3ZXQA

Crystal structure of the atp-binding domain of mycobacterium tuberculosis dost
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
TGLRHRLDKVIDQLAIPALHTTVQYTGPLSVVDTVLANHAEAVLREAVSNAVRHANATSLAINVSVEDDVRVEVVDDGVGISGDITESGLRNLRQRADDAGGEFTVENMPTGGTLLRWSAPLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Activation of ATP Binding for the Autophosphorylation of Doss, a Mycobacterium Tuberculosis Histidine Kinase Lacking an ATP-Lid Motif.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords HYPOXIA SENSOR HISTIDINE KINASE RESPONSE REGULATOR DOST
total genus 33
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3zxqA00
2YK2A 1YC3A 5D6QA 2YI7A 2EXLA 2XDLA 3INXA 3LPSA 4MPEA 1EA6A 4L94A 2WERA 2WI5A 2BSMA 4NH9A 2XHTA 4R3MA 3BM9A 1Z5BA 1Y4UA 2YE4A 3T2SA 4CE2A 5FNCA 3TZ5A 2VCJA 4EM7A 4B6CA 2Q8GA 3EKRA 3G75A 3R4NA 1TC0A 3R4MA 4V26A 4MP2A 5M4KA 3GIGA 3EHGA 1PVGA 3CGZA 4PRXA 4E02A 4WUDA 2WEQA 3EHFA 4LP0A 3D36A 2ESAA 2YGFA 3DGEA 2YEBA 2YECA 2BU6A 2IORA 3RLRA 2XX4A 3TTZA 1I5CA 2CCTA 4EGIA 1UYLA 4YKXA 2BYIA 5M4HA 4NH7A 3B27A 4GEEA 4Q20A 2YEAA 3VHDA 3HYYA 4DUHA 2YEFA 4URMA 5M4MA 3HEKA 3R91A 3B24A 1S16A 3FT8A 2XDXA 3PEHA 5D7RA 4YKWA 2K5BA 5CTWA 5C93A 3OWDA 3HHUA 1U0ZA 3D0BA 3Q5KA 4CWTA 2VWCA 3C0EA 2YKBA 2JJCA 4PRVA 2FWYA 4FCRA 4XD8A 2GQPA 4HXWA 2YKCA 2XHRA 5F5RA 5BOCA 4JAVA 2BT0A 1AJ6A 3ZM7A 2WI6A 4HYPA 5GGZA 4L93A 4ASGA 1Y4SA 4CWRA 2H55A 1THNA 2BYHA 3K99A 3IEDA 4HZ0A 2HCHA 2HKJA 4WUBA 2YKJA 1QYEA 3B26A 3CRLA 3KE6A 4WUCA 1NHIA 2YJWA 4XE2A 1UYIA 2XDUA 1I59A 3ZXQA 3B28A 4LWEA 4XKAA 1S14A 3K97A 1OSFA 4U93A 3FV5A 4CWPA 2YGAA 2XJJA 3G7EA 4ASFA 2VW5A 1AMWA 1R62A 1UYDA 4YKTA 4AWQA 4CWFA 2PNRA 1B63A 4HZ5A 1YT2A 2WI3A 3U2KA 3TZ0A 5CPHA 3A0ZA 3BMYA 5F3KA 4DZYA 3O2FA 3TUHA 4O04A 4YKRA 4O09A 2BZ5A 3D2RA 1NHJA 1YS3A 4YKYA 2FXSA 2IWSA 3RLPA 4V25A 2IOPA 3CWVA 4XKKA 4URNA 4MPNA 1NHHA 2JKIA 4FCPA 3ZXOA 2XCMA 1KIJA 4EMVA 2O1VA 3T10A 3CGYA 1UYCA 3EHJA 2XJXA 2HG1A 1EI1A 4P7AA 4H81A 1GJVA 1YESA 3LNUA 4EGHA 3Q5LA 4EGKA 2YEDA 1MU5A 1ID0A 3GIEA 1QY8A 4KFGA 4W7TA 4CE1A 2YEIA 2YI6A 2YKIA 3GIGB 2CGFA 3RKZA 2YEHA 3G7BA 4QPJA 1UY9A 4UROA 1Y8PA 4O07A 2Q8IA 3T0ZA 3JZ3A 4CWOA 1UYGA 2WI7A 2O1WA 2ZKJA 5D6PA 1YC4A 3INWA 2YE2A 5D7DA 2BU8A 4KTNA 1TBWA 3T1KA 3Q5JA 1GKXA 1I5AA 1ZWHA 2ZDYA 4XIRA 4KQVA 4YKQA 4CE3A 3QDDA 4B7PA 2UWDA 4KSHA 2QFOA 3ZKBA 2XD6A 4BAEA 3H80A 2FWZA 4KP4A 1Z5AA 3HZ1A 3MNRP 5IN9A 1TILA 2VCIA 2Q8FA 5CTYA 2BRCA 2YKEA 4PL9A 1YT0A 3EHHA 4GQTA 1ZXMA 1Z59A 3OMUA 3O6OA 4GCZA 3HZ5A 5IDJA 1H7UA 2WI2A 2GFDA 4QPKA 5M4EA 4LWHA 1UYHA 4HY1A 1AM1A 2WI4A 1UYEA 4EEHA 2ZDXA 1B62A 4U7OA 3A0WA 5J71A 4EFUA 4CWSA 3K98A 4URLA 4XIPA 1MX0A 4HYMA 1UYMA 1YETA 4HY6A 4ASAA 2YJXA 2YEJA 4ZVIA 2H8MA 1BYQA 1YSZA 1US7A 1YT1A 4ASBA 5D7CA 1A4HA 4FMTA 2IWUA 1UYFA 3TZ4A 4XIQA 1QZRA 3ZKDA 3A0YA 4FCQA 2YE5A 3PEJA 3A0RA 4MB9A 4BIUA 5M4NA 5FNDA 1I5DA 1B3QA 2BU2A 3FT5A 5BODA 4YKZA 2O1UA 4EFTA 2QF6A 1Z5CA 2E0AA 3VHCA 4JASA 4MPCA 3VHAA 5L3JA 4X9LA 2C2AA 4YKUA 1YSRA 4NH8A 4R1FA 3GIFA 4JAUA 4O05A 1TH8A 4H85A 3NMQA 1BXDA 2XDSA 3R4OA 1U2OA 1I5BA 3R4PA 2XJGA 4K4OA 2IWXA 5CTUA 3C11A 4AWOA 2QG2A 2YEEA 4H7QA 3HYZA 4JQLA 4LWGA 4CWQA 2CCUA 4GGLA 1I58A 4L90A 2YEGA 4BXIA 5M4PA 2YE8A 3A0TA 4E01A 3T0HA 4GFNA 1UY6A 1H7SA 2XDKA 2YGEA 3H4LA 4MP7A 1GKZA 2XX2A 4AS9A 4BQGA 2YE9A 2Q8HA 4BIZA 1AH6A 2CH4A 1KZNA 2YE7A 5CTXA 3K60A 5FNFA 2BTZA 2WEPA 3U2DA 1ZW9A 5IDMA 3WQ9A 5CF0A 4ZKIA 4CWNA 4I5SA 4MBCA 2YI5A 4LWFA 2BU7A 2Q2EB 5FWKA 3B25A 3OPDA 3EKOA 2BU5A 1ZXNA 4MOTA 4XKOA 4LPBA 2YE6A 1Y8OA 1YC1A 3U67A 4R3AA 1AH8A 1L0OA 3TZ2A 2CG9A 4I3HA 4AWPA 1JM6A 2AKPA 3A0XA 2WI1A 4XTJA 4XDMA 4LWIA 4U7NA 3R92A 1UY7A 3QTFA 4L91A 3O0IA 3OW6A 3CRKA 2XHXA 3OWBA 4P8OA 1YERA 4PU9A 4BQJA 4KSGA 2XX5A 2FYPA 4XCLA 3WHAA 4FPPA 4GT8A 2CCSA 4L8ZA 1TC6A 4O0BA 1BKNA 1UYKA 4HXZA 4XC0A 2YI0A 4XCJA 3SL2A 2QG0A 2YK9A 2XABA 2IOQA 1Y8NA 1TIDA 4E00A 2ZBKB 5J6AA 3VADA 1BGQA 1UY8A 2BREA 3RLQA 2YE3A 4XITA 2XK2A
chains in the Genus database with same CATH superfamily
2YK2A 1YC3A 5D6QA 2YI7A 2EXLA 2XDLA 3INXA 3LPSA 4MPEA 1EA6A 4L94A 2WERA 2WI5A 2BSMA 4NH9A 2XHTA 4R3MA 3BM9A 1Z5BA 1Y4UA 2YE4A 3T2SA 4CE2A 5FNCA 3TZ5A 2VCJA 4EM7A 4B6CA 2Q8GA 3EKRA 3G75A 3R4NA 1TC0A 3R4MA 4V26A 4MP2A 5M4KA 3GIGA 3EHGA 1PVGA 3CGZA 4PRXA 4E02A 4WUDA 2WEQA 3EHFA 4LP0A 3D36A 2ESAA 2YGFA 3DGEA 2YEBA 2YECA 2BU6A 2IORA 3RLRA 2XX4A 3TTZA 1I5CA 2CCTA 4EGIA 1UYLA 4YKXA 2BYIA 5M4HA 4NH7A 3B27A 4GEEA 4Q20A 2YEAA 3VHDA 3HYYA 4DUHA 2YEFA 4URMA 5M4MA 3HEKA 3R91A 3B24A 1S16A 3FT8A 2XDXA 3PEHA 5D7RA 4YKWA 2K5BA 5CTWA 5C93A 3OWDA 3HHUA 1U0ZA 3D0BA 3Q5KA 4CWTA 2VWCA 3C0EA 2YKBA 2JJCA 4PRVA 2FWYA 4FCRA 4XD8A 2GQPA 4HXWA 2YKCA 2XHRA 5F5RA 5BOCA 4JAVA 2BT0A 1AJ6A 3ZM7A 2WI6A 4HYPA 5GGZA 4L93A 4ASGA 1Y4SA 4CWRA 2H55A 1THNA 2BYHA 3K99A 3IEDA 4HZ0A 2HCHA 2HKJA 4WUBA 2YKJA 1QYEA 3B26A 3CRLA 3KE6A 4WUCA 1NHIA 2YJWA 4XE2A 1UYIA 2XDUA 1I59A 3ZXQA 3B28A 4LWEA 4XKAA 1S14A 3K97A 1OSFA 4U93A 3FV5A 4CWPA 2YGAA 2XJJA 3G7EA 4ASFA 2VW5A 1AMWA 1R62A 1UYDA 4YKTA 4AWQA 4CWFA 2PNRA 1B63A 4HZ5A 1YT2A 2WI3A 3U2KA 3TZ0A 5CPHA 3S5TA 3A0ZA 3BMYA 5F3KA 4DZYA 3O2FA 3TUHA 4O04A 4YKRA 4O09A 2BZ5A 3D2RA 1NHJA 1YS3A 4YKYA 2FXSA 2IWSA 3RLPA 4V25A 2IOPA 3CWVA 4XKKA 4URNA 4MPNA 1NHHA 2JKIA 4FCPA 3ZXOA 2XCMA 1KIJA 4EMVA 2O1VA 3T10A 3LMMA 3CGYA 1UYCA 3EHJA 2XJXA 2HG1A 1EI1A 4P7AA 4H81A 1GJVA 2FTKA 1YESA 3LNUA 4EGHA 3Q5LA 4EGKA 2YEDA 1MU5A 1ID0A 3GIEA 1QY8A 4KFGA 4W7TA 4CE1A 2YEIA 2YI6A 2YKIA 3GIGB 2CGFA 3RKZA 2YEHA 3G7BA 4QPJA 1UY9A 4UROA 1Y8PA 4O07A 2Q8IA 3T0ZA 3JZ3A 4CWOA 1UYGA 2WI7A 2O1WA 2ZKJA 5D6PA 1YC4A 3INWA 2YE2A 5D7DA 2BU8A 4KTNA 1TBWA 3T1KA 3Q5JA 1GKXA 1I5AA 1ZWHA 2ZDYA 4XIRA 4KQVA 4YKQA 4CE3A 3QDDA 3CYGA 4B7PA 2UWDA 4KSHA 2QFOA 3ZKBA 2XD6A 4BAEA 3H80A 2FWZA 4KP4A 1Z5AA 3HZ1A 3MNRP 5IN9A 1TILA 2VCIA 2Q8FA 5CTYA 2BRCA 2YKEA 4PL9A 1YT0A 3EHHA 4GQTA 1ZXMA 1Z59A 3OMUA 3O6OA 4GCZA 3HZ5A 5IDJA 1H7UA 2WI2A 2GFDA 4QPKA 5M4EA 4LWHA 1UYHA 4HY1A 1AM1A 2WI4A 1UYEA 4EEHA 2ZDXA 1B62A 4U7OA 3A0WA 5J71A 4EFUA 4CWSA 3K98A 4E72A 4URLA 4XIPA 1MX0A 4HYMA 1UYMA 1YETA 4HY6A 4ASAA 2YJXA 2YEJA 4ZVIA 2H8MA 1BYQA 1YSZA 1US7A 1YT1A 4ASBA 5D7CA 1A4HA 4FMTA 2IWUA 1UYFA 1IXMA 3TZ4A 4XIQA 1QZRA 3ZKDA 3A0YA 4FCQA 2YE5A 3PEJA 3A0RA 4MB9A 4BIUA 5M4NA 5FNDA 1I5DA 1B3QA 2BU2A 3FT5A 5BODA 4YKZA 5JENA 2O1UA 4EFTA 2QF6A 1Z5CA 2E0AA 3VHCA 4JASA 4MPCA 3VHAA 5L3JA 4X9LA 2C2AA 4YKUA 1YSRA 4NH8A 4R1FA 4JAUA 3GIFA 4O05A 1TH8A 4H85A 3NMQA 1BXDA 2XDSA 3R4OA 1U2OA 1I5BA 3R4PA 2XJGA 4K4OA 2IWXA 5CTUA 3C11A 4AWOA 2QG2A 2YEEA 4H7QA 3HYZA 4JQLA 4LWGA 4CWQA 2CCUA 4GGLA 1I58A 4L90A 2YEGA 4BXIA 5M4PA 2YE8A 3A0TA 4E01A 3T0HA 4GFNA 1UY6A 1H7SA 2HHIA 2XDKA 2YGEA 3H4LA 4MP7A 1GKZA 2XX2A 4AS9A 4BQGA 2YE9A 2Q8HA 4BIZA 1AH6A 2CH4A 1KZNA 2YE7A 5CTXA 3K60A 5FNFA 2BTZA 2WEPA 3U2DA 1ZW9A 5IDMA 3WQ9A 5CF0A 4ZKIA 4CWNA 4I5SA 4MBCA 2YI5A 4LWFA 2BU7A 2Q2EB 5FWKA 3B25A 3OPDA 3EKOA 2BU5A 1ZXNA 4MOTA 4XKOA 4LPBA 2YE6A 1Y8OA 1YC1A 3U67A 4R3AA 1AH8A 1L0OA 3TZ2A 2CG9A 4I3HA 4AWPA 1JM6A 2AKPA 3A0XA 2WI1A 4XTJA 4XDMA 4LWIA 4U7NA 3R92A 1UY7A 3QTFA 4L91A 3O0IA 3OW6A 1F51A 3CRKA 2XHXA 3OWBA 4P8OA 1YERA 4PU9A 4BQJA 4KSGA 2XX5A 2FYPA 4XCLA 3WHAA 2C1IA 4FPPA 4GT8A 2CCSA 4L8ZA 1TC6A 4O0BA 1BKNA 1UYKA 4HXZA 4XC0A 2YI0A 4XCJA 3SL2A 2C1GA 2QG0A 2YK9A 2XABA 2IOQA 1Y8NA 1TIDA 4E00A 2ZBKB 5J6AA 3VADA 1BGQA 1UY8A 2BREA 3RLQA 2YE3A 4XITA 2XK2A
chains in the Genus database with same CATH topology
2YK2A 1YC3A 5D6QA 2YI7A 2EXLA 2XDLA 3INXA 3LPSA 4MPEA 1EA6A 4L94A 2WERA 2WI5A 2BSMA 4NH9A 2XHTA 4R3MA 3BM9A 1Z5BA 1Y4UA 2YE4A 3T2SA 4CE2A 5FNCA 3TZ5A 2VCJA 4EM7A 4B6CA 2Q8GA 3EKRA 3G75A 3R4NA 1TC0A 3R4MA 4V26A 4MP2A 5M4KA 3GIGA 3EHGA 1PVGA 3CGZA 4PRXA 4E02A 4WUDA 2WEQA 3EHFA 4LP0A 3D36A 2ESAA 2YGFA 3DGEA 2YEBA 2YECA 2BU6A 2IORA 3RLRA 2XX4A 3TTZA 1I5CA 2CCTA 4EGIA 1UYLA 4YKXA 2BYIA 5M4HA 4NH7A 3B27A 4GEEA 4Q20A 2YEAA 3VHDA 3HYYA 4DUHA 2YEFA 4URMA 5M4MA 3HEKA 3R91A 3B24A 1S16A 3FT8A 2XDXA 3PEHA 5D7RA 4YKWA 2K5BA 5CTWA 5C93A 3OWDA 3HHUA 1U0ZA 3D0BA 3Q5KA 4CWTA 2VWCA 3C0EA 2YKBA 2JJCA 4PRVA 2FWYA 4FCRA 4XD8A 2GQPA 4HXWA 2YKCA 2XHRA 5F5RA 5BOCA 4JAVA 2BT0A 1AJ6A 3ZM7A 2WI6A 4HYPA 5GGZA 4L93A 4ASGA 1Y4SA 4CWRA 2H55A 1THNA 2BYHA 3K99A 3IEDA 4HZ0A 2HCHA 2HKJA 4WUBA 2YKJA 1QYEA 3B26A 3CRLA 3KE6A 4WUCA 1NHIA 2YJWA 4XE2A 1UYIA 2XDUA 1I59A 3ZXQA 3B28A 4LWEA 4XKAA 1S14A 3K97A 1OSFA 4U93A 3FV5A 4CWPA 2YGAA 2XJJA 3G7EA 4ASFA 2VW5A 1AMWA 1R62A 1UYDA 4YKTA 4AWQA 4CWFA 2PNRA 1B63A 4HZ5A 1YT2A 2WI3A 3U2KA 3TZ0A 5CPHA 3A0ZA 3BMYA 5F3KA 4DZYA 3O2FA 3TUHA 4O04A 4YKRA 4O09A 2BZ5A 3D2RA 1NHJA 1YS3A 4YKYA 2FXSA 2IWSA 3RLPA 4V25A 2IOPA 3CWVA 4XKKA 4URNA 4MPNA 1NHHA 2JKIA 4FCPA 3ZXOA 2XCMA 1KIJA 4EMVA 2O1VA 3T10A 3CGYA 1UYCA 3EHJA 2XJXA 2HG1A 1EI1A 4P7AA 4H81A 1GJVA 1YESA 3LNUA 4EGHA 3Q5LA 4EGKA 2YEDA 1MU5A 1ID0A 3GIEA 1QY8A 4KFGA 4W7TA 4CE1A 2YEIA 2YI6A 2YKIA 3GIGB 2CGFA 3RKZA 2YEHA 3G7BA 4QPJA 1UY9A 4UROA 1Y8PA 4O07A 2Q8IA 3T0ZA 3JZ3A 4CWOA 1UYGA 2WI7A 2O1WA 2ZKJA 5D6PA 1YC4A 3INWA 2YE2A 5D7DA 2BU8A 4KTNA 1TBWA 3T1KA 3Q5JA 1GKXA 1I5AA 1ZWHA 2ZDYA 4XIRA 4KQVA 4YKQA 4CE3A 3QDDA 4B7PA 2UWDA 4KSHA 2QFOA 3ZKBA 2XD6A 4BAEA 3H80A 2FWZA 4KP4A 1Z5AA 3HZ1A 3MNRP 5IN9A 1TILA 2VCIA 2Q8FA 5CTYA 2BRCA 2YKEA 4PL9A 1YT0A 3EHHA 4GQTA 1ZXMA 1Z59A 3OMUA 3O6OA 4GCZA 3HZ5A 5IDJA 1H7UA 2WI2A 2GFDA 4QPKA 5M4EA 4LWHA 1UYHA 4HY1A 1AM1A 2WI4A 1UYEA 4EEHA 2ZDXA 1B62A 4U7OA 3A0WA 5J71A 4EFUA 4CWSA 3K98A 4URLA 4XIPA 1MX0A 4HYMA 1UYMA 1YETA 4HY6A 4ASAA 2YJXA 2YEJA 4ZVIA 2H8MA 1BYQA 1YSZA 1US7A 1YT1A 4ASBA 5D7CA 1A4HA 4FMTA 2IWUA 1UYFA 3TZ4A 4XIQA 1QZRA 3ZKDA 3A0YA 4FCQA 2YE5A 3PEJA 3A0RA 4MB9A 4BIUA 5M4NA 5FNDA 1I5DA 1B3QA 2BU2A 3FT5A 5BODA 4YKZA 2O1UA 4EFTA 2QF6A 1Z5CA 2E0AA 3VHCA 4JASA 4MPCA 3VHAA 5L3JA 4X9LA 2C2AA 4YKUA 1YSRA 4NH8A 4R1FA 3GIFA 4JAUA 4O05A 1TH8A 4H85A 3NMQA 1BXDA 2XDSA 3R4OA 1U2OA 1I5BA 3R4PA 2XJGA 4K4OA 2IWXA 5CTUA 3C11A 4AWOA 2QG2A 2YEEA 4H7QA 3HYZA 4JQLA 4LWGA 4CWQA 2CCUA 4GGLA 1I58A 4L90A 2YEGA 4BXIA 5M4PA 2YE8A 3A0TA 4E01A 3T0HA 4GFNA 1UY6A 1H7SA 2XDKA 2YGEA 3H4LA 4MP7A 1GKZA 2XX2A 4AS9A 4BQGA 2YE9A 2Q8HA 4BIZA 1AH6A 2CH4A 1KZNA 2YE7A 5CTXA 3K60A 5FNFA 2BTZA 2WEPA 3U2DA 1ZW9A 5IDMA 3WQ9A 5CF0A 4ZKIA 4CWNA 4I5SA 4MBCA 2YI5A 4LWFA 2BU7A 2Q2EB 5FWKA 3B25A 3OPDA 3EKOA 2BU5A 1ZXNA 4MOTA 4XKOA 4LPBA 2YE6A 1Y8OA 1YC1A 3U67A 4R3AA 1AH8A 1L0OA 3TZ2A 2CG9A 4I3HA 4AWPA 1JM6A 2AKPA 3A0XA 2WI1A 4XTJA 4XDMA 4LWIA 4U7NA 3R92A 1UY7A 3QTFA 4L91A 3O0IA 3OW6A 3CRKA 2XHXA 3OWBA 4P8OA 1YERA 4PU9A 4BQJA 4KSGA 2XX5A 2FYPA 4XCLA 3WHAA 4FPPA 4GT8A 2CCSA 4L8ZA 1TC6A 4O0BA 1BKNA 1UYKA 4HXZA 4XC0A 2YI0A 4XCJA 3SL2A 2QG0A 2YK9A 2XABA 2IOQA 1Y8NA 1TIDA 4E00A 2ZBKB 5J6AA 3VADA 1BGQA 1UY8A 2BREA 3RLQA 2YE3A 4XITA 2XK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YK2 A;  1YC3 A;  5D6Q A;  2YI7 A;  2EXL A;  2XDL A;  3INX A;  3LPS A;  4MPE A;  1EA6 A;  4L94 A;  2WER A;  2WI5 A;  2BSM A;  4NH9 A;  2XHT A;  4R3M A;  3BM9 A;  1Z5B A;  1Y4U A;  2YE4 A;  3T2S A;  4CE2 A;  5FNC A;  3TZ5 A;  2VCJ A;  4EM7 A;  4B6C A;  2Q8G A;  3EKR A;  3G75 A;  3R4N A;  1TC0 A;  3R4M A;  4V26 A;  4MP2 A;  5M4K A;  3GIG A;  3EHG A;  1PVG A;  3CGZ A;  4PRX A;  4E02 A;  4WUD A;  2WEQ A;  3EHF A;  4LP0 A;  3D36 A;  2ESA A;  2YGF A;  3DGE A;  2YEB A;  2YEC A;  2BU6 A;  2IOR A;  3RLR A;  2XX4 A;  3TTZ A;  1I5C A;  2CCT A;  4EGI A;  1UYL A;  4YKX A;  2BYI A;  5M4H A;  4NH7 A;  3B27 A;  4GEE A;  4Q20 A;  2YEA A;  3VHD A;  3HYY A;  4DUH A;  2YEF A;  4URM A;  5M4M A;  3HEK A;  3R91 A;  3B24 A;  1S16 A;  3FT8 A;  2XDX A;  3PEH A;  5D7R A;  4YKW A;  2K5B A;  5CTW A;  5C93 A;  3OWD A;  3HHU A;  1U0Z A;  3D0B A;  3Q5K A;  4CWT A;  2VWC A;  3C0E A;  2YKB A;  2JJC A;  4PRV A;  2FWY A;  4FCR A;  4XD8 A;  2GQP A;  4HXW A;  2YKC A;  2XHR A;  5F5R A;  5BOC A;  4JAV A;  2BT0 A;  1AJ6 A;  3ZM7 A;  2WI6 A;  4HYP A;  5GGZ A;  4L93 A;  4ASG A;  1Y4S A;  4CWR A;  2H55 A;  1THN A;  2BYH A;  3K99 A;  3IED A;  4HZ0 A;  2HCH A;  2HKJ A;  4WUB A;  2YKJ A;  1QYE A;  3B26 A;  3CRL A;  3KE6 A;  4WUC A;  1NHI A;  2YJW A;  4XE2 A;  1UYI A;  2XDU A;  1I59 A;  3ZXQ A;  3B28 A;  4LWE A;  4XKA A;  1S14 A;  3K97 A;  1OSF A;  4U93 A;  3FV5 A;  4CWP A;  2YGA A;  2XJJ A;  3G7E A;  4ASF A;  2VW5 A;  1AMW A;  1R62 A;  1UYD A;  4YKT A;  4AWQ A;  4CWF A;  2PNR A;  1B63 A;  4HZ5 A;  1YT2 A;  2WI3 A;  3U2K A;  3TZ0 A;  5CPH A;  3A0Z A;  3BMY A;  5F3K A;  4DZY A;  3O2F A;  3TUH A;  4O04 A;  4YKR A;  4O09 A;  2BZ5 A;  3D2R A;  1NHJ A;  1YS3 A;  4YKY A;  2FXS A;  2IWS A;  3RLP A;  4V25 A;  2IOP A;  3CWV A;  4XKK A;  4URN A;  4MPN A;  1NHH A;  2JKI A;  4FCP A;  3ZXO A;  2XCM A;  1KIJ A;  4EMV A;  2O1V A;  3T10 A;  3CGY A;  1UYC A;  3EHJ A;  2XJX A;  2HG1 A;  1EI1 A;  4P7A A;  4H81 A;  1GJV A;  1YES A;  3LNU A;  4EGH A;  3Q5L A;  4EGK A;  2YED A;  1MU5 A;  1ID0 A;  3GIE A;  1QY8 A;  4KFG A;  4W7T A;  4CE1 A;  2YEI A;  2YI6 A;  2YKI A;  3GIG B;  2CGF A;  3RKZ A;  2YEH A;  3G7B A;  4QPJ A;  1UY9 A;  4URO A;  1Y8P A;  4O07 A;  2Q8I A;  3T0Z A;  3JZ3 A;  4CWO A;  1UYG A;  2WI7 A;  2O1W A;  2ZKJ A;  5D6P A;  1YC4 A;  3INW A;  2YE2 A;  5D7D A;  2BU8 A;  4KTN A;  1TBW A;  3T1K A;  3Q5J A;  1GKX A;  1I5A A;  1ZWH A;  2ZDY A;  4XIR A;  4KQV A;  4YKQ A;  4CE3 A;  3QDD A;  4B7P A;  2UWD A;  4KSH A;  2QFO A;  3ZKB A;  2XD6 A;  4BAE A;  3H80 A;  2FWZ A;  4KP4 A;  1Z5A A;  3HZ1 A;  3MNR P;  5IN9 A;  1TIL A;  2VCI A;  2Q8F A;  5CTY A;  2BRC A;  2YKE A;  4PL9 A;  1YT0 A;  3EHH A;  4GQT A;  1ZXM A;  1Z59 A;  3OMU A;  3O6O A;  4GCZ A;  3HZ5 A;  5IDJ A;  1H7U A;  2WI2 A;  2GFD A;  4QPK A;  5M4E A;  4LWH A;  1UYH A;  4HY1 A;  1AM1 A;  2WI4 A;  1UYE A;  4EEH A;  2ZDX A;  1B62 A;  4U7O A;  3A0W A;  5J71 A;  4EFU A;  4CWS A;  3K98 A;  4URL A;  4XIP A;  1MX0 A;  4HYM A;  1UYM A;  1YET A;  4HY6 A;  4ASA A;  2YJX A;  2YEJ A;  4ZVI A;  2H8M A;  1BYQ A;  1YSZ A;  1US7 A;  1YT1 A;  4ASB A;  5D7C A;  1A4H A;  4FMT A;  2IWU A;  1UYF A;  3TZ4 A;  4XIQ A;  1QZR A;  3ZKD A;  3A0Y A;  4FCQ A;  2YE5 A;  3PEJ A;  3A0R A;  4MB9 A;  4BIU A;  5M4N A;  5FND A;  1I5D A;  1B3Q A;  2BU2 A;  3FT5 A;  5BOD A;  4YKZ A;  2O1U A;  4EFT A;  2QF6 A;  1Z5C A;  2E0A A;  3VHC A;  4JAS A;  4MPC A;  3VHA A;  5L3J A;  4X9L A;  2C2A A;  4YKU A;  1YSR A;  4NH8 A;  4R1F A;  3GIF A;  4JAU A;  4O05 A;  1TH8 A;  4H85 A;  3NMQ A;  1BXD A;  2XDS A;  3R4O A;  1U2O A;  1I5B A;  3R4P A;  2XJG A;  4K4O A;  2IWX A;  5CTU A;  3C11 A;  4AWO A;  2QG2 A;  2YEE A;  4H7Q A;  3HYZ A;  4JQL A;  4LWG A;  4CWQ A;  2CCU A;  4GGL A;  1I58 A;  4L90 A;  2YEG A;  4BXI A;  5M4P A;  2YE8 A;  3A0T A;  4E01 A;  3T0H A;  4GFN A;  1UY6 A;  1H7S A;  2XDK A;  2YGE A;  3H4L A;  4MP7 A;  1GKZ A;  2XX2 A;  4AS9 A;  4BQG A;  2YE9 A;  2Q8H A;  4BIZ A;  1AH6 A;  2CH4 A;  1KZN A;  2YE7 A;  5CTX A;  3K60 A;  5FNF A;  2BTZ A;  2WEP A;  3U2D A;  1ZW9 A;  5IDM A;  3WQ9 A;  5CF0 A;  4ZKI A;  4CWN A;  4I5S A;  4MBC A;  2YI5 A;  4LWF A;  2BU7 A;  2Q2E B;  5FWK A;  3B25 A;  3OPD A;  3EKO A;  2BU5 A;  1ZXN A;  4MOT A;  4XKO A;  4LPB A;  2YE6 A;  1Y8O A;  1YC1 A;  3U67 A;  4R3A A;  1AH8 A;  1L0O A;  3TZ2 A;  2CG9 A;  4I3H A;  4AWP A;  1JM6 A;  2AKP A;  3A0X A;  2WI1 A;  4XTJ A;  4XDM A;  4LWI A;  4U7N A;  3R92 A;  1UY7 A;  3QTF A;  4L91 A;  3O0I A;  3OW6 A;  3CRK A;  2XHX A;  3OWB A;  4P8O A;  1YER A;  4PU9 A;  4BQJ A;  4KSG A;  2XX5 A;  2FYP A;  4XCL A;  3WHA A;  4FPP A;  4GT8 A;  2CCS A;  4L8Z A;  1TC6 A;  4O0B A;  1BKN A;  1UYK A;  4HXZ A;  4XC0 A;  2YI0 A;  4XCJ A;  3SL2 A;  2QG0 A;  2YK9 A;  2XAB A;  2IOQ A;  1Y8N A;  1TID A;  4E00 A;  2ZBK B;  5J6A A;  3VAD A;  1BGQ A;  1UY8 A;  2BRE A;  3RLQ A;  2YE3 A;  4XIT A;  2XK2 A; 
#chains in the Genus database with same CATH topology
 2YK2 A;  1YC3 A;  5D6Q A;  2YI7 A;  2EXL A;  2XDL A;  3INX A;  3LPS A;  4MPE A;  1EA6 A;  4L94 A;  2WER A;  2WI5 A;  2BSM A;  4NH9 A;  2XHT A;  4R3M A;  3BM9 A;  1Z5B A;  1Y4U A;  2YE4 A;  3T2S A;  4CE2 A;  5FNC A;  3TZ5 A;  2VCJ A;  4EM7 A;  4B6C A;  2Q8G A;  3EKR A;  3G75 A;  3R4N A;  1TC0 A;  3R4M A;  4V26 A;  4MP2 A;  5M4K A;  3GIG A;  3EHG A;  1PVG A;  3CGZ A;  4PRX A;  4E02 A;  4WUD A;  2WEQ A;  3EHF A;  4LP0 A;  3D36 A;  2ESA A;  2YGF A;  3DGE A;  2YEB A;  2YEC A;  2BU6 A;  2IOR A;  3RLR A;  2XX4 A;  3TTZ A;  1I5C A;  2CCT A;  4EGI A;  1UYL A;  4YKX A;  2BYI A;  5M4H A;  4NH7 A;  3B27 A;  4GEE A;  4Q20 A;  2YEA A;  3VHD A;  3HYY A;  4DUH A;  2YEF A;  4URM A;  5M4M A;  3HEK A;  3R91 A;  3B24 A;  1S16 A;  3FT8 A;  2XDX A;  3PEH A;  5D7R A;  4YKW A;  2K5B A;  5CTW A;  5C93 A;  3OWD A;  3HHU A;  1U0Z A;  3D0B A;  3Q5K A;  4CWT A;  2VWC A;  3C0E A;  2YKB A;  2JJC A;  4PRV A;  2FWY A;  4FCR A;  4XD8 A;  2GQP A;  4HXW A;  2YKC A;  2XHR A;  5F5R A;  5BOC A;  4JAV A;  2BT0 A;  1AJ6 A;  3ZM7 A;  2WI6 A;  4HYP A;  5GGZ A;  4L93 A;  4ASG A;  1Y4S A;  4CWR A;  2H55 A;  1THN A;  2BYH A;  3K99 A;  3IED A;  4HZ0 A;  2HCH A;  2HKJ A;  4WUB A;  2YKJ A;  1QYE A;  3B26 A;  3CRL A;  3KE6 A;  4WUC A;  1NHI A;  2YJW A;  4XE2 A;  1UYI A;  2XDU A;  1I59 A;  3ZXQ A;  3B28 A;  4LWE A;  4XKA A;  1S14 A;  3K97 A;  1OSF A;  4U93 A;  3FV5 A;  4CWP A;  2YGA A;  2XJJ A;  3G7E A;  4ASF A;  2VW5 A;  1AMW A;  1R62 A;  1UYD A;  4YKT A;  4AWQ A;  4CWF A;  2PNR A;  1B63 A;  4HZ5 A;  1YT2 A;  2WI3 A;  3U2K A;  3TZ0 A;  5CPH A;  3S5T A;  3A0Z A;  3BMY A;  5F3K A;  4DZY A;  3O2F A;  3TUH A;  4O04 A;  4YKR A;  4O09 A;  2BZ5 A;  3D2R A;  1NHJ A;  1YS3 A;  4YKY A;  2FXS A;  2IWS A;  3RLP A;  4V25 A;  2IOP A;  3CWV A;  4XKK A;  4URN A;  4MPN A;  1NHH A;  2JKI A;  4FCP A;  3ZXO A;  2XCM A;  1KIJ A;  4EMV A;  2O1V A;  3T10 A;  3LMM A;  3CGY A;  1UYC A;  3EHJ A;  2XJX A;  2HG1 A;  1EI1 A;  4P7A A;  4H81 A;  1GJV A;  2FTK A;  1YES A;  3LNU A;  4EGH A;  3Q5L A;  4EGK A;  2YED A;  1MU5 A;  1ID0 A;  3GIE A;  1QY8 A;  4KFG A;  4W7T A;  4CE1 A;  2YEI A;  2YI6 A;  2YKI A;  3GIG B;  2CGF A;  3RKZ A;  2YEH A;  3G7B A;  4QPJ A;  1UY9 A;  4URO A;  1Y8P A;  4O07 A;  2Q8I A;  3T0Z A;  3JZ3 A;  4CWO A;  1UYG A;  2WI7 A;  2O1W A;  2ZKJ A;  5D6P A;  1YC4 A;  3INW A;  2YE2 A;  5D7D A;  2BU8 A;  4KTN A;  1TBW A;  3T1K A;  3Q5J A;  1GKX A;  1I5A A;  1ZWH A;  2ZDY A;  4XIR A;  4KQV A;  4YKQ A;  4CE3 A;  3QDD A;  3CYG A;  4B7P A;  2UWD A;  4KSH A;  2QFO A;  3ZKB A;  2XD6 A;  4BAE A;  3H80 A;  2FWZ A;  4KP4 A;  1Z5A A;  3HZ1 A;  3MNR P;  5IN9 A;  1TIL A;  2VCI A;  2Q8F A;  5CTY A;  2BRC A;  2YKE A;  4PL9 A;  1YT0 A;  3EHH A;  4GQT A;  1ZXM A;  1Z59 A;  3OMU A;  3O6O A;  4GCZ A;  3HZ5 A;  5IDJ A;  1H7U A;  2WI2 A;  2GFD A;  4QPK A;  5M4E A;  4LWH A;  1UYH A;  4HY1 A;  1AM1 A;  2WI4 A;  1UYE A;  4EEH A;  2ZDX A;  1B62 A;  4U7O A;  3A0W A;  5J71 A;  4EFU A;  4CWS A;  3K98 A;  4E72 A;  4URL A;  4XIP A;  1MX0 A;  4HYM A;  1UYM A;  1YET A;  4HY6 A;  4ASA A;  2YJX A;  2YEJ A;  4ZVI A;  2H8M A;  1BYQ A;  1YSZ A;  1US7 A;  1YT1 A;  4ASB A;  5D7C A;  1A4H A;  4FMT A;  2IWU A;  1UYF A;  1IXM A;  3TZ4 A;  4XIQ A;  1QZR A;  3ZKD A;  3A0Y A;  4FCQ A;  2YE5 A;  3PEJ A;  3A0R A;  4MB9 A;  4BIU A;  5M4N A;  5FND A;  1I5D A;  1B3Q A;  2BU2 A;  3FT5 A;  5BOD A;  4YKZ A;  5JEN A;  2O1U A;  4EFT A;  2QF6 A;  1Z5C A;  2E0A A;  3VHC A;  4JAS A;  4MPC A;  3VHA A;  5L3J A;  4X9L A;  2C2A A;  4YKU A;  1YSR A;  4NH8 A;  4R1F A;  4JAU A;  3GIF A;  4O05 A;  1TH8 A;  4H85 A;  3NMQ A;  1BXD A;  2XDS A;  3R4O A;  1U2O A;  1I5B A;  3R4P A;  2XJG A;  4K4O A;  2IWX A;  5CTU A;  3C11 A;  4AWO A;  2QG2 A;  2YEE A;  4H7Q A;  3HYZ A;  4JQL A;  4LWG A;  4CWQ A;  2CCU A;  4GGL A;  1I58 A;  4L90 A;  2YEG A;  4BXI A;  5M4P A;  2YE8 A;  3A0T A;  4E01 A;  3T0H A;  4GFN A;  1UY6 A;  1H7S A;  2HHI A;  2XDK A;  2YGE A;  3H4L A;  4MP7 A;  1GKZ A;  2XX2 A;  4AS9 A;  4BQG A;  2YE9 A;  2Q8H A;  4BIZ A;  1AH6 A;  2CH4 A;  1KZN A;  2YE7 A;  5CTX A;  3K60 A;  5FNF A;  2BTZ A;  2WEP A;  3U2D A;  1ZW9 A;  5IDM A;  3WQ9 A;  5CF0 A;  4ZKI A;  4CWN A;  4I5S A;  4MBC A;  2YI5 A;  4LWF A;  2BU7 A;  2Q2E B;  5FWK A;  3B25 A;  3OPD A;  3EKO A;  2BU5 A;  1ZXN A;  4MOT A;  4XKO A;  4LPB A;  2YE6 A;  1Y8O A;  1YC1 A;  3U67 A;  4R3A A;  1AH8 A;  1L0O A;  3TZ2 A;  2CG9 A;  4I3H A;  4AWP A;  1JM6 A;  2AKP A;  3A0X A;  2WI1 A;  4XTJ A;  4XDM A;  4LWI A;  4U7N A;  3R92 A;  1UY7 A;  3QTF A;  4L91 A;  3O0I A;  3OW6 A;  1F51 A;  3CRK A;  2XHX A;  3OWB A;  4P8O A;  1YER A;  4PU9 A;  4BQJ A;  4KSG A;  2XX5 A;  2FYP A;  4XCL A;  3WHA A;  2C1I A;  4FPP A;  4GT8 A;  2CCS A;  4L8Z A;  1TC6 A;  4O0B A;  1BKN A;  1UYK A;  4HXZ A;  4XC0 A;  2YI0 A;  4XCJ A;  3SL2 A;  2C1G A;  2QG0 A;  2YK9 A;  2XAB A;  2IOQ A;  1Y8N A;  1TID A;  4E00 A;  2ZBK B;  5J6A A;  3VAD A;  1BGQ A;  1UY8 A;  2BRE A;  3RLQ A;  2YE3 A;  4XIT A;  2XK2 A; 
#chains in the Genus database with same CATH homology
 2YK2 A;  1YC3 A;  5D6Q A;  2YI7 A;  2EXL A;  2XDL A;  3INX A;  3LPS A;  4MPE A;  1EA6 A;  4L94 A;  2WER A;  2WI5 A;  2BSM A;  4NH9 A;  2XHT A;  4R3M A;  3BM9 A;  1Z5B A;  1Y4U A;  2YE4 A;  3T2S A;  4CE2 A;  5FNC A;  3TZ5 A;  2VCJ A;  4EM7 A;  4B6C A;  2Q8G A;  3EKR A;  3G75 A;  3R4N A;  1TC0 A;  3R4M A;  4V26 A;  4MP2 A;  5M4K A;  3GIG A;  3EHG A;  1PVG A;  3CGZ A;  4PRX A;  4E02 A;  4WUD A;  2WEQ A;  3EHF A;  4LP0 A;  3D36 A;  2ESA A;  2YGF A;  3DGE A;  2YEB A;  2YEC A;  2BU6 A;  2IOR A;  3RLR A;  2XX4 A;  3TTZ A;  1I5C A;  2CCT A;  4EGI A;  1UYL A;  4YKX A;  2BYI A;  5M4H A;  4NH7 A;  3B27 A;  4GEE A;  4Q20 A;  2YEA A;  3VHD A;  3HYY A;  4DUH A;  2YEF A;  4URM A;  5M4M A;  3HEK A;  3R91 A;  3B24 A;  1S16 A;  3FT8 A;  2XDX A;  3PEH A;  5D7R A;  4YKW A;  2K5B A;  5CTW A;  5C93 A;  3OWD A;  3HHU A;  1U0Z A;  3D0B A;  3Q5K A;  4CWT A;  2VWC A;  3C0E A;  2YKB A;  2JJC A;  4PRV A;  2FWY A;  4FCR A;  4XD8 A;  2GQP A;  4HXW A;  2YKC A;  2XHR A;  5F5R A;  5BOC A;  4JAV A;  2BT0 A;  1AJ6 A;  3ZM7 A;  2WI6 A;  4HYP A;  5GGZ A;  4L93 A;  4ASG A;  1Y4S A;  4CWR A;  2H55 A;  1THN A;  2BYH A;  3K99 A;  3IED A;  4HZ0 A;  2HCH A;  2HKJ A;  4WUB A;  2YKJ A;  1QYE A;  3B26 A;  3CRL A;  3KE6 A;  4WUC A;  1NHI A;  2YJW A;  4XE2 A;  1UYI A;  2XDU A;  1I59 A;  3ZXQ A;  3B28 A;  4LWE A;  4XKA A;  1S14 A;  3K97 A;  1OSF A;  4U93 A;  3FV5 A;  4CWP A;  2YGA A;  2XJJ A;  3G7E A;  4ASF A;  2VW5 A;  1AMW A;  1R62 A;  1UYD A;  4YKT A;  4AWQ A;  4CWF A;  2PNR A;  1B63 A;  4HZ5 A;  1YT2 A;  2WI3 A;  3U2K A;  3TZ0 A;  5CPH A;  3A0Z A;  3BMY A;  5F3K A;  4DZY A;  3O2F A;  3TUH A;  4O04 A;  4YKR A;  4O09 A;  2BZ5 A;  3D2R A;  1NHJ A;  1YS3 A;  4YKY A;  2FXS A;  2IWS A;  3RLP A;  4V25 A;  2IOP A;  3CWV A;  4XKK A;  4URN A;  4MPN A;  1NHH A;  2JKI A;  4FCP A;  3ZXO A;  2XCM A;  1KIJ A;  4EMV A;  2O1V A;  3T10 A;  3CGY A;  1UYC A;  3EHJ A;  2XJX A;  2HG1 A;  1EI1 A;  4P7A A;  4H81 A;  1GJV A;  1YES A;  3LNU A;  4EGH A;  3Q5L A;  4EGK A;  2YED A;  1MU5 A;  1ID0 A;  3GIE A;  1QY8 A;  4KFG A;  4W7T A;  4CE1 A;  2YEI A;  2YI6 A;  2YKI A;  3GIG B;  2CGF A;  3RKZ A;  2YEH A;  3G7B A;  4QPJ A;  1UY9 A;  4URO A;  1Y8P A;  4O07 A;  2Q8I A;  3T0Z A;  3JZ3 A;  4CWO A;  1UYG A;  2WI7 A;  2O1W A;  2ZKJ A;  5D6P A;  1YC4 A;  3INW A;  2YE2 A;  5D7D A;  2BU8 A;  4KTN A;  1TBW A;  3T1K A;  3Q5J A;  1GKX A;  1I5A A;  1ZWH A;  2ZDY A;  4XIR A;  4KQV A;  4YKQ A;  4CE3 A;  3QDD A;  4B7P A;  2UWD A;  4KSH A;  2QFO A;  3ZKB A;  2XD6 A;  4BAE A;  3H80 A;  2FWZ A;  4KP4 A;  1Z5A A;  3HZ1 A;  3MNR P;  5IN9 A;  1TIL A;  2VCI A;  2Q8F A;  5CTY A;  2BRC A;  2YKE A;  4PL9 A;  1YT0 A;  3EHH A;  4GQT A;  1ZXM A;  1Z59 A;  3OMU A;  3O6O A;  4GCZ A;  3HZ5 A;  5IDJ A;  1H7U A;  2WI2 A;  2GFD A;  4QPK A;  5M4E A;  4LWH A;  1UYH A;  4HY1 A;  1AM1 A;  2WI4 A;  1UYE A;  4EEH A;  2ZDX A;  1B62 A;  4U7O A;  3A0W A;  5J71 A;  4EFU A;  4CWS A;  3K98 A;  4URL A;  4XIP A;  1MX0 A;  4HYM A;  1UYM A;  1YET A;  4HY6 A;  4ASA A;  2YJX A;  2YEJ A;  4ZVI A;  2H8M A;  1BYQ A;  1YSZ A;  1US7 A;  1YT1 A;  4ASB A;  5D7C A;  1A4H A;  4FMT A;  2IWU A;  1UYF A;  3TZ4 A;  4XIQ A;  1QZR A;  3ZKD A;  3A0Y A;  4FCQ A;  2YE5 A;  3PEJ A;  3A0R A;  4MB9 A;  4BIU A;  5M4N A;  5FND A;  1I5D A;  1B3Q A;  2BU2 A;  3FT5 A;  5BOD A;  4YKZ A;  2O1U A;  4EFT A;  2QF6 A;  1Z5C A;  2E0A A;  3VHC A;  4JAS A;  4MPC A;  3VHA A;  5L3J A;  4X9L A;  2C2A A;  4YKU A;  1YSR A;  4NH8 A;  4R1F A;  3GIF A;  4JAU A;  4O05 A;  1TH8 A;  4H85 A;  3NMQ A;  1BXD A;  2XDS A;  3R4O A;  1U2O A;  1I5B A;  3R4P A;  2XJG A;  4K4O A;  2IWX A;  5CTU A;  3C11 A;  4AWO A;  2QG2 A;  2YEE A;  4H7Q A;  3HYZ A;  4JQL A;  4LWG A;  4CWQ A;  2CCU A;  4GGL A;  1I58 A;  4L90 A;  2YEG A;  4BXI A;  5M4P A;  2YE8 A;  3A0T A;  4E01 A;  3T0H A;  4GFN A;  1UY6 A;  1H7S A;  2XDK A;  2YGE A;  3H4L A;  4MP7 A;  1GKZ A;  2XX2 A;  4AS9 A;  4BQG A;  2YE9 A;  2Q8H A;  4BIZ A;  1AH6 A;  2CH4 A;  1KZN A;  2YE7 A;  5CTX A;  3K60 A;  5FNF A;  2BTZ A;  2WEP A;  3U2D A;  1ZW9 A;  5IDM A;  3WQ9 A;  5CF0 A;  4ZKI A;  4CWN A;  4I5S A;  4MBC A;  2YI5 A;  4LWF A;  2BU7 A;  2Q2E B;  5FWK A;  3B25 A;  3OPD A;  3EKO A;  2BU5 A;  1ZXN A;  4MOT A;  4XKO A;  4LPB A;  2YE6 A;  1Y8O A;  1YC1 A;  3U67 A;  4R3A A;  1AH8 A;  1L0O A;  3TZ2 A;  2CG9 A;  4I3H A;  4AWP A;  1JM6 A;  2AKP A;  3A0X A;  2WI1 A;  4XTJ A;  4XDM A;  4LWI A;  4U7N A;  3R92 A;  1UY7 A;  3QTF A;  4L91 A;  3O0I A;  3OW6 A;  3CRK A;  2XHX A;  3OWB A;  4P8O A;  1YER A;  4PU9 A;  4BQJ A;  4KSG A;  2XX5 A;  2FYP A;  4XCL A;  3WHA A;  4FPP A;  4GT8 A;  2CCS A;  4L8Z A;  1TC6 A;  4O0B A;  1BKN A;  1UYK A;  4HXZ A;  4XC0 A;  2YI0 A;  4XCJ A;  3SL2 A;  2QG0 A;  2YK9 A;  2XAB A;  2IOQ A;  1Y8N A;  1TID A;  4E00 A;  2ZBK B;  5J6A A;  3VAD A;  1BGQ A;  1UY8 A;  2BRE A;  3RLQ A;  2YE3 A;  4XIT A;  2XK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...