1YS3A

Crystal structure of the atp binding domain of prrb from mycobacterium tuberculosis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
148
structure length
137
Chain Sequence
DDHVPVDITDLLDRAAHDAARIYPDLDVSLVPSPTCIIVGLPAGLRLAVDNAIANAVKHGGATLVQLSAVSSRAGVEIAIDDNGSGVPEGERQVVFERFSLGLALVAQQAQLHGGTASLENSPLGGARLVLRLPGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor-type histidine kinase prrB
publication title Crystal structure of ATP binding domain of Hidtidine Kinase from MTB
rcsb
source organism Mycobacterium tuberculosis
total genus 35
structure length 137
sequence length 148
chains with identical sequence B, C
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2005-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1ys3A00
3EHHA 3OPDA 1R62A 1Y8OA 4XCLA 1I5BA 1MU5A 4LWIA 3RKZA 2XD6A 2Q8HA 1UY8A 4R1FA 5IN9A 4LWGA 2Q8GA 2XDLA 4E00A 4CWPA 4KSHA 2BU8A 3R4PA 4ASGA 2ZBKB 4WUDA 1YT1A 2YK9A 3B27A 3T10A 5IDMA 2Q8FA 2XDUA 4MBCA 4ZKIA 3PEHA 4MPEA 1S14A 3VHAA 1KIJA 4AWPA 4HXZA 4EGIA 4B6CA 1Z59A 5J71A 1U0ZA 4I5SA 2YJWA 1YETA 3Q5LA 4DUHA 1I58A 3ZXOA 5D7RA 5BODA 4XD8A 1UYHA 2YE2A 3IEDA 1EI1A 2IOPA 4CWSA 4KFGA 2WI4A 2XK2A 3KE6A 5M4HA 2BU6A 1Y8NA 4E02A 4LWEA 3BMYA 3B28A 2XHRA 1ZXMA 1ID0A 4R3AA 4ZVIA 4Q20A 3O6OA 3QDDA 4XCJA 1I5CA 2YEHA 5CTUA 4JAVA 4JASA 2IWSA 3PEJA 1L0OA 2ZDXA 5FNDA 4HXWA 3JZ3A 2BREA 4MPNA 1TBWA 1YC4A 3BM9A 4L90A 1ZW9A 4L91A 2BYHA 1B63A 1UYGA 2JKIA 2QG0A 3LPSA 4DZYA 4FCPA 3NMQA 2YI5A 4H81A 5FWKA 4CWRA 1A4HA 4PU9A 1OSFA 1UYMA 2HKJA 3H80A 1AJ6A 2IORA 4JQLA 2VWCA 4KP4A 4EFTA 2XABA 3TZ5A 2IOQA 2XX5A 2YEJA 1BXDA 1UYEA 4UROA 4QPKA 1YSRA 3CRKA 3ZKBA 4BQJA 3TZ4A 2YGEA 2QFOA 2YI0A 4XE2A 2XDKA 4O04A 2WI5A 4XIPA 1GKXA 2VW5A 1I5AA 4PL9A 3OMUA 2YEEA 4WUCA 4XKAA 4BIUA 5M4NA 3DGEA 5F5RA 2BU5A 1QYEA 2FYPA 2VCIA 4YKXA 5J6AA 4L8ZA 2CGFA 1TH8A 3OW6A 1NHIA 1UY6A 2YE5A 4GEEA 5CF0A 3INXA 2YEGA 4EMVA 2XDSA 2XJGA 3A0WA 3TUHA 3CGZA 1AMWA 4P8OA 4KTNA 4EGKA 5M4PA 3HYYA 1PVGA 4ASAA 2PNRA 5C93A 1UYIA 2VCJA 1NHHA 1UYFA 2WI2A 3R4NA 3EKOA 5F3KA 2CCTA 4R3MA 4MB9A 5CTXA 4O0BA 4XKOA 3RLQA 3T0ZA 3HYZA 4ASBA 3WHAA 2XCMA 2QF6A 4GT8A 4X9LA 1YERA 3ZM7A 2XX2A 5L3JA 2GQPA 3EKRA 4XIQA 2H8MA 4XITA 3TZ2A 2BT0A 5BOCA 1YC1A 4U7OA 4EEHA 4YKYA 1BGQA 3OWBA 2Q2EB 3SL2A 3EHGA 4NH7A 5CPHA 3T2SA 2CH4A 5D6QA 2YKCA 3B25A 2YE7A 5D6PA 3C0EA 2YECA 1UYDA 1YC3A 2YE4A 3ZXQA 5D7DA 3WQ9A 2YGAA 2YKIA 3B26A 3QTFA 1I59A 2YE8A 2YEIA 4CWNA 1ZWHA 4O07A 4GFNA 2YGFA 1QZRA 1AM1A 4LWHA 3TTZA 4URNA 1NHJA 2BSMA 3D2RA 3H4LA 1Y8PA 1Z5AA 2CCSA 3CGYA 4ASFA 1YSZA 2WI6A 1H7SA 3RLRA 4PRVA 4YKUA 3EHJA 3R4OA 1B62A 3U2DA 3HZ1A 4CWFA 3R91A 1AH6A 2O1UA 4HZ0A 4BAEA 2WI3A 2YEAA 2YEFA 4XC0A 2EXLA 4XIRA 5FNFA 4PRXA 2XJJA 4BQGA 4FCQA 4XKKA 4YKTA 2XJXA 4MPCA 3U67A 1AH8A 3O0IA 2ZDYA 2ZKJA 4JAUA 2IWXA 3D0BA 3VHDA 3GIGB 3U2KA 4H7QA 3LNUA 1Z5BA 4EM7A 2AKPA 2YJXA 4U7NA 2O1VA 3K97A 3R4MA 2WEPA 3GIGA 2CG9A 2HCHA 1TC6A 1TIDA 4V25A 4HY6A 5M4MA 4KSGA 4YKZA 3G7EA 1QY8A 2UWDA 2YE9A 3K98A 2YI6A 4YKRA 1GJVA 2XHTA 2K5BA 4BXIA 4CWQA 4FMTA 3TZ0A 3A0TA 3A0RA 3K99A 4MP7A 4YKWA 4L93A 2BYIA 3HHUA 4CE1A 5FNCA 3HZ5A 2BU7A 1Y4UA 4HYPA 3OWDA 1BKNA 2O1WA 2FWYA 5M4EA 1YT0A 4AWQA 3Q5JA 4LP0A 1YESA 4FCRA 4WUBA 5IDJA 4XTJA 2BRCA 3RLPA 4GGLA 3A0XA 3VADA 3T0HA 1UYKA 4HZ5A 5CTYA 1YT2A 4CE3A 3D36A 2YE6A 1ZXNA 1UY9A 2BZ5A 1THNA 3CRLA 3R92A 2FWZA 4MOTA 4KQVA 5CTWA 1EA6A 4B7PA 4O09A 4L94A 4MP2A 1B3QA 4GQTA 2YEBA 2WEQA 3C11A 2FXSA 4AS9A 3K60A 4CE2A 1UYLA 3T1KA 2H55A 2QG2A 3FT5A 1US7A 2C2AA 3VHCA 4U93A 1KZNA 3GIEA 4EFUA 3B24A 2ESAA 4XDMA 2XHXA 1S16A 4O05A 1TILA 1BYQA 1H7UA 3ZKDA 1YS3A 5GGZA 5D7CA 3O2FA 1Z5CA 3G75A 5M4KA 1UYCA 2YE3A 3EHFA 3FT8A 4GCZA 3HEKA 4CWOA 2JJCA 3A0YA 4FPPA 2WERA 2YEDA 2Q8IA 4EGHA 1MX0A 4P7AA 1JM6A 2YKJA 2XDXA 4H85A 2WI7A 3Q5KA 1Y4SA 1UY7A 4V26A 4BIZA 4NH9A 4YKQA 3G7BA 2WI1A 2BTZA 3FV5A 3MNRP 2GFDA 4LWFA 4W7TA 1TC0A 3A0ZA 4LPBA 4HYMA 2IWUA 2XX4A 4URMA 4URLA 2HG1A 4AWOA 2YK2A 2YKBA 4K4OA 2YKEA 3CWVA 4E01A 4HY1A 4I3HA 4CWTA 2E0AA 1GKZA 2BU2A 1U2OA 3INWA 3GIFA 4QPJA 2YI7A 4NH8A 2CCUA 1I5DA
chains in the Genus database with same CATH superfamily
3EHHA 3OPDA 1R62A 1Y8OA 4XCLA 1I5BA 1MU5A 4LWIA 3RKZA 2XD6A 2Q8HA 1UY8A 4R1FA 5IN9A 3S5TA 4LWGA 2Q8GA 2XDLA 4E00A 4CWPA 4KSHA 2BU8A 3R4PA 4ASGA 2ZBKB 4WUDA 1YT1A 2YK9A 3B27A 3T10A 5IDMA 2Q8FA 2XDUA 4MBCA 4ZKIA 3PEHA 4MPEA 1S14A 3VHAA 1KIJA 4AWPA 4HXZA 4EGIA 4B6CA 1Z59A 5J71A 1U0ZA 4I5SA 2YJWA 1YETA 3Q5LA 4DUHA 1I58A 3ZXOA 5D7RA 5BODA 4XD8A 1UYHA 2C1GA 2YE2A 3IEDA 1EI1A 2IOPA 4CWSA 4KFGA 2WI4A 2XK2A 3KE6A 5M4HA 2BU6A 1Y8NA 4E02A 4LWEA 3BMYA 3B28A 2XHRA 1ZXMA 1ID0A 4R3AA 3CYGA 4ZVIA 4Q20A 3O6OA 3QDDA 4XCJA 1I5CA 2YEHA 5CTUA 4JAVA 4JASA 2IWSA 3PEJA 1L0OA 2ZDXA 5FNDA 4HXWA 3JZ3A 2BREA 4MPNA 1TBWA 1YC4A 3BM9A 4L90A 1ZW9A 4L91A 2BYHA 1B63A 1UYGA 2JKIA 2QG0A 3LPSA 4DZYA 4FCPA 3NMQA 2YI5A 4H81A 5FWKA 4CWRA 1A4HA 4PU9A 1OSFA 1UYMA 2HKJA 1IXMA 3H80A 1AJ6A 2IORA 4JQLA 2VWCA 4KP4A 4EFTA 2XABA 3TZ5A 2IOQA 2XX5A 2YEJA 1BXDA 1UYEA 4UROA 4QPKA 1YSRA 3CRKA 3ZKBA 4BQJA 3TZ4A 2YGEA 2QFOA 2YI0A 4XE2A 2XDKA 4O04A 2WI5A 4XIPA 1GKXA 2VW5A 1I5AA 4PL9A 3OMUA 2YEEA 4WUCA 4XKAA 4BIUA 5M4NA 3DGEA 5F5RA 2BU5A 1QYEA 2FYPA 2VCIA 4YKXA 5J6AA 4L8ZA 2CGFA 1TH8A 3LMMA 3OW6A 1NHIA 1UY6A 2YE5A 4GEEA 5CF0A 3INXA 2YEGA 4EMVA 2XDSA 2XJGA 3A0WA 3TUHA 3CGZA 1AMWA 4P8OA 4KTNA 4EGKA 5M4PA 3HYYA 1PVGA 4ASAA 2PNRA 5C93A 1UYIA 2VCJA 1NHHA 1UYFA 2WI2A 3R4NA 3EKOA 5F3KA 2CCTA 4R3MA 4MB9A 5CTXA 4O0BA 4XKOA 3RLQA 3T0ZA 3HYZA 4ASBA 3WHAA 2XCMA 2QF6A 4GT8A 4X9LA 1YERA 3ZM7A 2XX2A 5L3JA 2GQPA 3EKRA 4XIQA 2H8MA 4XITA 3TZ2A 2BT0A 5BOCA 1YC1A 4U7OA 4EEHA 4YKYA 1BGQA 3OWBA 2Q2EB 3SL2A 3EHGA 4NH7A 5CPHA 3T2SA 2CH4A 5D6QA 2YKCA 3B25A 2YE7A 5D6PA 3C0EA 2YECA 1UYDA 1YC3A 2YE4A 3ZXQA 5D7DA 3WQ9A 2YGAA 2YKIA 3B26A 3QTFA 1I59A 2YE8A 2YEIA 4CWNA 1ZWHA 4O07A 4GFNA 2YGFA 1QZRA 1AM1A 4LWHA 3TTZA 4URNA 1NHJA 2BSMA 3D2RA 3H4LA 1Y8PA 1Z5AA 2CCSA 3CGYA 4ASFA 1YSZA 2WI6A 1H7SA 3RLRA 4PRVA 4YKUA 3EHJA 3R4OA 1B62A 3U2DA 3HZ1A 4CWFA 3R91A 1AH6A 2O1UA 4HZ0A 4BAEA 2WI3A 2YEAA 2YEFA 4XC0A 2EXLA 4XIRA 5FNFA 4PRXA 2XJJA 4BQGA 4FCQA 4XKKA 4YKTA 2XJXA 4MPCA 2FTKA 3U67A 1AH8A 3O0IA 2ZDYA 2ZKJA 4JAUA 2IWXA 3D0BA 3VHDA 3GIGB 3U2KA 4H7QA 3LNUA 1Z5BA 4EM7A 2AKPA 2YJXA 4U7NA 2O1VA 3K97A 3R4MA 2WEPA 3GIGA 2CG9A 2HCHA 1TC6A 1TIDA 4V25A 4HY6A 5M4MA 4KSGA 4YKZA 3G7EA 1QY8A 2UWDA 4E72A 2YE9A 3K98A 2YI6A 4YKRA 1GJVA 2XHTA 2K5BA 4BXIA 4CWQA 4FMTA 3TZ0A 5JENA 3A0TA 3A0RA 3K99A 4MP7A 4YKWA 4L93A 2BYIA 3HHUA 4CE1A 5FNCA 3HZ5A 2BU7A 1Y4UA 4HYPA 3OWDA 1BKNA 2O1WA 2FWYA 5M4EA 1YT0A 4AWQA 3Q5JA 4LP0A 1YESA 4FCRA 1F51A 4WUBA 5IDJA 4XTJA 2BRCA 3RLPA 4GGLA 3A0XA 3VADA 3T0HA 1UYKA 4HZ5A 2C1IA 5CTYA 1YT2A 4CE3A 3D36A 2YE6A 1ZXNA 1UY9A 2BZ5A 1THNA 3CRLA 3R92A 2FWZA 4MOTA 4KQVA 5CTWA 1EA6A 4B7PA 4O09A 4L94A 4MP2A 1B3QA 4GQTA 2YEBA 2WEQA 3C11A 2FXSA 4AS9A 3K60A 4CE2A 1UYLA 3T1KA 2H55A 2QG2A 3FT5A 1US7A 2C2AA 3VHCA 4U93A 1KZNA 3GIEA 4EFUA 3B24A 2ESAA 4XDMA 2XHXA 1S16A 2HHIA 4O05A 1TILA 1H7UA 1BYQA 3ZKDA 1YS3A 5GGZA 5D7CA 3O2FA 1Z5CA 3G75A 5M4KA 1UYCA 2YE3A 3EHFA 3FT8A 4GCZA 3HEKA 4CWOA 2JJCA 3A0YA 4FPPA 2WERA 2YEDA 2Q8IA 4EGHA 1MX0A 4P7AA 1JM6A 2YKJA 2XDXA 4H85A 2WI7A 3Q5KA 1Y4SA 1UY7A 4V26A 4BIZA 4NH9A 4YKQA 3G7BA 2WI1A 2BTZA 3FV5A 3MNRP 2GFDA 4LWFA 4W7TA 1TC0A 3A0ZA 4LPBA 4HYMA 2IWUA 2XX4A 4URMA 4URLA 2HG1A 4AWOA 2YK2A 2YKBA 4K4OA 2YKEA 3CWVA 4E01A 4HY1A 4I3HA 4CWTA 2E0AA 1GKZA 2BU2A 1U2OA 3INWA 3GIFA 4QPJA 2YI7A 4NH8A 2CCUA 1I5DA
chains in the Genus database with same CATH topology
3EHHA 3OPDA 1R62A 1Y8OA 4XCLA 1I5BA 1MU5A 4LWIA 3RKZA 2XD6A 2Q8HA 1UY8A 4R1FA 5IN9A 4LWGA 2Q8GA 2XDLA 4E00A 4CWPA 4KSHA 2BU8A 3R4PA 4ASGA 2ZBKB 4WUDA 1YT1A 2YK9A 3B27A 3T10A 5IDMA 2Q8FA 2XDUA 4MBCA 4ZKIA 3PEHA 4MPEA 1S14A 3VHAA 1KIJA 4AWPA 4HXZA 4EGIA 4B6CA 1Z59A 5J71A 1U0ZA 4I5SA 2YJWA 1YETA 3Q5LA 4DUHA 1I58A 3ZXOA 5D7RA 5BODA 4XD8A 1UYHA 2YE2A 3IEDA 1EI1A 2IOPA 4CWSA 4KFGA 2WI4A 2XK2A 3KE6A 5M4HA 2BU6A 1Y8NA 4E02A 4LWEA 3BMYA 3B28A 2XHRA 1ZXMA 1ID0A 4R3AA 4ZVIA 4Q20A 3O6OA 3QDDA 4XCJA 1I5CA 2YEHA 5CTUA 4JAVA 4JASA 2IWSA 3PEJA 1L0OA 2ZDXA 5FNDA 4HXWA 3JZ3A 2BREA 4MPNA 1TBWA 1YC4A 3BM9A 4L90A 1ZW9A 4L91A 2BYHA 1B63A 1UYGA 2JKIA 2QG0A 3LPSA 4DZYA 4FCPA 3NMQA 2YI5A 4H81A 5FWKA 4CWRA 1A4HA 4PU9A 1OSFA 1UYMA 2HKJA 3H80A 1AJ6A 2IORA 4JQLA 2VWCA 4KP4A 4EFTA 2XABA 3TZ5A 2IOQA 2XX5A 2YEJA 1BXDA 1UYEA 4UROA 4QPKA 1YSRA 3CRKA 3ZKBA 4BQJA 3TZ4A 2YGEA 2QFOA 2YI0A 4XE2A 2XDKA 4O04A 2WI5A 4XIPA 1GKXA 2VW5A 1I5AA 4PL9A 3OMUA 2YEEA 4WUCA 4XKAA 4BIUA 5M4NA 3DGEA 5F5RA 2BU5A 1QYEA 2FYPA 2VCIA 4YKXA 5J6AA 4L8ZA 2CGFA 1TH8A 3OW6A 1NHIA 1UY6A 2YE5A 4GEEA 5CF0A 3INXA 2YEGA 4EMVA 2XDSA 2XJGA 3A0WA 3TUHA 3CGZA 1AMWA 4P8OA 4KTNA 4EGKA 5M4PA 3HYYA 1PVGA 4ASAA 2PNRA 5C93A 1UYIA 2VCJA 1NHHA 1UYFA 2WI2A 3R4NA 3EKOA 5F3KA 2CCTA 4R3MA 4MB9A 5CTXA 4O0BA 4XKOA 3RLQA 3T0ZA 3HYZA 4ASBA 3WHAA 2XCMA 2QF6A 4GT8A 4X9LA 1YERA 3ZM7A 2XX2A 5L3JA 2GQPA 3EKRA 4XIQA 2H8MA 4XITA 3TZ2A 2BT0A 5BOCA 1YC1A 4U7OA 4EEHA 4YKYA 1BGQA 3OWBA 2Q2EB 3SL2A 3EHGA 4NH7A 5CPHA 3T2SA 2CH4A 5D6QA 2YKCA 3B25A 2YE7A 5D6PA 3C0EA 2YECA 1UYDA 1YC3A 2YE4A 3ZXQA 5D7DA 3WQ9A 2YGAA 2YKIA 3B26A 3QTFA 1I59A 2YE8A 2YEIA 4CWNA 1ZWHA 4O07A 4GFNA 2YGFA 1QZRA 1AM1A 4LWHA 3TTZA 4URNA 1NHJA 2BSMA 3D2RA 3H4LA 1Y8PA 1Z5AA 2CCSA 3CGYA 4ASFA 1YSZA 2WI6A 1H7SA 3RLRA 4PRVA 4YKUA 3EHJA 3R4OA 1B62A 3U2DA 3HZ1A 4CWFA 3R91A 1AH6A 2O1UA 4HZ0A 4BAEA 2WI3A 2YEAA 2YEFA 4XC0A 2EXLA 4XIRA 5FNFA 4PRXA 2XJJA 4BQGA 4FCQA 4XKKA 4YKTA 2XJXA 4MPCA 3U67A 1AH8A 3O0IA 2ZDYA 2ZKJA 4JAUA 2IWXA 3D0BA 3VHDA 3GIGB 3U2KA 4H7QA 3LNUA 1Z5BA 4EM7A 2AKPA 2YJXA 4U7NA 2O1VA 3K97A 3R4MA 2WEPA 3GIGA 2CG9A 2HCHA 1TC6A 1TIDA 4V25A 4HY6A 5M4MA 4KSGA 4YKZA 3G7EA 1QY8A 2UWDA 2YE9A 3K98A 2YI6A 4YKRA 1GJVA 2XHTA 2K5BA 4BXIA 4CWQA 4FMTA 3TZ0A 3A0TA 3A0RA 3K99A 4MP7A 4YKWA 4L93A 2BYIA 3HHUA 4CE1A 5FNCA 3HZ5A 2BU7A 1Y4UA 4HYPA 3OWDA 1BKNA 2O1WA 2FWYA 5M4EA 1YT0A 4AWQA 3Q5JA 4LP0A 1YESA 4FCRA 4WUBA 5IDJA 4XTJA 2BRCA 3RLPA 4GGLA 3A0XA 3VADA 3T0HA 1UYKA 4HZ5A 5CTYA 1YT2A 4CE3A 3D36A 2YE6A 1ZXNA 1UY9A 2BZ5A 1THNA 3CRLA 3R92A 2FWZA 4MOTA 4KQVA 5CTWA 1EA6A 4B7PA 4O09A 4L94A 4MP2A 1B3QA 4GQTA 2YEBA 2WEQA 3C11A 2FXSA 4AS9A 3K60A 4CE2A 1UYLA 3T1KA 2H55A 2QG2A 3FT5A 1US7A 2C2AA 3VHCA 4U93A 1KZNA 3GIEA 4EFUA 3B24A 2ESAA 4XDMA 2XHXA 1S16A 4O05A 1TILA 1BYQA 1H7UA 3ZKDA 1YS3A 5GGZA 5D7CA 3O2FA 1Z5CA 3G75A 5M4KA 1UYCA 2YE3A 3EHFA 3FT8A 4GCZA 3HEKA 4CWOA 2JJCA 3A0YA 4FPPA 2WERA 2YEDA 2Q8IA 4EGHA 1MX0A 4P7AA 1JM6A 2YKJA 2XDXA 4H85A 2WI7A 3Q5KA 1Y4SA 1UY7A 4V26A 4BIZA 4NH9A 4YKQA 3G7BA 2WI1A 2BTZA 3FV5A 3MNRP 2GFDA 4LWFA 4W7TA 1TC0A 3A0ZA 4LPBA 4HYMA 2IWUA 2XX4A 4URMA 4URLA 2HG1A 4AWOA 2YK2A 2YKBA 4K4OA 2YKEA 3CWVA 4E01A 4HY1A 4I3HA 4CWTA 2E0AA 1GKZA 2BU2A 1U2OA 3INWA 3GIFA 4QPJA 2YI7A 4NH8A 2CCUA 1I5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHH A;  3OPD A;  1R62 A;  1Y8O A;  4XCL A;  1I5B A;  1MU5 A;  4LWI A;  3RKZ A;  2XD6 A;  2Q8H A;  1UY8 A;  4R1F A;  5IN9 A;  4LWG A;  2Q8G A;  2XDL A;  4E00 A;  4CWP A;  4KSH A;  2BU8 A;  3R4P A;  4ASG A;  2ZBK B;  4WUD A;  1YT1 A;  2YK9 A;  3B27 A;  3T10 A;  5IDM A;  2Q8F A;  2XDU A;  4MBC A;  4ZKI A;  3PEH A;  4MPE A;  1S14 A;  3VHA A;  1KIJ A;  4AWP A;  4HXZ A;  4EGI A;  4B6C A;  1Z59 A;  5J71 A;  1U0Z A;  4I5S A;  2YJW A;  1YET A;  3Q5L A;  4DUH A;  1I58 A;  3ZXO A;  5D7R A;  5BOD A;  4XD8 A;  1UYH A;  2YE2 A;  3IED A;  1EI1 A;  2IOP A;  4CWS A;  4KFG A;  2WI4 A;  2XK2 A;  3KE6 A;  5M4H A;  2BU6 A;  1Y8N A;  4E02 A;  4LWE A;  3BMY A;  3B28 A;  2XHR A;  1ZXM A;  1ID0 A;  4R3A A;  4ZVI A;  4Q20 A;  3O6O A;  3QDD A;  4XCJ A;  1I5C A;  2YEH A;  5CTU A;  4JAV A;  4JAS A;  2IWS A;  3PEJ A;  1L0O A;  2ZDX A;  5FND A;  4HXW A;  3JZ3 A;  2BRE A;  4MPN A;  1TBW A;  1YC4 A;  3BM9 A;  4L90 A;  1ZW9 A;  4L91 A;  2BYH A;  1B63 A;  1UYG A;  2JKI A;  2QG0 A;  3LPS A;  4DZY A;  4FCP A;  3NMQ A;  2YI5 A;  4H81 A;  5FWK A;  4CWR A;  1A4H A;  4PU9 A;  1OSF A;  1UYM A;  2HKJ A;  3H80 A;  1AJ6 A;  2IOR A;  4JQL A;  2VWC A;  4KP4 A;  4EFT A;  2XAB A;  3TZ5 A;  2IOQ A;  2XX5 A;  2YEJ A;  1BXD A;  1UYE A;  4URO A;  4QPK A;  1YSR A;  3CRK A;  3ZKB A;  4BQJ A;  3TZ4 A;  2YGE A;  2QFO A;  2YI0 A;  4XE2 A;  2XDK A;  4O04 A;  2WI5 A;  4XIP A;  1GKX A;  2VW5 A;  1I5A A;  4PL9 A;  3OMU A;  2YEE A;  4WUC A;  4XKA A;  4BIU A;  5M4N A;  3DGE A;  5F5R A;  2BU5 A;  1QYE A;  2FYP A;  2VCI A;  4YKX A;  5J6A A;  4L8Z A;  2CGF A;  1TH8 A;  3OW6 A;  1NHI A;  1UY6 A;  2YE5 A;  4GEE A;  5CF0 A;  3INX A;  2YEG A;  4EMV A;  2XDS A;  2XJG A;  3A0W A;  3TUH A;  3CGZ A;  1AMW A;  4P8O A;  4KTN A;  4EGK A;  5M4P A;  3HYY A;  1PVG A;  4ASA A;  2PNR A;  5C93 A;  1UYI A;  2VCJ A;  1NHH A;  1UYF A;  2WI2 A;  3R4N A;  3EKO A;  5F3K A;  2CCT A;  4R3M A;  4MB9 A;  5CTX A;  4O0B A;  4XKO A;  3RLQ A;  3T0Z A;  3HYZ A;  4ASB A;  3WHA A;  2XCM A;  2QF6 A;  4GT8 A;  4X9L A;  1YER A;  3ZM7 A;  2XX2 A;  5L3J A;  2GQP A;  3EKR A;  4XIQ A;  2H8M A;  4XIT A;  3TZ2 A;  2BT0 A;  5BOC A;  1YC1 A;  4U7O A;  4EEH A;  4YKY A;  1BGQ A;  3OWB A;  2Q2E B;  3SL2 A;  3EHG A;  4NH7 A;  5CPH A;  3T2S A;  2CH4 A;  5D6Q A;  2YKC A;  3B25 A;  2YE7 A;  5D6P A;  3C0E A;  2YEC A;  1UYD A;  1YC3 A;  2YE4 A;  3ZXQ A;  5D7D A;  3WQ9 A;  2YGA A;  2YKI A;  3B26 A;  3QTF A;  1I59 A;  2YE8 A;  2YEI A;  4CWN A;  1ZWH A;  4O07 A;  4GFN A;  2YGF A;  1QZR A;  1AM1 A;  4LWH A;  3TTZ A;  4URN A;  1NHJ A;  2BSM A;  3D2R A;  3H4L A;  1Y8P A;  1Z5A A;  2CCS A;  3CGY A;  4ASF A;  1YSZ A;  2WI6 A;  1H7S A;  3RLR A;  4PRV A;  4YKU A;  3EHJ A;  3R4O A;  1B62 A;  3U2D A;  3HZ1 A;  4CWF A;  3R91 A;  1AH6 A;  2O1U A;  4HZ0 A;  4BAE A;  2WI3 A;  2YEA A;  2YEF A;  4XC0 A;  2EXL A;  4XIR A;  5FNF A;  4PRX A;  2XJJ A;  4BQG A;  4FCQ A;  4XKK A;  4YKT A;  2XJX A;  4MPC A;  3U67 A;  1AH8 A;  3O0I A;  2ZDY A;  2ZKJ A;  4JAU A;  2IWX A;  3D0B A;  3VHD A;  3GIG B;  3U2K A;  4H7Q A;  3LNU A;  1Z5B A;  4EM7 A;  2AKP A;  2YJX A;  4U7N A;  2O1V A;  3K97 A;  3R4M A;  2WEP A;  3GIG A;  2CG9 A;  2HCH A;  1TC6 A;  1TID A;  4V25 A;  4HY6 A;  5M4M A;  4KSG A;  4YKZ A;  3G7E A;  1QY8 A;  2UWD A;  2YE9 A;  3K98 A;  2YI6 A;  4YKR A;  1GJV A;  2XHT A;  2K5B A;  4BXI A;  4CWQ A;  4FMT A;  3TZ0 A;  3A0T A;  3A0R A;  3K99 A;  4MP7 A;  4YKW A;  4L93 A;  2BYI A;  3HHU A;  4CE1 A;  5FNC A;  3HZ5 A;  2BU7 A;  1Y4U A;  4HYP A;  3OWD A;  1BKN A;  2O1W A;  2FWY A;  5M4E A;  1YT0 A;  4AWQ A;  3Q5J A;  4LP0 A;  1YES A;  4FCR A;  4WUB A;  5IDJ A;  4XTJ A;  2BRC A;  3RLP A;  4GGL A;  3A0X A;  3VAD A;  3T0H A;  1UYK A;  4HZ5 A;  5CTY A;  1YT2 A;  4CE3 A;  3D36 A;  2YE6 A;  1ZXN A;  1UY9 A;  2BZ5 A;  1THN A;  3CRL A;  3R92 A;  2FWZ A;  4MOT A;  4KQV A;  5CTW A;  1EA6 A;  4B7P A;  4O09 A;  4L94 A;  4MP2 A;  1B3Q A;  4GQT A;  2YEB A;  2WEQ A;  3C11 A;  2FXS A;  4AS9 A;  3K60 A;  4CE2 A;  1UYL A;  3T1K A;  2H55 A;  2QG2 A;  3FT5 A;  1US7 A;  2C2A A;  3VHC A;  4U93 A;  1KZN A;  3GIE A;  4EFU A;  3B24 A;  2ESA A;  4XDM A;  2XHX A;  1S16 A;  4O05 A;  1TIL A;  1BYQ A;  1H7U A;  3ZKD A;  1YS3 A;  5GGZ A;  5D7C A;  3O2F A;  1Z5C A;  3G75 A;  5M4K A;  1UYC A;  2YE3 A;  3EHF A;  3FT8 A;  4GCZ A;  3HEK A;  4CWO A;  2JJC A;  3A0Y A;  4FPP A;  2WER A;  2YED A;  2Q8I A;  4EGH A;  1MX0 A;  4P7A A;  1JM6 A;  2YKJ A;  2XDX A;  4H85 A;  2WI7 A;  3Q5K A;  1Y4S A;  1UY7 A;  4V26 A;  4BIZ A;  4NH9 A;  4YKQ A;  3G7B A;  2WI1 A;  2BTZ A;  3FV5 A;  3MNR P;  2GFD A;  4LWF A;  4W7T A;  1TC0 A;  3A0Z A;  4LPB A;  4HYM A;  2IWU A;  2XX4 A;  4URM A;  4URL A;  2HG1 A;  4AWO A;  2YK2 A;  2YKB A;  4K4O A;  2YKE A;  3CWV A;  4E01 A;  4HY1 A;  4I3H A;  4CWT A;  2E0A A;  1GKZ A;  2BU2 A;  1U2O A;  3INW A;  3GIF A;  4QPJ A;  2YI7 A;  4NH8 A;  2CCU A;  1I5D A; 
#chains in the Genus database with same CATH topology
 3EHH A;  3OPD A;  1R62 A;  1Y8O A;  4XCL A;  1I5B A;  1MU5 A;  4LWI A;  3RKZ A;  2XD6 A;  2Q8H A;  1UY8 A;  4R1F A;  5IN9 A;  3S5T A;  4LWG A;  2Q8G A;  2XDL A;  4E00 A;  4CWP A;  4KSH A;  2BU8 A;  3R4P A;  4ASG A;  2ZBK B;  4WUD A;  1YT1 A;  2YK9 A;  3B27 A;  3T10 A;  5IDM A;  2Q8F A;  2XDU A;  4MBC A;  4ZKI A;  3PEH A;  4MPE A;  1S14 A;  3VHA A;  1KIJ A;  4AWP A;  4HXZ A;  4EGI A;  4B6C A;  1Z59 A;  5J71 A;  1U0Z A;  4I5S A;  2YJW A;  1YET A;  3Q5L A;  4DUH A;  1I58 A;  3ZXO A;  5D7R A;  5BOD A;  4XD8 A;  1UYH A;  2C1G A;  2YE2 A;  3IED A;  1EI1 A;  2IOP A;  4CWS A;  4KFG A;  2WI4 A;  2XK2 A;  3KE6 A;  5M4H A;  2BU6 A;  1Y8N A;  4E02 A;  4LWE A;  3BMY A;  3B28 A;  2XHR A;  1ZXM A;  1ID0 A;  4R3A A;  3CYG A;  4ZVI A;  4Q20 A;  3O6O A;  3QDD A;  4XCJ A;  1I5C A;  2YEH A;  5CTU A;  4JAV A;  4JAS A;  2IWS A;  3PEJ A;  1L0O A;  2ZDX A;  5FND A;  4HXW A;  3JZ3 A;  2BRE A;  4MPN A;  1TBW A;  1YC4 A;  3BM9 A;  4L90 A;  1ZW9 A;  4L91 A;  2BYH A;  1B63 A;  1UYG A;  2JKI A;  2QG0 A;  3LPS A;  4DZY A;  4FCP A;  3NMQ A;  2YI5 A;  4H81 A;  5FWK A;  4CWR A;  1A4H A;  4PU9 A;  1OSF A;  1UYM A;  2HKJ A;  1IXM A;  3H80 A;  1AJ6 A;  2IOR A;  4JQL A;  2VWC A;  4KP4 A;  4EFT A;  2XAB A;  3TZ5 A;  2IOQ A;  2XX5 A;  2YEJ A;  1BXD A;  1UYE A;  4URO A;  4QPK A;  1YSR A;  3CRK A;  3ZKB A;  4BQJ A;  3TZ4 A;  2YGE A;  2QFO A;  2YI0 A;  4XE2 A;  2XDK A;  4O04 A;  2WI5 A;  4XIP A;  1GKX A;  2VW5 A;  1I5A A;  4PL9 A;  3OMU A;  2YEE A;  4WUC A;  4XKA A;  4BIU A;  5M4N A;  3DGE A;  5F5R A;  2BU5 A;  1QYE A;  2FYP A;  2VCI A;  4YKX A;  5J6A A;  4L8Z A;  2CGF A;  1TH8 A;  3LMM A;  3OW6 A;  1NHI A;  1UY6 A;  2YE5 A;  4GEE A;  5CF0 A;  3INX A;  2YEG A;  4EMV A;  2XDS A;  2XJG A;  3A0W A;  3TUH A;  3CGZ A;  1AMW A;  4P8O A;  4KTN A;  4EGK A;  5M4P A;  3HYY A;  1PVG A;  4ASA A;  2PNR A;  5C93 A;  1UYI A;  2VCJ A;  1NHH A;  1UYF A;  2WI2 A;  3R4N A;  3EKO A;  5F3K A;  2CCT A;  4R3M A;  4MB9 A;  5CTX A;  4O0B A;  4XKO A;  3RLQ A;  3T0Z A;  3HYZ A;  4ASB A;  3WHA A;  2XCM A;  2QF6 A;  4GT8 A;  4X9L A;  1YER A;  3ZM7 A;  2XX2 A;  5L3J A;  2GQP A;  3EKR A;  4XIQ A;  2H8M A;  4XIT A;  3TZ2 A;  2BT0 A;  5BOC A;  1YC1 A;  4U7O A;  4EEH A;  4YKY A;  1BGQ A;  3OWB A;  2Q2E B;  3SL2 A;  3EHG A;  4NH7 A;  5CPH A;  3T2S A;  2CH4 A;  5D6Q A;  2YKC A;  3B25 A;  2YE7 A;  5D6P A;  3C0E A;  2YEC A;  1UYD A;  1YC3 A;  2YE4 A;  3ZXQ A;  5D7D A;  3WQ9 A;  2YGA A;  2YKI A;  3B26 A;  3QTF A;  1I59 A;  2YE8 A;  2YEI A;  4CWN A;  1ZWH A;  4O07 A;  4GFN A;  2YGF A;  1QZR A;  1AM1 A;  4LWH A;  3TTZ A;  4URN A;  1NHJ A;  2BSM A;  3D2R A;  3H4L A;  1Y8P A;  1Z5A A;  2CCS A;  3CGY A;  4ASF A;  1YSZ A;  2WI6 A;  1H7S A;  3RLR A;  4PRV A;  4YKU A;  3EHJ A;  3R4O A;  1B62 A;  3U2D A;  3HZ1 A;  4CWF A;  3R91 A;  1AH6 A;  2O1U A;  4HZ0 A;  4BAE A;  2WI3 A;  2YEA A;  2YEF A;  4XC0 A;  2EXL A;  4XIR A;  5FNF A;  4PRX A;  2XJJ A;  4BQG A;  4FCQ A;  4XKK A;  4YKT A;  2XJX A;  4MPC A;  2FTK A;  3U67 A;  1AH8 A;  3O0I A;  2ZDY A;  2ZKJ A;  4JAU A;  2IWX A;  3D0B A;  3VHD A;  3GIG B;  3U2K A;  4H7Q A;  3LNU A;  1Z5B A;  4EM7 A;  2AKP A;  2YJX A;  4U7N A;  2O1V A;  3K97 A;  3R4M A;  2WEP A;  3GIG A;  2CG9 A;  2HCH A;  1TC6 A;  1TID A;  4V25 A;  4HY6 A;  5M4M A;  4KSG A;  4YKZ A;  3G7E A;  1QY8 A;  2UWD A;  4E72 A;  2YE9 A;  3K98 A;  2YI6 A;  4YKR A;  1GJV A;  2XHT A;  2K5B A;  4BXI A;  4CWQ A;  4FMT A;  3TZ0 A;  5JEN A;  3A0T A;  3A0R A;  3K99 A;  4MP7 A;  4YKW A;  4L93 A;  2BYI A;  3HHU A;  4CE1 A;  5FNC A;  3HZ5 A;  2BU7 A;  1Y4U A;  4HYP A;  3OWD A;  1BKN A;  2O1W A;  2FWY A;  5M4E A;  1YT0 A;  4AWQ A;  3Q5J A;  4LP0 A;  1YES A;  4FCR A;  1F51 A;  4WUB A;  5IDJ A;  4XTJ A;  2BRC A;  3RLP A;  4GGL A;  3A0X A;  3VAD A;  3T0H A;  1UYK A;  4HZ5 A;  2C1I A;  5CTY A;  1YT2 A;  4CE3 A;  3D36 A;  2YE6 A;  1ZXN A;  1UY9 A;  2BZ5 A;  1THN A;  3CRL A;  3R92 A;  2FWZ A;  4MOT A;  4KQV A;  5CTW A;  1EA6 A;  4B7P A;  4O09 A;  4L94 A;  4MP2 A;  1B3Q A;  4GQT A;  2YEB A;  2WEQ A;  3C11 A;  2FXS A;  4AS9 A;  3K60 A;  4CE2 A;  1UYL A;  3T1K A;  2H55 A;  2QG2 A;  3FT5 A;  1US7 A;  2C2A A;  3VHC A;  4U93 A;  1KZN A;  3GIE A;  4EFU A;  3B24 A;  2ESA A;  4XDM A;  2XHX A;  1S16 A;  2HHI A;  4O05 A;  1TIL A;  1H7U A;  1BYQ A;  3ZKD A;  1YS3 A;  5GGZ A;  5D7C A;  3O2F A;  1Z5C A;  3G75 A;  5M4K A;  1UYC A;  2YE3 A;  3EHF A;  3FT8 A;  4GCZ A;  3HEK A;  4CWO A;  2JJC A;  3A0Y A;  4FPP A;  2WER A;  2YED A;  2Q8I A;  4EGH A;  1MX0 A;  4P7A A;  1JM6 A;  2YKJ A;  2XDX A;  4H85 A;  2WI7 A;  3Q5K A;  1Y4S A;  1UY7 A;  4V26 A;  4BIZ A;  4NH9 A;  4YKQ A;  3G7B A;  2WI1 A;  2BTZ A;  3FV5 A;  3MNR P;  2GFD A;  4LWF A;  4W7T A;  1TC0 A;  3A0Z A;  4LPB A;  4HYM A;  2IWU A;  2XX4 A;  4URM A;  4URL A;  2HG1 A;  4AWO A;  2YK2 A;  2YKB A;  4K4O A;  2YKE A;  3CWV A;  4E01 A;  4HY1 A;  4I3H A;  4CWT A;  2E0A A;  1GKZ A;  2BU2 A;  1U2O A;  3INW A;  3GIF A;  4QPJ A;  2YI7 A;  4NH8 A;  2CCU A;  1I5D A; 
#chains in the Genus database with same CATH homology
 3EHH A;  3OPD A;  1R62 A;  1Y8O A;  4XCL A;  1I5B A;  1MU5 A;  4LWI A;  3RKZ A;  2XD6 A;  2Q8H A;  1UY8 A;  4R1F A;  5IN9 A;  4LWG A;  2Q8G A;  2XDL A;  4E00 A;  4CWP A;  4KSH A;  2BU8 A;  3R4P A;  4ASG A;  2ZBK B;  4WUD A;  1YT1 A;  2YK9 A;  3B27 A;  3T10 A;  5IDM A;  2Q8F A;  2XDU A;  4MBC A;  4ZKI A;  3PEH A;  4MPE A;  1S14 A;  3VHA A;  1KIJ A;  4AWP A;  4HXZ A;  4EGI A;  4B6C A;  1Z59 A;  5J71 A;  1U0Z A;  4I5S A;  2YJW A;  1YET A;  3Q5L A;  4DUH A;  1I58 A;  3ZXO A;  5D7R A;  5BOD A;  4XD8 A;  1UYH A;  2YE2 A;  3IED A;  1EI1 A;  2IOP A;  4CWS A;  4KFG A;  2WI4 A;  2XK2 A;  3KE6 A;  5M4H A;  2BU6 A;  1Y8N A;  4E02 A;  4LWE A;  3BMY A;  3B28 A;  2XHR A;  1ZXM A;  1ID0 A;  4R3A A;  4ZVI A;  4Q20 A;  3O6O A;  3QDD A;  4XCJ A;  1I5C A;  2YEH A;  5CTU A;  4JAV A;  4JAS A;  2IWS A;  3PEJ A;  1L0O A;  2ZDX A;  5FND A;  4HXW A;  3JZ3 A;  2BRE A;  4MPN A;  1TBW A;  1YC4 A;  3BM9 A;  4L90 A;  1ZW9 A;  4L91 A;  2BYH A;  1B63 A;  1UYG A;  2JKI A;  2QG0 A;  3LPS A;  4DZY A;  4FCP A;  3NMQ A;  2YI5 A;  4H81 A;  5FWK A;  4CWR A;  1A4H A;  4PU9 A;  1OSF A;  1UYM A;  2HKJ A;  3H80 A;  1AJ6 A;  2IOR A;  4JQL A;  2VWC A;  4KP4 A;  4EFT A;  2XAB A;  3TZ5 A;  2IOQ A;  2XX5 A;  2YEJ A;  1BXD A;  1UYE A;  4URO A;  4QPK A;  1YSR A;  3CRK A;  3ZKB A;  4BQJ A;  3TZ4 A;  2YGE A;  2QFO A;  2YI0 A;  4XE2 A;  2XDK A;  4O04 A;  2WI5 A;  4XIP A;  1GKX A;  2VW5 A;  1I5A A;  4PL9 A;  3OMU A;  2YEE A;  4WUC A;  4XKA A;  4BIU A;  5M4N A;  3DGE A;  5F5R A;  2BU5 A;  1QYE A;  2FYP A;  2VCI A;  4YKX A;  5J6A A;  4L8Z A;  2CGF A;  1TH8 A;  3OW6 A;  1NHI A;  1UY6 A;  2YE5 A;  4GEE A;  5CF0 A;  3INX A;  2YEG A;  4EMV A;  2XDS A;  2XJG A;  3A0W A;  3TUH A;  3CGZ A;  1AMW A;  4P8O A;  4KTN A;  4EGK A;  5M4P A;  3HYY A;  1PVG A;  4ASA A;  2PNR A;  5C93 A;  1UYI A;  2VCJ A;  1NHH A;  1UYF A;  2WI2 A;  3R4N A;  3EKO A;  5F3K A;  2CCT A;  4R3M A;  4MB9 A;  5CTX A;  4O0B A;  4XKO A;  3RLQ A;  3T0Z A;  3HYZ A;  4ASB A;  3WHA A;  2XCM A;  2QF6 A;  4GT8 A;  4X9L A;  1YER A;  3ZM7 A;  2XX2 A;  5L3J A;  2GQP A;  3EKR A;  4XIQ A;  2H8M A;  4XIT A;  3TZ2 A;  2BT0 A;  5BOC A;  1YC1 A;  4U7O A;  4EEH A;  4YKY A;  1BGQ A;  3OWB A;  2Q2E B;  3SL2 A;  3EHG A;  4NH7 A;  5CPH A;  3T2S A;  2CH4 A;  5D6Q A;  2YKC A;  3B25 A;  2YE7 A;  5D6P A;  3C0E A;  2YEC A;  1UYD A;  1YC3 A;  2YE4 A;  3ZXQ A;  5D7D A;  3WQ9 A;  2YGA A;  2YKI A;  3B26 A;  3QTF A;  1I59 A;  2YE8 A;  2YEI A;  4CWN A;  1ZWH A;  4O07 A;  4GFN A;  2YGF A;  1QZR A;  1AM1 A;  4LWH A;  3TTZ A;  4URN A;  1NHJ A;  2BSM A;  3D2R A;  3H4L A;  1Y8P A;  1Z5A A;  2CCS A;  3CGY A;  4ASF A;  1YSZ A;  2WI6 A;  1H7S A;  3RLR A;  4PRV A;  4YKU A;  3EHJ A;  3R4O A;  1B62 A;  3U2D A;  3HZ1 A;  4CWF A;  3R91 A;  1AH6 A;  2O1U A;  4HZ0 A;  4BAE A;  2WI3 A;  2YEA A;  2YEF A;  4XC0 A;  2EXL A;  4XIR A;  5FNF A;  4PRX A;  2XJJ A;  4BQG A;  4FCQ A;  4XKK A;  4YKT A;  2XJX A;  4MPC A;  3U67 A;  1AH8 A;  3O0I A;  2ZDY A;  2ZKJ A;  4JAU A;  2IWX A;  3D0B A;  3VHD A;  3GIG B;  3U2K A;  4H7Q A;  3LNU A;  1Z5B A;  4EM7 A;  2AKP A;  2YJX A;  4U7N A;  2O1V A;  3K97 A;  3R4M A;  2WEP A;  3GIG A;  2CG9 A;  2HCH A;  1TC6 A;  1TID A;  4V25 A;  4HY6 A;  5M4M A;  4KSG A;  4YKZ A;  3G7E A;  1QY8 A;  2UWD A;  2YE9 A;  3K98 A;  2YI6 A;  4YKR A;  1GJV A;  2XHT A;  2K5B A;  4BXI A;  4CWQ A;  4FMT A;  3TZ0 A;  3A0T A;  3A0R A;  3K99 A;  4MP7 A;  4YKW A;  4L93 A;  2BYI A;  3HHU A;  4CE1 A;  5FNC A;  3HZ5 A;  2BU7 A;  1Y4U A;  4HYP A;  3OWD A;  1BKN A;  2O1W A;  2FWY A;  5M4E A;  1YT0 A;  4AWQ A;  3Q5J A;  4LP0 A;  1YES A;  4FCR A;  4WUB A;  5IDJ A;  4XTJ A;  2BRC A;  3RLP A;  4GGL A;  3A0X A;  3VAD A;  3T0H A;  1UYK A;  4HZ5 A;  5CTY A;  1YT2 A;  4CE3 A;  3D36 A;  2YE6 A;  1ZXN A;  1UY9 A;  2BZ5 A;  1THN A;  3CRL A;  3R92 A;  2FWZ A;  4MOT A;  4KQV A;  5CTW A;  1EA6 A;  4B7P A;  4O09 A;  4L94 A;  4MP2 A;  1B3Q A;  4GQT A;  2YEB A;  2WEQ A;  3C11 A;  2FXS A;  4AS9 A;  3K60 A;  4CE2 A;  1UYL A;  3T1K A;  2H55 A;  2QG2 A;  3FT5 A;  1US7 A;  2C2A A;  3VHC A;  4U93 A;  1KZN A;  3GIE A;  4EFU A;  3B24 A;  2ESA A;  4XDM A;  2XHX A;  1S16 A;  4O05 A;  1TIL A;  1BYQ A;  1H7U A;  3ZKD A;  1YS3 A;  5GGZ A;  5D7C A;  3O2F A;  1Z5C A;  3G75 A;  5M4K A;  1UYC A;  2YE3 A;  3EHF A;  3FT8 A;  4GCZ A;  3HEK A;  4CWO A;  2JJC A;  3A0Y A;  4FPP A;  2WER A;  2YED A;  2Q8I A;  4EGH A;  1MX0 A;  4P7A A;  1JM6 A;  2YKJ A;  2XDX A;  4H85 A;  2WI7 A;  3Q5K A;  1Y4S A;  1UY7 A;  4V26 A;  4BIZ A;  4NH9 A;  4YKQ A;  3G7B A;  2WI1 A;  2BTZ A;  3FV5 A;  3MNR P;  2GFD A;  4LWF A;  4W7T A;  1TC0 A;  3A0Z A;  4LPB A;  4HYM A;  2IWU A;  2XX4 A;  4URM A;  4URL A;  2HG1 A;  4AWO A;  2YK2 A;  2YKB A;  4K4O A;  2YKE A;  3CWV A;  4E01 A;  4HY1 A;  4I3H A;  4CWT A;  2E0A A;  1GKZ A;  2BU2 A;  1U2O A;  3INW A;  3GIF A;  4QPJ A;  2YI7 A;  4NH8 A;  2CCU A;  1I5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...