1F51A

A transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in singal transduction
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
181
structure length
181
Chain Sequence
ISDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEITSHECLIEIGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPORULATION INITIATION PHOSPHOTRANSFERASE B
publication title A transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in signal transduction.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 64
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature ec 2.7.-.-:
pdb deposition date 2000-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14682 SPOB_ab Sporulation initiation phospho-transferase B, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1f51A01
3.30.565.30 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Sporulation initiation phosphotransferase B (SpoOB), C-terminal domain 1f51A02
2C2AA 4BIZA 2WWWA 3DGEA 2QM8A 3ZRWB 4JAUA 4JYBA 4U7NA 3TK1A 3D36A 3ZCCA 3ZRXA 3NXSA 4Q20A 4U7OA 4FMTA 2QM7A 3A0RA 4GCZA 4JASA 1F51A 3P32A 4MTXA 4MT8A 3ZRVA 5C93A 3ZRWA 5B1NA 2FTKA 4BIUA 1IXMA 4FPPA 5B1OA 3MD0A 5IDJA 4QPKA 4LC1A 4I5SA 4JAVA 4JYCA 4ZKIA 1JOYA 4GT1A 2LFSA 2LFRA 4KP4A 4QPJA 2P67A
chains in the Genus database with same CATH superfamily
2W6JG 4LWSB 2KG7A 3KCYA 5LGTA 1R3JC 4H44B 1PM9A 2BTQB 2XABA 3FKSG 2HKOA 2CCUA 2WLLA 1GTOA 1AB3A 1S14A 3JALA 2CTWA 1NTZH 5E1AC 3Q4HA 5H2FZ 3RYFA 1XMOO 1ZL8B 3CXHF 4XKOA 2JEXA 1I59A 2E75B 3ZHQA 1EA6A 5FLXN 4U3JB 3HKEA 1PL0A 3W7SA 3CJHA 2Q67A 2CTQA 1Q5OA 2WEPA 2VCIA 4J41A 1YC4A 2EULA 1GN3A 2BTOA 1Z2GA 2RMKB 1Y6XA 3LDCA 5CTUA 4J80A 2Q8VA 3ZMVA 3E8HA 1YITV 2YI0A 4UCOA 5HFLA 2P67A 3AG3B 3BABA 2P6JA 4TSFG 2FWYA 4QGPA 2O57A 2E76B 3CMAV 3ICXA 4WBNB 3T4DA 4I9WA 3ZJZA 4V25A 4MTXA 4XDKA 4LF9B 2CTPA 4PI2A 1GN6A 1K3EA 4LWSA 4OPHA 4GX0A 3ABUA 4X62B 5IYBO 5D6QA 4NXNO 1UYKA 4LC1A 1G8MA 3OMNB 4X65B 2GUZB 1YT1A 4E2LA 1FFXB 2QKCA 1T5EA 3QF7A 4YKRA 2ZIOA 5LGUA 4K0KB 3B24A 1XREA 3UO2A 2EILC 4TT3G 3A0WA 4OXSA 3B2EE 3VHCA 3CCVV 5KA6A 3AG7A 5L3BA 1VQOV 1H2LA 1P84F 3CX5F 4B7EA 4KSHA 5M4MA 3B8MA 1N32O 1SRYA 5M4HA 2XJXA 1VQ5V 2IWXA 1Q82W 1NS1A 1Y8OA 2C1IA 3CWVA 2UXNA 4I3HA 5DEDA 1IBMO 1ZUQA 1WAZA 2QM4A 1KIJA 1YESA 1HR0B 3G4SV 3BA9A 3K08A 2GSMB 2YEBA 4ABMA 4XKAA 2EBOA 5KMGA 3ZXQA 2YK2A 4FZ1A 2D3OW 4O0BA 2PZSA 3IAYA 1PNLA 2A0LA 2ADPA 5B1NA 3E86A 1KKDA 5FNDA 1BQZA 2WLIB 4O2BB 2H3OA 3G75A 4WBNA 1P7BA 2WA4A 1Q7YW 4H33A 4XTJA 4ZOLB 1SETA 4JI1O 2ZR2A 1BT8A 2QM7A 2Q8GA 1Q90D 4J9YB 4CH3A 4MVOA 1NHHA 2XDXA 2GBOA 1E79G 2YC0A 2YE7A 1P49A 3ZMTA 2AHYA 1N0JA 2BSMA 2ZD9A 3GWKC 1MSWD 4RQEA 2YI6A 1PNKA 4B7PA 2QWPB 4BIZA 2UXCB 3M7MX 1AJQA 4LP8A 5LXTA 3E2EA 3JAMN 5FPRA 1L1FA 2IWUA 5D5PA 2YE2A 1MABG 1V54C 1THNA 4JI2B 2YKCA 2FTKA 1S5HC 3TUHA 1TH8A 3LNUA 4E00A 1OV9A 3R66A 1URFA 2QJ1A 1PP9H 4KL1A 3G67A 4FCRA 2NLJC 4B3MB 4AWQA 3EKOA 1JJ2U 4N23A 4UVCA 4XC0A 2WLIA 4O2BA 3JD1A 1K9MW 3ZCCA 1ZSPA 2Q8FA 5J2UB 2C1GA 4XDMA 4BW9A 3EXAA 2YKEA 4CS3A 3A0BZ 1MNGA 3SPIA 2YGFA 3K99A 2Q8HA 2YEVB 4FM2A 3SGIA 2F23A 1H2KA 4DR7O 3DXRA 1BSMA 1TA8A 3G71V 2HP8A 2XCMA 5KX5B 4IIJA 2BTZA 2QM8A 1RPOA 4PA9A 3IEDA 3AG4B 4MP7A 3K5LA 1DLBA 2ITDC 3G7BA 1K5SA 2WERA 4EGHA 4L91A 4KQVA 1VQLV 3HYYA 2ZE6A 4DV4O 4LF6O 1WA8A 3CCMV 1IBLB 1GM9A 3VOUA 4HYOA 3ZX6A 5K1XA 2EIKB 4PDMA 1KU9A 5EZYA 2P06A 2CUGA 4FLTA 1Q6HA 5L3DA 1UYIA 3M8AA 5M4EA 2IJJA 1NR7A 4LF8O 1AR4A 3CC7V 4X88A 4P30A 4JI7B 5LP6B 2BE3A 1HNZO 3BFRA 3JD4A 5M4NA 3HKBA 4ZIBA 4JPRA 4DV6B 2Q4PA 4L87A 2IOPA 4R3AA 4JAUA 2PGGA 1AP6A 1WLEA 3B27A 2O1WA 4CE1A 2YEVA 2VQFO 1TUEB 4IT5A 4FVMA 4O4HA 4BQJA 1HNWB 4LFCB 3BHPA 4B3SB 2M6YA 2GDSA 3AG3C 1J95A 3MHSC 2ZNIA 4GKKO 1H7UA 3MNRP 1AVMA 3LSQA 3ABTA 4MW8A 5D7RA 3LUTB 5LMUB 3C90A 2VWCA 4J7JA 4B7KA 2QR4A 2BYHA 2E74B 1AI7A 5GW7A 1XUQA 4WFFA 1VQKV 5CA0A 3PN1A 4J7KA 4H7QA 1XNRB 4JTAB 5B1OA 1SZXA 3S3WA 5CTYA 4CE3A 5M4KA 3THOA 1WPXA 4LP0A 4FLVA 4GKJO 1MG1A 4MW3A 5J71A 3MDSA 4MVUA 3X2QB 4I55A 3U11A 4W4KA 1L0NH 1W0KG 4X9QA 1I7FA 2DMXA 3ABKC 4AI8A 4CS4A 4DYLA 5LP6A 1YIJV 4EGIA 4MS2A 2WI5A 3ZRSA 2PTMA 3RLRA 1AROP 1GMGA 3G80A 3K79A 1THZA 2HHHO 3H1HH 5GONB 1BGYH 1AILA 2XAGA 3RN4A 5LOVA 1M5IA 2XJJA 1FXKB 1RP3B 1H8HG 2ARHA 2B1IA 2QG0A 5LYJB 2XHRA 2Q69A 1OZ0A 3SPHA 2LW1A 5IY5B 2PF4E 5LA6A 2DYSB 3VQYA 4J42A 2Y69C 3VADA 4BAEA 2JK5C 3JAKB 3GIGB 1SERA 1F4MA 1V9PA 3T1HB 2GV9A 4YKXA 2ODMA 4EEQA 3QO8A 4R1FA 2XX2A 2WPDG 2HJDA 2UUBO 3CCEV 1K97A 4AWOA 4B3TB 3RYHB 1KKCA 4RUEA 4DK0A 4CWSA 1QCEA 4JZGA 3J80N 2W0FC 2YE8A 1A32A 4GQTA 3RGBA 3E8BA 4JZ2A 5J2TB 2WA3A 1L0LH 2QWNB 2YUAA 4X89A 4GT8A 4NH9A 4DV2B 3CRQA 1VF7A 1EFRG 4UVBA 1E1QG 3JATA 3SYOA 1U2OA 4KXRA 1D5NA 1KBHA 2UXDO 2F66C 3BM9A 2YEJA 2Z3YA 4JI6B 4E72A 1PKXA 3FAVA 1ZTEA 5DECA 4MTOA 2AKPA 1WB8A 2JJCA 5LMNB 1UY8A 1FXKA 2YKBA 4GCZA 1XOUA 2YEIA 1AR5A 2IH1C 4DR2B 3HR0A 3RYCA 4D7TA 4G2KA 1S72V 3A8TA 3OWDA 5IYZB 3GIGA 3PEHA 4O2AA 4AQYO 4X64O 3CS5A 4LFAO 2IWSA 2RQ6A 5FNVB 3CC2V 1QR8A 2BRCA 3B8NA 4HZ5A 3RYHA 2UUCB 3RYIB 2HVJC 3KG2A 5KHKA 5JH7B 5ITZB 2HG1A 4X1KA 2CK3G 2FYUH 1NHIA 3OWBA 2EJ7A 5B1AB 1AMWA 1XMQB 3ZRWA 4KHPB 4XIQA 2Y0PA 1BE3H 5IDJA 1XL4A 2BCCH 2E0AA 2BU8A 4ASFA 3JARB 2JRIA 4JYCA 3SYCA 1HNXB 1SKVA 3AG2B 1BKNA 3JAWA 4DR6O 1DGSA 2YI9A 3VQWA 4LFBB 1IBKB 4W7TA 1FJGB 2H94A 3AG4C 4UCVA 3GVMA 3L72H 1VF6C 1EN4A 4G27B 1GJVA 3CCLV 4DV1O 1F7YA 5GGZA 3WB0A 4LWFA 2WI6A 4K4OA 4DW0A 1AJNA 4O05A 4X1IA 2MK3A 4O4LB 3OMUA 4PHZA 4DR4B 3K59A 4QE9A 3FB5C 2EIKC 1MA1A 4QE7A 2YE5A 2E5LB 5F2VO 4QPJA 5JQGA 2XHTA 4X20B 3OPDA 4X66B 1J5EB 5CA3A 1Y4UA 5BR8O 1YTFD 2H8MA 3T2SA 5FNVA 2O1UA 2ZDXA 4LF5B 1KMIZ 1KP2A 2KG7B 3QO7A 3RYIA 2KKWA 5A9GA 2AZ0A 3JD0A 2WSSG 3EVKA 1CPYA 3K0GA 3K06A 2ZXWB 4CH4A 2ZM6O 4UB6Z 4YHHO 2WLLB 3LDDA 3CE2A 4FJCC 3EHBB 1BMFG 3AEIA 4UUJC 3JALB 1R3IC 5CBFA 1YTFB 2A9HA 1O9HA 4ZHQA 3Q4HB 2VQEB 3RLPA 5B66Z 2AZ2A 1TAEA 3AK1A 1ZAUA 2BZ5A 1SESA 3HKEB 2FXSA 3CGYA 4X9LA 4XKKA 5F5RA 2Q0OC 1Y8NA 1S16A 4JAVA 4KFMA 3OGCC 4JI3B 4JI0B 4V26A 2UU9B 5L3GA 5JJJB 2JIZG 1WN7A 1YJWV 3CHXA 5B1BB 4Z1VA 1TILA 3QDDA 4YKZA 3A0RA 1RM1B 2ZE8A 1UYHA 1RSOA 2B5UA 1CP9A 1UPGA 4L8JA 4JV5B 3INXA 2R9RB 4DR5B 4X20A 3CP1A 3X2QC 3R65A 4YIOA 2WI3A 3OEHG 3LNNA 2R70A 4DV5O 1YEWA 2PUSA 3CRAA 5JWPA 4X8AA 2YKJA 2JKIA 2QKAA 1R6TA 3HZ1A 5J9PC 2JJ2G 3SR2C 4C7UA 1Y8PA 3QTFA 1U97A 3CMEV 4DR1O 2QEXV 4DUZO 4TQFA 4ZVIA 4GEEA 3OTFA 1R3LC 2NR5A 5JCOA 1R73A 2P4KA 4DV3B 1OCRB 3IC7A 1P4RA 4DZYA 4DV7B 1I0HA 2DYSC 1AR1B 4DV0O 1I08A 5EBLC 2PYLA 4WUDA 2KQXA 4UROA 1HWYA 1DF5A 2XD6A 2Z0AA 4MB9A 5FPOA 1Z5WA 1VEWA 2L6LA 4MVMA 4GX1A 3FT8A 2AGAA 3ZHRA 3FD9A 1Q6UA 3IFXA 2XHXA 1H2NA 5BMVA 4JI5O 2CDYA 2V4DA 2P90A 3G6BA 2A79B 1QBZA 3STZC 3TETA 2BOBC 4DR3B 2DQ3A 1YVWA 5KMGB 3E8FA 1HR0O 3Q5JA 2EX3A 3PJSK 1H2GA 4TUYB 2YE6A 3FT5A 1I5BA 3D3IA 2Q9LA 4RAIA 3UT5A 1YC3A 1ROPA 4PELA 4YKQA 5FWKA 2OIGA 5KUMA 2QF6A 1KP3A 4WFEA 2ZDIC 4PI0A 2Z5UA 2WEQA 2XUMA 3P3NA 1BYQA 3WU2Z 1YETA 3HKDB 4ASAA 2Y48A 1VQMV 1I94B 5BXZA 4E02A 1EZJA 4NKGB 2FMLA 2DN9A 4TOIA 3TCUA 2R9IA 3RBZA 5CMUA 2XK2A 4FLUA 1HP8A 4K35A 2GTAA 5IT9N 3VQVA 4PA3A 3ZS8C 5B5EZ 1ZXNA 1VP7A 3ZHTA 4FLWA 2YGEA 1B06A 1EN6A 1K5QA 4XITA 4TWKA 3B25A 3U2KA 1XILA 1BS3A 2AW9A 2B9ZA 5LXTB 4CS2A 2X6AA 3CRMA 4YJ2B 2F95B 1XMOB 2JGDA 1G1XB 2YIDA 4FK5C 2EJRA 2MW2B 1RPRA 1AM1A 4FCPA 1SS3A 1GRJA 3D36A 5B1AC 4Q20A 1BCCH 4TV9A 4TUYA 4EKWA 2IORA 3SYAA 2Q7GA 4U3FH 4MVZA 1Y76A 3UO3A 4IYIA 1H38A 3AG2C 2ATKC 1B6QA 3K5OA 2LGWA 1R6NA 2HG5C 2QGNA 1MOFA 3OMAB 1Q43A 2YJXA 3CCUV 3J7AU 4RO2A 3HKDA 3SJBC 3MAQA 3JCUZ 5LHIA 2BU5A 1EM1A 4U7OA 4CWRA 4JASA 3P32A 3DXRB 4QJFB 3A0TA 1JPXA 4IIJB 1U96A 3HPLC 4PV1B 4BIUA 4UFZA 3Q5LA 1QYEA 4YXWG 2YI5A 3P30A 4P9OA 2ZINA 5EC2C 1YI2V 4I50A 2LFSA 2YXLA 1XDCA 4H37A 1GKZA 3DC6A 1I5DA 4PU9A 1NR1A 1SQBH 2Q5ZA 1YZBA 2FKXA 3WG7B 3OUSA 1US7A 1Y4SA 4YJ2A 5IYDO 2YXYA 1WA8B 1OCZB 3HB3B 2CG9A 4MBCA 3ETEA 3K57A 1WB7A 1N32B 3OGIB 3STLC 5K1PA 3T2MA 2ZXWC 2CH7B 5EZYB 1V55C 3B77A 2ILMA 1N36O 2ZQMA 1IBMB 3O6OA 1OCOB 4WCEV 4AWPA 5IN9A 1B63A 3A0XA 3ASNB 2VCJA 4UVAA 4HXZA 4JI8O 1YT2A 4EM7A 1UYEA 2F4VO 1LR1A 3TZ5A 4KUMA 4FLXA 4A5UB 3HKBB 2WI4A 2VRZA 3FYIB 3K9AA 5IDMA 4GFNA 2YEDA 1VQ6V 4LH6A 4NH7A 5D7CA 2OCCB 1TUBB 2QSAA 1XI1A 1M57B 3ZKBA 4URNA 4R6ZA 3QNEA 3FB8C 4XBFA 1IXMA 5B1BC 4XDLA 4DXWA 1VQ7V 2Y4TA 1Z5CA 5EYPA 2ITCC 2EZPA 4O4HB 3ZIAG 3ZHVA 1VQNV 5L3FA 3K98A 4JI1B 4D7SA 1GM7A 3K04A 2HHIA 2LO1A 1QLEB 3O65A 3ASOC 4LBEC 3CB2A 5C93A 3WFVA 2ZE7A 2Q6AA 2HJFC 1N34O 3T1CA 2M7WA 3B09A 5GTIZ 2R9AA 4LF4O 2LQTA 3A0YA 3FV5A 5CA0B 3APQA 2CH7A 2LW7A 4OX9O 4E4EA 5GTHZ 2RJZA 4FFBB 2OTJV 4MT8A 3QVNA 1L8DA 3OT7A 4I55B 4URMA 2A06H 5J6AA 4YKUA 3ZHSA 3INWA 2L35A 4LWHA 1FAFA 2YIBA 4DUYO 2XHBA 1I58A 5HFMA 2JS5A 4PA7A 4H81A 2F93B 4EGKA 2G38A 3SL2A 1R3KC 3DGEA 2N74A 3L74H 3WB2A 5LOVB 3SJQC 3OTOO 1TUBA 3ZKDA 1BZKA 3A0HZ 2IU0A 1WJZA 1CEZA 4LF7O 4WUBA 4JI4B 4B3RO 4R3MA 1ZWIC 5LA6B 5D6PA 4WUCA 1QVFU 1M9NA 5EIBD 2IBZH 3LMMA 4DK1A 2KB1A 1ORQC 4DR7B 5H5NA 3BCCH 1N33O 2YEGA 3OR6C 1Q81W 2GTSA 4Z2WA 3K97A 1RFYA 3SPJA 2GFDA 1NTMH 2X6BA 1UYCA 1UYDA 1OCCB 5IWAO 4IGGA 1MZFA 1YC1A 2NNUA 1GN4A 4NTWA 4DV4B 2QTOA 4L90A 2E3CA 4LF6B 2FYPA 4FFBA 4GX2A 2BT0A 4X1YA 4R7CA 1GM8A 3JATB 1K4CC 2CGNA 1M93A 4XIRA 4HZ3A 3N2GA 5A2QN 1K33A 3T10A 4ASBA 1JCHA 3FAVB 3OAAG 4LF8B 3IGAC 3LNMB 3RLQA 1HNZB 3N2KA 2UXBB 3MHHC 4HNAB 4D6TH 1AP5A 2F1MA 5LMNO 2Q68A 2ZNJA 4IYHA 3RYCB 2PNRA 2D2CB 3KE6A 3CYOA 4IHJA 1W2BU 3I5DA 2K1EA 4O2AB 5H6QA 4JF3A 1VF5B 2VQFB 1NH2D 3Q5KA 1G6UA 4P7AA 4OPAA 3ABMB 2XAFA 3KKYA 1MMMA 1H2MA 3RWRD 1AI6A 2A7WA 4GKKB 4UCRA 3AK3A 4X1KB 5B3SB 2ZKJA 4CWPA 4EMVA 1ZWHA 3GWOA 1MSDA 2QWOB 4NXMB 4AS9A 3ZRWB 2QDOA 4U93A 1JX9A 4JYBA 3SJAC 4YKWA 3FB7C 1NH2B 3ZHUA 3CEIA 4J11A 2JEUA 3RT3C 5CBHA 4EFTA 1SQVH 1JFFA 3JAWB 1K8AW 1DTOA 2K9PA 1M56B 1VQ8V 1Y74A 5H9CA 4LCUC 3H1LH 2CCSA 2BYIA 2ZT9B 4XCLA 4GKJB 4ICGA 2YE4A 2YEEA 2YK9A 1ENVA 1W0JG 1YSZA 4X1IB 1QNMA 1OCZC 2HKJA 3W7TA 4EFBA 1KB9F 4HNAA 2CTRA 1NVPD 5CB4A 2WLNA 3IC9A 2UUAO 1H7SA 1MU5A 3SPCA 5JQGB 2HHHB 4I0XB 2CH4A 3L73H 3ETQA 3K03A 1SA0B 1QZRA 3ASNC 1DF4A 4JYAO 3B4SA 1H2SB 3CRRA 4MPEA 1KQSU 3SYQA 4B6CA 1SQFA 3U2DA 3CXCU 3CWBH 2YS8A 4QIWF 2IH3C 1NVPB 4O4JB 2OCCC 1M57C 3OM3B 3I55V 5IJ9A 1I5XA 2HEPA 2UUBB 2ZE5A 3VBBA 2BU2A 1XBLA 3RVZA 4ZHQB 3KCXA 5D5QA 4Z1MG 1YXBA 3O9OA 1JOYA 1TC6A 5CN0A 1QLEC 3E22A 5KHIA 1VMGA 4FIPC 4NTYA 4LWIA 1KD1W 3F5WC 4LWEA 4H13B 2GHYA 2W6IG 3ZEDA 4YY3O 2VS0A 2WLMA 3A2FA 2XJGA 4RWUA 3JZ3A 1PL4A 5LHGA 2UXDB 4WF9V 2HVKC 2UU9O 3ETDA 2IW5A 3CGZA 1RSOB 3T1YO 2WLHA 3UKMA 3GB7C 5KAFZ 2O1VA 4HYPA 4I0XA 1SA0A 4P9PA 2YI8A 2BSKB 2EIMB 3B28A 3RVYA 3OW6A 5LP6C 4PA4A 5KHHA 2CAZC 2QE7G 4ZI7A 3H1KH 1QY8A 1ZXMA 3O2FA 3JD3A 2Y0IA 4O4JA 4L8ZA 2YXHA 1F4NA 4X64B 1NQTA 4AQYB 1FKAO 4LFAB 1ID0A 1XNQO 1SZTA 1SQXH 3D0BA 4NB5A 5JJEB 3RFRA 4K8XA 4CWNA 1FFTB 3C0EA 1AH8A 3C11A 3H1IH 1BGQA 1V54B 2CCTA 4KTNA 2PI4A 2XTAA 2PI5A 2JS3A 2Q7HA 3OD4A 4EB6A 1ZLZA 1PV0A 2EZOA 3H9VA 3K3WA 1EBOA 4BXIA 5BMVB 1QVGU 4DR6B 1JM6A 1OCCC 3K0DA 2YEAA 4I9QA 2ZDYA 1F23A 2P4VA 4CE2A 5EIBC 1SC5B 1NKDA 4DV1B 4DR3O 2HCHA 4PD4F 3TGUH 3UT5B 2CGOA 3H80A 4WFBV 5IE9A 3H4LA 3QO5A 2PYJA 2BSKA 1W59A 3T1KA 2LFRA 1AJPA 1R62A 4GUNA 3DTUB 3F7VC 1XEQA 2H8PC 2VWJA 1GK9A 5JENA 3BRCA 2JGUA 3TJTA 1OSFA 2X7RB 1TVKB 2YI7A 3ZN0A 4LF9O 1IURA 2LP7A 5BR8B 1BL8A 3E8GA 4CZZA 1FXKC 1FS0G 4X62O 1M1KW 5KA5A 1IVSA 3MD0A 4HY6A 4X65O 1Z5BA 1XHZA 1KC8W 5IY5C 2QWRB 1LUWA 4K0KO 2XAQA 1DK1A 2ZM6B 4YHHB 2YJWA 2X0LA 3E83A 1YJ9V 2YEHA 1E1RG 5TISZ 5JVDA 1FD9A 4WFGA 5KHJA 3ABMC 2IU3A 3EHGA 3C3TA 3R4NA 1U0ZA 3EHJA 2JGDB 2JVDA 3K9SA 1TC0A 3R92A 5B3SC 1K4DC 1NBMG 4MP2A 1GKFA 4LPBA 4TV9B 3UM7A 5C8YB 2IJKA 3JASA 2N05A 2DWDC 1Y76B 1AJ6A 5CTWA 3JD2A 3SJCC 2ESAA 2UXXA 2FWZA 3EKRA 2OT5A 4LNUA 1D2DA 1K34A 1M56C 3OUFA 3OW2U 1UYLA 3K60A 1G4YB 4NYKA 3S3XA 4YJ3A 3BA8A 5LL6Y 1SQGA 1TVKA 2XDUA 5H6RA 4DV5B 3RKZA 3FYEB 2DWEC 5KUKA 1Z5AA 3HKCA 2IM9A 5IJ0B 1SQPH 4ASGA 5LGNA 1S5LZ 4HXWA 4CWTA 2NN4A 4DR1B 1AH6A 4DUZB 1K92A 1UFIA 2IJIA 4I50B 1KYOF 3EHFA 2WLKA 5CPHA 4FFKA 2BTQA 4XCJA 2UWDA 2DW4A 3B26A 1MX0A 4AILC 4UCUA 3NMQA 2JJ1G 4PDRA 4DV0B 2UXCO 4XIPA 1MZEA 1Y67A 5BY1A 2XX5A 1ZL8A 3BEHA 1ZW9A 3ABKB 1VIBA 2XAJA 5C8YA 4JI2O 4U3JA 4JI5B 3HHUA 2BREA 3W7UA 3D3QA 3S5TA 4KSGA 1YCIA 4RUFA 1GKXA 1S0VA 4ZKIA 3JCZA 2R72A 4BIOA 4B3MO 4MPCA 4YKTA 2WI7A 4PRVA 5FNCA 3W7WA 4U7NA 5BOCA 2Y69B 4JYYA 4WFAV 3K58A 1JQ0A 2GQPA 4MSWC 2RCVA 5IJ0A 5EYPB 2QG2A 4R8CA 1UYGA 1YSCA 1R6KA 2EXLA 4LR3A 4NXNB 3JSLA 2XX4A 4E01A 3D2RA 3ML0A 3QTCA 4UXNA 2EIMC 3TTZA 4UV8A 1HDJA 4Q6GA 3HZ5A 3M99B 2GUZA 1FPOA 3I56V 1FFXA 1Y66A 4WFHA 5L3EA 3EFFK 2XDSA 4BAYA 2KSDA 2YIBD 1A4HA 2QWQB 1B3QA 2ZKOA 4AHCA 3OR7C 2YECA 4YIPA 1VQ9V 1N8RW 3H01A 3ZMUA 4FLYA 4YKYA 1JJOA 1NZ6A 4KFGA 1KECA 5CF0A 1IBLO 5JCOC 4J7ZA 3GIEA 3T4ZA 3UCSC 5EC1C 2C2AA 1FYJA 1S5JA 1XHXA 1Q8IA 1Z5VA 3CYGA 1AI4A 3CD6V 4FCQA 4JAAA 1WP8A 3CRKA 3VHAA 2XOKG 3AG1B 4JI7O 2H55A 2XT9A 1Z59A 1TIDA 1S77D 3CRLA 4MVQA 1ZX3A 4TQDA 4P8OA 4PA6A 3JYCA 4GYCB 1IX9A 4I5SA 4DV6O 4JQLA 3K5NA 4NR1A 1BQ0A 3CRCA 1RM1C 5BZBA 2IOQA 3ZBHA 5E79Z 2OYQA 1UY7A 5D7DA 5F3KA 4JI4O 4FM0A 1HNWO 1PVGA 4ZOLA 4LFCO 4B3SO 4CBCA 4N21A 4BW5A 4K8ZA 2DE0X 4IL6Z 1S3JA 2QTSA 2BU6A 3C3SA 3R4MA 2CE4A 3OFNG 5LMUO 1NTKH 2YEFA 2EINB 1QLNA 3CCSV 5CTXA 2Y4UA 5LHHA 4HYMA 3LDEA 2RDCA 4PRXA 2OTLV 1GO3F 1OCRC 1XNRO 2OIEA 3CC4V 4X1YB 2PY5A 3AK2A 3WQ9A 3SYPA 4CWFA 4CC6A 4MPNA 1XQ8A 4BQGA 4OGQB 2QA4V 4L94A 4HY1A 2HFEC 1N36B 3N2GB 3ZXOA 3NR7A 2WWWA 5JJNB 1TBWA 4DRXB 4JI8B 2DYRB 1L0OA 5M4PA 1K73W 2F4VB 3N2KB 4K3AA 4W4LA 2YIAA 1F51A 2YICA 4GGLA 3ZMZA 3D36C 3U10A 1JA8A 5EBMC 2UXBO 4IHJB 3QG5A 1BHAA 3R4OA 1YS3A 2YKIA 5J2UA 1GN2A 2QKSA 4KP4A 1YERA 1KUQA 2BU7A 1QR9A 1P7GA 3T1HO 4HBNA 2VW5A 1X59A 1LUVA 4EEHA 4MVSA 5KX5A 3B40A 2X6CA 4B3TO 2P5OA 2WLJA 3TZ0A 3H1JH 3U0ZA 4MTGA 2RN9A 4ZBMA 4GX5A 4R50A 1N34B 3L75H 2BOCC 2JDIG 5IYCO 3F7YC 4LF4B 4NXMO 1S76D 1VF6A 3L70H 1JFFB 1COWG 1LNQA 2DOSA 5L3CA 4FLZA 1Y74B 3SDLA 4OX9B 1WPBA 4H0LB 2WAMA 4DV2O 1JR9A 1GH6A 3ABLB 4CC5A 2AXTZ 1QU7A 3UQ8A 1UYFA 4DRXA 1N0NA 4JTDB 3D8CA 4NVPA 4JI6O 3OE7G 1EI1A 2W0XA 4DUYB 1Q86W 4CWQA 4O09A 5CB4B 3TXQA 4F4LA 2EIJB 5L3JA 4URLA 2K5BA 4FZ0A 1QHTA 1WNSA 3OTOB 4GLXA 4PDLA 2ZBKB 4DR2O 3T0ZA 1PNMA 3LSSA 4LF7B 4J9ZB 4B3RB 1TGOA 1NT2B 1VARA 4MOTA 4TV8B 1CXZB 5LBQA 2Q0AA 3E35A 2UUCO 4CWOA 3OEEG 3CCQV 5IJ9B 4HZ0A 1N33B 2V1DA 2RNBA 1EN5A 3HEKA 2YSUB 4UCTA 4I7ZB 4UCSA 2WI1A 1XMQO 5BODA 4KHPO 2F43G 1WP7A 5IWAB 5CBGA 3VHDA 3CPWU 4NTXA 3E22B 2IJHA 1HNXO 4LH7A 2YE9A 1EZVH 3WG7C 2Q73A 3W7XA 4LFBO 4O4IB 1IBKO 1KZNA 1PPJH 3DSQA 1FJGO 2N04A 2B1GA 5KHGA 3CCJV 3TK1A 3P3PA 3IJ4A 3FFQA 4JTCB 5KLVH 4HAMA 5DM6V 4DR4O 3KZIZ 1NU1H 2VWKA 1I5AA 1OCOC 3APOA 2FL4A 4UV9A 2ADQB 2LGQA 2E5LO 1H8EG 3ETGA 5GONA 2Q8IA 4F6EA 4ZI7B 1OHHG 4X66O 4FM1A 2DQ0A 1J5EO 4BR6A 1Q6IA 4EFUA 3AG1C 3ZRXA 3J81N 1VQ4V 5LYJA 4FMTA 4TV8A 4LF5O 2EILB 4ASUG 3LSUA 2Q7EA 2OWOA 4DW1A 3JAKA 5FNFA 2XNDG 4H85A 5CA1B 3CSXA 3FX7A 2YDEA 4MTFA 2XDLA 1HW7A 3VQXA 2ZR3A 1YJNV 3BMYA 1IXBA 3ZM7A 3BPZA 2V7QG 1Q3EA 2ETNA 2YE3A 3FB6C 3LPSA 1SF9A 2VQEO 5DN6G 3R91A 4EB6B 3A0ZA 4GZRB 2HLDG 5J2TA 4O4IA 3BVOA 4QNHB 4PL9A 4FPPA 1BXDA 4PJ0Z 1I5CA 5KAIZ 3RW0A 4XE2A 4JI3O 4JI0O 2EINC 3G7EA 3G6EV 1I5YA 2Q2EB 1X4TA 2ZDIA 1YDXA 4B08A 3OMIB 4CH6A 4EFEA 4PDVA 3O0IA 1B04A 3K5MA 2QFOA 1UY6A 1YT0A 2XAHA 3SPGA 4DUHA 4JV5O 3L9DA 4MVRA 4DR5O 1K7DA 2UUAB 2WI2A 1NJIW 2FB5A 2DJVA 4UB8Z 4F6RB 4XD8A 4JYAB 3R4PA 2DYRC 1NHJA 3E89A 1YF2A 4I4TB 3T0HA 4XDJA 5IYZA 3ZMSA 4J10A 4JGSA 5CA1A 1N4CA 4DO2A 1M90W 3TZ2A 1NI8A 3WB1A 2P7TC 2HR3A 2P22C 5EBWC 3L71H 3ZRVA 4LWGA 3PEJA 4P2ZA 1GAXA 4DV3O 5JH7A 1BHBA 1IDSA 4G28B 4DV7O 5ITZA 1JMKC 4CH5A 2ZCEA 5JVDB 4BWAA 1D5AA 3F5TA 4GT1A 1UYMA 1V55B 1XL6A 3BAAA 1B62A 1AI5A 1UJWB 1JVMA 3JSNA 4O07A 3JARA 3BY6A 3NXSA 3RYFB 3HYZA 3GIFA 4O04A 3JASB 1M4UA 1OJHA 3CJHB 1US6A 1UY9A 4YY3B 1VQPV 4QPKA 2XDKA 3DC5A 4LNUB 2XASA 3WHAA 3ZN1A 2A3QA 1SQQH 5FL7G 3TZ4A 4O4LA 2OCHA 5AG2A 3T1YB 2CGFA 2LJ2A 3TXSA 1O9GA 2YGAA 4L93A 3ABLC 3U67A 4YJ3B 4F6RA 1Y4MA 4RQFA 5EK0A 4I4TA 1YSRA 4NH8A 1IZ3A 2ZIMA 3HKCB 1FXHA 1FXVA 2AHZA 1I94O 3ASOB 1QQCA 1PD3A 2EIJC 3N27A 1YHQV 3EHHA 3CCRV 1R1BA 1XNQB
chains in the Genus database with same CATH topology
3ML0A 2W6JG 4UXNA 2EIMC 5LGTA 1R3JC 2HVJC 4UV8A 3KG2A 3OR6C 1Q81W 3M99B 3SPJA 3I56V 1Y66A 2X6BA 4WFHA 5L3EA 3EFFK 3FKSG 1OCCB 2CK3G 4BAYA 2HKOA 2WLLA 5B1AB 1GTOA 3ZRWA 3OR7C 1VQ9V 2NNUA 3H01A 1N8RW 3ZMUA 5E1AC 5IDJA 1XL4A 2QTOA 1KECA 4JYCA 3SYCA 3AG2B 4GX2A 3T4ZA 5EC1C 2JEXA 2C2AA 4R7CA 1GM8A 1AI4A 1PL0A 3W7SA 2Q67A 3CD6V 2H94A 1K4CC 3AG4C 4G27B 4HZ3A 3CCLV 1K33A 2XOKG 1JCHA 3AG1B 1AJNA 3OAAG 3IGAC 2MK3A 3LNMB 1S77D 4MVQA 3LDCA 4PA6A 3JYCA 3MHHC 3FB5C 4QE9A 2EIKC 3E8HA 4QE7A 3ZMVA 1YITV 4I5SA 5HFLA 4QPJA 2P67A 3AG3B 2Q68A 2P6JA 4TSFG 3CYOA 1W2BU 1RM1C 5BZBA 2K1EA 5CA3A 3CMAV 1YTFD 5H6QA 4JF3A 3T4DA 4I9WA 3ZJZA 1NH2D 4MTXA 4XDKA 1K3EA 1KP2A 3ABMB 4CBCA 3QO7A 2XAFA 4GX0A 4N21A 3ABUA 4BW5A 5IYBO 1S3JA 1AI6A 3JD0A 4LC1A 1G8MA 2WSSG 3OMNB 4E2LA 1CPYA 3K0GA 3K06A 2ZXWB 5B3SB 3OFNG 5LGUA 2WLLB 3LDDA 2EINB 3GWOA 4FJCC 3EHBB 1QLNA 1BMFG 3AEIA 2EILC 4TT3G 4UUJC 1JX9A 1R3IC 3ZRWB 4JYBA 5CBFA 1YTFB 3CCSV 4OXSA 2A9HA 3FB7C 1NH2B 5LHHA 5KA6A 3CCVV 5L3BA 2JEUA 5CBHA 3LDEA 1VQOV 2OTLV 1GO3F 1OCRC 3B8MA 3CC4V 1SRYA 1DTOA 1K8AW 1VQ5V 1SESA 1M56B 1Q82W 1VQ8V 3SYPA 5H9CA 2UXNA 4LCUC 2QA4V 4JAVA 4KFMA 3OGCC 2HFEC 3G4SV 3K08A 5L3GA 2GSMB 1ENVA 1W0JG 2WWWA 2JIZG 2EBOA 1OCZC 1YJWV 2DYRB 5B1BB 3W7TA 1K73W 2D3OW 3A0RA 1NVPD 1RM1B 1F51A 1PNLA 2WLNA 2A0LA 2B5UA 1CP9A 3ZMZA 2R9RB 5B1NA 3SPCA 3E86A 3CP1A 5EBMC 3X2QC 3R65A 1KKDA 1BHAA 2WLIB 3K03A 3OEHG 3ASNC 1DF4A 1KQSU 3SYQA 4X8AA 2QKSA 1P7BA 4KP4A 3CXCU 1Q7YW 4H33A 1QR9A 5J9PC 2JJ2G 4QIWF 2IH3C 1SETA 1NVPB 3CMEV 2QEXV 2ZR2A 2QM7A 4J9YB 4MVSA 2X6CA 2OCCC 4MVOA 1R3LC 1M57C 1E79G 3OM3B 3I55V 2WLJA 1I5XA 3ZMTA 4MTGA 1R73A 1OCRB 2AHYA 3IC7A 1P4RA 4ZBMA 3VBBA 4GX5A 4R50A 2ZD9A 1MSWD 4RQEA 3RVZA 2DYSC 1AR1B 2BOCC 2JDIG 4Z1MG 1PNKA 1JOYA 5EBLC 5IYCO 3F7YC 1HWYA 1DF5A 1S76D 4BIZA 1COWG 1LNQA 1AJQA 4LP8A 5CN0A 3E2EA 1QLEC 4MVMA 4GX1A 5L3CA 1L1FA 3IFXA 4FIPC 2WAMA 1KD1W 1MABG 1V54C 3F5WC 2P90A 2GHYA 3ABLB 2A79B 1QBZA 2W6IG 3STZC 2FTKA 1S5HC 2BOBC 3TETA 2WLMA 2DQ3A 3E8FA 5LHGA 4JTDB 4WF9V 2HVKC 3OE7G 3PJSK 1H2GA 3ETDA 1Q86W 2IW5A 3D3IA 4F4LA 2WLHA 3UKMA 2EIJB 3GB7C 4RAIA 2NLJC 1JJ2U 1ROPA 4N23A 4PELA 4UVCA 2WLIA 3JD1A 4P9PA 1K9MW 3ZCCA 5KUMA 2EIMB 1KP3A 4PDLA 4WFEA 2ZDIC 3RVYA 2Z5UA 1PNMA 4PA4A 2QE7G 3LSSA 3SPIA 4J9ZB 2Y48A 1VQMV 3JD3A 1EZJA 2YEVB 1F4NA 1NQTA 5LBQA 3G71V 3TCUA 1SZTA 2R9IA 3E35A 3OEEG 3RBZA 3CCQV 2QM8A 5CMUA 1RPOA 4PA9A 2V1DA 1FFTB 4PA3A 2YSUB 3AG4B 1DLBA 1K5QA 2ITDC 4TWKA 1K5SA 2F43G 5CBGA 1V54B 1VQLV 3CPWU 2PI4A 2PI5A 2X6AA 2IJHA 2EZOA 3K3WA 1EBOA 3CCMV 1GM9A 3VOUA 3WG7C 3W7XA 1QVGU 4FK5C 4HYOA 2EIKB 2EJRA 4PDMA 1RPRA 1OCCC 3K0DA 2B1GA 5L3DA 3CCJV 1F23A 3D36A 3TK1A 5B1AC 4Q20A 4EKWA 4JTCB 1NKDA 3SYAA 2IJJA 1NR7A 4MVZA 4X88A 3CC7V 4P30A 4HAMA 5DM6V 1H38A 3AG2C 4WFBV 1VQ7V 2ATKC 3JD4A 1B6QA 1OCOC 1R6NA 3QO5A 2HG5C 4UV9A 3OMAB 1MOFA 1H8EG 4JPRA 3ETGA 2LFRA 4L87A 3CCUV 1AJPA 4RO2A 1OHHG 3DTUB 2DQ0A 3F7VC 4JAUA 2H8PC 5LHIA 1GK9A 3AG1C 1WLEA 2YEVA 3ZRXA 2X7RB 4U7OA 1VQ4V 4FMTA 3ZN0A 2LP7A 2EILB 4JASA 1TUEB 3P32A 4ASUG 1BL8A 4QJFB 3E8GA 4CZZA 1FXKC 1JPXA 3HPLC 1FS0G 1M1KW 4BIUA 5KA5A 2XNDG 3MD0A 4YXWG 3P30A 3AG3C 4P9OA 1YI2V 5EC2C 1J95A 3MHSC 1KC8W 5IY5C 4MTFA 3LSQA 2LFSA 2ZR3A 3ABTA 4MW8A 1YJNV 2XAQA 3LUTB 4H37A 2V7QG 1NR1A 2X0LA 3E83A 3FB6C 1YJ9V 3WG7B 3OUSA 1E1RG 5DN6G 4WFGA 5IYDO 3ABMC 2IU3A 1AI7A 1OCZB 3HB3B 5GW7A 4WFFA 1VQKV 3ETEA 2HLDG 4QNHB 3STLC 4JTAB 4FPPA 5B1OA 2ZXWC 3T2MA 5B3SC 1K4DC 1V55C 1WPXA 1NBMG 3RW0A 3B77A 2EINC 1GKFA 1MG1A 2ZQMA 3G6EV 4MW3A 1I5YA 4MVUA 3UM7A 3X2QB 2IJKA 1OCOB 4WCEV 2DWDC 1W0KG 3ASNB 2ZDIA 4UVAA 3ABKC 3OMIB 3JD2A 2UXXA 4PDVA 2OT5A 1YIJV 1K34A 4MS2A 1M56C 4KUMA 3ZRSA 3OUFA 2XAHA 3SPGA 1AROP 1GMGA 4MVRA 3FYIB 3K9AA 3K79A 1THZA 2XAGA 3OW2U 1K7DA 1VQ6V 2OCCB 1G4YB 1NJIW 1FXKB 1H8HG 1M57B 4R6ZA 2B1IA 3QNEA 5H6RA 3FB8C 4XBFA 1IXMA 2DWEC 2DYRC 3FYEB 3E89A 2Q69A 4XDLA 1OZ0A 5B1BC 3SPHA 4DXWA 5IY5B 5KUKA 2ITCC 4XDJA 2DYSB 2EZPA 2Y69C 3ZMSA 2JK5C 5LGNA 1SERA 3ZIAG 1F4MA 4JGSA 4DO2A 1M90W 1VQNV 5L3FA 1GM7A 3K04A 3QO8A 2P7TC 1QLEB 2WPDG 2HR3A 1K92A 2IJIA 5EBWC 3ZRVA 3ASOC 4LBEC 1K97A 2WLKA 4P2ZA 5C93A 3CCEV 3WFVA 1BHBA 4RUEA 2Q6AA 2HJFC 4G28B 3T1CA 2DW4A 2M7WA 1QCEA 4GT1A 1V55B 1XL6A 2JJ1G 2W0FC 4PDRA 3E8BA 1AI5A 1UJWB 1JVMA 3BY6A 4X89A 3BEHA 3ABKB 3NXSA 2XAJA 2OTJV 4MT8A 1EFRG 4UVBA 1E1QG 3SYOA 3W7UA 1VQPV 4QPKA 4RUFA 2Z3YA 2XASA 3ZN1A 1S0VA 4ZKIA 5HFMA 4PA7A 1PKXA 3JCZA 5FL7G 4MTOA 1R3KC 3DGEA 3W7WA 3SJQC 1FXKA 4U7NA 3ABLC 2IU0A 2Y69B 4WFAV 1JQ0A 4GCZA 1CEZA 1Y4MA 4MSWC 2IH1C 4RQFA 5EK0A 4G2KA 1S72V 1FXHA 1ZWIC 1FXVA 4R8CA 2AHZA 1QVFU 1M9NA 3ASOB 1YSCA 1R6KA 1PD3A 2EIJC 2KB1A 1ORQC 1YHQV 3CC2V 1QR8A 3CCRV 3B8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2A A;  4BIZ A;  2WWW A;  3DGE A;  2QM8 A;  3ZRW B;  4JAU A;  4JYB A;  4U7N A;  3TK1 A;  3D36 A;  3ZCC A;  3ZRX A;  3NXS A;  4Q20 A;  4U7O A;  4FMT A;  2QM7 A;  3A0R A;  4GCZ A;  4JAS A;  1F51 A;  3P32 A;  4MTX A;  4MT8 A;  3ZRV A;  5C93 A;  3ZRW A;  5B1N A;  2FTK A;  4BIU A;  1IXM A;  4FPP A;  5B1O A;  3MD0 A;  5IDJ A;  4QPK A;  4LC1 A;  4I5S A;  4JAV A;  4JYC A;  4ZKI A;  1JOY A;  4GT1 A;  2LFS A;  2LFR A;  4KP4 A;  4QPJ A;  2P67 A; 
#chains in the Genus database with same CATH topology
 2W6J G;  4LWS B;  2KG7 A;  3KCY A;  5LGT A;  1R3J C;  4H44 B;  1PM9 A;  2BTQ B;  2XAB A;  3FKS G;  2HKO A;  2CCU A;  2WLL A;  1GTO A;  1AB3 A;  1S14 A;  3JAL A;  2CTW A;  1NTZ H;  5E1A C;  3Q4H A;  5H2F Z;  3RYF A;  1XMO O;  1ZL8 B;  3CXH F;  4XKO A;  2JEX A;  1I59 A;  2E75 B;  3ZHQ A;  1EA6 A;  5FLX N;  4U3J B;  3HKE A;  1PL0 A;  3W7S A;  3CJH A;  2Q67 A;  2CTQ A;  1Q5O A;  2WEP A;  2VCI A;  4J41 A;  1YC4 A;  2EUL A;  1GN3 A;  2BTO A;  1Z2G A;  2RMK B;  1Y6X A;  3LDC A;  5CTU A;  4J80 A;  2Q8V A;  3ZMV A;  3E8H A;  1YIT V;  2YI0 A;  4UCO A;  5HFL A;  2P67 A;  3AG3 B;  3BAB A;  2P6J A;  4TSF G;  2FWY A;  4QGP A;  2O57 A;  2E76 B;  3CMA V;  3ICX A;  4WBN B;  3T4D A;  4I9W A;  3ZJZ A;  4V25 A;  4MTX A;  4XDK A;  4LF9 B;  2CTP A;  4PI2 A;  1GN6 A;  1K3E A;  4LWS A;  4OPH A;  4GX0 A;  3ABU A;  4X62 B;  5IYB O;  5D6Q A;  4NXN O;  1UYK A;  4LC1 A;  1G8M A;  3OMN B;  4X65 B;  2GUZ B;  1YT1 A;  4E2L A;  1FFX B;  2QKC A;  1T5E A;  3QF7 A;  4YKR A;  2ZIO A;  5LGU A;  4K0K B;  3B24 A;  1XRE A;  3UO2 A;  2EIL C;  4TT3 G;  3A0W A;  4OXS A;  3B2E E;  3VHC A;  3CCV V;  5KA6 A;  3AG7 A;  5L3B A;  1VQO V;  1H2L A;  1P84 F;  3CX5 F;  4B7E A;  4KSH A;  5M4M A;  3B8M A;  1N32 O;  1SRY A;  5M4H A;  2XJX A;  1VQ5 V;  2IWX A;  1Q82 W;  1NS1 A;  1Y8O A;  2C1I A;  3CWV A;  2UXN A;  4I3H A;  5DED A;  1IBM O;  1ZUQ A;  1WAZ A;  2QM4 A;  1KIJ A;  1YES A;  1HR0 B;  3G4S V;  3BA9 A;  3K08 A;  2GSM B;  2YEB A;  4ABM A;  4XKA A;  2EBO A;  5KMG A;  3ZXQ A;  2YK2 A;  4FZ1 A;  2D3O W;  4O0B A;  2PZS A;  3IAY A;  1PNL A;  2A0L A;  2ADP A;  5B1N A;  3E86 A;  1KKD A;  5FND A;  1BQZ A;  2WLI B;  4O2B B;  2H3O A;  3G75 A;  4WBN A;  1P7B A;  2WA4 A;  1Q7Y W;  4H33 A;  4XTJ A;  4ZOL B;  1SET A;  4JI1 O;  2ZR2 A;  1BT8 A;  2QM7 A;  2Q8G A;  1Q90 D;  4J9Y B;  4CH3 A;  4MVO A;  1NHH A;  2XDX A;  2GBO A;  1E79 G;  2YC0 A;  2YE7 A;  1P49 A;  3ZMT A;  2AHY A;  1N0J A;  2BSM A;  2ZD9 A;  3GWK C;  1MSW D;  4RQE A;  2YI6 A;  1PNK A;  4B7P A;  2QWP B;  4BIZ A;  2UXC B;  3M7M X;  1AJQ A;  4LP8 A;  5LXT A;  3E2E A;  3JAM N;  5FPR A;  1L1F A;  2IWU A;  5D5P A;  2YE2 A;  1MAB G;  1V54 C;  1THN A;  4JI2 B;  2YKC A;  2FTK A;  1S5H C;  3TUH A;  1TH8 A;  3LNU A;  4E00 A;  1OV9 A;  3R66 A;  1URF A;  2QJ1 A;  1PP9 H;  4KL1 A;  3G67 A;  4FCR A;  2NLJ C;  4B3M B;  4AWQ A;  3EKO A;  1JJ2 U;  4N23 A;  4UVC A;  4XC0 A;  2WLI A;  4O2B A;  3JD1 A;  1K9M W;  3ZCC A;  1ZSP A;  2Q8F A;  5J2U B;  2C1G A;  4XDM A;  4BW9 A;  3EXA A;  2YKE A;  4CS3 A;  3A0B Z;  1MNG A;  3SPI A;  2YGF A;  3K99 A;  2Q8H A;  2YEV B;  4FM2 A;  3SGI A;  2F23 A;  1H2K A;  4DR7 O;  3DXR A;  1BSM A;  1TA8 A;  3G71 V;  2HP8 A;  2XCM A;  5KX5 B;  4IIJ A;  2BTZ A;  2QM8 A;  1RPO A;  4PA9 A;  3IED A;  3AG4 B;  4MP7 A;  3K5L A;  1DLB A;  2ITD C;  3G7B A;  1K5S A;  2WER A;  4EGH A;  4L91 A;  4KQV A;  1VQL V;  3HYY A;  2ZE6 A;  4DV4 O;  4LF6 O;  1WA8 A;  3CCM V;  1IBL B;  1GM9 A;  3VOU A;  4HYO A;  3ZX6 A;  5K1X A;  2EIK B;  4PDM A;  1KU9 A;  5EZY A;  2P06 A;  2CUG A;  4FLT A;  1Q6H A;  5L3D A;  1UYI A;  3M8A A;  5M4E A;  2IJJ A;  1NR7 A;  4LF8 O;  1AR4 A;  3CC7 V;  4X88 A;  4P30 A;  4JI7 B;  5LP6 B;  2BE3 A;  1HNZ O;  3BFR A;  3JD4 A;  5M4N A;  3HKB A;  4ZIB A;  4JPR A;  4DV6 B;  2Q4P A;  4L87 A;  2IOP A;  4R3A A;  4JAU A;  2PGG A;  1AP6 A;  1WLE A;  3B27 A;  2O1W A;  4CE1 A;  2YEV A;  2VQF O;  1TUE B;  4IT5 A;  4FVM A;  4O4H A;  4BQJ A;  1HNW B;  4LFC B;  3BHP A;  4B3S B;  2M6Y A;  2GDS A;  3AG3 C;  1J95 A;  3MHS C;  2ZNI A;  4GKK O;  1H7U A;  3MNR P;  1AVM A;  3LSQ A;  3ABT A;  4MW8 A;  5D7R A;  3LUT B;  5LMU B;  3C90 A;  2VWC A;  4J7J A;  4B7K A;  2QR4 A;  2BYH A;  2E74 B;  1AI7 A;  5GW7 A;  1XUQ A;  4WFF A;  1VQK V;  5CA0 A;  3PN1 A;  4J7K A;  4H7Q A;  1XNR B;  4JTA B;  5B1O A;  1SZX A;  3S3W A;  5CTY A;  4CE3 A;  5M4K A;  3THO A;  1WPX A;  4LP0 A;  4FLV A;  4GKJ O;  1MG1 A;  4MW3 A;  5J71 A;  3MDS A;  4MVU A;  3X2Q B;  4I55 A;  3U11 A;  4W4K A;  1L0N H;  1W0K G;  4X9Q A;  1I7F A;  2DMX A;  3ABK C;  4AI8 A;  4CS4 A;  4DYL A;  5LP6 A;  1YIJ V;  4EGI A;  4MS2 A;  2WI5 A;  3ZRS A;  2PTM A;  3RLR A;  1ARO P;  1GMG A;  3G80 A;  3K79 A;  1THZ A;  2HHH O;  3H1H H;  5GON B;  1BGY H;  1AIL A;  2XAG A;  3RN4 A;  5LOV A;  1M5I A;  2XJJ A;  1FXK B;  1RP3 B;  1H8H G;  2ARH A;  2B1I A;  2QG0 A;  5LYJ B;  2XHR A;  2Q69 A;  1OZ0 A;  3SPH A;  2LW1 A;  5IY5 B;  2PF4 E;  5LA6 A;  2DYS B;  3VQY A;  4J42 A;  2Y69 C;  3VAD A;  4BAE A;  2JK5 C;  3JAK B;  3GIG B;  1SER A;  1F4M A;  1V9P A;  3T1H B;  2GV9 A;  4YKX A;  2ODM A;  4EEQ A;  3QO8 A;  4R1F A;  2XX2 A;  2WPD G;  2HJD A;  2UUB O;  3CCE V;  1K97 A;  4AWO A;  4B3T B;  3RYH B;  1KKC A;  4RUE A;  4DK0 A;  4CWS A;  1QCE A;  4JZG A;  3J80 N;  2W0F C;  2YE8 A;  1A32 A;  4GQT A;  3RGB A;  3E8B A;  4JZ2 A;  5J2T B;  2WA3 A;  1L0L H;  2QWN B;  2YUA A;  4X89 A;  4GT8 A;  4NH9 A;  4DV2 B;  3CRQ A;  1VF7 A;  1EFR G;  4UVB A;  1E1Q G;  3JAT A;  3SYO A;  1U2O A;  4KXR A;  1D5N A;  1KBH A;  2UXD O;  2F66 C;  3BM9 A;  2YEJ A;  2Z3Y A;  4JI6 B;  4E72 A;  1PKX A;  3FAV A;  1ZTE A;  5DEC A;  4MTO A;  2AKP A;  1WB8 A;  2JJC A;  5LMN B;  1UY8 A;  1FXK A;  2YKB A;  4GCZ A;  1XOU A;  2YEI A;  1AR5 A;  2IH1 C;  4DR2 B;  3HR0 A;  3RYC A;  4D7T A;  4G2K A;  1S72 V;  3A8T A;  3OWD A;  5IYZ B;  3GIG A;  3PEH A;  4O2A A;  4AQY O;  4X64 O;  3CS5 A;  4LFA O;  2IWS A;  2RQ6 A;  5FNV B;  3CC2 V;  1QR8 A;  2BRC A;  3B8N A;  4HZ5 A;  3RYH A;  2UUC B;  3RYI B;  2HVJ C;  3KG2 A;  5KHK A;  5JH7 B;  5ITZ B;  2HG1 A;  4X1K A;  2CK3 G;  2FYU H;  1NHI A;  3OWB A;  2EJ7 A;  5B1A B;  1AMW A;  1XMQ B;  3ZRW A;  4KHP B;  4XIQ A;  2Y0P A;  1BE3 H;  5IDJ A;  1XL4 A;  2BCC H;  2E0A A;  2BU8 A;  4ASF A;  3JAR B;  2JRI A;  4JYC A;  3SYC A;  1HNX B;  1SKV A;  3AG2 B;  1BKN A;  3JAW A;  4DR6 O;  1DGS A;  2YI9 A;  3VQW A;  4LFB B;  1IBK B;  4W7T A;  1FJG B;  2H94 A;  3AG4 C;  4UCV A;  3GVM A;  3L72 H;  1VF6 C;  1EN4 A;  4G27 B;  1GJV A;  3CCL V;  4DV1 O;  1F7Y A;  5GGZ A;  3WB0 A;  4LWF A;  2WI6 A;  4K4O A;  4DW0 A;  1AJN A;  4O05 A;  4X1I A;  2MK3 A;  4O4L B;  3OMU A;  4PHZ A;  4DR4 B;  3K59 A;  4QE9 A;  3FB5 C;  2EIK C;  1MA1 A;  4QE7 A;  2YE5 A;  2E5L B;  5F2V O;  4QPJ A;  5JQG A;  2XHT A;  4X20 B;  3OPD A;  4X66 B;  1J5E B;  5CA3 A;  1Y4U A;  5BR8 O;  1YTF D;  2H8M A;  3T2S A;  5FNV A;  2O1U A;  2ZDX A;  4LF5 B;  1KMI Z;  1KP2 A;  2KG7 B;  3QO7 A;  3RYI A;  2KKW A;  5A9G A;  2AZ0 A;  3JD0 A;  2WSS G;  3EVK A;  1CPY A;  3K0G A;  3K06 A;  2ZXW B;  4CH4 A;  2ZM6 O;  4UB6 Z;  4YHH O;  2WLL B;  3LDD A;  3CE2 A;  4FJC C;  3EHB B;  1BMF G;  3AEI A;  4UUJ C;  3JAL B;  1R3I C;  5CBF A;  1YTF B;  2A9H A;  1O9H A;  4ZHQ A;  3Q4H B;  2VQE B;  3RLP A;  5B66 Z;  2AZ2 A;  1TAE A;  3AK1 A;  1ZAU A;  2BZ5 A;  1SES A;  3HKE B;  2FXS A;  3CGY A;  4X9L A;  4XKK A;  5F5R A;  2Q0O C;  1Y8N A;  1S16 A;  4JAV A;  4KFM A;  3OGC C;  4JI3 B;  4JI0 B;  4V26 A;  2UU9 B;  5L3G A;  5JJJ B;  2JIZ G;  1WN7 A;  1YJW V;  3CHX A;  5B1B B;  4Z1V A;  1TIL A;  3QDD A;  4YKZ A;  3A0R A;  1RM1 B;  2ZE8 A;  1UYH A;  1RSO A;  2B5U A;  1CP9 A;  1UPG A;  4L8J A;  4JV5 B;  3INX A;  2R9R B;  4DR5 B;  4X20 A;  3CP1 A;  3X2Q C;  3R65 A;  4YIO A;  2WI3 A;  3OEH G;  3LNN A;  2R70 A;  4DV5 O;  1YEW A;  2PUS A;  3CRA A;  5JWP A;  4X8A A;  2YKJ A;  2JKI A;  2QKA A;  1R6T A;  3HZ1 A;  5J9P C;  2JJ2 G;  3SR2 C;  4C7U A;  1Y8P A;  3QTF A;  1U97 A;  3CME V;  4DR1 O;  2QEX V;  4DUZ O;  4TQF A;  4ZVI A;  4GEE A;  3OTF A;  1R3L C;  2NR5 A;  5JCO A;  1R73 A;  2P4K A;  4DV3 B;  1OCR B;  3IC7 A;  1P4R A;  4DZY A;  4DV7 B;  1I0H A;  2DYS C;  1AR1 B;  4DV0 O;  1I08 A;  5EBL C;  2PYL A;  4WUD A;  2KQX A;  4URO A;  1HWY A;  1DF5 A;  2XD6 A;  2Z0A A;  4MB9 A;  5FPO A;  1Z5W A;  1VEW A;  2L6L A;  4MVM A;  4GX1 A;  3FT8 A;  2AGA A;  3ZHR A;  3FD9 A;  1Q6U A;  3IFX A;  2XHX A;  1H2N A;  5BMV A;  4JI5 O;  2CDY A;  2V4D A;  2P90 A;  3G6B A;  2A79 B;  1QBZ A;  3STZ C;  3TET A;  2BOB C;  4DR3 B;  2DQ3 A;  1YVW A;  5KMG B;  3E8F A;  1HR0 O;  3Q5J A;  2EX3 A;  3PJS K;  1H2G A;  4TUY B;  2YE6 A;  3FT5 A;  1I5B A;  3D3I A;  2Q9L A;  4RAI A;  3UT5 A;  1YC3 A;  1ROP A;  4PEL A;  4YKQ A;  5FWK A;  2OIG A;  5KUM A;  2QF6 A;  1KP3 A;  4WFE A;  2ZDI C;  4PI0 A;  2Z5U A;  2WEQ A;  2XUM A;  3P3N A;  1BYQ A;  3WU2 Z;  1YET A;  3HKD B;  4ASA A;  2Y48 A;  1VQM V;  1I94 B;  5BXZ A;  4E02 A;  1EZJ A;  4NKG B;  2FML A;  2DN9 A;  4TOI A;  3TCU A;  2R9I A;  3RBZ A;  5CMU A;  2XK2 A;  4FLU A;  1HP8 A;  4K35 A;  2GTA A;  5IT9 N;  3VQV A;  4PA3 A;  3ZS8 C;  5B5E Z;  1ZXN A;  1VP7 A;  3ZHT A;  4FLW A;  2YGE A;  1B06 A;  1EN6 A;  1K5Q A;  4XIT A;  4TWK A;  3B25 A;  3U2K A;  1XIL A;  1BS3 A;  2AW9 A;  2B9Z A;  5LXT B;  4CS2 A;  2X6A A;  3CRM A;  4YJ2 B;  2F95 B;  1XMO B;  2JGD A;  1G1X B;  2YID A;  4FK5 C;  2EJR A;  2MW2 B;  1RPR A;  1AM1 A;  4FCP A;  1SS3 A;  1GRJ A;  3D36 A;  5B1A C;  4Q20 A;  1BCC H;  4TV9 A;  4TUY A;  4EKW A;  2IOR A;  3SYA A;  2Q7G A;  4U3F H;  4MVZ A;  1Y76 A;  3UO3 A;  4IYI A;  1H38 A;  3AG2 C;  2ATK C;  1B6Q A;  3K5O A;  2LGW A;  1R6N A;  2HG5 C;  2QGN A;  1MOF A;  3OMA B;  1Q43 A;  2YJX A;  3CCU V;  3J7A U;  4RO2 A;  3HKD A;  3SJB C;  3MAQ A;  3JCU Z;  5LHI A;  2BU5 A;  1EM1 A;  4U7O A;  4CWR A;  4JAS A;  3P32 A;  3DXR B;  4QJF B;  3A0T A;  1JPX A;  4IIJ B;  1U96 A;  3HPL C;  4PV1 B;  4BIU A;  4UFZ A;  3Q5L A;  1QYE A;  4YXW G;  2YI5 A;  3P30 A;  4P9O A;  2ZIN A;  5EC2 C;  1YI2 V;  4I50 A;  2LFS A;  2YXL A;  1XDC A;  4H37 A;  1GKZ A;  3DC6 A;  1I5D A;  4PU9 A;  1NR1 A;  1SQB H;  2Q5Z A;  1YZB A;  2FKX A;  3WG7 B;  3OUS A;  1US7 A;  1Y4S A;  4YJ2 A;  5IYD O;  2YXY A;  1WA8 B;  1OCZ B;  3HB3 B;  2CG9 A;  4MBC A;  3ETE A;  3K57 A;  1WB7 A;  1N32 B;  3OGI B;  3STL C;  5K1P A;  3T2M A;  2ZXW C;  2CH7 B;  5EZY B;  1V55 C;  3B77 A;  2ILM A;  1N36 O;  2ZQM A;  1IBM B;  3O6O A;  1OCO B;  4WCE V;  4AWP A;  5IN9 A;  1B63 A;  3A0X A;  3ASN B;  2VCJ A;  4UVA A;  4HXZ A;  4JI8 O;  1YT2 A;  4EM7 A;  1UYE A;  2F4V O;  1LR1 A;  3TZ5 A;  4KUM A;  4FLX A;  4A5U B;  3HKB B;  2WI4 A;  2VRZ A;  3FYI B;  3K9A A;  5IDM A;  4GFN A;  2YED A;  1VQ6 V;  4LH6 A;  4NH7 A;  5D7C A;  2OCC B;  1TUB B;  2QSA A;  1XI1 A;  1M57 B;  3ZKB A;  4URN A;  4R6Z A;  3QNE A;  3FB8 C;  4XBF A;  1IXM A;  5B1B C;  4XDL A;  4DXW A;  1VQ7 V;  2Y4T A;  1Z5C A;  5EYP A;  2ITC C;  2EZP A;  4O4H B;  3ZIA G;  3ZHV A;  1VQN V;  5L3F A;  3K98 A;  4JI1 B;  4D7S A;  1GM7 A;  3K04 A;  2HHI A;  2LO1 A;  1QLE B;  3O65 A;  3ASO C;  4LBE C;  3CB2 A;  5C93 A;  3WFV A;  2ZE7 A;  2Q6A A;  2HJF C;  1N34 O;  3T1C A;  2M7W A;  3B09 A;  5GTI Z;  2R9A A;  4LF4 O;  2LQT A;  3A0Y A;  3FV5 A;  5CA0 B;  3APQ A;  2CH7 A;  2LW7 A;  4OX9 O;  4E4E A;  5GTH Z;  2RJZ A;  4FFB B;  2OTJ V;  4MT8 A;  3QVN A;  1L8D A;  3OT7 A;  4I55 B;  4URM A;  2A06 H;  5J6A A;  4YKU A;  3ZHS A;  3INW A;  2L35 A;  4LWH A;  1FAF A;  2YIB A;  4DUY O;  2XHB A;  1I58 A;  5HFM A;  2JS5 A;  4PA7 A;  4H81 A;  2F93 B;  4EGK A;  2G38 A;  3SL2 A;  1R3K C;  3DGE A;  2N74 A;  3L74 H;  3WB2 A;  5LOV B;  3SJQ C;  3OTO O;  1TUB A;  3ZKD A;  1BZK A;  3A0H Z;  2IU0 A;  1WJZ A;  1CEZ A;  4LF7 O;  4WUB A;  4JI4 B;  4B3R O;  4R3M A;  1ZWI C;  5LA6 B;  5D6P A;  4WUC A;  1QVF U;  1M9N A;  5EIB D;  2IBZ H;  3LMM A;  4DK1 A;  2KB1 A;  1ORQ C;  4DR7 B;  5H5N A;  3BCC H;  1N33 O;  2YEG A;  3OR6 C;  1Q81 W;  2GTS A;  4Z2W A;  3K97 A;  1RFY A;  3SPJ A;  2GFD A;  1NTM H;  2X6B A;  1UYC A;  1UYD A;  1OCC B;  5IWA O;  4IGG A;  1MZF A;  1YC1 A;  2NNU A;  1GN4 A;  4NTW A;  4DV4 B;  2QTO A;  4L90 A;  2E3C A;  4LF6 B;  2FYP A;  4FFB A;  4GX2 A;  2BT0 A;  4X1Y A;  4R7C A;  1GM8 A;  3JAT B;  1K4C C;  2CGN A;  1M93 A;  4XIR A;  4HZ3 A;  3N2G A;  5A2Q N;  1K33 A;  3T10 A;  4ASB A;  1JCH A;  3FAV B;  3OAA G;  4LF8 B;  3IGA C;  3LNM B;  3RLQ A;  1HNZ B;  3N2K A;  2UXB B;  3MHH C;  4HNA B;  4D6T H;  1AP5 A;  2F1M A;  5LMN O;  2Q68 A;  2ZNJ A;  4IYH A;  3RYC B;  2PNR A;  2D2C B;  3KE6 A;  3CYO A;  4IHJ A;  1W2B U;  3I5D A;  2K1E A;  4O2A B;  5H6Q A;  4JF3 A;  1VF5 B;  2VQF B;  1NH2 D;  3Q5K A;  1G6U A;  4P7A A;  4OPA A;  3ABM B;  2XAF A;  3KKY A;  1MMM A;  1H2M A;  3RWR D;  1AI6 A;  2A7W A;  4GKK B;  4UCR A;  3AK3 A;  4X1K B;  5B3S B;  2ZKJ A;  4CWP A;  4EMV A;  1ZWH A;  3GWO A;  1MSD A;  2QWO B;  4NXM B;  4AS9 A;  3ZRW B;  2QDO A;  4U93 A;  1JX9 A;  4JYB A;  3SJA C;  4YKW A;  3FB7 C;  1NH2 B;  3ZHU A;  3CEI A;  4J11 A;  2JEU A;  3RT3 C;  5CBH A;  4EFT A;  1SQV H;  1JFF A;  3JAW B;  1K8A W;  1DTO A;  2K9P A;  1M56 B;  1VQ8 V;  1Y74 A;  5H9C A;  4LCU C;  3H1L H;  2CCS A;  2BYI A;  2ZT9 B;  4XCL A;  4GKJ B;  4ICG A;  2YE4 A;  2YEE A;  2YK9 A;  1ENV A;  1W0J G;  1YSZ A;  4X1I B;  1QNM A;  1OCZ C;  2HKJ A;  3W7T A;  4EFB A;  1KB9 F;  4HNA A;  2CTR A;  1NVP D;  5CB4 A;  2WLN A;  3IC9 A;  2UUA O;  1H7S A;  1MU5 A;  3SPC A;  5JQG B;  2HHH B;  4I0X B;  2CH4 A;  3L73 H;  3ETQ A;  3K03 A;  1SA0 B;  1QZR A;  3ASN C;  1DF4 A;  4JYA O;  3B4S A;  1H2S B;  3CRR A;  4MPE A;  1KQS U;  3SYQ A;  4B6C A;  1SQF A;  3U2D A;  3CXC U;  3CWB H;  2YS8 A;  4QIW F;  2IH3 C;  1NVP B;  4O4J B;  2OCC C;  1M57 C;  3OM3 B;  3I55 V;  5IJ9 A;  1I5X A;  2HEP A;  2UUB B;  2ZE5 A;  3VBB A;  2BU2 A;  1XBL A;  3RVZ A;  4ZHQ B;  3KCX A;  5D5Q A;  4Z1M G;  1YXB A;  3O9O A;  1JOY A;  1TC6 A;  5CN0 A;  1QLE C;  3E22 A;  5KHI A;  1VMG A;  4FIP C;  4NTY A;  4LWI A;  1KD1 W;  3F5W C;  4LWE A;  4H13 B;  2GHY A;  2W6I G;  3ZED A;  4YY3 O;  2VS0 A;  2WLM A;  3A2F A;  2XJG A;  4RWU A;  3JZ3 A;  1PL4 A;  5LHG A;  2UXD B;  4WF9 V;  2HVK C;  2UU9 O;  3ETD A;  2IW5 A;  3CGZ A;  1RSO B;  3T1Y O;  2WLH A;  3UKM A;  3GB7 C;  5KAF Z;  2O1V A;  4HYP A;  4I0X A;  1SA0 A;  4P9P A;  2YI8 A;  2BSK B;  2EIM B;  3B28 A;  3RVY A;  3OW6 A;  5LP6 C;  4PA4 A;  5KHH A;  2CAZ C;  2QE7 G;  4ZI7 A;  3H1K H;  1QY8 A;  1ZXM A;  3O2F A;  3JD3 A;  2Y0I A;  4O4J A;  4L8Z A;  2YXH A;  1F4N A;  4X64 B;  1NQT A;  4AQY B;  1FKA O;  4LFA B;  1ID0 A;  1XNQ O;  1SZT A;  1SQX H;  3D0B A;  4NB5 A;  5JJE B;  3RFR A;  4K8X A;  4CWN A;  1FFT B;  3C0E A;  1AH8 A;  3C11 A;  3H1I H;  1BGQ A;  1V54 B;  2CCT A;  4KTN A;  2PI4 A;  2XTA A;  2PI5 A;  2JS3 A;  2Q7H A;  3OD4 A;  4EB6 A;  1ZLZ A;  1PV0 A;  2EZO A;  3H9V A;  3K3W A;  1EBO A;  4BXI A;  5BMV B;  1QVG U;  4DR6 B;  1JM6 A;  1OCC C;  3K0D A;  2YEA A;  4I9Q A;  2ZDY A;  1F23 A;  2P4V A;  4CE2 A;  5EIB C;  1SC5 B;  1NKD A;  4DV1 B;  4DR3 O;  2HCH A;  4PD4 F;  3TGU H;  3UT5 B;  2CGO A;  3H80 A;  4WFB V;  5IE9 A;  3H4L A;  3QO5 A;  2PYJ A;  2BSK A;  1W59 A;  3T1K A;  2LFR A;  1AJP A;  1R62 A;  4GUN A;  3DTU B;  3F7V C;  1XEQ A;  2H8P C;  2VWJ A;  1GK9 A;  5JEN A;  3BRC A;  2JGU A;  3TJT A;  1OSF A;  2X7R B;  1TVK B;  2YI7 A;  3ZN0 A;  4LF9 O;  1IUR A;  2LP7 A;  5BR8 B;  1BL8 A;  3E8G A;  4CZZ A;  1FXK C;  1FS0 G;  4X62 O;  1M1K W;  5KA5 A;  1IVS A;  3MD0 A;  4HY6 A;  4X65 O;  1Z5B A;  1XHZ A;  1KC8 W;  5IY5 C;  2QWR B;  1LUW A;  4K0K O;  2XAQ A;  1DK1 A;  2ZM6 B;  4YHH B;  2YJW A;  2X0L A;  3E83 A;  1YJ9 V;  2YEH A;  1E1R G;  5TIS Z;  5JVD A;  1FD9 A;  4WFG A;  5KHJ A;  3ABM C;  2IU3 A;  3EHG A;  3C3T A;  3R4N A;  1U0Z A;  3EHJ A;  2JGD B;  2JVD A;  3K9S A;  1TC0 A;  3R92 A;  5B3S C;  1K4D C;  1NBM G;  4MP2 A;  1GKF A;  4LPB A;  4TV9 B;  3UM7 A;  5C8Y B;  2IJK A;  3JAS A;  2N05 A;  2DWD C;  1Y76 B;  1AJ6 A;  5CTW A;  3JD2 A;  3SJC C;  2ESA A;  2UXX A;  2FWZ A;  3EKR A;  2OT5 A;  4LNU A;  1D2D A;  1K34 A;  1M56 C;  3OUF A;  3OW2 U;  1UYL A;  3K60 A;  1G4Y B;  4NYK A;  3S3X A;  4YJ3 A;  3BA8 A;  5LL6 Y;  1SQG A;  1TVK A;  2XDU A;  5H6R A;  4DV5 B;  3RKZ A;  3FYE B;  2DWE C;  5KUK A;  1Z5A A;  3HKC A;  2IM9 A;  5IJ0 B;  1SQP H;  4ASG A;  5LGN A;  1S5L Z;  4HXW A;  4CWT A;  2NN4 A;  4DR1 B;  1AH6 A;  4DUZ B;  1K92 A;  1UFI A;  2IJI A;  4I50 B;  1KYO F;  3EHF A;  2WLK A;  5CPH A;  4FFK A;  2BTQ A;  4XCJ A;  2UWD A;  2DW4 A;  3B26 A;  1MX0 A;  4AIL C;  4UCU A;  3NMQ A;  2JJ1 G;  4PDR A;  4DV0 B;  2UXC O;  4XIP A;  1MZE A;  1Y67 A;  5BY1 A;  2XX5 A;  1ZL8 A;  3BEH A;  1ZW9 A;  3ABK B;  1VIB A;  2XAJ A;  5C8Y A;  4JI2 O;  4U3J A;  4JI5 B;  3HHU A;  2BRE A;  3W7U A;  3D3Q A;  3S5T A;  4KSG A;  1YCI A;  4RUF A;  1GKX A;  1S0V A;  4ZKI A;  3JCZ A;  2R72 A;  4BIO A;  4B3M O;  4MPC A;  4YKT A;  2WI7 A;  4PRV A;  5FNC A;  3W7W A;  4U7N A;  5BOC A;  2Y69 B;  4JYY A;  4WFA V;  3K58 A;  1JQ0 A;  2GQP A;  4MSW C;  2RCV A;  5IJ0 A;  5EYP B;  2QG2 A;  4R8C A;  1UYG A;  1YSC A;  1R6K A;  2EXL A;  4LR3 A;  4NXN B;  3JSL A;  2XX4 A;  4E01 A;  3D2R A;  3ML0 A;  3QTC A;  4UXN A;  2EIM C;  3TTZ A;  4UV8 A;  1HDJ A;  4Q6G A;  3HZ5 A;  3M99 B;  2GUZ A;  1FPO A;  3I56 V;  1FFX A;  1Y66 A;  4WFH A;  5L3E A;  3EFF K;  2XDS A;  4BAY A;  2KSD A;  2YIB D;  1A4H A;  2QWQ B;  1B3Q A;  2ZKO A;  4AHC A;  3OR7 C;  2YEC A;  4YIP A;  1VQ9 V;  1N8R W;  3H01 A;  3ZMU A;  4FLY A;  4YKY A;  1JJO A;  1NZ6 A;  4KFG A;  1KEC A;  5CF0 A;  1IBL O;  5JCO C;  4J7Z A;  3GIE A;  3T4Z A;  3UCS C;  5EC1 C;  2C2A A;  1FYJ A;  1S5J A;  1XHX A;  1Q8I A;  1Z5V A;  3CYG A;  1AI4 A;  3CD6 V;  4FCQ A;  4JAA A;  1WP8 A;  3CRK A;  3VHA A;  2XOK G;  3AG1 B;  4JI7 O;  2H55 A;  2XT9 A;  1Z59 A;  1TID A;  1S77 D;  3CRL A;  4MVQ A;  1ZX3 A;  4TQD A;  4P8O A;  4PA6 A;  3JYC A;  4GYC B;  1IX9 A;  4I5S A;  4DV6 O;  4JQL A;  3K5N A;  4NR1 A;  1BQ0 A;  3CRC A;  1RM1 C;  5BZB A;  2IOQ A;  3ZBH A;  5E79 Z;  2OYQ A;  1UY7 A;  5D7D A;  5F3K A;  4JI4 O;  4FM0 A;  1HNW O;  1PVG A;  4ZOL A;  4LFC O;  4B3S O;  4CBC A;  4N21 A;  4BW5 A;  4K8Z A;  2DE0 X;  4IL6 Z;  1S3J A;  2QTS A;  2BU6 A;  3C3S A;  3R4M A;  2CE4 A;  3OFN G;  5LMU O;  1NTK H;  2YEF A;  2EIN B;  1QLN A;  3CCS V;  5CTX A;  2Y4U A;  5LHH A;  4HYM A;  3LDE A;  2RDC A;  4PRX A;  2OTL V;  1GO3 F;  1OCR C;  1XNR O;  2OIE A;  3CC4 V;  4X1Y B;  2PY5 A;  3AK2 A;  3WQ9 A;  3SYP A;  4CWF A;  4CC6 A;  4MPN A;  1XQ8 A;  4BQG A;  4OGQ B;  2QA4 V;  4L94 A;  4HY1 A;  2HFE C;  1N36 B;  3N2G B;  3ZXO A;  3NR7 A;  2WWW A;  5JJN B;  1TBW A;  4DRX B;  4JI8 B;  2DYR B;  1L0O A;  5M4P A;  1K73 W;  2F4V B;  3N2K B;  4K3A A;  4W4L A;  2YIA A;  1F51 A;  2YIC A;  4GGL A;  3ZMZ A;  3D36 C;  3U10 A;  1JA8 A;  5EBM C;  2UXB O;  4IHJ B;  3QG5 A;  1BHA A;  3R4O A;  1YS3 A;  2YKI A;  5J2U A;  1GN2 A;  2QKS A;  4KP4 A;  1YER A;  1KUQ A;  2BU7 A;  1QR9 A;  1P7G A;  3T1H O;  4HBN A;  2VW5 A;  1X59 A;  1LUV A;  4EEH A;  4MVS A;  5KX5 A;  3B40 A;  2X6C A;  4B3T O;  2P5O A;  2WLJ A;  3TZ0 A;  3H1J H;  3U0Z A;  4MTG A;  2RN9 A;  4ZBM A;  4GX5 A;  4R50 A;  1N34 B;  3L75 H;  2BOC C;  2JDI G;  5IYC O;  3F7Y C;  4LF4 B;  4NXM O;  1S76 D;  1VF6 A;  3L70 H;  1JFF B;  1COW G;  1LNQ A;  2DOS A;  5L3C A;  4FLZ A;  1Y74 B;  3SDL A;  4OX9 B;  1WPB A;  4H0L B;  2WAM A;  4DV2 O;  1JR9 A;  1GH6 A;  3ABL B;  4CC5 A;  2AXT Z;  1QU7 A;  3UQ8 A;  1UYF A;  4DRX A;  1N0N A;  4JTD B;  3D8C A;  4NVP A;  4JI6 O;  3OE7 G;  1EI1 A;  2W0X A;  4DUY B;  1Q86 W;  4CWQ A;  4O09 A;  5CB4 B;  3TXQ A;  4F4L A;  2EIJ B;  5L3J A;  4URL A;  2K5B A;  4FZ0 A;  1QHT A;  1WNS A;  3OTO B;  4GLX A;  4PDL A;  2ZBK B;  4DR2 O;  3T0Z A;  1PNM A;  3LSS A;  4LF7 B;  4J9Z B;  4B3R B;  1TGO A;  1NT2 B;  1VAR A;  4MOT A;  4TV8 B;  1CXZ B;  5LBQ A;  2Q0A A;  3E35 A;  2UUC O;  4CWO A;  3OEE G;  3CCQ V;  5IJ9 B;  4HZ0 A;  1N33 B;  2V1D A;  2RNB A;  1EN5 A;  3HEK A;  2YSU B;  4UCT A;  4I7Z B;  4UCS A;  2WI1 A;  1XMQ O;  5BOD A;  4KHP O;  2F43 G;  1WP7 A;  5IWA B;  5CBG A;  3VHD A;  3CPW U;  4NTX A;  3E22 B;  2IJH A;  1HNX O;  4LH7 A;  2YE9 A;  1EZV H;  3WG7 C;  2Q73 A;  3W7X A;  4LFB O;  4O4I B;  1IBK O;  1KZN A;  1PPJ H;  3DSQ A;  1FJG O;  2N04 A;  2B1G A;  5KHG A;  3CCJ V;  3TK1 A;  3P3P A;  3IJ4 A;  3FFQ A;  4JTC B;  5KLV H;  4HAM A;  5DM6 V;  4DR4 O;  3KZI Z;  1NU1 H;  2VWK A;  1I5A A;  1OCO C;  3APO A;  2FL4 A;  4UV9 A;  2ADQ B;  2LGQ A;  2E5L O;  1H8E G;  3ETG A;  5GON A;  2Q8I A;  4F6E A;  4ZI7 B;  1OHH G;  4X66 O;  4FM1 A;  2DQ0 A;  1J5E O;  4BR6 A;  1Q6I A;  4EFU A;  3AG1 C;  3ZRX A;  3J81 N;  1VQ4 V;  5LYJ A;  4FMT A;  4TV8 A;  4LF5 O;  2EIL B;  4ASU G;  3LSU A;  2Q7E A;  2OWO A;  4DW1 A;  3JAK A;  5FNF A;  2XND G;  4H85 A;  5CA1 B;  3CSX A;  3FX7 A;  2YDE A;  4MTF A;  2XDL A;  1HW7 A;  3VQX A;  2ZR3 A;  1YJN V;  3BMY A;  1IXB A;  3ZM7 A;  3BPZ A;  2V7Q G;  1Q3E A;  2ETN A;  2YE3 A;  3FB6 C;  3LPS A;  1SF9 A;  2VQE O;  5DN6 G;  3R91 A;  4EB6 B;  3A0Z A;  4GZR B;  2HLD G;  5J2T A;  4O4I A;  3BVO A;  4QNH B;  4PL9 A;  4FPP A;  1BXD A;  4PJ0 Z;  1I5C A;  5KAI Z;  3RW0 A;  4XE2 A;  4JI3 O;  4JI0 O;  2EIN C;  3G7E A;  3G6E V;  1I5Y A;  2Q2E B;  1X4T A;  2ZDI A;  1YDX A;  4B08 A;  3OMI B;  4CH6 A;  4EFE A;  4PDV A;  3O0I A;  1B04 A;  3K5M A;  2QFO A;  1UY6 A;  1YT0 A;  2XAH A;  3SPG A;  4DUH A;  4JV5 O;  3L9D A;  4MVR A;  4DR5 O;  1K7D A;  2UUA B;  2WI2 A;  1NJI W;  2FB5 A;  2DJV A;  4UB8 Z;  4F6R B;  4XD8 A;  4JYA B;  3R4P A;  2DYR C;  1NHJ A;  3E89 A;  1YF2 A;  4I4T B;  3T0H A;  4XDJ A;  5IYZ A;  3ZMS A;  4J10 A;  4JGS A;  5CA1 A;  1N4C A;  4DO2 A;  1M90 W;  3TZ2 A;  1NI8 A;  3WB1 A;  2P7T C;  2HR3 A;  2P22 C;  5EBW C;  3L71 H;  3ZRV A;  4LWG A;  3PEJ A;  4P2Z A;  1GAX A;  4DV3 O;  5JH7 A;  1BHB A;  1IDS A;  4G28 B;  4DV7 O;  5ITZ A;  1JMK C;  4CH5 A;  2ZCE A;  5JVD B;  4BWA A;  1D5A A;  3F5T A;  4GT1 A;  1UYM A;  1V55 B;  1XL6 A;  3BAA A;  1B62 A;  1AI5 A;  1UJW B;  1JVM A;  3JSN A;  4O07 A;  3JAR A;  3BY6 A;  3NXS A;  3RYF B;  3HYZ A;  3GIF A;  4O04 A;  3JAS B;  1M4U A;  1OJH A;  3CJH B;  1US6 A;  1UY9 A;  4YY3 B;  1VQP V;  4QPK A;  2XDK A;  3DC5 A;  4LNU B;  2XAS A;  3WHA A;  3ZN1 A;  2A3Q A;  1SQQ H;  5FL7 G;  3TZ4 A;  4O4L A;  2OCH A;  5AG2 A;  3T1Y B;  2CGF A;  2LJ2 A;  3TXS A;  1O9G A;  2YGA A;  4L93 A;  3ABL C;  3U67 A;  4YJ3 B;  4F6R A;  1Y4M A;  4RQF A;  5EK0 A;  4I4T A;  1YSR A;  4NH8 A;  1IZ3 A;  2ZIM A;  3HKC B;  1FXH A;  1FXV A;  2AHZ A;  1I94 O;  3ASO B;  1QQC A;  1PD3 A;  2EIJ C;  3N27 A;  1YHQ V;  3EHH A;  3CCR V;  1R1B A;  1XNQ B; 
#chains in the Genus database with same CATH homology
 3ML0 A;  2W6J G;  4UXN A;  2EIM C;  5LGT A;  1R3J C;  2HVJ C;  4UV8 A;  3KG2 A;  3OR6 C;  1Q81 W;  3M99 B;  3SPJ A;  3I56 V;  1Y66 A;  2X6B A;  4WFH A;  5L3E A;  3EFF K;  3FKS G;  1OCC B;  2CK3 G;  4BAY A;  2HKO A;  2WLL A;  5B1A B;  1GTO A;  3ZRW A;  3OR7 C;  1VQ9 V;  2NNU A;  3H01 A;  1N8R W;  3ZMU A;  5E1A C;  5IDJ A;  1XL4 A;  2QTO A;  1KEC A;  4JYC A;  3SYC A;  3AG2 B;  4GX2 A;  3T4Z A;  5EC1 C;  2JEX A;  2C2A A;  4R7C A;  1GM8 A;  1AI4 A;  1PL0 A;  3W7S A;  2Q67 A;  3CD6 V;  2H94 A;  1K4C C;  3AG4 C;  4G27 B;  4HZ3 A;  3CCL V;  1K33 A;  2XOK G;  1JCH A;  3AG1 B;  1AJN A;  3OAA G;  3IGA C;  2MK3 A;  3LNM B;  1S77 D;  4MVQ A;  3LDC A;  4PA6 A;  3JYC A;  3MHH C;  3FB5 C;  4QE9 A;  2EIK C;  3E8H A;  4QE7 A;  3ZMV A;  1YIT V;  4I5S A;  5HFL A;  4QPJ A;  2P67 A;  3AG3 B;  2Q68 A;  2P6J A;  4TSF G;  3CYO A;  1W2B U;  1RM1 C;  5BZB A;  2K1E A;  5CA3 A;  3CMA V;  1YTF D;  5H6Q A;  4JF3 A;  3T4D A;  4I9W A;  3ZJZ A;  1NH2 D;  4MTX A;  4XDK A;  1K3E A;  1KP2 A;  3ABM B;  4CBC A;  3QO7 A;  2XAF A;  4GX0 A;  4N21 A;  3ABU A;  4BW5 A;  5IYB O;  1S3J A;  1AI6 A;  3JD0 A;  4LC1 A;  1G8M A;  2WSS G;  3OMN B;  4E2L A;  1CPY A;  3K0G A;  3K06 A;  2ZXW B;  5B3S B;  3OFN G;  5LGU A;  2WLL B;  3LDD A;  2EIN B;  3GWO A;  4FJC C;  3EHB B;  1QLN A;  1BMF G;  3AEI A;  2EIL C;  4TT3 G;  4UUJ C;  1JX9 A;  1R3I C;  3ZRW B;  4JYB A;  5CBF A;  1YTF B;  3CCS V;  4OXS A;  2A9H A;  3FB7 C;  1NH2 B;  5LHH A;  5KA6 A;  3CCV V;  5L3B A;  2JEU A;  5CBH A;  3LDE A;  1VQO V;  2OTL V;  1GO3 F;  1OCR C;  3B8M A;  3CC4 V;  1SRY A;  1DTO A;  1K8A W;  1VQ5 V;  1SES A;  1M56 B;  1Q82 W;  1VQ8 V;  3SYP A;  5H9C A;  2UXN A;  4LCU C;  2QA4 V;  4JAV A;  4KFM A;  3OGC C;  2HFE C;  3G4S V;  3K08 A;  5L3G A;  2GSM B;  1ENV A;  1W0J G;  2WWW A;  2JIZ G;  2EBO A;  1OCZ C;  1YJW V;  2DYR B;  5B1B B;  3W7T A;  1K73 W;  2D3O W;  3A0R A;  1NVP D;  1RM1 B;  1F51 A;  1PNL A;  2WLN A;  2A0L A;  2B5U A;  1CP9 A;  3ZMZ A;  2R9R B;  5B1N A;  3SPC A;  3E86 A;  3CP1 A;  5EBM C;  3X2Q C;  3R65 A;  1KKD A;  1BHA A;  2WLI B;  3K03 A;  3OEH G;  3ASN C;  1DF4 A;  1KQS U;  3SYQ A;  4X8A A;  2QKS A;  1P7B A;  4KP4 A;  3CXC U;  1Q7Y W;  4H33 A;  1QR9 A;  5J9P C;  2JJ2 G;  4QIW F;  2IH3 C;  1SET A;  1NVP B;  3CME V;  2QEX V;  2ZR2 A;  2QM7 A;  4J9Y B;  4MVS A;  2X6C A;  2OCC C;  4MVO A;  1R3L C;  1M57 C;  1E79 G;  3OM3 B;  3I55 V;  2WLJ A;  1I5X A;  3ZMT A;  4MTG A;  1R73 A;  1OCR B;  2AHY A;  3IC7 A;  1P4R A;  4ZBM A;  3VBB A;  4GX5 A;  4R50 A;  2ZD9 A;  1MSW D;  4RQE A;  3RVZ A;  2DYS C;  1AR1 B;  2BOC C;  2JDI G;  4Z1M G;  1PNK A;  1JOY A;  5EBL C;  5IYC O;  3F7Y C;  1HWY A;  1DF5 A;  1S76 D;  4BIZ A;  1COW G;  1LNQ A;  1AJQ A;  4LP8 A;  5CN0 A;  3E2E A;  1QLE C;  4MVM A;  4GX1 A;  5L3C A;  1L1F A;  3IFX A;  4FIP C;  2WAM A;  1KD1 W;  1MAB G;  1V54 C;  3F5W C;  2P90 A;  2GHY A;  3ABL B;  2A79 B;  1QBZ A;  2W6I G;  3STZ C;  2FTK A;  1S5H C;  2BOB C;  3TET A;  2WLM A;  2DQ3 A;  3E8F A;  5LHG A;  4JTD B;  4WF9 V;  2HVK C;  3OE7 G;  3PJS K;  1H2G A;  3ETD A;  1Q86 W;  2IW5 A;  3D3I A;  4F4L A;  2WLH A;  3UKM A;  2EIJ B;  3GB7 C;  4RAI A;  2NLJ C;  1JJ2 U;  1ROP A;  4N23 A;  4PEL A;  4UVC A;  2WLI A;  3JD1 A;  4P9P A;  1K9M W;  3ZCC A;  5KUM A;  2EIM B;  1KP3 A;  4PDL A;  4WFE A;  2ZDI C;  3RVY A;  2Z5U A;  1PNM A;  4PA4 A;  2QE7 G;  3LSS A;  3SPI A;  4J9Z B;  2Y48 A;  1VQM V;  3JD3 A;  1EZJ A;  2YEV B;  1F4N A;  1NQT A;  5LBQ A;  3G71 V;  3TCU A;  1SZT A;  2R9I A;  3E35 A;  3OEE G;  3RBZ A;  3CCQ V;  2QM8 A;  5CMU A;  1RPO A;  4PA9 A;  2V1D A;  1FFT B;  4PA3 A;  2YSU B;  3AG4 B;  1DLB A;  1K5Q A;  2ITD C;  4TWK A;  1K5S A;  2F43 G;  5CBG A;  1V54 B;  1VQL V;  3CPW U;  2PI4 A;  2PI5 A;  2X6A A;  2IJH A;  2EZO A;  3K3W A;  1EBO A;  3CCM V;  1GM9 A;  3VOU A;  3WG7 C;  3W7X A;  1QVG U;  4FK5 C;  4HYO A;  2EIK B;  2EJR A;  4PDM A;  1RPR A;  1OCC C;  3K0D A;  2B1G A;  5L3D A;  3CCJ V;  1F23 A;  3D36 A;  3TK1 A;  5B1A C;  4Q20 A;  4EKW A;  4JTC B;  1NKD A;  3SYA A;  2IJJ A;  1NR7 A;  4MVZ A;  4X88 A;  3CC7 V;  4P30 A;  4HAM A;  5DM6 V;  1H38 A;  3AG2 C;  4WFB V;  1VQ7 V;  2ATK C;  3JD4 A;  1B6Q A;  1OCO C;  1R6N A;  3QO5 A;  2HG5 C;  4UV9 A;  3OMA B;  1MOF A;  1H8E G;  4JPR A;  3ETG A;  2LFR A;  4L87 A;  3CCU V;  1AJP A;  4RO2 A;  1OHH G;  3DTU B;  2DQ0 A;  3F7V C;  4JAU A;  2H8P C;  5LHI A;  1GK9 A;  3AG1 C;  1WLE A;  2YEV A;  3ZRX A;  2X7R B;  4U7O A;  1VQ4 V;  4FMT A;  3ZN0 A;  2LP7 A;  2EIL B;  4JAS A;  1TUE B;  3P32 A;  4ASU G;  1BL8 A;  4QJF B;  3E8G A;  4CZZ A;  1FXK C;  1JPX A;  3HPL C;  1FS0 G;  1M1K W;  4BIU A;  5KA5 A;  2XND G;  3MD0 A;  4YXW G;  3P30 A;  3AG3 C;  4P9O A;  1YI2 V;  5EC2 C;  1J95 A;  3MHS C;  1KC8 W;  5IY5 C;  4MTF A;  3LSQ A;  2LFS A;  2ZR3 A;  3ABT A;  4MW8 A;  1YJN V;  2XAQ A;  3LUT B;  4H37 A;  2V7Q G;  1NR1 A;  2X0L A;  3E83 A;  3FB6 C;  1YJ9 V;  3WG7 B;  3OUS A;  1E1R G;  5DN6 G;  4WFG A;  5IYD O;  3ABM C;  2IU3 A;  1AI7 A;  1OCZ B;  3HB3 B;  5GW7 A;  4WFF A;  1VQK V;  3ETE A;  2HLD G;  4QNH B;  3STL C;  4JTA B;  4FPP A;  5B1O A;  2ZXW C;  3T2M A;  5B3S C;  1K4D C;  1V55 C;  1WPX A;  1NBM G;  3RW0 A;  3B77 A;  2EIN C;  1GKF A;  1MG1 A;  2ZQM A;  3G6E V;  4MW3 A;  1I5Y A;  4MVU A;  3UM7 A;  3X2Q B;  2IJK A;  1OCO B;  4WCE V;  2DWD C;  1W0K G;  3ASN B;  2ZDI A;  4UVA A;  3ABK C;  3OMI B;  3JD2 A;  2UXX A;  4PDV A;  2OT5 A;  1YIJ V;  1K34 A;  4MS2 A;  1M56 C;  4KUM A;  3ZRS A;  3OUF A;  2XAH A;  3SPG A;  1ARO P;  1GMG A;  4MVR A;  3FYI B;  3K9A A;  3K79 A;  1THZ A;  2XAG A;  3OW2 U;  1K7D A;  1VQ6 V;  2OCC B;  1G4Y B;  1NJI W;  1FXK B;  1H8H G;  1M57 B;  4R6Z A;  2B1I A;  3QNE A;  5H6R A;  3FB8 C;  4XBF A;  1IXM A;  2DWE C;  2DYR C;  3FYE B;  3E89 A;  2Q69 A;  4XDL A;  1OZ0 A;  5B1B C;  3SPH A;  4DXW A;  5IY5 B;  5KUK A;  2ITC C;  4XDJ A;  2DYS B;  2EZP A;  2Y69 C;  3ZMS A;  2JK5 C;  5LGN A;  1SER A;  3ZIA G;  1F4M A;  4JGS A;  4DO2 A;  1M90 W;  1VQN V;  5L3F A;  1GM7 A;  3K04 A;  3QO8 A;  2P7T C;  1QLE B;  2WPD G;  2HR3 A;  1K92 A;  2IJI A;  5EBW C;  3ZRV A;  3ASO C;  4LBE C;  1K97 A;  2WLK A;  4P2Z A;  5C93 A;  3CCE V;  3WFV A;  1BHB A;  4RUE A;  2Q6A A;  2HJF C;  4G28 B;  3T1C A;  2DW4 A;  2M7W A;  1QCE A;  4GT1 A;  1V55 B;  1XL6 A;  2JJ1 G;  2W0F C;  4PDR A;  3E8B A;  1AI5 A;  1UJW B;  1JVM A;  3BY6 A;  4X89 A;  3BEH A;  3ABK B;  3NXS A;  2XAJ A;  2OTJ V;  4MT8 A;  1EFR G;  4UVB A;  1E1Q G;  3SYO A;  3W7U A;  1VQP V;  4QPK A;  4RUF A;  2Z3Y A;  2XAS A;  3ZN1 A;  1S0V A;  4ZKI A;  5HFM A;  4PA7 A;  1PKX A;  3JCZ A;  5FL7 G;  4MTO A;  1R3K C;  3DGE A;  3W7W A;  3SJQ C;  1FXK A;  4U7N A;  3ABL C;  2IU0 A;  2Y69 B;  4WFA V;  1JQ0 A;  4GCZ A;  1CEZ A;  1Y4M A;  4MSW C;  2IH1 C;  4RQF A;  5EK0 A;  4G2K A;  1S72 V;  1FXH A;  1ZWI C;  1FXV A;  4R8C A;  2AHZ A;  1QVF U;  1M9N A;  3ASO B;  1YSC A;  1R6K A;  1PD3 A;  2EIJ C;  2KB1 A;  1ORQ C;  1YHQ V;  3CC2 V;  1QR8 A;  3CCR V;  3B8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...