1F51A

A transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in singal transduction
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
181
structure length
181
Chain Sequence
b'ISDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEITSHECLIEIGLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPORULATION INITIATION PHOSPHOTRANSFERASE B
publication title A transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in signal transduction.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 64
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature ec 2.7.-.-:
pdb deposition date 2000-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14682 SPOB_ab Sporulation initiation phospho-transferase B, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1f51A01
3.30.565.30 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Sporulation initiation phosphotransferase B (SpoOB), C-terminal domain 1f51A02
4Q20A 4JASA 4GT1A 4LC1A 4BIUA 3ZRWA 4JAUA 4FMTA 5C93A 4U7NA 2QM7A 4JAVA 4BIZA 3MD0A 3A0RA 3NXSA 4JYBA 2LFRA 1F51A 2WWWA 2LFSA 3ZCCA 2C2AA 3P32A 3TK1A 4MT8A 2FTKA 3ZRWB 4FPPA 5B1OA 4JYCA 4MTXA 4ZKIA 2QM8A 4U7OA 5IDJA 5B1NA 3ZRXA 3DGEA 2P67A 4QPKA 3ZRVA 1IXMA 4QPJA 1JOYA 4KP4A 3D36A 4I5SA 4GCZA
chains in the Genus database with same CATH superfamily
2XD6A 1Q8IA 1ZSPA 1VQ7V 2Y4TA 3K5MA 2YICA 3P3PA 4YJ3A 4J80A 1EN5A 1ZL8B 2WEPA 4NXMB 1ZXNA 1BS3A 3FB6C 4DR3B 1WB7A 3JARB 1SQBH 4PDRA 3OE7G 3UO2A 2EZPA 3AG7A 3F7YC 1NZ6A 3K60A 1ZLZA 1WN7A 1M56C 1GM8A 4DR5O 4LF6B 1WB8A 4FFKA 5LHHA 3CCUV 3RYHA 3T1CA 2IWXA 4O2BA 4UUJC 3R65A 4AS9A 3K0DA 3B28A 1A32A 4PELA 2PYLA 2P4KA 1FJGO 5IYDO 3JCUZ 3G7BA 1PM9A 5CBFA 3C3TA 4UCTA 2V1DA 3H9VA 3B77A 1R3JC 3CCLV 1E79G 4CE1A 2IOQA 4O09A 1MMMA 4TUYA 2HJDA 2PF4E 1XQ8A 4XBFA 4U3JA 5H2FZ 4MVMA 1EN6A 2ZKJA 2ZDIC 1BYQA 2BRCA 4RAIA 4LF5B 4FLYA 5AG2A 3X2QC 1AI6A 4JI7B 1OCZB 1FXHA 2DJVA 3OUFA 4DUZB 4U3JB 1YDXA 4J9YB 3ZN0A 2Q8IA 3RVZA 3THOA 4MS2A 1QHTA 4MOTA 1PNLA 3S5TA 4H7QA 2WLLA 3CCSV 2CTQA 1TVKA 3LSUA 3P32A 3NMQA 4MTOA 1VIBA 1GN3A 1H8EG 3QO5A 1R3KC 4IHJB 1Y4SA 3ZRXA 2P4VA 2A7WA 5J2UA 1EBOA 4LFAB 2YI9A 4MVRA 2FL4A 2ADPA 1Y76B 2JJCA 3JALA 1KP2A 1Y66A 3N2GA 1MABG 4XCJA 1V55C 2WI4A 2XNDG 4X65O 3CXCU 5D6PA 2JJ1G 2GTAA 4JTAB 3JALB 3K9AA 4BQJA 4UV9A 2HEPA 4H44B 3U10A 2IJKA 4YJ2B 4FLXA 2BTQA 3GB7C 1K5SA 4Z2WA 4NXNO 3OW2U 4K8ZA 1I59A 2HG1A 4ZOLA 1S3JA 5GGZA 1IBKO 3SYAA 2BTQB 3K5NA 1HW7A 1UYFA 1XHXA 2ZXWC 3UCSC 3PEHA 2FTKA 3C0EA 2O1WA 1ZXMA 4E2LA 3RWRD 2IBZH 3ZKBA 4EFBA 4DV3B 3LPSA 4U93A 3OT7A 1I94O 2XX4A 3DC6A 3HYYA 3VHDA 2X6AA 3ML0A 1W0JG 2P5OA 2Q8HA 2DW4A 4PD4F 1QVFU 4PRVA 2CDYA 2DYSB 1G1XB 4B3TO 4CWQA 2F4VO 5CPHA 3LNUA 1WPXA 1PNMA 1JX9A 3HPLC 2YE5A 4AHCA 1SESA 1ROPA 4LNUA 3TZ0A 1W0KG 3CHXA 4PA7A 1YJNV 3DSQA 1K3EA 3I55V 1K97A 3SDLA 4LC1A 2PZSA 1XMOO 4DR5B 1KZNA 2B5UA 4B3RO 3LDCA 1QU7A 1DF4A 4JYAO 4LWSA 4UB8Z 2YEEA 2EULA 4L8JA 3RYIA 2YKJA 3B26A 3HKBA 1QCEA 1B06A 4I7ZB 1RPOA 1S5HC 4GX1A 5JQGA 3AG2C 3FYIB 2XTAA 1FJGB 4NH8A 4LFBO 1N0NA 3X2QB 3PEJA 3RYIB 3BABA 3G67A 2BSKB 3RBZA 3SYQA 1KB9F 4WCEV 2YJWA 1JVMA 4DW0A 5A9GA 1I5CA 1TIDA 1V9PA 1QBZA 3H1JH 4HXZA 1K33A 3K99A 1JJOA 2WAMA 4GX5A 3TK1A 2PGGA 3OAAG 1XI1A 3W7UA 1YHQV 1NQTA 2UUBO 2ZDYA 4FIPC 3BFRA 3FAVB 3T2MA 1N33O 3W7TA 4FLVA 3L72H 1SA0B 4UXNA 4YKZA 1COWG 1QVGU 2HKJA 3GIFA 1YSRA 1V55B 1O9GA 1GH6A 2NN4A 5FNVA 4ICGA 1QLNA 5B5EZ 3WQ9A 1G8MA 1YT2A 2YC0A 2WPDG 4MBCA 3OUSA 5KUKA 2YIAA 4WF9V 3ABMC 3DGEA 2Q7EA 4B7KA 4GFNA 4HZ5A 2QG2A 2F1MA 5EZYA 1I7FA 3QG5A 1TC6A 1Y6XA 4J7KA 3JZ3A 1B04A 1OSFA 2YKEA 1EI1A 1WP7A 3U2DA 2ZNJA 2ITCC 1YITV 4GKKO 5EYPB 1MZEA 1NU1H 2Z3YA 1QR8A 4JI0O 4LF8O 4O2AB 4X65B 1S0VA 5L3GA 1F7YA 2CCSA 2YEVB 1YC4A 3HHUA 1BE3H 1S77D 3FKSG 1Q6IA 4H37A 3CYGA 1CP9A 3Q4HA 5B1BC 2ZT9B 2JJ2G 4D6TH 4HNAA 1BHAA 2Q7GA 2XHBA 4FCQA 2ZQMA 3BVOA 3E83A 1MZFA 5IY5B 4NXNB 2EILC 3AG4C 4DRXA 3LDDA 2CH7B 2R9AA 4KL1A 1IBMO 3ZBHA 1F51A 1SC5B 1RP3B 3ZN1A 1LR1A 1IBKB 4K8XA 3Q4HB 3CRLA 1YZBA 4URNA 3K57A 1KECA 2CG9A 3CXHF 2YEIA 3QTCA 4I5SA 4XIPA 2CE4A 2IU3A 1K4DC 4L94A 3ZKDA 1I94B 4Q6GA 5BZBA 1AH6A 4I0XB 2VWKA 4DUHA 1VF6A 3K97A 1Z5AA 2ZR2A 2R72A 3T4ZA 4B3TB 2F4VB 2HFEC 4NB5A 3A0WA 4R6ZA 1JMKC 1M90W 3UT5A 1SF9A 5LYJB 3VOUA 2H8MA 1O9HA 4MP7A 4O07A 1QZRA 3G75A 3OGCC 4HY6A 1MNGA 3STLC 4XDMA 2KG7A 3ABUA 1PNKA 3JD1A 3TJTA 4K35A 3W7WA 2QF6A 1XMOB 4B3RB 2YGFA 3P3NA 4JYAB 2GUZB 5IWAO 1PD3A 1UYIA 3CCMV 5CTYA 3DXRA 3IEDA 1SERA 1ZUQA 4GX0A 3T1HO 4J7ZA 5B1NA 4CZZA 1G6UA 3T0HA 1X4TA 2WA4A 4V26A 1GN4A 4LFBB 4GT8A 1TH8A 5FPOA 1WA8A 1FXKC 2X0LA 1K73W 5FNFA 5IDMA 3IC7A 4O4JB 1F4MA 3ZMUA 2VRZA 2F43G 2Q67A 3EKRA 2X6BA 1HWYA 5J71A 2XJJA 2W0FC 1BXDA 4FLUA 3ZM7A 4CWOA 3W7SA 3H1LH 3R4OA 5EC2C 4YIPA 2PTMA 4UV8A 2ESAA 2UUBB 2AKPA 1S5JA 4KP4A 1N33B 2YE6A 1UY7A 1HNXO 1YSZA 4NVPA 3W7XA 4JYYA 2QG0A 4HYOA 3OEHG 2AZ2A 1I5BA 4R50A 2JGDB 2AW9A 2JVDA 2FWYA 1N8RW 2Q69A 1L1FA 3E8BA 3ETQA 3A0XA 4J42A 2XDXA 3ZMZA 3JD4A 3CS5A 3G6EV 1Q90D 4LP8A 2GBOA 2ZIMA 5L3DA 3INWA 3L73H 2E75B 4EFTA 4RWUA 2DWDC 5L3JA 3GVMA 4X64O 2EILB 2A9HA 3AG4B 2M7WA 2Q68A 2ZR3A 2Q6AA 4OGQB 4GKKB 4TV8A 2FYUH 4JI0B 4LF8B 3D3IA 1AJPA 2XAHA 3D2RA 1TBWA 3GWKC 3KE6A 3EHHA 2VS0A 3K06A 1A4HA 4TV8B 4DR1O 3E89A 3O9OA 4QIWF 1FAFA 4LWFA 3L71H 4UCRA 2Q8FA 5LMNO 3E2EA 2YGAA 3UQ8A 1RSOB 3RVYA 1IX9A 4UVCA 2WI7A 1IBMB 3RFRA 2WLIA 5BOCA 4CC6A 3B8NA 1V54C 2UXBO 1XDCA 3EHFA 1SQGA 5J6AA 3SPGA 3R4PA 3BRCA 4YIOA 1M5IA 2X6CA 4P2ZA 4MTFA 3TZ2A 4HBNA 1H7UA 1FYJA 4I9WA 1OCCC 1XNQO 2QTSA 2QJ1A 4GGLA 3A0RA 2VWJA 4B7PA 5JCOC 3CCRV 5CA0A 5D7DA 5IJ9B 2Q5ZA 2LQTA 4TQDA 4DR2O 1MSWD 2PI5A 4HYPA 4LFCO 5LOVB 3JD2A 4AWOA 1THZA 2YEGA 1NR7A 2QEXV 3HKDB 4I50A 4BIUA 1MU5A 3ASOC 4X8AA 2JS3A 4X20A 4F6RB 4DV1O 3OW6A 4XDJA 3C3SA 1GTOA 1TA8A 2NR5A 1BCCH 1FKAO 1H8HG 4H33A 1PPJH 1DTOA 4FCRA 1YSCA 5IWAB 3TZ5A 4DV2O 3T4DA 1GKXA 1FFXB 5GTIZ 5LA6A 3T1HB 2KKWA 1IXMA 5BMVA 5LL6Y 2ZIOA 3LNNA 5EIBD 3A0HZ 3OTOO 4C7UA 5D7RA 5M4NA 3F5TA 2JIZG 3CRKA 4XD8A 3EHBB 2YSUB 3WG7C 3QNEA 4EKWA 1I5AA 4E01A 2KSDA 2WLMA 4UCUA 2AZ0A 1BHBA 1YS3A 4XC0A 4I3HA 1XNRO 3U2KA 4H0LB 3K58A 1ZL8A 4XKAA 2OIGA 1K34A 4LP0A 3PJSK 3OR6C 4WFFA 4PHZA 4NTXA 3L70H 5H6RA 1NR1A 4JQLA 4BR6A 2VW5A 1HNXB 1YETA 3JAKA 2Q8VA 4CH3A 3VQXA 2HG5C 1Q86W 3FX7A 2ITDC 1UY9A 1S5LZ 1AMWA 1ENVA 3CEIA 4ABMA 4NH7A 3T2SA 3LSSA 1XL6A 2H3OA 4AQYO 3ZMTA 5C8YB 3JAKB 5H5NA 5GW7A 2B1GA 2YKIA 2WLHA 3APOA 4MTGA 4GEEA 4O0BA 4XTJA 2CAZC 4YXWG 1I58A 4YKWA 1S16A 3A0TA 1Y4UA 3T1KA 2CGOA 4IT5A 4OPHA 2BU7A 4IYIA 2DOSA 4X64B 3EXAA 4QE9A 2BTOA 2A0LA 2WLNA 2IWSA 3K5LA 2B9ZA 3OMAB 4IL6Z 1J95A 2EBOA 4FZ0A 2P7TC 3EHJA 1QLEC 2WI1A 5D7CA 3D36A 3B09A 2YE7A 1BMFG 1B62A 4WUCA 2YIDA 4DR1B 4B7EA 4CC5A 5LMNB 1Q7YW 4E00A 4JYBA 1M9NA 2PY5A 1ZWHA 2OCCB 2PI4A 3ZHQA 3WU2Z 3VQWA 2XJGA 2UXBB 4DR4O 5CF0A 1NJIW 2P67A 4R3AA 1BSMA 2DYRC 5JWPA 2EXLA 2IJHA 3BPZA 3SPJA 2YK2A 4IHJA 4LWIA 1XNQB 4JI2O 1XUQA 2A79B 2WWWA 1TILA 5L3CA 1UYLA 2EJRA 1Z59A 1Y76A 2CTPA 1NVPB 4AWQA 4FFBA 1QNMA 1R73A 4DR2B 3OFNG 2OTJV 1UYGA 4LFCB 2YECA 3D3QA 3CCVV 2EINC 3OMUA 4ASGA 3IAYA 4FFBB 1H2LA 2IW5A 3BY6A 4JAVA 4DV1B 4R1FA 1DLBA 3WG7B 1L8DA 4NH9A 4YJ2A 4E02A 3AG1B 1I0HA 3EKOA 2QA4V 2BU6A 4TQFA 5IN9A 4QNHB 4MPNA 2YEFA 4DV2B 2Y48A 1VP7A 2AHYA 3O2FA 3AK2A 5LP6C 2FXSA 3RYFA 5K1PA 2QGNA 1BKNA 3BM9A 3CGZA 3CX5F 3OTOB 4L8ZA 4R3MA 3H1HH 4HXWA 2ZBKB 1MG1A 1UYKA 4LWHA 3WB0A 3TUHA 3RYFB 4MT8A 3SJCC 5CA1B 3CD6V 2VCIA 2Q0OC 3WFVA 4JYCA 1R1BA 4B08A 4XE2A 1GO3F 1NTMH 5KAIZ 3AK1A 3OTFA 3T1YO 1XNRB 5L3EA 2QM4A 1D5NA 1M56B 1F23A 2UU9O 5LMUO 4HAMA 2BREA 1VQKV 2LGQA 3RYCB 3ZHTA 2OWOA 4W4LA 5KHKA 2YXLA 1P4RA 4GLXA 3FT8A 2ZE8A 4YKQA 2FWZA 4DYLA 2X7RB 1VARA 2MW2B 4WFEA 4WFBV 4EM7A 4PA6A 1XBLA 2ZDXA 2BSMA 1SS3A 1WLEA 4U7OA 4NYKA 3B25A 3RKZA 2Q9LA 4AQYB 1QLEB 4NR1A 3A8TA 1OCRC 4FLTA 4P30A 2ZDIA 2WLKA 2EIKC 5BODA 5M4HA 2E3CA 3D8CA 2BE3A 3JAMN 4KHPO 4EGIA 2HVKC 3JD3A 3M99B 4G2KA 2BSKA 5DEDA 2L35A 3ZRWB 1K8AW 1LUWA 1Z5CA 3B4SA 2M6YA 5KA6A 2WERA 5CN0A 2HHHO 3AEIA 1FPOA 2KQXA 2XCMA 5KA5A 1URFA 4O4HB 5B1AC 1VEWA 3KKYA 1SKVA 1SETA 2BCCH 2JEXA 2XDSA 1NHJA 4DZYA 3O0IA 2V7QG 2XASA 4U7NA 4XDKA 1S76D 5FNDA 4BIOA 3FAVA 3ZMVA 1NHIA 2WI5A 1SA0A 3BHPA 4N21A 2G38A 3AK3A 3GIGB 4YHHO 4DR4B 1VQ6V 1VQOV 1UYDA 1EZVH 2JS5A 4P7AA 3SYPA 2EINB 2YUAA 5LGTA 4LF4O 1SQFA 5LXTA 3CMAV 2DMXA 3RLQA 3UO3A 4YKTA 5JJNB 4L93A 4UVBA 4JI2B 1QYEA 4R8CA 4BAEA 4IGGA 4FPPA 4X62O 2GTSA 1B6QA 5LXTB 5CTXA 2LJ2A 5L3FA 5EYPA 2UXCO 3ZXOA 1NS1A 5E1AC 5CTUA 3FB5C 5LP6B 3G6BA 4O2AA 5J9PC 1P7BA 1N34O 2YEVA 1JFFA 1VQ5V 4R7CA 3VQYA 3CPWU 4EGHA 3MHSC 5FLXN 2FYPA 3CJHB 3JATB 4BWAA 5IJ0B 2ZCEA 2ZXWB 2Q8GA 1NTKH 4MVSA 1VF7A 2P90A 1JFFB 4DK0A 2DN9A 2CH7A 4LF7O 3G80A 5DN6G 2WSSG 5IYZA 4O04A 2FB5A 4NKGB 1YJ9V 2HKOA 4L91A 4FMTA 3TETA 4ZIBA 1UYHA 2YI5A 1BGYH 4ZI7B 2A06H 5TISZ 2EZOA 3G4SV 4ASFA 1UY6A 4P9OA 4URLA 3CC7V 2WI2A 2IM9A 4XDLA 1UJWB 1MSDA 1OHHG 5IYZB 1HP8A 4JI6O 4PV1B 1NTZH 4MVUA 2UUCO 4J41A 4I0XA 3H80A 1PL4A 4G28B 2BYHA 1TUEB 2NLJC 3T1YB 1TUBB 1VQMV 2IJIA 4X1YB 2UWDA 4UVAA 5JVDB 5LYJA 2UU9B 1Q82W 5LMUB 5JJEB 1VQPV 2GFDA 1K5QA 1H38A 2QM7A 4CBCA 2CCTA 3HB3B 4O4IB 2UUAO 2F66C 3ZXQA 4MVQA 3SGIA 4DV7O 3ZCCA 4E72A 3LUTB 2YI6A 2F93B 1GM7A 3ZS8C 5B3SC 1NHHA 4ZBMA 3GIEA 3AG2B 2ZNIA 5B1AB 2GUZA 4MSWC 2R9IA 4P9PA 3E22B 4LCUC 3RGBA 1KMIZ 1OZ0A 3WB1A 4RUEA 5FPRA 4JI5O 2OT5A 2XABA 4W4KA 1ZW9A 4CS3A 3ABLC 4J7JA 4P8OA 4KHPB 1ZWIC 4WBNA 4JI1O 1KC8W 2E76B 2HVJC 4X89A 4O4JA 4DR7O 1ZAUA 5HFMA 4KTNA 4YKUA 2CK3G 2IOPA 4LWGA 2HHHB 1U96A 5KX5B 4WBNB 1FFTB 4GUNA 3SL2A 4FM0A 4FM2A 4JGSA 5CBGA 1W2BU 2ZKOA 1H2SB 2BOCC 4X9LA 4CWPA 1VMGA 3OMIB 5JJJB 2VQEO 1NH2B 5EK0A 3L75H 2RQ6A 2JGDA 4DV4O 3ZHRA 3ABMB 4YHHB 1ZX3A 2PYJA 5GTHZ 4GKJO 2GSMB 2GDSA 1YERA 1DK1A 4LF4B 3FFQA 4IYHA 3HKEA 5KLVH 2IH1C 5EIBC 3K5OA 4YKYA 4H13B 2YI0A 2GQPA 2RMKB 2H94A 3M7MX 1OV9A 1Q43A 4X1IB 5JH7B 5L3BA 4KXRA 3H01A 5EBWC 3INXA 3WHAA 4ZVIA 3ASNC 5KMGB 4X62B 1J5EO 3DC5A 4K0KO 1XREA 3HKEB 3OGIB 4D7SA 5ITZA 2UXCB 1JCHA 2O57A 3FB8C 3CMEV 2XHXA 5B1BB 4L90A 3CCJV 3BMYA 3QVNA 2IU0A 3KZIZ 3ZX6A 1N34B 3K3WA 5H9CA 2ILMA 4TV9A 4DW1A 3WB2A 4B3SO 4CWTA 1BQZA 2ARHA 5ITZB 3JASB 1SZTA 1M93A 2XDKA 3VADA 4I55B 2ZE5A 2BU5A 1Q6HA 3ZEDA 1RSOA 2CGNA 3MAQA 4TV9B 2EIJC 2VQFO 4LF7B 4EGKA 5CB4A 5KHHA 2LO1A 2R9RB 5M4KA 4J9ZB 3UM7A 4BIZA 2JDIG 1P7GA 3NXSA 4DO2A 4HZ3A 3T10A 4PA4A 2C2AA 1GRJA 5CB4B 4MVOA 3ICXA 4MPCA 4EB6A 4JI6B 1PKXA 5B3SB 1IDSA 2UUCB 4CH4A 1GMGA 1AI7A 3CWBH 3JAWB 4GCZA 4BXIA 4A5UB 4MW8A 5EC1C 4GT1A 4JTDB 2N74A 5IJ9A 1UPGA 3H4LA 2QWPB 3BCCH 4EB6B 4BW9A 1Z5WA 2LW7A 5LOVA 4GZRB 4KUMA 3A0BZ 4DK1A 3ABLB 2UUAB 2IORA 5DECA 3HKDA 2K5BA 4DV7B 3N2KA 2YI8A 1YIJV 3ETDA 4F6RA 4JF3A 4CS2A 4ZKIA 4XCLA 1U97A 2YKBA 4FLZA 2PUSA 2YXHA 2UXNA 4PA3A 3B27A 3EHGA 3K03A 4OX9O 1I5XA 1JR9A 2QE7G 1H2NA 2H8PC 4RUFA 2YS8A 1GM9A 3N2KB 1FFXA 1FXKB 1L0LH 1NT2B 2R70A 5LHGA 1EA6A 1UY8A 5KHIA 5GONB 3R91A 3ZMSA 1I5DA 4JI5B 3D36C 1M57C 1SQPH 1GKFA 1YESA 2HP8A 4O05A 1S72V 1NBMG 2AGAA 3I5DA 4JI1B 2YXYA 1KUQA 2QWNB 4ZHQB 5CBHA 2OIEA 1H2GA 3KG2A 1JQ0A 2LW1A 1OCZC 2CTRA 2YKCA 4YKRA 2AXTZ 4PDMA 3R4NA 1D2DA 3HEKA 2P22C 3R4MA 4O4LB 1WAZA 3EFFK 2HHIA 1CXZB 2HJFC 3BA9A 4PU9A 4OXSA 1YTFB 3ZHVA 2LFRA 4J10A 2JK5C 2XOKG 1Z5BA 4EEHA 3G7EA 3TCUA 5E79Z 3CC2V 5IT9N 3CSXA 3HR0A 3ASNB 2VQEB 3OR7C 4KSGA 4ASBA 2YEJA 4DV4B 1UFIA 4JASA 1EFRG 1R6TA 3KCXA 2JKIA 4GKJB 1N0JA 5C8YA 1KIJA 1PVGA 4JI4O 1Y74B 1YEWA 1IURA 1AM1A 4J11A 2C1IA 2W6JG 3CE2A 1AR1B 2VCJA 4DR6O 1J5EB 4K0KB 1L0OA 3HKCB 1TAEA 2RDCA 1EZJA 5F2VO 2YK9A 1OJHA 4DUYO 4X1KB 1U2OA 3RN4A 3APQA 2ATKC 5M4PA 5IYBO 1XEQA 3LDEA 1XL4A 2RJZA 4WUDA 4PDLA 3ZJZA 4B3SB 2QWQB 3J81N 3K9SA 1V54B 1BQ0A 3ZRSA 2CUGA 2QWOB 4YJ3B 3VHCA 4XKOA 2Y0PA 1Y8NA 2GV9A 4JAAA 5JCOA 4NTWA 1Q6UA 2VQFB 2QSAA 3SYCA 2QKAA 5BXZA 1K4CC 2XX5A 1OCCB 1YVWA 2DYSC 2ADQB 1R3IC 1XOUA 3CWVA 2YE2A 1HNWO 1TC0A 5M4EA 1XILA 1JA8A 2DQ3A 2V4DA 2BT0A 1VF5B 3RYHB 4O2BB 2YEBA 1US6A 4LH6A 1AROP 1OCOC 2PNRA 1GJVA 2H55A 3JYCA 3K04A 3E8FA 5D5QA 4UROA 1ZTEA 3ASOB 1B3QA 4JZGA 1YJWV 1AILA 2Q0AA 3E35A 2JEUA 4D7TA 1R3LC 1M1KW 2FKXA 3E8GA 5LHIA 1M57B 4UCSA 3D0BA 3B2EE 1D5AA 1R6NA 3MHHC 4DV0O 2K9PA 4JV5O 1L0NH 2O1VA 3HZ5A 1QY8A 4HZ0A 1WPBA 4HY1A 4TUYB 5IE9A 5K1XA 4BAYA 3ZHUA 4OX9B 3LNMB 1NVPD 1RM1C 1Q5OA 4YKXA 2HCHA 2ETNA 2RN9A 2Q2EB 2WA3A 2EIMC 5LBQA 5D5PA 1QQCA 1Y4MA 2XK2A 1ID0A 2DE0X 3H1IH 4LF9O 3VBBA 2LP7A 5CA3A 3FB7C 2QFOA 2WLLB 2YE3A 3SPHA 1TVKB 5CA1A 1K9MW 5C93A 2AHZA 4PDVA 4PJ0Z 4AWPA 2ZE6A 5J2UB 2WEQA 4JI3O 3CRCA 2P6JA 2CH4A 3P30A 3RYCA 3JSNA 3N2GB 2YIBA 4WUBA 5BY1A 3Q5LA 2E5LO 3K0GA 4B3MO 1QR9A 2BU8A 2XHRA 3IFXA 4XITA 1RFYA 2DWEC 4UFZA 3STZC 4RQFA 2A3QA 2QWRB 3C11A 1KYOF 2YJXA 1IXBA 3SPCA 1Z2GA 1GKZA 3JSLA 5BR8O 4PL9A 4RQEA 3A0YA 3CCEV 1JM6A 4JI4B 4DV6O 4CS4A 1AI4A 3AG3C 3K08A 5CMUA 3ABKC 2YIBD 2JRIA 4ZOLB 5J2TA 2YGEA 3CRQA 4DR6B 3QF7A 3SR2C 1R6KA 1IZ3A 3OEEG 1FS0G 1H7SA 1M4UA 3ZIAG 3NR7A 3ZRWA 1Q3EA 5IY5C 2B1IA 4X66O 4DUYB 5J2TB 2ODMA 4WFGA 3TTZA 5M4MA 4O4HA 3U0ZA 4GX2A 2ZM6O 3JD0A 4PA9A 1K92A 4AI8A 4MTXA 1FXVA 2WI6A 1KQSU 4W7TA 1OCOB 2N04A 2XHTA 4QPJA 2CTWA 2RNBA 3SJAC 5DM6V 5FL7G 1SQXH 2DYRB 1T5EA 2Y69C 1JJ2U 1HNZO 5HFLA 4JAUA 1Z5VA 4LNUB 4MW3A 1Y8PA 3GIGA 3I56V 2YDEA 1H2KA 2E0AA 3N27A 4TT3G 4CH5A 1PV0A 2CCUA 1HNWB 3LSQA 3OM3B 1VF6C 2QTOA 1XHZA 2UXDO 4LWSB 1KKCA 4G27B 4KFGA 1GN2A 1IBLO 1SQQH 3KCYA 4LPBA 2OCHA 3HKBB 4F4LA 2BU2A 2XDLA 2JGUA 1UYMA 5LGUA 1RM1B 3K79A 1B63A 5JQGB 1THNA 2ZINA 1VQ8V 3K98A 3TZ4A 2EIMB 5LP6A 3IGAC 2BOBC 2L6LA 4JPRA 1WNSA 2QDOA 2O1UA 1KU9A 4JZ2A 4DV0B 4JV5B 4LWEA 1DF5A 3CJHA 4QPKA 3JATA 2XT9A 1UYEA 5IJ0A 4UCOA 1E1QG 1AP6A 1P49A 2EJ7A 4PI2A 1VQ4V 1YC3A 3SJQC 4WFAV 1AI5A 4B6CA 1AVMA 4Z1VA 3CC4V 4CWSA 2ZD9A 3T0ZA 3B24A 3QO7A 3FT5A 3FYEB 3OWDA 1AJQA 1KP3A 2QKSA 1VQNV 3RLRA 3SYOA 4KFMA 2Z5UA 4ZI7A 2XAQA 4LF9B 2C1GA 5FNVB 4KQVA 4NTYA 3B8MA 4Q20A 1US7A 2MK3A 1NKDA 4E4EA 1P84F 2QKCA 1R62A 1TUBA 5EZYB 4X1YA 3C90A 1ORQC 2P06A 2E74B 4JI3B 5JVDA 3AG3B 2QM8A 3ABKB 4L87A 5IYCO 4O4IA 4DV5O 2E5LB 1PL0A 3J80N 4KSHA 4B3MB 5A2QN 3CCQV 1OCRB 1GAXA 2EIKB 1LNQA 4IIJA 4LBEC 2F95B 2YE4A 1N32O 1AJNA 4H81A 5BR8B 1K7DA 4FK5C 3E22A 4HNAB 4XKKA 4CWFA 4DV6B 5F3KA 4MP2A 4IIJB 1MOFA 2Y0IA 2RCVA 4DRXB 2XX2A 1JOYA 1JPXA 4CWRA 3EVKA 1KKDA 2XAFA 1X59A 3RW0A 2Y69B 4JTCB 3A0ZA 3HZ1A 3RT3C 4LR3A 1HR0O 2FMLA 3SPIA 1GK9A 1YI2V 1BT8A 3ETGA 4X66B 1N36O 1MA1A 3TGUH 4URMA 1Y8OA 4TSFG 2CGFA 1F4NA 5JENA 5KX5A 4N23A 4YY3O 2ZM6B 3H1KH 3O6OA 3VHAA 4EFUA 4FVMA 4K3AA 1AR5A 2BYIA 3UT5B 3B40A 4QJFB 1HNZB 3U67A 3CRAA 4MVZA 2D3OW 4JI8O 5CTWA 3ETEA 2KG7B 2N05A 1I5YA 2UXXA 2XAJA 1EN4A 2WI3A 3F7VC 1LUVA 2OYQA 4Z1MG 2UXDB 2YEHA 4MPEA 1G4YB 2YEAA 1YF2A 1IBLB 2OTLV 1YCIA 4X1IA 5JH7A 1AR4A 4EFEA 4QGPA 3DXRB 4UCVA 5KMGA 3CP1A 1YT1A 1NH2D 2IWUA 2YEDA 3JCZA 4CWNA 4TWKA 1CEZA 2YI7A 1WA8B 1BL8A 2YE8A 3CRRA 3M8AA 3J7AU 2W6IG 3ABTA 3E8HA 3MDSA 4XIRA 1GN6A 1XMQO 5LGNA 1S14A 2VWCA 3JASA 4X88A 4I55A 4CH6A 2Q4PA 4NXMO 3DTUB 1EM1A 1U0ZA 4DR3O 1BZKA 5EBLC 1VQLV 2Z0AA 3TXQA 1YT0A 3VQVA 1H2MA 3BEHA 4HYMA 4FM1A 2DQ0A 4FCPA 3L74H 1AJ6A 4LF6O 4BQGA 4U3FH 2BZ5A 2Q7HA 3S3WA 3SJBC 2XJXA 4X9QA 3K59A 4DXWA 1PP9H 5FNCA 1AH8A 3FD9A 3CYOA 3CRMA 3JAWA 2LFSA 3IC9A 5KHJA 1Q81W 3CB2A 2KB1A 4BW5A 1AB3A 1FD9A 3QDDA 3ZRVA 3OMNB 2LGWA 4DV5B 4FLWA 2EX3A 2YE9A 4MB9A 4CE3A 4K4OA 3S3XA 5FWKA 5F5RA 1N32B 3IJ4A 5KUMA 3L9DA 1TGOA 2ZE7A 4EEQA 3OWBA 1FXKA 4LF5O 2IH3C 5GONA 5IDJA 4JI7O 4DUZO 3ZHSA 2GHYA 2WLIB 4PI0A 4I4TA 2BTZA 3Q5KA 2XUMA 5H6QA 4ZHQA 5D6QA 1RPRA 1HR0B 2WLJA 1MX0A 3LMMA 2K1EA 2OCCC 1DGSA 4RO2A 4AILC 1KD1W 4UB6Z 2NNUA 3BAAA 3PN1A 1N36B 3CGYA 5B1OA 1YC1A 3QO8A 4QE7A 4O4LA 3Q5JA 1CPYA 3O65A 3F5WC 4I4TB 5KAFZ 4YY3B 4LFAO 4DR7B 1AP5A 1IVSA 1HDJA 5CA0B 4XIQA 1I08A 2IJJA 2W0XA 1NI8A 4H85A 4F6EA 3QTFA 3OPDA 3MD0A 3HYZA 3U11A 1VQ9V 1W59A 4JI8B 2Y4UA 2D2CB 4I50B 2HR3A 1KBHA 4FZ1A 1YXBA 4X20B 3UKMA 3R92A 1Y67A 3TXSA 4I9QA 2XDUA 5B66Z 3A2FA 1Y74A 3GWOA 3R66A 1YTFD 1WJZA 1UYCA 3RLPA 4ASAA 2QR4A 2Q73A 3FV5A 4ASUG 2XAGA 4GQTA 4PRXA 3G71V 1SQVH 1WP8A 2F23A 5LA6B 3AG1C 4FJCC 4EMVA 1E1RG 5BMVB 5EBMC 3HKCA 5KHGA 1SZXA 1N4CA 4LH7A 3OD4A 4V25A 3E86A 4DV3O 4X1KA 3MNRP 4CE2A 4OPAA 4WFHA 4GYCB 2HLDG 4TOIA 1BGQA 1XMQB 3JARA 3BA8A 2EIJB 1SRYA
chains in the Genus database with same CATH topology
3STZC 4RQFA 1YJ9V 1VQ7V 2HKOA 4FMTA 3TETA 2DWDC 2EILB 2A9HA 2EZOA 2M7WA 2Q68A 2ZR3A 2Q6AA 3AG4B 4P9OA 3SPCA 3G4SV 4RQEA 3CC7V 3CCEV 4XDLA 1UJWB 3FB6C 1OHHG 1AI4A 4PDRA 3OE7G 4MVUA 2EZPA 3D3IA 1AJPA 2XAHA 3AG3C 3K08A 3F7YC 5CMUA 3ABKC 4G28B 1TUEB 1M56C 2NLJC 1GM8A 1R6KA 3K06A 1VQMV 2IJIA 3OEEG 1FS0G 4UVAA 5LHHA 3E89A 3ZIAG 4QIWF 3ZRWA 3CCUV 3T1CA 1VQPV 1Q82W 1K5QA 4UUJC 1H38A 5IY5C 2B1IA 2QM7A 4CBCA 3E2EA 3HB3B 3R65A 3RVYA 3K0DA 4MVQA 4WFGA 4UVCA 2WLIA 3ZCCA 4GX2A 3B8NA 3JD0A 3LUTB 1V54C 4PA9A 4PELA 1K92A 1GM7A 4MTXA 3SPGA 5B3SC 5IYDO 4ZBMA 1FXVA 3AG2B 1KQSU 1OCOB 4QPJA 5B1AB 5CBFA 2X6CA 4P2ZA 4MSWC 4MTFA 2R9IA 4P9PA 5DM6V 5FL7G 2V1DA 2DYRB 3B77A 1R3JC 3CCLV 2Y69C 1E79G 4LCUC 1JJ2U 1OZ0A 5HFLA 4JAUA 4I9WA 4RUEA 4MW3A 1OCCC 2OT5A 3A0RA 3I56V 3ABLC 4XBFA 3CCRV 4TT3G 4MVMA 1ZWIC 2ZDIC 1KC8W 1MSWD 3LSQA 3OM3B 2PI5A 2HVJC 4RAIA 4X89A 2QTOA 5HFMA 3JD2A 1THZA 4G27B 2CK3G 3X2QC 1AI6A 1NR7A 1OCZB 1FXHA 3OUFA 2QEXV 4F4LA 4J9YB 3ZN0A 4BIUA 3ASOC 4X8AA 3RVZA 4MS2A 5LGUA 1RM1B 1FFTB 3K79A 4XDJA 1PNLA 4JGSA 1GTOA 5CBGA 1W2BU 1VQ8V 2BOCC 2EIMB 2WLLA 3IGAC 2BOBC 3CCSV 1H8HG 4H33A 1DTOA 3P32A 1YSCA 4JPRA 3T4DA 3OMIB 4MTOA 1H8EG 3QO5A 1NH2B 1R3KC 5EK0A 3ZRXA 1DF5A 4QPKA 1IXMA 3ABMB 1EBOA 4MVRA 2GSMB 1E1QG 1KP2A 1Y66A 1MABG 1V55C 2JIZG 1VQ4V 3SJQC 4WFAV 1AI5A 2XNDG 3EHBB 2IH1C 2YSUB 3WG7C 3CC4V 3QNEA 4EKWA 2ZD9A 3CXCU 2WLMA 2JJ1G 3QO7A 2H94A 5L3BA 3FYEB 1BHBA 1AJQA 1KP3A 2QKSA 4JTAB 1VQNV 3K9AA 3H01A 5EBWC 4KFMA 3SYOA 2Z5UA 3ASNC 4UV9A 2XAQA 2IJKA 3GB7C 1JCHA 3FB8C 1K5SA 3B8MA 3CMEV 1K34A 4Q20A 3PJSK 3OR6C 4WFFA 5B1BB 2MK3A 3CCJV 1NKDA 5H6RA 1NR1A 2IU0A 3OW2U 3K3WA 1S3JA 5H9CA 2HG5C 3SYAA 1Q86W 1SZTA 1ORQC 2ITDC 2ZXWC 2FTKA 1ENVA 3AG3B 3LSSA 1XL6A 4E2LA 2QM8A 3ABKB 4L87A 5IYCO 3ZMTA 5GW7A 2B1GA 2EIJC 1PL0A 2WLHA 4MTGA 3CCQV 1OCRB 4YXWG 2R9RB 2X6AA 3ML0A 2EIKB 1LNQA 4J9ZB 4LBEC 3UM7A 4BIZA 1W0JG 2JDIG 2DW4A 1QVFU 3NXSA 2DYSB 4DO2A 1AJNA 4HZ3A 4QE9A 2A0LA 2WLNA 1K7DA 4PA4A 1WPXA 4FK5C 1PNMA 2C2AA 1JX9A 3HPLC 3OMAB 4MVOA 1SESA 1ROPA 1J95A 1PKXA 1W0KG 2EBOA 5B3SB 1MOFA 2P7TC 1GMGA 1JOYA 1JPXA 1QLEC 1AI7A 2XAFA 4PA7A 1YJNV 1KKDA 3D36A 4GCZA 1BMFG 4MW8A 5EC1C 1K3EA 4GT1A 1K97A 2Y69B 4JTDB 4LC1A 3RW0A 4JTCB 3I55V 2B5UA 3LDCA 1DF4A 3SPIA 1GK9A 1YI2V 1Q7YW 3ETGA 4JYBA 4KUMA 1M9NA 3ABLB 4TSFG 2OCCB 2PI4A 1F4NA 1QCEA 4N23A 1YIJV 1RPOA 3ETDA 4JF3A 4ZKIA 1S5HC 4GX1A 3AG2C 3FYIB 2UXNA 1NJIW 2P67A 4PA3A 3X2QB 2DYRC 3K03A 1I5XA 2QE7G 3RBZA 2H8PC 4RUFA 3SYQA 5LHGA 1GM9A 1FXKB 2IJHA 4QJFB 4WCEV 4MVZA 3SPJA 1JVMA 2D3OW 3ZMSA 2A79B 2WWWA 5L3CA 1M57C 1QBZA 3ETEA 1K33A 2EJRA 1NVPB 1GKFA 1I5YA 2UXXA 2WAMA 2XAJA 4GX5A 3TK1A 3OAAG 3W7UA 1YHQV 1NQTA 1S72V 1NBMG 1R73A 3F7VC 5CBHA 4FIPC 3OFNG 2OTJV 1H2GA 3T2MA 3KG2A 1JQ0A 4Z1MG 1G4YB 1OCZC 3W7TA 3CCVV 2OTLV 4UXNA 4PDMA 2EINC 1COWG 1QVGU 3EFFK 1V55B 2IW5A 2HJFC 3BY6A 4JAVA 3CP1A 4OXSA 1DLBA 3WG7B 1NH2D 1YTFB 1QLNA 2LFRA 3JCZA 2JK5C 2XOKG 3AG1B 1G8MA 3TCUA 4TWKA 2QA4V 1CEZA 2WPDG 1BL8A 3CC2V 2W6IG 4QNHB 3ABTA 3ASNB 3E8HA 3OUSA 2Y48A 5KUKA 4WF9V 3ABMC 3DGEA 5LGNA 2AHYA 3OR7C 4JASA 4X88A 1EFRG 2ITCC 1YITV 3DTUB 1MG1A 2Z3YA 1QR8A 5EBLC 1VQLV 1S0VA 5L3GA 4MT8A 2W6JG 2YEVB 1AR1B 3CD6V 3WFVA 4JYCA 3BEHA 1GO3F 2DQ0A 1S77D 3FKSG 4H37A 5L3EA 1M56B 1CP9A 1F23A 5B1BC 2JJ2G 4HAMA 1EZJA 1VQKV 1BHAA 4DXWA 2ZQMA 1P4RA 3E83A 5IY5B 2EILC 3AG4C 2ATKC 3LDDA 2X7RB 5IYBO 3CYOA 1F51A 3LDEA 1XL4A 3ZN1A 4PDLA 3ZJZA 2LFSA 4WFEA 4WFBV 4PA6A 1Q81W 1V54B 1WLEA 3ZRSA 4U7OA 1KECA 2KB1A 4BW5A 3ZRVA 1QLEB 3OMNB 1OCRC 4I5SA 2IU3A 1K4DC 4P30A 2ZDIA 2WLKA 2EIKC 5BZBA 3SYCA 1K4CC 1OCCB 2DYSC 2ZR2A 2HVKC 1R3IC 3JD3A 3T4ZA 3M99B 5KUMA 2DQ3A 2HFEC 4G2KA 4R6ZA 1M90W 3ZRWB 1FXKA 3VOUA 1K8AW 2IH3C 5IDJA 5KA6A 1AROP 1OCOC 5CN0A 3AEIA 5KA5A 3OGCC 5B1AC 3JYCA 3STLC 2GHYA 2WLIB 3ABUA 1PNKA 1SETA 3JD1A 2JEXA 3E8FA 3K04A 2V7QG 3W7WA 3ASOB 2XASA 4U7NA 4XDKA 1S76D 1YJWV 5H6QA 1RPRA 2WLJA 3E35A 2JEUA 1M1KW 1R3LC 3ZMVA 2K1EA 2OCCC 3E8GA 1M57B 4RO2A 5LHIA 1KD1W 1PD3A 2NNUA 3MHHC 3CCMV 1R6NA 4N21A 5B1OA 3QO8A 4QE7A 1SERA 1CPYA 4GX0A 3F5WC 5B1NA 4CZZA 1VQ6V 1VQOV 4BAYA 3SYPA 2EINB 2IJJA 5LGTA 1FXKC 3LNMB 2X0LA 1NVPD 3CMAV 1K73W 3IC7A 1RM1C 1F4MA 3MD0A 3ZMUA 2F43G 1VQ9V 2Q67A 2EIMC 5LBQA 2X6BA 1HWYA 4UVBA 2W0FC 4R8CA 1Y4MA 2HR3A 3W7SA 4FPPA 3UKMA 1B6QA 5EC2C 5L3FA 3VBBA 2LP7A 5CA3A 3FB7C 4UV8A 3GWOA 4KP4A 3FB5C 5E1AC 2WLLB 1YTFD 5J9PC 1P7BA 3SPHA 2YEVA 3W7XA 1VQ5V 4R7CA 3CPWU 1K9MW 5C93A 4HYOA 4ASUG 3OEHG 2AHZA 2XAGA 3MHSC 4PDVA 2DWEC 3G71V 4R50A 3AG1C 4FJCC 1E1RG 1N8RW 2Q69A 5EBMC 1L1FA 2P6JA 3E8BA 3P30A 2ZXWB 4MVSA 3E86A 2P90A 3ZMZA 3K0GA 3JD4A 4WFHA 3G6EV 1QR9A 2HLDG 3IFXA 4LP8A 5DN6G 5L3DA 2WSSG 2EIJB 1SRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q20 A;  4JAS A;  4GT1 A;  4LC1 A;  4BIU A;  3ZRW A;  4JAU A;  4FMT A;  5C93 A;  4U7N A;  2QM7 A;  4JAV A;  4BIZ A;  3MD0 A;  3A0R A;  3NXS A;  4JYB A;  2LFR A;  1F51 A;  2WWW A;  2LFS A;  3ZCC A;  2C2A A;  3P32 A;  3TK1 A;  4MT8 A;  2FTK A;  3ZRW B;  4FPP A;  5B1O A;  4JYC A;  4MTX A;  4ZKI A;  2QM8 A;  4U7O A;  5IDJ A;  5B1N A;  3ZRX A;  3DGE A;  2P67 A;  4QPK A;  3ZRV A;  1IXM A;  4QPJ A;  1JOY A;  4KP4 A;  3D36 A;  4I5S A;  4GCZ A; 
#chains in the Genus database with same CATH topology
 2XD6 A;  1Q8I A;  1ZSP A;  1VQ7 V;  2Y4T A;  3K5M A;  2YIC A;  3P3P A;  4YJ3 A;  4J80 A;  1EN5 A;  1ZL8 B;  2WEP A;  4NXM B;  1ZXN A;  1BS3 A;  3FB6 C;  4DR3 B;  1WB7 A;  3JAR B;  1SQB H;  4PDR A;  3OE7 G;  3UO2 A;  2EZP A;  3AG7 A;  3F7Y C;  1NZ6 A;  3K60 A;  1ZLZ A;  1WN7 A;  1M56 C;  1GM8 A;  4DR5 O;  4LF6 B;  1WB8 A;  4FFK A;  5LHH A;  3CCU V;  3RYH A;  3T1C A;  2IWX A;  4O2B A;  4UUJ C;  3R65 A;  4AS9 A;  3K0D A;  3B28 A;  1A32 A;  4PEL A;  2PYL A;  2P4K A;  1FJG O;  5IYD O;  3JCU Z;  3G7B A;  1PM9 A;  5CBF A;  3C3T A;  4UCT A;  2V1D A;  3H9V A;  3B77 A;  1R3J C;  3CCL V;  1E79 G;  4CE1 A;  2IOQ A;  4O09 A;  1MMM A;  4TUY A;  2HJD A;  2PF4 E;  1XQ8 A;  4XBF A;  4U3J A;  5H2F Z;  4MVM A;  1EN6 A;  2ZKJ A;  2ZDI C;  1BYQ A;  2BRC A;  4RAI A;  4LF5 B;  4FLY A;  5AG2 A;  3X2Q C;  1AI6 A;  4JI7 B;  1OCZ B;  1FXH A;  2DJV A;  3OUF A;  4DUZ B;  4U3J B;  1YDX A;  4J9Y B;  3ZN0 A;  2Q8I A;  3RVZ A;  3THO A;  4MS2 A;  1QHT A;  4MOT A;  1PNL A;  3S5T A;  4H7Q A;  2WLL A;  3CCS V;  2CTQ A;  1TVK A;  3LSU A;  3P32 A;  3NMQ A;  4MTO A;  1VIB A;  1GN3 A;  1H8E G;  3QO5 A;  1R3K C;  4IHJ B;  1Y4S A;  3ZRX A;  2P4V A;  2A7W A;  5J2U A;  1EBO A;  4LFA B;  2YI9 A;  4MVR A;  2FL4 A;  2ADP A;  1Y76 B;  2JJC A;  3JAL A;  1KP2 A;  1Y66 A;  3N2G A;  1MAB G;  4XCJ A;  1V55 C;  2WI4 A;  2XND G;  4X65 O;  3CXC U;  5D6P A;  2JJ1 G;  2GTA A;  4JTA B;  3JAL B;  3K9A A;  4BQJ A;  4UV9 A;  2HEP A;  4H44 B;  3U10 A;  2IJK A;  4YJ2 B;  4FLX A;  2BTQ A;  3GB7 C;  1K5S A;  4Z2W A;  4NXN O;  3OW2 U;  4K8Z A;  1I59 A;  2HG1 A;  4ZOL A;  1S3J A;  5GGZ A;  1IBK O;  3SYA A;  2BTQ B;  3K5N A;  1HW7 A;  1UYF A;  1XHX A;  2ZXW C;  3UCS C;  3PEH A;  2FTK A;  3C0E A;  2O1W A;  1ZXM A;  4E2L A;  3RWR D;  2IBZ H;  3ZKB A;  4EFB A;  4DV3 B;  3LPS A;  4U93 A;  3OT7 A;  1I94 O;  2XX4 A;  3DC6 A;  3HYY A;  3VHD A;  2X6A A;  3ML0 A;  1W0J G;  2P5O A;  2Q8H A;  2DW4 A;  4PD4 F;  1QVF U;  4PRV A;  2CDY A;  2DYS B;  1G1X B;  4B3T O;  4CWQ A;  2F4V O;  5CPH A;  3LNU A;  1WPX A;  1PNM A;  1JX9 A;  3HPL C;  2YE5 A;  4AHC A;  1SES A;  1ROP A;  4LNU A;  3TZ0 A;  1W0K G;  3CHX A;  4PA7 A;  1YJN V;  3DSQ A;  1K3E A;  3I55 V;  1K97 A;  3SDL A;  4LC1 A;  2PZS A;  1XMO O;  4DR5 B;  1KZN A;  2B5U A;  4B3R O;  3LDC A;  1QU7 A;  1DF4 A;  4JYA O;  4LWS A;  4UB8 Z;  2YEE A;  2EUL A;  4L8J A;  3RYI A;  2YKJ A;  3B26 A;  3HKB A;  1QCE A;  1B06 A;  4I7Z B;  1RPO A;  1S5H C;  4GX1 A;  5JQG A;  3AG2 C;  3FYI B;  2XTA A;  1FJG B;  4NH8 A;  4LFB O;  1N0N A;  3X2Q B;  3PEJ A;  3RYI B;  3BAB A;  3G67 A;  2BSK B;  3RBZ A;  3SYQ A;  1KB9 F;  4WCE V;  2YJW A;  1JVM A;  4DW0 A;  5A9G A;  1I5C A;  1TID A;  1V9P A;  1QBZ A;  3H1J H;  4HXZ A;  1K33 A;  3K99 A;  1JJO A;  2WAM A;  4GX5 A;  3TK1 A;  2PGG A;  3OAA G;  1XI1 A;  3W7U A;  1YHQ V;  1NQT A;  2UUB O;  2ZDY A;  4FIP C;  3BFR A;  3FAV B;  3T2M A;  1N33 O;  3W7T A;  4FLV A;  3L72 H;  1SA0 B;  4UXN A;  4YKZ A;  1COW G;  1QVG U;  2HKJ A;  3GIF A;  1YSR A;  1V55 B;  1O9G A;  1GH6 A;  2NN4 A;  5FNV A;  4ICG A;  1QLN A;  5B5E Z;  3WQ9 A;  1G8M A;  1YT2 A;  2YC0 A;  2WPD G;  4MBC A;  3OUS A;  5KUK A;  2YIA A;  4WF9 V;  3ABM C;  3DGE A;  2Q7E A;  4B7K A;  4GFN A;  4HZ5 A;  2QG2 A;  2F1M A;  5EZY A;  1I7F A;  3QG5 A;  1TC6 A;  1Y6X A;  4J7K A;  3JZ3 A;  1B04 A;  1OSF A;  2YKE A;  1EI1 A;  1WP7 A;  3U2D A;  2ZNJ A;  2ITC C;  1YIT V;  4GKK O;  5EYP B;  1MZE A;  1NU1 H;  2Z3Y A;  1QR8 A;  4JI0 O;  4LF8 O;  4O2A B;  4X65 B;  1S0V A;  5L3G A;  1F7Y A;  2CCS A;  2YEV B;  1YC4 A;  3HHU A;  1BE3 H;  1S77 D;  3FKS G;  1Q6I A;  4H37 A;  3CYG A;  1CP9 A;  3Q4H A;  5B1B C;  2ZT9 B;  2JJ2 G;  4D6T H;  4HNA A;  1BHA A;  2Q7G A;  2XHB A;  4FCQ A;  2ZQM A;  3BVO A;  3E83 A;  1MZF A;  5IY5 B;  4NXN B;  2EIL C;  3AG4 C;  4DRX A;  3LDD A;  2CH7 B;  2R9A A;  4KL1 A;  1IBM O;  3ZBH A;  1F51 A;  1SC5 B;  1RP3 B;  3ZN1 A;  1LR1 A;  1IBK B;  4K8X A;  3Q4H B;  3CRL A;  1YZB A;  4URN A;  3K57 A;  1KEC A;  2CG9 A;  3CXH F;  2YEI A;  3QTC A;  4I5S A;  4XIP A;  2CE4 A;  2IU3 A;  1K4D C;  4L94 A;  3ZKD A;  1I94 B;  4Q6G A;  5BZB A;  1AH6 A;  4I0X B;  2VWK A;  4DUH A;  1VF6 A;  3K97 A;  1Z5A A;  2ZR2 A;  2R72 A;  3T4Z A;  4B3T B;  2F4V B;  2HFE C;  4NB5 A;  3A0W A;  4R6Z A;  1JMK C;  1M90 W;  3UT5 A;  1SF9 A;  5LYJ B;  3VOU A;  2H8M A;  1O9H A;  4MP7 A;  4O07 A;  1QZR A;  3G75 A;  3OGC C;  4HY6 A;  1MNG A;  3STL C;  4XDM A;  2KG7 A;  3ABU A;  1PNK A;  3JD1 A;  3TJT A;  4K35 A;  3W7W A;  2QF6 A;  1XMO B;  4B3R B;  2YGF A;  3P3N A;  4JYA B;  2GUZ B;  5IWA O;  1PD3 A;  1UYI A;  3CCM V;  5CTY A;  3DXR A;  3IED A;  1SER A;  1ZUQ A;  4GX0 A;  3T1H O;  4J7Z A;  5B1N A;  4CZZ A;  1G6U A;  3T0H A;  1X4T A;  2WA4 A;  4V26 A;  1GN4 A;  4LFB B;  4GT8 A;  1TH8 A;  5FPO A;  1WA8 A;  1FXK C;  2X0L A;  1K73 W;  5FNF A;  5IDM A;  3IC7 A;  4O4J B;  1F4M A;  3ZMU A;  2VRZ A;  2F43 G;  2Q67 A;  3EKR A;  2X6B A;  1HWY A;  5J71 A;  2XJJ A;  2W0F C;  1BXD A;  4FLU A;  3ZM7 A;  4CWO A;  3W7S A;  3H1L H;  3R4O A;  5EC2 C;  4YIP A;  2PTM A;  4UV8 A;  2ESA A;  2UUB B;  2AKP A;  1S5J A;  4KP4 A;  1N33 B;  2YE6 A;  1UY7 A;  1HNX O;  1YSZ A;  4NVP A;  3W7X A;  4JYY A;  2QG0 A;  4HYO A;  3OEH G;  2AZ2 A;  1I5B A;  4R50 A;  2JGD B;  2AW9 A;  2JVD A;  2FWY A;  1N8R W;  2Q69 A;  1L1F A;  3E8B A;  3ETQ A;  3A0X A;  4J42 A;  2XDX A;  3ZMZ A;  3JD4 A;  3CS5 A;  3G6E V;  1Q90 D;  4LP8 A;  2GBO A;  2ZIM A;  5L3D A;  3INW A;  3L73 H;  2E75 B;  4EFT A;  4RWU A;  2DWD C;  5L3J A;  3GVM A;  4X64 O;  2EIL B;  2A9H A;  3AG4 B;  2M7W A;  2Q68 A;  2ZR3 A;  2Q6A A;  4OGQ B;  4GKK B;  4TV8 A;  2FYU H;  4JI0 B;  4LF8 B;  3D3I A;  1AJP A;  2XAH A;  3D2R A;  1TBW A;  3GWK C;  3KE6 A;  3EHH A;  2VS0 A;  3K06 A;  1A4H A;  4TV8 B;  4DR1 O;  3E89 A;  3O9O A;  4QIW F;  1FAF A;  4LWF A;  3L71 H;  4UCR A;  2Q8F A;  5LMN O;  3E2E A;  2YGA A;  3UQ8 A;  1RSO B;  3RVY A;  1IX9 A;  4UVC A;  2WI7 A;  1IBM B;  3RFR A;  2WLI A;  5BOC A;  4CC6 A;  3B8N A;  1V54 C;  2UXB O;  1XDC A;  3EHF A;  1SQG A;  5J6A A;  3SPG A;  3R4P A;  3BRC A;  4YIO A;  1M5I A;  2X6C A;  4P2Z A;  4MTF A;  3TZ2 A;  4HBN A;  1H7U A;  1FYJ A;  4I9W A;  1OCC C;  1XNQ O;  2QTS A;  2QJ1 A;  4GGL A;  3A0R A;  2VWJ A;  4B7P A;  5JCO C;  3CCR V;  5CA0 A;  5D7D A;  5IJ9 B;  2Q5Z A;  2LQT A;  4TQD A;  4DR2 O;  1MSW D;  2PI5 A;  4HYP A;  4LFC O;  5LOV B;  3JD2 A;  4AWO A;  1THZ A;  2YEG A;  1NR7 A;  2QEX V;  3HKD B;  4I50 A;  4BIU A;  1MU5 A;  3ASO C;  4X8A A;  2JS3 A;  4X20 A;  4F6R B;  4DV1 O;  3OW6 A;  4XDJ A;  3C3S A;  1GTO A;  1TA8 A;  2NR5 A;  1BCC H;  1FKA O;  1H8H G;  4H33 A;  1PPJ H;  1DTO A;  4FCR A;  1YSC A;  5IWA B;  3TZ5 A;  4DV2 O;  3T4D A;  1GKX A;  1FFX B;  5GTI Z;  5LA6 A;  3T1H B;  2KKW A;  1IXM A;  5BMV A;  5LL6 Y;  2ZIO A;  3LNN A;  5EIB D;  3A0H Z;  3OTO O;  4C7U A;  5D7R A;  5M4N A;  3F5T A;  2JIZ G;  3CRK A;  4XD8 A;  3EHB B;  2YSU B;  3WG7 C;  3QNE A;  4EKW A;  1I5A A;  4E01 A;  2KSD A;  2WLM A;  4UCU A;  2AZ0 A;  1BHB A;  1YS3 A;  4XC0 A;  4I3H A;  1XNR O;  3U2K A;  4H0L B;  3K58 A;  1ZL8 A;  4XKA A;  2OIG A;  1K34 A;  4LP0 A;  3PJS K;  3OR6 C;  4WFF A;  4PHZ A;  4NTX A;  3L70 H;  5H6R A;  1NR1 A;  4JQL A;  4BR6 A;  2VW5 A;  1HNX B;  1YET A;  3JAK A;  2Q8V A;  4CH3 A;  3VQX A;  2HG5 C;  1Q86 W;  3FX7 A;  2ITD C;  1UY9 A;  1S5L Z;  1AMW A;  1ENV A;  3CEI A;  4ABM A;  4NH7 A;  3T2S A;  3LSS A;  1XL6 A;  2H3O A;  4AQY O;  3ZMT A;  5C8Y B;  3JAK B;  5H5N A;  5GW7 A;  2B1G A;  2YKI A;  2WLH A;  3APO A;  4MTG A;  4GEE A;  4O0B A;  4XTJ A;  2CAZ C;  4YXW G;  1I58 A;  4YKW A;  1S16 A;  3A0T A;  1Y4U A;  3T1K A;  2CGO A;  4IT5 A;  4OPH A;  2BU7 A;  4IYI A;  2DOS A;  4X64 B;  3EXA A;  4QE9 A;  2BTO A;  2A0L A;  2WLN A;  2IWS A;  3K5L A;  2B9Z A;  3OMA B;  4IL6 Z;  1J95 A;  2EBO A;  4FZ0 A;  2P7T C;  3EHJ A;  1QLE C;  2WI1 A;  5D7C A;  3D36 A;  3B09 A;  2YE7 A;  1BMF G;  1B62 A;  4WUC A;  2YID A;  4DR1 B;  4B7E A;  4CC5 A;  5LMN B;  1Q7Y W;  4E00 A;  4JYB A;  1M9N A;  2PY5 A;  1ZWH A;  2OCC B;  2PI4 A;  3ZHQ A;  3WU2 Z;  3VQW A;  2XJG A;  2UXB B;  4DR4 O;  5CF0 A;  1NJI W;  2P67 A;  4R3A A;  1BSM A;  2DYR C;  5JWP A;  2EXL A;  2IJH A;  3BPZ A;  3SPJ A;  2YK2 A;  4IHJ A;  4LWI A;  1XNQ B;  4JI2 O;  1XUQ A;  2A79 B;  2WWW A;  1TIL A;  5L3C A;  1UYL A;  2EJR A;  1Z59 A;  1Y76 A;  2CTP A;  1NVP B;  4AWQ A;  4FFB A;  1QNM A;  1R73 A;  4DR2 B;  3OFN G;  2OTJ V;  1UYG A;  4LFC B;  2YEC A;  3D3Q A;  3CCV V;  2EIN C;  3OMU A;  4ASG A;  3IAY A;  4FFB B;  1H2L A;  2IW5 A;  3BY6 A;  4JAV A;  4DV1 B;  4R1F A;  1DLB A;  3WG7 B;  1L8D A;  4NH9 A;  4YJ2 A;  4E02 A;  3AG1 B;  1I0H A;  3EKO A;  2QA4 V;  2BU6 A;  4TQF A;  5IN9 A;  4QNH B;  4MPN A;  2YEF A;  4DV2 B;  2Y48 A;  1VP7 A;  2AHY A;  3O2F A;  3AK2 A;  5LP6 C;  2FXS A;  3RYF A;  5K1P A;  2QGN A;  1BKN A;  3BM9 A;  3CGZ A;  3CX5 F;  3OTO B;  4L8Z A;  4R3M A;  3H1H H;  4HXW A;  2ZBK B;  1MG1 A;  1UYK A;  4LWH A;  3WB0 A;  3TUH A;  3RYF B;  4MT8 A;  3SJC C;  5CA1 B;  3CD6 V;  2VCI A;  2Q0O C;  3WFV A;  4JYC A;  1R1B A;  4B08 A;  4XE2 A;  1GO3 F;  1NTM H;  5KAI Z;  3AK1 A;  3OTF A;  3T1Y O;  1XNR B;  5L3E A;  2QM4 A;  1D5N A;  1M56 B;  1F23 A;  2UU9 O;  5LMU O;  4HAM A;  2BRE A;  1VQK V;  2LGQ A;  3RYC B;  3ZHT A;  2OWO A;  4W4L A;  5KHK A;  2YXL A;  1P4R A;  4GLX A;  3FT8 A;  2ZE8 A;  4YKQ A;  2FWZ A;  4DYL A;  2X7R B;  1VAR A;  2MW2 B;  4WFE A;  4WFB V;  4EM7 A;  4PA6 A;  1XBL A;  2ZDX A;  2BSM A;  1SS3 A;  1WLE A;  4U7O A;  4NYK A;  3B25 A;  3RKZ A;  2Q9L A;  4AQY B;  1QLE B;  4NR1 A;  3A8T A;  1OCR C;  4FLT A;  4P30 A;  2ZDI A;  2WLK A;  2EIK C;  5BOD A;  5M4H A;  2E3C A;  3D8C A;  2BE3 A;  3JAM N;  4KHP O;  4EGI A;  2HVK C;  3JD3 A;  3M99 B;  4G2K A;  2BSK A;  5DED A;  2L35 A;  3ZRW B;  1K8A W;  1LUW A;  1Z5C A;  3B4S A;  2M6Y A;  5KA6 A;  2WER A;  5CN0 A;  2HHH O;  3AEI A;  1FPO A;  2KQX A;  2XCM A;  5KA5 A;  1URF A;  4O4H B;  5B1A C;  1VEW A;  3KKY A;  1SKV A;  1SET A;  2BCC H;  2JEX A;  2XDS A;  1NHJ A;  4DZY A;  3O0I A;  2V7Q G;  2XAS A;  4U7N A;  4XDK A;  1S76 D;  5FND A;  4BIO A;  3FAV A;  3ZMV A;  1NHI A;  2WI5 A;  1SA0 A;  3BHP A;  4N21 A;  2G38 A;  3AK3 A;  3GIG B;  4YHH O;  4DR4 B;  1VQ6 V;  1VQO V;  1UYD A;  1EZV H;  2JS5 A;  4P7A A;  3SYP A;  2EIN B;  2YUA A;  5LGT A;  4LF4 O;  1SQF A;  5LXT A;  3CMA V;  2DMX A;  3RLQ A;  3UO3 A;  4YKT A;  5JJN B;  4L93 A;  4UVB A;  4JI2 B;  1QYE A;  4R8C A;  4BAE A;  4IGG A;  4FPP A;  4X62 O;  2GTS A;  1B6Q A;  5LXT B;  5CTX A;  2LJ2 A;  5L3F A;  5EYP A;  2UXC O;  3ZXO A;  1NS1 A;  5E1A C;  5CTU A;  3FB5 C;  5LP6 B;  3G6B A;  4O2A A;  5J9P C;  1P7B A;  1N34 O;  2YEV A;  1JFF A;  1VQ5 V;  4R7C A;  3VQY A;  3CPW U;  4EGH A;  3MHS C;  5FLX N;  2FYP A;  3CJH B;  3JAT B;  4BWA A;  5IJ0 B;  2ZCE A;  2ZXW B;  2Q8G A;  1NTK H;  4MVS A;  1VF7 A;  2P90 A;  1JFF B;  4DK0 A;  2DN9 A;  2CH7 A;  4LF7 O;  3G80 A;  5DN6 G;  2WSS G;  5IYZ A;  4O04 A;  2FB5 A;  4NKG B;  1YJ9 V;  2HKO A;  4L91 A;  4FMT A;  3TET A;  4ZIB A;  1UYH A;  2YI5 A;  1BGY H;  4ZI7 B;  2A06 H;  5TIS Z;  2EZO A;  3G4S V;  4ASF A;  1UY6 A;  4P9O A;  4URL A;  3CC7 V;  2WI2 A;  2IM9 A;  4XDL A;  1UJW B;  1MSD A;  1OHH G;  5IYZ B;  1HP8 A;  4JI6 O;  4PV1 B;  1NTZ H;  4MVU A;  2UUC O;  4J41 A;  4I0X A;  3H80 A;  1PL4 A;  4G28 B;  2BYH A;  1TUE B;  2NLJ C;  3T1Y B;  1TUB B;  1VQM V;  2IJI A;  4X1Y B;  2UWD A;  4UVA A;  5JVD B;  5LYJ A;  2UU9 B;  1Q82 W;  5LMU B;  5JJE B;  1VQP V;  2GFD A;  1K5Q A;  1H38 A;  2QM7 A;  4CBC A;  2CCT A;  3HB3 B;  4O4I B;  2UUA O;  2F66 C;  3ZXQ A;  4MVQ A;  3SGI A;  4DV7 O;  3ZCC A;  4E72 A;  3LUT B;  2YI6 A;  2F93 B;  1GM7 A;  3ZS8 C;  5B3S C;  1NHH A;  4ZBM A;  3GIE A;  3AG2 B;  2ZNI A;  5B1A B;  2GUZ A;  4MSW C;  2R9I A;  4P9P A;  3E22 B;  4LCU C;  3RGB A;  1KMI Z;  1OZ0 A;  3WB1 A;  4RUE A;  5FPR A;  4JI5 O;  2OT5 A;  2XAB A;  4W4K A;  1ZW9 A;  4CS3 A;  3ABL C;  4J7J A;  4P8O A;  4KHP B;  1ZWI C;  4WBN A;  4JI1 O;  1KC8 W;  2E76 B;  2HVJ C;  4X89 A;  4O4J A;  4DR7 O;  1ZAU A;  5HFM A;  4KTN A;  4YKU A;  2CK3 G;  2IOP A;  4LWG A;  2HHH B;  1U96 A;  5KX5 B;  4WBN B;  1FFT B;  4GUN A;  3SL2 A;  4FM0 A;  4FM2 A;  4JGS A;  5CBG A;  1W2B U;  2ZKO A;  1H2S B;  2BOC C;  4X9L A;  4CWP A;  1VMG A;  3OMI B;  5JJJ B;  2VQE O;  1NH2 B;  5EK0 A;  3L75 H;  2RQ6 A;  2JGD A;  4DV4 O;  3ZHR A;  3ABM B;  4YHH B;  1ZX3 A;  2PYJ A;  5GTH Z;  4GKJ O;  2GSM B;  2GDS A;  1YER A;  1DK1 A;  4LF4 B;  3FFQ A;  4IYH A;  3HKE A;  5KLV H;  2IH1 C;  5EIB C;  3K5O A;  4YKY A;  4H13 B;  2YI0 A;  2GQP A;  2RMK B;  2H94 A;  3M7M X;  1OV9 A;  1Q43 A;  4X1I B;  5JH7 B;  5L3B A;  4KXR A;  3H01 A;  5EBW C;  3INX A;  3WHA A;  4ZVI A;  3ASN C;  5KMG B;  4X62 B;  1J5E O;  3DC5 A;  4K0K O;  1XRE A;  3HKE B;  3OGI B;  4D7S A;  5ITZ A;  2UXC B;  1JCH A;  2O57 A;  3FB8 C;  3CME V;  2XHX A;  5B1B B;  4L90 A;  3CCJ V;  3BMY A;  3QVN A;  2IU0 A;  3KZI Z;  3ZX6 A;  1N34 B;  3K3W A;  5H9C A;  2ILM A;  4TV9 A;  4DW1 A;  3WB2 A;  4B3S O;  4CWT A;  1BQZ A;  2ARH A;  5ITZ B;  3JAS B;  1SZT A;  1M93 A;  2XDK A;  3VAD A;  4I55 B;  2ZE5 A;  2BU5 A;  1Q6H A;  3ZED A;  1RSO A;  2CGN A;  3MAQ A;  4TV9 B;  2EIJ C;  2VQF O;  4LF7 B;  4EGK A;  5CB4 A;  5KHH A;  2LO1 A;  2R9R B;  5M4K A;  4J9Z B;  3UM7 A;  4BIZ A;  2JDI G;  1P7G A;  3NXS A;  4DO2 A;  4HZ3 A;  3T10 A;  4PA4 A;  2C2A A;  1GRJ A;  5CB4 B;  4MVO A;  3ICX A;  4MPC A;  4EB6 A;  4JI6 B;  1PKX A;  5B3S B;  1IDS A;  2UUC B;  4CH4 A;  1GMG A;  1AI7 A;  3CWB H;  3JAW B;  4GCZ A;  4BXI A;  4A5U B;  4MW8 A;  5EC1 C;  4GT1 A;  4JTD B;  2N74 A;  5IJ9 A;  1UPG A;  3H4L A;  2QWP B;  3BCC H;  4EB6 B;  4BW9 A;  1Z5W A;  2LW7 A;  5LOV A;  4GZR B;  4KUM A;  3A0B Z;  4DK1 A;  3ABL B;  2UUA B;  2IOR A;  5DEC A;  3HKD A;  2K5B A;  4DV7 B;  3N2K A;  2YI8 A;  1YIJ V;  3ETD A;  4F6R A;  4JF3 A;  4CS2 A;  4ZKI A;  4XCL A;  1U97 A;  2YKB A;  4FLZ A;  2PUS A;  2YXH A;  2UXN A;  4PA3 A;  3B27 A;  3EHG A;  3K03 A;  4OX9 O;  1I5X A;  1JR9 A;  2QE7 G;  1H2N A;  2H8P C;  4RUF A;  2YS8 A;  1GM9 A;  3N2K B;  1FFX A;  1FXK B;  1L0L H;  1NT2 B;  2R70 A;  5LHG A;  1EA6 A;  1UY8 A;  5KHI A;  5GON B;  3R91 A;  3ZMS A;  1I5D A;  4JI5 B;  3D36 C;  1M57 C;  1SQP H;  1GKF A;  1YES A;  2HP8 A;  4O05 A;  1S72 V;  1NBM G;  2AGA A;  3I5D A;  4JI1 B;  2YXY A;  1KUQ A;  2QWN B;  4ZHQ B;  5CBH A;  2OIE A;  1H2G A;  3KG2 A;  1JQ0 A;  2LW1 A;  1OCZ C;  2CTR A;  2YKC A;  4YKR A;  2AXT Z;  4PDM A;  3R4N A;  1D2D A;  3HEK A;  2P22 C;  3R4M A;  4O4L B;  1WAZ A;  3EFF K;  2HHI A;  1CXZ B;  2HJF C;  3BA9 A;  4PU9 A;  4OXS A;  1YTF B;  3ZHV A;  2LFR A;  4J10 A;  2JK5 C;  2XOK G;  1Z5B A;  4EEH A;  3G7E A;  3TCU A;  5E79 Z;  3CC2 V;  5IT9 N;  3CSX A;  3HR0 A;  3ASN B;  2VQE B;  3OR7 C;  4KSG A;  4ASB A;  2YEJ A;  4DV4 B;  1UFI A;  4JAS A;  1EFR G;  1R6T A;  3KCX A;  2JKI A;  4GKJ B;  1N0J A;  5C8Y A;  1KIJ A;  1PVG A;  4JI4 O;  1Y74 B;  1YEW A;  1IUR A;  1AM1 A;  4J11 A;  2C1I A;  2W6J G;  3CE2 A;  1AR1 B;  2VCJ A;  4DR6 O;  1J5E B;  4K0K B;  1L0O A;  3HKC B;  1TAE A;  2RDC A;  1EZJ A;  5F2V O;  2YK9 A;  1OJH A;  4DUY O;  4X1K B;  1U2O A;  3RN4 A;  3APQ A;  2ATK C;  5M4P A;  5IYB O;  1XEQ A;  3LDE A;  1XL4 A;  2RJZ A;  4WUD A;  4PDL A;  3ZJZ A;  4B3S B;  2QWQ B;  3J81 N;  3K9S A;  1V54 B;  1BQ0 A;  3ZRS A;  2CUG A;  2QWO B;  4YJ3 B;  3VHC A;  4XKO A;  2Y0P A;  1Y8N A;  2GV9 A;  4JAA A;  5JCO A;  4NTW A;  1Q6U A;  2VQF B;  2QSA A;  3SYC A;  2QKA A;  5BXZ A;  1K4C C;  2XX5 A;  1OCC B;  1YVW A;  2DYS C;  2ADQ B;  1R3I C;  1XOU A;  3CWV A;  2YE2 A;  1HNW O;  1TC0 A;  5M4E A;  1XIL A;  1JA8 A;  2DQ3 A;  2V4D A;  2BT0 A;  1VF5 B;  3RYH B;  4O2B B;  2YEB A;  1US6 A;  4LH6 A;  1ARO P;  1OCO C;  2PNR A;  1GJV A;  2H55 A;  3JYC A;  3K04 A;  3E8F A;  5D5Q A;  4URO A;  1ZTE A;  3ASO B;  1B3Q A;  4JZG A;  1YJW V;  1AIL A;  2Q0A A;  3E35 A;  2JEU A;  4D7T A;  1R3L C;  1M1K W;  2FKX A;  3E8G A;  5LHI A;  1M57 B;  4UCS A;  3D0B A;  3B2E E;  1D5A A;  1R6N A;  3MHH C;  4DV0 O;  2K9P A;  4JV5 O;  1L0N H;  2O1V A;  3HZ5 A;  1QY8 A;  4HZ0 A;  1WPB A;  4HY1 A;  4TUY B;  5IE9 A;  5K1X A;  4BAY A;  3ZHU A;  4OX9 B;  3LNM B;  1NVP D;  1RM1 C;  1Q5O A;  4YKX A;  2HCH A;  2ETN A;  2RN9 A;  2Q2E B;  2WA3 A;  2EIM C;  5LBQ A;  5D5P A;  1QQC A;  1Y4M A;  2XK2 A;  1ID0 A;  2DE0 X;  3H1I H;  4LF9 O;  3VBB A;  2LP7 A;  5CA3 A;  3FB7 C;  2QFO A;  2WLL B;  2YE3 A;  3SPH A;  1TVK B;  5CA1 A;  1K9M W;  5C93 A;  2AHZ A;  4PDV A;  4PJ0 Z;  4AWP A;  2ZE6 A;  5J2U B;  2WEQ A;  4JI3 O;  3CRC A;  2P6J A;  2CH4 A;  3P30 A;  3RYC A;  3JSN A;  3N2G B;  2YIB A;  4WUB A;  5BY1 A;  3Q5L A;  2E5L O;  3K0G A;  4B3M O;  1QR9 A;  2BU8 A;  2XHR A;  3IFX A;  4XIT A;  1RFY A;  2DWE C;  4UFZ A;  3STZ C;  4RQF A;  2A3Q A;  2QWR B;  3C11 A;  1KYO F;  2YJX A;  1IXB A;  3SPC A;  1Z2G A;  1GKZ A;  3JSL A;  5BR8 O;  4PL9 A;  4RQE A;  3A0Y A;  3CCE V;  1JM6 A;  4JI4 B;  4DV6 O;  4CS4 A;  1AI4 A;  3AG3 C;  3K08 A;  5CMU A;  3ABK C;  2YIB D;  2JRI A;  4ZOL B;  5J2T A;  2YGE A;  3CRQ A;  4DR6 B;  3QF7 A;  3SR2 C;  1R6K A;  1IZ3 A;  3OEE G;  1FS0 G;  1H7S A;  1M4U A;  3ZIA G;  3NR7 A;  3ZRW A;  1Q3E A;  5IY5 C;  2B1I A;  4X66 O;  4DUY B;  5J2T B;  2ODM A;  4WFG A;  3TTZ A;  5M4M A;  4O4H A;  3U0Z A;  4GX2 A;  2ZM6 O;  3JD0 A;  4PA9 A;  1K92 A;  4AI8 A;  4MTX A;  1FXV A;  2WI6 A;  1KQS U;  4W7T A;  1OCO B;  2N04 A;  2XHT A;  4QPJ A;  2CTW A;  2RNB A;  3SJA C;  5DM6 V;  5FL7 G;  1SQX H;  2DYR B;  1T5E A;  2Y69 C;  1JJ2 U;  1HNZ O;  5HFL A;  4JAU A;  1Z5V A;  4LNU B;  4MW3 A;  1Y8P A;  3GIG A;  3I56 V;  2YDE A;  1H2K A;  2E0A A;  3N27 A;  4TT3 G;  4CH5 A;  1PV0 A;  2CCU A;  1HNW B;  3LSQ A;  3OM3 B;  1VF6 C;  2QTO A;  1XHZ A;  2UXD O;  4LWS B;  1KKC A;  4G27 B;  4KFG A;  1GN2 A;  1IBL O;  1SQQ H;  3KCY A;  4LPB A;  2OCH A;  3HKB B;  4F4L A;  2BU2 A;  2XDL A;  2JGU A;  1UYM A;  5LGU A;  1RM1 B;  3K79 A;  1B63 A;  5JQG B;  1THN A;  2ZIN A;  1VQ8 V;  3K98 A;  3TZ4 A;  2EIM B;  5LP6 A;  3IGA C;  2BOB C;  2L6L A;  4JPR A;  1WNS A;  2QDO A;  2O1U A;  1KU9 A;  4JZ2 A;  4DV0 B;  4JV5 B;  4LWE A;  1DF5 A;  3CJH A;  4QPK A;  3JAT A;  2XT9 A;  1UYE A;  5IJ0 A;  4UCO A;  1E1Q G;  1AP6 A;  1P49 A;  2EJ7 A;  4PI2 A;  1VQ4 V;  1YC3 A;  3SJQ C;  4WFA V;  1AI5 A;  4B6C A;  1AVM A;  4Z1V A;  3CC4 V;  4CWS A;  2ZD9 A;  3T0Z A;  3B24 A;  3QO7 A;  3FT5 A;  3FYE B;  3OWD A;  1AJQ A;  1KP3 A;  2QKS A;  1VQN V;  3RLR A;  3SYO A;  4KFM A;  2Z5U A;  4ZI7 A;  2XAQ A;  4LF9 B;  2C1G A;  5FNV B;  4KQV A;  4NTY A;  3B8M A;  4Q20 A;  1US7 A;  2MK3 A;  1NKD A;  4E4E A;  1P84 F;  2QKC A;  1R62 A;  1TUB A;  5EZY B;  4X1Y A;  3C90 A;  1ORQ C;  2P06 A;  2E74 B;  4JI3 B;  5JVD A;  3AG3 B;  2QM8 A;  3ABK B;  4L87 A;  5IYC O;  4O4I A;  4DV5 O;  2E5L B;  1PL0 A;  3J80 N;  4KSH A;  4B3M B;  5A2Q N;  3CCQ V;  1OCR B;  1GAX A;  2EIK B;  1LNQ A;  4IIJ A;  4LBE C;  2F95 B;  2YE4 A;  1N32 O;  1AJN A;  4H81 A;  5BR8 B;  1K7D A;  4FK5 C;  3E22 A;  4HNA B;  4XKK A;  4CWF A;  4DV6 B;  5F3K A;  4MP2 A;  4IIJ B;  1MOF A;  2Y0I A;  2RCV A;  4DRX B;  2XX2 A;  1JOY A;  1JPX A;  4CWR A;  3EVK A;  1KKD A;  2XAF A;  1X59 A;  3RW0 A;  2Y69 B;  4JTC B;  3A0Z A;  3HZ1 A;  3RT3 C;  4LR3 A;  1HR0 O;  2FML A;  3SPI A;  1GK9 A;  1YI2 V;  1BT8 A;  3ETG A;  4X66 B;  1N36 O;  1MA1 A;  3TGU H;  4URM A;  1Y8O A;  4TSF G;  2CGF A;  1F4N A;  5JEN A;  5KX5 A;  4N23 A;  4YY3 O;  2ZM6 B;  3H1K H;  3O6O A;  3VHA A;  4EFU A;  4FVM A;  4K3A A;  1AR5 A;  2BYI A;  3UT5 B;  3B40 A;  4QJF B;  1HNZ B;  3U67 A;  3CRA A;  4MVZ A;  2D3O W;  4JI8 O;  5CTW A;  3ETE A;  2KG7 B;  2N05 A;  1I5Y A;  2UXX A;  2XAJ A;  1EN4 A;  2WI3 A;  3F7V C;  1LUV A;  2OYQ A;  4Z1M G;  2UXD B;  2YEH A;  4MPE A;  1G4Y B;  2YEA A;  1YF2 A;  1IBL B;  2OTL V;  1YCI A;  4X1I A;  5JH7 A;  1AR4 A;  4EFE A;  4QGP A;  3DXR B;  4UCV A;  5KMG A;  3CP1 A;  1YT1 A;  1NH2 D;  2IWU A;  2YED A;  3JCZ A;  4CWN A;  4TWK A;  1CEZ A;  2YI7 A;  1WA8 B;  1BL8 A;  2YE8 A;  3CRR A;  3M8A A;  3J7A U;  2W6I G;  3ABT A;  3E8H A;  3MDS A;  4XIR A;  1GN6 A;  1XMQ O;  5LGN A;  1S14 A;  2VWC A;  3JAS A;  4X88 A;  4I55 A;  4CH6 A;  2Q4P A;  4NXM O;  3DTU B;  1EM1 A;  1U0Z A;  4DR3 O;  1BZK A;  5EBL C;  1VQL V;  2Z0A A;  3TXQ A;  1YT0 A;  3VQV A;  1H2M A;  3BEH A;  4HYM A;  4FM1 A;  2DQ0 A;  4FCP A;  3L74 H;  1AJ6 A;  4LF6 O;  4BQG A;  4U3F H;  2BZ5 A;  2Q7H A;  3S3W A;  3SJB C;  2XJX A;  4X9Q A;  3K59 A;  4DXW A;  1PP9 H;  5FNC A;  1AH8 A;  3FD9 A;  3CYO A;  3CRM A;  3JAW A;  2LFS A;  3IC9 A;  5KHJ A;  1Q81 W;  3CB2 A;  2KB1 A;  4BW5 A;  1AB3 A;  1FD9 A;  3QDD A;  3ZRV A;  3OMN B;  2LGW A;  4DV5 B;  4FLW A;  2EX3 A;  2YE9 A;  4MB9 A;  4CE3 A;  4K4O A;  3S3X A;  5FWK A;  5F5R A;  1N32 B;  3IJ4 A;  5KUM A;  3L9D A;  1TGO A;  2ZE7 A;  4EEQ A;  3OWB A;  1FXK A;  4LF5 O;  2IH3 C;  5GON A;  5IDJ A;  4JI7 O;  4DUZ O;  3ZHS A;  2GHY A;  2WLI B;  4PI0 A;  4I4T A;  2BTZ A;  3Q5K A;  2XUM A;  5H6Q A;  4ZHQ A;  5D6Q A;  1RPR A;  1HR0 B;  2WLJ A;  1MX0 A;  3LMM A;  2K1E A;  2OCC C;  1DGS A;  4RO2 A;  4AIL C;  1KD1 W;  4UB6 Z;  2NNU A;  3BAA A;  3PN1 A;  1N36 B;  3CGY A;  5B1O A;  1YC1 A;  3QO8 A;  4QE7 A;  4O4L A;  3Q5J A;  1CPY A;  3O65 A;  3F5W C;  4I4T B;  5KAF Z;  4YY3 B;  4LFA O;  4DR7 B;  1AP5 A;  1IVS A;  1HDJ A;  5CA0 B;  4XIQ A;  1I08 A;  2IJJ A;  2W0X A;  1NI8 A;  4H85 A;  4F6E A;  3QTF A;  3OPD A;  3MD0 A;  3HYZ A;  3U11 A;  1VQ9 V;  1W59 A;  4JI8 B;  2Y4U A;  2D2C B;  4I50 B;  2HR3 A;  1KBH A;  4FZ1 A;  1YXB A;  4X20 B;  3UKM A;  3R92 A;  1Y67 A;  3TXS A;  4I9Q A;  2XDU A;  5B66 Z;  3A2F A;  1Y74 A;  3GWO A;  3R66 A;  1YTF D;  1WJZ A;  1UYC A;  3RLP A;  4ASA A;  2QR4 A;  2Q73 A;  3FV5 A;  4ASU G;  2XAG A;  4GQT A;  4PRX A;  3G71 V;  1SQV H;  1WP8 A;  2F23 A;  5LA6 B;  3AG1 C;  4FJC C;  4EMV A;  1E1R G;  5BMV B;  5EBM C;  3HKC A;  5KHG A;  1SZX A;  1N4C A;  4LH7 A;  3OD4 A;  4V25 A;  3E86 A;  4DV3 O;  4X1K A;  3MNR P;  4CE2 A;  4OPA A;  4WFH A;  4GYC B;  2HLD G;  4TOI A;  1BGQ A;  1XMQ B;  3JAR A;  3BA8 A;  2EIJ B;  1SRY A; 
#chains in the Genus database with same CATH homology
 3STZ C;  4RQF A;  1YJ9 V;  1VQ7 V;  2HKO A;  4FMT A;  3TET A;  2DWD C;  2EIL B;  2A9H A;  2EZO A;  2M7W A;  2Q68 A;  2ZR3 A;  2Q6A A;  3AG4 B;  4P9O A;  3SPC A;  3G4S V;  4RQE A;  3CC7 V;  3CCE V;  4XDL A;  1UJW B;  3FB6 C;  1OHH G;  1AI4 A;  4PDR A;  3OE7 G;  4MVU A;  2EZP A;  3D3I A;  1AJP A;  2XAH A;  3AG3 C;  3K08 A;  3F7Y C;  5CMU A;  3ABK C;  4G28 B;  1TUE B;  1M56 C;  2NLJ C;  1GM8 A;  1R6K A;  3K06 A;  1VQM V;  2IJI A;  3OEE G;  1FS0 G;  4UVA A;  5LHH A;  3E89 A;  3ZIA G;  4QIW F;  3ZRW A;  3CCU V;  3T1C A;  1VQP V;  1Q82 W;  1K5Q A;  4UUJ C;  1H38 A;  5IY5 C;  2B1I A;  2QM7 A;  4CBC A;  3E2E A;  3HB3 B;  3R65 A;  3RVY A;  3K0D A;  4MVQ A;  4WFG A;  4UVC A;  2WLI A;  3ZCC A;  4GX2 A;  3B8N A;  3JD0 A;  3LUT B;  1V54 C;  4PA9 A;  4PEL A;  1K92 A;  1GM7 A;  4MTX A;  3SPG A;  5B3S C;  5IYD O;  4ZBM A;  1FXV A;  3AG2 B;  1KQS U;  1OCO B;  4QPJ A;  5B1A B;  5CBF A;  2X6C A;  4P2Z A;  4MSW C;  4MTF A;  2R9I A;  4P9P A;  5DM6 V;  5FL7 G;  2V1D A;  2DYR B;  3B77 A;  1R3J C;  3CCL V;  2Y69 C;  1E79 G;  4LCU C;  1JJ2 U;  1OZ0 A;  5HFL A;  4JAU A;  4I9W A;  4RUE A;  4MW3 A;  1OCC C;  2OT5 A;  3A0R A;  3I56 V;  3ABL C;  4XBF A;  3CCR V;  4TT3 G;  4MVM A;  1ZWI C;  2ZDI C;  1KC8 W;  1MSW D;  3LSQ A;  3OM3 B;  2PI5 A;  2HVJ C;  4RAI A;  4X89 A;  2QTO A;  5HFM A;  3JD2 A;  1THZ A;  4G27 B;  2CK3 G;  3X2Q C;  1AI6 A;  1NR7 A;  1OCZ B;  1FXH A;  3OUF A;  2QEX V;  4F4L A;  4J9Y B;  3ZN0 A;  4BIU A;  3ASO C;  4X8A A;  3RVZ A;  4MS2 A;  5LGU A;  1RM1 B;  1FFT B;  3K79 A;  4XDJ A;  1PNL A;  4JGS A;  1GTO A;  5CBG A;  1W2B U;  1VQ8 V;  2BOC C;  2EIM B;  2WLL A;  3IGA C;  2BOB C;  3CCS V;  1H8H G;  4H33 A;  1DTO A;  3P32 A;  1YSC A;  4JPR A;  3T4D A;  3OMI B;  4MTO A;  1H8E G;  3QO5 A;  1NH2 B;  1R3K C;  5EK0 A;  3ZRX A;  1DF5 A;  4QPK A;  1IXM A;  3ABM B;  1EBO A;  4MVR A;  2GSM B;  1E1Q G;  1KP2 A;  1Y66 A;  1MAB G;  1V55 C;  2JIZ G;  1VQ4 V;  3SJQ C;  4WFA V;  1AI5 A;  2XND G;  3EHB B;  2IH1 C;  2YSU B;  3WG7 C;  3CC4 V;  3QNE A;  4EKW A;  2ZD9 A;  3CXC U;  2WLM A;  2JJ1 G;  3QO7 A;  2H94 A;  5L3B A;  3FYE B;  1BHB A;  1AJQ A;  1KP3 A;  2QKS A;  4JTA B;  1VQN V;  3K9A A;  3H01 A;  5EBW C;  4KFM A;  3SYO A;  2Z5U A;  3ASN C;  4UV9 A;  2XAQ A;  2IJK A;  3GB7 C;  1JCH A;  3FB8 C;  1K5S A;  3B8M A;  3CME V;  1K34 A;  4Q20 A;  3PJS K;  3OR6 C;  4WFF A;  5B1B B;  2MK3 A;  3CCJ V;  1NKD A;  5H6R A;  1NR1 A;  2IU0 A;  3OW2 U;  3K3W A;  1S3J A;  5H9C A;  2HG5 C;  3SYA A;  1Q86 W;  1SZT A;  1ORQ C;  2ITD C;  2ZXW C;  2FTK A;  1ENV A;  3AG3 B;  3LSS A;  1XL6 A;  4E2L A;  2QM8 A;  3ABK B;  4L87 A;  5IYC O;  3ZMT A;  5GW7 A;  2B1G A;  2EIJ C;  1PL0 A;  2WLH A;  4MTG A;  3CCQ V;  1OCR B;  4YXW G;  2R9R B;  2X6A A;  3ML0 A;  2EIK B;  1LNQ A;  4J9Z B;  4LBE C;  3UM7 A;  4BIZ A;  1W0J G;  2JDI G;  2DW4 A;  1QVF U;  3NXS A;  2DYS B;  4DO2 A;  1AJN A;  4HZ3 A;  4QE9 A;  2A0L A;  2WLN A;  1K7D A;  4PA4 A;  1WPX A;  4FK5 C;  1PNM A;  2C2A A;  1JX9 A;  3HPL C;  3OMA B;  4MVO A;  1SES A;  1ROP A;  1J95 A;  1PKX A;  1W0K G;  2EBO A;  5B3S B;  1MOF A;  2P7T C;  1GMG A;  1JOY A;  1JPX A;  1QLE C;  1AI7 A;  2XAF A;  4PA7 A;  1YJN V;  1KKD A;  3D36 A;  4GCZ A;  1BMF G;  4MW8 A;  5EC1 C;  1K3E A;  4GT1 A;  1K97 A;  2Y69 B;  4JTD B;  4LC1 A;  3RW0 A;  4JTC B;  3I55 V;  2B5U A;  3LDC A;  1DF4 A;  3SPI A;  1GK9 A;  1YI2 V;  1Q7Y W;  3ETG A;  4JYB A;  4KUM A;  1M9N A;  3ABL B;  4TSF G;  2OCC B;  2PI4 A;  1F4N A;  1QCE A;  4N23 A;  1YIJ V;  1RPO A;  3ETD A;  4JF3 A;  4ZKI A;  1S5H C;  4GX1 A;  3AG2 C;  3FYI B;  2UXN A;  1NJI W;  2P67 A;  4PA3 A;  3X2Q B;  2DYR C;  3K03 A;  1I5X A;  2QE7 G;  3RBZ A;  2H8P C;  4RUF A;  3SYQ A;  5LHG A;  1GM9 A;  1FXK B;  2IJH A;  4QJF B;  4WCE V;  4MVZ A;  3SPJ A;  1JVM A;  2D3O W;  3ZMS A;  2A79 B;  2WWW A;  5L3C A;  1M57 C;  1QBZ A;  3ETE A;  1K33 A;  2EJR A;  1NVP B;  1GKF A;  1I5Y A;  2UXX A;  2WAM A;  2XAJ A;  4GX5 A;  3TK1 A;  3OAA G;  3W7U A;  1YHQ V;  1NQT A;  1S72 V;  1NBM G;  1R73 A;  3F7V C;  5CBH A;  4FIP C;  3OFN G;  2OTJ V;  1H2G A;  3T2M A;  3KG2 A;  1JQ0 A;  4Z1M G;  1G4Y B;  1OCZ C;  3W7T A;  3CCV V;  2OTL V;  4UXN A;  4PDM A;  2EIN C;  1COW G;  1QVG U;  3EFF K;  1V55 B;  2IW5 A;  2HJF C;  3BY6 A;  4JAV A;  3CP1 A;  4OXS A;  1DLB A;  3WG7 B;  1NH2 D;  1YTF B;  1QLN A;  2LFR A;  3JCZ A;  2JK5 C;  2XOK G;  3AG1 B;  1G8M A;  3TCU A;  4TWK A;  2QA4 V;  1CEZ A;  2WPD G;  1BL8 A;  3CC2 V;  2W6I G;  4QNH B;  3ABT A;  3ASN B;  3E8H A;  3OUS A;  2Y48 A;  5KUK A;  4WF9 V;  3ABM C;  3DGE A;  5LGN A;  2AHY A;  3OR7 C;  4JAS A;  4X88 A;  1EFR G;  2ITC C;  1YIT V;  3DTU B;  1MG1 A;  2Z3Y A;  1QR8 A;  5EBL C;  1VQL V;  1S0V A;  5L3G A;  4MT8 A;  2W6J G;  2YEV B;  1AR1 B;  3CD6 V;  3WFV A;  4JYC A;  3BEH A;  1GO3 F;  2DQ0 A;  1S77 D;  3FKS G;  4H37 A;  5L3E A;  1M56 B;  1CP9 A;  1F23 A;  5B1B C;  2JJ2 G;  4HAM A;  1EZJ A;  1VQK V;  1BHA A;  4DXW A;  2ZQM A;  1P4R A;  3E83 A;  5IY5 B;  2EIL C;  3AG4 C;  2ATK C;  3LDD A;  2X7R B;  5IYB O;  3CYO A;  1F51 A;  3LDE A;  1XL4 A;  3ZN1 A;  4PDL A;  3ZJZ A;  2LFS A;  4WFE A;  4WFB V;  4PA6 A;  1Q81 W;  1V54 B;  1WLE A;  3ZRS A;  4U7O A;  1KEC A;  2KB1 A;  4BW5 A;  3ZRV A;  1QLE B;  3OMN B;  1OCR C;  4I5S A;  2IU3 A;  1K4D C;  4P30 A;  2ZDI A;  2WLK A;  2EIK C;  5BZB A;  3SYC A;  1K4C C;  1OCC B;  2DYS C;  2ZR2 A;  2HVK C;  1R3I C;  3JD3 A;  3T4Z A;  3M99 B;  5KUM A;  2DQ3 A;  2HFE C;  4G2K A;  4R6Z A;  1M90 W;  3ZRW B;  1FXK A;  3VOU A;  1K8A W;  2IH3 C;  5IDJ A;  5KA6 A;  1ARO P;  1OCO C;  5CN0 A;  3AEI A;  5KA5 A;  3OGC C;  5B1A C;  3JYC A;  3STL C;  2GHY A;  2WLI B;  3ABU A;  1PNK A;  1SET A;  3JD1 A;  2JEX A;  3E8F A;  3K04 A;  2V7Q G;  3W7W A;  3ASO B;  2XAS A;  4U7N A;  4XDK A;  1S76 D;  1YJW V;  5H6Q A;  1RPR A;  2WLJ A;  3E35 A;  2JEU A;  1M1K W;  1R3L C;  3ZMV A;  2K1E A;  2OCC C;  3E8G A;  1M57 B;  4RO2 A;  5LHI A;  1KD1 W;  1PD3 A;  2NNU A;  3MHH C;  3CCM V;  1R6N A;  4N21 A;  5B1O A;  3QO8 A;  4QE7 A;  1SER A;  1CPY A;  4GX0 A;  3F5W C;  5B1N A;  4CZZ A;  1VQ6 V;  1VQO V;  4BAY A;  3SYP A;  2EIN B;  2IJJ A;  5LGT A;  1FXK C;  3LNM B;  2X0L A;  1NVP D;  3CMA V;  1K73 W;  3IC7 A;  1RM1 C;  1F4M A;  3MD0 A;  3ZMU A;  2F43 G;  1VQ9 V;  2Q67 A;  2EIM C;  5LBQ A;  2X6B A;  1HWY A;  4UVB A;  2W0F C;  4R8C A;  1Y4M A;  2HR3 A;  3W7S A;  4FPP A;  3UKM A;  1B6Q A;  5EC2 C;  5L3F A;  3VBB A;  2LP7 A;  5CA3 A;  3FB7 C;  4UV8 A;  3GWO A;  4KP4 A;  3FB5 C;  5E1A C;  2WLL B;  1YTF D;  5J9P C;  1P7B A;  3SPH A;  2YEV A;  3W7X A;  1VQ5 V;  4R7C A;  3CPW U;  1K9M W;  5C93 A;  4HYO A;  4ASU G;  3OEH G;  2AHZ A;  2XAG A;  3MHS C;  4PDV A;  2DWE C;  3G71 V;  4R50 A;  3AG1 C;  4FJC C;  1E1R G;  1N8R W;  2Q69 A;  5EBM C;  1L1F A;  2P6J A;  3E8B A;  3P30 A;  2ZXW B;  4MVS A;  3E86 A;  2P90 A;  3ZMZ A;  3K0G A;  3JD4 A;  4WFH A;  3G6E V;  1QR9 A;  2HLD G;  3IFX A;  4LP8 A;  5DN6 G;  5L3D A;  2WSS G;  2EIJ B;  1SRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...