1F51A

A transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in singal transduction
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
181
structure length
181
Chain Sequence
ISDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEITSHECLIEIGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SPORULATION INITIATION PHOSPHOTRANSFERASE B
publication title A transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in signal transduction.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 64
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature ec 2.7.-.-:
pdb deposition date 2000-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14682 SPOB_ab Sporulation initiation phospho-transferase B, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1f51A01
3.30.565.30 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Sporulation initiation phosphotransferase B (SpoOB), C-terminal domain 1f51A02
4JASA 5B1OA 3NXSA 4QPJA 4I5SA 4JAVA 4JAUA 4LC1A 4JYCA 2QM8A 4KP4A 3D36A 1JOYA 4U7NA 4BIZA 4GT1A 3ZRXA 3ZRVA 4ZKIA 3P32A 2FTKA 2LFSA 4JYBA 2C2AA 4GCZA 5B1NA 4FPPA 1F51A 3ZRWB 3DGEA 4FMTA 5C93A 2QM7A 4MT8A 2P67A 4BIUA 3ZCCA 4MTXA 1IXMA 2LFRA 4Q20A 5IDJA 3A0RA 2WWWA 4QPKA 3MD0A 3TK1A 3ZRWA 4U7OA
chains in the Genus database with same CATH superfamily
1VQKV 3CB2A 4DR3B 3L72H 1N0NA 1GAXA 3OW6A 2YE6A 3G7BA 2GDSA 1FXHA 2YEJA 4XDKA 1EBOA 4ZI7A 1FPOA 1RP3B 3O6OA 1WPXA 3U67A 1PL4A 5LGNA 4B3SB 1SETA 1XI1A 1NVPD 5E1AC 1THZA 2EX3A 1IBLO 1A4HA 4YXWG 4DV7O 1XQ8A 4L94A 3ABMB 3R4OA 4XTJA 1I94B 4WF9V 4JI7B 1VF6A 1S3JA 3JD4A 2ZE6A 2XX5A 5BOCA 4CWNA 1R6TA 2ZE7A 5HFLA 5D6PA 4KHPO 3TUHA 4QNHB 2IOQA 3N2KA 3STLC 4YKRA 3HKDA 4JI4O 3AG3C 3O2FA 4YKUA 2CTPA 1G4YB 4NXMB 3N2GB 1YSCA 2HR3A 1UYGA 2ATKC 2Y69B 1Z5CA 4JZGA 4X62O 5FNVA 4IYIA 3BRCA 3A0TA 3TGUH 4NH8A 3G71V 4DR2B 4F4LA 4UB6Z 1S76D 1Y67A 1I5BA 4O07A 2QGNA 3FAVA 1YHQV 3H1HH 3ZHQA 1P7BA 5B1AC 1MG1A 2R72A 2CGOA 3R66A 2UXDO 4XBFA 2XX2A 1MMMA 1AI4A 2FTKA 2OIGA 3CCSV 2YE4A 2JRIA 1VQ6V 4CWPA 1I5YA 1N32O 2C1IA 5CA0B 5AG2A 4AWQA 4WFBV 2EIJB 2JK5C 4JAAA 4HZ5A 4U7OA 2ZM6O 1H8EG 4I55B 5J9PC 3CX5F 4Q6GA 4DR6O 5D5PA 2XAGA 5BZBA 1RFYA 4B3RO 1NHHA 3OEEG 1V55C 1AR5A 3UM7A 3R4MA 4MOTA 4J7JA 1Q5OA 5LMNB 1OCCC 5IWAB 1RSOA 1V9PA 1YETA 1VQOV 4B7PA 3CJHB 4WCEV 2WERA 4CWQA 2YJXA 2GV9A 4TWKA 2BZ5A 4ZOLB 1Q43A 4MW3A 4MPCA 1WJZA 1US6A 1U0ZA 4ZIBA 4URLA 4JTCB 4FZ0A 4U3JA 3CCEV 4PA9A 3SL2A 5KAFZ 4BQJA 3TZ2A 4YKZA 3RLPA 3OW2U 1IURA 3QG5A 4TV9B 4OX9O 3BFRA 2Q69A 1YJNV 3D0BA 4YY3B 5EYPB 4TQDA 2JGDA 4PA3A 1I5AA 2FWZA 2YUAA 1M4UA 4RAIA 2VQEB 2QDOA 1AJ6A 4UUJC 3HKBA 5JH7B 4X1IB 1BZKA 4R1FA 3ASOB 5EK0A 2ARHA 1UPGA 3GWKC 4WBNA 2YIAA 1WN7A 2P90A 2ADPA 5B66Z 4K8XA 3RYIA 5K1PA 3OMUA 1H7SA 2JS3A 4X1KB 4PDLA 4MT8A 4BIUA 4LF5O 4MVOA 4HYOA 2Q7EA 4MPEA 1ROPA 5CTUA 2EIKC 3K97A 1UYLA 5CTXA 3L71H 3CHXA 4CH6A 2XX4A 2LJ2A 4NR1A 2VS0A 2WLLA 1L0OA 3SYOA 4BAEA 4MVUA 5FPRA 3E2EA 2YI6A 2ZE8A 4AWPA 2AZ0A 1JFFA 3I5DA 4YJ2B 3AK3A 4JV5B 3OT7A 4YKWA 1Y76B 2JEUA 2CK3G 4EFEA 1FJGO 1QYEA 1YTFD 5EIBC 1MSDA 3AEIA 4C7UA 3G6EV 2WLNA 2CG9A 2IWUA 5IJ0A 5LMUB 1JA8A 3JSLA 2BRCA 4O4LB 5L3EA 2Z3YA 4O4IB 1HNWO 1NR1A 5ITZA 4WUDA 3QO8A 5IE9A 4H37A 3D2RA 3ABLB 4BW9A 1GKZA 4DUYB 2HCHA 4LWEA 2UU9B 2UXCB 4CH4A 4DV1B 4XIPA 3JARB 2F1MA 4DV3O 1SRYA 3HZ5A 4OPAA 1ZL8B 2YXLA 3AG2C 1XREA 4FK5C 1NI8A 1K5SA 4K35A 4KQVA 1IBKO 4O09A 4DV2B 3RYFA 3ZBHA 1AM1A 4EFBA 3H1IH 4LF9O 4XKAA 4GT1A 3G7EA 2XAFA 3KZIZ 1N8RW 4H44B 2F66C 1ORQC 3O9OA 2GUZB 3I55V 4UROA 3T0HA 1JQ0A 3CWVA 4DV6O 1X59A 2YK2A 1OCOB 3R4PA 1M56C 4AS9A 1MOFA 3RKZA 4XE2A 1WNSA 5GTIZ 2BTQB 3A0RA 4RQEA 5D7DA 3MD0A 3E89A 2BT0A 2N74A 5DN6G 3TXSA 4YIOA 3ASNC 1NVPB 1FXKB 4B3MB 1B06A 2IJIA 5KX5A 3BMYA 5L3CA 1OV9A 4MTXA 5KMGA 1GO3F 1N4CA 1HWYA 4ASAA 2BU5A 1IVSA 4E00A 4NTWA 1TUEB 3LDCA 5LA6B 1XNQO 5B5EZ 2UXXA 1YSRA 5B3SB 1EN6A 1KKCA 2K1EA 2CAZC 4J42A 5BXZA 1QY8A 3BVOA 4GKKB 2G38A 3EVKA 2Q7HA 1H2MA 2CH7A 1YITV 3N27A 4CWFA 3ZHSA 4OPHA 3RYCA 3K59A 5L3DA 2FMLA 2IU0A 2GTAA 1SQXH 5KA5A 2Y69C 5FNVB 4ICGA 4MP2A 3ZMSA 2LQTA 1HNWB 3GB7C 1I08A 3EHFA 4DYLA 5F5RA 4U7NA 4DR7B 2HP8A 4GZRB 4WFEA 3K9SA 2P67A 1VQLV 1UY9A 3SJCC 3TK1A 1OHHG 2JGUA 4NH9A 3ZS8C 4D7TA 2BYHA 4I5SA 4F6EA 3T1HO 2AW9A 1R3KC 1K4CC 1XMOO 4DRXA 2E74B 2P6JA 5J2UA 3T2SA 3PJSK 3K98A 1HR0B 4BXIA 4EFTA 3OUSA 4DR5O 1GN6A 2IBZH 2LO1A 3OD4A 2GQPA 2Q0AA 2HEPA 1VQ4V 3JAKB 3B25A 4G2KA 1SQPH 1Z5VA 2ZKJA 4XDLA 2LGWA 1Y8NA 1UY8A 2WLMA 1VQ8V 3JATB 1S0VA 3IFXA 4LF4B 3CC7V 1KQSU 4JTDB 1GMGA 3ABUA 5IYCO 4XCJA 4X8AA 1G6UA 1QLNA 2FWYA 4XKKA 4LF6O 2QF6A 4W7TA 1BHAA 4U93A 3CSXA 5B1AB 1WPBA 5L3FA 2A7WA 1K9MW 5FWKA 5IY5C 4FLWA 1BQ0A 2XCMA 4R6ZA 3EHBB 5LHIA 3ZMTA 4FLVA 3CRQA 3H1KH 3B27A 1P84F 1U2OA 1SERA 2Z5UA 2JJCA 4O4JA 4JGSA 2QEXV 4F6RB 3BM9A 5CTWA 2Y4TA 5LOVA 4LP0A 3E22B 3ASOC 3H1JH 2LW7A 1Y4UA 4ZHQB 1CEZA 4L87A 3BEHA 4IIJA 3RYIB 4J7KA 1P7GA 4W4LA 3IC9A 2HVJC 3VQXA 3K5NA 2R9IA 1MX0A 2BE3A 3T1KA 5IYBO 2E5LO 4JYCA 2E76B 4FLUA 1YJ9V 3E8BA 1YTFB 3PEHA 2Q9LA 2O1WA 2LGQA 3S3XA 4HXWA 1WAZA 4NH7A 2YIBD 2ZDYA 1VQMV 5LL6Y 1SS3A 2VQFB 4LFCB 1JJ2U 4P8OA 2Y0IA 3CRRA 2IM9A 5CA1A 3K06A 4JF3A 1DLBA 1VEWA 5FNFA 2XABA 4KTNA 4XDMA 4CE3A 5IJ0B 1AILA 2JJ1G 4MVZA 2YICA 1Y4SA 3W7TA 1NH2B 4X9LA 4LNUB 5EBLC 3IEDA 5EC2C 1PVGA 4DV5B 4HNAB 1FYJA 4ASUG 4B3TB 4DUHA 1SQBH 2LFRA 4JI1O 2B5UA 1N34O 3ZHUA 3CEIA 3OTOB 3CRCA 3H80A 4XKOA 4R7CA 4MVMA 3WB0A 2XK2A 5IT9N 2R9AA 4LP8A 5A2QN 2XAJA 3P32A 4L8JA 1Q6UA 4JI2O 3G75A 1XNRO 3FB8C 3CCJV 4DUZB 1JMKC 1PM9A 5H5NA 2E3CA 2DQ3A 3CCQV 1YC3A 2F4VB 1AR1B 3RVYA 3OTFA 3B8NA 1NQTA 3WFVA 1WB8A 3BPZA 4X1YA 1F4NA 1SF9A 4DK1A 3CP1A 1XILA 1LNQA 1OCOC 2BSKA 4DW1A 1M57B 3IC7A 4B6CA 4WFGA 3DXRB 4PHZA 4HY1A 4DR4O 2ZR2A 4E02A 1PV0A 5H9CA 1OCRB 4JYYA 1VF5B 2QG2A 4YIPA 1FXKC 1EN5A 3M99B 4UCTA 1N33O 1ZTEA 4GKJB 3ZHRA 2BU8A 4X66O 3R92A 2JJ2G 3BY6A 5H6QA 2K5BA 1L1FA 4O4HA 1B3QA 2UUBB 2HHHB 4I0XA 3CXCU 1K73W 2WI6A 4TQFA 1AJNA 3GIGA 2PF4E 3E8FA 1PNMA 2ILMA 3HKEB 1N36O 2YEDA 2WAMA 2UUCB 1VARA 4JTAB 3B8MA 4PA7A 5FL7G 5B3SC 4E2LA 4LH6A 2ZKOA 3E8GA 4RUFA 1QR9A 4NVPA 2XAHA 4MSWC 3FYIB 3FB5C 4URMA 1TBWA 4O0BA 3R91A 4XD8A 3MHHC 3D36A 4JI0O 1TVKA 3DSQA 4XIRA 1GM9A 2DQ0A 3HEKA 1M1KW 2XUMA 1DK1A 4NXNO 1KYOF 1UJWB 3ASNB 1XUQA 4LR3A 2OTJV 4J9YB 2YGEA 2A9HA 3FV5A 1N0JA 1KP3A 2WI5A 2CCSA 2OTLV 4X65B 1ZW9A 4EMVA 1J95A 1NTMH 1QU7A 3LSQA 1FAFA 4L93A 1BMFG 3ZRVA 1QVFU 4FFBA 2WLHA 1TUBA 3CGYA 1W0JG 2QM4A 3OUFA 2EILC 4E4EA 5M4KA 2AGAA 1L8DA 2BOCC 3JD3A 1HDJA 2KG7B 2QWOB 4R50A 4UB8Z 1NTZH 1NU1H 4LF8B 4PA6A 1R3JC 2HKJA 1K8AW 1U96A 3K0DA 1YERA 2N04A 2UWDA 4X89A 2YE5A 3JD1A 4GCZA 1BKNA 5GW7A 3QTCA 1Y66A 4UCSA 4FM1A 4XITA 4GFNA 3C3TA 2D2CB 2DW4A 3THOA 1J5EB 4HBNA 1BYQA 2QKCA 4JYAO 2IWXA 2H94A 4QIWF 3APOA 3FKSG 2Y0PA 3EXAA 2EJ7A 3VBBA 4ASBA 2VWJA 3JCZA 4DR1O 1EI1A 1BGYH 5IJ9B 3OAAG 1ZXMA 3D3QA 1GM7A 3SJQC 2PYJA 1L0LH 1VP7A 2DE0X 2VCIA 2PGGA 4ABMA 3IGAC 1K97A 3O65A 3LNMB 4JI8O 2RQ6A 3BCCH 4LF7B 4K0KB 1FFTB 3F7VC 1QR8A 4O2BB 3QO5A 5IYZB 3LNNA 2OIEA 1SZTA 5CA3A 1HNXB 3JSNA 1H8HG 4GGLA 3FYEB 5M4PA 2AXTZ 3ZRWB 1ZWIC 4DV4B 5JQGA 4H7QA 4LFAB 3FX7A 5LP6A 3HZ1A 2YI9A 3K5OA 3ZHVA 4IL6Z 3ZHTA 1EM1A 1ZX3A 1G1XB 3OWBA 4O2AB 2W6JG 4A5UB 2AZ2A 1YEWA 3RGBA 1IX9A 4J80A 2RCVA 4TT3G 2E75B 4JI6B 1TC6A 5L3JA 4QGPA 1UYIA 3T4ZA 5J2TB 4DV0O 1FS0G 2Q8HA 4ZKIA 3S5TA 3WG7B 4PJ0Z 5IY5B 1LUVA 4XCLA 2QSAA 3FD9A 3HKCA 3RYHB 2UUAO 5CMUA 3L73H 1QZRA 3K5LA 5D7CA 5LXTA 3UT5B 2JVDA 1GN2A 1IBLB 1TA8A 5KHJA 4CWSA 4QPJA 4DV7B 3GIFA 5M4NA 3K58A 4UV8A 2Q5ZA 4YJ3B 2YKJA 3HR0A 5H2FZ 3E8HA 4CE1A 5JJEB 2WA4A 1G8MA 3M7MX 2MK3A 1D5AA 3UQ8A 4KHPB 2BSMA 4TV8A 2HFEC 2HJDA 3TZ5A 3CRLA 4JI4B 2F95B 1F7YA 2EXLA 5JVDA 1SA0B 2ZCEA 5KLVH 3QDDA 2EINB 3A0WA 3FT5A 1CPYA 4FLXA 4PDRA 2QG0A 4EB6A 1QBZA 4X62B 4K4OA 3G67A 2YI7A 3CD6V 2YEIA 1S14A 3A8TA 2ETNA 2FB5A 2WLJA 3SYCA 1H2LA 2ZNIA 1LUWA 1HW7A 4P2ZA 3T4DA 2ZD9A 4X1YB 4GT8A 4DR1B 3W7SA 1M9NA 1YESA 4FVMA 4FZ1A 2UXDB 3H9VA 1M57C 1YF2A 4E72A 2YEGA 4YKQA 2YE8A 5BR8O 3EKOA 1XHXA 5KUKA 1HNZO 1N32B 1UYHA 1OCRC 4CS2A 2OCHA 5GONA 2XHXA 2YS8A 3IAYA 1GN3A 2ZM6B 1DF5A 4UFZA 4UXNA 4N23A 1Q86W 4DR6B 4FCQA 5H6RA 4PDVA 1FKAO 3ZKDA 4PI0A 2PYLA 4B3RB 1Y74A 1Q6HA 3ABKB 1NH2D 3CCUV 1NKDA 3AG7A 2CCTA 3CCVV 4I0XB 4BIOA 2Q6AA 1TGOA 3RLRA 3B2EE 3ZMZA 4CC5A 3WU2Z 3JAWB 4P9PA 5LYJA 3L9DA 2YKIA 1FFXA 4TUYB 2N05A 1YVWA 1U97A 3K5MA 4XIQA 3FFQA 1F23A 1VQ7V 1YS3A 4LH7A 4OX9B 1W0KG 3JASA 1MU5A 4CS4A 1AH6A 1YCIA 1BS3A 1K7DA 4JI5O 5F2VO 4MPNA 5KUMA 1IXBA 4I50B 1BHBA 2YSUB 2RDCA 3C11A 3QVNA 2WA3A 2OYQA 3CRAA 1T5EA 2QFOA 2XD6A 2DYRB 1XL6A 2WLIA 2UXBO 4ZI7B 1IXMA 4MP7A 2M6YA 1KD1W 3OM3B 1TUBB 3JAMN 4DW0A 1AI6A 4LF5B 3ML0A 4LFBO 3U2KA 1ZUQA 4QE9A 4CZZA 1CXZB 3I56V 4YHHO 3SPCA 1MA1A 2XASA 5B1BB 4LPBA 2YEVA 2KKWA 3H01A 4I9QA 4IHJA 2CGNA 3TZ0A 3N2KB 1XOUA 5EZYA 3HKDB 4I4TA 1FJGB 5L3BA 3U10A 3UCSC 5J6AA 4AQYO 1IBMO 2ZDIA 2VW5A 1WA8A 3Q4HA 1XMQO 4LWSA 3ZN1A 4PA4A 1IZ3A 5CB4A 1WP8A 2CDYA 1NBMG 5D6QA 2IJKA 3FAVB 3PEJA 1PD3A 4JI3O 4DV3B 4WFAV 1Z5BA 4X20A 4V25A 4UCVA 2EILB 1R62A 1JX9A 3INWA 2KB1A 1AJPA 1FXVA 5BMVA 3T1YO 1NZ6A 3Q5LA 4Z1VA 1A32A 2R70A 1IBKB 2L6LA 2YE2A 2L35A 4LF9B 4H85A 5KHIA 1SZXA 1AJQA 2HJFC 5E79Z 4DK0A 3W7UA 4DV6B 5JQGB 2ESAA 2QM8A 5LP6B 2WLKA 4PRXA 1RSOB 5JWPA 4KUMA 2NNUA 3CC4V 4I3HA 2YI0A 4J9ZB 1H38A 2DWDC 4P30A 1Q7YW 3E83A 2EJRA 1Y8PA 2WI1A 4U3JB 1AP6A 2QKAA 1KB9F 3WG7C 1KBHA 2V4DA 2V1DA 4EGKA 1H2SB 2YECA 1RM1B 2JGDB 3ICXA 3RFRA 3ETDA 2QWPB 2C1GA 3B26A 3U2DA 3VHAA 4IYHA 1M5IA 3HKBB 4CWOA 1NHIA 3K60A 1AB3A 5EC1C 1XNQB 4BW5A 1SQGA 1PNLA 2Y4UA 1MZFA 1K92A 2FYUH 2HG5C 4WBNB 1NR7A 4IGGA 4CH5A 2K9PA 3B28A 1H2KA 1WLEA 1ZXNA 4FM2A 3K0GA 1IDSA 4XDJA 4R8CA 4WUBA 2YI8A 3EHHA 5M4EA 4KP4A 3KKYA 5CA0A 1SKVA 2PI5A 1GTOA 4X64O 2EINC 3LSUA 4LWHA 4I55A 3STZC 2C2AA 4EB6B 3CWBH 3S3WA 1B63A 4JQLA 4J7ZA 3T10A 3JALA 2WLLB 1PNKA 3J7AU 1AMWA 1B62A 1K33A 2O1VA 2WEPA 2YIBA 4J11A 4AILC 1SQFA 1JPXA 1K4DC 1JM6A 1JFFB 2P4VA 2WI4A 1MABG 3TJTA 1URFA 5FLXN 3GVMA 1TH8A 3CCMV 2PUSA 4ZOLA 1Q81W 1EZVH 3T1HB 4BWAA 3KCYA 3KE6A 2ODMA 5ITZB 2JEXA 2RN9A 5DEDA 2UXNA 2HHIA 3VHCA 4RQFA 1XMOB 2IWSA 4TV9A 3C90A 4EGIA 1UY6A 3VQYA 5EYPA 4ASFA 3LSSA 2BOBC 4CC6A 3JCUZ 1I58A 3KCXA 3ZEDA 4DR5B 3ABKC 1XEQA 2NLJC 2FYPA 5JH7A 4GX0A 3K79A 4X1IA 4G28B 4J41A 2RJZA 2WI3A 3H1LH 3CMAV 4DR3O 3RYFB 4P7AA 3A0YA 1UYFA 2A0LA 1RPRA 1BL8A 3U0ZA 3G4SV 1TC0A 3HYYA 4J10A 1O9HA 5M4HA 4LF6B 1BT8A 4X1KA 4B3SO 2YGFA 3ZMVA 1UYDA 1F4MA 4MVQA 3A2FA 4GYCB 4U3FH 5A9GA 4QE7A 1Z2GA 1YC1A 3TXQA 3LMMA 4OXSA 1I94O 1F51A 1BGQA 4JI7O 3A0XA 3W7XA 3LUTB 4OGQB 4H0LB 3MNRP 3SPIA 3CRMA 4L91A 2W0FC 1I7FA 1KECA 3ETEA 1SESA 2ZBKB 4FCPA 5B1OA 2JS5A 4NXMO 4H13B 2DYRC 4MTOA 5KX5B 1PPJH 3SJBC 1YT1A 2Q7GA 3D3IA 5KMGB 3QNEA 4O4LA 3TTZA 4O4IA 4BQGA 2LFSA 4UV9A 4DR2O 2E5LB 2ZDXA 2ITDC 5HFMA 3LDEA 1O9GA 1WP7A 4EEQA 1W2BU 1SC5B 5B1BC 1VF6C 4UCOA 1SQQH 3JARA 4FLYA 2F43G 1ZL8A 4EFUA 1QNMA 5TISZ 3UO2A 2Q8GA 4KSHA 2CH7B 2WEQA 1XBLA 3RYCB 3J80N 1EA6A 2BU7A 2IORA 2CTQA 1MZEA 3P3PA 4RWUA 1AVMA 3ZJZA 1D2DA 3GIEA 1ZSPA 3HYZA 2FL4A 2QTSA 4MW8A 3L75H 2GUZA 1Q3EA 4JI1B 2BCCH 4LBEC 5LMNO 1N34B 4GX2A 2OCCB 5IDMA 5IWAO 2Q4PA 4FLZA 1LR1A 1S5LZ 1YIJV 2LW1A 1UYMA 1BCCH 1JVMA 3HHUA 1FXKA 1VQ9V 3EFFK 4LWGA 2D3OW 3W7WA 2Y48A 4Q20A 1JCHA 3SGIA 5F3KA 1H7UA 3CXHF 1YT2A 4JI2B 5D7RA 1XNRB 3F5WC 4DRXB 3L74H 4R3AA 1W59A 3BA8A 5JCOA 3C0EA 1NS1A 5J2UB 2DOSA 4B7KA 5CBGA 1Z59A 1KZNA 3K04A 4YY3O 3R65A 2QWQB 3D8CA 2VQEO 2YXYA 1GK9A 3DGEA 3B4SA 3K08A 1FD9A 4UVCA 3RW0A 5LA6A 1S72V 4TOIA 3T2MA 4KFMA 3QTFA 5LP6C 3VOUA 4DR4B 2HLDG 4TSFG 3ZX6A 2IJJA 2XJGA 3BABA 2X6CA 2EIMB 1YDXA 2YKCA 3RBZA 1N33B 2XT9A 3BA9A 3OGIB 2CH4A 2YE7A 4UCUA 1I5XA 3ZRXA 4X66B 4ZVIA 4R3MA 4HYPA 3K03A 1BE3H 2W0XA 3A0HZ 2CGFA 4FCRA 1RM1C 4I7ZB 2MW2B 2XDLA 4NKGB 3SYPA 3NR7A 1R6NA 4DXWA 1UY7A 1AI7A 3GWOA 4QJFB 5M4MA 4O4JB 2ZE5A 3SYQA 2YEAA 3JD2A 4NTYA 2HKOA 4JV5O 1N36B 4D6TH 5LOVB 2XJXA 3G80A 1CP9A 2GTSA 2RNBA 2IOPA 1P49A 4DO2A 1I0HA 4PDMA 2YEHA 5FNCA 1UYCA 2XNDG 4IIJB 3OMIB 2H8MA 2H55A 2XDSA 2XHTA 5LGTA 5LMUO 1GM8A 5GTHZ 3X2QB 4JI0B 2ZXWB 4FJCC 4YKYA 4PL9A 2EULA 2B1IA 2ITCC 2XJJA 4UVBA 2YDEA 2Z0AA 3RVZA 5CBHA 4NXNB 3VQWA 1VF7A 4DUYO 2UU9O 2UXCO 2YI5A 5C8YA 4DV1O 3JALB 3R4NA 3K9AA 1ZLZA 3HPLC 1V54B 1RPOA 3AG1B 1S77D 3JAKA 4FPPA 2XHRA 3MHSC 2XAQA 5CA1B 3B09A 5LBQA 1UYKA 4CWTA 1S5HC 5JJJB 3AG4B 3JATA 4K3AA 5J71A 4DV2O 1XDCA 1YI2V 3CRKA 4BR6A 1E79G 4DZYA 3OMNB 4FIPC 1EZJA 1M90W 3ABTA 4UCRA 2VRZA 4O04A 4Z2WA 3ZIAG 2P22C 3E35A 3T0ZA 4YKTA 2ZIOA 4P9OA 3OPDA 4H33A 1TAEA 2YEEA 3ZM7A 3QF7A 2DYSB 3MAQA 2AHYA 2NR5A 1BSMA 2Q8FA 3OE7G 4F6RA 3WHAA 4JASA 5KA6A 1XHZA 4B3MO 3E22A 3Q5KA 4LC1A 4GX1A 1K5QA 5EBWC 4IT5A 4ZHQA 2GHYA 2YEBA 1GN4A 1L0NH 1Z5AA 3INXA 4JYAB 5KHHA 2M7WA 3FT8A 2PTMA 2BU2A 4B08A 1R3LC 2ADQB 4W4KA 3APQA 2QTOA 3TETA 2CCUA 2Q67A 2BSKB 5LHHA 4RO2A 2ZR3A 1E1QG 2XHBA 1R73A 4BAYA 1OZ0A 1H2GA 4GKKO 1YJWV 1D5NA 4JI8B 3SJAC 1OSFA 3ZKBA 3K99A 4EKWA 3CCLV 3BHPA 4BIZA 2Q2EB 2P5OA 4PELA 3SPJA 3LDDA 5D5QA 4GQTA 4V26A 2QM7A 1Y6XA 2VCJA 2WPDG 4K8ZA 3RLQA 2V7QG 4O4HB 4GX5A 5LHGA 1AP5A 3OEHG 4LNUA 1M93A 2PY5A 3HB3B 3GIGB 3Q5JA 3DTUB 4DR7O 1VQPV 4HNAA 4PD4F 2P06A 1OCZB 5BY1A 2QA4V 4ZBMA 3CYOA 2FKXA 3QO7A 4CBCA 1SQVH 2EZOA 2F93B 4PV1B 2A79B 3ZRSA 4CE2A 2EBOA 1S5JA 2CTWA 2PNRA 1KIJA 4DV0B 2CUGA 5JENA 1I5DA 3SYAA 2GBOA 1TVKB 1ID0A 1DTOA 1KMIZ 4HYMA 2LP7A 2PI4A 3VADA 2IU3A 1OJHA 2RMKB 1VQNV 2YKEA 2ZDIC 2UUAB 1QHTA 2ZQMA 3MDSA 1KU9A 3UO3A 1HR0O 1PP9H 5JJNB 1K3EA 4AHCA 4FMTA 2CE4A 3OFNG 4NYKA 4PU9A 3SR2C 2YE3A 3DXRA 3SDLA 2OCCC 5GGZA 2CTRA 4LF4O 4MTFA 4FFBB 1K34A 4AI8A 2HG1A 3U11A 2P4KA 1EN4A 3OMAB 3CGZA 4GLXA 5FPOA 3O0IA 3ZXOA 1NHJA 2QE7G 1VIBA 5EIBD 2O1UA 1YC4A 3K3WA 2ZT9B 4Z1MG 2YEFA 4CH3A 4MVRA 2DMXA 5BODA 3SPHA 3CYGA 5CBFA 3HKEA 3ABMC 5BR8B 1X4TA 3CS5A 3ETGA 4FM0A 1HNZB 1BQZA 5FNDA 2OT5A 1NT2B 2EIMC 1R3IC 4L8ZA 2HVKC 2JKIA 2X7RB 3OR7C 2FXSA 1US7A 4MBCA 2A3QA 1TIDA 5CTYA 1QLEB 2PZSA 1Q8IA 1GJVA 2WI7A 2VQFO 1MNGA 2NN4A 4LFCO 1H2NA 1B04A 2YKBA 4NB5A 1VQ5V 2QWNB 1JJOA 1NJIW 2GFDA 2BU6A 2GSMB 5L3GA 4FLTA 2ZINA 1B6QA 3X2QC 4B7EA 3H4LA 4PI2A 2ZXWC 1Q82W 2B1GA 2X6AA 3ZN0A 4AWOA 4DV5O 1HP8A 3CPWU 2EIJC 2KG7A 5CF0A 4B3TO 4GUNA 4JI5B 2BTZA 4I9WA 4NTXA 4PRVA 4ASGA 4E01A 3CC2V 5C8YB 3C3SA 4L90A 2H3OA 3OTOO 2DN9A 2W6IG 1KUQA 3PN1A 1V54C 3AG3B 4KL1A 5IDJA 2O57A 1AR4A 3VQVA 3AG1C 3CMEV 3OWDA 1PKXA 2IH3C 3KG2A 3N2GA 3TZ4A 4JAUA 5CPHA 3AG4C 2UXBB 2XDUA 3HKCB 4WFHA 4MB9A 4LCUC 5KHKA 3K57A 4DUZO 1JR9A 4LFBB 3RWRD 5LXTB 2F4VO 3FB6C 1Y8OA 4X9QA 1KC8W 1R1BA 2QJ1A 4YHHB 3SPGA 2Q68A 5IJ9A 5CN0A 3M8AA 4HXZA 4EGHA 3P30A 4TV8B 3B24A 3NXSA 4HAMA 2Q8VA 4JAVA 1YT0A 3EKRA 2DWEC 2P7TC 1UFIA 3RT3C 2DYSC 4WUCA 1XL4A 2YC0A 3B40A 2VWKA 1JOYA 5JVDB 3IJ4A 3A0ZA 3BAAA 4AQYB 1IBMB 5DECA 4O2BA 5IYZA 4LWFA 5C93A 1Q90D 4CWRA 1XMQB 4GKJO 1Z5WA 1R6KA 4YKXA 1AROP 2VWCA 2YE9A 2YJWA 1V55B 3ZRWA 2ZIMA 2UUBO 2HHHO 1I5CA 1UYEA 2KSDA 3OR6C 4HY6A 1PL0A 4LWIA 4EM7A 4JI3B 1OCCB 1GH6A 3CJHA 4FFKA 1YZBA 1KKDA 2F23A 2UUCO 4O2AA 2Q0OC 2QKSA 3T1YB 1KP2A 5GONB 1Q6IA 3E86A 2EZPA 3ETQA 1Y4MA 2A06H 4HZ3A 5J2TA 2YGAA 5K1XA 4URNA 1NTKH 4KXRA 2YIDA 2WI2A 4H81A 3DC6A 3B77A 1DGSA 3J81N 1GKFA 1Y74B 3RYHA 4JPRA 2X0LA 3UT5A 1AH8A 1EFRG 4MVSA 2XDXA 4JYBA 3LNUA 3A0BZ 3WB1A 4YJ3A 3AK1A 4X65O 1BXDA 1ZWHA 4HZ0A 3ABLC 3FB7C 2AKPA 5LYJB 2IW5A 2QWRB 5EBMC 1OCZC 2WWWA 3EHJA 1YXBA 2QR4A 1FFXB 2BYIA 3WB2A 2ZNJA 1WB7A 2KQXA 3LPSA 2DJVA 5IN9A 4N21A 2Q73A 1SA0A 4EEHA 3D36C 3F7YC 1I59A 2EIKB 3JASB 2X6BA 2YXHA 1P4RA 2B9ZA 3TCUA 2OWOA 1E1RG 1AI5A 3JYCA 4LF8O 4G27B 1TILA 4QPKA 4YJ2A 2YK9A 1VMGA 4WFFA 1Y76A 4D7SA 1YSZA 2WSSG 1ZAUA 2XOKG 2BREA 2WLIB 3DC5A 2H8PC 2XDKA 2IH1C 1QVGU 4O05A 1J5EO 3WQ9A 2R9RB 3G6BA 4MS2A 4X64B 5DM6V 1QQCA 5KHGA 2E0AA 3T1CA 5KAIZ 4CS3A 1GKXA 3VHDA 3L70H 4MTGA 3P3NA 3UKMA 4RUEA 2YEVB 5JCOC 4IHJB 5IYDO 3AG2B 5EZYB 3F5TA 4I4TB 3ZXQA 3NMQA 3ZMUA 4LF7O 4K0KO 3JAWA 2JDIG 4JZ2A 4KSGA 1THNA 2Q8IA 1WA8B 3Q4HB 4TUYA 4LWSB 1HNXO 2XTAA 2BTOA 4UVAA 1S16A 2AHZA 4GEEA 3OGCC 5CB4B 1QCEA 1M56B 2JIZG 4DV4O 3CCRV 3EHGA 4LFAO 2BTQA 1ENVA 1GRJA 3CE2A 4XC0A 1COWG 4KFGA 1DF4A 3JZ3A 5B1NA 2IJHA 3JD0A 3AK2A 1MSWD 4X20B 4I50A 4X88A 1QLEC 3ZCCA 5BMVB 3RN4A 5LGUA 4JI6O
chains in the Genus database with same CATH topology
1VQKV 3K06A 4JASA 4JF3A 5KA6A 4LC1A 1DLBA 2ZDIA 4GX1A 1FXHA 1K5QA 5EBWC 4XDKA 1EBOA 2GHYA 2JJ1G 4MVZA 1WPXA 3W7TA 5LGNA 2M7WA 3ZN1A 1SETA 1NH2B 1NVPD 4PA4A 5E1AC 1THZA 1NBMG 5EBLC 5EC2C 2IJKA 1R3LC 4YXWG 2QTOA 4ASUG 3ABMB 3TETA 2Q67A 2LFRA 5LHHA 1PD3A 4WF9V 2B5UA 1S3JA 3JD4A 2ZR3A 4RO2A 1E1QG 5HFLA 4WFAV 1R73A 4BAYA 2EILB 1OZ0A 4QNHB 1H2GA 4R7CA 1YJWV 4MVMA 1JX9A 3STLC 2KB1A 1AJPA 4LP8A 1FXVA 4EKWA 3AG3C 3CCLV 4BIZA 2XAJA 1G4YB 4PELA 3P32A 3SPJA 3LDDA 1YSCA 2HR3A 2QM7A 2ATKC 2Y69B 3FB8C 3CCJV 2WPDG 2HJFC 1AJQA 3CCQV 2DQ3A 2V7QG 4GX5A 1AR1B 3RVYA 5LHGA 3W7UA 3B8NA 1NQTA 3WFVA 4F4LA 3G71V 1S76D 3OEHG 1F4NA 3CP1A 3HB3B 3DTUB 1YHQV 1VQPV 1LNQA 1OCOC 2QM8A 1P7BA 5B1AC 1MG1A 2WLKA 1M57B 3IC7A 4WFGA 1OCZB 4KUMA 2NNUA 4ZBMA 3CYOA 4XBFA 2QA4V 3CC4V 4J9ZB 3QO7A 1AI4A 2FTKA 4CBCA 1H38A 2ZR2A 2DWDC 3CCSV 4P30A 2EZOA 2A79B 3E83A 3ZRSA 1Q7YW 1VQ6V 2EBOA 1OCRB 2EJRA 5H9CA 1I5YA 1FXKC 3SYAA 4WFBV 3M99B 2EIJB 2JK5C 1DTOA 4U7OA 1H8EG 3WG7C 2LP7A 2V1DA 5J9PC 2PI4A 2IU3A 2JJ2G 3BY6A 1VQNV 2ZDIC 5H6QA 1RM1B 2ZQMA 1L1FA 3ETDA 2XAGA 5BZBA 3OEEG 3CXCU 1K73W 1V55C 3UM7A 1K3EA 1AJNA 4FMTA 3E8FA 5EC1C 4BW5A 3OFNG 1PNLA 1PNMA 1K92A 1OCCC 2WAMA 2HG5C 4JTAB 3B8MA 4PA7A 1VQOV 5FL7G 4WCEV 2OCCC 4E2LA 5B3SC 1NR7A 1WLEA 3E8GA 4TWKA 4RUFA 4MTFA 1QR9A 2XAHA 4MW3A 3K0GA 1K34A 4MSWC 3FYIB 3FB5C 4XDJA 3OMAB 4R8CA 4JTCB 3MHHC 4KP4A 2PI5A 3D36A 3CCEV 4PA9A 1GTOA 2EINC 2QE7G 3OW2U 3STZC 1GM9A 2C2AA 2DQ0A 2Q69A 3K3WA 1YJNV 1M1KW 2WLLB 1PNKA 3ASNB 1UJWB 4PA3A 1K33A 4Z1MG 4RAIA 2OTJV 4UUJC 4J9YB 1JPXA 1K4DC 2A9HA 4MVRA 1KP3A 2OTLV 3SPHA 1MABG 5CBFA 3ASOB 5EK0A 3ABMC 1J95A 3LSQA 2P90A 3CCMV 3ETGA 1BMFG 3ZRVA 1Q81W 1QVFU 2WLHA 2OT5A 1W0JG 3OUFA 2EILC 4PDLA 2JEXA 2UXNA 4MT8A 4BIUA 2EIMC 1R3IC 4RQFA 4MVOA 2HVKC 4HYOA 2BOCC 2X7RB 3JD3A 1ROPA 2EIKC 4R50A 3OR7C 3LSSA 2WLLA 2BOBC 3SYOA 4PA6A 4MVUA 1R3JC 3E2EA 1QLEB 1K8AW 3ABKC 2NLJC 3K0DA 4GX0A 4X89A 3K79A 3JD1A 2JEUA 4GCZA 2CK3G 5GW7A 4G28B 1Y66A 1YTFD 1VQ5V 3CMAV 3AEIA 3G6EV 1NJIW 2WLNA 2GSMB 2A0LA 1RPRA 1BL8A 2DW4A 5L3GA 3G4SV 5L3EA 2Z3YA 1B6QA 1NR1A 2H94A 3ZMVA 3X2QC 4QIWF 3FKSG 1F4MA 2ZXWC 3QO8A 1Q82W 2B1GA 2X6AA 4H37A 4MVQA 3ZN0A 3ABLB 3VBBA 3JCZA 3CPWU 2EIJC 4QE7A 3OAAG 4OXSA 1F51A 4I9WA 1GM7A 3SJQC 3CC2V 1SRYA 3W7XA 3LUTB 3SPIA 2W6IG 3IGAC 1K97A 3AG2C 3LNMB 2W0FC 1V54C 3AG3B 5IDJA 1KECA 4FK5C 3ETEA 3AG1C 3CMEV 1SESA 1FFTB 3F7VC 1PKXA 1QR8A 2IH3C 3KG2A 5B1OA 1K5SA 3QO5A 4JAUA 1SZTA 3AG4C 2DYRC 5CA3A 4MTOA 4WFHA 4LCUC 1H8HG 3D3IA 3QNEA 3FYEB 4GT1A 2LFSA 2XAFA 3ZRWB 1N8RW 1ZWIC 3FB6C 4UV9A 1ORQC 1KC8W 3I55V 1JQ0A 2ITDC 1OCOB 1M56C 5HFMA 1MOFA 3SPGA 3LDEA 2Q68A 3A0RA 4RQEA 1W2BU 3MD0A 3E89A 5B1BC 5CN0A 5DN6G 3P30A 2W6JG 3NXSA 4HAMA 2F43G 4JAVA 3ASNC 1NVPB 2DWEC 2P7TC 2DYSC 1FXKB 1XL4A 4TT3G 1JOYA 3T4ZA 1FS0G 4ZKIA 2IJIA 3WG7B 5IY5B 5C93A 1R6KA 3ZJZA 5L3CA 1AROP 4MTXA 5CMUA 1GO3F 4MW8A 1HWYA 1V55B 3ZRWA 4QPJA 1TUEB 3LDCA 4UV8A 3OR6C 1PL0A 1OCCB 4LBEC 3E8HA 2UXXA 4GX2A 2OCCB 5B3SB 2K1EA 1G8MA 1KKDA 2MK3A 2HFEC 2QKSA 1YIJV 1JVMA 1FXKA 1KP2A 1YITV 1VQ9V 3EFFK 3E86A 2EZPA 2D3OW 3W7WA 2Y48A 1Y4MA 1JCHA 4HZ3A 4Q20A 2EINB 1CPYA 5L3DA 3F5WC 4PDRA 1QBZA 2IU0A 5KA5A 3CD6V 2Y69C 3B77A 5CBGA 3K04A 1GKFA 2WLJA 3R65A 3SYCA 3ZMSA 4JPRA 2X0LA 4P2ZA 3GB7C 4U7NA 3T4DA 1EFRG 2ZD9A 1GK9A 4MVSA 4JYBA 3DGEA 4WFEA 3K08A 3W7SA 1M9NA 4UVCA 3RW0A 2P67A 1S72V 3ABLC 3FB7C 3T2MA 1VQLV 4KFMA 2IW5A 3VOUA 1M57C 5EBMC 1OCZC 2WWWA 2HLDG 4TSFG 3TK1A 1OHHG 5KUKA 2IJJA 4N21A 4I5SA 2X6CA 1OCRC 2EIMB 3RBZA 1R3KC 1I5XA 1DF5A 1K4CC 3F7YC 2EIKB 3ZRXA 4UXNA 4N23A 1Q86W 2X6BA 2P6JA 4PDVA 5H6RA 1P4RA 3K03A 3TCUA 3PJSK 1E1RG 1AI5A 1RM1C 3JYCA 3SYPA 3ABKB 3OUSA 4G27B 1NH2D 3CCUV 1R6NA 4QPKA 1NKDA 4DXWA 3CCVV 1AI7A 3GWOA 4QJFB 4WFFA 3SYQA 2Q6AA 1VQ4V 3JD2A 2HKOA 4G2KA 2WSSG 3ZMZA 4XDLA 1CP9A 4P9PA 2WLMA 1VQ8V 2XOKG 1S0VA 4DO2A 3IFXA 2WLIB 4PDMA 3CC7V 1KQSU 2XNDG 2H8PC 3OMIB 1GMGA 4JTDB 2IH1C 3ABUA 1QVGU 5IYCO 5LGTA 1GM8A 4X8AA 3X2QB 1QLNA 2R9RB 4MS2A 2ZXWB 4FJCC 1F23A 5DM6V 1VQ7V 3T1CA 1BHAA 5B1AB 2B1IA 2ITCC 1W0KG 5L3FA 4UVBA 1K9MW 3RVZA 4MTGA 5CBHA 3UKMA 4RUEA 5IY5C 1K7DA 2YEVB 5KUMA 4R6ZA 3EHBB 3K9AA 3ZMTA 5LHIA 5IYDO 1BHBA 2YSUB 3AG2B 3HPLC 1V54B 1SERA 2Z5UA 1RPOA 3AG1B 4JGSA 1S77D 2QEXV 4FPPA 3ZMUA 3MHSC 2XAQA 5LBQA 1S5HC 3AG4B 2DYRB 3ASOC 2JDIG 1XL6A 2WLIA 1CEZA 4L87A 3BEHA 1IXMA 1YI2V 1KD1W 4UVAA 2AHZA 3OM3B 2HVJC 3OGCC 1AI6A 1E79G 3ML0A 3OMNB 1QCEA 2R9IA 4FIPC 1EZJA 1M90W 3ABTA 4QE9A 4CZZA 5IYBO 1M56B 4JYCA 2JIZG 1YJ9V 3E8BA 3I56V 3CCRV 1YTFB 3ZIAG 1ENVA 3SPCA 3E35A 2XASA 1COWG 5B1BB 1DF4A 4P9OA 5B1NA 2IJHA 2YEVA 3JD0A 4H33A 3H01A 1MSWD 4X88A 2DYSB 2AHYA 1QLEC 3ZCCA 1VQMV 5LGUA 5L3BA 1JJ2U 3OE7G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JAS A;  5B1O A;  3NXS A;  4QPJ A;  4I5S A;  4JAV A;  4JAU A;  4LC1 A;  4JYC A;  2QM8 A;  4KP4 A;  3D36 A;  1JOY A;  4U7N A;  4BIZ A;  4GT1 A;  3ZRX A;  3ZRV A;  4ZKI A;  3P32 A;  2FTK A;  2LFS A;  4JYB A;  2C2A A;  4GCZ A;  5B1N A;  4FPP A;  1F51 A;  3ZRW B;  3DGE A;  4FMT A;  5C93 A;  2QM7 A;  4MT8 A;  2P67 A;  4BIU A;  3ZCC A;  4MTX A;  1IXM A;  2LFR A;  4Q20 A;  5IDJ A;  3A0R A;  2WWW A;  4QPK A;  3MD0 A;  3TK1 A;  3ZRW A;  4U7O A; 
#chains in the Genus database with same CATH topology
 1VQK V;  3CB2 A;  4DR3 B;  3L72 H;  1N0N A;  1GAX A;  3OW6 A;  2YE6 A;  3G7B A;  2GDS A;  1FXH A;  2YEJ A;  4XDK A;  1EBO A;  4ZI7 A;  1FPO A;  1RP3 B;  3O6O A;  1WPX A;  3U67 A;  1PL4 A;  5LGN A;  4B3S B;  1SET A;  1XI1 A;  1NVP D;  5E1A C;  1THZ A;  2EX3 A;  1IBL O;  1A4H A;  4YXW G;  4DV7 O;  1XQ8 A;  4L94 A;  3ABM B;  3R4O A;  4XTJ A;  1I94 B;  4WF9 V;  4JI7 B;  1VF6 A;  1S3J A;  3JD4 A;  2ZE6 A;  2XX5 A;  5BOC A;  4CWN A;  1R6T A;  2ZE7 A;  5HFL A;  5D6P A;  4KHP O;  3TUH A;  4QNH B;  2IOQ A;  3N2K A;  3STL C;  4YKR A;  3HKD A;  4JI4 O;  3AG3 C;  3O2F A;  4YKU A;  2CTP A;  1G4Y B;  4NXM B;  3N2G B;  1YSC A;  2HR3 A;  1UYG A;  2ATK C;  2Y69 B;  1Z5C A;  4JZG A;  4X62 O;  5FNV A;  4IYI A;  3BRC A;  3A0T A;  3TGU H;  4NH8 A;  3G71 V;  4DR2 B;  4F4L A;  4UB6 Z;  1S76 D;  1Y67 A;  1I5B A;  4O07 A;  2QGN A;  3FAV A;  1YHQ V;  3H1H H;  3ZHQ A;  1P7B A;  5B1A C;  1MG1 A;  2R72 A;  2CGO A;  3R66 A;  2UXD O;  4XBF A;  2XX2 A;  1MMM A;  1AI4 A;  2FTK A;  2OIG A;  3CCS V;  2YE4 A;  2JRI A;  1VQ6 V;  4CWP A;  1I5Y A;  1N32 O;  2C1I A;  5CA0 B;  5AG2 A;  4AWQ A;  4WFB V;  2EIJ B;  2JK5 C;  4JAA A;  4HZ5 A;  4U7O A;  2ZM6 O;  1H8E G;  4I55 B;  5J9P C;  3CX5 F;  4Q6G A;  4DR6 O;  5D5P A;  2XAG A;  5BZB A;  1RFY A;  4B3R O;  1NHH A;  3OEE G;  1V55 C;  1AR5 A;  3UM7 A;  3R4M A;  4MOT A;  4J7J A;  1Q5O A;  5LMN B;  1OCC C;  5IWA B;  1RSO A;  1V9P A;  1YET A;  1VQO V;  4B7P A;  3CJH B;  4WCE V;  2WER A;  4CWQ A;  2YJX A;  2GV9 A;  4TWK A;  2BZ5 A;  4ZOL B;  1Q43 A;  4MW3 A;  4MPC A;  1WJZ A;  1US6 A;  1U0Z A;  4ZIB A;  4URL A;  4JTC B;  4FZ0 A;  4U3J A;  3CCE V;  4PA9 A;  3SL2 A;  5KAF Z;  4BQJ A;  3TZ2 A;  4YKZ A;  3RLP A;  3OW2 U;  1IUR A;  3QG5 A;  4TV9 B;  4OX9 O;  3BFR A;  2Q69 A;  1YJN V;  3D0B A;  4YY3 B;  5EYP B;  4TQD A;  2JGD A;  4PA3 A;  1I5A A;  2FWZ A;  2YUA A;  1M4U A;  4RAI A;  2VQE B;  2QDO A;  1AJ6 A;  4UUJ C;  3HKB A;  5JH7 B;  4X1I B;  1BZK A;  4R1F A;  3ASO B;  5EK0 A;  2ARH A;  1UPG A;  3GWK C;  4WBN A;  2YIA A;  1WN7 A;  2P90 A;  2ADP A;  5B66 Z;  4K8X A;  3RYI A;  5K1P A;  3OMU A;  1H7S A;  2JS3 A;  4X1K B;  4PDL A;  4MT8 A;  4BIU A;  4LF5 O;  4MVO A;  4HYO A;  2Q7E A;  4MPE A;  1ROP A;  5CTU A;  2EIK C;  3K97 A;  1UYL A;  5CTX A;  3L71 H;  3CHX A;  4CH6 A;  2XX4 A;  2LJ2 A;  4NR1 A;  2VS0 A;  2WLL A;  1L0O A;  3SYO A;  4BAE A;  4MVU A;  5FPR A;  3E2E A;  2YI6 A;  2ZE8 A;  4AWP A;  2AZ0 A;  1JFF A;  3I5D A;  4YJ2 B;  3AK3 A;  4JV5 B;  3OT7 A;  4YKW A;  1Y76 B;  2JEU A;  2CK3 G;  4EFE A;  1FJG O;  1QYE A;  1YTF D;  5EIB C;  1MSD A;  3AEI A;  4C7U A;  3G6E V;  2WLN A;  2CG9 A;  2IWU A;  5IJ0 A;  5LMU B;  1JA8 A;  3JSL A;  2BRC A;  4O4L B;  5L3E A;  2Z3Y A;  4O4I B;  1HNW O;  1NR1 A;  5ITZ A;  4WUD A;  3QO8 A;  5IE9 A;  4H37 A;  3D2R A;  3ABL B;  4BW9 A;  1GKZ A;  4DUY B;  2HCH A;  4LWE A;  2UU9 B;  2UXC B;  4CH4 A;  4DV1 B;  4XIP A;  3JAR B;  2F1M A;  4DV3 O;  1SRY A;  3HZ5 A;  4OPA A;  1ZL8 B;  2YXL A;  3AG2 C;  1XRE A;  4FK5 C;  1NI8 A;  1K5S A;  4K35 A;  4KQV A;  1IBK O;  4O09 A;  4DV2 B;  3RYF A;  3ZBH A;  1AM1 A;  4EFB A;  3H1I H;  4LF9 O;  4XKA A;  4GT1 A;  3G7E A;  2XAF A;  3KZI Z;  1N8R W;  4H44 B;  2F66 C;  1ORQ C;  3O9O A;  2GUZ B;  3I55 V;  4URO A;  3T0H A;  1JQ0 A;  3CWV A;  4DV6 O;  1X59 A;  2YK2 A;  1OCO B;  3R4P A;  1M56 C;  4AS9 A;  1MOF A;  3RKZ A;  4XE2 A;  1WNS A;  5GTI Z;  2BTQ B;  3A0R A;  4RQE A;  5D7D A;  3MD0 A;  3E89 A;  2BT0 A;  2N74 A;  5DN6 G;  3TXS A;  4YIO A;  3ASN C;  1NVP B;  1FXK B;  4B3M B;  1B06 A;  2IJI A;  5KX5 A;  3BMY A;  5L3C A;  1OV9 A;  4MTX A;  5KMG A;  1GO3 F;  1N4C A;  1HWY A;  4ASA A;  2BU5 A;  1IVS A;  4E00 A;  4NTW A;  1TUE B;  3LDC A;  5LA6 B;  1XNQ O;  5B5E Z;  2UXX A;  1YSR A;  5B3S B;  1EN6 A;  1KKC A;  2K1E A;  2CAZ C;  4J42 A;  5BXZ A;  1QY8 A;  3BVO A;  4GKK B;  2G38 A;  3EVK A;  2Q7H A;  1H2M A;  2CH7 A;  1YIT V;  3N27 A;  4CWF A;  3ZHS A;  4OPH A;  3RYC A;  3K59 A;  5L3D A;  2FML A;  2IU0 A;  2GTA A;  1SQX H;  5KA5 A;  2Y69 C;  5FNV B;  4ICG A;  4MP2 A;  3ZMS A;  2LQT A;  1HNW B;  3GB7 C;  1I08 A;  3EHF A;  4DYL A;  5F5R A;  4U7N A;  4DR7 B;  2HP8 A;  4GZR B;  4WFE A;  3K9S A;  2P67 A;  1VQL V;  1UY9 A;  3SJC C;  3TK1 A;  1OHH G;  2JGU A;  4NH9 A;  3ZS8 C;  4D7T A;  2BYH A;  4I5S A;  4F6E A;  3T1H O;  2AW9 A;  1R3K C;  1K4C C;  1XMO O;  4DRX A;  2E74 B;  2P6J A;  5J2U A;  3T2S A;  3PJS K;  3K98 A;  1HR0 B;  4BXI A;  4EFT A;  3OUS A;  4DR5 O;  1GN6 A;  2IBZ H;  2LO1 A;  3OD4 A;  2GQP A;  2Q0A A;  2HEP A;  1VQ4 V;  3JAK B;  3B25 A;  4G2K A;  1SQP H;  1Z5V A;  2ZKJ A;  4XDL A;  2LGW A;  1Y8N A;  1UY8 A;  2WLM A;  1VQ8 V;  3JAT B;  1S0V A;  3IFX A;  4LF4 B;  3CC7 V;  1KQS U;  4JTD B;  1GMG A;  3ABU A;  5IYC O;  4XCJ A;  4X8A A;  1G6U A;  1QLN A;  2FWY A;  4XKK A;  4LF6 O;  2QF6 A;  4W7T A;  1BHA A;  4U93 A;  3CSX A;  5B1A B;  1WPB A;  5L3F A;  2A7W A;  1K9M W;  5FWK A;  5IY5 C;  4FLW A;  1BQ0 A;  2XCM A;  4R6Z A;  3EHB B;  5LHI A;  3ZMT A;  4FLV A;  3CRQ A;  3H1K H;  3B27 A;  1P84 F;  1U2O A;  1SER A;  2Z5U A;  2JJC A;  4O4J A;  4JGS A;  2QEX V;  4F6R B;  3BM9 A;  5CTW A;  2Y4T A;  5LOV A;  4LP0 A;  3E22 B;  3ASO C;  3H1J H;  2LW7 A;  1Y4U A;  4ZHQ B;  1CEZ A;  4L87 A;  3BEH A;  4IIJ A;  3RYI B;  4J7K A;  1P7G A;  4W4L A;  3IC9 A;  2HVJ C;  3VQX A;  3K5N A;  2R9I A;  1MX0 A;  2BE3 A;  3T1K A;  5IYB O;  2E5L O;  4JYC A;  2E76 B;  4FLU A;  1YJ9 V;  3E8B A;  1YTF B;  3PEH A;  2Q9L A;  2O1W A;  2LGQ A;  3S3X A;  4HXW A;  1WAZ A;  4NH7 A;  2YIB D;  2ZDY A;  1VQM V;  5LL6 Y;  1SS3 A;  2VQF B;  4LFC B;  1JJ2 U;  4P8O A;  2Y0I A;  3CRR A;  2IM9 A;  5CA1 A;  3K06 A;  4JF3 A;  1DLB A;  1VEW A;  5FNF A;  2XAB A;  4KTN A;  4XDM A;  4CE3 A;  5IJ0 B;  1AIL A;  2JJ1 G;  4MVZ A;  2YIC A;  1Y4S A;  3W7T A;  1NH2 B;  4X9L A;  4LNU B;  5EBL C;  3IED A;  5EC2 C;  1PVG A;  4DV5 B;  4HNA B;  1FYJ A;  4ASU G;  4B3T B;  4DUH A;  1SQB H;  2LFR A;  4JI1 O;  2B5U A;  1N34 O;  3ZHU A;  3CEI A;  3OTO B;  3CRC A;  3H80 A;  4XKO A;  4R7C A;  4MVM A;  3WB0 A;  2XK2 A;  5IT9 N;  2R9A A;  4LP8 A;  5A2Q N;  2XAJ A;  3P32 A;  4L8J A;  1Q6U A;  4JI2 O;  3G75 A;  1XNR O;  3FB8 C;  3CCJ V;  4DUZ B;  1JMK C;  1PM9 A;  5H5N A;  2E3C A;  2DQ3 A;  3CCQ V;  1YC3 A;  2F4V B;  1AR1 B;  3RVY A;  3OTF A;  3B8N A;  1NQT A;  3WFV A;  1WB8 A;  3BPZ A;  4X1Y A;  1F4N A;  1SF9 A;  4DK1 A;  3CP1 A;  1XIL A;  1LNQ A;  1OCO C;  2BSK A;  4DW1 A;  1M57 B;  3IC7 A;  4B6C A;  4WFG A;  3DXR B;  4PHZ A;  4HY1 A;  4DR4 O;  2ZR2 A;  4E02 A;  1PV0 A;  5H9C A;  1OCR B;  4JYY A;  1VF5 B;  2QG2 A;  4YIP A;  1FXK C;  1EN5 A;  3M99 B;  4UCT A;  1N33 O;  1ZTE A;  4GKJ B;  3ZHR A;  2BU8 A;  4X66 O;  3R92 A;  2JJ2 G;  3BY6 A;  5H6Q A;  2K5B A;  1L1F A;  4O4H A;  1B3Q A;  2UUB B;  2HHH B;  4I0X A;  3CXC U;  1K73 W;  2WI6 A;  4TQF A;  1AJN A;  3GIG A;  2PF4 E;  3E8F A;  1PNM A;  2ILM A;  3HKE B;  1N36 O;  2YED A;  2WAM A;  2UUC B;  1VAR A;  4JTA B;  3B8M A;  4PA7 A;  5FL7 G;  5B3S C;  4E2L A;  4LH6 A;  2ZKO A;  3E8G A;  4RUF A;  1QR9 A;  4NVP A;  2XAH A;  4MSW C;  3FYI B;  3FB5 C;  4URM A;  1TBW A;  4O0B A;  3R91 A;  4XD8 A;  3MHH C;  3D36 A;  4JI0 O;  1TVK A;  3DSQ A;  4XIR A;  1GM9 A;  2DQ0 A;  3HEK A;  1M1K W;  2XUM A;  1DK1 A;  4NXN O;  1KYO F;  1UJW B;  3ASN B;  1XUQ A;  4LR3 A;  2OTJ V;  4J9Y B;  2YGE A;  2A9H A;  3FV5 A;  1N0J A;  1KP3 A;  2WI5 A;  2CCS A;  2OTL V;  4X65 B;  1ZW9 A;  4EMV A;  1J95 A;  1NTM H;  1QU7 A;  3LSQ A;  1FAF A;  4L93 A;  1BMF G;  3ZRV A;  1QVF U;  4FFB A;  2WLH A;  1TUB A;  3CGY A;  1W0J G;  2QM4 A;  3OUF A;  2EIL C;  4E4E A;  5M4K A;  2AGA A;  1L8D A;  2BOC C;  3JD3 A;  1HDJ A;  2KG7 B;  2QWO B;  4R50 A;  4UB8 Z;  1NTZ H;  1NU1 H;  4LF8 B;  4PA6 A;  1R3J C;  2HKJ A;  1K8A W;  1U96 A;  3K0D A;  1YER A;  2N04 A;  2UWD A;  4X89 A;  2YE5 A;  3JD1 A;  4GCZ A;  1BKN A;  5GW7 A;  3QTC A;  1Y66 A;  4UCS A;  4FM1 A;  4XIT A;  4GFN A;  3C3T A;  2D2C B;  2DW4 A;  3THO A;  1J5E B;  4HBN A;  1BYQ A;  2QKC A;  4JYA O;  2IWX A;  2H94 A;  4QIW F;  3APO A;  3FKS G;  2Y0P A;  3EXA A;  2EJ7 A;  3VBB A;  4ASB A;  2VWJ A;  3JCZ A;  4DR1 O;  1EI1 A;  1BGY H;  5IJ9 B;  3OAA G;  1ZXM A;  3D3Q A;  1GM7 A;  3SJQ C;  2PYJ A;  1L0L H;  1VP7 A;  2DE0 X;  2VCI A;  2PGG A;  4ABM A;  3IGA C;  1K97 A;  3O65 A;  3LNM B;  4JI8 O;  2RQ6 A;  3BCC H;  4LF7 B;  4K0K B;  1FFT B;  3F7V C;  1QR8 A;  4O2B B;  3QO5 A;  5IYZ B;  3LNN A;  2OIE A;  1SZT A;  5CA3 A;  1HNX B;  3JSN A;  1H8H G;  4GGL A;  3FYE B;  5M4P A;  2AXT Z;  3ZRW B;  1ZWI C;  4DV4 B;  5JQG A;  4H7Q A;  4LFA B;  3FX7 A;  5LP6 A;  3HZ1 A;  2YI9 A;  3K5O A;  3ZHV A;  4IL6 Z;  3ZHT A;  1EM1 A;  1ZX3 A;  1G1X B;  3OWB A;  4O2A B;  2W6J G;  4A5U B;  2AZ2 A;  1YEW A;  3RGB A;  1IX9 A;  4J80 A;  2RCV A;  4TT3 G;  2E75 B;  4JI6 B;  1TC6 A;  5L3J A;  4QGP A;  1UYI A;  3T4Z A;  5J2T B;  4DV0 O;  1FS0 G;  2Q8H A;  4ZKI A;  3S5T A;  3WG7 B;  4PJ0 Z;  5IY5 B;  1LUV A;  4XCL A;  2QSA A;  3FD9 A;  3HKC A;  3RYH B;  2UUA O;  5CMU A;  3L73 H;  1QZR A;  3K5L A;  5D7C A;  5LXT A;  3UT5 B;  2JVD A;  1GN2 A;  1IBL B;  1TA8 A;  5KHJ A;  4CWS A;  4QPJ A;  4DV7 B;  3GIF A;  5M4N A;  3K58 A;  4UV8 A;  2Q5Z A;  4YJ3 B;  2YKJ A;  3HR0 A;  5H2F Z;  3E8H A;  4CE1 A;  5JJE B;  2WA4 A;  1G8M A;  3M7M X;  2MK3 A;  1D5A A;  3UQ8 A;  4KHP B;  2BSM A;  4TV8 A;  2HFE C;  2HJD A;  3TZ5 A;  3CRL A;  4JI4 B;  2F95 B;  1F7Y A;  2EXL A;  5JVD A;  1SA0 B;  2ZCE A;  5KLV H;  3QDD A;  2EIN B;  3A0W A;  3FT5 A;  1CPY A;  4FLX A;  4PDR A;  2QG0 A;  4EB6 A;  1QBZ A;  4X62 B;  4K4O A;  3G67 A;  2YI7 A;  3CD6 V;  2YEI A;  1S14 A;  3A8T A;  2ETN A;  2FB5 A;  2WLJ A;  3SYC A;  1H2L A;  2ZNI A;  1LUW A;  1HW7 A;  4P2Z A;  3T4D A;  2ZD9 A;  4X1Y B;  4GT8 A;  4DR1 B;  3W7S A;  1M9N A;  1YES A;  4FVM A;  4FZ1 A;  2UXD B;  3H9V A;  1M57 C;  1YF2 A;  4E72 A;  2YEG A;  4YKQ A;  2YE8 A;  5BR8 O;  3EKO A;  1XHX A;  5KUK A;  1HNZ O;  1N32 B;  1UYH A;  1OCR C;  4CS2 A;  2OCH A;  5GON A;  2XHX A;  2YS8 A;  3IAY A;  1GN3 A;  2ZM6 B;  1DF5 A;  4UFZ A;  4UXN A;  4N23 A;  1Q86 W;  4DR6 B;  4FCQ A;  5H6R A;  4PDV A;  1FKA O;  3ZKD A;  4PI0 A;  2PYL A;  4B3R B;  1Y74 A;  1Q6H A;  3ABK B;  1NH2 D;  3CCU V;  1NKD A;  3AG7 A;  2CCT A;  3CCV V;  4I0X B;  4BIO A;  2Q6A A;  1TGO A;  3RLR A;  3B2E E;  3ZMZ A;  4CC5 A;  3WU2 Z;  3JAW B;  4P9P A;  5LYJ A;  3L9D A;  2YKI A;  1FFX A;  4TUY B;  2N05 A;  1YVW A;  1U97 A;  3K5M A;  4XIQ A;  3FFQ A;  1F23 A;  1VQ7 V;  1YS3 A;  4LH7 A;  4OX9 B;  1W0K G;  3JAS A;  1MU5 A;  4CS4 A;  1AH6 A;  1YCI A;  1BS3 A;  1K7D A;  4JI5 O;  5F2V O;  4MPN A;  5KUM A;  1IXB A;  4I50 B;  1BHB A;  2YSU B;  2RDC A;  3C11 A;  3QVN A;  2WA3 A;  2OYQ A;  3CRA A;  1T5E A;  2QFO A;  2XD6 A;  2DYR B;  1XL6 A;  2WLI A;  2UXB O;  4ZI7 B;  1IXM A;  4MP7 A;  2M6Y A;  1KD1 W;  3OM3 B;  1TUB B;  3JAM N;  4DW0 A;  1AI6 A;  4LF5 B;  3ML0 A;  4LFB O;  3U2K A;  1ZUQ A;  4QE9 A;  4CZZ A;  1CXZ B;  3I56 V;  4YHH O;  3SPC A;  1MA1 A;  2XAS A;  5B1B B;  4LPB A;  2YEV A;  2KKW A;  3H01 A;  4I9Q A;  4IHJ A;  2CGN A;  3TZ0 A;  3N2K B;  1XOU A;  5EZY A;  3HKD B;  4I4T A;  1FJG B;  5L3B A;  3U10 A;  3UCS C;  5J6A A;  4AQY O;  1IBM O;  2ZDI A;  2VW5 A;  1WA8 A;  3Q4H A;  1XMQ O;  4LWS A;  3ZN1 A;  4PA4 A;  1IZ3 A;  5CB4 A;  1WP8 A;  2CDY A;  1NBM G;  5D6Q A;  2IJK A;  3FAV B;  3PEJ A;  1PD3 A;  4JI3 O;  4DV3 B;  4WFA V;  1Z5B A;  4X20 A;  4V25 A;  4UCV A;  2EIL B;  1R62 A;  1JX9 A;  3INW A;  2KB1 A;  1AJP A;  1FXV A;  5BMV A;  3T1Y O;  1NZ6 A;  3Q5L A;  4Z1V A;  1A32 A;  2R70 A;  1IBK B;  2L6L A;  2YE2 A;  2L35 A;  4LF9 B;  4H85 A;  5KHI A;  1SZX A;  1AJQ A;  2HJF C;  5E79 Z;  4DK0 A;  3W7U A;  4DV6 B;  5JQG B;  2ESA A;  2QM8 A;  5LP6 B;  2WLK A;  4PRX A;  1RSO B;  5JWP A;  4KUM A;  2NNU A;  3CC4 V;  4I3H A;  2YI0 A;  4J9Z B;  1H38 A;  2DWD C;  4P30 A;  1Q7Y W;  3E83 A;  2EJR A;  1Y8P A;  2WI1 A;  4U3J B;  1AP6 A;  2QKA A;  1KB9 F;  3WG7 C;  1KBH A;  2V4D A;  2V1D A;  4EGK A;  1H2S B;  2YEC A;  1RM1 B;  2JGD B;  3ICX A;  3RFR A;  3ETD A;  2QWP B;  2C1G A;  3B26 A;  3U2D A;  3VHA A;  4IYH A;  1M5I A;  3HKB B;  4CWO A;  1NHI A;  3K60 A;  1AB3 A;  5EC1 C;  1XNQ B;  4BW5 A;  1SQG A;  1PNL A;  2Y4U A;  1MZF A;  1K92 A;  2FYU H;  2HG5 C;  4WBN B;  1NR7 A;  4IGG A;  4CH5 A;  2K9P A;  3B28 A;  1H2K A;  1WLE A;  1ZXN A;  4FM2 A;  3K0G A;  1IDS A;  4XDJ A;  4R8C A;  4WUB A;  2YI8 A;  3EHH A;  5M4E A;  4KP4 A;  3KKY A;  5CA0 A;  1SKV A;  2PI5 A;  1GTO A;  4X64 O;  2EIN C;  3LSU A;  4LWH A;  4I55 A;  3STZ C;  2C2A A;  4EB6 B;  3CWB H;  3S3W A;  1B63 A;  4JQL A;  4J7Z A;  3T10 A;  3JAL A;  2WLL B;  1PNK A;  3J7A U;  1AMW A;  1B62 A;  1K33 A;  2O1V A;  2WEP A;  2YIB A;  4J11 A;  4AIL C;  1SQF A;  1JPX A;  1K4D C;  1JM6 A;  1JFF B;  2P4V A;  2WI4 A;  1MAB G;  3TJT A;  1URF A;  5FLX N;  3GVM A;  1TH8 A;  3CCM V;  2PUS A;  4ZOL A;  1Q81 W;  1EZV H;  3T1H B;  4BWA A;  3KCY A;  3KE6 A;  2ODM A;  5ITZ B;  2JEX A;  2RN9 A;  5DED A;  2UXN A;  2HHI A;  3VHC A;  4RQF A;  1XMO B;  2IWS A;  4TV9 A;  3C90 A;  4EGI A;  1UY6 A;  3VQY A;  5EYP A;  4ASF A;  3LSS A;  2BOB C;  4CC6 A;  3JCU Z;  1I58 A;  3KCX A;  3ZED A;  4DR5 B;  3ABK C;  1XEQ A;  2NLJ C;  2FYP A;  5JH7 A;  4GX0 A;  3K79 A;  4X1I A;  4G28 B;  4J41 A;  2RJZ A;  2WI3 A;  3H1L H;  3CMA V;  4DR3 O;  3RYF B;  4P7A A;  3A0Y A;  1UYF A;  2A0L A;  1RPR A;  1BL8 A;  3U0Z A;  3G4S V;  1TC0 A;  3HYY A;  4J10 A;  1O9H A;  5M4H A;  4LF6 B;  1BT8 A;  4X1K A;  4B3S O;  2YGF A;  3ZMV A;  1UYD A;  1F4M A;  4MVQ A;  3A2F A;  4GYC B;  4U3F H;  5A9G A;  4QE7 A;  1Z2G A;  1YC1 A;  3TXQ A;  3LMM A;  4OXS A;  1I94 O;  1F51 A;  1BGQ A;  4JI7 O;  3A0X A;  3W7X A;  3LUT B;  4OGQ B;  4H0L B;  3MNR P;  3SPI A;  3CRM A;  4L91 A;  2W0F C;  1I7F A;  1KEC A;  3ETE A;  1SES A;  2ZBK B;  4FCP A;  5B1O A;  2JS5 A;  4NXM O;  4H13 B;  2DYR C;  4MTO A;  5KX5 B;  1PPJ H;  3SJB C;  1YT1 A;  2Q7G A;  3D3I A;  5KMG B;  3QNE A;  4O4L A;  3TTZ A;  4O4I A;  4BQG A;  2LFS A;  4UV9 A;  4DR2 O;  2E5L B;  2ZDX A;  2ITD C;  5HFM A;  3LDE A;  1O9G A;  1WP7 A;  4EEQ A;  1W2B U;  1SC5 B;  5B1B C;  1VF6 C;  4UCO A;  1SQQ H;  3JAR A;  4FLY A;  2F43 G;  1ZL8 A;  4EFU A;  1QNM A;  5TIS Z;  3UO2 A;  2Q8G A;  4KSH A;  2CH7 B;  2WEQ A;  1XBL A;  3RYC B;  3J80 N;  1EA6 A;  2BU7 A;  2IOR A;  2CTQ A;  1MZE A;  3P3P A;  4RWU A;  1AVM A;  3ZJZ A;  1D2D A;  3GIE A;  1ZSP A;  3HYZ A;  2FL4 A;  2QTS A;  4MW8 A;  3L75 H;  2GUZ A;  1Q3E A;  4JI1 B;  2BCC H;  4LBE C;  5LMN O;  1N34 B;  4GX2 A;  2OCC B;  5IDM A;  5IWA O;  2Q4P A;  4FLZ A;  1LR1 A;  1S5L Z;  1YIJ V;  2LW1 A;  1UYM A;  1BCC H;  1JVM A;  3HHU A;  1FXK A;  1VQ9 V;  3EFF K;  4LWG A;  2D3O W;  3W7W A;  2Y48 A;  4Q20 A;  1JCH A;  3SGI A;  5F3K A;  1H7U A;  3CXH F;  1YT2 A;  4JI2 B;  5D7R A;  1XNR B;  3F5W C;  4DRX B;  3L74 H;  4R3A A;  1W59 A;  3BA8 A;  5JCO A;  3C0E A;  1NS1 A;  5J2U B;  2DOS A;  4B7K A;  5CBG A;  1Z59 A;  1KZN A;  3K04 A;  4YY3 O;  3R65 A;  2QWQ B;  3D8C A;  2VQE O;  2YXY A;  1GK9 A;  3DGE A;  3B4S A;  3K08 A;  1FD9 A;  4UVC A;  3RW0 A;  5LA6 A;  1S72 V;  4TOI A;  3T2M A;  4KFM A;  3QTF A;  5LP6 C;  3VOU A;  4DR4 B;  2HLD G;  4TSF G;  3ZX6 A;  2IJJ A;  2XJG A;  3BAB A;  2X6C A;  2EIM B;  1YDX A;  2YKC A;  3RBZ A;  1N33 B;  2XT9 A;  3BA9 A;  3OGI B;  2CH4 A;  2YE7 A;  4UCU A;  1I5X A;  3ZRX A;  4X66 B;  4ZVI A;  4R3M A;  4HYP A;  3K03 A;  1BE3 H;  2W0X A;  3A0H Z;  2CGF A;  4FCR A;  1RM1 C;  4I7Z B;  2MW2 B;  2XDL A;  4NKG B;  3SYP A;  3NR7 A;  1R6N A;  4DXW A;  1UY7 A;  1AI7 A;  3GWO A;  4QJF B;  5M4M A;  4O4J B;  2ZE5 A;  3SYQ A;  2YEA A;  3JD2 A;  4NTY A;  2HKO A;  4JV5 O;  1N36 B;  4D6T H;  5LOV B;  2XJX A;  3G80 A;  1CP9 A;  2GTS A;  2RNB A;  2IOP A;  1P49 A;  4DO2 A;  1I0H A;  4PDM A;  2YEH A;  5FNC A;  1UYC A;  2XND G;  4IIJ B;  3OMI B;  2H8M A;  2H55 A;  2XDS A;  2XHT A;  5LGT A;  5LMU O;  1GM8 A;  5GTH Z;  3X2Q B;  4JI0 B;  2ZXW B;  4FJC C;  4YKY A;  4PL9 A;  2EUL A;  2B1I A;  2ITC C;  2XJJ A;  4UVB A;  2YDE A;  2Z0A A;  3RVZ A;  5CBH A;  4NXN B;  3VQW A;  1VF7 A;  4DUY O;  2UU9 O;  2UXC O;  2YI5 A;  5C8Y A;  4DV1 O;  3JAL B;  3R4N A;  3K9A A;  1ZLZ A;  3HPL C;  1V54 B;  1RPO A;  3AG1 B;  1S77 D;  3JAK A;  4FPP A;  2XHR A;  3MHS C;  2XAQ A;  5CA1 B;  3B09 A;  5LBQ A;  1UYK A;  4CWT A;  1S5H C;  5JJJ B;  3AG4 B;  3JAT A;  4K3A A;  5J71 A;  4DV2 O;  1XDC A;  1YI2 V;  3CRK A;  4BR6 A;  1E79 G;  4DZY A;  3OMN B;  4FIP C;  1EZJ A;  1M90 W;  3ABT A;  4UCR A;  2VRZ A;  4O04 A;  4Z2W A;  3ZIA G;  2P22 C;  3E35 A;  3T0Z A;  4YKT A;  2ZIO A;  4P9O A;  3OPD A;  4H33 A;  1TAE A;  2YEE A;  3ZM7 A;  3QF7 A;  2DYS B;  3MAQ A;  2AHY A;  2NR5 A;  1BSM A;  2Q8F A;  3OE7 G;  4F6R A;  3WHA A;  4JAS A;  5KA6 A;  1XHZ A;  4B3M O;  3E22 A;  3Q5K A;  4LC1 A;  4GX1 A;  1K5Q A;  5EBW C;  4IT5 A;  4ZHQ A;  2GHY A;  2YEB A;  1GN4 A;  1L0N H;  1Z5A A;  3INX A;  4JYA B;  5KHH A;  2M7W A;  3FT8 A;  2PTM A;  2BU2 A;  4B08 A;  1R3L C;  2ADQ B;  4W4K A;  3APQ A;  2QTO A;  3TET A;  2CCU A;  2Q67 A;  2BSK B;  5LHH A;  4RO2 A;  2ZR3 A;  1E1Q G;  2XHB A;  1R73 A;  4BAY A;  1OZ0 A;  1H2G A;  4GKK O;  1YJW V;  1D5N A;  4JI8 B;  3SJA C;  1OSF A;  3ZKB A;  3K99 A;  4EKW A;  3CCL V;  3BHP A;  4BIZ A;  2Q2E B;  2P5O A;  4PEL A;  3SPJ A;  3LDD A;  5D5Q A;  4GQT A;  4V26 A;  2QM7 A;  1Y6X A;  2VCJ A;  2WPD G;  4K8Z A;  3RLQ A;  2V7Q G;  4O4H B;  4GX5 A;  5LHG A;  1AP5 A;  3OEH G;  4LNU A;  1M93 A;  2PY5 A;  3HB3 B;  3GIG B;  3Q5J A;  3DTU B;  4DR7 O;  1VQP V;  4HNA A;  4PD4 F;  2P06 A;  1OCZ B;  5BY1 A;  2QA4 V;  4ZBM A;  3CYO A;  2FKX A;  3QO7 A;  4CBC A;  1SQV H;  2EZO A;  2F93 B;  4PV1 B;  2A79 B;  3ZRS A;  4CE2 A;  2EBO A;  1S5J A;  2CTW A;  2PNR A;  1KIJ A;  4DV0 B;  2CUG A;  5JEN A;  1I5D A;  3SYA A;  2GBO A;  1TVK B;  1ID0 A;  1DTO A;  1KMI Z;  4HYM A;  2LP7 A;  2PI4 A;  3VAD A;  2IU3 A;  1OJH A;  2RMK B;  1VQN V;  2YKE A;  2ZDI C;  2UUA B;  1QHT A;  2ZQM A;  3MDS A;  1KU9 A;  3UO3 A;  1HR0 O;  1PP9 H;  5JJN B;  1K3E A;  4AHC A;  4FMT A;  2CE4 A;  3OFN G;  4NYK A;  4PU9 A;  3SR2 C;  2YE3 A;  3DXR A;  3SDL A;  2OCC C;  5GGZ A;  2CTR A;  4LF4 O;  4MTF A;  4FFB B;  1K34 A;  4AI8 A;  2HG1 A;  3U11 A;  2P4K A;  1EN4 A;  3OMA B;  3CGZ A;  4GLX A;  5FPO A;  3O0I A;  3ZXO A;  1NHJ A;  2QE7 G;  1VIB A;  5EIB D;  2O1U A;  1YC4 A;  3K3W A;  2ZT9 B;  4Z1M G;  2YEF A;  4CH3 A;  4MVR A;  2DMX A;  5BOD A;  3SPH A;  3CYG A;  5CBF A;  3HKE A;  3ABM C;  5BR8 B;  1X4T A;  3CS5 A;  3ETG A;  4FM0 A;  1HNZ B;  1BQZ A;  5FND A;  2OT5 A;  1NT2 B;  2EIM C;  1R3I C;  4L8Z A;  2HVK C;  2JKI A;  2X7R B;  3OR7 C;  2FXS A;  1US7 A;  4MBC A;  2A3Q A;  1TID A;  5CTY A;  1QLE B;  2PZS A;  1Q8I A;  1GJV A;  2WI7 A;  2VQF O;  1MNG A;  2NN4 A;  4LFC O;  1H2N A;  1B04 A;  2YKB A;  4NB5 A;  1VQ5 V;  2QWN B;  1JJO A;  1NJI W;  2GFD A;  2BU6 A;  2GSM B;  5L3G A;  4FLT A;  2ZIN A;  1B6Q A;  3X2Q C;  4B7E A;  3H4L A;  4PI2 A;  2ZXW C;  1Q82 W;  2B1G A;  2X6A A;  3ZN0 A;  4AWO A;  4DV5 O;  1HP8 A;  3CPW U;  2EIJ C;  2KG7 A;  5CF0 A;  4B3T O;  4GUN A;  4JI5 B;  2BTZ A;  4I9W A;  4NTX A;  4PRV A;  4ASG A;  4E01 A;  3CC2 V;  5C8Y B;  3C3S A;  4L90 A;  2H3O A;  3OTO O;  2DN9 A;  2W6I G;  1KUQ A;  3PN1 A;  1V54 C;  3AG3 B;  4KL1 A;  5IDJ A;  2O57 A;  1AR4 A;  3VQV A;  3AG1 C;  3CME V;  3OWD A;  1PKX A;  2IH3 C;  3KG2 A;  3N2G A;  3TZ4 A;  4JAU A;  5CPH A;  3AG4 C;  2UXB B;  2XDU A;  3HKC B;  4WFH A;  4MB9 A;  4LCU C;  5KHK A;  3K57 A;  4DUZ O;  1JR9 A;  4LFB B;  3RWR D;  5LXT B;  2F4V O;  3FB6 C;  1Y8O A;  4X9Q A;  1KC8 W;  1R1B A;  2QJ1 A;  4YHH B;  3SPG A;  2Q68 A;  5IJ9 A;  5CN0 A;  3M8A A;  4HXZ A;  4EGH A;  3P30 A;  4TV8 B;  3B24 A;  3NXS A;  4HAM A;  2Q8V A;  4JAV A;  1YT0 A;  3EKR A;  2DWE C;  2P7T C;  1UFI A;  3RT3 C;  2DYS C;  4WUC A;  1XL4 A;  2YC0 A;  3B40 A;  2VWK A;  1JOY A;  5JVD B;  3IJ4 A;  3A0Z A;  3BAA A;  4AQY B;  1IBM B;  5DEC A;  4O2B A;  5IYZ A;  4LWF A;  5C93 A;  1Q90 D;  4CWR A;  1XMQ B;  4GKJ O;  1Z5W A;  1R6K A;  4YKX A;  1ARO P;  2VWC A;  2YE9 A;  2YJW A;  1V55 B;  3ZRW A;  2ZIM A;  2UUB O;  2HHH O;  1I5C A;  1UYE A;  2KSD A;  3OR6 C;  4HY6 A;  1PL0 A;  4LWI A;  4EM7 A;  4JI3 B;  1OCC B;  1GH6 A;  3CJH A;  4FFK A;  1YZB A;  1KKD A;  2F23 A;  2UUC O;  4O2A A;  2Q0O C;  2QKS A;  3T1Y B;  1KP2 A;  5GON B;  1Q6I A;  3E86 A;  2EZP A;  3ETQ A;  1Y4M A;  2A06 H;  4HZ3 A;  5J2T A;  2YGA A;  5K1X A;  4URN A;  1NTK H;  4KXR A;  2YID A;  2WI2 A;  4H81 A;  3DC6 A;  3B77 A;  1DGS A;  3J81 N;  1GKF A;  1Y74 B;  3RYH A;  4JPR A;  2X0L A;  3UT5 A;  1AH8 A;  1EFR G;  4MVS A;  2XDX A;  4JYB A;  3LNU A;  3A0B Z;  3WB1 A;  4YJ3 A;  3AK1 A;  4X65 O;  1BXD A;  1ZWH A;  4HZ0 A;  3ABL C;  3FB7 C;  2AKP A;  5LYJ B;  2IW5 A;  2QWR B;  5EBM C;  1OCZ C;  2WWW A;  3EHJ A;  1YXB A;  2QR4 A;  1FFX B;  2BYI A;  3WB2 A;  2ZNJ A;  1WB7 A;  2KQX A;  3LPS A;  2DJV A;  5IN9 A;  4N21 A;  2Q73 A;  1SA0 A;  4EEH A;  3D36 C;  3F7Y C;  1I59 A;  2EIK B;  3JAS B;  2X6B A;  2YXH A;  1P4R A;  2B9Z A;  3TCU A;  2OWO A;  1E1R G;  1AI5 A;  3JYC A;  4LF8 O;  4G27 B;  1TIL A;  4QPK A;  4YJ2 A;  2YK9 A;  1VMG A;  4WFF A;  1Y76 A;  4D7S A;  1YSZ A;  2WSS G;  1ZAU A;  2XOK G;  2BRE A;  2WLI B;  3DC5 A;  2H8P C;  2XDK A;  2IH1 C;  1QVG U;  4O05 A;  1J5E O;  3WQ9 A;  2R9R B;  3G6B A;  4MS2 A;  4X64 B;  5DM6 V;  1QQC A;  5KHG A;  2E0A A;  3T1C A;  5KAI Z;  4CS3 A;  1GKX A;  3VHD A;  3L70 H;  4MTG A;  3P3N A;  3UKM A;  4RUE A;  2YEV B;  5JCO C;  4IHJ B;  5IYD O;  3AG2 B;  5EZY B;  3F5T A;  4I4T B;  3ZXQ A;  3NMQ A;  3ZMU A;  4LF7 O;  4K0K O;  3JAW A;  2JDI G;  4JZ2 A;  4KSG A;  1THN A;  2Q8I A;  1WA8 B;  3Q4H B;  4TUY A;  4LWS B;  1HNX O;  2XTA A;  2BTO A;  4UVA A;  1S16 A;  2AHZ A;  4GEE A;  3OGC C;  5CB4 B;  1QCE A;  1M56 B;  2JIZ G;  4DV4 O;  3CCR V;  3EHG A;  4LFA O;  2BTQ A;  1ENV A;  1GRJ A;  3CE2 A;  4XC0 A;  1COW G;  4KFG A;  1DF4 A;  3JZ3 A;  5B1N A;  2IJH A;  3JD0 A;  3AK2 A;  1MSW D;  4X20 B;  4I50 A;  4X88 A;  1QLE C;  3ZCC A;  5BMV B;  3RN4 A;  5LGU A;  4JI6 O; 
#chains in the Genus database with same CATH homology
 1VQK V;  3K06 A;  4JAS A;  4JF3 A;  5KA6 A;  4LC1 A;  1DLB A;  2ZDI A;  4GX1 A;  1FXH A;  1K5Q A;  5EBW C;  4XDK A;  1EBO A;  2GHY A;  2JJ1 G;  4MVZ A;  1WPX A;  3W7T A;  5LGN A;  2M7W A;  3ZN1 A;  1SET A;  1NH2 B;  1NVP D;  4PA4 A;  5E1A C;  1THZ A;  1NBM G;  5EBL C;  5EC2 C;  2IJK A;  1R3L C;  4YXW G;  2QTO A;  4ASU G;  3ABM B;  3TET A;  2Q67 A;  2LFR A;  5LHH A;  1PD3 A;  4WF9 V;  2B5U A;  1S3J A;  3JD4 A;  2ZR3 A;  4RO2 A;  1E1Q G;  5HFL A;  4WFA V;  1R73 A;  4BAY A;  2EIL B;  1OZ0 A;  4QNH B;  1H2G A;  4R7C A;  1YJW V;  4MVM A;  1JX9 A;  3STL C;  2KB1 A;  1AJP A;  4LP8 A;  1FXV A;  4EKW A;  3AG3 C;  3CCL V;  4BIZ A;  2XAJ A;  1G4Y B;  4PEL A;  3P32 A;  3SPJ A;  3LDD A;  1YSC A;  2HR3 A;  2QM7 A;  2ATK C;  2Y69 B;  3FB8 C;  3CCJ V;  2WPD G;  2HJF C;  1AJQ A;  3CCQ V;  2DQ3 A;  2V7Q G;  4GX5 A;  1AR1 B;  3RVY A;  5LHG A;  3W7U A;  3B8N A;  1NQT A;  3WFV A;  4F4L A;  3G71 V;  1S76 D;  3OEH G;  1F4N A;  3CP1 A;  3HB3 B;  3DTU B;  1YHQ V;  1VQP V;  1LNQ A;  1OCO C;  2QM8 A;  1P7B A;  5B1A C;  1MG1 A;  2WLK A;  1M57 B;  3IC7 A;  4WFG A;  1OCZ B;  4KUM A;  2NNU A;  4ZBM A;  3CYO A;  4XBF A;  2QA4 V;  3CC4 V;  4J9Z B;  3QO7 A;  1AI4 A;  2FTK A;  4CBC A;  1H38 A;  2ZR2 A;  2DWD C;  3CCS V;  4P30 A;  2EZO A;  2A79 B;  3E83 A;  3ZRS A;  1Q7Y W;  1VQ6 V;  2EBO A;  1OCR B;  2EJR A;  5H9C A;  1I5Y A;  1FXK C;  3SYA A;  4WFB V;  3M99 B;  2EIJ B;  2JK5 C;  1DTO A;  4U7O A;  1H8E G;  3WG7 C;  2LP7 A;  2V1D A;  5J9P C;  2PI4 A;  2IU3 A;  2JJ2 G;  3BY6 A;  1VQN V;  2ZDI C;  5H6Q A;  1RM1 B;  2ZQM A;  1L1F A;  3ETD A;  2XAG A;  5BZB A;  3OEE G;  3CXC U;  1K73 W;  1V55 C;  3UM7 A;  1K3E A;  1AJN A;  4FMT A;  3E8F A;  5EC1 C;  4BW5 A;  3OFN G;  1PNL A;  1PNM A;  1K92 A;  1OCC C;  2WAM A;  2HG5 C;  4JTA B;  3B8M A;  4PA7 A;  1VQO V;  5FL7 G;  4WCE V;  2OCC C;  4E2L A;  5B3S C;  1NR7 A;  1WLE A;  3E8G A;  4TWK A;  4RUF A;  4MTF A;  1QR9 A;  2XAH A;  4MW3 A;  3K0G A;  1K34 A;  4MSW C;  3FYI B;  3FB5 C;  4XDJ A;  3OMA B;  4R8C A;  4JTC B;  3MHH C;  4KP4 A;  2PI5 A;  3D36 A;  3CCE V;  4PA9 A;  1GTO A;  2EIN C;  2QE7 G;  3OW2 U;  3STZ C;  1GM9 A;  2C2A A;  2DQ0 A;  2Q69 A;  3K3W A;  1YJN V;  1M1K W;  2WLL B;  1PNK A;  3ASN B;  1UJW B;  4PA3 A;  1K33 A;  4Z1M G;  4RAI A;  2OTJ V;  4UUJ C;  4J9Y B;  1JPX A;  1K4D C;  2A9H A;  4MVR A;  1KP3 A;  2OTL V;  3SPH A;  1MAB G;  5CBF A;  3ASO B;  5EK0 A;  3ABM C;  1J95 A;  3LSQ A;  2P90 A;  3CCM V;  3ETG A;  1BMF G;  3ZRV A;  1Q81 W;  1QVF U;  2WLH A;  2OT5 A;  1W0J G;  3OUF A;  2EIL C;  4PDL A;  2JEX A;  2UXN A;  4MT8 A;  4BIU A;  2EIM C;  1R3I C;  4RQF A;  4MVO A;  2HVK C;  4HYO A;  2BOC C;  2X7R B;  3JD3 A;  1ROP A;  2EIK C;  4R50 A;  3OR7 C;  3LSS A;  2WLL A;  2BOB C;  3SYO A;  4PA6 A;  4MVU A;  1R3J C;  3E2E A;  1QLE B;  1K8A W;  3ABK C;  2NLJ C;  3K0D A;  4GX0 A;  4X89 A;  3K79 A;  3JD1 A;  2JEU A;  4GCZ A;  2CK3 G;  5GW7 A;  4G28 B;  1Y66 A;  1YTF D;  1VQ5 V;  3CMA V;  3AEI A;  3G6E V;  1NJI W;  2WLN A;  2GSM B;  2A0L A;  1RPR A;  1BL8 A;  2DW4 A;  5L3G A;  3G4S V;  5L3E A;  2Z3Y A;  1B6Q A;  1NR1 A;  2H94 A;  3ZMV A;  3X2Q C;  4QIW F;  3FKS G;  1F4M A;  2ZXW C;  3QO8 A;  1Q82 W;  2B1G A;  2X6A A;  4H37 A;  4MVQ A;  3ZN0 A;  3ABL B;  3VBB A;  3JCZ A;  3CPW U;  2EIJ C;  4QE7 A;  3OAA G;  4OXS A;  1F51 A;  4I9W A;  1GM7 A;  3SJQ C;  3CC2 V;  1SRY A;  3W7X A;  3LUT B;  3SPI A;  2W6I G;  3IGA C;  1K97 A;  3AG2 C;  3LNM B;  2W0F C;  1V54 C;  3AG3 B;  5IDJ A;  1KEC A;  4FK5 C;  3ETE A;  3AG1 C;  3CME V;  1SES A;  1FFT B;  3F7V C;  1PKX A;  1QR8 A;  2IH3 C;  3KG2 A;  5B1O A;  1K5S A;  3QO5 A;  4JAU A;  1SZT A;  3AG4 C;  2DYR C;  5CA3 A;  4MTO A;  4WFH A;  4LCU C;  1H8H G;  3D3I A;  3QNE A;  3FYE B;  4GT1 A;  2LFS A;  2XAF A;  3ZRW B;  1N8R W;  1ZWI C;  3FB6 C;  4UV9 A;  1ORQ C;  1KC8 W;  3I55 V;  1JQ0 A;  2ITD C;  1OCO B;  1M56 C;  5HFM A;  1MOF A;  3SPG A;  3LDE A;  2Q68 A;  3A0R A;  4RQE A;  1W2B U;  3MD0 A;  3E89 A;  5B1B C;  5CN0 A;  5DN6 G;  3P30 A;  2W6J G;  3NXS A;  4HAM A;  2F43 G;  4JAV A;  3ASN C;  1NVP B;  2DWE C;  2P7T C;  2DYS C;  1FXK B;  1XL4 A;  4TT3 G;  1JOY A;  3T4Z A;  1FS0 G;  4ZKI A;  2IJI A;  3WG7 B;  5IY5 B;  5C93 A;  1R6K A;  3ZJZ A;  5L3C A;  1ARO P;  4MTX A;  5CMU A;  1GO3 F;  4MW8 A;  1HWY A;  1V55 B;  3ZRW A;  4QPJ A;  1TUE B;  3LDC A;  4UV8 A;  3OR6 C;  1PL0 A;  1OCC B;  4LBE C;  3E8H A;  2UXX A;  4GX2 A;  2OCC B;  5B3S B;  2K1E A;  1G8M A;  1KKD A;  2MK3 A;  2HFE C;  2QKS A;  1YIJ V;  1JVM A;  1FXK A;  1KP2 A;  1YIT V;  1VQ9 V;  3EFF K;  3E86 A;  2EZP A;  2D3O W;  3W7W A;  2Y48 A;  1Y4M A;  1JCH A;  4HZ3 A;  4Q20 A;  2EIN B;  1CPY A;  5L3D A;  3F5W C;  4PDR A;  1QBZ A;  2IU0 A;  5KA5 A;  3CD6 V;  2Y69 C;  3B77 A;  5CBG A;  3K04 A;  1GKF A;  2WLJ A;  3R65 A;  3SYC A;  3ZMS A;  4JPR A;  2X0L A;  4P2Z A;  3GB7 C;  4U7N A;  3T4D A;  1EFR G;  2ZD9 A;  1GK9 A;  4MVS A;  4JYB A;  3DGE A;  4WFE A;  3K08 A;  3W7S A;  1M9N A;  4UVC A;  3RW0 A;  2P67 A;  1S72 V;  3ABL C;  3FB7 C;  3T2M A;  1VQL V;  4KFM A;  2IW5 A;  3VOU A;  1M57 C;  5EBM C;  1OCZ C;  2WWW A;  2HLD G;  4TSF G;  3TK1 A;  1OHH G;  5KUK A;  2IJJ A;  4N21 A;  4I5S A;  2X6C A;  1OCR C;  2EIM B;  3RBZ A;  1R3K C;  1I5X A;  1DF5 A;  1K4C C;  3F7Y C;  2EIK B;  3ZRX A;  4UXN A;  4N23 A;  1Q86 W;  2X6B A;  2P6J A;  4PDV A;  5H6R A;  1P4R A;  3K03 A;  3TCU A;  3PJS K;  1E1R G;  1AI5 A;  1RM1 C;  3JYC A;  3SYP A;  3ABK B;  3OUS A;  4G27 B;  1NH2 D;  3CCU V;  1R6N A;  4QPK A;  1NKD A;  4DXW A;  3CCV V;  1AI7 A;  3GWO A;  4QJF B;  4WFF A;  3SYQ A;  2Q6A A;  1VQ4 V;  3JD2 A;  2HKO A;  4G2K A;  2WSS G;  3ZMZ A;  4XDL A;  1CP9 A;  4P9P A;  2WLM A;  1VQ8 V;  2XOK G;  1S0V A;  4DO2 A;  3IFX A;  2WLI B;  4PDM A;  3CC7 V;  1KQS U;  2XND G;  2H8P C;  3OMI B;  1GMG A;  4JTD B;  2IH1 C;  3ABU A;  1QVG U;  5IYC O;  5LGT A;  1GM8 A;  4X8A A;  3X2Q B;  1QLN A;  2R9R B;  4MS2 A;  2ZXW B;  4FJC C;  1F23 A;  5DM6 V;  1VQ7 V;  3T1C A;  1BHA A;  5B1A B;  2B1I A;  2ITC C;  1W0K G;  5L3F A;  4UVB A;  1K9M W;  3RVZ A;  4MTG A;  5CBH A;  3UKM A;  4RUE A;  5IY5 C;  1K7D A;  2YEV B;  5KUM A;  4R6Z A;  3EHB B;  3K9A A;  3ZMT A;  5LHI A;  5IYD O;  1BHB A;  2YSU B;  3AG2 B;  3HPL C;  1V54 B;  1SER A;  2Z5U A;  1RPO A;  3AG1 B;  4JGS A;  1S77 D;  2QEX V;  4FPP A;  3ZMU A;  3MHS C;  2XAQ A;  5LBQ A;  1S5H C;  3AG4 B;  2DYR B;  3ASO C;  2JDI G;  1XL6 A;  2WLI A;  1CEZ A;  4L87 A;  3BEH A;  1IXM A;  1YI2 V;  1KD1 W;  4UVA A;  2AHZ A;  3OM3 B;  2HVJ C;  3OGC C;  1AI6 A;  1E79 G;  3ML0 A;  3OMN B;  1QCE A;  2R9I A;  4FIP C;  1EZJ A;  1M90 W;  3ABT A;  4QE9 A;  4CZZ A;  5IYB O;  1M56 B;  4JYC A;  2JIZ G;  1YJ9 V;  3E8B A;  3I56 V;  3CCR V;  1YTF B;  3ZIA G;  1ENV A;  3SPC A;  3E35 A;  2XAS A;  1COW G;  5B1B B;  1DF4 A;  4P9O A;  5B1N A;  2IJH A;  2YEV A;  3JD0 A;  4H33 A;  3H01 A;  1MSW D;  4X88 A;  2DYS B;  2AHY A;  1QLE C;  3ZCC A;  1VQM V;  5LGU A;  5L3B A;  1JJ2 U;  3OE7 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...