3ZXQA

Crystal structure of the atp-binding domain of mycobacterium tuberculosis dost
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
b'TGLRHRLDKVIDQLAIPALHTTVQYTGPLSVVDTVLANHAEAVLREAVSNAVRHANATSLAINVSVEDDVRVEVVDDGVGISGDITESGLRNLRQRADDAGGEFTVENMPTGGTLLRWSAPLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYPOXIA SENSOR HISTIDINE KINASE RESPONSE REGULATOR DOST
publication title Activation of ATP Binding for the Autophosphorylation of Doss, a Mycobacterium Tuberculosis Histidine Kinase Lacking an ATP-Lid Motif.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 33
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3zxqA00
2XDKA 3RLPA 4EEHA 4ASFA 4QPKA 4HY1A 2YKJA 3QDDA 2XX5A 1UY7A 1UYHA 2YKBA 4XKKA 3T1KA 4O07A 1BKNA 4GQTA 4CWFA 4KTNA 3LPSA 1Z59A 5J71A 4CE1A 3HEKA 2YJXA 1Y4SA 3EKRA 1ID0A 4YKZA 4EGHA 2CG9A 4XIQA 1UYIA 2YE9A 1ZXNA 2XJXA 4YKXA 2YI0A 4GCZA 3K99A 4CE3A 1U2OA 4HY6A 3C0EA 4HXZA 4B6CA 3BM9A 3U2KA 3OPDA 3HZ1A 4O04A 4E02A 4ZKIA 2WEPA 3T0HA 1UYKA 2HG1A 4JAVA 3FV5A 2YE4A 2XABA 3B24A 4KP4A 4CWNA 1NHHA 4H85A 4XIRA 3U67A 1UY9A 3Q5JA 4LWHA 3Q5KA 4U7NA 1Y8NA 4XCLA 2JKIA 4FPPA 2BU6A 4ASBA 4GFNA 2O1WA 5D7RA 1PVGA 3A0ZA 4MPNA 2XCMA 3ZXOA 5C93A 4JASA 2VCIA 1YC4A 2XHTA 2YEDA 3T2SA 3OMUA 4URNA 4AS9A 1BGQA 1S16A 1UY6A 2YEEA 2E0AA 2IWXA 1I59A 2YE2A 4FCPA 4L93A 3U2DA 4E01A 2FYPA 2BZ5A 2UWDA 5CTXA 4BQJA 2ZKJA 4R1FA 3C11A 4PU9A 4CWSA 2EXLA 3HYYA 2Q8GA 4GT8A 2O1VA 3A0WA 1YSRA 1AJ6A 4LWGA 2XX2A 4EGIA 3TZ2A 5M4MA 4O09A 3PEHA 4FCQA 2YKIA 2YI6A 3GIGB 1YT1A 4NH8A 2XDLA 2XK2A 2CGFA 3O6OA 4HYPA 4YKYA 1KZNA 3VHCA 4AWQA 3O0IA 1YS3A 3FT5A 2ZBKB 2WI6A 1AH8A 4DUHA 5CPHA 3TZ0A 4LWFA 5F5RA 4Q20A 1AM1A 3H80A 3A0TA 4ASAA 2YJWA 4KSHA 4L8ZA 1YC1A 4K4OA 1I58A 2C2AA 5D7DA 3RKZA 1Y4UA 1QYEA 2Q8IA 1H7UA 4EM7A 3MNRP 3ZM7A 3K98A 4URMA 1R62A 2H55A 2YGFA 4R3AA 4XTJA 3A0XA 2YE7A 5FWKA 4AWPA 2YKEA 2YK9A 4XDMA 4HYMA 4R3MA 2BT0A 5GGZA 2WI3A 2YEFA 1L0OA 1EA6A 1UYLA 2YE8A 2CCSA 1U0ZA 1BYQA 1NHJA 1ZW9A 1GJVA 1NHIA 2XDUA 3CRLA 3ZKBA 2BSMA 4V25A 3K97A 4O0BA 2YEIA 4URLA 4LWIA 3R92A 5M4NA 4BXIA 4GGLA 4W7TA 4MOTA 3VHDA 2YEJA 4NH9A 3HZ5A 2QF6A 1US7A 1ZXMA 4FMTA 4HZ0A 2IORA 2WERA 2WI1A 4ZVIA 4CWPA 2WI5A 3EHJA 5M4PA 5D6PA 4EGKA 4XE2A 2ESAA 3INXA 2IOPA 2XHXA 4BIZA 1Y8OA 3RLRA 1Y8PA 4V26A 3R4OA 4XKAA 2VWCA 3G75A 2GQPA 4UROA 1A4HA 3GIEA 3TTZA 1TILA 3B28A 2WEQA 4AWOA 3WHAA 1UYGA 4KSGA 2ZDYA 4L94A 1AMWA 4WUDA 2BU5A 2BU2A 1I5AA 4H81A 4WUCA 2CCTA 5M4HA 2BRCA 2QG0A 4CWQA 2VCJA 3JZ3A 4YKQA 2YE6A 4PL9A 2O1UA 4MP7A 4BQGA 3ZXQA 4X9LA 1UYMA 1UYDA 2WI4A 4DZYA 2CH4A 2YEHA 4XC0A 3B25A 1UYCA 5CTWA 2Q8FA 3R4NA 3G7EA 1YSZA 3INWA 2WI7A 3EKOA 5IDMA 2XX4A 5BODA 1YT2A 3GIGA 2VW5A 2CCUA 2XDXA 3R4MA 4GEEA 1B63A 1B3QA 1I5BA 4L90A 2ZDXA 1JM6A 3Q5LA 2YECA 4MP2A 1YETA 5IN9A 2YGAA 3CGZA 3FT8A 3OWBA 4LPBA 4MB9A 2AKPA 3TZ4A 1BXDA 1I5DA 3H4LA 4HXWA 4MPCA 4CWTA 4XITA 2JJCA 2BYHA 4U93A 5IDJA 4BAEA 2FWYA 3VHAA 4EFTA 4P8OA 3B27A 5BOCA 3LNUA 1YC3A 3A0YA 2GFDA 2XDSA 3EHFA 5FNFA 2XJJA 1MX0A 3BMYA 3ZKDA 4YKTA 1YT0A 1MU5A 3GIFA 1TBWA 1YESA 4NH7A 5M4EA 3CWVA 3EHGA 3SL2A 3CRKA 3VADA 4XD8A 4P7AA 3EHHA 2XJGA 1UYFA 4I3HA 4KFGA 3CGYA 4I5SA 4O05A 3IEDA 5CTUA 3R4PA 1UYEA 3G7BA 4B7PA 3RLQA 2Q2EB 4XIPA 2XD6A 4HZ5A 1EI1A 4CWOA 3D0BA 1GKXA 2YEAA 3HYZA 5M4KA 4XKOA 1TH8A 2BTZA 3WQ9A 5F3KA 2BREA 2K5BA 2YI5A 2IOQA 2BU8A 3OWDA 2PNRA 5FNCA 4LWEA 1H7SA 4YKRA 4CE2A 4QPJA 3TZ5A 1B62A 1S14A 4WUBA 5CF0A 4U7OA 4PRVA 1OSFA 2QG2A 1Z5AA 3QTFA 2FXSA 2YE3A 5D6QA 1UY8A 3HHUA 3T10A 3B26A 3D2RA 2BU7A 2YEGA 3OW6A 1THNA 2BYIA 1TC6A 1KIJA 5FNDA 4E00A 4BIUA 1GKZA 3O2FA 4LP0A 5J6AA 5CTYA 2HCHA 2Q8HA 2YEBA 2YKCA 2YE5A 4FCRA 1Z5BA 2YGEA 3R91A 5L3JA 4CWRA 4ASGA 1TIDA 2IWSA 2HKJA 4KQVA 2QFOA 4EFUA 4JQLA 2YI7A 1QZRA 4YKWA 3K60A 2FWZA 2WI2A 3NMQA 4PRXA 4MBCA 3A0RA 4L91A 2YK2A 4EMVA 4JAUA 2IWUA 3DGEA 3PEJA 3KE6A 2H8MA 3D36A 4YKUA 4H7QA 1AH6A 4MPEA 2XHRA 1QY8A 3T0ZA 4XCJA 1Z5CA 1ZWHA 5D7CA 1TC0A 1YERA 1I5CA 3TUHA
chains in the Genus database with same CATH superfamily
2XDKA 3RLPA 4EEHA 4ASFA 4QPKA 4HY1A 2YKJA 3QDDA 2XX5A 1UY7A 1UYHA 2YKBA 4XKKA 3T1KA 4O07A 1BKNA 4GQTA 4CWFA 4KTNA 3LPSA 1Z59A 5J71A 4CE1A 3HEKA 2YJXA 1Y4SA 3EKRA 1ID0A 4YKZA 4EGHA 2CG9A 4XIQA 1UYIA 2YE9A 1ZXNA 2XJXA 4YKXA 2YI0A 4GCZA 3K99A 4CE3A 1U2OA 4HY6A 3C0EA 4HXZA 4B6CA 3BM9A 3U2KA 3OPDA 3HZ1A 4O04A 4E02A 4ZKIA 2WEPA 3T0HA 1UYKA 2HG1A 4JAVA 3FV5A 2YE4A 2XABA 3B24A 4KP4A 4CWNA 1NHHA 4H85A 4XIRA 3U67A 1UY9A 3Q5JA 4LWHA 3Q5KA 4U7NA 1Y8NA 4XCLA 2JKIA 4FPPA 2BU6A 4ASBA 4GFNA 2O1WA 5D7RA 1PVGA 3A0ZA 4MPNA 2XCMA 3ZXOA 5C93A 4JASA 2VCIA 1YC4A 2XHTA 2YEDA 3T2SA 3OMUA 4URNA 4AS9A 1BGQA 1S16A 1UY6A 2YEEA 2E0AA 2IWXA 1I59A 2YE2A 4FCPA 4L93A 3U2DA 4E01A 2FYPA 2BZ5A 3LMMA 2UWDA 5CTXA 4BQJA 2ZKJA 4R1FA 3C11A 4PU9A 4CWSA 2EXLA 3HYYA 2Q8GA 4GT8A 2O1VA 3S5TA 3A0WA 1YSRA 1AJ6A 4LWGA 2XX2A 4EGIA 3TZ2A 5M4MA 4O09A 3PEHA 4FCQA 2YKIA 2YI6A 3GIGB 1YT1A 4NH8A 2XDLA 2C1IA 2XK2A 2CGFA 3O6OA 4HYPA 4YKYA 1KZNA 3VHCA 4AWQA 3O0IA 1YS3A 3FT5A 2ZBKB 2WI6A 1AH8A 4DUHA 5CPHA 3TZ0A 4LWFA 5F5RA 4Q20A 1AM1A 3H80A 3A0TA 4ASAA 2YJWA 4KSHA 4L8ZA 1YC1A 4K4OA 1I58A 2C2AA 5D7DA 3RKZA 1Y4UA 1QYEA 2Q8IA 1H7UA 4EM7A 3MNRP 3ZM7A 3K98A 4URMA 1R62A 2H55A 2YGFA 4R3AA 4XTJA 3A0XA 2YE7A 5FWKA 4AWPA 2YKEA 2YK9A 4XDMA 4HYMA 4R3MA 2BT0A 5GGZA 3CYGA 2WI3A 2YEFA 1L0OA 1EA6A 1UYLA 2YE8A 2CCSA 1U0ZA 1BYQA 1NHJA 1ZW9A 1GJVA 1NHIA 2XDUA 3CRLA 3ZKBA 2BSMA 4V25A 3K97A 4O0BA 2YEIA 4URLA 4LWIA 3R92A 5M4NA 4BXIA 4GGLA 4W7TA 4MOTA 3VHDA 2YEJA 4NH9A 3HZ5A 2QF6A 1US7A 1ZXMA 4FMTA 4HZ0A 2IORA 2WERA 2WI1A 4ZVIA 4CWPA 2WI5A 3EHJA 5M4PA 5D6PA 4EGKA 4XE2A 2ESAA 3INXA 2IOPA 2XHXA 4BIZA 1Y8OA 3RLRA 1Y8PA 4V26A 3R4OA 4XKAA 1IXMA 2VWCA 3G75A 2GQPA 4UROA 1A4HA 3GIEA 3TTZA 1TILA 3B28A 2WEQA 4AWOA 3WHAA 1UYGA 4KSGA 2ZDYA 4L94A 1AMWA 4WUDA 2BU5A 2BU2A 1I5AA 4H81A 4WUCA 2CCTA 5M4HA 2BRCA 2QG0A 4CWQA 2VCJA 3JZ3A 4YKQA 2YE6A 4PL9A 2O1UA 4MP7A 4BQGA 3ZXQA 4X9LA 1UYMA 1UYDA 2WI4A 4DZYA 2CH4A 2YEHA 4XC0A 3B25A 1UYCA 5CTWA 2Q8FA 3R4NA 3G7EA 1YSZA 3INWA 2WI7A 3EKOA 5IDMA 2XX4A 5BODA 1YT2A 3GIGA 2VW5A 2CCUA 2XDXA 3R4MA 4GEEA 1B63A 1B3QA 1I5BA 4L90A 2ZDXA 1JM6A 3Q5LA 2YECA 4MP2A 1YETA 5IN9A 2YGAA 3CGZA 3FT8A 3OWBA 4LPBA 4MB9A 2AKPA 3TZ4A 1BXDA 1I5DA 3H4LA 4HXWA 4MPCA 4CWTA 4XITA 2JJCA 2BYHA 4U93A 5IDJA 4BAEA 2FWYA 3VHAA 4EFTA 4P8OA 3B27A 5BOCA 3LNUA 1YC3A 3A0YA 2GFDA 2XDSA 3EHFA 5FNFA 2XJJA 1MX0A 3BMYA 3ZKDA 4YKTA 1YT0A 1MU5A 3GIFA 1TBWA 2FTKA 1YESA 4NH7A 5M4EA 3CWVA 3EHGA 3SL2A 3CRKA 3VADA 4XD8A 4P7AA 3EHHA 2XJGA 1UYFA 4I3HA 4KFGA 3CGYA 4I5SA 4O05A 3IEDA 5CTUA 3R4PA 1UYEA 3G7BA 4B7PA 3RLQA 2Q2EB 4XIPA 2XD6A 4HZ5A 1EI1A 4CWOA 3D0BA 1GKXA 2YEAA 3HYZA 5M4KA 4XKOA 1TH8A 2BTZA 3WQ9A 5F3KA 2BREA 2K5BA 2YI5A 2IOQA 2BU8A 3OWDA 5JENA 2PNRA 5FNCA 4LWEA 1H7SA 4YKRA 4CE2A 4QPJA 3TZ5A 1B62A 1S14A 4WUBA 5CF0A 4U7OA 4PRVA 1OSFA 2QG2A 1Z5AA 3QTFA 2FXSA 2YE3A 5D6QA 1UY8A 3HHUA 3T10A 3B26A 3D2RA 2BU7A 1F51A 2HHIA 2YEGA 3OW6A 1THNA 4E72A 2BYIA 1TC6A 1KIJA 5FNDA 4E00A 4BIUA 1GKZA 3O2FA 4LP0A 5J6AA 5CTYA 2HCHA 2Q8HA 2YEBA 2YKCA 2YE5A 4FCRA 1Z5BA 2YGEA 3R91A 5L3JA 4CWRA 2C1GA 4ASGA 1TIDA 2IWSA 2HKJA 4KQVA 2QFOA 4EFUA 4JQLA 2YI7A 1QZRA 4YKWA 3K60A 2FWZA 2WI2A 3NMQA 4PRXA 4MBCA 3A0RA 4L91A 2YK2A 4EMVA 4JAUA 2IWUA 3DGEA 3PEJA 3KE6A 2H8MA 3D36A 4YKUA 4H7QA 1AH6A 4MPEA 2XHRA 1QY8A 3T0ZA 4XCJA 1Z5CA 1ZWHA 5D7CA 1TC0A 1YERA 1I5CA 3TUHA
chains in the Genus database with same CATH topology
2XDKA 3RLPA 4EEHA 4ASFA 4QPKA 4HY1A 2YKJA 3QDDA 2XX5A 1UY7A 1UYHA 2YKBA 4XKKA 3T1KA 4O07A 1BKNA 4GQTA 4CWFA 4KTNA 3LPSA 1Z59A 5J71A 4CE1A 3HEKA 2YJXA 1Y4SA 3EKRA 1ID0A 4YKZA 4EGHA 2CG9A 4XIQA 1UYIA 2YE9A 1ZXNA 2XJXA 4YKXA 2YI0A 4GCZA 3K99A 4CE3A 1U2OA 4HY6A 3C0EA 4HXZA 4B6CA 3BM9A 3U2KA 3OPDA 3HZ1A 4O04A 4E02A 4ZKIA 2WEPA 3T0HA 1UYKA 2HG1A 4JAVA 3FV5A 2YE4A 2XABA 3B24A 4KP4A 4CWNA 1NHHA 4H85A 4XIRA 3U67A 1UY9A 3Q5JA 4LWHA 3Q5KA 4U7NA 1Y8NA 4XCLA 2JKIA 4FPPA 2BU6A 4ASBA 4GFNA 2O1WA 5D7RA 1PVGA 3A0ZA 4MPNA 2XCMA 3ZXOA 5C93A 4JASA 2VCIA 1YC4A 2XHTA 2YEDA 3T2SA 3OMUA 4URNA 4AS9A 1BGQA 1S16A 1UY6A 2YEEA 2E0AA 2IWXA 1I59A 2YE2A 4FCPA 4L93A 3U2DA 4E01A 2FYPA 2BZ5A 2UWDA 5CTXA 4BQJA 2ZKJA 4R1FA 3C11A 4PU9A 4CWSA 2EXLA 3HYYA 2Q8GA 4GT8A 2O1VA 3A0WA 1YSRA 1AJ6A 4LWGA 2XX2A 4EGIA 3TZ2A 5M4MA 4O09A 3PEHA 4FCQA 2YKIA 2YI6A 3GIGB 1YT1A 4NH8A 2XDLA 2XK2A 2CGFA 3O6OA 4HYPA 4YKYA 1KZNA 3VHCA 4AWQA 3O0IA 1YS3A 3FT5A 2ZBKB 2WI6A 1AH8A 4DUHA 5CPHA 3TZ0A 4LWFA 5F5RA 4Q20A 1AM1A 3H80A 3A0TA 4ASAA 2YJWA 4KSHA 4L8ZA 1YC1A 4K4OA 1I58A 2C2AA 5D7DA 3RKZA 1Y4UA 1QYEA 2Q8IA 1H7UA 4EM7A 3MNRP 3ZM7A 3K98A 4URMA 1R62A 2H55A 2YGFA 4R3AA 4XTJA 3A0XA 2YE7A 5FWKA 4AWPA 2YKEA 2YK9A 4XDMA 4HYMA 4R3MA 2BT0A 5GGZA 2WI3A 2YEFA 1L0OA 1EA6A 1UYLA 2YE8A 2CCSA 1U0ZA 1BYQA 1NHJA 1ZW9A 1GJVA 1NHIA 2XDUA 3CRLA 3ZKBA 2BSMA 4V25A 3K97A 4O0BA 2YEIA 4URLA 4LWIA 3R92A 5M4NA 4BXIA 4GGLA 4W7TA 4MOTA 3VHDA 2YEJA 4NH9A 3HZ5A 2QF6A 1US7A 1ZXMA 4FMTA 4HZ0A 2IORA 2WERA 2WI1A 4ZVIA 4CWPA 2WI5A 3EHJA 5M4PA 5D6PA 4EGKA 4XE2A 2ESAA 3INXA 2IOPA 2XHXA 4BIZA 1Y8OA 3RLRA 1Y8PA 4V26A 3R4OA 4XKAA 2VWCA 3G75A 2GQPA 4UROA 1A4HA 3GIEA 3TTZA 1TILA 3B28A 2WEQA 4AWOA 3WHAA 1UYGA 4KSGA 2ZDYA 4L94A 1AMWA 4WUDA 2BU5A 2BU2A 1I5AA 4H81A 4WUCA 2CCTA 5M4HA 2BRCA 2QG0A 4CWQA 2VCJA 3JZ3A 4YKQA 2YE6A 4PL9A 2O1UA 4MP7A 4BQGA 3ZXQA 4X9LA 1UYMA 1UYDA 2WI4A 4DZYA 2CH4A 2YEHA 4XC0A 3B25A 1UYCA 5CTWA 2Q8FA 3R4NA 3G7EA 1YSZA 3INWA 2WI7A 3EKOA 5IDMA 2XX4A 5BODA 1YT2A 3GIGA 2VW5A 2CCUA 2XDXA 3R4MA 4GEEA 1B63A 1B3QA 1I5BA 4L90A 2ZDXA 1JM6A 3Q5LA 2YECA 4MP2A 1YETA 5IN9A 2YGAA 3CGZA 3FT8A 3OWBA 4LPBA 4MB9A 2AKPA 3TZ4A 1BXDA 1I5DA 3H4LA 4HXWA 4MPCA 4CWTA 4XITA 2JJCA 2BYHA 4U93A 5IDJA 4BAEA 2FWYA 3VHAA 4EFTA 4P8OA 3B27A 5BOCA 3LNUA 1YC3A 3A0YA 2GFDA 2XDSA 3EHFA 5FNFA 2XJJA 1MX0A 3BMYA 3ZKDA 4YKTA 1YT0A 1MU5A 3GIFA 1TBWA 1YESA 4NH7A 5M4EA 3CWVA 3EHGA 3SL2A 3CRKA 3VADA 4XD8A 4P7AA 3EHHA 2XJGA 1UYFA 4I3HA 4KFGA 3CGYA 4I5SA 4O05A 3IEDA 5CTUA 3R4PA 1UYEA 3G7BA 4B7PA 3RLQA 2Q2EB 4XIPA 2XD6A 4HZ5A 1EI1A 4CWOA 3D0BA 1GKXA 2YEAA 3HYZA 5M4KA 4XKOA 1TH8A 2BTZA 3WQ9A 5F3KA 2BREA 2K5BA 2YI5A 2IOQA 2BU8A 3OWDA 2PNRA 5FNCA 4LWEA 1H7SA 4YKRA 4CE2A 4QPJA 3TZ5A 1B62A 1S14A 4WUBA 5CF0A 4U7OA 4PRVA 1OSFA 2QG2A 1Z5AA 3QTFA 2FXSA 2YE3A 5D6QA 1UY8A 3HHUA 3T10A 3B26A 3D2RA 2BU7A 2YEGA 3OW6A 1THNA 2BYIA 1TC6A 1KIJA 5FNDA 4E00A 4BIUA 1GKZA 3O2FA 4LP0A 5J6AA 5CTYA 2HCHA 2Q8HA 2YEBA 2YKCA 2YE5A 4FCRA 1Z5BA 2YGEA 3R91A 5L3JA 4CWRA 4ASGA 1TIDA 2IWSA 2HKJA 4KQVA 2QFOA 4EFUA 4JQLA 2YI7A 1QZRA 4YKWA 3K60A 2FWZA 2WI2A 3NMQA 4PRXA 4MBCA 3A0RA 4L91A 2YK2A 4EMVA 4JAUA 2IWUA 3DGEA 3PEJA 3KE6A 2H8MA 3D36A 4YKUA 4H7QA 1AH6A 4MPEA 2XHRA 1QY8A 3T0ZA 4XCJA 1Z5CA 1ZWHA 5D7CA 1TC0A 1YERA 1I5CA 3TUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDK A;  3RLP A;  4EEH A;  4ASF A;  4QPK A;  4HY1 A;  2YKJ A;  3QDD A;  2XX5 A;  1UY7 A;  1UYH A;  2YKB A;  4XKK A;  3T1K A;  4O07 A;  1BKN A;  4GQT A;  4CWF A;  4KTN A;  3LPS A;  1Z59 A;  5J71 A;  4CE1 A;  3HEK A;  2YJX A;  1Y4S A;  3EKR A;  1ID0 A;  4YKZ A;  4EGH A;  2CG9 A;  4XIQ A;  1UYI A;  2YE9 A;  1ZXN A;  2XJX A;  4YKX A;  2YI0 A;  4GCZ A;  3K99 A;  4CE3 A;  1U2O A;  4HY6 A;  3C0E A;  4HXZ A;  4B6C A;  3BM9 A;  3U2K A;  3OPD A;  3HZ1 A;  4O04 A;  4E02 A;  4ZKI A;  2WEP A;  3T0H A;  1UYK A;  2HG1 A;  4JAV A;  3FV5 A;  2YE4 A;  2XAB A;  3B24 A;  4KP4 A;  4CWN A;  1NHH A;  4H85 A;  4XIR A;  3U67 A;  1UY9 A;  3Q5J A;  4LWH A;  3Q5K A;  4U7N A;  1Y8N A;  4XCL A;  2JKI A;  4FPP A;  2BU6 A;  4ASB A;  4GFN A;  2O1W A;  5D7R A;  1PVG A;  3A0Z A;  4MPN A;  2XCM A;  3ZXO A;  5C93 A;  4JAS A;  2VCI A;  1YC4 A;  2XHT A;  2YED A;  3T2S A;  3OMU A;  4URN A;  4AS9 A;  1BGQ A;  1S16 A;  1UY6 A;  2YEE A;  2E0A A;  2IWX A;  1I59 A;  2YE2 A;  4FCP A;  4L93 A;  3U2D A;  4E01 A;  2FYP A;  2BZ5 A;  2UWD A;  5CTX A;  4BQJ A;  2ZKJ A;  4R1F A;  3C11 A;  4PU9 A;  4CWS A;  2EXL A;  3HYY A;  2Q8G A;  4GT8 A;  2O1V A;  3A0W A;  1YSR A;  1AJ6 A;  4LWG A;  2XX2 A;  4EGI A;  3TZ2 A;  5M4M A;  4O09 A;  3PEH A;  4FCQ A;  2YKI A;  2YI6 A;  3GIG B;  1YT1 A;  4NH8 A;  2XDL A;  2XK2 A;  2CGF A;  3O6O A;  4HYP A;  4YKY A;  1KZN A;  3VHC A;  4AWQ A;  3O0I A;  1YS3 A;  3FT5 A;  2ZBK B;  2WI6 A;  1AH8 A;  4DUH A;  5CPH A;  3TZ0 A;  4LWF A;  5F5R A;  4Q20 A;  1AM1 A;  3H80 A;  3A0T A;  4ASA A;  2YJW A;  4KSH A;  4L8Z A;  1YC1 A;  4K4O A;  1I58 A;  2C2A A;  5D7D A;  3RKZ A;  1Y4U A;  1QYE A;  2Q8I A;  1H7U A;  4EM7 A;  3MNR P;  3ZM7 A;  3K98 A;  4URM A;  1R62 A;  2H55 A;  2YGF A;  4R3A A;  4XTJ A;  3A0X A;  2YE7 A;  5FWK A;  4AWP A;  2YKE A;  2YK9 A;  4XDM A;  4HYM A;  4R3M A;  2BT0 A;  5GGZ A;  2WI3 A;  2YEF A;  1L0O A;  1EA6 A;  1UYL A;  2YE8 A;  2CCS A;  1U0Z A;  1BYQ A;  1NHJ A;  1ZW9 A;  1GJV A;  1NHI A;  2XDU A;  3CRL A;  3ZKB A;  2BSM A;  4V25 A;  3K97 A;  4O0B A;  2YEI A;  4URL A;  4LWI A;  3R92 A;  5M4N A;  4BXI A;  4GGL A;  4W7T A;  4MOT A;  3VHD A;  2YEJ A;  4NH9 A;  3HZ5 A;  2QF6 A;  1US7 A;  1ZXM A;  4FMT A;  4HZ0 A;  2IOR A;  2WER A;  2WI1 A;  4ZVI A;  4CWP A;  2WI5 A;  3EHJ A;  5M4P A;  5D6P A;  4EGK A;  4XE2 A;  2ESA A;  3INX A;  2IOP A;  2XHX A;  4BIZ A;  1Y8O A;  3RLR A;  1Y8P A;  4V26 A;  3R4O A;  4XKA A;  2VWC A;  3G75 A;  2GQP A;  4URO A;  1A4H A;  3GIE A;  3TTZ A;  1TIL A;  3B28 A;  2WEQ A;  4AWO A;  3WHA A;  1UYG A;  4KSG A;  2ZDY A;  4L94 A;  1AMW A;  4WUD A;  2BU5 A;  2BU2 A;  1I5A A;  4H81 A;  4WUC A;  2CCT A;  5M4H A;  2BRC A;  2QG0 A;  4CWQ A;  2VCJ A;  3JZ3 A;  4YKQ A;  2YE6 A;  4PL9 A;  2O1U A;  4MP7 A;  4BQG A;  3ZXQ A;  4X9L A;  1UYM A;  1UYD A;  2WI4 A;  4DZY A;  2CH4 A;  2YEH A;  4XC0 A;  3B25 A;  1UYC A;  5CTW A;  2Q8F A;  3R4N A;  3G7E A;  1YSZ A;  3INW A;  2WI7 A;  3EKO A;  5IDM A;  2XX4 A;  5BOD A;  1YT2 A;  3GIG A;  2VW5 A;  2CCU A;  2XDX A;  3R4M A;  4GEE A;  1B63 A;  1B3Q A;  1I5B A;  4L90 A;  2ZDX A;  1JM6 A;  3Q5L A;  2YEC A;  4MP2 A;  1YET A;  5IN9 A;  2YGA A;  3CGZ A;  3FT8 A;  3OWB A;  4LPB A;  4MB9 A;  2AKP A;  3TZ4 A;  1BXD A;  1I5D A;  3H4L A;  4HXW A;  4MPC A;  4CWT A;  4XIT A;  2JJC A;  2BYH A;  4U93 A;  5IDJ A;  4BAE A;  2FWY A;  3VHA A;  4EFT A;  4P8O A;  3B27 A;  5BOC A;  3LNU A;  1YC3 A;  3A0Y A;  2GFD A;  2XDS A;  3EHF A;  5FNF A;  2XJJ A;  1MX0 A;  3BMY A;  3ZKD A;  4YKT A;  1YT0 A;  1MU5 A;  3GIF A;  1TBW A;  1YES A;  4NH7 A;  5M4E A;  3CWV A;  3EHG A;  3SL2 A;  3CRK A;  3VAD A;  4XD8 A;  4P7A A;  3EHH A;  2XJG A;  1UYF A;  4I3H A;  4KFG A;  3CGY A;  4I5S A;  4O05 A;  3IED A;  5CTU A;  3R4P A;  1UYE A;  3G7B A;  4B7P A;  3RLQ A;  2Q2E B;  4XIP A;  2XD6 A;  4HZ5 A;  1EI1 A;  4CWO A;  3D0B A;  1GKX A;  2YEA A;  3HYZ A;  5M4K A;  4XKO A;  1TH8 A;  2BTZ A;  3WQ9 A;  5F3K A;  2BRE A;  2K5B A;  2YI5 A;  2IOQ A;  2BU8 A;  3OWD A;  2PNR A;  5FNC A;  4LWE A;  1H7S A;  4YKR A;  4CE2 A;  4QPJ A;  3TZ5 A;  1B62 A;  1S14 A;  4WUB A;  5CF0 A;  4U7O A;  4PRV A;  1OSF A;  2QG2 A;  1Z5A A;  3QTF A;  2FXS A;  2YE3 A;  5D6Q A;  1UY8 A;  3HHU A;  3T10 A;  3B26 A;  3D2R A;  2BU7 A;  2YEG A;  3OW6 A;  1THN A;  2BYI A;  1TC6 A;  1KIJ A;  5FND A;  4E00 A;  4BIU A;  1GKZ A;  3O2F A;  4LP0 A;  5J6A A;  5CTY A;  2HCH A;  2Q8H A;  2YEB A;  2YKC A;  2YE5 A;  4FCR A;  1Z5B A;  2YGE A;  3R91 A;  5L3J A;  4CWR A;  4ASG A;  1TID A;  2IWS A;  2HKJ A;  4KQV A;  2QFO A;  4EFU A;  4JQL A;  2YI7 A;  1QZR A;  4YKW A;  3K60 A;  2FWZ A;  2WI2 A;  3NMQ A;  4PRX A;  4MBC A;  3A0R A;  4L91 A;  2YK2 A;  4EMV A;  4JAU A;  2IWU A;  3DGE A;  3PEJ A;  3KE6 A;  2H8M A;  3D36 A;  4YKU A;  4H7Q A;  1AH6 A;  4MPE A;  2XHR A;  1QY8 A;  3T0Z A;  4XCJ A;  1Z5C A;  1ZWH A;  5D7C A;  1TC0 A;  1YER A;  1I5C A;  3TUH A; 
#chains in the Genus database with same CATH topology
 2XDK A;  3RLP A;  4EEH A;  4ASF A;  4QPK A;  4HY1 A;  2YKJ A;  3QDD A;  2XX5 A;  1UY7 A;  1UYH A;  2YKB A;  4XKK A;  3T1K A;  4O07 A;  1BKN A;  4GQT A;  4CWF A;  4KTN A;  3LPS A;  1Z59 A;  5J71 A;  4CE1 A;  3HEK A;  2YJX A;  1Y4S A;  3EKR A;  1ID0 A;  4YKZ A;  4EGH A;  2CG9 A;  4XIQ A;  1UYI A;  2YE9 A;  1ZXN A;  2XJX A;  4YKX A;  2YI0 A;  4GCZ A;  3K99 A;  4CE3 A;  1U2O A;  4HY6 A;  3C0E A;  4HXZ A;  4B6C A;  3BM9 A;  3U2K A;  3OPD A;  3HZ1 A;  4O04 A;  4E02 A;  4ZKI A;  2WEP A;  3T0H A;  1UYK A;  2HG1 A;  4JAV A;  3FV5 A;  2YE4 A;  2XAB A;  3B24 A;  4KP4 A;  4CWN A;  1NHH A;  4H85 A;  4XIR A;  3U67 A;  1UY9 A;  3Q5J A;  4LWH A;  3Q5K A;  4U7N A;  1Y8N A;  4XCL A;  2JKI A;  4FPP A;  2BU6 A;  4ASB A;  4GFN A;  2O1W A;  5D7R A;  1PVG A;  3A0Z A;  4MPN A;  2XCM A;  3ZXO A;  5C93 A;  4JAS A;  2VCI A;  1YC4 A;  2XHT A;  2YED A;  3T2S A;  3OMU A;  4URN A;  4AS9 A;  1BGQ A;  1S16 A;  1UY6 A;  2YEE A;  2E0A A;  2IWX A;  1I59 A;  2YE2 A;  4FCP A;  4L93 A;  3U2D A;  4E01 A;  2FYP A;  2BZ5 A;  3LMM A;  2UWD A;  5CTX A;  4BQJ A;  2ZKJ A;  4R1F A;  3C11 A;  4PU9 A;  4CWS A;  2EXL A;  3HYY A;  2Q8G A;  4GT8 A;  2O1V A;  3S5T A;  3A0W A;  1YSR A;  1AJ6 A;  4LWG A;  2XX2 A;  4EGI A;  3TZ2 A;  5M4M A;  4O09 A;  3PEH A;  4FCQ A;  2YKI A;  2YI6 A;  3GIG B;  1YT1 A;  4NH8 A;  2XDL A;  2C1I A;  2XK2 A;  2CGF A;  3O6O A;  4HYP A;  4YKY A;  1KZN A;  3VHC A;  4AWQ A;  3O0I A;  1YS3 A;  3FT5 A;  2ZBK B;  2WI6 A;  1AH8 A;  4DUH A;  5CPH A;  3TZ0 A;  4LWF A;  5F5R A;  4Q20 A;  1AM1 A;  3H80 A;  3A0T A;  4ASA A;  2YJW A;  4KSH A;  4L8Z A;  1YC1 A;  4K4O A;  1I58 A;  2C2A A;  5D7D A;  3RKZ A;  1Y4U A;  1QYE A;  2Q8I A;  1H7U A;  4EM7 A;  3MNR P;  3ZM7 A;  3K98 A;  4URM A;  1R62 A;  2H55 A;  2YGF A;  4R3A A;  4XTJ A;  3A0X A;  2YE7 A;  5FWK A;  4AWP A;  2YKE A;  2YK9 A;  4XDM A;  4HYM A;  4R3M A;  2BT0 A;  5GGZ A;  3CYG A;  2WI3 A;  2YEF A;  1L0O A;  1EA6 A;  1UYL A;  2YE8 A;  2CCS A;  1U0Z A;  1BYQ A;  1NHJ A;  1ZW9 A;  1GJV A;  1NHI A;  2XDU A;  3CRL A;  3ZKB A;  2BSM A;  4V25 A;  3K97 A;  4O0B A;  2YEI A;  4URL A;  4LWI A;  3R92 A;  5M4N A;  4BXI A;  4GGL A;  4W7T A;  4MOT A;  3VHD A;  2YEJ A;  4NH9 A;  3HZ5 A;  2QF6 A;  1US7 A;  1ZXM A;  4FMT A;  4HZ0 A;  2IOR A;  2WER A;  2WI1 A;  4ZVI A;  4CWP A;  2WI5 A;  3EHJ A;  5M4P A;  5D6P A;  4EGK A;  4XE2 A;  2ESA A;  3INX A;  2IOP A;  2XHX A;  4BIZ A;  1Y8O A;  3RLR A;  1Y8P A;  4V26 A;  3R4O A;  4XKA A;  1IXM A;  2VWC A;  3G75 A;  2GQP A;  4URO A;  1A4H A;  3GIE A;  3TTZ A;  1TIL A;  3B28 A;  2WEQ A;  4AWO A;  3WHA A;  1UYG A;  4KSG A;  2ZDY A;  4L94 A;  1AMW A;  4WUD A;  2BU5 A;  2BU2 A;  1I5A A;  4H81 A;  4WUC A;  2CCT A;  5M4H A;  2BRC A;  2QG0 A;  4CWQ A;  2VCJ A;  3JZ3 A;  4YKQ A;  2YE6 A;  4PL9 A;  2O1U A;  4MP7 A;  4BQG A;  3ZXQ A;  4X9L A;  1UYM A;  1UYD A;  2WI4 A;  4DZY A;  2CH4 A;  2YEH A;  4XC0 A;  3B25 A;  1UYC A;  5CTW A;  2Q8F A;  3R4N A;  3G7E A;  1YSZ A;  3INW A;  2WI7 A;  3EKO A;  5IDM A;  2XX4 A;  5BOD A;  1YT2 A;  3GIG A;  2VW5 A;  2CCU A;  2XDX A;  3R4M A;  4GEE A;  1B63 A;  1B3Q A;  1I5B A;  4L90 A;  2ZDX A;  1JM6 A;  3Q5L A;  2YEC A;  4MP2 A;  1YET A;  5IN9 A;  2YGA A;  3CGZ A;  3FT8 A;  3OWB A;  4LPB A;  4MB9 A;  2AKP A;  3TZ4 A;  1BXD A;  1I5D A;  3H4L A;  4HXW A;  4MPC A;  4CWT A;  4XIT A;  2JJC A;  2BYH A;  4U93 A;  5IDJ A;  4BAE A;  2FWY A;  3VHA A;  4EFT A;  4P8O A;  3B27 A;  5BOC A;  3LNU A;  1YC3 A;  3A0Y A;  2GFD A;  2XDS A;  3EHF A;  5FNF A;  2XJJ A;  1MX0 A;  3BMY A;  3ZKD A;  4YKT A;  1YT0 A;  1MU5 A;  3GIF A;  1TBW A;  2FTK A;  1YES A;  4NH7 A;  5M4E A;  3CWV A;  3EHG A;  3SL2 A;  3CRK A;  3VAD A;  4XD8 A;  4P7A A;  3EHH A;  2XJG A;  1UYF A;  4I3H A;  4KFG A;  3CGY A;  4I5S A;  4O05 A;  3IED A;  5CTU A;  3R4P A;  1UYE A;  3G7B A;  4B7P A;  3RLQ A;  2Q2E B;  4XIP A;  2XD6 A;  4HZ5 A;  1EI1 A;  4CWO A;  3D0B A;  1GKX A;  2YEA A;  3HYZ A;  5M4K A;  4XKO A;  1TH8 A;  2BTZ A;  3WQ9 A;  5F3K A;  2BRE A;  2K5B A;  2YI5 A;  2IOQ A;  2BU8 A;  3OWD A;  5JEN A;  2PNR A;  5FNC A;  4LWE A;  1H7S A;  4YKR A;  4CE2 A;  4QPJ A;  3TZ5 A;  1B62 A;  1S14 A;  4WUB A;  5CF0 A;  4U7O A;  4PRV A;  1OSF A;  2QG2 A;  1Z5A A;  3QTF A;  2FXS A;  2YE3 A;  5D6Q A;  1UY8 A;  3HHU A;  3T10 A;  3B26 A;  3D2R A;  2BU7 A;  1F51 A;  2HHI A;  2YEG A;  3OW6 A;  1THN A;  4E72 A;  2BYI A;  1TC6 A;  1KIJ A;  5FND A;  4E00 A;  4BIU A;  1GKZ A;  3O2F A;  4LP0 A;  5J6A A;  5CTY A;  2HCH A;  2Q8H A;  2YEB A;  2YKC A;  2YE5 A;  4FCR A;  1Z5B A;  2YGE A;  3R91 A;  5L3J A;  4CWR A;  2C1G A;  4ASG A;  1TID A;  2IWS A;  2HKJ A;  4KQV A;  2QFO A;  4EFU A;  4JQL A;  2YI7 A;  1QZR A;  4YKW A;  3K60 A;  2FWZ A;  2WI2 A;  3NMQ A;  4PRX A;  4MBC A;  3A0R A;  4L91 A;  2YK2 A;  4EMV A;  4JAU A;  2IWU A;  3DGE A;  3PEJ A;  3KE6 A;  2H8M A;  3D36 A;  4YKU A;  4H7Q A;  1AH6 A;  4MPE A;  2XHR A;  1QY8 A;  3T0Z A;  4XCJ A;  1Z5C A;  1ZWH A;  5D7C A;  1TC0 A;  1YER A;  1I5C A;  3TUH A; 
#chains in the Genus database with same CATH homology
 2XDK A;  3RLP A;  4EEH A;  4ASF A;  4QPK A;  4HY1 A;  2YKJ A;  3QDD A;  2XX5 A;  1UY7 A;  1UYH A;  2YKB A;  4XKK A;  3T1K A;  4O07 A;  1BKN A;  4GQT A;  4CWF A;  4KTN A;  3LPS A;  1Z59 A;  5J71 A;  4CE1 A;  3HEK A;  2YJX A;  1Y4S A;  3EKR A;  1ID0 A;  4YKZ A;  4EGH A;  2CG9 A;  4XIQ A;  1UYI A;  2YE9 A;  1ZXN A;  2XJX A;  4YKX A;  2YI0 A;  4GCZ A;  3K99 A;  4CE3 A;  1U2O A;  4HY6 A;  3C0E A;  4HXZ A;  4B6C A;  3BM9 A;  3U2K A;  3OPD A;  3HZ1 A;  4O04 A;  4E02 A;  4ZKI A;  2WEP A;  3T0H A;  1UYK A;  2HG1 A;  4JAV A;  3FV5 A;  2YE4 A;  2XAB A;  3B24 A;  4KP4 A;  4CWN A;  1NHH A;  4H85 A;  4XIR A;  3U67 A;  1UY9 A;  3Q5J A;  4LWH A;  3Q5K A;  4U7N A;  1Y8N A;  4XCL A;  2JKI A;  4FPP A;  2BU6 A;  4ASB A;  4GFN A;  2O1W A;  5D7R A;  1PVG A;  3A0Z A;  4MPN A;  2XCM A;  3ZXO A;  5C93 A;  4JAS A;  2VCI A;  1YC4 A;  2XHT A;  2YED A;  3T2S A;  3OMU A;  4URN A;  4AS9 A;  1BGQ A;  1S16 A;  1UY6 A;  2YEE A;  2E0A A;  2IWX A;  1I59 A;  2YE2 A;  4FCP A;  4L93 A;  3U2D A;  4E01 A;  2FYP A;  2BZ5 A;  2UWD A;  5CTX A;  4BQJ A;  2ZKJ A;  4R1F A;  3C11 A;  4PU9 A;  4CWS A;  2EXL A;  3HYY A;  2Q8G A;  4GT8 A;  2O1V A;  3A0W A;  1YSR A;  1AJ6 A;  4LWG A;  2XX2 A;  4EGI A;  3TZ2 A;  5M4M A;  4O09 A;  3PEH A;  4FCQ A;  2YKI A;  2YI6 A;  3GIG B;  1YT1 A;  4NH8 A;  2XDL A;  2XK2 A;  2CGF A;  3O6O A;  4HYP A;  4YKY A;  1KZN A;  3VHC A;  4AWQ A;  3O0I A;  1YS3 A;  3FT5 A;  2ZBK B;  2WI6 A;  1AH8 A;  4DUH A;  5CPH A;  3TZ0 A;  4LWF A;  5F5R A;  4Q20 A;  1AM1 A;  3H80 A;  3A0T A;  4ASA A;  2YJW A;  4KSH A;  4L8Z A;  1YC1 A;  4K4O A;  1I58 A;  2C2A A;  5D7D A;  3RKZ A;  1Y4U A;  1QYE A;  2Q8I A;  1H7U A;  4EM7 A;  3MNR P;  3ZM7 A;  3K98 A;  4URM A;  1R62 A;  2H55 A;  2YGF A;  4R3A A;  4XTJ A;  3A0X A;  2YE7 A;  5FWK A;  4AWP A;  2YKE A;  2YK9 A;  4XDM A;  4HYM A;  4R3M A;  2BT0 A;  5GGZ A;  2WI3 A;  2YEF A;  1L0O A;  1EA6 A;  1UYL A;  2YE8 A;  2CCS A;  1U0Z A;  1BYQ A;  1NHJ A;  1ZW9 A;  1GJV A;  1NHI A;  2XDU A;  3CRL A;  3ZKB A;  2BSM A;  4V25 A;  3K97 A;  4O0B A;  2YEI A;  4URL A;  4LWI A;  3R92 A;  5M4N A;  4BXI A;  4GGL A;  4W7T A;  4MOT A;  3VHD A;  2YEJ A;  4NH9 A;  3HZ5 A;  2QF6 A;  1US7 A;  1ZXM A;  4FMT A;  4HZ0 A;  2IOR A;  2WER A;  2WI1 A;  4ZVI A;  4CWP A;  2WI5 A;  3EHJ A;  5M4P A;  5D6P A;  4EGK A;  4XE2 A;  2ESA A;  3INX A;  2IOP A;  2XHX A;  4BIZ A;  1Y8O A;  3RLR A;  1Y8P A;  4V26 A;  3R4O A;  4XKA A;  2VWC A;  3G75 A;  2GQP A;  4URO A;  1A4H A;  3GIE A;  3TTZ A;  1TIL A;  3B28 A;  2WEQ A;  4AWO A;  3WHA A;  1UYG A;  4KSG A;  2ZDY A;  4L94 A;  1AMW A;  4WUD A;  2BU5 A;  2BU2 A;  1I5A A;  4H81 A;  4WUC A;  2CCT A;  5M4H A;  2BRC A;  2QG0 A;  4CWQ A;  2VCJ A;  3JZ3 A;  4YKQ A;  2YE6 A;  4PL9 A;  2O1U A;  4MP7 A;  4BQG A;  3ZXQ A;  4X9L A;  1UYM A;  1UYD A;  2WI4 A;  4DZY A;  2CH4 A;  2YEH A;  4XC0 A;  3B25 A;  1UYC A;  5CTW A;  2Q8F A;  3R4N A;  3G7E A;  1YSZ A;  3INW A;  2WI7 A;  3EKO A;  5IDM A;  2XX4 A;  5BOD A;  1YT2 A;  3GIG A;  2VW5 A;  2CCU A;  2XDX A;  3R4M A;  4GEE A;  1B63 A;  1B3Q A;  1I5B A;  4L90 A;  2ZDX A;  1JM6 A;  3Q5L A;  2YEC A;  4MP2 A;  1YET A;  5IN9 A;  2YGA A;  3CGZ A;  3FT8 A;  3OWB A;  4LPB A;  4MB9 A;  2AKP A;  3TZ4 A;  1BXD A;  1I5D A;  3H4L A;  4HXW A;  4MPC A;  4CWT A;  4XIT A;  2JJC A;  2BYH A;  4U93 A;  5IDJ A;  4BAE A;  2FWY A;  3VHA A;  4EFT A;  4P8O A;  3B27 A;  5BOC A;  3LNU A;  1YC3 A;  3A0Y A;  2GFD A;  2XDS A;  3EHF A;  5FNF A;  2XJJ A;  1MX0 A;  3BMY A;  3ZKD A;  4YKT A;  1YT0 A;  1MU5 A;  3GIF A;  1TBW A;  1YES A;  4NH7 A;  5M4E A;  3CWV A;  3EHG A;  3SL2 A;  3CRK A;  3VAD A;  4XD8 A;  4P7A A;  3EHH A;  2XJG A;  1UYF A;  4I3H A;  4KFG A;  3CGY A;  4I5S A;  4O05 A;  3IED A;  5CTU A;  3R4P A;  1UYE A;  3G7B A;  4B7P A;  3RLQ A;  2Q2E B;  4XIP A;  2XD6 A;  4HZ5 A;  1EI1 A;  4CWO A;  3D0B A;  1GKX A;  2YEA A;  3HYZ A;  5M4K A;  4XKO A;  1TH8 A;  2BTZ A;  3WQ9 A;  5F3K A;  2BRE A;  2K5B A;  2YI5 A;  2IOQ A;  2BU8 A;  3OWD A;  2PNR A;  5FNC A;  4LWE A;  1H7S A;  4YKR A;  4CE2 A;  4QPJ A;  3TZ5 A;  1B62 A;  1S14 A;  4WUB A;  5CF0 A;  4U7O A;  4PRV A;  1OSF A;  2QG2 A;  1Z5A A;  3QTF A;  2FXS A;  2YE3 A;  5D6Q A;  1UY8 A;  3HHU A;  3T10 A;  3B26 A;  3D2R A;  2BU7 A;  2YEG A;  3OW6 A;  1THN A;  2BYI A;  1TC6 A;  1KIJ A;  5FND A;  4E00 A;  4BIU A;  1GKZ A;  3O2F A;  4LP0 A;  5J6A A;  5CTY A;  2HCH A;  2Q8H A;  2YEB A;  2YKC A;  2YE5 A;  4FCR A;  1Z5B A;  2YGE A;  3R91 A;  5L3J A;  4CWR A;  4ASG A;  1TID A;  2IWS A;  2HKJ A;  4KQV A;  2QFO A;  4EFU A;  4JQL A;  2YI7 A;  1QZR A;  4YKW A;  3K60 A;  2FWZ A;  2WI2 A;  3NMQ A;  4PRX A;  4MBC A;  3A0R A;  4L91 A;  2YK2 A;  4EMV A;  4JAU A;  2IWU A;  3DGE A;  3PEJ A;  3KE6 A;  2H8M A;  3D36 A;  4YKU A;  4H7Q A;  1AH6 A;  4MPE A;  2XHR A;  1QY8 A;  3T0Z A;  4XCJ A;  1Z5C A;  1ZWH A;  5D7C A;  1TC0 A;  1YER A;  1I5C A;  3TUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...