3LNUA

Crystal structure of pare subunit
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
364
structure length
344
Chain Sequence
GLDPVKRRPGMYTDTARPNHLAQEVIDNSVDEALAGHAKQIEVTLYKDGSCEVSDDGRGMPVDIHPEEKIPGVELILTRLGVSVVNALSTKVELFIKREGSEHRMEFRDGNAASKLEVVGTVGKKNTGTRLRFWADPKYFDTPKFNVRALRHLLRAKAVLCPGLTVKLHDEATGEQDSWYFENGLRDYLKGEMAEHEMLPADLFVGSLKKDTEIVDWAAGWVPEGELVQESYVNLIPTAQHGTHVNGLRSGLTDALREFCDFRNLLPRGVKLAPEDVWDRVTFVLSLKMTDPQFSGQTKERLSSRQAAGFIEGAAHDAFSLYLNQNVEIGEKIAQIAIDRASAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Topoisomerase IV subunit B
publication title Crystal structure of ParE subunit
rcsb
source organism Xanthomonas oryzae pv. oryzae
molecule tags Isomerase
total genus 108
structure length 344
sequence length 364
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2010-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3lnuA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3lnuA01
3K99A 4EGKA 1EA6A 2AJ4A 4NXNI 2BZ5A 1RREA 1N32I 4AWPA 2UUCE 3G75A 4CWQA 5IWAI 1K47A 1KVKA 4ZKIA 2CGFA 3C0EA 1Y8NA 2YKIA 5D7CA 3TZ5A 2Q8HA 4X64I 4XIPA 2V8PA 4KP4A 1ZM2A 3PYFA 4O05A 2O1UA 2VCJA 3A0XA 4DUZE 4BAEA 4YKXA 4JI3I 2XDLA 3R4OA 1AH8A 4K4OA 3GIGA 3O6OA 2YEIA 2DEJA 2QG0A 4FPPA 4JI4I 2WEQA 2WI3A 2YE2A 4V26A 3A0RA 4AWOA 4LWEA 4ASAA 1XNQE 4KFGA 4NXMI 3BMYA 1JM6A 4AQYE 3T0ZA 3K17A 4FN5A 1N33E 4LFAE 4LF5I 2VWCA 3OWDA 2UXBI 2WI1A 4DPUA 1FI4A 5GMDA 1YS3A 3WU4A 2BU8A 2H8MA 2BRCA 2WI4A 4GKKI 3J81C 2XJJA 1UYFA 2R42A 4YKUA 4EEHA 4DR6I 2HG1A 5LMNI 4LFCE 4DPWA 2YE7A 2C2AA 3U2DA 4L8ZA 4HXZA 2WI2A 1IBMI 2YEHA 3HZ5A 4KSGA 4YKQA 4DR7I 1AMWA 1UYLA 5IDJA 3QT7A 4YY3I 2UUBI 2UUAE 1B62A 1UY9A 4CE1A 4JI0I 3RLRA 4R3AA 3G7BA 4CWNA 3D4JA 3TZ0A 2XHRA 2JJCA 4MP7A 4JYAE 2XX2A 1EI1A 4L93A 2CCTA 5CTWA 4GQTA 3SL2A 2WW4A 4UT4A 2J7KA 4MYUA 1N34I 4LP0A 4YKWA 3RKZA 1UYGA 4CWPA 1Y8OA 5LMUE 4DR1E 1N36E 4O09A 4DR5I 1TIDA 1HR0E 2IWXA 1NHHA 4FWDA 3FV5A 4JQLA 1TH8A 4XDMA 3BM9A 4CWTA 2VQFE 3HYYA 3CGYA 1PKPA 1XNRE 1WUUA 3T1YI 2V2QA 4LPBA 1HNXI 4NH9A 2UXCE 2BREA 1YC3A 2UU9I 1HNWE 2BV3A 4LWFA 4ASFA 1H73A 4X66I 2PNRA 4MB9A 2ESAA 4E00A 4GKJI 1XMOI 2YKJA 2XX5A 4DV2I 4O07A 4CWOA 5BODA 4JI2I 2K5BA 2HKEA 1ID0A 4HYPA 4DV5E 2YE5A 1H7UA 5CTUA 4HY6A 3WQ9A 4YKTA 2YK2A 1ZXNA 5D6PA 4JI7I 4MOTA 1TC0A 1YC4A 1I94I 1NZ0A 3J7AM 4ASBA 4MPNA 1US7A 4XKAA 1Z59A 4LF8E 5D6QA 4YKZA 1BYQA 2XDKA 3B26A 2UUCI 4U93A 4DPYA 4NH7A 3VHCA 3Q5JA 3PYGA 4DV4E 4LWIA 4DR4E 3GIFA 4CWRA 2GS8A 3A0YA 4B3ME 4X62E 3A0WA 1ZM3A 2HKJA 3ZXQA 5BR8I 2IOPA 4DUZI 2YE3A 2WI7A 1A6FA 4P8OA 4B3RE 2H55A 2BM0A 3CRLA 1RR9A 3Q5KA 4CE3A 1N0UA 2V34A 1UYIA 3CWVA 1KIJA 1A4HA 3INWA 4FMTA 2DEIA 1UYKA 3OTOE 4XKKA 4AQYI 4MP2A 1N33I 2YI6A 3Q1QA 2YI0A 3T1HE 4B3SE 4LF6I 1YESA 2V2VA 3ZZTA 2QF6A 4GCZA 2YEEA 5M4HA 2EXLA 3TZ2A 3B78A 3GIEA 3PYEA 2BSMA 1BXDA 4BXIA 4L91A 4HZ0A 2YJXA 4GGLA 3IEDA 4BQJA 1MG7A 5J71A 4LFCI 4DU8A 1D6TA 1J5EE 4DR2E 4LF4I 2EFGA 5FLXQ 1QY8A 2UWDA 4Q20A 1B3QA 4EFTA 5IN9A 3F0NA 2GFDA 2UUAI 2O1VA 2ZDYA 4XC0A 2E5LE 4DV0E 2YGEA 4DV1E 4URLA 3K60A 4DUHA 3RLPA 2BU6A 3K98A 4X9LA 4YKYA 4AS9A 4JYAI 3D0BA 2YE6A 4XCLA 2XABA 4EM7A 4E02A 3O0IA 3OW6A 2YGFA 4DUYE 4BQGA 2ZKJA 1OJ4A 5A2QQ 1GKZA 1NHIA 1Z5BA 5IWAE 4U7NA 4U7OA 4WUCA 2XDUA 5LMUI 4RPFA 2O1WA 3ZXOA 4DR1I 1N36I 1UYHA 2HHHI 3GONA 4M1KA 1HR0I 1BKNA 4LF9E 3Q5LA 4R1FA 3VADA 4YHHE 3GIGB 4KQVA 4EMDA 2VQFI 1L0OA 1HNZE 2JKIA 3HHUA 5M4KA 1XNRI 2UXDE 2WEPA 2XJXA 4JAUA 4JI8E 4KTNA 4USKA 2IWUA 4MPEA 2HK2A 2UXCI 2XX4A 3B82A 4GFNA 4JI4E 1HNWI 4OX9I 5D7RA 3R91A 2XEXA 2X7IA 2YI5A 4LWGA 3RLQA 4EMVA 4WUDA 3OPDA 4KHPE 1ZWHA 1KKHA 4R3MA 4JI6I 1YC1A 3ZZ0A 4LF5E 3EHJA 4DV5I 4E01A 1Z0BA 5FNFA 2UXBE 2BM1A 1Z5AA 3D36A 4PRXA 3A0ZA 1Y4UA 1PVGA 4DR3I 1MX0A 1FJGE 5GGZA 4GKKE 5FNDA 5CTXA 5F5RA 2ZBKB 4DPTA 2XHTA 2YE8A 5CPHA 4LF8I 1AH6A 2Q8GA 4PRVA 2YEAA 5IDMA 1R62A 1UYDA 3A0TA 3OWBA 4FWGA 4DV4I 4WUBA 4DR4I 1I5DA 4HACA 2FYPA 4QPJA 4FWHA 4HYMA 4HY1A 3EKOA 4B3MI 2CZ9A 3EHHA 2LJPA 1U0ZA 1UY8A 1I5AA 2YEBA 3VHAA 2Q8FA 4P52A 3J80Q 4B3RI 4EGIA 5FNCA 4ZVIA 4I5SA 1ZM4A 2ZM6I 2HFSA 4DXLA 1ZM9A 1XHKA 4DV6E 3DGEA 1Z0WA 4PU9A 4LF7E 1S4EA 3V5RA 3PEJA 4JI1E 3JAMQ 5D7DA 5IT9Q 3B28A 5LL6R 3OTOI 3R4NA 4H81A 2ZITA 4FCRA 4YKRA 1B63A 4H7QA 4DR5E 3HEKA 5C93A 4X65E 4URMA 4XCJA 4I3HA 3T1HI 4B3SI 2F4VE 4PL9A 4JV5E 1FKAE 1U2OA 3T1YE 1HNXE 3ZZUA 3QT5A 1YT1A 1ELOA 2WI5A 3JZ3A 1KTVA 4USMA 1IBLE 1Z0VA 4GKJE 2YK9A 1XMOE 4DR2I 1MU5A 2BU2A 3WU3A 1IBKE 1VISA 4K0KE 4XTJA 2CCSA 1XNQI 3K1JA 3KE6A 2VQEE 4LFAI 1S14A 4QPKA 2FXSA 2V2ZA 1Z0TA 4DV1I 1H74A 4JI7E 3J7AG 4EGHA 4DV7E 1UEKA 5BOCA 2XD6A 4Z7CA 3HZ1A 1Z5CA 4DUYI 1QZRA 3EKRA 4DV3E 2XDXA 4L90A 4KSHA 5CTYA 1S16A 3J81Q 2IWSA 4JG4A 2YEJA 4JI5E 4V25A 4LFBE 4B3TE 2WERA 4GT8A 5M4EA 1FNMA 1Z0EA 4W7TA 2E1RA 5BR8E 1ZW9A 2HFUA 5M4NA 3U2KA 4LF9I 2YE9A 2Q2EB 3WU5A 4YHHI 1AM1A 1TILA 1I5BA 2QFOA 3K97A 1HNZI 1XMQE 4EFUA 2UXDI 4JI8I 3TZ4A 1TBWA 4FCPA 4NXNE 1YSZA 1NHJA 1N32E 4L94A 1U2RA 4KHPI 3QT6A 2NPFA 4DU7A 3FT8A 4X64E 4HZ5A 3R4MA 3WU6A 3LPSA 2AKPA 2QG2A 4HXWA 1Z0CA 4LF6E 4XITA 2BTZA 3C11A 3PEHA 4JI3E 2GQPA 2XDSA 2YGAA 2BYHA 3FT5A 1FJGI 3R4PA 1I58A 5FLXC 2YKBA 4B7PA 2HK3A 2VCIA 4XKOA 3H80A 3D2RA 5M4MA 2OI2A 4LF4E 3B25A 4P7AA 4JAVA 4MPCA 4JASA 1N0VC 2VF3A 3LTOA 4NXME 1I59A 4XE2A 3B24A 1KZNA 2A2CA 3ZM7A 2E0AA 2ZDXA 3EHGA 1GJVA 2CG9A 5A2QC 2X36A 2YKCA 4O04A 4AWQA 2BU7A 4BIUA 1UYMA 3O2FA 4UTGA 3B8HA 1ZXMA 4DR6E 5LMNE 3MNRP 3TTZA 4DV6I 4LF7I 3CGZA 1Y4SA 4JI1I 1IBME 1PIEA 1QYEA 5L3JA 4DR7E 4O0BA 1H7SA 5M4PA 3ZKBA 4CWSA 2CCUA 1Z0GA 2R3VA 3QTFA 4YY3E 1H72C 2UUBE 2BT0A 3H4LA 4NH8A 2HHHE 1AJ6A 2BYIA 4X65I 3CRKA 4X62I 3HULA 3M6AA 4JI0E 1THNA 3NMQA 4CE2A 1I5CA 2F4VI 3R92A 4Z7YA 4JV5I 1Y8PA 4LWHA 2Q8IA 3T1KA 1GKXA 4H85A 1FWKA 2IORA 1UY6A 1YSRA 4MBCA 5J6AA 3LNUA 3V2UC 4OX9E 2YECA 3T2SA 2YEGA 1N34E 1IBLI 1YT0A 1YERA 3OMUA 2FWYA 1IBKI 4K0KI 1UYEA 4JI6E 4FCQA 4MYTA 5CF0A 2FWZA 2HCHA 2VQEI 4FW9A 2YEDA 4XIQA 2VW5A 4DZYA 3TUHA 3U67A 2IOQA 3G7EA 4XIRA 3INXA 1UYCA 3B27A 4B6CA 4BIZA 1YETA 4DR3E 2XHXA 5FWKA 4UROA 5F3KA 4DV7I 3ZKDA 1TC6A 2UU9E 1YT2A 2YJWA 4X66E 4URNA 3QDDA 1BGQA 2WI6A 4DV3I 1J5EI 3HYZA 3WHAA 2XCMA 2XK2A 2YI7A 2YEFA 4HACB 3PYDA 4ED4A 4DV2E 2XJGA 3VHDA 3J80C 4JI2E 4JI5I 4DPXA 4LFBI 3T0HA 4B3TI 1UY7A 2CH4A 2YE4A 2YKEA 4CWFA 3QT8A 2E5LI 4DV0I 3T10A 3EHFA 1OSFA 1DARA 3JAMC 5GMEA 4XD8A 4ASGA 5IT9C 2A2DA 2ZM6E 1XMQI 1I94E 4GEEA 2BU5A 1FWLA
chains in the Genus database with same CATH superfamily
3K99A 4EGKA 1EA6A 2AJ4A 4NXNI 3B4TA 2BZ5A 1RREA 1N32I 4AWPA 2UUCE 2GO3A 3G75A 4CWQA 5C0XA 5IWAI 1K47A 1KVKA 5DRRA 2JEAA 2CGFA 3C0EA 1Y8NA 2YKIA 5D7CA 5K36E 3TZ5A 2Q8HA 4X64I 4XIPA 2V8PA 2C1GA 2Z5EA 4KP4A 4LCFA 1ZM2A 3PYFA 4O05A 4OO1E 2O1UA 2VCJA 3A0XA 5ELWA 4DUZE 4BAEA 4YKXA 4JI3I 2XDLA 3R4OA 4OZEA 1AH8A 4K4OA 3GIGA 3O6OA 3CDJA 4IFDE 2YEIA 2DEJA 2QG0A 4FPPA 3PS3A 4JI4I 2WEQA 2WI3A 2YE2A 1XXEA 3A0RA 4V26A 4AWOA 5K36F 4LWEA 4ASAA 1XNQE 2BA1D 4KFGA 4NXMI 3BMYA 1JM6A 4AQYE 4MU0A 4OO1F 3K17A 4FN5A 1N33E 3T0ZA 4LFAE 4LF5I 2VWCA 3OWDA 2UXBI 2WI1A 2BA0G 4DPUA 1FI4A 5GMDA 1YS3A 3WU4A 2BU8A 2H8MA 2BRCA 4IFDF 2WI4A 4ZKIA 4GKKI 3L7ZA 3J81C 3M85G 2XJJA 4AM3A 2R42A 1UYFA 4YKUA 4EEHA 4DR6I 2HG1A 5LMNI 4LFCE 4DPWA 2YE7A 1RHYA 2C2AA 3U2DA 4L8ZA 4HXZA 2WI2A 1IBMI 2C37B 2YEHA 3HZ5A 3PRYA 4KSGA 4YKQA 4DR7I 3P3GA 1AMWA 5K36D 1UYLA 5IDJA 3QT7A 4YY3I 2UUBI 4IZJB 1VI7A 2UUAE 4LPFA 1B62A 4OO1D 1UY9A 4CE1A 4JI0I 3RLRA 4R3AA 3G7BA 4CWNA 3D4JA 3TZ0A 2XHRA 2JJCA 4GQUA 4JYAE 2XX2A 4MP7A 3M7ND 1EI1A 4L93A 2CCTA 4IFDD 5CTWA 2IERA 4GQTA 3SL2A 2WW4A 4UT4A 2J7KA 4MYUA 1N34I 4LP0A 4YKWA 3RKZA 2WP8B 1UYGA 4CWPA 1Y8OA 5LMUE 2PNLA 4DR1E 1N36E 4O09A 4DR5I 1TIDA 1HR0E 2IWXA 2PO0A 1NHHA 4FWDA 3FV5A 4JQLA 1TH8A 4J3DA 4XDMA 3BM9A 2C38A 2VQFE 4CWTA 3HYYA 3CGYA 1PKPA 1XNRE 1WUUA 3T1YI 2V2QA 4LPBA 1HNXI 4NH9A 2UXCE 2BREA 1YC3A 2UU9I 1HNWE 2BV3A 4OO1A 4LWFA 4ASFA 1H73A 4X66I 2PNRA 4MB9A 4AIMA 2ESAA 4E00A 4GKJI 3GMEA 1XMOI 2YKJA 2PO2A 2XX5A 4DV2I 4O07A 4CWOA 5BODA 4JI2I 2K5BA 2HKEA 1ID0A 4HYPA 4DV5E 4IFDA 2Z5BB 2YE5A 1H7UA 5CTUA 4HY6A 3WQ9A 4YKTA 2YK2A 1ZXNA 4BA2A 3P3CA 4JI7I 5D6PA 4MOTA 1TC0A 2JE6B 1YC4A 1I94I 5JENA 1NZ0A 3J7AM 4ASBA 3NZKA 4MPNA 1US7A 4XKAA 1Z59A 4LF8E 5D6QA 1E3PA 1BYQA 2XDKA 3B26A 2UUCI 4YKZA 4U93A 4DPYA 4NH7A 3VHCA 3Q5JA 3PYGA 4DV4E 4LWIA 4DR4E 3GIFA 4CWRA 3Q6NA 2GS8A 3A0YA 4B3ME 1P42A 2Z5CA 4X62E 3A0WA 1ZM3A 2HKJA 3ZXQA 2C38B 5BR8I 2IOPA 4DUZI 2YE3A 2WI7A 1A6FA 4P8OA 4B3RE 2J65A 2H55A 2BM0A 3CRLA 1RR9A 2F1DA 2C39A 3Q5KA 4CE3A 1N0UA 2V34A 1UYIA 3CWVA 1KIJA 1A4HA 3INWA 4FMTA 2DEIA 1UYKA 3OTOE 4XKKA 4AQYI 1UDNA 4MP2A 1N33I 2YI6A 2NN6B 2PO1A 3Q1QA 2YI0A 3T1HE 4B3SE 1E3HA 4LF6I 1YESA 3LMMA 2V2VA 3ZZTA 2QF6A 4GCZA 2YEEA 5M4HA 2EXLA 4LOMA 5DNXA 3TZ2A 3B78A 4FW6A 3PYEA 2BSMA 3CYGA 3GIEA 4BXIA 1BXDA 2JEBB 2PNZA 4L91A 4HZ0A 1UDQA 2YJXA 4GGLA 3IEDA 4BQJA 1MG7A 2VESA 5J71A 4LFCI 4DU8A 1D6TA 2BR2B 4NBQA 1J5EE 4DR2E 3HKMA 4IS9A 3UHMA 4LF4I 2O1TA 2EFGA 5FLXQ 1QY8A 2UWDA 4Q20A 1B3QA 4IZKB 5DRPA 1OYRA 4EFTA 5IN9A 3F0NA 3K85A 2GFDA 2UUAI 2O1VA 2ZDYA 4XC0A 2E5LE 4DV0E 2YGEA 4DV1E 4URLA 3K60A 4DUHA 3RLPA 2BU6A 3K98A 5JEAB 4X9LA 4YKYA 3U1KA 4JYAI 3D0BA 3OWBA 4AS9A 2YE6A 4XCLA 4ISAA 2XABA 4EM7A 4E02A 3O0IA 3OW6A 4U3BA 2YGFA 4DUYE 4BQGA 2BA0D 2ZKJA 1OJ4A 5A2QQ 1GKZA 5C0XB 2JEAB 1NHIA 2PNMA 1Z5BA 5IWAE 2CGEA 4U7NA 3M85D 4U7OA 4WUCA 1Y5YA 3Q6MA 2XDUA 5LMUI 2O1WA 4RPFA 3ZXOA 4DR1I 1N36I 1R6LA 1UYHA 2HHHI 3GONA 4M1KA 1HR0I 2C1IA 1BKNA 3P76A 3CDIA 4LF9E 3Q5LA 4R1FA 3U1YA 4YHHE 3P3EA 3GIGB 4KQVA 4EMDA 2VQFI 1L0OA 1HNZE 2JKIA 3HHUA 5M4KA 1USUA 2NN6C 5DNLA 1XNRI 2UXDE 2WEPA 4JI8E 3HJCA 4USKA 2IWUA 2XJXA 2HK2A 2UXCI 4KTNA 2XX4A 3B82A 4GFNA 4JI4E 1HNWI 4U3DA 4OX9I 5D7RA 3R91A 2XEXA 2X7IA 2YI5A 4LWGA 3RLQA 4EMVA 4WUDA 3OPDA 3GLLA 4KHPE 1ZWHA 1KKHA 4R3MA 1UDOA 4JI6I 1YC1A 3ZZ0A 4LF5E 3EHJA 4DV5I 4E01A 1Z0BA 5FNFA 2UXBE 2BM1A 1Z5AA 3D36A 4PRXA 3A0ZA 1Y4UA 1PVGA 3L7ZB 1MX0A 4DR3I 1FJGE 5GGZA 4GKKE 5FNDA 5K36A 5CTXA 3PS1A 1Y60A 5F5RA 2ZBKB 5JEAC 4DPTA 2XHTA 2YE8A 5CPHA 4LF8I 1AH6A 2Q8GA 5JEAF 4PRVA 2YEAA 5IDMA 1R62A 1UYDA 1HK7A 3A0TA 4FWGA 4DV4I 4WUBA 4DR4I 1I5DA 4HACA 2FYPA 4QPJA 5C0XC 4FWHA 4HYMA 4HY1A 3EKOA 4FW4A 2CZ9A 4B3MI 1IXMA 5C0XF 2LJPA 3EHHA 1U0ZA 2WNRA 1UY8A 1R6MA 1I5AA 2YEBA 3VHAA 2Q8FA 4P52A 3J80Q 4B3RI 4EGIA 1OYPA 5FNCA 4ZVIA 4I5SA 1ZM4A 2ZM6I 2HFSA 2CVEA 4DXLA 1ZM9A 1XHKA 4DV6E 3DGEA 1Z0WA 4PU9A 3GCMA 4LF7E 1S4EA 3V5RA 3PEJA 4JI1E 3JAMQ 5D7DA 5IT9Q 3B28A 5LL6R 3OTOI 3R4NA 4H81A 5JEAD 2ZITA 4FCRA 4YKRA 1B63A 2PO0B 4H7QA 4DR5E 3HEKA 5C93A 4X65E 4URMA 4XCJA 4I3HA 3T1HI 4B3SI 2F4VE 4FW3A 5C0XD 4JV5E 4PL9A 5K36B 1FKAE 1U2OA 3T1YE 1HNXE 2JT2A 3ZZUA 3QT5A 5DRQA 4OO1B 1YT1A 1ELOA 2WI5A 3JZ3A 1KTVA 4IZJD 4USMA 1IBLE 1Z0VA 2PO2B 4MU4A 4GKJE 2YK9A 1XMOE 4QNKA 4DR2I 1MU5A 2BU2A 3WU3A 1IBKE 1VISA 4K0KE 4XTJA 2CCSA 1XNQI 4IFDB 3K1JA 3KE6A 3S5TA 2VQEE 4LFAI 1S14A 4QPKA 1Y6ZA 2FXSA 2V2ZA 4BA2B 1Z0TA 4DV1I 1H74A 1OYSA 4JI7E 4AIDA 2GO4A 3J7AG 4EGHA 4DV7E 1UEKA 5BOCA 2XD6A 4Z7CA 3HZ1A 1Z5CA 4DUYI 1QZRA 3PS2A 1F51A 3EKRA 4DV3E 2XDXA 4L90A 4OKGA 4KSHA 5CTYA 1S16A 3J81Q 2IWSA 2C37A 4JG4A 2YEJA 4JI5E 4V25A 2Z5CB 4LFBE 4B3TE 2WERA 4GT8A 3VADA 5M4EA 1FNMA 4IZJA 1Z0EA 4W7TA 2E1RA 5BR8E 1ZW9A 2HFUA 5M4NA 3U2KA 4LF9I 2YE9A 2Q2EB 2C39B 3WU5A 4YHHI 1AM1A 1TILA 1I5BA 2QFOA 3K97A 1HNZI 1XMQE 4EFUA 2UXDI 4JI8I 2BA1G 3TZ4A 1TBWA 4FCPA 4NXNE 1YSZA 5K36C 1NHJA 1N32E 4L94A 2NN6E 1U2RA 4N3OA 4KHPI 4OO1C 3QT6A 2NPFA 4DU7A 3FT8A 2WP8A 4X64E 4HZ5A 2GQ0A 3R4MA 3WU6A 2PO1B 3LPSA 2AKPA 2QG2A 4HXWA 1Z0CA 4LF6E 4XITA 2BTZA 3C11A 3PEHA 4IFDC 4JI3E 2GQPA 2PNZB 2XDSA 2YGAA 2BYHA 3FT5A 1FJGI 3R4PA 1I58A 4FW7A 5FLXC 2YKBA 4B7PA 2HK3A 2IESA 2NN6F 2VCIA 4XKOA 3H80A 3D2RA 5M4MA 2OI2A 4LF4E 3B25A 4P7AA 4JAVA 4MPCA 2HHIA 4JASA 1N0VC 2VF3A 3LTOA 4NXME 5JEAE 4MDTA 1I59A 4XE2A 3B24A 3KRNA 2A2CA 1KZNA 5EKWA 3M7NG 2FTKA 3ZM7A 2E0AA 2ZDXA 3H1CA 3EHGA 4MQYA 2Z5BA 4BA1A 1GJVA 2CG9A 5A2QC 2X36A 2YKCA 4O04A 5C0XE 4AWQA 2BU7A 4E72A 4BIUA 1UYMA 3O2FA 1USVA 4UTGA 2JE6A 3DD6A 2O3ZA 3B8HA 1ZXMA 4DR6E 2AE8A 5LMNE 3MNRP 3TTZA 4DV6I 2NN6D 3P06A 4LF7I 3CGZA 1Y4SA 4JI1I 1IBME 1PIEA 1QYEA 5L3JA 4DR7E 4O0BA 1H7SA 4LCHA 3ZKBA 5M4PA 4CWSA 2CCUA 1Z0GA 2R3VA 3QTFA 4YY3E 1H72C 2UUBE 2BT0A 3H4LA 4NH8A 2HHHE 1AJ6A 2BYIA 4X65I 3CRKA 4X62I 3HULA 3M6AA 4MU1A 4JI0E 1THNA 3NMQA 4CE2A 1I5CA 4JAUA 2F4VI 3R92A 4Z7YA 4JV5I 1Y8PA 4LWHA 2Q8IA 3T1KA 1GKXA 4H85A 1FWKA 2IORA 1UY6A 1YSRA 4MBCA 5J6AA 3LNUA 3V2UC 4OX9E 5EL9A 2YECA 3T2SA 2YEGA 1N34E 1IBLI 1YT0A 1YERA 3OMUA 2FWYA 1IBKI 4K0KI 1UYEA 4JI6E 4FCQA 4MYTA 5CF0A 5DROA 2FWZA 2HCHA 2VQEI 4FW9A 2YEDA 4XIQA 2VW5A 4DZYA 4BA1B 3TUHA 4QNJA 3U67A 2IOQA 3G7EA 1YHCA 4XIRA 3INXA 1UYCA 2NN6A 3B27A 4B6CA 4BIZA 1YETA 4DR3E 2XHXA 5FWKA 4UROA 4MPEA 5F3KA 4DV7I 3ZKDA 1TC6A 2JEBA 2UU9E 1YT2A 2YJWA 4X66E 1UDSA 4URNA 3QDDA 1BGQA 2WI6A 4FW5A 4DV3I 1J5EI 3HYZA 3WHAA 2XCMA 2XK2A 2BR2A 2YI7A 2YEFA 4HACB 3PYDA 4ED4A 4DV2E 2XJGA 3VHDA 1YH8A 3J80C 4JI2E 4JI5I 4LCGA 4DPXA 4LFBI 3T0HA 4B3TI 1UY7A 2WNRB 4IZKA 2CH4A 2YE4A 2YKEA 4CWFA 3QT8A 2E5LI 4DV0I 3T10A 3EHFA 1OSFA 1DARA 3JAMC 5GMEA 4XD8A 4ASGA 5IT9C 5JEAA 2A2DA 2ZM6E 1XMQI 1I94E 4GEEA 2BU5A 1FWLA 4MU3A
chains in the Genus database with same CATH topology
3K99A 4EGKA 1EA6A 2AJ4A 4NXNI 2BZ5A 1RREA 1N32I 4AWPA 2UUCE 3G75A 4CWQA 5IWAI 1K47A 1KVKA 4ZKIA 2CGFA 3C0EA 1Y8NA 2YKIA 5D7CA 3TZ5A 2Q8HA 4X64I 4XIPA 2V8PA 2Z5EA 4KP4A 1ZM2A 3PYFA 4O05A 2O1UA 2VCJA 3A0XA 4DUZE 4BAEA 4YKXA 4JI3I 2XDLA 3R4OA 1AH8A 4K4OA 3GIGA 3O6OA 2YEIA 2DEJA 2QG0A 4FPPA 4JI4I 2WEQA 2WI3A 2YE2A 4V26A 3A0RA 4AWOA 4LWEA 4ASAA 1XNQE 4KFGA 4NXMI 3BMYA 1JM6A 4AQYE 3T0ZA 3K17A 4FN5A 1N33E 4LFAE 4LF5I 2VWCA 3OWDA 2UXBI 2WI1A 4DPUA 1FI4A 5GMDA 1YS3A 3WU4A 2BU8A 2H8MA 2BRCA 2WI4A 4GKKI 3J81C 2XJJA 1UYFA 2R42A 4YKUA 4EEHA 4DR6I 2HG1A 5LMNI 4LFCE 4DPWA 2YE7A 2C2AA 3U2DA 4L8ZA 4HXZA 2WI2A 1IBMI 2YEHA 3HZ5A 3PRYA 4KSGA 4YKQA 4DR7I 1AMWA 1UYLA 5IDJA 3QT7A 4YY3I 2UUBI 4IZJB 2UUAE 1B62A 1UY9A 4CE1A 4JI0I 3RLRA 4R3AA 3G7BA 4CWNA 3D4JA 3TZ0A 2XHRA 2JJCA 4MP7A 4JYAE 2XX2A 1EI1A 4L93A 2CCTA 5CTWA 4GQTA 3SL2A 2WW4A 4UT4A 2J7KA 4MYUA 1N34I 4LP0A 4YKWA 3RKZA 1UYGA 4CWPA 1Y8OA 5LMUE 2PNLA 4DR1E 1N36E 4O09A 4DR5I 1TIDA 1HR0E 2IWXA 1NHHA 4FWDA 3FV5A 4JQLA 1TH8A 4XDMA 3BM9A 4CWTA 2VQFE 3HYYA 3CGYA 1PKPA 1XNRE 1WUUA 3T1YI 2V2QA 4LPBA 1HNXI 4NH9A 2UXCE 2BREA 1YC3A 2UU9I 1HNWE 2BV3A 4LWFA 4ASFA 1H73A 4X66I 2PNRA 4MB9A 2ESAA 4E00A 4GKJI 1XMOI 2YKJA 2XX5A 4DV2I 4O07A 4CWOA 5BODA 4JI2I 2K5BA 2HKEA 1ID0A 4HYPA 4DV5E 2Z5BB 2YE5A 1H7UA 5CTUA 4HY6A 3WQ9A 4YKTA 2YK2A 1ZXNA 5D6PA 4JI7I 4MOTA 1TC0A 1YC4A 1I94I 1NZ0A 3J7AM 4ASBA 4MPNA 1US7A 4XKAA 1Z59A 4LF8E 5D6QA 4YKZA 1BYQA 2XDKA 3B26A 2UUCI 4U93A 4DPYA 4NH7A 3VHCA 3Q5JA 3PYGA 4DV4E 4LWIA 4DR4E 3GIFA 4CWRA 3Q6NA 2GS8A 3A0YA 4B3ME 2Z5CA 4X62E 3A0WA 1ZM3A 2HKJA 3ZXQA 5BR8I 2IOPA 4DUZI 2YE3A 2WI7A 1A6FA 4P8OA 4B3RE 2H55A 2BM0A 3CRLA 1RR9A 3Q5KA 4CE3A 1N0UA 2V34A 1UYIA 3CWVA 1KIJA 1A4HA 3INWA 4FMTA 2DEIA 1UYKA 3OTOE 4XKKA 4AQYI 4MP2A 1N33I 2YI6A 3Q1QA 2YI0A 3T1HE 4B3SE 4LF6I 1YESA 2V2VA 3ZZTA 2QF6A 4GCZA 2YEEA 5M4HA 2EXLA 3TZ2A 3B78A 3GIEA 3PYEA 2BSMA 1BXDA 4BXIA 4L91A 4HZ0A 2YJXA 4GGLA 3IEDA 4BQJA 1MG7A 5J71A 4LFCI 4DU8A 1D6TA 1J5EE 4DR2E 4LF4I 2O1TA 2EFGA 5FLXQ 1QY8A 2UWDA 4Q20A 1B3QA 4IZKB 4EFTA 5IN9A 3F0NA 3K85A 2GFDA 2UUAI 2O1VA 2ZDYA 4XC0A 2E5LE 4DV0E 2YGEA 4DV1E 4URLA 3K60A 4DUHA 3RLPA 2BU6A 3K98A 4X9LA 4YKYA 4AS9A 4JYAI 3D0BA 3OWBA 2YE6A 4XCLA 2XABA 4EM7A 4E02A 3O0IA 3OW6A 2YGFA 4DUYE 4BQGA 2ZKJA 1OJ4A 5A2QQ 1GKZA 1NHIA 2PNMA 1Z5BA 5IWAE 2CGEA 4U7NA 4U7OA 4WUCA 3Q6MA 2XDUA 5LMUI 2O1WA 4RPFA 3ZXOA 4DR1I 1N36I 1UYHA 2HHHI 3GONA 4M1KA 1HR0I 1BKNA 4LF9E 3Q5LA 4R1FA 3VADA 4YHHE 3GIGB 4KQVA 4EMDA 2VQFI 1L0OA 1HNZE 2JKIA 3HHUA 5M4KA 1USUA 1XNRI 2UXDE 2WEPA 2XJXA 4JAUA 4JI8E 3HJCA 4USKA 2IWUA 4KTNA 2HK2A 2UXCI 2XX4A 3B82A 4GFNA 4JI4E 1HNWI 4OX9I 5D7RA 3R91A 2XEXA 2X7IA 2YI5A 4LWGA 3RLQA 4EMVA 4WUDA 3OPDA 4KHPE 1ZWHA 1KKHA 4R3MA 4JI6I 1YC1A 3ZZ0A 4LF5E 3EHJA 4DV5I 4E01A 1Z0BA 5FNFA 2UXBE 2BM1A 1Z5AA 3D36A 4PRXA 3A0ZA 1Y4UA 1PVGA 4DR3I 1MX0A 1FJGE 5GGZA 4GKKE 5FNDA 5CTXA 5F5RA 2ZBKB 4DPTA 2XHTA 2YE8A 5CPHA 4LF8I 1AH6A 2Q8GA 4PRVA 2YEAA 5IDMA 1R62A 1UYDA 1HK7A 3A0TA 4FWGA 4DV4I 4WUBA 4DR4I 1I5DA 4HACA 2FYPA 4QPJA 4FWHA 4HYMA 4HY1A 3EKOA 4B3MI 2CZ9A 3EHHA 2LJPA 1U0ZA 1UY8A 1I5AA 2YEBA 3VHAA 2Q8FA 4P52A 3J80Q 4B3RI 4EGIA 5FNCA 4ZVIA 4I5SA 1ZM4A 2ZM6I 2HFSA 4DXLA 1ZM9A 1XHKA 4DV6E 3DGEA 1Z0WA 4PU9A 4LF7E 1S4EA 3V5RA 3PEJA 4JI1E 3JAMQ 5D7DA 5IT9Q 3B28A 5LL6R 3OTOI 3R4NA 4H81A 2ZITA 4FCRA 4YKRA 1B63A 4H7QA 4DR5E 3HEKA 5C93A 4X65E 4URMA 4XCJA 4I3HA 3T1HI 4B3SI 2F4VE 4PL9A 4JV5E 1FKAE 1U2OA 3T1YE 1HNXE 3ZZUA 3QT5A 1YT1A 1ELOA 2WI5A 3JZ3A 1KTVA 4IZJD 4USMA 1IBLE 1Z0VA 4GKJE 2YK9A 1XMOE 4DR2I 1MU5A 2BU2A 3WU3A 1IBKE 1VISA 4K0KE 4XTJA 2CCSA 1XNQI 3K1JA 3KE6A 2VQEE 4LFAI 1S14A 4QPKA 1Y6ZA 2FXSA 2V2ZA 1Z0TA 4DV1I 1H74A 4JI7E 3J7AG 4EGHA 4DV7E 1UEKA 5BOCA 2XD6A 4Z7CA 3HZ1A 1Z5CA 4DUYI 1QZRA 3EKRA 4DV3E 2XDXA 4L90A 4KSHA 5CTYA 1S16A 3J81Q 2IWSA 4JG4A 2YEJA 4JI5E 4V25A 2Z5CB 4LFBE 4B3TE 2WERA 4GT8A 5M4EA 1FNMA 4IZJA 1Z0EA 4W7TA 2E1RA 5BR8E 1ZW9A 2HFUA 5M4NA 3U2KA 4LF9I 2YE9A 2Q2EB 3WU5A 4YHHI 1AM1A 1TILA 1I5BA 2QFOA 3K97A 1HNZI 1XMQE 4EFUA 2UXDI 4JI8I 3TZ4A 1TBWA 4FCPA 4NXNE 1YSZA 1NHJA 1N32E 4L94A 1U2RA 4N3OA 4KHPI 3QT6A 2NPFA 4DU7A 3FT8A 4X64E 4HZ5A 2GQ0A 3R4MA 3WU6A 3LPSA 2AKPA 2QG2A 4HXWA 1Z0CA 4LF6E 4XITA 2BTZA 3C11A 3PEHA 4JI3E 2GQPA 2XDSA 2YGAA 2BYHA 3FT5A 1FJGI 3R4PA 1I58A 5FLXC 2YKBA 4B7PA 2HK3A 2VCIA 4XKOA 3H80A 3D2RA 5M4MA 2OI2A 4LF4E 3B25A 4P7AA 4JAVA 4MPCA 4JASA 1N0VC 2VF3A 3LTOA 4NXME 1I59A 4XE2A 3B24A 1KZNA 2A2CA 3ZM7A 2E0AA 2ZDXA 3EHGA 2Z5BA 1GJVA 2CG9A 5A2QC 2X36A 2YKCA 4O04A 4AWQA 2BU7A 4BIUA 1UYMA 3O2FA 1USVA 4UTGA 3B8HA 1ZXMA 4DR6E 5LMNE 3MNRP 3TTZA 4DV6I 3P06A 4LF7I 3CGZA 1Y4SA 4JI1I 1IBME 1PIEA 1QYEA 5L3JA 4DR7E 4O0BA 1H7SA 5M4PA 3ZKBA 4CWSA 2CCUA 1Z0GA 2R3VA 3QTFA 4YY3E 1H72C 2UUBE 2BT0A 3H4LA 4NH8A 2HHHE 1AJ6A 2BYIA 4X65I 3CRKA 4X62I 3HULA 3M6AA 4JI0E 1THNA 3NMQA 4CE2A 1I5CA 2F4VI 3R92A 4Z7YA 4JV5I 1Y8PA 4LWHA 2Q8IA 3T1KA 1GKXA 4H85A 1FWKA 2IORA 1UY6A 1YSRA 4MBCA 5J6AA 3LNUA 3V2UC 4OX9E 2YECA 3T2SA 2YEGA 1N34E 1IBLI 1YT0A 1YERA 3OMUA 2FWYA 1IBKI 4K0KI 1UYEA 4JI6E 4FCQA 4MYTA 5CF0A 2FWZA 2HCHA 2VQEI 4FW9A 2YEDA 4XIQA 2VW5A 4DZYA 3TUHA 3U67A 2IOQA 3G7EA 4XIRA 3INXA 1UYCA 3B27A 4B6CA 4BIZA 1YETA 4DR3E 2XHXA 5FWKA 4UROA 4MPEA 5F3KA 4DV7I 3ZKDA 1TC6A 2UU9E 1YT2A 2YJWA 4X66E 4URNA 3QDDA 1BGQA 2WI6A 4DV3I 1J5EI 3HYZA 3WHAA 2XCMA 2XK2A 2YI7A 2YEFA 4HACB 4DV2E 3PYDA 4ED4A 2XJGA 3VHDA 3J80C 4JI2E 4JI5I 4DPXA 4LFBI 3T0HA 4B3TI 1UY7A 4IZKA 2CH4A 2YE4A 2YKEA 4CWFA 3QT8A 2E5LI 4DV0I 3T10A 3EHFA 1OSFA 1DARA 3JAMC 5GMEA 4XD8A 4ASGA 5IT9C 2A2DA 2ZM6E 1XMQI 1I94E 4GEEA 2BU5A 1FWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K99 A;  4EGK A;  1EA6 A;  2AJ4 A;  4NXN I;  2BZ5 A;  1RRE A;  1N32 I;  4AWP A;  2UUC E;  3G75 A;  4CWQ A;  5IWA I;  1K47 A;  1KVK A;  4ZKI A;  2CGF A;  3C0E A;  1Y8N A;  2YKI A;  5D7C A;  3TZ5 A;  2Q8H A;  4X64 I;  4XIP A;  2V8P A;  4KP4 A;  1ZM2 A;  3PYF A;  4O05 A;  2O1U A;  2VCJ A;  3A0X A;  4DUZ E;  4BAE A;  4YKX A;  4JI3 I;  2XDL A;  3R4O A;  1AH8 A;  4K4O A;  3GIG A;  3O6O A;  2YEI A;  2DEJ A;  2QG0 A;  4FPP A;  4JI4 I;  2WEQ A;  2WI3 A;  2YE2 A;  4V26 A;  3A0R A;  4AWO A;  4LWE A;  4ASA A;  1XNQ E;  4KFG A;  4NXM I;  3BMY A;  1JM6 A;  4AQY E;  3T0Z A;  3K17 A;  4FN5 A;  1N33 E;  4LFA E;  4LF5 I;  2VWC A;  3OWD A;  2UXB I;  2WI1 A;  4DPU A;  1FI4 A;  5GMD A;  1YS3 A;  3WU4 A;  2BU8 A;  2H8M A;  2BRC A;  2WI4 A;  4GKK I;  3J81 C;  2XJJ A;  1UYF A;  2R42 A;  4YKU A;  4EEH A;  4DR6 I;  2HG1 A;  5LMN I;  4LFC E;  4DPW A;  2YE7 A;  2C2A A;  3U2D A;  4L8Z A;  4HXZ A;  2WI2 A;  1IBM I;  2YEH A;  3HZ5 A;  4KSG A;  4YKQ A;  4DR7 I;  1AMW A;  1UYL A;  5IDJ A;  3QT7 A;  4YY3 I;  2UUB I;  2UUA E;  1B62 A;  1UY9 A;  4CE1 A;  4JI0 I;  3RLR A;  4R3A A;  3G7B A;  4CWN A;  3D4J A;  3TZ0 A;  2XHR A;  2JJC A;  4MP7 A;  4JYA E;  2XX2 A;  1EI1 A;  4L93 A;  2CCT A;  5CTW A;  4GQT A;  3SL2 A;  2WW4 A;  4UT4 A;  2J7K A;  4MYU A;  1N34 I;  4LP0 A;  4YKW A;  3RKZ A;  1UYG A;  4CWP A;  1Y8O A;  5LMU E;  4DR1 E;  1N36 E;  4O09 A;  4DR5 I;  1TID A;  1HR0 E;  2IWX A;  1NHH A;  4FWD A;  3FV5 A;  4JQL A;  1TH8 A;  4XDM A;  3BM9 A;  4CWT A;  2VQF E;  3HYY A;  3CGY A;  1PKP A;  1XNR E;  1WUU A;  3T1Y I;  2V2Q A;  4LPB A;  1HNX I;  4NH9 A;  2UXC E;  2BRE A;  1YC3 A;  2UU9 I;  1HNW E;  2BV3 A;  4LWF A;  4ASF A;  1H73 A;  4X66 I;  2PNR A;  4MB9 A;  2ESA A;  4E00 A;  4GKJ I;  1XMO I;  2YKJ A;  2XX5 A;  4DV2 I;  4O07 A;  4CWO A;  5BOD A;  4JI2 I;  2K5B A;  2HKE A;  1ID0 A;  4HYP A;  4DV5 E;  2YE5 A;  1H7U A;  5CTU A;  4HY6 A;  3WQ9 A;  4YKT A;  2YK2 A;  1ZXN A;  5D6P A;  4JI7 I;  4MOT A;  1TC0 A;  1YC4 A;  1I94 I;  1NZ0 A;  3J7A M;  4ASB A;  4MPN A;  1US7 A;  4XKA A;  1Z59 A;  4LF8 E;  5D6Q A;  4YKZ A;  1BYQ A;  2XDK A;  3B26 A;  2UUC I;  4U93 A;  4DPY A;  4NH7 A;  3VHC A;  3Q5J A;  3PYG A;  4DV4 E;  4LWI A;  4DR4 E;  3GIF A;  4CWR A;  2GS8 A;  3A0Y A;  4B3M E;  4X62 E;  3A0W A;  1ZM3 A;  2HKJ A;  3ZXQ A;  5BR8 I;  2IOP A;  4DUZ I;  2YE3 A;  2WI7 A;  1A6F A;  4P8O A;  4B3R E;  2H55 A;  2BM0 A;  3CRL A;  1RR9 A;  3Q5K A;  4CE3 A;  1N0U A;  2V34 A;  1UYI A;  3CWV A;  1KIJ A;  1A4H A;  3INW A;  4FMT A;  2DEI A;  1UYK A;  3OTO E;  4XKK A;  4AQY I;  4MP2 A;  1N33 I;  2YI6 A;  3Q1Q A;  2YI0 A;  3T1H E;  4B3S E;  4LF6 I;  1YES A;  2V2V A;  3ZZT A;  2QF6 A;  4GCZ A;  2YEE A;  5M4H A;  2EXL A;  3TZ2 A;  3B78 A;  3GIE A;  3PYE A;  2BSM A;  1BXD A;  4BXI A;  4L91 A;  4HZ0 A;  2YJX A;  4GGL A;  3IED A;  4BQJ A;  1MG7 A;  5J71 A;  4LFC I;  4DU8 A;  1D6T A;  1J5E E;  4DR2 E;  4LF4 I;  2EFG A;  5FLX Q;  1QY8 A;  2UWD A;  4Q20 A;  1B3Q A;  4EFT A;  5IN9 A;  3F0N A;  2GFD A;  2UUA I;  2O1V A;  2ZDY A;  4XC0 A;  2E5L E;  4DV0 E;  2YGE A;  4DV1 E;  4URL A;  3K60 A;  4DUH A;  3RLP A;  2BU6 A;  3K98 A;  4X9L A;  4YKY A;  4AS9 A;  4JYA I;  3D0B A;  2YE6 A;  4XCL A;  2XAB A;  4EM7 A;  4E02 A;  3O0I A;  3OW6 A;  2YGF A;  4DUY E;  4BQG A;  2ZKJ A;  1OJ4 A;  5A2Q Q;  1GKZ A;  1NHI A;  1Z5B A;  5IWA E;  4U7N A;  4U7O A;  4WUC A;  2XDU A;  5LMU I;  4RPF A;  2O1W A;  3ZXO A;  4DR1 I;  1N36 I;  1UYH A;  2HHH I;  3GON A;  4M1K A;  1HR0 I;  1BKN A;  4LF9 E;  3Q5L A;  4R1F A;  3VAD A;  4YHH E;  3GIG B;  4KQV A;  4EMD A;  2VQF I;  1L0O A;  1HNZ E;  2JKI A;  3HHU A;  5M4K A;  1XNR I;  2UXD E;  2WEP A;  2XJX A;  4JAU A;  4JI8 E;  4KTN A;  4USK A;  2IWU A;  4MPE A;  2HK2 A;  2UXC I;  2XX4 A;  3B82 A;  4GFN A;  4JI4 E;  1HNW I;  4OX9 I;  5D7R A;  3R91 A;  2XEX A;  2X7I A;  2YI5 A;  4LWG A;  3RLQ A;  4EMV A;  4WUD A;  3OPD A;  4KHP E;  1ZWH A;  1KKH A;  4R3M A;  4JI6 I;  1YC1 A;  3ZZ0 A;  4LF5 E;  3EHJ A;  4DV5 I;  4E01 A;  1Z0B A;  5FNF A;  2UXB E;  2BM1 A;  1Z5A A;  3D36 A;  4PRX A;  3A0Z A;  1Y4U A;  1PVG A;  4DR3 I;  1MX0 A;  1FJG E;  5GGZ A;  4GKK E;  5FND A;  5CTX A;  5F5R A;  2ZBK B;  4DPT A;  2XHT A;  2YE8 A;  5CPH A;  4LF8 I;  1AH6 A;  2Q8G A;  4PRV A;  2YEA A;  5IDM A;  1R62 A;  1UYD A;  3A0T A;  3OWB A;  4FWG A;  4DV4 I;  4WUB A;  4DR4 I;  1I5D A;  4HAC A;  2FYP A;  4QPJ A;  4FWH A;  4HYM A;  4HY1 A;  3EKO A;  4B3M I;  2CZ9 A;  3EHH A;  2LJP A;  1U0Z A;  1UY8 A;  1I5A A;  2YEB A;  3VHA A;  2Q8F A;  4P52 A;  3J80 Q;  4B3R I;  4EGI A;  5FNC A;  4ZVI A;  4I5S A;  1ZM4 A;  2ZM6 I;  2HFS A;  4DXL A;  1ZM9 A;  1XHK A;  4DV6 E;  3DGE A;  1Z0W A;  4PU9 A;  4LF7 E;  1S4E A;  3V5R A;  3PEJ A;  4JI1 E;  3JAM Q;  5D7D A;  5IT9 Q;  3B28 A;  5LL6 R;  3OTO I;  3R4N A;  4H81 A;  2ZIT A;  4FCR A;  4YKR A;  1B63 A;  4H7Q A;  4DR5 E;  3HEK A;  5C93 A;  4X65 E;  4URM A;  4XCJ A;  4I3H A;  3T1H I;  4B3S I;  2F4V E;  4PL9 A;  4JV5 E;  1FKA E;  1U2O A;  3T1Y E;  1HNX E;  3ZZU A;  3QT5 A;  1YT1 A;  1ELO A;  2WI5 A;  3JZ3 A;  1KTV A;  4USM A;  1IBL E;  1Z0V A;  4GKJ E;  2YK9 A;  1XMO E;  4DR2 I;  1MU5 A;  2BU2 A;  3WU3 A;  1IBK E;  1VIS A;  4K0K E;  4XTJ A;  2CCS A;  1XNQ I;  3K1J A;  3KE6 A;  2VQE E;  4LFA I;  1S14 A;  4QPK A;  2FXS A;  2V2Z A;  1Z0T A;  4DV1 I;  1H74 A;  4JI7 E;  3J7A G;  4EGH A;  4DV7 E;  1UEK A;  5BOC A;  2XD6 A;  4Z7C A;  3HZ1 A;  1Z5C A;  4DUY I;  1QZR A;  3EKR A;  4DV3 E;  2XDX A;  4L90 A;  4KSH A;  5CTY A;  1S16 A;  3J81 Q;  2IWS A;  4JG4 A;  2YEJ A;  4JI5 E;  4V25 A;  4LFB E;  4B3T E;  2WER A;  4GT8 A;  5M4E A;  1FNM A;  1Z0E A;  4W7T A;  2E1R A;  5BR8 E;  1ZW9 A;  2HFU A;  5M4N A;  3U2K A;  4LF9 I;  2YE9 A;  2Q2E B;  3WU5 A;  4YHH I;  1AM1 A;  1TIL A;  1I5B A;  2QFO A;  3K97 A;  1HNZ I;  1XMQ E;  4EFU A;  2UXD I;  4JI8 I;  3TZ4 A;  1TBW A;  4FCP A;  4NXN E;  1YSZ A;  1NHJ A;  1N32 E;  4L94 A;  1U2R A;  4KHP I;  3QT6 A;  2NPF A;  4DU7 A;  3FT8 A;  4X64 E;  4HZ5 A;  3R4M A;  3WU6 A;  3LPS A;  2AKP A;  2QG2 A;  4HXW A;  1Z0C A;  4LF6 E;  4XIT A;  2BTZ A;  3C11 A;  3PEH A;  4JI3 E;  2GQP A;  2XDS A;  2YGA A;  2BYH A;  3FT5 A;  1FJG I;  3R4P A;  1I58 A;  5FLX C;  2YKB A;  4B7P A;  2HK3 A;  2VCI A;  4XKO A;  3H80 A;  3D2R A;  5M4M A;  2OI2 A;  4LF4 E;  3B25 A;  4P7A A;  4JAV A;  4MPC A;  4JAS A;  1N0V C;  2VF3 A;  3LTO A;  4NXM E;  1I59 A;  4XE2 A;  3B24 A;  1KZN A;  2A2C A;  3ZM7 A;  2E0A A;  2ZDX A;  3EHG A;  1GJV A;  2CG9 A;  5A2Q C;  2X36 A;  2YKC A;  4O04 A;  4AWQ A;  2BU7 A;  4BIU A;  1UYM A;  3O2F A;  4UTG A;  3B8H A;  1ZXM A;  4DR6 E;  5LMN E;  3MNR P;  3TTZ A;  4DV6 I;  4LF7 I;  3CGZ A;  1Y4S A;  4JI1 I;  1IBM E;  1PIE A;  1QYE A;  5L3J A;  4DR7 E;  4O0B A;  1H7S A;  5M4P A;  3ZKB A;  4CWS A;  2CCU A;  1Z0G A;  2R3V A;  3QTF A;  4YY3 E;  1H72 C;  2UUB E;  2BT0 A;  3H4L A;  4NH8 A;  2HHH E;  1AJ6 A;  2BYI A;  4X65 I;  3CRK A;  4X62 I;  3HUL A;  3M6A A;  4JI0 E;  1THN A;  3NMQ A;  4CE2 A;  1I5C A;  2F4V I;  3R92 A;  4Z7Y A;  4JV5 I;  1Y8P A;  4LWH A;  2Q8I A;  3T1K A;  1GKX A;  4H85 A;  1FWK A;  2IOR A;  1UY6 A;  1YSR A;  4MBC A;  5J6A A;  3LNU A;  3V2U C;  4OX9 E;  2YEC A;  3T2S A;  2YEG A;  1N34 E;  1IBL I;  1YT0 A;  1YER A;  3OMU A;  2FWY A;  1IBK I;  4K0K I;  1UYE A;  4JI6 E;  4FCQ A;  4MYT A;  5CF0 A;  2FWZ A;  2HCH A;  2VQE I;  4FW9 A;  2YED A;  4XIQ A;  2VW5 A;  4DZY A;  3TUH A;  3U67 A;  2IOQ A;  3G7E A;  4XIR A;  3INX A;  1UYC A;  3B27 A;  4B6C A;  4BIZ A;  1YET A;  4DR3 E;  2XHX A;  5FWK A;  4URO A;  5F3K A;  4DV7 I;  3ZKD A;  1TC6 A;  2UU9 E;  1YT2 A;  2YJW A;  4X66 E;  4URN A;  3QDD A;  1BGQ A;  2WI6 A;  4DV3 I;  1J5E I;  3HYZ A;  3WHA A;  2XCM A;  2XK2 A;  2YI7 A;  2YEF A;  4HAC B;  3PYD A;  4ED4 A;  4DV2 E;  2XJG A;  3VHD A;  3J80 C;  4JI2 E;  4JI5 I;  4DPX A;  4LFB I;  3T0H A;  4B3T I;  1UY7 A;  2CH4 A;  2YE4 A;  2YKE A;  4CWF A;  3QT8 A;  2E5L I;  4DV0 I;  3T10 A;  3EHF A;  1OSF A;  1DAR A;  3JAM C;  5GME A;  4XD8 A;  4ASG A;  5IT9 C;  2A2D A;  2ZM6 E;  1XMQ I;  1I94 E;  4GEE A;  2BU5 A;  1FWL A; 
#chains in the Genus database with same CATH topology
 3K99 A;  4EGK A;  1EA6 A;  2AJ4 A;  4NXN I;  3B4T A;  2BZ5 A;  1RRE A;  1N32 I;  4AWP A;  2UUC E;  2GO3 A;  3G75 A;  4CWQ A;  5C0X A;  5IWA I;  1K47 A;  1KVK A;  5DRR A;  2JEA A;  2CGF A;  3C0E A;  1Y8N A;  2YKI A;  5D7C A;  5K36 E;  3TZ5 A;  2Q8H A;  4X64 I;  4XIP A;  2V8P A;  2C1G A;  2Z5E A;  4KP4 A;  4LCF A;  1ZM2 A;  3PYF A;  4O05 A;  4OO1 E;  2O1U A;  2VCJ A;  3A0X A;  5ELW A;  4DUZ E;  4BAE A;  4YKX A;  4JI3 I;  2XDL A;  3R4O A;  4OZE A;  1AH8 A;  4K4O A;  3GIG A;  3O6O A;  3CDJ A;  4IFD E;  2YEI A;  2DEJ A;  2QG0 A;  4FPP A;  3PS3 A;  4JI4 I;  2WEQ A;  2WI3 A;  2YE2 A;  1XXE A;  3A0R A;  4V26 A;  4AWO A;  5K36 F;  4LWE A;  4ASA A;  1XNQ E;  2BA1 D;  4KFG A;  4NXM I;  3BMY A;  1JM6 A;  4AQY E;  4MU0 A;  4OO1 F;  3K17 A;  4FN5 A;  1N33 E;  3T0Z A;  4LFA E;  4LF5 I;  2VWC A;  3OWD A;  2UXB I;  2WI1 A;  2BA0 G;  4DPU A;  1FI4 A;  5GMD A;  1YS3 A;  3WU4 A;  2BU8 A;  2H8M A;  2BRC A;  4IFD F;  2WI4 A;  4ZKI A;  4GKK I;  3L7Z A;  3J81 C;  3M85 G;  2XJJ A;  4AM3 A;  2R42 A;  1UYF A;  4YKU A;  4EEH A;  4DR6 I;  2HG1 A;  5LMN I;  4LFC E;  4DPW A;  2YE7 A;  1RHY A;  2C2A A;  3U2D A;  4L8Z A;  4HXZ A;  2WI2 A;  1IBM I;  2C37 B;  2YEH A;  3HZ5 A;  3PRY A;  4KSG A;  4YKQ A;  4DR7 I;  3P3G A;  1AMW A;  5K36 D;  1UYL A;  5IDJ A;  3QT7 A;  4YY3 I;  2UUB I;  4IZJ B;  1VI7 A;  2UUA E;  4LPF A;  1B62 A;  4OO1 D;  1UY9 A;  4CE1 A;  4JI0 I;  3RLR A;  4R3A A;  3G7B A;  4CWN A;  3D4J A;  3TZ0 A;  2XHR A;  2JJC A;  4GQU A;  4JYA E;  2XX2 A;  4MP7 A;  3M7N D;  1EI1 A;  4L93 A;  2CCT A;  4IFD D;  5CTW A;  2IER A;  4GQT A;  3SL2 A;  2WW4 A;  4UT4 A;  2J7K A;  4MYU A;  1N34 I;  4LP0 A;  4YKW A;  3RKZ A;  2WP8 B;  1UYG A;  4CWP A;  1Y8O A;  5LMU E;  2PNL A;  4DR1 E;  1N36 E;  4O09 A;  4DR5 I;  1TID A;  1HR0 E;  2IWX A;  2PO0 A;  1NHH A;  4FWD A;  3FV5 A;  4JQL A;  1TH8 A;  4J3D A;  4XDM A;  3BM9 A;  2C38 A;  2VQF E;  4CWT A;  3HYY A;  3CGY A;  1PKP A;  1XNR E;  1WUU A;  3T1Y I;  2V2Q A;  4LPB A;  1HNX I;  4NH9 A;  2UXC E;  2BRE A;  1YC3 A;  2UU9 I;  1HNW E;  2BV3 A;  4OO1 A;  4LWF A;  4ASF A;  1H73 A;  4X66 I;  2PNR A;  4MB9 A;  4AIM A;  2ESA A;  4E00 A;  4GKJ I;  3GME A;  1XMO I;  2YKJ A;  2PO2 A;  2XX5 A;  4DV2 I;  4O07 A;  4CWO A;  5BOD A;  4JI2 I;  2K5B A;  2HKE A;  1ID0 A;  4HYP A;  4DV5 E;  4IFD A;  2Z5B B;  2YE5 A;  1H7U A;  5CTU A;  4HY6 A;  3WQ9 A;  4YKT A;  2YK2 A;  1ZXN A;  4BA2 A;  3P3C A;  4JI7 I;  5D6P A;  4MOT A;  1TC0 A;  2JE6 B;  1YC4 A;  1I94 I;  5JEN A;  1NZ0 A;  3J7A M;  4ASB A;  3NZK A;  4MPN A;  1US7 A;  4XKA A;  1Z59 A;  4LF8 E;  5D6Q A;  1E3P A;  1BYQ A;  2XDK A;  3B26 A;  2UUC I;  4YKZ A;  4U93 A;  4DPY A;  4NH7 A;  3VHC A;  3Q5J A;  3PYG A;  4DV4 E;  4LWI A;  4DR4 E;  3GIF A;  4CWR A;  3Q6N A;  2GS8 A;  3A0Y A;  4B3M E;  1P42 A;  2Z5C A;  4X62 E;  3A0W A;  1ZM3 A;  2HKJ A;  3ZXQ A;  2C38 B;  5BR8 I;  2IOP A;  4DUZ I;  2YE3 A;  2WI7 A;  1A6F A;  4P8O A;  4B3R E;  2J65 A;  2H55 A;  2BM0 A;  3CRL A;  1RR9 A;  2F1D A;  2C39 A;  3Q5K A;  4CE3 A;  1N0U A;  2V34 A;  1UYI A;  3CWV A;  1KIJ A;  1A4H A;  3INW A;  4FMT A;  2DEI A;  1UYK A;  3OTO E;  4XKK A;  4AQY I;  1UDN A;  4MP2 A;  1N33 I;  2YI6 A;  2NN6 B;  2PO1 A;  3Q1Q A;  2YI0 A;  3T1H E;  4B3S E;  1E3H A;  4LF6 I;  1YES A;  3LMM A;  2V2V A;  3ZZT A;  2QF6 A;  4GCZ A;  2YEE A;  5M4H A;  2EXL A;  4LOM A;  5DNX A;  3TZ2 A;  3B78 A;  4FW6 A;  3PYE A;  2BSM A;  3CYG A;  3GIE A;  4BXI A;  1BXD A;  2JEB B;  2PNZ A;  4L91 A;  4HZ0 A;  1UDQ A;  2YJX A;  4GGL A;  3IED A;  4BQJ A;  1MG7 A;  2VES A;  5J71 A;  4LFC I;  4DU8 A;  1D6T A;  2BR2 B;  4NBQ A;  1J5E E;  4DR2 E;  3HKM A;  4IS9 A;  3UHM A;  4LF4 I;  2O1T A;  2EFG A;  5FLX Q;  1QY8 A;  2UWD A;  4Q20 A;  1B3Q A;  4IZK B;  5DRP A;  1OYR A;  4EFT A;  5IN9 A;  3F0N A;  3K85 A;  2GFD A;  2UUA I;  2O1V A;  2ZDY A;  4XC0 A;  2E5L E;  4DV0 E;  2YGE A;  4DV1 E;  4URL A;  3K60 A;  4DUH A;  3RLP A;  2BU6 A;  3K98 A;  5JEA B;  4X9L A;  4YKY A;  3U1K A;  4JYA I;  3D0B A;  3OWB A;  4AS9 A;  2YE6 A;  4XCL A;  4ISA A;  2XAB A;  4EM7 A;  4E02 A;  3O0I A;  3OW6 A;  4U3B A;  2YGF A;  4DUY E;  4BQG A;  2BA0 D;  2ZKJ A;  1OJ4 A;  5A2Q Q;  1GKZ A;  5C0X B;  2JEA B;  1NHI A;  2PNM A;  1Z5B A;  5IWA E;  2CGE A;  4U7N A;  3M85 D;  4U7O A;  4WUC A;  1Y5Y A;  3Q6M A;  2XDU A;  5LMU I;  2O1W A;  4RPF A;  3ZXO A;  4DR1 I;  1N36 I;  1R6L A;  1UYH A;  2HHH I;  3GON A;  4M1K A;  1HR0 I;  2C1I A;  1BKN A;  3P76 A;  3CDI A;  4LF9 E;  3Q5L A;  4R1F A;  3U1Y A;  4YHH E;  3P3E A;  3GIG B;  4KQV A;  4EMD A;  2VQF I;  1L0O A;  1HNZ E;  2JKI A;  3HHU A;  5M4K A;  1USU A;  2NN6 C;  5DNL A;  1XNR I;  2UXD E;  2WEP A;  4JI8 E;  3HJC A;  4USK A;  2IWU A;  2XJX A;  2HK2 A;  2UXC I;  4KTN A;  2XX4 A;  3B82 A;  4GFN A;  4JI4 E;  1HNW I;  4U3D A;  4OX9 I;  5D7R A;  3R91 A;  2XEX A;  2X7I A;  2YI5 A;  4LWG A;  3RLQ A;  4EMV A;  4WUD A;  3OPD A;  3GLL A;  4KHP E;  1ZWH A;  1KKH A;  4R3M A;  1UDO A;  4JI6 I;  1YC1 A;  3ZZ0 A;  4LF5 E;  3EHJ A;  4DV5 I;  4E01 A;  1Z0B A;  5FNF A;  2UXB E;  2BM1 A;  1Z5A A;  3D36 A;  4PRX A;  3A0Z A;  1Y4U A;  1PVG A;  3L7Z B;  1MX0 A;  4DR3 I;  1FJG E;  5GGZ A;  4GKK E;  5FND A;  5K36 A;  5CTX A;  3PS1 A;  1Y60 A;  5F5R A;  2ZBK B;  5JEA C;  4DPT A;  2XHT A;  2YE8 A;  5CPH A;  4LF8 I;  1AH6 A;  2Q8G A;  5JEA F;  4PRV A;  2YEA A;  5IDM A;  1R62 A;  1UYD A;  1HK7 A;  3A0T A;  4FWG A;  4DV4 I;  4WUB A;  4DR4 I;  1I5D A;  4HAC A;  2FYP A;  4QPJ A;  5C0X C;  4FWH A;  4HYM A;  4HY1 A;  3EKO A;  4FW4 A;  2CZ9 A;  4B3M I;  1IXM A;  5C0X F;  2LJP A;  3EHH A;  1U0Z A;  2WNR A;  1UY8 A;  1R6M A;  1I5A A;  2YEB A;  3VHA A;  2Q8F A;  4P52 A;  3J80 Q;  4B3R I;  4EGI A;  1OYP A;  5FNC A;  4ZVI A;  4I5S A;  1ZM4 A;  2ZM6 I;  2HFS A;  2CVE A;  4DXL A;  1ZM9 A;  1XHK A;  4DV6 E;  3DGE A;  1Z0W A;  4PU9 A;  3GCM A;  4LF7 E;  1S4E A;  3V5R A;  3PEJ A;  4JI1 E;  3JAM Q;  5D7D A;  5IT9 Q;  3B28 A;  5LL6 R;  3OTO I;  3R4N A;  4H81 A;  5JEA D;  2ZIT A;  4FCR A;  4YKR A;  1B63 A;  2PO0 B;  4H7Q A;  4DR5 E;  3HEK A;  5C93 A;  4X65 E;  4URM A;  4XCJ A;  4I3H A;  3T1H I;  4B3S I;  2F4V E;  4FW3 A;  5C0X D;  4JV5 E;  4PL9 A;  5K36 B;  1FKA E;  1U2O A;  3T1Y E;  1HNX E;  2JT2 A;  3ZZU A;  3QT5 A;  5DRQ A;  4OO1 B;  1YT1 A;  1ELO A;  2WI5 A;  3JZ3 A;  1KTV A;  4IZJ D;  4USM A;  1IBL E;  1Z0V A;  2PO2 B;  4MU4 A;  4GKJ E;  2YK9 A;  1XMO E;  4QNK A;  4DR2 I;  1MU5 A;  2BU2 A;  3WU3 A;  1IBK E;  1VIS A;  4K0K E;  4XTJ A;  2CCS A;  1XNQ I;  4IFD B;  3K1J A;  3KE6 A;  3S5T A;  2VQE E;  4LFA I;  1S14 A;  4QPK A;  1Y6Z A;  2FXS A;  2V2Z A;  4BA2 B;  1Z0T A;  4DV1 I;  1H74 A;  1OYS A;  4JI7 E;  4AID A;  2GO4 A;  3J7A G;  4EGH A;  4DV7 E;  1UEK A;  5BOC A;  2XD6 A;  4Z7C A;  3HZ1 A;  1Z5C A;  4DUY I;  1QZR A;  3PS2 A;  1F51 A;  3EKR A;  4DV3 E;  2XDX A;  4L90 A;  4OKG A;  4KSH A;  5CTY A;  1S16 A;  3J81 Q;  2IWS A;  2C37 A;  4JG4 A;  2YEJ A;  4JI5 E;  4V25 A;  2Z5C B;  4LFB E;  4B3T E;  2WER A;  4GT8 A;  3VAD A;  5M4E A;  1FNM A;  4IZJ A;  1Z0E A;  4W7T A;  2E1R A;  5BR8 E;  1ZW9 A;  2HFU A;  5M4N A;  3U2K A;  4LF9 I;  2YE9 A;  2Q2E B;  2C39 B;  3WU5 A;  4YHH I;  1AM1 A;  1TIL A;  1I5B A;  2QFO A;  3K97 A;  1HNZ I;  1XMQ E;  4EFU A;  2UXD I;  4JI8 I;  2BA1 G;  3TZ4 A;  1TBW A;  4FCP A;  4NXN E;  1YSZ A;  5K36 C;  1NHJ A;  1N32 E;  4L94 A;  2NN6 E;  1U2R A;  4N3O A;  4KHP I;  4OO1 C;  3QT6 A;  2NPF A;  4DU7 A;  3FT8 A;  2WP8 A;  4X64 E;  4HZ5 A;  2GQ0 A;  3R4M A;  3WU6 A;  2PO1 B;  3LPS A;  2AKP A;  2QG2 A;  4HXW A;  1Z0C A;  4LF6 E;  4XIT A;  2BTZ A;  3C11 A;  3PEH A;  4IFD C;  4JI3 E;  2GQP A;  2PNZ B;  2XDS A;  2YGA A;  2BYH A;  3FT5 A;  1FJG I;  3R4P A;  1I58 A;  4FW7 A;  5FLX C;  2YKB A;  4B7P A;  2HK3 A;  2IES A;  2NN6 F;  2VCI A;  4XKO A;  3H80 A;  3D2R A;  5M4M A;  2OI2 A;  4LF4 E;  3B25 A;  4P7A A;  4JAV A;  4MPC A;  2HHI A;  4JAS A;  1N0V C;  2VF3 A;  3LTO A;  4NXM E;  5JEA E;  4MDT A;  1I59 A;  4XE2 A;  3B24 A;  3KRN A;  2A2C A;  1KZN A;  5EKW A;  3M7N G;  2FTK A;  3ZM7 A;  2E0A A;  2ZDX A;  3H1C A;  3EHG A;  4MQY A;  2Z5B A;  4BA1 A;  1GJV A;  2CG9 A;  5A2Q C;  2X36 A;  2YKC A;  4O04 A;  5C0X E;  4AWQ A;  2BU7 A;  4E72 A;  4BIU A;  1UYM A;  3O2F A;  1USV A;  4UTG A;  2JE6 A;  3DD6 A;  2O3Z A;  3B8H A;  1ZXM A;  4DR6 E;  2AE8 A;  5LMN E;  3MNR P;  3TTZ A;  4DV6 I;  2NN6 D;  3P06 A;  4LF7 I;  3CGZ A;  1Y4S A;  4JI1 I;  1IBM E;  1PIE A;  1QYE A;  5L3J A;  4DR7 E;  4O0B A;  1H7S A;  4LCH A;  3ZKB A;  5M4P A;  4CWS A;  2CCU A;  1Z0G A;  2R3V A;  3QTF A;  4YY3 E;  1H72 C;  2UUB E;  2BT0 A;  3H4L A;  4NH8 A;  2HHH E;  1AJ6 A;  2BYI A;  4X65 I;  3CRK A;  4X62 I;  3HUL A;  3M6A A;  4MU1 A;  4JI0 E;  1THN A;  3NMQ A;  4CE2 A;  1I5C A;  4JAU A;  2F4V I;  3R92 A;  4Z7Y A;  4JV5 I;  1Y8P A;  4LWH A;  2Q8I A;  3T1K A;  1GKX A;  4H85 A;  1FWK A;  2IOR A;  1UY6 A;  1YSR A;  4MBC A;  5J6A A;  3LNU A;  3V2U C;  4OX9 E;  5EL9 A;  2YEC A;  3T2S A;  2YEG A;  1N34 E;  1IBL I;  1YT0 A;  1YER A;  3OMU A;  2FWY A;  1IBK I;  4K0K I;  1UYE A;  4JI6 E;  4FCQ A;  4MYT A;  5CF0 A;  5DRO A;  2FWZ A;  2HCH A;  2VQE I;  4FW9 A;  2YED A;  4XIQ A;  2VW5 A;  4DZY A;  4BA1 B;  3TUH A;  4QNJ A;  3U67 A;  2IOQ A;  3G7E A;  1YHC A;  4XIR A;  3INX A;  1UYC A;  2NN6 A;  3B27 A;  4B6C A;  4BIZ A;  1YET A;  4DR3 E;  2XHX A;  5FWK A;  4URO A;  4MPE A;  5F3K A;  4DV7 I;  3ZKD A;  1TC6 A;  2JEB A;  2UU9 E;  1YT2 A;  2YJW A;  4X66 E;  1UDS A;  4URN A;  3QDD A;  1BGQ A;  2WI6 A;  4FW5 A;  4DV3 I;  1J5E I;  3HYZ A;  3WHA A;  2XCM A;  2XK2 A;  2BR2 A;  2YI7 A;  2YEF A;  4HAC B;  3PYD A;  4ED4 A;  4DV2 E;  2XJG A;  3VHD A;  1YH8 A;  3J80 C;  4JI2 E;  4JI5 I;  4LCG A;  4DPX A;  4LFB I;  3T0H A;  4B3T I;  1UY7 A;  2WNR B;  4IZK A;  2CH4 A;  2YE4 A;  2YKE A;  4CWF A;  3QT8 A;  2E5L I;  4DV0 I;  3T10 A;  3EHF A;  1OSF A;  1DAR A;  3JAM C;  5GME A;  4XD8 A;  4ASG A;  5IT9 C;  5JEA A;  2A2D A;  2ZM6 E;  1XMQ I;  1I94 E;  4GEE A;  2BU5 A;  1FWL A;  4MU3 A; 
#chains in the Genus database with same CATH homology
 3K99 A;  4EGK A;  1EA6 A;  2AJ4 A;  4NXN I;  2BZ5 A;  1RRE A;  1N32 I;  4AWP A;  2UUC E;  3G75 A;  4CWQ A;  5IWA I;  1K47 A;  1KVK A;  4ZKI A;  2CGF A;  3C0E A;  1Y8N A;  2YKI A;  5D7C A;  3TZ5 A;  2Q8H A;  4X64 I;  4XIP A;  2V8P A;  2Z5E A;  4KP4 A;  1ZM2 A;  3PYF A;  4O05 A;  2O1U A;  2VCJ A;  3A0X A;  4DUZ E;  4BAE A;  4YKX A;  4JI3 I;  2XDL A;  3R4O A;  1AH8 A;  4K4O A;  3GIG A;  3O6O A;  2YEI A;  2DEJ A;  2QG0 A;  4FPP A;  4JI4 I;  2WEQ A;  2WI3 A;  2YE2 A;  4V26 A;  3A0R A;  4AWO A;  4LWE A;  4ASA A;  1XNQ E;  4KFG A;  4NXM I;  3BMY A;  1JM6 A;  4AQY E;  3T0Z A;  3K17 A;  4FN5 A;  1N33 E;  4LFA E;  4LF5 I;  2VWC A;  3OWD A;  2UXB I;  2WI1 A;  4DPU A;  1FI4 A;  5GMD A;  1YS3 A;  3WU4 A;  2BU8 A;  2H8M A;  2BRC A;  2WI4 A;  4GKK I;  3J81 C;  2XJJ A;  1UYF A;  2R42 A;  4YKU A;  4EEH A;  4DR6 I;  2HG1 A;  5LMN I;  4LFC E;  4DPW A;  2YE7 A;  2C2A A;  3U2D A;  4L8Z A;  4HXZ A;  2WI2 A;  1IBM I;  2YEH A;  3HZ5 A;  3PRY A;  4KSG A;  4YKQ A;  4DR7 I;  1AMW A;  1UYL A;  5IDJ A;  3QT7 A;  4YY3 I;  2UUB I;  4IZJ B;  2UUA E;  1B62 A;  1UY9 A;  4CE1 A;  4JI0 I;  3RLR A;  4R3A A;  3G7B A;  4CWN A;  3D4J A;  3TZ0 A;  2XHR A;  2JJC A;  4MP7 A;  4JYA E;  2XX2 A;  1EI1 A;  4L93 A;  2CCT A;  5CTW A;  4GQT A;  3SL2 A;  2WW4 A;  4UT4 A;  2J7K A;  4MYU A;  1N34 I;  4LP0 A;  4YKW A;  3RKZ A;  1UYG A;  4CWP A;  1Y8O A;  5LMU E;  2PNL A;  4DR1 E;  1N36 E;  4O09 A;  4DR5 I;  1TID A;  1HR0 E;  2IWX A;  1NHH A;  4FWD A;  3FV5 A;  4JQL A;  1TH8 A;  4XDM A;  3BM9 A;  4CWT A;  2VQF E;  3HYY A;  3CGY A;  1PKP A;  1XNR E;  1WUU A;  3T1Y I;  2V2Q A;  4LPB A;  1HNX I;  4NH9 A;  2UXC E;  2BRE A;  1YC3 A;  2UU9 I;  1HNW E;  2BV3 A;  4LWF A;  4ASF A;  1H73 A;  4X66 I;  2PNR A;  4MB9 A;  2ESA A;  4E00 A;  4GKJ I;  1XMO I;  2YKJ A;  2XX5 A;  4DV2 I;  4O07 A;  4CWO A;  5BOD A;  4JI2 I;  2K5B A;  2HKE A;  1ID0 A;  4HYP A;  4DV5 E;  2Z5B B;  2YE5 A;  1H7U A;  5CTU A;  4HY6 A;  3WQ9 A;  4YKT A;  2YK2 A;  1ZXN A;  5D6P A;  4JI7 I;  4MOT A;  1TC0 A;  1YC4 A;  1I94 I;  1NZ0 A;  3J7A M;  4ASB A;  4MPN A;  1US7 A;  4XKA A;  1Z59 A;  4LF8 E;  5D6Q A;  4YKZ A;  1BYQ A;  2XDK A;  3B26 A;  2UUC I;  4U93 A;  4DPY A;  4NH7 A;  3VHC A;  3Q5J A;  3PYG A;  4DV4 E;  4LWI A;  4DR4 E;  3GIF A;  4CWR A;  3Q6N A;  2GS8 A;  3A0Y A;  4B3M E;  2Z5C A;  4X62 E;  3A0W A;  1ZM3 A;  2HKJ A;  3ZXQ A;  5BR8 I;  2IOP A;  4DUZ I;  2YE3 A;  2WI7 A;  1A6F A;  4P8O A;  4B3R E;  2H55 A;  2BM0 A;  3CRL A;  1RR9 A;  3Q5K A;  4CE3 A;  1N0U A;  2V34 A;  1UYI A;  3CWV A;  1KIJ A;  1A4H A;  3INW A;  4FMT A;  2DEI A;  1UYK A;  3OTO E;  4XKK A;  4AQY I;  4MP2 A;  1N33 I;  2YI6 A;  3Q1Q A;  2YI0 A;  3T1H E;  4B3S E;  4LF6 I;  1YES A;  2V2V A;  3ZZT A;  2QF6 A;  4GCZ A;  2YEE A;  5M4H A;  2EXL A;  3TZ2 A;  3B78 A;  3GIE A;  3PYE A;  2BSM A;  1BXD A;  4BXI A;  4L91 A;  4HZ0 A;  2YJX A;  4GGL A;  3IED A;  4BQJ A;  1MG7 A;  5J71 A;  4LFC I;  4DU8 A;  1D6T A;  1J5E E;  4DR2 E;  4LF4 I;  2O1T A;  2EFG A;  5FLX Q;  1QY8 A;  2UWD A;  4Q20 A;  1B3Q A;  4IZK B;  4EFT A;  5IN9 A;  3F0N A;  3K85 A;  2GFD A;  2UUA I;  2O1V A;  2ZDY A;  4XC0 A;  2E5L E;  4DV0 E;  2YGE A;  4DV1 E;  4URL A;  3K60 A;  4DUH A;  3RLP A;  2BU6 A;  3K98 A;  4X9L A;  4YKY A;  4AS9 A;  4JYA I;  3D0B A;  3OWB A;  2YE6 A;  4XCL A;  2XAB A;  4EM7 A;  4E02 A;  3O0I A;  3OW6 A;  2YGF A;  4DUY E;  4BQG A;  2ZKJ A;  1OJ4 A;  5A2Q Q;  1GKZ A;  1NHI A;  2PNM A;  1Z5B A;  5IWA E;  2CGE A;  4U7N A;  4U7O A;  4WUC A;  3Q6M A;  2XDU A;  5LMU I;  2O1W A;  4RPF A;  3ZXO A;  4DR1 I;  1N36 I;  1UYH A;  2HHH I;  3GON A;  4M1K A;  1HR0 I;  1BKN A;  4LF9 E;  3Q5L A;  4R1F A;  3VAD A;  4YHH E;  3GIG B;  4KQV A;  4EMD A;  2VQF I;  1L0O A;  1HNZ E;  2JKI A;  3HHU A;  5M4K A;  1USU A;  1XNR I;  2UXD E;  2WEP A;  2XJX A;  4JAU A;  4JI8 E;  3HJC A;  4USK A;  2IWU A;  4KTN A;  2HK2 A;  2UXC I;  2XX4 A;  3B82 A;  4GFN A;  4JI4 E;  1HNW I;  4OX9 I;  5D7R A;  3R91 A;  2XEX A;  2X7I A;  2YI5 A;  4LWG A;  3RLQ A;  4EMV A;  4WUD A;  3OPD A;  4KHP E;  1ZWH A;  1KKH A;  4R3M A;  4JI6 I;  1YC1 A;  3ZZ0 A;  4LF5 E;  3EHJ A;  4DV5 I;  4E01 A;  1Z0B A;  5FNF A;  2UXB E;  2BM1 A;  1Z5A A;  3D36 A;  4PRX A;  3A0Z A;  1Y4U A;  1PVG A;  4DR3 I;  1MX0 A;  1FJG E;  5GGZ A;  4GKK E;  5FND A;  5CTX A;  5F5R A;  2ZBK B;  4DPT A;  2XHT A;  2YE8 A;  5CPH A;  4LF8 I;  1AH6 A;  2Q8G A;  4PRV A;  2YEA A;  5IDM A;  1R62 A;  1UYD A;  1HK7 A;  3A0T A;  4FWG A;  4DV4 I;  4WUB A;  4DR4 I;  1I5D A;  4HAC A;  2FYP A;  4QPJ A;  4FWH A;  4HYM A;  4HY1 A;  3EKO A;  4B3M I;  2CZ9 A;  3EHH A;  2LJP A;  1U0Z A;  1UY8 A;  1I5A A;  2YEB A;  3VHA A;  2Q8F A;  4P52 A;  3J80 Q;  4B3R I;  4EGI A;  5FNC A;  4ZVI A;  4I5S A;  1ZM4 A;  2ZM6 I;  2HFS A;  4DXL A;  1ZM9 A;  1XHK A;  4DV6 E;  3DGE A;  1Z0W A;  4PU9 A;  4LF7 E;  1S4E A;  3V5R A;  3PEJ A;  4JI1 E;  3JAM Q;  5D7D A;  5IT9 Q;  3B28 A;  5LL6 R;  3OTO I;  3R4N A;  4H81 A;  2ZIT A;  4FCR A;  4YKR A;  1B63 A;  4H7Q A;  4DR5 E;  3HEK A;  5C93 A;  4X65 E;  4URM A;  4XCJ A;  4I3H A;  3T1H I;  4B3S I;  2F4V E;  4PL9 A;  4JV5 E;  1FKA E;  1U2O A;  3T1Y E;  1HNX E;  3ZZU A;  3QT5 A;  1YT1 A;  1ELO A;  2WI5 A;  3JZ3 A;  1KTV A;  4IZJ D;  4USM A;  1IBL E;  1Z0V A;  4GKJ E;  2YK9 A;  1XMO E;  4DR2 I;  1MU5 A;  2BU2 A;  3WU3 A;  1IBK E;  1VIS A;  4K0K E;  4XTJ A;  2CCS A;  1XNQ I;  3K1J A;  3KE6 A;  2VQE E;  4LFA I;  1S14 A;  4QPK A;  1Y6Z A;  2FXS A;  2V2Z A;  1Z0T A;  4DV1 I;  1H74 A;  4JI7 E;  3J7A G;  4EGH A;  4DV7 E;  1UEK A;  5BOC A;  2XD6 A;  4Z7C A;  3HZ1 A;  1Z5C A;  4DUY I;  1QZR A;  3EKR A;  4DV3 E;  2XDX A;  4L90 A;  4KSH A;  5CTY A;  1S16 A;  3J81 Q;  2IWS A;  4JG4 A;  2YEJ A;  4JI5 E;  4V25 A;  2Z5C B;  4LFB E;  4B3T E;  2WER A;  4GT8 A;  5M4E A;  1FNM A;  4IZJ A;  1Z0E A;  4W7T A;  2E1R A;  5BR8 E;  1ZW9 A;  2HFU A;  5M4N A;  3U2K A;  4LF9 I;  2YE9 A;  2Q2E B;  3WU5 A;  4YHH I;  1AM1 A;  1TIL A;  1I5B A;  2QFO A;  3K97 A;  1HNZ I;  1XMQ E;  4EFU A;  2UXD I;  4JI8 I;  3TZ4 A;  1TBW A;  4FCP A;  4NXN E;  1YSZ A;  1NHJ A;  1N32 E;  4L94 A;  1U2R A;  4N3O A;  4KHP I;  3QT6 A;  2NPF A;  4DU7 A;  3FT8 A;  4X64 E;  4HZ5 A;  2GQ0 A;  3R4M A;  3WU6 A;  3LPS A;  2AKP A;  2QG2 A;  4HXW A;  1Z0C A;  4LF6 E;  4XIT A;  2BTZ A;  3C11 A;  3PEH A;  4JI3 E;  2GQP A;  2XDS A;  2YGA A;  2BYH A;  3FT5 A;  1FJG I;  3R4P A;  1I58 A;  5FLX C;  2YKB A;  4B7P A;  2HK3 A;  2VCI A;  4XKO A;  3H80 A;  3D2R A;  5M4M A;  2OI2 A;  4LF4 E;  3B25 A;  4P7A A;  4JAV A;  4MPC A;  4JAS A;  1N0V C;  2VF3 A;  3LTO A;  4NXM E;  1I59 A;  4XE2 A;  3B24 A;  1KZN A;  2A2C A;  3ZM7 A;  2E0A A;  2ZDX A;  3EHG A;  2Z5B A;  1GJV A;  2CG9 A;  5A2Q C;  2X36 A;  2YKC A;  4O04 A;  4AWQ A;  2BU7 A;  4BIU A;  1UYM A;  3O2F A;  1USV A;  4UTG A;  3B8H A;  1ZXM A;  4DR6 E;  5LMN E;  3MNR P;  3TTZ A;  4DV6 I;  3P06 A;  4LF7 I;  3CGZ A;  1Y4S A;  4JI1 I;  1IBM E;  1PIE A;  1QYE A;  5L3J A;  4DR7 E;  4O0B A;  1H7S A;  5M4P A;  3ZKB A;  4CWS A;  2CCU A;  1Z0G A;  2R3V A;  3QTF A;  4YY3 E;  1H72 C;  2UUB E;  2BT0 A;  3H4L A;  4NH8 A;  2HHH E;  1AJ6 A;  2BYI A;  4X65 I;  3CRK A;  4X62 I;  3HUL A;  3M6A A;  4JI0 E;  1THN A;  3NMQ A;  4CE2 A;  1I5C A;  2F4V I;  3R92 A;  4Z7Y A;  4JV5 I;  1Y8P A;  4LWH A;  2Q8I A;  3T1K A;  1GKX A;  4H85 A;  1FWK A;  2IOR A;  1UY6 A;  1YSR A;  4MBC A;  5J6A A;  3LNU A;  3V2U C;  4OX9 E;  2YEC A;  3T2S A;  2YEG A;  1N34 E;  1IBL I;  1YT0 A;  1YER A;  3OMU A;  2FWY A;  1IBK I;  4K0K I;  1UYE A;  4JI6 E;  4FCQ A;  4MYT A;  5CF0 A;  2FWZ A;  2HCH A;  2VQE I;  4FW9 A;  2YED A;  4XIQ A;  2VW5 A;  4DZY A;  3TUH A;  3U67 A;  2IOQ A;  3G7E A;  4XIR A;  3INX A;  1UYC A;  3B27 A;  4B6C A;  4BIZ A;  1YET A;  4DR3 E;  2XHX A;  5FWK A;  4URO A;  4MPE A;  5F3K A;  4DV7 I;  3ZKD A;  1TC6 A;  2UU9 E;  1YT2 A;  2YJW A;  4X66 E;  4URN A;  3QDD A;  1BGQ A;  2WI6 A;  4DV3 I;  1J5E I;  3HYZ A;  3WHA A;  2XCM A;  2XK2 A;  2YI7 A;  2YEF A;  4HAC B;  4DV2 E;  3PYD A;  4ED4 A;  2XJG A;  3VHD A;  3J80 C;  4JI2 E;  4JI5 I;  4DPX A;  4LFB I;  3T0H A;  4B3T I;  1UY7 A;  4IZK A;  2CH4 A;  2YE4 A;  2YKE A;  4CWF A;  3QT8 A;  2E5L I;  4DV0 I;  3T10 A;  3EHF A;  1OSF A;  1DAR A;  3JAM C;  5GME A;  4XD8 A;  4ASG A;  5IT9 C;  2A2D A;  2ZM6 E;  1XMQ I;  1I94 E;  4GEE A;  2BU5 A;  1FWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...