1I5DA

Structure of chea domain p4 in complex with tnp-atp
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
190
Chain Sequence
VMKIRMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein, transferase
total genus 46
structure length 190
sequence length 190
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i5dA00
3EKRA 2FXSA 1B63A 3TZ2A 3TUHA 5D7DA 1YESA 2WERA 1BYQA 1ZXMA 1QZRA 2YEIA 2YEBA 2YKJA 2XHTA 3C11A 4GFNA 4XE2A 5J6AA 2YEGA 3IEDA 1YC3A 3D36A 1YERA 2WI2A 3KE6A 2BYIA 4GT8A 2QG2A 4KSHA 5D7CA 4ASBA 4XKKA 2XX2A 2YJXA 4PU9A 2IOQA 4MPNA 4HZ0A 2BU8A 5CTWA 1H7UA 4YKQA 3INWA 4R3MA 5M4MA 3QTFA 2YI5A 3GIEA 3FV5A 4XCJA 3T1KA 2XABA 3T0HA 4CWFA 1I58A 3A0RA 4BIZA 4XKOA 4MOTA 3R4NA 4AWOA 2IOPA 3O6OA 2YEHA 2Q8HA 2XJXA 4DUHA 3A0YA 3HYZA 1UYCA 4E00A 4I5SA 3EKOA 4V26A 5CF0A 2PNRA 4UROA 2YECA 4ASGA 1JM6A 4EFUA 5D6QA 1UY6A 2VWCA 3VHDA 2WI4A 4ASFA 4XCLA 4W7TA 2YE9A 4WUBA 1YC4A 4MB9A 4FPPA 2ZBKB 2Q8IA 3K98A 4LWFA 4FCQA 4AWQA 2FWYA 3HZ5A 4H85A 1BGQA 5D6PA 3HHUA 1B62A 4YKZA 2WI1A 2Q8GA 5D7RA 2E0AA 1H7SA 2XJJA 3RLQA 2XDXA 3HZ1A 4BXIA 3EHGA 2IWSA 2QF6A 4AWPA 3A0XA 1UYKA 4HXZA 4KFGA 3OW6A 1KZNA 1UYIA 4XC0A 3ZXOA 1GJVA 5BODA 2QFOA 1Y4UA 3DGEA 1Y8NA 2YEJA 2BZ5A 5M4PA 3GIGB 2YEEA 1UY7A 1QY8A 4GQTA 2XDSA 4GGLA 3T2SA 1UY8A 3G7EA 5M4HA 1I5BA 4ZVIA 2O1UA 4JASA 3B27A 4CWOA 4O04A 4LWEA 2XHRA 3SL2A 1ZXNA 3B25A 4L93A 3PEJA 1MX0A 3CWVA 3U2DA 4XITA 4WUCA 2YEDA 4EM7A 2YKIA 2CCTA 3ZKBA 1Z5BA 1I59A 2CCUA 2XX4A 3CGYA 2WEPA 5M4NA 4O09A 4O07A 4MP7A 1R62A 4Q20A 3GIFA 2YE4A 4O05A 2YI6A 3CRLA 3Q5LA 4URMA 3EHHA 2VW5A 4EGIA 3HYYA 4PL9A 2H55A 2XDKA 3B28A 2YE2A 2YI0A 2XHXA 4XKAA 4I3HA 3BM9A 1UYHA 3K99A 3EHFA 3D2RA 3RLRA 1BXDA 5IDMA 1AMWA 3MNRP 4CWTA 1YT1A 2IWXA 4CWSA 4H7QA 1QYEA 3TZ4A 3H80A 2BTZA 4BQGA 3C0EA 4CWQA 3VHCA 4BAEA 1B3QA 4U93A 1Z5AA 3O2FA 3OWBA 2CGFA 2XCMA 4CE2A 5F3KA 2O1VA 3CGZA 5CTXA 4P7AA 1MU5A 2CCSA 1U2OA 2XDUA 1TBWA 2XX5A 4HYMA 4MP2A 2XD6A 4P8OA 2YGFA 4YKYA 3T0ZA 4PRVA 3GIGA 1US7A 4YKTA 1YSZA 4YKRA 5FNDA 4EMVA 4R1FA 2ZDXA 4CE1A 4FCRA 3B26A 3R91A 2GFDA 3LNUA 1UYGA 1GKZA 3A0ZA 5CPHA 3A0TA 4CWPA 4LPBA 3VHAA 1AM1A 4B7PA 3LPSA 3K97A 2Q8FA 1L0OA 2CH4A 1ZW9A 2BU7A 1UYLA 2YGEA 2YKEA 4WUDA 2EXLA 3ZKDA 1PVGA 5FWKA 1TIDA 4QPJA 4CWRA 3Q5JA 3OMUA 1Y8PA 3CRKA 5FNCA 2O1WA 3R4OA 1TC0A 4CE3A 4L94A 4JQLA 1I5AA 3WHAA 1AH6A 2IORA 2HKJA 4L90A 3B24A 1UYFA 4U7OA 2BU6A 4GEEA 5GGZA 5M4KA 3D0BA 4MBCA 4XD8A 3ZXQA 1YT2A 5CTUA 1UYMA 2WI3A 1THNA 2WI7A 1YC1A 3BMYA 2ESAA 2UWDA 4LWGA 1I5CA 4AS9A 2JKIA 3NMQA 4XIPA 1Z59A 2YK2A 1UYDA 4JAVA 4LWHA 4BIUA 2C2AA 3FT8A 1TILA 2WEQA 1AH8A 1OSFA 4NH8A 4ZKIA 5FNFA 1EI1A 3WQ9A 5C93A 3G75A 2GQPA 3K60A 4X9LA 1YS3A 2YKCA 1Y8OA 4B6CA 5J71A 4CWNA 4QPKA 2XDLA 5CTYA 3HEKA 1YETA 2AKPA 3H4LA 4HZ5A 4L91A 4LP0A 4MPCA 4XIQA 2BYHA 4EGKA 2YEAA 4EFTA 4L8ZA 2YE7A 4ASAA 1BKNA 1YT0A 1NHIA 4HXWA 4PRXA 4URNA 3PEHA 3R4MA 4KQVA 2BU5A 1Z5CA 3JZ3A 3RLPA 2QG0A 4KTNA 2Q2EB 1ZWHA 3VADA 4XDMA 4E01A 1A4HA 1EA6A 3QDDA 2BSMA 3A0WA 4BQJA 4EEHA 4E02A 2BRCA 2YE5A 4GCZA 3T10A 4FCPA 2XJGA 4YKWA 1UYEA 2H8MA 4U7NA 3OPDA 2BREA 2YGAA 2ZKJA 4HY1A 2YJWA 2FYPA 1YSRA 5IN9A 4LWIA 5M4EA 2IWUA 2YKBA 3ZM7A 5F5RA 2BU2A 1S16A 3O0IA 4HY6A 4JAUA 3U2KA 2VCIA 3R92A 2YE6A 3TZ5A 2K5BA 5L3JA 1I5DA 2BT0A 4O0BA 3FT5A 3TTZA 2YK9A 2CG9A 2ZDYA 3OWDA 4R3AA 4HYPA 2YEFA 3INXA 4NH7A 4XIRA 4DZYA 2FWZA 4K4OA 2HCHA 4H81A 2HG1A 1TH8A 2VCJA 4XTJA 3Q5KA 2YE8A 1Y4SA 1U0ZA 2WI5A 1TC6A 1NHJA 2WI6A 2XK2A 3R4PA 1NHHA 4V25A 4URLA 2YI7A 4MPEA 3TZ0A 4YKUA 4FMTA 4KP4A 3RKZA 5BOCA 3G7BA 4NH9A 1AJ6A 4YKXA 1KIJA 2YE3A 5IDJA 1ID0A 1S14A 4EGHA 3EHJA 1UY9A 3U67A 2JJCA 1GKXA 4KSGA
chains in the Genus database with same CATH superfamily
3EKRA 2FXSA 1B63A 3TZ2A 3TUHA 5D7DA 1YESA 2WERA 1BYQA 1ZXMA 1QZRA 2YEIA 2YEBA 2YKJA 2XHTA 3C11A 4GFNA 4XE2A 5J6AA 2YEGA 3IEDA 1YC3A 3D36A 1YERA 2WI2A 3KE6A 2BYIA 4GT8A 2QG2A 4KSHA 5D7CA 4ASBA 4XKKA 2XX2A 2YJXA 4PU9A 2IOQA 4MPNA 4HZ0A 2BU8A 5CTWA 1H7UA 4YKQA 3INWA 4R3MA 5M4MA 3QTFA 2YI5A 3GIEA 3FV5A 4XCJA 3T1KA 2XABA 3T0HA 4CWFA 1I58A 3LMMA 3A0RA 4BIZA 4XKOA 4MOTA 3R4NA 4AWOA 2IOPA 3O6OA 2YEHA 2Q8HA 2XJXA 4DUHA 3A0YA 3HYZA 1UYCA 4E00A 4I5SA 3EKOA 4V26A 5CF0A 2PNRA 4UROA 2YECA 4ASGA 1JM6A 4EFUA 5D6QA 2FTKA 1UY6A 2VWCA 3VHDA 2WI4A 4ASFA 4XCLA 4W7TA 2YE9A 4WUBA 1YC4A 4MB9A 4FPPA 2ZBKB 2Q8IA 3K98A 4LWFA 4FCQA 4AWQA 2FWYA 3HZ5A 4H85A 1BGQA 5D6PA 3HHUA 1B62A 4YKZA 2WI1A 2Q8GA 5D7RA 2E0AA 1H7SA 2XJJA 3RLQA 2XDXA 3HZ1A 4BXIA 3EHGA 2IWSA 2QF6A 4AWPA 3A0XA 1UYKA 4HXZA 4KFGA 3OW6A 1KZNA 1UYIA 4XC0A 3ZXOA 1GJVA 5BODA 2QFOA 1Y4UA 3DGEA 1Y8NA 2YEJA 2BZ5A 5M4PA 3GIGB 2YEEA 1F51A 1UY7A 4E72A 1QY8A 4GQTA 2XDSA 4GGLA 3T2SA 1UY8A 3G7EA 5M4HA 1I5BA 4ZVIA 2O1UA 4JASA 3B27A 4CWOA 4O04A 4LWEA 2XHRA 3SL2A 1ZXNA 3B25A 4L93A 3PEJA 1MX0A 3CWVA 3U2DA 4XITA 4WUCA 2YEDA 4EM7A 2YKIA 2CCTA 3ZKBA 1Z5BA 1I59A 2CCUA 2XX4A 3CGYA 1IXMA 2WEPA 5M4NA 4O09A 4O07A 4MP7A 1R62A 4Q20A 3GIFA 2YE4A 4O05A 2YI6A 3CRLA 3Q5LA 4URMA 3EHHA 2VW5A 4EGIA 3HYYA 2C1IA 4PL9A 2H55A 2XDKA 3B28A 2YE2A 2YI0A 2XHXA 4XKAA 4I3HA 3BM9A 1UYHA 3K99A 3EHFA 3D2RA 3RLRA 1BXDA 5IDMA 1AMWA 3MNRP 4CWTA 1YT1A 2IWXA 4CWSA 4H7QA 1QYEA 3TZ4A 3H80A 2BTZA 4BQGA 3C0EA 4CWQA 3VHCA 4BAEA 1B3QA 4U93A 1Z5AA 3O2FA 3OWBA 2CGFA 2XCMA 4CE2A 5F3KA 2O1VA 3CGZA 5CTXA 4P7AA 1MU5A 2CCSA 1U2OA 2XDUA 1TBWA 2XX5A 4HYMA 4MP2A 2XD6A 4P8OA 2YGFA 4YKYA 3T0ZA 4PRVA 3GIGA 1US7A 4YKTA 1YSZA 4YKRA 5FNDA 4EMVA 4R1FA 2ZDXA 4CE1A 4FCRA 3B26A 3R91A 2GFDA 3LNUA 1UYGA 1GKZA 3A0ZA 5CPHA 3A0TA 4CWPA 2C1GA 4LPBA 3VHAA 1AM1A 4B7PA 3LPSA 3K97A 2Q8FA 1L0OA 2CH4A 1ZW9A 2BU7A 1UYLA 2YGEA 2YKEA 4WUDA 2EXLA 3ZKDA 1PVGA 5FWKA 1TIDA 4QPJA 4CWRA 3Q5JA 3OMUA 1Y8PA 3CRKA 5FNCA 2O1WA 3R4OA 1TC0A 4CE3A 4L94A 4JQLA 1I5AA 3WHAA 1AH6A 2IORA 2HKJA 5JENA 4L90A 3B24A 1UYFA 4U7OA 2BU6A 4GEEA 5GGZA 5M4KA 3D0BA 4MBCA 4XD8A 3ZXQA 1YT2A 5CTUA 1UYMA 2WI3A 1THNA 2WI7A 1YC1A 3BMYA 2ESAA 2UWDA 4LWGA 1I5CA 4AS9A 2JKIA 3NMQA 4XIPA 1Z59A 2YK2A 1UYDA 4JAVA 4LWHA 4BIUA 2C2AA 3FT8A 1TILA 2WEQA 1AH8A 1OSFA 4NH8A 4ZKIA 5FNFA 1EI1A 3WQ9A 5C93A 3G75A 2GQPA 3K60A 4X9LA 1YS3A 2YKCA 1Y8OA 4B6CA 5J71A 4CWNA 4QPKA 3S5TA 2XDLA 5CTYA 3HEKA 1YETA 2AKPA 3H4LA 4HZ5A 4L91A 4LP0A 4MPCA 4XIQA 2BYHA 4EGKA 2YEAA 4EFTA 4L8ZA 2YE7A 4ASAA 1BKNA 1YT0A 1NHIA 4HXWA 4PRXA 4URNA 3PEHA 3R4MA 4KQVA 2BU5A 1Z5CA 3JZ3A 3RLPA 2QG0A 4KTNA 2Q2EB 1ZWHA 3VADA 4XDMA 4E01A 1A4HA 1EA6A 3QDDA 2BSMA 3A0WA 4BQJA 4EEHA 4E02A 2BRCA 2YE5A 4GCZA 3T10A 4FCPA 2XJGA 4YKWA 1UYEA 2HHIA 2H8MA 4U7NA 3OPDA 2BREA 2YGAA 2ZKJA 4HY1A 2YJWA 2FYPA 1YSRA 5IN9A 4LWIA 5M4EA 2IWUA 2YKBA 3ZM7A 5F5RA 2BU2A 1S16A 3O0IA 4HY6A 4JAUA 3U2KA 2VCIA 3R92A 2YE6A 3TZ5A 2K5BA 5L3JA 1I5DA 2BT0A 4O0BA 3FT5A 3TTZA 2YK9A 2CG9A 2ZDYA 3OWDA 4R3AA 4HYPA 2YEFA 3INXA 4NH7A 4XIRA 4DZYA 2FWZA 4K4OA 2HCHA 4H81A 2HG1A 1TH8A 2VCJA 3CYGA 4XTJA 3Q5KA 2YE8A 1Y4SA 1U0ZA 2WI5A 1TC6A 1NHJA 2WI6A 2XK2A 3R4PA 1NHHA 4V25A 4URLA 2YI7A 4MPEA 3TZ0A 4YKUA 4FMTA 4KP4A 3RKZA 5BOCA 3G7BA 4NH9A 1AJ6A 4YKXA 1KIJA 2YE3A 5IDJA 1ID0A 1S14A 4EGHA 3EHJA 1UY9A 3U67A 2JJCA 1GKXA 4KSGA
chains in the Genus database with same CATH topology
3EKRA 2FXSA 1B63A 3TZ2A 3TUHA 5D7DA 1YESA 2WERA 1BYQA 1ZXMA 1QZRA 2YEIA 2YEBA 2YKJA 2XHTA 3C11A 4GFNA 4XE2A 5J6AA 2YEGA 3IEDA 1YC3A 3D36A 1YERA 2WI2A 3KE6A 2BYIA 4GT8A 2QG2A 4KSHA 5D7CA 4ASBA 4XKKA 2XX2A 2YJXA 4PU9A 2IOQA 4MPNA 4HZ0A 2BU8A 5CTWA 1H7UA 4YKQA 3INWA 4R3MA 5M4MA 3QTFA 2YI5A 3GIEA 3FV5A 4XCJA 3T1KA 2XABA 3T0HA 4CWFA 1I58A 3A0RA 4BIZA 4XKOA 4MOTA 3R4NA 4AWOA 2IOPA 3O6OA 2YEHA 2Q8HA 2XJXA 4DUHA 3A0YA 3HYZA 1UYCA 4E00A 4I5SA 3EKOA 4V26A 5CF0A 2PNRA 4UROA 2YECA 4ASGA 1JM6A 4EFUA 5D6QA 1UY6A 2VWCA 3VHDA 2WI4A 4ASFA 4XCLA 4W7TA 2YE9A 4WUBA 1YC4A 4MB9A 4FPPA 2ZBKB 2Q8IA 3K98A 4LWFA 4FCQA 4AWQA 2FWYA 3HZ5A 4H85A 1BGQA 5D6PA 3HHUA 1B62A 4YKZA 2WI1A 2Q8GA 5D7RA 2E0AA 1H7SA 2XJJA 3RLQA 2XDXA 3HZ1A 4BXIA 3EHGA 2IWSA 2QF6A 4AWPA 3A0XA 1UYKA 4HXZA 4KFGA 3OW6A 1KZNA 1UYIA 4XC0A 3ZXOA 1GJVA 5BODA 2QFOA 1Y4UA 3DGEA 1Y8NA 2YEJA 2BZ5A 5M4PA 3GIGB 2YEEA 1UY7A 1QY8A 4GQTA 2XDSA 4GGLA 3T2SA 1UY8A 3G7EA 5M4HA 1I5BA 4ZVIA 2O1UA 4JASA 3B27A 4CWOA 4O04A 4LWEA 2XHRA 3SL2A 1ZXNA 3B25A 4L93A 3PEJA 1MX0A 3CWVA 3U2DA 4XITA 4WUCA 2YEDA 4EM7A 2YKIA 2CCTA 3ZKBA 1Z5BA 1I59A 2CCUA 2XX4A 3CGYA 2WEPA 5M4NA 4O09A 4O07A 4MP7A 1R62A 4Q20A 3GIFA 2YE4A 4O05A 2YI6A 3CRLA 3Q5LA 4URMA 3EHHA 2VW5A 4EGIA 3HYYA 4PL9A 2H55A 2XDKA 3B28A 2YE2A 2YI0A 2XHXA 4XKAA 4I3HA 3BM9A 1UYHA 3K99A 3EHFA 3D2RA 3RLRA 1BXDA 5IDMA 1AMWA 3MNRP 4CWTA 1YT1A 2IWXA 4CWSA 4H7QA 1QYEA 3TZ4A 3H80A 2BTZA 4BQGA 3C0EA 4CWQA 3VHCA 4BAEA 1B3QA 4U93A 1Z5AA 3O2FA 3OWBA 2CGFA 2XCMA 4CE2A 5F3KA 2O1VA 3CGZA 5CTXA 4P7AA 1MU5A 2CCSA 1U2OA 2XDUA 1TBWA 2XX5A 4HYMA 4MP2A 2XD6A 4P8OA 2YGFA 4YKYA 3T0ZA 4PRVA 3GIGA 1US7A 4YKTA 1YSZA 4YKRA 5FNDA 4EMVA 4R1FA 2ZDXA 4CE1A 4FCRA 3B26A 3R91A 2GFDA 3LNUA 1UYGA 1GKZA 3A0ZA 5CPHA 3A0TA 4CWPA 4LPBA 3VHAA 1AM1A 4B7PA 3LPSA 3K97A 2Q8FA 1L0OA 2CH4A 1ZW9A 2BU7A 1UYLA 2YGEA 2YKEA 4WUDA 2EXLA 3ZKDA 1PVGA 5FWKA 1TIDA 4QPJA 4CWRA 3Q5JA 3OMUA 1Y8PA 3CRKA 5FNCA 2O1WA 3R4OA 1TC0A 4CE3A 4L94A 4JQLA 1I5AA 3WHAA 1AH6A 2IORA 2HKJA 4L90A 3B24A 1UYFA 4U7OA 2BU6A 4GEEA 5GGZA 5M4KA 3D0BA 4MBCA 4XD8A 3ZXQA 1YT2A 5CTUA 1UYMA 2WI3A 1THNA 2WI7A 1YC1A 3BMYA 2ESAA 2UWDA 4LWGA 1I5CA 4AS9A 2JKIA 3NMQA 4XIPA 1Z59A 2YK2A 1UYDA 4JAVA 4LWHA 4BIUA 2C2AA 3FT8A 1TILA 2WEQA 1AH8A 1OSFA 4NH8A 4ZKIA 5FNFA 1EI1A 3WQ9A 5C93A 3G75A 2GQPA 3K60A 4X9LA 1YS3A 2YKCA 1Y8OA 4B6CA 5J71A 4CWNA 4QPKA 2XDLA 5CTYA 3HEKA 1YETA 2AKPA 3H4LA 4HZ5A 4L91A 4LP0A 4MPCA 4XIQA 2BYHA 4EGKA 2YEAA 4EFTA 4L8ZA 2YE7A 4ASAA 1BKNA 1YT0A 1NHIA 4HXWA 4PRXA 4URNA 3PEHA 3R4MA 4KQVA 2BU5A 1Z5CA 3JZ3A 3RLPA 2QG0A 4KTNA 2Q2EB 1ZWHA 3VADA 4XDMA 4E01A 1A4HA 1EA6A 3QDDA 2BSMA 3A0WA 4BQJA 4EEHA 4E02A 2BRCA 2YE5A 4GCZA 3T10A 4FCPA 2XJGA 4YKWA 1UYEA 2H8MA 4U7NA 3OPDA 2BREA 2YGAA 2ZKJA 4HY1A 2YJWA 2FYPA 1YSRA 5IN9A 4LWIA 5M4EA 2IWUA 2YKBA 3ZM7A 5F5RA 2BU2A 1S16A 3O0IA 4HY6A 4JAUA 3U2KA 2VCIA 3R92A 2YE6A 3TZ5A 2K5BA 5L3JA 1I5DA 2BT0A 4O0BA 3FT5A 3TTZA 2YK9A 2CG9A 2ZDYA 3OWDA 4R3AA 4HYPA 2YEFA 3INXA 4NH7A 4XIRA 4DZYA 2FWZA 4K4OA 2HCHA 4H81A 2HG1A 1TH8A 2VCJA 4XTJA 3Q5KA 2YE8A 1Y4SA 1U0ZA 2WI5A 1TC6A 1NHJA 2WI6A 2XK2A 3R4PA 1NHHA 4V25A 4URLA 2YI7A 4MPEA 3TZ0A 4YKUA 4FMTA 4KP4A 3RKZA 5BOCA 3G7BA 4NH9A 1AJ6A 4YKXA 1KIJA 2YE3A 5IDJA 1ID0A 1S14A 4EGHA 3EHJA 1UY9A 3U67A 2JJCA 1GKXA 4KSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EKR A;  2FXS A;  1B63 A;  3TZ2 A;  3TUH A;  5D7D A;  1YES A;  2WER A;  1BYQ A;  1ZXM A;  1QZR A;  2YEI A;  2YEB A;  2YKJ A;  2XHT A;  3C11 A;  4GFN A;  4XE2 A;  5J6A A;  2YEG A;  3IED A;  1YC3 A;  3D36 A;  1YER A;  2WI2 A;  3KE6 A;  2BYI A;  4GT8 A;  2QG2 A;  4KSH A;  5D7C A;  4ASB A;  4XKK A;  2XX2 A;  2YJX A;  4PU9 A;  2IOQ A;  4MPN A;  4HZ0 A;  2BU8 A;  5CTW A;  1H7U A;  4YKQ A;  3INW A;  4R3M A;  5M4M A;  3QTF A;  2YI5 A;  3GIE A;  3FV5 A;  4XCJ A;  3T1K A;  2XAB A;  3T0H A;  4CWF A;  1I58 A;  3A0R A;  4BIZ A;  4XKO A;  4MOT A;  3R4N A;  4AWO A;  2IOP A;  3O6O A;  2YEH A;  2Q8H A;  2XJX A;  4DUH A;  3A0Y A;  3HYZ A;  1UYC A;  4E00 A;  4I5S A;  3EKO A;  4V26 A;  5CF0 A;  2PNR A;  4URO A;  2YEC A;  4ASG A;  1JM6 A;  4EFU A;  5D6Q A;  1UY6 A;  2VWC A;  3VHD A;  2WI4 A;  4ASF A;  4XCL A;  4W7T A;  2YE9 A;  4WUB A;  1YC4 A;  4MB9 A;  4FPP A;  2ZBK B;  2Q8I A;  3K98 A;  4LWF A;  4FCQ A;  4AWQ A;  2FWY A;  3HZ5 A;  4H85 A;  1BGQ A;  5D6P A;  3HHU A;  1B62 A;  4YKZ A;  2WI1 A;  2Q8G A;  5D7R A;  2E0A A;  1H7S A;  2XJJ A;  3RLQ A;  2XDX A;  3HZ1 A;  4BXI A;  3EHG A;  2IWS A;  2QF6 A;  4AWP A;  3A0X A;  1UYK A;  4HXZ A;  4KFG A;  3OW6 A;  1KZN A;  1UYI A;  4XC0 A;  3ZXO A;  1GJV A;  5BOD A;  2QFO A;  1Y4U A;  3DGE A;  1Y8N A;  2YEJ A;  2BZ5 A;  5M4P A;  3GIG B;  2YEE A;  1UY7 A;  1QY8 A;  4GQT A;  2XDS A;  4GGL A;  3T2S A;  1UY8 A;  3G7E A;  5M4H A;  1I5B A;  4ZVI A;  2O1U A;  4JAS A;  3B27 A;  4CWO A;  4O04 A;  4LWE A;  2XHR A;  3SL2 A;  1ZXN A;  3B25 A;  4L93 A;  3PEJ A;  1MX0 A;  3CWV A;  3U2D A;  4XIT A;  4WUC A;  2YED A;  4EM7 A;  2YKI A;  2CCT A;  3ZKB A;  1Z5B A;  1I59 A;  2CCU A;  2XX4 A;  3CGY A;  2WEP A;  5M4N A;  4O09 A;  4O07 A;  4MP7 A;  1R62 A;  4Q20 A;  3GIF A;  2YE4 A;  4O05 A;  2YI6 A;  3CRL A;  3Q5L A;  4URM A;  3EHH A;  2VW5 A;  4EGI A;  3HYY A;  4PL9 A;  2H55 A;  2XDK A;  3B28 A;  2YE2 A;  2YI0 A;  2XHX A;  4XKA A;  4I3H A;  3BM9 A;  1UYH A;  3K99 A;  3EHF A;  3D2R A;  3RLR A;  1BXD A;  5IDM A;  1AMW A;  3MNR P;  4CWT A;  1YT1 A;  2IWX A;  4CWS A;  4H7Q A;  1QYE A;  3TZ4 A;  3H80 A;  2BTZ A;  4BQG A;  3C0E A;  4CWQ A;  3VHC A;  4BAE A;  1B3Q A;  4U93 A;  1Z5A A;  3O2F A;  3OWB A;  2CGF A;  2XCM A;  4CE2 A;  5F3K A;  2O1V A;  3CGZ A;  5CTX A;  4P7A A;  1MU5 A;  2CCS A;  1U2O A;  2XDU A;  1TBW A;  2XX5 A;  4HYM A;  4MP2 A;  2XD6 A;  4P8O A;  2YGF A;  4YKY A;  3T0Z A;  4PRV A;  3GIG A;  1US7 A;  4YKT A;  1YSZ A;  4YKR A;  5FND A;  4EMV A;  4R1F A;  2ZDX A;  4CE1 A;  4FCR A;  3B26 A;  3R91 A;  2GFD A;  3LNU A;  1UYG A;  1GKZ A;  3A0Z A;  5CPH A;  3A0T A;  4CWP A;  4LPB A;  3VHA A;  1AM1 A;  4B7P A;  3LPS A;  3K97 A;  2Q8F A;  1L0O A;  2CH4 A;  1ZW9 A;  2BU7 A;  1UYL A;  2YGE A;  2YKE A;  4WUD A;  2EXL A;  3ZKD A;  1PVG A;  5FWK A;  1TID A;  4QPJ A;  4CWR A;  3Q5J A;  3OMU A;  1Y8P A;  3CRK A;  5FNC A;  2O1W A;  3R4O A;  1TC0 A;  4CE3 A;  4L94 A;  4JQL A;  1I5A A;  3WHA A;  1AH6 A;  2IOR A;  2HKJ A;  4L90 A;  3B24 A;  1UYF A;  4U7O A;  2BU6 A;  4GEE A;  5GGZ A;  5M4K A;  3D0B A;  4MBC A;  4XD8 A;  3ZXQ A;  1YT2 A;  5CTU A;  1UYM A;  2WI3 A;  1THN A;  2WI7 A;  1YC1 A;  3BMY A;  2ESA A;  2UWD A;  4LWG A;  1I5C A;  4AS9 A;  2JKI A;  3NMQ A;  4XIP A;  1Z59 A;  2YK2 A;  1UYD A;  4JAV A;  4LWH A;  4BIU A;  2C2A A;  3FT8 A;  1TIL A;  2WEQ A;  1AH8 A;  1OSF A;  4NH8 A;  4ZKI A;  5FNF A;  1EI1 A;  3WQ9 A;  5C93 A;  3G75 A;  2GQP A;  3K60 A;  4X9L A;  1YS3 A;  2YKC A;  1Y8O A;  4B6C A;  5J71 A;  4CWN A;  4QPK A;  2XDL A;  5CTY A;  3HEK A;  1YET A;  2AKP A;  3H4L A;  4HZ5 A;  4L91 A;  4LP0 A;  4MPC A;  4XIQ A;  2BYH A;  4EGK A;  2YEA A;  4EFT A;  4L8Z A;  2YE7 A;  4ASA A;  1BKN A;  1YT0 A;  1NHI A;  4HXW A;  4PRX A;  4URN A;  3PEH A;  3R4M A;  4KQV A;  2BU5 A;  1Z5C A;  3JZ3 A;  3RLP A;  2QG0 A;  4KTN A;  2Q2E B;  1ZWH A;  3VAD A;  4XDM A;  4E01 A;  1A4H A;  1EA6 A;  3QDD A;  2BSM A;  3A0W A;  4BQJ A;  4EEH A;  4E02 A;  2BRC A;  2YE5 A;  4GCZ A;  3T10 A;  4FCP A;  2XJG A;  4YKW A;  1UYE A;  2H8M A;  4U7N A;  3OPD A;  2BRE A;  2YGA A;  2ZKJ A;  4HY1 A;  2YJW A;  2FYP A;  1YSR A;  5IN9 A;  4LWI A;  5M4E A;  2IWU A;  2YKB A;  3ZM7 A;  5F5R A;  2BU2 A;  1S16 A;  3O0I A;  4HY6 A;  4JAU A;  3U2K A;  2VCI A;  3R92 A;  2YE6 A;  3TZ5 A;  2K5B A;  5L3J A;  1I5D A;  2BT0 A;  4O0B A;  3FT5 A;  3TTZ A;  2YK9 A;  2CG9 A;  2ZDY A;  3OWD A;  4R3A A;  4HYP A;  2YEF A;  3INX A;  4NH7 A;  4XIR A;  4DZY A;  2FWZ A;  4K4O A;  2HCH A;  4H81 A;  2HG1 A;  1TH8 A;  2VCJ A;  4XTJ A;  3Q5K A;  2YE8 A;  1Y4S A;  1U0Z A;  2WI5 A;  1TC6 A;  1NHJ A;  2WI6 A;  2XK2 A;  3R4P A;  1NHH A;  4V25 A;  4URL A;  2YI7 A;  4MPE A;  3TZ0 A;  4YKU A;  4FMT A;  4KP4 A;  3RKZ A;  5BOC A;  3G7B A;  4NH9 A;  1AJ6 A;  4YKX A;  1KIJ A;  2YE3 A;  5IDJ A;  1ID0 A;  1S14 A;  4EGH A;  3EHJ A;  1UY9 A;  3U67 A;  2JJC A;  1GKX A;  4KSG A; 
#chains in the Genus database with same CATH topology
 3EKR A;  2FXS A;  1B63 A;  3TZ2 A;  3TUH A;  5D7D A;  1YES A;  2WER A;  1BYQ A;  1ZXM A;  1QZR A;  2YEI A;  2YEB A;  2YKJ A;  2XHT A;  3C11 A;  4GFN A;  4XE2 A;  5J6A A;  2YEG A;  3IED A;  1YC3 A;  3D36 A;  1YER A;  2WI2 A;  3KE6 A;  2BYI A;  4GT8 A;  2QG2 A;  4KSH A;  5D7C A;  4ASB A;  4XKK A;  2XX2 A;  2YJX A;  4PU9 A;  2IOQ A;  4MPN A;  4HZ0 A;  2BU8 A;  5CTW A;  1H7U A;  4YKQ A;  3INW A;  4R3M A;  5M4M A;  3QTF A;  2YI5 A;  3GIE A;  3FV5 A;  4XCJ A;  3T1K A;  2XAB A;  3T0H A;  4CWF A;  1I58 A;  3LMM A;  3A0R A;  4BIZ A;  4XKO A;  4MOT A;  3R4N A;  4AWO A;  2IOP A;  3O6O A;  2YEH A;  2Q8H A;  2XJX A;  4DUH A;  3A0Y A;  3HYZ A;  1UYC A;  4E00 A;  4I5S A;  3EKO A;  4V26 A;  5CF0 A;  2PNR A;  4URO A;  2YEC A;  4ASG A;  1JM6 A;  4EFU A;  5D6Q A;  2FTK A;  1UY6 A;  2VWC A;  3VHD A;  2WI4 A;  4ASF A;  4XCL A;  4W7T A;  2YE9 A;  4WUB A;  1YC4 A;  4MB9 A;  4FPP A;  2ZBK B;  2Q8I A;  3K98 A;  4LWF A;  4FCQ A;  4AWQ A;  2FWY A;  3HZ5 A;  4H85 A;  1BGQ A;  5D6P A;  3HHU A;  1B62 A;  4YKZ A;  2WI1 A;  2Q8G A;  5D7R A;  2E0A A;  1H7S A;  2XJJ A;  3RLQ A;  2XDX A;  3HZ1 A;  4BXI A;  3EHG A;  2IWS A;  2QF6 A;  4AWP A;  3A0X A;  1UYK A;  4HXZ A;  4KFG A;  3OW6 A;  1KZN A;  1UYI A;  4XC0 A;  3ZXO A;  1GJV A;  5BOD A;  2QFO A;  1Y4U A;  3DGE A;  1Y8N A;  2YEJ A;  2BZ5 A;  5M4P A;  3GIG B;  2YEE A;  1F51 A;  1UY7 A;  4E72 A;  1QY8 A;  4GQT A;  2XDS A;  4GGL A;  3T2S A;  1UY8 A;  3G7E A;  5M4H A;  1I5B A;  4ZVI A;  2O1U A;  4JAS A;  3B27 A;  4CWO A;  4O04 A;  4LWE A;  2XHR A;  3SL2 A;  1ZXN A;  3B25 A;  4L93 A;  3PEJ A;  1MX0 A;  3CWV A;  3U2D A;  4XIT A;  4WUC A;  2YED A;  4EM7 A;  2YKI A;  2CCT A;  3ZKB A;  1Z5B A;  1I59 A;  2CCU A;  2XX4 A;  3CGY A;  1IXM A;  2WEP A;  5M4N A;  4O09 A;  4O07 A;  4MP7 A;  1R62 A;  4Q20 A;  3GIF A;  2YE4 A;  4O05 A;  2YI6 A;  3CRL A;  3Q5L A;  4URM A;  3EHH A;  2VW5 A;  4EGI A;  3HYY A;  2C1I A;  4PL9 A;  2H55 A;  2XDK A;  3B28 A;  2YE2 A;  2YI0 A;  2XHX A;  4XKA A;  4I3H A;  3BM9 A;  1UYH A;  3K99 A;  3EHF A;  3D2R A;  3RLR A;  1BXD A;  5IDM A;  1AMW A;  3MNR P;  4CWT A;  1YT1 A;  2IWX A;  4CWS A;  4H7Q A;  1QYE A;  3TZ4 A;  3H80 A;  2BTZ A;  4BQG A;  3C0E A;  4CWQ A;  3VHC A;  4BAE A;  1B3Q A;  4U93 A;  1Z5A A;  3O2F A;  3OWB A;  2CGF A;  2XCM A;  4CE2 A;  5F3K A;  2O1V A;  3CGZ A;  5CTX A;  4P7A A;  1MU5 A;  2CCS A;  1U2O A;  2XDU A;  1TBW A;  2XX5 A;  4HYM A;  4MP2 A;  2XD6 A;  4P8O A;  2YGF A;  4YKY A;  3T0Z A;  4PRV A;  3GIG A;  1US7 A;  4YKT A;  1YSZ A;  4YKR A;  5FND A;  4EMV A;  4R1F A;  2ZDX A;  4CE1 A;  4FCR A;  3B26 A;  3R91 A;  2GFD A;  3LNU A;  1UYG A;  1GKZ A;  3A0Z A;  5CPH A;  3A0T A;  4CWP A;  2C1G A;  4LPB A;  3VHA A;  1AM1 A;  4B7P A;  3LPS A;  3K97 A;  2Q8F A;  1L0O A;  2CH4 A;  1ZW9 A;  2BU7 A;  1UYL A;  2YGE A;  2YKE A;  4WUD A;  2EXL A;  3ZKD A;  1PVG A;  5FWK A;  1TID A;  4QPJ A;  4CWR A;  3Q5J A;  3OMU A;  1Y8P A;  3CRK A;  5FNC A;  2O1W A;  3R4O A;  1TC0 A;  4CE3 A;  4L94 A;  4JQL A;  1I5A A;  3WHA A;  1AH6 A;  2IOR A;  2HKJ A;  5JEN A;  4L90 A;  3B24 A;  1UYF A;  4U7O A;  2BU6 A;  4GEE A;  5GGZ A;  5M4K A;  3D0B A;  4MBC A;  4XD8 A;  3ZXQ A;  1YT2 A;  5CTU A;  1UYM A;  2WI3 A;  1THN A;  2WI7 A;  1YC1 A;  3BMY A;  2ESA A;  2UWD A;  4LWG A;  1I5C A;  4AS9 A;  2JKI A;  3NMQ A;  4XIP A;  1Z59 A;  2YK2 A;  1UYD A;  4JAV A;  4LWH A;  4BIU A;  2C2A A;  3FT8 A;  1TIL A;  2WEQ A;  1AH8 A;  1OSF A;  4NH8 A;  4ZKI A;  5FNF A;  1EI1 A;  3WQ9 A;  5C93 A;  3G75 A;  2GQP A;  3K60 A;  4X9L A;  1YS3 A;  2YKC A;  1Y8O A;  4B6C A;  5J71 A;  4CWN A;  4QPK A;  3S5T A;  2XDL A;  5CTY A;  3HEK A;  1YET A;  2AKP A;  3H4L A;  4HZ5 A;  4L91 A;  4LP0 A;  4MPC A;  4XIQ A;  2BYH A;  4EGK A;  2YEA A;  4EFT A;  4L8Z A;  2YE7 A;  4ASA A;  1BKN A;  1YT0 A;  1NHI A;  4HXW A;  4PRX A;  4URN A;  3PEH A;  3R4M A;  4KQV A;  2BU5 A;  1Z5C A;  3JZ3 A;  3RLP A;  2QG0 A;  4KTN A;  2Q2E B;  1ZWH A;  3VAD A;  4XDM A;  4E01 A;  1A4H A;  1EA6 A;  3QDD A;  2BSM A;  3A0W A;  4BQJ A;  4EEH A;  4E02 A;  2BRC A;  2YE5 A;  4GCZ A;  3T10 A;  4FCP A;  2XJG A;  4YKW A;  1UYE A;  2HHI A;  2H8M A;  4U7N A;  3OPD A;  2BRE A;  2YGA A;  2ZKJ A;  4HY1 A;  2YJW A;  2FYP A;  1YSR A;  5IN9 A;  4LWI A;  5M4E A;  2IWU A;  2YKB A;  3ZM7 A;  5F5R A;  2BU2 A;  1S16 A;  3O0I A;  4HY6 A;  4JAU A;  3U2K A;  2VCI A;  3R92 A;  2YE6 A;  3TZ5 A;  2K5B A;  5L3J A;  1I5D A;  2BT0 A;  4O0B A;  3FT5 A;  3TTZ A;  2YK9 A;  2CG9 A;  2ZDY A;  3OWD A;  4R3A A;  4HYP A;  2YEF A;  3INX A;  4NH7 A;  4XIR A;  4DZY A;  2FWZ A;  4K4O A;  2HCH A;  4H81 A;  2HG1 A;  1TH8 A;  2VCJ A;  3CYG A;  4XTJ A;  3Q5K A;  2YE8 A;  1Y4S A;  1U0Z A;  2WI5 A;  1TC6 A;  1NHJ A;  2WI6 A;  2XK2 A;  3R4P A;  1NHH A;  4V25 A;  4URL A;  2YI7 A;  4MPE A;  3TZ0 A;  4YKU A;  4FMT A;  4KP4 A;  3RKZ A;  5BOC A;  3G7B A;  4NH9 A;  1AJ6 A;  4YKX A;  1KIJ A;  2YE3 A;  5IDJ A;  1ID0 A;  1S14 A;  4EGH A;  3EHJ A;  1UY9 A;  3U67 A;  2JJC A;  1GKX A;  4KSG A; 
#chains in the Genus database with same CATH homology
 3EKR A;  2FXS A;  1B63 A;  3TZ2 A;  3TUH A;  5D7D A;  1YES A;  2WER A;  1BYQ A;  1ZXM A;  1QZR A;  2YEI A;  2YEB A;  2YKJ A;  2XHT A;  3C11 A;  4GFN A;  4XE2 A;  5J6A A;  2YEG A;  3IED A;  1YC3 A;  3D36 A;  1YER A;  2WI2 A;  3KE6 A;  2BYI A;  4GT8 A;  2QG2 A;  4KSH A;  5D7C A;  4ASB A;  4XKK A;  2XX2 A;  2YJX A;  4PU9 A;  2IOQ A;  4MPN A;  4HZ0 A;  2BU8 A;  5CTW A;  1H7U A;  4YKQ A;  3INW A;  4R3M A;  5M4M A;  3QTF A;  2YI5 A;  3GIE A;  3FV5 A;  4XCJ A;  3T1K A;  2XAB A;  3T0H A;  4CWF A;  1I58 A;  3A0R A;  4BIZ A;  4XKO A;  4MOT A;  3R4N A;  4AWO A;  2IOP A;  3O6O A;  2YEH A;  2Q8H A;  2XJX A;  4DUH A;  3A0Y A;  3HYZ A;  1UYC A;  4E00 A;  4I5S A;  3EKO A;  4V26 A;  5CF0 A;  2PNR A;  4URO A;  2YEC A;  4ASG A;  1JM6 A;  4EFU A;  5D6Q A;  1UY6 A;  2VWC A;  3VHD A;  2WI4 A;  4ASF A;  4XCL A;  4W7T A;  2YE9 A;  4WUB A;  1YC4 A;  4MB9 A;  4FPP A;  2ZBK B;  2Q8I A;  3K98 A;  4LWF A;  4FCQ A;  4AWQ A;  2FWY A;  3HZ5 A;  4H85 A;  1BGQ A;  5D6P A;  3HHU A;  1B62 A;  4YKZ A;  2WI1 A;  2Q8G A;  5D7R A;  2E0A A;  1H7S A;  2XJJ A;  3RLQ A;  2XDX A;  3HZ1 A;  4BXI A;  3EHG A;  2IWS A;  2QF6 A;  4AWP A;  3A0X A;  1UYK A;  4HXZ A;  4KFG A;  3OW6 A;  1KZN A;  1UYI A;  4XC0 A;  3ZXO A;  1GJV A;  5BOD A;  2QFO A;  1Y4U A;  3DGE A;  1Y8N A;  2YEJ A;  2BZ5 A;  5M4P A;  3GIG B;  2YEE A;  1UY7 A;  1QY8 A;  4GQT A;  2XDS A;  4GGL A;  3T2S A;  1UY8 A;  3G7E A;  5M4H A;  1I5B A;  4ZVI A;  2O1U A;  4JAS A;  3B27 A;  4CWO A;  4O04 A;  4LWE A;  2XHR A;  3SL2 A;  1ZXN A;  3B25 A;  4L93 A;  3PEJ A;  1MX0 A;  3CWV A;  3U2D A;  4XIT A;  4WUC A;  2YED A;  4EM7 A;  2YKI A;  2CCT A;  3ZKB A;  1Z5B A;  1I59 A;  2CCU A;  2XX4 A;  3CGY A;  2WEP A;  5M4N A;  4O09 A;  4O07 A;  4MP7 A;  1R62 A;  4Q20 A;  3GIF A;  2YE4 A;  4O05 A;  2YI6 A;  3CRL A;  3Q5L A;  4URM A;  3EHH A;  2VW5 A;  4EGI A;  3HYY A;  4PL9 A;  2H55 A;  2XDK A;  3B28 A;  2YE2 A;  2YI0 A;  2XHX A;  4XKA A;  4I3H A;  3BM9 A;  1UYH A;  3K99 A;  3EHF A;  3D2R A;  3RLR A;  1BXD A;  5IDM A;  1AMW A;  3MNR P;  4CWT A;  1YT1 A;  2IWX A;  4CWS A;  4H7Q A;  1QYE A;  3TZ4 A;  3H80 A;  2BTZ A;  4BQG A;  3C0E A;  4CWQ A;  3VHC A;  4BAE A;  1B3Q A;  4U93 A;  1Z5A A;  3O2F A;  3OWB A;  2CGF A;  2XCM A;  4CE2 A;  5F3K A;  2O1V A;  3CGZ A;  5CTX A;  4P7A A;  1MU5 A;  2CCS A;  1U2O A;  2XDU A;  1TBW A;  2XX5 A;  4HYM A;  4MP2 A;  2XD6 A;  4P8O A;  2YGF A;  4YKY A;  3T0Z A;  4PRV A;  3GIG A;  1US7 A;  4YKT A;  1YSZ A;  4YKR A;  5FND A;  4EMV A;  4R1F A;  2ZDX A;  4CE1 A;  4FCR A;  3B26 A;  3R91 A;  2GFD A;  3LNU A;  1UYG A;  1GKZ A;  3A0Z A;  5CPH A;  3A0T A;  4CWP A;  4LPB A;  3VHA A;  1AM1 A;  4B7P A;  3LPS A;  3K97 A;  2Q8F A;  1L0O A;  2CH4 A;  1ZW9 A;  2BU7 A;  1UYL A;  2YGE A;  2YKE A;  4WUD A;  2EXL A;  3ZKD A;  1PVG A;  5FWK A;  1TID A;  4QPJ A;  4CWR A;  3Q5J A;  3OMU A;  1Y8P A;  3CRK A;  5FNC A;  2O1W A;  3R4O A;  1TC0 A;  4CE3 A;  4L94 A;  4JQL A;  1I5A A;  3WHA A;  1AH6 A;  2IOR A;  2HKJ A;  4L90 A;  3B24 A;  1UYF A;  4U7O A;  2BU6 A;  4GEE A;  5GGZ A;  5M4K A;  3D0B A;  4MBC A;  4XD8 A;  3ZXQ A;  1YT2 A;  5CTU A;  1UYM A;  2WI3 A;  1THN A;  2WI7 A;  1YC1 A;  3BMY A;  2ESA A;  2UWD A;  4LWG A;  1I5C A;  4AS9 A;  2JKI A;  3NMQ A;  4XIP A;  1Z59 A;  2YK2 A;  1UYD A;  4JAV A;  4LWH A;  4BIU A;  2C2A A;  3FT8 A;  1TIL A;  2WEQ A;  1AH8 A;  1OSF A;  4NH8 A;  4ZKI A;  5FNF A;  1EI1 A;  3WQ9 A;  5C93 A;  3G75 A;  2GQP A;  3K60 A;  4X9L A;  1YS3 A;  2YKC A;  1Y8O A;  4B6C A;  5J71 A;  4CWN A;  4QPK A;  2XDL A;  5CTY A;  3HEK A;  1YET A;  2AKP A;  3H4L A;  4HZ5 A;  4L91 A;  4LP0 A;  4MPC A;  4XIQ A;  2BYH A;  4EGK A;  2YEA A;  4EFT A;  4L8Z A;  2YE7 A;  4ASA A;  1BKN A;  1YT0 A;  1NHI A;  4HXW A;  4PRX A;  4URN A;  3PEH A;  3R4M A;  4KQV A;  2BU5 A;  1Z5C A;  3JZ3 A;  3RLP A;  2QG0 A;  4KTN A;  2Q2E B;  1ZWH A;  3VAD A;  4XDM A;  4E01 A;  1A4H A;  1EA6 A;  3QDD A;  2BSM A;  3A0W A;  4BQJ A;  4EEH A;  4E02 A;  2BRC A;  2YE5 A;  4GCZ A;  3T10 A;  4FCP A;  2XJG A;  4YKW A;  1UYE A;  2H8M A;  4U7N A;  3OPD A;  2BRE A;  2YGA A;  2ZKJ A;  4HY1 A;  2YJW A;  2FYP A;  1YSR A;  5IN9 A;  4LWI A;  5M4E A;  2IWU A;  2YKB A;  3ZM7 A;  5F5R A;  2BU2 A;  1S16 A;  3O0I A;  4HY6 A;  4JAU A;  3U2K A;  2VCI A;  3R92 A;  2YE6 A;  3TZ5 A;  2K5B A;  5L3J A;  1I5D A;  2BT0 A;  4O0B A;  3FT5 A;  3TTZ A;  2YK9 A;  2CG9 A;  2ZDY A;  3OWD A;  4R3A A;  4HYP A;  2YEF A;  3INX A;  4NH7 A;  4XIR A;  4DZY A;  2FWZ A;  4K4O A;  2HCH A;  4H81 A;  2HG1 A;  1TH8 A;  2VCJ A;  4XTJ A;  3Q5K A;  2YE8 A;  1Y4S A;  1U0Z A;  2WI5 A;  1TC6 A;  1NHJ A;  2WI6 A;  2XK2 A;  3R4P A;  1NHH A;  4V25 A;  4URL A;  2YI7 A;  4MPE A;  3TZ0 A;  4YKU A;  4FMT A;  4KP4 A;  3RKZ A;  5BOC A;  3G7B A;  4NH9 A;  1AJ6 A;  4YKX A;  1KIJ A;  2YE3 A;  5IDJ A;  1ID0 A;  1S14 A;  4EGH A;  3EHJ A;  1UY9 A;  3U67 A;  2JJC A;  1GKX A;  4KSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...