3LNUA

Crystal structure of pare subunit
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
364
structure length
344
Chain Sequence
GLDPVKRRPGMYTDTARPNHLAQEVIDNSVDEALAGHAKQIEVTLYKDGSCEVSDDGRGMPVDIHPEEKIPGVELILTRLGVSVVNALSTKVELFIKREGSEHRMEFRDGNAASKLEVVGTVGKKNTGTRLRFWADPKYFDTPKFNVRALRHLLRAKAVLCPGLTVKLHDEATGEQDSWYFENGLRDYLKGEMAEHEMLPADLFVGSLKKDTEIVDWAAGWVPEGELVQESYVNLIPTAQHGTHVNGLRSGLTDALREFCDFRNLLPRGVKLAPEDVWDRVTFVLSLKMTDPQFSGQTKERLSSRQAAGFIEGAAHDAFSLYLNQNVEIGEKIAQIAIDRASAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Topoisomerase IV subunit B
publication title Crystal structure of ParE subunit
rcsb
source organism Xanthomonas oryzae pv. oryzae
molecule tags Isomerase
total genus 108
structure length 344
sequence length 364
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2010-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3lnuA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3lnuA01
2IOPA 3A0WA 3B8HA 3ZKDA 1UYHA 2BM0A 4BQJA 2FXSA 1H72C 1ZM4A 2PNRA 4E01A 3H80A 5C93A 4GGLA 4USMA 3B82A 2XDKA 4AS9A 1FI4A 4JI5I 2E0AA 3B24A 3CGYA 3J81Q 3HEKA 4LWFA 5IN9A 4Q20A 4K4OA 4NH7A 1U2RA 4WUDA 1U0ZA 1UEKA 4LF8I 3TZ5A 1B62A 1TH8A 2BREA 2HHHE 2NPFA 4UROA 4H85A 1N0VC 1GKZA 2UXDI 2BZ5A 4XKOA 1KZNA 3J80C 2XDXA 3GIEA 4R1FA 4FCPA 4DXLA 2AKPA 4DR1E 1MG7A 2CH4A 2BT0A 4DUHA 2YI0A 3TTZA 2CZ9A 3VHCA 1YSZA 1ZW9A 3VADA 2UUCE 1ZXNA 2CCTA 4GKKI 3QT6A 4HZ0A 2QF6A 4EEHA 1IBME 1UYKA 2YEIA 3O0IA 2BV3A 4NXNE 3BMYA 4CE2A 3ZZUA 2UUAI 3OW6A 4CWQA 1XMOI 2BU7A 4FW9A 3MNRP 2V2ZA 4DR4E 5F5RA 4EGIA 1YESA 4O09A 2F4VE 5CF0A 1IBKI 3FT5A 3D4JA 5GGZA 4EMDA 2VWCA 2YEGA 4YKYA 4CWOA 4EFTA 4JI7E 1RR9A 1S16A 4MPCA 3GIFA 2XX4A 3EHJA 4DUZI 4DV5I 4U7OA 5IWAE 2JKIA 3Q5LA 4ASAA 2ZKJA 4FPPA 4XIRA 1GJVA 1ID0A 1AMWA 2ZBKB 3A0YA 4MPNA 3VHDA 4DR2I 4Z7CA 4XIQA 4BIUA 2CG9A 2WEQA 3JAMC 4XKAA 2YE6A 4YKZA 3TZ4A 1FKAE 1RREA 2XD6A 4AWPA 1XNRE 5D6QA 3R4PA 1HNWE 1HNXE 2BRCA 2YEEA 2YEBA 3B25A 4CWTA 1VISA 1PVGA 2E5LI 2HFSA 3K99A 2AJ4A 1NZ0A 4KHPI 4JYAI 4P7AA 3R4NA 2YK2A 4PU9A 2XJXA 2BSMA 2VQFI 2V34A 2BU6A 3T0HA 2XHTA 3B28A 4JI0I 3Q5KA 1UYEA 3GONA 4DPUA 3CRKA 3TUHA 4E00A 2YKEA 3HHUA 2UUAE 4KTNA 4LF6E 1TIDA 2VF3A 1NHHA 3WU3A 4FWGA 2WERA 2XJJA 3Q1QA 4DPWA 2YEDA 4KQVA 4DV3I 1XMQE 4X65E 1YC4A 4XC0A 4AQYE 1WUUA 2HKJA 1ZM9A 4JI4E 2YEJA 1PIEA 1Z5CA 2H55A 4JI2E 3RLQA 4Z7YA 2HHHI 4DV5E 4LWEA 4DUYI 4X9LA 4YKXA 1FWKA 4XCLA 4W7TA 1K47A 5M4HA 4CE3A 4FWHA 4UTGA 2ZDYA 1KTVA 4DR1I 1Z5AA 4KSGA 4B3TE 3G75A 4LWHA 1XHKA 3ZKBA 2UUBI 4LF5E 2HKEA 2WI6A 3EHHA 4YY3E 2WI2A 2HG1A 4R3MA 2IWUA 2GS8A 5LMNE 4DV7I 4LF9I 3CRLA 1IBMI 2R3VA 1GKXA 3NMQA 1H74A 1N32I 2HK3A 4NXNI 3SL2A 2EFGA 4UT4A 4KHPE 1U2OA 5D7DA 3T2SA 4AWOA 4DR4I 4LFAE 1UYGA 2DEJA 2F4VI 4O04A 4HXWA 4JI0E 2UXBE 1D6TA 4QPKA 3OPDA 2UWDA 1J5EE 4JI7I 2X36A 4DV4E 3WU5A 2FYPA 1MX0A 1TILA 2XABA 5IWAI 1Y8OA 4DV3E 3C11A 5FNCA 2YKBA 4FMTA 4BAEA 1S4EA 5A2QC 4NH8A 4B3SE 1AM1A 2YEFA 4CE1A 4P8OA 1N33E 2YI6A 2YGEA 4X64E 3K1JA 2QG0A 3T10A 2YK9A 5CTXA 3OWDA 4DUYE 2V8PA 4DV1I 3PYFA 1XNQI 4B3ME 2ESAA 5CTYA 1Z0CA 4LP0A 1XNRI 3A0RA 1IBLE 4KP4A 4MPEA 5D7RA 4YHHE 4DR6E 1HNWI 1HNXI 4U7NA 4ASGA 4P52A 2VQEE 4EMVA 2IORA 1YT2A 2YE7A 4YKTA 3K98A 4HACA 4OX9E 3QDDA 2X7IA 2XCMA 4O0BA 2UUBE 4XD8A 2BU8A 2IWSA 4NH9A 1UYMA 2VW5A 4LWGA 1AJ6A 4DV7E 4LF9E 3OTOI 4JAUA 3QTFA 5BOCA 4BXIA 3INWA 4EM7A 1N32E 1TC6A 4LF6I 5L3JA 4JI6E 2XX5A 1QZRA 3K17A 4MYUA 4WUBA 1Y8NA 1Z0GA 4URNA 1XMQI 4MP2A 5IDMA 4X65I 1YT0A 4DV0E 4AQYI 5BODA 5LMUI 1I59A 1Y4UA 3R91A 3PYDA 1H73A 4JI4I 3U67A 1Z0TA 1NHIA 4JI2I 3HYZA 3PEJA 3ZM7A 1A4HA 4XDMA 3LNUA 5CTWA 3QT7A 5FNDA 2XEXA 4LF4E 1BYQA 4GT8A 2ZITA 4B3TI 3J7AG 4LF5I 4DV1E 4MP7A 1XNQE 2BYIA 1H7UA 5J71A 4DU8A 4HYPA 3OMUA 2YKIA 4YY3I 4LFCI 2CCSA 4JI8E 2FWZA 1ZM3A 4DPTA 5A2QQ 5LMNI 4KSHA 2XK2A 1BGQA 4YKWA 4E02A 4EGKA 3EKRA 3G7BA 3T1KA 3HZ1A 1ZM2A 2CGFA 3F0NA 1H7SA 3RKZA 1Z0BA 5J6AA 4MB9A 5FNFA 4LFAI 3GIGA 5IT9C 2XDSA 4HYMA 1EA6A 2FWYA 4H7QA 3OTOE 3ZZ0A 3J80Q 2UXBI 3EKOA 1TBWA 5FLXC 4DZYA 1J5EI 2EXLA 4CWPA 1UY6A 3R4MA 1N34E 4DV4I 2WI1A 2YGAA 4HY6A 3V5RA 3K60A 4DV6I 4X66E 4RPFA 1MU5A 5M4NA 2HCHA 1OJ4A 3B78A 2BM1A 4PRXA 5LMUE 4B3SI 4XKKA 2HFUA 4XTJA 2R42A 3V2UC 2C2AA 1N33I 4XCJA 5FWKA 4X64I 3ZZTA 3J81C 4O07A 3HULA 2O1VA 4LWIA 3O2FA 4B3MI 2V2VA 2WI3A 3EHGA 1IBLI 4GQTA 4YHHI 4NXMI 4DR6I 2Q8HA 2VQEI 2QG2A 1Z0EA 2YJWA 4XIPA 2Q8GA 1FNMA 4OX9I 4HZ5A 3B26A 4ZKIA 2YECA 1KIJA 1FJGE 3C0EA 3RLRA 2O1WA 2WI5A 3D36A 4LFCE 4GKJE 1UYIA 1UY7A 3QT5A 4B6CA 4DR5E 4ED4A 2HK2A 2GFDA 3A0XA 4DR3E 2VCIA 2YE8A 4BIZA 1N36E 1HNZE 3LPSA 2K5BA 1Y8PA 3FV5A 4JI6I 2WI7A 1YSRA 3JAMQ 2XHRA 2Q8IA 5BR8E 2DEIA 3ZXQA 3RLPA 4WUCA 4V25A 3JZ3A 2IOQA 4DV0I 1R62A 2WW4A 1OSFA 2V2QA 5F3KA 5M4PA 1AH8A 3WU4A 4L94A 1Z0WA 4JASA 4XITA 3TZ0A 2LJPA 1I58A 4DV6E 4YKRA 3PYEA 5IT9Q 4LPBA 3H4LA 4B3RE 2UU9E 4CWRA 2XX2A 3WU6A 1YC1A 4DU7A 4LF4I 4ASFA 2YE9A 1ZXMA 3G7EA 4LFBE 4EGHA 2YE2A 1HR0E 2YI7A 4R3AA 3OWBA 3BM9A 4JI3E 4NXME 2ZM6E 4JI8I 3ZXOA 5IDJA 1I5CA 2YEHA 3J7AM 4L93A 1I94I 1PKPA 1ELOA 4JG4A 4JI1E 5M4KA 3TZ2A 4DR7E 1THNA 3D0BA 4X62I 4GEEA 3FT8A 5D7CA 1FWLA 1AH6A 4URLA 4GFNA 4K0KI 1N34I 1S14A 2XJGA 5D6PA 4L91A 3CGZA 4X66I 3T1YI 1I5BA 4ASBA 3KE6A 4FCRA 4FN5A 4YKUA 1ZWHA 2XDUA 5M4EA 1YS3A 4LF7E 1UY9A 4HY1A 4KFGA 3U2DA 4L8ZA 1UYLA 2XDLA 4GCZA 2IWXA 2QFOA 2J7KA 1A6FA 4FWDA 4HACB 4DV2E 5CTUA 3D2RA 2BTZA 2YI5A 4I3HA 2ZDXA 4URMA 3R92A 1FJGI 3HYYA 2A2DA 4V26A 4GKJI 4USKA 4DR5I 2OI2A 4DPXA 2UXCI 4JI5E 4DR3I 1UY8A 4DPYA 1N36I 1HNZI 1KVKA 1I94E 1US7A 5BR8I 3HZ5A 4CWSA 3WHAA 1Z59A 2BU5A 4X62E 2YEAA 3T0ZA 4LF8E 2YE5A 1L0OA 1B3QA 4AWQA 3VHAA 4K0KE 4BQGA 5LL6R 3K97A 5M4MA 2O1UA 1Y4SA 4MBCA 2UXDE 2VCJA 3A0ZA 3T1HI 1YETA 3T1YE 2YE4A 3Q5JA 2H8MA 4B3RI 2UU9I 1KKHA 3IEDA 3CWVA 4U93A 2WEPA 4JV5I 4HXZA 4LFBI 5CPHA 4L90A 4GKKE 1QY8A 1I5AA 2YGFA 4XE2A 4CWFA 2BU2A 2Q8FA 1HR0I 1UYCA 4JI3I 2WI4A 2YKCA 1TC0A 4I5SA 2ZM6I 3WQ9A 2YKJA 3R4OA 4QPJA 2YE3A 1XMOE 4MYTA 2E1RA 1UYFA 3GIGB 1YERA 2GQPA 4ZVIA 4JI1I 1IBKE 4EFUA 4DR7I 4JAVA 3EHFA 3U2KA 1N0UA 2UXCE 4MOTA 3B27A 1DARA 2BYHA 4DUZE 1BKNA 1JM6A 3O6OA 5GMDA 4B7PA 3LTOA 2XHXA 4JQLA 1YT1A 4M1KA 3QT8A 4PL9A 4DR2E 1YC3A 1BXDA 3DGEA 1B63A 4CWNA 4FCQA 4LF7I 1QYEA 4YKQA 1Z0VA 3A0TA 2UUCI 4H81A 1EI1A 3T1HE 5GMEA 3M6AA 3PEHA 4O05A 2Q2EB 2YJXA 2JJCA 3INXA 4DV2I 2E5LE 4PRVA 1I5DA 3PYGA 5FLXQ 2A2CA 4JYAE 4JV5E 1Z5BA 1UYDA 2CCUA 1NHJA 2VQFE
chains in the Genus database with same CATH superfamily
2IOPA 4LCHA 5DROA 3A0WA 5EL9A 3B8HA 4IZJB 4MU4A 2BM0A 4QNKA 3ZKDA 1UYHA 2FXSA 4BQJA 4MU0A 1H72C 1ZM4A 2PNRA 4E01A 3H80A 5C93A 1NHJA 4USMA 4GGLA 3B82A 2XDKA 4AS9A 1FI4A 4JI5I 2E0AA 3B24A 3CGYA 3J81Q 3HEKA 1UDOA 3M85D 4LWFA 5IN9A 4Q20A 4IFDE 4K4OA 4NH7A 2PO0A 2C1IA 2O1TA 1U2RA 4WUDA 2FTKA 1U0ZA 1UEKA 1VI7A 4LF8I 3TZ5A 1B62A 1TH8A 1Y5YA 2BREA 2HHHE 3B4TA 2NPFA 4UROA 4H85A 1N0VC 1GKZA 2UXDI 2BZ5A 4XKOA 1KZNA 3J80C 2XDXA 3GIEA 4R1FA 4FCPA 4DXLA 2AKPA 4DR1E 1MG7A 2WNRB 2CH4A 2BT0A 4DUHA 2YI0A 3TTZA 2CZ9A 5JEAA 3VHCA 1YSZA 1ZW9A 3VADA 2UUCE 1ZXNA 2PNLA 2CCTA 4GKKI 3QT6A 4HZ0A 4OKGA 5C0XA 2QF6A 4EEHA 1IBME 1UYKA 2YEIA 4BA2B 3O0IA 2C38B 2BV3A 4NXNE 3BMYA 4CE2A 3ZZUA 2UUAI 1OYPA 3OW6A 4CWQA 1XMOI 2BU7A 4FW9A 3MNRP 2V2ZA 4DR4E 5F5RA 4EGIA 1YESA 4O09A 3Q6MA 5C0XF 2F4VE 3GCMA 5CF0A 3H1CA 1IBKI 1F51A 3D4JA 2BA1D 3FT5A 4EMDA 2VWCA 5GGZA 2YEGA 4YKYA 4CWOA 4EFTA 4OO1D 4JI7E 1RR9A 1S16A 4MPCA 3GIFA 2XX4A 3EHJA 4DUZI 4DV5I 2PO1A 5IWAE 2JKIA 3Q5LA 4U7OA 2ZKJA 4ASAA 4FPPA 4U3DA 4XIRA 1GJVA 1ID0A 4MDTA 1AMWA 3CYGA 2ZBKB 4IFDC 3A0YA 4MPNA 3VHDA 4DR2I 4Z7CA 4XIQA 4BIUA 4BA1A 2CG9A 2WEQA 3JAMC 4XKAA 3S5TA 2GQ0A 2YE6A 4YKZA 3TZ4A 1FKAE 1RREA 2XD6A 4AWPA 1XNRE 5D6QA 3R4PA 4OO1E 2BR2A 5ELWA 1HNWE 2GO4A 1HNXE 5K36B 4IZJD 2BRCA 2C1GA 3Q6NA 2YEEA 2YEBA 3B25A 4CWTA 1VISA 1PVGA 2E5LI 2HFSA 3K99A 2AJ4A 1NZ0A 4IZKB 4JYAI 4P7AA 4KHPI 2YK2A 4PU9A 3R4NA 2XJXA 2BSMA 1OYSA 2VQFI 2V34A 2NN6F 2BU6A 2XHTA 3B28A 3T0HA 2GO3A 4JI0I 3Q5KA 1UYEA 3GONA 4DPUA 3CRKA 3TUHA 4E00A 2YKEA 3HHUA 3L7ZA 2UUAE 4LF6E 1TIDA 4KTNA 2VF3A 1NHHA 3P3EA 4FWGA 5DRQA 3WU3A 3M7ND 2WERA 2XJJA 3Q1QA 4DPWA 4URNA 2YEDA 4KQVA 4DV3I 1XMQE 4X65E 1YC4A 4XC0A 4AQYE 1WUUA 3CDIA 4QNJA 2HKJA 1ZM9A 4JI4E 2YEJA 1PIEA 1Z5CA 2H55A 4JI2E 3RLQA 3PS3A 4Z7YA 4DV5E 2HHHI 4DUYI 4LWEA 4OZEA 2NN6B 4X9LA 4YKXA 1FWKA 4XCLA 2JEAA 4W7TA 1K47A 2PO2B 5M4HA 2O3ZA 4FWHA 4UTGA 2ZDYA 4CE3A 1KTVA 4DR1I 1Z5AA 4KSGA 4MU1A 4B3TE 3G75A 4LWHA 5JENA 1XHKA 2Z5BB 3ZKBA 4AM3A 2UUBI 4LF5E 2HKEA 2WI6A 3EHHA 1Y6ZA 4YY3E 2WI2A 2HG1A 4R3MA 2IWUA 2GS8A 5LMNE 4DV7I 4LF9I 3CRLA 1IBMI 2R3VA 1GKXA 3NMQA 4LOMA 1H74A 2Z5EA 3PS2A 1N32I 2HK3A 4NXNI 3SL2A 2EFGA 2JE6A 4UT4A 4KHPE 1U2OA 5D7DA 3T2SA 4AWOA 4DR4I 4LFAE 1UYGA 2DEJA 2F4VI 4O04A 4HXWA 2C39A 4JI0E 2JEBA 2UXBE 1D6TA 4QPKA 4LCGA 3OPDA 2UWDA 1J5EE 1HK7A 3HKMA 4JI7I 1YHCA 2X36A 4DV4E 3WU5A 2FYPA 1MX0A 1TILA 2XABA 5IWAI 1Y8OA 4DV3E 3C11A 5FNCA 2YKBA 4FMTA 4BAEA 1S4EA 5A2QC 4NH8A 5K36D 4B3SE 1AM1A 2YEFA 4CE1A 4P8OA 1N33E 2HHIA 2YI6A 4X64E 3K1JA 2QG0A 2YGEA 3T10A 2YK9A 5CTXA 3P3CA 4XCJA 3OWDA 4DUYE 2V8PA 1USVA 4DV1I 3PYFA 1XNQI 4B3ME 2ESAA 5CTYA 1Z0CA 4LP0A 1XNRI 3A0RA 1IBLE 4KP4A 4MPEA 5D7RA 4YHHE 4DR6E 1HNWI 1HNXI 4U7NA 4ASGA 4P52A 2VQEE 4EMVA 2IORA 1YT2A 2YE7A 4YKTA 3K98A 4HACA 5C0XE 4OX9E 3QDDA 2X7IA 2XCMA 2CGEA 4O0BA 2UUBE 4XD8A 2BU8A 2IWSA 4NH9A 5K36E 1UYMA 2WP8A 4FW5A 2VW5A 4LWGA 2F1DA 1AJ6A 3LMMA 4DV7E 4LF9E 3OTOI 4JAUA 3QTFA 5BOCA 4BXIA 3INWA 4EM7A 1N32E 1TC6A 5JEAF 4LF6I 4IFDA 5L3JA 4JI6E 2XX5A 1QZRA 3KRNA 3K17A 4MYUA 2VESA 4WUBA 1Z0GA 2NN6D 1Y8NA 1XMQI 2PO0B 4MP2A 4X65I 5IDMA 1YT0A 4DV0E 4AQYI 5BODA 5LMUI 1I59A 1Y4UA 3R91A 3PYDA 1H73A 3U1YA 4JI4I 4IFDF 1Z0TA 3U67A 2CVEA 1NHIA 4JI2I 3HYZA 3PEJA 3ZM7A 1A4HA 4XDMA 3LNUA 5CTWA 3QT7A 5FNDA 2XEXA 4LF4E 1BYQA 5JEAB 3PS1A 4GT8A 1RHYA 2NN6E 2ZITA 4B3TI 3J7AG 3M85G 4LF5I 4DV1E 4MP7A 5C0XB 1XNQE 2BYIA 1H7UA 4YKWA 4DU8A 4HYPA 5J71A 3OMUA 2YKIA 4YY3I 4LFCI 2CCSA 2Z5CA 4JI8E 2FWZA 1ZM3A 4DPTA 5A2QQ 5LMNI 4KSHA 2XK2A 1BGQA 4N3OA 4E02A 4FW7A 3EKRA 4EGKA 3G7BA 3T1KA 3HZ1A 1ZM2A 5C0XC 3F0NA 2CGFA 1H7SA 4U3BA 3RKZA 1Z0BA 5J6AA 4MB9A 5K36C 5FNFA 3CDJA 4LFAI 3GIGA 5IT9C 2XDSA 4HYMA 1EA6A 2FWYA 4H7QA 3OTOE 3ZZ0A 3J80Q 4FW4A 2UXBI 2PNZA 4IS9A 1TBWA 3EKOA 5FLXC 4DZYA 1J5EI 2EXLA 4CWPA 2PO1B 1UY6A 3R4MA 1N34E 4DV4I 2WI1A 2YGAA 4HY6A 3V5RA 3K60A 4AIDA 4DV6I 4X66E 4RPFA 1MU5A 5M4NA 2HCHA 1OJ4A 3B78A 2BM1A 4PRXA 5LMUE 4B3SI 4XKKA 2HFUA 4XTJA 2R42A 3V2UC 4BA1B 1N33I 5FWKA 2C2AA 4OO1A 3ZZTA 4X64I 3J81C 3UHMA 4O07A 4AIMA 3HULA 4MQYA 2O1VA 2BR2B 4LWIA 2BA0G 5DRRA 3O2FA 2BA1G 4B3MI 2V2VA 2WI3A 3EHGA 1IBLI 4GQTA 4YHHI 4NXMI 4DR6I 2Q8HA 2VQEI 2QG2A 1Z0EA 4OO1F 2YJWA 4XIPA 2Q8GA 1FNMA 4OX9I 1UDQA 2NN6C 4HZ5A 3B26A 4E72A 4ZKIA 3HJCA 2YECA 1KIJA 1FJGE 3C0EA 3RLRA 2O1WA 2WI5A 3D36A 4LFCE 4GKJE 1UYIA 1UY7A 3QT5A 4B6CA 4IZJA 4DR5E 3L7ZB 2HK2A 4ED4A 2GFDA 3A0XA 4DR3E 2VCIA 2YE8A 4BIZA 1N36E 1HNZE 1R6LA 3LPSA 2K5BA 1Y8PA 1USUA 4JI6I 2WI7A 1YSRA 3JAMQ 2XHRA 2JT2A 3FV5A 2Q8IA 1YH8A 4LPFA 5BR8E 2DEIA 3ZXQA 3RLPA 4WUCA 4V25A 3JZ3A 2IOQA 4DV0I 1R62A 2WW4A 1OSFA 5JEAD 2V2QA 3P06A 5F3KA 5M4PA 1AH8A 3WU4A 4L94A 1XXEA 1Z0WA 1UDNA 4JASA 4XITA 3TZ0A 2LJPA 5C0XD 1I58A 4DV6E 4YKRA 3PYEA 5IT9Q 4LPBA 3H4LA 4B3RE 2UU9E 4CWRA 2XX2A 3WU6A 1YC1A 4DU7A 4LF4I 4ASFA 2WNRA 2YE9A 2IESA 1ZXMA 3G7EA 4LFBE 4EGHA 2YE2A 1HR0E 1E3PA 2YI7A 3OWBA 3BM9A 4JI3E 4R3AA 5JEAE 4NXME 2ZM6E 4JI8I 3ZXOA 2JE6B 5IDJA 4BA2A 2C38A 1I5CA 2C37B 2YEHA 3J7AM 4L93A 1I94I 1PKPA 1ELOA 2C39B 2JEBB 4JG4A 4JI1E 5M4KA 3TZ2A 4DR7E 3P76A 1THNA 3D0BA 4X62I 4GEEA 3FT8A 5D7CA 1FWLA 1AH6A 4URLA 5DNXA 4GFNA 4K0KI 1N34I 1S14A 2PNMA 2XJGA 5D6PA 4L91A 3CGZA 4X66I 3T1YI 1I5BA 4ASBA 3KE6A 4FCRA 4FN5A 4YKUA 1ZWHA 2XDUA 5M4EA 1YS3A 4LF7E 1UY9A 4HY1A 4KFGA 3U2DA 4L8ZA 1UYLA 2XDLA 4GCZA 2IWXA 2QFOA 2J7KA 1A6FA 4FWDA 4HACB 5K36A 3GMEA 4DV2E 5CTUA 3D2RA 1E3HA 2WP8B 2BTZA 4I3HA 2YI5A 2ZDXA 3PRYA 4URMA 3R92A 4IZKA 1P42A 1FJGI 3HYYA 2BA0D 2A2DA 4V26A 4GKJI 5K36F 4USKA 5JEAC 4DR5I 2AE8A 4IFDB 2OI2A 2J65A 4DPXA 2UXCI 4JI5E 4DR3I 4ISAA 4DPYA 1UY8A 1N36I 1HNZI 4NBQA 1KVKA 1I94E 1US7A 5BR8I 3HZ5A 4CWSA 3WHAA 1Z59A 2BU5A 4X62E 2YEAA 3T0ZA 3U1KA 4LF8E 2YE5A 1L0OA 1B3QA 4AWQA 3VHAA 4K0KE 4BQGA 5LL6R 3K97A 5M4MA 2O1UA 1Y4SA 4MBCA 5DRPA 2UXDE 2VCJA 3A0ZA 3T1HI 1YETA 2NN6A 3T1YE 2YE4A 3Q5JA 2H8MA 4B3RI 2PO2A 1KKHA 4FW6A 2UU9I 4FW3A 3CWVA 3IEDA 4U93A 2WEPA 4JV5I 4HXZA 4LFBI 5CPHA 2Z5BA 4L90A 4GKKE 1OYRA 1I5AA 1QY8A 2YGFA 2Z5CB 4XE2A 2BU2A 4CWFA 2Q8FA 1HR0I 3K85A 1UYCA 4JI3I 2WI4A 2YKCA 1TC0A 4I5SA 2ZM6I 3WQ9A 2YKJA 3R4OA 2IERA 4QPJA 2YE3A 1XMOE 5DNLA 4MYTA 2E1RA 1UYFA 3GIGB 1YERA 2GQPA 1IXMA 4ZVIA 4JI1I 1IBKE 2PNZB 4EFUA 4DR7I 4JAVA 4LCFA 3EHFA 3U2KA 1N0UA 1R6MA 4J3DA 2UXCE 4MOTA 3B27A 1DARA 4GQUA 2BYHA 4DUZE 1BKNA 1UDSA 1JM6A 3O6OA 5GMDA 4B7PA 3LTOA 2XHXA 4JQLA 1YT1A 4M1KA 3QT8A 4PL9A 4OO1B 4DR2E 1YC3A 1BXDA 3DGEA 1B63A 4CWNA 3DD6A 4FCQA 4LF7I 1QYEA 4YKQA 1Z0VA 1Y60A 3A0TA 2UUCI 4H81A 1EI1A 3T1HE 5GMEA 2JEAB 3M6AA 5EKWA 4MU3A 4OO1C 3PEHA 4O05A 2Q2EB 3NZKA 2YJXA 2JJCA 3INXA 4DV2I 2E5LE 4PRVA 1I5DA 3M7NG 4IFDD 3PYGA 5FLXQ 2A2CA 4JYAE 4JV5E 1Z5BA 1UYDA 2CCUA 3P3GA 2C37A 3GLLA 2VQFE
chains in the Genus database with same CATH topology
2IOPA 3A0WA 3B8HA 4IZJB 3ZKDA 2BM0A 1UYHA 2FXSA 4BQJA 1H72C 1ZM4A 2PNRA 4E01A 3H80A 5C93A 4GGLA 4USMA 3B82A 2XDKA 4AS9A 1FI4A 4JI5I 2E0AA 3B24A 3CGYA 3J81Q 3HEKA 4LWFA 5IN9A 4Q20A 4K4OA 4NH7A 2O1TA 1U2RA 4WUDA 1U0ZA 1UEKA 4LF8I 3TZ5A 1B62A 1TH8A 2BREA 2HHHE 2NPFA 4UROA 4H85A 1N0VC 1GKZA 2UXDI 2BZ5A 4XKOA 1KZNA 3J80C 2XDXA 3GIEA 4R1FA 4FCPA 4DXLA 2AKPA 4DR1E 1MG7A 2CH4A 2BT0A 4DUHA 2YI0A 3TTZA 2CZ9A 3VHCA 1YSZA 1ZW9A 3VADA 2UUCE 1ZXNA 2PNLA 2CCTA 4GKKI 3QT6A 4HZ0A 2QF6A 4EEHA 1IBME 1UYKA 2YEIA 3O0IA 2BV3A 4NXNE 3BMYA 4CE2A 3ZZUA 2UUAI 3OW6A 4CWQA 1XMOI 2BU7A 4FW9A 3MNRP 2V2ZA 4DR4E 5F5RA 4EGIA 1YESA 4O09A 3Q6MA 2F4VE 5CF0A 1IBKI 3FT5A 3D4JA 5GGZA 4EMDA 2VWCA 2YEGA 4YKYA 4CWOA 4EFTA 4JI7E 1RR9A 1S16A 4MPCA 3GIFA 2XX4A 3EHJA 4DUZI 4DV5I 4U7OA 5IWAE 2JKIA 3Q5LA 4ASAA 2ZKJA 4FPPA 4XIRA 1GJVA 1ID0A 1AMWA 2ZBKB 3A0YA 4MPNA 3VHDA 4DR2I 4Z7CA 4XIQA 4BIUA 2CG9A 2WEQA 3JAMC 4XKAA 2GQ0A 2YE6A 4YKZA 3TZ4A 1FKAE 1RREA 2XD6A 4AWPA 1XNRE 5D6QA 3R4PA 1HNWE 1HNXE 2BRCA 4IZJD 2YEEA 2YEBA 3Q6NA 3B25A 4CWTA 1VISA 1PVGA 2E5LI 2HFSA 3K99A 2AJ4A 1NZ0A 4IZKB 4JYAI 4P7AA 4KHPI 2YK2A 4PU9A 3R4NA 2XJXA 2BSMA 2VQFI 2V34A 2BU6A 3T0HA 2XHTA 3B28A 4JI0I 3Q5KA 1UYEA 3GONA 4DPUA 3CRKA 3TUHA 4E00A 2YKEA 3HHUA 2UUAE 4KTNA 4LF6E 1TIDA 2VF3A 1NHHA 3WU3A 4FWGA 2WERA 2XJJA 3Q1QA 4DPWA 2YEDA 4KQVA 4DV3I 1XMQE 4X65E 1YC4A 4XC0A 4AQYE 1WUUA 2HKJA 1ZM9A 4JI4E 2YEJA 1PIEA 1Z5CA 2H55A 4JI2E 3RLQA 4Z7YA 2HHHI 4DV5E 4LWEA 4DUYI 4X9LA 4YKXA 1FWKA 4XCLA 4W7TA 1K47A 5M4HA 4CE3A 4FWHA 4UTGA 2ZDYA 1KTVA 4DR1I 1Z5AA 4KSGA 4B3TE 3G75A 4LWHA 1XHKA 2Z5BB 3ZKBA 2UUBI 4LF5E 2HKEA 2WI6A 3EHHA 1Y6ZA 4YY3E 2WI2A 2HG1A 4R3MA 2IWUA 2GS8A 5LMNE 4DV7I 4LF9I 3CRLA 1IBMI 2R3VA 1GKXA 3NMQA 1H74A 2Z5EA 1N32I 2HK3A 4NXNI 3SL2A 2EFGA 4UT4A 4KHPE 1U2OA 5D7DA 3T2SA 4AWOA 4DR4I 4LFAE 1UYGA 2DEJA 2F4VI 4O04A 4HXWA 4JI0E 2UXBE 1D6TA 4QPKA 3OPDA 2UWDA 1J5EE 1HK7A 4JI7I 2X36A 4DV4E 3WU5A 2FYPA 1MX0A 1TILA 2XABA 5IWAI 1Y8OA 4DV3E 3C11A 5FNCA 2YKBA 4FMTA 4BAEA 1S4EA 5A2QC 4NH8A 4B3SE 1AM1A 2YEFA 4CE1A 4P8OA 1N33E 2YI6A 2YGEA 4X64E 3K1JA 2QG0A 3T10A 2YK9A 5CTXA 3OWDA 4DUYE 2V8PA 1USVA 4DV1I 3PYFA 1XNQI 4B3ME 2ESAA 5CTYA 1Z0CA 4LP0A 1XNRI 3A0RA 1IBLE 4KP4A 4MPEA 5D7RA 4YHHE 4DR6E 1HNWI 1HNXI 4U7NA 4ASGA 4P52A 2VQEE 4EMVA 2IORA 1YT2A 2YE7A 4YKTA 3K98A 4HACA 4OX9E 3QDDA 2X7IA 2XCMA 2CGEA 4O0BA 2UUBE 4XD8A 2BU8A 2IWSA 4NH9A 1UYMA 2VW5A 4LWGA 1AJ6A 4DV7E 4LF9E 3OTOI 4JAUA 3QTFA 5BOCA 4BXIA 3INWA 4EM7A 1N32E 1TC6A 4LF6I 5L3JA 4JI6E 2XX5A 1QZRA 3K17A 4MYUA 4WUBA 1Y8NA 1Z0GA 4URNA 1XMQI 4MP2A 5IDMA 4X65I 1YT0A 4DV0E 4AQYI 5BODA 5LMUI 1I59A 1Y4UA 3R91A 3PYDA 1H73A 4JI4I 3U67A 1Z0TA 1NHIA 4JI2I 3HYZA 3PEJA 3ZM7A 1A4HA 4XDMA 3LNUA 5CTWA 3QT7A 5FNDA 2XEXA 4LF4E 1BYQA 4GT8A 2ZITA 4B3TI 3J7AG 4LF5I 4DV1E 4MP7A 1XNQE 2BYIA 1H7UA 4YKWA 4DU8A 4HYPA 5J71A 3OMUA 2YKIA 4YY3I 4LFCI 2CCSA 2Z5CA 4JI8E 2FWZA 1ZM3A 4DPTA 5A2QQ 5LMNI 4KSHA 2XK2A 1BGQA 4N3OA 4E02A 4EGKA 3EKRA 3G7BA 3T1KA 3HZ1A 1ZM2A 2CGFA 3F0NA 1H7SA 3RKZA 1Z0BA 5J6AA 4MB9A 5FNFA 4LFAI 3GIGA 5IT9C 2XDSA 4HYMA 1EA6A 2FWYA 4H7QA 3OTOE 3ZZ0A 3J80Q 2UXBI 3EKOA 1TBWA 5FLXC 4DZYA 1J5EI 2EXLA 4CWPA 1UY6A 3R4MA 1N34E 4DV4I 2WI1A 2YGAA 4HY6A 3V5RA 3K60A 4DV6I 4X66E 4RPFA 1MU5A 5M4NA 2HCHA 1OJ4A 3B78A 2BM1A 4PRXA 5LMUE 4B3SI 4XKKA 2HFUA 4XTJA 2R42A 3V2UC 2C2AA 1N33I 5FWKA 4XCJA 4X64I 3ZZTA 3J81C 4O07A 3HULA 2O1VA 4LWIA 3O2FA 4B3MI 2V2VA 2WI3A 3EHGA 1IBLI 4GQTA 4YHHI 4NXMI 4DR6I 2Q8HA 2VQEI 2QG2A 1Z0EA 2YJWA 4XIPA 2Q8GA 1FNMA 4OX9I 4HZ5A 3B26A 4ZKIA 3HJCA 2YECA 1KIJA 1FJGE 3C0EA 3RLRA 2O1WA 2WI5A 3D36A 4LFCE 4GKJE 1UYIA 1UY7A 3QT5A 4B6CA 4IZJA 4DR5E 4ED4A 2HK2A 2GFDA 3A0XA 4DR3E 2VCIA 2YE8A 4BIZA 1N36E 1HNZE 3LPSA 2K5BA 1Y8PA 1USUA 4JI6I 2WI7A 1YSRA 3JAMQ 2XHRA 3FV5A 2Q8IA 5BR8E 2DEIA 3ZXQA 3RLPA 4WUCA 4V25A 3JZ3A 2IOQA 4DV0I 1R62A 2WW4A 1OSFA 2V2QA 3P06A 5F3KA 5M4PA 1AH8A 3WU4A 4L94A 1Z0WA 4JASA 4XITA 3TZ0A 2LJPA 1I58A 4DV6E 4YKRA 3PYEA 5IT9Q 4LPBA 3H4LA 4B3RE 2UU9E 4CWRA 2XX2A 3WU6A 1YC1A 4DU7A 4LF4I 4ASFA 2YE9A 1ZXMA 3G7EA 4LFBE 4EGHA 2YE2A 1HR0E 2YI7A 4R3AA 3OWBA 3BM9A 4JI3E 4NXME 2ZM6E 4JI8I 3ZXOA 5IDJA 1I5CA 2YEHA 3J7AM 4L93A 1I94I 1PKPA 1ELOA 4JG4A 4JI1E 5M4KA 3TZ2A 4DR7E 1THNA 3D0BA 4X62I 4GEEA 3FT8A 5D7CA 1FWLA 1AH6A 4URLA 4GFNA 4K0KI 1N34I 1S14A 2PNMA 2XJGA 5D6PA 4L91A 3CGZA 4X66I 3T1YI 1I5BA 4ASBA 3KE6A 4FCRA 4FN5A 4YKUA 1ZWHA 2XDUA 5M4EA 1YS3A 4LF7E 1UY9A 4HY1A 4KFGA 3U2DA 4L8ZA 1UYLA 2XDLA 4GCZA 2IWXA 2QFOA 2J7KA 1A6FA 4FWDA 4HACB 4DV2E 5CTUA 3D2RA 2BTZA 2YI5A 4I3HA 2ZDXA 3PRYA 4URMA 3R92A 4IZKA 1FJGI 3HYYA 2A2DA 4V26A 4GKJI 4USKA 4DR5I 2OI2A 4DPXA 2UXCI 4JI5E 4DR3I 1UY8A 4DPYA 1N36I 1HNZI 1KVKA 1I94E 1US7A 5BR8I 3HZ5A 4CWSA 3WHAA 1Z59A 2BU5A 4X62E 2YEAA 3T0ZA 4LF8E 2YE5A 1L0OA 1B3QA 4AWQA 3VHAA 4K0KE 4BQGA 5LL6R 3K97A 5M4MA 2O1UA 1Y4SA 4MBCA 2UXDE 2VCJA 3A0ZA 3T1HI 1YETA 3T1YE 2YE4A 3Q5JA 2H8MA 4B3RI 2UU9I 1KKHA 3IEDA 3CWVA 4U93A 2WEPA 4JV5I 4HXZA 4LFBI 5CPHA 2Z5BA 4L90A 4GKKE 1QY8A 1I5AA 2YGFA 4XE2A 2Z5CB 4CWFA 2BU2A 2Q8FA 1HR0I 3K85A 1UYCA 4JI3I 2WI4A 2YKCA 1TC0A 4I5SA 2ZM6I 3WQ9A 2YKJA 3R4OA 4QPJA 2YE3A 1XMOE 4MYTA 2E1RA 1UYFA 3GIGB 1YERA 2GQPA 4ZVIA 4JI1I 1IBKE 4EFUA 4DR7I 4JAVA 3EHFA 3U2KA 1N0UA 2UXCE 4MOTA 3B27A 1DARA 2BYHA 4DUZE 1BKNA 1JM6A 3O6OA 5GMDA 4B7PA 3LTOA 2XHXA 4JQLA 1YT1A 4M1KA 3QT8A 4PL9A 4DR2E 1YC3A 1BXDA 3DGEA 1B63A 4CWNA 4FCQA 4LF7I 1QYEA 4YKQA 1Z0VA 3A0TA 2UUCI 4H81A 1EI1A 3T1HE 5GMEA 3M6AA 3PEHA 4O05A 2Q2EB 2YJXA 2JJCA 3INXA 4DV2I 2E5LE 4PRVA 1I5DA 3PYGA 5FLXQ 2A2CA 4JYAE 4JV5E 1Z5BA 1UYDA 2CCUA 1NHJA 2VQFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IOP A;  3A0W A;  3B8H A;  3ZKD A;  1UYH A;  2BM0 A;  4BQJ A;  2FXS A;  1H72 C;  1ZM4 A;  2PNR A;  4E01 A;  3H80 A;  5C93 A;  4GGL A;  4USM A;  3B82 A;  2XDK A;  4AS9 A;  1FI4 A;  4JI5 I;  2E0A A;  3B24 A;  3CGY A;  3J81 Q;  3HEK A;  4LWF A;  5IN9 A;  4Q20 A;  4K4O A;  4NH7 A;  1U2R A;  4WUD A;  1U0Z A;  1UEK A;  4LF8 I;  3TZ5 A;  1B62 A;  1TH8 A;  2BRE A;  2HHH E;  2NPF A;  4URO A;  4H85 A;  1N0V C;  1GKZ A;  2UXD I;  2BZ5 A;  4XKO A;  1KZN A;  3J80 C;  2XDX A;  3GIE A;  4R1F A;  4FCP A;  4DXL A;  2AKP A;  4DR1 E;  1MG7 A;  2CH4 A;  2BT0 A;  4DUH A;  2YI0 A;  3TTZ A;  2CZ9 A;  3VHC A;  1YSZ A;  1ZW9 A;  3VAD A;  2UUC E;  1ZXN A;  2CCT A;  4GKK I;  3QT6 A;  4HZ0 A;  2QF6 A;  4EEH A;  1IBM E;  1UYK A;  2YEI A;  3O0I A;  2BV3 A;  4NXN E;  3BMY A;  4CE2 A;  3ZZU A;  2UUA I;  3OW6 A;  4CWQ A;  1XMO I;  2BU7 A;  4FW9 A;  3MNR P;  2V2Z A;  4DR4 E;  5F5R A;  4EGI A;  1YES A;  4O09 A;  2F4V E;  5CF0 A;  1IBK I;  3FT5 A;  3D4J A;  5GGZ A;  4EMD A;  2VWC A;  2YEG A;  4YKY A;  4CWO A;  4EFT A;  4JI7 E;  1RR9 A;  1S16 A;  4MPC A;  3GIF A;  2XX4 A;  3EHJ A;  4DUZ I;  4DV5 I;  4U7O A;  5IWA E;  2JKI A;  3Q5L A;  4ASA A;  2ZKJ A;  4FPP A;  4XIR A;  1GJV A;  1ID0 A;  1AMW A;  2ZBK B;  3A0Y A;  4MPN A;  3VHD A;  4DR2 I;  4Z7C A;  4XIQ A;  4BIU A;  2CG9 A;  2WEQ A;  3JAM C;  4XKA A;  2YE6 A;  4YKZ A;  3TZ4 A;  1FKA E;  1RRE A;  2XD6 A;  4AWP A;  1XNR E;  5D6Q A;  3R4P A;  1HNW E;  1HNX E;  2BRC A;  2YEE A;  2YEB A;  3B25 A;  4CWT A;  1VIS A;  1PVG A;  2E5L I;  2HFS A;  3K99 A;  2AJ4 A;  1NZ0 A;  4KHP I;  4JYA I;  4P7A A;  3R4N A;  2YK2 A;  4PU9 A;  2XJX A;  2BSM A;  2VQF I;  2V34 A;  2BU6 A;  3T0H A;  2XHT A;  3B28 A;  4JI0 I;  3Q5K A;  1UYE A;  3GON A;  4DPU A;  3CRK A;  3TUH A;  4E00 A;  2YKE A;  3HHU A;  2UUA E;  4KTN A;  4LF6 E;  1TID A;  2VF3 A;  1NHH A;  3WU3 A;  4FWG A;  2WER A;  2XJJ A;  3Q1Q A;  4DPW A;  2YED A;  4KQV A;  4DV3 I;  1XMQ E;  4X65 E;  1YC4 A;  4XC0 A;  4AQY E;  1WUU A;  2HKJ A;  1ZM9 A;  4JI4 E;  2YEJ A;  1PIE A;  1Z5C A;  2H55 A;  4JI2 E;  3RLQ A;  4Z7Y A;  2HHH I;  4DV5 E;  4LWE A;  4DUY I;  4X9L A;  4YKX A;  1FWK A;  4XCL A;  4W7T A;  1K47 A;  5M4H A;  4CE3 A;  4FWH A;  4UTG A;  2ZDY A;  1KTV A;  4DR1 I;  1Z5A A;  4KSG A;  4B3T E;  3G75 A;  4LWH A;  1XHK A;  3ZKB A;  2UUB I;  4LF5 E;  2HKE A;  2WI6 A;  3EHH A;  4YY3 E;  2WI2 A;  2HG1 A;  4R3M A;  2IWU A;  2GS8 A;  5LMN E;  4DV7 I;  4LF9 I;  3CRL A;  1IBM I;  2R3V A;  1GKX A;  3NMQ A;  1H74 A;  1N32 I;  2HK3 A;  4NXN I;  3SL2 A;  2EFG A;  4UT4 A;  4KHP E;  1U2O A;  5D7D A;  3T2S A;  4AWO A;  4DR4 I;  4LFA E;  1UYG A;  2DEJ A;  2F4V I;  4O04 A;  4HXW A;  4JI0 E;  2UXB E;  1D6T A;  4QPK A;  3OPD A;  2UWD A;  1J5E E;  4JI7 I;  2X36 A;  4DV4 E;  3WU5 A;  2FYP A;  1MX0 A;  1TIL A;  2XAB A;  5IWA I;  1Y8O A;  4DV3 E;  3C11 A;  5FNC A;  2YKB A;  4FMT A;  4BAE A;  1S4E A;  5A2Q C;  4NH8 A;  4B3S E;  1AM1 A;  2YEF A;  4CE1 A;  4P8O A;  1N33 E;  2YI6 A;  2YGE A;  4X64 E;  3K1J A;  2QG0 A;  3T10 A;  2YK9 A;  5CTX A;  3OWD A;  4DUY E;  2V8P A;  4DV1 I;  3PYF A;  1XNQ I;  4B3M E;  2ESA A;  5CTY A;  1Z0C A;  4LP0 A;  1XNR I;  3A0R A;  1IBL E;  4KP4 A;  4MPE A;  5D7R A;  4YHH E;  4DR6 E;  1HNW I;  1HNX I;  4U7N A;  4ASG A;  4P52 A;  2VQE E;  4EMV A;  2IOR A;  1YT2 A;  2YE7 A;  4YKT A;  3K98 A;  4HAC A;  4OX9 E;  3QDD A;  2X7I A;  2XCM A;  4O0B A;  2UUB E;  4XD8 A;  2BU8 A;  2IWS A;  4NH9 A;  1UYM A;  2VW5 A;  4LWG A;  1AJ6 A;  4DV7 E;  4LF9 E;  3OTO I;  4JAU A;  3QTF A;  5BOC A;  4BXI A;  3INW A;  4EM7 A;  1N32 E;  1TC6 A;  4LF6 I;  5L3J A;  4JI6 E;  2XX5 A;  1QZR A;  3K17 A;  4MYU A;  4WUB A;  1Y8N A;  1Z0G A;  4URN A;  1XMQ I;  4MP2 A;  5IDM A;  4X65 I;  1YT0 A;  4DV0 E;  4AQY I;  5BOD A;  5LMU I;  1I59 A;  1Y4U A;  3R91 A;  3PYD A;  1H73 A;  4JI4 I;  3U67 A;  1Z0T A;  1NHI A;  4JI2 I;  3HYZ A;  3PEJ A;  3ZM7 A;  1A4H A;  4XDM A;  3LNU A;  5CTW A;  3QT7 A;  5FND A;  2XEX A;  4LF4 E;  1BYQ A;  4GT8 A;  2ZIT A;  4B3T I;  3J7A G;  4LF5 I;  4DV1 E;  4MP7 A;  1XNQ E;  2BYI A;  1H7U A;  5J71 A;  4DU8 A;  4HYP A;  3OMU A;  2YKI A;  4YY3 I;  4LFC I;  2CCS A;  4JI8 E;  2FWZ A;  1ZM3 A;  4DPT A;  5A2Q Q;  5LMN I;  4KSH A;  2XK2 A;  1BGQ A;  4YKW A;  4E02 A;  4EGK A;  3EKR A;  3G7B A;  3T1K A;  3HZ1 A;  1ZM2 A;  2CGF A;  3F0N A;  1H7S A;  3RKZ A;  1Z0B A;  5J6A A;  4MB9 A;  5FNF A;  4LFA I;  3GIG A;  5IT9 C;  2XDS A;  4HYM A;  1EA6 A;  2FWY A;  4H7Q A;  3OTO E;  3ZZ0 A;  3J80 Q;  2UXB I;  3EKO A;  1TBW A;  5FLX C;  4DZY A;  1J5E I;  2EXL A;  4CWP A;  1UY6 A;  3R4M A;  1N34 E;  4DV4 I;  2WI1 A;  2YGA A;  4HY6 A;  3V5R A;  3K60 A;  4DV6 I;  4X66 E;  4RPF A;  1MU5 A;  5M4N A;  2HCH A;  1OJ4 A;  3B78 A;  2BM1 A;  4PRX A;  5LMU E;  4B3S I;  4XKK A;  2HFU A;  4XTJ A;  2R42 A;  3V2U C;  2C2A A;  1N33 I;  4XCJ A;  5FWK A;  4X64 I;  3ZZT A;  3J81 C;  4O07 A;  3HUL A;  2O1V A;  4LWI A;  3O2F A;  4B3M I;  2V2V A;  2WI3 A;  3EHG A;  1IBL I;  4GQT A;  4YHH I;  4NXM I;  4DR6 I;  2Q8H A;  2VQE I;  2QG2 A;  1Z0E A;  2YJW A;  4XIP A;  2Q8G A;  1FNM A;  4OX9 I;  4HZ5 A;  3B26 A;  4ZKI A;  2YEC A;  1KIJ A;  1FJG E;  3C0E A;  3RLR A;  2O1W A;  2WI5 A;  3D36 A;  4LFC E;  4GKJ E;  1UYI A;  1UY7 A;  3QT5 A;  4B6C A;  4DR5 E;  4ED4 A;  2HK2 A;  2GFD A;  3A0X A;  4DR3 E;  2VCI A;  2YE8 A;  4BIZ A;  1N36 E;  1HNZ E;  3LPS A;  2K5B A;  1Y8P A;  3FV5 A;  4JI6 I;  2WI7 A;  1YSR A;  3JAM Q;  2XHR A;  2Q8I A;  5BR8 E;  2DEI A;  3ZXQ A;  3RLP A;  4WUC A;  4V25 A;  3JZ3 A;  2IOQ A;  4DV0 I;  1R62 A;  2WW4 A;  1OSF A;  2V2Q A;  5F3K A;  5M4P A;  1AH8 A;  3WU4 A;  4L94 A;  1Z0W A;  4JAS A;  4XIT A;  3TZ0 A;  2LJP A;  1I58 A;  4DV6 E;  4YKR A;  3PYE A;  5IT9 Q;  4LPB A;  3H4L A;  4B3R E;  2UU9 E;  4CWR A;  2XX2 A;  3WU6 A;  1YC1 A;  4DU7 A;  4LF4 I;  4ASF A;  2YE9 A;  1ZXM A;  3G7E A;  4LFB E;  4EGH A;  2YE2 A;  1HR0 E;  2YI7 A;  4R3A A;  3OWB A;  3BM9 A;  4JI3 E;  4NXM E;  2ZM6 E;  4JI8 I;  3ZXO A;  5IDJ A;  1I5C A;  2YEH A;  3J7A M;  4L93 A;  1I94 I;  1PKP A;  1ELO A;  4JG4 A;  4JI1 E;  5M4K A;  3TZ2 A;  4DR7 E;  1THN A;  3D0B A;  4X62 I;  4GEE A;  3FT8 A;  5D7C A;  1FWL A;  1AH6 A;  4URL A;  4GFN A;  4K0K I;  1N34 I;  1S14 A;  2XJG A;  5D6P A;  4L91 A;  3CGZ A;  4X66 I;  3T1Y I;  1I5B A;  4ASB A;  3KE6 A;  4FCR A;  4FN5 A;  4YKU A;  1ZWH A;  2XDU A;  5M4E A;  1YS3 A;  4LF7 E;  1UY9 A;  4HY1 A;  4KFG A;  3U2D A;  4L8Z A;  1UYL A;  2XDL A;  4GCZ A;  2IWX A;  2QFO A;  2J7K A;  1A6F A;  4FWD A;  4HAC B;  4DV2 E;  5CTU A;  3D2R A;  2BTZ A;  2YI5 A;  4I3H A;  2ZDX A;  4URM A;  3R92 A;  1FJG I;  3HYY A;  2A2D A;  4V26 A;  4GKJ I;  4USK A;  4DR5 I;  2OI2 A;  4DPX A;  2UXC I;  4JI5 E;  4DR3 I;  1UY8 A;  4DPY A;  1N36 I;  1HNZ I;  1KVK A;  1I94 E;  1US7 A;  5BR8 I;  3HZ5 A;  4CWS A;  3WHA A;  1Z59 A;  2BU5 A;  4X62 E;  2YEA A;  3T0Z A;  4LF8 E;  2YE5 A;  1L0O A;  1B3Q A;  4AWQ A;  3VHA A;  4K0K E;  4BQG A;  5LL6 R;  3K97 A;  5M4M A;  2O1U A;  1Y4S A;  4MBC A;  2UXD E;  2VCJ A;  3A0Z A;  3T1H I;  1YET A;  3T1Y E;  2YE4 A;  3Q5J A;  2H8M A;  4B3R I;  2UU9 I;  1KKH A;  3IED A;  3CWV A;  4U93 A;  2WEP A;  4JV5 I;  4HXZ A;  4LFB I;  5CPH A;  4L90 A;  4GKK E;  1QY8 A;  1I5A A;  2YGF A;  4XE2 A;  4CWF A;  2BU2 A;  2Q8F A;  1HR0 I;  1UYC A;  4JI3 I;  2WI4 A;  2YKC A;  1TC0 A;  4I5S A;  2ZM6 I;  3WQ9 A;  2YKJ A;  3R4O A;  4QPJ A;  2YE3 A;  1XMO E;  4MYT A;  2E1R A;  1UYF A;  3GIG B;  1YER A;  2GQP A;  4ZVI A;  4JI1 I;  1IBK E;  4EFU A;  4DR7 I;  4JAV A;  3EHF A;  3U2K A;  1N0U A;  2UXC E;  4MOT A;  3B27 A;  1DAR A;  2BYH A;  4DUZ E;  1BKN A;  1JM6 A;  3O6O A;  5GMD A;  4B7P A;  3LTO A;  2XHX A;  4JQL A;  1YT1 A;  4M1K A;  3QT8 A;  4PL9 A;  4DR2 E;  1YC3 A;  1BXD A;  3DGE A;  1B63 A;  4CWN A;  4FCQ A;  4LF7 I;  1QYE A;  4YKQ A;  1Z0V A;  3A0T A;  2UUC I;  4H81 A;  1EI1 A;  3T1H E;  5GME A;  3M6A A;  3PEH A;  4O05 A;  2Q2E B;  2YJX A;  2JJC A;  3INX A;  4DV2 I;  2E5L E;  4PRV A;  1I5D A;  3PYG A;  5FLX Q;  2A2C A;  4JYA E;  4JV5 E;  1Z5B A;  1UYD A;  2CCU A;  1NHJ A;  2VQF E; 
#chains in the Genus database with same CATH topology
 2IOP A;  4LCH A;  5DRO A;  3A0W A;  5EL9 A;  3B8H A;  4IZJ B;  4MU4 A;  2BM0 A;  4QNK A;  3ZKD A;  1UYH A;  2FXS A;  4BQJ A;  4MU0 A;  1H72 C;  1ZM4 A;  2PNR A;  4E01 A;  3H80 A;  5C93 A;  1NHJ A;  4USM A;  4GGL A;  3B82 A;  2XDK A;  4AS9 A;  1FI4 A;  4JI5 I;  2E0A A;  3B24 A;  3CGY A;  3J81 Q;  3HEK A;  1UDO A;  3M85 D;  4LWF A;  5IN9 A;  4Q20 A;  4IFD E;  4K4O A;  4NH7 A;  2PO0 A;  2C1I A;  2O1T A;  1U2R A;  4WUD A;  2FTK A;  1U0Z A;  1UEK A;  1VI7 A;  4LF8 I;  3TZ5 A;  1B62 A;  1TH8 A;  1Y5Y A;  2BRE A;  2HHH E;  3B4T A;  2NPF A;  4URO A;  4H85 A;  1N0V C;  1GKZ A;  2UXD I;  2BZ5 A;  4XKO A;  1KZN A;  3J80 C;  2XDX A;  3GIE A;  4R1F A;  4FCP A;  4DXL A;  2AKP A;  4DR1 E;  1MG7 A;  2WNR B;  2CH4 A;  2BT0 A;  4DUH A;  2YI0 A;  3TTZ A;  2CZ9 A;  5JEA A;  3VHC A;  1YSZ A;  1ZW9 A;  3VAD A;  2UUC E;  1ZXN A;  2PNL A;  2CCT A;  4GKK I;  3QT6 A;  4HZ0 A;  4OKG A;  5C0X A;  2QF6 A;  4EEH A;  1IBM E;  1UYK A;  2YEI A;  4BA2 B;  3O0I A;  2C38 B;  2BV3 A;  4NXN E;  3BMY A;  4CE2 A;  3ZZU A;  2UUA I;  1OYP A;  3OW6 A;  4CWQ A;  1XMO I;  2BU7 A;  4FW9 A;  3MNR P;  2V2Z A;  4DR4 E;  5F5R A;  4EGI A;  1YES A;  4O09 A;  3Q6M A;  5C0X F;  2F4V E;  3GCM A;  5CF0 A;  3H1C A;  1IBK I;  1F51 A;  3D4J A;  2BA1 D;  3FT5 A;  4EMD A;  2VWC A;  5GGZ A;  2YEG A;  4YKY A;  4CWO A;  4EFT A;  4OO1 D;  4JI7 E;  1RR9 A;  1S16 A;  4MPC A;  3GIF A;  2XX4 A;  3EHJ A;  4DUZ I;  4DV5 I;  2PO1 A;  5IWA E;  2JKI A;  3Q5L A;  4U7O A;  2ZKJ A;  4ASA A;  4FPP A;  4U3D A;  4XIR A;  1GJV A;  1ID0 A;  4MDT A;  1AMW A;  3CYG A;  2ZBK B;  4IFD C;  3A0Y A;  4MPN A;  3VHD A;  4DR2 I;  4Z7C A;  4XIQ A;  4BIU A;  4BA1 A;  2CG9 A;  2WEQ A;  3JAM C;  4XKA A;  3S5T A;  2GQ0 A;  2YE6 A;  4YKZ A;  3TZ4 A;  1FKA E;  1RRE A;  2XD6 A;  4AWP A;  1XNR E;  5D6Q A;  3R4P A;  4OO1 E;  2BR2 A;  5ELW A;  1HNW E;  2GO4 A;  1HNX E;  5K36 B;  4IZJ D;  2BRC A;  2C1G A;  3Q6N A;  2YEE A;  2YEB A;  3B25 A;  4CWT A;  1VIS A;  1PVG A;  2E5L I;  2HFS A;  3K99 A;  2AJ4 A;  1NZ0 A;  4IZK B;  4JYA I;  4P7A A;  4KHP I;  2YK2 A;  4PU9 A;  3R4N A;  2XJX A;  2BSM A;  1OYS A;  2VQF I;  2V34 A;  2NN6 F;  2BU6 A;  2XHT A;  3B28 A;  3T0H A;  2GO3 A;  4JI0 I;  3Q5K A;  1UYE A;  3GON A;  4DPU A;  3CRK A;  3TUH A;  4E00 A;  2YKE A;  3HHU A;  3L7Z A;  2UUA E;  4LF6 E;  1TID A;  4KTN A;  2VF3 A;  1NHH A;  3P3E A;  4FWG A;  5DRQ A;  3WU3 A;  3M7N D;  2WER A;  2XJJ A;  3Q1Q A;  4DPW A;  4URN A;  2YED A;  4KQV A;  4DV3 I;  1XMQ E;  4X65 E;  1YC4 A;  4XC0 A;  4AQY E;  1WUU A;  3CDI A;  4QNJ A;  2HKJ A;  1ZM9 A;  4JI4 E;  2YEJ A;  1PIE A;  1Z5C A;  2H55 A;  4JI2 E;  3RLQ A;  3PS3 A;  4Z7Y A;  4DV5 E;  2HHH I;  4DUY I;  4LWE A;  4OZE A;  2NN6 B;  4X9L A;  4YKX A;  1FWK A;  4XCL A;  2JEA A;  4W7T A;  1K47 A;  2PO2 B;  5M4H A;  2O3Z A;  4FWH A;  4UTG A;  2ZDY A;  4CE3 A;  1KTV A;  4DR1 I;  1Z5A A;  4KSG A;  4MU1 A;  4B3T E;  3G75 A;  4LWH A;  5JEN A;  1XHK A;  2Z5B B;  3ZKB A;  4AM3 A;  2UUB I;  4LF5 E;  2HKE A;  2WI6 A;  3EHH A;  1Y6Z A;  4YY3 E;  2WI2 A;  2HG1 A;  4R3M A;  2IWU A;  2GS8 A;  5LMN E;  4DV7 I;  4LF9 I;  3CRL A;  1IBM I;  2R3V A;  1GKX A;  3NMQ A;  4LOM A;  1H74 A;  2Z5E A;  3PS2 A;  1N32 I;  2HK3 A;  4NXN I;  3SL2 A;  2EFG A;  2JE6 A;  4UT4 A;  4KHP E;  1U2O A;  5D7D A;  3T2S A;  4AWO A;  4DR4 I;  4LFA E;  1UYG A;  2DEJ A;  2F4V I;  4O04 A;  4HXW A;  2C39 A;  4JI0 E;  2JEB A;  2UXB E;  1D6T A;  4QPK A;  4LCG A;  3OPD A;  2UWD A;  1J5E E;  1HK7 A;  3HKM A;  4JI7 I;  1YHC A;  2X36 A;  4DV4 E;  3WU5 A;  2FYP A;  1MX0 A;  1TIL A;  2XAB A;  5IWA I;  1Y8O A;  4DV3 E;  3C11 A;  5FNC A;  2YKB A;  4FMT A;  4BAE A;  1S4E A;  5A2Q C;  4NH8 A;  5K36 D;  4B3S E;  1AM1 A;  2YEF A;  4CE1 A;  4P8O A;  1N33 E;  2HHI A;  2YI6 A;  4X64 E;  3K1J A;  2QG0 A;  2YGE A;  3T10 A;  2YK9 A;  5CTX A;  3P3C A;  4XCJ A;  3OWD A;  4DUY E;  2V8P A;  1USV A;  4DV1 I;  3PYF A;  1XNQ I;  4B3M E;  2ESA A;  5CTY A;  1Z0C A;  4LP0 A;  1XNR I;  3A0R A;  1IBL E;  4KP4 A;  4MPE A;  5D7R A;  4YHH E;  4DR6 E;  1HNW I;  1HNX I;  4U7N A;  4ASG A;  4P52 A;  2VQE E;  4EMV A;  2IOR A;  1YT2 A;  2YE7 A;  4YKT A;  3K98 A;  4HAC A;  5C0X E;  4OX9 E;  3QDD A;  2X7I A;  2XCM A;  2CGE A;  4O0B A;  2UUB E;  4XD8 A;  2BU8 A;  2IWS A;  4NH9 A;  5K36 E;  1UYM A;  2WP8 A;  4FW5 A;  2VW5 A;  4LWG A;  2F1D A;  1AJ6 A;  3LMM A;  4DV7 E;  4LF9 E;  3OTO I;  4JAU A;  3QTF A;  5BOC A;  4BXI A;  3INW A;  4EM7 A;  1N32 E;  1TC6 A;  5JEA F;  4LF6 I;  4IFD A;  5L3J A;  4JI6 E;  2XX5 A;  1QZR A;  3KRN A;  3K17 A;  4MYU A;  2VES A;  4WUB A;  1Z0G A;  2NN6 D;  1Y8N A;  1XMQ I;  2PO0 B;  4MP2 A;  4X65 I;  5IDM A;  1YT0 A;  4DV0 E;  4AQY I;  5BOD A;  5LMU I;  1I59 A;  1Y4U A;  3R91 A;  3PYD A;  1H73 A;  3U1Y A;  4JI4 I;  4IFD F;  1Z0T A;  3U67 A;  2CVE A;  1NHI A;  4JI2 I;  3HYZ A;  3PEJ A;  3ZM7 A;  1A4H A;  4XDM A;  3LNU A;  5CTW A;  3QT7 A;  5FND A;  2XEX A;  4LF4 E;  1BYQ A;  5JEA B;  3PS1 A;  4GT8 A;  1RHY A;  2NN6 E;  2ZIT A;  4B3T I;  3J7A G;  3M85 G;  4LF5 I;  4DV1 E;  4MP7 A;  5C0X B;  1XNQ E;  2BYI A;  1H7U A;  4YKW A;  4DU8 A;  4HYP A;  5J71 A;  3OMU A;  2YKI A;  4YY3 I;  4LFC I;  2CCS A;  2Z5C A;  4JI8 E;  2FWZ A;  1ZM3 A;  4DPT A;  5A2Q Q;  5LMN I;  4KSH A;  2XK2 A;  1BGQ A;  4N3O A;  4E02 A;  4FW7 A;  3EKR A;  4EGK A;  3G7B A;  3T1K A;  3HZ1 A;  1ZM2 A;  5C0X C;  3F0N A;  2CGF A;  1H7S A;  4U3B A;  3RKZ A;  1Z0B A;  5J6A A;  4MB9 A;  5K36 C;  5FNF A;  3CDJ A;  4LFA I;  3GIG A;  5IT9 C;  2XDS A;  4HYM A;  1EA6 A;  2FWY A;  4H7Q A;  3OTO E;  3ZZ0 A;  3J80 Q;  4FW4 A;  2UXB I;  2PNZ A;  4IS9 A;  1TBW A;  3EKO A;  5FLX C;  4DZY A;  1J5E I;  2EXL A;  4CWP A;  2PO1 B;  1UY6 A;  3R4M A;  1N34 E;  4DV4 I;  2WI1 A;  2YGA A;  4HY6 A;  3V5R A;  3K60 A;  4AID A;  4DV6 I;  4X66 E;  4RPF A;  1MU5 A;  5M4N A;  2HCH A;  1OJ4 A;  3B78 A;  2BM1 A;  4PRX A;  5LMU E;  4B3S I;  4XKK A;  2HFU A;  4XTJ A;  2R42 A;  3V2U C;  4BA1 B;  1N33 I;  5FWK A;  2C2A A;  4OO1 A;  3ZZT A;  4X64 I;  3J81 C;  3UHM A;  4O07 A;  4AIM A;  3HUL A;  4MQY A;  2O1V A;  2BR2 B;  4LWI A;  2BA0 G;  5DRR A;  3O2F A;  2BA1 G;  4B3M I;  2V2V A;  2WI3 A;  3EHG A;  1IBL I;  4GQT A;  4YHH I;  4NXM I;  4DR6 I;  2Q8H A;  2VQE I;  2QG2 A;  1Z0E A;  4OO1 F;  2YJW A;  4XIP A;  2Q8G A;  1FNM A;  4OX9 I;  1UDQ A;  2NN6 C;  4HZ5 A;  3B26 A;  4E72 A;  4ZKI A;  3HJC A;  2YEC A;  1KIJ A;  1FJG E;  3C0E A;  3RLR A;  2O1W A;  2WI5 A;  3D36 A;  4LFC E;  4GKJ E;  1UYI A;  1UY7 A;  3QT5 A;  4B6C A;  4IZJ A;  4DR5 E;  3L7Z B;  2HK2 A;  4ED4 A;  2GFD A;  3A0X A;  4DR3 E;  2VCI A;  2YE8 A;  4BIZ A;  1N36 E;  1HNZ E;  1R6L A;  3LPS A;  2K5B A;  1Y8P A;  1USU A;  4JI6 I;  2WI7 A;  1YSR A;  3JAM Q;  2XHR A;  2JT2 A;  3FV5 A;  2Q8I A;  1YH8 A;  4LPF A;  5BR8 E;  2DEI A;  3ZXQ A;  3RLP A;  4WUC A;  4V25 A;  3JZ3 A;  2IOQ A;  4DV0 I;  1R62 A;  2WW4 A;  1OSF A;  5JEA D;  2V2Q A;  3P06 A;  5F3K A;  5M4P A;  1AH8 A;  3WU4 A;  4L94 A;  1XXE A;  1Z0W A;  1UDN A;  4JAS A;  4XIT A;  3TZ0 A;  2LJP A;  5C0X D;  1I58 A;  4DV6 E;  4YKR A;  3PYE A;  5IT9 Q;  4LPB A;  3H4L A;  4B3R E;  2UU9 E;  4CWR A;  2XX2 A;  3WU6 A;  1YC1 A;  4DU7 A;  4LF4 I;  4ASF A;  2WNR A;  2YE9 A;  2IES A;  1ZXM A;  3G7E A;  4LFB E;  4EGH A;  2YE2 A;  1HR0 E;  1E3P A;  2YI7 A;  3OWB A;  3BM9 A;  4JI3 E;  4R3A A;  5JEA E;  4NXM E;  2ZM6 E;  4JI8 I;  3ZXO A;  2JE6 B;  5IDJ A;  4BA2 A;  2C38 A;  1I5C A;  2C37 B;  2YEH A;  3J7A M;  4L93 A;  1I94 I;  1PKP A;  1ELO A;  2C39 B;  2JEB B;  4JG4 A;  4JI1 E;  5M4K A;  3TZ2 A;  4DR7 E;  3P76 A;  1THN A;  3D0B A;  4X62 I;  4GEE A;  3FT8 A;  5D7C A;  1FWL A;  1AH6 A;  4URL A;  5DNX A;  4GFN A;  4K0K I;  1N34 I;  1S14 A;  2PNM A;  2XJG A;  5D6P A;  4L91 A;  3CGZ A;  4X66 I;  3T1Y I;  1I5B A;  4ASB A;  3KE6 A;  4FCR A;  4FN5 A;  4YKU A;  1ZWH A;  2XDU A;  5M4E A;  1YS3 A;  4LF7 E;  1UY9 A;  4HY1 A;  4KFG A;  3U2D A;  4L8Z A;  1UYL A;  2XDL A;  4GCZ A;  2IWX A;  2QFO A;  2J7K A;  1A6F A;  4FWD A;  4HAC B;  5K36 A;  3GME A;  4DV2 E;  5CTU A;  3D2R A;  1E3H A;  2WP8 B;  2BTZ A;  4I3H A;  2YI5 A;  2ZDX A;  3PRY A;  4URM A;  3R92 A;  4IZK A;  1P42 A;  1FJG I;  3HYY A;  2BA0 D;  2A2D A;  4V26 A;  4GKJ I;  5K36 F;  4USK A;  5JEA C;  4DR5 I;  2AE8 A;  4IFD B;  2OI2 A;  2J65 A;  4DPX A;  2UXC I;  4JI5 E;  4DR3 I;  4ISA A;  4DPY A;  1UY8 A;  1N36 I;  1HNZ I;  4NBQ A;  1KVK A;  1I94 E;  1US7 A;  5BR8 I;  3HZ5 A;  4CWS A;  3WHA A;  1Z59 A;  2BU5 A;  4X62 E;  2YEA A;  3T0Z A;  3U1K A;  4LF8 E;  2YE5 A;  1L0O A;  1B3Q A;  4AWQ A;  3VHA A;  4K0K E;  4BQG A;  5LL6 R;  3K97 A;  5M4M A;  2O1U A;  1Y4S A;  4MBC A;  5DRP A;  2UXD E;  2VCJ A;  3A0Z A;  3T1H I;  1YET A;  2NN6 A;  3T1Y E;  2YE4 A;  3Q5J A;  2H8M A;  4B3R I;  2PO2 A;  1KKH A;  4FW6 A;  2UU9 I;  4FW3 A;  3CWV A;  3IED A;  4U93 A;  2WEP A;  4JV5 I;  4HXZ A;  4LFB I;  5CPH A;  2Z5B A;  4L90 A;  4GKK E;  1OYR A;  1I5A A;  1QY8 A;  2YGF A;  2Z5C B;  4XE2 A;  2BU2 A;  4CWF A;  2Q8F A;  1HR0 I;  3K85 A;  1UYC A;  4JI3 I;  2WI4 A;  2YKC A;  1TC0 A;  4I5S A;  2ZM6 I;  3WQ9 A;  2YKJ A;  3R4O A;  2IER A;  4QPJ A;  2YE3 A;  1XMO E;  5DNL A;  4MYT A;  2E1R A;  1UYF A;  3GIG B;  1YER A;  2GQP A;  1IXM A;  4ZVI A;  4JI1 I;  1IBK E;  2PNZ B;  4EFU A;  4DR7 I;  4JAV A;  4LCF A;  3EHF A;  3U2K A;  1N0U A;  1R6M A;  4J3D A;  2UXC E;  4MOT A;  3B27 A;  1DAR A;  4GQU A;  2BYH A;  4DUZ E;  1BKN A;  1UDS A;  1JM6 A;  3O6O A;  5GMD A;  4B7P A;  3LTO A;  2XHX A;  4JQL A;  1YT1 A;  4M1K A;  3QT8 A;  4PL9 A;  4OO1 B;  4DR2 E;  1YC3 A;  1BXD A;  3DGE A;  1B63 A;  4CWN A;  3DD6 A;  4FCQ A;  4LF7 I;  1QYE A;  4YKQ A;  1Z0V A;  1Y60 A;  3A0T A;  2UUC I;  4H81 A;  1EI1 A;  3T1H E;  5GME A;  2JEA B;  3M6A A;  5EKW A;  4MU3 A;  4OO1 C;  3PEH A;  4O05 A;  2Q2E B;  3NZK A;  2YJX A;  2JJC A;  3INX A;  4DV2 I;  2E5L E;  4PRV A;  1I5D A;  3M7N G;  4IFD D;  3PYG A;  5FLX Q;  2A2C A;  4JYA E;  4JV5 E;  1Z5B A;  1UYD A;  2CCU A;  3P3G A;  2C37 A;  3GLL A;  2VQF E; 
#chains in the Genus database with same CATH homology
 2IOP A;  3A0W A;  3B8H A;  4IZJ B;  3ZKD A;  2BM0 A;  1UYH A;  2FXS A;  4BQJ A;  1H72 C;  1ZM4 A;  2PNR A;  4E01 A;  3H80 A;  5C93 A;  4GGL A;  4USM A;  3B82 A;  2XDK A;  4AS9 A;  1FI4 A;  4JI5 I;  2E0A A;  3B24 A;  3CGY A;  3J81 Q;  3HEK A;  4LWF A;  5IN9 A;  4Q20 A;  4K4O A;  4NH7 A;  2O1T A;  1U2R A;  4WUD A;  1U0Z A;  1UEK A;  4LF8 I;  3TZ5 A;  1B62 A;  1TH8 A;  2BRE A;  2HHH E;  2NPF A;  4URO A;  4H85 A;  1N0V C;  1GKZ A;  2UXD I;  2BZ5 A;  4XKO A;  1KZN A;  3J80 C;  2XDX A;  3GIE A;  4R1F A;  4FCP A;  4DXL A;  2AKP A;  4DR1 E;  1MG7 A;  2CH4 A;  2BT0 A;  4DUH A;  2YI0 A;  3TTZ A;  2CZ9 A;  3VHC A;  1YSZ A;  1ZW9 A;  3VAD A;  2UUC E;  1ZXN A;  2PNL A;  2CCT A;  4GKK I;  3QT6 A;  4HZ0 A;  2QF6 A;  4EEH A;  1IBM E;  1UYK A;  2YEI A;  3O0I A;  2BV3 A;  4NXN E;  3BMY A;  4CE2 A;  3ZZU A;  2UUA I;  3OW6 A;  4CWQ A;  1XMO I;  2BU7 A;  4FW9 A;  3MNR P;  2V2Z A;  4DR4 E;  5F5R A;  4EGI A;  1YES A;  4O09 A;  3Q6M A;  2F4V E;  5CF0 A;  1IBK I;  3FT5 A;  3D4J A;  5GGZ A;  4EMD A;  2VWC A;  2YEG A;  4YKY A;  4CWO A;  4EFT A;  4JI7 E;  1RR9 A;  1S16 A;  4MPC A;  3GIF A;  2XX4 A;  3EHJ A;  4DUZ I;  4DV5 I;  4U7O A;  5IWA E;  2JKI A;  3Q5L A;  4ASA A;  2ZKJ A;  4FPP A;  4XIR A;  1GJV A;  1ID0 A;  1AMW A;  2ZBK B;  3A0Y A;  4MPN A;  3VHD A;  4DR2 I;  4Z7C A;  4XIQ A;  4BIU A;  2CG9 A;  2WEQ A;  3JAM C;  4XKA A;  2GQ0 A;  2YE6 A;  4YKZ A;  3TZ4 A;  1FKA E;  1RRE A;  2XD6 A;  4AWP A;  1XNR E;  5D6Q A;  3R4P A;  1HNW E;  1HNX E;  2BRC A;  4IZJ D;  2YEE A;  2YEB A;  3Q6N A;  3B25 A;  4CWT A;  1VIS A;  1PVG A;  2E5L I;  2HFS A;  3K99 A;  2AJ4 A;  1NZ0 A;  4IZK B;  4JYA I;  4P7A A;  4KHP I;  2YK2 A;  4PU9 A;  3R4N A;  2XJX A;  2BSM A;  2VQF I;  2V34 A;  2BU6 A;  3T0H A;  2XHT A;  3B28 A;  4JI0 I;  3Q5K A;  1UYE A;  3GON A;  4DPU A;  3CRK A;  3TUH A;  4E00 A;  2YKE A;  3HHU A;  2UUA E;  4KTN A;  4LF6 E;  1TID A;  2VF3 A;  1NHH A;  3WU3 A;  4FWG A;  2WER A;  2XJJ A;  3Q1Q A;  4DPW A;  2YED A;  4KQV A;  4DV3 I;  1XMQ E;  4X65 E;  1YC4 A;  4XC0 A;  4AQY E;  1WUU A;  2HKJ A;  1ZM9 A;  4JI4 E;  2YEJ A;  1PIE A;  1Z5C A;  2H55 A;  4JI2 E;  3RLQ A;  4Z7Y A;  2HHH I;  4DV5 E;  4LWE A;  4DUY I;  4X9L A;  4YKX A;  1FWK A;  4XCL A;  4W7T A;  1K47 A;  5M4H A;  4CE3 A;  4FWH A;  4UTG A;  2ZDY A;  1KTV A;  4DR1 I;  1Z5A A;  4KSG A;  4B3T E;  3G75 A;  4LWH A;  1XHK A;  2Z5B B;  3ZKB A;  2UUB I;  4LF5 E;  2HKE A;  2WI6 A;  3EHH A;  1Y6Z A;  4YY3 E;  2WI2 A;  2HG1 A;  4R3M A;  2IWU A;  2GS8 A;  5LMN E;  4DV7 I;  4LF9 I;  3CRL A;  1IBM I;  2R3V A;  1GKX A;  3NMQ A;  1H74 A;  2Z5E A;  1N32 I;  2HK3 A;  4NXN I;  3SL2 A;  2EFG A;  4UT4 A;  4KHP E;  1U2O A;  5D7D A;  3T2S A;  4AWO A;  4DR4 I;  4LFA E;  1UYG A;  2DEJ A;  2F4V I;  4O04 A;  4HXW A;  4JI0 E;  2UXB E;  1D6T A;  4QPK A;  3OPD A;  2UWD A;  1J5E E;  1HK7 A;  4JI7 I;  2X36 A;  4DV4 E;  3WU5 A;  2FYP A;  1MX0 A;  1TIL A;  2XAB A;  5IWA I;  1Y8O A;  4DV3 E;  3C11 A;  5FNC A;  2YKB A;  4FMT A;  4BAE A;  1S4E A;  5A2Q C;  4NH8 A;  4B3S E;  1AM1 A;  2YEF A;  4CE1 A;  4P8O A;  1N33 E;  2YI6 A;  2YGE A;  4X64 E;  3K1J A;  2QG0 A;  3T10 A;  2YK9 A;  5CTX A;  3OWD A;  4DUY E;  2V8P A;  1USV A;  4DV1 I;  3PYF A;  1XNQ I;  4B3M E;  2ESA A;  5CTY A;  1Z0C A;  4LP0 A;  1XNR I;  3A0R A;  1IBL E;  4KP4 A;  4MPE A;  5D7R A;  4YHH E;  4DR6 E;  1HNW I;  1HNX I;  4U7N A;  4ASG A;  4P52 A;  2VQE E;  4EMV A;  2IOR A;  1YT2 A;  2YE7 A;  4YKT A;  3K98 A;  4HAC A;  4OX9 E;  3QDD A;  2X7I A;  2XCM A;  2CGE A;  4O0B A;  2UUB E;  4XD8 A;  2BU8 A;  2IWS A;  4NH9 A;  1UYM A;  2VW5 A;  4LWG A;  1AJ6 A;  4DV7 E;  4LF9 E;  3OTO I;  4JAU A;  3QTF A;  5BOC A;  4BXI A;  3INW A;  4EM7 A;  1N32 E;  1TC6 A;  4LF6 I;  5L3J A;  4JI6 E;  2XX5 A;  1QZR A;  3K17 A;  4MYU A;  4WUB A;  1Y8N A;  1Z0G A;  4URN A;  1XMQ I;  4MP2 A;  5IDM A;  4X65 I;  1YT0 A;  4DV0 E;  4AQY I;  5BOD A;  5LMU I;  1I59 A;  1Y4U A;  3R91 A;  3PYD A;  1H73 A;  4JI4 I;  3U67 A;  1Z0T A;  1NHI A;  4JI2 I;  3HYZ A;  3PEJ A;  3ZM7 A;  1A4H A;  4XDM A;  3LNU A;  5CTW A;  3QT7 A;  5FND A;  2XEX A;  4LF4 E;  1BYQ A;  4GT8 A;  2ZIT A;  4B3T I;  3J7A G;  4LF5 I;  4DV1 E;  4MP7 A;  1XNQ E;  2BYI A;  1H7U A;  4YKW A;  4DU8 A;  4HYP A;  5J71 A;  3OMU A;  2YKI A;  4YY3 I;  4LFC I;  2CCS A;  2Z5C A;  4JI8 E;  2FWZ A;  1ZM3 A;  4DPT A;  5A2Q Q;  5LMN I;  4KSH A;  2XK2 A;  1BGQ A;  4N3O A;  4E02 A;  4EGK A;  3EKR A;  3G7B A;  3T1K A;  3HZ1 A;  1ZM2 A;  2CGF A;  3F0N A;  1H7S A;  3RKZ A;  1Z0B A;  5J6A A;  4MB9 A;  5FNF A;  4LFA I;  3GIG A;  5IT9 C;  2XDS A;  4HYM A;  1EA6 A;  2FWY A;  4H7Q A;  3OTO E;  3ZZ0 A;  3J80 Q;  2UXB I;  3EKO A;  1TBW A;  5FLX C;  4DZY A;  1J5E I;  2EXL A;  4CWP A;  1UY6 A;  3R4M A;  1N34 E;  4DV4 I;  2WI1 A;  2YGA A;  4HY6 A;  3V5R A;  3K60 A;  4DV6 I;  4X66 E;  4RPF A;  1MU5 A;  5M4N A;  2HCH A;  1OJ4 A;  3B78 A;  2BM1 A;  4PRX A;  5LMU E;  4B3S I;  4XKK A;  2HFU A;  4XTJ A;  2R42 A;  3V2U C;  2C2A A;  1N33 I;  5FWK A;  4XCJ A;  4X64 I;  3ZZT A;  3J81 C;  4O07 A;  3HUL A;  2O1V A;  4LWI A;  3O2F A;  4B3M I;  2V2V A;  2WI3 A;  3EHG A;  1IBL I;  4GQT A;  4YHH I;  4NXM I;  4DR6 I;  2Q8H A;  2VQE I;  2QG2 A;  1Z0E A;  2YJW A;  4XIP A;  2Q8G A;  1FNM A;  4OX9 I;  4HZ5 A;  3B26 A;  4ZKI A;  3HJC A;  2YEC A;  1KIJ A;  1FJG E;  3C0E A;  3RLR A;  2O1W A;  2WI5 A;  3D36 A;  4LFC E;  4GKJ E;  1UYI A;  1UY7 A;  3QT5 A;  4B6C A;  4IZJ A;  4DR5 E;  4ED4 A;  2HK2 A;  2GFD A;  3A0X A;  4DR3 E;  2VCI A;  2YE8 A;  4BIZ A;  1N36 E;  1HNZ E;  3LPS A;  2K5B A;  1Y8P A;  1USU A;  4JI6 I;  2WI7 A;  1YSR A;  3JAM Q;  2XHR A;  3FV5 A;  2Q8I A;  5BR8 E;  2DEI A;  3ZXQ A;  3RLP A;  4WUC A;  4V25 A;  3JZ3 A;  2IOQ A;  4DV0 I;  1R62 A;  2WW4 A;  1OSF A;  2V2Q A;  3P06 A;  5F3K A;  5M4P A;  1AH8 A;  3WU4 A;  4L94 A;  1Z0W A;  4JAS A;  4XIT A;  3TZ0 A;  2LJP A;  1I58 A;  4DV6 E;  4YKR A;  3PYE A;  5IT9 Q;  4LPB A;  3H4L A;  4B3R E;  2UU9 E;  4CWR A;  2XX2 A;  3WU6 A;  1YC1 A;  4DU7 A;  4LF4 I;  4ASF A;  2YE9 A;  1ZXM A;  3G7E A;  4LFB E;  4EGH A;  2YE2 A;  1HR0 E;  2YI7 A;  4R3A A;  3OWB A;  3BM9 A;  4JI3 E;  4NXM E;  2ZM6 E;  4JI8 I;  3ZXO A;  5IDJ A;  1I5C A;  2YEH A;  3J7A M;  4L93 A;  1I94 I;  1PKP A;  1ELO A;  4JG4 A;  4JI1 E;  5M4K A;  3TZ2 A;  4DR7 E;  1THN A;  3D0B A;  4X62 I;  4GEE A;  3FT8 A;  5D7C A;  1FWL A;  1AH6 A;  4URL A;  4GFN A;  4K0K I;  1N34 I;  1S14 A;  2PNM A;  2XJG A;  5D6P A;  4L91 A;  3CGZ A;  4X66 I;  3T1Y I;  1I5B A;  4ASB A;  3KE6 A;  4FCR A;  4FN5 A;  4YKU A;  1ZWH A;  2XDU A;  5M4E A;  1YS3 A;  4LF7 E;  1UY9 A;  4HY1 A;  4KFG A;  3U2D A;  4L8Z A;  1UYL A;  2XDL A;  4GCZ A;  2IWX A;  2QFO A;  2J7K A;  1A6F A;  4FWD A;  4HAC B;  4DV2 E;  5CTU A;  3D2R A;  2BTZ A;  2YI5 A;  4I3H A;  2ZDX A;  3PRY A;  4URM A;  3R92 A;  4IZK A;  1FJG I;  3HYY A;  2A2D A;  4V26 A;  4GKJ I;  4USK A;  4DR5 I;  2OI2 A;  4DPX A;  2UXC I;  4JI5 E;  4DR3 I;  1UY8 A;  4DPY A;  1N36 I;  1HNZ I;  1KVK A;  1I94 E;  1US7 A;  5BR8 I;  3HZ5 A;  4CWS A;  3WHA A;  1Z59 A;  2BU5 A;  4X62 E;  2YEA A;  3T0Z A;  4LF8 E;  2YE5 A;  1L0O A;  1B3Q A;  4AWQ A;  3VHA A;  4K0K E;  4BQG A;  5LL6 R;  3K97 A;  5M4M A;  2O1U A;  1Y4S A;  4MBC A;  2UXD E;  2VCJ A;  3A0Z A;  3T1H I;  1YET A;  3T1Y E;  2YE4 A;  3Q5J A;  2H8M A;  4B3R I;  2UU9 I;  1KKH A;  3IED A;  3CWV A;  4U93 A;  2WEP A;  4JV5 I;  4HXZ A;  4LFB I;  5CPH A;  2Z5B A;  4L90 A;  4GKK E;  1QY8 A;  1I5A A;  2YGF A;  4XE2 A;  2Z5C B;  4CWF A;  2BU2 A;  2Q8F A;  1HR0 I;  3K85 A;  1UYC A;  4JI3 I;  2WI4 A;  2YKC A;  1TC0 A;  4I5S A;  2ZM6 I;  3WQ9 A;  2YKJ A;  3R4O A;  4QPJ A;  2YE3 A;  1XMO E;  4MYT A;  2E1R A;  1UYF A;  3GIG B;  1YER A;  2GQP A;  4ZVI A;  4JI1 I;  1IBK E;  4EFU A;  4DR7 I;  4JAV A;  3EHF A;  3U2K A;  1N0U A;  2UXC E;  4MOT A;  3B27 A;  1DAR A;  2BYH A;  4DUZ E;  1BKN A;  1JM6 A;  3O6O A;  5GMD A;  4B7P A;  3LTO A;  2XHX A;  4JQL A;  1YT1 A;  4M1K A;  3QT8 A;  4PL9 A;  4DR2 E;  1YC3 A;  1BXD A;  3DGE A;  1B63 A;  4CWN A;  4FCQ A;  4LF7 I;  1QYE A;  4YKQ A;  1Z0V A;  3A0T A;  2UUC I;  4H81 A;  1EI1 A;  3T1H E;  5GME A;  3M6A A;  3PEH A;  4O05 A;  2Q2E B;  2YJX A;  2JJC A;  3INX A;  4DV2 I;  2E5L E;  4PRV A;  1I5D A;  3PYG A;  5FLX Q;  2A2C A;  4JYA E;  4JV5 E;  1Z5B A;  1UYD A;  2CCU A;  1NHJ A;  2VQF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...