1I5DA

Structure of chea domain p4 in complex with tnp-atp
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
190
Chain Sequence
b'VMKIRMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein, transferase
total genus 46
structure length 190
sequence length 190
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i5dA00
3R4MA 4K4OA 3D36A 3C11A 2VWCA 4V26A 4CWFA 2YEHA 1I5DA 1UY8A 4URNA 3LPSA 2WI4A 3HZ1A 4AWOA 4YKRA 5IN9A 4KP4A 3A0TA 3R4NA 4B7PA 2BU8A 5FNCA 2JJCA 2UWDA 2BU2A 2WI2A 4HY6A 2E0AA 1MU5A 4YKUA 3GIGA 2H8MA 1ZW9A 4GCZA 1QYEA 2FWZA 4KQVA 2ZBKB 4BIZA 2XJGA 3TTZA 4HZ0A 1AJ6A 4CE3A 2YJWA 2YKEA 4XDMA 4HZ5A 3B24A 4LWEA 4ASBA 2YEGA 4QPKA 4EEHA 4JAUA 5CTYA 3WHAA 4WUDA 1I59A 3EKOA 4GEEA 4KTNA 2O1WA 2BTZA 2WERA 5FNFA 4GT8A 3ZKDA 4GFNA 5D7DA 2BU5A 1UYFA 1NHHA 4MBCA 2IOPA 2YECA 4PRVA 2QF6A 2BYHA 4LPBA 5C93A 4KFGA 1ZWHA 2ZDXA 2YEJA 2YEFA 2YEBA 3T2SA 2WI7A 2QFOA 4MPEA 2YE2A 3HHUA 4FCQA 4PU9A 3U67A 1ZXMA 3EHHA 4L91A 2VCIA 2YGEA 2CCUA 1S14A 4AWPA 2O1UA 5BODA 2WI3A 3VADA 4LP0A 4AWQA 1US7A 4LWIA 1QY8A 1BXDA 4L8ZA 2QG2A 2YKBA 1KZNA 2WEPA 4JAVA 1S16A 1ID0A 3TZ4A 4CWRA 3CRKA 4O09A 1AMWA 4O04A 2AKPA 3RLPA 2XJJA 4EGIA 2YE9A 4O07A 3HYZA 3K98A 4YKQA 4CWQA 2ZDYA 3VHCA 1UY7A 1BYQA 4QPJA 4WUBA 4URLA 3HZ5A 3KE6A 1U0ZA 4HYPA 3GIFA 1BKNA 1UYIA 4XIRA 1KIJA 3OMUA 1I5CA 3FT5A 3EHJA 4XCJA 5M4HA 3D2RA 4LWHA 2YI6A 3R92A 4V25A 1Y8NA 1Z5BA 1YT1A 2WI6A 1UYCA 3CGYA 3VHAA 3SL2A 3DGEA 2YEIA 3TZ2A 4U7NA 1QZRA 3G7EA 3B26A 5FWKA 3RLRA 4E02A 4CWPA 4UROA 3G7BA 1YETA 2Q2EB 5IDMA 4O05A 2YI0A 2BT0A 4R3AA 3TUHA 4XE2A 2CGFA 2BU6A 2XK2A 4MPCA 2C2AA 1TH8A 1YC4A 4NH7A 1JM6A 4BAEA 1GJVA 3CWVA 1UYGA 4EFUA 1YS3A 2XABA 4XITA 2XDLA 1I5BA 3BM9A 1YC1A 3B27A 5CF0A 4L93A 1BGQA 2WI5A 2O1VA 3T10A 1UYLA 4NH8A 4U93A 1NHIA 5J71A 1UY6A 1OSFA 4H85A 2ESAA 4P7AA 4XKKA 3R91A 4CE2A 4EFTA 3Q5KA 3A0WA 3R4PA 3FT8A 3RKZA 4B6CA 5BOCA 1UYKA 2JKIA 5L3JA 4CE1A 4HY1A 4H7QA 2BSMA 1A4HA 4E01A 1Z59A 4XC0A 3MNRP 4CWOA 3RLQA 4BXIA 2FYPA 1THNA 5D7RA 5FNDA 1I5AA 4GGLA 4YKYA 1L0OA 2BU7A 4YKTA 2BREA 3H80A 2YKCA 2YI5A 2CG9A 3LNUA 4DUHA 3R4OA 3A0YA 3TZ0A 3Q5JA 1B3QA 4I3HA 4XTJA 3EKRA 4W7TA 3ZXOA 2CCTA 4ZVIA 4LWFA 4L94A 2YE4A 2IWUA 4BQGA 3O6OA 1I58A 4XKAA 2YGAA 3EHGA 2Q8GA 1TC6A 2YE6A 5CTWA 1YERA 2GFDA 4O0BA 3Q5LA 3B25A 2ZKJA 3C0EA 3U2DA 1U2OA 4JASA 4PRXA 3NMQA 5IDJA 4CWTA 4NH9A 3B28A 3VHDA 3H4LA 2Q8IA 5M4MA 4YKZA 5D6QA 3ZKBA 4WUCA 1EA6A 3D0BA 4CWSA 1YT2A 4U7OA 1ZXNA 4FCRA 3QTFA 2XX2A 5D7CA 4AS9A 2YE5A 3IEDA 2VW5A 3GIGB 4XCLA 3T0HA 2CH4A 2XDKA 2YI7A 2H55A 1GKXA 3QDDA 4PL9A 5CTXA 3HYYA 1GKZA 5M4EA 2FWYA 2YE8A 2HKJA 4ASAA 3ZM7A 2BZ5A 4YKWA 2XX4A 1H7UA 1YESA 1YSZA 4Q20A 3K99A 2YEEA 3PEJA 3ZXQA 1YT0A 3BMYA 3K60A 5F3KA 5D6PA 2XD6A 4EM7A 5M4PA 1R62A 4MPNA 1Y4SA 4MB9A 5GGZA 2YEAA 2YE7A 5CPHA 1TIDA 2YK9A 5F5RA 3T0ZA 3A0RA 3OW6A 5M4KA 1UYMA 2IOQA 2HG1A 3OPDA 4HYMA 1B63A 1AH8A 2XHRA 3GIEA 2YE3A 1UYDA 4DZYA 2BRCA 2YKIA 2GQPA 2Q8FA 3WQ9A 3A0XA 3EHFA 1UYEA 4FMTA 4BIUA 2VCJA 2XDUA 1UYHA 4URMA 1Z5CA 3K97A 2HCHA 4P8OA 4KSHA 1NHJA 2XDXA 2WEQA 1YSRA 3OWBA 4XIPA 4I5SA 4KSGA 4ASGA 2CCSA 2BYIA 2YKJA 4JQLA 2YEDA 1Z5AA 2K5BA 3G75A 1B62A 2EXLA 1H7SA 1PVGA 1TBWA 3INWA 4EMVA 4H81A 4YKXA 4ASFA 3T1KA 4GQTA 4MP7A 4R3MA 2XHTA 3PEHA 5M4NA 1Y8OA 2YGFA 4HXZA 4EGKA 4XKOA 1AM1A 4FCPA 4BQJA 4EGHA 3FV5A 1Y4UA 4XIQA 1TC0A 2PNRA 2QG0A 4MOTA 4HXWA 3JZ3A 4FPPA 3A0ZA 1UY9A 1AH6A 4L90A 2IORA 2XHXA 2YJXA 4XD8A 3TZ5A 4E00A 2FXSA 3O0IA 2XX5A 3OWDA 5J6AA 4LWGA 3CRLA 4X9LA 2XCMA 3CGZA 2Q8HA 2IWXA 3HEKA 3INXA 4CWNA 2YK2A 3U2KA 1TILA 2WI1A 1MX0A 1EI1A 1Y8PA 3O2FA 4R1FA 4ZKIA 2IWSA 1YC3A 2XDSA 4MP2A 2XJXA 5CTUA
chains in the Genus database with same CATH superfamily
3R4MA 4K4OA 3D36A 3C11A 2VWCA 4V26A 4CWFA 2YEHA 1I5DA 1UY8A 4URNA 4E72A 3LPSA 2WI4A 3HZ1A 4AWOA 4YKRA 5IN9A 4KP4A 3A0TA 3R4NA 4B7PA 2BU8A 5FNCA 2JJCA 2UWDA 2BU2A 2WI2A 4HY6A 2E0AA 1MU5A 4YKUA 3GIGA 2H8MA 1ZW9A 4GCZA 1QYEA 2FWZA 4KQVA 2ZBKB 4BIZA 2XJGA 3TTZA 4HZ0A 1AJ6A 4CE3A 2YJWA 2YKEA 4XDMA 4HZ5A 3B24A 4LWEA 4ASBA 2YEGA 4QPKA 4EEHA 4JAUA 5CTYA 3WHAA 4WUDA 1I59A 3EKOA 4GEEA 4KTNA 2O1WA 2BTZA 2WERA 5FNFA 4GT8A 3ZKDA 4GFNA 5D7DA 2BU5A 1UYFA 1NHHA 4MBCA 2IOPA 2YECA 4PRVA 2QF6A 2BYHA 4LPBA 5C93A 4KFGA 1ZWHA 2ZDXA 2YEJA 2YEFA 2YEBA 3T2SA 2WI7A 2QFOA 4MPEA 2YE2A 3HHUA 4FCQA 4PU9A 3U67A 1ZXMA 3EHHA 4L91A 2VCIA 2YGEA 2CCUA 1S14A 4AWPA 2O1UA 5BODA 2WI3A 3LMMA 3VADA 4LP0A 4AWQA 1US7A 4LWIA 1QY8A 1BXDA 4L8ZA 2QG2A 2YKBA 1KZNA 2WEPA 4JAVA 1S16A 1ID0A 3TZ4A 4CWRA 3CRKA 4O09A 1AMWA 4O04A 2AKPA 3RLPA 2XJJA 4EGIA 2YE9A 4O07A 3HYZA 3K98A 4YKQA 4CWQA 2ZDYA 3VHCA 1UY7A 1BYQA 4QPJA 4WUBA 4URLA 3HZ5A 3KE6A 1U0ZA 4HYPA 3GIFA 1BKNA 1UYIA 4XIRA 1KIJA 3OMUA 1I5CA 3FT5A 3EHJA 4XCJA 5M4HA 3D2RA 4LWHA 2YI6A 3R92A 3CYGA 4V25A 1Y8NA 1Z5BA 1YT1A 2WI6A 1UYCA 3CGYA 3VHAA 3SL2A 3DGEA 2YEIA 3TZ2A 4U7NA 1QZRA 3G7EA 3B26A 5FWKA 3RLRA 4E02A 4CWPA 4UROA 3G7BA 1YETA 2Q2EB 5IDMA 4O05A 2YI0A 2BT0A 4R3AA 3TUHA 4XE2A 2CGFA 2BU6A 2XK2A 4MPCA 2C2AA 1TH8A 1YC4A 4NH7A 1JM6A 4BAEA 1GJVA 3CWVA 1UYGA 4EFUA 1YS3A 2XABA 4XITA 2XDLA 1I5BA 3BM9A 1YC1A 3B27A 5CF0A 4L93A 1BGQA 2WI5A 2O1VA 3T10A 1UYLA 4NH8A 4U93A 1NHIA 5J71A 1UY6A 1OSFA 4H85A 2ESAA 4P7AA 4XKKA 3R91A 4CE2A 4EFTA 2FTKA 3A0WA 3Q5KA 3R4PA 3FT8A 3RKZA 4B6CA 5BOCA 1UYKA 2JKIA 5L3JA 4CE1A 4HY1A 4H7QA 2BSMA 1A4HA 4E01A 1Z59A 4XC0A 3MNRP 4CWOA 3RLQA 4BXIA 2FYPA 1THNA 5D7RA 5FNDA 1I5AA 4GGLA 4YKYA 1L0OA 2BU7A 4YKTA 2BREA 3H80A 2YKCA 2YI5A 2CG9A 3LNUA 4DUHA 3R4OA 3A0YA 3TZ0A 3Q5JA 1B3QA 4I3HA 4XTJA 3EKRA 4W7TA 3ZXOA 2CCTA 4ZVIA 4LWFA 4L94A 2YE4A 2IWUA 4BQGA 3O6OA 1I58A 4XKAA 2YGAA 3EHGA 2Q8GA 1TC6A 2YE6A 5CTWA 1YERA 3S5TA 2GFDA 4O0BA 3Q5LA 3B25A 2ZKJA 3C0EA 3U2DA 1U2OA 4JASA 4PRXA 3NMQA 5IDJA 4CWTA 4NH9A 3B28A 3VHDA 3H4LA 2Q8IA 5M4MA 4YKZA 5D6QA 3ZKBA 4WUCA 1EA6A 3D0BA 4CWSA 1YT2A 4U7OA 1ZXNA 4FCRA 3QTFA 2XX2A 5D7CA 4AS9A 2YE5A 3IEDA 2VW5A 3GIGB 4XCLA 3T0HA 2CH4A 2XDKA 2YI7A 2H55A 1GKXA 3QDDA 4PL9A 5CTXA 3HYYA 1GKZA 5M4EA 2FWYA 2YE8A 2HKJA 4ASAA 3ZM7A 2BZ5A 4YKWA 2XX4A 1H7UA 1YESA 1YSZA 4Q20A 3K99A 2YEEA 3PEJA 3ZXQA 1YT0A 3BMYA 3K60A 5F3KA 5D6PA 2XD6A 4EM7A 5M4PA 1R62A 4MPNA 1Y4SA 2C1IA 4MB9A 5GGZA 2YEAA 2YE7A 5CPHA 1TIDA 2YK9A 5F5RA 3T0ZA 3A0RA 3OW6A 5M4KA 1UYMA 2IOQA 2HG1A 3OPDA 4HYMA 1B63A 1AH8A 2XHRA 3GIEA 2YE3A 1UYDA 4DZYA 2BRCA 2YKIA 2GQPA 2Q8FA 3WQ9A 3A0XA 2HHIA 1UYEA 3EHFA 4FMTA 4BIUA 2VCJA 2XDUA 1UYHA 4URMA 1Z5CA 3K97A 2HCHA 4P8OA 4KSHA 1NHJA 2XDXA 2WEQA 1YSRA 3OWBA 4XIPA 4I5SA 4KSGA 4ASGA 2CCSA 2BYIA 2YKJA 4JQLA 2YEDA 1Z5AA 2K5BA 3G75A 1B62A 2EXLA 1H7SA 1PVGA 1TBWA 3INWA 4EMVA 2C1GA 4H81A 4YKXA 4ASFA 3T1KA 4GQTA 4MP7A 4R3MA 2XHTA 3PEHA 5M4NA 1Y8OA 2YGFA 4HXZA 4EGKA 4XKOA 1AM1A 4FCPA 4BQJA 4EGHA 3FV5A 1Y4UA 4XIQA 1TC0A 2PNRA 2QG0A 4MOTA 4HXWA 3JZ3A 4FPPA 3A0ZA 1UY9A 1AH6A 4L90A 2IORA 2XHXA 1IXMA 2YJXA 4XD8A 3TZ5A 4E00A 2FXSA 3O0IA 2XX5A 3OWDA 5J6AA 4LWGA 3CRLA 5JENA 4X9LA 2XCMA 3CGZA 2Q8HA 2IWXA 3HEKA 3INXA 4CWNA 2YK2A 3U2KA 1TILA 2WI1A 1MX0A 1F51A 1EI1A 1Y8PA 3O2FA 4R1FA 4ZKIA 2IWSA 1YC3A 2XDSA 4MP2A 2XJXA 5CTUA
chains in the Genus database with same CATH topology
3R4MA 4K4OA 3D36A 3C11A 2VWCA 4V26A 4CWFA 2YEHA 1I5DA 1UY8A 4URNA 3LPSA 2WI4A 3HZ1A 4AWOA 4YKRA 5IN9A 4KP4A 3A0TA 3R4NA 4B7PA 2BU8A 5FNCA 2JJCA 2UWDA 2BU2A 2WI2A 4HY6A 2E0AA 1MU5A 4YKUA 3GIGA 2H8MA 1ZW9A 4GCZA 1QYEA 2FWZA 4KQVA 2ZBKB 4BIZA 2XJGA 3TTZA 4HZ0A 1AJ6A 4CE3A 2YJWA 2YKEA 4XDMA 4HZ5A 3B24A 4LWEA 4ASBA 2YEGA 4QPKA 4EEHA 4JAUA 5CTYA 3WHAA 4WUDA 1I59A 3EKOA 4GEEA 4KTNA 2O1WA 2BTZA 2WERA 5FNFA 4GT8A 3ZKDA 4GFNA 5D7DA 2BU5A 1UYFA 1NHHA 4MBCA 2IOPA 2YECA 4PRVA 2QF6A 2BYHA 4LPBA 5C93A 4KFGA 1ZWHA 2ZDXA 2YEJA 2YEFA 2YEBA 3T2SA 2WI7A 2QFOA 4MPEA 2YE2A 3HHUA 4FCQA 4PU9A 3U67A 1ZXMA 3EHHA 4L91A 2VCIA 2YGEA 2CCUA 1S14A 4AWPA 2O1UA 5BODA 2WI3A 3VADA 4LP0A 4AWQA 1US7A 4LWIA 1QY8A 1BXDA 4L8ZA 2QG2A 2YKBA 1KZNA 2WEPA 4JAVA 1S16A 1ID0A 3TZ4A 4CWRA 3CRKA 4O09A 1AMWA 4O04A 2AKPA 3RLPA 2XJJA 4EGIA 2YE9A 4O07A 3HYZA 3K98A 4YKQA 4CWQA 2ZDYA 3VHCA 1UY7A 1BYQA 4QPJA 4WUBA 4URLA 3HZ5A 3KE6A 1U0ZA 4HYPA 3GIFA 1BKNA 1UYIA 4XIRA 1KIJA 3OMUA 1I5CA 3FT5A 3EHJA 4XCJA 5M4HA 3D2RA 4LWHA 2YI6A 3R92A 4V25A 1Y8NA 1Z5BA 1YT1A 2WI6A 1UYCA 3CGYA 3VHAA 3SL2A 3DGEA 2YEIA 3TZ2A 4U7NA 1QZRA 3G7EA 3B26A 5FWKA 3RLRA 4E02A 4CWPA 4UROA 3G7BA 1YETA 2Q2EB 5IDMA 4O05A 2YI0A 2BT0A 4R3AA 3TUHA 4XE2A 2CGFA 2BU6A 2XK2A 4MPCA 2C2AA 1TH8A 1YC4A 4NH7A 1JM6A 4BAEA 1GJVA 3CWVA 1UYGA 4EFUA 1YS3A 2XABA 4XITA 2XDLA 1I5BA 3BM9A 1YC1A 3B27A 5CF0A 4L93A 1BGQA 2WI5A 2O1VA 3T10A 1UYLA 4NH8A 4U93A 1NHIA 5J71A 1UY6A 1OSFA 4H85A 2ESAA 4P7AA 4XKKA 3R91A 4CE2A 4EFTA 3Q5KA 3A0WA 3R4PA 3FT8A 3RKZA 4B6CA 5BOCA 1UYKA 2JKIA 5L3JA 4CE1A 4HY1A 4H7QA 2BSMA 1A4HA 4E01A 1Z59A 4XC0A 3MNRP 4CWOA 3RLQA 4BXIA 2FYPA 1THNA 5D7RA 5FNDA 1I5AA 4GGLA 4YKYA 1L0OA 2BU7A 4YKTA 2BREA 3H80A 2YKCA 2YI5A 2CG9A 3LNUA 4DUHA 3R4OA 3A0YA 3TZ0A 3Q5JA 1B3QA 4I3HA 4XTJA 3EKRA 4W7TA 3ZXOA 2CCTA 4ZVIA 4LWFA 4L94A 2YE4A 2IWUA 4BQGA 3O6OA 1I58A 4XKAA 2YGAA 3EHGA 2Q8GA 1TC6A 2YE6A 5CTWA 1YERA 2GFDA 4O0BA 3Q5LA 3B25A 2ZKJA 3C0EA 3U2DA 1U2OA 4JASA 4PRXA 3NMQA 5IDJA 4CWTA 4NH9A 3B28A 3VHDA 3H4LA 2Q8IA 5M4MA 4YKZA 5D6QA 3ZKBA 4WUCA 1EA6A 3D0BA 4CWSA 1YT2A 4U7OA 1ZXNA 4FCRA 3QTFA 2XX2A 5D7CA 4AS9A 2YE5A 3IEDA 2VW5A 3GIGB 4XCLA 3T0HA 2CH4A 2XDKA 2YI7A 2H55A 1GKXA 3QDDA 4PL9A 5CTXA 3HYYA 1GKZA 5M4EA 2FWYA 2YE8A 2HKJA 4ASAA 3ZM7A 2BZ5A 4YKWA 2XX4A 1H7UA 1YESA 1YSZA 4Q20A 3K99A 2YEEA 3PEJA 3ZXQA 1YT0A 3BMYA 3K60A 5F3KA 5D6PA 2XD6A 4EM7A 5M4PA 1R62A 4MPNA 1Y4SA 4MB9A 5GGZA 2YEAA 2YE7A 5CPHA 1TIDA 2YK9A 5F5RA 3T0ZA 3A0RA 3OW6A 5M4KA 1UYMA 2IOQA 2HG1A 3OPDA 4HYMA 1B63A 1AH8A 2XHRA 3GIEA 2YE3A 1UYDA 4DZYA 2BRCA 2YKIA 2GQPA 2Q8FA 3WQ9A 3A0XA 3EHFA 1UYEA 4FMTA 4BIUA 2VCJA 2XDUA 1UYHA 4URMA 1Z5CA 3K97A 2HCHA 4P8OA 4KSHA 1NHJA 2XDXA 2WEQA 1YSRA 3OWBA 4XIPA 4I5SA 4KSGA 4ASGA 2CCSA 2BYIA 2YKJA 4JQLA 2YEDA 1Z5AA 2K5BA 3G75A 1B62A 2EXLA 1H7SA 1PVGA 1TBWA 3INWA 4EMVA 4H81A 4YKXA 4ASFA 3T1KA 4GQTA 4MP7A 4R3MA 2XHTA 3PEHA 5M4NA 1Y8OA 2YGFA 4HXZA 4EGKA 4XKOA 1AM1A 4FCPA 4BQJA 4EGHA 3FV5A 1Y4UA 4XIQA 1TC0A 2PNRA 2QG0A 4MOTA 4HXWA 3JZ3A 4FPPA 3A0ZA 1UY9A 1AH6A 4L90A 2IORA 2XHXA 2YJXA 4XD8A 3TZ5A 4E00A 2FXSA 3O0IA 2XX5A 3OWDA 5J6AA 4LWGA 3CRLA 4X9LA 2XCMA 3CGZA 2Q8HA 2IWXA 3HEKA 3INXA 4CWNA 2YK2A 3U2KA 1TILA 2WI1A 1MX0A 1EI1A 1Y8PA 3O2FA 4R1FA 4ZKIA 2IWSA 1YC3A 2XDSA 4MP2A 2XJXA 5CTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R4M A;  4K4O A;  3D36 A;  3C11 A;  2VWC A;  4V26 A;  4CWF A;  2YEH A;  1I5D A;  1UY8 A;  4URN A;  3LPS A;  2WI4 A;  3HZ1 A;  4AWO A;  4YKR A;  5IN9 A;  4KP4 A;  3A0T A;  3R4N A;  4B7P A;  2BU8 A;  5FNC A;  2JJC A;  2UWD A;  2BU2 A;  2WI2 A;  4HY6 A;  2E0A A;  1MU5 A;  4YKU A;  3GIG A;  2H8M A;  1ZW9 A;  4GCZ A;  1QYE A;  2FWZ A;  4KQV A;  2ZBK B;  4BIZ A;  2XJG A;  3TTZ A;  4HZ0 A;  1AJ6 A;  4CE3 A;  2YJW A;  2YKE A;  4XDM A;  4HZ5 A;  3B24 A;  4LWE A;  4ASB A;  2YEG A;  4QPK A;  4EEH A;  4JAU A;  5CTY A;  3WHA A;  4WUD A;  1I59 A;  3EKO A;  4GEE A;  4KTN A;  2O1W A;  2BTZ A;  2WER A;  5FNF A;  4GT8 A;  3ZKD A;  4GFN A;  5D7D A;  2BU5 A;  1UYF A;  1NHH A;  4MBC A;  2IOP A;  2YEC A;  4PRV A;  2QF6 A;  2BYH A;  4LPB A;  5C93 A;  4KFG A;  1ZWH A;  2ZDX A;  2YEJ A;  2YEF A;  2YEB A;  3T2S A;  2WI7 A;  2QFO A;  4MPE A;  2YE2 A;  3HHU A;  4FCQ A;  4PU9 A;  3U67 A;  1ZXM A;  3EHH A;  4L91 A;  2VCI A;  2YGE A;  2CCU A;  1S14 A;  4AWP A;  2O1U A;  5BOD A;  2WI3 A;  3VAD A;  4LP0 A;  4AWQ A;  1US7 A;  4LWI A;  1QY8 A;  1BXD A;  4L8Z A;  2QG2 A;  2YKB A;  1KZN A;  2WEP A;  4JAV A;  1S16 A;  1ID0 A;  3TZ4 A;  4CWR A;  3CRK A;  4O09 A;  1AMW A;  4O04 A;  2AKP A;  3RLP A;  2XJJ A;  4EGI A;  2YE9 A;  4O07 A;  3HYZ A;  3K98 A;  4YKQ A;  4CWQ A;  2ZDY A;  3VHC A;  1UY7 A;  1BYQ A;  4QPJ A;  4WUB A;  4URL A;  3HZ5 A;  3KE6 A;  1U0Z A;  4HYP A;  3GIF A;  1BKN A;  1UYI A;  4XIR A;  1KIJ A;  3OMU A;  1I5C A;  3FT5 A;  3EHJ A;  4XCJ A;  5M4H A;  3D2R A;  4LWH A;  2YI6 A;  3R92 A;  4V25 A;  1Y8N A;  1Z5B A;  1YT1 A;  2WI6 A;  1UYC A;  3CGY A;  3VHA A;  3SL2 A;  3DGE A;  2YEI A;  3TZ2 A;  4U7N A;  1QZR A;  3G7E A;  3B26 A;  5FWK A;  3RLR A;  4E02 A;  4CWP A;  4URO A;  3G7B A;  1YET A;  2Q2E B;  5IDM A;  4O05 A;  2YI0 A;  2BT0 A;  4R3A A;  3TUH A;  4XE2 A;  2CGF A;  2BU6 A;  2XK2 A;  4MPC A;  2C2A A;  1TH8 A;  1YC4 A;  4NH7 A;  1JM6 A;  4BAE A;  1GJV A;  3CWV A;  1UYG A;  4EFU A;  1YS3 A;  2XAB A;  4XIT A;  2XDL A;  1I5B A;  3BM9 A;  1YC1 A;  3B27 A;  5CF0 A;  4L93 A;  1BGQ A;  2WI5 A;  2O1V A;  3T10 A;  1UYL A;  4NH8 A;  4U93 A;  1NHI A;  5J71 A;  1UY6 A;  1OSF A;  4H85 A;  2ESA A;  4P7A A;  4XKK A;  3R91 A;  4CE2 A;  4EFT A;  3Q5K A;  3A0W A;  3R4P A;  3FT8 A;  3RKZ A;  4B6C A;  5BOC A;  1UYK A;  2JKI A;  5L3J A;  4CE1 A;  4HY1 A;  4H7Q A;  2BSM A;  1A4H A;  4E01 A;  1Z59 A;  4XC0 A;  3MNR P;  4CWO A;  3RLQ A;  4BXI A;  2FYP A;  1THN A;  5D7R A;  5FND A;  1I5A A;  4GGL A;  4YKY A;  1L0O A;  2BU7 A;  4YKT A;  2BRE A;  3H80 A;  2YKC A;  2YI5 A;  2CG9 A;  3LNU A;  4DUH A;  3R4O A;  3A0Y A;  3TZ0 A;  3Q5J A;  1B3Q A;  4I3H A;  4XTJ A;  3EKR A;  4W7T A;  3ZXO A;  2CCT A;  4ZVI A;  4LWF A;  4L94 A;  2YE4 A;  2IWU A;  4BQG A;  3O6O A;  1I58 A;  4XKA A;  2YGA A;  3EHG A;  2Q8G A;  1TC6 A;  2YE6 A;  5CTW A;  1YER A;  2GFD A;  4O0B A;  3Q5L A;  3B25 A;  2ZKJ A;  3C0E A;  3U2D A;  1U2O A;  4JAS A;  4PRX A;  3NMQ A;  5IDJ A;  4CWT A;  4NH9 A;  3B28 A;  3VHD A;  3H4L A;  2Q8I A;  5M4M A;  4YKZ A;  5D6Q A;  3ZKB A;  4WUC A;  1EA6 A;  3D0B A;  4CWS A;  1YT2 A;  4U7O A;  1ZXN A;  4FCR A;  3QTF A;  2XX2 A;  5D7C A;  4AS9 A;  2YE5 A;  3IED A;  2VW5 A;  3GIG B;  4XCL A;  3T0H A;  2CH4 A;  2XDK A;  2YI7 A;  2H55 A;  1GKX A;  3QDD A;  4PL9 A;  5CTX A;  3HYY A;  1GKZ A;  5M4E A;  2FWY A;  2YE8 A;  2HKJ A;  4ASA A;  3ZM7 A;  2BZ5 A;  4YKW A;  2XX4 A;  1H7U A;  1YES A;  1YSZ A;  4Q20 A;  3K99 A;  2YEE A;  3PEJ A;  3ZXQ A;  1YT0 A;  3BMY A;  3K60 A;  5F3K A;  5D6P A;  2XD6 A;  4EM7 A;  5M4P A;  1R62 A;  4MPN A;  1Y4S A;  4MB9 A;  5GGZ A;  2YEA A;  2YE7 A;  5CPH A;  1TID A;  2YK9 A;  5F5R A;  3T0Z A;  3A0R A;  3OW6 A;  5M4K A;  1UYM A;  2IOQ A;  2HG1 A;  3OPD A;  4HYM A;  1B63 A;  1AH8 A;  2XHR A;  3GIE A;  2YE3 A;  1UYD A;  4DZY A;  2BRC A;  2YKI A;  2GQP A;  2Q8F A;  3WQ9 A;  3A0X A;  3EHF A;  1UYE A;  4FMT A;  4BIU A;  2VCJ A;  2XDU A;  1UYH A;  4URM A;  1Z5C A;  3K97 A;  2HCH A;  4P8O A;  4KSH A;  1NHJ A;  2XDX A;  2WEQ A;  1YSR A;  3OWB A;  4XIP A;  4I5S A;  4KSG A;  4ASG A;  2CCS A;  2BYI A;  2YKJ A;  4JQL A;  2YED A;  1Z5A A;  2K5B A;  3G75 A;  1B62 A;  2EXL A;  1H7S A;  1PVG A;  1TBW A;  3INW A;  4EMV A;  4H81 A;  4YKX A;  4ASF A;  3T1K A;  4GQT A;  4MP7 A;  4R3M A;  2XHT A;  3PEH A;  5M4N A;  1Y8O A;  2YGF A;  4HXZ A;  4EGK A;  4XKO A;  1AM1 A;  4FCP A;  4BQJ A;  4EGH A;  3FV5 A;  1Y4U A;  4XIQ A;  1TC0 A;  2PNR A;  2QG0 A;  4MOT A;  4HXW A;  3JZ3 A;  4FPP A;  3A0Z A;  1UY9 A;  1AH6 A;  4L90 A;  2IOR A;  2XHX A;  2YJX A;  4XD8 A;  3TZ5 A;  4E00 A;  2FXS A;  3O0I A;  2XX5 A;  3OWD A;  5J6A A;  4LWG A;  3CRL A;  4X9L A;  2XCM A;  3CGZ A;  2Q8H A;  2IWX A;  3HEK A;  3INX A;  4CWN A;  2YK2 A;  3U2K A;  1TIL A;  2WI1 A;  1MX0 A;  1EI1 A;  1Y8P A;  3O2F A;  4R1F A;  4ZKI A;  2IWS A;  1YC3 A;  2XDS A;  4MP2 A;  2XJX A;  5CTU A; 
#chains in the Genus database with same CATH topology
 3R4M A;  4K4O A;  3D36 A;  3C11 A;  2VWC A;  4V26 A;  4CWF A;  2YEH A;  1I5D A;  1UY8 A;  4URN A;  4E72 A;  3LPS A;  2WI4 A;  3HZ1 A;  4AWO A;  4YKR A;  5IN9 A;  4KP4 A;  3A0T A;  3R4N A;  4B7P A;  2BU8 A;  5FNC A;  2JJC A;  2UWD A;  2BU2 A;  2WI2 A;  4HY6 A;  2E0A A;  1MU5 A;  4YKU A;  3GIG A;  2H8M A;  1ZW9 A;  4GCZ A;  1QYE A;  2FWZ A;  4KQV A;  2ZBK B;  4BIZ A;  2XJG A;  3TTZ A;  4HZ0 A;  1AJ6 A;  4CE3 A;  2YJW A;  2YKE A;  4XDM A;  4HZ5 A;  3B24 A;  4LWE A;  4ASB A;  2YEG A;  4QPK A;  4EEH A;  4JAU A;  5CTY A;  3WHA A;  4WUD A;  1I59 A;  3EKO A;  4GEE A;  4KTN A;  2O1W A;  2BTZ A;  2WER A;  5FNF A;  4GT8 A;  3ZKD A;  4GFN A;  5D7D A;  2BU5 A;  1UYF A;  1NHH A;  4MBC A;  2IOP A;  2YEC A;  4PRV A;  2QF6 A;  2BYH A;  4LPB A;  5C93 A;  4KFG A;  1ZWH A;  2ZDX A;  2YEJ A;  2YEF A;  2YEB A;  3T2S A;  2WI7 A;  2QFO A;  4MPE A;  2YE2 A;  3HHU A;  4FCQ A;  4PU9 A;  3U67 A;  1ZXM A;  3EHH A;  4L91 A;  2VCI A;  2YGE A;  2CCU A;  1S14 A;  4AWP A;  2O1U A;  5BOD A;  2WI3 A;  3LMM A;  3VAD A;  4LP0 A;  4AWQ A;  1US7 A;  4LWI A;  1QY8 A;  1BXD A;  4L8Z A;  2QG2 A;  2YKB A;  1KZN A;  2WEP A;  4JAV A;  1S16 A;  1ID0 A;  3TZ4 A;  4CWR A;  3CRK A;  4O09 A;  1AMW A;  4O04 A;  2AKP A;  3RLP A;  2XJJ A;  4EGI A;  2YE9 A;  4O07 A;  3HYZ A;  3K98 A;  4YKQ A;  4CWQ A;  2ZDY A;  3VHC A;  1UY7 A;  1BYQ A;  4QPJ A;  4WUB A;  4URL A;  3HZ5 A;  3KE6 A;  1U0Z A;  4HYP A;  3GIF A;  1BKN A;  1UYI A;  4XIR A;  1KIJ A;  3OMU A;  1I5C A;  3FT5 A;  3EHJ A;  4XCJ A;  5M4H A;  3D2R A;  4LWH A;  2YI6 A;  3R92 A;  3CYG A;  4V25 A;  1Y8N A;  1Z5B A;  1YT1 A;  2WI6 A;  1UYC A;  3CGY A;  3VHA A;  3SL2 A;  3DGE A;  2YEI A;  3TZ2 A;  4U7N A;  1QZR A;  3G7E A;  3B26 A;  5FWK A;  3RLR A;  4E02 A;  4CWP A;  4URO A;  3G7B A;  1YET A;  2Q2E B;  5IDM A;  4O05 A;  2YI0 A;  2BT0 A;  4R3A A;  3TUH A;  4XE2 A;  2CGF A;  2BU6 A;  2XK2 A;  4MPC A;  2C2A A;  1TH8 A;  1YC4 A;  4NH7 A;  1JM6 A;  4BAE A;  1GJV A;  3CWV A;  1UYG A;  4EFU A;  1YS3 A;  2XAB A;  4XIT A;  2XDL A;  1I5B A;  3BM9 A;  1YC1 A;  3B27 A;  5CF0 A;  4L93 A;  1BGQ A;  2WI5 A;  2O1V A;  3T10 A;  1UYL A;  4NH8 A;  4U93 A;  1NHI A;  5J71 A;  1UY6 A;  1OSF A;  4H85 A;  2ESA A;  4P7A A;  4XKK A;  3R91 A;  4CE2 A;  4EFT A;  2FTK A;  3A0W A;  3Q5K A;  3R4P A;  3FT8 A;  3RKZ A;  4B6C A;  5BOC A;  1UYK A;  2JKI A;  5L3J A;  4CE1 A;  4HY1 A;  4H7Q A;  2BSM A;  1A4H A;  4E01 A;  1Z59 A;  4XC0 A;  3MNR P;  4CWO A;  3RLQ A;  4BXI A;  2FYP A;  1THN A;  5D7R A;  5FND A;  1I5A A;  4GGL A;  4YKY A;  1L0O A;  2BU7 A;  4YKT A;  2BRE A;  3H80 A;  2YKC A;  2YI5 A;  2CG9 A;  3LNU A;  4DUH A;  3R4O A;  3A0Y A;  3TZ0 A;  3Q5J A;  1B3Q A;  4I3H A;  4XTJ A;  3EKR A;  4W7T A;  3ZXO A;  2CCT A;  4ZVI A;  4LWF A;  4L94 A;  2YE4 A;  2IWU A;  4BQG A;  3O6O A;  1I58 A;  4XKA A;  2YGA A;  3EHG A;  2Q8G A;  1TC6 A;  2YE6 A;  5CTW A;  1YER A;  3S5T A;  2GFD A;  4O0B A;  3Q5L A;  3B25 A;  2ZKJ A;  3C0E A;  3U2D A;  1U2O A;  4JAS A;  4PRX A;  3NMQ A;  5IDJ A;  4CWT A;  4NH9 A;  3B28 A;  3VHD A;  3H4L A;  2Q8I A;  5M4M A;  4YKZ A;  5D6Q A;  3ZKB A;  4WUC A;  1EA6 A;  3D0B A;  4CWS A;  1YT2 A;  4U7O A;  1ZXN A;  4FCR A;  3QTF A;  2XX2 A;  5D7C A;  4AS9 A;  2YE5 A;  3IED A;  2VW5 A;  3GIG B;  4XCL A;  3T0H A;  2CH4 A;  2XDK A;  2YI7 A;  2H55 A;  1GKX A;  3QDD A;  4PL9 A;  5CTX A;  3HYY A;  1GKZ A;  5M4E A;  2FWY A;  2YE8 A;  2HKJ A;  4ASA A;  3ZM7 A;  2BZ5 A;  4YKW A;  2XX4 A;  1H7U A;  1YES A;  1YSZ A;  4Q20 A;  3K99 A;  2YEE A;  3PEJ A;  3ZXQ A;  1YT0 A;  3BMY A;  3K60 A;  5F3K A;  5D6P A;  2XD6 A;  4EM7 A;  5M4P A;  1R62 A;  4MPN A;  1Y4S A;  2C1I A;  4MB9 A;  5GGZ A;  2YEA A;  2YE7 A;  5CPH A;  1TID A;  2YK9 A;  5F5R A;  3T0Z A;  3A0R A;  3OW6 A;  5M4K A;  1UYM A;  2IOQ A;  2HG1 A;  3OPD A;  4HYM A;  1B63 A;  1AH8 A;  2XHR A;  3GIE A;  2YE3 A;  1UYD A;  4DZY A;  2BRC A;  2YKI A;  2GQP A;  2Q8F A;  3WQ9 A;  3A0X A;  2HHI A;  1UYE A;  3EHF A;  4FMT A;  4BIU A;  2VCJ A;  2XDU A;  1UYH A;  4URM A;  1Z5C A;  3K97 A;  2HCH A;  4P8O A;  4KSH A;  1NHJ A;  2XDX A;  2WEQ A;  1YSR A;  3OWB A;  4XIP A;  4I5S A;  4KSG A;  4ASG A;  2CCS A;  2BYI A;  2YKJ A;  4JQL A;  2YED A;  1Z5A A;  2K5B A;  3G75 A;  1B62 A;  2EXL A;  1H7S A;  1PVG A;  1TBW A;  3INW A;  4EMV A;  2C1G A;  4H81 A;  4YKX A;  4ASF A;  3T1K A;  4GQT A;  4MP7 A;  4R3M A;  2XHT A;  3PEH A;  5M4N A;  1Y8O A;  2YGF A;  4HXZ A;  4EGK A;  4XKO A;  1AM1 A;  4FCP A;  4BQJ A;  4EGH A;  3FV5 A;  1Y4U A;  4XIQ A;  1TC0 A;  2PNR A;  2QG0 A;  4MOT A;  4HXW A;  3JZ3 A;  4FPP A;  3A0Z A;  1UY9 A;  1AH6 A;  4L90 A;  2IOR A;  2XHX A;  1IXM A;  2YJX A;  4XD8 A;  3TZ5 A;  4E00 A;  2FXS A;  3O0I A;  2XX5 A;  3OWD A;  5J6A A;  4LWG A;  3CRL A;  5JEN A;  4X9L A;  2XCM A;  3CGZ A;  2Q8H A;  2IWX A;  3HEK A;  3INX A;  4CWN A;  2YK2 A;  3U2K A;  1TIL A;  2WI1 A;  1MX0 A;  1F51 A;  1EI1 A;  1Y8P A;  3O2F A;  4R1F A;  4ZKI A;  2IWS A;  1YC3 A;  2XDS A;  4MP2 A;  2XJX A;  5CTU A; 
#chains in the Genus database with same CATH homology
 3R4M A;  4K4O A;  3D36 A;  3C11 A;  2VWC A;  4V26 A;  4CWF A;  2YEH A;  1I5D A;  1UY8 A;  4URN A;  3LPS A;  2WI4 A;  3HZ1 A;  4AWO A;  4YKR A;  5IN9 A;  4KP4 A;  3A0T A;  3R4N A;  4B7P A;  2BU8 A;  5FNC A;  2JJC A;  2UWD A;  2BU2 A;  2WI2 A;  4HY6 A;  2E0A A;  1MU5 A;  4YKU A;  3GIG A;  2H8M A;  1ZW9 A;  4GCZ A;  1QYE A;  2FWZ A;  4KQV A;  2ZBK B;  4BIZ A;  2XJG A;  3TTZ A;  4HZ0 A;  1AJ6 A;  4CE3 A;  2YJW A;  2YKE A;  4XDM A;  4HZ5 A;  3B24 A;  4LWE A;  4ASB A;  2YEG A;  4QPK A;  4EEH A;  4JAU A;  5CTY A;  3WHA A;  4WUD A;  1I59 A;  3EKO A;  4GEE A;  4KTN A;  2O1W A;  2BTZ A;  2WER A;  5FNF A;  4GT8 A;  3ZKD A;  4GFN A;  5D7D A;  2BU5 A;  1UYF A;  1NHH A;  4MBC A;  2IOP A;  2YEC A;  4PRV A;  2QF6 A;  2BYH A;  4LPB A;  5C93 A;  4KFG A;  1ZWH A;  2ZDX A;  2YEJ A;  2YEF A;  2YEB A;  3T2S A;  2WI7 A;  2QFO A;  4MPE A;  2YE2 A;  3HHU A;  4FCQ A;  4PU9 A;  3U67 A;  1ZXM A;  3EHH A;  4L91 A;  2VCI A;  2YGE A;  2CCU A;  1S14 A;  4AWP A;  2O1U A;  5BOD A;  2WI3 A;  3VAD A;  4LP0 A;  4AWQ A;  1US7 A;  4LWI A;  1QY8 A;  1BXD A;  4L8Z A;  2QG2 A;  2YKB A;  1KZN A;  2WEP A;  4JAV A;  1S16 A;  1ID0 A;  3TZ4 A;  4CWR A;  3CRK A;  4O09 A;  1AMW A;  4O04 A;  2AKP A;  3RLP A;  2XJJ A;  4EGI A;  2YE9 A;  4O07 A;  3HYZ A;  3K98 A;  4YKQ A;  4CWQ A;  2ZDY A;  3VHC A;  1UY7 A;  1BYQ A;  4QPJ A;  4WUB A;  4URL A;  3HZ5 A;  3KE6 A;  1U0Z A;  4HYP A;  3GIF A;  1BKN A;  1UYI A;  4XIR A;  1KIJ A;  3OMU A;  1I5C A;  3FT5 A;  3EHJ A;  4XCJ A;  5M4H A;  3D2R A;  4LWH A;  2YI6 A;  3R92 A;  4V25 A;  1Y8N A;  1Z5B A;  1YT1 A;  2WI6 A;  1UYC A;  3CGY A;  3VHA A;  3SL2 A;  3DGE A;  2YEI A;  3TZ2 A;  4U7N A;  1QZR A;  3G7E A;  3B26 A;  5FWK A;  3RLR A;  4E02 A;  4CWP A;  4URO A;  3G7B A;  1YET A;  2Q2E B;  5IDM A;  4O05 A;  2YI0 A;  2BT0 A;  4R3A A;  3TUH A;  4XE2 A;  2CGF A;  2BU6 A;  2XK2 A;  4MPC A;  2C2A A;  1TH8 A;  1YC4 A;  4NH7 A;  1JM6 A;  4BAE A;  1GJV A;  3CWV A;  1UYG A;  4EFU A;  1YS3 A;  2XAB A;  4XIT A;  2XDL A;  1I5B A;  3BM9 A;  1YC1 A;  3B27 A;  5CF0 A;  4L93 A;  1BGQ A;  2WI5 A;  2O1V A;  3T10 A;  1UYL A;  4NH8 A;  4U93 A;  1NHI A;  5J71 A;  1UY6 A;  1OSF A;  4H85 A;  2ESA A;  4P7A A;  4XKK A;  3R91 A;  4CE2 A;  4EFT A;  3Q5K A;  3A0W A;  3R4P A;  3FT8 A;  3RKZ A;  4B6C A;  5BOC A;  1UYK A;  2JKI A;  5L3J A;  4CE1 A;  4HY1 A;  4H7Q A;  2BSM A;  1A4H A;  4E01 A;  1Z59 A;  4XC0 A;  3MNR P;  4CWO A;  3RLQ A;  4BXI A;  2FYP A;  1THN A;  5D7R A;  5FND A;  1I5A A;  4GGL A;  4YKY A;  1L0O A;  2BU7 A;  4YKT A;  2BRE A;  3H80 A;  2YKC A;  2YI5 A;  2CG9 A;  3LNU A;  4DUH A;  3R4O A;  3A0Y A;  3TZ0 A;  3Q5J A;  1B3Q A;  4I3H A;  4XTJ A;  3EKR A;  4W7T A;  3ZXO A;  2CCT A;  4ZVI A;  4LWF A;  4L94 A;  2YE4 A;  2IWU A;  4BQG A;  3O6O A;  1I58 A;  4XKA A;  2YGA A;  3EHG A;  2Q8G A;  1TC6 A;  2YE6 A;  5CTW A;  1YER A;  2GFD A;  4O0B A;  3Q5L A;  3B25 A;  2ZKJ A;  3C0E A;  3U2D A;  1U2O A;  4JAS A;  4PRX A;  3NMQ A;  5IDJ A;  4CWT A;  4NH9 A;  3B28 A;  3VHD A;  3H4L A;  2Q8I A;  5M4M A;  4YKZ A;  5D6Q A;  3ZKB A;  4WUC A;  1EA6 A;  3D0B A;  4CWS A;  1YT2 A;  4U7O A;  1ZXN A;  4FCR A;  3QTF A;  2XX2 A;  5D7C A;  4AS9 A;  2YE5 A;  3IED A;  2VW5 A;  3GIG B;  4XCL A;  3T0H A;  2CH4 A;  2XDK A;  2YI7 A;  2H55 A;  1GKX A;  3QDD A;  4PL9 A;  5CTX A;  3HYY A;  1GKZ A;  5M4E A;  2FWY A;  2YE8 A;  2HKJ A;  4ASA A;  3ZM7 A;  2BZ5 A;  4YKW A;  2XX4 A;  1H7U A;  1YES A;  1YSZ A;  4Q20 A;  3K99 A;  2YEE A;  3PEJ A;  3ZXQ A;  1YT0 A;  3BMY A;  3K60 A;  5F3K A;  5D6P A;  2XD6 A;  4EM7 A;  5M4P A;  1R62 A;  4MPN A;  1Y4S A;  4MB9 A;  5GGZ A;  2YEA A;  2YE7 A;  5CPH A;  1TID A;  2YK9 A;  5F5R A;  3T0Z A;  3A0R A;  3OW6 A;  5M4K A;  1UYM A;  2IOQ A;  2HG1 A;  3OPD A;  4HYM A;  1B63 A;  1AH8 A;  2XHR A;  3GIE A;  2YE3 A;  1UYD A;  4DZY A;  2BRC A;  2YKI A;  2GQP A;  2Q8F A;  3WQ9 A;  3A0X A;  3EHF A;  1UYE A;  4FMT A;  4BIU A;  2VCJ A;  2XDU A;  1UYH A;  4URM A;  1Z5C A;  3K97 A;  2HCH A;  4P8O A;  4KSH A;  1NHJ A;  2XDX A;  2WEQ A;  1YSR A;  3OWB A;  4XIP A;  4I5S A;  4KSG A;  4ASG A;  2CCS A;  2BYI A;  2YKJ A;  4JQL A;  2YED A;  1Z5A A;  2K5B A;  3G75 A;  1B62 A;  2EXL A;  1H7S A;  1PVG A;  1TBW A;  3INW A;  4EMV A;  4H81 A;  4YKX A;  4ASF A;  3T1K A;  4GQT A;  4MP7 A;  4R3M A;  2XHT A;  3PEH A;  5M4N A;  1Y8O A;  2YGF A;  4HXZ A;  4EGK A;  4XKO A;  1AM1 A;  4FCP A;  4BQJ A;  4EGH A;  3FV5 A;  1Y4U A;  4XIQ A;  1TC0 A;  2PNR A;  2QG0 A;  4MOT A;  4HXW A;  3JZ3 A;  4FPP A;  3A0Z A;  1UY9 A;  1AH6 A;  4L90 A;  2IOR A;  2XHX A;  2YJX A;  4XD8 A;  3TZ5 A;  4E00 A;  2FXS A;  3O0I A;  2XX5 A;  3OWD A;  5J6A A;  4LWG A;  3CRL A;  4X9L A;  2XCM A;  3CGZ A;  2Q8H A;  2IWX A;  3HEK A;  3INX A;  4CWN A;  2YK2 A;  3U2K A;  1TIL A;  2WI1 A;  1MX0 A;  1EI1 A;  1Y8P A;  3O2F A;  4R1F A;  4ZKI A;  2IWS A;  1YC3 A;  2XDS A;  4MP2 A;  2XJX A;  5CTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...