3ZXQA

Crystal structure of the atp-binding domain of mycobacterium tuberculosis dost
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
TGLRHRLDKVIDQLAIPALHTTVQYTGPLSVVDTVLANHAEAVLREAVSNAVRHANATSLAINVSVEDDVRVEVVDDGVGISGDITESGLRNLRQRADDAGGEFTVENMPTGGTLLRWSAPLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYPOXIA SENSOR HISTIDINE KINASE RESPONSE REGULATOR DOST
publication title Activation of ATP Binding for the Autophosphorylation of Doss, a Mycobacterium Tuberculosis Histidine Kinase Lacking an ATP-Lid Motif.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 33
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3zxqA00
1U2OA 2WI4A 1I5AA 2PNRA 4XCLA 5IDMA 2YEFA 3T10A 4YKYA 1I5DA 4FPPA 5FWKA 4URNA 3KE6A 3RKZA 2BU5A 1UYIA 2VCJA 3A0YA 3RLPA 4DUHA 2YJXA 3D36A 2WI6A 3CRKA 3B27A 4O04A 4XKKA 4U7NA 1Z5CA 4JAUA 3T0ZA 1ZXMA 4GT8A 5D6PA 3VHCA 2FXSA 1BXDA 4MP2A 4XTJA 5FNDA 1US7A 2FYPA 3EHHA 4O05A 1UYFA 4XCJA 4U93A 4I3HA 1S14A 5J6AA 4P7AA 4GQTA 4W7TA 3Q5KA 3K98A 4YKXA 1YT2A 3G7BA 4JAVA 4JASA 4V25A 4H7QA 2ESAA 3O6OA 1KZNA 2YEDA 4XKOA 2WEPA 3C0EA 2YEIA 2ZDXA 5CTYA 5CTWA 3QDDA 2ZKJA 3K99A 4PL9A 2BU6A 3TZ4A 4XE2A 2YE6A 4EFTA 1MU5A 1ID0A 4L90A 4ZVIA 4EGIA 2YE7A 1PVGA 3OMUA 3NMQA 2IOQA 5D7RA 2GFDA 2O1WA 4HXZA 2O1UA 3A0RA 3H4LA 1UY8A 1OSFA 1GKXA 2QF6A 3HYZA 3GIEA 4BQJA 4CWFA 2YGAA 3WQ9A 2XX2A 2XJGA 2BRCA 2YE9A 3HYYA 5FNCA 3G75A 3QTFA 1H7UA 3LNUA 2YE5A 1H7SA 5M4EA 1JM6A 5BODA 4EGKA 2YK9A 1NHIA 2BU7A 1KIJA 3U2KA 2YK2A 1I5BA 2FWZA 4XITA 1AH6A 3B24A 3B26A 4E02A 3TZ0A 4EEHA 4Q20A 1Z5BA 2Q2EB 1UY7A 2YGEA 2CCUA 3WHAA 1I59A 4WUCA 1AM1A 2YI0A 4XDMA 4EGHA 1UY9A 2EXLA 3GIGB 4MPCA 4BXIA 1THNA 2YKJA 4HYPA 2Q8FA 4DZYA 4CWPA 4URMA 3JZ3A 2WI2A 5L3JA 2XX5A 4AWOA 1EA6A 2CCSA 4QPJA 1TILA 1AJ6A 3A0XA 4ASGA 4CWNA 5BOCA 2JJCA 2E0AA 3TTZA 5CPHA 1Y4SA 2YJWA 2XDLA 4HY1A 2YEHA 3Q5JA 2IWUA 1B3QA 1ZW9A 2GQPA 2YE2A 4AWPA 4I5SA 1BGQA 2YEJA 2YE8A 3DGEA 2BTZA 2XK2A 4KTNA 4XKAA 2YECA 4E01A 3FT8A 2XD6A 4H85A 3A0TA 4LWFA 3K60A 2C2AA 4FCRA 2Q8IA 4CE1A 4U7OA 2BU2A 5D7CA 2YGFA 4H81A 2XDKA 4MP7A 2XABA 5F3KA 5F5RA 2K5BA 4YKUA 1L0OA 4FCQA 1Y8PA 1EI1A 3INWA 4V26A 4CE2A 3U67A 4XIPA 3GIGA 3R4OA 4QPKA 3BM9A 4ASAA 4LWIA 3FV5A 4L94A 1Z5AA 3EKRA 3OWBA 3INXA 4HZ0A 4HYMA 2IORA 4HY6A 1Y8NA 2HKJA 2VW5A 2YEAA 3VADA 4KQVA 4O0BA 4O09A 1TH8A 1R62A 3ZKDA 4XIRA 4UROA 1YESA 2ZDYA 3K97A 2WI3A 4EMVA 5D6QA 1YETA 2BZ5A 4KP4A 1UY6A 2XDUA 4KSHA 4YKQA 4CWSA 3CGYA 4K4OA 3CGZA 2XJXA 5GGZA 2CGFA 2XJJA 3T1KA 2YE4A 3O2FA 4B7PA 4MPNA 1MX0A 2FWYA 2CCTA 5IN9A 5M4HA 3T0HA 4XIQA 3A0ZA 2Q8HA 3R4MA 4NH7A 4FCPA 2XCMA 4MBCA 3GIFA 4WUBA 3R92A 4CWQA 1I5CA 1B63A 4AS9A 1A4HA 4YKTA 4B6CA 2QG2A 1I58A 4LPBA 3OWDA 4L91A 1Z59A 1YT0A 1QZRA 2BSMA 3SL2A 2QG0A 3LPSA 1UYCA 2BYIA 4AWQA 2YI6A 1YC4A 2YKIA 1U0ZA 2XHXA 4MPEA 2VCIA 5M4MA 3A0WA 2YI7A 2O1VA 2VWCA 2IWSA 4ASBA 2HCHA 2BU8A 4LWHA 3CRLA 4R1FA 2WERA 3EKOA 3MNRP 2QFOA 2WI5A 4LWGA 1UYGA 2YE3A 4BQGA 2XHRA 3R91A 4NH8A 3OW6A 2XDSA 1TC6A 4MOTA 1UYDA 4R3MA 3Q5LA 5C93A 3BMYA 4BAEA 2BREA 2IOPA 4LWEA 2IWXA 2XHTA 4P8OA 1UYHA 3EHFA 1UYLA 4XC0A 1ZXNA 5CTUA 2JKIA 4GFNA 1YT1A 4PRVA 4EM7A 4FMTA 1YS3A 4X9LA 1B62A 4LP0A 3PEJA 1BYQA 2UWDA 1QYEA 3T2SA 3TZ2A 5CF0A 5J71A 2Q8GA 3PEHA 3VHDA 3R4PA 4YKWA 4CWOA 5D7DA 4BIUA 1UYEA 3HZ1A 4YKRA 4HXWA 3D0BA 2AKPA 3RLQA 2HG1A 3D2RA 3ZM7A 4XD8A 1UYKA 3HZ5A 4JQLA 4KSGA 4ASFA 4MB9A 3EHGA 4PRXA 5FNFA 2ZBKB 4HZ5A 4EFUA 4R3AA 3G7EA 1YC3A 3IEDA 3HHUA 1AMWA 3O0IA 1ZWHA 5M4KA 2CH4A 2YI5A 2YKEA 4L8ZA 3ZXQA 1YSZA 1NHHA 2H8MA 5M4NA 1Y8OA 4BIZA 4URLA 4NH9A 3U2DA 1UYMA 4GEEA 1NHJA 1TIDA 1AH8A 5M4PA 2BT0A 3B28A 2WEQA 3TUHA 1YSRA 2H55A 1YERA 5IDJA 4L93A 2CG9A 3ZKBA 4O07A 3CWVA 2YKBA 2YEGA 4WUDA 5CTXA 1GJVA 3H80A 3R4NA 2YEEA 4CE3A 1TBWA 3ZXOA 1Y4UA 1TC0A 3B25A 3C11A 2WI7A 4GCZA 4CWTA 4YKZA 3HEKA 1YC1A 4GGLA 3RLRA 1BKNA 1GKZA 4KFGA 3VHAA 1QY8A 2WI1A 4E00A 2XX4A 2BYHA 1S16A 2YEBA 4ZKIA 3FT5A 2YKCA 3EHJA 4PU9A 3OPDA 3TZ5A 4CWRA 2XDXA
chains in the Genus database with same CATH superfamily
1U2OA 2WI4A 1I5AA 2PNRA 4XCLA 5IDMA 2C1IA 2YEFA 5JENA 3T10A 4YKYA 1I5DA 4FPPA 5FWKA 4URNA 3KE6A 3RKZA 2BU5A 1UYIA 2VCJA 3A0YA 3RLPA 4DUHA 2YJXA 3D36A 2WI6A 3CRKA 3B27A 4O04A 4XKKA 4U7NA 1Z5CA 4JAUA 3T0ZA 1ZXMA 4GT8A 5D6PA 3VHCA 2FXSA 1BXDA 4E72A 4MP2A 4XTJA 5FNDA 1US7A 2FYPA 3EHHA 4O05A 1UYFA 4XCJA 4U93A 4I3HA 1S14A 5J6AA 4P7AA 4GQTA 4W7TA 3Q5KA 3K98A 4YKXA 1YT2A 3G7BA 4JAVA 4JASA 4V25A 4H7QA 2ESAA 3O6OA 1KZNA 2YEDA 4XKOA 2WEPA 3C0EA 2YEIA 2ZDXA 5CTYA 5CTWA 3QDDA 2ZKJA 3K99A 4PL9A 2BU6A 3TZ4A 4XE2A 2YE6A 4EFTA 1MU5A 1ID0A 4L90A 4ZVIA 4EGIA 2YE7A 1PVGA 3OMUA 3NMQA 2IOQA 5D7RA 2GFDA 2O1WA 4HXZA 2O1UA 3A0RA 3S5TA 3H4LA 1UY8A 1OSFA 1GKXA 2QF6A 3HYZA 3GIEA 4BQJA 4CWFA 2YGAA 3WQ9A 2XX2A 2XJGA 2BRCA 2YE9A 3HYYA 5FNCA 3G75A 3QTFA 1H7UA 3LNUA 2YE5A 1H7SA 5M4EA 1JM6A 5BODA 4EGKA 2YK9A 1NHIA 2BU7A 1KIJA 3U2KA 2YK2A 1I5BA 2FWZA 4XITA 1AH6A 3B24A 3B26A 4E02A 3TZ0A 4EEHA 4Q20A 1Z5BA 2Q2EB 1UY7A 2YGEA 2CCUA 3WHAA 1I59A 4WUCA 3CYGA 1AM1A 2YI0A 4XDMA 4EGHA 1UY9A 2EXLA 3GIGB 4MPCA 4BXIA 1THNA 2YKJA 4HYPA 2Q8FA 4DZYA 4CWPA 4URMA 3JZ3A 2WI2A 5L3JA 2XX5A 4AWOA 1EA6A 2CCSA 4QPJA 1TILA 1AJ6A 3A0XA 4ASGA 4CWNA 5BOCA 2JJCA 2E0AA 3TTZA 5CPHA 1Y4SA 2YJWA 2XDLA 4HY1A 2YEHA 3Q5JA 2HHIA 2IWUA 1B3QA 1ZW9A 2GQPA 2YE2A 4AWPA 4I5SA 1BGQA 2YEJA 2YE8A 3DGEA 2BTZA 2XK2A 4KTNA 4XKAA 2YECA 4E01A 3FT8A 2XD6A 4H85A 3A0TA 4LWFA 3K60A 1IXMA 2C2AA 4FCRA 2Q8IA 4CE1A 4U7OA 2BU2A 5D7CA 2YGFA 4H81A 2XDKA 4MP7A 2XABA 5F3KA 5F5RA 2K5BA 4YKUA 1L0OA 4FCQA 1Y8PA 1EI1A 3INWA 4V26A 4CE2A 3U67A 4XIPA 3GIGA 3R4OA 4QPKA 3BM9A 4ASAA 4LWIA 3FV5A 4L94A 1Z5AA 3EKRA 3OWBA 3INXA 4HZ0A 4HYMA 2IORA 4HY6A 1Y8NA 2HKJA 2VW5A 2YEAA 3VADA 4KQVA 4O0BA 4O09A 1TH8A 1R62A 3ZKDA 4XIRA 4UROA 1YESA 2ZDYA 3K97A 2WI3A 4EMVA 5D6QA 1YETA 2BZ5A 4KP4A 1UY6A 2XDUA 4KSHA 4YKQA 4CWSA 3CGYA 4K4OA 3CGZA 2XJXA 5GGZA 2CGFA 2XJJA 3T1KA 2YE4A 3O2FA 4B7PA 4MPNA 1MX0A 2FWYA 2CCTA 5IN9A 5M4HA 3T0HA 4XIQA 3A0ZA 2Q8HA 3R4MA 4NH7A 4FCPA 2XCMA 4MBCA 3GIFA 4WUBA 3R92A 4CWQA 1I5CA 1B63A 4AS9A 1A4HA 4YKTA 4B6CA 2QG2A 1I58A 4LPBA 3OWDA 4L91A 1Z59A 1YT0A 1QZRA 2BSMA 3SL2A 2QG0A 3LPSA 1UYCA 2BYIA 4AWQA 2YI6A 1YC4A 2YKIA 1U0ZA 2XHXA 4MPEA 2VCIA 5M4MA 3A0WA 2YI7A 2O1VA 2VWCA 2IWSA 4ASBA 2HCHA 2BU8A 4LWHA 3CRLA 4R1FA 2WERA 3EKOA 3MNRP 2QFOA 2WI5A 4LWGA 1UYGA 2YE3A 4BQGA 2XHRA 3R91A 4NH8A 3LMMA 3OW6A 2XDSA 1TC6A 4MOTA 2C1GA 1UYDA 4R3MA 3Q5LA 5C93A 3BMYA 4BAEA 2BREA 2IOPA 4LWEA 2IWXA 2XHTA 4P8OA 1UYHA 3EHFA 1UYLA 4XC0A 1ZXNA 5CTUA 2JKIA 4GFNA 1YT1A 4PRVA 4EM7A 4FMTA 1YS3A 4X9LA 1B62A 4LP0A 3PEJA 1BYQA 2UWDA 1QYEA 3T2SA 3TZ2A 5CF0A 5J71A 2Q8GA 3PEHA 3VHDA 3R4PA 4YKWA 4CWOA 5D7DA 4BIUA 1UYEA 3HZ1A 4YKRA 4HXWA 3D0BA 2AKPA 3RLQA 2HG1A 3D2RA 3ZM7A 4XD8A 1UYKA 3HZ5A 4JQLA 4KSGA 4ASFA 4MB9A 3EHGA 2FTKA 4PRXA 5FNFA 2ZBKB 4HZ5A 4EFUA 4R3AA 3G7EA 1YC3A 3IEDA 3HHUA 1AMWA 3O0IA 1ZWHA 5M4KA 2CH4A 2YI5A 2YKEA 4L8ZA 3ZXQA 1YSZA 1NHHA 2H8MA 5M4NA 1Y8OA 4BIZA 4URLA 4NH9A 3U2DA 1UYMA 4GEEA 1NHJA 1TIDA 1AH8A 5M4PA 2BT0A 3B28A 2WEQA 3TUHA 1YSRA 2H55A 1YERA 5IDJA 4L93A 2CG9A 3ZKBA 4O07A 3CWVA 2YKBA 2YEGA 4WUDA 5CTXA 1GJVA 3H80A 3R4NA 2YEEA 4CE3A 1TBWA 3ZXOA 1Y4UA 1TC0A 3B25A 3C11A 1F51A 2WI7A 4GCZA 4CWTA 4YKZA 3HEKA 1YC1A 4GGLA 3RLRA 1BKNA 1GKZA 4KFGA 3VHAA 1QY8A 2WI1A 4E00A 2XX4A 2BYHA 1S16A 2YEBA 4ZKIA 3FT5A 2YKCA 3EHJA 4PU9A 3OPDA 3TZ5A 4CWRA 2XDXA
chains in the Genus database with same CATH topology
1U2OA 2WI4A 1I5AA 2PNRA 4XCLA 5IDMA 2YEFA 3T10A 4YKYA 1I5DA 4FPPA 5FWKA 4URNA 3KE6A 3RKZA 2BU5A 1UYIA 2VCJA 3A0YA 3RLPA 4DUHA 2YJXA 3D36A 2WI6A 3CRKA 3B27A 4O04A 4XKKA 4U7NA 1Z5CA 4JAUA 3T0ZA 1ZXMA 4GT8A 5D6PA 3VHCA 2FXSA 1BXDA 4MP2A 4XTJA 5FNDA 1US7A 2FYPA 3EHHA 4O05A 1UYFA 4XCJA 4U93A 4I3HA 1S14A 5J6AA 4P7AA 4GQTA 4W7TA 3Q5KA 3K98A 4YKXA 1YT2A 3G7BA 4JAVA 4JASA 4V25A 4H7QA 2ESAA 3O6OA 1KZNA 2YEDA 4XKOA 2WEPA 3C0EA 2YEIA 2ZDXA 5CTYA 5CTWA 3QDDA 2ZKJA 3K99A 4PL9A 2BU6A 3TZ4A 4XE2A 2YE6A 4EFTA 1MU5A 1ID0A 4L90A 4ZVIA 4EGIA 2YE7A 1PVGA 3OMUA 3NMQA 2IOQA 5D7RA 2GFDA 2O1WA 4HXZA 2O1UA 3A0RA 3H4LA 1UY8A 1OSFA 1GKXA 2QF6A 3HYZA 3GIEA 4BQJA 4CWFA 2YGAA 3WQ9A 2XX2A 2XJGA 2BRCA 2YE9A 3HYYA 5FNCA 3G75A 3QTFA 1H7UA 3LNUA 2YE5A 1H7SA 5M4EA 1JM6A 5BODA 4EGKA 2YK9A 1NHIA 2BU7A 1KIJA 3U2KA 2YK2A 1I5BA 2FWZA 4XITA 1AH6A 3B24A 3B26A 4E02A 3TZ0A 4EEHA 4Q20A 1Z5BA 2Q2EB 1UY7A 2YGEA 2CCUA 3WHAA 1I59A 4WUCA 1AM1A 2YI0A 4XDMA 4EGHA 1UY9A 2EXLA 3GIGB 4MPCA 4BXIA 1THNA 2YKJA 4HYPA 2Q8FA 4DZYA 4CWPA 4URMA 3JZ3A 2WI2A 5L3JA 2XX5A 4AWOA 1EA6A 2CCSA 4QPJA 1TILA 1AJ6A 3A0XA 4ASGA 4CWNA 5BOCA 2JJCA 2E0AA 3TTZA 5CPHA 1Y4SA 2YJWA 2XDLA 4HY1A 2YEHA 3Q5JA 2IWUA 1B3QA 1ZW9A 2GQPA 2YE2A 4AWPA 4I5SA 1BGQA 2YEJA 2YE8A 3DGEA 2BTZA 2XK2A 4KTNA 4XKAA 2YECA 4E01A 3FT8A 2XD6A 4H85A 3A0TA 4LWFA 3K60A 2C2AA 4FCRA 2Q8IA 4CE1A 4U7OA 2BU2A 5D7CA 2YGFA 4H81A 2XDKA 4MP7A 2XABA 5F3KA 5F5RA 2K5BA 4YKUA 1L0OA 4FCQA 1Y8PA 1EI1A 3INWA 4V26A 4CE2A 3U67A 4XIPA 3GIGA 3R4OA 4QPKA 3BM9A 4ASAA 4LWIA 3FV5A 4L94A 1Z5AA 3EKRA 3OWBA 3INXA 4HZ0A 4HYMA 2IORA 4HY6A 1Y8NA 2HKJA 2VW5A 2YEAA 3VADA 4KQVA 4O0BA 4O09A 1TH8A 1R62A 3ZKDA 4XIRA 4UROA 1YESA 2ZDYA 3K97A 2WI3A 4EMVA 5D6QA 1YETA 2BZ5A 4KP4A 1UY6A 2XDUA 4KSHA 4YKQA 4CWSA 3CGYA 4K4OA 3CGZA 2XJXA 5GGZA 2CGFA 2XJJA 3T1KA 2YE4A 3O2FA 4B7PA 4MPNA 1MX0A 2FWYA 2CCTA 5IN9A 5M4HA 3T0HA 4XIQA 3A0ZA 2Q8HA 3R4MA 4NH7A 4FCPA 2XCMA 4MBCA 3GIFA 4WUBA 3R92A 4CWQA 1I5CA 1B63A 4AS9A 1A4HA 4YKTA 4B6CA 2QG2A 1I58A 4LPBA 3OWDA 4L91A 1Z59A 1YT0A 1QZRA 2BSMA 3SL2A 2QG0A 3LPSA 1UYCA 2BYIA 4AWQA 2YI6A 1YC4A 2YKIA 1U0ZA 2XHXA 4MPEA 2VCIA 5M4MA 3A0WA 2YI7A 2O1VA 2VWCA 2IWSA 4ASBA 2HCHA 2BU8A 4LWHA 3CRLA 4R1FA 2WERA 3EKOA 3MNRP 2QFOA 2WI5A 4LWGA 1UYGA 2YE3A 4BQGA 2XHRA 3R91A 4NH8A 3OW6A 2XDSA 1TC6A 4MOTA 1UYDA 4R3MA 3Q5LA 5C93A 3BMYA 4BAEA 2BREA 2IOPA 4LWEA 2IWXA 2XHTA 4P8OA 1UYHA 3EHFA 1UYLA 4XC0A 1ZXNA 5CTUA 2JKIA 4GFNA 1YT1A 4PRVA 4EM7A 4FMTA 1YS3A 4X9LA 1B62A 4LP0A 3PEJA 1BYQA 2UWDA 1QYEA 3T2SA 3TZ2A 5CF0A 5J71A 2Q8GA 3PEHA 3VHDA 3R4PA 4YKWA 4CWOA 5D7DA 4BIUA 1UYEA 3HZ1A 4YKRA 4HXWA 3D0BA 2AKPA 3RLQA 2HG1A 3D2RA 3ZM7A 4XD8A 1UYKA 3HZ5A 4JQLA 4KSGA 4ASFA 4MB9A 3EHGA 4PRXA 5FNFA 2ZBKB 4HZ5A 4EFUA 4R3AA 3G7EA 1YC3A 3IEDA 3HHUA 1AMWA 3O0IA 1ZWHA 5M4KA 2CH4A 2YI5A 2YKEA 4L8ZA 3ZXQA 1YSZA 1NHHA 2H8MA 5M4NA 1Y8OA 4BIZA 4URLA 4NH9A 3U2DA 1UYMA 4GEEA 1NHJA 1TIDA 1AH8A 5M4PA 2BT0A 3B28A 2WEQA 3TUHA 1YSRA 2H55A 1YERA 5IDJA 4L93A 2CG9A 3ZKBA 4O07A 3CWVA 2YKBA 2YEGA 4WUDA 5CTXA 1GJVA 3H80A 3R4NA 2YEEA 4CE3A 1TBWA 3ZXOA 1Y4UA 1TC0A 3B25A 3C11A 2WI7A 4GCZA 4CWTA 4YKZA 3HEKA 1YC1A 4GGLA 3RLRA 1BKNA 1GKZA 4KFGA 3VHAA 1QY8A 2WI1A 4E00A 2XX4A 2BYHA 1S16A 2YEBA 4ZKIA 3FT5A 2YKCA 3EHJA 4PU9A 3OPDA 3TZ5A 4CWRA 2XDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U2O A;  2WI4 A;  1I5A A;  2PNR A;  4XCL A;  5IDM A;  2YEF A;  3T10 A;  4YKY A;  1I5D A;  4FPP A;  5FWK A;  4URN A;  3KE6 A;  3RKZ A;  2BU5 A;  1UYI A;  2VCJ A;  3A0Y A;  3RLP A;  4DUH A;  2YJX A;  3D36 A;  2WI6 A;  3CRK A;  3B27 A;  4O04 A;  4XKK A;  4U7N A;  1Z5C A;  4JAU A;  3T0Z A;  1ZXM A;  4GT8 A;  5D6P A;  3VHC A;  2FXS A;  1BXD A;  4MP2 A;  4XTJ A;  5FND A;  1US7 A;  2FYP A;  3EHH A;  4O05 A;  1UYF A;  4XCJ A;  4U93 A;  4I3H A;  1S14 A;  5J6A A;  4P7A A;  4GQT A;  4W7T A;  3Q5K A;  3K98 A;  4YKX A;  1YT2 A;  3G7B A;  4JAV A;  4JAS A;  4V25 A;  4H7Q A;  2ESA A;  3O6O A;  1KZN A;  2YED A;  4XKO A;  2WEP A;  3C0E A;  2YEI A;  2ZDX A;  5CTY A;  5CTW A;  3QDD A;  2ZKJ A;  3K99 A;  4PL9 A;  2BU6 A;  3TZ4 A;  4XE2 A;  2YE6 A;  4EFT A;  1MU5 A;  1ID0 A;  4L90 A;  4ZVI A;  4EGI A;  2YE7 A;  1PVG A;  3OMU A;  3NMQ A;  2IOQ A;  5D7R A;  2GFD A;  2O1W A;  4HXZ A;  2O1U A;  3A0R A;  3H4L A;  1UY8 A;  1OSF A;  1GKX A;  2QF6 A;  3HYZ A;  3GIE A;  4BQJ A;  4CWF A;  2YGA A;  3WQ9 A;  2XX2 A;  2XJG A;  2BRC A;  2YE9 A;  3HYY A;  5FNC A;  3G75 A;  3QTF A;  1H7U A;  3LNU A;  2YE5 A;  1H7S A;  5M4E A;  1JM6 A;  5BOD A;  4EGK A;  2YK9 A;  1NHI A;  2BU7 A;  1KIJ A;  3U2K A;  2YK2 A;  1I5B A;  2FWZ A;  4XIT A;  1AH6 A;  3B24 A;  3B26 A;  4E02 A;  3TZ0 A;  4EEH A;  4Q20 A;  1Z5B A;  2Q2E B;  1UY7 A;  2YGE A;  2CCU A;  3WHA A;  1I59 A;  4WUC A;  1AM1 A;  2YI0 A;  4XDM A;  4EGH A;  1UY9 A;  2EXL A;  3GIG B;  4MPC A;  4BXI A;  1THN A;  2YKJ A;  4HYP A;  2Q8F A;  4DZY A;  4CWP A;  4URM A;  3JZ3 A;  2WI2 A;  5L3J A;  2XX5 A;  4AWO A;  1EA6 A;  2CCS A;  4QPJ A;  1TIL A;  1AJ6 A;  3A0X A;  4ASG A;  4CWN A;  5BOC A;  2JJC A;  2E0A A;  3TTZ A;  5CPH A;  1Y4S A;  2YJW A;  2XDL A;  4HY1 A;  2YEH A;  3Q5J A;  2IWU A;  1B3Q A;  1ZW9 A;  2GQP A;  2YE2 A;  4AWP A;  4I5S A;  1BGQ A;  2YEJ A;  2YE8 A;  3DGE A;  2BTZ A;  2XK2 A;  4KTN A;  4XKA A;  2YEC A;  4E01 A;  3FT8 A;  2XD6 A;  4H85 A;  3A0T A;  4LWF A;  3K60 A;  2C2A A;  4FCR A;  2Q8I A;  4CE1 A;  4U7O A;  2BU2 A;  5D7C A;  2YGF A;  4H81 A;  2XDK A;  4MP7 A;  2XAB A;  5F3K A;  5F5R A;  2K5B A;  4YKU A;  1L0O A;  4FCQ A;  1Y8P A;  1EI1 A;  3INW A;  4V26 A;  4CE2 A;  3U67 A;  4XIP A;  3GIG A;  3R4O A;  4QPK A;  3BM9 A;  4ASA A;  4LWI A;  3FV5 A;  4L94 A;  1Z5A A;  3EKR A;  3OWB A;  3INX A;  4HZ0 A;  4HYM A;  2IOR A;  4HY6 A;  1Y8N A;  2HKJ A;  2VW5 A;  2YEA A;  3VAD A;  4KQV A;  4O0B A;  4O09 A;  1TH8 A;  1R62 A;  3ZKD A;  4XIR A;  4URO A;  1YES A;  2ZDY A;  3K97 A;  2WI3 A;  4EMV A;  5D6Q A;  1YET A;  2BZ5 A;  4KP4 A;  1UY6 A;  2XDU A;  4KSH A;  4YKQ A;  4CWS A;  3CGY A;  4K4O A;  3CGZ A;  2XJX A;  5GGZ A;  2CGF A;  2XJJ A;  3T1K A;  2YE4 A;  3O2F A;  4B7P A;  4MPN A;  1MX0 A;  2FWY A;  2CCT A;  5IN9 A;  5M4H A;  3T0H A;  4XIQ A;  3A0Z A;  2Q8H A;  3R4M A;  4NH7 A;  4FCP A;  2XCM A;  4MBC A;  3GIF A;  4WUB A;  3R92 A;  4CWQ A;  1I5C A;  1B63 A;  4AS9 A;  1A4H A;  4YKT A;  4B6C A;  2QG2 A;  1I58 A;  4LPB A;  3OWD A;  4L91 A;  1Z59 A;  1YT0 A;  1QZR A;  2BSM A;  3SL2 A;  2QG0 A;  3LPS A;  1UYC A;  2BYI A;  4AWQ A;  2YI6 A;  1YC4 A;  2YKI A;  1U0Z A;  2XHX A;  4MPE A;  2VCI A;  5M4M A;  3A0W A;  2YI7 A;  2O1V A;  2VWC A;  2IWS A;  4ASB A;  2HCH A;  2BU8 A;  4LWH A;  3CRL A;  4R1F A;  2WER A;  3EKO A;  3MNR P;  2QFO A;  2WI5 A;  4LWG A;  1UYG A;  2YE3 A;  4BQG A;  2XHR A;  3R91 A;  4NH8 A;  3OW6 A;  2XDS A;  1TC6 A;  4MOT A;  1UYD A;  4R3M A;  3Q5L A;  5C93 A;  3BMY A;  4BAE A;  2BRE A;  2IOP A;  4LWE A;  2IWX A;  2XHT A;  4P8O A;  1UYH A;  3EHF A;  1UYL A;  4XC0 A;  1ZXN A;  5CTU A;  2JKI A;  4GFN A;  1YT1 A;  4PRV A;  4EM7 A;  4FMT A;  1YS3 A;  4X9L A;  1B62 A;  4LP0 A;  3PEJ A;  1BYQ A;  2UWD A;  1QYE A;  3T2S A;  3TZ2 A;  5CF0 A;  5J71 A;  2Q8G A;  3PEH A;  3VHD A;  3R4P A;  4YKW A;  4CWO A;  5D7D A;  4BIU A;  1UYE A;  3HZ1 A;  4YKR A;  4HXW A;  3D0B A;  2AKP A;  3RLQ A;  2HG1 A;  3D2R A;  3ZM7 A;  4XD8 A;  1UYK A;  3HZ5 A;  4JQL A;  4KSG A;  4ASF A;  4MB9 A;  3EHG A;  4PRX A;  5FNF A;  2ZBK B;  4HZ5 A;  4EFU A;  4R3A A;  3G7E A;  1YC3 A;  3IED A;  3HHU A;  1AMW A;  3O0I A;  1ZWH A;  5M4K A;  2CH4 A;  2YI5 A;  2YKE A;  4L8Z A;  3ZXQ A;  1YSZ A;  1NHH A;  2H8M A;  5M4N A;  1Y8O A;  4BIZ A;  4URL A;  4NH9 A;  3U2D A;  1UYM A;  4GEE A;  1NHJ A;  1TID A;  1AH8 A;  5M4P A;  2BT0 A;  3B28 A;  2WEQ A;  3TUH A;  1YSR A;  2H55 A;  1YER A;  5IDJ A;  4L93 A;  2CG9 A;  3ZKB A;  4O07 A;  3CWV A;  2YKB A;  2YEG A;  4WUD A;  5CTX A;  1GJV A;  3H80 A;  3R4N A;  2YEE A;  4CE3 A;  1TBW A;  3ZXO A;  1Y4U A;  1TC0 A;  3B25 A;  3C11 A;  2WI7 A;  4GCZ A;  4CWT A;  4YKZ A;  3HEK A;  1YC1 A;  4GGL A;  3RLR A;  1BKN A;  1GKZ A;  4KFG A;  3VHA A;  1QY8 A;  2WI1 A;  4E00 A;  2XX4 A;  2BYH A;  1S16 A;  2YEB A;  4ZKI A;  3FT5 A;  2YKC A;  3EHJ A;  4PU9 A;  3OPD A;  3TZ5 A;  4CWR A;  2XDX A; 
#chains in the Genus database with same CATH topology
 1U2O A;  2WI4 A;  1I5A A;  2PNR A;  4XCL A;  5IDM A;  2C1I A;  2YEF A;  5JEN A;  3T10 A;  4YKY A;  1I5D A;  4FPP A;  5FWK A;  4URN A;  3KE6 A;  3RKZ A;  2BU5 A;  1UYI A;  2VCJ A;  3A0Y A;  3RLP A;  4DUH A;  2YJX A;  3D36 A;  2WI6 A;  3CRK A;  3B27 A;  4O04 A;  4XKK A;  4U7N A;  1Z5C A;  4JAU A;  3T0Z A;  1ZXM A;  4GT8 A;  5D6P A;  3VHC A;  2FXS A;  1BXD A;  4E72 A;  4MP2 A;  4XTJ A;  5FND A;  1US7 A;  2FYP A;  3EHH A;  4O05 A;  1UYF A;  4XCJ A;  4U93 A;  4I3H A;  1S14 A;  5J6A A;  4P7A A;  4GQT A;  4W7T A;  3Q5K A;  3K98 A;  4YKX A;  1YT2 A;  3G7B A;  4JAV A;  4JAS A;  4V25 A;  4H7Q A;  2ESA A;  3O6O A;  1KZN A;  2YED A;  4XKO A;  2WEP A;  3C0E A;  2YEI A;  2ZDX A;  5CTY A;  5CTW A;  3QDD A;  2ZKJ A;  3K99 A;  4PL9 A;  2BU6 A;  3TZ4 A;  4XE2 A;  2YE6 A;  4EFT A;  1MU5 A;  1ID0 A;  4L90 A;  4ZVI A;  4EGI A;  2YE7 A;  1PVG A;  3OMU A;  3NMQ A;  2IOQ A;  5D7R A;  2GFD A;  2O1W A;  4HXZ A;  2O1U A;  3A0R A;  3S5T A;  3H4L A;  1UY8 A;  1OSF A;  1GKX A;  2QF6 A;  3HYZ A;  3GIE A;  4BQJ A;  4CWF A;  2YGA A;  3WQ9 A;  2XX2 A;  2XJG A;  2BRC A;  2YE9 A;  3HYY A;  5FNC A;  3G75 A;  3QTF A;  1H7U A;  3LNU A;  2YE5 A;  1H7S A;  5M4E A;  1JM6 A;  5BOD A;  4EGK A;  2YK9 A;  1NHI A;  2BU7 A;  1KIJ A;  3U2K A;  2YK2 A;  1I5B A;  2FWZ A;  4XIT A;  1AH6 A;  3B24 A;  3B26 A;  4E02 A;  3TZ0 A;  4EEH A;  4Q20 A;  1Z5B A;  2Q2E B;  1UY7 A;  2YGE A;  2CCU A;  3WHA A;  1I59 A;  4WUC A;  3CYG A;  1AM1 A;  2YI0 A;  4XDM A;  4EGH A;  1UY9 A;  2EXL A;  3GIG B;  4MPC A;  4BXI A;  1THN A;  2YKJ A;  4HYP A;  2Q8F A;  4DZY A;  4CWP A;  4URM A;  3JZ3 A;  2WI2 A;  5L3J A;  2XX5 A;  4AWO A;  1EA6 A;  2CCS A;  4QPJ A;  1TIL A;  1AJ6 A;  3A0X A;  4ASG A;  4CWN A;  5BOC A;  2JJC A;  2E0A A;  3TTZ A;  5CPH A;  1Y4S A;  2YJW A;  2XDL A;  4HY1 A;  2YEH A;  3Q5J A;  2HHI A;  2IWU A;  1B3Q A;  1ZW9 A;  2GQP A;  2YE2 A;  4AWP A;  4I5S A;  1BGQ A;  2YEJ A;  2YE8 A;  3DGE A;  2BTZ A;  2XK2 A;  4KTN A;  4XKA A;  2YEC A;  4E01 A;  3FT8 A;  2XD6 A;  4H85 A;  3A0T A;  4LWF A;  3K60 A;  1IXM A;  2C2A A;  4FCR A;  2Q8I A;  4CE1 A;  4U7O A;  2BU2 A;  5D7C A;  2YGF A;  4H81 A;  2XDK A;  4MP7 A;  2XAB A;  5F3K A;  5F5R A;  2K5B A;  4YKU A;  1L0O A;  4FCQ A;  1Y8P A;  1EI1 A;  3INW A;  4V26 A;  4CE2 A;  3U67 A;  4XIP A;  3GIG A;  3R4O A;  4QPK A;  3BM9 A;  4ASA A;  4LWI A;  3FV5 A;  4L94 A;  1Z5A A;  3EKR A;  3OWB A;  3INX A;  4HZ0 A;  4HYM A;  2IOR A;  4HY6 A;  1Y8N A;  2HKJ A;  2VW5 A;  2YEA A;  3VAD A;  4KQV A;  4O0B A;  4O09 A;  1TH8 A;  1R62 A;  3ZKD A;  4XIR A;  4URO A;  1YES A;  2ZDY A;  3K97 A;  2WI3 A;  4EMV A;  5D6Q A;  1YET A;  2BZ5 A;  4KP4 A;  1UY6 A;  2XDU A;  4KSH A;  4YKQ A;  4CWS A;  3CGY A;  4K4O A;  3CGZ A;  2XJX A;  5GGZ A;  2CGF A;  2XJJ A;  3T1K A;  2YE4 A;  3O2F A;  4B7P A;  4MPN A;  1MX0 A;  2FWY A;  2CCT A;  5IN9 A;  5M4H A;  3T0H A;  4XIQ A;  3A0Z A;  2Q8H A;  3R4M A;  4NH7 A;  4FCP A;  2XCM A;  4MBC A;  3GIF A;  4WUB A;  3R92 A;  4CWQ A;  1I5C A;  1B63 A;  4AS9 A;  1A4H A;  4YKT A;  4B6C A;  2QG2 A;  1I58 A;  4LPB A;  3OWD A;  4L91 A;  1Z59 A;  1YT0 A;  1QZR A;  2BSM A;  3SL2 A;  2QG0 A;  3LPS A;  1UYC A;  2BYI A;  4AWQ A;  2YI6 A;  1YC4 A;  2YKI A;  1U0Z A;  2XHX A;  4MPE A;  2VCI A;  5M4M A;  3A0W A;  2YI7 A;  2O1V A;  2VWC A;  2IWS A;  4ASB A;  2HCH A;  2BU8 A;  4LWH A;  3CRL A;  4R1F A;  2WER A;  3EKO A;  3MNR P;  2QFO A;  2WI5 A;  4LWG A;  1UYG A;  2YE3 A;  4BQG A;  2XHR A;  3R91 A;  4NH8 A;  3LMM A;  3OW6 A;  2XDS A;  1TC6 A;  4MOT A;  2C1G A;  1UYD A;  4R3M A;  3Q5L A;  5C93 A;  3BMY A;  4BAE A;  2BRE A;  2IOP A;  4LWE A;  2IWX A;  2XHT A;  4P8O A;  1UYH A;  3EHF A;  1UYL A;  4XC0 A;  1ZXN A;  5CTU A;  2JKI A;  4GFN A;  1YT1 A;  4PRV A;  4EM7 A;  4FMT A;  1YS3 A;  4X9L A;  1B62 A;  4LP0 A;  3PEJ A;  1BYQ A;  2UWD A;  1QYE A;  3T2S A;  3TZ2 A;  5CF0 A;  5J71 A;  2Q8G A;  3PEH A;  3VHD A;  3R4P A;  4YKW A;  4CWO A;  5D7D A;  4BIU A;  1UYE A;  3HZ1 A;  4YKR A;  4HXW A;  3D0B A;  2AKP A;  3RLQ A;  2HG1 A;  3D2R A;  3ZM7 A;  4XD8 A;  1UYK A;  3HZ5 A;  4JQL A;  4KSG A;  4ASF A;  4MB9 A;  3EHG A;  2FTK A;  4PRX A;  5FNF A;  2ZBK B;  4HZ5 A;  4EFU A;  4R3A A;  3G7E A;  1YC3 A;  3IED A;  3HHU A;  1AMW A;  3O0I A;  1ZWH A;  5M4K A;  2CH4 A;  2YI5 A;  2YKE A;  4L8Z A;  3ZXQ A;  1YSZ A;  1NHH A;  2H8M A;  5M4N A;  1Y8O A;  4BIZ A;  4URL A;  4NH9 A;  3U2D A;  1UYM A;  4GEE A;  1NHJ A;  1TID A;  1AH8 A;  5M4P A;  2BT0 A;  3B28 A;  2WEQ A;  3TUH A;  1YSR A;  2H55 A;  1YER A;  5IDJ A;  4L93 A;  2CG9 A;  3ZKB A;  4O07 A;  3CWV A;  2YKB A;  2YEG A;  4WUD A;  5CTX A;  1GJV A;  3H80 A;  3R4N A;  2YEE A;  4CE3 A;  1TBW A;  3ZXO A;  1Y4U A;  1TC0 A;  3B25 A;  3C11 A;  1F51 A;  2WI7 A;  4GCZ A;  4CWT A;  4YKZ A;  3HEK A;  1YC1 A;  4GGL A;  3RLR A;  1BKN A;  1GKZ A;  4KFG A;  3VHA A;  1QY8 A;  2WI1 A;  4E00 A;  2XX4 A;  2BYH A;  1S16 A;  2YEB A;  4ZKI A;  3FT5 A;  2YKC A;  3EHJ A;  4PU9 A;  3OPD A;  3TZ5 A;  4CWR A;  2XDX A; 
#chains in the Genus database with same CATH homology
 1U2O A;  2WI4 A;  1I5A A;  2PNR A;  4XCL A;  5IDM A;  2YEF A;  3T10 A;  4YKY A;  1I5D A;  4FPP A;  5FWK A;  4URN A;  3KE6 A;  3RKZ A;  2BU5 A;  1UYI A;  2VCJ A;  3A0Y A;  3RLP A;  4DUH A;  2YJX A;  3D36 A;  2WI6 A;  3CRK A;  3B27 A;  4O04 A;  4XKK A;  4U7N A;  1Z5C A;  4JAU A;  3T0Z A;  1ZXM A;  4GT8 A;  5D6P A;  3VHC A;  2FXS A;  1BXD A;  4MP2 A;  4XTJ A;  5FND A;  1US7 A;  2FYP A;  3EHH A;  4O05 A;  1UYF A;  4XCJ A;  4U93 A;  4I3H A;  1S14 A;  5J6A A;  4P7A A;  4GQT A;  4W7T A;  3Q5K A;  3K98 A;  4YKX A;  1YT2 A;  3G7B A;  4JAV A;  4JAS A;  4V25 A;  4H7Q A;  2ESA A;  3O6O A;  1KZN A;  2YED A;  4XKO A;  2WEP A;  3C0E A;  2YEI A;  2ZDX A;  5CTY A;  5CTW A;  3QDD A;  2ZKJ A;  3K99 A;  4PL9 A;  2BU6 A;  3TZ4 A;  4XE2 A;  2YE6 A;  4EFT A;  1MU5 A;  1ID0 A;  4L90 A;  4ZVI A;  4EGI A;  2YE7 A;  1PVG A;  3OMU A;  3NMQ A;  2IOQ A;  5D7R A;  2GFD A;  2O1W A;  4HXZ A;  2O1U A;  3A0R A;  3H4L A;  1UY8 A;  1OSF A;  1GKX A;  2QF6 A;  3HYZ A;  3GIE A;  4BQJ A;  4CWF A;  2YGA A;  3WQ9 A;  2XX2 A;  2XJG A;  2BRC A;  2YE9 A;  3HYY A;  5FNC A;  3G75 A;  3QTF A;  1H7U A;  3LNU A;  2YE5 A;  1H7S A;  5M4E A;  1JM6 A;  5BOD A;  4EGK A;  2YK9 A;  1NHI A;  2BU7 A;  1KIJ A;  3U2K A;  2YK2 A;  1I5B A;  2FWZ A;  4XIT A;  1AH6 A;  3B24 A;  3B26 A;  4E02 A;  3TZ0 A;  4EEH A;  4Q20 A;  1Z5B A;  2Q2E B;  1UY7 A;  2YGE A;  2CCU A;  3WHA A;  1I59 A;  4WUC A;  1AM1 A;  2YI0 A;  4XDM A;  4EGH A;  1UY9 A;  2EXL A;  3GIG B;  4MPC A;  4BXI A;  1THN A;  2YKJ A;  4HYP A;  2Q8F A;  4DZY A;  4CWP A;  4URM A;  3JZ3 A;  2WI2 A;  5L3J A;  2XX5 A;  4AWO A;  1EA6 A;  2CCS A;  4QPJ A;  1TIL A;  1AJ6 A;  3A0X A;  4ASG A;  4CWN A;  5BOC A;  2JJC A;  2E0A A;  3TTZ A;  5CPH A;  1Y4S A;  2YJW A;  2XDL A;  4HY1 A;  2YEH A;  3Q5J A;  2IWU A;  1B3Q A;  1ZW9 A;  2GQP A;  2YE2 A;  4AWP A;  4I5S A;  1BGQ A;  2YEJ A;  2YE8 A;  3DGE A;  2BTZ A;  2XK2 A;  4KTN A;  4XKA A;  2YEC A;  4E01 A;  3FT8 A;  2XD6 A;  4H85 A;  3A0T A;  4LWF A;  3K60 A;  2C2A A;  4FCR A;  2Q8I A;  4CE1 A;  4U7O A;  2BU2 A;  5D7C A;  2YGF A;  4H81 A;  2XDK A;  4MP7 A;  2XAB A;  5F3K A;  5F5R A;  2K5B A;  4YKU A;  1L0O A;  4FCQ A;  1Y8P A;  1EI1 A;  3INW A;  4V26 A;  4CE2 A;  3U67 A;  4XIP A;  3GIG A;  3R4O A;  4QPK A;  3BM9 A;  4ASA A;  4LWI A;  3FV5 A;  4L94 A;  1Z5A A;  3EKR A;  3OWB A;  3INX A;  4HZ0 A;  4HYM A;  2IOR A;  4HY6 A;  1Y8N A;  2HKJ A;  2VW5 A;  2YEA A;  3VAD A;  4KQV A;  4O0B A;  4O09 A;  1TH8 A;  1R62 A;  3ZKD A;  4XIR A;  4URO A;  1YES A;  2ZDY A;  3K97 A;  2WI3 A;  4EMV A;  5D6Q A;  1YET A;  2BZ5 A;  4KP4 A;  1UY6 A;  2XDU A;  4KSH A;  4YKQ A;  4CWS A;  3CGY A;  4K4O A;  3CGZ A;  2XJX A;  5GGZ A;  2CGF A;  2XJJ A;  3T1K A;  2YE4 A;  3O2F A;  4B7P A;  4MPN A;  1MX0 A;  2FWY A;  2CCT A;  5IN9 A;  5M4H A;  3T0H A;  4XIQ A;  3A0Z A;  2Q8H A;  3R4M A;  4NH7 A;  4FCP A;  2XCM A;  4MBC A;  3GIF A;  4WUB A;  3R92 A;  4CWQ A;  1I5C A;  1B63 A;  4AS9 A;  1A4H A;  4YKT A;  4B6C A;  2QG2 A;  1I58 A;  4LPB A;  3OWD A;  4L91 A;  1Z59 A;  1YT0 A;  1QZR A;  2BSM A;  3SL2 A;  2QG0 A;  3LPS A;  1UYC A;  2BYI A;  4AWQ A;  2YI6 A;  1YC4 A;  2YKI A;  1U0Z A;  2XHX A;  4MPE A;  2VCI A;  5M4M A;  3A0W A;  2YI7 A;  2O1V A;  2VWC A;  2IWS A;  4ASB A;  2HCH A;  2BU8 A;  4LWH A;  3CRL A;  4R1F A;  2WER A;  3EKO A;  3MNR P;  2QFO A;  2WI5 A;  4LWG A;  1UYG A;  2YE3 A;  4BQG A;  2XHR A;  3R91 A;  4NH8 A;  3OW6 A;  2XDS A;  1TC6 A;  4MOT A;  1UYD A;  4R3M A;  3Q5L A;  5C93 A;  3BMY A;  4BAE A;  2BRE A;  2IOP A;  4LWE A;  2IWX A;  2XHT A;  4P8O A;  1UYH A;  3EHF A;  1UYL A;  4XC0 A;  1ZXN A;  5CTU A;  2JKI A;  4GFN A;  1YT1 A;  4PRV A;  4EM7 A;  4FMT A;  1YS3 A;  4X9L A;  1B62 A;  4LP0 A;  3PEJ A;  1BYQ A;  2UWD A;  1QYE A;  3T2S A;  3TZ2 A;  5CF0 A;  5J71 A;  2Q8G A;  3PEH A;  3VHD A;  3R4P A;  4YKW A;  4CWO A;  5D7D A;  4BIU A;  1UYE A;  3HZ1 A;  4YKR A;  4HXW A;  3D0B A;  2AKP A;  3RLQ A;  2HG1 A;  3D2R A;  3ZM7 A;  4XD8 A;  1UYK A;  3HZ5 A;  4JQL A;  4KSG A;  4ASF A;  4MB9 A;  3EHG A;  4PRX A;  5FNF A;  2ZBK B;  4HZ5 A;  4EFU A;  4R3A A;  3G7E A;  1YC3 A;  3IED A;  3HHU A;  1AMW A;  3O0I A;  1ZWH A;  5M4K A;  2CH4 A;  2YI5 A;  2YKE A;  4L8Z A;  3ZXQ A;  1YSZ A;  1NHH A;  2H8M A;  5M4N A;  1Y8O A;  4BIZ A;  4URL A;  4NH9 A;  3U2D A;  1UYM A;  4GEE A;  1NHJ A;  1TID A;  1AH8 A;  5M4P A;  2BT0 A;  3B28 A;  2WEQ A;  3TUH A;  1YSR A;  2H55 A;  1YER A;  5IDJ A;  4L93 A;  2CG9 A;  3ZKB A;  4O07 A;  3CWV A;  2YKB A;  2YEG A;  4WUD A;  5CTX A;  1GJV A;  3H80 A;  3R4N A;  2YEE A;  4CE3 A;  1TBW A;  3ZXO A;  1Y4U A;  1TC0 A;  3B25 A;  3C11 A;  2WI7 A;  4GCZ A;  4CWT A;  4YKZ A;  3HEK A;  1YC1 A;  4GGL A;  3RLR A;  1BKN A;  1GKZ A;  4KFG A;  3VHA A;  1QY8 A;  2WI1 A;  4E00 A;  2XX4 A;  2BYH A;  1S16 A;  2YEB A;  4ZKI A;  3FT5 A;  2YKC A;  3EHJ A;  4PU9 A;  3OPD A;  3TZ5 A;  4CWR A;  2XDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...