1I5DA

Structure of chea domain p4 in complex with tnp-atp
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
190
Chain Sequence
VMKIRMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein, transferase
molecule keywords CHEMOTAXIS PROTEIN CHEA
total genus 46
structure length 190
sequence length 190
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i5dA00
1ZW9A 4H7QA 1YT0A 3EHHA 2WI7A 4V25A 4YKWA 1UYLA 4CWFA 4K4OA 1Y4SA 4ASAA 4KTNA 4I3HA 1UYEA 2IWXA 2YECA 3K97A 1S16A 4H81A 3CGZA 5FNFA 3GIGB 4EMVA 4FCQA 3T0ZA 2YE3A 2YGAA 1BKNA 4E01A 4ASFA 2E0AA 2GQPA 2XHTA 4CWSA 5M4MA 5BOCA 3B26A 3TZ2A 1I58A 1U0ZA 4L90A 4XIRA 1UYCA 4BAEA 4FMTA 2YE7A 3CGYA 4HYMA 4L94A 4WUBA 2O1VA 3GIEA 4Q20A 2XJJA 3CRLA 3OMUA 5CTWA 3U67A 4GGLA 4JAVA 3ZKDA 4CWOA 1BGQA 1NHJA 2WERA 5IN9A 2YGFA 4XKAA 4LPBA 2VWCA 3T0HA 4L91A 2CCUA 4URLA 1BYQA 2WI2A 4GT8A 4YKZA 2PNRA 3GIFA 1TC0A 5CPHA 2IOQA 4XKKA 1AJ6A 1I5AA 2XJXA 3A0YA 2BU6A 1ZXMA 2EXLA 5CF0A 1ID0A 3INXA 1MU5A 1NHHA 1OSFA 5FWKA 3KE6A 1L0OA 2H55A 4LWIA 1AM1A 2YE8A 4LWFA 4PRXA 2BTZA 4DZYA 3HYYA 3VHCA 2QG2A 2BU2A 4CWQA 2Q8HA 4ZKIA 1Y8NA 3RKZA 2YEHA 1Y8OA 4XCJA 4KFGA 1UY8A 4XC0A 4ASBA 3LNUA 4HXZA 1R62A 4GFNA 4FCRA 5CTUA 2C2AA 3VHDA 4LWEA 4XIQA 3A0WA 2XX4A 2WEPA 2WI4A 1I5BA 3HEKA 4ASGA 2BU5A 4CE3A 1YC3A 1TH8A 4GEEA 1B62A 2HG1A 2BU7A 2YK2A 4XTJA 2WI3A 3A0XA 3QTFA 2YEEA 2ZBKB 4EFTA 4XE2A 2BYHA 3R4NA 1ZWHA 1GKZA 4NH8A 4O05A 4GCZA 1UYGA 3R4PA 4YKXA 3VADA 2YE9A 3OWDA 1UY6A 4PL9A 2CG9A 5D7DA 5FNCA 1TILA 4XDMA 1S14A 3NMQA 3R4OA 2CH4A 4U93A 4CWTA 2XHXA 1YSRA 3QDDA 3HZ1A 2FXSA 5D7CA 1Y8PA 3B27A 4MPCA 1YERA 3R92A 4AWOA 4B6CA 1YETA 2JJCA 3JZ3A 4CWNA 4MPNA 4P8OA 4X9LA 2WI1A 1I5CA 3Q5KA 4O09A 3OWBA 5CTXA 4MOTA 3LPSA 4NH7A 3IEDA 1UYHA 4GQTA 3U2KA 2WI6A 5D6QA 3K60A 4YKUA 1H7SA 2ESAA 2YE4A 4ZVIA 3FT5A 3C11A 1QZRA 2CCSA 3O0IA 4XKOA 4URNA 5J71A 4CE2A 1AMWA 4HXWA 2Q8GA 2K5BA 1QY8A 3RLRA 2YJWA 1YC1A 2XDKA 2YI7A 5IDJA 4YKQA 1YESA 5F3KA 4YKTA 4KSGA 4XD8A 2BREA 4BIUA 3TZ5A 4WUDA 4R1FA 4QPKA 4V26A 1UYIA 3EKOA 4I5SA 3EKRA 4LWGA 5C93A 2XDLA 3ZKBA 3INWA 4R3MA 3O2FA 2YE6A 4KP4A 4DUHA 2QFOA 2YEJA 3HYZA 2VCIA 2QF6A 2YEIA 4L93A 4U7OA 3EHFA 3EHJA 1YT1A 2FWZA 3ZM7A 3D2RA 4JAUA 1TBWA 3B25A 1UYFA 2HCHA 3FV5A 1Z5CA 2XABA 2XX2A 5D7RA 4R3AA 2BU8A 1JM6A 2CCTA 2Q8FA 4L8ZA 4CE1A 3A0ZA 2AKPA 4HY6A 2BRCA 3H4LA 3RLQA 3ZXOA 5M4NA 4O04A 4URMA 2XDUA 4WUCA 5L3JA 4E02A 3K98A 3EHGA 2XDSA 1YSZA 2YI0A 3WHAA 3DGEA 1NHIA 1GKXA 4O0BA 2WEQA 2VCJA 4MPEA 4YKYA 4B7PA 3A0TA 1ZXNA 4YKRA 2HKJA 1U2OA 2YEAA 4XITA 2YJXA 4AWPA 4BQJA 3U2DA 4EFUA 4BXIA 5F5RA 4JASA 2XHRA 4LWHA 2ZKJA 2XK2A 3O6OA 1AH6A 1Z5BA 2XX5A 3G7EA 2XD6A 2YKIA 1QYEA 3A0RA 4H85A 4EEHA 2H8MA 1EI1A 3K99A 4KQVA 4O07A 3WQ9A 3B28A 1GJVA 5M4EA 3OW6A 2QG0A 3GIGA 2XDXA 3TZ0A 3Q5LA 2BZ5A 1EA6A 4KSHA 4CWPA 5M4PA 2UWDA 4XIPA 3PEHA 3D0BA 2WI5A 4QPJA 2CGFA 4FCPA 4AWQA 4HZ0A 3MNRP 5CTYA 5J6AA 2YGEA 2YK9A 1Z5AA 2O1UA 3H80A 3RLPA 5IDMA 3OPDA 2YI5A 1US7A 2Q8IA 4MB9A 1Z59A 1THNA 4PU9A 3TZ4A 4FPPA 4EM7A 2IWSA 1TC6A 1BXDA 4XCLA 1H7UA 3BMYA 1I5DA 2Q2EB 4EGIA 4NH9A 4PRVA 4MP2A 2ZDXA 1KZNA 3CWVA 5BODA 1UYDA 3B24A 1UY7A 2YKEA 3Q5JA 4CWRA 2YE2A 3FT8A 3TTZA 3TUHA 2YE5A 2IORA 3HHUA 4BQGA 2YEDA 1YT2A 4UROA 3PEJA 1KIJA 2YKJA 3G75A 1MX0A 5D6PA 2XCMA 4W7TA 1PVGA 2YEBA 1B3QA 5FNDA 1A4HA 5GGZA 2GFDA 1TIDA 4AS9A 1UYMA 3T10A 3BM9A 1YS3A 4HZ5A 3T1KA 2FYPA 4U7NA 4EGHA 3SL2A 3D36A 4LP0A 4MP7A 2O1WA 4HYPA 2YEFA 3T2SA 3HZ5A 2BT0A 4JQLA 2IOPA 2YKBA 1AH8A 2BYIA 4P7AA 5M4HA 2YEGA 2JKIA 2IWUA 2XJGA 2VW5A 1YC4A 3ZXQA 4MBCA 1UY9A 3VHAA 1B63A 3CRKA 3R4MA 4E00A 4EGKA 5M4KA 2FWYA 2YI6A 1UYKA 1Y4UA 4BIZA 3C0EA 1I59A 2BSMA 2ZDYA 3R91A 2YKCA 3G7BA 4HY1A
chains in the Genus database with same CATH superfamily
1ZW9A 4H7QA 1YT0A 3EHHA 2WI7A 4V25A 4YKWA 1UYLA 4CWFA 4K4OA 1Y4SA 4ASAA 4KTNA 4I3HA 1UYEA 2IWXA 2C1IA 2YECA 3K97A 1S16A 4H81A 3CGZA 5FNFA 3GIGB 4EMVA 4FCQA 3T0ZA 2YE3A 2YGAA 1BKNA 4E01A 4ASFA 2E0AA 2GQPA 2XHTA 4CWSA 2HHIA 5M4MA 5BOCA 3B26A 3TZ2A 1I58A 1U0ZA 4L90A 4XIRA 1UYCA 4BAEA 4FMTA 2YE7A 3CGYA 4HYMA 4L94A 4WUBA 2O1VA 3GIEA 4Q20A 2XJJA 3CRLA 3OMUA 5CTWA 3U67A 4GGLA 4JAVA 3ZKDA 4CWOA 1BGQA 1F51A 1NHJA 2WERA 5IN9A 2YGFA 4XKAA 4LPBA 2VWCA 3T0HA 4L91A 2CCUA 4URLA 1BYQA 2WI2A 4GT8A 4YKZA 2PNRA 3GIFA 1TC0A 5CPHA 2IOQA 4XKKA 1AJ6A 1I5AA 2XJXA 3A0YA 2BU6A 1ZXMA 2EXLA 5CF0A 1ID0A 3INXA 1MU5A 2FTKA 1NHHA 1OSFA 5FWKA 3KE6A 1L0OA 2H55A 4LWIA 1AM1A 2YE8A 4LWFA 4PRXA 2BTZA 1IXMA 4DZYA 3HYYA 3VHCA 2QG2A 2BU2A 4CWQA 2Q8HA 4ZKIA 1Y8NA 3RKZA 2YEHA 1Y8OA 4XCJA 4KFGA 1UY8A 4XC0A 4ASBA 3LNUA 4HXZA 1R62A 4GFNA 4FCRA 5CTUA 2C2AA 3VHDA 4LWEA 4XIQA 3A0WA 2XX4A 2WEPA 2WI4A 1I5BA 3HEKA 4ASGA 2BU5A 4CE3A 1YC3A 1TH8A 4GEEA 1B62A 2HG1A 2BU7A 2YK2A 4XTJA 2WI3A 3A0XA 3QTFA 2YEEA 2ZBKB 4EFTA 4XE2A 2BYHA 3R4NA 1ZWHA 1GKZA 4NH8A 4O05A 4GCZA 1UYGA 3R4PA 4YKXA 3VADA 2YE9A 3OWDA 1UY6A 4PL9A 2CG9A 5D7DA 5FNCA 1TILA 4XDMA 1S14A 3NMQA 3R4OA 2CH4A 4U93A 4CWTA 2XHXA 1YSRA 3QDDA 3HZ1A 2FXSA 5D7CA 1Y8PA 3B27A 4MPCA 1YERA 3R92A 4AWOA 4B6CA 1YETA 2JJCA 3JZ3A 4CWNA 4MPNA 4P8OA 4X9LA 2WI1A 1I5CA 3Q5KA 4O09A 3OWBA 5CTXA 4MOTA 3LPSA 4NH7A 3IEDA 1UYHA 4GQTA 3U2KA 2WI6A 5D6QA 3K60A 3LMMA 4YKUA 1H7SA 2ESAA 2YE4A 4ZVIA 3FT5A 3C11A 1QZRA 2CCSA 3O0IA 4XKOA 4URNA 5J71A 4CE2A 3S5TA 1AMWA 4HXWA 2Q8GA 2K5BA 1QY8A 3RLRA 2YJWA 1YC1A 2XDKA 2YI7A 5IDJA 4YKQA 1YESA 5F3KA 4YKTA 4KSGA 4XD8A 2BREA 4BIUA 3TZ5A 4WUDA 4R1FA 4QPKA 4V26A 1UYIA 3EKOA 4I5SA 3EKRA 4LWGA 5C93A 2XDLA 3ZKBA 3INWA 4R3MA 3O2FA 2YE6A 4KP4A 4DUHA 2QFOA 2YEJA 3HYZA 2VCIA 5JENA 2QF6A 2YEIA 4L93A 4U7OA 3EHFA 3EHJA 1YT1A 2FWZA 3ZM7A 3D2RA 4JAUA 1TBWA 3B25A 2C1GA 1UYFA 2HCHA 3FV5A 1Z5CA 2XABA 2XX2A 5D7RA 4R3AA 2BU8A 1JM6A 2CCTA 2Q8FA 4L8ZA 4CE1A 3CYGA 3A0ZA 2AKPA 4HY6A 2BRCA 3H4LA 3RLQA 3ZXOA 5M4NA 4O04A 4URMA 2XDUA 4WUCA 5L3JA 4E02A 3K98A 3EHGA 2XDSA 1YSZA 2YI0A 3WHAA 3DGEA 1NHIA 1GKXA 4O0BA 2WEQA 2VCJA 4MPEA 4YKYA 4B7PA 3A0TA 1ZXNA 4YKRA 2HKJA 1U2OA 2YEAA 4XITA 2YJXA 4AWPA 4BQJA 3U2DA 4EFUA 4BXIA 5F5RA 4JASA 2XHRA 4LWHA 2ZKJA 2XK2A 3O6OA 1AH6A 1Z5BA 2XX5A 3G7EA 2XD6A 2YKIA 1QYEA 3A0RA 4H85A 4EEHA 2H8MA 1EI1A 3K99A 4KQVA 4O07A 3WQ9A 3B28A 1GJVA 5M4EA 3OW6A 2QG0A 3GIGA 2XDXA 3TZ0A 3Q5LA 2BZ5A 1EA6A 4KSHA 4CWPA 5M4PA 2UWDA 4XIPA 3PEHA 3D0BA 2WI5A 4QPJA 2CGFA 4FCPA 4AWQA 4HZ0A 3MNRP 5CTYA 5J6AA 2YGEA 2YK9A 1Z5AA 2O1UA 3H80A 3RLPA 5IDMA 3OPDA 2YI5A 1US7A 2Q8IA 4MB9A 1Z59A 1THNA 4PU9A 3TZ4A 4FPPA 4EM7A 2IWSA 1TC6A 1BXDA 4XCLA 1H7UA 3BMYA 1I5DA 2Q2EB 4EGIA 4NH9A 4PRVA 4MP2A 2ZDXA 1KZNA 3CWVA 5BODA 1UYDA 3B24A 1UY7A 2YKEA 3Q5JA 4CWRA 2YE2A 3FT8A 3TTZA 3TUHA 2YE5A 2IORA 3HHUA 4BQGA 2YEDA 1YT2A 4UROA 3PEJA 1KIJA 2YKJA 3G75A 1MX0A 5D6PA 2XCMA 4W7TA 1PVGA 4E72A 2YEBA 1B3QA 5FNDA 1A4HA 5GGZA 2GFDA 1TIDA 4AS9A 1UYMA 3T10A 3BM9A 1YS3A 4HZ5A 3T1KA 2FYPA 4U7NA 4EGHA 3SL2A 3D36A 4LP0A 4MP7A 2O1WA 4HYPA 2YEFA 3T2SA 3HZ5A 2BT0A 4JQLA 2IOPA 2YKBA 1AH8A 2BYIA 4P7AA 5M4HA 2YEGA 2JKIA 2IWUA 2XJGA 2VW5A 1YC4A 3ZXQA 4MBCA 1UY9A 3VHAA 1B63A 3CRKA 3R4MA 4E00A 4EGKA 5M4KA 2FWYA 2YI6A 1UYKA 1Y4UA 4BIZA 3C0EA 1I59A 2BSMA 2ZDYA 3R91A 2YKCA 3G7BA 4HY1A
chains in the Genus database with same CATH topology
1ZW9A 4H7QA 1YT0A 3EHHA 2WI7A 4V25A 4YKWA 1UYLA 4CWFA 4K4OA 1Y4SA 4ASAA 4KTNA 4I3HA 1UYEA 2IWXA 2YECA 3K97A 1S16A 4H81A 3CGZA 5FNFA 3GIGB 4EMVA 4FCQA 3T0ZA 2YE3A 2YGAA 1BKNA 4E01A 4ASFA 2E0AA 2GQPA 2XHTA 4CWSA 5M4MA 5BOCA 3B26A 3TZ2A 1I58A 1U0ZA 4L90A 4XIRA 1UYCA 4BAEA 4FMTA 2YE7A 3CGYA 4HYMA 4L94A 4WUBA 2O1VA 3GIEA 4Q20A 2XJJA 3CRLA 3OMUA 5CTWA 3U67A 4GGLA 4JAVA 3ZKDA 4CWOA 1BGQA 1NHJA 2WERA 5IN9A 2YGFA 4XKAA 4LPBA 2VWCA 3T0HA 4L91A 2CCUA 4URLA 1BYQA 2WI2A 4GT8A 4YKZA 2PNRA 3GIFA 1TC0A 5CPHA 2IOQA 4XKKA 1AJ6A 1I5AA 2XJXA 3A0YA 2BU6A 1ZXMA 2EXLA 5CF0A 1ID0A 3INXA 1MU5A 1NHHA 1OSFA 5FWKA 3KE6A 1L0OA 2H55A 4LWIA 1AM1A 2YE8A 4LWFA 4PRXA 2BTZA 4DZYA 3HYYA 3VHCA 2QG2A 2BU2A 4CWQA 2Q8HA 4ZKIA 1Y8NA 3RKZA 2YEHA 1Y8OA 4XCJA 4KFGA 1UY8A 4XC0A 4ASBA 3LNUA 4HXZA 1R62A 4GFNA 4FCRA 5CTUA 2C2AA 3VHDA 4LWEA 4XIQA 3A0WA 2XX4A 2WEPA 2WI4A 1I5BA 3HEKA 4ASGA 2BU5A 4CE3A 1YC3A 1TH8A 4GEEA 1B62A 2HG1A 2BU7A 2YK2A 4XTJA 2WI3A 3A0XA 3QTFA 2YEEA 2ZBKB 4EFTA 4XE2A 2BYHA 3R4NA 1ZWHA 1GKZA 4NH8A 4O05A 4GCZA 1UYGA 3R4PA 4YKXA 3VADA 2YE9A 3OWDA 1UY6A 4PL9A 2CG9A 5D7DA 5FNCA 1TILA 4XDMA 1S14A 3NMQA 3R4OA 2CH4A 4U93A 4CWTA 2XHXA 1YSRA 3QDDA 3HZ1A 2FXSA 5D7CA 1Y8PA 3B27A 4MPCA 1YERA 3R92A 4AWOA 4B6CA 1YETA 2JJCA 3JZ3A 4CWNA 4MPNA 4P8OA 4X9LA 2WI1A 1I5CA 3Q5KA 4O09A 3OWBA 5CTXA 4MOTA 3LPSA 4NH7A 3IEDA 1UYHA 4GQTA 3U2KA 2WI6A 5D6QA 3K60A 4YKUA 1H7SA 2ESAA 2YE4A 4ZVIA 3FT5A 3C11A 1QZRA 2CCSA 3O0IA 4XKOA 4URNA 5J71A 4CE2A 1AMWA 4HXWA 2Q8GA 2K5BA 1QY8A 3RLRA 2YJWA 1YC1A 2XDKA 2YI7A 5IDJA 4YKQA 1YESA 5F3KA 4YKTA 4KSGA 4XD8A 2BREA 4BIUA 3TZ5A 4WUDA 4R1FA 4QPKA 4V26A 1UYIA 3EKOA 4I5SA 3EKRA 4LWGA 5C93A 2XDLA 3ZKBA 3INWA 4R3MA 3O2FA 2YE6A 4KP4A 4DUHA 2QFOA 2YEJA 3HYZA 2VCIA 2QF6A 2YEIA 4L93A 4U7OA 3EHFA 3EHJA 1YT1A 2FWZA 3ZM7A 3D2RA 4JAUA 1TBWA 3B25A 1UYFA 2HCHA 3FV5A 1Z5CA 2XABA 2XX2A 5D7RA 4R3AA 2BU8A 1JM6A 2CCTA 2Q8FA 4L8ZA 4CE1A 3A0ZA 2AKPA 4HY6A 2BRCA 3H4LA 3RLQA 3ZXOA 5M4NA 4O04A 4URMA 2XDUA 4WUCA 5L3JA 4E02A 3K98A 3EHGA 2XDSA 1YSZA 2YI0A 3WHAA 3DGEA 1NHIA 1GKXA 4O0BA 2WEQA 2VCJA 4MPEA 4YKYA 4B7PA 3A0TA 1ZXNA 4YKRA 2HKJA 1U2OA 2YEAA 4XITA 2YJXA 4AWPA 4BQJA 3U2DA 4EFUA 4BXIA 5F5RA 4JASA 2XHRA 4LWHA 2ZKJA 2XK2A 3O6OA 1AH6A 1Z5BA 2XX5A 3G7EA 2XD6A 2YKIA 1QYEA 3A0RA 4H85A 4EEHA 2H8MA 1EI1A 3K99A 4KQVA 4O07A 3WQ9A 3B28A 1GJVA 5M4EA 3OW6A 2QG0A 3GIGA 2XDXA 3TZ0A 3Q5LA 2BZ5A 1EA6A 4KSHA 4CWPA 5M4PA 2UWDA 4XIPA 3PEHA 3D0BA 2WI5A 4QPJA 2CGFA 4FCPA 4AWQA 4HZ0A 3MNRP 5CTYA 5J6AA 2YGEA 2YK9A 1Z5AA 2O1UA 3H80A 3RLPA 5IDMA 3OPDA 2YI5A 1US7A 2Q8IA 4MB9A 1Z59A 1THNA 4PU9A 3TZ4A 4FPPA 4EM7A 2IWSA 1TC6A 1BXDA 4XCLA 1H7UA 3BMYA 1I5DA 2Q2EB 4EGIA 4NH9A 4PRVA 4MP2A 2ZDXA 1KZNA 3CWVA 5BODA 1UYDA 3B24A 1UY7A 2YKEA 3Q5JA 4CWRA 2YE2A 3FT8A 3TTZA 3TUHA 2YE5A 2IORA 3HHUA 4BQGA 2YEDA 1YT2A 4UROA 3PEJA 1KIJA 2YKJA 3G75A 1MX0A 5D6PA 2XCMA 4W7TA 1PVGA 2YEBA 1B3QA 5FNDA 1A4HA 5GGZA 2GFDA 1TIDA 4AS9A 1UYMA 3T10A 3BM9A 1YS3A 4HZ5A 3T1KA 2FYPA 4U7NA 4EGHA 3SL2A 3D36A 4LP0A 4MP7A 2O1WA 4HYPA 2YEFA 3T2SA 3HZ5A 2BT0A 4JQLA 2IOPA 2YKBA 1AH8A 2BYIA 4P7AA 5M4HA 2YEGA 2JKIA 2IWUA 2XJGA 2VW5A 1YC4A 3ZXQA 4MBCA 1UY9A 3VHAA 1B63A 3CRKA 3R4MA 4E00A 4EGKA 5M4KA 2FWYA 2YI6A 1UYKA 1Y4UA 4BIZA 3C0EA 1I59A 2BSMA 2ZDYA 3R91A 2YKCA 3G7BA 4HY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZW9 A;  4H7Q A;  1YT0 A;  3EHH A;  2WI7 A;  4V25 A;  4YKW A;  1UYL A;  4CWF A;  4K4O A;  1Y4S A;  4ASA A;  4KTN A;  4I3H A;  1UYE A;  2IWX A;  2YEC A;  3K97 A;  1S16 A;  4H81 A;  3CGZ A;  5FNF A;  3GIG B;  4EMV A;  4FCQ A;  3T0Z A;  2YE3 A;  2YGA A;  1BKN A;  4E01 A;  4ASF A;  2E0A A;  2GQP A;  2XHT A;  4CWS A;  5M4M A;  5BOC A;  3B26 A;  3TZ2 A;  1I58 A;  1U0Z A;  4L90 A;  4XIR A;  1UYC A;  4BAE A;  4FMT A;  2YE7 A;  3CGY A;  4HYM A;  4L94 A;  4WUB A;  2O1V A;  3GIE A;  4Q20 A;  2XJJ A;  3CRL A;  3OMU A;  5CTW A;  3U67 A;  4GGL A;  4JAV A;  3ZKD A;  4CWO A;  1BGQ A;  1NHJ A;  2WER A;  5IN9 A;  2YGF A;  4XKA A;  4LPB A;  2VWC A;  3T0H A;  4L91 A;  2CCU A;  4URL A;  1BYQ A;  2WI2 A;  4GT8 A;  4YKZ A;  2PNR A;  3GIF A;  1TC0 A;  5CPH A;  2IOQ A;  4XKK A;  1AJ6 A;  1I5A A;  2XJX A;  3A0Y A;  2BU6 A;  1ZXM A;  2EXL A;  5CF0 A;  1ID0 A;  3INX A;  1MU5 A;  1NHH A;  1OSF A;  5FWK A;  3KE6 A;  1L0O A;  2H55 A;  4LWI A;  1AM1 A;  2YE8 A;  4LWF A;  4PRX A;  2BTZ A;  4DZY A;  3HYY A;  3VHC A;  2QG2 A;  2BU2 A;  4CWQ A;  2Q8H A;  4ZKI A;  1Y8N A;  3RKZ A;  2YEH A;  1Y8O A;  4XCJ A;  4KFG A;  1UY8 A;  4XC0 A;  4ASB A;  3LNU A;  4HXZ A;  1R62 A;  4GFN A;  4FCR A;  5CTU A;  2C2A A;  3VHD A;  4LWE A;  4XIQ A;  3A0W A;  2XX4 A;  2WEP A;  2WI4 A;  1I5B A;  3HEK A;  4ASG A;  2BU5 A;  4CE3 A;  1YC3 A;  1TH8 A;  4GEE A;  1B62 A;  2HG1 A;  2BU7 A;  2YK2 A;  4XTJ A;  2WI3 A;  3A0X A;  3QTF A;  2YEE A;  2ZBK B;  4EFT A;  4XE2 A;  2BYH A;  3R4N A;  1ZWH A;  1GKZ A;  4NH8 A;  4O05 A;  4GCZ A;  1UYG A;  3R4P A;  4YKX A;  3VAD A;  2YE9 A;  3OWD A;  1UY6 A;  4PL9 A;  2CG9 A;  5D7D A;  5FNC A;  1TIL A;  4XDM A;  1S14 A;  3NMQ A;  3R4O A;  2CH4 A;  4U93 A;  4CWT A;  2XHX A;  1YSR A;  3QDD A;  3HZ1 A;  2FXS A;  5D7C A;  1Y8P A;  3B27 A;  4MPC A;  1YER A;  3R92 A;  4AWO A;  4B6C A;  1YET A;  2JJC A;  3JZ3 A;  4CWN A;  4MPN A;  4P8O A;  4X9L A;  2WI1 A;  1I5C A;  3Q5K A;  4O09 A;  3OWB A;  5CTX A;  4MOT A;  3LPS A;  4NH7 A;  3IED A;  1UYH A;  4GQT A;  3U2K A;  2WI6 A;  5D6Q A;  3K60 A;  4YKU A;  1H7S A;  2ESA A;  2YE4 A;  4ZVI A;  3FT5 A;  3C11 A;  1QZR A;  2CCS A;  3O0I A;  4XKO A;  4URN A;  5J71 A;  4CE2 A;  1AMW A;  4HXW A;  2Q8G A;  2K5B A;  1QY8 A;  3RLR A;  2YJW A;  1YC1 A;  2XDK A;  2YI7 A;  5IDJ A;  4YKQ A;  1YES A;  5F3K A;  4YKT A;  4KSG A;  4XD8 A;  2BRE A;  4BIU A;  3TZ5 A;  4WUD A;  4R1F A;  4QPK A;  4V26 A;  1UYI A;  3EKO A;  4I5S A;  3EKR A;  4LWG A;  5C93 A;  2XDL A;  3ZKB A;  3INW A;  4R3M A;  3O2F A;  2YE6 A;  4KP4 A;  4DUH A;  2QFO A;  2YEJ A;  3HYZ A;  2VCI A;  2QF6 A;  2YEI A;  4L93 A;  4U7O A;  3EHF A;  3EHJ A;  1YT1 A;  2FWZ A;  3ZM7 A;  3D2R A;  4JAU A;  1TBW A;  3B25 A;  1UYF A;  2HCH A;  3FV5 A;  1Z5C A;  2XAB A;  2XX2 A;  5D7R A;  4R3A A;  2BU8 A;  1JM6 A;  2CCT A;  2Q8F A;  4L8Z A;  4CE1 A;  3A0Z A;  2AKP A;  4HY6 A;  2BRC A;  3H4L A;  3RLQ A;  3ZXO A;  5M4N A;  4O04 A;  4URM A;  2XDU A;  4WUC A;  5L3J A;  4E02 A;  3K98 A;  3EHG A;  2XDS A;  1YSZ A;  2YI0 A;  3WHA A;  3DGE A;  1NHI A;  1GKX A;  4O0B A;  2WEQ A;  2VCJ A;  4MPE A;  4YKY A;  4B7P A;  3A0T A;  1ZXN A;  4YKR A;  2HKJ A;  1U2O A;  2YEA A;  4XIT A;  2YJX A;  4AWP A;  4BQJ A;  3U2D A;  4EFU A;  4BXI A;  5F5R A;  4JAS A;  2XHR A;  4LWH A;  2ZKJ A;  2XK2 A;  3O6O A;  1AH6 A;  1Z5B A;  2XX5 A;  3G7E A;  2XD6 A;  2YKI A;  1QYE A;  3A0R A;  4H85 A;  4EEH A;  2H8M A;  1EI1 A;  3K99 A;  4KQV A;  4O07 A;  3WQ9 A;  3B28 A;  1GJV A;  5M4E A;  3OW6 A;  2QG0 A;  3GIG A;  2XDX A;  3TZ0 A;  3Q5L A;  2BZ5 A;  1EA6 A;  4KSH A;  4CWP A;  5M4P A;  2UWD A;  4XIP A;  3PEH A;  3D0B A;  2WI5 A;  4QPJ A;  2CGF A;  4FCP A;  4AWQ A;  4HZ0 A;  3MNR P;  5CTY A;  5J6A A;  2YGE A;  2YK9 A;  1Z5A A;  2O1U A;  3H80 A;  3RLP A;  5IDM A;  3OPD A;  2YI5 A;  1US7 A;  2Q8I A;  4MB9 A;  1Z59 A;  1THN A;  4PU9 A;  3TZ4 A;  4FPP A;  4EM7 A;  2IWS A;  1TC6 A;  1BXD A;  4XCL A;  1H7U A;  3BMY A;  1I5D A;  2Q2E B;  4EGI A;  4NH9 A;  4PRV A;  4MP2 A;  2ZDX A;  1KZN A;  3CWV A;  5BOD A;  1UYD A;  3B24 A;  1UY7 A;  2YKE A;  3Q5J A;  4CWR A;  2YE2 A;  3FT8 A;  3TTZ A;  3TUH A;  2YE5 A;  2IOR A;  3HHU A;  4BQG A;  2YED A;  1YT2 A;  4URO A;  3PEJ A;  1KIJ A;  2YKJ A;  3G75 A;  1MX0 A;  5D6P A;  2XCM A;  4W7T A;  1PVG A;  2YEB A;  1B3Q A;  5FND A;  1A4H A;  5GGZ A;  2GFD A;  1TID A;  4AS9 A;  1UYM A;  3T10 A;  3BM9 A;  1YS3 A;  4HZ5 A;  3T1K A;  2FYP A;  4U7N A;  4EGH A;  3SL2 A;  3D36 A;  4LP0 A;  4MP7 A;  2O1W A;  4HYP A;  2YEF A;  3T2S A;  3HZ5 A;  2BT0 A;  4JQL A;  2IOP A;  2YKB A;  1AH8 A;  2BYI A;  4P7A A;  5M4H A;  2YEG A;  2JKI A;  2IWU A;  2XJG A;  2VW5 A;  1YC4 A;  3ZXQ A;  4MBC A;  1UY9 A;  3VHA A;  1B63 A;  3CRK A;  3R4M A;  4E00 A;  4EGK A;  5M4K A;  2FWY A;  2YI6 A;  1UYK A;  1Y4U A;  4BIZ A;  3C0E A;  1I59 A;  2BSM A;  2ZDY A;  3R91 A;  2YKC A;  3G7B A;  4HY1 A; 
#chains in the Genus database with same CATH topology
 1ZW9 A;  4H7Q A;  1YT0 A;  3EHH A;  2WI7 A;  4V25 A;  4YKW A;  1UYL A;  4CWF A;  4K4O A;  1Y4S A;  4ASA A;  4KTN A;  4I3H A;  1UYE A;  2IWX A;  2C1I A;  2YEC A;  3K97 A;  1S16 A;  4H81 A;  3CGZ A;  5FNF A;  3GIG B;  4EMV A;  4FCQ A;  3T0Z A;  2YE3 A;  2YGA A;  1BKN A;  4E01 A;  4ASF A;  2E0A A;  2GQP A;  2XHT A;  4CWS A;  2HHI A;  5M4M A;  5BOC A;  3B26 A;  3TZ2 A;  1I58 A;  1U0Z A;  4L90 A;  4XIR A;  1UYC A;  4BAE A;  4FMT A;  2YE7 A;  3CGY A;  4HYM A;  4L94 A;  4WUB A;  2O1V A;  3GIE A;  4Q20 A;  2XJJ A;  3CRL A;  3OMU A;  5CTW A;  3U67 A;  4GGL A;  4JAV A;  3ZKD A;  4CWO A;  1BGQ A;  1F51 A;  1NHJ A;  2WER A;  5IN9 A;  2YGF A;  4XKA A;  4LPB A;  2VWC A;  3T0H A;  4L91 A;  2CCU A;  4URL A;  1BYQ A;  2WI2 A;  4GT8 A;  4YKZ A;  2PNR A;  3GIF A;  1TC0 A;  5CPH A;  2IOQ A;  4XKK A;  1AJ6 A;  1I5A A;  2XJX A;  3A0Y A;  2BU6 A;  1ZXM A;  2EXL A;  5CF0 A;  1ID0 A;  3INX A;  1MU5 A;  2FTK A;  1NHH A;  1OSF A;  5FWK A;  3KE6 A;  1L0O A;  2H55 A;  4LWI A;  1AM1 A;  2YE8 A;  4LWF A;  4PRX A;  2BTZ A;  1IXM A;  4DZY A;  3HYY A;  3VHC A;  2QG2 A;  2BU2 A;  4CWQ A;  2Q8H A;  4ZKI A;  1Y8N A;  3RKZ A;  2YEH A;  1Y8O A;  4XCJ A;  4KFG A;  1UY8 A;  4XC0 A;  4ASB A;  3LNU A;  4HXZ A;  1R62 A;  4GFN A;  4FCR A;  5CTU A;  2C2A A;  3VHD A;  4LWE A;  4XIQ A;  3A0W A;  2XX4 A;  2WEP A;  2WI4 A;  1I5B A;  3HEK A;  4ASG A;  2BU5 A;  4CE3 A;  1YC3 A;  1TH8 A;  4GEE A;  1B62 A;  2HG1 A;  2BU7 A;  2YK2 A;  4XTJ A;  2WI3 A;  3A0X A;  3QTF A;  2YEE A;  2ZBK B;  4EFT A;  4XE2 A;  2BYH A;  3R4N A;  1ZWH A;  1GKZ A;  4NH8 A;  4O05 A;  4GCZ A;  1UYG A;  3R4P A;  4YKX A;  3VAD A;  2YE9 A;  3OWD A;  1UY6 A;  4PL9 A;  2CG9 A;  5D7D A;  5FNC A;  1TIL A;  4XDM A;  1S14 A;  3NMQ A;  3R4O A;  2CH4 A;  4U93 A;  4CWT A;  2XHX A;  1YSR A;  3QDD A;  3HZ1 A;  2FXS A;  5D7C A;  1Y8P A;  3B27 A;  4MPC A;  1YER A;  3R92 A;  4AWO A;  4B6C A;  1YET A;  2JJC A;  3JZ3 A;  4CWN A;  4MPN A;  4P8O A;  4X9L A;  2WI1 A;  1I5C A;  3Q5K A;  4O09 A;  3OWB A;  5CTX A;  4MOT A;  3LPS A;  4NH7 A;  3IED A;  1UYH A;  4GQT A;  3U2K A;  2WI6 A;  5D6Q A;  3K60 A;  3LMM A;  4YKU A;  1H7S A;  2ESA A;  2YE4 A;  4ZVI A;  3FT5 A;  3C11 A;  1QZR A;  2CCS A;  3O0I A;  4XKO A;  4URN A;  5J71 A;  4CE2 A;  3S5T A;  1AMW A;  4HXW A;  2Q8G A;  2K5B A;  1QY8 A;  3RLR A;  2YJW A;  1YC1 A;  2XDK A;  2YI7 A;  5IDJ A;  4YKQ A;  1YES A;  5F3K A;  4YKT A;  4KSG A;  4XD8 A;  2BRE A;  4BIU A;  3TZ5 A;  4WUD A;  4R1F A;  4QPK A;  4V26 A;  1UYI A;  3EKO A;  4I5S A;  3EKR A;  4LWG A;  5C93 A;  2XDL A;  3ZKB A;  3INW A;  4R3M A;  3O2F A;  2YE6 A;  4KP4 A;  4DUH A;  2QFO A;  2YEJ A;  3HYZ A;  2VCI A;  5JEN A;  2QF6 A;  2YEI A;  4L93 A;  4U7O A;  3EHF A;  3EHJ A;  1YT1 A;  2FWZ A;  3ZM7 A;  3D2R A;  4JAU A;  1TBW A;  3B25 A;  2C1G A;  1UYF A;  2HCH A;  3FV5 A;  1Z5C A;  2XAB A;  2XX2 A;  5D7R A;  4R3A A;  2BU8 A;  1JM6 A;  2CCT A;  2Q8F A;  4L8Z A;  4CE1 A;  3CYG A;  3A0Z A;  2AKP A;  4HY6 A;  2BRC A;  3H4L A;  3RLQ A;  3ZXO A;  5M4N A;  4O04 A;  4URM A;  2XDU A;  4WUC A;  5L3J A;  4E02 A;  3K98 A;  3EHG A;  2XDS A;  1YSZ A;  2YI0 A;  3WHA A;  3DGE A;  1NHI A;  1GKX A;  4O0B A;  2WEQ A;  2VCJ A;  4MPE A;  4YKY A;  4B7P A;  3A0T A;  1ZXN A;  4YKR A;  2HKJ A;  1U2O A;  2YEA A;  4XIT A;  2YJX A;  4AWP A;  4BQJ A;  3U2D A;  4EFU A;  4BXI A;  5F5R A;  4JAS A;  2XHR A;  4LWH A;  2ZKJ A;  2XK2 A;  3O6O A;  1AH6 A;  1Z5B A;  2XX5 A;  3G7E A;  2XD6 A;  2YKI A;  1QYE A;  3A0R A;  4H85 A;  4EEH A;  2H8M A;  1EI1 A;  3K99 A;  4KQV A;  4O07 A;  3WQ9 A;  3B28 A;  1GJV A;  5M4E A;  3OW6 A;  2QG0 A;  3GIG A;  2XDX A;  3TZ0 A;  3Q5L A;  2BZ5 A;  1EA6 A;  4KSH A;  4CWP A;  5M4P A;  2UWD A;  4XIP A;  3PEH A;  3D0B A;  2WI5 A;  4QPJ A;  2CGF A;  4FCP A;  4AWQ A;  4HZ0 A;  3MNR P;  5CTY A;  5J6A A;  2YGE A;  2YK9 A;  1Z5A A;  2O1U A;  3H80 A;  3RLP A;  5IDM A;  3OPD A;  2YI5 A;  1US7 A;  2Q8I A;  4MB9 A;  1Z59 A;  1THN A;  4PU9 A;  3TZ4 A;  4FPP A;  4EM7 A;  2IWS A;  1TC6 A;  1BXD A;  4XCL A;  1H7U A;  3BMY A;  1I5D A;  2Q2E B;  4EGI A;  4NH9 A;  4PRV A;  4MP2 A;  2ZDX A;  1KZN A;  3CWV A;  5BOD A;  1UYD A;  3B24 A;  1UY7 A;  2YKE A;  3Q5J A;  4CWR A;  2YE2 A;  3FT8 A;  3TTZ A;  3TUH A;  2YE5 A;  2IOR A;  3HHU A;  4BQG A;  2YED A;  1YT2 A;  4URO A;  3PEJ A;  1KIJ A;  2YKJ A;  3G75 A;  1MX0 A;  5D6P A;  2XCM A;  4W7T A;  1PVG A;  4E72 A;  2YEB A;  1B3Q A;  5FND A;  1A4H A;  5GGZ A;  2GFD A;  1TID A;  4AS9 A;  1UYM A;  3T10 A;  3BM9 A;  1YS3 A;  4HZ5 A;  3T1K A;  2FYP A;  4U7N A;  4EGH A;  3SL2 A;  3D36 A;  4LP0 A;  4MP7 A;  2O1W A;  4HYP A;  2YEF A;  3T2S A;  3HZ5 A;  2BT0 A;  4JQL A;  2IOP A;  2YKB A;  1AH8 A;  2BYI A;  4P7A A;  5M4H A;  2YEG A;  2JKI A;  2IWU A;  2XJG A;  2VW5 A;  1YC4 A;  3ZXQ A;  4MBC A;  1UY9 A;  3VHA A;  1B63 A;  3CRK A;  3R4M A;  4E00 A;  4EGK A;  5M4K A;  2FWY A;  2YI6 A;  1UYK A;  1Y4U A;  4BIZ A;  3C0E A;  1I59 A;  2BSM A;  2ZDY A;  3R91 A;  2YKC A;  3G7B A;  4HY1 A; 
#chains in the Genus database with same CATH homology
 1ZW9 A;  4H7Q A;  1YT0 A;  3EHH A;  2WI7 A;  4V25 A;  4YKW A;  1UYL A;  4CWF A;  4K4O A;  1Y4S A;  4ASA A;  4KTN A;  4I3H A;  1UYE A;  2IWX A;  2YEC A;  3K97 A;  1S16 A;  4H81 A;  3CGZ A;  5FNF A;  3GIG B;  4EMV A;  4FCQ A;  3T0Z A;  2YE3 A;  2YGA A;  1BKN A;  4E01 A;  4ASF A;  2E0A A;  2GQP A;  2XHT A;  4CWS A;  5M4M A;  5BOC A;  3B26 A;  3TZ2 A;  1I58 A;  1U0Z A;  4L90 A;  4XIR A;  1UYC A;  4BAE A;  4FMT A;  2YE7 A;  3CGY A;  4HYM A;  4L94 A;  4WUB A;  2O1V A;  3GIE A;  4Q20 A;  2XJJ A;  3CRL A;  3OMU A;  5CTW A;  3U67 A;  4GGL A;  4JAV A;  3ZKD A;  4CWO A;  1BGQ A;  1NHJ A;  2WER A;  5IN9 A;  2YGF A;  4XKA A;  4LPB A;  2VWC A;  3T0H A;  4L91 A;  2CCU A;  4URL A;  1BYQ A;  2WI2 A;  4GT8 A;  4YKZ A;  2PNR A;  3GIF A;  1TC0 A;  5CPH A;  2IOQ A;  4XKK A;  1AJ6 A;  1I5A A;  2XJX A;  3A0Y A;  2BU6 A;  1ZXM A;  2EXL A;  5CF0 A;  1ID0 A;  3INX A;  1MU5 A;  1NHH A;  1OSF A;  5FWK A;  3KE6 A;  1L0O A;  2H55 A;  4LWI A;  1AM1 A;  2YE8 A;  4LWF A;  4PRX A;  2BTZ A;  4DZY A;  3HYY A;  3VHC A;  2QG2 A;  2BU2 A;  4CWQ A;  2Q8H A;  4ZKI A;  1Y8N A;  3RKZ A;  2YEH A;  1Y8O A;  4XCJ A;  4KFG A;  1UY8 A;  4XC0 A;  4ASB A;  3LNU A;  4HXZ A;  1R62 A;  4GFN A;  4FCR A;  5CTU A;  2C2A A;  3VHD A;  4LWE A;  4XIQ A;  3A0W A;  2XX4 A;  2WEP A;  2WI4 A;  1I5B A;  3HEK A;  4ASG A;  2BU5 A;  4CE3 A;  1YC3 A;  1TH8 A;  4GEE A;  1B62 A;  2HG1 A;  2BU7 A;  2YK2 A;  4XTJ A;  2WI3 A;  3A0X A;  3QTF A;  2YEE A;  2ZBK B;  4EFT A;  4XE2 A;  2BYH A;  3R4N A;  1ZWH A;  1GKZ A;  4NH8 A;  4O05 A;  4GCZ A;  1UYG A;  3R4P A;  4YKX A;  3VAD A;  2YE9 A;  3OWD A;  1UY6 A;  4PL9 A;  2CG9 A;  5D7D A;  5FNC A;  1TIL A;  4XDM A;  1S14 A;  3NMQ A;  3R4O A;  2CH4 A;  4U93 A;  4CWT A;  2XHX A;  1YSR A;  3QDD A;  3HZ1 A;  2FXS A;  5D7C A;  1Y8P A;  3B27 A;  4MPC A;  1YER A;  3R92 A;  4AWO A;  4B6C A;  1YET A;  2JJC A;  3JZ3 A;  4CWN A;  4MPN A;  4P8O A;  4X9L A;  2WI1 A;  1I5C A;  3Q5K A;  4O09 A;  3OWB A;  5CTX A;  4MOT A;  3LPS A;  4NH7 A;  3IED A;  1UYH A;  4GQT A;  3U2K A;  2WI6 A;  5D6Q A;  3K60 A;  4YKU A;  1H7S A;  2ESA A;  2YE4 A;  4ZVI A;  3FT5 A;  3C11 A;  1QZR A;  2CCS A;  3O0I A;  4XKO A;  4URN A;  5J71 A;  4CE2 A;  1AMW A;  4HXW A;  2Q8G A;  2K5B A;  1QY8 A;  3RLR A;  2YJW A;  1YC1 A;  2XDK A;  2YI7 A;  5IDJ A;  4YKQ A;  1YES A;  5F3K A;  4YKT A;  4KSG A;  4XD8 A;  2BRE A;  4BIU A;  3TZ5 A;  4WUD A;  4R1F A;  4QPK A;  4V26 A;  1UYI A;  3EKO A;  4I5S A;  3EKR A;  4LWG A;  5C93 A;  2XDL A;  3ZKB A;  3INW A;  4R3M A;  3O2F A;  2YE6 A;  4KP4 A;  4DUH A;  2QFO A;  2YEJ A;  3HYZ A;  2VCI A;  2QF6 A;  2YEI A;  4L93 A;  4U7O A;  3EHF A;  3EHJ A;  1YT1 A;  2FWZ A;  3ZM7 A;  3D2R A;  4JAU A;  1TBW A;  3B25 A;  1UYF A;  2HCH A;  3FV5 A;  1Z5C A;  2XAB A;  2XX2 A;  5D7R A;  4R3A A;  2BU8 A;  1JM6 A;  2CCT A;  2Q8F A;  4L8Z A;  4CE1 A;  3A0Z A;  2AKP A;  4HY6 A;  2BRC A;  3H4L A;  3RLQ A;  3ZXO A;  5M4N A;  4O04 A;  4URM A;  2XDU A;  4WUC A;  5L3J A;  4E02 A;  3K98 A;  3EHG A;  2XDS A;  1YSZ A;  2YI0 A;  3WHA A;  3DGE A;  1NHI A;  1GKX A;  4O0B A;  2WEQ A;  2VCJ A;  4MPE A;  4YKY A;  4B7P A;  3A0T A;  1ZXN A;  4YKR A;  2HKJ A;  1U2O A;  2YEA A;  4XIT A;  2YJX A;  4AWP A;  4BQJ A;  3U2D A;  4EFU A;  4BXI A;  5F5R A;  4JAS A;  2XHR A;  4LWH A;  2ZKJ A;  2XK2 A;  3O6O A;  1AH6 A;  1Z5B A;  2XX5 A;  3G7E A;  2XD6 A;  2YKI A;  1QYE A;  3A0R A;  4H85 A;  4EEH A;  2H8M A;  1EI1 A;  3K99 A;  4KQV A;  4O07 A;  3WQ9 A;  3B28 A;  1GJV A;  5M4E A;  3OW6 A;  2QG0 A;  3GIG A;  2XDX A;  3TZ0 A;  3Q5L A;  2BZ5 A;  1EA6 A;  4KSH A;  4CWP A;  5M4P A;  2UWD A;  4XIP A;  3PEH A;  3D0B A;  2WI5 A;  4QPJ A;  2CGF A;  4FCP A;  4AWQ A;  4HZ0 A;  3MNR P;  5CTY A;  5J6A A;  2YGE A;  2YK9 A;  1Z5A A;  2O1U A;  3H80 A;  3RLP A;  5IDM A;  3OPD A;  2YI5 A;  1US7 A;  2Q8I A;  4MB9 A;  1Z59 A;  1THN A;  4PU9 A;  3TZ4 A;  4FPP A;  4EM7 A;  2IWS A;  1TC6 A;  1BXD A;  4XCL A;  1H7U A;  3BMY A;  1I5D A;  2Q2E B;  4EGI A;  4NH9 A;  4PRV A;  4MP2 A;  2ZDX A;  1KZN A;  3CWV A;  5BOD A;  1UYD A;  3B24 A;  1UY7 A;  2YKE A;  3Q5J A;  4CWR A;  2YE2 A;  3FT8 A;  3TTZ A;  3TUH A;  2YE5 A;  2IOR A;  3HHU A;  4BQG A;  2YED A;  1YT2 A;  4URO A;  3PEJ A;  1KIJ A;  2YKJ A;  3G75 A;  1MX0 A;  5D6P A;  2XCM A;  4W7T A;  1PVG A;  2YEB A;  1B3Q A;  5FND A;  1A4H A;  5GGZ A;  2GFD A;  1TID A;  4AS9 A;  1UYM A;  3T10 A;  3BM9 A;  1YS3 A;  4HZ5 A;  3T1K A;  2FYP A;  4U7N A;  4EGH A;  3SL2 A;  3D36 A;  4LP0 A;  4MP7 A;  2O1W A;  4HYP A;  2YEF A;  3T2S A;  3HZ5 A;  2BT0 A;  4JQL A;  2IOP A;  2YKB A;  1AH8 A;  2BYI A;  4P7A A;  5M4H A;  2YEG A;  2JKI A;  2IWU A;  2XJG A;  2VW5 A;  1YC4 A;  3ZXQ A;  4MBC A;  1UY9 A;  3VHA A;  1B63 A;  3CRK A;  3R4M A;  4E00 A;  4EGK A;  5M4K A;  2FWY A;  2YI6 A;  1UYK A;  1Y4U A;  4BIZ A;  3C0E A;  1I59 A;  2BSM A;  2ZDY A;  3R91 A;  2YKC A;  3G7B A;  4HY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...