3LNUA

Crystal structure of pare subunit
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
364
structure length
344
Chain Sequence
GLDPVKRRPGMYTDTARPNHLAQEVIDNSVDEALAGHAKQIEVTLYKDGSCEVSDDGRGMPVDIHPEEKIPGVELILTRLGVSVVNALSTKVELFIKREGSEHRMEFRDGNAASKLEVVGTVGKKNTGTRLRFWADPKYFDTPKFNVRALRHLLRAKAVLCPGLTVKLHDEATGEQDSWYFENGLRDYLKGEMAEHEMLPADLFVGSLKKDTEIVDWAAGWVPEGELVQESYVNLIPTAQHGTHVNGLRSGLTDALREFCDFRNLLPRGVKLAPEDVWDRVTFVLSLKMTDPQFSGQTKERLSSRQAAGFIEGAAHDAFSLYLNQNVEIGEKIAQIAIDRASAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ParE subunit
rcsb
source organism Xanthomonas oryzae pv. oryzae
molecule tags Isomerase
molecule keywords Topoisomerase IV subunit B
total genus 108
structure length 344
sequence length 364
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2010-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3lnuA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3lnuA01
4CE1A 4R1FA 4LFAE 3ZKDA 2XX2A 3EHGA 1EI1A 1JM6A 3BM9A 5FNDA 4DR2E 5FWKA 2BU5A 3K1JA 4LF5I 1NZ0A 1H7SA 2UWDA 2YE4A 1KIJA 4KFGA 5J71A 3J7AM 2YI7A 1I5DA 4LWEA 1I5CA 5D7CA 3ZZTA 1XNRE 4DR6I 1YSRA 3RLRA 4DV5I 4DR3I 2XHRA 2WI7A 2R3VA 2UUAI 4NXNE 2VCJA 3RKZA 1UYIA 4FW9A 3J80Q 3T1HE 3B8HA 4DV0E 3KE6A 2FWYA 4YHHI 4DV2E 3T1YE 1UEKA 4CWQA 4X65I 1UY8A 1TH8A 4YKZA 3D36A 4DR1I 4H81A 2J7KA 2HFUA 3ZZ0A 4XKAA 4E02A 3CGYA 5BR8E 1S14A 1NHIA 1N0VC 4ZVIA 1AH8A 1HNXI 4QPJA 4LF9E 3VHCA 5IN9A 3V5RA 1XNQI 2XCMA 5BOCA 5IT9Q 1ZM4A 4DPUA 2O1VA 4JV5E 4DU8A 3SL2A 4X64I 4USMA 4JI5I 1YC1A 4EFUA 3D2RA 2GFDA 2BU7A 2ZKJA 4X66I 3FT8A 4NXMI 4LF4I 2GQPA 3CRLA 2UXBI 4GEEA 1Z59A 4HZ0A 4LWIA 4DV7E 2CCSA 4UT4A 4DUZI 2FWZA 2BU6A 4E01A 4XIQA 1FJGE 3QDDA 1YT1A 4FPPA 1HNWE 1ZM3A 1QYEA 3HEKA 4JQLA 5CTYA 4BIZA 4K0KI 2VQFE 2LJPA 2CCUA 5C93A 4FN5A 5J6AA 4URLA 3U67A 2YE5A 2BYIA 2IORA 2DEJA 2YEBA 2UU9E 2A2DA 2F4VE 1TBWA 2WI3A 2WI2A 1XMQI 2YEDA 3PEHA 3HHUA 2Q8GA 2XJXA 4WUCA 1YSZA 3TZ0A 3T0ZA 2XK2A 2BU8A 3K99A 2DEIA 4O09A 3VADA 3Q5LA 1MU5A 2UXCI 1H74A 4XD8A 3T1KA 2XJGA 2JKIA 4XCJA 1XMOE 3J81Q 4DR4E 4JI2E 4DUZE 2UUBI 1J5EE 4XIRA 1UYKA 1EA6A 2XDSA 3JZ3A 4CWFA 1XNRI 4DR6E 4Z7YA 5M4MA 3B82A 3LNUA 2HG1A 3PYGA 1H73A 2QG0A 3T0HA 4RPFA 1N32I 1UYHA 2YI5A 2UXDI 2Q8FA 2HK3A 2XJJA 1HR0E 2YEGA 5A2QQ 4GKJE 2ZITA 4LFCE 2XD6A 3OTOE 4AWQA 3LTOA 3TTZA 2IWXA 3OMUA 1KVKA 4FWDA 2E0AA 4AQYI 2IWUA 4PRXA 3HZ5A 1RREA 5CPHA 1ID0A 3A0TA 3JAMC 4DUYI 1BXDA 4EMDA 5LMUE 4YKTA 2UUBE 1FI4A 3K97A 1N34I 4AWPA 1YERA 1HNZI 4P8OA 4JYAI 1Z0VA 4KSHA 2FXSA 4XE2A 4LF6E 4B3MI 1H72C 3IEDA 4JI4I 1FJGI 2XEXA 1HNWI 2WERA 4NH9A 1S4EA 3G75A 3TUHA 4L94A 3NMQA 3VHAA 4CE2A 2BM0A 3GONA 3GIGA 2YJWA 4ASAA 2UU9I 1I59A 1BGQA 2H8MA 2HK2A 4X62E 3J7AG 4YKWA 1NHHA 3GIGB 4YKRA 2YEJA 4ED4A 4WUDA 1I5BA 1Z0EA 5CTUA 1YESA 1WUUA 4JI6I 2YKCA 5L3JA 4LWGA 3B27A 2YE2A 4CE3A 2WI6A 2YE9A 3H80A 4B6CA 1N34E 3B26A 2CGFA 1HNZE 2VF3A 5M4PA 1ZM2A 4DR4I 2C2AA 5FLXC 3PEJA 4AWOA 1OJ4A 3INWA 4HY1A 4MYUA 4EEHA 4DR5I 1A4HA 1Y4UA 4B3SI 3T1HI 3QT5A 3D0BA 2E5LE 4YHHE 2BYHA 2UUCI 2YEAA 4CWNA 4ASFA 4B3TE 3FT5A 1AJ6A 4PL9A 2YGAA 1N33E 1NHJA 4JI8I 5A2QC 3O2FA 3OWDA 4JAVA 4DV3E 5M4HA 1PKPA 2V2QA 4P7AA 4FCRA 2V2VA 4JG4A 2YE3A 4KTNA 4FWGA 4LF9I 4X9LA 1ZXMA 5FNCA 1XNQE 2X36A 3OW6A 1YC4A 2K5BA 2XX5A 3ZXOA 1ZWHA 4EGHA 2YEIA 2CH4A 4JV5I 4OX9E 4JI3E 4XDMA 1Y8PA 1FKAE 4KP4A 2YI6A 1Y4SA 4DV6E 4DU7A 4BQJA 1Z5CA 2YGEA 4HYMA 2X7IA 4WUBA 4DPYA 4E00A 2WW4A 5CF0A 2O1WA 4HACB 4H7QA 1Z5AA 4DR7I 1ELOA 4K0KE 1UYFA 4GFNA 4URMA 4DR3E 2UUAE 4B3TI 4NH8A 1MG7A 4B3RE 3K60A 4LF7I 3T2SA 1Z0TA 1PVGA 2HKJA 4CWOA 3M6AA 1DARA 4O04A 3Q5KA 4LP0A 2AJ4A 1VISA 1RR9A 2BRCA 1BKNA 3U2KA 4DV1E 4OX9I 3R4MA 3DGEA 4DPTA 3J80C 1HNXE 2YKIA 3V2UC 2UXCE 4LF8I 3PYEA 4MPEA 2VWCA 4V26A 1FNMA 4X64E 1IBME 1UYCA 5LL6R 1UYDA 2R42A 1UYGA 4LFBI 4GKKE 1KZNA 4LWFA 3CGZA 3CRKA 3ZZUA 5D7DA 4GT8A 3A0ZA 4YKXA 4O05A 3QT6A 2UXDE 1N36I 2E5LI 1N0UA 2YECA 4PRVA 4KSGA 1XHKA 1FWKA 2BREA 2XHTA 4W7TA 4LFCI 4URNA 2NPFA 3EHFA 4JI8E 2VQEI 4JI0E 1XMQE 4DV1I 1FWLA 3MNRP 1UYEA 2HHHI 3G7BA 1IBLE 3CWVA 3QTFA 3Q5JA 4HZ5A 3PYFA 1Z5BA 3ZKBA 2BTZA 2Q2EB 3EKOA 2XHXA 2V8PA 4YY3E 3K98A 3TZ4A 4DV6I 3WU5A 4B7PA 4JYAE 4H85A 1Y8OA 3INXA 3T10A 3WU3A 4U93A 1TIDA 1UY6A 2XABA 4CWRA 1D6TA 2Q8HA 3ZM7A 4MYTA 4FMTA 3R92A 1IBKE 4JI1E 1N36E 4PU9A 2BT0A 3QT8A 1A6FA 2O1UA 2VW5A 3ZXQA 4GGLA 4JAUA 2YE7A 4XITA 2EXLA 3HZ1A 1TC6A 5IDJA 3PYDA 4CWPA 1K47A 4B3RI 4MPCA 4LF7E 2ESAA 4O07A 4U7OA 1HR0I 3R91A 1YETA 4EMVA 4GKJI 5D6PA 5BR8I 4EGKA 2ZM6I 4I5SA 2HHHE 4LPBA 4UROA 3R4OA 4JI6E 2YK9A 2H55A 3A0RA 3O6OA 4JI5E 4XC0A 4YY3I 4LFAI 2WI4A 2YEEA 2HCHA 4CWTA 3HULA 4L91A 4DUYE 4LF5E 1B63A 4MPNA 5LMUI 2YE8A 4K4OA 1TC0A 3EKRA 5CTWA 4L93A 4UTGA 2CCTA 2YKBA 4JASA 3B25A 4B3SE 2ZBKB 4JI1I 2FYPA 2VQFI 2CZ9A 2IWSA 2YGFA 1R62A 5GMEA 1Z0WA 4JI4E 1UY7A 4CWSA 3F0NA 4BXIA 2V2ZA 1Y8NA 3JAMQ 4DV0I 1N33I 4GCZA 1ZW9A 4MBCA 4MB9A 2YI0A 2WEPA 3J81C 3Q1QA 1S16A 2ZM6E 4M1KA 3EHJA 2WI1A 4JI0I 1MX0A 1Z0CA 2QF6A 3R4NA 1YT2A 4DUHA 2PNRA 4FWHA 2JJCA 2BV3A 5D6QA 4I3HA 1THNA 3RLPA 2YEHA 4USKA 3A0XA 4YKYA 2HFSA 3HYYA 4JI2I 2YKEA 1J5EI 2AKPA 1I94E 3VHDA 2YK2A 1PIEA 4EFTA 2YE6A 2UXBE 5IWAE 2YEFA 3B24A 4XCLA 4DV7I 4KHPE 5F5RA 3WU6A 2WEQA 4FCPA 4HY6A 2IOQA 2XDXA 4DR5E 3O0IA 5M4KA 1AMWA 4DV4E 4L8ZA 3K17A 1N32E 2CG9A 4XKOA 4DXLA 2XX4A 4BIUA 3B78A 3GIFA 3HYZA 1AM1A 1US7A 2ZDYA 2Q8IA 5CTXA 3WQ9A 4ASGA 1I5AA 1U2RA 2GS8A 4AS9A 1GJVA 1I58A 5M4EA 1KKHA 2OI2A 3A0YA 2YKJA 4AQYE 1ZXNA 3C0EA 4LF8E 1YT0A 3GIEA 1H7UA 4R3MA 1OSFA 4DR2I 4ZKIA 4YKQA 3B28A 5IT9C 1KTVA 1I94I 2QG2A 3TZ2A 5F3KA 1XMOI 3C11A 4GKKI 4Z7CA 4V25A 3OPDA 2QFOA 4LF6I 2BU2A 4KQVA 2BSMA 3FV5A 3OWBA 1GKXA 1Z0BA 1Z0GA 3RLQA 2V34A 4DR7E 4NXNI 2ZDXA 4O0BA 4NH7A 1QY8A 1B3QA 4QPKA 4YKUA 5LMNI 1BYQA 2BM1A 1ZM9A 1U2OA 1UYMA 3QT7A 2E1RA 3EHHA 2VQEE 2YJXA 4X62I 4JI7E 4EM7A 4U7NA 4R3AA 2HKEA 1IBLI 2BZ5A 3OTOI 4P52A 2VCIA 1UYLA 2IOPA 3U2DA 2XDKA 4HXWA 4BQGA 3A0WA 1AH6A 1B62A 5GMDA 4X66E 1QZRA 3WU4A 4XTJA 4NXME 4LF4E 1TILA 5D7RA 3TZ5A 5FNFA 2WI5A 4XIPA 1IBMI 3BMYA 4Q20A 4LFBE 5IWAI 1IBKI 3WHAA 4KHPI 4L90A 4B3ME 4DPWA 4HXZA 2UUCE 2XDUA 4DV5E 4FCQA 5LMNE 1L0OA 1YC3A 3D4JA 5M4NA 2A2CA 1U0ZA 4DV4I 4ASBA 5BODA 5GGZA 4DV2I 3T1YI 4GQTA 4MOTA 4DZYA 2F4VI 4DV3I 3LPSA 4X65E 4MP7A 4JI7I 4BAEA 4DR1E 4HACA 3R4PA 4DPXA 1YS3A 5IDMA 3H4LA 4HYPA 3G7EA 4LWHA 4EGIA 2XDLA 4XKKA 1UY9A 2EFGA 4JI3I 1GKZA 4MP2A 5FLXQ
chains in the Genus database with same CATH superfamily
4CE1A 4R1FA 4LFAE 3ZKDA 2XX2A 4MU4A 4IZJB 3EHGA 1JM6A 3BM9A 5FNDA 5FWKA 4DR2E 2BU5A 3K1JA 4LF5I 1NZ0A 1H7SA 2UWDA 2YE4A 1KIJA 4KFGA 5J71A 3J7AM 2YI7A 1I5DA 3HJCA 4LWEA 1I5CA 3NZKA 4IFDE 5D7CA 3ZZTA 1XNRE 4DR6I 1YSRA 3RLRA 4DV5I 4DR3I 2XHRA 3U1YA 2R3VA 2UUAI 2WI7A 4NXNE 2VCJA 3RKZA 1UYIA 4FW9A 3J80Q 1UDNA 3T1HE 3B8HA 4DV0E 3KE6A 2FWYA 4YHHI 4DV2E 3T1YE 1UEKA 4CWQA 4X65I 1UY8A 1TH8A 4YKZA 3D36A 4DR1I 4H81A 2J7KA 2HFUA 2JT2A 3ZZ0A 3PRYA 4XKAA 4E02A 3CGYA 5BR8E 1S14A 1NHIA 1N0VC 4ZVIA 3P06A 1HNXI 4OO1F 4LF9E 1AH8A 3M7NG 3V5RA 4QPJA 1XNQI 2XCMA 3VHCA 5BOCA 5IT9Q 1ZM4A 2O1VA 4DPUA 4JV5E 4DU8A 3SL2A 4OO1C 3KRNA 4X64I 3GCMA 4USMA 4JI5I 1YC1A 4EFUA 3D2RA 2GFDA 2BU7A 2ZKJA 4X66I 3FT8A 1OYPA 4NXMI 4LF4I 2GQPA 2HHIA 2UXBI 3CRLA 1Z59A 4GEEA 4HZ0A 4DV7E 2CCSA 4LWIA 4UT4A 4DUZI 2FWZA 2BU6A 2Z5BA 4XIQA 4E01A 1FJGE 2WNRA 1YT1A 3QDDA 4FPPA 1HNWE 1ZM3A 1QYEA 3HEKA 3CDJA 4JQLA 5CTYA 4BIZA 4K0KI 2VQFE 2PO2B 2LJPA 2CCUA 5C93A 2PO1A 4FN5A 5K36A 5J6AA 4URLA 5C0XA 3U67A 5IN9A 2YE5A 2BYIA 2IORA 2DEJA 2YEBA 2UU9E 2A2DA 2F4VE 1TBWA 2WI3A 2WI2A 1XMQI 2YEDA 3PEHA 3HHUA 2Q8GA 2Z5CA 2XJXA 4WUCA 1YSZA 3TZ0A 4FW7A 2XK2A 3T0ZA 4AIMA 2BU8A 1HK7A 3K99A 2DEIA 4U3BA 4O09A 2J65A 3VADA 3Q5LA 1MU5A 4N3OA 1H74A 2UXCI 4XD8A 3T1KA 2WP8A 2XJGA 1R6MA 5JEAE 1XMOE 2JKIA 3J81Q 4XCJA 5JEAA 4DR4E 4JI2E 4DUZE 4IFDF 2UUBI 1J5EE 3CYGA 4XIRA 1UYKA 3K85A 1EA6A 2XDSA 4JI3I 3JZ3A 4CWFA 1XNRI 4DR6E 4Z7YA 5EKWA 5M4MA 3B82A 3LNUA 2HG1A 4BA1A 3PYGA 1H73A 2QG0A 3T0HA 4RPFA 1N32I 1UYHA 2YI5A 2UXDI 2Q8FA 2HK3A 2XJJA 1HR0E 2YEGA 5A2QQ 2IERA 4GKJE 2ZITA 5K36E 4LFCE 2XD6A 3OTOE 4AWQA 3LTOA 3TTZA 2IWXA 1OYSA 3OMUA 1KVKA 4FWDA 4MU3A 2E0AA 4AQYI 2IWUA 2AE8A 4PRXA 3HZ5A 1RREA 5CPHA 1ID0A 3A0TA 4E72A 3JAMC 4DUYI 4GQUA 1BXDA 4EMDA 5LMUE 4YKTA 2BA0G 2UUBE 1FI4A 3K97A 1N34I 4AWPA 1YERA 3P3EA 1HNZI 4P8OA 4JYAI 1UDQA 1Z0VA 4KSHA 2FXSA 4XE2A 4LF6E 5ELWA 4B3MI 2PO0B 1H72C 3IEDA 5JEAF 4JI4I 2JEAA 1FJGI 5JENA 2XEXA 1HNWI 4ISAA 2WERA 2C39B 4NH9A 1S4EA 3G75A 3TUHA 4L94A 2CVEA 3NMQA 3VHAA 4CE2A 2BM0A 2FTKA 4U3DA 3GONA 3B4TA 3GIGA 2YJWA 4ASAA 2UU9I 1Y6ZA 1I59A 1BGQA 2H8MA 2HK2A 4X62E 3J7AG 4YKWA 1NHHA 3GIGB 4YKRA 1P42A 1USUA 4ED4A 4WUDA 4IFDB 1I5BA 2YEJA 1Z0EA 5CTUA 1YESA 1WUUA 4JI6I 2YKCA 5L3JA 4LWGA 3B27A 4LOMA 2YE2A 4CE3A 2WI6A 2PO1B 2YE9A 3H80A 4B6CA 1N34E 3B26A 3H1CA 2CGFA 1HNZE 5C0XB 2JE6A 2VF3A 5M4PA 4QNJA 1ZM2A 4DR4I 2C2AA 5FLXC 3PEJA 4AWOA 1OJ4A 3INWA 4HY1A 4MYUA 4EEHA 4DR5I 1A4HA 1Y4UA 4B3SI 3T1HI 3QT5A 3D0BA 2E5LE 4YHHE 3HKMA 2UUCI 2BYHA 2YEAA 4CWNA 4ASFA 5C0XE 4MU1A 4B3TE 3FT5A 3Q6MA 2C1IA 2NN6B 1AJ6A 4PL9A 2YGAA 1N33E 1NHJA 4JI8I 5A2QC 3O2FA 3OWDA 4JAVA 3P3CA 4DV3E 2JEBA 1PKPA 2V2QA 4P7AA 4FCRA 2V2VA 4JG4A 5M4HA 2YE3A 4KTNA 4FWGA 5C0XC 4LF9I 4X9LA 1ZXMA 5FNCA 1XNQE 2X36A 3OW6A 1YC4A 2K5BA 2XX5A 3ZXOA 1ZWHA 4EGHA 2YEIA 2CH4A 4JV5I 4OX9E 4JI3E 3M85G 4XDMA 1Y8PA 2C37A 1FKAE 4KP4A 4MU0A 2YI6A 1Y4SA 1UDSA 4DV6E 4DU7A 4BQJA 2C37B 1Z5CA 2YGEA 4HYMA 2BA1G 2X7IA 4WUBA 4DPYA 4E00A 2WW4A 5CF0A 2O1WA 4IZKB 4HACB 4H7QA 1Z5AA 4DR7I 1ELOA 4K0KE 1UYFA 4GFNA 4URMA 4DR3E 2UUAE 4B3TI 4NH8A 1MG7A 4B3RE 3K60A 4LF7I 3T2SA 1Z0TA 1PVGA 2HKJA 5DROA 3M6AA 4CWOA 5DRRA 2Z5EA 1DARA 4O04A 3Q5KA 4LP0A 1Y60A 2AJ4A 1VISA 4IZJD 1RR9A 2BRCA 5C0XF 1BKNA 3U2KA 4DV1E 2BR2A 4OX9I 3R4MA 3DGEA 4DPTA 1USVA 2PO0A 3J80C 1E3PA 1HNXE 3V2UC 2YKIA 2UXCE 3U1KA 4LF8I 3PYEA 2BR2B 4MPEA 5DNXA 2VWCA 4AM3A 1FNMA 4V26A 2GO4A 4X64E 3M85D 1IBME 1UYCA 5LL6R 1UYDA 2R42A 1UYGA 4LFBI 3Q6NA 4GKKE 1KZNA 4LWFA 3CGZA 3CRKA 3ZZUA 5D7DA 5DRPA 4GT8A 3A0ZA 2GO3A 4YKXA 2C38A 4O05A 3L7ZA 3QT6A 2UXDE 1N36I 2E5LI 1N0UA 2YECA 3LMMA 4PRVA 4FW4A 4KSGA 1VI7A 2C38B 1XHKA 1FWKA 2BREA 2PNZB 2XHTA 4W7TA 4LFCI 4URNA 2NPFA 3EHFA 4JI8E 5EL9A 2VQEI 4JI0E 2PNZA 1XMQE 4DV1I 1FWLA 3MNRP 1UYEA 2HHHI 3G7BA 4FW3A 1IBLE 3CWVA 3QTFA 3Q5JA 4HZ5A 3PYFA 1Z5BA 4QNKA 4AIDA 2JE6B 3ZKBA 2BTZA 2Q2EB 3EKOA 2XHXA 2V8PA 4YY3E 2IESA 3PS1A 5K36B 3K98A 3TZ4A 4DV6I 3WU5A 4B7PA 4JYAE 4H85A 1Y8OA 3DD6A 3INXA 3T10A 3WU3A 4U93A 1TIDA 1UY6A 2XABA 4CWRA 1D6TA 2Q8HA 3ZM7A 4MYTA 4FMTA 3R92A 1IBKE 4JI1E 1N36E 4PU9A 2BT0A 3QT8A 1A6FA 2O1UA 2VW5A 3ZXQA 4GGLA 4JAUA 2YE7A 4XITA 2EXLA 3HZ1A 1TC6A 5IDJA 3P3GA 3PYDA 4CWPA 1K47A 4B3RI 4OO1E 4MPCA 2PNMA 4LF7E 1UDOA 5C0XD 2ESAA 1HR0I 4O07A 1YETA 4U7OA 3R91A 4EMVA 5JEAB 4GKJI 5D6PA 5BR8I 4EGKA 2ZM6I 4I5SA 4OZEA 2HHHE 5DRQA 4LPBA 4UROA 3R4OA 4JI6E 1RHYA 1OYRA 2YK9A 2H55A 3A0RA 3O6OA 4JI5E 4OKGA 1R6LA 4XC0A 4YY3I 4LFAI 2WI4A 2YEEA 2HCHA 4CWTA 3HULA 4FW5A 4L91A 4MQYA 4IZKA 4DUYE 1B63A 4LF5E 4MPNA 5LMUI 2YE8A 4K4OA 5JEAD 1TC0A 3EKRA 4L93A 4UTGA 5CTWA 2CCTA 2YKBA 2O1TA 4JASA 3B25A 4B3SE 2ZBKB 4JI1I 2FYPA 2VQFI 2CZ9A 2IWSA 2YGFA 1R62A 5GMEA 1Z0WA 4JI4E 4IFDD 1UY7A 4CWSA 3F0NA 2BA1D 1IXMA 4BXIA 2V2ZA 1Y5YA 3JAMQ 4DV0I 1Y8NA 1N33I 4GCZA 1ZW9A 4MBCA 4MB9A 2YI0A 2WEPA 3J81C 4OO1A 3Q1QA 1F51A 1S16A 2ZM6E 4M1KA 3EHJA 3P76A 3S5TA 5K36F 2WI1A 2O3ZA 4JI0I 1MX0A 1Z0CA 3GLLA 2QF6A 3R4NA 1YT2A 4DUHA 2PNRA 4FWHA 1YHCA 2VESA 4BA2A 2BV3A 4IS9A 4I3HA 1THNA 2JJCA 5D6QA 2NN6F 3RLPA 2JEAB 2YEHA 3L7ZB 4USKA 3A0XA 2C39A 2GQ0A 2HFSA 4LCFA 4BA2B 3HYYA 4YKYA 2NN6C 4JI2I 2YKEA 1J5EI 2AKPA 1I94E 3VHDA 2YK2A 2NN6D 1PIEA 2CGEA 2YE6A 4EFTA 2UXBE 5IWAE 2YEFA 3B24A 4XCLA 4DV7I 4KHPE 3CDIA 5F5RA 3WU6A 2WEQA 4FCPA 4HY6A 2IOQA 2XDXA 4DR5E 4IFDA 3O0IA 2F1DA 5M4KA 4IZJA 4DV4E 1AMWA 3K17A 1N32E 4L8ZA 2CG9A 4XKOA 4DXLA 2XX4A 4BIUA 1YH8A 3B78A 3GIFA 3HYZA 1AM1A 1US7A 2ZDYA 2Q8IA 5CTXA 3WQ9A 4NBQA 4ASGA 1I5AA 1U2RA 2GS8A 4AS9A 1GJVA 5K36C 1I58A 5M4EA 1KKHA 2OI2A 3A0YA 2YKJA 4IFDC 3M7ND 4AQYE 1ZXNA 3C0EA 4LF8E 1YT0A 3GIEA 1H7UA 4R3MA 1OSFA 4DR2I 4ZKIA 4YKQA 3B28A 5IT9C 1KTVA 1I94I 2QG2A 3TZ2A 5F3KA 3PS3A 1XMOI 2NN6A 4GKKI 4Z7CA 3C11A 4V25A 1E3HA 2QFOA 3OPDA 4LF6I 4LPFA 4KQVA 2BSMA 2BU2A 3FV5A 3OWBA 1GKXA 1Z0BA 1Z0GA 2JEBB 3RLQA 2V34A 4DR7E 4NXNI 2ZDXA 4O0BA 3PS2A 5DNLA 4NH7A 1QY8A 1B3QA 4QPKA 4YKUA 5LMNI 1BYQA 2BM1A 1ZM9A 1U2OA 1UYMA 3QT7A 2E1RA 2PO2A 3EHHA 2VQEE 2YJXA 4X62I 4JI7E 4OO1D 2Z5BB 4U7NA 4EM7A 4R3AA 2WNRB 2HKEA 1IBLI 2BZ5A 3OTOI 4P52A 2BA0D 2C1GA 2Z5CB 1XXEA 1UYLA 2VCIA 2IOPA 4MDTA 3GMEA 3U2DA 5K36D 4J3DA 2XDKA 4HXWA 3A0WA 4BQGA 1AH6A 1B62A 5GMDA 4X66E 1QZRA 3WU4A 4XTJA 4NXME 2PNLA 4LF4E 1TILA 5D7RA 3TZ5A 5FNFA 2WI5A 4XIPA 1IBMI 3BMYA 4OO1B 4Q20A 4LFBE 5IWAI 1IBKI 3WHAA 4KHPI 4L90A 4B3ME 4DPWA 4HXZA 5JEAC 2UUCE 4DV5E 2XDUA 4FCQA 5LMNE 1L0OA 1YC3A 3D4JA 5M4NA 2A2CA 2WP8B 1U0ZA 2NN6E 4LCHA 4DV4I 4ASBA 5BODA 3UHMA 5GGZA 4LCGA 4DV2I 3T1YI 4GQTA 4MOTA 4DZYA 2F4VI 4DV3I 3LPSA 4X65E 4MP7A 4JI7I 4BAEA 4DR1E 4HACA 3R4PA 4DPXA 1YS3A 5IDMA 3H4LA 4HYPA 3G7EA 4LWHA 4EGIA 2XDLA 4XKKA 4FW6A 1UY9A 2EFGA 1EI1A 1GKZA 4BA1B 4MP2A 5FLXQ
chains in the Genus database with same CATH topology
4CE1A 4R1FA 4LFAE 3ZKDA 2XX2A 4IZJB 3EHGA 1JM6A 3BM9A 5FNDA 5FWKA 4DR2E 2BU5A 3K1JA 4LF5I 1NZ0A 1H7SA 2UWDA 2YE4A 1KIJA 4KFGA 5J71A 3J7AM 2YI7A 1I5DA 3HJCA 4LWEA 1I5CA 5D7CA 3ZZTA 1XNRE 4DR6I 1YSRA 3RLRA 4DV5I 4DR3I 2XHRA 2WI7A 2R3VA 2UUAI 4NXNE 2VCJA 3RKZA 1UYIA 4FW9A 3J80Q 3T1HE 3B8HA 4DV0E 3KE6A 2FWYA 4YHHI 4DV2E 3T1YE 1UEKA 4CWQA 4X65I 1UY8A 1TH8A 4YKZA 3D36A 4DR1I 4H81A 2J7KA 2HFUA 3ZZ0A 3PRYA 4XKAA 4E02A 3CGYA 5BR8E 1S14A 1NHIA 1N0VC 4ZVIA 3P06A 1HNXI 1AH8A 4LF9E 4QPJA 3VHCA 3V5RA 5IN9A 1XNQI 2XCMA 5BOCA 5IT9Q 1ZM4A 2O1VA 4DPUA 4JV5E 4DU8A 3SL2A 4X64I 4USMA 4JI5I 1YC1A 4EFUA 3D2RA 2GFDA 2BU7A 2ZKJA 4X66I 3FT8A 4NXMI 4LF4I 2GQPA 3CRLA 2UXBI 4GEEA 1Z59A 4HZ0A 4LWIA 4DV7E 2CCSA 4UT4A 4DUZI 2FWZA 2BU6A 2Z5BA 4XIQA 4E01A 1FJGE 3QDDA 1YT1A 4FPPA 1HNWE 1ZM3A 1QYEA 3HEKA 4JQLA 5CTYA 4BIZA 4K0KI 2VQFE 2LJPA 2CCUA 5C93A 4FN5A 5J6AA 4URLA 3U67A 2YE5A 2BYIA 2IORA 2DEJA 2YEBA 2UU9E 2A2DA 2F4VE 1TBWA 2WI3A 2WI2A 1XMQI 2YEDA 3PEHA 3HHUA 2Q8GA 2Z5CA 2XJXA 4WUCA 1YSZA 3TZ0A 3T0ZA 2XK2A 2BU8A 1HK7A 3K99A 2DEIA 4O09A 3VADA 3Q5LA 1MU5A 4N3OA 1H74A 2UXCI 4XD8A 3T1KA 2XJGA 2JKIA 4XCJA 1XMOE 3J81Q 4DR4E 4JI2E 4DUZE 2UUBI 1J5EE 4XIRA 1UYKA 3K85A 1EA6A 2XDSA 4JI3I 3JZ3A 4CWFA 1XNRI 4DR6E 4Z7YA 5M4MA 3B82A 3LNUA 2HG1A 3PYGA 1H73A 2QG0A 3T0HA 4RPFA 1N32I 1UYHA 2YI5A 2UXDI 2Q8FA 2HK3A 2XJJA 1HR0E 2YEGA 5A2QQ 4GKJE 2ZITA 4LFCE 2XD6A 3OTOE 4AWQA 3LTOA 3TTZA 2IWXA 3OMUA 1KVKA 4FWDA 2E0AA 4AQYI 2IWUA 4PRXA 3HZ5A 1RREA 5CPHA 1ID0A 3A0TA 3JAMC 4DUYI 1BXDA 4EMDA 5LMUE 4YKTA 2UUBE 1FI4A 3K97A 1N34I 4AWPA 1YERA 1HNZI 4P8OA 4JYAI 1Z0VA 4KSHA 2FXSA 4XE2A 4LF6E 4B3MI 1H72C 3IEDA 4JI4I 1FJGI 2XEXA 1HNWI 2WERA 4NH9A 1S4EA 3G75A 3TUHA 4L94A 3NMQA 3VHAA 4CE2A 2BM0A 3GONA 3GIGA 2YJWA 4ASAA 2UU9I 1Y6ZA 1I59A 1BGQA 2H8MA 2HK2A 4X62E 3J7AG 4YKWA 1NHHA 3GIGB 4YKRA 2YEJA 1USUA 4ED4A 4WUDA 1I5BA 1Z0EA 5CTUA 1YESA 1WUUA 4JI6I 2YKCA 5L3JA 4LWGA 3B27A 2YE2A 4CE3A 2WI6A 2YE9A 3H80A 4B6CA 1N34E 3B26A 2CGFA 1HNZE 2VF3A 5M4PA 1ZM2A 4DR4I 2C2AA 5FLXC 3PEJA 4AWOA 1OJ4A 3INWA 4HY1A 4MYUA 4EEHA 4DR5I 1A4HA 1Y4UA 4B3SI 3T1HI 3QT5A 3D0BA 2E5LE 4YHHE 2BYHA 2UUCI 2YEAA 4CWNA 4ASFA 4B3TE 3FT5A 3Q6MA 1AJ6A 4PL9A 2YGAA 1N33E 1NHJA 4JI8I 5A2QC 3O2FA 3OWDA 4JAVA 4DV3E 5M4HA 1PKPA 2V2QA 4P7AA 4FCRA 2V2VA 4JG4A 2YE3A 4KTNA 4FWGA 4LF9I 4X9LA 1ZXMA 5FNCA 1XNQE 2X36A 3OW6A 1YC4A 2K5BA 2XX5A 3ZXOA 1ZWHA 4EGHA 2YEIA 2CH4A 4JV5I 4OX9E 4JI3E 4XDMA 1Y8PA 1FKAE 4KP4A 2YI6A 1Y4SA 4DV6E 4DU7A 4BQJA 1Z5CA 2YGEA 4HYMA 2X7IA 4WUBA 4DPYA 4E00A 2WW4A 5CF0A 2O1WA 4IZKB 4HACB 4H7QA 1Z5AA 4DR7I 1ELOA 4K0KE 1UYFA 4GFNA 4URMA 4DR3E 2UUAE 4B3TI 4NH8A 1MG7A 4B3RE 3K60A 4LF7I 3T2SA 1Z0TA 1PVGA 2HKJA 4CWOA 3M6AA 2Z5EA 1DARA 4O04A 3Q5KA 4LP0A 2AJ4A 1VISA 4IZJD 1RR9A 2BRCA 1BKNA 3U2KA 4DV1E 4OX9I 3R4MA 3DGEA 4DPTA 1USVA 3J80C 1HNXE 2YKIA 3V2UC 2UXCE 4LF8I 3PYEA 4MPEA 2VWCA 4V26A 1FNMA 4X64E 1IBME 1UYCA 5LL6R 1UYDA 2R42A 1UYGA 4LFBI 3Q6NA 4GKKE 1KZNA 4LWFA 3CGZA 3CRKA 3ZZUA 5D7DA 4GT8A 3A0ZA 4YKXA 4O05A 3QT6A 2UXDE 1N36I 2E5LI 1N0UA 2YECA 4PRVA 4KSGA 1XHKA 1FWKA 2BREA 2XHTA 4W7TA 4LFCI 4URNA 2NPFA 3EHFA 4JI8E 2VQEI 4JI0E 1XMQE 4DV1I 1FWLA 3MNRP 1UYEA 2HHHI 3G7BA 1IBLE 3CWVA 3QTFA 3Q5JA 4HZ5A 3PYFA 1Z5BA 3ZKBA 2BTZA 2Q2EB 3EKOA 2XHXA 2V8PA 4YY3E 3K98A 3TZ4A 4DV6I 3WU5A 4B7PA 4JYAE 4H85A 1Y8OA 3INXA 3T10A 3WU3A 4U93A 1TIDA 1UY6A 2XABA 4CWRA 1D6TA 2Q8HA 3ZM7A 4MYTA 4FMTA 3R92A 1IBKE 4JI1E 1N36E 4PU9A 2BT0A 3QT8A 1A6FA 2O1UA 2VW5A 3ZXQA 4GGLA 4JAUA 2YE7A 4XITA 2EXLA 3HZ1A 1TC6A 5IDJA 3PYDA 4CWPA 1K47A 4B3RI 4MPCA 2PNMA 4LF7E 2ESAA 4O07A 4U7OA 1HR0I 3R91A 1YETA 4EMVA 4GKJI 5D6PA 5BR8I 4EGKA 2ZM6I 4I5SA 2HHHE 4LPBA 4UROA 3R4OA 4JI6E 2YK9A 2H55A 3A0RA 3O6OA 4JI5E 4XC0A 4YY3I 4LFAI 2WI4A 2YEEA 2HCHA 4CWTA 3HULA 4L91A 4IZKA 4DUYE 1B63A 4LF5E 4MPNA 5LMUI 2YE8A 4K4OA 1TC0A 3EKRA 5CTWA 4L93A 4UTGA 2CCTA 2YKBA 2O1TA 4JASA 3B25A 4B3SE 2ZBKB 4JI1I 2FYPA 2VQFI 2CZ9A 2IWSA 2YGFA 1R62A 5GMEA 1Z0WA 4JI4E 1UY7A 4CWSA 3F0NA 4BXIA 2V2ZA 1Y8NA 3JAMQ 4DV0I 1N33I 4GCZA 1ZW9A 4MBCA 4MB9A 2YI0A 2WEPA 3J81C 3Q1QA 1S16A 2ZM6E 4M1KA 3EHJA 2WI1A 4JI0I 1MX0A 1Z0CA 2QF6A 3R4NA 1YT2A 4DUHA 2PNRA 4FWHA 2JJCA 2BV3A 5D6QA 4I3HA 1THNA 3RLPA 2YEHA 4USKA 3A0XA 2GQ0A 2HFSA 4YKYA 3HYYA 4JI2I 2YKEA 1J5EI 2AKPA 1I94E 3VHDA 2YK2A 1PIEA 2CGEA 2YE6A 4EFTA 2UXBE 5IWAE 2YEFA 3B24A 4XCLA 4DV7I 4KHPE 5F5RA 3WU6A 2WEQA 4FCPA 4HY6A 2IOQA 2XDXA 4DR5E 3O0IA 5M4KA 4IZJA 4DV4E 1AMWA 3K17A 1N32E 4L8ZA 2CG9A 4XKOA 4DXLA 2XX4A 4BIUA 3B78A 3GIFA 3HYZA 1AM1A 1US7A 2ZDYA 2Q8IA 5CTXA 3WQ9A 4ASGA 1I5AA 1U2RA 2GS8A 4AS9A 1GJVA 1I58A 5M4EA 1KKHA 2OI2A 3A0YA 2YKJA 4AQYE 1ZXNA 3C0EA 4LF8E 1YT0A 3GIEA 1H7UA 4R3MA 1OSFA 4DR2I 4ZKIA 4YKQA 3B28A 5IT9C 1KTVA 1I94I 2QG2A 3TZ2A 5F3KA 1XMOI 3C11A 4GKKI 4Z7CA 4V25A 3OPDA 2QFOA 4LF6I 2BU2A 4KQVA 2BSMA 3FV5A 3OWBA 1GKXA 1Z0BA 1Z0GA 3RLQA 2V34A 4DR7E 4NXNI 2ZDXA 4O0BA 4NH7A 1QY8A 1B3QA 4QPKA 4YKUA 5LMNI 1BYQA 2BM1A 1ZM9A 1U2OA 1UYMA 3QT7A 2E1RA 3EHHA 2VQEE 2YJXA 4X62I 4JI7E 4EM7A 2Z5BB 4U7NA 4R3AA 2HKEA 1IBLI 2BZ5A 3OTOI 4P52A 2VCIA 2Z5CB 1UYLA 2IOPA 3U2DA 2XDKA 4HXWA 4BQGA 3A0WA 1AH6A 1B62A 5GMDA 4X66E 1QZRA 3WU4A 4XTJA 4NXME 2PNLA 4LF4E 1TILA 5D7RA 3TZ5A 5FNFA 2WI5A 4XIPA 1IBMI 3BMYA 4Q20A 4LFBE 5IWAI 1IBKI 3WHAA 4KHPI 4L90A 4B3ME 4DPWA 4HXZA 2UUCE 2XDUA 4DV5E 4FCQA 5LMNE 1L0OA 1YC3A 3D4JA 5M4NA 2A2CA 1U0ZA 4DV4I 4ASBA 5BODA 5GGZA 4DV2I 3T1YI 4GQTA 4MOTA 4DZYA 2F4VI 4DV3I 3LPSA 4X65E 4MP7A 4JI7I 4BAEA 4DR1E 4HACA 3R4PA 4DPXA 1YS3A 5IDMA 3H4LA 4HYPA 3G7EA 4LWHA 4EGIA 2XDLA 4XKKA 1UY9A 2EFGA 1EI1A 1GKZA 4MP2A 5FLXQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CE1 A;  4R1F A;  4LFA E;  3ZKD A;  2XX2 A;  3EHG A;  1EI1 A;  1JM6 A;  3BM9 A;  5FND A;  4DR2 E;  5FWK A;  2BU5 A;  3K1J A;  4LF5 I;  1NZ0 A;  1H7S A;  2UWD A;  2YE4 A;  1KIJ A;  4KFG A;  5J71 A;  3J7A M;  2YI7 A;  1I5D A;  4LWE A;  1I5C A;  5D7C A;  3ZZT A;  1XNR E;  4DR6 I;  1YSR A;  3RLR A;  4DV5 I;  4DR3 I;  2XHR A;  2WI7 A;  2R3V A;  2UUA I;  4NXN E;  2VCJ A;  3RKZ A;  1UYI A;  4FW9 A;  3J80 Q;  3T1H E;  3B8H A;  4DV0 E;  3KE6 A;  2FWY A;  4YHH I;  4DV2 E;  3T1Y E;  1UEK A;  4CWQ A;  4X65 I;  1UY8 A;  1TH8 A;  4YKZ A;  3D36 A;  4DR1 I;  4H81 A;  2J7K A;  2HFU A;  3ZZ0 A;  4XKA A;  4E02 A;  3CGY A;  5BR8 E;  1S14 A;  1NHI A;  1N0V C;  4ZVI A;  1AH8 A;  1HNX I;  4QPJ A;  4LF9 E;  3VHC A;  5IN9 A;  3V5R A;  1XNQ I;  2XCM A;  5BOC A;  5IT9 Q;  1ZM4 A;  4DPU A;  2O1V A;  4JV5 E;  4DU8 A;  3SL2 A;  4X64 I;  4USM A;  4JI5 I;  1YC1 A;  4EFU A;  3D2R A;  2GFD A;  2BU7 A;  2ZKJ A;  4X66 I;  3FT8 A;  4NXM I;  4LF4 I;  2GQP A;  3CRL A;  2UXB I;  4GEE A;  1Z59 A;  4HZ0 A;  4LWI A;  4DV7 E;  2CCS A;  4UT4 A;  4DUZ I;  2FWZ A;  2BU6 A;  4E01 A;  4XIQ A;  1FJG E;  3QDD A;  1YT1 A;  4FPP A;  1HNW E;  1ZM3 A;  1QYE A;  3HEK A;  4JQL A;  5CTY A;  4BIZ A;  4K0K I;  2VQF E;  2LJP A;  2CCU A;  5C93 A;  4FN5 A;  5J6A A;  4URL A;  3U67 A;  2YE5 A;  2BYI A;  2IOR A;  2DEJ A;  2YEB A;  2UU9 E;  2A2D A;  2F4V E;  1TBW A;  2WI3 A;  2WI2 A;  1XMQ I;  2YED A;  3PEH A;  3HHU A;  2Q8G A;  2XJX A;  4WUC A;  1YSZ A;  3TZ0 A;  3T0Z A;  2XK2 A;  2BU8 A;  3K99 A;  2DEI A;  4O09 A;  3VAD A;  3Q5L A;  1MU5 A;  2UXC I;  1H74 A;  4XD8 A;  3T1K A;  2XJG A;  2JKI A;  4XCJ A;  1XMO E;  3J81 Q;  4DR4 E;  4JI2 E;  4DUZ E;  2UUB I;  1J5E E;  4XIR A;  1UYK A;  1EA6 A;  2XDS A;  3JZ3 A;  4CWF A;  1XNR I;  4DR6 E;  4Z7Y A;  5M4M A;  3B82 A;  3LNU A;  2HG1 A;  3PYG A;  1H73 A;  2QG0 A;  3T0H A;  4RPF A;  1N32 I;  1UYH A;  2YI5 A;  2UXD I;  2Q8F A;  2HK3 A;  2XJJ A;  1HR0 E;  2YEG A;  5A2Q Q;  4GKJ E;  2ZIT A;  4LFC E;  2XD6 A;  3OTO E;  4AWQ A;  3LTO A;  3TTZ A;  2IWX A;  3OMU A;  1KVK A;  4FWD A;  2E0A A;  4AQY I;  2IWU A;  4PRX A;  3HZ5 A;  1RRE A;  5CPH A;  1ID0 A;  3A0T A;  3JAM C;  4DUY I;  1BXD A;  4EMD A;  5LMU E;  4YKT A;  2UUB E;  1FI4 A;  3K97 A;  1N34 I;  4AWP A;  1YER A;  1HNZ I;  4P8O A;  4JYA I;  1Z0V A;  4KSH A;  2FXS A;  4XE2 A;  4LF6 E;  4B3M I;  1H72 C;  3IED A;  4JI4 I;  1FJG I;  2XEX A;  1HNW I;  2WER A;  4NH9 A;  1S4E A;  3G75 A;  3TUH A;  4L94 A;  3NMQ A;  3VHA A;  4CE2 A;  2BM0 A;  3GON A;  3GIG A;  2YJW A;  4ASA A;  2UU9 I;  1I59 A;  1BGQ A;  2H8M A;  2HK2 A;  4X62 E;  3J7A G;  4YKW A;  1NHH A;  3GIG B;  4YKR A;  2YEJ A;  4ED4 A;  4WUD A;  1I5B A;  1Z0E A;  5CTU A;  1YES A;  1WUU A;  4JI6 I;  2YKC A;  5L3J A;  4LWG A;  3B27 A;  2YE2 A;  4CE3 A;  2WI6 A;  2YE9 A;  3H80 A;  4B6C A;  1N34 E;  3B26 A;  2CGF A;  1HNZ E;  2VF3 A;  5M4P A;  1ZM2 A;  4DR4 I;  2C2A A;  5FLX C;  3PEJ A;  4AWO A;  1OJ4 A;  3INW A;  4HY1 A;  4MYU A;  4EEH A;  4DR5 I;  1A4H A;  1Y4U A;  4B3S I;  3T1H I;  3QT5 A;  3D0B A;  2E5L E;  4YHH E;  2BYH A;  2UUC I;  2YEA A;  4CWN A;  4ASF A;  4B3T E;  3FT5 A;  1AJ6 A;  4PL9 A;  2YGA A;  1N33 E;  1NHJ A;  4JI8 I;  5A2Q C;  3O2F A;  3OWD A;  4JAV A;  4DV3 E;  5M4H A;  1PKP A;  2V2Q A;  4P7A A;  4FCR A;  2V2V A;  4JG4 A;  2YE3 A;  4KTN A;  4FWG A;  4LF9 I;  4X9L A;  1ZXM A;  5FNC A;  1XNQ E;  2X36 A;  3OW6 A;  1YC4 A;  2K5B A;  2XX5 A;  3ZXO A;  1ZWH A;  4EGH A;  2YEI A;  2CH4 A;  4JV5 I;  4OX9 E;  4JI3 E;  4XDM A;  1Y8P A;  1FKA E;  4KP4 A;  2YI6 A;  1Y4S A;  4DV6 E;  4DU7 A;  4BQJ A;  1Z5C A;  2YGE A;  4HYM A;  2X7I A;  4WUB A;  4DPY A;  4E00 A;  2WW4 A;  5CF0 A;  2O1W A;  4HAC B;  4H7Q A;  1Z5A A;  4DR7 I;  1ELO A;  4K0K E;  1UYF A;  4GFN A;  4URM A;  4DR3 E;  2UUA E;  4B3T I;  4NH8 A;  1MG7 A;  4B3R E;  3K60 A;  4LF7 I;  3T2S A;  1Z0T A;  1PVG A;  2HKJ A;  4CWO A;  3M6A A;  1DAR A;  4O04 A;  3Q5K A;  4LP0 A;  2AJ4 A;  1VIS A;  1RR9 A;  2BRC A;  1BKN A;  3U2K A;  4DV1 E;  4OX9 I;  3R4M A;  3DGE A;  4DPT A;  3J80 C;  1HNX E;  2YKI A;  3V2U C;  2UXC E;  4LF8 I;  3PYE A;  4MPE A;  2VWC A;  4V26 A;  1FNM A;  4X64 E;  1IBM E;  1UYC A;  5LL6 R;  1UYD A;  2R42 A;  1UYG A;  4LFB I;  4GKK E;  1KZN A;  4LWF A;  3CGZ A;  3CRK A;  3ZZU A;  5D7D A;  4GT8 A;  3A0Z A;  4YKX A;  4O05 A;  3QT6 A;  2UXD E;  1N36 I;  2E5L I;  1N0U A;  2YEC A;  4PRV A;  4KSG A;  1XHK A;  1FWK A;  2BRE A;  2XHT A;  4W7T A;  4LFC I;  4URN A;  2NPF A;  3EHF A;  4JI8 E;  2VQE I;  4JI0 E;  1XMQ E;  4DV1 I;  1FWL A;  3MNR P;  1UYE A;  2HHH I;  3G7B A;  1IBL E;  3CWV A;  3QTF A;  3Q5J A;  4HZ5 A;  3PYF A;  1Z5B A;  3ZKB A;  2BTZ A;  2Q2E B;  3EKO A;  2XHX A;  2V8P A;  4YY3 E;  3K98 A;  3TZ4 A;  4DV6 I;  3WU5 A;  4B7P A;  4JYA E;  4H85 A;  1Y8O A;  3INX A;  3T10 A;  3WU3 A;  4U93 A;  1TID A;  1UY6 A;  2XAB A;  4CWR A;  1D6T A;  2Q8H A;  3ZM7 A;  4MYT A;  4FMT A;  3R92 A;  1IBK E;  4JI1 E;  1N36 E;  4PU9 A;  2BT0 A;  3QT8 A;  1A6F A;  2O1U A;  2VW5 A;  3ZXQ A;  4GGL A;  4JAU A;  2YE7 A;  4XIT A;  2EXL A;  3HZ1 A;  1TC6 A;  5IDJ A;  3PYD A;  4CWP A;  1K47 A;  4B3R I;  4MPC A;  4LF7 E;  2ESA A;  4O07 A;  4U7O A;  1HR0 I;  3R91 A;  1YET A;  4EMV A;  4GKJ I;  5D6P A;  5BR8 I;  4EGK A;  2ZM6 I;  4I5S A;  2HHH E;  4LPB A;  4URO A;  3R4O A;  4JI6 E;  2YK9 A;  2H55 A;  3A0R A;  3O6O A;  4JI5 E;  4XC0 A;  4YY3 I;  4LFA I;  2WI4 A;  2YEE A;  2HCH A;  4CWT A;  3HUL A;  4L91 A;  4DUY E;  4LF5 E;  1B63 A;  4MPN A;  5LMU I;  2YE8 A;  4K4O A;  1TC0 A;  3EKR A;  5CTW A;  4L93 A;  4UTG A;  2CCT A;  2YKB A;  4JAS A;  3B25 A;  4B3S E;  2ZBK B;  4JI1 I;  2FYP A;  2VQF I;  2CZ9 A;  2IWS A;  2YGF A;  1R62 A;  5GME A;  1Z0W A;  4JI4 E;  1UY7 A;  4CWS A;  3F0N A;  4BXI A;  2V2Z A;  1Y8N A;  3JAM Q;  4DV0 I;  1N33 I;  4GCZ A;  1ZW9 A;  4MBC A;  4MB9 A;  2YI0 A;  2WEP A;  3J81 C;  3Q1Q A;  1S16 A;  2ZM6 E;  4M1K A;  3EHJ A;  2WI1 A;  4JI0 I;  1MX0 A;  1Z0C A;  2QF6 A;  3R4N A;  1YT2 A;  4DUH A;  2PNR A;  4FWH A;  2JJC A;  2BV3 A;  5D6Q A;  4I3H A;  1THN A;  3RLP A;  2YEH A;  4USK A;  3A0X A;  4YKY A;  2HFS A;  3HYY A;  4JI2 I;  2YKE A;  1J5E I;  2AKP A;  1I94 E;  3VHD A;  2YK2 A;  1PIE A;  4EFT A;  2YE6 A;  2UXB E;  5IWA E;  2YEF A;  3B24 A;  4XCL A;  4DV7 I;  4KHP E;  5F5R A;  3WU6 A;  2WEQ A;  4FCP A;  4HY6 A;  2IOQ A;  2XDX A;  4DR5 E;  3O0I A;  5M4K A;  1AMW A;  4DV4 E;  4L8Z A;  3K17 A;  1N32 E;  2CG9 A;  4XKO A;  4DXL A;  2XX4 A;  4BIU A;  3B78 A;  3GIF A;  3HYZ A;  1AM1 A;  1US7 A;  2ZDY A;  2Q8I A;  5CTX A;  3WQ9 A;  4ASG A;  1I5A A;  1U2R A;  2GS8 A;  4AS9 A;  1GJV A;  1I58 A;  5M4E A;  1KKH A;  2OI2 A;  3A0Y A;  2YKJ A;  4AQY E;  1ZXN A;  3C0E A;  4LF8 E;  1YT0 A;  3GIE A;  1H7U A;  4R3M A;  1OSF A;  4DR2 I;  4ZKI A;  4YKQ A;  3B28 A;  5IT9 C;  1KTV A;  1I94 I;  2QG2 A;  3TZ2 A;  5F3K A;  1XMO I;  3C11 A;  4GKK I;  4Z7C A;  4V25 A;  3OPD A;  2QFO A;  4LF6 I;  2BU2 A;  4KQV A;  2BSM A;  3FV5 A;  3OWB A;  1GKX A;  1Z0B A;  1Z0G A;  3RLQ A;  2V34 A;  4DR7 E;  4NXN I;  2ZDX A;  4O0B A;  4NH7 A;  1QY8 A;  1B3Q A;  4QPK A;  4YKU A;  5LMN I;  1BYQ A;  2BM1 A;  1ZM9 A;  1U2O A;  1UYM A;  3QT7 A;  2E1R A;  3EHH A;  2VQE E;  2YJX A;  4X62 I;  4JI7 E;  4EM7 A;  4U7N A;  4R3A A;  2HKE A;  1IBL I;  2BZ5 A;  3OTO I;  4P52 A;  2VCI A;  1UYL A;  2IOP A;  3U2D A;  2XDK A;  4HXW A;  4BQG A;  3A0W A;  1AH6 A;  1B62 A;  5GMD A;  4X66 E;  1QZR A;  3WU4 A;  4XTJ A;  4NXM E;  4LF4 E;  1TIL A;  5D7R A;  3TZ5 A;  5FNF A;  2WI5 A;  4XIP A;  1IBM I;  3BMY A;  4Q20 A;  4LFB E;  5IWA I;  1IBK I;  3WHA A;  4KHP I;  4L90 A;  4B3M E;  4DPW A;  4HXZ A;  2UUC E;  2XDU A;  4DV5 E;  4FCQ A;  5LMN E;  1L0O A;  1YC3 A;  3D4J A;  5M4N A;  2A2C A;  1U0Z A;  4DV4 I;  4ASB A;  5BOD A;  5GGZ A;  4DV2 I;  3T1Y I;  4GQT A;  4MOT A;  4DZY A;  2F4V I;  4DV3 I;  3LPS A;  4X65 E;  4MP7 A;  4JI7 I;  4BAE A;  4DR1 E;  4HAC A;  3R4P A;  4DPX A;  1YS3 A;  5IDM A;  3H4L A;  4HYP A;  3G7E A;  4LWH A;  4EGI A;  2XDL A;  4XKK A;  1UY9 A;  2EFG A;  4JI3 I;  1GKZ A;  4MP2 A;  5FLX Q; 
#chains in the Genus database with same CATH topology
 4CE1 A;  4R1F A;  4LFA E;  3ZKD A;  2XX2 A;  4MU4 A;  4IZJ B;  3EHG A;  1JM6 A;  3BM9 A;  5FND A;  5FWK A;  4DR2 E;  2BU5 A;  3K1J A;  4LF5 I;  1NZ0 A;  1H7S A;  2UWD A;  2YE4 A;  1KIJ A;  4KFG A;  5J71 A;  3J7A M;  2YI7 A;  1I5D A;  3HJC A;  4LWE A;  1I5C A;  3NZK A;  4IFD E;  5D7C A;  3ZZT A;  1XNR E;  4DR6 I;  1YSR A;  3RLR A;  4DV5 I;  4DR3 I;  2XHR A;  3U1Y A;  2R3V A;  2UUA I;  2WI7 A;  4NXN E;  2VCJ A;  3RKZ A;  1UYI A;  4FW9 A;  3J80 Q;  1UDN A;  3T1H E;  3B8H A;  4DV0 E;  3KE6 A;  2FWY A;  4YHH I;  4DV2 E;  3T1Y E;  1UEK A;  4CWQ A;  4X65 I;  1UY8 A;  1TH8 A;  4YKZ A;  3D36 A;  4DR1 I;  4H81 A;  2J7K A;  2HFU A;  2JT2 A;  3ZZ0 A;  3PRY A;  4XKA A;  4E02 A;  3CGY A;  5BR8 E;  1S14 A;  1NHI A;  1N0V C;  4ZVI A;  3P06 A;  1HNX I;  4OO1 F;  4LF9 E;  1AH8 A;  3M7N G;  3V5R A;  4QPJ A;  1XNQ I;  2XCM A;  3VHC A;  5BOC A;  5IT9 Q;  1ZM4 A;  2O1V A;  4DPU A;  4JV5 E;  4DU8 A;  3SL2 A;  4OO1 C;  3KRN A;  4X64 I;  3GCM A;  4USM A;  4JI5 I;  1YC1 A;  4EFU A;  3D2R A;  2GFD A;  2BU7 A;  2ZKJ A;  4X66 I;  3FT8 A;  1OYP A;  4NXM I;  4LF4 I;  2GQP A;  2HHI A;  2UXB I;  3CRL A;  1Z59 A;  4GEE A;  4HZ0 A;  4DV7 E;  2CCS A;  4LWI A;  4UT4 A;  4DUZ I;  2FWZ A;  2BU6 A;  2Z5B A;  4XIQ A;  4E01 A;  1FJG E;  2WNR A;  1YT1 A;  3QDD A;  4FPP A;  1HNW E;  1ZM3 A;  1QYE A;  3HEK A;  3CDJ A;  4JQL A;  5CTY A;  4BIZ A;  4K0K I;  2VQF E;  2PO2 B;  2LJP A;  2CCU A;  5C93 A;  2PO1 A;  4FN5 A;  5K36 A;  5J6A A;  4URL A;  5C0X A;  3U67 A;  5IN9 A;  2YE5 A;  2BYI A;  2IOR A;  2DEJ A;  2YEB A;  2UU9 E;  2A2D A;  2F4V E;  1TBW A;  2WI3 A;  2WI2 A;  1XMQ I;  2YED A;  3PEH A;  3HHU A;  2Q8G A;  2Z5C A;  2XJX A;  4WUC A;  1YSZ A;  3TZ0 A;  4FW7 A;  2XK2 A;  3T0Z A;  4AIM A;  2BU8 A;  1HK7 A;  3K99 A;  2DEI A;  4U3B A;  4O09 A;  2J65 A;  3VAD A;  3Q5L A;  1MU5 A;  4N3O A;  1H74 A;  2UXC I;  4XD8 A;  3T1K A;  2WP8 A;  2XJG A;  1R6M A;  5JEA E;  1XMO E;  2JKI A;  3J81 Q;  4XCJ A;  5JEA A;  4DR4 E;  4JI2 E;  4DUZ E;  4IFD F;  2UUB I;  1J5E E;  3CYG A;  4XIR A;  1UYK A;  3K85 A;  1EA6 A;  2XDS A;  4JI3 I;  3JZ3 A;  4CWF A;  1XNR I;  4DR6 E;  4Z7Y A;  5EKW A;  5M4M A;  3B82 A;  3LNU A;  2HG1 A;  4BA1 A;  3PYG A;  1H73 A;  2QG0 A;  3T0H A;  4RPF A;  1N32 I;  1UYH A;  2YI5 A;  2UXD I;  2Q8F A;  2HK3 A;  2XJJ A;  1HR0 E;  2YEG A;  5A2Q Q;  2IER A;  4GKJ E;  2ZIT A;  5K36 E;  4LFC E;  2XD6 A;  3OTO E;  4AWQ A;  3LTO A;  3TTZ A;  2IWX A;  1OYS A;  3OMU A;  1KVK A;  4FWD A;  4MU3 A;  2E0A A;  4AQY I;  2IWU A;  2AE8 A;  4PRX A;  3HZ5 A;  1RRE A;  5CPH A;  1ID0 A;  3A0T A;  4E72 A;  3JAM C;  4DUY I;  4GQU A;  1BXD A;  4EMD A;  5LMU E;  4YKT A;  2BA0 G;  2UUB E;  1FI4 A;  3K97 A;  1N34 I;  4AWP A;  1YER A;  3P3E A;  1HNZ I;  4P8O A;  4JYA I;  1UDQ A;  1Z0V A;  4KSH A;  2FXS A;  4XE2 A;  4LF6 E;  5ELW A;  4B3M I;  2PO0 B;  1H72 C;  3IED A;  5JEA F;  4JI4 I;  2JEA A;  1FJG I;  5JEN A;  2XEX A;  1HNW I;  4ISA A;  2WER A;  2C39 B;  4NH9 A;  1S4E A;  3G75 A;  3TUH A;  4L94 A;  2CVE A;  3NMQ A;  3VHA A;  4CE2 A;  2BM0 A;  2FTK A;  4U3D A;  3GON A;  3B4T A;  3GIG A;  2YJW A;  4ASA A;  2UU9 I;  1Y6Z A;  1I59 A;  1BGQ A;  2H8M A;  2HK2 A;  4X62 E;  3J7A G;  4YKW A;  1NHH A;  3GIG B;  4YKR A;  1P42 A;  1USU A;  4ED4 A;  4WUD A;  4IFD B;  1I5B A;  2YEJ A;  1Z0E A;  5CTU A;  1YES A;  1WUU A;  4JI6 I;  2YKC A;  5L3J A;  4LWG A;  3B27 A;  4LOM A;  2YE2 A;  4CE3 A;  2WI6 A;  2PO1 B;  2YE9 A;  3H80 A;  4B6C A;  1N34 E;  3B26 A;  3H1C A;  2CGF A;  1HNZ E;  5C0X B;  2JE6 A;  2VF3 A;  5M4P A;  4QNJ A;  1ZM2 A;  4DR4 I;  2C2A A;  5FLX C;  3PEJ A;  4AWO A;  1OJ4 A;  3INW A;  4HY1 A;  4MYU A;  4EEH A;  4DR5 I;  1A4H A;  1Y4U A;  4B3S I;  3T1H I;  3QT5 A;  3D0B A;  2E5L E;  4YHH E;  3HKM A;  2UUC I;  2BYH A;  2YEA A;  4CWN A;  4ASF A;  5C0X E;  4MU1 A;  4B3T E;  3FT5 A;  3Q6M A;  2C1I A;  2NN6 B;  1AJ6 A;  4PL9 A;  2YGA A;  1N33 E;  1NHJ A;  4JI8 I;  5A2Q C;  3O2F A;  3OWD A;  4JAV A;  3P3C A;  4DV3 E;  2JEB A;  1PKP A;  2V2Q A;  4P7A A;  4FCR A;  2V2V A;  4JG4 A;  5M4H A;  2YE3 A;  4KTN A;  4FWG A;  5C0X C;  4LF9 I;  4X9L A;  1ZXM A;  5FNC A;  1XNQ E;  2X36 A;  3OW6 A;  1YC4 A;  2K5B A;  2XX5 A;  3ZXO A;  1ZWH A;  4EGH A;  2YEI A;  2CH4 A;  4JV5 I;  4OX9 E;  4JI3 E;  3M85 G;  4XDM A;  1Y8P A;  2C37 A;  1FKA E;  4KP4 A;  4MU0 A;  2YI6 A;  1Y4S A;  1UDS A;  4DV6 E;  4DU7 A;  4BQJ A;  2C37 B;  1Z5C A;  2YGE A;  4HYM A;  2BA1 G;  2X7I A;  4WUB A;  4DPY A;  4E00 A;  2WW4 A;  5CF0 A;  2O1W A;  4IZK B;  4HAC B;  4H7Q A;  1Z5A A;  4DR7 I;  1ELO A;  4K0K E;  1UYF A;  4GFN A;  4URM A;  4DR3 E;  2UUA E;  4B3T I;  4NH8 A;  1MG7 A;  4B3R E;  3K60 A;  4LF7 I;  3T2S A;  1Z0T A;  1PVG A;  2HKJ A;  5DRO A;  3M6A A;  4CWO A;  5DRR A;  2Z5E A;  1DAR A;  4O04 A;  3Q5K A;  4LP0 A;  1Y60 A;  2AJ4 A;  1VIS A;  4IZJ D;  1RR9 A;  2BRC A;  5C0X F;  1BKN A;  3U2K A;  4DV1 E;  2BR2 A;  4OX9 I;  3R4M A;  3DGE A;  4DPT A;  1USV A;  2PO0 A;  3J80 C;  1E3P A;  1HNX E;  3V2U C;  2YKI A;  2UXC E;  3U1K A;  4LF8 I;  3PYE A;  2BR2 B;  4MPE A;  5DNX A;  2VWC A;  4AM3 A;  1FNM A;  4V26 A;  2GO4 A;  4X64 E;  3M85 D;  1IBM E;  1UYC A;  5LL6 R;  1UYD A;  2R42 A;  1UYG A;  4LFB I;  3Q6N A;  4GKK E;  1KZN A;  4LWF A;  3CGZ A;  3CRK A;  3ZZU A;  5D7D A;  5DRP A;  4GT8 A;  3A0Z A;  2GO3 A;  4YKX A;  2C38 A;  4O05 A;  3L7Z A;  3QT6 A;  2UXD E;  1N36 I;  2E5L I;  1N0U A;  2YEC A;  3LMM A;  4PRV A;  4FW4 A;  4KSG A;  1VI7 A;  2C38 B;  1XHK A;  1FWK A;  2BRE A;  2PNZ B;  2XHT A;  4W7T A;  4LFC I;  4URN A;  2NPF A;  3EHF A;  4JI8 E;  5EL9 A;  2VQE I;  4JI0 E;  2PNZ A;  1XMQ E;  4DV1 I;  1FWL A;  3MNR P;  1UYE A;  2HHH I;  3G7B A;  4FW3 A;  1IBL E;  3CWV A;  3QTF A;  3Q5J A;  4HZ5 A;  3PYF A;  1Z5B A;  4QNK A;  4AID A;  2JE6 B;  3ZKB A;  2BTZ A;  2Q2E B;  3EKO A;  2XHX A;  2V8P A;  4YY3 E;  2IES A;  3PS1 A;  5K36 B;  3K98 A;  3TZ4 A;  4DV6 I;  3WU5 A;  4B7P A;  4JYA E;  4H85 A;  1Y8O A;  3DD6 A;  3INX A;  3T10 A;  3WU3 A;  4U93 A;  1TID A;  1UY6 A;  2XAB A;  4CWR A;  1D6T A;  2Q8H A;  3ZM7 A;  4MYT A;  4FMT A;  3R92 A;  1IBK E;  4JI1 E;  1N36 E;  4PU9 A;  2BT0 A;  3QT8 A;  1A6F A;  2O1U A;  2VW5 A;  3ZXQ A;  4GGL A;  4JAU A;  2YE7 A;  4XIT A;  2EXL A;  3HZ1 A;  1TC6 A;  5IDJ A;  3P3G A;  3PYD A;  4CWP A;  1K47 A;  4B3R I;  4OO1 E;  4MPC A;  2PNM A;  4LF7 E;  1UDO A;  5C0X D;  2ESA A;  1HR0 I;  4O07 A;  1YET A;  4U7O A;  3R91 A;  4EMV A;  5JEA B;  4GKJ I;  5D6P A;  5BR8 I;  4EGK A;  2ZM6 I;  4I5S A;  4OZE A;  2HHH E;  5DRQ A;  4LPB A;  4URO A;  3R4O A;  4JI6 E;  1RHY A;  1OYR A;  2YK9 A;  2H55 A;  3A0R A;  3O6O A;  4JI5 E;  4OKG A;  1R6L A;  4XC0 A;  4YY3 I;  4LFA I;  2WI4 A;  2YEE A;  2HCH A;  4CWT A;  3HUL A;  4FW5 A;  4L91 A;  4MQY A;  4IZK A;  4DUY E;  1B63 A;  4LF5 E;  4MPN A;  5LMU I;  2YE8 A;  4K4O A;  5JEA D;  1TC0 A;  3EKR A;  4L93 A;  4UTG A;  5CTW A;  2CCT A;  2YKB A;  2O1T A;  4JAS A;  3B25 A;  4B3S E;  2ZBK B;  4JI1 I;  2FYP A;  2VQF I;  2CZ9 A;  2IWS A;  2YGF A;  1R62 A;  5GME A;  1Z0W A;  4JI4 E;  4IFD D;  1UY7 A;  4CWS A;  3F0N A;  2BA1 D;  1IXM A;  4BXI A;  2V2Z A;  1Y5Y A;  3JAM Q;  4DV0 I;  1Y8N A;  1N33 I;  4GCZ A;  1ZW9 A;  4MBC A;  4MB9 A;  2YI0 A;  2WEP A;  3J81 C;  4OO1 A;  3Q1Q A;  1F51 A;  1S16 A;  2ZM6 E;  4M1K A;  3EHJ A;  3P76 A;  3S5T A;  5K36 F;  2WI1 A;  2O3Z A;  4JI0 I;  1MX0 A;  1Z0C A;  3GLL A;  2QF6 A;  3R4N A;  1YT2 A;  4DUH A;  2PNR A;  4FWH A;  1YHC A;  2VES A;  4BA2 A;  2BV3 A;  4IS9 A;  4I3H A;  1THN A;  2JJC A;  5D6Q A;  2NN6 F;  3RLP A;  2JEA B;  2YEH A;  3L7Z B;  4USK A;  3A0X A;  2C39 A;  2GQ0 A;  2HFS A;  4LCF A;  4BA2 B;  3HYY A;  4YKY A;  2NN6 C;  4JI2 I;  2YKE A;  1J5E I;  2AKP A;  1I94 E;  3VHD A;  2YK2 A;  2NN6 D;  1PIE A;  2CGE A;  2YE6 A;  4EFT A;  2UXB E;  5IWA E;  2YEF A;  3B24 A;  4XCL A;  4DV7 I;  4KHP E;  3CDI A;  5F5R A;  3WU6 A;  2WEQ A;  4FCP A;  4HY6 A;  2IOQ A;  2XDX A;  4DR5 E;  4IFD A;  3O0I A;  2F1D A;  5M4K A;  4IZJ A;  4DV4 E;  1AMW A;  3K17 A;  1N32 E;  4L8Z A;  2CG9 A;  4XKO A;  4DXL A;  2XX4 A;  4BIU A;  1YH8 A;  3B78 A;  3GIF A;  3HYZ A;  1AM1 A;  1US7 A;  2ZDY A;  2Q8I A;  5CTX A;  3WQ9 A;  4NBQ A;  4ASG A;  1I5A A;  1U2R A;  2GS8 A;  4AS9 A;  1GJV A;  5K36 C;  1I58 A;  5M4E A;  1KKH A;  2OI2 A;  3A0Y A;  2YKJ A;  4IFD C;  3M7N D;  4AQY E;  1ZXN A;  3C0E A;  4LF8 E;  1YT0 A;  3GIE A;  1H7U A;  4R3M A;  1OSF A;  4DR2 I;  4ZKI A;  4YKQ A;  3B28 A;  5IT9 C;  1KTV A;  1I94 I;  2QG2 A;  3TZ2 A;  5F3K A;  3PS3 A;  1XMO I;  2NN6 A;  4GKK I;  4Z7C A;  3C11 A;  4V25 A;  1E3H A;  2QFO A;  3OPD A;  4LF6 I;  4LPF A;  4KQV A;  2BSM A;  2BU2 A;  3FV5 A;  3OWB A;  1GKX A;  1Z0B A;  1Z0G A;  2JEB B;  3RLQ A;  2V34 A;  4DR7 E;  4NXN I;  2ZDX A;  4O0B A;  3PS2 A;  5DNL A;  4NH7 A;  1QY8 A;  1B3Q A;  4QPK A;  4YKU A;  5LMN I;  1BYQ A;  2BM1 A;  1ZM9 A;  1U2O A;  1UYM A;  3QT7 A;  2E1R A;  2PO2 A;  3EHH A;  2VQE E;  2YJX A;  4X62 I;  4JI7 E;  4OO1 D;  2Z5B B;  4U7N A;  4EM7 A;  4R3A A;  2WNR B;  2HKE A;  1IBL I;  2BZ5 A;  3OTO I;  4P52 A;  2BA0 D;  2C1G A;  2Z5C B;  1XXE A;  1UYL A;  2VCI A;  2IOP A;  4MDT A;  3GME A;  3U2D A;  5K36 D;  4J3D A;  2XDK A;  4HXW A;  3A0W A;  4BQG A;  1AH6 A;  1B62 A;  5GMD A;  4X66 E;  1QZR A;  3WU4 A;  4XTJ A;  4NXM E;  2PNL A;  4LF4 E;  1TIL A;  5D7R A;  3TZ5 A;  5FNF A;  2WI5 A;  4XIP A;  1IBM I;  3BMY A;  4OO1 B;  4Q20 A;  4LFB E;  5IWA I;  1IBK I;  3WHA A;  4KHP I;  4L90 A;  4B3M E;  4DPW A;  4HXZ A;  5JEA C;  2UUC E;  4DV5 E;  2XDU A;  4FCQ A;  5LMN E;  1L0O A;  1YC3 A;  3D4J A;  5M4N A;  2A2C A;  2WP8 B;  1U0Z A;  2NN6 E;  4LCH A;  4DV4 I;  4ASB A;  5BOD A;  3UHM A;  5GGZ A;  4LCG A;  4DV2 I;  3T1Y I;  4GQT A;  4MOT A;  4DZY A;  2F4V I;  4DV3 I;  3LPS A;  4X65 E;  4MP7 A;  4JI7 I;  4BAE A;  4DR1 E;  4HAC A;  3R4P A;  4DPX A;  1YS3 A;  5IDM A;  3H4L A;  4HYP A;  3G7E A;  4LWH A;  4EGI A;  2XDL A;  4XKK A;  4FW6 A;  1UY9 A;  2EFG A;  1EI1 A;  1GKZ A;  4BA1 B;  4MP2 A;  5FLX Q; 
#chains in the Genus database with same CATH homology
 4CE1 A;  4R1F A;  4LFA E;  3ZKD A;  2XX2 A;  4IZJ B;  3EHG A;  1JM6 A;  3BM9 A;  5FND A;  5FWK A;  4DR2 E;  2BU5 A;  3K1J A;  4LF5 I;  1NZ0 A;  1H7S A;  2UWD A;  2YE4 A;  1KIJ A;  4KFG A;  5J71 A;  3J7A M;  2YI7 A;  1I5D A;  3HJC A;  4LWE A;  1I5C A;  5D7C A;  3ZZT A;  1XNR E;  4DR6 I;  1YSR A;  3RLR A;  4DV5 I;  4DR3 I;  2XHR A;  2WI7 A;  2R3V A;  2UUA I;  4NXN E;  2VCJ A;  3RKZ A;  1UYI A;  4FW9 A;  3J80 Q;  3T1H E;  3B8H A;  4DV0 E;  3KE6 A;  2FWY A;  4YHH I;  4DV2 E;  3T1Y E;  1UEK A;  4CWQ A;  4X65 I;  1UY8 A;  1TH8 A;  4YKZ A;  3D36 A;  4DR1 I;  4H81 A;  2J7K A;  2HFU A;  3ZZ0 A;  3PRY A;  4XKA A;  4E02 A;  3CGY A;  5BR8 E;  1S14 A;  1NHI A;  1N0V C;  4ZVI A;  3P06 A;  1HNX I;  1AH8 A;  4LF9 E;  4QPJ A;  3VHC A;  3V5R A;  5IN9 A;  1XNQ I;  2XCM A;  5BOC A;  5IT9 Q;  1ZM4 A;  2O1V A;  4DPU A;  4JV5 E;  4DU8 A;  3SL2 A;  4X64 I;  4USM A;  4JI5 I;  1YC1 A;  4EFU A;  3D2R A;  2GFD A;  2BU7 A;  2ZKJ A;  4X66 I;  3FT8 A;  4NXM I;  4LF4 I;  2GQP A;  3CRL A;  2UXB I;  4GEE A;  1Z59 A;  4HZ0 A;  4LWI A;  4DV7 E;  2CCS A;  4UT4 A;  4DUZ I;  2FWZ A;  2BU6 A;  2Z5B A;  4XIQ A;  4E01 A;  1FJG E;  3QDD A;  1YT1 A;  4FPP A;  1HNW E;  1ZM3 A;  1QYE A;  3HEK A;  4JQL A;  5CTY A;  4BIZ A;  4K0K I;  2VQF E;  2LJP A;  2CCU A;  5C93 A;  4FN5 A;  5J6A A;  4URL A;  3U67 A;  2YE5 A;  2BYI A;  2IOR A;  2DEJ A;  2YEB A;  2UU9 E;  2A2D A;  2F4V E;  1TBW A;  2WI3 A;  2WI2 A;  1XMQ I;  2YED A;  3PEH A;  3HHU A;  2Q8G A;  2Z5C A;  2XJX A;  4WUC A;  1YSZ A;  3TZ0 A;  3T0Z A;  2XK2 A;  2BU8 A;  1HK7 A;  3K99 A;  2DEI A;  4O09 A;  3VAD A;  3Q5L A;  1MU5 A;  4N3O A;  1H74 A;  2UXC I;  4XD8 A;  3T1K A;  2XJG A;  2JKI A;  4XCJ A;  1XMO E;  3J81 Q;  4DR4 E;  4JI2 E;  4DUZ E;  2UUB I;  1J5E E;  4XIR A;  1UYK A;  3K85 A;  1EA6 A;  2XDS A;  4JI3 I;  3JZ3 A;  4CWF A;  1XNR I;  4DR6 E;  4Z7Y A;  5M4M A;  3B82 A;  3LNU A;  2HG1 A;  3PYG A;  1H73 A;  2QG0 A;  3T0H A;  4RPF A;  1N32 I;  1UYH A;  2YI5 A;  2UXD I;  2Q8F A;  2HK3 A;  2XJJ A;  1HR0 E;  2YEG A;  5A2Q Q;  4GKJ E;  2ZIT A;  4LFC E;  2XD6 A;  3OTO E;  4AWQ A;  3LTO A;  3TTZ A;  2IWX A;  3OMU A;  1KVK A;  4FWD A;  2E0A A;  4AQY I;  2IWU A;  4PRX A;  3HZ5 A;  1RRE A;  5CPH A;  1ID0 A;  3A0T A;  3JAM C;  4DUY I;  1BXD A;  4EMD A;  5LMU E;  4YKT A;  2UUB E;  1FI4 A;  3K97 A;  1N34 I;  4AWP A;  1YER A;  1HNZ I;  4P8O A;  4JYA I;  1Z0V A;  4KSH A;  2FXS A;  4XE2 A;  4LF6 E;  4B3M I;  1H72 C;  3IED A;  4JI4 I;  1FJG I;  2XEX A;  1HNW I;  2WER A;  4NH9 A;  1S4E A;  3G75 A;  3TUH A;  4L94 A;  3NMQ A;  3VHA A;  4CE2 A;  2BM0 A;  3GON A;  3GIG A;  2YJW A;  4ASA A;  2UU9 I;  1Y6Z A;  1I59 A;  1BGQ A;  2H8M A;  2HK2 A;  4X62 E;  3J7A G;  4YKW A;  1NHH A;  3GIG B;  4YKR A;  2YEJ A;  1USU A;  4ED4 A;  4WUD A;  1I5B A;  1Z0E A;  5CTU A;  1YES A;  1WUU A;  4JI6 I;  2YKC A;  5L3J A;  4LWG A;  3B27 A;  2YE2 A;  4CE3 A;  2WI6 A;  2YE9 A;  3H80 A;  4B6C A;  1N34 E;  3B26 A;  2CGF A;  1HNZ E;  2VF3 A;  5M4P A;  1ZM2 A;  4DR4 I;  2C2A A;  5FLX C;  3PEJ A;  4AWO A;  1OJ4 A;  3INW A;  4HY1 A;  4MYU A;  4EEH A;  4DR5 I;  1A4H A;  1Y4U A;  4B3S I;  3T1H I;  3QT5 A;  3D0B A;  2E5L E;  4YHH E;  2BYH A;  2UUC I;  2YEA A;  4CWN A;  4ASF A;  4B3T E;  3FT5 A;  3Q6M A;  1AJ6 A;  4PL9 A;  2YGA A;  1N33 E;  1NHJ A;  4JI8 I;  5A2Q C;  3O2F A;  3OWD A;  4JAV A;  4DV3 E;  5M4H A;  1PKP A;  2V2Q A;  4P7A A;  4FCR A;  2V2V A;  4JG4 A;  2YE3 A;  4KTN A;  4FWG A;  4LF9 I;  4X9L A;  1ZXM A;  5FNC A;  1XNQ E;  2X36 A;  3OW6 A;  1YC4 A;  2K5B A;  2XX5 A;  3ZXO A;  1ZWH A;  4EGH A;  2YEI A;  2CH4 A;  4JV5 I;  4OX9 E;  4JI3 E;  4XDM A;  1Y8P A;  1FKA E;  4KP4 A;  2YI6 A;  1Y4S A;  4DV6 E;  4DU7 A;  4BQJ A;  1Z5C A;  2YGE A;  4HYM A;  2X7I A;  4WUB A;  4DPY A;  4E00 A;  2WW4 A;  5CF0 A;  2O1W A;  4IZK B;  4HAC B;  4H7Q A;  1Z5A A;  4DR7 I;  1ELO A;  4K0K E;  1UYF A;  4GFN A;  4URM A;  4DR3 E;  2UUA E;  4B3T I;  4NH8 A;  1MG7 A;  4B3R E;  3K60 A;  4LF7 I;  3T2S A;  1Z0T A;  1PVG A;  2HKJ A;  4CWO A;  3M6A A;  2Z5E A;  1DAR A;  4O04 A;  3Q5K A;  4LP0 A;  2AJ4 A;  1VIS A;  4IZJ D;  1RR9 A;  2BRC A;  1BKN A;  3U2K A;  4DV1 E;  4OX9 I;  3R4M A;  3DGE A;  4DPT A;  1USV A;  3J80 C;  1HNX E;  2YKI A;  3V2U C;  2UXC E;  4LF8 I;  3PYE A;  4MPE A;  2VWC A;  4V26 A;  1FNM A;  4X64 E;  1IBM E;  1UYC A;  5LL6 R;  1UYD A;  2R42 A;  1UYG A;  4LFB I;  3Q6N A;  4GKK E;  1KZN A;  4LWF A;  3CGZ A;  3CRK A;  3ZZU A;  5D7D A;  4GT8 A;  3A0Z A;  4YKX A;  4O05 A;  3QT6 A;  2UXD E;  1N36 I;  2E5L I;  1N0U A;  2YEC A;  4PRV A;  4KSG A;  1XHK A;  1FWK A;  2BRE A;  2XHT A;  4W7T A;  4LFC I;  4URN A;  2NPF A;  3EHF A;  4JI8 E;  2VQE I;  4JI0 E;  1XMQ E;  4DV1 I;  1FWL A;  3MNR P;  1UYE A;  2HHH I;  3G7B A;  1IBL E;  3CWV A;  3QTF A;  3Q5J A;  4HZ5 A;  3PYF A;  1Z5B A;  3ZKB A;  2BTZ A;  2Q2E B;  3EKO A;  2XHX A;  2V8P A;  4YY3 E;  3K98 A;  3TZ4 A;  4DV6 I;  3WU5 A;  4B7P A;  4JYA E;  4H85 A;  1Y8O A;  3INX A;  3T10 A;  3WU3 A;  4U93 A;  1TID A;  1UY6 A;  2XAB A;  4CWR A;  1D6T A;  2Q8H A;  3ZM7 A;  4MYT A;  4FMT A;  3R92 A;  1IBK E;  4JI1 E;  1N36 E;  4PU9 A;  2BT0 A;  3QT8 A;  1A6F A;  2O1U A;  2VW5 A;  3ZXQ A;  4GGL A;  4JAU A;  2YE7 A;  4XIT A;  2EXL A;  3HZ1 A;  1TC6 A;  5IDJ A;  3PYD A;  4CWP A;  1K47 A;  4B3R I;  4MPC A;  2PNM A;  4LF7 E;  2ESA A;  4O07 A;  4U7O A;  1HR0 I;  3R91 A;  1YET A;  4EMV A;  4GKJ I;  5D6P A;  5BR8 I;  4EGK A;  2ZM6 I;  4I5S A;  2HHH E;  4LPB A;  4URO A;  3R4O A;  4JI6 E;  2YK9 A;  2H55 A;  3A0R A;  3O6O A;  4JI5 E;  4XC0 A;  4YY3 I;  4LFA I;  2WI4 A;  2YEE A;  2HCH A;  4CWT A;  3HUL A;  4L91 A;  4IZK A;  4DUY E;  1B63 A;  4LF5 E;  4MPN A;  5LMU I;  2YE8 A;  4K4O A;  1TC0 A;  3EKR A;  5CTW A;  4L93 A;  4UTG A;  2CCT A;  2YKB A;  2O1T A;  4JAS A;  3B25 A;  4B3S E;  2ZBK B;  4JI1 I;  2FYP A;  2VQF I;  2CZ9 A;  2IWS A;  2YGF A;  1R62 A;  5GME A;  1Z0W A;  4JI4 E;  1UY7 A;  4CWS A;  3F0N A;  4BXI A;  2V2Z A;  1Y8N A;  3JAM Q;  4DV0 I;  1N33 I;  4GCZ A;  1ZW9 A;  4MBC A;  4MB9 A;  2YI0 A;  2WEP A;  3J81 C;  3Q1Q A;  1S16 A;  2ZM6 E;  4M1K A;  3EHJ A;  2WI1 A;  4JI0 I;  1MX0 A;  1Z0C A;  2QF6 A;  3R4N A;  1YT2 A;  4DUH A;  2PNR A;  4FWH A;  2JJC A;  2BV3 A;  5D6Q A;  4I3H A;  1THN A;  3RLP A;  2YEH A;  4USK A;  3A0X A;  2GQ0 A;  2HFS A;  4YKY A;  3HYY A;  4JI2 I;  2YKE A;  1J5E I;  2AKP A;  1I94 E;  3VHD A;  2YK2 A;  1PIE A;  2CGE A;  2YE6 A;  4EFT A;  2UXB E;  5IWA E;  2YEF A;  3B24 A;  4XCL A;  4DV7 I;  4KHP E;  5F5R A;  3WU6 A;  2WEQ A;  4FCP A;  4HY6 A;  2IOQ A;  2XDX A;  4DR5 E;  3O0I A;  5M4K A;  4IZJ A;  4DV4 E;  1AMW A;  3K17 A;  1N32 E;  4L8Z A;  2CG9 A;  4XKO A;  4DXL A;  2XX4 A;  4BIU A;  3B78 A;  3GIF A;  3HYZ A;  1AM1 A;  1US7 A;  2ZDY A;  2Q8I A;  5CTX A;  3WQ9 A;  4ASG A;  1I5A A;  1U2R A;  2GS8 A;  4AS9 A;  1GJV A;  1I58 A;  5M4E A;  1KKH A;  2OI2 A;  3A0Y A;  2YKJ A;  4AQY E;  1ZXN A;  3C0E A;  4LF8 E;  1YT0 A;  3GIE A;  1H7U A;  4R3M A;  1OSF A;  4DR2 I;  4ZKI A;  4YKQ A;  3B28 A;  5IT9 C;  1KTV A;  1I94 I;  2QG2 A;  3TZ2 A;  5F3K A;  1XMO I;  3C11 A;  4GKK I;  4Z7C A;  4V25 A;  3OPD A;  2QFO A;  4LF6 I;  2BU2 A;  4KQV A;  2BSM A;  3FV5 A;  3OWB A;  1GKX A;  1Z0B A;  1Z0G A;  3RLQ A;  2V34 A;  4DR7 E;  4NXN I;  2ZDX A;  4O0B A;  4NH7 A;  1QY8 A;  1B3Q A;  4QPK A;  4YKU A;  5LMN I;  1BYQ A;  2BM1 A;  1ZM9 A;  1U2O A;  1UYM A;  3QT7 A;  2E1R A;  3EHH A;  2VQE E;  2YJX A;  4X62 I;  4JI7 E;  4EM7 A;  2Z5B B;  4U7N A;  4R3A A;  2HKE A;  1IBL I;  2BZ5 A;  3OTO I;  4P52 A;  2VCI A;  2Z5C B;  1UYL A;  2IOP A;  3U2D A;  2XDK A;  4HXW A;  4BQG A;  3A0W A;  1AH6 A;  1B62 A;  5GMD A;  4X66 E;  1QZR A;  3WU4 A;  4XTJ A;  4NXM E;  2PNL A;  4LF4 E;  1TIL A;  5D7R A;  3TZ5 A;  5FNF A;  2WI5 A;  4XIP A;  1IBM I;  3BMY A;  4Q20 A;  4LFB E;  5IWA I;  1IBK I;  3WHA A;  4KHP I;  4L90 A;  4B3M E;  4DPW A;  4HXZ A;  2UUC E;  2XDU A;  4DV5 E;  4FCQ A;  5LMN E;  1L0O A;  1YC3 A;  3D4J A;  5M4N A;  2A2C A;  1U0Z A;  4DV4 I;  4ASB A;  5BOD A;  5GGZ A;  4DV2 I;  3T1Y I;  4GQT A;  4MOT A;  4DZY A;  2F4V I;  4DV3 I;  3LPS A;  4X65 E;  4MP7 A;  4JI7 I;  4BAE A;  4DR1 E;  4HAC A;  3R4P A;  4DPX A;  1YS3 A;  5IDM A;  3H4L A;  4HYP A;  3G7E A;  4LWH A;  4EGI A;  2XDL A;  4XKK A;  1UY9 A;  2EFG A;  1EI1 A;  1GKZ A;  4MP2 A;  5FLX Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...