3LNUA

Crystal structure of pare subunit
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
364
structure length
344
Chain Sequence
GLDPVKRRPGMYTDTARPNHLAQEVIDNSVDEALAGHAKQIEVTLYKDGSCEVSDDGRGMPVDIHPEEKIPGVELILTRLGVSVVNALSTKVELFIKREGSEHRMEFRDGNAASKLEVVGTVGKKNTGTRLRFWADPKYFDTPKFNVRALRHLLRAKAVLCPGLTVKLHDEATGEQDSWYFENGLRDYLKGEMAEHEMLPADLFVGSLKKDTEIVDWAAGWVPEGELVQESYVNLIPTAQHGTHVNGLRSGLTDALREFCDFRNLLPRGVKLAPEDVWDRVTFVLSLKMTDPQFSGQTKERLSSRQAAGFIEGAAHDAFSLYLNQNVEIGEKIAQIAIDRASAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Topoisomerase IV subunit B
publication title Crystal structure of ParE subunit
rcsb
source organism Xanthomonas oryzae pv. oryzae
total genus 108
structure length 344
sequence length 364
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2010-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3lnuA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3lnuA01
2XDLA 4AWOA 2CCSA 3O2FA 2ZDYA 3R91A 1U0ZA 2BU7A 4P7AA 3O0IA 4RPFA 2VWCA 4URLA 1VISA 1XMQE 4YKYA 2UUAI 2GFDA 1Z5CA 3K99A 4Z7YA 2GQPA 1FKAE 3TZ4A 1I58A 1AMWA 3ZKBA 1UY9A 2YE4A 2YEEA 1AH6A 4NXMI 4B3RE 4JI4I 3R4OA 3TZ0A 2OI2A 2XHTA 2FWZA 4URNA 4YKUA 1J5EE 4LF8I 5IT9Q 3D2RA 4LFCE 1L0OA 1PVGA 1NZ0A 5C93A 3EHFA 4JI1I 2XD6A 4W7TA 1TILA 5F5RA 1NHHA 4X65I 3PYFA 5LMNE 4CE1A 1XNQI 1OSFA 2E5LI 4LF6I 2YE6A 4DV0I 2UXCE 4KFGA 2V8PA 2ZM6E 4K0KI 1AM1A 4DPXA 2YKIA 3NMQA 5D7DA 1FJGI 1EI1A 1UYHA 2HFSA 1THNA 5D6PA 2HFUA 1BYQA 4DPYA 1BXDA 2FXSA 1UY7A 1BKNA 3ZXOA 2XX4A 1XMOE 2UUCI 4DXLA 2YEIA 4CWQA 3C11A 5CTWA 4R3MA 5FWKA 5LL6R 4DR7I 1AJ6A 4XKOA 1AH8A 1Y8NA 4CWRA 4FMTA 4O0BA 3T10A 2O1VA 4JI6E 3RLPA 4X66E 3VHDA 5FLXQ 4YKWA 4KHPI 4LF9E 3J81C 4DPUA 1IBKI 1N32I 4XKAA 4CWOA 1XNRE 1KTVA 4AQYI 4YHHE 4LF4E 3HZ1A 1YS3A 2VCIA 5CPHA 4JI2I 4DUYE 4GKKI 3T0ZA 5FNDA 1YSRA 1HNZI 3J7AM 2QFOA 1UYEA 4V25A 3G7BA 2R3VA 2YE8A 4Z7CA 4YY3I 3EHJA 1I5AA 3OWDA 1R62A 1MX0A 2IWXA 4KTNA 4P8OA 1XHKA 3HZ5A 5L3JA 4FWDA 1NHIA 4UTGA 4B3SI 2NPFA 1UYCA 2BU8A 2XX5A 4GQTA 4E00A 2YGEA 4FW9A 4KSHA 4USKA 4DUZI 3RLRA 4NH9A 1HNXI 4JI0E 2BU5A 2WEQA 2YEGA 2ZKJA 2E1RA 3ZKDA 2VW5A 4ED4A 3VHCA 3WQ9A 4WUDA 4DR1E 2Q8IA 1HNWE 4XIRA 5BR8I 4JAUA 2UXDE 2YE9A 5BOCA 4M1KA 4GGLA 4HYPA 4X62I 4JI7I 1TC0A 4DUHA 4FCPA 3A0TA 4LWGA 4LP0A 2CCUA 1Z0TA 4BIUA 4CWFA 2F4VE 2V34A 1ZWHA 1PIEA 1FNMA 2CGFA 2XEXA 4XE2A 4U7NA 4DV7E 4GT8A 3A0XA 2QG0A 1QZRA 5D7CA 1ZM9A 4MB9A 2YKCA 4DV2I 4PU9A 4JYAE 4JV5I 1N33I 1ZW9A 2UUBE 1UY6A 1YETA 4CWTA 2HCHA 4JI8E 2DEIA 5J6AA 4MP2A 4MBCA 5IWAE 3EKRA 3A0RA 1I5CA 2YI6A 1KVKA 2UWDA 2XHRA 4K4OA 4XD8A 4EFUA 3B8HA 4X64I 4B3ME 2Q8FA 5A2QQ 3K98A 4DV5E 2BREA 3PYGA 4DR4E 4EMVA 1KKHA 1FI4A 2WI1A 4XCJA 4HACB 4BIZA 4JI5E 5M4NA 4DV1I 4OX9E 2WI5A 4DV3I 3CRLA 1IBMI 4AS9A 1JM6A 1WUUA 2WEPA 4DU8A 4EGIA 4QPJA 3B25A 2A2DA 4LF7E 4LF5E 4PL9A 3PEHA 4DV6I 2BZ5A 1ID0A 1B62A 4L94A 4HY1A 4V26A 1I94I 3R92A 2V2ZA 2ZITA 3OTOE 1N36I 2O1UA 4LWFA 3HYZA 3JAMC 2EXLA 1H73A 4WUCA 2YEFA 4O07A 4ZVIA 4YKRA 3WHAA 5M4PA 4DR3I 3MNRP 2XK2A 5FNCA 3B26A 3BMYA 1DARA 1UYLA 2Q2EB 1US7A 2YI0A 4LFCI 2E0AA 3CGYA 2UUAE 1YT2A 1Z5BA 5IDMA 4GKJI 4DU7A 2PNRA 1QY8A 1YC4A 4MYUA 2H8MA 2IWUA 4NXME 4DR5I 2YI5A 2YI7A 4DV4I 4R3AA 4XC0A 2UXCI 2QG2A 3T1YI 2ZM6I 3A0YA 5LMUE 4NH8A 4EM7A 4LF8E 1UYFA 4B7PA 4LFAE 2JKIA 4NXNE 3V5RA 3TTZA 4L93A 3F0NA 5GGZA 2VQEI 3JZ3A 2AJ4A 3VHAA 1QYEA 4MOTA 3GIGA 4X65E 4CWPA 1B63A 3C0EA 4U7OA 1Z59A 2E5LE 5IT9C 4LF6E 2A2CA 4LWHA 4K0KE 3O6OA 2YEHA 4EMDA 1YT1A 4JI6I 4HXZA 1FJGE 4LFBI 1GKXA 3WU4A 2K5BA 5GMDA 2HKEA 3ZZUA 1A4HA 1N0UA 1Y8PA 1ZM2A 2H55A 4LF4I 3QT8A 2J7KA 4XDMA 4DUYI 2UUCE 5M4HA 4NH7A 1TH8A 4I5SA 5M4EA 3HHUA 2VF3A 2XDSA 3IEDA 4LPBA 4MYTA 4HZ5A 2HG1A 3OPDA 2HHHE 2YE2A 4KHPE 2BYHA 3PYEA 4AWPA 1IBKE 1N32E 4DR2I 2BU6A 4XIQA 4JI2E 2FYPA 4E02A 4O09A 1HNZE 3Q1QA 5FLXC 4FCQA 4YKQA 1KZNA 2Q8HA 4B3TI 3B28A 1ELOA 4YY3E 2YEAA 3A0ZA 5F3KA 1IBLI 2XDUA 3QDDA 1RR9A 1UYKA 3J80Q 3SL2A 1Z0EA 2YKJA 3HULA 4ASAA 1FWLA 3HEKA 1UEKA 3TUHA 4JI3I 3T1HI 1I5DA 4B3SE 2YK2A 1KIJA 3OWBA 4BAEA 2BSMA 4DUZE 3WU5A 4H7QA 1HNXE 5CTXA 3WU6A 3WU3A 4YKXA 3ZZTA 2QF6A 2HKJA 2X36A 2R42A 4DPTA 3B78A 5BR8E 5IN9A 4KQVA 2C2AA 3RKZA 4JYAI 4CE3A 4X62E 3EHHA 4JI7E 1ZXNA 2VQFE 4XITA 2UUBI 1ZXMA 3QT7A 3LTOA 5CF0A 2EFGA 4P52A 1UYDA 3GIEA 3ZXQA 2V2QA 4Q20A 4KP4A 4I3HA 1BGQA 1N0VC 1Z0VA 2UU9I 3CRKA 4CWSA 4O05A 3BM9A 2LJPA 2AKPA 4JV5E 1N33E 4O04A 1HR0E 4MPCA 1N34E 1UYGA 2UXBI 3GONA 2JJCA 2XCMA 3INXA 1S4EA 3T2SA 3R4PA 4FWGA 2YJXA 3U2KA 2XJGA 4X64E 2YE5A 4YKZA 4LF7I 2WI3A 2YECA 1XMQI 5CTUA 3HYYA 1MG7A 1TBWA 3D4JA 1Y8OA 4XIPA 4KSGA 5CTYA 4DR6E 4MPEA 3QT6A 1YSZA 5D6QA 5FNFA 4DV1E 2ZDXA 4B3RI 3PYDA 3U67A 2WERA 1H72C 4DV3E 1MU5A 3G7EA 2BYIA 1IBME 3FT8A 5A2QC 5M4MA 1PKPA 4FPPA 1J5EI 5D7RA 1RREA 1UYIA 3OMUA 4JG4A 2YJWA 1EA6A 2BV3A 2HK2A 4DV6E 4EFTA 1K47A 1YESA 3OW6A 3U2DA 1I94E 3TZ2A 5LMNI 1U2OA 3D36A 1N36E 4LWIA 2GS8A 2DEJA 4JI4E 4DPWA 1Z0CA 3ZM7A 4LWEA 4DR3E 1B3QA 4PRXA 2XABA 5LMUI 4MPNA 2CZ9A 4JI1E 4LFAI 2XHXA 4NXNI 1Y4SA 3J7AG 1FWKA 5IDJA 3Q5JA 2WI4A 4GKJE 4JASA 1XNQE 4HYMA 1XMOI 3LPSA 3J81Q 2X7IA 4DV0E 2YEBA 1S16A 4DR5E 4R1FA 4DV4E 3T1YE 1I5BA 3ZZ0A 1ZM4A 2FWYA 4X66I 4USMA 2CH4A 2XJXA 2YK9A 3K1JA 4L91A 4X9LA 4XCLA 1Z0BA 4LF9I 4BQGA 2BM0A 4YKTA 1H7UA 2BM1A 3K17A 1XNRI 4L8ZA 4YHHI 2YEJA 4XTJA 2VQEE 2YE7A 1A6FA 1GKZA 4EEHA 3KE6A 4DR7E 4EGHA 1UYMA 3QT5A 1I59A 2O1WA 1Y4UA 4GEEA 2YKBA 2IOQA 2BRCA 3G75A 4LFBE 3PEJA 2HHHI 4B6CA 4CWNA 3EKOA 4BXIA 4AQYE 2WI2A 4ASGA 3R4NA 1H7SA 2HK3A 4GKKE 1H74A 4URMA 1Z0GA 4HZ0A 4JI0I 4MP7A 4EGKA 3TZ5A 1Z5AA 4HACA 3D0BA 4DR1I 1HNWI 4ASFA 3RLQA 4XKKA 2YEDA 1D6TA 2UXDI 5BODA 1ZM3A 1Z0WA 3CWVA 4JQLA 3VADA 1YT0A 4DR2E 2WW4A 1GJVA 5M4KA 1YC1A 2V2VA 1YERA 2F4VI 5GMEA 4H85A 3EHGA 2XJJA 2Q8GA 1TIDA 4B3TE 4FCRA 4DV7I 3Q5LA 3GIGB 3K97A 1IBLE 3GIFA 3A0WA 3FT5A 3QTFA 1NHJA 2IOPA 2XDXA 1UY8A 2IWSA 4JI3E 3T1HE 3INWA 4FWHA 4JI8I 3B82A 4AWQA 2VQFI 4QPKA 5IWAI 2YGAA 4HXWA 4ASBA 3J80C 3B24A 3Q5KA 2IORA 4DZYA 4B3MI 2WI7A 3H80A 4L90A 1U2RA 4DV2E 3K60A 4CE2A 1OJ4A 4DV5I 3DGEA 2WI6A 4DR4I 4JI5I 2BT0A 2BTZA 4OX9I 1HR0I 2BU2A 3CGZA 1S14A 1N34I 3FV5A 1YC3A 2CG9A 2XX2A 4H81A 3M6AA 2CCTA 4WUBA 3T0HA 4LF5I 4GCZA 4PRVA 3JAMQ 4UROA 3V2UC 4FN5A 4JAVA 4U93A 2UU9E 3R4MA 3LNUA 2YE3A 4BQJA 2YKEA 2VCJA 3H4LA 4UT4A 1TC6A 4GFNA 3B27A 4E01A 3T1KA 3OTOI 4DR6I 2YGFA 4ZKIA 2ZBKB 4HY6A 5J71A 2ESAA 2XDKA 2UXBE
chains in the Genus database with same CATH superfamily
3DD6A 5K36D 2XDLA 4AWOA 3P3CA 5K36A 2CCSA 3O2FA 2ZDYA 3R91A 1U0ZA 2BU7A 4P7AA 3O0IA 4RPFA 2VWCA 3H1CA 4URLA 1VISA 2CVEA 1XMQE 2UUAI 4YKYA 2GFDA 1Z5CA 3K99A 4Z7YA 4AIMA 2GQPA 1FKAE 3TZ4A 1I58A 1AMWA 3ZKBA 1UY9A 2YE4A 2YEEA 1AH6A 4NXMI 4B3RE 4JI4I 4IFDE 3R4OA 3TZ0A 2OI2A 5DNXA 2XHTA 2FWZA 3M85G 4URNA 4YKUA 1J5EE 1F51A 4LF8I 5IT9Q 3D2RA 4LFCE 1L0OA 1PVGA 1NZ0A 5C93A 3EHFA 2NN6E 4JI1I 2XD6A 2PNZB 4W7TA 1TILA 2PNLA 5F5RA 1NHHA 4X65I 3PYFA 5LMNE 3GMEA 4CE1A 1XNQI 1OSFA 2E5LI 4LF6I 2YE6A 4IZJA 4DV0I 2UXCE 4KFGA 2V8PA 2ZM6E 4K0KI 1AM1A 4DPXA 2YKIA 5C0XF 3NMQA 5D7DA 1FJGI 1EI1A 1UYHA 4MU1A 2HFSA 1THNA 5D6PA 3PS2A 2HFUA 1BYQA 4DPYA 1BXDA 4LCHA 2FXSA 1UY7A 1BKNA 3ZXOA 2XX4A 1XMOE 2UUCI 4DXLA 2YEIA 4CWQA 3C11A 5CTWA 4R3MA 1P42A 5FWKA 5LL6R 4DR7I 1AJ6A 4XKOA 1AH8A 1Y8NA 2PO1B 4J3DA 4FMTA 4O0BA 4CWRA 3T10A 2O1VA 3U1YA 4JI6E 3RLPA 4X66E 3VHDA 5FLXQ 4YKWA 4KHPI 4LF9E 5JEAF 3J81C 4DPUA 1IBKI 1N32I 5K36F 4XKAA 1XNRE 4CWOA 1KTVA 4AQYI 4YHHE 2AE8A 4LF4E 3HZ1A 1YS3A 2VCIA 3M85D 4JI2I 4DUYE 4GKKI 5CPHA 3T0ZA 5FNDA 1YSRA 4MU4A 4LCFA 1HNZI 3J7AM 2QFOA 1UYEA 5DRQA 4V25A 1OYSA 3G7BA 2R3VA 2YE8A 4Z7CA 4YY3I 3EHJA 1I5AA 3OWDA 4IS9A 1R62A 1R6MA 4IZKA 1MX0A 2IWXA 4KTNA 4OO1E 4P8OA 1XHKA 3HZ5A 5L3JA 4FWDA 1RHYA 1NHIA 4UTGA 2NPFA 4B3SI 1E3HA 3Q6MA 1UYCA 2BU8A 2XX5A 4GQTA 4E00A 2YGEA 4U3DA 4FW9A 4KSHA 4USKA 4DUZI 3RLRA 4NH9A 1HNXI 4JI0E 2BU5A 2WEQA 2YEGA 2ZKJA 2E1RA 2JE6A 4GQUA 3ZKDA 2VW5A 4MU0A 4ED4A 3VHCA 3WQ9A 4WUDA 4DR1E 2Q8IA 1HNWE 4LCGA 4XIRA 5BR8I 4JAUA 2UXDE 2YE9A 5BOCA 4M1KA 4GGLA 4HYPA 4LPFA 4X62I 4JI7I 2Z5EA 1TC0A 4DUHA 2JEBB 4FCPA 3A0TA 4LWGA 2C1IA 2CCUA 4LP0A 1Z0TA 4BIUA 4CWFA 2F4VE 2V34A 1ZWHA 1PIEA 1FNMA 3CYGA 2CGFA 2XEXA 3U1KA 3P3EA 4XE2A 2Z5BB 4U7NA 4DV7E 4IFDC 4GT8A 3A0XA 2CGEA 2QG0A 1QZRA 5D7CA 1ZM9A 4MB9A 2YKCA 4FW3A 4DV2I 1XXEA 4PU9A 4JYAE 5C0XA 4JV5I 2NN6C 1N33I 1ZW9A 2UUBE 1UY6A 1YETA 4CWTA 2HCHA 4JI8E 2DEIA 1USUA 4MP2A 2C39B 5J6AA 4MBCA 5IWAE 3EKRA 3A0RA 1I5CA 2PNZA 2YI6A 1KVKA 2UWDA 2XHRA 4K4OA 4XD8A 4EFUA 3B8HA 4X64I 4B3ME 2Q8FA 4BA2A 5A2QQ 3K98A 4DV5E 2WP8B 2BREA 3PYGA 4DR4E 4EMVA 1KKHA 2C37B 4IFDB 1FI4A 2WI1A 4XCJA 4HACB 4BIZA 4JI5E 2JT2A 2C1GA 4DV1I 4OX9E 5M4NA 5JEAA 1YHCA 2WI5A 4DV3I 3CRLA 1IBMI 4AS9A 1JM6A 1WUUA 2PNMA 2WNRB 2NN6B 4DU8A 2Z5CB 2WEPA 4QPJA 3B25A 4EGIA 2A2DA 2C38B 3HKMA 4LF5E 4LF7E 3PEHA 4PL9A 4DV6I 2BZ5A 1ID0A 1B62A 4L94A 5DROA 4HY1A 4V26A 1I94I 2PO1A 3L7ZB 3R92A 2V2ZA 2ZITA 3OTOE 2O1UA 1N36I 4LWFA 3HYZA 3JAMC 2EXLA 1H73A 4WUCA 2YEFA 4O07A 4ZVIA 4YKRA 3WHAA 5M4PA 4DR3I 3MNRP 2XK2A 5FNCA 3B26A 3BMYA 1DARA 1UYLA 2Q2EB 1US7A 2YI0A 4LFCI 2E0AA 2BA0G 3CGYA 2UUAE 1YT2A 1OYRA 1Z5BA 5IDMA 1R6LA 4GKJI 4DU7A 2BA1G 2PNRA 1QY8A 1YC4A 4FW5A 4MU3A 4MYUA 4NBQA 2H8MA 4NXME 4DR5I 2IWUA 2YI5A 2YI7A 4DV4I 4R3AA 4XC0A 2UXCI 2QG2A 3T1YI 2ZM6I 3A0YA 2JEAB 5LMUE 4NH8A 4EM7A 4LF8E 1UYFA 4B7PA 4LFAE 2JKIA 4NXNE 3V5RA 3TTZA 3PS1A 4L93A 3F0NA 5GGZA 2VQEI 3JZ3A 2AJ4A 3VHAA 1QYEA 4MOTA 3GIGA 4X65E 4CWPA 4AIDA 1B63A 3C0EA 4U7OA 1Z59A 2E5LE 5IT9C 4LF6E 2A2CA 4LWHA 2PO2A 4K0KE 3O6OA 2YEHA 4EMDA 3Q6NA 1YT1A 2GO3A 4HXZA 4JI6I 1FJGE 4LFBI 1GKXA 3WU4A 2K5BA 3M7NG 5GMDA 2HKEA 3ZZUA 1A4HA 1N0UA 5C0XE 1Y8PA 1ZM2A 5EKWA 2H55A 1UDSA 4LF4I 3QT8A 3LMMA 2J7KA 2IESA 5EL9A 4XDMA 4DUYI 2UUCE 5M4HA 4NH7A 1TH8A 1VI7A 4I5SA 5M4EA 3HHUA 2VF3A 2XDSA 3IEDA 4LPBA 2PO0A 4MYTA 4HZ5A 2BA1D 2HG1A 3OPDA 2HHHE 2YE2A 4KHPE 2BYHA 3PYEA 4AWPA 1IBKE 1N32E 4DR2I 4QNJA 2BU6A 4XIQA 5JEAE 4JI2E 2FYPA 4E02A 5K36E 4O09A 1HNZE 1Y60A 5FLXC 3Q1QA 4FCQA 4YKQA 1KZNA 2Q8HA 4B3TI 3B28A 1ELOA 4YY3E 4IFDD 2YEAA 3A0ZA 5F3KA 1IBLI 1USVA 2XDUA 3QDDA 1RR9A 1UYKA 3J80Q 3SL2A 4IZJB 1Z0EA 4N3OA 3HULA 2YKJA 4ASAA 1FWLA 3KRNA 3HEKA 1UEKA 3TUHA 4JI3I 2NN6D 3T1HI 4B3SE 2WNRA 1I5DA 2NN6A 2YK2A 1KIJA 3OWBA 4BAEA 2J65A 2BSMA 2C38A 5DRPA 4DUZE 3WU5A 4H7QA 1HNXE 5CTXA 3WU6A 3WU3A 4YKXA 3ZZTA 4LOMA 2QF6A 2HKJA 2X36A 3L7ZA 2R42A 4DPTA 3B78A 5BR8E 5IN9A 4KQVA 2C2AA 5JENA 3RKZA 4JYAI 4CE3A 4X62E 3EHHA 4JI7E 1ZXNA 2VQFE 4XITA 2UUBI 1ZXMA 3QT7A 3LTOA 5CF0A 2EFGA 4P52A 1UYDA 1IXMA 3GIEA 3ZXQA 2V2QA 4Q20A 4KP4A 4I3HA 1BGQA 1N0VC 2GO4A 1Z0VA 4ISAA 2UU9I 3CRKA 3PRYA 4CWSA 4O05A 3BM9A 2LJPA 4QNKA 2AKPA 4JV5E 1N33E 4O04A 1HR0E 4IZKB 4MPCA 1N34E 1UYGA 1UDNA 2UXBI 2BR2B 2O3ZA 4AM3A 3GONA 2JJCA 3NZKA 2XCMA 3INXA 3P06A 1S4EA 3T2SA 3R4PA 4FWGA 2YJXA 3P76A 3U2KA 2VESA 2XJGA 4X64E 2YE5A 4YKZA 4LF7I 2WI3A 2YECA 1XMQI 5CTUA 3PS3A 3HYYA 1MG7A 1TBWA 3D4JA 3B4TA 1Y8OA 4XIPA 3S5TA 4FW4A 4KSGA 5CTYA 3CDIA 4FW7A 3QT6A 5C0XC 4DR6E 4IFDF 1YSZA 4MPEA 5D6QA 5FNFA 4DV1E 2ZDXA 4B3RI 3PYDA 3U67A 2WERA 1H72C 4DV3E 1MU5A 3G7EA 2BYIA 5DNLA 1IBME 3FT8A 3CDJA 5A2QC 5M4MA 1PKPA 2HHIA 4FPPA 2NN6F 1J5EI 5D7RA 1RREA 1UYIA 3OMUA 4JG4A 2YJWA 1EA6A 2BV3A 2HK2A 4DV6E 4EFTA 1K47A 4OO1C 2F1DA 1YESA 3OW6A 1Y5YA 3U2DA 1I94E 3TZ2A 5LMNI 1U2OA 3D36A 1N36E 2GQ0A 4LWIA 5JEAC 2GS8A 2DEJA 4JI4E 4DPWA 1Z0CA 5K36C 3ZM7A 4LWEA 4BA1B 4DR3E 5C0XB 1B3QA 4PRXA 2XABA 5LMUI 4MPNA 2CZ9A 4JI1E 4LFAI 2XHXA 4NXNI 1Y4SA 3GLLA 3J7AG 1FWKA 5IDJA 3Q5JA 1UDQA 4GKJE 2WI4A 4JASA 1XNQE 4HYMA 1XMOI 3LPSA 3J81Q 2X7IA 4DV0E 4BA2B 2YEBA 1S16A 4IZJD 4DR5E 4OO1B 4R1FA 4DV4E 3T1YE 1I5BA 3ZZ0A 1HK7A 1ZM4A 2FWYA 2JEBA 4USMA 4X66I 2CH4A 4MDTA 3K1JA 5ELWA 2XJXA 2YK9A 1Z0BA 4L91A 4X9LA 5JEAB 4LF9I 4XCLA 4BQGA 2BM0A 4YKTA 1H7UA 2BM1A 5K36B 3K17A 1XNRI 4L8ZA 4YHHI 2YEJA 4XTJA 2VQEE 2Z5BA 2YE7A 1A6FA 1E3PA 1GKZA 2BA0D 4EEHA 3KE6A 4DR7E 4EGHA 1UYMA 4U3BA 3QT5A 1I59A 2O1WA 4OO1F 1Y4UA 4GEEA 2YKBA 2IOQA 1Y6ZA 2BRCA 3G75A 2C39A 4LFBE 3PEJA 2HHHI 4B6CA 4CWNA 3EKOA 4BXIA 4AQYE 1OYPA 2WI2A 4ASGA 3R4NA 1H7SA 2HK3A 4GKKE 1H74A 4MQYA 4URMA 1Z0GA 4HZ0A 4JI0I 4MP7A 2WP8A 4EGKA 3TZ5A 3K85A 2C37A 4IFDA 1Z5AA 4HACA 3D0BA 4DR1I 1HNWI 4ASFA 3RLQA 4XKKA 2YEDA 1D6TA 2UXDI 1YH8A 5BODA 1ZM3A 1Z0WA 3CWVA 2BR2A 2IERA 4JQLA 3VADA 2Z5CA 1YT0A 4DR2E 2WW4A 1GJVA 5M4KA 1YC1A 2V2VA 3UHMA 1YERA 3M7ND 2F4VI 5GMEA 4H85A 3EHGA 1UDOA 2XJJA 2Q8GA 1TIDA 4B3TE 4E72A 4FCRA 4DV7I 3Q5LA 3GIGB 3K97A 1IBLE 3GIFA 3A0WA 3FT5A 3QTFA 1NHJA 2IOPA 3P3GA 2PO2B 2XDXA 1UY8A 2IWSA 4JI3E 3T1HE 3INWA 2FTKA 4FWHA 4JI8I 3B82A 4AWQA 2VQFI 4QPKA 5IWAI 2YGAA 4HXWA 4ASBA 3J80C 3B24A 3Q5KA 2IORA 4DZYA 4B3MI 2WI7A 3H80A 4L90A 4OZEA 4OKGA 1U2RA 4DV2E 3K60A 4CE2A 1OJ4A 4DV5I 3DGEA 2WI6A 4DR4I 2JEAA 2PO0B 5C0XD 2O1TA 4BA1A 4JI5I 4OX9I 2BT0A 2BTZA 1HR0I 2BU2A 4FW6A 1S14A 1N34I 3CGZA 3FV5A 2CG9A 1YC3A 2XX2A 4H81A 3M6AA 2CCTA 4WUBA 3T0HA 4LF5I 3GCMA 4GCZA 4PRVA 3JAMQ 4UROA 3V2UC 4FN5A 4JAVA 4U93A 2UU9E 3R4MA 3LNUA 2YE3A 4BQJA 3HJCA 2JE6B 4OO1D 2YKEA 4OO1A 2VCJA 3H4LA 4UT4A 5DRRA 1TC6A 4GFNA 3B27A 4E01A 3T1KA 3OTOI 4DR6I 2YGFA 4ZKIA 2ZBKB 4HY6A 5J71A 2ESAA 5JEAD 2XDKA 2UXBE
chains in the Genus database with same CATH topology
2XDLA 4AWOA 2CCSA 3O2FA 2ZDYA 3R91A 1U0ZA 2BU7A 4P7AA 3O0IA 4RPFA 2VWCA 4URLA 1VISA 1XMQE 4YKYA 2UUAI 2GFDA 1Z5CA 3K99A 4Z7YA 2GQPA 1FKAE 3TZ4A 1I58A 1AMWA 3ZKBA 1UY9A 2YE4A 2YEEA 1AH6A 4NXMI 4B3RE 4JI4I 3R4OA 3TZ0A 2OI2A 2XHTA 2FWZA 4URNA 4YKUA 1J5EE 4LF8I 5IT9Q 3D2RA 4LFCE 1L0OA 1PVGA 1NZ0A 5C93A 3EHFA 4JI1I 2XD6A 4W7TA 1TILA 2PNLA 5F5RA 1NHHA 4X65I 3PYFA 5LMNE 4CE1A 1XNQI 1OSFA 2E5LI 4LF6I 2YE6A 4IZJA 4DV0I 2UXCE 4KFGA 2V8PA 2ZM6E 4K0KI 1AM1A 4DPXA 2YKIA 3NMQA 5D7DA 1FJGI 1EI1A 1UYHA 2HFSA 1THNA 5D6PA 2HFUA 1BYQA 4DPYA 1BXDA 2FXSA 1UY7A 1BKNA 3ZXOA 2XX4A 1XMOE 2UUCI 4DXLA 2YEIA 4CWQA 3C11A 5CTWA 4R3MA 5FWKA 5LL6R 4DR7I 1AJ6A 4XKOA 1AH8A 1Y8NA 4CWRA 4FMTA 4O0BA 3T10A 2O1VA 4JI6E 3RLPA 4X66E 3VHDA 5FLXQ 4YKWA 4KHPI 4LF9E 3J81C 4DPUA 1IBKI 1N32I 4XKAA 4CWOA 1XNRE 1KTVA 4AQYI 4YHHE 4LF4E 3HZ1A 1YS3A 2VCIA 5CPHA 4JI2I 4DUYE 4GKKI 3T0ZA 5FNDA 1YSRA 1HNZI 3J7AM 2QFOA 1UYEA 4V25A 3G7BA 2R3VA 2YE8A 4Z7CA 4YY3I 3EHJA 1I5AA 3OWDA 1R62A 4IZKA 1MX0A 2IWXA 4KTNA 4P8OA 1XHKA 3HZ5A 5L3JA 4FWDA 1NHIA 4UTGA 2NPFA 4B3SI 3Q6MA 1UYCA 2BU8A 2XX5A 4GQTA 4E00A 2YGEA 4FW9A 4KSHA 4USKA 4DUZI 3RLRA 4NH9A 1HNXI 4JI0E 2BU5A 2WEQA 2YEGA 2ZKJA 2E1RA 3ZKDA 2VW5A 4ED4A 3VHCA 3WQ9A 4WUDA 4DR1E 2Q8IA 1HNWE 4XIRA 5BR8I 4JAUA 2UXDE 2YE9A 5BOCA 4M1KA 4GGLA 4HYPA 4X62I 4JI7I 2Z5EA 1TC0A 4DUHA 4FCPA 3A0TA 4LWGA 4LP0A 2CCUA 1Z0TA 4BIUA 4CWFA 2F4VE 2V34A 1ZWHA 1PIEA 1FNMA 2CGFA 2XEXA 4XE2A 2Z5BB 4U7NA 4DV7E 4GT8A 3A0XA 2CGEA 2QG0A 1QZRA 5D7CA 1ZM9A 4MB9A 2YKCA 4DV2I 4PU9A 4JYAE 4JV5I 1N33I 1ZW9A 2UUBE 1UY6A 1YETA 4CWTA 2HCHA 4JI8E 2DEIA 1USUA 4MP2A 5J6AA 4MBCA 5IWAE 3EKRA 3A0RA 1I5CA 2YI6A 1KVKA 2UWDA 2XHRA 4K4OA 4XD8A 4EFUA 3B8HA 4X64I 4B3ME 2Q8FA 5A2QQ 3K98A 4DV5E 2BREA 3PYGA 4DR4E 4EMVA 1KKHA 1FI4A 2WI1A 4XCJA 4HACB 4BIZA 4JI5E 5M4NA 4DV1I 4OX9E 2WI5A 4DV3I 3CRLA 1IBMI 4AS9A 1JM6A 1WUUA 2PNMA 2WEPA 4DU8A 2Z5CB 4EGIA 4QPJA 3B25A 2A2DA 4LF7E 4LF5E 4PL9A 3PEHA 4DV6I 2BZ5A 1ID0A 1B62A 4L94A 4HY1A 4V26A 1I94I 3R92A 2V2ZA 2ZITA 3OTOE 2O1UA 1N36I 4LWFA 3HYZA 3JAMC 2EXLA 1H73A 4WUCA 2YEFA 4O07A 4ZVIA 4YKRA 3WHAA 5M4PA 4DR3I 3MNRP 2XK2A 5FNCA 3B26A 3BMYA 1DARA 1UYLA 2Q2EB 1US7A 2YI0A 4LFCI 2E0AA 3CGYA 2UUAE 1YT2A 1Z5BA 5IDMA 4GKJI 4DU7A 2PNRA 1QY8A 1YC4A 4MYUA 2H8MA 2IWUA 4NXME 4DR5I 2YI5A 2YI7A 4DV4I 4R3AA 4XC0A 2UXCI 2QG2A 3T1YI 2ZM6I 3A0YA 5LMUE 4NH8A 4EM7A 4LF8E 1UYFA 4B7PA 4LFAE 2JKIA 4NXNE 3V5RA 3TTZA 4L93A 3F0NA 5GGZA 2VQEI 3JZ3A 2AJ4A 3VHAA 1QYEA 4MOTA 3GIGA 4X65E 4CWPA 1B63A 3C0EA 4U7OA 1Z59A 2E5LE 5IT9C 4LF6E 2A2CA 4LWHA 4K0KE 3O6OA 2YEHA 4EMDA 3Q6NA 1YT1A 4JI6I 4HXZA 1FJGE 4LFBI 1GKXA 3WU4A 2K5BA 5GMDA 2HKEA 3ZZUA 1A4HA 1N0UA 1Y8PA 1ZM2A 2H55A 4LF4I 3QT8A 2J7KA 4XDMA 4DUYI 2UUCE 5M4HA 4NH7A 1TH8A 4I5SA 5M4EA 3HHUA 2VF3A 2XDSA 3IEDA 4LPBA 4MYTA 4HZ5A 2HG1A 3OPDA 2HHHE 2YE2A 4KHPE 2BYHA 3PYEA 4AWPA 1IBKE 1N32E 4DR2I 2BU6A 4XIQA 4JI2E 2FYPA 4E02A 4O09A 1HNZE 3Q1QA 5FLXC 4FCQA 4YKQA 1KZNA 2Q8HA 4B3TI 3B28A 1ELOA 4YY3E 2YEAA 3A0ZA 5F3KA 1IBLI 1USVA 2XDUA 3QDDA 1RR9A 1UYKA 3J80Q 3SL2A 4IZJB 1Z0EA 4N3OA 3HULA 2YKJA 4ASAA 1FWLA 3HEKA 1UEKA 3TUHA 4JI3I 3T1HI 1I5DA 4B3SE 2YK2A 1KIJA 3OWBA 4BAEA 2BSMA 4DUZE 3WU5A 4H7QA 1HNXE 5CTXA 3WU6A 3WU3A 4YKXA 3ZZTA 2QF6A 2HKJA 2X36A 2R42A 4DPTA 3B78A 5BR8E 5IN9A 4KQVA 2C2AA 3RKZA 4JYAI 4CE3A 4X62E 3EHHA 4JI7E 1ZXNA 2VQFE 4XITA 2UUBI 1ZXMA 3QT7A 3LTOA 5CF0A 2EFGA 4P52A 1UYDA 3GIEA 3ZXQA 2V2QA 4Q20A 4KP4A 4I3HA 1BGQA 1N0VC 1Z0VA 2UU9I 3CRKA 3PRYA 4CWSA 4O05A 3BM9A 2LJPA 2AKPA 4JV5E 1N33E 4O04A 1HR0E 4IZKB 4MPCA 1N34E 1UYGA 2UXBI 3GONA 2JJCA 2XCMA 3INXA 3P06A 1S4EA 3T2SA 3R4PA 4FWGA 2YJXA 3U2KA 2XJGA 4X64E 2YE5A 4YKZA 4LF7I 2WI3A 2YECA 1XMQI 5CTUA 3HYYA 1MG7A 1TBWA 3D4JA 1Y8OA 4XIPA 4KSGA 5CTYA 4DR6E 4MPEA 3QT6A 1YSZA 5D6QA 5FNFA 4DV1E 2ZDXA 4B3RI 3PYDA 3U67A 2WERA 1H72C 4DV3E 1MU5A 3G7EA 2BYIA 1IBME 3FT8A 5A2QC 5M4MA 1PKPA 4FPPA 1J5EI 5D7RA 1RREA 1UYIA 3OMUA 4JG4A 2YJWA 1EA6A 2BV3A 2HK2A 4DV6E 4EFTA 1K47A 1YESA 3OW6A 3U2DA 1I94E 3TZ2A 5LMNI 1U2OA 3D36A 1N36E 2GQ0A 4LWIA 2GS8A 2DEJA 4JI4E 4DPWA 1Z0CA 3ZM7A 4LWEA 4DR3E 1B3QA 4PRXA 2XABA 5LMUI 4MPNA 2CZ9A 4JI1E 4LFAI 2XHXA 4NXNI 1Y4SA 3J7AG 1FWKA 5IDJA 3Q5JA 2WI4A 4GKJE 4JASA 1XNQE 4HYMA 1XMOI 3LPSA 3J81Q 2X7IA 4DV0E 2YEBA 1S16A 4IZJD 4DR5E 4R1FA 4DV4E 3T1YE 1I5BA 3ZZ0A 1HK7A 1ZM4A 2FWYA 4X66I 4USMA 2CH4A 2XJXA 2YK9A 3K1JA 4L91A 4X9LA 4XCLA 1Z0BA 4LF9I 4BQGA 2BM0A 4YKTA 1H7UA 2BM1A 3K17A 1XNRI 4L8ZA 4YHHI 2YEJA 4XTJA 2VQEE 2Z5BA 2YE7A 1A6FA 1GKZA 4EEHA 3KE6A 4DR7E 4EGHA 1UYMA 3QT5A 1I59A 2O1WA 1Y4UA 4GEEA 2YKBA 2IOQA 1Y6ZA 2BRCA 3G75A 4LFBE 3PEJA 2HHHI 4B6CA 4CWNA 3EKOA 4BXIA 4AQYE 2WI2A 4ASGA 3R4NA 1H7SA 2HK3A 4GKKE 1H74A 4URMA 1Z0GA 4HZ0A 4JI0I 4MP7A 4EGKA 3TZ5A 3K85A 1Z5AA 4HACA 3D0BA 4DR1I 1HNWI 4ASFA 3RLQA 4XKKA 2YEDA 1D6TA 2UXDI 5BODA 1ZM3A 1Z0WA 3CWVA 4JQLA 3VADA 2Z5CA 1YT0A 4DR2E 2WW4A 1GJVA 5M4KA 1YC1A 2V2VA 1YERA 2F4VI 5GMEA 4H85A 3EHGA 2XJJA 2Q8GA 1TIDA 4B3TE 4FCRA 4DV7I 3Q5LA 3GIGB 3K97A 1IBLE 3GIFA 3A0WA 3FT5A 3QTFA 1NHJA 2IOPA 2XDXA 1UY8A 2IWSA 4JI3E 3T1HE 3INWA 4FWHA 4JI8I 3B82A 4AWQA 2VQFI 4QPKA 5IWAI 2YGAA 4HXWA 4ASBA 3J80C 3B24A 3Q5KA 2IORA 4DZYA 4B3MI 2WI7A 3H80A 4L90A 1U2RA 4DV2E 3K60A 4CE2A 1OJ4A 4DV5I 3DGEA 2WI6A 4DR4I 2O1TA 4JI5I 2BT0A 4OX9I 2BTZA 1HR0I 2BU2A 3CGZA 1S14A 1N34I 3FV5A 2CG9A 1YC3A 2XX2A 4H81A 3M6AA 2CCTA 4WUBA 3T0HA 4LF5I 4GCZA 4PRVA 3JAMQ 4UROA 3V2UC 4FN5A 4JAVA 4U93A 2UU9E 3R4MA 3LNUA 2YE3A 4BQJA 3HJCA 2YKEA 2VCJA 3H4LA 4UT4A 1TC6A 4GFNA 3B27A 4E01A 3T1KA 3OTOI 4DR6I 2YGFA 4ZKIA 2ZBKB 4HY6A 5J71A 2ESAA 2XDKA 2UXBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDL A;  4AWO A;  2CCS A;  3O2F A;  2ZDY A;  3R91 A;  1U0Z A;  2BU7 A;  4P7A A;  3O0I A;  4RPF A;  2VWC A;  4URL A;  1VIS A;  1XMQ E;  4YKY A;  2UUA I;  2GFD A;  1Z5C A;  3K99 A;  4Z7Y A;  2GQP A;  1FKA E;  3TZ4 A;  1I58 A;  1AMW A;  3ZKB A;  1UY9 A;  2YE4 A;  2YEE A;  1AH6 A;  4NXM I;  4B3R E;  4JI4 I;  3R4O A;  3TZ0 A;  2OI2 A;  2XHT A;  2FWZ A;  4URN A;  4YKU A;  1J5E E;  4LF8 I;  5IT9 Q;  3D2R A;  4LFC E;  1L0O A;  1PVG A;  1NZ0 A;  5C93 A;  3EHF A;  4JI1 I;  2XD6 A;  4W7T A;  1TIL A;  5F5R A;  1NHH A;  4X65 I;  3PYF A;  5LMN E;  4CE1 A;  1XNQ I;  1OSF A;  2E5L I;  4LF6 I;  2YE6 A;  4DV0 I;  2UXC E;  4KFG A;  2V8P A;  2ZM6 E;  4K0K I;  1AM1 A;  4DPX A;  2YKI A;  3NMQ A;  5D7D A;  1FJG I;  1EI1 A;  1UYH A;  2HFS A;  1THN A;  5D6P A;  2HFU A;  1BYQ A;  4DPY A;  1BXD A;  2FXS A;  1UY7 A;  1BKN A;  3ZXO A;  2XX4 A;  1XMO E;  2UUC I;  4DXL A;  2YEI A;  4CWQ A;  3C11 A;  5CTW A;  4R3M A;  5FWK A;  5LL6 R;  4DR7 I;  1AJ6 A;  4XKO A;  1AH8 A;  1Y8N A;  4CWR A;  4FMT A;  4O0B A;  3T10 A;  2O1V A;  4JI6 E;  3RLP A;  4X66 E;  3VHD A;  5FLX Q;  4YKW A;  4KHP I;  4LF9 E;  3J81 C;  4DPU A;  1IBK I;  1N32 I;  4XKA A;  4CWO A;  1XNR E;  1KTV A;  4AQY I;  4YHH E;  4LF4 E;  3HZ1 A;  1YS3 A;  2VCI A;  5CPH A;  4JI2 I;  4DUY E;  4GKK I;  3T0Z A;  5FND A;  1YSR A;  1HNZ I;  3J7A M;  2QFO A;  1UYE A;  4V25 A;  3G7B A;  2R3V A;  2YE8 A;  4Z7C A;  4YY3 I;  3EHJ A;  1I5A A;  3OWD A;  1R62 A;  1MX0 A;  2IWX A;  4KTN A;  4P8O A;  1XHK A;  3HZ5 A;  5L3J A;  4FWD A;  1NHI A;  4UTG A;  4B3S I;  2NPF A;  1UYC A;  2BU8 A;  2XX5 A;  4GQT A;  4E00 A;  2YGE A;  4FW9 A;  4KSH A;  4USK A;  4DUZ I;  3RLR A;  4NH9 A;  1HNX I;  4JI0 E;  2BU5 A;  2WEQ A;  2YEG A;  2ZKJ A;  2E1R A;  3ZKD A;  2VW5 A;  4ED4 A;  3VHC A;  3WQ9 A;  4WUD A;  4DR1 E;  2Q8I A;  1HNW E;  4XIR A;  5BR8 I;  4JAU A;  2UXD E;  2YE9 A;  5BOC A;  4M1K A;  4GGL A;  4HYP A;  4X62 I;  4JI7 I;  1TC0 A;  4DUH A;  4FCP A;  3A0T A;  4LWG A;  4LP0 A;  2CCU A;  1Z0T A;  4BIU A;  4CWF A;  2F4V E;  2V34 A;  1ZWH A;  1PIE A;  1FNM A;  2CGF A;  2XEX A;  4XE2 A;  4U7N A;  4DV7 E;  4GT8 A;  3A0X A;  2QG0 A;  1QZR A;  5D7C A;  1ZM9 A;  4MB9 A;  2YKC A;  4DV2 I;  4PU9 A;  4JYA E;  4JV5 I;  1N33 I;  1ZW9 A;  2UUB E;  1UY6 A;  1YET A;  4CWT A;  2HCH A;  4JI8 E;  2DEI A;  5J6A A;  4MP2 A;  4MBC A;  5IWA E;  3EKR A;  3A0R A;  1I5C A;  2YI6 A;  1KVK A;  2UWD A;  2XHR A;  4K4O A;  4XD8 A;  4EFU A;  3B8H A;  4X64 I;  4B3M E;  2Q8F A;  5A2Q Q;  3K98 A;  4DV5 E;  2BRE A;  3PYG A;  4DR4 E;  4EMV A;  1KKH A;  1FI4 A;  2WI1 A;  4XCJ A;  4HAC B;  4BIZ A;  4JI5 E;  5M4N A;  4DV1 I;  4OX9 E;  2WI5 A;  4DV3 I;  3CRL A;  1IBM I;  4AS9 A;  1JM6 A;  1WUU A;  2WEP A;  4DU8 A;  4EGI A;  4QPJ A;  3B25 A;  2A2D A;  4LF7 E;  4LF5 E;  4PL9 A;  3PEH A;  4DV6 I;  2BZ5 A;  1ID0 A;  1B62 A;  4L94 A;  4HY1 A;  4V26 A;  1I94 I;  3R92 A;  2V2Z A;  2ZIT A;  3OTO E;  1N36 I;  2O1U A;  4LWF A;  3HYZ A;  3JAM C;  2EXL A;  1H73 A;  4WUC A;  2YEF A;  4O07 A;  4ZVI A;  4YKR A;  3WHA A;  5M4P A;  4DR3 I;  3MNR P;  2XK2 A;  5FNC A;  3B26 A;  3BMY A;  1DAR A;  1UYL A;  2Q2E B;  1US7 A;  2YI0 A;  4LFC I;  2E0A A;  3CGY A;  2UUA E;  1YT2 A;  1Z5B A;  5IDM A;  4GKJ I;  4DU7 A;  2PNR A;  1QY8 A;  1YC4 A;  4MYU A;  2H8M A;  2IWU A;  4NXM E;  4DR5 I;  2YI5 A;  2YI7 A;  4DV4 I;  4R3A A;  4XC0 A;  2UXC I;  2QG2 A;  3T1Y I;  2ZM6 I;  3A0Y A;  5LMU E;  4NH8 A;  4EM7 A;  4LF8 E;  1UYF A;  4B7P A;  4LFA E;  2JKI A;  4NXN E;  3V5R A;  3TTZ A;  4L93 A;  3F0N A;  5GGZ A;  2VQE I;  3JZ3 A;  2AJ4 A;  3VHA A;  1QYE A;  4MOT A;  3GIG A;  4X65 E;  4CWP A;  1B63 A;  3C0E A;  4U7O A;  1Z59 A;  2E5L E;  5IT9 C;  4LF6 E;  2A2C A;  4LWH A;  4K0K E;  3O6O A;  2YEH A;  4EMD A;  1YT1 A;  4JI6 I;  4HXZ A;  1FJG E;  4LFB I;  1GKX A;  3WU4 A;  2K5B A;  5GMD A;  2HKE A;  3ZZU A;  1A4H A;  1N0U A;  1Y8P A;  1ZM2 A;  2H55 A;  4LF4 I;  3QT8 A;  2J7K A;  4XDM A;  4DUY I;  2UUC E;  5M4H A;  4NH7 A;  1TH8 A;  4I5S A;  5M4E A;  3HHU A;  2VF3 A;  2XDS A;  3IED A;  4LPB A;  4MYT A;  4HZ5 A;  2HG1 A;  3OPD A;  2HHH E;  2YE2 A;  4KHP E;  2BYH A;  3PYE A;  4AWP A;  1IBK E;  1N32 E;  4DR2 I;  2BU6 A;  4XIQ A;  4JI2 E;  2FYP A;  4E02 A;  4O09 A;  1HNZ E;  3Q1Q A;  5FLX C;  4FCQ A;  4YKQ A;  1KZN A;  2Q8H A;  4B3T I;  3B28 A;  1ELO A;  4YY3 E;  2YEA A;  3A0Z A;  5F3K A;  1IBL I;  2XDU A;  3QDD A;  1RR9 A;  1UYK A;  3J80 Q;  3SL2 A;  1Z0E A;  2YKJ A;  3HUL A;  4ASA A;  1FWL A;  3HEK A;  1UEK A;  3TUH A;  4JI3 I;  3T1H I;  1I5D A;  4B3S E;  2YK2 A;  1KIJ A;  3OWB A;  4BAE A;  2BSM A;  4DUZ E;  3WU5 A;  4H7Q A;  1HNX E;  5CTX A;  3WU6 A;  3WU3 A;  4YKX A;  3ZZT A;  2QF6 A;  2HKJ A;  2X36 A;  2R42 A;  4DPT A;  3B78 A;  5BR8 E;  5IN9 A;  4KQV A;  2C2A A;  3RKZ A;  4JYA I;  4CE3 A;  4X62 E;  3EHH A;  4JI7 E;  1ZXN A;  2VQF E;  4XIT A;  2UUB I;  1ZXM A;  3QT7 A;  3LTO A;  5CF0 A;  2EFG A;  4P52 A;  1UYD A;  3GIE A;  3ZXQ A;  2V2Q A;  4Q20 A;  4KP4 A;  4I3H A;  1BGQ A;  1N0V C;  1Z0V A;  2UU9 I;  3CRK A;  4CWS A;  4O05 A;  3BM9 A;  2LJP A;  2AKP A;  4JV5 E;  1N33 E;  4O04 A;  1HR0 E;  4MPC A;  1N34 E;  1UYG A;  2UXB I;  3GON A;  2JJC A;  2XCM A;  3INX A;  1S4E A;  3T2S A;  3R4P A;  4FWG A;  2YJX A;  3U2K A;  2XJG A;  4X64 E;  2YE5 A;  4YKZ A;  4LF7 I;  2WI3 A;  2YEC A;  1XMQ I;  5CTU A;  3HYY A;  1MG7 A;  1TBW A;  3D4J A;  1Y8O A;  4XIP A;  4KSG A;  5CTY A;  4DR6 E;  4MPE A;  3QT6 A;  1YSZ A;  5D6Q A;  5FNF A;  4DV1 E;  2ZDX A;  4B3R I;  3PYD A;  3U67 A;  2WER A;  1H72 C;  4DV3 E;  1MU5 A;  3G7E A;  2BYI A;  1IBM E;  3FT8 A;  5A2Q C;  5M4M A;  1PKP A;  4FPP A;  1J5E I;  5D7R A;  1RRE A;  1UYI A;  3OMU A;  4JG4 A;  2YJW A;  1EA6 A;  2BV3 A;  2HK2 A;  4DV6 E;  4EFT A;  1K47 A;  1YES A;  3OW6 A;  3U2D A;  1I94 E;  3TZ2 A;  5LMN I;  1U2O A;  3D36 A;  1N36 E;  4LWI A;  2GS8 A;  2DEJ A;  4JI4 E;  4DPW A;  1Z0C A;  3ZM7 A;  4LWE A;  4DR3 E;  1B3Q A;  4PRX A;  2XAB A;  5LMU I;  4MPN A;  2CZ9 A;  4JI1 E;  4LFA I;  2XHX A;  4NXN I;  1Y4S A;  3J7A G;  1FWK A;  5IDJ A;  3Q5J A;  2WI4 A;  4GKJ E;  4JAS A;  1XNQ E;  4HYM A;  1XMO I;  3LPS A;  3J81 Q;  2X7I A;  4DV0 E;  2YEB A;  1S16 A;  4DR5 E;  4R1F A;  4DV4 E;  3T1Y E;  1I5B A;  3ZZ0 A;  1ZM4 A;  2FWY A;  4X66 I;  4USM A;  2CH4 A;  2XJX A;  2YK9 A;  3K1J A;  4L91 A;  4X9L A;  4XCL A;  1Z0B A;  4LF9 I;  4BQG A;  2BM0 A;  4YKT A;  1H7U A;  2BM1 A;  3K17 A;  1XNR I;  4L8Z A;  4YHH I;  2YEJ A;  4XTJ A;  2VQE E;  2YE7 A;  1A6F A;  1GKZ A;  4EEH A;  3KE6 A;  4DR7 E;  4EGH A;  1UYM A;  3QT5 A;  1I59 A;  2O1W A;  1Y4U A;  4GEE A;  2YKB A;  2IOQ A;  2BRC A;  3G75 A;  4LFB E;  3PEJ A;  2HHH I;  4B6C A;  4CWN A;  3EKO A;  4BXI A;  4AQY E;  2WI2 A;  4ASG A;  3R4N A;  1H7S A;  2HK3 A;  4GKK E;  1H74 A;  4URM A;  1Z0G A;  4HZ0 A;  4JI0 I;  4MP7 A;  4EGK A;  3TZ5 A;  1Z5A A;  4HAC A;  3D0B A;  4DR1 I;  1HNW I;  4ASF A;  3RLQ A;  4XKK A;  2YED A;  1D6T A;  2UXD I;  5BOD A;  1ZM3 A;  1Z0W A;  3CWV A;  4JQL A;  3VAD A;  1YT0 A;  4DR2 E;  2WW4 A;  1GJV A;  5M4K A;  1YC1 A;  2V2V A;  1YER A;  2F4V I;  5GME A;  4H85 A;  3EHG A;  2XJJ A;  2Q8G A;  1TID A;  4B3T E;  4FCR A;  4DV7 I;  3Q5L A;  3GIG B;  3K97 A;  1IBL E;  3GIF A;  3A0W A;  3FT5 A;  3QTF A;  1NHJ A;  2IOP A;  2XDX A;  1UY8 A;  2IWS A;  4JI3 E;  3T1H E;  3INW A;  4FWH A;  4JI8 I;  3B82 A;  4AWQ A;  2VQF I;  4QPK A;  5IWA I;  2YGA A;  4HXW A;  4ASB A;  3J80 C;  3B24 A;  3Q5K A;  2IOR A;  4DZY A;  4B3M I;  2WI7 A;  3H80 A;  4L90 A;  1U2R A;  4DV2 E;  3K60 A;  4CE2 A;  1OJ4 A;  4DV5 I;  3DGE A;  2WI6 A;  4DR4 I;  4JI5 I;  2BT0 A;  2BTZ A;  4OX9 I;  1HR0 I;  2BU2 A;  3CGZ A;  1S14 A;  1N34 I;  3FV5 A;  1YC3 A;  2CG9 A;  2XX2 A;  4H81 A;  3M6A A;  2CCT A;  4WUB A;  3T0H A;  4LF5 I;  4GCZ A;  4PRV A;  3JAM Q;  4URO A;  3V2U C;  4FN5 A;  4JAV A;  4U93 A;  2UU9 E;  3R4M A;  3LNU A;  2YE3 A;  4BQJ A;  2YKE A;  2VCJ A;  3H4L A;  4UT4 A;  1TC6 A;  4GFN A;  3B27 A;  4E01 A;  3T1K A;  3OTO I;  4DR6 I;  2YGF A;  4ZKI A;  2ZBK B;  4HY6 A;  5J71 A;  2ESA A;  2XDK A;  2UXB E; 
#chains in the Genus database with same CATH topology
 3DD6 A;  5K36 D;  2XDL A;  4AWO A;  3P3C A;  5K36 A;  2CCS A;  3O2F A;  2ZDY A;  3R91 A;  1U0Z A;  2BU7 A;  4P7A A;  3O0I A;  4RPF A;  2VWC A;  3H1C A;  4URL A;  1VIS A;  2CVE A;  1XMQ E;  2UUA I;  4YKY A;  2GFD A;  1Z5C A;  3K99 A;  4Z7Y A;  4AIM A;  2GQP A;  1FKA E;  3TZ4 A;  1I58 A;  1AMW A;  3ZKB A;  1UY9 A;  2YE4 A;  2YEE A;  1AH6 A;  4NXM I;  4B3R E;  4JI4 I;  4IFD E;  3R4O A;  3TZ0 A;  2OI2 A;  5DNX A;  2XHT A;  2FWZ A;  3M85 G;  4URN A;  4YKU A;  1J5E E;  1F51 A;  4LF8 I;  5IT9 Q;  3D2R A;  4LFC E;  1L0O A;  1PVG A;  1NZ0 A;  5C93 A;  3EHF A;  2NN6 E;  4JI1 I;  2XD6 A;  2PNZ B;  4W7T A;  1TIL A;  2PNL A;  5F5R A;  1NHH A;  4X65 I;  3PYF A;  5LMN E;  3GME A;  4CE1 A;  1XNQ I;  1OSF A;  2E5L I;  4LF6 I;  2YE6 A;  4IZJ A;  4DV0 I;  2UXC E;  4KFG A;  2V8P A;  2ZM6 E;  4K0K I;  1AM1 A;  4DPX A;  2YKI A;  5C0X F;  3NMQ A;  5D7D A;  1FJG I;  1EI1 A;  1UYH A;  4MU1 A;  2HFS A;  1THN A;  5D6P A;  3PS2 A;  2HFU A;  1BYQ A;  4DPY A;  1BXD A;  4LCH A;  2FXS A;  1UY7 A;  1BKN A;  3ZXO A;  2XX4 A;  1XMO E;  2UUC I;  4DXL A;  2YEI A;  4CWQ A;  3C11 A;  5CTW A;  4R3M A;  1P42 A;  5FWK A;  5LL6 R;  4DR7 I;  1AJ6 A;  4XKO A;  1AH8 A;  1Y8N A;  2PO1 B;  4J3D A;  4FMT A;  4O0B A;  4CWR A;  3T10 A;  2O1V A;  3U1Y A;  4JI6 E;  3RLP A;  4X66 E;  3VHD A;  5FLX Q;  4YKW A;  4KHP I;  4LF9 E;  5JEA F;  3J81 C;  4DPU A;  1IBK I;  1N32 I;  5K36 F;  4XKA A;  1XNR E;  4CWO A;  1KTV A;  4AQY I;  4YHH E;  2AE8 A;  4LF4 E;  3HZ1 A;  1YS3 A;  2VCI A;  3M85 D;  4JI2 I;  4DUY E;  4GKK I;  5CPH A;  3T0Z A;  5FND A;  1YSR A;  4MU4 A;  4LCF A;  1HNZ I;  3J7A M;  2QFO A;  1UYE A;  5DRQ A;  4V25 A;  1OYS A;  3G7B A;  2R3V A;  2YE8 A;  4Z7C A;  4YY3 I;  3EHJ A;  1I5A A;  3OWD A;  4IS9 A;  1R62 A;  1R6M A;  4IZK A;  1MX0 A;  2IWX A;  4KTN A;  4OO1 E;  4P8O A;  1XHK A;  3HZ5 A;  5L3J A;  4FWD A;  1RHY A;  1NHI A;  4UTG A;  2NPF A;  4B3S I;  1E3H A;  3Q6M A;  1UYC A;  2BU8 A;  2XX5 A;  4GQT A;  4E00 A;  2YGE A;  4U3D A;  4FW9 A;  4KSH A;  4USK A;  4DUZ I;  3RLR A;  4NH9 A;  1HNX I;  4JI0 E;  2BU5 A;  2WEQ A;  2YEG A;  2ZKJ A;  2E1R A;  2JE6 A;  4GQU A;  3ZKD A;  2VW5 A;  4MU0 A;  4ED4 A;  3VHC A;  3WQ9 A;  4WUD A;  4DR1 E;  2Q8I A;  1HNW E;  4LCG A;  4XIR A;  5BR8 I;  4JAU A;  2UXD E;  2YE9 A;  5BOC A;  4M1K A;  4GGL A;  4HYP A;  4LPF A;  4X62 I;  4JI7 I;  2Z5E A;  1TC0 A;  4DUH A;  2JEB B;  4FCP A;  3A0T A;  4LWG A;  2C1I A;  2CCU A;  4LP0 A;  1Z0T A;  4BIU A;  4CWF A;  2F4V E;  2V34 A;  1ZWH A;  1PIE A;  1FNM A;  3CYG A;  2CGF A;  2XEX A;  3U1K A;  3P3E A;  4XE2 A;  2Z5B B;  4U7N A;  4DV7 E;  4IFD C;  4GT8 A;  3A0X A;  2CGE A;  2QG0 A;  1QZR A;  5D7C A;  1ZM9 A;  4MB9 A;  2YKC A;  4FW3 A;  4DV2 I;  1XXE A;  4PU9 A;  4JYA E;  5C0X A;  4JV5 I;  2NN6 C;  1N33 I;  1ZW9 A;  2UUB E;  1UY6 A;  1YET A;  4CWT A;  2HCH A;  4JI8 E;  2DEI A;  1USU A;  4MP2 A;  2C39 B;  5J6A A;  4MBC A;  5IWA E;  3EKR A;  3A0R A;  1I5C A;  2PNZ A;  2YI6 A;  1KVK A;  2UWD A;  2XHR A;  4K4O A;  4XD8 A;  4EFU A;  3B8H A;  4X64 I;  4B3M E;  2Q8F A;  4BA2 A;  5A2Q Q;  3K98 A;  4DV5 E;  2WP8 B;  2BRE A;  3PYG A;  4DR4 E;  4EMV A;  1KKH A;  2C37 B;  4IFD B;  1FI4 A;  2WI1 A;  4XCJ A;  4HAC B;  4BIZ A;  4JI5 E;  2JT2 A;  2C1G A;  4DV1 I;  4OX9 E;  5M4N A;  5JEA A;  1YHC A;  2WI5 A;  4DV3 I;  3CRL A;  1IBM I;  4AS9 A;  1JM6 A;  1WUU A;  2PNM A;  2WNR B;  2NN6 B;  4DU8 A;  2Z5C B;  2WEP A;  4QPJ A;  3B25 A;  4EGI A;  2A2D A;  2C38 B;  3HKM A;  4LF5 E;  4LF7 E;  3PEH A;  4PL9 A;  4DV6 I;  2BZ5 A;  1ID0 A;  1B62 A;  4L94 A;  5DRO A;  4HY1 A;  4V26 A;  1I94 I;  2PO1 A;  3L7Z B;  3R92 A;  2V2Z A;  2ZIT A;  3OTO E;  2O1U A;  1N36 I;  4LWF A;  3HYZ A;  3JAM C;  2EXL A;  1H73 A;  4WUC A;  2YEF A;  4O07 A;  4ZVI A;  4YKR A;  3WHA A;  5M4P A;  4DR3 I;  3MNR P;  2XK2 A;  5FNC A;  3B26 A;  3BMY A;  1DAR A;  1UYL A;  2Q2E B;  1US7 A;  2YI0 A;  4LFC I;  2E0A A;  2BA0 G;  3CGY A;  2UUA E;  1YT2 A;  1OYR A;  1Z5B A;  5IDM A;  1R6L A;  4GKJ I;  4DU7 A;  2BA1 G;  2PNR A;  1QY8 A;  1YC4 A;  4FW5 A;  4MU3 A;  4MYU A;  4NBQ A;  2H8M A;  4NXM E;  4DR5 I;  2IWU A;  2YI5 A;  2YI7 A;  4DV4 I;  4R3A A;  4XC0 A;  2UXC I;  2QG2 A;  3T1Y I;  2ZM6 I;  3A0Y A;  2JEA B;  5LMU E;  4NH8 A;  4EM7 A;  4LF8 E;  1UYF A;  4B7P A;  4LFA E;  2JKI A;  4NXN E;  3V5R A;  3TTZ A;  3PS1 A;  4L93 A;  3F0N A;  5GGZ A;  2VQE I;  3JZ3 A;  2AJ4 A;  3VHA A;  1QYE A;  4MOT A;  3GIG A;  4X65 E;  4CWP A;  4AID A;  1B63 A;  3C0E A;  4U7O A;  1Z59 A;  2E5L E;  5IT9 C;  4LF6 E;  2A2C A;  4LWH A;  2PO2 A;  4K0K E;  3O6O A;  2YEH A;  4EMD A;  3Q6N A;  1YT1 A;  2GO3 A;  4HXZ A;  4JI6 I;  1FJG E;  4LFB I;  1GKX A;  3WU4 A;  2K5B A;  3M7N G;  5GMD A;  2HKE A;  3ZZU A;  1A4H A;  1N0U A;  5C0X E;  1Y8P A;  1ZM2 A;  5EKW A;  2H55 A;  1UDS A;  4LF4 I;  3QT8 A;  3LMM A;  2J7K A;  2IES A;  5EL9 A;  4XDM A;  4DUY I;  2UUC E;  5M4H A;  4NH7 A;  1TH8 A;  1VI7 A;  4I5S A;  5M4E A;  3HHU A;  2VF3 A;  2XDS A;  3IED A;  4LPB A;  2PO0 A;  4MYT A;  4HZ5 A;  2BA1 D;  2HG1 A;  3OPD A;  2HHH E;  2YE2 A;  4KHP E;  2BYH A;  3PYE A;  4AWP A;  1IBK E;  1N32 E;  4DR2 I;  4QNJ A;  2BU6 A;  4XIQ A;  5JEA E;  4JI2 E;  2FYP A;  4E02 A;  5K36 E;  4O09 A;  1HNZ E;  1Y60 A;  5FLX C;  3Q1Q A;  4FCQ A;  4YKQ A;  1KZN A;  2Q8H A;  4B3T I;  3B28 A;  1ELO A;  4YY3 E;  4IFD D;  2YEA A;  3A0Z A;  5F3K A;  1IBL I;  1USV A;  2XDU A;  3QDD A;  1RR9 A;  1UYK A;  3J80 Q;  3SL2 A;  4IZJ B;  1Z0E A;  4N3O A;  3HUL A;  2YKJ A;  4ASA A;  1FWL A;  3KRN A;  3HEK A;  1UEK A;  3TUH A;  4JI3 I;  2NN6 D;  3T1H I;  4B3S E;  2WNR A;  1I5D A;  2NN6 A;  2YK2 A;  1KIJ A;  3OWB A;  4BAE A;  2J65 A;  2BSM A;  2C38 A;  5DRP A;  4DUZ E;  3WU5 A;  4H7Q A;  1HNX E;  5CTX A;  3WU6 A;  3WU3 A;  4YKX A;  3ZZT A;  4LOM A;  2QF6 A;  2HKJ A;  2X36 A;  3L7Z A;  2R42 A;  4DPT A;  3B78 A;  5BR8 E;  5IN9 A;  4KQV A;  2C2A A;  5JEN A;  3RKZ A;  4JYA I;  4CE3 A;  4X62 E;  3EHH A;  4JI7 E;  1ZXN A;  2VQF E;  4XIT A;  2UUB I;  1ZXM A;  3QT7 A;  3LTO A;  5CF0 A;  2EFG A;  4P52 A;  1UYD A;  1IXM A;  3GIE A;  3ZXQ A;  2V2Q A;  4Q20 A;  4KP4 A;  4I3H A;  1BGQ A;  1N0V C;  2GO4 A;  1Z0V A;  4ISA A;  2UU9 I;  3CRK A;  3PRY A;  4CWS A;  4O05 A;  3BM9 A;  2LJP A;  4QNK A;  2AKP A;  4JV5 E;  1N33 E;  4O04 A;  1HR0 E;  4IZK B;  4MPC A;  1N34 E;  1UYG A;  1UDN A;  2UXB I;  2BR2 B;  2O3Z A;  4AM3 A;  3GON A;  2JJC A;  3NZK A;  2XCM A;  3INX A;  3P06 A;  1S4E A;  3T2S A;  3R4P A;  4FWG A;  2YJX A;  3P76 A;  3U2K A;  2VES A;  2XJG A;  4X64 E;  2YE5 A;  4YKZ A;  4LF7 I;  2WI3 A;  2YEC A;  1XMQ I;  5CTU A;  3PS3 A;  3HYY A;  1MG7 A;  1TBW A;  3D4J A;  3B4T A;  1Y8O A;  4XIP A;  3S5T A;  4FW4 A;  4KSG A;  5CTY A;  3CDI A;  4FW7 A;  3QT6 A;  5C0X C;  4DR6 E;  4IFD F;  1YSZ A;  4MPE A;  5D6Q A;  5FNF A;  4DV1 E;  2ZDX A;  4B3R I;  3PYD A;  3U67 A;  2WER A;  1H72 C;  4DV3 E;  1MU5 A;  3G7E A;  2BYI A;  5DNL A;  1IBM E;  3FT8 A;  3CDJ A;  5A2Q C;  5M4M A;  1PKP A;  2HHI A;  4FPP A;  2NN6 F;  1J5E I;  5D7R A;  1RRE A;  1UYI A;  3OMU A;  4JG4 A;  2YJW A;  1EA6 A;  2BV3 A;  2HK2 A;  4DV6 E;  4EFT A;  1K47 A;  4OO1 C;  2F1D A;  1YES A;  3OW6 A;  1Y5Y A;  3U2D A;  1I94 E;  3TZ2 A;  5LMN I;  1U2O A;  3D36 A;  1N36 E;  2GQ0 A;  4LWI A;  5JEA C;  2GS8 A;  2DEJ A;  4JI4 E;  4DPW A;  1Z0C A;  5K36 C;  3ZM7 A;  4LWE A;  4BA1 B;  4DR3 E;  5C0X B;  1B3Q A;  4PRX A;  2XAB A;  5LMU I;  4MPN A;  2CZ9 A;  4JI1 E;  4LFA I;  2XHX A;  4NXN I;  1Y4S A;  3GLL A;  3J7A G;  1FWK A;  5IDJ A;  3Q5J A;  1UDQ A;  4GKJ E;  2WI4 A;  4JAS A;  1XNQ E;  4HYM A;  1XMO I;  3LPS A;  3J81 Q;  2X7I A;  4DV0 E;  4BA2 B;  2YEB A;  1S16 A;  4IZJ D;  4DR5 E;  4OO1 B;  4R1F A;  4DV4 E;  3T1Y E;  1I5B A;  3ZZ0 A;  1HK7 A;  1ZM4 A;  2FWY A;  2JEB A;  4USM A;  4X66 I;  2CH4 A;  4MDT A;  3K1J A;  5ELW A;  2XJX A;  2YK9 A;  1Z0B A;  4L91 A;  4X9L A;  5JEA B;  4LF9 I;  4XCL A;  4BQG A;  2BM0 A;  4YKT A;  1H7U A;  2BM1 A;  5K36 B;  3K17 A;  1XNR I;  4L8Z A;  4YHH I;  2YEJ A;  4XTJ A;  2VQE E;  2Z5B A;  2YE7 A;  1A6F A;  1E3P A;  1GKZ A;  2BA0 D;  4EEH A;  3KE6 A;  4DR7 E;  4EGH A;  1UYM A;  4U3B A;  3QT5 A;  1I59 A;  2O1W A;  4OO1 F;  1Y4U A;  4GEE A;  2YKB A;  2IOQ A;  1Y6Z A;  2BRC A;  3G75 A;  2C39 A;  4LFB E;  3PEJ A;  2HHH I;  4B6C A;  4CWN A;  3EKO A;  4BXI A;  4AQY E;  1OYP A;  2WI2 A;  4ASG A;  3R4N A;  1H7S A;  2HK3 A;  4GKK E;  1H74 A;  4MQY A;  4URM A;  1Z0G A;  4HZ0 A;  4JI0 I;  4MP7 A;  2WP8 A;  4EGK A;  3TZ5 A;  3K85 A;  2C37 A;  4IFD A;  1Z5A A;  4HAC A;  3D0B A;  4DR1 I;  1HNW I;  4ASF A;  3RLQ A;  4XKK A;  2YED A;  1D6T A;  2UXD I;  1YH8 A;  5BOD A;  1ZM3 A;  1Z0W A;  3CWV A;  2BR2 A;  2IER A;  4JQL A;  3VAD A;  2Z5C A;  1YT0 A;  4DR2 E;  2WW4 A;  1GJV A;  5M4K A;  1YC1 A;  2V2V A;  3UHM A;  1YER A;  3M7N D;  2F4V I;  5GME A;  4H85 A;  3EHG A;  1UDO A;  2XJJ A;  2Q8G A;  1TID A;  4B3T E;  4E72 A;  4FCR A;  4DV7 I;  3Q5L A;  3GIG B;  3K97 A;  1IBL E;  3GIF A;  3A0W A;  3FT5 A;  3QTF A;  1NHJ A;  2IOP A;  3P3G A;  2PO2 B;  2XDX A;  1UY8 A;  2IWS A;  4JI3 E;  3T1H E;  3INW A;  2FTK A;  4FWH A;  4JI8 I;  3B82 A;  4AWQ A;  2VQF I;  4QPK A;  5IWA I;  2YGA A;  4HXW A;  4ASB A;  3J80 C;  3B24 A;  3Q5K A;  2IOR A;  4DZY A;  4B3M I;  2WI7 A;  3H80 A;  4L90 A;  4OZE A;  4OKG A;  1U2R A;  4DV2 E;  3K60 A;  4CE2 A;  1OJ4 A;  4DV5 I;  3DGE A;  2WI6 A;  4DR4 I;  2JEA A;  2PO0 B;  5C0X D;  2O1T A;  4BA1 A;  4JI5 I;  4OX9 I;  2BT0 A;  2BTZ A;  1HR0 I;  2BU2 A;  4FW6 A;  1S14 A;  1N34 I;  3CGZ A;  3FV5 A;  2CG9 A;  1YC3 A;  2XX2 A;  4H81 A;  3M6A A;  2CCT A;  4WUB A;  3T0H A;  4LF5 I;  3GCM A;  4GCZ A;  4PRV A;  3JAM Q;  4URO A;  3V2U C;  4FN5 A;  4JAV A;  4U93 A;  2UU9 E;  3R4M A;  3LNU A;  2YE3 A;  4BQJ A;  3HJC A;  2JE6 B;  4OO1 D;  2YKE A;  4OO1 A;  2VCJ A;  3H4L A;  4UT4 A;  5DRR A;  1TC6 A;  4GFN A;  3B27 A;  4E01 A;  3T1K A;  3OTO I;  4DR6 I;  2YGF A;  4ZKI A;  2ZBK B;  4HY6 A;  5J71 A;  2ESA A;  5JEA D;  2XDK A;  2UXB E; 
#chains in the Genus database with same CATH homology
 2XDL A;  4AWO A;  2CCS A;  3O2F A;  2ZDY A;  3R91 A;  1U0Z A;  2BU7 A;  4P7A A;  3O0I A;  4RPF A;  2VWC A;  4URL A;  1VIS A;  1XMQ E;  4YKY A;  2UUA I;  2GFD A;  1Z5C A;  3K99 A;  4Z7Y A;  2GQP A;  1FKA E;  3TZ4 A;  1I58 A;  1AMW A;  3ZKB A;  1UY9 A;  2YE4 A;  2YEE A;  1AH6 A;  4NXM I;  4B3R E;  4JI4 I;  3R4O A;  3TZ0 A;  2OI2 A;  2XHT A;  2FWZ A;  4URN A;  4YKU A;  1J5E E;  4LF8 I;  5IT9 Q;  3D2R A;  4LFC E;  1L0O A;  1PVG A;  1NZ0 A;  5C93 A;  3EHF A;  4JI1 I;  2XD6 A;  4W7T A;  1TIL A;  2PNL A;  5F5R A;  1NHH A;  4X65 I;  3PYF A;  5LMN E;  4CE1 A;  1XNQ I;  1OSF A;  2E5L I;  4LF6 I;  2YE6 A;  4IZJ A;  4DV0 I;  2UXC E;  4KFG A;  2V8P A;  2ZM6 E;  4K0K I;  1AM1 A;  4DPX A;  2YKI A;  3NMQ A;  5D7D A;  1FJG I;  1EI1 A;  1UYH A;  2HFS A;  1THN A;  5D6P A;  2HFU A;  1BYQ A;  4DPY A;  1BXD A;  2FXS A;  1UY7 A;  1BKN A;  3ZXO A;  2XX4 A;  1XMO E;  2UUC I;  4DXL A;  2YEI A;  4CWQ A;  3C11 A;  5CTW A;  4R3M A;  5FWK A;  5LL6 R;  4DR7 I;  1AJ6 A;  4XKO A;  1AH8 A;  1Y8N A;  4CWR A;  4FMT A;  4O0B A;  3T10 A;  2O1V A;  4JI6 E;  3RLP A;  4X66 E;  3VHD A;  5FLX Q;  4YKW A;  4KHP I;  4LF9 E;  3J81 C;  4DPU A;  1IBK I;  1N32 I;  4XKA A;  4CWO A;  1XNR E;  1KTV A;  4AQY I;  4YHH E;  4LF4 E;  3HZ1 A;  1YS3 A;  2VCI A;  5CPH A;  4JI2 I;  4DUY E;  4GKK I;  3T0Z A;  5FND A;  1YSR A;  1HNZ I;  3J7A M;  2QFO A;  1UYE A;  4V25 A;  3G7B A;  2R3V A;  2YE8 A;  4Z7C A;  4YY3 I;  3EHJ A;  1I5A A;  3OWD A;  1R62 A;  4IZK A;  1MX0 A;  2IWX A;  4KTN A;  4P8O A;  1XHK A;  3HZ5 A;  5L3J A;  4FWD A;  1NHI A;  4UTG A;  2NPF A;  4B3S I;  3Q6M A;  1UYC A;  2BU8 A;  2XX5 A;  4GQT A;  4E00 A;  2YGE A;  4FW9 A;  4KSH A;  4USK A;  4DUZ I;  3RLR A;  4NH9 A;  1HNX I;  4JI0 E;  2BU5 A;  2WEQ A;  2YEG A;  2ZKJ A;  2E1R A;  3ZKD A;  2VW5 A;  4ED4 A;  3VHC A;  3WQ9 A;  4WUD A;  4DR1 E;  2Q8I A;  1HNW E;  4XIR A;  5BR8 I;  4JAU A;  2UXD E;  2YE9 A;  5BOC A;  4M1K A;  4GGL A;  4HYP A;  4X62 I;  4JI7 I;  2Z5E A;  1TC0 A;  4DUH A;  4FCP A;  3A0T A;  4LWG A;  4LP0 A;  2CCU A;  1Z0T A;  4BIU A;  4CWF A;  2F4V E;  2V34 A;  1ZWH A;  1PIE A;  1FNM A;  2CGF A;  2XEX A;  4XE2 A;  2Z5B B;  4U7N A;  4DV7 E;  4GT8 A;  3A0X A;  2CGE A;  2QG0 A;  1QZR A;  5D7C A;  1ZM9 A;  4MB9 A;  2YKC A;  4DV2 I;  4PU9 A;  4JYA E;  4JV5 I;  1N33 I;  1ZW9 A;  2UUB E;  1UY6 A;  1YET A;  4CWT A;  2HCH A;  4JI8 E;  2DEI A;  1USU A;  4MP2 A;  5J6A A;  4MBC A;  5IWA E;  3EKR A;  3A0R A;  1I5C A;  2YI6 A;  1KVK A;  2UWD A;  2XHR A;  4K4O A;  4XD8 A;  4EFU A;  3B8H A;  4X64 I;  4B3M E;  2Q8F A;  5A2Q Q;  3K98 A;  4DV5 E;  2BRE A;  3PYG A;  4DR4 E;  4EMV A;  1KKH A;  1FI4 A;  2WI1 A;  4XCJ A;  4HAC B;  4BIZ A;  4JI5 E;  5M4N A;  4DV1 I;  4OX9 E;  2WI5 A;  4DV3 I;  3CRL A;  1IBM I;  4AS9 A;  1JM6 A;  1WUU A;  2PNM A;  2WEP A;  4DU8 A;  2Z5C B;  4EGI A;  4QPJ A;  3B25 A;  2A2D A;  4LF7 E;  4LF5 E;  4PL9 A;  3PEH A;  4DV6 I;  2BZ5 A;  1ID0 A;  1B62 A;  4L94 A;  4HY1 A;  4V26 A;  1I94 I;  3R92 A;  2V2Z A;  2ZIT A;  3OTO E;  2O1U A;  1N36 I;  4LWF A;  3HYZ A;  3JAM C;  2EXL A;  1H73 A;  4WUC A;  2YEF A;  4O07 A;  4ZVI A;  4YKR A;  3WHA A;  5M4P A;  4DR3 I;  3MNR P;  2XK2 A;  5FNC A;  3B26 A;  3BMY A;  1DAR A;  1UYL A;  2Q2E B;  1US7 A;  2YI0 A;  4LFC I;  2E0A A;  3CGY A;  2UUA E;  1YT2 A;  1Z5B A;  5IDM A;  4GKJ I;  4DU7 A;  2PNR A;  1QY8 A;  1YC4 A;  4MYU A;  2H8M A;  2IWU A;  4NXM E;  4DR5 I;  2YI5 A;  2YI7 A;  4DV4 I;  4R3A A;  4XC0 A;  2UXC I;  2QG2 A;  3T1Y I;  2ZM6 I;  3A0Y A;  5LMU E;  4NH8 A;  4EM7 A;  4LF8 E;  1UYF A;  4B7P A;  4LFA E;  2JKI A;  4NXN E;  3V5R A;  3TTZ A;  4L93 A;  3F0N A;  5GGZ A;  2VQE I;  3JZ3 A;  2AJ4 A;  3VHA A;  1QYE A;  4MOT A;  3GIG A;  4X65 E;  4CWP A;  1B63 A;  3C0E A;  4U7O A;  1Z59 A;  2E5L E;  5IT9 C;  4LF6 E;  2A2C A;  4LWH A;  4K0K E;  3O6O A;  2YEH A;  4EMD A;  3Q6N A;  1YT1 A;  4JI6 I;  4HXZ A;  1FJG E;  4LFB I;  1GKX A;  3WU4 A;  2K5B A;  5GMD A;  2HKE A;  3ZZU A;  1A4H A;  1N0U A;  1Y8P A;  1ZM2 A;  2H55 A;  4LF4 I;  3QT8 A;  2J7K A;  4XDM A;  4DUY I;  2UUC E;  5M4H A;  4NH7 A;  1TH8 A;  4I5S A;  5M4E A;  3HHU A;  2VF3 A;  2XDS A;  3IED A;  4LPB A;  4MYT A;  4HZ5 A;  2HG1 A;  3OPD A;  2HHH E;  2YE2 A;  4KHP E;  2BYH A;  3PYE A;  4AWP A;  1IBK E;  1N32 E;  4DR2 I;  2BU6 A;  4XIQ A;  4JI2 E;  2FYP A;  4E02 A;  4O09 A;  1HNZ E;  3Q1Q A;  5FLX C;  4FCQ A;  4YKQ A;  1KZN A;  2Q8H A;  4B3T I;  3B28 A;  1ELO A;  4YY3 E;  2YEA A;  3A0Z A;  5F3K A;  1IBL I;  1USV A;  2XDU A;  3QDD A;  1RR9 A;  1UYK A;  3J80 Q;  3SL2 A;  4IZJ B;  1Z0E A;  4N3O A;  3HUL A;  2YKJ A;  4ASA A;  1FWL A;  3HEK A;  1UEK A;  3TUH A;  4JI3 I;  3T1H I;  1I5D A;  4B3S E;  2YK2 A;  1KIJ A;  3OWB A;  4BAE A;  2BSM A;  4DUZ E;  3WU5 A;  4H7Q A;  1HNX E;  5CTX A;  3WU6 A;  3WU3 A;  4YKX A;  3ZZT A;  2QF6 A;  2HKJ A;  2X36 A;  2R42 A;  4DPT A;  3B78 A;  5BR8 E;  5IN9 A;  4KQV A;  2C2A A;  3RKZ A;  4JYA I;  4CE3 A;  4X62 E;  3EHH A;  4JI7 E;  1ZXN A;  2VQF E;  4XIT A;  2UUB I;  1ZXM A;  3QT7 A;  3LTO A;  5CF0 A;  2EFG A;  4P52 A;  1UYD A;  3GIE A;  3ZXQ A;  2V2Q A;  4Q20 A;  4KP4 A;  4I3H A;  1BGQ A;  1N0V C;  1Z0V A;  2UU9 I;  3CRK A;  3PRY A;  4CWS A;  4O05 A;  3BM9 A;  2LJP A;  2AKP A;  4JV5 E;  1N33 E;  4O04 A;  1HR0 E;  4IZK B;  4MPC A;  1N34 E;  1UYG A;  2UXB I;  3GON A;  2JJC A;  2XCM A;  3INX A;  3P06 A;  1S4E A;  3T2S A;  3R4P A;  4FWG A;  2YJX A;  3U2K A;  2XJG A;  4X64 E;  2YE5 A;  4YKZ A;  4LF7 I;  2WI3 A;  2YEC A;  1XMQ I;  5CTU A;  3HYY A;  1MG7 A;  1TBW A;  3D4J A;  1Y8O A;  4XIP A;  4KSG A;  5CTY A;  4DR6 E;  4MPE A;  3QT6 A;  1YSZ A;  5D6Q A;  5FNF A;  4DV1 E;  2ZDX A;  4B3R I;  3PYD A;  3U67 A;  2WER A;  1H72 C;  4DV3 E;  1MU5 A;  3G7E A;  2BYI A;  1IBM E;  3FT8 A;  5A2Q C;  5M4M A;  1PKP A;  4FPP A;  1J5E I;  5D7R A;  1RRE A;  1UYI A;  3OMU A;  4JG4 A;  2YJW A;  1EA6 A;  2BV3 A;  2HK2 A;  4DV6 E;  4EFT A;  1K47 A;  1YES A;  3OW6 A;  3U2D A;  1I94 E;  3TZ2 A;  5LMN I;  1U2O A;  3D36 A;  1N36 E;  2GQ0 A;  4LWI A;  2GS8 A;  2DEJ A;  4JI4 E;  4DPW A;  1Z0C A;  3ZM7 A;  4LWE A;  4DR3 E;  1B3Q A;  4PRX A;  2XAB A;  5LMU I;  4MPN A;  2CZ9 A;  4JI1 E;  4LFA I;  2XHX A;  4NXN I;  1Y4S A;  3J7A G;  1FWK A;  5IDJ A;  3Q5J A;  2WI4 A;  4GKJ E;  4JAS A;  1XNQ E;  4HYM A;  1XMO I;  3LPS A;  3J81 Q;  2X7I A;  4DV0 E;  2YEB A;  1S16 A;  4IZJ D;  4DR5 E;  4R1F A;  4DV4 E;  3T1Y E;  1I5B A;  3ZZ0 A;  1HK7 A;  1ZM4 A;  2FWY A;  4X66 I;  4USM A;  2CH4 A;  2XJX A;  2YK9 A;  3K1J A;  4L91 A;  4X9L A;  4XCL A;  1Z0B A;  4LF9 I;  4BQG A;  2BM0 A;  4YKT A;  1H7U A;  2BM1 A;  3K17 A;  1XNR I;  4L8Z A;  4YHH I;  2YEJ A;  4XTJ A;  2VQE E;  2Z5B A;  2YE7 A;  1A6F A;  1GKZ A;  4EEH A;  3KE6 A;  4DR7 E;  4EGH A;  1UYM A;  3QT5 A;  1I59 A;  2O1W A;  1Y4U A;  4GEE A;  2YKB A;  2IOQ A;  1Y6Z A;  2BRC A;  3G75 A;  4LFB E;  3PEJ A;  2HHH I;  4B6C A;  4CWN A;  3EKO A;  4BXI A;  4AQY E;  2WI2 A;  4ASG A;  3R4N A;  1H7S A;  2HK3 A;  4GKK E;  1H74 A;  4URM A;  1Z0G A;  4HZ0 A;  4JI0 I;  4MP7 A;  4EGK A;  3TZ5 A;  3K85 A;  1Z5A A;  4HAC A;  3D0B A;  4DR1 I;  1HNW I;  4ASF A;  3RLQ A;  4XKK A;  2YED A;  1D6T A;  2UXD I;  5BOD A;  1ZM3 A;  1Z0W A;  3CWV A;  4JQL A;  3VAD A;  2Z5C A;  1YT0 A;  4DR2 E;  2WW4 A;  1GJV A;  5M4K A;  1YC1 A;  2V2V A;  1YER A;  2F4V I;  5GME A;  4H85 A;  3EHG A;  2XJJ A;  2Q8G A;  1TID A;  4B3T E;  4FCR A;  4DV7 I;  3Q5L A;  3GIG B;  3K97 A;  1IBL E;  3GIF A;  3A0W A;  3FT5 A;  3QTF A;  1NHJ A;  2IOP A;  2XDX A;  1UY8 A;  2IWS A;  4JI3 E;  3T1H E;  3INW A;  4FWH A;  4JI8 I;  3B82 A;  4AWQ A;  2VQF I;  4QPK A;  5IWA I;  2YGA A;  4HXW A;  4ASB A;  3J80 C;  3B24 A;  3Q5K A;  2IOR A;  4DZY A;  4B3M I;  2WI7 A;  3H80 A;  4L90 A;  1U2R A;  4DV2 E;  3K60 A;  4CE2 A;  1OJ4 A;  4DV5 I;  3DGE A;  2WI6 A;  4DR4 I;  2O1T A;  4JI5 I;  2BT0 A;  4OX9 I;  2BTZ A;  1HR0 I;  2BU2 A;  3CGZ A;  1S14 A;  1N34 I;  3FV5 A;  2CG9 A;  1YC3 A;  2XX2 A;  4H81 A;  3M6A A;  2CCT A;  4WUB A;  3T0H A;  4LF5 I;  4GCZ A;  4PRV A;  3JAM Q;  4URO A;  3V2U C;  4FN5 A;  4JAV A;  4U93 A;  2UU9 E;  3R4M A;  3LNU A;  2YE3 A;  4BQJ A;  3HJC A;  2YKE A;  2VCJ A;  3H4L A;  4UT4 A;  1TC6 A;  4GFN A;  3B27 A;  4E01 A;  3T1K A;  3OTO I;  4DR6 I;  2YGF A;  4ZKI A;  2ZBK B;  4HY6 A;  5J71 A;  2ESA A;  2XDK A;  2UXB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...