3LNUA

Crystal structure of pare subunit
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
364
structure length
344
Chain Sequence
b'GLDPVKRRPGMYTDTARPNHLAQEVIDNSVDEALAGHAKQIEVTLYKDGSCEVSDDGRGMPVDIHPEEKIPGVELILTRLGVSVVNALSTKVELFIKREGSEHRMEFRDGNAASKLEVVGTVGKKNTGTRLRFWADPKYFDTPKFNVRALRHLLRAKAVLCPGLTVKLHDEATGEQDSWYFENGLRDYLKGEMAEHEMLPADLFVGSLKKDTEIVDWAAGWVPEGELVQESYVNLIPTAQHGTHVNGLRSGLTDALREFCDFRNLLPRGVKLAPEDVWDRVTFVLSLKMTDPQFSGQTKERLSSRQAAGFIEGAAHDAFSLYLNQNVEIGEKIAQIAIDRASAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Topoisomerase IV subunit B
publication title Crystal structure of ParE subunit
rcsb
source organism Xanthomonas oryzae pv. oryzae
molecule tags Isomerase
total genus 108
structure length 344
sequence length 364
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2010-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3lnuA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3lnuA01
3EHGA 5M4KA 4JI2E 2YI6A 4U7NA 3DGEA 3TZ4A 3FT5A 2VQEE 3J80Q 2J7KA 5L3JA 4CE2A 4YKRA 4GKJE 1UYEA 3IEDA 2BYIA 2R3VA 4EM7A 3F0NA 3INWA 2XJGA 4JI1E 2IORA 2JJCA 4DR3E 3ZKDA 4B3SE 2DEJA 1ID0A 1MG7A 1NZ0A 4LFAE 5M4PA 1ZM4A 2UXCE 2VF3A 2YJWA 2WI6A 3T10A 1TILA 2YKBA 4DUYE 5LMUE 1KVKA 4HACA 2CZ9A 3A0XA 4MPCA 2DEIA 1BXDA 2XEXA 1N34I 2AJ4A 2XDSA 4HY6A 1ZXMA 1UYLA 3HULA 4R3MA 2WERA 1A6FA 4O09A 4LWIA 1YT1A 4DZYA 1XHKA 4USMA 1FKAE 4JI6I 4DUHA 4Z7CA 2FXSA 2YI0A 4XE2A 4H85A 1TH8A 1ELOA 2XCMA 4GGLA 4MOTA 1YS3A 2CCSA 2XJXA 5F3KA 3K97A 2BTZA 2E1RA 1FWLA 1S16A 2V2VA 4B3MI 1YERA 1AH8A 4XCJA 4CWOA 2BM1A 3C11A 4URMA 2ZDYA 4JQLA 1N34E 4XITA 4M1KA 3M6AA 3R4NA 1UYKA 1UYMA 5IWAI 3FT8A 5D6PA 4P8OA 2IWXA 3CWVA 1GKZA 4UROA 1JM6A 4JI6E 1TC6A 3SL2A 1HNXI 4O0BA 5CTUA 2CCUA 1Z59A 3G7BA 1KTVA 3Q1QA 4YKYA 2VCIA 3QDDA 4GT8A 3TZ5A 4I3HA 1ZW9A 3K99A 4XD8A 2K5BA 4DR5I 1HNWI 4ASBA 4CE1A 2XDKA 1UEKA 5GMDA 2QF6A 1VISA 1YT0A 2GQPA 3ZXOA 3NMQA 3J81C 1FI4A 3B25A 4DPTA 5BODA 1R62A 3BM9A 4R3AA 1Y4SA 5IWAE 4LF9I 3GIGA 4FN5A 2HKJA 3GIEA 4XIPA 4DV5I 2BYHA 1QY8A 3B78A 5IDMA 1UYCA 4QPJA 5FNCA 1MX0A 1EA6A 4JI4I 1QYEA 4FWHA 1YSRA 1NHIA 2BU5A 2YI5A 1N0UA 4PU9A 2YEJA 4DR5E 5BR8I 2YEHA 3H80A 2UUCE 4HXWA 3ZZUA 2VWCA 4E02A 4XIQA 1ZXNA 4FPPA 2E5LI 2YKIA 1B63A 3HZ1A 1Z5AA 1D6TA 2R42A 1YESA 3U2KA 4LF9E 4CWFA 4YKUA 4JV5I 4EGKA 4USKA 4DV5E 4LF7I 5FNFA 2HFUA 1Z0TA 3HYZA 4DR7I 3PYEA 4DV2I 4EGIA 1UY7A 3O2FA 4LF6I 4U7OA 1I5CA 3CGYA 3K17A 4JI4E 2YE8A 4E00A 4JI2I 2Q8HA 2XHRA 2AKPA 4XCLA 2GS8A 4X64I 1BGQA 3WQ9A 2XHTA 4XIRA 2E5LE 3VHCA 2BU7A 4FWGA 4LWHA 4UTGA 4DR6I 5IDJA 3J7AG 5CTWA 1A4HA 3FV5A 3K60A 2V34A 3BMYA 1Y8NA 4JV5E 3PYFA 4U93A 3WU5A 2XK2A 4MP2A 4LF7E 4MBCA 4DR7E 4W7TA 5M4NA 4DV2E 4DV3E 2CGFA 2UXDI 4DXLA 4MP7A 4LF6E 3ZKBA 1AJ6A 3ZZTA 4YY3E 4DV0I 4X64E 1NHJA 4FW9A 5F5RA 2WI2A 2VQFI 3B28A 4LF4I 3PEHA 2VW5A 3QTFA 1N36I 3A0YA 4DR6E 4XDMA 4XKAA 4BAEA 1UYFA 3TTZA 4MB9A 4HY1A 5M4HA 1Z0BA 2HCHA 1Y4UA 3J81Q 4JAUA 4ZVIA 2UXDE 4BQJA 2YE4A 3TZ2A 4YHHI 3U2DA 4NH9A 1YC4A 5FWKA 3PYGA 1THNA 4XC0A 1Z5CA 1WUUA 4DV0E 3OWBA 3B8HA 4DPUA 2VQFE 3D0BA 1UYGA 2WI3A 4LF4E 3VADA 3B26A 1Z0VA 3T1YI 1N36E 4HZ5A 5GGZA 4BIUA 4DV4E 1IBKI 4PL9A 2FYPA 5M4MA 4CE3A 2PNRA 4O04A 2XHXA 5D7CA 4LP0A 1TC0A 1TIDA 2YJXA 4YHHE 2EFGA 3J7AM 4HACB 2H8MA 2WW4A 2X36A 3G7EA 4KTNA 3QT7A 3B24A 4CWQA 3LTOA 2XD6A 2A2CA 3R4MA 2YE5A 1XNQE 4EFUA 1OJ4A 4I5SA 2HK3A 2BU2A 2BU6A 3T1YE 3T0HA 3QT5A 2HK2A 5CTYA 3OPDA 2ZM6I 1IBKE 1N33E 4K4OA 5FLXQ 3A0RA 1PIEA 1GJVA 2HG1A 4BIZA 4JYAE 4LF5E 1EI1A 1H73A 4ZKIA 1HNZI 2UUCI 5CTXA 1UYDA 4FWDA 3D2RA 3T2SA 1N32I 3HHUA 4OX9I 2XABA 4CWSA 4NXNE 2WEPA 2Q8FA 3HEKA 4DR4I 4YKXA 1YETA 2IWSA 1UY8A 3D4JA 2QG2A 2WI4A 4HZ0A 1ZM9A 2ZITA 1I5BA 2YE2A 3RLPA 4NH8A 4AWQA 2ZM6E 2NPFA 3PYDA 2CH4A 1HNZE 4EEHA 2O1WA 2O1VA 1YT2A 2IWUA 4EMVA 1N32E 3EHHA 4OX9E 4LFBI 3HYYA 5M4EA 3T1HI 4LWGA 4EFTA 1Z0GA 2UXBI 1KIJA 2V2ZA 4DR4E 1HR0I 1PKPA 4JI8I 3GIGB 2HHHI 1Z0EA 4KHPI 1US7A 1XMOE 1I58A 2BRCA 1S4EA 2ZKJA 4AS9A 3H4LA 4AWOA 4DV3I 4BQGA 4DR2I 3VHAA 2YEEA 2IOQA 2V2QA 3EKOA 4YY3I 5IN9A 4V26A 5FLXC 5D7DA 4DV6I 2QG0A 1RR9A 1DARA 5A2QC 1FJGI 1I5DA 4LFBE 3JAMC 3OTOI 1H7UA 3T1HE 4BXIA 3V2UC 3O0IA 4LPBA 4WUCA 4CWPA 3RLQA 2UXBE 1U2RA 5IT9C 4MYUA 4MYTA 1HR0E 1I59A 4L91A 4JI8E 2HHHE 4KHPE 3LNUA 2UUAI 5CF0A 4JI3I 2Q8GA 4QPKA 2WI5A 4DR2E 4Q20A 2EXLA 1UYIA 2BT0A 3RLRA 4K0KE 3R92A 1Y8PA 5LL6R 2XDXA 4KSHA 2XX5A 2QFOA 4DV6E 4DR1I 4X9LA 1U0ZA 1AMWA 1FJGE 1AM1A 2FWYA 3ZM7A 3OTOE 1BYQA 5FNDA 4DV4I 3GONA 4HXZA 1XNRI 4V25A 4JI5I 1QZRA 4MPNA 2XDUA 2ESAA 2UUAE 3PEJA 4JI3E 3VHDA 2F4VI 4CWRA 3K98A 4NXME 5J6AA 1AH6A 2YE3A 4LWFA 4JI7E 4GKKI 1J5EI 4YKTA 2YKCA 3OMUA 4B6CA 4DR1E 2H55A 1XNQI 4UT4A 1YC3A 1H7SA 4X66E 3A0WA 2E0AA 4LFCI 4AQYI 2YEAA 4DV7E 1GKXA 1XNRE 4YKZA 1B3QA 1YSZA 2ZDXA 4FCQA 3QT8A 1N33I 4X62I 4JI5E 2GFDA 5C93A 4JYAI 4LF5I 3B82A 1RREA 1UY6A 4CWTA 3A0ZA 1IBMI 3D36A 2F4VE 4X65E 3T1KA 3QT6A 2VCJA 2XX4A 1PVGA 4XKKA 4YKQA 4GKKE 3CRLA 1J5EE 4NXNI 4P52A 2YEIA 4URLA 3U67A 2ZBKB 4ASAA 1TBWA 1KZNA 1XMQI 3CGZA 2YEBA 2YEFA 4ASGA 2YK2A 4LFCE 4AQYE 1K47A 3EKRA 3KE6A 2Q8IA 4EGHA 4DV1I 4DPWA 4X62E 5D6QA 2XDLA 3G75A 4JAVA 4WUBA 1KKHA 4KFGA 2WEQA 1YC1A 1IBME 5A2QQ 1I5AA 3JAMQ 3WU3A 4B3RI 3EHFA 4ED4A 4NH7A 4O05A 1IBLI 5D7RA 2UWDA 4LWEA 5IT9Q 1U2OA 2YGAA 5GMEA 2XJJA 3J80C 3RKZA 3R4PA 2BM0A 1N0VC 1XMQE 3WU6A 1FNMA 3INXA 4KSGA 4ASFA 2WI7A 1XMOI 2XX2A 2YKJA 1MU5A 2HFSA 4R1FA 1Y8OA 2IOPA 2BV3A 1FWKA 4DV1E 4WUDA 4L8ZA 2OI2A 4XTJA 4DUZI 1L0OA 2BZ5A 4DPYA 3JZ3A 3HZ5A 4B3ME 3V5RA 4PRXA 2CCTA 1ZM3A 2A2DA 4GEEA 5J71A 2UUBI 3OWDA 4FMTA 4B3RE 3Q5KA 2YEDA 1IBLE 4YKWA 1UYHA 3R4OA 3TZ0A 3WHAA 4URNA 1H72C 1B62A 2YI7A 3WU4A 4O07A 3C0EA 4H81A 1Z0WA 2YE6A 1HNXE 4H7QA 3K1JA 2YKEA 4Z7YA 3Q5JA 4PRVA 3EHJA 3MNRP 4DUZE 4KP4A 2YECA 2V8PA 4FCPA 3LPSA 4K0KI 1HNWE 3CRKA 4L90A 1I94I 1Z5BA 1BKNA 2UUBE 4LF8I 4E01A 1ZWHA 4HYPA 4EMDA 4GFNA 4JI0I 5LMNI 3GIFA 3ZXQA 4DU8A 3Q5LA 4B3TI 1OSFA 2BSMA 4JASA 3R91A 4DPXA 2UU9I 2YEGA 4GCZA 2LJPA 3OW6A 3O6OA 2JKIA 4KQVA 2WI1A 2YE7A 4RPFA 1ZM2A 4B7PA 2CG9A 2YK9A 2YGEA 5CPHA 2YE9A 3T0ZA 4NXMI 1NHHA 4JI7I 2Q2EB 3B27A 5BOCA 5BR8E 4DU7A 2VQEI 4P7AA 4L93A 3TUHA 1I94E 2X7IA 3A0TA 4L94A 4LF8E 4GKJI 2FWZA 4MPEA 4CWNA 1Z0CA 2HKEA 3ZZ0A 2YGFA 4X66I 4JI0E 4JI1I 5LMNE 2BREA 4DR3I 4AWPA 4DV7I 4HYMA 4B3SI 4B3TE 4LFAI 2O1UA 2UU9E 2UXCI 4GQTA 1S14A 4JG4A 4XKOA 4FCRA 4DUYI 1H74A 5LMUI 2BU8A 1UY9A 4X65I 2C2AA
chains in the Genus database with same CATH superfamily
3EHGA 5M4KA 4JI2E 2YI6A 4U7NA 3DGEA 3TZ4A 3FT5A 2VQEE 3J80Q 2J7KA 5L3JA 4CE2A 4YKRA 4GKJE 1UYEA 3IEDA 2BYIA 3U1KA 2R3VA 4EM7A 3F0NA 4OO1D 3INWA 2XJGA 4JI1E 2IORA 2JJCA 4DR3E 4NBQA 4BA2B 3ZKDA 4B3SE 2DEJA 1ID0A 1MG7A 1E3HA 1NZ0A 4LFAE 3M7ND 5M4PA 1ZM4A 2UXCE 2VF3A 2YJWA 2WI6A 3T10A 1TILA 2YKBA 4DUYE 5LMUE 1KVKA 4HACA 2CZ9A 3A0XA 4MPCA 2DEIA 1BXDA 2XEXA 1N34I 2F1DA 2AJ4A 2XDSA 5JEAC 4HY6A 1ZXMA 3Q6MA 1UYLA 3HULA 4R3MA 2WERA 4U3BA 1A6FA 4O09A 2FTKA 4LWIA 1YT1A 4DZYA 1XHKA 4USMA 1FKAE 4JI6I 4DUHA 4Z7CA 2FXSA 2YI0A 4XE2A 4H85A 1TH8A 1ELOA 5K36D 2XCMA 4GGLA 1YS3A 2CCSA 4MOTA 2XJXA 5F3KA 3K97A 2BTZA 2BA0D 2E1RA 1FWLA 1S16A 2V2VA 4B3MI 2CGEA 1YERA 4IFDB 4OZEA 1AH8A 4XCJA 4CWOA 2BM1A 3C11A 4URMA 2ZDYA 4JQLA 1N34E 4XITA 4AIMA 4M1KA 3M6AA 3R4NA 2JEAB 1UYKA 1UYMA 5IWAI 3FT8A 5D6PA 4P8OA 2IWXA 3CWVA 1GKZA 4UROA 2WP8A 1JM6A 4JI6E 1TC6A 3SL2A 1HNXI 4O0BA 5CTUA 2JE6A 2CCUA 1Z59A 3G7BA 1KTVA 3Q1QA 4YKYA 2VCIA 3QDDA 4GT8A 5C0XF 3NZKA 2PO1B 3TZ5A 4I3HA 1ZW9A 3K99A 4XD8A 2K5BA 4DR5I 1HNWI 4IZJD 4ASBA 4CE1A 2XDKA 1UEKA 5GMDA 2QF6A 1VISA 1YT0A 2GQPA 3ZXOA 3NMQA 3J81C 1FI4A 3B25A 4DPTA 5BODA 1UDSA 1R62A 3BM9A 4R3AA 1Y4SA 5IWAE 4LF9I 3GIGA 4FN5A 2PO0B 2HKJA 3GIEA 4XIPA 1P42A 5JEAB 4DV5I 2BYHA 1QY8A 3B78A 5IDMA 1UYCA 2CVEA 2IERA 4QPJA 5FNCA 1MX0A 1EA6A 4JI4I 1QYEA 4FWHA 1YSRA 1NHIA 2BU5A 2YI5A 1N0UA 4PU9A 2Z5CA 4DR5E 5BR8I 2YEHA 2Z5EA 2YEJA 3H80A 2UUCE 4HXWA 3ZZUA 2VWCA 4E02A 2C37A 4XIQA 1ZXNA 4FPPA 2E5LI 2YKIA 1B63A 3HZ1A 1Z5AA 1D6TA 2C38B 2R42A 1YESA 4LCFA 3U2KA 4LF9E 4CWFA 5DNLA 4YKUA 4JV5I 4EGKA 4USKA 4DV5E 4LF7I 5FNFA 2HFUA 1Z0TA 3HYZA 4DR7I 3PYEA 4DV2I 4EGIA 1UY7A 3O2FA 4LF6I 4U7OA 1I5CA 3CGYA 3K17A 4JI4E 1OYRA 2YE8A 4E00A 4JI2I 2Q8HA 2XHRA 2AKPA 4XCLA 2GS8A 2PNZA 4X64I 2JEBA 1BGQA 3WQ9A 2XHTA 4AIDA 4XIRA 2E5LE 3VHCA 1USUA 2BU7A 4FWGA 4LWHA 4UTGA 4DR6I 3M85G 5IDJA 3J7AG 5CTWA 1A4HA 3FV5A 3K60A 2V34A 3BMYA 1Y8NA 4JV5E 3PYFA 4U93A 3WU5A 3DD6A 2XK2A 4MP2A 4LF7E 2Z5BB 4MBCA 4DR7E 4MDTA 4W7TA 4DV2E 4DV3E 2CGFA 5M4NA 4OO1F 4DXLA 2UXDI 4MP7A 4LF6E 3ZKBA 1AJ6A 3ZZTA 4YY3E 2BR2A 2IESA 4DV0I 2C1IA 2PNMA 4X64E 1NHJA 4FW9A 5F5RA 2PNZB 2WI2A 2VQFI 3B28A 4LF4I 3PEHA 2VW5A 3QTFA 1N36I 3A0YA 4DR6E 4LPFA 4XDMA 2NN6F 4XKAA 4BAEA 4FW6A 4MU4A 4U3DA 2BA0G 1UYFA 4MB9A 3TTZA 4HY1A 5M4HA 3PS3A 1Z0BA 4BA1A 4OO1A 1Y4UA 3J81Q 2HCHA 4ZVIA 2UXDE 2HHIA 4JAUA 2YE4A 3TZ2A 4BQJA 4YHHI 3U2DA 4FW5A 5EL9A 5K36F 5FWKA 1YC4A 4NH9A 3PYGA 2PNLA 1THNA 1Z5CA 4XC0A 1WUUA 4DV0E 4IFDD 1YHCA 4ISAA 3OWBA 2BR2B 1OYSA 3B8HA 1R6MA 3UHMA 4DPUA 2VQFE 3D0BA 1UYGA 2WI3A 4LF4E 3VADA 3CYGA 1UDQA 3B26A 2JT2A 4OO1E 1Z0VA 3T1YI 1N36E 1UDNA 4HZ5A 5GGZA 4BIUA 5DRRA 4DV4E 2NN6A 3CDJA 1IBKI 4PL9A 3KRNA 1UDOA 2FYPA 5M4MA 4CE3A 2PNRA 4O04A 2XHXA 5D7CA 4LP0A 1TC0A 1TIDA 2YJXA 4YHHE 2EFGA 3J7AM 4HACB 2H8MA 2WW4A 2X36A 3G7EA 4KTNA 3QT7A 3B24A 4CWQA 2NN6E 3LTOA 2XD6A 5DRQA 2BA1G 2A2CA 4FW7A 4QNJA 1XNQE 2YE5A 3R4MA 3S5TA 4EFUA 1OJ4A 4I5SA 2HK3A 4IZKA 2BU2A 2BU6A 3T1YE 3T0HA 3QT5A 2HK2A 5CTYA 3OPDA 2ZM6I 1IBKE 1N33E 4K4OA 5FLXQ 3A0RA 1PIEA 1GJVA 2NN6B 2HG1A 4JYAE 4LF5E 4BIZA 3P76A 5JEAD 1EI1A 1H73A 4ZKIA 2C39A 1HNZI 2UUCI 5CTXA 1UYDA 4FWDA 3D2RA 3T2SA 1N32I 3HHUA 4OX9I 5DROA 2XABA 4FW4A 4CWSA 4NXNE 2WEPA 2Q8FA 3HEKA 4DR4I 4YKXA 1YETA 2IWSA 1UY8A 3D4JA 2QG2A 2WI4A 4MU0A 4HZ0A 1VI7A 1ZM9A 2ZITA 2WP8B 1I5BA 2YE2A 4NH8A 3RLPA 5DRPA 4AWQA 2ZM6E 2JE6B 3L7ZA 5C0XA 1Y5YA 2NPFA 3PS1A 3PYDA 2CH4A 5DNXA 1HNZE 3P06A 4EEHA 2O1WA 2O1VA 1YT2A 2C39B 2IWUA 4EMVA 1N32E 3EHHA 4OX9E 4LFBI 3HYYA 5M4EA 3T1HI 1E3PA 4LWGA 4EFTA 5C0XE 5EKWA 1Z0GA 2UXBI 1KIJA 2V2ZA 4DR4E 1HR0I 1PKPA 4JI8I 3GIGB 2HHHI 1Z0EA 4KHPI 1US7A 1XMOE 1I58A 2BRCA 1S4EA 2ZKJA 4AS9A 3H4LA 4AWOA 4DV3I 4BQGA 4DR2I 3VHAA 2YEEA 2IOQA 4AM3A 2V2QA 3EKOA 4YY3I 5IN9A 5C0XB 4V26A 4FW3A 5FLXC 2PO2A 5D7DA 2Z5CB 4DV6I 2QG0A 1RR9A 1HK7A 3B4TA 1DARA 5A2QC 1FJGI 1I5DA 2C37B 3JAMC 3OTOI 4LFBE 1H7UA 3HJCA 3T1HE 3V2UC 4BXIA 3O0IA 4LPBA 4WUCA 4GQUA 4CWPA 3RLQA 2GQ0A 3M7NG 2UXBE 1U2RA 5IT9C 4MYUA 4MYTA 1HR0E 4OO1C 1I59A 4L91A 4JI8E 2WNRA 2HHHE 4KHPE 3LNUA 2UUAI 5CF0A 4JI3I 2Q8GA 4QPKA 2WI5A 4DR2E 4Q20A 5JENA 4IS9A 2EXLA 3PS2A 1UYIA 2BT0A 3RLRA 4K0KE 3R92A 1Y8PA 1RHYA 5LL6R 2XDXA 4KSHA 2XX5A 2QFOA 4DV6E 4DR1I 4X9LA 4QNKA 1AMWA 2JEBB 1U0ZA 2NN6C 1FJGE 4BA2A 2J65A 1AM1A 3ZM7A 3OTOE 2FWYA 1BYQA 5FNDA 4DV4I 3GONA 4HXZA 1XNRI 4V25A 4JI5I 1QZRA 4IFDF 4MPNA 1Y60A 2XDUA 2ESAA 2UUAE 3PEJA 4JI3E 3U1YA 2WNRB 3VHDA 2F4VI 4CWRA 1USVA 4LOMA 3K98A 4NXME 5J6AA 1AH6A 2YE3A 4LWFA 4JI7E 4GKKI 1J5EI 4YKTA 2VESA 3P3EA 2YKCA 3OMUA 4B6CA 4DR1E 4LCGA 2H55A 1XNQI 4UT4A 1YC3A 1H7SA 4X66E 3A0WA 2E0AA 4LFCI 4AQYI 2YEAA 4DV7E 3M85D 1GKXA 3CDIA 1XNRE 4YKZA 1B3QA 1YSZA 2ZDXA 4FCQA 3QT8A 1N33I 4X62I 4IFDA 4JI5E 2GFDA 5C93A 4JYAI 4LF5I 3B82A 1RREA 1UY6A 4CWTA 3A0ZA 1IBMI 3D36A 2F4VE 4X65E 4BA1B 4OO1B 3QT6A 2JEAA 3T1KA 5K36A 2VCJA 2XX4A 1YH8A 1PVGA 4XKKA 4YKQA 2O3ZA 2NN6D 1J5EE 4GKKE 3CRLA 3P3CA 4NXNI 4P52A 2YEIA 4URLA 3U67A 2ZBKB 4ASAA 1TBWA 5JEAF 4IFDE 1KZNA 1XMQI 3CGZA 2YEBA 5C0XC 2YEFA 4ASGA 2YK2A 4LFCE 4AQYE 1K47A 2PO1A 3EKRA 3KE6A 2Q8IA 4EGHA 4DV1I 4DPWA 1IXMA 5K36E 4X62E 5D6QA 1R6LA 2XDLA 3G75A 4JAVA 4WUBA 1KKHA 4KFGA 2WEQA 1YC1A 1IBME 5A2QQ 1I5AA 3JAMQ 3WU3A 4B3RI 3EHFA 4ED4A 4NH7A 4O05A 4MU1A 1IBLI 5D7RA 2UWDA 5K36B 2PO0A 1XXEA 5IT9Q 4LWEA 1U2OA 2YGAA 5GMEA 5JEAA 2XJJA 3J80C 4IZJA 1F51A 3RKZA 3R4PA 2BM0A 1N0VC 1XMQE 3WU6A 1FNMA 3INXA 4KSGA 4ASFA 2WI7A 1XMOI 2XX2A 2YKJA 1MU5A 2HFSA 4R1FA 1Y8OA 2IOPA 2GO3A 4IZKB 2BV3A 1FWKA 4DV1E 4WUDA 2O1TA 4L8ZA 2OI2A 4XTJA 4DUZI 2AE8A 1L0OA 3P3GA 2BZ5A 4DPYA 3JZ3A 3HZ5A 4B3ME 3V5RA 4PRXA 2CCTA 1ZM3A 2A2DA 5JEAE 1Y6ZA 4GEEA 5J71A 2UUBI 3OWDA 4FMTA 4B3RE 2C38A 3HKMA 3Q5KA 2YEDA 1IBLE 4YKWA 1UYHA 4N3OA 5C0XD 3R4OA 3TZ0A 1H72C 3WHAA 4URNA 1B62A 1OYPA 2YI7A 3GCMA 3WU4A 4O07A 2BA1D 3C0EA 4H81A 3LMMA 1Z0WA 3H1CA 2YE6A 4IZJB 1HNXE 4H7QA 3K1JA 2YKEA 4Z7YA 3Q5JA 4PRVA 2C1GA 3EHJA 3MNRP 4DUZE 4KP4A 2YECA 3L7ZB 2V8PA 4FCPA 3LPSA 4LCHA 3Q6NA 4K0KI 1HNWE 3CRKA 4L90A 1I94I 1Z5BA 4OKGA 1BKNA 2UUBE 4LF8I 4E01A 1ZWHA 4HYPA 4EMDA 4GFNA 4MU3A 4JI0I 5LMNI 3GMEA 3GIFA 3ZXQA 4DU8A 3PRYA 3Q5LA 4B3TI 1OSFA 2BSMA 4JASA 3R91A 2Z5BA 4DPXA 2UU9I 2YEGA 4GCZA 2LJPA 4MQYA 3OW6A 3O6OA 2JKIA 4KQVA 2WI1A 2YE7A 4RPFA 1ZM2A 4B7PA 2CG9A 2YK9A 2YGEA 5CPHA 2YE9A 3T0ZA 4NXMI 1NHHA 4E72A 4JI7I 2Q2EB 3B27A 5BOCA 5BR8E 4DU7A 2VQEI 4P7AA 4L93A 3TUHA 1I94E 2X7IA 3A0TA 4L94A 2GO4A 4LF8E 4GKJI 2FWZA 4MPEA 4CWNA 2PO2B 1Z0CA 2HKEA 3ZZ0A 2YGFA 4X66I 4JI0E 3K85A 4JI1I 5LMNE 4DR3I 4IFDC 2BREA 4DV7I 4AWPA 4HYMA 4B3SI 3GLLA 2O1UA 4B3TE 4LFAI 2UU9E 2UXCI 4GQTA 1S14A 4JG4A 4XKOA 4FCRA 4J3DA 4DUYI 5ELWA 1H74A 5LMUI 5K36C 2BU8A 1UY9A 4X65I 2C2AA
chains in the Genus database with same CATH topology
3EHGA 5M4KA 4JI2E 2YI6A 4U7NA 3DGEA 3TZ4A 3FT5A 2VQEE 3J80Q 2J7KA 5L3JA 4CE2A 4YKRA 4GKJE 1UYEA 3IEDA 2BYIA 2R3VA 4EM7A 3F0NA 3INWA 2XJGA 4JI1E 2IORA 2JJCA 4DR3E 3ZKDA 4B3SE 2DEJA 1ID0A 1MG7A 1NZ0A 4LFAE 5M4PA 1ZM4A 2UXCE 2VF3A 2YJWA 2WI6A 3T10A 1TILA 2YKBA 4DUYE 5LMUE 1KVKA 4HACA 2CZ9A 3A0XA 4MPCA 2DEIA 1BXDA 2XEXA 1N34I 2AJ4A 2XDSA 4HY6A 1ZXMA 3Q6MA 1UYLA 3HULA 4R3MA 2WERA 1A6FA 4O09A 4LWIA 1YT1A 4DZYA 1XHKA 4USMA 1FKAE 4JI6I 4DUHA 4Z7CA 2FXSA 2YI0A 4XE2A 4H85A 1TH8A 1ELOA 2XCMA 4GGLA 4MOTA 1YS3A 2CCSA 2XJXA 5F3KA 3K97A 2BTZA 2E1RA 1FWLA 1S16A 2V2VA 4B3MI 2CGEA 1YERA 1AH8A 4XCJA 4CWOA 2BM1A 3C11A 4URMA 2ZDYA 4JQLA 1N34E 4XITA 4M1KA 3M6AA 3R4NA 1UYKA 1UYMA 5IWAI 3FT8A 5D6PA 4P8OA 2IWXA 3CWVA 1GKZA 4UROA 1JM6A 4JI6E 1TC6A 3SL2A 1HNXI 4O0BA 5CTUA 2CCUA 1Z59A 3G7BA 1KTVA 3Q1QA 4YKYA 2VCIA 3QDDA 4GT8A 3TZ5A 4I3HA 1ZW9A 3K99A 4XD8A 2K5BA 4DR5I 1HNWI 4IZJD 4ASBA 4CE1A 2XDKA 1UEKA 5GMDA 2QF6A 1VISA 1YT0A 2GQPA 3ZXOA 3NMQA 3J81C 1FI4A 3B25A 4DPTA 5BODA 1R62A 3BM9A 4R3AA 1Y4SA 5IWAE 4LF9I 3GIGA 4FN5A 2HKJA 3GIEA 4XIPA 4DV5I 2BYHA 1QY8A 3B78A 5IDMA 1UYCA 4QPJA 5FNCA 1MX0A 1EA6A 4JI4I 1QYEA 4FWHA 1YSRA 1NHIA 2BU5A 2YI5A 1N0UA 4PU9A 2Z5CA 4DR5E 5BR8I 2YEHA 2Z5EA 2YEJA 3H80A 2UUCE 4HXWA 3ZZUA 2VWCA 4E02A 4XIQA 1ZXNA 4FPPA 2E5LI 2YKIA 1B63A 3HZ1A 1Z5AA 1D6TA 2R42A 1YESA 3U2KA 4LF9E 4CWFA 4YKUA 4JV5I 4EGKA 4USKA 4DV5E 4LF7I 5FNFA 2HFUA 1Z0TA 3HYZA 4DR7I 3PYEA 4DV2I 4EGIA 1UY7A 3O2FA 4LF6I 4U7OA 1I5CA 3CGYA 3K17A 4JI4E 2YE8A 4E00A 4JI2I 2Q8HA 2XHRA 2AKPA 4XCLA 2GS8A 4X64I 1BGQA 3WQ9A 2XHTA 4XIRA 2E5LE 3VHCA 1USUA 2BU7A 4FWGA 4LWHA 4UTGA 4DR6I 5IDJA 3J7AG 5CTWA 1A4HA 3FV5A 3K60A 2V34A 3BMYA 1Y8NA 4JV5E 3PYFA 4U93A 3WU5A 2XK2A 4MP2A 4LF7E 2Z5BB 4MBCA 4DR7E 4W7TA 5M4NA 4DV2E 4DV3E 2CGFA 2UXDI 4DXLA 4MP7A 4LF6E 3ZKBA 1AJ6A 3ZZTA 4YY3E 4DV0I 2PNMA 4X64E 1NHJA 4FW9A 5F5RA 2WI2A 2VQFI 3B28A 4LF4I 3PEHA 2VW5A 3QTFA 1N36I 3A0YA 4DR6E 4XDMA 4XKAA 4BAEA 1UYFA 3TTZA 4MB9A 4HY1A 5M4HA 1Z0BA 2HCHA 1Y4UA 3J81Q 4JAUA 4ZVIA 2UXDE 4BQJA 2YE4A 3TZ2A 4YHHI 3U2DA 4NH9A 5FWKA 1YC4A 3PYGA 2PNLA 1THNA 1Z5CA 4XC0A 1WUUA 4DV0E 3OWBA 3B8HA 4DPUA 2VQFE 3D0BA 1UYGA 2WI3A 4LF4E 3VADA 3B26A 1Z0VA 3T1YI 1N36E 4HZ5A 5GGZA 4BIUA 4DV4E 1IBKI 4PL9A 2FYPA 5M4MA 4CE3A 2PNRA 4O04A 2XHXA 5D7CA 4LP0A 1TC0A 1TIDA 2YJXA 4YHHE 2EFGA 3J7AM 4HACB 2H8MA 2WW4A 2X36A 3G7EA 4KTNA 3QT7A 3B24A 4CWQA 3LTOA 2XD6A 2A2CA 3R4MA 2YE5A 1XNQE 4EFUA 1OJ4A 4I5SA 2HK3A 4IZKA 2BU2A 2BU6A 3T1YE 3T0HA 3QT5A 2HK2A 5CTYA 3OPDA 2ZM6I 1IBKE 1N33E 4K4OA 5FLXQ 3A0RA 1PIEA 1GJVA 2HG1A 4BIZA 4JYAE 4LF5E 1EI1A 1H73A 4ZKIA 1HNZI 2UUCI 5CTXA 1UYDA 4FWDA 3D2RA 3T2SA 1N32I 3HHUA 4OX9I 2XABA 4CWSA 4NXNE 2WEPA 2Q8FA 3HEKA 4DR4I 4YKXA 1YETA 2IWSA 1UY8A 3D4JA 2QG2A 2WI4A 4HZ0A 1ZM9A 2ZITA 1I5BA 2YE2A 3RLPA 4NH8A 4AWQA 2ZM6E 2NPFA 3PYDA 2CH4A 1HNZE 3P06A 4EEHA 2O1WA 2O1VA 1YT2A 2IWUA 4EMVA 1N32E 3EHHA 4OX9E 4LFBI 3HYYA 5M4EA 3T1HI 4LWGA 4EFTA 1Z0GA 2UXBI 1KIJA 2V2ZA 4DR4E 1HR0I 1PKPA 4JI8I 3GIGB 2HHHI 1Z0EA 4KHPI 1US7A 1XMOE 1I58A 2BRCA 1S4EA 2ZKJA 4AS9A 3H4LA 4AWOA 4DV3I 4BQGA 4DR2I 3VHAA 2YEEA 2IOQA 2V2QA 3EKOA 4YY3I 5IN9A 4V26A 5FLXC 5D7DA 2Z5CB 4DV6I 2QG0A 1RR9A 1HK7A 1DARA 5A2QC 1FJGI 1I5DA 4LFBE 3JAMC 3OTOI 1H7UA 3HJCA 3T1HE 3V2UC 4BXIA 3O0IA 4LPBA 4WUCA 4CWPA 3RLQA 2GQ0A 2UXBE 1U2RA 5IT9C 4MYUA 4MYTA 1HR0E 1I59A 4L91A 4JI8E 2HHHE 4KHPE 3LNUA 2UUAI 5CF0A 4JI3I 2Q8GA 4QPKA 2WI5A 4DR2E 4Q20A 2EXLA 1UYIA 2BT0A 3RLRA 4K0KE 3R92A 1Y8PA 5LL6R 2XDXA 4KSHA 2XX5A 2QFOA 4DV6E 4DR1I 4X9LA 1U0ZA 1AMWA 1FJGE 1AM1A 2FWYA 3ZM7A 3OTOE 1BYQA 5FNDA 4DV4I 3GONA 4HXZA 1XNRI 4V25A 4JI5I 1QZRA 4MPNA 2XDUA 2ESAA 2UUAE 3PEJA 4JI3E 3VHDA 2F4VI 4CWRA 1USVA 3K98A 4NXME 5J6AA 1AH6A 2YE3A 4LWFA 4JI7E 4GKKI 1J5EI 4YKTA 2YKCA 3OMUA 4B6CA 4DR1E 2H55A 1XNQI 4UT4A 1YC3A 1H7SA 4X66E 3A0WA 2E0AA 4LFCI 4AQYI 2YEAA 4DV7E 1GKXA 1XNRE 4YKZA 1B3QA 1YSZA 2ZDXA 4FCQA 3QT8A 1N33I 4X62I 4JI5E 2GFDA 5C93A 4JYAI 4LF5I 3B82A 1RREA 1UY6A 4CWTA 3A0ZA 1IBMI 3D36A 2F4VE 4X65E 3T1KA 3QT6A 2VCJA 2XX4A 1PVGA 4XKKA 4YKQA 4GKKE 3CRLA 1J5EE 4NXNI 4P52A 2YEIA 4URLA 3U67A 2ZBKB 4ASAA 1TBWA 1KZNA 1XMQI 3CGZA 2YEBA 2YEFA 4ASGA 2YK2A 4LFCE 4AQYE 1K47A 3EKRA 3KE6A 2Q8IA 4EGHA 4DV1I 4DPWA 4X62E 5D6QA 2XDLA 3G75A 4JAVA 4WUBA 1KKHA 4KFGA 2WEQA 1YC1A 1IBME 5A2QQ 1I5AA 3JAMQ 3WU3A 4B3RI 3EHFA 4ED4A 4NH7A 4O05A 1IBLI 5D7RA 2UWDA 4LWEA 5IT9Q 1U2OA 2YGAA 5GMEA 2XJJA 3J80C 4IZJA 3RKZA 3R4PA 2BM0A 1N0VC 1XMQE 3WU6A 1FNMA 3INXA 4KSGA 4ASFA 2WI7A 1XMOI 2XX2A 2YKJA 1MU5A 2HFSA 4R1FA 1Y8OA 2IOPA 4IZKB 2BV3A 1FWKA 4DV1E 4WUDA 2O1TA 4L8ZA 2OI2A 4XTJA 4DUZI 1L0OA 2BZ5A 4DPYA 3JZ3A 3HZ5A 4B3ME 3V5RA 4PRXA 2CCTA 1ZM3A 2A2DA 1Y6ZA 4GEEA 5J71A 2UUBI 3OWDA 4FMTA 4B3RE 3Q5KA 2YEDA 1IBLE 4YKWA 1UYHA 4N3OA 3R4OA 3TZ0A 3WHAA 1H72C 4URNA 1B62A 2YI7A 3WU4A 4O07A 3C0EA 4H81A 1Z0WA 2YE6A 4IZJB 1HNXE 4H7QA 3K1JA 2YKEA 4Z7YA 3Q5JA 4PRVA 3EHJA 3MNRP 4DUZE 4KP4A 2YECA 2V8PA 4FCPA 3LPSA 4K0KI 3Q6NA 1HNWE 3CRKA 4L90A 1I94I 1Z5BA 1BKNA 2UUBE 4LF8I 4E01A 1ZWHA 4HYPA 4EMDA 4GFNA 4JI0I 5LMNI 3GIFA 3ZXQA 4DU8A 3PRYA 3Q5LA 4B3TI 1OSFA 2BSMA 4JASA 3R91A 2Z5BA 4DPXA 2UU9I 2YEGA 4GCZA 2LJPA 3OW6A 3O6OA 2JKIA 4KQVA 2WI1A 2YE7A 4RPFA 1ZM2A 4B7PA 2CG9A 2YK9A 2YGEA 5CPHA 2YE9A 3T0ZA 4NXMI 1NHHA 4JI7I 2Q2EB 3B27A 5BOCA 5BR8E 4DU7A 2VQEI 4P7AA 4L93A 3TUHA 1I94E 2X7IA 3A0TA 4L94A 4LF8E 4GKJI 2FWZA 4MPEA 4CWNA 1Z0CA 2HKEA 3ZZ0A 2YGFA 4X66I 4JI0E 3K85A 4JI1I 5LMNE 4DR3I 2BREA 4AWPA 4DV7I 4HYMA 4B3SI 2O1UA 4B3TE 4LFAI 2UU9E 2UXCI 4GQTA 1S14A 4JG4A 4XKOA 4FCRA 4DUYI 1H74A 5LMUI 2BU8A 1UY9A 4X65I 2C2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHG A;  5M4K A;  4JI2 E;  2YI6 A;  4U7N A;  3DGE A;  3TZ4 A;  3FT5 A;  2VQE E;  3J80 Q;  2J7K A;  5L3J A;  4CE2 A;  4YKR A;  4GKJ E;  1UYE A;  3IED A;  2BYI A;  2R3V A;  4EM7 A;  3F0N A;  3INW A;  2XJG A;  4JI1 E;  2IOR A;  2JJC A;  4DR3 E;  3ZKD A;  4B3S E;  2DEJ A;  1ID0 A;  1MG7 A;  1NZ0 A;  4LFA E;  5M4P A;  1ZM4 A;  2UXC E;  2VF3 A;  2YJW A;  2WI6 A;  3T10 A;  1TIL A;  2YKB A;  4DUY E;  5LMU E;  1KVK A;  4HAC A;  2CZ9 A;  3A0X A;  4MPC A;  2DEI A;  1BXD A;  2XEX A;  1N34 I;  2AJ4 A;  2XDS A;  4HY6 A;  1ZXM A;  1UYL A;  3HUL A;  4R3M A;  2WER A;  1A6F A;  4O09 A;  4LWI A;  1YT1 A;  4DZY A;  1XHK A;  4USM A;  1FKA E;  4JI6 I;  4DUH A;  4Z7C A;  2FXS A;  2YI0 A;  4XE2 A;  4H85 A;  1TH8 A;  1ELO A;  2XCM A;  4GGL A;  4MOT A;  1YS3 A;  2CCS A;  2XJX A;  5F3K A;  3K97 A;  2BTZ A;  2E1R A;  1FWL A;  1S16 A;  2V2V A;  4B3M I;  1YER A;  1AH8 A;  4XCJ A;  4CWO A;  2BM1 A;  3C11 A;  4URM A;  2ZDY A;  4JQL A;  1N34 E;  4XIT A;  4M1K A;  3M6A A;  3R4N A;  1UYK A;  1UYM A;  5IWA I;  3FT8 A;  5D6P A;  4P8O A;  2IWX A;  3CWV A;  1GKZ A;  4URO A;  1JM6 A;  4JI6 E;  1TC6 A;  3SL2 A;  1HNX I;  4O0B A;  5CTU A;  2CCU A;  1Z59 A;  3G7B A;  1KTV A;  3Q1Q A;  4YKY A;  2VCI A;  3QDD A;  4GT8 A;  3TZ5 A;  4I3H A;  1ZW9 A;  3K99 A;  4XD8 A;  2K5B A;  4DR5 I;  1HNW I;  4ASB A;  4CE1 A;  2XDK A;  1UEK A;  5GMD A;  2QF6 A;  1VIS A;  1YT0 A;  2GQP A;  3ZXO A;  3NMQ A;  3J81 C;  1FI4 A;  3B25 A;  4DPT A;  5BOD A;  1R62 A;  3BM9 A;  4R3A A;  1Y4S A;  5IWA E;  4LF9 I;  3GIG A;  4FN5 A;  2HKJ A;  3GIE A;  4XIP A;  4DV5 I;  2BYH A;  1QY8 A;  3B78 A;  5IDM A;  1UYC A;  4QPJ A;  5FNC A;  1MX0 A;  1EA6 A;  4JI4 I;  1QYE A;  4FWH A;  1YSR A;  1NHI A;  2BU5 A;  2YI5 A;  1N0U A;  4PU9 A;  2YEJ A;  4DR5 E;  5BR8 I;  2YEH A;  3H80 A;  2UUC E;  4HXW A;  3ZZU A;  2VWC A;  4E02 A;  4XIQ A;  1ZXN A;  4FPP A;  2E5L I;  2YKI A;  1B63 A;  3HZ1 A;  1Z5A A;  1D6T A;  2R42 A;  1YES A;  3U2K A;  4LF9 E;  4CWF A;  4YKU A;  4JV5 I;  4EGK A;  4USK A;  4DV5 E;  4LF7 I;  5FNF A;  2HFU A;  1Z0T A;  3HYZ A;  4DR7 I;  3PYE A;  4DV2 I;  4EGI A;  1UY7 A;  3O2F A;  4LF6 I;  4U7O A;  1I5C A;  3CGY A;  3K17 A;  4JI4 E;  2YE8 A;  4E00 A;  4JI2 I;  2Q8H A;  2XHR A;  2AKP A;  4XCL A;  2GS8 A;  4X64 I;  1BGQ A;  3WQ9 A;  2XHT A;  4XIR A;  2E5L E;  3VHC A;  2BU7 A;  4FWG A;  4LWH A;  4UTG A;  4DR6 I;  5IDJ A;  3J7A G;  5CTW A;  1A4H A;  3FV5 A;  3K60 A;  2V34 A;  3BMY A;  1Y8N A;  4JV5 E;  3PYF A;  4U93 A;  3WU5 A;  2XK2 A;  4MP2 A;  4LF7 E;  4MBC A;  4DR7 E;  4W7T A;  5M4N A;  4DV2 E;  4DV3 E;  2CGF A;  2UXD I;  4DXL A;  4MP7 A;  4LF6 E;  3ZKB A;  1AJ6 A;  3ZZT A;  4YY3 E;  4DV0 I;  4X64 E;  1NHJ A;  4FW9 A;  5F5R A;  2WI2 A;  2VQF I;  3B28 A;  4LF4 I;  3PEH A;  2VW5 A;  3QTF A;  1N36 I;  3A0Y A;  4DR6 E;  4XDM A;  4XKA A;  4BAE A;  1UYF A;  3TTZ A;  4MB9 A;  4HY1 A;  5M4H A;  1Z0B A;  2HCH A;  1Y4U A;  3J81 Q;  4JAU A;  4ZVI A;  2UXD E;  4BQJ A;  2YE4 A;  3TZ2 A;  4YHH I;  3U2D A;  4NH9 A;  1YC4 A;  5FWK A;  3PYG A;  1THN A;  4XC0 A;  1Z5C A;  1WUU A;  4DV0 E;  3OWB A;  3B8H A;  4DPU A;  2VQF E;  3D0B A;  1UYG A;  2WI3 A;  4LF4 E;  3VAD A;  3B26 A;  1Z0V A;  3T1Y I;  1N36 E;  4HZ5 A;  5GGZ A;  4BIU A;  4DV4 E;  1IBK I;  4PL9 A;  2FYP A;  5M4M A;  4CE3 A;  2PNR A;  4O04 A;  2XHX A;  5D7C A;  4LP0 A;  1TC0 A;  1TID A;  2YJX A;  4YHH E;  2EFG A;  3J7A M;  4HAC B;  2H8M A;  2WW4 A;  2X36 A;  3G7E A;  4KTN A;  3QT7 A;  3B24 A;  4CWQ A;  3LTO A;  2XD6 A;  2A2C A;  3R4M A;  2YE5 A;  1XNQ E;  4EFU A;  1OJ4 A;  4I5S A;  2HK3 A;  2BU2 A;  2BU6 A;  3T1Y E;  3T0H A;  3QT5 A;  2HK2 A;  5CTY A;  3OPD A;  2ZM6 I;  1IBK E;  1N33 E;  4K4O A;  5FLX Q;  3A0R A;  1PIE A;  1GJV A;  2HG1 A;  4BIZ A;  4JYA E;  4LF5 E;  1EI1 A;  1H73 A;  4ZKI A;  1HNZ I;  2UUC I;  5CTX A;  1UYD A;  4FWD A;  3D2R A;  3T2S A;  1N32 I;  3HHU A;  4OX9 I;  2XAB A;  4CWS A;  4NXN E;  2WEP A;  2Q8F A;  3HEK A;  4DR4 I;  4YKX A;  1YET A;  2IWS A;  1UY8 A;  3D4J A;  2QG2 A;  2WI4 A;  4HZ0 A;  1ZM9 A;  2ZIT A;  1I5B A;  2YE2 A;  3RLP A;  4NH8 A;  4AWQ A;  2ZM6 E;  2NPF A;  3PYD A;  2CH4 A;  1HNZ E;  4EEH A;  2O1W A;  2O1V A;  1YT2 A;  2IWU A;  4EMV A;  1N32 E;  3EHH A;  4OX9 E;  4LFB I;  3HYY A;  5M4E A;  3T1H I;  4LWG A;  4EFT A;  1Z0G A;  2UXB I;  1KIJ A;  2V2Z A;  4DR4 E;  1HR0 I;  1PKP A;  4JI8 I;  3GIG B;  2HHH I;  1Z0E A;  4KHP I;  1US7 A;  1XMO E;  1I58 A;  2BRC A;  1S4E A;  2ZKJ A;  4AS9 A;  3H4L A;  4AWO A;  4DV3 I;  4BQG A;  4DR2 I;  3VHA A;  2YEE A;  2IOQ A;  2V2Q A;  3EKO A;  4YY3 I;  5IN9 A;  4V26 A;  5FLX C;  5D7D A;  4DV6 I;  2QG0 A;  1RR9 A;  1DAR A;  5A2Q C;  1FJG I;  1I5D A;  4LFB E;  3JAM C;  3OTO I;  1H7U A;  3T1H E;  4BXI A;  3V2U C;  3O0I A;  4LPB A;  4WUC A;  4CWP A;  3RLQ A;  2UXB E;  1U2R A;  5IT9 C;  4MYU A;  4MYT A;  1HR0 E;  1I59 A;  4L91 A;  4JI8 E;  2HHH E;  4KHP E;  3LNU A;  2UUA I;  5CF0 A;  4JI3 I;  2Q8G A;  4QPK A;  2WI5 A;  4DR2 E;  4Q20 A;  2EXL A;  1UYI A;  2BT0 A;  3RLR A;  4K0K E;  3R92 A;  1Y8P A;  5LL6 R;  2XDX A;  4KSH A;  2XX5 A;  2QFO A;  4DV6 E;  4DR1 I;  4X9L A;  1U0Z A;  1AMW A;  1FJG E;  1AM1 A;  2FWY A;  3ZM7 A;  3OTO E;  1BYQ A;  5FND A;  4DV4 I;  3GON A;  4HXZ A;  1XNR I;  4V25 A;  4JI5 I;  1QZR A;  4MPN A;  2XDU A;  2ESA A;  2UUA E;  3PEJ A;  4JI3 E;  3VHD A;  2F4V I;  4CWR A;  3K98 A;  4NXM E;  5J6A A;  1AH6 A;  2YE3 A;  4LWF A;  4JI7 E;  4GKK I;  1J5E I;  4YKT A;  2YKC A;  3OMU A;  4B6C A;  4DR1 E;  2H55 A;  1XNQ I;  4UT4 A;  1YC3 A;  1H7S A;  4X66 E;  3A0W A;  2E0A A;  4LFC I;  4AQY I;  2YEA A;  4DV7 E;  1GKX A;  1XNR E;  4YKZ A;  1B3Q A;  1YSZ A;  2ZDX A;  4FCQ A;  3QT8 A;  1N33 I;  4X62 I;  4JI5 E;  2GFD A;  5C93 A;  4JYA I;  4LF5 I;  3B82 A;  1RRE A;  1UY6 A;  4CWT A;  3A0Z A;  1IBM I;  3D36 A;  2F4V E;  4X65 E;  3T1K A;  3QT6 A;  2VCJ A;  2XX4 A;  1PVG A;  4XKK A;  4YKQ A;  4GKK E;  3CRL A;  1J5E E;  4NXN I;  4P52 A;  2YEI A;  4URL A;  3U67 A;  2ZBK B;  4ASA A;  1TBW A;  1KZN A;  1XMQ I;  3CGZ A;  2YEB A;  2YEF A;  4ASG A;  2YK2 A;  4LFC E;  4AQY E;  1K47 A;  3EKR A;  3KE6 A;  2Q8I A;  4EGH A;  4DV1 I;  4DPW A;  4X62 E;  5D6Q A;  2XDL A;  3G75 A;  4JAV A;  4WUB A;  1KKH A;  4KFG A;  2WEQ A;  1YC1 A;  1IBM E;  5A2Q Q;  1I5A A;  3JAM Q;  3WU3 A;  4B3R I;  3EHF A;  4ED4 A;  4NH7 A;  4O05 A;  1IBL I;  5D7R A;  2UWD A;  4LWE A;  5IT9 Q;  1U2O A;  2YGA A;  5GME A;  2XJJ A;  3J80 C;  3RKZ A;  3R4P A;  2BM0 A;  1N0V C;  1XMQ E;  3WU6 A;  1FNM A;  3INX A;  4KSG A;  4ASF A;  2WI7 A;  1XMO I;  2XX2 A;  2YKJ A;  1MU5 A;  2HFS A;  4R1F A;  1Y8O A;  2IOP A;  2BV3 A;  1FWK A;  4DV1 E;  4WUD A;  4L8Z A;  2OI2 A;  4XTJ A;  4DUZ I;  1L0O A;  2BZ5 A;  4DPY A;  3JZ3 A;  3HZ5 A;  4B3M E;  3V5R A;  4PRX A;  2CCT A;  1ZM3 A;  2A2D A;  4GEE A;  5J71 A;  2UUB I;  3OWD A;  4FMT A;  4B3R E;  3Q5K A;  2YED A;  1IBL E;  4YKW A;  1UYH A;  3R4O A;  3TZ0 A;  3WHA A;  4URN A;  1H72 C;  1B62 A;  2YI7 A;  3WU4 A;  4O07 A;  3C0E A;  4H81 A;  1Z0W A;  2YE6 A;  1HNX E;  4H7Q A;  3K1J A;  2YKE A;  4Z7Y A;  3Q5J A;  4PRV A;  3EHJ A;  3MNR P;  4DUZ E;  4KP4 A;  2YEC A;  2V8P A;  4FCP A;  3LPS A;  4K0K I;  1HNW E;  3CRK A;  4L90 A;  1I94 I;  1Z5B A;  1BKN A;  2UUB E;  4LF8 I;  4E01 A;  1ZWH A;  4HYP A;  4EMD A;  4GFN A;  4JI0 I;  5LMN I;  3GIF A;  3ZXQ A;  4DU8 A;  3Q5L A;  4B3T I;  1OSF A;  2BSM A;  4JAS A;  3R91 A;  4DPX A;  2UU9 I;  2YEG A;  4GCZ A;  2LJP A;  3OW6 A;  3O6O A;  2JKI A;  4KQV A;  2WI1 A;  2YE7 A;  4RPF A;  1ZM2 A;  4B7P A;  2CG9 A;  2YK9 A;  2YGE A;  5CPH A;  2YE9 A;  3T0Z A;  4NXM I;  1NHH A;  4JI7 I;  2Q2E B;  3B27 A;  5BOC A;  5BR8 E;  4DU7 A;  2VQE I;  4P7A A;  4L93 A;  3TUH A;  1I94 E;  2X7I A;  3A0T A;  4L94 A;  4LF8 E;  4GKJ I;  2FWZ A;  4MPE A;  4CWN A;  1Z0C A;  2HKE A;  3ZZ0 A;  2YGF A;  4X66 I;  4JI0 E;  4JI1 I;  5LMN E;  2BRE A;  4DR3 I;  4AWP A;  4DV7 I;  4HYM A;  4B3S I;  4B3T E;  4LFA I;  2O1U A;  2UU9 E;  2UXC I;  4GQT A;  1S14 A;  4JG4 A;  4XKO A;  4FCR A;  4DUY I;  1H74 A;  5LMU I;  2BU8 A;  1UY9 A;  4X65 I;  2C2A A; 
#chains in the Genus database with same CATH topology
 3EHG A;  5M4K A;  4JI2 E;  2YI6 A;  4U7N A;  3DGE A;  3TZ4 A;  3FT5 A;  2VQE E;  3J80 Q;  2J7K A;  5L3J A;  4CE2 A;  4YKR A;  4GKJ E;  1UYE A;  3IED A;  2BYI A;  3U1K A;  2R3V A;  4EM7 A;  3F0N A;  4OO1 D;  3INW A;  2XJG A;  4JI1 E;  2IOR A;  2JJC A;  4DR3 E;  4NBQ A;  4BA2 B;  3ZKD A;  4B3S E;  2DEJ A;  1ID0 A;  1MG7 A;  1E3H A;  1NZ0 A;  4LFA E;  3M7N D;  5M4P A;  1ZM4 A;  2UXC E;  2VF3 A;  2YJW A;  2WI6 A;  3T10 A;  1TIL A;  2YKB A;  4DUY E;  5LMU E;  1KVK A;  4HAC A;  2CZ9 A;  3A0X A;  4MPC A;  2DEI A;  1BXD A;  2XEX A;  1N34 I;  2F1D A;  2AJ4 A;  2XDS A;  5JEA C;  4HY6 A;  1ZXM A;  3Q6M A;  1UYL A;  3HUL A;  4R3M A;  2WER A;  4U3B A;  1A6F A;  4O09 A;  2FTK A;  4LWI A;  1YT1 A;  4DZY A;  1XHK A;  4USM A;  1FKA E;  4JI6 I;  4DUH A;  4Z7C A;  2FXS A;  2YI0 A;  4XE2 A;  4H85 A;  1TH8 A;  1ELO A;  5K36 D;  2XCM A;  4GGL A;  1YS3 A;  2CCS A;  4MOT A;  2XJX A;  5F3K A;  3K97 A;  2BTZ A;  2BA0 D;  2E1R A;  1FWL A;  1S16 A;  2V2V A;  4B3M I;  2CGE A;  1YER A;  4IFD B;  4OZE A;  1AH8 A;  4XCJ A;  4CWO A;  2BM1 A;  3C11 A;  4URM A;  2ZDY A;  4JQL A;  1N34 E;  4XIT A;  4AIM A;  4M1K A;  3M6A A;  3R4N A;  2JEA B;  1UYK A;  1UYM A;  5IWA I;  3FT8 A;  5D6P A;  4P8O A;  2IWX A;  3CWV A;  1GKZ A;  4URO A;  2WP8 A;  1JM6 A;  4JI6 E;  1TC6 A;  3SL2 A;  1HNX I;  4O0B A;  5CTU A;  2JE6 A;  2CCU A;  1Z59 A;  3G7B A;  1KTV A;  3Q1Q A;  4YKY A;  2VCI A;  3QDD A;  4GT8 A;  5C0X F;  3NZK A;  2PO1 B;  3TZ5 A;  4I3H A;  1ZW9 A;  3K99 A;  4XD8 A;  2K5B A;  4DR5 I;  1HNW I;  4IZJ D;  4ASB A;  4CE1 A;  2XDK A;  1UEK A;  5GMD A;  2QF6 A;  1VIS A;  1YT0 A;  2GQP A;  3ZXO A;  3NMQ A;  3J81 C;  1FI4 A;  3B25 A;  4DPT A;  5BOD A;  1UDS A;  1R62 A;  3BM9 A;  4R3A A;  1Y4S A;  5IWA E;  4LF9 I;  3GIG A;  4FN5 A;  2PO0 B;  2HKJ A;  3GIE A;  4XIP A;  1P42 A;  5JEA B;  4DV5 I;  2BYH A;  1QY8 A;  3B78 A;  5IDM A;  1UYC A;  2CVE A;  2IER A;  4QPJ A;  5FNC A;  1MX0 A;  1EA6 A;  4JI4 I;  1QYE A;  4FWH A;  1YSR A;  1NHI A;  2BU5 A;  2YI5 A;  1N0U A;  4PU9 A;  2Z5C A;  4DR5 E;  5BR8 I;  2YEH A;  2Z5E A;  2YEJ A;  3H80 A;  2UUC E;  4HXW A;  3ZZU A;  2VWC A;  4E02 A;  2C37 A;  4XIQ A;  1ZXN A;  4FPP A;  2E5L I;  2YKI A;  1B63 A;  3HZ1 A;  1Z5A A;  1D6T A;  2C38 B;  2R42 A;  1YES A;  4LCF A;  3U2K A;  4LF9 E;  4CWF A;  5DNL A;  4YKU A;  4JV5 I;  4EGK A;  4USK A;  4DV5 E;  4LF7 I;  5FNF A;  2HFU A;  1Z0T A;  3HYZ A;  4DR7 I;  3PYE A;  4DV2 I;  4EGI A;  1UY7 A;  3O2F A;  4LF6 I;  4U7O A;  1I5C A;  3CGY A;  3K17 A;  4JI4 E;  1OYR A;  2YE8 A;  4E00 A;  4JI2 I;  2Q8H A;  2XHR A;  2AKP A;  4XCL A;  2GS8 A;  2PNZ A;  4X64 I;  2JEB A;  1BGQ A;  3WQ9 A;  2XHT A;  4AID A;  4XIR A;  2E5L E;  3VHC A;  1USU A;  2BU7 A;  4FWG A;  4LWH A;  4UTG A;  4DR6 I;  3M85 G;  5IDJ A;  3J7A G;  5CTW A;  1A4H A;  3FV5 A;  3K60 A;  2V34 A;  3BMY A;  1Y8N A;  4JV5 E;  3PYF A;  4U93 A;  3WU5 A;  3DD6 A;  2XK2 A;  4MP2 A;  4LF7 E;  2Z5B B;  4MBC A;  4DR7 E;  4MDT A;  4W7T A;  4DV2 E;  4DV3 E;  2CGF A;  5M4N A;  4OO1 F;  4DXL A;  2UXD I;  4MP7 A;  4LF6 E;  3ZKB A;  1AJ6 A;  3ZZT A;  4YY3 E;  2BR2 A;  2IES A;  4DV0 I;  2C1I A;  2PNM A;  4X64 E;  1NHJ A;  4FW9 A;  5F5R A;  2PNZ B;  2WI2 A;  2VQF I;  3B28 A;  4LF4 I;  3PEH A;  2VW5 A;  3QTF A;  1N36 I;  3A0Y A;  4DR6 E;  4LPF A;  4XDM A;  2NN6 F;  4XKA A;  4BAE A;  4FW6 A;  4MU4 A;  4U3D A;  2BA0 G;  1UYF A;  4MB9 A;  3TTZ A;  4HY1 A;  5M4H A;  3PS3 A;  1Z0B A;  4BA1 A;  4OO1 A;  1Y4U A;  3J81 Q;  2HCH A;  4ZVI A;  2UXD E;  2HHI A;  4JAU A;  2YE4 A;  3TZ2 A;  4BQJ A;  4YHH I;  3U2D A;  4FW5 A;  5EL9 A;  5K36 F;  5FWK A;  1YC4 A;  4NH9 A;  3PYG A;  2PNL A;  1THN A;  1Z5C A;  4XC0 A;  1WUU A;  4DV0 E;  4IFD D;  1YHC A;  4ISA A;  3OWB A;  2BR2 B;  1OYS A;  3B8H A;  1R6M A;  3UHM A;  4DPU A;  2VQF E;  3D0B A;  1UYG A;  2WI3 A;  4LF4 E;  3VAD A;  3CYG A;  1UDQ A;  3B26 A;  2JT2 A;  4OO1 E;  1Z0V A;  3T1Y I;  1N36 E;  1UDN A;  4HZ5 A;  5GGZ A;  4BIU A;  5DRR A;  4DV4 E;  2NN6 A;  3CDJ A;  1IBK I;  4PL9 A;  3KRN A;  1UDO A;  2FYP A;  5M4M A;  4CE3 A;  2PNR A;  4O04 A;  2XHX A;  5D7C A;  4LP0 A;  1TC0 A;  1TID A;  2YJX A;  4YHH E;  2EFG A;  3J7A M;  4HAC B;  2H8M A;  2WW4 A;  2X36 A;  3G7E A;  4KTN A;  3QT7 A;  3B24 A;  4CWQ A;  2NN6 E;  3LTO A;  2XD6 A;  5DRQ A;  2BA1 G;  2A2C A;  4FW7 A;  4QNJ A;  1XNQ E;  2YE5 A;  3R4M A;  3S5T A;  4EFU A;  1OJ4 A;  4I5S A;  2HK3 A;  4IZK A;  2BU2 A;  2BU6 A;  3T1Y E;  3T0H A;  3QT5 A;  2HK2 A;  5CTY A;  3OPD A;  2ZM6 I;  1IBK E;  1N33 E;  4K4O A;  5FLX Q;  3A0R A;  1PIE A;  1GJV A;  2NN6 B;  2HG1 A;  4JYA E;  4LF5 E;  4BIZ A;  3P76 A;  5JEA D;  1EI1 A;  1H73 A;  4ZKI A;  2C39 A;  1HNZ I;  2UUC I;  5CTX A;  1UYD A;  4FWD A;  3D2R A;  3T2S A;  1N32 I;  3HHU A;  4OX9 I;  5DRO A;  2XAB A;  4FW4 A;  4CWS A;  4NXN E;  2WEP A;  2Q8F A;  3HEK A;  4DR4 I;  4YKX A;  1YET A;  2IWS A;  1UY8 A;  3D4J A;  2QG2 A;  2WI4 A;  4MU0 A;  4HZ0 A;  1VI7 A;  1ZM9 A;  2ZIT A;  2WP8 B;  1I5B A;  2YE2 A;  4NH8 A;  3RLP A;  5DRP A;  4AWQ A;  2ZM6 E;  2JE6 B;  3L7Z A;  5C0X A;  1Y5Y A;  2NPF A;  3PS1 A;  3PYD A;  2CH4 A;  5DNX A;  1HNZ E;  3P06 A;  4EEH A;  2O1W A;  2O1V A;  1YT2 A;  2C39 B;  2IWU A;  4EMV A;  1N32 E;  3EHH A;  4OX9 E;  4LFB I;  3HYY A;  5M4E A;  3T1H I;  1E3P A;  4LWG A;  4EFT A;  5C0X E;  5EKW A;  1Z0G A;  2UXB I;  1KIJ A;  2V2Z A;  4DR4 E;  1HR0 I;  1PKP A;  4JI8 I;  3GIG B;  2HHH I;  1Z0E A;  4KHP I;  1US7 A;  1XMO E;  1I58 A;  2BRC A;  1S4E A;  2ZKJ A;  4AS9 A;  3H4L A;  4AWO A;  4DV3 I;  4BQG A;  4DR2 I;  3VHA A;  2YEE A;  2IOQ A;  4AM3 A;  2V2Q A;  3EKO A;  4YY3 I;  5IN9 A;  5C0X B;  4V26 A;  4FW3 A;  5FLX C;  2PO2 A;  5D7D A;  2Z5C B;  4DV6 I;  2QG0 A;  1RR9 A;  1HK7 A;  3B4T A;  1DAR A;  5A2Q C;  1FJG I;  1I5D A;  2C37 B;  3JAM C;  3OTO I;  4LFB E;  1H7U A;  3HJC A;  3T1H E;  3V2U C;  4BXI A;  3O0I A;  4LPB A;  4WUC A;  4GQU A;  4CWP A;  3RLQ A;  2GQ0 A;  3M7N G;  2UXB E;  1U2R A;  5IT9 C;  4MYU A;  4MYT A;  1HR0 E;  4OO1 C;  1I59 A;  4L91 A;  4JI8 E;  2WNR A;  2HHH E;  4KHP E;  3LNU A;  2UUA I;  5CF0 A;  4JI3 I;  2Q8G A;  4QPK A;  2WI5 A;  4DR2 E;  4Q20 A;  5JEN A;  4IS9 A;  2EXL A;  3PS2 A;  1UYI A;  2BT0 A;  3RLR A;  4K0K E;  3R92 A;  1Y8P A;  1RHY A;  5LL6 R;  2XDX A;  4KSH A;  2XX5 A;  2QFO A;  4DV6 E;  4DR1 I;  4X9L A;  4QNK A;  1AMW A;  2JEB B;  1U0Z A;  2NN6 C;  1FJG E;  4BA2 A;  2J65 A;  1AM1 A;  3ZM7 A;  3OTO E;  2FWY A;  1BYQ A;  5FND A;  4DV4 I;  3GON A;  4HXZ A;  1XNR I;  4V25 A;  4JI5 I;  1QZR A;  4IFD F;  4MPN A;  1Y60 A;  2XDU A;  2ESA A;  2UUA E;  3PEJ A;  4JI3 E;  3U1Y A;  2WNR B;  3VHD A;  2F4V I;  4CWR A;  1USV A;  4LOM A;  3K98 A;  4NXM E;  5J6A A;  1AH6 A;  2YE3 A;  4LWF A;  4JI7 E;  4GKK I;  1J5E I;  4YKT A;  2VES A;  3P3E A;  2YKC A;  3OMU A;  4B6C A;  4DR1 E;  4LCG A;  2H55 A;  1XNQ I;  4UT4 A;  1YC3 A;  1H7S A;  4X66 E;  3A0W A;  2E0A A;  4LFC I;  4AQY I;  2YEA A;  4DV7 E;  3M85 D;  1GKX A;  3CDI A;  1XNR E;  4YKZ A;  1B3Q A;  1YSZ A;  2ZDX A;  4FCQ A;  3QT8 A;  1N33 I;  4X62 I;  4IFD A;  4JI5 E;  2GFD A;  5C93 A;  4JYA I;  4LF5 I;  3B82 A;  1RRE A;  1UY6 A;  4CWT A;  3A0Z A;  1IBM I;  3D36 A;  2F4V E;  4X65 E;  4BA1 B;  4OO1 B;  3QT6 A;  2JEA A;  3T1K A;  5K36 A;  2VCJ A;  2XX4 A;  1YH8 A;  1PVG A;  4XKK A;  4YKQ A;  2O3Z A;  2NN6 D;  1J5E E;  4GKK E;  3CRL A;  3P3C A;  4NXN I;  4P52 A;  2YEI A;  4URL A;  3U67 A;  2ZBK B;  4ASA A;  1TBW A;  5JEA F;  4IFD E;  1KZN A;  1XMQ I;  3CGZ A;  2YEB A;  5C0X C;  2YEF A;  4ASG A;  2YK2 A;  4LFC E;  4AQY E;  1K47 A;  2PO1 A;  3EKR A;  3KE6 A;  2Q8I A;  4EGH A;  4DV1 I;  4DPW A;  1IXM A;  5K36 E;  4X62 E;  5D6Q A;  1R6L A;  2XDL A;  3G75 A;  4JAV A;  4WUB A;  1KKH A;  4KFG A;  2WEQ A;  1YC1 A;  1IBM E;  5A2Q Q;  1I5A A;  3JAM Q;  3WU3 A;  4B3R I;  3EHF A;  4ED4 A;  4NH7 A;  4O05 A;  4MU1 A;  1IBL I;  5D7R A;  2UWD A;  5K36 B;  2PO0 A;  1XXE A;  5IT9 Q;  4LWE A;  1U2O A;  2YGA A;  5GME A;  5JEA A;  2XJJ A;  3J80 C;  4IZJ A;  1F51 A;  3RKZ A;  3R4P A;  2BM0 A;  1N0V C;  1XMQ E;  3WU6 A;  1FNM A;  3INX A;  4KSG A;  4ASF A;  2WI7 A;  1XMO I;  2XX2 A;  2YKJ A;  1MU5 A;  2HFS A;  4R1F A;  1Y8O A;  2IOP A;  2GO3 A;  4IZK B;  2BV3 A;  1FWK A;  4DV1 E;  4WUD A;  2O1T A;  4L8Z A;  2OI2 A;  4XTJ A;  4DUZ I;  2AE8 A;  1L0O A;  3P3G A;  2BZ5 A;  4DPY A;  3JZ3 A;  3HZ5 A;  4B3M E;  3V5R A;  4PRX A;  2CCT A;  1ZM3 A;  2A2D A;  5JEA E;  1Y6Z A;  4GEE A;  5J71 A;  2UUB I;  3OWD A;  4FMT A;  4B3R E;  2C38 A;  3HKM A;  3Q5K A;  2YED A;  1IBL E;  4YKW A;  1UYH A;  4N3O A;  5C0X D;  3R4O A;  3TZ0 A;  1H72 C;  3WHA A;  4URN A;  1B62 A;  1OYP A;  2YI7 A;  3GCM A;  3WU4 A;  4O07 A;  2BA1 D;  3C0E A;  4H81 A;  3LMM A;  1Z0W A;  3H1C A;  2YE6 A;  4IZJ B;  1HNX E;  4H7Q A;  3K1J A;  2YKE A;  4Z7Y A;  3Q5J A;  4PRV A;  2C1G A;  3EHJ A;  3MNR P;  4DUZ E;  4KP4 A;  2YEC A;  3L7Z B;  2V8P A;  4FCP A;  3LPS A;  4LCH A;  3Q6N A;  4K0K I;  1HNW E;  3CRK A;  4L90 A;  1I94 I;  1Z5B A;  4OKG A;  1BKN A;  2UUB E;  4LF8 I;  4E01 A;  1ZWH A;  4HYP A;  4EMD A;  4GFN A;  4MU3 A;  4JI0 I;  5LMN I;  3GME A;  3GIF A;  3ZXQ A;  4DU8 A;  3PRY A;  3Q5L A;  4B3T I;  1OSF A;  2BSM A;  4JAS A;  3R91 A;  2Z5B A;  4DPX A;  2UU9 I;  2YEG A;  4GCZ A;  2LJP A;  4MQY A;  3OW6 A;  3O6O A;  2JKI A;  4KQV A;  2WI1 A;  2YE7 A;  4RPF A;  1ZM2 A;  4B7P A;  2CG9 A;  2YK9 A;  2YGE A;  5CPH A;  2YE9 A;  3T0Z A;  4NXM I;  1NHH A;  4E72 A;  4JI7 I;  2Q2E B;  3B27 A;  5BOC A;  5BR8 E;  4DU7 A;  2VQE I;  4P7A A;  4L93 A;  3TUH A;  1I94 E;  2X7I A;  3A0T A;  4L94 A;  2GO4 A;  4LF8 E;  4GKJ I;  2FWZ A;  4MPE A;  4CWN A;  2PO2 B;  1Z0C A;  2HKE A;  3ZZ0 A;  2YGF A;  4X66 I;  4JI0 E;  3K85 A;  4JI1 I;  5LMN E;  4DR3 I;  4IFD C;  2BRE A;  4DV7 I;  4AWP A;  4HYM A;  4B3S I;  3GLL A;  2O1U A;  4B3T E;  4LFA I;  2UU9 E;  2UXC I;  4GQT A;  1S14 A;  4JG4 A;  4XKO A;  4FCR A;  4J3D A;  4DUY I;  5ELW A;  1H74 A;  5LMU I;  5K36 C;  2BU8 A;  1UY9 A;  4X65 I;  2C2A A; 
#chains in the Genus database with same CATH homology
 3EHG A;  5M4K A;  4JI2 E;  2YI6 A;  4U7N A;  3DGE A;  3TZ4 A;  3FT5 A;  2VQE E;  3J80 Q;  2J7K A;  5L3J A;  4CE2 A;  4YKR A;  4GKJ E;  1UYE A;  3IED A;  2BYI A;  2R3V A;  4EM7 A;  3F0N A;  3INW A;  2XJG A;  4JI1 E;  2IOR A;  2JJC A;  4DR3 E;  3ZKD A;  4B3S E;  2DEJ A;  1ID0 A;  1MG7 A;  1NZ0 A;  4LFA E;  5M4P A;  1ZM4 A;  2UXC E;  2VF3 A;  2YJW A;  2WI6 A;  3T10 A;  1TIL A;  2YKB A;  4DUY E;  5LMU E;  1KVK A;  4HAC A;  2CZ9 A;  3A0X A;  4MPC A;  2DEI A;  1BXD A;  2XEX A;  1N34 I;  2AJ4 A;  2XDS A;  4HY6 A;  1ZXM A;  3Q6M A;  1UYL A;  3HUL A;  4R3M A;  2WER A;  1A6F A;  4O09 A;  4LWI A;  1YT1 A;  4DZY A;  1XHK A;  4USM A;  1FKA E;  4JI6 I;  4DUH A;  4Z7C A;  2FXS A;  2YI0 A;  4XE2 A;  4H85 A;  1TH8 A;  1ELO A;  2XCM A;  4GGL A;  4MOT A;  1YS3 A;  2CCS A;  2XJX A;  5F3K A;  3K97 A;  2BTZ A;  2E1R A;  1FWL A;  1S16 A;  2V2V A;  4B3M I;  2CGE A;  1YER A;  1AH8 A;  4XCJ A;  4CWO A;  2BM1 A;  3C11 A;  4URM A;  2ZDY A;  4JQL A;  1N34 E;  4XIT A;  4M1K A;  3M6A A;  3R4N A;  1UYK A;  1UYM A;  5IWA I;  3FT8 A;  5D6P A;  4P8O A;  2IWX A;  3CWV A;  1GKZ A;  4URO A;  1JM6 A;  4JI6 E;  1TC6 A;  3SL2 A;  1HNX I;  4O0B A;  5CTU A;  2CCU A;  1Z59 A;  3G7B A;  1KTV A;  3Q1Q A;  4YKY A;  2VCI A;  3QDD A;  4GT8 A;  3TZ5 A;  4I3H A;  1ZW9 A;  3K99 A;  4XD8 A;  2K5B A;  4DR5 I;  1HNW I;  4IZJ D;  4ASB A;  4CE1 A;  2XDK A;  1UEK A;  5GMD A;  2QF6 A;  1VIS A;  1YT0 A;  2GQP A;  3ZXO A;  3NMQ A;  3J81 C;  1FI4 A;  3B25 A;  4DPT A;  5BOD A;  1R62 A;  3BM9 A;  4R3A A;  1Y4S A;  5IWA E;  4LF9 I;  3GIG A;  4FN5 A;  2HKJ A;  3GIE A;  4XIP A;  4DV5 I;  2BYH A;  1QY8 A;  3B78 A;  5IDM A;  1UYC A;  4QPJ A;  5FNC A;  1MX0 A;  1EA6 A;  4JI4 I;  1QYE A;  4FWH A;  1YSR A;  1NHI A;  2BU5 A;  2YI5 A;  1N0U A;  4PU9 A;  2Z5C A;  4DR5 E;  5BR8 I;  2YEH A;  2Z5E A;  2YEJ A;  3H80 A;  2UUC E;  4HXW A;  3ZZU A;  2VWC A;  4E02 A;  4XIQ A;  1ZXN A;  4FPP A;  2E5L I;  2YKI A;  1B63 A;  3HZ1 A;  1Z5A A;  1D6T A;  2R42 A;  1YES A;  3U2K A;  4LF9 E;  4CWF A;  4YKU A;  4JV5 I;  4EGK A;  4USK A;  4DV5 E;  4LF7 I;  5FNF A;  2HFU A;  1Z0T A;  3HYZ A;  4DR7 I;  3PYE A;  4DV2 I;  4EGI A;  1UY7 A;  3O2F A;  4LF6 I;  4U7O A;  1I5C A;  3CGY A;  3K17 A;  4JI4 E;  2YE8 A;  4E00 A;  4JI2 I;  2Q8H A;  2XHR A;  2AKP A;  4XCL A;  2GS8 A;  4X64 I;  1BGQ A;  3WQ9 A;  2XHT A;  4XIR A;  2E5L E;  3VHC A;  1USU A;  2BU7 A;  4FWG A;  4LWH A;  4UTG A;  4DR6 I;  5IDJ A;  3J7A G;  5CTW A;  1A4H A;  3FV5 A;  3K60 A;  2V34 A;  3BMY A;  1Y8N A;  4JV5 E;  3PYF A;  4U93 A;  3WU5 A;  2XK2 A;  4MP2 A;  4LF7 E;  2Z5B B;  4MBC A;  4DR7 E;  4W7T A;  5M4N A;  4DV2 E;  4DV3 E;  2CGF A;  2UXD I;  4DXL A;  4MP7 A;  4LF6 E;  3ZKB A;  1AJ6 A;  3ZZT A;  4YY3 E;  4DV0 I;  2PNM A;  4X64 E;  1NHJ A;  4FW9 A;  5F5R A;  2WI2 A;  2VQF I;  3B28 A;  4LF4 I;  3PEH A;  2VW5 A;  3QTF A;  1N36 I;  3A0Y A;  4DR6 E;  4XDM A;  4XKA A;  4BAE A;  1UYF A;  3TTZ A;  4MB9 A;  4HY1 A;  5M4H A;  1Z0B A;  2HCH A;  1Y4U A;  3J81 Q;  4JAU A;  4ZVI A;  2UXD E;  4BQJ A;  2YE4 A;  3TZ2 A;  4YHH I;  3U2D A;  4NH9 A;  5FWK A;  1YC4 A;  3PYG A;  2PNL A;  1THN A;  1Z5C A;  4XC0 A;  1WUU A;  4DV0 E;  3OWB A;  3B8H A;  4DPU A;  2VQF E;  3D0B A;  1UYG A;  2WI3 A;  4LF4 E;  3VAD A;  3B26 A;  1Z0V A;  3T1Y I;  1N36 E;  4HZ5 A;  5GGZ A;  4BIU A;  4DV4 E;  1IBK I;  4PL9 A;  2FYP A;  5M4M A;  4CE3 A;  2PNR A;  4O04 A;  2XHX A;  5D7C A;  4LP0 A;  1TC0 A;  1TID A;  2YJX A;  4YHH E;  2EFG A;  3J7A M;  4HAC B;  2H8M A;  2WW4 A;  2X36 A;  3G7E A;  4KTN A;  3QT7 A;  3B24 A;  4CWQ A;  3LTO A;  2XD6 A;  2A2C A;  3R4M A;  2YE5 A;  1XNQ E;  4EFU A;  1OJ4 A;  4I5S A;  2HK3 A;  4IZK A;  2BU2 A;  2BU6 A;  3T1Y E;  3T0H A;  3QT5 A;  2HK2 A;  5CTY A;  3OPD A;  2ZM6 I;  1IBK E;  1N33 E;  4K4O A;  5FLX Q;  3A0R A;  1PIE A;  1GJV A;  2HG1 A;  4BIZ A;  4JYA E;  4LF5 E;  1EI1 A;  1H73 A;  4ZKI A;  1HNZ I;  2UUC I;  5CTX A;  1UYD A;  4FWD A;  3D2R A;  3T2S A;  1N32 I;  3HHU A;  4OX9 I;  2XAB A;  4CWS A;  4NXN E;  2WEP A;  2Q8F A;  3HEK A;  4DR4 I;  4YKX A;  1YET A;  2IWS A;  1UY8 A;  3D4J A;  2QG2 A;  2WI4 A;  4HZ0 A;  1ZM9 A;  2ZIT A;  1I5B A;  2YE2 A;  3RLP A;  4NH8 A;  4AWQ A;  2ZM6 E;  2NPF A;  3PYD A;  2CH4 A;  1HNZ E;  3P06 A;  4EEH A;  2O1W A;  2O1V A;  1YT2 A;  2IWU A;  4EMV A;  1N32 E;  3EHH A;  4OX9 E;  4LFB I;  3HYY A;  5M4E A;  3T1H I;  4LWG A;  4EFT A;  1Z0G A;  2UXB I;  1KIJ A;  2V2Z A;  4DR4 E;  1HR0 I;  1PKP A;  4JI8 I;  3GIG B;  2HHH I;  1Z0E A;  4KHP I;  1US7 A;  1XMO E;  1I58 A;  2BRC A;  1S4E A;  2ZKJ A;  4AS9 A;  3H4L A;  4AWO A;  4DV3 I;  4BQG A;  4DR2 I;  3VHA A;  2YEE A;  2IOQ A;  2V2Q A;  3EKO A;  4YY3 I;  5IN9 A;  4V26 A;  5FLX C;  5D7D A;  2Z5C B;  4DV6 I;  2QG0 A;  1RR9 A;  1HK7 A;  1DAR A;  5A2Q C;  1FJG I;  1I5D A;  4LFB E;  3JAM C;  3OTO I;  1H7U A;  3HJC A;  3T1H E;  3V2U C;  4BXI A;  3O0I A;  4LPB A;  4WUC A;  4CWP A;  3RLQ A;  2GQ0 A;  2UXB E;  1U2R A;  5IT9 C;  4MYU A;  4MYT A;  1HR0 E;  1I59 A;  4L91 A;  4JI8 E;  2HHH E;  4KHP E;  3LNU A;  2UUA I;  5CF0 A;  4JI3 I;  2Q8G A;  4QPK A;  2WI5 A;  4DR2 E;  4Q20 A;  2EXL A;  1UYI A;  2BT0 A;  3RLR A;  4K0K E;  3R92 A;  1Y8P A;  5LL6 R;  2XDX A;  4KSH A;  2XX5 A;  2QFO A;  4DV6 E;  4DR1 I;  4X9L A;  1U0Z A;  1AMW A;  1FJG E;  1AM1 A;  2FWY A;  3ZM7 A;  3OTO E;  1BYQ A;  5FND A;  4DV4 I;  3GON A;  4HXZ A;  1XNR I;  4V25 A;  4JI5 I;  1QZR A;  4MPN A;  2XDU A;  2ESA A;  2UUA E;  3PEJ A;  4JI3 E;  3VHD A;  2F4V I;  4CWR A;  1USV A;  3K98 A;  4NXM E;  5J6A A;  1AH6 A;  2YE3 A;  4LWF A;  4JI7 E;  4GKK I;  1J5E I;  4YKT A;  2YKC A;  3OMU A;  4B6C A;  4DR1 E;  2H55 A;  1XNQ I;  4UT4 A;  1YC3 A;  1H7S A;  4X66 E;  3A0W A;  2E0A A;  4LFC I;  4AQY I;  2YEA A;  4DV7 E;  1GKX A;  1XNR E;  4YKZ A;  1B3Q A;  1YSZ A;  2ZDX A;  4FCQ A;  3QT8 A;  1N33 I;  4X62 I;  4JI5 E;  2GFD A;  5C93 A;  4JYA I;  4LF5 I;  3B82 A;  1RRE A;  1UY6 A;  4CWT A;  3A0Z A;  1IBM I;  3D36 A;  2F4V E;  4X65 E;  3T1K A;  3QT6 A;  2VCJ A;  2XX4 A;  1PVG A;  4XKK A;  4YKQ A;  4GKK E;  3CRL A;  1J5E E;  4NXN I;  4P52 A;  2YEI A;  4URL A;  3U67 A;  2ZBK B;  4ASA A;  1TBW A;  1KZN A;  1XMQ I;  3CGZ A;  2YEB A;  2YEF A;  4ASG A;  2YK2 A;  4LFC E;  4AQY E;  1K47 A;  3EKR A;  3KE6 A;  2Q8I A;  4EGH A;  4DV1 I;  4DPW A;  4X62 E;  5D6Q A;  2XDL A;  3G75 A;  4JAV A;  4WUB A;  1KKH A;  4KFG A;  2WEQ A;  1YC1 A;  1IBM E;  5A2Q Q;  1I5A A;  3JAM Q;  3WU3 A;  4B3R I;  3EHF A;  4ED4 A;  4NH7 A;  4O05 A;  1IBL I;  5D7R A;  2UWD A;  4LWE A;  5IT9 Q;  1U2O A;  2YGA A;  5GME A;  2XJJ A;  3J80 C;  4IZJ A;  3RKZ A;  3R4P A;  2BM0 A;  1N0V C;  1XMQ E;  3WU6 A;  1FNM A;  3INX A;  4KSG A;  4ASF A;  2WI7 A;  1XMO I;  2XX2 A;  2YKJ A;  1MU5 A;  2HFS A;  4R1F A;  1Y8O A;  2IOP A;  4IZK B;  2BV3 A;  1FWK A;  4DV1 E;  4WUD A;  2O1T A;  4L8Z A;  2OI2 A;  4XTJ A;  4DUZ I;  1L0O A;  2BZ5 A;  4DPY A;  3JZ3 A;  3HZ5 A;  4B3M E;  3V5R A;  4PRX A;  2CCT A;  1ZM3 A;  2A2D A;  1Y6Z A;  4GEE A;  5J71 A;  2UUB I;  3OWD A;  4FMT A;  4B3R E;  3Q5K A;  2YED A;  1IBL E;  4YKW A;  1UYH A;  4N3O A;  3R4O A;  3TZ0 A;  3WHA A;  1H72 C;  4URN A;  1B62 A;  2YI7 A;  3WU4 A;  4O07 A;  3C0E A;  4H81 A;  1Z0W A;  2YE6 A;  4IZJ B;  1HNX E;  4H7Q A;  3K1J A;  2YKE A;  4Z7Y A;  3Q5J A;  4PRV A;  3EHJ A;  3MNR P;  4DUZ E;  4KP4 A;  2YEC A;  2V8P A;  4FCP A;  3LPS A;  4K0K I;  3Q6N A;  1HNW E;  3CRK A;  4L90 A;  1I94 I;  1Z5B A;  1BKN A;  2UUB E;  4LF8 I;  4E01 A;  1ZWH A;  4HYP A;  4EMD A;  4GFN A;  4JI0 I;  5LMN I;  3GIF A;  3ZXQ A;  4DU8 A;  3PRY A;  3Q5L A;  4B3T I;  1OSF A;  2BSM A;  4JAS A;  3R91 A;  2Z5B A;  4DPX A;  2UU9 I;  2YEG A;  4GCZ A;  2LJP A;  3OW6 A;  3O6O A;  2JKI A;  4KQV A;  2WI1 A;  2YE7 A;  4RPF A;  1ZM2 A;  4B7P A;  2CG9 A;  2YK9 A;  2YGE A;  5CPH A;  2YE9 A;  3T0Z A;  4NXM I;  1NHH A;  4JI7 I;  2Q2E B;  3B27 A;  5BOC A;  5BR8 E;  4DU7 A;  2VQE I;  4P7A A;  4L93 A;  3TUH A;  1I94 E;  2X7I A;  3A0T A;  4L94 A;  4LF8 E;  4GKJ I;  2FWZ A;  4MPE A;  4CWN A;  1Z0C A;  2HKE A;  3ZZ0 A;  2YGF A;  4X66 I;  4JI0 E;  3K85 A;  4JI1 I;  5LMN E;  4DR3 I;  2BRE A;  4AWP A;  4DV7 I;  4HYM A;  4B3S I;  2O1U A;  4B3T E;  4LFA I;  2UU9 E;  2UXC I;  4GQT A;  1S14 A;  4JG4 A;  4XKO A;  4FCR A;  4DUY I;  1H74 A;  5LMU I;  2BU8 A;  1UY9 A;  4X65 I;  2C2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...