1F51A

A transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in singal transduction
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
181
structure length
181
Chain Sequence
ISDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEITSHECLIEIGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in signal transduction.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords SPORULATION INITIATION PHOSPHOTRANSFERASE B
total genus 64
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature ec 2.7.-.-:
pdb deposition date 2000-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14682 SPOB_ab Sporulation initiation phospho-transferase B, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1f51A01
3.30.565.30 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Sporulation initiation phosphotransferase B (SpoOB), C-terminal domain 1f51A02
2C2AA 4JASA 4QPKA 3A0RA 3ZCCA 5IDJA 2P67A 4JYBA 4FMTA 4U7OA 4JAVA 4KP4A 4MT8A 3ZRXA 3ZRWB 2LFRA 5B1OA 3D36A 2FTKA 5B1NA 4GT1A 4MTXA 4JYCA 1F51A 3NXSA 3DGEA 4FPPA 4GCZA 4I5SA 3ZRWA 1JOYA 4ZKIA 2QM8A 4QPJA 2QM7A 4LC1A 2LFSA 4BIUA 2WWWA 4JAUA 4U7NA 4Q20A 4BIZA 3MD0A 3ZRVA 1IXMA 3P32A 3TK1A 5C93A
chains in the Genus database with same CATH superfamily
1VF6C 2UXCB 4DR7O 1NHJA 3A0RA 3C90A 3CCRV 4B3MB 3LMMA 4JI5O 4J7JA 4X88A 3W7WA 1Z5BA 4UCTA 4CWNA 3RYFA 3QTCA 2DJVA 5LHHA 2YI7A 2XDXA 3P3PA 1Y66A 1QLNA 2CH7B 1P4RA 4QNHB 1FFTB 2HVKC 3VQVA 3L74H 3OAAG 2YKIA 2EZOA 4P2ZA 3O65A 4IIJA 1JA8A 3ZRVA 4DUZB 2YE2A 1EBOA 2BTZA 2PY5A 4B7EA 3G75A 3W7TA 3C3SA 1M57C 1NH2D 2ZDXA 1TUBB 3RVZA 4EGKA 2IJHA 4URNA 4PDLA 3HKEB 4H33A 1XI1A 1WAZA 3ICXA 4CC6A 4NKGB 3CYGA 1I94B 3BY6A 2AZ0A 2PGGA 1BQ0A 2XDSA 2EULA 1SKVA 3OE7G 4PDVA 1GTOA 1YEWA 3CCEV 1LUVA 4AWPA 2Y0PA 1R1BA 2JS3A 4GEEA 2BU6A 5LYJA 1M5IA 3TZ4A 2XT9A 1S0VA 3K3WA 4RUEA 5B5EZ 4MVUA 2YJWA 4EB6B 2YS8A 3D36C 5LL6Y 3JASB 3ABLC 3WQ9A 2B5UA 1GM9A 2UUCO 4TSFG 3OUFA 2XAFA 1UYGA 1YERA 4TQDA 1UYHA 1S3JA 2QG2A 3PEHA 1NHIA 4FJCC 4YIOA 3VQXA 4JI2B 1ROPA 3ZHTA 4QPKA 3RYCA 4ASBA 3J7AU 2DW4A 4CZZA 3B4SA 4O04A 5D7DA 2N74A 5IE9A 3ZMSA 1QVGU 4B3RO 3EVKA 1FAFA 4HXWA 2HKJA 5H5NA 3UKMA 4HNAB 1N34B 4DR3O 4DZYA 2FMLA 2GTSA 1DTOA 2ITCC 2YKBA 3T0HA 5KMGA 1R3JC 4I4TB 1JMKC 1TUBA 1KP3A 2LQTA 2VW5A 1Z5AA 1SQGA 1MNGA 1XL4A 3EKRA 1F4NA 4ZBMA 3QVNA 2WI7A 1FJGO 2WI5A 2ZCEA 1VP7A 2LJ2A 2QWNB 3SJCC 4X62B 2W0FC 2R72A 4UCUA 1GN6A 1QCEA 1XHXA 1SERA 5IYZB 3T1HB 4YY3O 1NH2B 2IU0A 2QSAA 4EB6A 4DR5O 5LGNA 4OX9B 1GM7A 5D7CA 3K03A 2KB1A 4R1FA 1PPJH 2BU5A 4FM1A 4FLUA 3ZHSA 2Q2EB 2X6AA 3F5TA 5J9PC 4JI8O 1D5NA 4I9WA 2ZR2A 1IBLO 2UUAB 1SQQH 3K99A 4L87A 4DUHA 3U67A 3T1CA 1Y8PA 3DGEA 2Q7EA 1H8EG 2ITDC 3LSQA 3TJTA 3T4DA 3P30A 2JIZG 4HYOA 1D5AA 3ZRSA 2NR5A 4CC5A 5C8YB 4WFFA 2JJCA 1EN5A 2QKSA 2XAJA 2UXNA 4PD4F 3ZJZA 4JTDB 3BCCH 2WI3A 2X7RB 2DE0X 2JEXA 3K9SA 3DC6A 1FJGB 1K73W 5H6RA 1I5BA 3A0BZ 4A5UB 3EFFK 3CCJV 2YE3A 1H7SA 3BHPA 5EBMC 5EBWC 1VQ9V 2Y69B 4NH7A 3JASA 4X1IB 2WLHA 4LF5O 4WBNB 4MS2A 4XDLA 3CMAV 1OCCC 3CJHB 1F7YA 1NU1H 5BMVB 3O0IA 2ZE5A 4DV2B 2KSDA 4JYAO 2IOQA 4JI3O 1NVPD 1Y67A 4B3SO 3CJHA 3D36A 3CGZA 1KKDA 3ETGA 5JQGB 2ODMA 2YEEA 3I56V 1U2OA 2XAHA 2PYLA 4XIRA 3SYCA 4PELA 5LP6B 4CWOA 2Q0OC 5HFLA 4BWAA 1MMMA 3ZCCA 2CH7A 1VQ5V 4F6EA 1DF4A 1CP9A 2XHTA 2IJJA 1TC6A 3JD0A 4NR1A 4PA7A 2CTRA 4MW3A 3ZN1A 4LF5B 1I59A 2BZ5A 2P4VA 1XREA 1Q5OA 4UCRA 4EGHA 4RQFA 1L1FA 1JJ2U 2WI6A 3JARB 5F5RA 4KFGA 4O4IA 3R4MA 3FB5C 2XX2A 1O9GA 3JZ3A 2OTJV 4TT3G 4HAMA 2N04A 1SQXH 4MOTA 2LW7A 2FYPA 2PI5A 4OPAA 4JI7O 1WB7A 2GQPA 3HZ5A 1H2MA 1QQCA 1TIDA 2Z0AA 4X65B 2YKCA 3TZ5A 4BQJA 3EHHA 4EFBA 2PZSA 3K06A 2QWRB 2YI8A 2EILB 2CGNA 4UCOA 1PV0A 4LF8B 1AI4A 4CH5A 1B04A 1KC8W 3DXRA 1DGSA 1RP3B 2EINC 3THOA 2PTMA 4FLZA 2WPDG 5LP6A 2ZXWB 3MAQA 1I0HA 3AG1C 5C93A 1I08A 3AG3B 3FAVB 5IY5B 1N34O 1W2BU 3OWBA 1YSCA 5KMGB 1QZRA 2ZINA 3N2GA 4X1IA 4JV5O 4GT1A 2LGQA 4WBNA 4U3FH 3A0HZ 3ZKBA 5FLXN 5H9CA 4JAUA 1K34A 2ZE6A 3MD0A 4L8JA 1QNMA 2YIDA 3ZBHA 1UPGA 2EIMC 2KG7B 4LFBO 2CCSA 1XL6A 1I5AA 1HNZB 2JRIA 4K4OA 4YKQA 3K5NA 2BE3A 4CS4A 1J5EB 4OXSA 4TWKA 1UYIA 1JPXA 1PKXA 2GUZB 3A8TA 5FNFA 4JTCB 1UY7A 3FT8A 2EIJB 1S16A 1QR8A 2QM7A 3LNNA 3QNEA 4G2KA 3B77A 1N4CA 2GBOA 3T1KA 4MBCA 5CF0A 1WA8B 4R7CA 4XDJA 2WLLA 4LF7O 3G7BA 5L3DA 1QY8A 1HR0O 4DV3O 3K0GA 4LFCO 4MB9A 4WUDA 3OEEG 4MT8A 1QYEA 4IHJB 3CRLA 3JARA 3RN4A 2ZD9A 2YEHA 2X6BA 3AG7A 1G6UA 2IU3A 2JGUA 4DXWA 1U96A 1TGOA 2EX3A 1GKZA 4LPBA 1K5QA 3HKDA 4P9PA 1VQNV 3FYEB 1Q82W 5BY1A 1FYJA 4RUFA 2V1DA 1E1RG 5ITZA 2P22C 3R92A 3ZXOA 2CGOA 5B1BC 3UT5B 2A9HA 4G27B 4JI1B 5ITZB 4O0BA 2HG1A 3RLRA 4G28B 3A0YA 4FCQA 2YXHA 1WN7A 3JATA 1UY9A 4L93A 4YJ2A 1K33A 4ZHQB 1ZXNA 1AP6A 1NHHA 5CTUA 2VWJA 2ZXWC 4U7OA 4FLXA 2EIMB 2W6IG 3RT3C 2WERA 4DW1A 1H2GA 1B06A 4FLWA 2YICA 1CEZA 2JJ1G 3G4SV 3FAVA 2VS0A 1JFFA 2JEUA 2YE8A 2VQEB 1RSOA 1DK1A 4X9LA 1PP9H 1N36B 1Q6UA 2XJXA 1EN4A 3DTUB 4YKXA 2YECA 2AHYA 1K97A 3SYOA 5CMUA 2DYSC 1NKDA 1W0KG 5H6QA 1BGYH 4MTFA 1URFA 4X89A 1NJIW 3WFVA 2A06H 5CTXA 5L3JA 3TTZA 2FL4A 4H7QA 5L3FA 1Y4MA 4X64O 3A2FA 3N2KA 3M7MX 3H9VA 5IDJA 2P06A 3CCQV 1R6TA 1XNQO 1AJ6A 3HKBA 3CRKA 4JAVA 4F6RA 4AS9A 1MABG 4FFBA 4NXMO 3HHUA 2DWDC 2FTKA 1JX9A 5B1NA 4JI6B 3WB2A 4GYCB 4DV4B 1N0NA 2UU9O 3AG4B 4XITA 1KP2A 1WA8A 3HKBB 3NXSA 2QJ1A 2ZE7A 3K5OA 4QPJA 2QDOA 1YJ9V 3VHDA 1VQLV 1UYCA 2EZPA 4Q20A 4CE2A 5KHHA 4KHPB 2BTQB 5EZYA 2XK2A 3E22A 5LHGA 3JAKA 3K04A 3ASNB 3WHAA 2K5BA 1YF2A 2D3OW 2BTQA 3E2EA 2Q9LA 5LA6B 1CXZB 1PL4A 5LMNB 1OV9A 3SJQC 3K97A 3L72H 4LWEA 5A2QN 4J10A 2YEGA 4NB5A 3PN1A 2XHBA 2XD6A 1XQ8A 1NS1A 1FXKA 1AMWA 1YJWV 5CTYA 5HFMA 1Y4SA 1R6KA 1UYDA 2IORA 1OHHG 1IBMO 2Q8HA 2Q4PA 4DW0A 1MOFA 1K4DC 1XMOO 2E76B 3C11A 1B63A 2PNRA 2BYHA 2UU9B 4R8CA 3ABKB 1NVPB 2CDYA 5IYBO 4I9QA 3N2KB 1IDSA 4O4JA 1V54C 3ASOB 1Z5CA 2ZR3A 1XNRO 1GN2A 3VQWA 5JJEB 3C3TA 4K3AA 3AEIA 2Q8FA 1PNLA 4GT8A 4NYKA 4DK0A 2CCUA 3G6BA 1YC3A 4I55B 1EZVH 1WNSA 1RSOB 4UCVA 4FM0A 2BOCC 2PYJA 2DYSB 4NTWA 4LWIA 2IJKA 3MHSC 5IWAB 1BSMA 2GSMB 1BXDA 3E22B 4CWQA 3ETEA 3B8NA 4ASUG 1N32O 4KUMA 5J2UA 4B08A 4R50A 4CS3A 4PDMA 5EYPB 2AXTZ 5DECA 4YKYA 4XKAA 4XIQA 2WLNA 1OCZC 2ZNJA 4W4KA 4QJFB 3F7VC 1SQFA 4X20A 4AQYB 2WSSG 3E8HA 4I50A 3DC5A 4BR6A 5B3SB 3A0XA 2AGAA 5IWAO 1UYFA 4E72A 5E79Z 2UXXA 3D3IA 3ZHRA 2VQFB 5BR8O 1AH6A 2YEIA 4LNUA 4QGPA 3UT5A 3Q4HB 4UROA 1YHQV 2N05A 3L73H 4DR2O 5FNCA 3I5DA 3JSNA 2QE7G 2YK9A 1AP5A 4XKOA 3T4ZA 4NXNO 3RYIA 4UVBA 4O2AB 3LDEA 1SQPH 2ZT9B 4XE2A 4XBFA 2DOSA 4CH6A 4ZIBA 5LA6A 4DV7O 3EHBB 4K0KB 3R66A 1N32B 4H44B 4FM2A 3APQA 3BEHA 4LFBB 4ZOLA 1S72V 4U3JB 4Z1VA 2OCCB 5LMUO 5J2UB 1WP7A 2RMKB 3K57A 2XHRA 3CMEV 1YT2A 2JGDB 4LF7B 1H8HG 3BABA 4QE7A 4TUYB 5CB4A 3RYHA 3ZKDA 2YSUB 1KUQA 4FCPA 5LP6C 2F23A 2V7QG 3B24A 4PDRA 4DR1B 1OCOB 2HFEC 4XCLA 2YEVA 4DV6O 2F93B 1Y8NA 3R4NA 5GGZA 1Q3EA 3SPHA 2OCCC 5CN0A 2CTQA 2E5LO 4DV7B 1HWYA 3TZ2A 1FFXA 4GUNA 5AG2A 5IJ9A 5L3GA 4X64B 2QWQB 4GX1A 2Q8GA 3JD1A 5CPHA 3LNUA 3CPWU 4JYAB 4F6RB 3TK1A 3K60A 2YE5A 5KX5A 4JQLA 2CGFA 2C1IA 4MVRA 4ABMA 5LOVA 4AILC 1G4YB 5KX5B 3NMQA 2Y69C 3OPDA 3OR7C 1SQBH 3QG5A 3CCSV 1Q43A 1JCHA 2A3QA 1NI8A 2FWYA 2YE4A 1KYOF 1HNXO 3BA8A 5DEDA 3VQYA 2XABA 1D2DA 2JK5C 2WA3A 3HR0A 2QWPB 3JSLA 1NR7A 3GVMA 3H1IH 3UQ8A 4ZI7B 1RM1B 3B2EE 4LFAB 4R3AA 1BQZA 2ZKJA 3C0EA 2C1GA 1P84F 1XDCA 2MW2B 3T0ZA 3LSSA 2FB5A 3RW0A 2IOPA 1UYKA 3HZ1A 3FFQA 4JYYA 1GM8A 1VQMV 4DR3B 4GX5A 4LH7A 4HYMA 1N0JA 4JTAB 1O9HA 4PRVA 3K5MA 2EJRA 4TOIA 1SETA 2YIAA 3CE2A 4E2LA 2OYQA 5KHIA 3OMNB 1M4UA 4H85A 4EEQA 1AVMA 1PVGA 1XNRB 3RBZA 3F7YC 5EC1C 1QU7A 2YKJA 2ILMA 2ZM6O 2CG9A 4GFNA 1YETA 2YEAA 1K9MW 5J6AA 2CE4A 4H81A 3FKSG 2Q69A 4O07A 1Z2GA 5CA0A 4YKZA 4JI4B 4DR6O 3ZXQA 2YEBA 1WP8A 4TV9A 1LNQA 1BL8A 2EIKC 4E02A 4XTJA 4YKTA 1M90W 3OFNG 5LXTB 4ZI7A 1XUQA 3T10A 1OCOC 5B1BB 2HHIA 2QTOA 3CC2V 1B3QA 2YK2A 3ZX6A 4KQVA 3IGAC 3JCZA 5FPRA 3UO3A 3JALB 4BAYA 5FNVA 4L90A 4LWHA 3AG2B 3RFRA 4HZ3A 4IL6Z 5FNVB 3ML0A 3CCLV 5D6PA 4LP8A 1XMQB 1J95A 4AHCA 1Q6HA 3UO2A 3AK1A 2A7WA 5CA1A 4B7PA 5M4EA 1S5HC 3ETDA 2XDLA 3R91A 2JS5A 3OW6A 2EXLA 5J2TB 2OIGA 4DRXA 4PI0A 3GIGB 4BAEA 1L8DA 4J41A 2RCVA 4MTGA 3H1HH 4O2AA 1US7A 4KSGA 4LFCB 1TC0A 2E75B 2XAQA 1GH6A 3SJBC 5L3CA 1L0OA 3FD9A 4YHHO 1N33O 1PL0A 2F43G 1ZW9A 4DR7B 3O2FA 3BFRA 3W7XA 3INWA 2QF6A 1R73A 4WF9V 1UY6A 1AJPA 2BT0A 5K1PA 3JCUZ 1MSWD 2IWXA 1E1QG 4UFZA 2BSMA 5CA0B 2YJXA 1I5CA 1M57B 5J71A 5LYJB 4D7TA 4X62O 1XMOB 5LGUA 3D2RA 2Y4UA 4JZGA 5IDMA 4Q6GA 4YY3B 4PA4A 4YJ3B 4X1KB 2LP7A 1TILA 3CRQA 4MVOA 1OCRB 4TUYA 2M7WA 3X2QC 2Q0AA 4GX2A 2HCHA 2GFDA 1I58A 1AI7A 1GK9A 4DR1O 2YEVB 3SL2A 2BCCH 4EM7A 1TVKB 2BRCA 4WFEA 4DR4B 2CCTA 2BTOA 1FFXB 2YGFA 3K0DA 4TV8A 3U11A 4KP4A 3SPGA 2XX5A 3T1YO 3ZHVA 2YI5A 4GQTA 3CRRA 2HHHB 3T1HO 5M4KA 4KSHA 4X66O 1COWG 1KKCA 3RYFB 1Q6IA 1IZ3A 5EIBD 2EINB 1L0NH 3D3QA 3OTOB 3CRMA 5LGTA 1R3IC 4X65O 2WEQA 3G71V 2VCIA 1US6A 3QO8A 4DUYO 4J80A 2XX4A 4IIJB 1BE3H 1IBLB 1AH8A 4LWFA 5BXZA 4V26A 5LXTA 4ASFA 4H37A 4O4IB 4XCJA 1VARA 2DWEC 1ID0A 5K1XA 4FLVA 4B3TO 4BQGA 3HKEA 2O1WA 1NTMH 4DO2A 1ZTEA 1YXBA 3OD4A 4URMA 5D5PA 2WLJA 2L35A 3K58A 3ZHUA 1XBLA 4LFAO 1GN4A 2E3CA 3TXQA 4BXIA 4NH9A 1EZJA 2P7TC 4JI4O 4DR6B 2YI9A 5CBHA 4HZ5A 4HY1A 2Y4TA 5LHIA 2RN9A 5FPOA 5KA6A 4DV3B 5B1OA 1AJQA 4DV2O 1E79G 4KL1A 1SQVH 3R65A 3B26A 4I5SA 1WJZA 2OWOA 4PHZA 3DXRB 3A0ZA 1ENVA 4GKKB 3MHHC 4ASAA 1Y6XA 3HPLC 2YEFA 5JQGA 3EHJA 3VBBA 2F1MA 1S77D 4CWFA 5EIBC 4HYPA 4JV5B 1TAEA 3UM7A 2BU8A 1YTFB 3GIFA 1V9PA 4DV0B 1S5LZ 4AI8A 5B66Z 3W7SA 1SZXA 4YKWA 3ABMB 1UY8A 4XD8A 2B1GA 2Q8IA 4I4TA 2YI0A 2EIJC 3B09A 3EKOA 4F4LA 4JYCA 3CSXA 1KU9A 1BZKA 1U97A 3L75H 3IEDA 2VWKA 1K92A 3CP1A 3JAWB 1VQ7V 5KUKA 4DV6B 5IT9N 1I5DA 2HR3A 1IXMA 1UYLA 2H8MA 5LMNO 1VIBA 2RNBA 4J9YB 5IN9A 1ZUQA 3ZM7A 3SPCA 5IYZA 1QR9A 2HKOA 1YDXA 1Q7YW 3PEJA 1AR4A 3LDDA 1EN6A 4OGQB 4DV5O 4FK5C 4FPPA 4WCEV 1ZWIC 1TVKA 3E8FA 2ZNIA 1OSFA 2UXDB 2O1VA 5E1AC 2M6YA 3WB1A 5JJJB 1VQ6V 1PNKA 2RJZA 5CBFA 3FB6C 4LF6O 1KECA 1XMQO 4JPRA 1XOUA 3AG1B 3KCYA 5JWPA 5IJ0A 1AB3A 4NTXA 3KCXA 5KHKA 5FWKA 1THZA 4C7UA 4RQEA 4PA9A 3G7EA 4I0XA 3M8AA 5IJ0B 4O05A 3LDCA 4ZKIA 1YESA 4PL9A 4B7KA 4PU9A 2ARHA 3RYCB 1AM1A 1QLEB 3INXA 2W0XA 4MVMA 4V25A 2AHZA 3CYOA 1H2LA 3K79A 5B1AC 1FXHA 4NXMB 1X59A 2R9RB 4P30A 1QVFU 2JDIG 1I5XA 4JI8B 1Z5WA 5C8YA 3SYPA 4H0LB 2ZBKB 4W4LA 3UCSC 1SZTA 1L0LH 1V55C 2IM9A 3L9DA 2CH4A 2RQ6A 2Q68A 1UFIA 2UUCB 5GTHZ 2LW1A 4DV4O 3HEKA 3HYZA 4GKKO 3SJAC 1SF9A 3HKCA 4D7SA 4HBNA 1F4MA 3FB7C 5KHGA 2XUMA 1NTZH 3ZS8C 3Q5LA 4KHPO 2XASA 2JJ2G 3BA9A 2Q73A 3HKCB 3JATB 2Q67A 4I3HA 1V54B 3ASOC 4KFMA 1KB9F 1JM6A 2OT5A 2IJIA 2LGWA 2ZE8A 4EMVA 3OTFA 3ZN0A 2O57A 3S3XA 3ASNC 1VEWA 1S14A 3EHFA 3TZ0A 1HR0B 1ZXMA 2YDEA 2NN4A 4JYBA 4GKJO 4R6ZA 3CS5A 4XDKA 2R9AA 4PJ0Z 3KE6A 1VQKV 2WLIA 4FCRA 4MPEA 5FL7G 2ZQMA 2WAMA 4LF9O 2WLIB 5EC2C 3ETQA 4IHJA 1ZWHA 2YIBA 4AWOA 4DV0O 2ZDYA 5F3KA 3CC4V 4D6TH 4B3TB 1Y4UA 1H2NA 2QM4A 1VQOV 2JVDA 3LSUA 2HEPA 3EXAA 1JJOA 1X4TA 1IBKO 3HB3B 5M4HA 1IURA 2YE7A 2VRZA 1H7UA 2ADQB 1YZBA 1WPBA 4DV1B 3WU2Z 1BS3A 1K4CC 4FZ0A 5BMVA 1QBZA 4WFGA 2QEXV 4EKWA 2ZKOA 4CWPA 3U2KA 2C2AA 1SA0B 3KKYA 5D7RA 2XHXA 3E8GA 4P7AA 2IH1C 4YIPA 2NNUA 3X2QB 4FLYA 2E74B 1QLEC 1TUEB 2AW9A 3TXSA 2LFRA 1DLBA 3VOUA 3CD6V 4BIOA 2Z5UA 4JAAA 1YCIA 2IW5A 3ZMTA 1YC1A 4AQYO 1NT2B 2K9PA 2QGNA 3VHCA 4EGIA 1Y74B 2XOKG 3TGUH 3O6OA 2GV9A 2YE9A 2WLKA 1RM1C 1B62A 1MX0A 2H55A 4E00A 1BMFG 3OMUA 4CS2A 5KAFZ 3HKDB 1YT1A 4DV1O 1S76D 3ZRXA 4MPNA 3K5LA 3L71H 2PUSA 3L70H 1VMGA 1A4HA 3SGIA 4IYIA 3BVOA 1IBKB 1R6NA 2IWUA 4UVCA 4Z1MG 3G6EV 4LH6A 2HHHO 4N23A 3E8BA 4ICGA 4B3RB 3K98A 4JI6O 3AK2A 4LR3A 4MVZA 1YJNV 1TH8A 2A79B 2UXDO 1VQ8V 2QKCA 2ZIOA 3ZMUA 4BW5A 1KZNA 1UYEA 3B28A 1K5SA 4DV5B 1VF6A 1BT8A 3CB2A 4BW9A 2DQ0A 3U0ZA 3P32A 1FXKC 2WI4A 1JFFB 1GN3A 3Q5KA 2BU2A 2AKPA 5A9GA 4U93A 4I0XB 3KZIZ 3I55V 2HJFC 1JR9A 3M99B 2UXBB 3LNMB 2CAZC 4K8ZA 4HXZA 4W7TA 1Y74A 4UB6Z 4X9QA 2QTSA 2Z3YA 4JI0B 3IC9A 4N21A 2P90A 4NXNB 2IBZH 3ZEDA 1ZLZA 4TQFA 5L3BA 3O9OA 3AG2C 4X1YA 4JF3A 3ZIAG 1BGQA 4URLA 3ZMZA 4WFAV 4LF4O 2HLDG 2YUAA 5GONB 5LBQA 2QFOA 1FD9A 4CE1A 1T5EA 4X1YB 4O4LB 3BM9A 1H38A 5DM6V 4FFKA 4LBEC 5GONA 2UXCO 2P4KA 3AG4C 1SA0A 4K0KO 2BOBC 2EIKB 2KG7A 3Q5JA 4O4LA 2XAGA 2X0LA 4LF8O 1AILA 5BZBA 5BOCA 3TETA 4EFEA 1Q90D 4GGLA 2H8PC 2K1EA 2DQ3A 5TISZ 5B3SC 2WEPA 2A0LA 1A32A 4FZ1A 4LWGA 1IVSA 5KAIZ 1HP8A 1YSZA 4HY6A 2DN9A 3ZMVA 1WB8A 4FVMA 4I7ZB 1LR1A 3QTFA 2WLLB 1ZL8B 4LC1A 4L8ZA 2ZDIA 1XNQB 2EILC 3OT7A 4NVPA 1OZ0A 3FYIB 3IAYA 2DYRB 3N2GB 4GKJB 4XKKA 1AJNA 4LF6B 4JI1O 4EFTA 1M56B 1EM1A 4OX9O 5IYCO 2F4VB 3OWDA 1YIJV 4JGSA 2XTAA 3ZRWB 1MZFA 2BSKA 2HP8A 4WUBA 2RDCA 3T2SA 4E01A 3RYHB 1F51A 1VQ4V 3G80A 3ZRWA 3STLC 1Q86W 3E89A 2UWDA 2H94A 1HNZO 1XEQA 3B25A 4O09A 3RGBA 3J81N 3SR2C 3HYYA 3JAMN 4FFBB 3H01A 1HNXB 3PJSK 2VQEO 2MK3A 4K8XA 1BHAA 3T1YB 4DYLA 1K8AW 1AI6A 3G67A 3ABKC 4J9ZB 3LPSA 4DR4O 3E86A 2CUGA 4MW8A 1HNWO 3STZC 4YJ2B 3OTOO 4CH3A 2GHYA 3OR6C 4J42A 1P7GA 5L3EA 2O1UA 4WFHA 3IFXA 1BHBA 2WI2A 4JI2O 3R4PA 5KUMA 5EBLC 4O4HB 1RFYA 1RPOA 4MTOA 3MDSA 4YKUA 3CCUV 3CXHF 4O4HA 2ZDIC 4CWTA 3NR7A 4FLTA 2EBOA 3CCMV 3K9AA 2Q8VA 3SPIA 3F5WC 3ABLB 4DK1A 1P49A 5LMUB 3CXCU 3BPZA 1FS0G 4XC0A 4QIWF 4I50B 4P9OA 4GLXA 3QO7A 1YI2V 1FXKB 2YIBD 2Y0IA 5DN6G 4R3MA 3SYQA 1UYMA 1MG1A 2QWOB 3CGYA 3WG7B 4JI0O 5KLVH 3D0BA 3D8CA 2DMXA 4ZHQA 1JVMA 4UV8A 1I94O 1M9NA 1PNMA 3FV5A 3DSQA 4PRXA 2ETNA 1EI1A 4MVQA 5F2VO 1Y76A 2XJJA 4ASGA 3S3WA 2GUZA 4JI5B 5IJ9B 1FXVA 4FMTA 1OCCB 4CH4A 1Y76B 2FYUH 3S5TA 4KTNA 3GWOA 1MSDA 5IYDO 2QKAA 3E35A 5BR8B 1YT0A 1KMIZ 2WI1A 4YKRA 4I55A 4UCSA 1G1XB 2H3OA 2QR4A 1V55B 3JAKB 1AR5A 4U7NA 1PD3A 5M4MA 4U3JA 1M56C 3VADA 4X8AA 4X20B 1WPXA 2W6JG 4LF4B 3TUHA 1K7DA 1ZX3A 2R70A 1JQ0A 2YGAA 1VF5B 5KA5A 3OMAB 3FX7A 5JCOA 2YC0A 1GJVA 4PA6A 4H13B 4LWSA 3QDDA 2P67A 1K3EA 3K59A 3H1LH 4MP7A 2XDUA 4RAIA 4JI3B 4B3SB 1ORQC 1GO3F 3JD3A 2BYIA 3FT5A 1SC5B 2F95B 3FB8C 3CRCA 3WG7C 5M4NA 3AK3A 3CWBH 5EZYB 4UUJC 2X6CA 4IT5A 2YE6A 2IH3C 3RYIB 1NBMG 3R4OA 2F66C 2GTAA 4GZRB 1WLEA 1Z59A 4JASA 5JENA 2P5OA 3RVYA 1J5EO 1XHZA 3H80A 4ZOLB 1FKAO 5M4PA 2LO1A 3OGIB 1ZL8A 4ZVIA 1IBMB 3A0WA 1NZ6A 4CBCA 1THNA 3T2MA 2YI6A 3APOA 2E5LB 3W7UA 2UUAO 4RO2A 4X66B 2QM8A 4QE9A 3K08A 1DF5A 2WA4A 1YVWA 3ABMC 5EK0A 3U2DA 1UJWB 3OUSA 2BSKB 1AROP 1MU5A 1NTKH 5JJNB 4OPHA 2PF4E 4IGGA 2Q7HA 3JD4A 1B6QA 4O4JB 5GW7A 1PM9A 3N27A 3U10A 3OMIB 1EA6A 2Q6AA 2IWSA 1IXBA 1ZSPA 1W59A 4CWRA 4LNUB 2OTLV 4UXNA 1XILA 3Q4HA 2GDSA 2ESAA 3ABTA 4J7KA 4XDMA 4DR5B 1F23A 1KQSU 4UB8Z 2FXSA 2AZ2A 2CTPA 3CX5F 2B9ZA 3RWRD 4J11A 1FPOA 4XIPA 4UV9A 1YTFD 1N8RW 3LUTB 5J2TA 4FIPC 2QG0A 3E83A 1HW7A 2KQXA 1Z5VA 2FWZA 1Q8IA 3ZHQA 4GCZA 3RKZA 4CE3A 4EEHA 1GKFA 3TCUA 2XCMA 4HZ0A 3J80N 4BIUA 5EYPA 1W0JG 3JD2A 4BIZA 3SDLA 1YITV 1S5JA 2R9IA 1HNWB 2HJDA 1I7FA 3AG3C 5JH7B 2VQFO 2HG5C 3A0TA 4AWQA 3CCVV 4EFUA 4Z2WA 4KXRA 5JH7A 3BRCA 3H1JH 4IYHA 3RLQA 4B6CA 4LWSB 2JGDA 1LUWA 1SESA 2LFSA 2UUBO 5BODA 1QHTA 1OCZB 5D6QA 1Y8OA 2OIEA 1U0ZA 5D5QA 2OCHA 3B8MA 5JVDB 1Q81W 4WFBV 2NLJC 2E0AA 2YXYA 1CPYA 4MPCA 4PA3A 5FNDA 2DYRC 4RWUA 1NR1A 2ATKC 3H1KH 1N36O 2VCJA 4P8OA 4DR2B 1R3LC 4GX0A 1H2KA 1ZAUA 2HVJC 3H4LA 1OCRC 4JI7B 2XDKA 3QO5A 4TV8B 2BU7A 2YEDA 2YKEA 2EJ7A 1SS3A 3BAAA 4DUYB 5LOVB 2V4DA 2F4VO 2CTWA 1VQPV 4B3MO 4NH8A 4JZ2A 5KHJA 3JAWA 3GIEA 3KG2A 1R62A 1YS3A 4L94A 3CC7V 3OEHG 1G8MA 2JKIA 2YGEA 1IX9A 2P6JA 1H2SB 4YXWG 3CEIA 1AI5A 1YSRA 3CRAA 3ABUA 1VF7A 2CK3G 5CB4B 2KKWA 2UUBB 1M93A 1P7BA 4YJ3A 4TV9B 3OGCC 2XJGA 1RPRA 4X1KA 1SRYA 5JCOC 2YEJA 3OW2U 5H2FZ 3SPJA 1KD1W 2ZM6B 1MA1A 3JALA 4MVSA 5CA1B 2YXLA 4LCUC 3GWKC 3IJ4A 3JYCA 4YHHB 1GMGA 1N33B 4E4EA 1JOYA 3EHGA 1I5YA 5GTIZ 1BKNA 3WB0A 2PI4A 3P3NA 2B1IA 1R3KC 4MTXA 2Y48A 4LF9B 3SYAA 2VWCA 4LP0A 2QA4V 1BYQA 4O2BA 1OJHA 5CTWA 2BREA 3CHXA 2UXBO 2D2CB 2Q5ZA 1NQTA 4DRXB 3GIGA 4UVAA 3RLPA 4O2BB 1TBWA 1AR1B 2ZIMA 2XNDG 3MNRP 1HDJA 1KIJA 4PI2A 4J7ZA 2WWWA 3VHAA 1TA8A 3OM3B 2G38A 5IY5C 1GRJA 4HNAA 5B1AB 4K35A 1YC4A 4WUCA 4PV1B 4DUZO 1BCCH 2FKXA 3B40A 1MZEA 1KBHA 1GKXA 4MP2A 2ADPA 3QF7A 4MSWC 1GAXA 5JVDA 3CWVA 5CA3A 3GB7C 3B27A 3IC7A 5CBGA 3BMYA 4NTYA 4L91A 2L6LA 2Q7GA 4CWSA 2WLMA 1EFRG 1M1KW
chains in the Genus database with same CATH topology
2DYRB 1AJNA 3A0RA 3CCRV 1M56B 4WFEA 4X88A 3W7WA 5IYCO 3DTUB 1YIJV 3K0DA 4JGSA 4KP4A 2AHYA 3SPGA 1K97A 3ZRWB 5LHHA 3SYOA 5CMUA 2DYSC 1NKDA 1W0KG 1Y66A 5H6QA 1COWG 4MTFA 1QLNA 1F51A 1P4RA 4QNHB 1FFTB 2HVKC 1VQ4V 4X89A 3ZRWA 1NJIW 3STLC 3OAAG 3WFVA 1Q86W 2EZOA 3E89A 2EINB 4P2ZA 2H94A 3ZRVA 5LGTA 1R3IC 1EBOA 3G71V 5L3FA 1Y4MA 3QO8A 3W7TA 3H01A 1M57C 1NH2D 5IDJA 3RVZA 3PJSK 2IJHA 4PDLA 3CCQV 2MK3A 1BHAA 4H33A 4JAVA 1K8AW 1MABG 1AI6A 4H37A 2DWDC 2FTKA 1JX9A 3ABKC 5B1NA 3BY6A 2DWEC 4J9ZB 3AG4B 3E86A 1KP2A 3OE7G 4PDVA 3NXSA 1GTOA 4MW8A 4DO2A 3STZC 3CCEV 4QPJA 1YJ9V 1VQLV 2EZPA 4Q20A 2GHYA 1S0VA 2WLJA 3K3WA 3OR6C 5L3EA 4WFHA 4RUEA 3IFXA 1BHBA 4MVUA 5KUMA 5LHGA 3K04A 1EZJA 2P7TC 3ASNB 5EBLC 5CBHA 2D3OW 1RPOA 3ABLC 5LHIA 3E2EA 4MTOA 5KA6A 2B5UA 5B1OA 1AJQA 1GM9A 3CCUV 1E79G 4TSFG 3OUFA 3SJQC 2ZDIC 3R65A 2EBOA 4I5SA 3CCMV 3K9AA 2XAFA 3SPIA 3F5WC 3ABLB 1S3JA 1ENVA 1FXKA 3MHHC 4FJCC 1YJWV 3HPLC 3CXCU 1FS0G 1ROPA 4QIWF 3VBBA 4QPKA 1S77D 4P9OA 5HFMA 3UM7A 1YTFB 1R6KA 2DW4A 3QO7A 4CZZA 1YI2V 1FXKB 5DN6G 1OHHG 3W7SA 1MOFA 3ABMB 1K4DC 3SYQA 1MG1A 3ZMSA 1QVGU 2B1GA 3WG7B 3UKMA 2EIJC 2ITCC 1DTOA 4JYCA 4F4LA 4R8CA 1JVMA 3ABKB 4UV8A 1NVPB 5IYBO 1K92A 3CP1A 1R3JC 1M9NA 5KUKA 1VQ7V 1PNMA 1KP3A 1V54C 3ASOB 2HR3A 2ZR3A 1IXMA 4MVQA 1XL4A 3AEIA 1PNLA 1F4NA 4ZBMA 4J9YB 1FXVA 4FMTA 1OCCB 3SPCA 1QR9A 2HKOA 1Q7YW 2W0FC 3LDDA 3GWOA 5IYDO 2BOCC 4FK5C 1QCEA 3E35A 1SERA 4FPPA 2DYSB 4WCEV 1ZWIC 2IJKA 3E8FA 3MHSC 2GSMB 1V55B 1NH2B 2IU0A 4U7NA 5E1AC 1PD3A 3ETEA 5LGNA 3B8NA 1GM7A 4ASUG 1M56C 4KUMA 1VQ6V 3K03A 1PNKA 2KB1A 5CBFA 3FB6C 4X8AA 1KECA 4R50A 4JPRA 4PDMA 1WPXA 3AG1B 2X6AA 5J9PC 2W6JG 2WLNA 1K7DA 1OCZC 4I9WA 2ZR2A 4L87A 4QJFB 1JQ0A 1THZA 3F7VC 4RQEA 4PA9A 3T1CA 3DGEA 5KA5A 1H8EG 3LDCA 2WSSG 3E8HA 3OMAB 4ZKIA 2ITDC 3LSQA 5B3SB 3T4DA 1QLEB 3P30A 2JIZG 4HYOA 3ZRSA 4MVMA 2UXXA 3D3IA 4PA6A 2AHZA 4WFFA 3CYOA 3K79A 5B1AC 2QKSA 2XAJA 1YHQV 2P67A 1FXHA 2UXNA 3ZJZA 1K3EA 2R9RB 4P30A 1QVFU 2JDIG 1I5XA 4JTDB 4RAIA 2X7RB 2QE7G 2JEXA 1ORQC 3SYPA 1GO3F 3JD3A 1K73W 1SZTA 3T4ZA 5H6RA 1V55C 3FB8C 3EFFK 3CCJV 3WG7C 2Q68A 4UVBA 4UUJC 3LDEA 2X6CA 5EBMC 5EBWC 4XBFA 1VQ9V 2Y69B 2IH3C 1NBMG 2WLHA 4MS2A 1WLEA 4XDLA 1F4MA 3FB7C 3EHBB 1OCCC 4JASA 3CMAV 3RVYA 2XASA 2JJ2G 1NVPD 2Q67A 1V54B 3ASOC 3D36A 4KFMA 3BEHA 4CBCA 2OT5A 1KKDA 3T2MA 2IJIA 3ETGA 1S72V 3W7UA 4RO2A 3I56V 2OCCB 2QM8A 4QE9A 2XAHA 3ZN0A 3K08A 3ASNC 1DF5A 3SYCA 3CMEV 4PELA 3ABMC 5EK0A 1UJWB 3OUSA 5HFLA 1H8HG 4QE7A 1AROP 3ZCCA 2YSUB 1VQ5V 4JYBA 1DF4A 1CP9A 4R6ZA 4XDKA 2V7QG 4PDRA 1OCOB 2IJJA 2HFEC 1VQKV 3JD0A 2YEVA 4PA7A 3JD4A 1B6QA 3SPHA 2WLIA 5GW7A 2OCCC 5CN0A 3OMIB 2Q6AA 4MW3A 3ZN1A 1HWYA 5FL7G 2ZQMA 2WAMA 5L3GA 4RQFA 2OTLV 4GX1A 2WLIB 4UXNA 3JD1A 5EC2C 1L1FA 1JJ2U 3ABTA 3CPWU 1F23A 1KQSU 3TK1A 3FB5C 3CC4V 4MVRA 2OTJV 4TT3G 4HAMA 1VQOV 4UV9A 1YTFD 1N8RW 3LUTB 1G4YB 4FIPC 2Y69C 3OR7C 3E83A 3CCSV 2PI5A 1JCHA 3HB3B 4GCZA 1GKFA 3TCUA 4BIUA 2JK5C 1K4CC 1W0JG 3JD2A 4BIZA 1YITV 1QBZA 4WFGA 2R9IA 4EKWA 1NR7A 3K06A 2QEXV 2C2AA 3AG3C 1RM1B 2EILB 3E8GA 2HG5C 2IH1C 3X2QB 2NNUA 1AI4A 1QLEC 1TUEB 3CCVV 2LFRA 1DLBA 3LSSA 1KC8W 3RW0A 3VOUA 2EINC 3CD6V 2Z5UA 2WPDG 2IW5A 3ZMTA 1SESA 2LFSA 2ZXWB 1OCZB 1GM8A 2XOKG 3AG1C 5C93A 1VQMV 2WLKA 3AG3B 1RM1C 3B8MA 1Q81W 1BMFG 5IY5B 1W2BU 4WFBV 2NLJC 4GX5A 1CPYA 1YSCA 4PA3A 4JTAB 2DYRC 1S76D 1NR1A 3ZRXA 2ATKC 2EJRA 1SETA 1R3LC 4GX0A 4E2LA 4GT1A 3OMNB 2HVJC 1OCRC 1R6NA 4UVCA 4Z1MG 3QO5A 3F7YC 5EC1C 3RBZA 3G6EV 5H9CA 4JAUA 1K34A 3MD0A 4N23A 3E8BA 2EIMC 1K9MW 1VQPV 3KG2A 1XL6A 3FKSG 2Q69A 3CC7V 3OEHG 4MVZA 1YJNV 1G8MA 2A79B 1VQ8V 4OXSA 4TWKA 1JPXA 1PKXA 3ZMUA 4BW5A 2P6JA 1LNQA 1BL8A 1K5SA 2EIKC 4JTCB 1AI5A 4YXWG 2EIJB 3ABUA 1QR8A 3OFNG 1M90W 2CK3G 2QM7A 1OCOC 3QNEA 4G2KA 5B1BB 2QTOA 1P7BA 3CC2V 3B77A 3OGCC 2DQ0A 1RPRA 3P32A 3IGAC 3JCZA 1SRYA 1FXKC 4R7CA 4XDJA 4BAYA 2WLLA 5L3DA 3AG2B 3OW2U 3FYIB 3K0GA 3SPJA 1KD1W 4HZ3A 3I55V 2HJFC 3M99B 4MVSA 3LNMB 3OEEG 3ML0A 4MT8A 3CCLV 4LCUC 4LP8A 1J95A 2Z3YA 2ZD9A 3JYCA 1GMGA 2X6BA 4N21A 2IU3A 2P90A 4DXWA 1JOYA 1I5YA 1S5HC 3ETDA 2PI4A 1K5QA 2B1IA 1R3KC 1M1KW 4MTXA 2Y48A 3SYAA 4P9PA 1VQNV 5L3BA 2QA4V 3FYEB 1Q82W 3AG2C 4JF3A 4RUFA 3ZIAG 2V1DA 4MTGA 3ZMZA 4WFAV 1E1RG 2HLDG 5LBQA 1NQTA 4UVAA 2XAQA 1AR1B 1H38A 5DM6V 2XNDG 5B1BC 5L3CA 4LBEC 2A9HA 1PL0A 2F43G 4G27B 3AG4C 2BOBC 2EIKB 3W7XA 4G28B 2XAGA 2X0LA 2WWWA 1R73A 4WF9V 1AJPA 3OM3B 5BZBA 5IY5C 3TETA 1MSWD 1E1QG 5B1AB 1K33A 1M57B 2H8PC 2K1EA 2ZXWC 4U7OA 2DQ3A 2EIMB 2W6IG 5LGUA 5B3SC 2A0LA 1H2GA 4PA4A 1CEZA 3ZMVA 2JJ1G 4MSWC 2LP7A 3G4SV 4MVOA 1OCRB 2WLLB 3GB7C 5CA3A 2M7WA 4LC1A 3X2QC 2JEUA 3IC7A 5CBGA 4GX2A 2ZDIA 2EILC 1OZ0A 1AI7A 1GK9A 2WLMA 1EFRG 2YEVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2A A;  4JAS A;  4QPK A;  3A0R A;  3ZCC A;  5IDJ A;  2P67 A;  4JYB A;  4FMT A;  4U7O A;  4JAV A;  4KP4 A;  4MT8 A;  3ZRX A;  3ZRW B;  2LFR A;  5B1O A;  3D36 A;  2FTK A;  5B1N A;  4GT1 A;  4MTX A;  4JYC A;  1F51 A;  3NXS A;  3DGE A;  4FPP A;  4GCZ A;  4I5S A;  3ZRW A;  1JOY A;  4ZKI A;  2QM8 A;  4QPJ A;  2QM7 A;  4LC1 A;  2LFS A;  4BIU A;  2WWW A;  4JAU A;  4U7N A;  4Q20 A;  4BIZ A;  3MD0 A;  3ZRV A;  1IXM A;  3P32 A;  3TK1 A;  5C93 A; 
#chains in the Genus database with same CATH topology
 1VF6 C;  2UXC B;  4DR7 O;  1NHJ A;  3A0R A;  3C90 A;  3CCR V;  4B3M B;  3LMM A;  4JI5 O;  4J7J A;  4X88 A;  3W7W A;  1Z5B A;  4UCT A;  4CWN A;  3RYF A;  3QTC A;  2DJV A;  5LHH A;  2YI7 A;  2XDX A;  3P3P A;  1Y66 A;  1QLN A;  2CH7 B;  1P4R A;  4QNH B;  1FFT B;  2HVK C;  3VQV A;  3L74 H;  3OAA G;  2YKI A;  2EZO A;  4P2Z A;  3O65 A;  4IIJ A;  1JA8 A;  3ZRV A;  4DUZ B;  2YE2 A;  1EBO A;  2BTZ A;  2PY5 A;  4B7E A;  3G75 A;  3W7T A;  3C3S A;  1M57 C;  1NH2 D;  2ZDX A;  1TUB B;  3RVZ A;  4EGK A;  2IJH A;  4URN A;  4PDL A;  3HKE B;  4H33 A;  1XI1 A;  1WAZ A;  3ICX A;  4CC6 A;  4NKG B;  3CYG A;  1I94 B;  3BY6 A;  2AZ0 A;  2PGG A;  1BQ0 A;  2XDS A;  2EUL A;  1SKV A;  3OE7 G;  4PDV A;  1GTO A;  1YEW A;  3CCE V;  1LUV A;  4AWP A;  2Y0P A;  1R1B A;  2JS3 A;  4GEE A;  2BU6 A;  5LYJ A;  1M5I A;  3TZ4 A;  2XT9 A;  1S0V A;  3K3W A;  4RUE A;  5B5E Z;  4MVU A;  2YJW A;  4EB6 B;  2YS8 A;  3D36 C;  5LL6 Y;  3JAS B;  3ABL C;  3WQ9 A;  2B5U A;  1GM9 A;  2UUC O;  4TSF G;  3OUF A;  2XAF A;  1UYG A;  1YER A;  4TQD A;  1UYH A;  1S3J A;  2QG2 A;  3PEH A;  1NHI A;  4FJC C;  4YIO A;  3VQX A;  4JI2 B;  1ROP A;  3ZHT A;  4QPK A;  3RYC A;  4ASB A;  3J7A U;  2DW4 A;  4CZZ A;  3B4S A;  4O04 A;  5D7D A;  2N74 A;  5IE9 A;  3ZMS A;  1QVG U;  4B3R O;  3EVK A;  1FAF A;  4HXW A;  2HKJ A;  5H5N A;  3UKM A;  4HNA B;  1N34 B;  4DR3 O;  4DZY A;  2FML A;  2GTS A;  1DTO A;  2ITC C;  2YKB A;  3T0H A;  5KMG A;  1R3J C;  4I4T B;  1JMK C;  1TUB A;  1KP3 A;  2LQT A;  2VW5 A;  1Z5A A;  1SQG A;  1MNG A;  1XL4 A;  3EKR A;  1F4N A;  4ZBM A;  3QVN A;  2WI7 A;  1FJG O;  2WI5 A;  2ZCE A;  1VP7 A;  2LJ2 A;  2QWN B;  3SJC C;  4X62 B;  2W0F C;  2R72 A;  4UCU A;  1GN6 A;  1QCE A;  1XHX A;  1SER A;  5IYZ B;  3T1H B;  4YY3 O;  1NH2 B;  2IU0 A;  2QSA A;  4EB6 A;  4DR5 O;  5LGN A;  4OX9 B;  1GM7 A;  5D7C A;  3K03 A;  2KB1 A;  4R1F A;  1PPJ H;  2BU5 A;  4FM1 A;  4FLU A;  3ZHS A;  2Q2E B;  2X6A A;  3F5T A;  5J9P C;  4JI8 O;  1D5N A;  4I9W A;  2ZR2 A;  1IBL O;  2UUA B;  1SQQ H;  3K99 A;  4L87 A;  4DUH A;  3U67 A;  3T1C A;  1Y8P A;  3DGE A;  2Q7E A;  1H8E G;  2ITD C;  3LSQ A;  3TJT A;  3T4D A;  3P30 A;  2JIZ G;  4HYO A;  1D5A A;  3ZRS A;  2NR5 A;  4CC5 A;  5C8Y B;  4WFF A;  2JJC A;  1EN5 A;  2QKS A;  2XAJ A;  2UXN A;  4PD4 F;  3ZJZ A;  4JTD B;  3BCC H;  2WI3 A;  2X7R B;  2DE0 X;  2JEX A;  3K9S A;  3DC6 A;  1FJG B;  1K73 W;  5H6R A;  1I5B A;  3A0B Z;  4A5U B;  3EFF K;  3CCJ V;  2YE3 A;  1H7S A;  3BHP A;  5EBM C;  5EBW C;  1VQ9 V;  2Y69 B;  4NH7 A;  3JAS A;  4X1I B;  2WLH A;  4LF5 O;  4WBN B;  4MS2 A;  4XDL A;  3CMA V;  1OCC C;  3CJH B;  1F7Y A;  1NU1 H;  5BMV B;  3O0I A;  2ZE5 A;  4DV2 B;  2KSD A;  4JYA O;  2IOQ A;  4JI3 O;  1NVP D;  1Y67 A;  4B3S O;  3CJH A;  3D36 A;  3CGZ A;  1KKD A;  3ETG A;  5JQG B;  2ODM A;  2YEE A;  3I56 V;  1U2O A;  2XAH A;  2PYL A;  4XIR A;  3SYC A;  4PEL A;  5LP6 B;  4CWO A;  2Q0O C;  5HFL A;  4BWA A;  1MMM A;  3ZCC A;  2CH7 A;  1VQ5 V;  4F6E A;  1DF4 A;  1CP9 A;  2XHT A;  2IJJ A;  1TC6 A;  3JD0 A;  4NR1 A;  4PA7 A;  2CTR A;  4MW3 A;  3ZN1 A;  4LF5 B;  1I59 A;  2BZ5 A;  2P4V A;  1XRE A;  1Q5O A;  4UCR A;  4EGH A;  4RQF A;  1L1F A;  1JJ2 U;  2WI6 A;  3JAR B;  5F5R A;  4KFG A;  4O4I A;  3R4M A;  3FB5 C;  2XX2 A;  1O9G A;  3JZ3 A;  2OTJ V;  4TT3 G;  4HAM A;  2N04 A;  1SQX H;  4MOT A;  2LW7 A;  2FYP A;  2PI5 A;  4OPA A;  4JI7 O;  1WB7 A;  2GQP A;  3HZ5 A;  1H2M A;  1QQC A;  1TID A;  2Z0A A;  4X65 B;  2YKC A;  3TZ5 A;  4BQJ A;  3EHH A;  4EFB A;  2PZS A;  3K06 A;  2QWR B;  2YI8 A;  2EIL B;  2CGN A;  4UCO A;  1PV0 A;  4LF8 B;  1AI4 A;  4CH5 A;  1B04 A;  1KC8 W;  3DXR A;  1DGS A;  1RP3 B;  2EIN C;  3THO A;  2PTM A;  4FLZ A;  2WPD G;  5LP6 A;  2ZXW B;  3MAQ A;  1I0H A;  3AG1 C;  5C93 A;  1I08 A;  3AG3 B;  3FAV B;  5IY5 B;  1N34 O;  1W2B U;  3OWB A;  1YSC A;  5KMG B;  1QZR A;  2ZIN A;  3N2G A;  4X1I A;  4JV5 O;  4GT1 A;  2LGQ A;  4WBN A;  4U3F H;  3A0H Z;  3ZKB A;  5FLX N;  5H9C A;  4JAU A;  1K34 A;  2ZE6 A;  3MD0 A;  4L8J A;  1QNM A;  2YID A;  3ZBH A;  1UPG A;  2EIM C;  2KG7 B;  4LFB O;  2CCS A;  1XL6 A;  1I5A A;  1HNZ B;  2JRI A;  4K4O A;  4YKQ A;  3K5N A;  2BE3 A;  4CS4 A;  1J5E B;  4OXS A;  4TWK A;  1UYI A;  1JPX A;  1PKX A;  2GUZ B;  3A8T A;  5FNF A;  4JTC B;  1UY7 A;  3FT8 A;  2EIJ B;  1S16 A;  1QR8 A;  2QM7 A;  3LNN A;  3QNE A;  4G2K A;  3B77 A;  1N4C A;  2GBO A;  3T1K A;  4MBC A;  5CF0 A;  1WA8 B;  4R7C A;  4XDJ A;  2WLL A;  4LF7 O;  3G7B A;  5L3D A;  1QY8 A;  1HR0 O;  4DV3 O;  3K0G A;  4LFC O;  4MB9 A;  4WUD A;  3OEE G;  4MT8 A;  1QYE A;  4IHJ B;  3CRL A;  3JAR A;  3RN4 A;  2ZD9 A;  2YEH A;  2X6B A;  3AG7 A;  1G6U A;  2IU3 A;  2JGU A;  4DXW A;  1U96 A;  1TGO A;  2EX3 A;  1GKZ A;  4LPB A;  1K5Q A;  3HKD A;  4P9P A;  1VQN V;  3FYE B;  1Q82 W;  5BY1 A;  1FYJ A;  4RUF A;  2V1D A;  1E1R G;  5ITZ A;  2P22 C;  3R92 A;  3ZXO A;  2CGO A;  5B1B C;  3UT5 B;  2A9H A;  4G27 B;  4JI1 B;  5ITZ B;  4O0B A;  2HG1 A;  3RLR A;  4G28 B;  3A0Y A;  4FCQ A;  2YXH A;  1WN7 A;  3JAT A;  1UY9 A;  4L93 A;  4YJ2 A;  1K33 A;  4ZHQ B;  1ZXN A;  1AP6 A;  1NHH A;  5CTU A;  2VWJ A;  2ZXW C;  4U7O A;  4FLX A;  2EIM B;  2W6I G;  3RT3 C;  2WER A;  4DW1 A;  1H2G A;  1B06 A;  4FLW A;  2YIC A;  1CEZ A;  2JJ1 G;  3G4S V;  3FAV A;  2VS0 A;  1JFF A;  2JEU A;  2YE8 A;  2VQE B;  1RSO A;  1DK1 A;  4X9L A;  1PP9 H;  1N36 B;  1Q6U A;  2XJX A;  1EN4 A;  3DTU B;  4YKX A;  2YEC A;  2AHY A;  1K97 A;  3SYO A;  5CMU A;  2DYS C;  1NKD A;  1W0K G;  5H6Q A;  1BGY H;  4MTF A;  1URF A;  4X89 A;  1NJI W;  3WFV A;  2A06 H;  5CTX A;  5L3J A;  3TTZ A;  2FL4 A;  4H7Q A;  5L3F A;  1Y4M A;  4X64 O;  3A2F A;  3N2K A;  3M7M X;  3H9V A;  5IDJ A;  2P06 A;  3CCQ V;  1R6T A;  1XNQ O;  1AJ6 A;  3HKB A;  3CRK A;  4JAV A;  4F6R A;  4AS9 A;  1MAB G;  4FFB A;  4NXM O;  3HHU A;  2DWD C;  2FTK A;  1JX9 A;  5B1N A;  4JI6 B;  3WB2 A;  4GYC B;  4DV4 B;  1N0N A;  2UU9 O;  3AG4 B;  4XIT A;  1KP2 A;  1WA8 A;  3HKB B;  3NXS A;  2QJ1 A;  2ZE7 A;  3K5O A;  4QPJ A;  2QDO A;  1YJ9 V;  3VHD A;  1VQL V;  1UYC A;  2EZP A;  4Q20 A;  4CE2 A;  5KHH A;  4KHP B;  2BTQ B;  5EZY A;  2XK2 A;  3E22 A;  5LHG A;  3JAK A;  3K04 A;  3ASN B;  3WHA A;  2K5B A;  1YF2 A;  2D3O W;  2BTQ A;  3E2E A;  2Q9L A;  5LA6 B;  1CXZ B;  1PL4 A;  5LMN B;  1OV9 A;  3SJQ C;  3K97 A;  3L72 H;  4LWE A;  5A2Q N;  4J10 A;  2YEG A;  4NB5 A;  3PN1 A;  2XHB A;  2XD6 A;  1XQ8 A;  1NS1 A;  1FXK A;  1AMW A;  1YJW V;  5CTY A;  5HFM A;  1Y4S A;  1R6K A;  1UYD A;  2IOR A;  1OHH G;  1IBM O;  2Q8H A;  2Q4P A;  4DW0 A;  1MOF A;  1K4D C;  1XMO O;  2E76 B;  3C11 A;  1B63 A;  2PNR A;  2BYH A;  2UU9 B;  4R8C A;  3ABK B;  1NVP B;  2CDY A;  5IYB O;  4I9Q A;  3N2K B;  1IDS A;  4O4J A;  1V54 C;  3ASO B;  1Z5C A;  2ZR3 A;  1XNR O;  1GN2 A;  3VQW A;  5JJE B;  3C3T A;  4K3A A;  3AEI A;  2Q8F A;  1PNL A;  4GT8 A;  4NYK A;  4DK0 A;  2CCU A;  3G6B A;  1YC3 A;  4I55 B;  1EZV H;  1WNS A;  1RSO B;  4UCV A;  4FM0 A;  2BOC C;  2PYJ A;  2DYS B;  4NTW A;  4LWI A;  2IJK A;  3MHS C;  5IWA B;  1BSM A;  2GSM B;  1BXD A;  3E22 B;  4CWQ A;  3ETE A;  3B8N A;  4ASU G;  1N32 O;  4KUM A;  5J2U A;  4B08 A;  4R50 A;  4CS3 A;  4PDM A;  5EYP B;  2AXT Z;  5DEC A;  4YKY A;  4XKA A;  4XIQ A;  2WLN A;  1OCZ C;  2ZNJ A;  4W4K A;  4QJF B;  3F7V C;  1SQF A;  4X20 A;  4AQY B;  2WSS G;  3E8H A;  4I50 A;  3DC5 A;  4BR6 A;  5B3S B;  3A0X A;  2AGA A;  5IWA O;  1UYF A;  4E72 A;  5E79 Z;  2UXX A;  3D3I A;  3ZHR A;  2VQF B;  5BR8 O;  1AH6 A;  2YEI A;  4LNU A;  4QGP A;  3UT5 A;  3Q4H B;  4URO A;  1YHQ V;  2N05 A;  3L73 H;  4DR2 O;  5FNC A;  3I5D A;  3JSN A;  2QE7 G;  2YK9 A;  1AP5 A;  4XKO A;  3T4Z A;  4NXN O;  3RYI A;  4UVB A;  4O2A B;  3LDE A;  1SQP H;  2ZT9 B;  4XE2 A;  4XBF A;  2DOS A;  4CH6 A;  4ZIB A;  5LA6 A;  4DV7 O;  3EHB B;  4K0K B;  3R66 A;  1N32 B;  4H44 B;  4FM2 A;  3APQ A;  3BEH A;  4LFB B;  4ZOL A;  1S72 V;  4U3J B;  4Z1V A;  2OCC B;  5LMU O;  5J2U B;  1WP7 A;  2RMK B;  3K57 A;  2XHR A;  3CME V;  1YT2 A;  2JGD B;  4LF7 B;  1H8H G;  3BAB A;  4QE7 A;  4TUY B;  5CB4 A;  3RYH A;  3ZKD A;  2YSU B;  1KUQ A;  4FCP A;  5LP6 C;  2F23 A;  2V7Q G;  3B24 A;  4PDR A;  4DR1 B;  1OCO B;  2HFE C;  4XCL A;  2YEV A;  4DV6 O;  2F93 B;  1Y8N A;  3R4N A;  5GGZ A;  1Q3E A;  3SPH A;  2OCC C;  5CN0 A;  2CTQ A;  2E5L O;  4DV7 B;  1HWY A;  3TZ2 A;  1FFX A;  4GUN A;  5AG2 A;  5IJ9 A;  5L3G A;  4X64 B;  2QWQ B;  4GX1 A;  2Q8G A;  3JD1 A;  5CPH A;  3LNU A;  3CPW U;  4JYA B;  4F6R B;  3TK1 A;  3K60 A;  2YE5 A;  5KX5 A;  4JQL A;  2CGF A;  2C1I A;  4MVR A;  4ABM A;  5LOV A;  4AIL C;  1G4Y B;  5KX5 B;  3NMQ A;  2Y69 C;  3OPD A;  3OR7 C;  1SQB H;  3QG5 A;  3CCS V;  1Q43 A;  1JCH A;  2A3Q A;  1NI8 A;  2FWY A;  2YE4 A;  1KYO F;  1HNX O;  3BA8 A;  5DED A;  3VQY A;  2XAB A;  1D2D A;  2JK5 C;  2WA3 A;  3HR0 A;  2QWP B;  3JSL A;  1NR7 A;  3GVM A;  3H1I H;  3UQ8 A;  4ZI7 B;  1RM1 B;  3B2E E;  4LFA B;  4R3A A;  1BQZ A;  2ZKJ A;  3C0E A;  2C1G A;  1P84 F;  1XDC A;  2MW2 B;  3T0Z A;  3LSS A;  2FB5 A;  3RW0 A;  2IOP A;  1UYK A;  3HZ1 A;  3FFQ A;  4JYY A;  1GM8 A;  1VQM V;  4DR3 B;  4GX5 A;  4LH7 A;  4HYM A;  1N0J A;  4JTA B;  1O9H A;  4PRV A;  3K5M A;  2EJR A;  4TOI A;  1SET A;  2YIA A;  3CE2 A;  4E2L A;  2OYQ A;  5KHI A;  3OMN B;  1M4U A;  4H85 A;  4EEQ A;  1AVM A;  1PVG A;  1XNR B;  3RBZ A;  3F7Y C;  5EC1 C;  1QU7 A;  2YKJ A;  2ILM A;  2ZM6 O;  2CG9 A;  4GFN A;  1YET A;  2YEA A;  1K9M W;  5J6A A;  2CE4 A;  4H81 A;  3FKS G;  2Q69 A;  4O07 A;  1Z2G A;  5CA0 A;  4YKZ A;  4JI4 B;  4DR6 O;  3ZXQ A;  2YEB A;  1WP8 A;  4TV9 A;  1LNQ A;  1BL8 A;  2EIK C;  4E02 A;  4XTJ A;  4YKT A;  1M90 W;  3OFN G;  5LXT B;  4ZI7 A;  1XUQ A;  3T10 A;  1OCO C;  5B1B B;  2HHI A;  2QTO A;  3CC2 V;  1B3Q A;  2YK2 A;  3ZX6 A;  4KQV A;  3IGA C;  3JCZ A;  5FPR A;  3UO3 A;  3JAL B;  4BAY A;  5FNV A;  4L90 A;  4LWH A;  3AG2 B;  3RFR A;  4HZ3 A;  4IL6 Z;  5FNV B;  3ML0 A;  3CCL V;  5D6P A;  4LP8 A;  1XMQ B;  1J95 A;  4AHC A;  1Q6H A;  3UO2 A;  3AK1 A;  2A7W A;  5CA1 A;  4B7P A;  5M4E A;  1S5H C;  3ETD A;  2XDL A;  3R91 A;  2JS5 A;  3OW6 A;  2EXL A;  5J2T B;  2OIG A;  4DRX A;  4PI0 A;  3GIG B;  4BAE A;  1L8D A;  4J41 A;  2RCV A;  4MTG A;  3H1H H;  4O2A A;  1US7 A;  4KSG A;  4LFC B;  1TC0 A;  2E75 B;  2XAQ A;  1GH6 A;  3SJB C;  5L3C A;  1L0O A;  3FD9 A;  4YHH O;  1N33 O;  1PL0 A;  2F43 G;  1ZW9 A;  4DR7 B;  3O2F A;  3BFR A;  3W7X A;  3INW A;  2QF6 A;  1R73 A;  4WF9 V;  1UY6 A;  1AJP A;  2BT0 A;  5K1P A;  3JCU Z;  1MSW D;  2IWX A;  1E1Q G;  4UFZ A;  2BSM A;  5CA0 B;  2YJX A;  1I5C A;  1M57 B;  5J71 A;  5LYJ B;  4D7T A;  4X62 O;  1XMO B;  5LGU A;  3D2R A;  2Y4U A;  4JZG A;  5IDM A;  4Q6G A;  4YY3 B;  4PA4 A;  4YJ3 B;  4X1K B;  2LP7 A;  1TIL A;  3CRQ A;  4MVO A;  1OCR B;  4TUY A;  2M7W A;  3X2Q C;  2Q0A A;  4GX2 A;  2HCH A;  2GFD A;  1I58 A;  1AI7 A;  1GK9 A;  4DR1 O;  2YEV B;  3SL2 A;  2BCC H;  4EM7 A;  1TVK B;  2BRC A;  4WFE A;  4DR4 B;  2CCT A;  2BTO A;  1FFX B;  2YGF A;  3K0D A;  4TV8 A;  3U11 A;  4KP4 A;  3SPG A;  2XX5 A;  3T1Y O;  3ZHV A;  2YI5 A;  4GQT A;  3CRR A;  2HHH B;  3T1H O;  5M4K A;  4KSH A;  4X66 O;  1COW G;  1KKC A;  3RYF B;  1Q6I A;  1IZ3 A;  5EIB D;  2EIN B;  1L0N H;  3D3Q A;  3OTO B;  3CRM A;  5LGT A;  1R3I C;  4X65 O;  2WEQ A;  3G71 V;  2VCI A;  1US6 A;  3QO8 A;  4DUY O;  4J80 A;  2XX4 A;  4IIJ B;  1BE3 H;  1IBL B;  1AH8 A;  4LWF A;  5BXZ A;  4V26 A;  5LXT A;  4ASF A;  4H37 A;  4O4I B;  4XCJ A;  1VAR A;  2DWE C;  1ID0 A;  5K1X A;  4FLV A;  4B3T O;  4BQG A;  3HKE A;  2O1W A;  1NTM H;  4DO2 A;  1ZTE A;  1YXB A;  3OD4 A;  4URM A;  5D5P A;  2WLJ A;  2L35 A;  3K58 A;  3ZHU A;  1XBL A;  4LFA O;  1GN4 A;  2E3C A;  3TXQ A;  4BXI A;  4NH9 A;  1EZJ A;  2P7T C;  4JI4 O;  4DR6 B;  2YI9 A;  5CBH A;  4HZ5 A;  4HY1 A;  2Y4T A;  5LHI A;  2RN9 A;  5FPO A;  5KA6 A;  4DV3 B;  5B1O A;  1AJQ A;  4DV2 O;  1E79 G;  4KL1 A;  1SQV H;  3R65 A;  3B26 A;  4I5S A;  1WJZ A;  2OWO A;  4PHZ A;  3DXR B;  3A0Z A;  1ENV A;  4GKK B;  3MHH C;  4ASA A;  1Y6X A;  3HPL C;  2YEF A;  5JQG A;  3EHJ A;  3VBB A;  2F1M A;  1S77 D;  4CWF A;  5EIB C;  4HYP A;  4JV5 B;  1TAE A;  3UM7 A;  2BU8 A;  1YTF B;  3GIF A;  1V9P A;  4DV0 B;  1S5L Z;  4AI8 A;  5B66 Z;  3W7S A;  1SZX A;  4YKW A;  3ABM B;  1UY8 A;  4XD8 A;  2B1G A;  2Q8I A;  4I4T A;  2YI0 A;  2EIJ C;  3B09 A;  3EKO A;  4F4L A;  4JYC A;  3CSX A;  1KU9 A;  1BZK A;  1U97 A;  3L75 H;  3IED A;  2VWK A;  1K92 A;  3CP1 A;  3JAW B;  1VQ7 V;  5KUK A;  4DV6 B;  5IT9 N;  1I5D A;  2HR3 A;  1IXM A;  1UYL A;  2H8M A;  5LMN O;  1VIB A;  2RNB A;  4J9Y B;  5IN9 A;  1ZUQ A;  3ZM7 A;  3SPC A;  5IYZ A;  1QR9 A;  2HKO A;  1YDX A;  1Q7Y W;  3PEJ A;  1AR4 A;  3LDD A;  1EN6 A;  4OGQ B;  4DV5 O;  4FK5 C;  4FPP A;  4WCE V;  1ZWI C;  1TVK A;  3E8F A;  2ZNI A;  1OSF A;  2UXD B;  2O1V A;  5E1A C;  2M6Y A;  3WB1 A;  5JJJ B;  1VQ6 V;  1PNK A;  2RJZ A;  5CBF A;  3FB6 C;  4LF6 O;  1KEC A;  1XMQ O;  4JPR A;  1XOU A;  3AG1 B;  3KCY A;  5JWP A;  5IJ0 A;  1AB3 A;  4NTX A;  3KCX A;  5KHK A;  5FWK A;  1THZ A;  4C7U A;  4RQE A;  4PA9 A;  3G7E A;  4I0X A;  3M8A A;  5IJ0 B;  4O05 A;  3LDC A;  4ZKI A;  1YES A;  4PL9 A;  4B7K A;  4PU9 A;  2ARH A;  3RYC B;  1AM1 A;  1QLE B;  3INX A;  2W0X A;  4MVM A;  4V25 A;  2AHZ A;  3CYO A;  1H2L A;  3K79 A;  5B1A C;  1FXH A;  4NXM B;  1X59 A;  2R9R B;  4P30 A;  1QVF U;  2JDI G;  1I5X A;  4JI8 B;  1Z5W A;  5C8Y A;  3SYP A;  4H0L B;  2ZBK B;  4W4L A;  3UCS C;  1SZT A;  1L0L H;  1V55 C;  2IM9 A;  3L9D A;  2CH4 A;  2RQ6 A;  2Q68 A;  1UFI A;  2UUC B;  5GTH Z;  2LW1 A;  4DV4 O;  3HEK A;  3HYZ A;  4GKK O;  3SJA C;  1SF9 A;  3HKC A;  4D7S A;  4HBN A;  1F4M A;  3FB7 C;  5KHG A;  2XUM A;  1NTZ H;  3ZS8 C;  3Q5L A;  4KHP O;  2XAS A;  2JJ2 G;  3BA9 A;  2Q73 A;  3HKC B;  3JAT B;  2Q67 A;  4I3H A;  1V54 B;  3ASO C;  4KFM A;  1KB9 F;  1JM6 A;  2OT5 A;  2IJI A;  2LGW A;  2ZE8 A;  4EMV A;  3OTF A;  3ZN0 A;  2O57 A;  3S3X A;  3ASN C;  1VEW A;  1S14 A;  3EHF A;  3TZ0 A;  1HR0 B;  1ZXM A;  2YDE A;  2NN4 A;  4JYB A;  4GKJ O;  4R6Z A;  3CS5 A;  4XDK A;  2R9A A;  4PJ0 Z;  3KE6 A;  1VQK V;  2WLI A;  4FCR A;  4MPE A;  5FL7 G;  2ZQM A;  2WAM A;  4LF9 O;  2WLI B;  5EC2 C;  3ETQ A;  4IHJ A;  1ZWH A;  2YIB A;  4AWO A;  4DV0 O;  2ZDY A;  5F3K A;  3CC4 V;  4D6T H;  4B3T B;  1Y4U A;  1H2N A;  2QM4 A;  1VQO V;  2JVD A;  3LSU A;  2HEP A;  3EXA A;  1JJO A;  1X4T A;  1IBK O;  3HB3 B;  5M4H A;  1IUR A;  2YE7 A;  2VRZ A;  1H7U A;  2ADQ B;  1YZB A;  1WPB A;  4DV1 B;  3WU2 Z;  1BS3 A;  1K4C C;  4FZ0 A;  5BMV A;  1QBZ A;  4WFG A;  2QEX V;  4EKW A;  2ZKO A;  4CWP A;  3U2K A;  2C2A A;  1SA0 B;  3KKY A;  5D7R A;  2XHX A;  3E8G A;  4P7A A;  2IH1 C;  4YIP A;  2NNU A;  3X2Q B;  4FLY A;  2E74 B;  1QLE C;  1TUE B;  2AW9 A;  3TXS A;  2LFR A;  1DLB A;  3VOU A;  3CD6 V;  4BIO A;  2Z5U A;  4JAA A;  1YCI A;  2IW5 A;  3ZMT A;  1YC1 A;  4AQY O;  1NT2 B;  2K9P A;  2QGN A;  3VHC A;  4EGI A;  1Y74 B;  2XOK G;  3TGU H;  3O6O A;  2GV9 A;  2YE9 A;  2WLK A;  1RM1 C;  1B62 A;  1MX0 A;  2H55 A;  4E00 A;  1BMF G;  3OMU A;  4CS2 A;  5KAF Z;  3HKD B;  1YT1 A;  4DV1 O;  1S76 D;  3ZRX A;  4MPN A;  3K5L A;  3L71 H;  2PUS A;  3L70 H;  1VMG A;  1A4H A;  3SGI A;  4IYI A;  3BVO A;  1IBK B;  1R6N A;  2IWU A;  4UVC A;  4Z1M G;  3G6E V;  4LH6 A;  2HHH O;  4N23 A;  3E8B A;  4ICG A;  4B3R B;  3K98 A;  4JI6 O;  3AK2 A;  4LR3 A;  4MVZ A;  1YJN V;  1TH8 A;  2A79 B;  2UXD O;  1VQ8 V;  2QKC A;  2ZIO A;  3ZMU A;  4BW5 A;  1KZN A;  1UYE A;  3B28 A;  1K5S A;  4DV5 B;  1VF6 A;  1BT8 A;  3CB2 A;  4BW9 A;  2DQ0 A;  3U0Z A;  3P32 A;  1FXK C;  2WI4 A;  1JFF B;  1GN3 A;  3Q5K A;  2BU2 A;  2AKP A;  5A9G A;  4U93 A;  4I0X B;  3KZI Z;  3I55 V;  2HJF C;  1JR9 A;  3M99 B;  2UXB B;  3LNM B;  2CAZ C;  4K8Z A;  4HXZ A;  4W7T A;  1Y74 A;  4UB6 Z;  4X9Q A;  2QTS A;  2Z3Y A;  4JI0 B;  3IC9 A;  4N21 A;  2P90 A;  4NXN B;  2IBZ H;  3ZED A;  1ZLZ A;  4TQF A;  5L3B A;  3O9O A;  3AG2 C;  4X1Y A;  4JF3 A;  3ZIA G;  1BGQ A;  4URL A;  3ZMZ A;  4WFA V;  4LF4 O;  2HLD G;  2YUA A;  5GON B;  5LBQ A;  2QFO A;  1FD9 A;  4CE1 A;  1T5E A;  4X1Y B;  4O4L B;  3BM9 A;  1H38 A;  5DM6 V;  4FFK A;  4LBE C;  5GON A;  2UXC O;  2P4K A;  3AG4 C;  1SA0 A;  4K0K O;  2BOB C;  2EIK B;  2KG7 A;  3Q5J A;  4O4L A;  2XAG A;  2X0L A;  4LF8 O;  1AIL A;  5BZB A;  5BOC A;  3TET A;  4EFE A;  1Q90 D;  4GGL A;  2H8P C;  2K1E A;  2DQ3 A;  5TIS Z;  5B3S C;  2WEP A;  2A0L A;  1A32 A;  4FZ1 A;  4LWG A;  1IVS A;  5KAI Z;  1HP8 A;  1YSZ A;  4HY6 A;  2DN9 A;  3ZMV A;  1WB8 A;  4FVM A;  4I7Z B;  1LR1 A;  3QTF A;  2WLL B;  1ZL8 B;  4LC1 A;  4L8Z A;  2ZDI A;  1XNQ B;  2EIL C;  3OT7 A;  4NVP A;  1OZ0 A;  3FYI B;  3IAY A;  2DYR B;  3N2G B;  4GKJ B;  4XKK A;  1AJN A;  4LF6 B;  4JI1 O;  4EFT A;  1M56 B;  1EM1 A;  4OX9 O;  5IYC O;  2F4V B;  3OWD A;  1YIJ V;  4JGS A;  2XTA A;  3ZRW B;  1MZF A;  2BSK A;  2HP8 A;  4WUB A;  2RDC A;  3T2S A;  4E01 A;  3RYH B;  1F51 A;  1VQ4 V;  3G80 A;  3ZRW A;  3STL C;  1Q86 W;  3E89 A;  2UWD A;  2H94 A;  1HNZ O;  1XEQ A;  3B25 A;  4O09 A;  3RGB A;  3J81 N;  3SR2 C;  3HYY A;  3JAM N;  4FFB B;  3H01 A;  1HNX B;  3PJS K;  2VQE O;  2MK3 A;  4K8X A;  1BHA A;  3T1Y B;  4DYL A;  1K8A W;  1AI6 A;  3G67 A;  3ABK C;  4J9Z B;  3LPS A;  4DR4 O;  3E86 A;  2CUG A;  4MW8 A;  1HNW O;  3STZ C;  4YJ2 B;  3OTO O;  4CH3 A;  2GHY A;  3OR6 C;  4J42 A;  1P7G A;  5L3E A;  2O1U A;  4WFH A;  3IFX A;  1BHB A;  2WI2 A;  4JI2 O;  3R4P A;  5KUM A;  5EBL C;  4O4H B;  1RFY A;  1RPO A;  4MTO A;  3MDS A;  4YKU A;  3CCU V;  3CXH F;  4O4H A;  2ZDI C;  4CWT A;  3NR7 A;  4FLT A;  2EBO A;  3CCM V;  3K9A A;  2Q8V A;  3SPI A;  3F5W C;  3ABL B;  4DK1 A;  1P49 A;  5LMU B;  3CXC U;  3BPZ A;  1FS0 G;  4XC0 A;  4QIW F;  4I50 B;  4P9O A;  4GLX A;  3QO7 A;  1YI2 V;  1FXK B;  2YIB D;  2Y0I A;  5DN6 G;  4R3M A;  3SYQ A;  1UYM A;  1MG1 A;  2QWO B;  3CGY A;  3WG7 B;  4JI0 O;  5KLV H;  3D0B A;  3D8C A;  2DMX A;  4ZHQ A;  1JVM A;  4UV8 A;  1I94 O;  1M9N A;  1PNM A;  3FV5 A;  3DSQ A;  4PRX A;  2ETN A;  1EI1 A;  4MVQ A;  5F2V O;  1Y76 A;  2XJJ A;  4ASG A;  3S3W A;  2GUZ A;  4JI5 B;  5IJ9 B;  1FXV A;  4FMT A;  1OCC B;  4CH4 A;  1Y76 B;  2FYU H;  3S5T A;  4KTN A;  3GWO A;  1MSD A;  5IYD O;  2QKA A;  3E35 A;  5BR8 B;  1YT0 A;  1KMI Z;  2WI1 A;  4YKR A;  4I55 A;  4UCS A;  1G1X B;  2H3O A;  2QR4 A;  1V55 B;  3JAK B;  1AR5 A;  4U7N A;  1PD3 A;  5M4M A;  4U3J A;  1M56 C;  3VAD A;  4X8A A;  4X20 B;  1WPX A;  2W6J G;  4LF4 B;  3TUH A;  1K7D A;  1ZX3 A;  2R70 A;  1JQ0 A;  2YGA A;  1VF5 B;  5KA5 A;  3OMA B;  3FX7 A;  5JCO A;  2YC0 A;  1GJV A;  4PA6 A;  4H13 B;  4LWS A;  3QDD A;  2P67 A;  1K3E A;  3K59 A;  3H1L H;  4MP7 A;  2XDU A;  4RAI A;  4JI3 B;  4B3S B;  1ORQ C;  1GO3 F;  3JD3 A;  2BYI A;  3FT5 A;  1SC5 B;  2F95 B;  3FB8 C;  3CRC A;  3WG7 C;  5M4N A;  3AK3 A;  3CWB H;  5EZY B;  4UUJ C;  2X6C A;  4IT5 A;  2YE6 A;  2IH3 C;  3RYI B;  1NBM G;  3R4O A;  2F66 C;  2GTA A;  4GZR B;  1WLE A;  1Z59 A;  4JAS A;  5JEN A;  2P5O A;  3RVY A;  1J5E O;  1XHZ A;  3H80 A;  4ZOL B;  1FKA O;  5M4P A;  2LO1 A;  3OGI B;  1ZL8 A;  4ZVI A;  1IBM B;  3A0W A;  1NZ6 A;  4CBC A;  1THN A;  3T2M A;  2YI6 A;  3APO A;  2E5L B;  3W7U A;  2UUA O;  4RO2 A;  4X66 B;  2QM8 A;  4QE9 A;  3K08 A;  1DF5 A;  2WA4 A;  1YVW A;  3ABM C;  5EK0 A;  3U2D A;  1UJW B;  3OUS A;  2BSK B;  1ARO P;  1MU5 A;  1NTK H;  5JJN B;  4OPH A;  2PF4 E;  4IGG A;  2Q7H A;  3JD4 A;  1B6Q A;  4O4J B;  5GW7 A;  1PM9 A;  3N27 A;  3U10 A;  3OMI B;  1EA6 A;  2Q6A A;  2IWS A;  1IXB A;  1ZSP A;  1W59 A;  4CWR A;  4LNU B;  2OTL V;  4UXN A;  1XIL A;  3Q4H A;  2GDS A;  2ESA A;  3ABT A;  4J7K A;  4XDM A;  4DR5 B;  1F23 A;  1KQS U;  4UB8 Z;  2FXS A;  2AZ2 A;  2CTP A;  3CX5 F;  2B9Z A;  3RWR D;  4J11 A;  1FPO A;  4XIP A;  4UV9 A;  1YTF D;  1N8R W;  3LUT B;  5J2T A;  4FIP C;  2QG0 A;  3E83 A;  1HW7 A;  2KQX A;  1Z5V A;  2FWZ A;  1Q8I A;  3ZHQ A;  4GCZ A;  3RKZ A;  4CE3 A;  4EEH A;  1GKF A;  3TCU A;  2XCM A;  4HZ0 A;  3J80 N;  4BIU A;  5EYP A;  1W0J G;  3JD2 A;  4BIZ A;  3SDL A;  1YIT V;  1S5J A;  2R9I A;  1HNW B;  2HJD A;  1I7F A;  3AG3 C;  5JH7 B;  2VQF O;  2HG5 C;  3A0T A;  4AWQ A;  3CCV V;  4EFU A;  4Z2W A;  4KXR A;  5JH7 A;  3BRC A;  3H1J H;  4IYH A;  3RLQ A;  4B6C A;  4LWS B;  2JGD A;  1LUW A;  1SES A;  2LFS A;  2UUB O;  5BOD A;  1QHT A;  1OCZ B;  5D6Q A;  1Y8O A;  2OIE A;  1U0Z A;  5D5Q A;  2OCH A;  3B8M A;  5JVD B;  1Q81 W;  4WFB V;  2NLJ C;  2E0A A;  2YXY A;  1CPY A;  4MPC A;  4PA3 A;  5FND A;  2DYR C;  4RWU A;  1NR1 A;  2ATK C;  3H1K H;  1N36 O;  2VCJ A;  4P8O A;  4DR2 B;  1R3L C;  4GX0 A;  1H2K A;  1ZAU A;  2HVJ C;  3H4L A;  1OCR C;  4JI7 B;  2XDK A;  3QO5 A;  4TV8 B;  2BU7 A;  2YED A;  2YKE A;  2EJ7 A;  1SS3 A;  3BAA A;  4DUY B;  5LOV B;  2V4D A;  2F4V O;  2CTW A;  1VQP V;  4B3M O;  4NH8 A;  4JZ2 A;  5KHJ A;  3JAW A;  3GIE A;  3KG2 A;  1R62 A;  1YS3 A;  4L94 A;  3CC7 V;  3OEH G;  1G8M A;  2JKI A;  2YGE A;  1IX9 A;  2P6J A;  1H2S B;  4YXW G;  3CEI A;  1AI5 A;  1YSR A;  3CRA A;  3ABU A;  1VF7 A;  2CK3 G;  5CB4 B;  2KKW A;  2UUB B;  1M93 A;  1P7B A;  4YJ3 A;  4TV9 B;  3OGC C;  2XJG A;  1RPR A;  4X1K A;  1SRY A;  5JCO C;  2YEJ A;  3OW2 U;  5H2F Z;  3SPJ A;  1KD1 W;  2ZM6 B;  1MA1 A;  3JAL A;  4MVS A;  5CA1 B;  2YXL A;  4LCU C;  3GWK C;  3IJ4 A;  3JYC A;  4YHH B;  1GMG A;  1N33 B;  4E4E A;  1JOY A;  3EHG A;  1I5Y A;  5GTI Z;  1BKN A;  3WB0 A;  2PI4 A;  3P3N A;  2B1I A;  1R3K C;  4MTX A;  2Y48 A;  4LF9 B;  3SYA A;  2VWC A;  4LP0 A;  2QA4 V;  1BYQ A;  4O2B A;  1OJH A;  5CTW A;  2BRE A;  3CHX A;  2UXB O;  2D2C B;  2Q5Z A;  1NQT A;  4DRX B;  3GIG A;  4UVA A;  3RLP A;  4O2B B;  1TBW A;  1AR1 B;  2ZIM A;  2XND G;  3MNR P;  1HDJ A;  1KIJ A;  4PI2 A;  4J7Z A;  2WWW A;  3VHA A;  1TA8 A;  3OM3 B;  2G38 A;  5IY5 C;  1GRJ A;  4HNA A;  5B1A B;  4K35 A;  1YC4 A;  4WUC A;  4PV1 B;  4DUZ O;  1BCC H;  2FKX A;  3B40 A;  1MZE A;  1KBH A;  1GKX A;  4MP2 A;  2ADP A;  3QF7 A;  4MSW C;  1GAX A;  5JVD A;  3CWV A;  5CA3 A;  3GB7 C;  3B27 A;  3IC7 A;  5CBG A;  3BMY A;  4NTY A;  4L91 A;  2L6L A;  2Q7G A;  4CWS A;  2WLM A;  1EFR G;  1M1K W; 
#chains in the Genus database with same CATH homology
 2DYR B;  1AJN A;  3A0R A;  3CCR V;  1M56 B;  4WFE A;  4X88 A;  3W7W A;  5IYC O;  3DTU B;  1YIJ V;  3K0D A;  4JGS A;  4KP4 A;  2AHY A;  3SPG A;  1K97 A;  3ZRW B;  5LHH A;  3SYO A;  5CMU A;  2DYS C;  1NKD A;  1W0K G;  1Y66 A;  5H6Q A;  1COW G;  4MTF A;  1QLN A;  1F51 A;  1P4R A;  4QNH B;  1FFT B;  2HVK C;  1VQ4 V;  4X89 A;  3ZRW A;  1NJI W;  3STL C;  3OAA G;  3WFV A;  1Q86 W;  2EZO A;  3E89 A;  2EIN B;  4P2Z A;  2H94 A;  3ZRV A;  5LGT A;  1R3I C;  1EBO A;  3G71 V;  5L3F A;  1Y4M A;  3QO8 A;  3W7T A;  3H01 A;  1M57 C;  1NH2 D;  5IDJ A;  3RVZ A;  3PJS K;  2IJH A;  4PDL A;  3CCQ V;  2MK3 A;  1BHA A;  4H33 A;  4JAV A;  1K8A W;  1MAB G;  1AI6 A;  4H37 A;  2DWD C;  2FTK A;  1JX9 A;  3ABK C;  5B1N A;  3BY6 A;  2DWE C;  4J9Z B;  3AG4 B;  3E86 A;  1KP2 A;  3OE7 G;  4PDV A;  3NXS A;  1GTO A;  4MW8 A;  4DO2 A;  3STZ C;  3CCE V;  4QPJ A;  1YJ9 V;  1VQL V;  2EZP A;  4Q20 A;  2GHY A;  1S0V A;  2WLJ A;  3K3W A;  3OR6 C;  5L3E A;  4WFH A;  4RUE A;  3IFX A;  1BHB A;  4MVU A;  5KUM A;  5LHG A;  3K04 A;  1EZJ A;  2P7T C;  3ASN B;  5EBL C;  5CBH A;  2D3O W;  1RPO A;  3ABL C;  5LHI A;  3E2E A;  4MTO A;  5KA6 A;  2B5U A;  5B1O A;  1AJQ A;  1GM9 A;  3CCU V;  1E79 G;  4TSF G;  3OUF A;  3SJQ C;  2ZDI C;  3R65 A;  2EBO A;  4I5S A;  3CCM V;  3K9A A;  2XAF A;  3SPI A;  3F5W C;  3ABL B;  1S3J A;  1ENV A;  1FXK A;  3MHH C;  4FJC C;  1YJW V;  3HPL C;  3CXC U;  1FS0 G;  1ROP A;  4QIW F;  3VBB A;  4QPK A;  1S77 D;  4P9O A;  5HFM A;  3UM7 A;  1YTF B;  1R6K A;  2DW4 A;  3QO7 A;  4CZZ A;  1YI2 V;  1FXK B;  5DN6 G;  1OHH G;  3W7S A;  1MOF A;  3ABM B;  1K4D C;  3SYQ A;  1MG1 A;  3ZMS A;  1QVG U;  2B1G A;  3WG7 B;  3UKM A;  2EIJ C;  2ITC C;  1DTO A;  4JYC A;  4F4L A;  4R8C A;  1JVM A;  3ABK B;  4UV8 A;  1NVP B;  5IYB O;  1K92 A;  3CP1 A;  1R3J C;  1M9N A;  5KUK A;  1VQ7 V;  1PNM A;  1KP3 A;  1V54 C;  3ASO B;  2HR3 A;  2ZR3 A;  1IXM A;  4MVQ A;  1XL4 A;  3AEI A;  1PNL A;  1F4N A;  4ZBM A;  4J9Y B;  1FXV A;  4FMT A;  1OCC B;  3SPC A;  1QR9 A;  2HKO A;  1Q7Y W;  2W0F C;  3LDD A;  3GWO A;  5IYD O;  2BOC C;  4FK5 C;  1QCE A;  3E35 A;  1SER A;  4FPP A;  2DYS B;  4WCE V;  1ZWI C;  2IJK A;  3E8F A;  3MHS C;  2GSM B;  1V55 B;  1NH2 B;  2IU0 A;  4U7N A;  5E1A C;  1PD3 A;  3ETE A;  5LGN A;  3B8N A;  1GM7 A;  4ASU G;  1M56 C;  4KUM A;  1VQ6 V;  3K03 A;  1PNK A;  2KB1 A;  5CBF A;  3FB6 C;  4X8A A;  1KEC A;  4R50 A;  4JPR A;  4PDM A;  1WPX A;  3AG1 B;  2X6A A;  5J9P C;  2W6J G;  2WLN A;  1K7D A;  1OCZ C;  4I9W A;  2ZR2 A;  4L87 A;  4QJF B;  1JQ0 A;  1THZ A;  3F7V C;  4RQE A;  4PA9 A;  3T1C A;  3DGE A;  5KA5 A;  1H8E G;  3LDC A;  2WSS G;  3E8H A;  3OMA B;  4ZKI A;  2ITD C;  3LSQ A;  5B3S B;  3T4D A;  1QLE B;  3P30 A;  2JIZ G;  4HYO A;  3ZRS A;  4MVM A;  2UXX A;  3D3I A;  4PA6 A;  2AHZ A;  4WFF A;  3CYO A;  3K79 A;  5B1A C;  2QKS A;  2XAJ A;  1YHQ V;  2P67 A;  1FXH A;  2UXN A;  3ZJZ A;  1K3E A;  2R9R B;  4P30 A;  1QVF U;  2JDI G;  1I5X A;  4JTD B;  4RAI A;  2X7R B;  2QE7 G;  2JEX A;  1ORQ C;  3SYP A;  1GO3 F;  3JD3 A;  1K73 W;  1SZT A;  3T4Z A;  5H6R A;  1V55 C;  3FB8 C;  3EFF K;  3CCJ V;  3WG7 C;  2Q68 A;  4UVB A;  4UUJ C;  3LDE A;  2X6C A;  5EBM C;  5EBW C;  4XBF A;  1VQ9 V;  2Y69 B;  2IH3 C;  1NBM G;  2WLH A;  4MS2 A;  1WLE A;  4XDL A;  1F4M A;  3FB7 C;  3EHB B;  1OCC C;  4JAS A;  3CMA V;  3RVY A;  2XAS A;  2JJ2 G;  1NVP D;  2Q67 A;  1V54 B;  3ASO C;  3D36 A;  4KFM A;  3BEH A;  4CBC A;  2OT5 A;  1KKD A;  3T2M A;  2IJI A;  3ETG A;  1S72 V;  3W7U A;  4RO2 A;  3I56 V;  2OCC B;  2QM8 A;  4QE9 A;  2XAH A;  3ZN0 A;  3K08 A;  3ASN C;  1DF5 A;  3SYC A;  3CME V;  4PEL A;  3ABM C;  5EK0 A;  1UJW B;  3OUS A;  5HFL A;  1H8H G;  4QE7 A;  1ARO P;  3ZCC A;  2YSU B;  1VQ5 V;  4JYB A;  1DF4 A;  1CP9 A;  4R6Z A;  4XDK A;  2V7Q G;  4PDR A;  1OCO B;  2IJJ A;  2HFE C;  1VQK V;  3JD0 A;  2YEV A;  4PA7 A;  3JD4 A;  1B6Q A;  3SPH A;  2WLI A;  5GW7 A;  2OCC C;  5CN0 A;  3OMI B;  2Q6A A;  4MW3 A;  3ZN1 A;  1HWY A;  5FL7 G;  2ZQM A;  2WAM A;  5L3G A;  4RQF A;  2OTL V;  4GX1 A;  2WLI B;  4UXN A;  3JD1 A;  5EC2 C;  1L1F A;  1JJ2 U;  3ABT A;  3CPW U;  1F23 A;  1KQS U;  3TK1 A;  3FB5 C;  3CC4 V;  4MVR A;  2OTJ V;  4TT3 G;  4HAM A;  1VQO V;  4UV9 A;  1YTF D;  1N8R W;  3LUT B;  1G4Y B;  4FIP C;  2Y69 C;  3OR7 C;  3E83 A;  3CCS V;  2PI5 A;  1JCH A;  3HB3 B;  4GCZ A;  1GKF A;  3TCU A;  4BIU A;  2JK5 C;  1K4C C;  1W0J G;  3JD2 A;  4BIZ A;  1YIT V;  1QBZ A;  4WFG A;  2R9I A;  4EKW A;  1NR7 A;  3K06 A;  2QEX V;  2C2A A;  3AG3 C;  1RM1 B;  2EIL B;  3E8G A;  2HG5 C;  2IH1 C;  3X2Q B;  2NNU A;  1AI4 A;  1QLE C;  1TUE B;  3CCV V;  2LFR A;  1DLB A;  3LSS A;  1KC8 W;  3RW0 A;  3VOU A;  2EIN C;  3CD6 V;  2Z5U A;  2WPD G;  2IW5 A;  3ZMT A;  1SES A;  2LFS A;  2ZXW B;  1OCZ B;  1GM8 A;  2XOK G;  3AG1 C;  5C93 A;  1VQM V;  2WLK A;  3AG3 B;  1RM1 C;  3B8M A;  1Q81 W;  1BMF G;  5IY5 B;  1W2B U;  4WFB V;  2NLJ C;  4GX5 A;  1CPY A;  1YSC A;  4PA3 A;  4JTA B;  2DYR C;  1S76 D;  1NR1 A;  3ZRX A;  2ATK C;  2EJR A;  1SET A;  1R3L C;  4GX0 A;  4E2L A;  4GT1 A;  3OMN B;  2HVJ C;  1OCR C;  1R6N A;  4UVC A;  4Z1M G;  3QO5 A;  3F7Y C;  5EC1 C;  3RBZ A;  3G6E V;  5H9C A;  4JAU A;  1K34 A;  3MD0 A;  4N23 A;  3E8B A;  2EIM C;  1K9M W;  1VQP V;  3KG2 A;  1XL6 A;  3FKS G;  2Q69 A;  3CC7 V;  3OEH G;  4MVZ A;  1YJN V;  1G8M A;  2A79 B;  1VQ8 V;  4OXS A;  4TWK A;  1JPX A;  1PKX A;  3ZMU A;  4BW5 A;  2P6J A;  1LNQ A;  1BL8 A;  1K5S A;  2EIK C;  4JTC B;  1AI5 A;  4YXW G;  2EIJ B;  3ABU A;  1QR8 A;  3OFN G;  1M90 W;  2CK3 G;  2QM7 A;  1OCO C;  3QNE A;  4G2K A;  5B1B B;  2QTO A;  1P7B A;  3CC2 V;  3B77 A;  3OGC C;  2DQ0 A;  1RPR A;  3P32 A;  3IGA C;  3JCZ A;  1SRY A;  1FXK C;  4R7C A;  4XDJ A;  4BAY A;  2WLL A;  5L3D A;  3AG2 B;  3OW2 U;  3FYI B;  3K0G A;  3SPJ A;  1KD1 W;  4HZ3 A;  3I55 V;  2HJF C;  3M99 B;  4MVS A;  3LNM B;  3OEE G;  3ML0 A;  4MT8 A;  3CCL V;  4LCU C;  4LP8 A;  1J95 A;  2Z3Y A;  2ZD9 A;  3JYC A;  1GMG A;  2X6B A;  4N21 A;  2IU3 A;  2P90 A;  4DXW A;  1JOY A;  1I5Y A;  1S5H C;  3ETD A;  2PI4 A;  1K5Q A;  2B1I A;  1R3K C;  1M1K W;  4MTX A;  2Y48 A;  3SYA A;  4P9P A;  1VQN V;  5L3B A;  2QA4 V;  3FYE B;  1Q82 W;  3AG2 C;  4JF3 A;  4RUF A;  3ZIA G;  2V1D A;  4MTG A;  3ZMZ A;  4WFA V;  1E1R G;  2HLD G;  5LBQ A;  1NQT A;  4UVA A;  2XAQ A;  1AR1 B;  1H38 A;  5DM6 V;  2XND G;  5B1B C;  5L3C A;  4LBE C;  2A9H A;  1PL0 A;  2F43 G;  4G27 B;  3AG4 C;  2BOB C;  2EIK B;  3W7X A;  4G28 B;  2XAG A;  2X0L A;  2WWW A;  1R73 A;  4WF9 V;  1AJP A;  3OM3 B;  5BZB A;  5IY5 C;  3TET A;  1MSW D;  1E1Q G;  5B1A B;  1K33 A;  1M57 B;  2H8P C;  2K1E A;  2ZXW C;  4U7O A;  2DQ3 A;  2EIM B;  2W6I G;  5LGU A;  5B3S C;  2A0L A;  1H2G A;  4PA4 A;  1CEZ A;  3ZMV A;  2JJ1 G;  4MSW C;  2LP7 A;  3G4S V;  4MVO A;  1OCR B;  2WLL B;  3GB7 C;  5CA3 A;  2M7W A;  4LC1 A;  3X2Q C;  2JEU A;  3IC7 A;  5CBG A;  4GX2 A;  2ZDI A;  2EIL C;  1OZ0 A;  1AI7 A;  1GK9 A;  2WLM A;  1EFR G;  2YEV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...