 1Z0GA 1YC4A 2NN6E 3GCMA 1OYPA 5D7CA 2YJXA 3RLPA 4EEHA 3C11A 4IS9A 2GQ0A 3JZ3A 2Q2EB 5M4KA 3HJCA 5LMUE 5D6PA 4DUHA 3K99A 4IFDE 3GONA 4OKGA 4HXWA 2HHHI 4XIRA 4DV6I 5IN9A 1GKXA 3R4OA 2CZ9A 3OPDA 3G7EA 4BA1A 1DARA 4NXNI 1NHIA 2CGFA 4R3MA 2YI7A 4GCZA 3GIFA 3Q6NA 4FWDA 4DV3I 2VQEE 4LPBA 1Z0WA 4DV5I 3B4TA 4R1FA 2JE6B 3A0RA 4YKZA 2IESA 5CTWA 4EM7A 4X64E 3P3GA 1N34E 4KHPI 5FLXQ 4RPFA 4EGIA 2C37B 2UXCI 2YECA 2XABA 1TH8A 4FW3A 4LF6I 2FWYA 4BIZA 2YI0A 1YT2A 1IBME 3QT5A 2XX2A 2AKPA 2E5LE 4OO1F 3B8HA 4XIPA 4BXIA 3ZM7A 1IBLE 4OZEA 2XHXA 5C0XF 4DR2I 2UUAE 2IWSA 2YEIA 1ZXNA 4FN5A 1Y60A 5IT9C 2PO1B 4OO1B 1KZNA 4JASA 4B3MI 1Z5CA 4DV1I 3OTOI 4CWSA 2YEHA 4DUYE 3EHFA 4UROA 4U7OA 1HR0E 1XMQE 2YE2A 4JI8I 3TZ4A 4DV7E 2WNRB 2FWZA 3F0NA 1J5EI 4FW6A 1YT1A 3R4NA 4YKXA 2UU9I 4ZKIA 2WI3A 3PEJA 5K36F 3EKOA 4DR1I 3CRLA 4JI4I 4ASAA 3ZZUA 2UXBE 1UDNA 2ZM6I 3T1YI 2BA0D 3A0ZA 4EFTA 1BYQA 1RR9A 4E72A 3CRKA 3J80Q 2YE5A 2YEEA 2Z5CB 4U93A 3HYYA 2F4VI 4DR5I 5GMDA 4JI1I 4USKA 3D2RA 4YKWA 2BU6A 4ED4A 4IFDF 4NXMI 3BM9A 1H73A 3FV5A 1HK7A 4DPYA 4KP4A 3RKZA 2H8MA 3PYFA 4NBQA 1TC0A 4LFBI 2HCHA 3Q5KA 2BT0A 2HK3A 3K85A 3M85G 1MX0A 3T1HE 4MOTA 4M1KA 3U1YA 3KRNA 4MU4A 3EHHA 3U67A 2BREA 5JEAF 4DV2E 2JKIA 1KKHA 2CH4A 4WUDA 1XNQE 4LWEA 2QFOA 4BA1B 1NHJA 5LMNI 3O0IA 1GJVA 1R6MA 4YKTA 4MU3A 3M7NG 2VQFE 4JI6E 4LCHA 5BODA 1EA6A 2XDUA 4LF4E 2GO3A 2XX4A 5CPHA 2UUBE 3ZZ0A 5C0XA 1FJGI 1WUUA 4LFCI 1UY9A 4L94A 4R3AA 1IBKI 1ID0A 4JI3E 2NN6C 4LF7E 2CGEA 4KTNA 2XDSA 2YK9A 4OO1A 2PO1A 3HKMA 4JI5E 3J7AM 1H7SA 2YEDA 1XMOI 4FCPA 2ESAA 1EI1A 5BR8E 1YT0A 2ZM6E 3T1YE 2XHRA 3OW6A 4HZ0A 3K60A 4JAVA 4LP0A 1D6TA 4JI2I 5DROA 2JEAB 1KTVA 1UYKA 2HK2A 4MBCA 1IXMA 1Z5AA 3ZXQA 1FJGE 2WNRA 4X66E 4ASBA 2R3VA 1UYLA 2XD6A 1BXDA 4HXZA 1PKPA 3Q1QA 4GKJE 4AIDA 4JI8E 1UYCA 3B27A 1N32E 3GIGA 1YC1A 2JEBB 2VQFI 3CWVA 1HR0I 1N36I 4IFDD 2GQPA 4DUYI 2EXLA 4BQJA 3OTOE 1QZRA 2X7IA 2JJCA 2XJGA 3RLRA 1YETA 4L90A 3T0ZA 4HYPA 4YKYA 4KFGA 1N36E 3JAMC 3LPSA 1Y8NA 2PO0B 5DNLA 4HYMA 4DV0I 4LWIA 5A2QC 3CGZA 2Z5BB 4BIUA 2VESA 3ZKDA 2E5LI 5K36B 2WEPA 4JI0I 1F51A 1Y4SA 1OSFA 2PNMA 3K98A 3J80C 3DD6A 4P8OA 5D7RA 4NXME 4DZYA 3D0BA 4LF6E 3D4JA 3PS3A 4DR5E 4LF5I 3NZKA 2C2AA 4YY3I 2BZ5A 3B28A 3EHJA 1H7UA 4XE2A 2Q8GA 2CCUA 4X64I 3GIGB 4B6CA 2WI5A 2YE4A 2VQEI 3TZ2A 2BM0A 5FNFA 4DR1E 4IZJB 3LNUA 1TILA 2PO2B 4OX9E 2QF6A 2UU9E 1I59A 2YE3A 4FW9A 2YEGA 3O6OA 4FW5A 3A0XA 4AQYE 4KQVA 3HULA 4IZJA 1JM6A 5C93A 4DV6E 4L93A 2A2CA 2NN6D 2Z5BA 1N0VC 4LPFA 4HZ5A 1XMQI 3PYGA 2BA1D 2VW5A 1USUA 5CF0A 2AJ4A 1I58A 4IZKA 4B3ME 1I5CA 2UUCE 4JV5I 2IWXA 3U2KA 2BU5A 2V2ZA 4FCQA 4NH7A 4HACA 4Z7YA 1Y8OA 1NHHA 3PYEA 3Q5LA 1N0UA 2C39A 2WP8B 3B24A 1HNWI 1UY6A 1B63A 1OJ4A 5JEAA 4I3HA 1NZ0A 2AE8A 3CDIA 2UUCI 4JV5E 5C0XD 4JI7I 2YE8A 2GFDA 2GS8A 3G7BA 1ZM9A 3PRYA 2WI4A 3VHDA 4U7NA 3R4MA 4JI2E 2BYHA 4BA2B 2YKIA 2FTKA 1BGQA 3VHCA 4GKJI 4QPKA 1FNMA 4DU8A 3L7ZB 4AQYI 2XEXA 4JI4E 5K36E 4H7QA 4YKQA 3KE6A 4JI3I 4OX9I 1I5AA 2BTZA 1ZW9A 4LFCE 1UYMA 4O0BA 1YH8A 1YERA 2V2VA 5EKWA 3PEHA 1I94I 4K4OA 4KSHA 5M4EA 1I5DA 2UUBI 1VI7A 4IFDA 1J5EE 3INWA 4GGLA 3ZKBA 4GKKE 4ISAA 2PNZB 3WU3A 1H72C 2IOQA 3TUHA 3G75A 3K17A 4LF7I 4I5SA 2C38A 1UY7A 4IZJD 4LFAE 1U0ZA 2IORA 4W7TA 2YE9A 1UEKA 1A6FA 4JI7E 1A4HA 5CTUA 3IEDA 2C38B 4XC0A 3P3CA 2X36A 2YE7A 3P06A 2UUAI 3OMUA 4DV0E 2BM1A 4B3SI 1S16A 2JEBA 2ZITA 4EMDA 4V26A 5C0XC 1B62A 1Z0CA 3H1CA 3R4PA 1XNQI 4EFUA 4USMA 3UHMA 4DR6E 3P76A 2YGFA 4LFAI 2Q8HA 4O09A 4FW7A 4E01A 2F4VE 2PO2A 2DEIA 2JT2A 2XDKA 1UYHA 4DPTA 1N34I 1ZXMA 4GKKI 2ZDXA 4O07A 1QY8A 2BA1G 2HFSA 3WU4A 3V5RA 4X66I 1GKZA 4EGHA 5CTXA 4DXLA 4HY1A 4GQUA 4P7AA 5DRQA 2FXSA 3T10A 5LL6R 4DPXA 1UYEA 5J6AA 2C1IA 2UWDA 2PNLA 3LTOA 3V2UC 1XNRE 1S14A 5BR8I 2WI6A 2UXBI 4U3DA 4Z7CA 4ASFA 4AWQA 4LF5E 3D36A 3TZ0A 4IZKB 5M4MA 4WUCA 1UYDA 2XDXA 4JI0E 4XKAA 3U1KA 4H81A 3CGYA 4X65E 4BAEA 3OWDA 4DV7I 4CE3A 4LF4I 5JEAD 1PIEA 4MPEA 3WHAA 1FWLA 3EHGA 2FYPA 4ASGA 2CCTA 1MU5A 3R92A 4MB9A 3GIEA 4MPCA 4JQLA 4GFNA 3QT7A 2VCIA 4N3OA 5M4NA 1FKAE 1N32I 2WERA 4JAUA 2R42A 5BOCA 4MPNA 1YHCA 1MG7A 2WI2A 1I5BA 2WW4A 2YEJA 3TTZA 2O1WA 1XXEA 1Z0VA 4LFBE 2XJJA 4CWPA 2XHTA 4LOMA 2VWCA 1OYRA 2Q8FA 3HYZA 1UYGA 1Y6ZA 2BV3A 1VISA 2BR2B 2J7KA 5K36A 5JEAC 4DUZI 2BYIA 2WI7A 4KHPE 1TIDA 3QT6A 1YESA 3DGEA 4PL9A 4YKRA 4MYTA 5F5RA 2Q8IA 1XMOE 5IDJA 3L7ZA 4JI5I 2HKJA 4OO1D 3K97A 4YY3E 4DR7E 4FWGA 4OO1E 1IBKE 1TC6A 3T0HA 2XCMA 4DPUA 4XDMA 4B7PA 1U2RA 4CWQA 2BSMA 2YEBA 4X62I 3QTFA 3J7AG 4J3DA 2H55A 1UY8A 2NPFA 4JI6I 4MP7A 1Z59A 4BQGA 3ZZTA 2BRCA 5LMNE 1R6LA 3B25A 4EMVA 4XIQA 1L0OA 3A0TA 3INXA 1AH6A 2BR2A 4DV1E 3S5TA 5CTYA 2JEAA 4XITA 2C37A 3FT8A 4DR2E 1YC3A 3HZ5A 1Y5YA 2HKEA 3T1HI 2IWUA 1TBWA 1IBLI 2K5BA 3J81C 4MP2A 5F3KA 3VHAA 5FWKA 4AWPA 1USVA 1RREA 1HNXE 4BA2A 1YSZA 2ZKJA 2YEAA 4YKUA 2XK2A 4UTGA 4XTJA 4YHHI 3T2SA 4L91A 2JE6A 1IBMI 2O1VA 4X62E 4K0KE 2PNRA 2YI6A 1H74A 4JI1E 5JEAB 3Q5JA 3H4LA 4LF9E 3NMQA 2UXCE 1P42A 4OO1C 1ELOA 1Y8PA 1Z0BA 3HEKA 4CWTA 4FCRA 4H85A 2YGEA 1AM1A 2YEFA 5K36D 3VADA 1KVKA 5DRRA 4NXNE 4PU9A 4LF9I
chains in the Genus database with same CATH topology
1N33E 4URMA 4DU7A 2HG1A 3FT5A 1UYIA 4GT8A 4DR3E 4B3RE 1YS3A 2V34A 2CG9A 5IWAE 2YGAA 5LMUI 4PRXA 3MNRP 3K1JA 3U2DA 3M6AA 5A2QQ 2O1TA 1QYEA 2DEJA 2VF3A 4DV2I 2BU2A 2BU8A 2YKJA 4EGKA 2Z5EA 2YE6A 2UXDI 2HFUA 1KIJA 4LWHA 3C0EA 2LJPA 5M4HA 5FLXC 4X9LA 1AJ6A 2YKBA 2VCJA 4DV4E 4LWGA 4PRVA 1B3QA 2YK2A 4H85A 4GEEA 1AH8A 2QG2A 5L3JA 4DR4I 4CE1A 4X65I 4JYAE 4E02A 2WI1A 3OWBA 5J71A 2XJXA 4GQTA 3QT8A 1BKNA 4LF8I 2YKEA 1S4EA 4B3TI 3R91A 5FNDA 4URNA 4HACB 4O05A 4DR7I 4DV5E 2V8PA 5GMEA 4E00A 4DV3E 3WU5A 1Y4UA 1XNRI 4XCLA 3Q6MA 2ZBKB 4B3TE 2BU7A 4XD8A 3SL2A 1FWKA 4CWNA 3B26A 4JYAI 4KSGA 2CCSA 1HNZE 4AWOA 3B78A 2QG0A 1K47A 4DR4E 3HHUA 4CWRA 4XKKA 4DV4I 1HNXI 5IDMA 4LF8E 3WU6A 1ZWHA 5M4PA 1FI4A 1Z0TA 4CWOA 1PVGA 5D7DA 4JG4A 4DR6I 3BMYA 4HY6A 1THNA 4UT4A 4P52A 4QPJA 4B3SE 1AMWA 3B82A 4AS9A 3A0WA 1N33I 2XX5A 3H80A 1ZM3A 4V25A 3O2FA 1XHKA 3QDDA 1Z5BA 4ZVIA 4MYUA 5IWAI 3A0YA 3TZ5A 1Z0EA 3PYDA 4DR3I 4B3RI 4Q20A 1HNZI 3HZ1A 1I94E 4DUZE 1US7A 4O04A 3WQ9A 3ZXOA 2E1RA 1UYFA 4XKOA 4K0KI 4WUBA 2E0AA 2A2DA 2HHHE 3EKRA 2YJWA 4URLA 4FWHA 2O1UA 1U2OA 3J81Q 5FNCA 2YI5A 4CE2A 4NH8A 2OI2A 1ZM2A 2Z5CA 3RLQA 3T1KA 1YSRA 4XCJA 4YHHE 2ZDYA 3JAMQ 4FPPA 1ZM4A 2EFGA 2IOPA 1HNWE 4L8ZA 2XDLA 5FNFA 5IT9Q 1R62A 4LWFA 4DPWA 4FMTA 4CWFA 4CWPA 4NH9A 2WEQA 2UXDE 2V2QA 2YKCA 1Z0GA 1YC4A 5D7CA 4EEHA 2YJXA 3RLPA 3C11A 2GQ0A 3JZ3A 2Q2EB 3HJCA 5LMUE 5D6PA 4DUHA 3K99A 4XIRA 3GONA 5IN9A 4HXWA 2HHHI 4DV6I 1GKXA 3R4OA 2CZ9A 3OPDA 3G7EA 1DARA 4NXNI 1NHIA 2CGFA 4R3MA 2YI7A 4GCZA 3GIFA 3Q6NA 4FWDA 4DV3I 2VQEE 4LPBA 1Z0WA 4DV5I 3A0RA 4R1FA 4YKZA 5CTWA 4EM7A 4X64E 1N34E 4KHPI 5FLXQ 4RPFA 4EGIA 2UXCI 2YECA 2XABA 1TH8A 4LF6I 2FWYA 4BIZA 2YI0A 1YT2A 1IBME 3QT5A 2XX2A 2AKPA 2E5LE 3B8HA 4XIPA 4BXIA 3ZM7A 1IBLE 2XHXA 2UUAE 4DR2I 2IWSA 2YEIA 5GGZA 1ZXNA 4FN5A 5IT9C 1KZNA 4JASA 4B3MI 1Z5CA 4DV1I 3OTOI 4CWSA 2YEHA 4DUYE 3EHFA 4UROA 4U7OA 1HR0E 1XMQE 2YE2A 4JI8I 3TZ4A 4DV7E 2FWZA 3F0NA 1J5EI 1YT1A 3R4NA 4YKXA 2UU9I 4ZKIA 2WI3A 3PEJA 3EKOA 4DR1I 3CRLA 4JI4I 4ASAA 3ZZUA 2UXBE 2ZM6I 3T1YI 3A0ZA 4EFTA 1BYQA 1RR9A 3CRKA 3J80Q 2YE5A 2YEEA 2Z5CB 4U93A 3HYYA 2F4VI 4DR5I 5GMDA 4JI1I 4USKA 3D2RA 4YKWA 2BU6A 4ED4A 4NXMI 3BM9A 1H73A 3FV5A 1HK7A 4DPYA 4KP4A 3RKZA 2H8MA 3PYFA 1TC0A 4LFBI 2HCHA 3Q5KA 2BT0A 2HK3A 3K85A 3T1HE 1MX0A 4MOTA 4M1KA 3EHHA 3U67A 2BREA 4DV2E 2JKIA 1KKHA 2CH4A 4WUDA 1XNQE 4LWEA 2QFOA 5LMNI 1NHJA 3O0IA 1GJVA 4YKTA 2VQFE 4JI6E 5BODA 1EA6A 2XDUA 4LF4E 2XX4A 5CPHA 2UUBE 3ZZ0A 1FJGI 1WUUA 4LFCI 1UY9A 4L94A 4R3AA 1IBKI 1ID0A 4JI3E 5M4KA 4LF7E 2CGEA 4KTNA 2XDSA 2YK9A 4JI5E 3J7AM 2YEDA 1H7SA 4FCPA 1XMOI 2ESAA 1EI1A 5BR8E 1YT0A 2ZM6E 3T1YE 2XHRA 3OW6A 4HZ0A 3K60A 4JAVA 4LP0A 1D6TA 4JI2I 1KTVA 1UYKA 2HK2A 4MBCA 3ZXQA 1Z5AA 1FJGE 4X66E 4ASBA 2R3VA 1UYLA 2XD6A 1BXDA 4HXZA 1PKPA 3Q1QA 4GKJE 4JI8E 1UYCA 3B27A 1N32E 3GIGA 1YC1A 2VQFI 3CWVA 1HR0I 1N36I 2GQPA 4DUYI 2EXLA 4BQJA 3OTOE 1QZRA 2X7IA 2JJCA 2XJGA 3RLRA 1YETA 4L90A 3T0ZA 4HYPA 4YKYA 4KFGA 1N36E 3JAMC 3LPSA 1Y8NA 4LWIA 4HYMA 4DV0I 5A2QC 3CGZA 2Z5BB 4BIUA 3ZKDA 2E5LI 2WEPA 4JI0I 1Y4SA 1OSFA 2PNMA 3K98A 3J80C 4P8OA 5D7RA 4NXME 4DZYA 3D0BA 4LF6E 3D4JA 4DR5E 4LF5I 2C2AA 3B28A 2BZ5A 4YY3I 3EHJA 4XE2A 1H7UA 2Q8GA 2CCUA 4X64I 3GIGB 4B6CA 2WI5A 2YE4A 2VQEI 3TZ2A 2BM0A 4DR1E 4IZJB 3LNUA 1TILA 4OX9E 2QF6A 2UU9E 1I59A 2YE3A 4FW9A 2YEGA 3O6OA 3A0XA 4AQYE 4KQVA 3HULA 4IZJA 1JM6A 5C93A 4DV6E 4L93A 2A2CA 2Z5BA 1N0VC 4HZ5A 1XMQI 3PYGA 2VW5A 1USUA 5CF0A 2AJ4A 1I58A 4IZKA 4B3ME 1I5CA 2UUCE 4JV5I 2IWXA 3U2KA 2BU5A 2V2ZA 4FCQA 4NH7A 4HACA 4Z7YA 1Y8OA 1NHHA 3PYEA 3Q5LA 1N0UA 3B24A 1HNWI 1UY6A 1B63A 1OJ4A 2UUCI 4I3HA 1NZ0A 4JV5E 5D6QA 2YE8A 4JI7I 2GFDA 2GS8A 3G7BA 1ZM9A 3PRYA 2WI4A 3VHDA 4U7NA 3R4MA 4JI2E 2BYHA 2YKIA 1BGQA 3VHCA 4GKJI 4QPKA 1FNMA 4DU8A 4AQYI 2XEXA 4JI4E 4H7QA 4YKQA 3KE6A 4JI3I 4OX9I 1I5AA 2BTZA 1ZW9A 4LFCE 1UYMA 4O0BA 1YERA 4KSHA 2V2VA 3PEHA 4K4OA 1I94I 5M4EA 1I5DA 2UUBI 3INWA 4GGLA 1J5EE 3ZKBA 4GKKE 1H72C 2IOQA 3WU3A 3TUHA 3G75A 3K17A 4LF7I 4I5SA 1UY7A 4IZJD 4LFAE 1U0ZA 2IORA 4W7TA 2YE9A 1UEKA 1A6FA 4JI7E 1A4HA 5CTUA 3IEDA 4XC0A 2X36A 2YE7A 3P06A 2UUAI 3OMUA 4DV0E 2BM1A 4B3SI 1S16A 4V26A 2ZITA 4EMDA 1B62A 1Z0CA 3R4PA 4EFUA 1XNQI 4USMA 4DR6E 2YGFA 4LFAI 2Q8HA 4O09A 4E01A 2F4VE 2DEIA 2XDKA 1UYHA 4DPTA 1N34I 1ZXMA 4GKKI 2ZDXA 4O07A 1QY8A 2HFSA 3WU4A 3V5RA 4X66I 1GKZA 4EGHA 5CTXA 4DXLA 4HY1A 4P7AA 2FXSA 3T10A 5LL6R 4DPXA 1UYEA 5J6AA 2UWDA 2PNLA 3LTOA 3V2UC 1XNRE 1S14A 5BR8I 2WI6A 2UXBI 4Z7CA 4ASFA 4AWQA 4LF5E 3D36A 3TZ0A 4IZKB 5M4MA 4WUCA 1UYDA 2XDXA 4JI0E 4XKAA 4H81A 3CGYA 4X65E 4BAEA 3OWDA 4DV7I 4CE3A 4LF4I 1PIEA 4MPEA 3WHAA 1FWLA 3EHGA 2FYPA 4ASGA 2CCTA 1MU5A 3R92A 4MB9A 3GIEA 4MPCA 4JQLA 4GFNA 3QT7A 2VCIA 4N3OA 5M4NA 1FKAE 1N32I 2WERA 4JAUA 2R42A 5BOCA 4MPNA 2WI2A 1MG7A 1I5BA 2WW4A 2YEJA 3TTZA 2O1WA 4LFBE 1Z0VA 2XJJA 2XHTA 2VWCA 2Q8FA 3HYZA 1UYGA 1Y6ZA 2BV3A 1VISA 2J7KA 4DUZI 2BYIA 2WI7A 4KHPE 1TIDA 3QT6A 1YESA 3DGEA 4PL9A 4YKRA 4MYTA 5F5RA 2Q8IA 1XMOE 5IDJA 4JI5I 2HKJA 3K97A 4YY3E 4DR7E 4FWGA 1IBKE 1TC6A 3T0HA 2XCMA 4DPUA 4XDMA 4B7PA 1U2RA 4CWQA 2BSMA 2YEBA 4X62I 3QTFA 3J7AG 2H55A 1UY8A 2NPFA 4JI6I 4MP7A 1Z59A 4BQGA 3ZZTA 2BRCA 5LMNE 3B25A 4EMVA 4XIQA 1L0OA 3A0TA 3INXA 1AH6A 4DV1E 5CTYA 4XITA 3FT8A 4DR2E 1YC3A 3HZ5A 2IWUA 2HKEA 3T1HI 1TBWA 1IBLI 2K5BA 3J81C 4MP2A 5F3KA 3VHAA 5FWKA 4AWPA 1USVA 1RREA 1HNXE 1YSZA 2ZKJA 4YKUA 2YEAA 2XK2A 4UTGA 4XTJA 4YHHI 3T2SA 4L91A 1IBMI 2O1VA 4X62E 4K0KE 2PNRA 2YI6A 1H74A 4JI1E 3Q5JA 3H4LA 4LF9E 3NMQA 2UXCE 1ELOA 1Y8PA 1Z0BA 3HEKA 4CWTA 4FCRA 2YGEA 1AM1A 2YEFA 3VADA 1KVKA 4NXNE 4PU9A 4LF9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 E;  4URM A;  4DU7 A;  2HG1 A;  3FT5 A;  1UYI A;  4GT8 A;  4DR3 E;  4B3R E;  1YS3 A;  2V34 A;  2CG9 A;  5IWA E;  2YGA A;  5LMU I;  4PRX A;  3MNR P;  3K1J A;  3U2D A;  3M6A A;  5A2Q Q;  1QYE A;  2DEJ A;  2VF3 A;  4DV2 I;  2BU2 A;  2BU8 A;  2YKJ A;  4EGK A;  2YE6 A;  2UXD I;  2HFU A;  1KIJ A;  4LWH A;  3C0E A;  2LJP A;  5M4H A;  5FLX C;  4X9L A;  1AJ6 A;  2YKB A;  2VCJ A;  4DV4 E;  4LWG A;  4PRV A;  1B3Q A;  2YK2 A;  4H85 A;  4GEE A;  1AH8 A;  2QG2 A;  5L3J A;  4DR4 I;  4CE1 A;  4X65 I;  4JYA E;  4E02 A;  2WI1 A;  3OWB A;  5J71 A;  2XJX A;  4GQT A;  3QT8 A;  1BKN A;  4LF8 I;  2YKE A;  1S4E A;  4B3T I;  3R91 A;  5FND A;  4URN A;  4HAC B;  4O05 A;  4DR7 I;  4DV5 E;  2V8P A;  5GME A;  4E00 A;  4DV3 E;  3WU5 A;  1Y4U A;  1XNR I;  4XCL A;  2ZBK B;  4B3T E;  2BU7 A;  4XD8 A;  3SL2 A;  1FWK A;  4CWN A;  3B26 A;  4JYA I;  4KSG A;  2CCS A;  1HNZ E;  4AWO A;  3B78 A;  2QG0 A;  1K47 A;  4DR4 E;  3HHU A;  4CWR A;  4XKK A;  4DV4 I;  1HNX I;  5IDM A;  4LF8 E;  3WU6 A;  1ZWH A;  5M4P A;  1FI4 A;  1Z0T A;  4CWO A;  1PVG A;  5D7D A;  4JG4 A;  4DR6 I;  3BMY A;  4HY6 A;  1THN A;  4UT4 A;  4P52 A;  4QPJ A;  4B3S E;  1AMW A;  3B82 A;  4AS9 A;  3A0W A;  1N33 I;  2XX5 A;  3H80 A;  1ZM3 A;  4V25 A;  3O2F A;  1XHK A;  3QDD A;  1Z5B A;  4ZVI A;  4MYU A;  5IWA I;  3A0Y A;  3TZ5 A;  1Z0E A;  3PYD A;  4DR3 I;  4B3R I;  4Q20 A;  1HNZ I;  3HZ1 A;  1I94 E;  4DUZ E;  1US7 A;  4O04 A;  3WQ9 A;  3ZXO A;  2E1R A;  1UYF A;  4XKO A;  4K0K I;  4WUB A;  2E0A A;  2A2D A;  2HHH E;  3EKR A;  2YJW A;  4URL A;  4FWH A;  2O1U A;  1U2O A;  3J81 Q;  5FNC A;  2YI5 A;  4CE2 A;  4NH8 A;  2OI2 A;  1ZM2 A;  3RLQ A;  3T1K A;  1YSR A;  4XCJ A;  4YHH E;  2ZDY A;  3JAM Q;  4FPP A;  1ZM4 A;  2EFG A;  1HNW E;  2IOP A;  4L8Z A;  2XDL A;  5FNF A;  5IT9 Q;  1R62 A;  4LWF A;  4DPW A;  4FMT A;  4CWF A;  4CWP A;  4NH9 A;  2WEQ A;  2UXD E;  2V2Q A;  2YKC A;  1Z0G A;  1YC4 A;  5D7C A;  4EEH A;  2YJX A;  3RLP A;  3C11 A;  3JZ3 A;  2Q2E B;  5LMU E;  5D6P A;  4DUH A;  3K99 A;  4XIR A;  3GON A;  5IN9 A;  4HXW A;  2HHH I;  4DV6 I;  1GKX A;  3R4O A;  2CZ9 A;  3OPD A;  3G7E A;  1DAR A;  4NXN I;  1NHI A;  2CGF A;  4R3M A;  2YI7 A;  4GCZ A;  3GIF A;  4FWD A;  4DV3 I;  2VQE E;  4LPB A;  1Z0W A;  4DV5 I;  3A0R A;  4R1F A;  4YKZ A;  5CTW A;  4EM7 A;  4X64 E;  1N34 E;  4KHP I;  5FLX Q;  4RPF A;  4EGI A;  2UXC I;  2YEC A;  2XAB A;  1TH8 A;  4LF6 I;  2FWY A;  4BIZ A;  2YI0 A;  1YT2 A;  1IBM E;  3QT5 A;  2XX2 A;  2AKP A;  2E5L E;  3B8H A;  4XIP A;  4BXI A;  3ZM7 A;  1IBL E;  2XHX A;  2UUA E;  4DR2 I;  2IWS A;  2YEI A;  5GGZ A;  1ZXN A;  4FN5 A;  5IT9 C;  1KZN A;  4JAS A;  4B3M I;  1Z5C A;  4DV1 I;  3OTO I;  4CWS A;  2YEH A;  4DUY E;  3EHF A;  4URO A;  4U7O A;  1HR0 E;  1XMQ E;  2YE2 A;  4JI8 I;  3TZ4 A;  4DV7 E;  2FWZ A;  3F0N A;  1J5E I;  1YT1 A;  3R4N A;  4YKX A;  2UU9 I;  4ZKI A;  2WI3 A;  3PEJ A;  3EKO A;  4DR1 I;  3CRL A;  4JI4 I;  4ASA A;  3ZZU A;  2UXB E;  2ZM6 I;  3T1Y I;  3A0Z A;  4EFT A;  1BYQ A;  1RR9 A;  3CRK A;  3J80 Q;  2YE5 A;  2YEE A;  4U93 A;  3HYY A;  2F4V I;  4DR5 I;  5GMD A;  4JI1 I;  4USK A;  3D2R A;  4YKW A;  2BU6 A;  4ED4 A;  4NXM I;  3BM9 A;  1H73 A;  3FV5 A;  4DPY A;  4KP4 A;  3RKZ A;  2H8M A;  3PYF A;  1TC0 A;  4LFB I;  2HCH A;  3Q5K A;  2BT0 A;  2HK3 A;  3T1H E;  1MX0 A;  4MOT A;  4M1K A;  3EHH A;  3U67 A;  2BRE A;  4DV2 E;  2JKI A;  1KKH A;  2CH4 A;  4WUD A;  1XNQ E;  4LWE A;  2QFO A;  5LMN I;  1NHJ A;  3O0I A;  1GJV A;  4YKT A;  2VQF E;  4JI6 E;  5BOD A;  1EA6 A;  2XDU A;  4LF4 E;  2XX4 A;  5CPH A;  2UUB E;  3ZZ0 A;  1FJG I;  1WUU A;  4LFC I;  1UY9 A;  4L94 A;  4R3A A;  1IBK I;  1ID0 A;  4JI3 E;  5M4K A;  4LF7 E;  4KTN A;  2XDS A;  2YK9 A;  4JI5 E;  3J7A M;  2YED A;  1H7S A;  4FCP A;  1XMO I;  2ESA A;  1EI1 A;  5BR8 E;  1YT0 A;  2ZM6 E;  3T1Y E;  2XHR A;  3OW6 A;  4HZ0 A;  3K60 A;  4JAV A;  4LP0 A;  1D6T A;  4JI2 I;  1KTV A;  1UYK A;  2HK2 A;  4MBC A;  3ZXQ A;  1Z5A A;  1FJG E;  4X66 E;  4ASB A;  2R3V A;  1UYL A;  2XD6 A;  1BXD A;  4HXZ A;  1PKP A;  3Q1Q A;  4GKJ E;  4JI8 E;  1UYC A;  3B27 A;  1N32 E;  3GIG A;  1YC1 A;  2VQF I;  3CWV A;  1HR0 I;  1N36 I;  2GQP A;  4DUY I;  2EXL A;  4BQJ A;  3OTO E;  1QZR A;  2X7I A;  2JJC A;  2XJG A;  3RLR A;  1YET A;  4L90 A;  3T0Z A;  4HYP A;  4YKY A;  4KFG A;  1N36 E;  3JAM C;  3LPS A;  1Y8N A;  4LWI A;  4HYM A;  4DV0 I;  5A2Q C;  3CGZ A;  4BIU A;  3ZKD A;  2E5L I;  2WEP A;  4JI0 I;  1Y4S A;  1OSF A;  3K98 A;  3J80 C;  4P8O A;  5D7R A;  4NXM E;  4DZY A;  3D0B A;  4LF6 E;  3D4J A;  4DR5 E;  4LF5 I;  2C2A A;  3B28 A;  2BZ5 A;  4YY3 I;  3EHJ A;  4XE2 A;  1H7U A;  2Q8G A;  2CCU A;  4X64 I;  3GIG B;  4B6C A;  2WI5 A;  2YE4 A;  2VQE I;  3TZ2 A;  2BM0 A;  4DR1 E;  3LNU A;  1TIL A;  4OX9 E;  2QF6 A;  2UU9 E;  1I59 A;  2YE3 A;  4FW9 A;  2YEG A;  3O6O A;  3A0X A;  4AQY E;  4KQV A;  3HUL A;  1JM6 A;  5C93 A;  4DV6 E;  4L93 A;  2A2C A;  1N0V C;  4HZ5 A;  1XMQ I;  3PYG A;  2VW5 A;  5CF0 A;  2AJ4 A;  1I58 A;  4B3M E;  1I5C A;  2UUC E;  4JV5 I;  2IWX A;  3U2K A;  2BU5 A;  2V2Z A;  4FCQ A;  4NH7 A;  4HAC A;  4Z7Y A;  1Y8O A;  1NHH A;  3PYE A;  3Q5L A;  1N0U A;  3B24 A;  1HNW I;  1UY6 A;  1B63 A;  1OJ4 A;  2UUC I;  4I3H A;  1NZ0 A;  4JV5 E;  5D6Q A;  2YE8 A;  4JI7 I;  2GFD A;  2GS8 A;  3G7B A;  1ZM9 A;  2WI4 A;  3VHD A;  4U7N A;  3R4M A;  4JI2 E;  2BYH A;  2YKI A;  1BGQ A;  3VHC A;  4GKJ I;  4QPK A;  1FNM A;  4DU8 A;  4AQY I;  2XEX A;  4JI4 E;  4H7Q A;  4YKQ A;  3KE6 A;  4JI3 I;  4OX9 I;  1I5A A;  2BTZ A;  1ZW9 A;  4LFC E;  1UYM A;  4O0B A;  1YER A;  4KSH A;  2V2V A;  3PEH A;  4K4O A;  1I94 I;  5M4E A;  1I5D A;  2UUB I;  3INW A;  4GGL A;  1J5E E;  3ZKB A;  4GKK E;  1H72 C;  3WU3 A;  2IOQ A;  3TUH A;  3G75 A;  3K17 A;  4LF7 I;  4I5S A;  1UY7 A;  4LFA E;  1U0Z A;  2IOR A;  4W7T A;  2YE9 A;  1UEK A;  1A6F A;  4JI7 E;  1A4H A;  5CTU A;  3IED A;  4XC0 A;  2X36 A;  2YE7 A;  2UUA I;  3OMU A;  4DV0 E;  2BM1 A;  4B3S I;  1S16 A;  4V26 A;  2ZIT A;  4EMD A;  1B62 A;  1Z0C A;  3R4P A;  4EFU A;  1XNQ I;  4USM A;  4DR6 E;  2YGF A;  4LFA I;  2Q8H A;  4O09 A;  4E01 A;  2F4V E;  2DEI A;  2XDK A;  1UYH A;  4DPT A;  1N34 I;  1ZXM A;  4GKK I;  2ZDX A;  4O07 A;  1QY8 A;  2HFS A;  3WU4 A;  3V5R A;  4X66 I;  1GKZ A;  4EGH A;  5CTX A;  4DXL A;  4HY1 A;  4P7A A;  2FXS A;  3T10 A;  5LL6 R;  4DPX A;  1UYE A;  5J6A A;  2UWD A;  3LTO A;  3V2U C;  1XNR E;  1S14 A;  5BR8 I;  2WI6 A;  2UXB I;  4Z7C A;  4ASF A;  4AWQ A;  4LF5 E;  3D36 A;  3TZ0 A;  5M4M A;  4WUC A;  1UYD A;  2XDX A;  4JI0 E;  4XKA A;  4H81 A;  3CGY A;  4X65 E;  4BAE A;  3OWD A;  4DV7 I;  4CE3 A;  4LF4 I;  1PIE A;  4MPE A;  3WHA A;  1FWL A;  3EHG A;  2FYP A;  4ASG A;  2CCT A;  1MU5 A;  3R92 A;  4MB9 A;  3GIE A;  4MPC A;  4JQL A;  4GFN A;  3QT7 A;  2VCI A;  5M4N A;  1FKA E;  1N32 I;  2WER A;  4JAU A;  2R42 A;  5BOC A;  4MPN A;  2WI2 A;  1MG7 A;  1I5B A;  2WW4 A;  2YEJ A;  3TTZ A;  4LFB E;  2O1W A;  1Z0V A;  2XJJ A;  2XHT A;  2VWC A;  2Q8F A;  3HYZ A;  1UYG A;  2BV3 A;  1VIS A;  2J7K A;  4DUZ I;  2BYI A;  2WI7 A;  4KHP E;  1TID A;  3QT6 A;  1YES A;  3DGE A;  4PL9 A;  4YKR A;  4MYT A;  5F5R A;  2Q8I A;  1XMO E;  5IDJ A;  4JI5 I;  2HKJ A;  3K97 A;  4YY3 E;  4DR7 E;  4FWG A;  1IBK E;  1TC6 A;  3T0H A;  2XCM A;  4DPU A;  4XDM A;  4B7P A;  1U2R A;  4CWQ A;  2BSM A;  2YEB A;  4X62 I;  3QTF A;  3J7A G;  2H55 A;  1UY8 A;  2NPF A;  4JI6 I;  4MP7 A;  1Z59 A;  4BQG A;  3ZZT A;  2BRC A;  5LMN E;  3B25 A;  4EMV A;  4XIQ A;  1L0O A;  3A0T A;  3INX A;  1AH6 A;  4DV1 E;  5CTY A;  4XIT A;  3FT8 A;  4DR2 E;  1YC3 A;  3HZ5 A;  2IWU A;  2HKE A;  3T1H I;  1TBW A;  1IBL I;  2K5B A;  3J81 C;  4MP2 A;  5F3K A;  3VHA A;  4AWP A;  5FWK A;  1HNX E;  1RRE A;  4YKU A;  1YSZ A;  2ZKJ A;  2YEA A;  2XK2 A;  4UTG A;  4XTJ A;  4YHH I;  3T2S A;  4L91 A;  1IBM I;  2O1V A;  4X62 E;  4K0K E;  2PNR A;  2YI6 A;  1H74 A;  4JI1 E;  3Q5J A;  3H4L A;  4LF9 E;  3NMQ A;  2UXC E;  1ELO A;  1Y8P A;  1Z0B A;  3HEK A;  4CWT A;  4FCR A;  2YGE A;  1AM1 A;  2YEF A;  3VAD A;  1KVK A;  4NXN E;  4PU9 A;  4LF9 I; 
#chains in the Genus database with same CATH topology
 1N33 E;  4URM A;  5D6Q A;  2O3Z A;  4DU7 A;  2HG1 A;  3FT5 A;  1UYI A;  4GT8 A;  4DR3 E;  4B3R E;  1YS3 A;  2V34 A;  2CG9 A;  4QNK A;  5IWA E;  2BA0 G;  2YGA A;  5LMU I;  4PRX A;  3MNR P;  3K1J A;  3U2D A;  3M6A A;  2PNZ A;  5A2Q Q;  2O1T A;  1QYE A;  2DEJ A;  2VF3 A;  4DV2 I;  4IFD B;  2BU2 A;  2BU8 A;  2YKJ A;  5GGZ A;  4EGK A;  2Z5E A;  2YE6 A;  2UXD I;  5K36 C;  2HFU A;  1KIJ A;  4LWH A;  3C0E A;  2LJP A;  5M4H A;  5FLX C;  4X9L A;  1AJ6 A;  2YKB A;  2VCJ A;  4DV4 E;  4LWG A;  4PRV A;  5ELW A;  1B3Q A;  2NN6 A;  5EL9 A;  2YK2 A;  4GEE A;  4QNJ A;  1AH8 A;  2QG2 A;  2J65 A;  3GME A;  1UDS A;  5L3J A;  4DR4 I;  4CE1 A;  4X65 I;  4JYA E;  4E02 A;  2WI1 A;  3OWB A;  5J71 A;  2XJX A;  4GQT A;  3QT8 A;  1BKN A;  4LF8 I;  2GO4 A;  1S4E A;  4B3T I;  2YKE A;  3R91 A;  5FND A;  4URN A;  1E3H A;  4CWF A;  4HAC B;  4O05 A;  4DR7 I;  4DV5 E;  2V8P A;  5GME A;  4E00 A;  4DV3 E;  3WU5 A;  1Y4U A;  1XNR I;  4XCL A;  3Q6M A;  3LMM A;  2ZBK B;  4B3T E;  2BU7 A;  4LCG A;  4XD8 A;  1RHY A;  4MQY A;  3SL2 A;  1FWK A;  4CWN A;  1OYS A;  3B26 A;  3PS1 A;  4JYA I;  4KSG A;  2CCS A;  2CVE A;  1HNZ E;  5C0X B;  3B78 A;  2C1G A;  1K47 A;  2QG0 A;  4DR4 E;  4AWO A;  5JEN A;  4MU0 A;  2HHI A;  3P3E A;  3HHU A;  4CWR A;  4XKK A;  4MU1 A;  5DNX A;  4DV4 I;  1HNX I;  3GLL A;  4LF8 E;  5IDM A;  1UDO A;  3WU6 A;  1ZWH A;  5M4P A;  1FI4 A;  1Z0T A;  3M85 D;  4IFD C;  4CWO A;  1PVG A;  5D7D A;  4JG4 A;  1E3P A;  4DR6 I;  2C39 B;  2WP8 A;  3BMY A;  4HY6 A;  5C0X E;  1THN A;  4UT4 A;  4P52 A;  2NN6 B;  4QPJ A;  4B3S E;  3M7N D;  1AMW A;  3B82 A;  4AS9 A;  3A0W A;  1N33 I;  2XX5 A;  3H80 A;  1ZM3 A;  4MDT A;  4V25 A;  3O2F A;  1XHK A;  2F1D A;  3QDD A;  1Z5B A;  4AIM A;  4ZVI A;  4MYU A;  5IWA I;  3A0Y A;  3TZ5 A;  1Z0E A;  3PYD A;  4DR3 I;  4B3R I;  4Q20 A;  1HNZ I;  2PO0 A;  3HZ1 A;  1I94 E;  4DUZ E;  1US7 A;  4O04 A;  3WQ9 A;  3ZXO A;  2E1R A;  1UYF A;  4XKO A;  4K0K I;  4WUB A;  2E0A A;  2A2D A;  2HHH E;  3EKR A;  2YJW A;  4URL A;  4FWH A;  4LCF A;  2IER A;  2O1U A;  1U2O A;  3J81 Q;  3CYG A;  2YI5 A;  5FNC A;  4CE2 A;  4NH8 A;  2OI2 A;  1ZM2 A;  2Z5C A;  3RLQ A;  3T1K A;  1YSR A;  2NN6 F;  3PS2 A;  4XCJ A;  4YHH E;  2ZDY A;  3JAM Q;  4FPP A;  1ZM4 A;  2EFG A;  2IOP A;  1HNW E;  4L8Z A;  4AM3 A;  5JEA E;  1UDQ A;  5IT9 Q;  1R62 A;  5DRP A;  2XDL A;  4LWF A;  4DPW A;  3CDJ A;  4U3B A;  4FW4 A;  4FMT A;  2WEQ A;  2UXD E;  2V2Q A;  2YKC A;  4NH9 A;  1Z0G A;  1YC4 A;  2NN6 E;  3GCM A;  1OYP A;  5D7C A;  2YJX A;  3RLP A;  4EEH A;  3C11 A;  4IS9 A;  2GQ0 A;  3JZ3 A;  2Q2E B;  5M4K A;  3HJC A;  5LMU E;  5D6P A;  4DUH A;  3K99 A;  4IFD E;  3GON A;  4OKG A;  4HXW A;  2HHH I;  4XIR A;  4DV6 I;  5IN9 A;  1GKX A;  3R4O A;  2CZ9 A;  3OPD A;  3G7E A;  4BA1 A;  1DAR A;  4NXN I;  1NHI A;  2CGF A;  4R3M A;  2YI7 A;  4GCZ A;  3GIF A;  3Q6N A;  4FWD A;  4DV3 I;  2VQE E;  4LPB A;  1Z0W A;  4DV5 I;  3B4T A;  4R1F A;  2JE6 B;  3A0R A;  4YKZ A;  2IES A;  5CTW A;  4EM7 A;  4X64 E;  3P3G A;  1N34 E;  4KHP I;  5FLX Q;  4RPF A;  4EGI A;  2C37 B;  2UXC I;  2YEC A;  2XAB A;  1TH8 A;  4FW3 A;  4LF6 I;  2FWY A;  4BIZ A;  2YI0 A;  1YT2 A;  1IBM E;  3QT5 A;  2XX2 A;  2AKP A;  2E5L E;  4OO1 F;  3B8H A;  4XIP A;  4BXI A;  3ZM7 A;  1IBL E;  4OZE A;  2XHX A;  5C0X F;  4DR2 I;  2UUA E;  2IWS A;  2YEI A;  1ZXN A;  4FN5 A;  1Y60 A;  5IT9 C;  2PO1 B;  4OO1 B;  1KZN A;  4JAS A;  4B3M I;  1Z5C A;  4DV1 I;  3OTO I;  4CWS A;  2YEH A;  4DUY E;  3EHF A;  4URO A;  4U7O A;  1HR0 E;  1XMQ E;  2YE2 A;  4JI8 I;  3TZ4 A;  4DV7 E;  2WNR B;  2FWZ A;  3F0N A;  1J5E I;  4FW6 A;  1YT1 A;  3R4N A;  4YKX A;  2UU9 I;  4ZKI A;  2WI3 A;  3PEJ A;  5K36 F;  3EKO A;  4DR1 I;  3CRL A;  4JI4 I;  4ASA A;  3ZZU A;  2UXB E;  1UDN A;  2ZM6 I;  3T1Y I;  2BA0 D;  3A0Z A;  4EFT A;  1BYQ A;  1RR9 A;  4E72 A;  3CRK A;  3J80 Q;  2YE5 A;  2YEE A;  2Z5C B;  4U93 A;  3HYY A;  2F4V I;  4DR5 I;  5GMD A;  4JI1 I;  4USK A;  3D2R A;  4YKW A;  2BU6 A;  4ED4 A;  4IFD F;  4NXM I;  3BM9 A;  1H73 A;  3FV5 A;  1HK7 A;  4DPY A;  4KP4 A;  3RKZ A;  2H8M A;  3PYF A;  4NBQ A;  1TC0 A;  4LFB I;  2HCH A;  3Q5K A;  2BT0 A;  2HK3 A;  3K85 A;  3M85 G;  1MX0 A;  3T1H E;  4MOT A;  4M1K A;  3U1Y A;  3KRN A;  4MU4 A;  3EHH A;  3U67 A;  2BRE A;  5JEA F;  4DV2 E;  2JKI A;  1KKH A;  2CH4 A;  4WUD A;  1XNQ E;  4LWE A;  2QFO A;  4BA1 B;  1NHJ A;  5LMN I;  3O0I A;  1GJV A;  1R6M A;  4YKT A;  4MU3 A;  3M7N G;  2VQF E;  4JI6 E;  4LCH A;  5BOD A;  1EA6 A;  2XDU A;  4LF4 E;  2GO3 A;  2XX4 A;  5CPH A;  2UUB E;  3ZZ0 A;  5C0X A;  1FJG I;  1WUU A;  4LFC I;  1UY9 A;  4L94 A;  4R3A A;  1IBK I;  1ID0 A;  4JI3 E;  2NN6 C;  4LF7 E;  2CGE A;  4KTN A;  2XDS A;  2YK9 A;  4OO1 A;  2PO1 A;  3HKM A;  4JI5 E;  3J7A M;  1H7S A;  2YED A;  1XMO I;  4FCP A;  2ESA A;  1EI1 A;  5BR8 E;  1YT0 A;  2ZM6 E;  3T1Y E;  2XHR A;  3OW6 A;  4HZ0 A;  3K60 A;  4JAV A;  4LP0 A;  1D6T A;  4JI2 I;  5DRO A;  2JEA B;  1KTV A;  1UYK A;  2HK2 A;  4MBC A;  1IXM A;  1Z5A A;  3ZXQ A;  1FJG E;  2WNR A;  4X66 E;  4ASB A;  2R3V A;  1UYL A;  2XD6 A;  1BXD A;  4HXZ A;  1PKP A;  3Q1Q A;  4GKJ E;  4AID A;  4JI8 E;  1UYC A;  3B27 A;  1N32 E;  3GIG A;  1YC1 A;  2JEB B;  2VQF I;  3CWV A;  1HR0 I;  1N36 I;  4IFD D;  2GQP A;  4DUY I;  2EXL A;  4BQJ A;  3OTO E;  1QZR A;  2X7I A;  2JJC A;  2XJG A;  3RLR A;  1YET A;  4L90 A;  3T0Z A;  4HYP A;  4YKY A;  4KFG A;  1N36 E;  3JAM C;  3LPS A;  1Y8N A;  2PO0 B;  5DNL A;  4HYM A;  4DV0 I;  4LWI A;  5A2Q C;  3CGZ A;  2Z5B B;  4BIU A;  2VES A;  3ZKD A;  2E5L I;  5K36 B;  2WEP A;  4JI0 I;  1F51 A;  1Y4S A;  1OSF A;  2PNM A;  3K98 A;  3J80 C;  3DD6 A;  4P8O A;  5D7R A;  4NXM E;  4DZY A;  3D0B A;  4LF6 E;  3D4J A;  3PS3 A;  4DR5 E;  4LF5 I;  3NZK A;  2C2A A;  4YY3 I;  2BZ5 A;  3B28 A;  3EHJ A;  1H7U A;  4XE2 A;  2Q8G A;  2CCU A;  4X64 I;  3GIG B;  4B6C A;  2WI5 A;  2YE4 A;  2VQE I;  3TZ2 A;  2BM0 A;  5FNF A;  4DR1 E;  4IZJ B;  3LNU A;  1TIL A;  2PO2 B;  4OX9 E;  2QF6 A;  2UU9 E;  1I59 A;  2YE3 A;  4FW9 A;  2YEG A;  3O6O A;  4FW5 A;  3A0X A;  4AQY E;  4KQV A;  3HUL A;  4IZJ A;  1JM6 A;  5C93 A;  4DV6 E;  4L93 A;  2A2C A;  2NN6 D;  2Z5B A;  1N0V C;  4LPF A;  4HZ5 A;  1XMQ I;  3PYG A;  2BA1 D;  2VW5 A;  1USU A;  5CF0 A;  2AJ4 A;  1I58 A;  4IZK A;  4B3M E;  1I5C A;  2UUC E;  4JV5 I;  2IWX A;  3U2K A;  2BU5 A;  2V2Z A;  4FCQ A;  4NH7 A;  4HAC A;  4Z7Y A;  1Y8O A;  1NHH A;  3PYE A;  3Q5L A;  1N0U A;  2C39 A;  2WP8 B;  3B24 A;  1HNW I;  1UY6 A;  1B63 A;  1OJ4 A;  5JEA A;  4I3H A;  1NZ0 A;  2AE8 A;  3CDI A;  2UUC I;  4JV5 E;  5C0X D;  4JI7 I;  2YE8 A;  2GFD A;  2GS8 A;  3G7B A;  1ZM9 A;  3PRY A;  2WI4 A;  3VHD A;  4U7N A;  3R4M A;  4JI2 E;  2BYH A;  4BA2 B;  2YKI A;  2FTK A;  1BGQ A;  3VHC A;  4GKJ I;  4QPK A;  1FNM A;  4DU8 A;  3L7Z B;  4AQY I;  2XEX A;  4JI4 E;  5K36 E;  4H7Q A;  4YKQ A;  3KE6 A;  4JI3 I;  4OX9 I;  1I5A A;  2BTZ A;  1ZW9 A;  4LFC E;  1UYM A;  4O0B A;  1YH8 A;  1YER A;  2V2V A;  5EKW A;  3PEH A;  1I94 I;  4K4O A;  4KSH A;  5M4E A;  1I5D A;  2UUB I;  1VI7 A;  4IFD A;  1J5E E;  3INW A;  4GGL A;  3ZKB A;  4GKK E;  4ISA A;  2PNZ B;  3WU3 A;  1H72 C;  2IOQ A;  3TUH A;  3G75 A;  3K17 A;  4LF7 I;  4I5S A;  2C38 A;  1UY7 A;  4IZJ D;  4LFA E;  1U0Z A;  2IOR A;  4W7T A;  2YE9 A;  1UEK A;  1A6F A;  4JI7 E;  1A4H A;  5CTU A;  3IED A;  2C38 B;  4XC0 A;  3P3C A;  2X36 A;  2YE7 A;  3P06 A;  2UUA I;  3OMU A;  4DV0 E;  2BM1 A;  4B3S I;  1S16 A;  2JEB A;  2ZIT A;  4EMD A;  4V26 A;  5C0X C;  1B62 A;  1Z0C A;  3H1C A;  3R4P A;  1XNQ I;  4EFU A;  4USM A;  3UHM A;  4DR6 E;  3P76 A;  2YGF A;  4LFA I;  2Q8H A;  4O09 A;  4FW7 A;  4E01 A;  2F4V E;  2PO2 A;  2DEI A;  2JT2 A;  2XDK A;  1UYH A;  4DPT A;  1N34 I;  1ZXM A;  4GKK I;  2ZDX A;  4O07 A;  1QY8 A;  2BA1 G;  2HFS A;  3WU4 A;  3V5R A;  4X66 I;  1GKZ A;  4EGH A;  5CTX A;  4DXL A;  4HY1 A;  4GQU A;  4P7A A;  5DRQ A;  2FXS A;  3T10 A;  5LL6 R;  4DPX A;  1UYE A;  5J6A A;  2C1I A;  2UWD A;  2PNL A;  3LTO A;  3V2U C;  1XNR E;  1S14 A;  5BR8 I;  2WI6 A;  2UXB I;  4U3D A;  4Z7C A;  4ASF A;  4AWQ A;  4LF5 E;  3D36 A;  3TZ0 A;  4IZK B;  5M4M A;  4WUC A;  1UYD A;  2XDX A;  4JI0 E;  4XKA A;  3U1K A;  4H81 A;  3CGY A;  4X65 E;  4BAE A;  3OWD A;  4DV7 I;  4CE3 A;  4LF4 I;  5JEA D;  1PIE A;  4MPE A;  3WHA A;  1FWL A;  3EHG A;  2FYP A;  4ASG A;  2CCT A;  1MU5 A;  3R92 A;  4MB9 A;  3GIE A;  4MPC A;  4JQL A;  4GFN A;  3QT7 A;  2VCI A;  4N3O A;  5M4N A;  1FKA E;  1N32 I;  2WER A;  4JAU A;  2R42 A;  5BOC A;  4MPN A;  1YHC A;  1MG7 A;  2WI2 A;  1I5B A;  2WW4 A;  2YEJ A;  3TTZ A;  2O1W A;  1XXE A;  1Z0V A;  4LFB E;  2XJJ A;  4CWP A;  2XHT A;  4LOM A;  2VWC A;  1OYR A;  2Q8F A;  3HYZ A;  1UYG A;  1Y6Z A;  2BV3 A;  1VIS A;  2BR2 B;  2J7K A;  5K36 A;  5JEA C;  4DUZ I;  2BYI A;  2WI7 A;  4KHP E;  1TID A;  3QT6 A;  1YES A;  3DGE A;  4PL9 A;  4YKR A;  4MYT A;  5F5R A;  2Q8I A;  1XMO E;  5IDJ A;  3L7Z A;  4JI5 I;  2HKJ A;  4OO1 D;  3K97 A;  4YY3 E;  4DR7 E;  4FWG A;  4OO1 E;  1IBK E;  1TC6 A;  3T0H A;  2XCM A;  4DPU A;  4XDM A;  4B7P A;  1U2R A;  4CWQ A;  2BSM A;  2YEB A;  4X62 I;  3QTF A;  3J7A G;  4J3D A;  2H55 A;  1UY8 A;  2NPF A;  4JI6 I;  4MP7 A;  1Z59 A;  4BQG A;  3ZZT A;  2BRC A;  5LMN E;  1R6L A;  3B25 A;  4EMV A;  4XIQ A;  1L0O A;  3A0T A;  3INX A;  1AH6 A;  2BR2 A;  4DV1 E;  3S5T A;  5CTY A;  2JEA A;  4XIT A;  2C37 A;  3FT8 A;  4DR2 E;  1YC3 A;  3HZ5 A;  1Y5Y A;  2HKE A;  3T1H I;  2IWU A;  1TBW A;  1IBL I;  2K5B A;  3J81 C;  4MP2 A;  5F3K A;  3VHA A;  5FWK A;  4AWP A;  1USV A;  1RRE A;  1HNX E;  4BA2 A;  1YSZ A;  2ZKJ A;  2YEA A;  4YKU A;  2XK2 A;  4UTG A;  4XTJ A;  4YHH I;  3T2S A;  4L91 A;  2JE6 A;  1IBM I;  2O1V A;  4X62 E;  4K0K E;  2PNR A;  2YI6 A;  1H74 A;  4JI1 E;  5JEA B;  3Q5J A;  3H4L A;  4LF9 E;  3NMQ A;  2UXC E;  1P42 A;  4OO1 C;  1ELO A;  1Y8P A;  1Z0B A;  3HEK A;  4CWT A;  4FCR A;  4H85 A;  2YGE A;  1AM1 A;  2YEF A;  5K36 D;  3VAD A;  1KVK A;  5DRR A;  4NXN E;  4PU9 A;  4LF9 I; 
#chains in the Genus database with same CATH homology
 1N33 E;  4URM A;  4DU7 A;  2HG1 A;  3FT5 A;  1UYI A;  4GT8 A;  4DR3 E;  4B3R E;  1YS3 A;  2V34 A;  2CG9 A;  5IWA E;  2YGA A;  5LMU I;  4PRX A;  3MNR P;  3K1J A;  3U2D A;  3M6A A;  5A2Q Q;  2O1T A;  1QYE A;  2DEJ A;  2VF3 A;  4DV2 I;  2BU2 A;  2BU8 A;  2YKJ A;  4EGK A;  2Z5E A;  2YE6 A;  2UXD I;  2HFU A;  1KIJ A;  4LWH A;  3C0E A;  2LJP A;  5M4H A;  5FLX C;  4X9L A;  1AJ6 A;  2YKB A;  2VCJ A;  4DV4 E;  4LWG A;  4PRV A;  1B3Q A;  2YK2 A;  4H85 A;  4GEE A;  1AH8 A;  2QG2 A;  5L3J A;  4DR4 I;  4CE1 A;  4X65 I;  4JYA E;  4E02 A;  2WI1 A;  3OWB A;  5J71 A;  2XJX A;  4GQT A;  3QT8 A;  1BKN A;  4LF8 I;  2YKE A;  1S4E A;  4B3T I;  3R91 A;  5FND A;  4URN A;  4HAC B;  4O05 A;  4DR7 I;  4DV5 E;  2V8P A;  5GME A;  4E00 A;  4DV3 E;  3WU5 A;  1Y4U A;  1XNR I;  4XCL A;  3Q6M A;  2ZBK B;  4B3T E;  2BU7 A;  4XD8 A;  3SL2 A;  1FWK A;  4CWN A;  3B26 A;  4JYA I;  4KSG A;  2CCS A;  1HNZ E;  4AWO A;  3B78 A;  2QG0 A;  1K47 A;  4DR4 E;  3HHU A;  4CWR A;  4XKK A;  4DV4 I;  1HNX I;  5IDM A;  4LF8 E;  3WU6 A;  1ZWH A;  5M4P A;  1FI4 A;  1Z0T A;  4CWO A;  1PVG A;  5D7D A;  4JG4 A;  4DR6 I;  3BMY A;  4HY6 A;  1THN A;  4UT4 A;  4P52 A;  4QPJ A;  4B3S E;  1AMW A;  3B82 A;  4AS9 A;  3A0W A;  1N33 I;  2XX5 A;  3H80 A;  1ZM3 A;  4V25 A;  3O2F A;  1XHK A;  3QDD A;  1Z5B A;  4ZVI A;  4MYU A;  5IWA I;  3A0Y A;  3TZ5 A;  1Z0E A;  3PYD A;  4DR3 I;  4B3R I;  4Q20 A;  1HNZ I;  3HZ1 A;  1I94 E;  4DUZ E;  1US7 A;  4O04 A;  3WQ9 A;  3ZXO A;  2E1R A;  1UYF A;  4XKO A;  4K0K I;  4WUB A;  2E0A A;  2A2D A;  2HHH E;  3EKR A;  2YJW A;  4URL A;  4FWH A;  2O1U A;  1U2O A;  3J81 Q;  5FNC A;  2YI5 A;  4CE2 A;  4NH8 A;  2OI2 A;  1ZM2 A;  2Z5C A;  3RLQ A;  3T1K A;  1YSR A;  4XCJ A;  4YHH E;  2ZDY A;  3JAM Q;  4FPP A;  1ZM4 A;  2EFG A;  2IOP A;  1HNW E;  4L8Z A;  2XDL A;  5FNF A;  5IT9 Q;  1R62 A;  4LWF A;  4DPW A;  4FMT A;  4CWF A;  4CWP A;  4NH9 A;  2WEQ A;  2UXD E;  2V2Q A;  2YKC A;  1Z0G A;  1YC4 A;  5D7C A;  4EEH A;  2YJX A;  3RLP A;  3C11 A;  2GQ0 A;  3JZ3 A;  2Q2E B;  3HJC A;  5LMU E;  5D6P A;  4DUH A;  3K99 A;  4XIR A;  3GON A;  5IN9 A;  4HXW A;  2HHH I;  4DV6 I;  1GKX A;  3R4O A;  2CZ9 A;  3OPD A;  3G7E A;  1DAR A;  4NXN I;  1NHI A;  2CGF A;  4R3M A;  2YI7 A;  4GCZ A;  3GIF A;  3Q6N A;  4FWD A;  4DV3 I;  2VQE E;  4LPB A;  1Z0W A;  4DV5 I;  3A0R A;  4R1F A;  4YKZ A;  5CTW A;  4EM7 A;  4X64 E;  1N34 E;  4KHP I;  5FLX Q;  4RPF A;  4EGI A;  2UXC I;  2YEC A;  2XAB A;  1TH8 A;  4LF6 I;  2FWY A;  4BIZ A;  2YI0 A;  1YT2 A;  1IBM E;  3QT5 A;  2XX2 A;  2AKP A;  2E5L E;  3B8H A;  4XIP A;  4BXI A;  3ZM7 A;  1IBL E;  2XHX A;  2UUA E;  4DR2 I;  2IWS A;  2YEI A;  5GGZ A;  1ZXN A;  4FN5 A;  5IT9 C;  1KZN A;  4JAS A;  4B3M I;  1Z5C A;  4DV1 I;  3OTO I;  4CWS A;  2YEH A;  4DUY E;  3EHF A;  4URO A;  4U7O A;  1HR0 E;  1XMQ E;  2YE2 A;  4JI8 I;  3TZ4 A;  4DV7 E;  2FWZ A;  3F0N A;  1J5E I;  1YT1 A;  3R4N A;  4YKX A;  2UU9 I;  4ZKI A;  2WI3 A;  3PEJ A;  3EKO A;  4DR1 I;  3CRL A;  4JI4 I;  4ASA A;  3ZZU A;  2UXB E;  2ZM6 I;  3T1Y I;  3A0Z A;  4EFT A;  1BYQ A;  1RR9 A;  3CRK A;  3J80 Q;  2YE5 A;  2YEE A;  2Z5C B;  4U93 A;  3HYY A;  2F4V I;  4DR5 I;  5GMD A;  4JI1 I;  4USK A;  3D2R A;  4YKW A;  2BU6 A;  4ED4 A;  4NXM I;  3BM9 A;  1H73 A;  3FV5 A;  1HK7 A;  4DPY A;  4KP4 A;  3RKZ A;  2H8M A;  3PYF A;  1TC0 A;  4LFB I;  2HCH A;  3Q5K A;  2BT0 A;  2HK3 A;  3K85 A;  3T1H E;  1MX0 A;  4MOT A;  4M1K A;  3EHH A;  3U67 A;  2BRE A;  4DV2 E;  2JKI A;  1KKH A;  2CH4 A;  4WUD A;  1XNQ E;  4LWE A;  2QFO A;  5LMN I;  1NHJ A;  3O0I A;  1GJV A;  4YKT A;  2VQF E;  4JI6 E;  5BOD A;  1EA6 A;  2XDU A;  4LF4 E;  2XX4 A;  5CPH A;  2UUB E;  3ZZ0 A;  1FJG I;  1WUU A;  4LFC I;  1UY9 A;  4L94 A;  4R3A A;  1IBK I;  1ID0 A;  4JI3 E;  5M4K A;  4LF7 E;  2CGE A;  4KTN A;  2XDS A;  2YK9 A;  4JI5 E;  3J7A M;  2YED A;  1H7S A;  4FCP A;  1XMO I;  2ESA A;  1EI1 A;  5BR8 E;  1YT0 A;  2ZM6 E;  3T1Y E;  2XHR A;  3OW6 A;  4HZ0 A;  3K60 A;  4JAV A;  4LP0 A;  1D6T A;  4JI2 I;  1KTV A;  1UYK A;  2HK2 A;  4MBC A;  3ZXQ A;  1Z5A A;  1FJG E;  4X66 E;  4ASB A;  2R3V A;  1UYL A;  2XD6 A;  1BXD A;  4HXZ A;  1PKP A;  3Q1Q A;  4GKJ E;  4JI8 E;  1UYC A;  3B27 A;  1N32 E;  3GIG A;  1YC1 A;  2VQF I;  3CWV A;  1HR0 I;  1N36 I;  2GQP A;  4DUY I;  2EXL A;  4BQJ A;  3OTO E;  1QZR A;  2X7I A;  2JJC A;  2XJG A;  3RLR A;  1YET A;  4L90 A;  3T0Z A;  4HYP A;  4YKY A;  4KFG A;  1N36 E;  3JAM C;  3LPS A;  1Y8N A;  4LWI A;  4HYM A;  4DV0 I;  5A2Q C;  3CGZ A;  2Z5B B;  4BIU A;  3ZKD A;  2E5L I;  2WEP A;  4JI0 I;  1Y4S A;  1OSF A;  2PNM A;  3K98 A;  3J80 C;  4P8O A;  5D7R A;  4NXM E;  4DZY A;  3D0B A;  4LF6 E;  3D4J A;  4DR5 E;  4LF5 I;  2C2A A;  3B28 A;  2BZ5 A;  4YY3 I;  3EHJ A;  4XE2 A;  1H7U A;  2Q8G A;  2CCU A;  4X64 I;  3GIG B;  4B6C A;  2WI5 A;  2YE4 A;  2VQE I;  3TZ2 A;  2BM0 A;  4DR1 E;  4IZJ B;  3LNU A;  1TIL A;  4OX9 E;  2QF6 A;  2UU9 E;  1I59 A;  2YE3 A;  4FW9 A;  2YEG A;  3O6O A;  3A0X A;  4AQY E;  4KQV A;  3HUL A;  4IZJ A;  1JM6 A;  5C93 A;  4DV6 E;  4L93 A;  2A2C A;  2Z5B A;  1N0V C;  4HZ5 A;  1XMQ I;  3PYG A;  2VW5 A;  1USU A;  5CF0 A;  2AJ4 A;  1I58 A;  4IZK A;  4B3M E;  1I5C A;  2UUC E;  4JV5 I;  2IWX A;  3U2K A;  2BU5 A;  2V2Z A;  4FCQ A;  4NH7 A;  4HAC A;  4Z7Y A;  1Y8O A;  1NHH A;  3PYE A;  3Q5L A;  1N0U A;  3B24 A;  1HNW I;  1UY6 A;  1B63 A;  1OJ4 A;  2UUC I;  4I3H A;  1NZ0 A;  4JV5 E;  5D6Q A;  2YE8 A;  4JI7 I;  2GFD A;  2GS8 A;  3G7B A;  1ZM9 A;  3PRY A;  2WI4 A;  3VHD A;  4U7N A;  3R4M A;  4JI2 E;  2BYH A;  2YKI A;  1BGQ A;  3VHC A;  4GKJ I;  4QPK A;  1FNM A;  4DU8 A;  4AQY I;  2XEX A;  4JI4 E;  4H7Q A;  4YKQ A;  3KE6 A;  4JI3 I;  4OX9 I;  1I5A A;  2BTZ A;  1ZW9 A;  4LFC E;  1UYM A;  4O0B A;  1YER A;  4KSH A;  2V2V A;  3PEH A;  4K4O A;  1I94 I;  5M4E A;  1I5D A;  2UUB I;  3INW A;  4GGL A;  1J5E E;  3ZKB A;  4GKK E;  1H72 C;  2IOQ A;  3WU3 A;  3TUH A;  3G75 A;  3K17 A;  4LF7 I;  4I5S A;  1UY7 A;  4IZJ D;  4LFA E;  1U0Z A;  2IOR A;  4W7T A;  2YE9 A;  1UEK A;  1A6F A;  4JI7 E;  1A4H A;  5CTU A;  3IED A;  4XC0 A;  2X36 A;  2YE7 A;  3P06 A;  2UUA I;  3OMU A;  4DV0 E;  2BM1 A;  4B3S I;  1S16 A;  4V26 A;  2ZIT A;  4EMD A;  1B62 A;  1Z0C A;  3R4P A;  4EFU A;  1XNQ I;  4USM A;  4DR6 E;  2YGF A;  4LFA I;  2Q8H A;  4O09 A;  4E01 A;  2F4V E;  2DEI A;  2XDK A;  1UYH A;  4DPT A;  1N34 I;  1ZXM A;  4GKK I;  2ZDX A;  4O07 A;  1QY8 A;  2HFS A;  3WU4 A;  3V5R A;  4X66 I;  1GKZ A;  4EGH A;  5CTX A;  4DXL A;  4HY1 A;  4P7A A;  2FXS A;  3T10 A;  5LL6 R;  4DPX A;  1UYE A;  5J6A A;  2UWD A;  2PNL A;  3LTO A;  3V2U C;  1XNR E;  1S14 A;  5BR8 I;  2WI6 A;  2UXB I;  4Z7C A;  4ASF A;  4AWQ A;  4LF5 E;  3D36 A;  3TZ0 A;  4IZK B;  5M4M A;  4WUC A;  1UYD A;  2XDX A;  4JI0 E;  4XKA A;  4H81 A;  3CGY A;  4X65 E;  4BAE A;  3OWD A;  4DV7 I;  4CE3 A;  4LF4 I;  1PIE A;  4MPE A;  3WHA A;  1FWL A;  3EHG A;  2FYP A;  4ASG A;  2CCT A;  1MU5 A;  3R92 A;  4MB9 A;  3GIE A;  4MPC A;  4JQL A;  4GFN A;  3QT7 A;  2VCI A;  4N3O A;  5M4N A;  1FKA E;  1N32 I;  2WER A;  4JAU A;  2R42 A;  5BOC A;  4MPN A;  2WI2 A;  1MG7 A;  1I5B A;  2WW4 A;  2YEJ A;  3TTZ A;  2O1W A;  4LFB E;  1Z0V A;  2XJJ A;  2XHT A;  2VWC A;  2Q8F A;  3HYZ A;  1UYG A;  1Y6Z A;  2BV3 A;  1VIS A;  2J7K A;  4DUZ I;  2BYI A;  2WI7 A;  4KHP E;  1TID A;  3QT6 A;  1YES A;  3DGE A;  4PL9 A;  4YKR A;  4MYT A;  5F5R A;  2Q8I A;  1XMO E;  5IDJ A;  4JI5 I;  2HKJ A;  3K97 A;  4YY3 E;  4DR7 E;  4FWG A;  1IBK E;  1TC6 A;  3T0H A;  2XCM A;  4DPU A;  4XDM A;  4B7P A;  1U2R A;  4CWQ A;  2BSM A;  2YEB A;  4X62 I;  3QTF A;  3J7A G;  2H55 A;  1UY8 A;  2NPF A;  4JI6 I;  4MP7 A;  1Z59 A;  4BQG A;  3ZZT A;  2BRC A;  5LMN E;  3B25 A;  4EMV A;  4XIQ A;  1L0O A;  3A0T A;  3INX A;  1AH6 A;  4DV1 E;  5CTY A;  4XIT A;  3FT8 A;  4DR2 E;  1YC3 A;  3HZ5 A;  2IWU A;  2HKE A;  3T1H I;  1TBW A;  1IBL I;  2K5B A;  3J81 C;  4MP2 A;  5F3K A;  3VHA A;  5FWK A;  4AWP A;  1USV A;  1RRE A;  1HNX E;  1YSZ A;  2ZKJ A;  4YKU A;  2YEA A;  2XK2 A;  4UTG A;  4XTJ A;  4YHH I;  3T2S A;  4L91 A;  1IBM I;  2O1V A;  4X62 E;  4K0K E;  2PNR A;  2YI6 A;  1H74 A;  4JI1 E;  3Q5J A;  3H4L A;  4LF9 E;  3NMQ A;  2UXC E;  1ELO A;  1Y8P A;  1Z0B A;  3HEK A;  4CWT A;  4FCR A;  2YGE A;  1AM1 A;  2YEF A;  3VAD A;  1KVK A;  4NXN E;  4PU9 A;  4LF9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...