1F51A

A transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in singal transduction
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
181
structure length
181
Chain Sequence
ISDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEITSHECLIEIGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in signal transduction.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords SPORULATION INITIATION PHOSPHOTRANSFERASE B
total genus 64
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature ec 2.7.-.-:
pdb deposition date 2000-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14682 SPOB_ab Sporulation initiation phospho-transferase B, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1f51A01
3.30.565.30 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Sporulation initiation phosphotransferase B (SpoOB), C-terminal domain 1f51A02
4BIUA 4GT1A 5B1NA 5IDJA 4GCZA 3NXSA 2WWWA 3ZRVA 3D36A 4JYBA 3ZCCA 4I5SA 4FPPA 4MTXA 2LFRA 4QPKA 4BIZA 4QPJA 4U7NA 2P67A 2LFSA 4FMTA 5B1OA 4JAVA 3MD0A 2C2AA 1IXMA 4Q20A 3TK1A 4JAUA 4MT8A 4KP4A 4ZKIA 5C93A 1F51A 3P32A 1JOYA 2QM8A 3A0RA 3ZRWA 4U7OA 3ZRWB 4JYCA 3DGEA 3ZRXA 4LC1A 2QM7A 4JASA 2FTKA
chains in the Genus database with same CATH superfamily
3LSQA 2DYRB 3RYHA 5CN0A 2LQTA 2A9HA 3CCVV 4K0KO 1TVKB 2WEPA 3D36A 2IW5A 3JSNA 4AHCA 2YECA 1BXDA 3FT8A 3OE7G 2ZR2A 3OGCC 1TILA 1W0KG 3G75A 3JAWB 2UXBB 2YEEA 3G7EA 1KB9F 4XE2A 4H13B 4KP4A 4DV5B 3JAKA 5B1AB 1XHXA 2CGFA 1S77D 2AHZA 4NTXA 4DV3O 4UCTA 3QTCA 1X4TA 2JDIG 2EIKB 2UXXA 1LUVA 3Q4HB 1OCRB 1H7SA 3OR7C 4L93A 5CMUA 1HDJA 4O4IB 3P3PA 3OFNG 1GO3F 1VP7A 2YEHA 1YSRA 4CWQA 5M4NA 4YKQA 2Q68A 2XABA 1OCCB 1XNRO 2N74A 2YK9A 5LHGA 4LFAO 4FM1A 1KP3A 1B62A 5M4MA 2QF6A 3BPZA 1FXKA 2XJJA 5D6PA 4HY1A 1OZ0A 3EHGA 4XDMA 5FWKA 2YKCA 1GM9A 3LPSA 2ZKOA 4DR5B 4HZ3A 1QLEC 5LP6A 2F4VO 4LWSB 4O2AB 5LP6B 2BU6A 2OCCC 3QTFA 5IJ9B 4DV4O 4QPJA 2ATKC 3SJQC 5IJ9A 4NTYA 4I50B 2P6JA 5DECA 1Q7YW 4I50A 3CCJV 1G6UA 2R9RB 3MNRP 2XOKG 3AG3C 3DXRB 2H3OA 5KA6A 5FNVB 4NXMB 3UM7A 2ZE5A 1MSWD 4PRXA 3CX5F 3NXSA 2WI7A 5B1BC 3ZMSA 3DC5A 1R6KA 4GX2A 1R62A 1I5DA 3BA9A 1HNWB 2P67A 3CGZA 2E76B 2E5LO 2Q69A 3FB8C 2F95B 2HCHA 1WPXA 2QWOB 3ZM7A 1VEWA 1Z5WA 2ZDIA 1VQ5V 2YEFA 3ZBHA 3GWKC 4PA6A 3VQXA 2YIAA 2DW4A 2P4KA 3FV5A 3M8AA 3AG4B 5EC2C 4JASA 2IJHA 3FT5A 4V25A 2Q4PA 1R6TA 1KP2A 3L73H 4H44B 1AB3A 4JI6O 5GGZA 2VWKA 3AG2B 1F7YA 2EIJC 5K1XA 2E74B 4LWEA 4KUMA 3BFRA 3CCEV 3IJ4A 2QKCA 1IBKB 4TOIA 1N34O 3LNMB 4PI2A 1PNKA 1COWG 2XT9A 2Y69B 2XDUA 5JQGA 3CCUV 4JI5B 5JQGB 1I5YA 2E3CA 3STZC 1PV0A 5DM6V 4X1IB 4CBCA 2YKJA 1M56C 3WQ9A 4WUBA 3QVNA 2VCJA 4AWOA 5LYJA 1GN2A 4DV1O 1EM1A 5C8YB 2QJ1A 3INWA 3B09A 1FFXA 3FD9A 5GONB 4P9OA 2F93B 1FFXB 1MZFA 2GTSA 1Y4MA 4CZZA 1ROPA 2RQ6A 1WA8A 2PZSA 4YY3O 3TZ4A 3JASA 4NH7A 1N0NA 3JALA 3PJSK 1AH6A 4PA9A 1G4YB 2EIJB 5J2TA 3OTOB 4MTGA 2BYIA 1N36B 2W0XA 2XAQA 4UVCA 2WAMA 2B9ZA 3OEHG 1K4DC 4HNAA 4LF8B 2Q7GA 2N05A 3L9DA 1YT1A 1S0VA 2HP8A 4JV5B 2UU9B 2XDSA 4JTAB 2F66C 4DR1B 3JAKB 3T4ZA 2CCUA 2DN9A 4J7JA 4MVQA 3ZKDA 4MPCA 4V26A 2LO1A 2EX3A 1XHZA 3R65A 3SPHA 3N2GA 3R4OA 3O6OA 3LSUA 1YSCA 2N04A 5DN6G 1K34A 2QWQB 4ZBMA 4O09A 4XKOA 1PM9A 4I9QA 3A8TA 2UU9O 5CA0A 3VHCA 4DYLA 1KMIZ 5CA0B 4JYCA 5KX5B 3OW2U 3UCSC 4CS4A 4J9YB 2ZBKB 3H9VA 2WLIB 1QLNA 1N36O 2LFRA 2DYRC 2UUCO 1BS3A 4FMTA 1E1RG 2EILC 1VQPV 2BSMA 1SETA 3KG2A 3ZRWA 4X9LA 3JD4A 5D5QA 1NH2D 4XD8A 3ZRSA 5KAIZ 4LF9B 3L70H 4FM2A 2GFDA 1W0JG 4DK1A 4EKWA 2XHRA 5FNVA 4HY6A 2YJWA 3STLC 3VADA 2Q0OC 4UVBA 4DR7B 4L8JA 2YEDA 4JI1B 2WI4A 2HHHO 1IBLO 2ZXWC 2WI5A 2R70A 5IN9A 5J2UB 2OTLV 2MK3A 4NVPA 2YUAA 2E5LB 5KHKA 2UUAO 1UPGA 3P30A 1H2MA 3ZHQA 3X2QC 4JI6B 1I58A 2Z5UA 1TVKA 1BMFG 2BCCH 4AQYO 3LNUA 1BSMA 4I3HA 3AEIA 4K3AA 1XEQA 4PDVA 3CMAV 4MW8A 1UY6A 3OTFA 1EI1A 2YEBA 1NVPB 4UCOA 2W6IG 3B25A 3O9OA 2YIBD 3E89A 1BKNA 1K97A 2ZT9B 1UYDA 1US6A 4OXSA 1Y8OA 2FWYA 2XDXA 2H94A 1L1FA 5IDJA 3OTOO 5EYPB 4YIOA 4DR2O 4LF7B 1I08A 3ABKC 5H9CA 3D0BA 1AI7A 2X7RB 3SPJA 1IURA 2YIBA 1S14A 2XAHA 1FXKB 1VQNV 2Q8IA 3CCSV 3ZX6A 4B7EA 3W7SA 3K60A 1Y8NA 3INXA 1KZNA 3E86A 2XDLA 3ABUA 2D3OW 3JALB 4DUYB 4JI4B 3TZ5A 4LC1A 5GW7A 4MBCA 5KHGA 3CYOA 4O2AA 1SQGA 5LMNB 4JI0B 1NHIA 1CPYA 1N0JA 4J80A 1MABG 1YESA 3A0HZ 1FJGB 2E75B 1PKXA 2ZE8A 3KZIZ 4LH7A 3A0ZA 4K35A 1ZWHA 4JAUA 4KFMA 2B5UA 3QO5A 3CCRV 5J6AA 3DXRA 2BU2A 2EJ7A 3P3NA 5CF0A 2VWCA 1F4NA 1VQ9V 2ESAA 1BCCH 3VBBA 4E01A 3T1YB 3JD2A 1I5XA 5BZBA 4DUHA 2YK2A 4K8XA 1K8AW 2ZR3A 1QCEA 1IBMO 3QDDA 3LDCA 5CTUA 1GKFA 4J41A 4L8ZA 3EHFA 5D7DA 3WHAA 5ITZB 1U96A 2OIEA 1YT2A 2AHYA 1BHAA 5BODA 2JGUA 4RQEA 1UYFA 3BVOA 1OHHG 3EHBB 2JIZG 3K0GA 3RBZA 1KUQA 4LF9O 1QZRA 3OUSA 2BU5A 4URNA 1S16A 1BHBA 4K0KB 4PRVA 4NXNB 1B6QA 2NR5A 3F5WC 1XL4A 3ZN0A 4DV4B 1GN3A 3SYCA 3BY6A 3TXQA 1VQ4V 4HZ0A 1Z5BA 3ZRWB 1SRYA 4MVZA 3K5NA 4YJ2A 3JAMN 4CE3A 1RP3B 5LYJB 3UKMA 3RLRA 5IY5B 3QO7A 1R3KC 1YI2V 4GQTA 2JJ1G 2C1IA 2IOQA 2RNBA 1S72V 1WA8B 2JEXA 4JYYA 4X62B 3JCZA 1XOUA 2EINC 5CB4A 3FB6C 4YXWG 1M90W 1I0HA 2O1UA 4DR3B 1Q90D 4ASFA 4OPAA 5IWAB 3UO2A 2Y0IA 4DV3B 4LCUC 2HHIA 3S3XA 1J95A 1CXZB 3JAWA 4HYMA 2YE6A 2A0LA 4R7CA 1R3LC 4LBEC 4WUCA 1BYQA 1XILA 2CH7B 3K3WA 4JYAO 1Y6XA 2CH7A 1LUWA 1YTFD 4GKKO 1Z59A 4YKYA 1XQ8A 2YXHA 3HKCB 3Q5KA 1NKDA 3HKCA 1YF2A 4B7PA 3LDDA 4WFBV 2CAZC 4B3RO 1FPOA 1NHJA 3OMAB 3N2GB 5EYPA 1P4RA 4MSWC 3FAVA 1QVGU 4FCQA 3FKSG 3I55V 4AWQA 2WLMA 1ZXMA 3MHSC 4JQLA 1OCZC 1KQSU 1JCHA 1R6NA 1JFFB 1XMOO 1ZSPA 4CS2A 1JFFA 2RJZA 4YJ3B 1AVMA 4CC6A 3CRLA 4RWUA 2JRIA 4UV8A 4DZYA 2ZCEA 1VQLV 4LWSA 1YXBA 1GKZA 2V4DA 3FB5C 2ADPA 1TUEB 4JI0O 1RM1B 1IX9A 3A0TA 1RFYA 1ENVA 4B7KA 2V1DA 3CRRA 2ZIMA 4YKZA 4NB5A 1NH2B 4DW1A 1XMOB 2Q8GA 5LA6A 5B1BB 5LGNA 3ABLB 5LA6B 4EMVA 5DEDA 3G4SV 4P8OA 3FYEB 3ABKB 2UUBB 3ZXOA 2V7QG 2AXTZ 2H8MA 4EFTA 1AH8A 2HFEC 3EKRA 4B3SB 4BR6A 3ZCCA 3JD3A 1Y74A 1Y74B 2FMLA 1ZWIC 4UV9A 4BW5A 1ZW9A 4PL9A 1HR0B 1PNMA 1TBWA 1JVMA 2Q0AA 4Z1MG 1YCIA 3BCCH 5C93A 1HNWO 1MA1A 1Q6UA 3FB7C 1EN5A 2WLLA 4LP8A 4BIUA 1XL6A 3B8NA 1M1KW 1KECA 1BT8A 4EGIA 1US7A 1VARA 2BTOA 2HG5C 4R8CA 4MPNA 2BTZA 1EZJA 1THNA 4JAVA 4CWNA 1LNQA 3U67A 1M57C 3FFQA 1F51A 2CE4A 1P84F 2Q7HA 3Q5LA 4UFZA 2IBZH 2Q9LA 1BQZA 4TQDA 2A3QA 4X64O 1YSZA 4Q20A 4ZVIA 1CEZA 4YJ2B 4JZ2A 3A0BZ 1NTZH 5B3SC 3CCLV 4FLYA 5EC1C 1JPXA 2HKJA 1QNMA 2XAGA 1KYOF 1BGQA 3AG4C 3J81N 3U0ZA 1OV9A 1UJWB 4XKKA 4GYCB 3ASOB 3CCMV 3JASB 3ZHUA 5KA5A 3EXAA 2QGNA 1XNRB 2X6AA 5J2TB 2HVKC 2NLJC 4GUNA 1Z2GA 1I5BA 4O4HA 3BMYA 1HWYA 3RWRD 2EIMB 2QM7A 2IU0A 2GUZA 2KG7A 3IC7A 2GUZB 4CH6A 2KG7B 2HLDG 4URLA 4DR5O 3RVYA 4DV5O 5B1AC 4EFEA 2QM4A 3K9SA 1SC5B 1U97A 4WCEV 4ASUG 4MVOA 1XNQO 1M4UA 4ZKIA 3OW6A 2P06A 4UROA 2P90A 1G8MA 3RN4A 1OCCC 1V54C 4GEEA 3CC2V 4H33A 4CS3A 5LL6Y 2H55A 2YEGA 3A0WA 1RPOA 3B26A 5ITZA 3CRKA 4XKAA 2QA4V 3H01A 1IXBA 3WG7B 4Q6GA 4X9QA 2YEIA 2K9PA 1L0LH 3BRCA 1NI8A 3H4LA 1N32O 3A0RA 1I7FA 1H38A 5L3EA 4LF4B 1PL0A 1XNQB 2BTQA 1KKDA 1NJIW 4G28B 4JI2B 3NR7A 1WN7A 5LMNO 4L91A 3BM9A 4LWGA 2EIKC 3AG3B 1WNSA 4EB6B 2ARHA 2GTAA 2OCCB 3CJHB 4X66O 1N34B 5M4HA 4EB6A 4BW9A 2KQXA 2ITCC 2X6CA 3W7XA 2ZM6O 1QQCA 3SPIA 4NYKA 4B3TB 2WLKA 1K7DA 4ICGA 2VQFB 5D7CA 4JI7O 4L87A 2VCIA 4I0XB 3CB2A 2YXYA 3ABMC 4B3MO 5CB4B 1HR0O 4PELA 1FYJA 4ZHQB 1XREA 2R9AA 2IU3A 2BE3A 4MPEA 2WLLB 2A79B 1U0ZA 1AP5A 1FD9A 4FJCC 4ASGA 2UXDB 4F6EA 2BRCA 4FPPA 1TIDA 2HR3A 2Y69C 2QKSA 1S76D 2EZOA 1L0NH 2XCMA 4LFCO 2XHBA 1JA8A 1YHQV 3JZ3A 4XBFA 2BOCC 4XDLA 1AJQA 2HEPA 5KUMA 2YKEA 1AI6A 3L72H 4AILC 3JD0A 3PEHA 3K5OA 5JENA 4PHZA 1EN6A 2YIDA 4A5UB 1VMGA 2X0LA 3C3TA 3ETEA 1I94O 3D2RA 3ZRVA 3ZIAG 3GIGA 4I5SA 1EFRG 2Q5ZA 4YY3B 1Y8PA 2RMKB 4BIZA 1AILA 3WB0A 1ZTEA 3OMNB 5LHIA 4O04A 2P22C 4YJ3A 1GMGA 3T1CA 4L94A 1JX9A 4KTNA 3ZEDA 5H5NA 1YETA 4PA7A 5M4EA 3RGBA 4GZRB 3DC6A 1KC8W 1VF6A 3B2EE 4MTXA 2IJKA 2X6BA 3E35A 1SQPH 3K57A 4LNUA 1K33A 3ZHSA 1SZTA 3T0ZA 4GGLA 1NHHA 5CTXA 4PA3A 4FLTA 1AJNA 3DSQA 4O2BB 4IGGA 1P7BA 3H1HH 2EBOA 3B77A 1F4MA 4UVAA 1AJPA 1AR4A 3KCYA 2DYSC 3T0HA 5BMVB 1AI5A 1FXHA 5BMVA 2DJVA 1SZXA 3ASNB 4BIOA 4YKXA 3EHJA 4MT8A 2AZ0A 3OEEG 4JI7B 1TGOA 2UXBO 4FCRA 4E72A 4G2KA 5LBQA 3D3QA 1HNXB 4EGKA 2VQFO 1K5QA 3OM3B 4DR7O 4PJ0Z 3JARB 4KHPB 1BE3H 3CC7V 3K08A 5LXTA 4YKWA 3T1KA 5LXTB 3D3IA 1YDXA 3CWVA 1T5EA 1X59A 4EEHA 3LDEA 3BABA 2B1IA 4FZ1A 1FKAO 1JM6A 1THZA 2YI8A 1SKVA 3FX7A 1V54B 2AZ2A 1H8EG 2QDOA 3CJHA 2KSDA 3WG7C 1NR7A 4PU9A 5JCOC 3S3WA 4FCPA 5CTWA 2YI7A 4LPBA 4P2ZA 4DXWA 4OX9O 4O0BA 3H1LH 5KLVH 2Q67A 4TV9B 1OCOB 1YIJV 3K9AA 2XTAA 2YI5A 2VS0A 4FZ0A 2XAFA 2Q7EA 3ZMZA 4RO2A 1FXVA 1H2LA 2WA4A 1GAXA 1Y66A 4DV2O 1KIJA 1K9MW 5EIBC 2CK3G 1BQ0A 5EZYA 2YC0A 4N21A 4YIPA 4ZHQA 1F23A 1H7UA 3OD4A 2K5BA 4HXZA 3K98A 3CD6V 4KFGA 4UCSA 3SR2C 3S5TA 3WU2Z 5KMGA 4JI8O 3CYGA 4GLXA 1VQ6V 5JVDA 5D7RA 4X8AA 1IZ3A 3CXHF 3UT5B 2BU8A 4HBNA 1ORQC 3TZ2A 1XMQO 3CCQV 2XNDG 5IY5C 5LOVB 1H8HG 1B04A 4UB8Z 3ZHVA 3EHHA 5M4PA 2EXLA 4QE7A 4Z1VA 3OPDA 3T10A 4ASAA 4WFAV 3TCUA 4EFUA 3PN1A 2WI2A 1YEWA 3FAVB 4LF5O 3T1YO 4FLVA 1ZL8A 4QNHB 5IYCO 3ML0A 1ZL8B 2Y4TA 2LGWA 1I5CA 3X2QB 1UY8A 2XD6A 4U3FH 1ZAUA 1R73A 4UCRA 2BTQB 1N4CA 1DF5A 4RUFA 1UYKA 4DR2B 5EBWC 2XHTA 1FS0G 4ZOLB 4I55B 2CDYA 3O2FA 4ZOLA 4X20A 1FAFA 4X64B 2CTPA 1UFIA 1URFA 4O4JA 4ABMA 3E8HA 1GTOA 3JATA 5LP6C 2KB1A 3GVMA 2A7WA 1MMMA 2EZPA 4W7TA 4MVMA 4OPHA 3APOA 1YC3A 3SL2A 2AGAA 2JS3A 2ZIOA 2IOPA 4O2BA 4MP2A 2PYJA 3CRQA 4MP7A 5J71A 5L3JA 4PDLA 2BYHA 3ZJZA 1DGSA 4FM0A 4LF6O 3GB7C 3ETDA 2HJFC 1G1XB 2BU7A 3OWDA 1Y4SA 2QTSA 3ASOC 3ZXQA 2YE5A 2PGGA 4I0XA 4JF3A 3VQVA 5B1OA 4UCUA 4DV6O 3OT7A 3IGAC 1YJ9V 2XJXA 4XITA 4DV7B 4YHHB 2ZXWB 3TETA 5AG2A 1Q5OA 3K5MA 1Y4UA 3R4MA 3SPGA 3JSLA 2BSKB 2UXCB 3E8GA 5H6RA 1H2NA 3JARA 1GN4A 5LGTA 4MVUA 2O1WA 1E79G 2UXDO 2GQPA 1SQQH 4TSFG 3MDSA 2RDCA 4CH4A 3B28A 1Y67A 1DK1A 5F3KA 2ODMA 4IT5A 2XUMA 3U2DA 5HFLA 5CBFA 1Q86W 3SPCA 4DO2A 4JI1O 2Q2EB 4DUYO 3GIGB 3HZ1A 1D2DA 2IWSA 5IYDO 3IFXA 1JJ2U 1VQOV 3OMIB 1R1BA 4WFHA 3ABTA 2H8PC 4I4TA 3HEKA 2VQEO 3E2EA 1TH8A 4O4HB 1EA6A 1I94B 4BAEA 1M93A 2XX4A 4E2LA 1ID0A 2QWPB 4WBNB 5IT9N 3GIEA 1XUQA 3QO8A 4GFNA 1J5EO 2WWWA 3AG1B 3K5LA 3BAAA 4GX5A 4URMA 4LNUB 2WLJA 3H1KH 1W2BU 5L3DA 1I5AA 1WAZA 4HZ5A 4JYAB 5JVDB 3J80N 1NZ6A 3CRMA 1MG1A 3UT5A 2XASA 1Y76B 5H2FZ 4FFKA 4R6ZA 4AQYB 4H81A 4LFBB 4FK5C 3F7YC 1K73W 4IIJA 1SESA 3MAQA 4IIJB 3TJTA 3PEJA 4GCZA 4K8ZA 2ZNIA 4OGQB 1OCZB 2DMXA 4XIPA 3TTZA 3R4NA 1KD1W 1NBMG 2L35A 4FLWA 2IM9A 1KKCA 1UYGA 3RYIA 1OCRC 3G6BA 2F43G 4DR4B 1UYMA 4CE1A 2IJJA 4TQFA 2KKWA 3HKEA 2YEVB 2ZQMA 2IJIA 4OX9B 4F4LA 4KXRA 5LGUA 1UYHA 3AG7A 1FJGO 2JGDB 1Q3EA 3HR0A 5JWPA 1J5EB 3E8FA 4IHJB 1YTFB 4NKGB 4JI5O 1ZX3A 3ZMTA 2WEQA 3BHPA 3ETGA 2OTJV 3JATB 4JI4O 2CCTA 4DV0O 1JMKC 3ABLC 2QM8A 1B63A 2PI5A 4U7OA 1NTMH 3W7WA 1YVWA 3DGEA 1DF4A 2PUSA 4PD4F 2YGEA 1MZEA 1EZVH 4WF9V 1QYEA 1Q82W 5EBLC 4KQVA 1NU1H 2DWEC 3ZHTA 4DR4O 4FLZA 1VQMV 4CH3A 5BR8B 3H1JH 2O57A 3B4SA 3RW0A 3UQ8A 3G71V 2M7WA 1TUBB 1L0OA 2QWNB 4B3SO 2K1EA 2LW7A 1UYEA 2QR4A 2WI6A 1OSFA 4IYIA 5FNCA 2WI1A 2JEUA 4CC5A 1SQFA 2ILMA 4KSGA 2UXCO 4FIPC 5FNFA 1NS1A 3BEHA 2YI9A 1UYLA 2CTQA 2G38A 4PV1B 1JOYA 2NNUA 1GKXA 4YHHO 1HP8A 3RKZA 4B3MB 3D8CA 2YICA 4JPRA 1AJ6A 4TV8B 2M6YA 4TV8A 1S5LZ 5A9GA 3U11A 5IYZB 4DR6B 3DTUB 5GTIZ 4ZIBA 4NXMO 4L90A 1Q6HA 4BXIA 2CGOA 4MB9A 1GJVA 3LNNA 4O07A 3A0YA 3RLQA 1TC0A 4DW0A 3P32A 2CUGA 3EFFK 1UY9A 4PDRA 4O4LA 5H6QA 1XBLA 5JJNB 2IORA 4XC0A 3OUFA 5FPRA 2YE9A 4QE9A 4DRXB 3K58A 4MW3A 4I55A 1P7GA 5BY1A 4P7AA 4X20B 5B1NA 2ITDC 4EM7A 4JTDB 4O4JB 2QFOA 3H80A 1VF7A 4JGSA 2BT0A 5FNDA 2L6LA 3R66A 3K03A 3SDLA 4LF4O 3AG2C 1YT0A 4LFAB 1M9NA 4WFGA 4TWKA 3I56V 3RLPA 3B40A 3KCXA 3K97A 2R9IA 1YERA 3ZMUA 3G7BA 1S5HC 1H2GA 2YEAA 2QG0A 4N23A 1ZLZA 5CTYA 2WLHA 4DV7O 4U93A 4X1YA 4E02A 3W7UA 1QY8A 1PL4A 3ZHRA 2CH4A 2PI4A 4LFCB 3SJCC 3AG1C 4MVRA 2MW2B 4BAYA 2F1MA 1WB8A 3ICXA 2YEVA 4YKRA 2FTKA 4TUYA 2OCHA 5IJ0A 4NR1A 4LF8O 4FFBA 4DK0A 2BREA 4FFBB 4DR3O 5IWAO 1D5NA 4MOTA 4IHJA 4HYOA 3CGYA 1GK9A 1XI1A 1RPRA 3SYQA 5L3CA 1VQKV 1PD3A 2P4VA 4XIQA 1VIBA 2Y48A 1MOFA 1WJZA 1KBHA 3C11A 4NH9A 2EULA 2OT5A 3ASNC 2FXSA 3EVKA 4B3TO 2QE7G 3RVZA 4TV9A 1QR8A 4KHPO 1NVPD 2ZKJA 2EJRA 3ABMB 2JKIA 4W4KA 4EFBA 2LFSA 4I4TB 2EIMC 4X66B 4JZGA 3AK2A 3K59A 2ZNJA 2YE7A 3L75H 1RSOB 5EZYB 4LWFA 2Q8FA 4LR3A 4CWFA 3K99A 4H0LB 5L3GA 2UXNA 4YKTA 2YEJA 3QG5A 1YJWV 4H85A 2ZINA 1JJOA 1TUBA 3J7AU 1IBMB 3NMQA 3JD1A 1TA8A 4GT1A 2YKIA 4R1FA 3U2KA 3RYHB 1YITV 4CWSA 4C7UA 5KMGB 4CWOA 1V55C 5CBHA 1XMQB 3HYZA 3M99B 1HNZB 2C2AA 1V9PA 2P5OA 4XCJA 1NTKH 5LOVA 4JV5O 3HZ5A 1VF5B 2Z3YA 1WP7A 1S3JA 3CMEV 2LGQA 1K92A 2YE3A 5E1AC 4I7ZB 1YZBA 3CP1A 3A0XA 3JYCA 1Q8IA 1QBZA 2LW1A 3SYOA 5FLXN 1B06A 5JJEB 2PNRA 2HJDA 3N27A 2GBOA 3WFVA 3HKEB 3SYAA 4U3JA 5A2QN 2C1GA 4XCLA 1JQ0A 1NT2B 3HKBB 4RAIA 3GWOA 1PP9H 3VOUA 2LP7A 2YE4A 1RM1C 2Q6AA 4HXWA 4H7QA 3K0DA 2NN4A 2VW5A 1IDSA 2DQ0A 4AS9A 4QIWF 3F5TA 4P30A 1DTOA 3TZ0A 1A32A 1AM1A 2CGNA 3CS5A 1B3QA 2GSMB 3K06A 2EILB 4G27B 4GKJO 4B6CA 4EGHA 4FLUA 3GIFA 1FFTB 2YJXA 3CHXA 4D7TA 3R91A 2IWXA 4XIRA 1SERA 1TAEA 4E00A 2ADQB 1GM7A 2FKXA 3OR6C 1KU9A 1WB7A 2OYQA 1M56B 1BGYH 4J9ZB 1QVFU 3TXSA 1SS3A 4XTJA 5CA3A 1GN6A 5BR8O 2D2CB 3WB1A 2DOSA 1QHTA 2XX5A 2GDSA 1IBLB 4CWRA 2BSKA 1IBKO 4LF6B 3HHUA 2ZD9A 1M5IA 5BOCA 2DQ3A 1IVSA 2UUBO 2Q73A 2IWUA 3G80A 4I9WA 2IH3C 3K04A 1WPBA 4JYBA 1DLBA 4J11A 3ZKBA 2JJ2G 1M57B 1NR1A 3R92A 2Y4UA 3KE6A 4YKUA 4DUZB 5FL7G 5HFMA 5IE9A 2YGAA 1W59A 4K4OA 4DV6B 3B24A 5K1PA 3L74H 1BL8A 1K3EA 3HYYA 3VHAA 3SJBC 1PNLA 3WB2A 5B3SB 3W7TA 4CE2A 2PYLA 2QTOA 5E79Z 1Q81W 2ETNA 5IYZA 4MVSA 4J42A 3CSXA 2CTWA 2HKOA 4FVMA 3HKDA 3N2KB 3RYFA 3CC4V 4X1KB 4AWPA 5EBMC 4O05A 2YS8A 1SQXH 2Y0PA 1L8DA 4RUEA 3AK3A 4WFFA 2YSUB 4LH6A 2AW9A 3KKYA 1O9GA 3AK1A 3TGUH 3CXCU 3UO3A 1RSOA 2XX2A 1GRJA 1Z5VA 4ZI7B 2UUCB 4WBNA 3RT3C 4IL6Z 1N33O 1PVGA 2YI0A 5LHHA 4XDJA 4QGPA 2RCVA 3C90A 4NXNO 2YXLA 3C0EA 4J10A 2XHXA 3VHDA 1E1QG 4QPKA 2WLNA 2WA3A 4D7SA 5D6QA 1PPJH 2YE2A 2CG9A 5FPOA 2QSAA 4MTOA 1Y76A 4R50A 2FYPA 1R3JC 3RFRA 2DYSB 4B08A 2QEXV 2CCSA 4LF5B 4E4EA 1H2SB 2OIGA 2GV9A 4UCVA 4QJFB 5KHHA 3SYPA 4F6RA 5KUKA 1U2OA 3L71H 3ZS8C 1N33B 1VQ7V 1D5AA 5B5EZ 3CEIA 3RYIB 4X1YB 3OGIB 4X62O 4LP0A 4FLXA 4RQFA 4GKKB 2JS5A 3ZMVA 1AMWA 1SF9A 2HHHB 2DWDC 5JH7A 3ETQA 1HW7A 1SQBH 2CTRA 2FB5A 4P9PA 3ZRXA 4JI8B 3HKBA 1EN4A 3OMUA 2UWDA 2JGDA 3T1HB 1MSDA 2IH1C 2WLIA 1ZUQA 2P7TC 1QU7A 2PTMA 2XAJA 3G67A 1UY7A 2JJCA 5J9PC 3MHHC 3MD0A 3U10A 3TK1A 5LMUO 3D36C 1YC4A 1V55B 5KAFZ 1MX0A 5KHIA 1Q43A 2VQEB 3T1HO 1SA0A 3HB3B 3O65A 1SA0B 1UYIA 1Q6IA 3OAAG 2YDEA 4NTWA 5CBGA 4DV1B 3IEDA 1BZKA 5CA1A 3OWBA 5L3BA 5F2VO 2EINB 1I59A 2XJGA 4KSHA 2VWJA 1N32B 1MU5A 3SJAC 1NQTA 4PA4A 1S5JA 2BOBC 4BQJA 3E83A 3K79A 2YKBA 3H1IH 3IC9A 5BXZA 3B8MA 1SQVH 2F23A 1LR1A 2HVJC 2YI6A 2WI3A 4CWPA 4HAMA 3RYCB 4XDKA 2YGFA 4W4LA 1FXKC 2W6JG 5L3FA 4BQGA 1EBOA 4BWAA 1WP8A 2QWRB 4PDMA 1P49A 3E8BA 4UXNA 2FWZA 2XK2A 4DR1O 2VRZA 1HNXO 3F7VC 1QLEB 1UYCA 3FYIB 4MS2A 4UUJC 2UUAB 1AP6A 4JI3B 4J7ZA 3B27A 2Q8VA 2PY5A 3THOA 2Q8HA 2E0AA 2HG1A 2JVDA 5IYBO 2B1GA 2JK5C 2OWOA 3Q4HA 1Z5CA 1JR9A 1K4CC 5TISZ 3QNEA 2YE8A 4O4IA 3SGIA 2BZ5A 3CRCA 2Z0AA 4WUDA 1YS3A 3N2KA 4X1KA 4U7NA 5F5RA 5C8YA 4X65B 2XDKA 4GKJB 1XDCA 3LMMA 4U3JB 2WERA 4O4LB 3LSSA 4LWIA 4DR6O 4DRXA 1VF6C 4TT3G 5LMUB 4ZI7A 4LF7O 2FL4A 1YJNV 2ZDIC 1Z5AA 1AROP 2QG2A 1MNGA 5M4KA 2O1VA 4HNAB 2WSSG 1YC1A 4JI3O 4GT8A 3APQA 4KL1A 1AI4A 2ZDXA 4IYHA 4UB6Z 5EK0A 4X65O 4CWTA 4CH5A 3G6EV 2DE0X 3IAYA 4GX1A 3Q5JA 2W0FC 3TUHA 1AR5A 4F6RB 1AR1B 1A4HA 5GTHZ 1K5SA 3CRAA 5JJJB 2R72A 3BA8A 3VQWA 4AI8A 4B3RB 3JCUZ 2ZDYA 4NH8A 1R3IC 3M7MX 2LJ2A 4LFBO 3LUTB 4LWHA 1HNZO 5IDMA 5JH7B 3I5DA 1QR9A 3T4DA 1ZXNA 4TUYB 5IJ0B 1O9HA 5KX5A 4GX0A 1N8RW 4JAAA 2ZE6A 2A06H 4HYPA 4J7KA 1CP9A 3EKOA 1OJHA 3T2SA 1WLEA 4ASBA 2FYUH 3C3SA 3R4PA 4DV0B 3CE2A 1TC6A 1GH6A 1IXMA 1H2KA 3A2FA 1GM8A 4PI0A 5B66Z 4DV2B 1VQ8V 2WPDG 4H37A 3E22A 2GHYA 2RN9A 2F4VB 4X1IA 4JI2O 3E22B 1OCOC 3ZN1A 4EEQA 4Z2WA 3VQYA 3RYFB 3HKDB 2QKAA 2ZE7A 4X88A 2ZM6B 5CA1B 5CPHA 4R3AA 4X89A 4WFEA 5D5PA 3HPLC 5GONA 5JCOA 3T2MA 2AKPA 3QF7A 3CWBH 4R3MA 5J2UA 2PF4E 3CPWU 4MTFA 5EIBD 4DUZO 3O0IA 4D6TH 4JTCB 5KHJA 3RYCA
chains in the Genus database with same CATH topology
3LSQA 2DYRB 4GT1A 5CN0A 2A9HA 3CD6V 3CCVV 1YITV 4LCUC 3D36A 2IW5A 1J95A 3OE7G 2ZR2A 1V55C 3OGCC 5CBHA 1VQ6V 1W0KG 2A0LA 4R7CA 1R3LC 3M99B 4LBEC 4X8AA 2C2AA 1ORQC 4KP4A 3CCQV 3K3WA 2XNDG 5B1AB 5IY5C 1YTFD 1S77D 2Z3YA 1H8HG 1S3JA 3CMEV 2AHZA 4QE7A 2JDIG 1NKDA 1K92A 2EIKB 5E1AC 2UXXA 3LDDA 3TCUA 4WFAV 4WFBV 1OCRB 3OR7C 5CMUA 3OMAB 3OFNG 3CP1A 1GO3F 1P4RA 4MSWC 1QVGU 3FKSG 3I55V 3JYCA 2WLMA 1QBZA 3MHSC 4QNHB 2Q68A 5IYCO 3SYOA 3ML0A 1OCZC 1OCCB 5LHGA 1KQSU 1JCHA 1KP3A 3X2QB 1R6NA 1FXKA 3WFVA 1R73A 3SYAA 1OZ0A 4UV8A 1DF5A 1JQ0A 4RUFA 1GM9A 1VQLV 4RAIA 5EBWC 3GWOA 4HZ3A 3VOUA 1FS0G 1QLEC 2LP7A 1RM1C 2Q6AA 3FB5C 2OCCC 3E8HA 1TUEB 3K0DA 1RM1B 1GTOA 4QPJA 2ATKC 2DQ0A 3SJQC 4QIWF 2KB1A 4P30A 1DTOA 2EZPA 2P6JA 1Q7YW 1ENVA 3CCJV 2V1DA 4MVMA 2R9RB 1NH2B 2GSMB 2XOKG 3K06A 2EILB 3AG3C 4G27B 5B1BB 5LGNA 3ABLB 1FFTB 3G4SV 5KA6A 3FYEB 4PDLA 3ABKB 2V7QG 3UM7A 3ZJZA 1MSWD 3NXSA 5B1BC 2HFEC 3ETDA 2HJFC 3GB7C 3ZCCA 3JD3A 1SERA 3ZMSA 1R6KA 4GX2A 3ASOC 1GM7A 3OR6C 4UV9A 1ZWIC 4BW5A 4JF3A 2P67A 5B1OA 1PNMA 1M56B 1JVMA 4J9ZB 1QVFU 2Q69A 3IGAC 1YJ9V 3FB8C 5CA3A 4Z1MG 5C93A 2ZXWB 3TETA 1WPXA 2ZDIA 1VQ5V 4PA6A 3FB7C 3SPGA 2ZD9A 2WLLA 4LP8A 2DQ3A 2DW4A 3E8GA 3AG4B 5EC2C 4JASA 2IJHA 5H6RA 4BIUA 1XL6A 3B8NA 1M1KW 1KECA 1KP2A 4I9WA 2IH3C 3K04A 5LGTA 4JYBA 1DLBA 4MVUA 3AG2B 2HG5C 1E79G 2EIJC 2JJ2G 1M57B 4KUMA 4R8CA 1NR1A 3CCEV 4TSFG 1EZJA 3LNMB 4JAVA 1LNQA 1PNKA 1COWG 1M57C 2Y69B 5FL7G 5HFMA 1F51A 3CCUV 1BL8A 1K3EA 1I5YA 5HFLA 3STZC 1PNLA 5B3SB 3W7TA 5CBFA 2QTOA 4Q20A 1Q86W 5DM6V 4CBCA 1Q81W 1CEZA 3SPCA 1M56C 4MVSA 4DO2A 2HKOA 5B3SC 5IYDO 3CCLV 3CC4V 5EBMC 5EC1C 3IFXA 1JPXA 2XAGA 1JJ2U 4RUEA 1VQOV 3OMIB 4WFHA 3AG4C 4P9OA 3ABTA 4WFFA 4CZZA 1Y4MA 1UJWB 1ROPA 3ASOB 2H8PC 2YSUB 3CCMV 5KA5A 3CXCU 2X6AA 3E2EA 3PJSK 2HVKC 4PA9A 1G4YB 2EIJB 2NLJC 4MTGA 1HWYA 2EIMB 2QM7A 4E2LA 2IU0A 2XAQA 4UVCA 2WAMA 5LHHA 4XDJA 3IC7A 3OEHG 3QO8A 2WWWA 2HLDG 3AG1B 1K4DC 1E1QG 4GX5A 4QPKA 2WLNA 3RVYA 5B1AC 2WLJA 1S0VA 1W2BU 5L3DA 4WCEV 4JTAB 4MTOA 4ASUG 4MVOA 1MG1A 4ZKIA 4R50A 2XASA 1R3JC 2DYSB 3T4ZA 4R6ZA 2P90A 2QEXV 4FK5C 3F7YC 4MVQA 1K73W 1SESA 1G8MA 4QJFB 4GCZA 3SYPA 5KUKA 1OCCC 1OCZB 1V54C 3CC2V 4H33A 1VQ7V 3R65A 3SPHA 1KD1W 1NBMG 1RPOA 2QA4V 3H01A 1YSCA 3WG7B 4RQFA 5DN6G 1OCRC 1K34A 3ZMVA 4ZBMA 2F43G 2DWDC 2IJJA 3A0RA 1H38A 5L3EA 2YEVB 1PL0A 2ZQMA 2IJIA 4JYCA 4F4LA 3OW2U 4P9PA 3ZRXA 5LGUA 1KKDA 4J9YB 2WLIB 1NJIW 1QLNA 4G28B 2IH1C 2WLIA 2P7TC 2XAJA 3E8FA 2LFRA 2DYRC 1YTFB 5J9PC 4FMTA 3ZMTA 3ETGA 2EIKC 3MHHC 1E1RG 3MD0A 2OTJV 2EILC 3AG3B 3TK1A 1VQPV 1V55B 3ABLC 1SETA 3KG2A 2QM8A 3ZRWA 2OCCB 3JD4A 2PI5A 4U7OA 1NH2D 3W7WA 3ZRSA 3DGEA 1DF4A 3HB3B 2ITCC 1W0JG 3OAAG 4EKWA 5CBGA 2X6CA 3W7XA 4WF9V 3SPIA 1Q82W 3STLC 5EBLC 5L3BA 4UVBA 2EINB 2WLKA 1K7DA 4L87A 1NQTA 2DWEC 2ZXWC 4PA4A 2BOBC 1VQMV 3E83A 3K79A 2OTLV 2MK3A 3ABMC 3RW0A 3B8MA 3G71V 2M7WA 4PELA 2HVJC 2IU3A 4HAMA 4XDKA 3P30A 2WLLB 1FXKC 2W6JG 2K1EA 2A79B 3X2QC 5L3FA 2Z5UA 1EBOA 1BMFG 4FJCC 4PDMA 4FPPA 2JEUA 2HR3A 3E8BA 4UXNA 3AEIA 2Y69C 2QKSA 1S76D 2EZOA 4PDVA 3F7VC 3CMAV 4FIPC 1QLEB 4MW8A 3FYIB 4MS2A 3BEHA 4UUJC 1NVPB 2W6IG 1YHQV 1JOYA 2NNUA 2BOCC 4XBFA 4XDLA 1AJQA 5KUMA 3E89A 1AI6A 2B1GA 1K97A 2JK5C 4JPRA 5IYBO 3JD0A 4OXSA 1K4CC 3QNEA 2H94A 1L1FA 5IDJA 2X0LA 3ETEA 3ZRVA 3ZIAG 4I5SA 1EFRG 3DTUB 3ABKC 5H9CA 4BIZA 1AI7A 2X7RB 4U7NA 3SPJA 2XAHA 3OMNB 1FXKB 1VQNV 5LHIA 3CCSV 3W7SA 1GMGA 3T1CA 3P32A 3EFFK 3E86A 3LSSA 4PDRA 1JX9A 3ABUA 2D3OW 4TT3G 5H6QA 3OUFA 4LC1A 4QE9A 5GW7A 4MW3A 3CYOA 4PA7A 1YJNV 5B1NA 2ITDC 2ZDIC 1CPYA 4JTDB 1KC8W 4MTXA 1MABG 1AROP 2IJKA 2X6BA 3E35A 1PKXA 4JGSA 1K33A 2WSSG 1SZTA 4JAUA 4KFMA 2B5UA 3QO5A 1AI4A 3CCRV 3K03A 4PA3A 1AJNA 3AG2C 5EK0A 1P7BA 1M9NA 4WFGA 4TWKA 2EBOA 3I56V 1F4NA 3B77A 1VQ9V 3G6EV 1F4MA 3VBBA 4GX1A 2R9IA 3JD2A 1I5XA 5BZBA 3ZMUA 4UVAA 2W0FC 1K8AW 2ZR3A 1QCEA 1S5HC 1AJPA 1H2GA 2DYSC 3LDCA 1AR1B 4N23A 1AI5A 1GKFA 1K5SA 1FXHA 2WLHA 3ASNB 1R3IC 4MT8A 3W7UA 3OEEG 3LUTB 2PI4A 2AHYA 1BHAA 3AG1C 4MVRA 4RQEA 4G2KA 5LBQA 4BAYA 1OHHG 3EHBB 1QR9A 2JIZG 3K0GA 3RBZA 3T4DA 2YEVA 1K5QA 3OM3B 4GX0A 1N8RW 2FTKA 3CC7V 3K08A 3OUSA 1CP9A 3D3IA 1BHBA 1WLEA 1B6QA 3F5WC 4HYOA 1XL4A 3LDEA 3ZN0A 1IXMA 2B1IA 1THZA 1GK9A 3SYCA 1RPRA 3BY6A 3SYQA 1VQ4V 1GM8A 1V54B 1H8EG 5L3CA 1VQKV 1VQ8V 1PD3A 2WPDG 4H37A 3ZRWB 1SRYA 4MVZA 2GHYA 2Y48A 1MOFA 3WG7C 1NR7A 3ASNC 2OT5A 1OCOC 3ZN1A 2QE7G 4P2ZA 3RVZA 4DXWA 3UKMA 4X88A 1QR8A 5IY5B 1NVPD 2Q67A 2EJRA 3ABMB 1OCOB 1R3KC 3QO7A 4WFEA 2JJ1G 4X89A 3HPLC 1YI2V 1YIJV 3K9AA 3T2MA 2LFSA 2XAFA 1S72V 2EIMC 3ZMZA 4RO2A 2JEXA 1FXVA 1Y66A 3JCZA 1K9MW 2EINC 2CK3G 3FB6C 5L3GA 4N21A 4YXWG 2UXNA 3CPWU 4MTFA 1YJWV 1M90W 4JTCB 1F23A 3JD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BIU A;  4GT1 A;  5B1N A;  5IDJ A;  4GCZ A;  3NXS A;  2WWW A;  3ZRV A;  3D36 A;  4JYB A;  3ZCC A;  4I5S A;  4FPP A;  4MTX A;  2LFR A;  4QPK A;  4BIZ A;  4QPJ A;  4U7N A;  2P67 A;  2LFS A;  4FMT A;  5B1O A;  4JAV A;  3MD0 A;  2C2A A;  1IXM A;  4Q20 A;  3TK1 A;  4JAU A;  4MT8 A;  4KP4 A;  4ZKI A;  5C93 A;  1F51 A;  3P32 A;  1JOY A;  2QM8 A;  3A0R A;  3ZRW A;  4U7O A;  3ZRW B;  4JYC A;  3DGE A;  3ZRX A;  4LC1 A;  2QM7 A;  4JAS A;  2FTK A; 
#chains in the Genus database with same CATH topology
 3LSQ A;  2DYR B;  3RYH A;  5CN0 A;  2LQT A;  2A9H A;  3CCV V;  4K0K O;  1TVK B;  2WEP A;  3D36 A;  2IW5 A;  3JSN A;  4AHC A;  2YEC A;  1BXD A;  3FT8 A;  3OE7 G;  2ZR2 A;  3OGC C;  1TIL A;  1W0K G;  3G75 A;  3JAW B;  2UXB B;  2YEE A;  3G7E A;  1KB9 F;  4XE2 A;  4H13 B;  4KP4 A;  4DV5 B;  3JAK A;  5B1A B;  1XHX A;  2CGF A;  1S77 D;  2AHZ A;  4NTX A;  4DV3 O;  4UCT A;  3QTC A;  1X4T A;  2JDI G;  2EIK B;  2UXX A;  1LUV A;  3Q4H B;  1OCR B;  1H7S A;  3OR7 C;  4L93 A;  5CMU A;  1HDJ A;  4O4I B;  3P3P A;  3OFN G;  1GO3 F;  1VP7 A;  2YEH A;  1YSR A;  4CWQ A;  5M4N A;  4YKQ A;  2Q68 A;  2XAB A;  1OCC B;  1XNR O;  2N74 A;  2YK9 A;  5LHG A;  4LFA O;  4FM1 A;  1KP3 A;  1B62 A;  5M4M A;  2QF6 A;  3BPZ A;  1FXK A;  2XJJ A;  5D6P A;  4HY1 A;  1OZ0 A;  3EHG A;  4XDM A;  5FWK A;  2YKC A;  1GM9 A;  3LPS A;  2ZKO A;  4DR5 B;  4HZ3 A;  1QLE C;  5LP6 A;  2F4V O;  4LWS B;  4O2A B;  5LP6 B;  2BU6 A;  2OCC C;  3QTF A;  5IJ9 B;  4DV4 O;  4QPJ A;  2ATK C;  3SJQ C;  5IJ9 A;  4NTY A;  4I50 B;  2P6J A;  5DEC A;  1Q7Y W;  4I50 A;  3CCJ V;  1G6U A;  2R9R B;  3MNR P;  2XOK G;  3AG3 C;  3DXR B;  2H3O A;  5KA6 A;  5FNV B;  4NXM B;  3UM7 A;  2ZE5 A;  1MSW D;  4PRX A;  3CX5 F;  3NXS A;  2WI7 A;  5B1B C;  3ZMS A;  3DC5 A;  1R6K A;  4GX2 A;  1R62 A;  1I5D A;  3BA9 A;  1HNW B;  2P67 A;  3CGZ A;  2E76 B;  2E5L O;  2Q69 A;  3FB8 C;  2F95 B;  2HCH A;  1WPX A;  2QWO B;  3ZM7 A;  1VEW A;  1Z5W A;  2ZDI A;  1VQ5 V;  2YEF A;  3ZBH A;  3GWK C;  4PA6 A;  3VQX A;  2YIA A;  2DW4 A;  2P4K A;  3FV5 A;  3M8A A;  3AG4 B;  5EC2 C;  4JAS A;  2IJH A;  3FT5 A;  4V25 A;  2Q4P A;  1R6T A;  1KP2 A;  3L73 H;  4H44 B;  1AB3 A;  4JI6 O;  5GGZ A;  2VWK A;  3AG2 B;  1F7Y A;  2EIJ C;  5K1X A;  2E74 B;  4LWE A;  4KUM A;  3BFR A;  3CCE V;  3IJ4 A;  2QKC A;  1IBK B;  4TOI A;  1N34 O;  3LNM B;  4PI2 A;  1PNK A;  1COW G;  2XT9 A;  2Y69 B;  2XDU A;  5JQG A;  3CCU V;  4JI5 B;  5JQG B;  1I5Y A;  2E3C A;  3STZ C;  1PV0 A;  5DM6 V;  4X1I B;  4CBC A;  2YKJ A;  1M56 C;  3WQ9 A;  4WUB A;  3QVN A;  2VCJ A;  4AWO A;  5LYJ A;  1GN2 A;  4DV1 O;  1EM1 A;  5C8Y B;  2QJ1 A;  3INW A;  3B09 A;  1FFX A;  3FD9 A;  5GON B;  4P9O A;  2F93 B;  1FFX B;  1MZF A;  2GTS A;  1Y4M A;  4CZZ A;  1ROP A;  2RQ6 A;  1WA8 A;  2PZS A;  4YY3 O;  3TZ4 A;  3JAS A;  4NH7 A;  1N0N A;  3JAL A;  3PJS K;  1AH6 A;  4PA9 A;  1G4Y B;  2EIJ B;  5J2T A;  3OTO B;  4MTG A;  2BYI A;  1N36 B;  2W0X A;  2XAQ A;  4UVC A;  2WAM A;  2B9Z A;  3OEH G;  1K4D C;  4HNA A;  4LF8 B;  2Q7G A;  2N05 A;  3L9D A;  1YT1 A;  1S0V A;  2HP8 A;  4JV5 B;  2UU9 B;  2XDS A;  4JTA B;  2F66 C;  4DR1 B;  3JAK B;  3T4Z A;  2CCU A;  2DN9 A;  4J7J A;  4MVQ A;  3ZKD A;  4MPC A;  4V26 A;  2LO1 A;  2EX3 A;  1XHZ A;  3R65 A;  3SPH A;  3N2G A;  3R4O A;  3O6O A;  3LSU A;  1YSC A;  2N04 A;  5DN6 G;  1K34 A;  2QWQ B;  4ZBM A;  4O09 A;  4XKO A;  1PM9 A;  4I9Q A;  3A8T A;  2UU9 O;  5CA0 A;  3VHC A;  4DYL A;  1KMI Z;  5CA0 B;  4JYC A;  5KX5 B;  3OW2 U;  3UCS C;  4CS4 A;  4J9Y B;  2ZBK B;  3H9V A;  2WLI B;  1QLN A;  1N36 O;  2LFR A;  2DYR C;  2UUC O;  1BS3 A;  4FMT A;  1E1R G;  2EIL C;  1VQP V;  2BSM A;  1SET A;  3KG2 A;  3ZRW A;  4X9L A;  3JD4 A;  5D5Q A;  1NH2 D;  4XD8 A;  3ZRS A;  5KAI Z;  4LF9 B;  3L70 H;  4FM2 A;  2GFD A;  1W0J G;  4DK1 A;  4EKW A;  2XHR A;  5FNV A;  4HY6 A;  2YJW A;  3STL C;  3VAD A;  2Q0O C;  4UVB A;  4DR7 B;  4L8J A;  2YED A;  4JI1 B;  2WI4 A;  2HHH O;  1IBL O;  2ZXW C;  2WI5 A;  2R70 A;  5IN9 A;  5J2U B;  2OTL V;  2MK3 A;  4NVP A;  2YUA A;  2E5L B;  5KHK A;  2UUA O;  1UPG A;  3P30 A;  1H2M A;  3ZHQ A;  3X2Q C;  4JI6 B;  1I58 A;  2Z5U A;  1TVK A;  1BMF G;  2BCC H;  4AQY O;  3LNU A;  1BSM A;  4I3H A;  3AEI A;  4K3A A;  1XEQ A;  4PDV A;  3CMA V;  4MW8 A;  1UY6 A;  3OTF A;  1EI1 A;  2YEB A;  1NVP B;  4UCO A;  2W6I G;  3B25 A;  3O9O A;  2YIB D;  3E89 A;  1BKN A;  1K97 A;  2ZT9 B;  1UYD A;  1US6 A;  4OXS A;  1Y8O A;  2FWY A;  2XDX A;  2H94 A;  1L1F A;  5IDJ A;  3OTO O;  5EYP B;  4YIO A;  4DR2 O;  4LF7 B;  1I08 A;  3ABK C;  5H9C A;  3D0B A;  1AI7 A;  2X7R B;  3SPJ A;  1IUR A;  2YIB A;  1S14 A;  2XAH A;  1FXK B;  1VQN V;  2Q8I A;  3CCS V;  3ZX6 A;  4B7E A;  3W7S A;  3K60 A;  1Y8N A;  3INX A;  1KZN A;  3E86 A;  2XDL A;  3ABU A;  2D3O W;  3JAL B;  4DUY B;  4JI4 B;  3TZ5 A;  4LC1 A;  5GW7 A;  4MBC A;  5KHG A;  3CYO A;  4O2A A;  1SQG A;  5LMN B;  4JI0 B;  1NHI A;  1CPY A;  1N0J A;  4J80 A;  1MAB G;  1YES A;  3A0H Z;  1FJG B;  2E75 B;  1PKX A;  2ZE8 A;  3KZI Z;  4LH7 A;  3A0Z A;  4K35 A;  1ZWH A;  4JAU A;  4KFM A;  2B5U A;  3QO5 A;  3CCR V;  5J6A A;  3DXR A;  2BU2 A;  2EJ7 A;  3P3N A;  5CF0 A;  2VWC A;  1F4N A;  1VQ9 V;  2ESA A;  1BCC H;  3VBB A;  4E01 A;  3T1Y B;  3JD2 A;  1I5X A;  5BZB A;  4DUH A;  2YK2 A;  4K8X A;  1K8A W;  2ZR3 A;  1QCE A;  1IBM O;  3QDD A;  3LDC A;  5CTU A;  1GKF A;  4J41 A;  4L8Z A;  3EHF A;  5D7D A;  3WHA A;  5ITZ B;  1U96 A;  2OIE A;  1YT2 A;  2AHY A;  1BHA A;  5BOD A;  2JGU A;  4RQE A;  1UYF A;  3BVO A;  1OHH G;  3EHB B;  2JIZ G;  3K0G A;  3RBZ A;  1KUQ A;  4LF9 O;  1QZR A;  3OUS A;  2BU5 A;  4URN A;  1S16 A;  1BHB A;  4K0K B;  4PRV A;  4NXN B;  1B6Q A;  2NR5 A;  3F5W C;  1XL4 A;  3ZN0 A;  4DV4 B;  1GN3 A;  3SYC A;  3BY6 A;  3TXQ A;  1VQ4 V;  4HZ0 A;  1Z5B A;  3ZRW B;  1SRY A;  4MVZ A;  3K5N A;  4YJ2 A;  3JAM N;  4CE3 A;  1RP3 B;  5LYJ B;  3UKM A;  3RLR A;  5IY5 B;  3QO7 A;  1R3K C;  1YI2 V;  4GQT A;  2JJ1 G;  2C1I A;  2IOQ A;  2RNB A;  1S72 V;  1WA8 B;  2JEX A;  4JYY A;  4X62 B;  3JCZ A;  1XOU A;  2EIN C;  5CB4 A;  3FB6 C;  4YXW G;  1M90 W;  1I0H A;  2O1U A;  4DR3 B;  1Q90 D;  4ASF A;  4OPA A;  5IWA B;  3UO2 A;  2Y0I A;  4DV3 B;  4LCU C;  2HHI A;  3S3X A;  1J95 A;  1CXZ B;  3JAW A;  4HYM A;  2YE6 A;  2A0L A;  4R7C A;  1R3L C;  4LBE C;  4WUC A;  1BYQ A;  1XIL A;  2CH7 B;  3K3W A;  4JYA O;  1Y6X A;  2CH7 A;  1LUW A;  1YTF D;  4GKK O;  1Z59 A;  4YKY A;  1XQ8 A;  2YXH A;  3HKC B;  3Q5K A;  1NKD A;  3HKC A;  1YF2 A;  4B7P A;  3LDD A;  4WFB V;  2CAZ C;  4B3R O;  1FPO A;  1NHJ A;  3OMA B;  3N2G B;  5EYP A;  1P4R A;  4MSW C;  3FAV A;  1QVG U;  4FCQ A;  3FKS G;  3I55 V;  4AWQ A;  2WLM A;  1ZXM A;  3MHS C;  4JQL A;  1OCZ C;  1KQS U;  1JCH A;  1R6N A;  1JFF B;  1XMO O;  1ZSP A;  4CS2 A;  1JFF A;  2RJZ A;  4YJ3 B;  1AVM A;  4CC6 A;  3CRL A;  4RWU A;  2JRI A;  4UV8 A;  4DZY A;  2ZCE A;  1VQL V;  4LWS A;  1YXB A;  1GKZ A;  2V4D A;  3FB5 C;  2ADP A;  1TUE B;  4JI0 O;  1RM1 B;  1IX9 A;  3A0T A;  1RFY A;  1ENV A;  4B7K A;  2V1D A;  3CRR A;  2ZIM A;  4YKZ A;  4NB5 A;  1NH2 B;  4DW1 A;  1XMO B;  2Q8G A;  5LA6 A;  5B1B B;  5LGN A;  3ABL B;  5LA6 B;  4EMV A;  5DED A;  3G4S V;  4P8O A;  3FYE B;  3ABK B;  2UUB B;  3ZXO A;  2V7Q G;  2AXT Z;  2H8M A;  4EFT A;  1AH8 A;  2HFE C;  3EKR A;  4B3S B;  4BR6 A;  3ZCC A;  3JD3 A;  1Y74 A;  1Y74 B;  2FML A;  1ZWI C;  4UV9 A;  4BW5 A;  1ZW9 A;  4PL9 A;  1HR0 B;  1PNM A;  1TBW A;  1JVM A;  2Q0A A;  4Z1M G;  1YCI A;  3BCC H;  5C93 A;  1HNW O;  1MA1 A;  1Q6U A;  3FB7 C;  1EN5 A;  2WLL A;  4LP8 A;  4BIU A;  1XL6 A;  3B8N A;  1M1K W;  1KEC A;  1BT8 A;  4EGI A;  1US7 A;  1VAR A;  2BTO A;  2HG5 C;  4R8C A;  4MPN A;  2BTZ A;  1EZJ A;  1THN A;  4JAV A;  4CWN A;  1LNQ A;  3U67 A;  1M57 C;  3FFQ A;  1F51 A;  2CE4 A;  1P84 F;  2Q7H A;  3Q5L A;  4UFZ A;  2IBZ H;  2Q9L A;  1BQZ A;  4TQD A;  2A3Q A;  4X64 O;  1YSZ A;  4Q20 A;  4ZVI A;  1CEZ A;  4YJ2 B;  4JZ2 A;  3A0B Z;  1NTZ H;  5B3S C;  3CCL V;  4FLY A;  5EC1 C;  1JPX A;  2HKJ A;  1QNM A;  2XAG A;  1KYO F;  1BGQ A;  3AG4 C;  3J81 N;  3U0Z A;  1OV9 A;  1UJW B;  4XKK A;  4GYC B;  3ASO B;  3CCM V;  3JAS B;  3ZHU A;  5KA5 A;  3EXA A;  2QGN A;  1XNR B;  2X6A A;  5J2T B;  2HVK C;  2NLJ C;  4GUN A;  1Z2G A;  1I5B A;  4O4H A;  3BMY A;  1HWY A;  3RWR D;  2EIM B;  2QM7 A;  2IU0 A;  2GUZ A;  2KG7 A;  3IC7 A;  2GUZ B;  4CH6 A;  2KG7 B;  2HLD G;  4URL A;  4DR5 O;  3RVY A;  4DV5 O;  5B1A C;  4EFE A;  2QM4 A;  3K9S A;  1SC5 B;  1U97 A;  4WCE V;  4ASU G;  4MVO A;  1XNQ O;  1M4U A;  4ZKI A;  3OW6 A;  2P06 A;  4URO A;  2P90 A;  1G8M A;  3RN4 A;  1OCC C;  1V54 C;  4GEE A;  3CC2 V;  4H33 A;  4CS3 A;  5LL6 Y;  2H55 A;  2YEG A;  3A0W A;  1RPO A;  3B26 A;  5ITZ A;  3CRK A;  4XKA A;  2QA4 V;  3H01 A;  1IXB A;  3WG7 B;  4Q6G A;  4X9Q A;  2YEI A;  2K9P A;  1L0L H;  3BRC A;  1NI8 A;  3H4L A;  1N32 O;  3A0R A;  1I7F A;  1H38 A;  5L3E A;  4LF4 B;  1PL0 A;  1XNQ B;  2BTQ A;  1KKD A;  1NJI W;  4G28 B;  4JI2 B;  3NR7 A;  1WN7 A;  5LMN O;  4L91 A;  3BM9 A;  4LWG A;  2EIK C;  3AG3 B;  1WNS A;  4EB6 B;  2ARH A;  2GTA A;  2OCC B;  3CJH B;  4X66 O;  1N34 B;  5M4H A;  4EB6 A;  4BW9 A;  2KQX A;  2ITC C;  2X6C A;  3W7X A;  2ZM6 O;  1QQC A;  3SPI A;  4NYK A;  4B3T B;  2WLK A;  1K7D A;  4ICG A;  2VQF B;  5D7C A;  4JI7 O;  4L87 A;  2VCI A;  4I0X B;  3CB2 A;  2YXY A;  3ABM C;  4B3M O;  5CB4 B;  1HR0 O;  4PEL A;  1FYJ A;  4ZHQ B;  1XRE A;  2R9A A;  2IU3 A;  2BE3 A;  4MPE A;  2WLL B;  2A79 B;  1U0Z A;  1AP5 A;  1FD9 A;  4FJC C;  4ASG A;  2UXD B;  4F6E A;  2BRC A;  4FPP A;  1TID A;  2HR3 A;  2Y69 C;  2QKS A;  1S76 D;  2EZO A;  1L0N H;  2XCM A;  4LFC O;  2XHB A;  1JA8 A;  1YHQ V;  3JZ3 A;  4XBF A;  2BOC C;  4XDL A;  1AJQ A;  2HEP A;  5KUM A;  2YKE A;  1AI6 A;  3L72 H;  4AIL C;  3JD0 A;  3PEH A;  3K5O A;  5JEN A;  4PHZ A;  1EN6 A;  2YID A;  4A5U B;  1VMG A;  2X0L A;  3C3T A;  3ETE A;  1I94 O;  3D2R A;  3ZRV A;  3ZIA G;  3GIG A;  4I5S A;  1EFR G;  2Q5Z A;  4YY3 B;  1Y8P A;  2RMK B;  4BIZ A;  1AIL A;  3WB0 A;  1ZTE A;  3OMN B;  5LHI A;  4O04 A;  2P22 C;  4YJ3 A;  1GMG A;  3T1C A;  4L94 A;  1JX9 A;  4KTN A;  3ZED A;  5H5N A;  1YET A;  4PA7 A;  5M4E A;  3RGB A;  4GZR B;  3DC6 A;  1KC8 W;  1VF6 A;  3B2E E;  4MTX A;  2IJK A;  2X6B A;  3E35 A;  1SQP H;  3K57 A;  4LNU A;  1K33 A;  3ZHS A;  1SZT A;  3T0Z A;  4GGL A;  1NHH A;  5CTX A;  4PA3 A;  4FLT A;  1AJN A;  3DSQ A;  4O2B B;  4IGG A;  1P7B A;  3H1H H;  2EBO A;  3B77 A;  1F4M A;  4UVA A;  1AJP A;  1AR4 A;  3KCY A;  2DYS C;  3T0H A;  5BMV B;  1AI5 A;  1FXH A;  5BMV A;  2DJV A;  1SZX A;  3ASN B;  4BIO A;  4YKX A;  3EHJ A;  4MT8 A;  2AZ0 A;  3OEE G;  4JI7 B;  1TGO A;  2UXB O;  4FCR A;  4E72 A;  4G2K A;  5LBQ A;  3D3Q A;  1HNX B;  4EGK A;  2VQF O;  1K5Q A;  3OM3 B;  4DR7 O;  4PJ0 Z;  3JAR B;  4KHP B;  1BE3 H;  3CC7 V;  3K08 A;  5LXT A;  4YKW A;  3T1K A;  5LXT B;  3D3I A;  1YDX A;  3CWV A;  1T5E A;  1X59 A;  4EEH A;  3LDE A;  3BAB A;  2B1I A;  4FZ1 A;  1FKA O;  1JM6 A;  1THZ A;  2YI8 A;  1SKV A;  3FX7 A;  1V54 B;  2AZ2 A;  1H8E G;  2QDO A;  3CJH A;  2KSD A;  3WG7 C;  1NR7 A;  4PU9 A;  5JCO C;  3S3W A;  4FCP A;  5CTW A;  2YI7 A;  4LPB A;  4P2Z A;  4DXW A;  4OX9 O;  4O0B A;  3H1L H;  5KLV H;  2Q67 A;  4TV9 B;  1OCO B;  1YIJ V;  3K9A A;  2XTA A;  2YI5 A;  2VS0 A;  4FZ0 A;  2XAF A;  2Q7E A;  3ZMZ A;  4RO2 A;  1FXV A;  1H2L A;  2WA4 A;  1GAX A;  1Y66 A;  4DV2 O;  1KIJ A;  1K9M W;  5EIB C;  2CK3 G;  1BQ0 A;  5EZY A;  2YC0 A;  4N21 A;  4YIP A;  4ZHQ A;  1F23 A;  1H7U A;  3OD4 A;  2K5B A;  4HXZ A;  3K98 A;  3CD6 V;  4KFG A;  4UCS A;  3SR2 C;  3S5T A;  3WU2 Z;  5KMG A;  4JI8 O;  3CYG A;  4GLX A;  1VQ6 V;  5JVD A;  5D7R A;  4X8A A;  1IZ3 A;  3CXH F;  3UT5 B;  2BU8 A;  4HBN A;  1ORQ C;  3TZ2 A;  1XMQ O;  3CCQ V;  2XND G;  5IY5 C;  5LOV B;  1H8H G;  1B04 A;  4UB8 Z;  3ZHV A;  3EHH A;  5M4P A;  2EXL A;  4QE7 A;  4Z1V A;  3OPD A;  3T10 A;  4ASA A;  4WFA V;  3TCU A;  4EFU A;  3PN1 A;  2WI2 A;  1YEW A;  3FAV B;  4LF5 O;  3T1Y O;  4FLV A;  1ZL8 A;  4QNH B;  5IYC O;  3ML0 A;  1ZL8 B;  2Y4T A;  2LGW A;  1I5C A;  3X2Q B;  1UY8 A;  2XD6 A;  4U3F H;  1ZAU A;  1R73 A;  4UCR A;  2BTQ B;  1N4C A;  1DF5 A;  4RUF A;  1UYK A;  4DR2 B;  5EBW C;  2XHT A;  1FS0 G;  4ZOL B;  4I55 B;  2CDY A;  3O2F A;  4ZOL A;  4X20 A;  1FAF A;  4X64 B;  2CTP A;  1UFI A;  1URF A;  4O4J A;  4ABM A;  3E8H A;  1GTO A;  3JAT A;  5LP6 C;  2KB1 A;  3GVM A;  2A7W A;  1MMM A;  2EZP A;  4W7T A;  4MVM A;  4OPH A;  3APO A;  1YC3 A;  3SL2 A;  2AGA A;  2JS3 A;  2ZIO A;  2IOP A;  4O2B A;  4MP2 A;  2PYJ A;  3CRQ A;  4MP7 A;  5J71 A;  5L3J A;  4PDL A;  2BYH A;  3ZJZ A;  1DGS A;  4FM0 A;  4LF6 O;  3GB7 C;  3ETD A;  2HJF C;  1G1X B;  2BU7 A;  3OWD A;  1Y4S A;  2QTS A;  3ASO C;  3ZXQ A;  2YE5 A;  2PGG A;  4I0X A;  4JF3 A;  3VQV A;  5B1O A;  4UCU A;  4DV6 O;  3OT7 A;  3IGA C;  1YJ9 V;  2XJX A;  4XIT A;  4DV7 B;  4YHH B;  2ZXW B;  3TET A;  5AG2 A;  1Q5O A;  3K5M A;  1Y4U A;  3R4M A;  3SPG A;  3JSL A;  2BSK B;  2UXC B;  3E8G A;  5H6R A;  1H2N A;  3JAR A;  1GN4 A;  5LGT A;  4MVU A;  2O1W A;  1E79 G;  2UXD O;  2GQP A;  1SQQ H;  4TSF G;  3MDS A;  2RDC A;  4CH4 A;  3B28 A;  1Y67 A;  1DK1 A;  5F3K A;  2ODM A;  4IT5 A;  2XUM A;  3U2D A;  5HFL A;  5CBF A;  1Q86 W;  3SPC A;  4DO2 A;  4JI1 O;  2Q2E B;  4DUY O;  3GIG B;  3HZ1 A;  1D2D A;  2IWS A;  5IYD O;  3IFX A;  1JJ2 U;  1VQO V;  3OMI B;  1R1B A;  4WFH A;  3ABT A;  2H8P C;  4I4T A;  3HEK A;  2VQE O;  3E2E A;  1TH8 A;  4O4H B;  1EA6 A;  1I94 B;  4BAE A;  1M93 A;  2XX4 A;  4E2L A;  1ID0 A;  2QWP B;  4WBN B;  5IT9 N;  3GIE A;  1XUQ A;  3QO8 A;  4GFN A;  1J5E O;  2WWW A;  3AG1 B;  3K5L A;  3BAA A;  4GX5 A;  4URM A;  4LNU B;  2WLJ A;  3H1K H;  1W2B U;  5L3D A;  1I5A A;  1WAZ A;  4HZ5 A;  4JYA B;  5JVD B;  3J80 N;  1NZ6 A;  3CRM A;  1MG1 A;  3UT5 A;  2XAS A;  1Y76 B;  5H2F Z;  4FFK A;  4R6Z A;  4AQY B;  4H81 A;  4LFB B;  4FK5 C;  3F7Y C;  1K73 W;  4IIJ A;  1SES A;  3MAQ A;  4IIJ B;  3TJT A;  3PEJ A;  4GCZ A;  4K8Z A;  2ZNI A;  4OGQ B;  1OCZ B;  2DMX A;  4XIP A;  3TTZ A;  3R4N A;  1KD1 W;  1NBM G;  2L35 A;  4FLW A;  2IM9 A;  1KKC A;  1UYG A;  3RYI A;  1OCR C;  3G6B A;  2F43 G;  4DR4 B;  1UYM A;  4CE1 A;  2IJJ A;  4TQF A;  2KKW A;  3HKE A;  2YEV B;  2ZQM A;  2IJI A;  4OX9 B;  4F4L A;  4KXR A;  5LGU A;  1UYH A;  3AG7 A;  1FJG O;  2JGD B;  1Q3E A;  3HR0 A;  5JWP A;  1J5E B;  3E8F A;  4IHJ B;  1YTF B;  4NKG B;  4JI5 O;  1ZX3 A;  3ZMT A;  2WEQ A;  3BHP A;  3ETG A;  2OTJ V;  3JAT B;  4JI4 O;  2CCT A;  4DV0 O;  1JMK C;  3ABL C;  2QM8 A;  1B63 A;  2PI5 A;  4U7O A;  1NTM H;  3W7W A;  1YVW A;  3DGE A;  1DF4 A;  2PUS A;  4PD4 F;  2YGE A;  1MZE A;  1EZV H;  4WF9 V;  1QYE A;  1Q82 W;  5EBL C;  4KQV A;  1NU1 H;  2DWE C;  3ZHT A;  4DR4 O;  4FLZ A;  1VQM V;  4CH3 A;  5BR8 B;  3H1J H;  2O57 A;  3B4S A;  3RW0 A;  3UQ8 A;  3G71 V;  2M7W A;  1TUB B;  1L0O A;  2QWN B;  4B3S O;  2K1E A;  2LW7 A;  1UYE A;  2QR4 A;  2WI6 A;  1OSF A;  4IYI A;  5FNC A;  2WI1 A;  2JEU A;  4CC5 A;  1SQF A;  2ILM A;  4KSG A;  2UXC O;  4FIP C;  5FNF A;  1NS1 A;  3BEH A;  2YI9 A;  1UYL A;  2CTQ A;  2G38 A;  4PV1 B;  1JOY A;  2NNU A;  1GKX A;  4YHH O;  1HP8 A;  3RKZ A;  4B3M B;  3D8C A;  2YIC A;  4JPR A;  1AJ6 A;  4TV8 B;  2M6Y A;  4TV8 A;  1S5L Z;  5A9G A;  3U11 A;  5IYZ B;  4DR6 B;  3DTU B;  5GTI Z;  4ZIB A;  4NXM O;  4L90 A;  1Q6H A;  4BXI A;  2CGO A;  4MB9 A;  1GJV A;  3LNN A;  4O07 A;  3A0Y A;  3RLQ A;  1TC0 A;  4DW0 A;  3P32 A;  2CUG A;  3EFF K;  1UY9 A;  4PDR A;  4O4L A;  5H6Q A;  1XBL A;  5JJN B;  2IOR A;  4XC0 A;  3OUF A;  5FPR A;  2YE9 A;  4QE9 A;  4DRX B;  3K58 A;  4MW3 A;  4I55 A;  1P7G A;  5BY1 A;  4P7A A;  4X20 B;  5B1N A;  2ITD C;  4EM7 A;  4JTD B;  4O4J B;  2QFO A;  3H80 A;  1VF7 A;  4JGS A;  2BT0 A;  5FND A;  2L6L A;  3R66 A;  3K03 A;  3SDL A;  4LF4 O;  3AG2 C;  1YT0 A;  4LFA B;  1M9N A;  4WFG A;  4TWK A;  3I56 V;  3RLP A;  3B40 A;  3KCX A;  3K97 A;  2R9I A;  1YER A;  3ZMU A;  3G7B A;  1S5H C;  1H2G A;  2YEA A;  2QG0 A;  4N23 A;  1ZLZ A;  5CTY A;  2WLH A;  4DV7 O;  4U93 A;  4X1Y A;  4E02 A;  3W7U A;  1QY8 A;  1PL4 A;  3ZHR A;  2CH4 A;  2PI4 A;  4LFC B;  3SJC C;  3AG1 C;  4MVR A;  2MW2 B;  4BAY A;  2F1M A;  1WB8 A;  3ICX A;  2YEV A;  4YKR A;  2FTK A;  4TUY A;  2OCH A;  5IJ0 A;  4NR1 A;  4LF8 O;  4FFB A;  4DK0 A;  2BRE A;  4FFB B;  4DR3 O;  5IWA O;  1D5N A;  4MOT A;  4IHJ A;  4HYO A;  3CGY A;  1GK9 A;  1XI1 A;  1RPR A;  3SYQ A;  5L3C A;  1VQK V;  1PD3 A;  2P4V A;  4XIQ A;  1VIB A;  2Y48 A;  1MOF A;  1WJZ A;  1KBH A;  3C11 A;  4NH9 A;  2EUL A;  2OT5 A;  3ASN C;  2FXS A;  3EVK A;  4B3T O;  2QE7 G;  3RVZ A;  4TV9 A;  1QR8 A;  4KHP O;  1NVP D;  2ZKJ A;  2EJR A;  3ABM B;  2JKI A;  4W4K A;  4EFB A;  2LFS A;  4I4T B;  2EIM C;  4X66 B;  4JZG A;  3AK2 A;  3K59 A;  2ZNJ A;  2YE7 A;  3L75 H;  1RSO B;  5EZY B;  4LWF A;  2Q8F A;  4LR3 A;  4CWF A;  3K99 A;  4H0L B;  5L3G A;  2UXN A;  4YKT A;  2YEJ A;  3QG5 A;  1YJW V;  4H85 A;  2ZIN A;  1JJO A;  1TUB A;  3J7A U;  1IBM B;  3NMQ A;  3JD1 A;  1TA8 A;  4GT1 A;  2YKI A;  4R1F A;  3U2K A;  3RYH B;  1YIT V;  4CWS A;  4C7U A;  5KMG B;  4CWO A;  1V55 C;  5CBH A;  1XMQ B;  3HYZ A;  3M99 B;  1HNZ B;  2C2A A;  1V9P A;  2P5O A;  4XCJ A;  1NTK H;  5LOV A;  4JV5 O;  3HZ5 A;  1VF5 B;  2Z3Y A;  1WP7 A;  1S3J A;  3CME V;  2LGQ A;  1K92 A;  2YE3 A;  5E1A C;  4I7Z B;  1YZB A;  3CP1 A;  3A0X A;  3JYC A;  1Q8I A;  1QBZ A;  2LW1 A;  3SYO A;  5FLX N;  1B06 A;  5JJE B;  2PNR A;  2HJD A;  3N27 A;  2GBO A;  3WFV A;  3HKE B;  3SYA A;  4U3J A;  5A2Q N;  2C1G A;  4XCL A;  1JQ0 A;  1NT2 B;  3HKB B;  4RAI A;  3GWO A;  1PP9 H;  3VOU A;  2LP7 A;  2YE4 A;  1RM1 C;  2Q6A A;  4HXW A;  4H7Q A;  3K0D A;  2NN4 A;  2VW5 A;  1IDS A;  2DQ0 A;  4AS9 A;  4QIW F;  3F5T A;  4P30 A;  1DTO A;  3TZ0 A;  1A32 A;  1AM1 A;  2CGN A;  3CS5 A;  1B3Q A;  2GSM B;  3K06 A;  2EIL B;  4G27 B;  4GKJ O;  4B6C A;  4EGH A;  4FLU A;  3GIF A;  1FFT B;  2YJX A;  3CHX A;  4D7T A;  3R91 A;  2IWX A;  4XIR A;  1SER A;  1TAE A;  4E00 A;  2ADQ B;  1GM7 A;  2FKX A;  3OR6 C;  1KU9 A;  1WB7 A;  2OYQ A;  1M56 B;  1BGY H;  4J9Z B;  1QVF U;  3TXS A;  1SS3 A;  4XTJ A;  5CA3 A;  1GN6 A;  5BR8 O;  2D2C B;  3WB1 A;  2DOS A;  1QHT A;  2XX5 A;  2GDS A;  1IBL B;  4CWR A;  2BSK A;  1IBK O;  4LF6 B;  3HHU A;  2ZD9 A;  1M5I A;  5BOC A;  2DQ3 A;  1IVS A;  2UUB O;  2Q73 A;  2IWU A;  3G80 A;  4I9W A;  2IH3 C;  3K04 A;  1WPB A;  4JYB A;  1DLB A;  4J11 A;  3ZKB A;  2JJ2 G;  1M57 B;  1NR1 A;  3R92 A;  2Y4U A;  3KE6 A;  4YKU A;  4DUZ B;  5FL7 G;  5HFM A;  5IE9 A;  2YGA A;  1W59 A;  4K4O A;  4DV6 B;  3B24 A;  5K1P A;  3L74 H;  1BL8 A;  1K3E A;  3HYY A;  3VHA A;  3SJB C;  1PNL A;  3WB2 A;  5B3S B;  3W7T A;  4CE2 A;  2PYL A;  2QTO A;  5E79 Z;  1Q81 W;  2ETN A;  5IYZ A;  4MVS A;  4J42 A;  3CSX A;  2CTW A;  2HKO A;  4FVM A;  3HKD A;  3N2K B;  3RYF A;  3CC4 V;  4X1K B;  4AWP A;  5EBM C;  4O05 A;  2YS8 A;  1SQX H;  2Y0P A;  1L8D A;  4RUE A;  3AK3 A;  4WFF A;  2YSU B;  4LH6 A;  2AW9 A;  3KKY A;  1O9G A;  3AK1 A;  3TGU H;  3CXC U;  3UO3 A;  1RSO A;  2XX2 A;  1GRJ A;  1Z5V A;  4ZI7 B;  2UUC B;  4WBN A;  3RT3 C;  4IL6 Z;  1N33 O;  1PVG A;  2YI0 A;  5LHH A;  4XDJ A;  4QGP A;  2RCV A;  3C90 A;  4NXN O;  2YXL A;  3C0E A;  4J10 A;  2XHX A;  3VHD A;  1E1Q G;  4QPK A;  2WLN A;  2WA3 A;  4D7S A;  5D6Q A;  1PPJ H;  2YE2 A;  2CG9 A;  5FPO A;  2QSA A;  4MTO A;  1Y76 A;  4R50 A;  2FYP A;  1R3J C;  3RFR A;  2DYS B;  4B08 A;  2QEX V;  2CCS A;  4LF5 B;  4E4E A;  1H2S B;  2OIG A;  2GV9 A;  4UCV A;  4QJF B;  5KHH A;  3SYP A;  4F6R A;  5KUK A;  1U2O A;  3L71 H;  3ZS8 C;  1N33 B;  1VQ7 V;  1D5A A;  5B5E Z;  3CEI A;  3RYI B;  4X1Y B;  3OGI B;  4X62 O;  4LP0 A;  4FLX A;  4RQF A;  4GKK B;  2JS5 A;  3ZMV A;  1AMW A;  1SF9 A;  2HHH B;  2DWD C;  5JH7 A;  3ETQ A;  1HW7 A;  1SQB H;  2CTR A;  2FB5 A;  4P9P A;  3ZRX A;  4JI8 B;  3HKB A;  1EN4 A;  3OMU A;  2UWD A;  2JGD A;  3T1H B;  1MSD A;  2IH1 C;  2WLI A;  1ZUQ A;  2P7T C;  1QU7 A;  2PTM A;  2XAJ A;  3G67 A;  1UY7 A;  2JJC A;  5J9P C;  3MHH C;  3MD0 A;  3U10 A;  3TK1 A;  5LMU O;  3D36 C;  1YC4 A;  1V55 B;  5KAF Z;  1MX0 A;  5KHI A;  1Q43 A;  2VQE B;  3T1H O;  1SA0 A;  3HB3 B;  3O65 A;  1SA0 B;  1UYI A;  1Q6I A;  3OAA G;  2YDE A;  4NTW A;  5CBG A;  4DV1 B;  3IED A;  1BZK A;  5CA1 A;  3OWB A;  5L3B A;  5F2V O;  2EIN B;  1I59 A;  2XJG A;  4KSH A;  2VWJ A;  1N32 B;  1MU5 A;  3SJA C;  1NQT A;  4PA4 A;  1S5J A;  2BOB C;  4BQJ A;  3E83 A;  3K79 A;  2YKB A;  3H1I H;  3IC9 A;  5BXZ A;  3B8M A;  1SQV H;  2F23 A;  1LR1 A;  2HVJ C;  2YI6 A;  2WI3 A;  4CWP A;  4HAM A;  3RYC B;  4XDK A;  2YGF A;  4W4L A;  1FXK C;  2W6J G;  5L3F A;  4BQG A;  1EBO A;  4BWA A;  1WP8 A;  2QWR B;  4PDM A;  1P49 A;  3E8B A;  4UXN A;  2FWZ A;  2XK2 A;  4DR1 O;  2VRZ A;  1HNX O;  3F7V C;  1QLE B;  1UYC A;  3FYI B;  4MS2 A;  4UUJ C;  2UUA B;  1AP6 A;  4JI3 B;  4J7Z A;  3B27 A;  2Q8V A;  2PY5 A;  3THO A;  2Q8H A;  2E0A A;  2HG1 A;  2JVD A;  5IYB O;  2B1G A;  2JK5 C;  2OWO A;  3Q4H A;  1Z5C A;  1JR9 A;  1K4C C;  5TIS Z;  3QNE A;  2YE8 A;  4O4I A;  3SGI A;  2BZ5 A;  3CRC A;  2Z0A A;  4WUD A;  1YS3 A;  3N2K A;  4X1K A;  4U7N A;  5F5R A;  5C8Y A;  4X65 B;  2XDK A;  4GKJ B;  1XDC A;  3LMM A;  4U3J B;  2WER A;  4O4L B;  3LSS A;  4LWI A;  4DR6 O;  4DRX A;  1VF6 C;  4TT3 G;  5LMU B;  4ZI7 A;  4LF7 O;  2FL4 A;  1YJN V;  2ZDI C;  1Z5A A;  1ARO P;  2QG2 A;  1MNG A;  5M4K A;  2O1V A;  4HNA B;  2WSS G;  1YC1 A;  4JI3 O;  4GT8 A;  3APQ A;  4KL1 A;  1AI4 A;  2ZDX A;  4IYH A;  4UB6 Z;  5EK0 A;  4X65 O;  4CWT A;  4CH5 A;  3G6E V;  2DE0 X;  3IAY A;  4GX1 A;  3Q5J A;  2W0F C;  3TUH A;  1AR5 A;  4F6R B;  1AR1 B;  1A4H A;  5GTH Z;  1K5S A;  3CRA A;  5JJJ B;  2R72 A;  3BA8 A;  3VQW A;  4AI8 A;  4B3R B;  3JCU Z;  2ZDY A;  4NH8 A;  1R3I C;  3M7M X;  2LJ2 A;  4LFB O;  3LUT B;  4LWH A;  1HNZ O;  5IDM A;  5JH7 B;  3I5D A;  1QR9 A;  3T4D A;  1ZXN A;  4TUY B;  5IJ0 B;  1O9H A;  5KX5 A;  4GX0 A;  1N8R W;  4JAA A;  2ZE6 A;  2A06 H;  4HYP A;  4J7K A;  1CP9 A;  3EKO A;  1OJH A;  3T2S A;  1WLE A;  4ASB A;  2FYU H;  3C3S A;  3R4P A;  4DV0 B;  3CE2 A;  1TC6 A;  1GH6 A;  1IXM A;  1H2K A;  3A2F A;  1GM8 A;  4PI0 A;  5B66 Z;  4DV2 B;  1VQ8 V;  2WPD G;  4H37 A;  3E22 A;  2GHY A;  2RN9 A;  2F4V B;  4X1I A;  4JI2 O;  3E22 B;  1OCO C;  3ZN1 A;  4EEQ A;  4Z2W A;  3VQY A;  3RYF B;  3HKD B;  2QKA A;  2ZE7 A;  4X88 A;  2ZM6 B;  5CA1 B;  5CPH A;  4R3A A;  4X89 A;  4WFE A;  5D5P A;  3HPL C;  5GON A;  5JCO A;  3T2M A;  2AKP A;  3QF7 A;  3CWB H;  4R3M A;  5J2U A;  2PF4 E;  3CPW U;  4MTF A;  5EIB D;  4DUZ O;  3O0I A;  4D6T H;  4JTC B;  5KHJ A;  3RYC A; 
#chains in the Genus database with same CATH homology
 3LSQ A;  2DYR B;  4GT1 A;  5CN0 A;  2A9H A;  3CD6 V;  3CCV V;  1YIT V;  4LCU C;  3D36 A;  2IW5 A;  1J95 A;  3OE7 G;  2ZR2 A;  1V55 C;  3OGC C;  5CBH A;  1VQ6 V;  1W0K G;  2A0L A;  4R7C A;  1R3L C;  3M99 B;  4LBE C;  4X8A A;  2C2A A;  1ORQ C;  4KP4 A;  3CCQ V;  3K3W A;  2XND G;  5B1A B;  5IY5 C;  1YTF D;  1S77 D;  2Z3Y A;  1H8H G;  1S3J A;  3CME V;  2AHZ A;  4QE7 A;  2JDI G;  1NKD A;  1K92 A;  2EIK B;  5E1A C;  2UXX A;  3LDD A;  3TCU A;  4WFA V;  4WFB V;  1OCR B;  3OR7 C;  5CMU A;  3OMA B;  3OFN G;  3CP1 A;  1GO3 F;  1P4R A;  4MSW C;  1QVG U;  3FKS G;  3I55 V;  3JYC A;  2WLM A;  1QBZ A;  3MHS C;  4QNH B;  2Q68 A;  5IYC O;  3SYO A;  3ML0 A;  1OCZ C;  1OCC B;  5LHG A;  1KQS U;  1JCH A;  1KP3 A;  3X2Q B;  1R6N A;  1FXK A;  3WFV A;  1R73 A;  3SYA A;  1OZ0 A;  4UV8 A;  1DF5 A;  1JQ0 A;  4RUF A;  1GM9 A;  1VQL V;  4RAI A;  5EBW C;  3GWO A;  4HZ3 A;  3VOU A;  1FS0 G;  1QLE C;  2LP7 A;  1RM1 C;  2Q6A A;  3FB5 C;  2OCC C;  3E8H A;  1TUE B;  3K0D A;  1RM1 B;  1GTO A;  4QPJ A;  2ATK C;  2DQ0 A;  3SJQ C;  4QIW F;  2KB1 A;  4P30 A;  1DTO A;  2EZP A;  2P6J A;  1Q7Y W;  1ENV A;  3CCJ V;  2V1D A;  4MVM A;  2R9R B;  1NH2 B;  2GSM B;  2XOK G;  3K06 A;  2EIL B;  3AG3 C;  4G27 B;  5B1B B;  5LGN A;  3ABL B;  1FFT B;  3G4S V;  5KA6 A;  3FYE B;  4PDL A;  3ABK B;  2V7Q G;  3UM7 A;  3ZJZ A;  1MSW D;  3NXS A;  5B1B C;  2HFE C;  3ETD A;  2HJF C;  3GB7 C;  3ZCC A;  3JD3 A;  1SER A;  3ZMS A;  1R6K A;  4GX2 A;  3ASO C;  1GM7 A;  3OR6 C;  4UV9 A;  1ZWI C;  4BW5 A;  4JF3 A;  2P67 A;  5B1O A;  1PNM A;  1M56 B;  1JVM A;  4J9Z B;  1QVF U;  2Q69 A;  3IGA C;  1YJ9 V;  3FB8 C;  5CA3 A;  4Z1M G;  5C93 A;  2ZXW B;  3TET A;  1WPX A;  2ZDI A;  1VQ5 V;  4PA6 A;  3FB7 C;  3SPG A;  2ZD9 A;  2WLL A;  4LP8 A;  2DQ3 A;  2DW4 A;  3E8G A;  3AG4 B;  5EC2 C;  4JAS A;  2IJH A;  5H6R A;  4BIU A;  1XL6 A;  3B8N A;  1M1K W;  1KEC A;  1KP2 A;  4I9W A;  2IH3 C;  3K04 A;  5LGT A;  4JYB A;  1DLB A;  4MVU A;  3AG2 B;  2HG5 C;  1E79 G;  2EIJ C;  2JJ2 G;  1M57 B;  4KUM A;  4R8C A;  1NR1 A;  3CCE V;  4TSF G;  1EZJ A;  3LNM B;  4JAV A;  1LNQ A;  1PNK A;  1COW G;  1M57 C;  2Y69 B;  5FL7 G;  5HFM A;  1F51 A;  3CCU V;  1BL8 A;  1K3E A;  1I5Y A;  5HFL A;  3STZ C;  1PNL A;  5B3S B;  3W7T A;  5CBF A;  2QTO A;  4Q20 A;  1Q86 W;  5DM6 V;  4CBC A;  1Q81 W;  1CEZ A;  3SPC A;  1M56 C;  4MVS A;  4DO2 A;  2HKO A;  5B3S C;  5IYD O;  3CCL V;  3CC4 V;  5EBM C;  5EC1 C;  3IFX A;  1JPX A;  2XAG A;  1JJ2 U;  4RUE A;  1VQO V;  3OMI B;  4WFH A;  3AG4 C;  4P9O A;  3ABT A;  4WFF A;  4CZZ A;  1Y4M A;  1UJW B;  1ROP A;  3ASO B;  2H8P C;  2YSU B;  3CCM V;  5KA5 A;  3CXC U;  2X6A A;  3E2E A;  3PJS K;  2HVK C;  4PA9 A;  1G4Y B;  2EIJ B;  2NLJ C;  4MTG A;  1HWY A;  2EIM B;  2QM7 A;  4E2L A;  2IU0 A;  2XAQ A;  4UVC A;  2WAM A;  5LHH A;  4XDJ A;  3IC7 A;  3OEH G;  3QO8 A;  2WWW A;  2HLD G;  3AG1 B;  1K4D C;  1E1Q G;  4GX5 A;  4QPK A;  2WLN A;  3RVY A;  5B1A C;  2WLJ A;  1S0V A;  1W2B U;  5L3D A;  4WCE V;  4JTA B;  4MTO A;  4ASU G;  4MVO A;  1MG1 A;  4ZKI A;  4R50 A;  2XAS A;  1R3J C;  2DYS B;  3T4Z A;  4R6Z A;  2P90 A;  2QEX V;  4FK5 C;  3F7Y C;  4MVQ A;  1K73 W;  1SES A;  1G8M A;  4QJF B;  4GCZ A;  3SYP A;  5KUK A;  1OCC C;  1OCZ B;  1V54 C;  3CC2 V;  4H33 A;  1VQ7 V;  3R65 A;  3SPH A;  1KD1 W;  1NBM G;  1RPO A;  2QA4 V;  3H01 A;  1YSC A;  3WG7 B;  4RQF A;  5DN6 G;  1OCR C;  1K34 A;  3ZMV A;  4ZBM A;  2F43 G;  2DWD C;  2IJJ A;  3A0R A;  1H38 A;  5L3E A;  2YEV B;  1PL0 A;  2ZQM A;  2IJI A;  4JYC A;  4F4L A;  3OW2 U;  4P9P A;  3ZRX A;  5LGU A;  1KKD A;  4J9Y B;  2WLI B;  1NJI W;  1QLN A;  4G28 B;  2IH1 C;  2WLI A;  2P7T C;  2XAJ A;  3E8F A;  2LFR A;  2DYR C;  1YTF B;  5J9P C;  4FMT A;  3ZMT A;  3ETG A;  2EIK C;  3MHH C;  1E1R G;  3MD0 A;  2OTJ V;  2EIL C;  3AG3 B;  3TK1 A;  1VQP V;  1V55 B;  3ABL C;  1SET A;  3KG2 A;  2QM8 A;  3ZRW A;  2OCC B;  3JD4 A;  2PI5 A;  4U7O A;  1NH2 D;  3W7W A;  3ZRS A;  3DGE A;  1DF4 A;  3HB3 B;  2ITC C;  1W0J G;  3OAA G;  4EKW A;  5CBG A;  2X6C A;  3W7X A;  4WF9 V;  3SPI A;  1Q82 W;  3STL C;  5EBL C;  5L3B A;  4UVB A;  2EIN B;  2WLK A;  1K7D A;  4L87 A;  1NQT A;  2DWE C;  2ZXW C;  4PA4 A;  2BOB C;  1VQM V;  3E83 A;  3K79 A;  2OTL V;  2MK3 A;  3ABM C;  3RW0 A;  3B8M A;  3G71 V;  2M7W A;  4PEL A;  2HVJ C;  2IU3 A;  4HAM A;  4XDK A;  3P30 A;  2WLL B;  1FXK C;  2W6J G;  2K1E A;  2A79 B;  3X2Q C;  5L3F A;  2Z5U A;  1EBO A;  1BMF G;  4FJC C;  4PDM A;  4FPP A;  2JEU A;  2HR3 A;  3E8B A;  4UXN A;  3AEI A;  2Y69 C;  2QKS A;  1S76 D;  2EZO A;  4PDV A;  3F7V C;  3CMA V;  4FIP C;  1QLE B;  4MW8 A;  3FYI B;  4MS2 A;  3BEH A;  4UUJ C;  1NVP B;  2W6I G;  1YHQ V;  1JOY A;  2NNU A;  2BOC C;  4XBF A;  4XDL A;  1AJQ A;  5KUM A;  3E89 A;  1AI6 A;  2B1G A;  1K97 A;  2JK5 C;  4JPR A;  5IYB O;  3JD0 A;  4OXS A;  1K4C C;  3QNE A;  2H94 A;  1L1F A;  5IDJ A;  2X0L A;  3ETE A;  3ZRV A;  3ZIA G;  4I5S A;  1EFR G;  3DTU B;  3ABK C;  5H9C A;  4BIZ A;  1AI7 A;  2X7R B;  4U7N A;  3SPJ A;  2XAH A;  3OMN B;  1FXK B;  1VQN V;  5LHI A;  3CCS V;  3W7S A;  1GMG A;  3T1C A;  3P32 A;  3EFF K;  3E86 A;  3LSS A;  4PDR A;  1JX9 A;  3ABU A;  2D3O W;  4TT3 G;  5H6Q A;  3OUF A;  4LC1 A;  4QE9 A;  5GW7 A;  4MW3 A;  3CYO A;  4PA7 A;  1YJN V;  5B1N A;  2ITD C;  2ZDI C;  1CPY A;  4JTD B;  1KC8 W;  4MTX A;  1MAB G;  1ARO P;  2IJK A;  2X6B A;  3E35 A;  1PKX A;  4JGS A;  1K33 A;  2WSS G;  1SZT A;  4JAU A;  4KFM A;  2B5U A;  3QO5 A;  1AI4 A;  3CCR V;  3K03 A;  4PA3 A;  1AJN A;  3AG2 C;  5EK0 A;  1P7B A;  1M9N A;  4WFG A;  4TWK A;  2EBO A;  3I56 V;  1F4N A;  3B77 A;  1VQ9 V;  3G6E V;  1F4M A;  3VBB A;  4GX1 A;  2R9I A;  3JD2 A;  1I5X A;  5BZB A;  3ZMU A;  4UVA A;  2W0F C;  1K8A W;  2ZR3 A;  1QCE A;  1S5H C;  1AJP A;  1H2G A;  2DYS C;  3LDC A;  1AR1 B;  4N23 A;  1AI5 A;  1GKF A;  1K5S A;  1FXH A;  2WLH A;  3ASN B;  1R3I C;  4MT8 A;  3W7U A;  3OEE G;  3LUT B;  2PI4 A;  2AHY A;  1BHA A;  3AG1 C;  4MVR A;  4RQE A;  4G2K A;  5LBQ A;  4BAY A;  1OHH G;  3EHB B;  1QR9 A;  2JIZ G;  3K0G A;  3RBZ A;  3T4D A;  2YEV A;  1K5Q A;  3OM3 B;  4GX0 A;  1N8R W;  2FTK A;  3CC7 V;  3K08 A;  3OUS A;  1CP9 A;  3D3I A;  1BHB A;  1WLE A;  1B6Q A;  3F5W C;  4HYO A;  1XL4 A;  3LDE A;  3ZN0 A;  1IXM A;  2B1I A;  1THZ A;  1GK9 A;  3SYC A;  1RPR A;  3BY6 A;  3SYQ A;  1VQ4 V;  1GM8 A;  1V54 B;  1H8E G;  5L3C A;  1VQK V;  1VQ8 V;  1PD3 A;  2WPD G;  4H37 A;  3ZRW B;  1SRY A;  4MVZ A;  2GHY A;  2Y48 A;  1MOF A;  3WG7 C;  1NR7 A;  3ASN C;  2OT5 A;  1OCO C;  3ZN1 A;  2QE7 G;  4P2Z A;  3RVZ A;  4DXW A;  3UKM A;  4X88 A;  1QR8 A;  5IY5 B;  1NVP D;  2Q67 A;  2EJR A;  3ABM B;  1OCO B;  1R3K C;  3QO7 A;  4WFE A;  2JJ1 G;  4X89 A;  3HPL C;  1YI2 V;  1YIJ V;  3K9A A;  3T2M A;  2LFS A;  2XAF A;  1S72 V;  2EIM C;  3ZMZ A;  4RO2 A;  2JEX A;  1FXV A;  1Y66 A;  3JCZ A;  1K9M W;  2EIN C;  2CK3 G;  3FB6 C;  5L3G A;  4N21 A;  4YXW G;  2UXN A;  3CPW U;  4MTF A;  1YJW V;  1M90 W;  4JTC B;  1F23 A;  3JD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...