4JAVA

Structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
246
structure length
246
Chain Sequence
NVTESKELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/signaling protein
molecule keywords Histidine kinase
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
total genus 79
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4javA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4javA02
2XDSA 3CWVA 1Y4UA 1YT0A 2YE3A 1R62A 4O0BA 2XDXA 4XKOA 1MU5A 4XD8A 4L90A 1AM1A 3Q5KA 4H85A 4W7TA 2WERA 1H7UA 1YESA 2BREA 3K99A 2ZDYA 4EGIA 4HZ0A 4XE2A 4BXIA 2H55A 4B7PA 1GJVA 3B27A 3OPDA 5BOCA 2XJJA 3PEHA 3B26A 1UYFA 1ZW9A 1Y4SA 5BODA 5B1NA 3GIFA 2IORA 2XK2A 2YKEA 4UROA 4MPCA 1B63A 2YK2A 2QM8A 5D6PA 4JAUA 5FNDA 3G75A 3R4NA 4O09A 4V25A 4KQVA 4YKQA 3A0RA 2YGEA 2FTKA 2IOQA 3O0IA 2XJGA 2WEPA 3TZ2A 3CRKA 4FPPA 4HY1A 5GGZA 4Q20A 1UYIA 2BU7A 1GKZA 1I5DA 5J71A 2Q8FA 1AMWA 3HEKA 2XCMA 1I59A 3OW6A 5D7CA 5M4MA 2CCSA 3ZXOA 3TK1A 3VHAA 3TZ0A 3INXA 1ID0A 1NHJA 3QDDA 4PRVA 2YEEA 4V26A 3TTZA 3LNUA 4FMTA 2ZKJA 2XHTA 5C93A 2XD6A 3HYYA 1YT1A 3EHFA 1Z59A 2YEJA 1YC3A 3LPSA 4CWQA 2YKIA 3GIGB 3A0TA 3ZKBA 1UYLA 4BQJA 4B6CA 4YKRA 4CWPA 1US7A 1Y8OA 4EFUA 1BYQA 4AWPA 2XDKA 4DUHA 2XHXA 4U93A 4YKUA 1TIDA 5FNFA 4MPNA 4XDMA 3A0YA 1I5BA 3TUHA 3GIGA 1YT2A 1TBWA 1PVGA 3A0WA 2BYIA 2YJXA 1F51A 2XDLA 4XCJA 3WQ9A 4CE3A 3JZ3A 3WHAA 3NXSA 2GQPA 3VADA 4WUDA 4QPJA 4YKZA 2XJXA 1AH6A 1YC4A 1NHIA 3R4OA 3H80A 5CPHA 2XHRA 3O6OA 3ZRWA 2YE8A 5IDJA 2YE2A 3BMYA 4EMVA 2Q8GA 4XTJA 4ASGA 5FWKA 4JYCA 1B62A 3IEDA 2FXSA 4KTNA 2BTZA 2IOPA 2YEBA 1EI1A 4R3AA 4X9LA 2Q2EB 4CWOA 2O1UA 4NH9A 3EHJA 2BYHA 5IN9A 3HZ1A 4BIZA 4I5SA 1BGQA 4URNA 2YEHA 1AJ6A 2CH4A 2BU8A 3K97A 3RKZA 1YC1A 3DGEA 2BU6A 2YJWA 1Z5AA 4O07A 2WI7A 2YE5A 3U2DA 3NMQA 4MPEA 2P67A 2YEFA 2HKJA 4NH8A 4BIUA 1I5CA 4AS9A 2LFSA 1TH8A 1YETA 1UY6A 2C2AA 3Q5JA 4L91A 1YS3A 4GFNA 1QYEA 1ZXNA 5CTUA 3MNRP 1S14A 5M4EA 3FT5A 4P7AA 2WI3A 3ZCCA 5B1OA 5D7DA 3R4PA 1THNA 2YE4A 4MBCA 3FT8A 3KE6A 2YI6A 3T2SA 4CWTA 4CWSA 2XX4A 4L93A 5M4KA 4KSGA 4GGLA 3T10A 3R92A 2IWXA 2CGFA 4MT8A 4MP2A 5M4HA 1NHHA 4JAVA 2EXLA 1UYCA 4CWRA 2WI2A 4HZ5A 5CF0A 3OWBA 3D2RA 4ASAA 4HXZA 2YI5A 2YGFA 4R1FA 4QPKA 1AH8A 3OMUA 4LWIA 1A4HA 1QY8A 4R3MA 4FCRA 3G7EA 2ESAA 3ZXQA 4GEEA 2YI0A 3EKOA 2JJCA 5D7RA 2YEDA 1Z5CA 1KZNA 3B28A 4XCLA 4LWHA 2O1WA 4MTXA 3D36A 2FYPA 4AWQA 2YGAA 2BSMA 3ZRWB 2ZDXA 3T0ZA 2YE9A 3ZM7A 3T1KA 3B25A 4URLA 2AKPA 4XITA 2YE7A 2YEAA 4YKTA 1U0ZA 4P8OA 1UYEA 4WUBA 1U2OA 2BRCA 3B24A 5J6AA 4GQTA 1I5AA 1JM6A 5CTYA 3VHCA 4YKWA 2HCHA 5IDMA 1IXMA 4DZYA 1OSFA 4L8ZA 5M4NA 2VCJA 3D0BA 5L3JA 1Y8NA 4AWOA 4HXWA 3EHHA 2CCUA 3O2FA 4E00A 2QM7A 4O04A 3RLQA 1UY8A 4CWNA 4GCZA 2VCIA 3HYZA 2WI1A 4K4OA 3CGYA 4H81A 3TZ4A 4EEHA 2YKJA 4CWFA 4HY6A 2IWUA 5FNCA 1UY9A 4XKAA 2WWWA 2Q8HA 3PEJA 1TC6A 2YKBA 2QF6A 4H7QA 2Q8IA 2YKCA 4URMA 4CE1A 4KFGA 3R91A 2VWCA 2BZ5A 2XDUA 4L94A 2FWZA 4HYMA 2XABA 3FV5A 2YEGA 2IWSA 3C0EA 4LWEA 4LWFA 2YEIA 3EKRA 3A0ZA 3ZRXA 1UYHA 1L0OA 4FCPA 2O1VA 4PL9A 2UWDA 3RLPA 3Q5LA 4LPBA 3U2KA 1QZRA 1Z5BA 4ZVIA 3HZ5A 2QFOA 1UYDA 3BM9A 4MOTA 4ASFA 4PRXA 4EGHA 2CG9A 3R4MA 1TC0A 2QG2A 2WEQA 1YSRA 2BU5A 2YE6A 3ZRVA 3CGZA 2BT0A 4JASA 1TILA 1EA6A 4LWGA 4BQGA 3GIEA 4MP7A 3G7BA 4I3HA 1GKXA 2H8MA 5F3KA 1UYMA 2VW5A 4EFTA 4CE2A 4WUCA 3QTFA 2HG1A 4KP4A 1JOYA 2WI5A 2ZBKB 4JYBA 1YSZA 4EM7A 5CTWA 1B3QA 3TZ5A 3P32A 3VHDA 3SL2A 4JQLA 4XKKA 4XIPA 5CTXA 2K5BA 2WI6A 4U7OA 4E01A 2PNRA 2YI7A 2WI4A 4EGKA 2E0AA 4XIQA 3K98A 4YKYA 4BAEA 2YECA 1BXDA 2GFDA 5F5RA 1ZXMA 1Y8PA 4ZKIA 4E02A 2XX2A 4KSHA 1UYKA 4MB9A 4LC1A 4NH7A 3H4LA 4HYPA 1BKNA 4PU9A 3MD0A 3INWA 3EHGA 4XIRA 1UY7A 4LP0A 4GT8A 3K60A 2JKIA 2FWYA 1ZWHA 5M4PA 3RLRA 2XX5A 4YKXA 2LFRA 3T0HA 2YK9A 1H7SA 1I58A 4GT1A 1S16A 2BU2A 3HHUA 3OWDA 4O05A 3A0XA 2CCTA 4U7NA 1UYGA 4XC0A 4FCQA 3C11A 4ASBA 3ZKDA 1YERA 2QG0A 1MX0A 3U67A 3CRLA 5D6QA 1KIJA
chains in the Genus database with same CATH superfamily
1NI8A 3UQ8A 2IM9A 3ZHQA 4DR2O 2EIKB 2IU3A 1T5EA 5KUKA 3RBZA 1R62A 4BAYA 1KQSU 4O0BA 3M99B 3OR6C 2XDXA 2OIEA 3WFVA 1FPOA 2CK3G 3CMAV 3WB1A 1YJNV 4DUYO 4W7TA 1Q43A 2QKCA 1H7UA 5J2UB 4DR1O 3K99A 4BXIA 3D8CA 2H55A 2ZE8A 4YJ3A 3K3WA 4YY3O 3OPDA 3AK3A 2IH3C 3RYHA 2GTSA 3OT7A 1NVPB 1WP8A 3FB7C 3UO3A 4NTXA 5D6PA 1XNQB 4NB5A 1S72V 3AG3B 1K92A 4KQVA 2PUSA 4MTOA 3A0BZ 3GB7C 1SA0A 1OCZB 3J80N 3LDCA 4CH4A 3ML0A 3CPWU 5GGZA 3CJHB 3ZS8C 4U3JA 2BU7A 5C8YA 4UCSA 4IHJB 3KKYA 5KHHA 5BMVB 3SR2C 1JFFB 1GKZA 1I5DA 4KL1A 1AMWA 5EYPB 3M8AA 3HKCB 2Q4PA 2AZ2A 5GW7A 1AR5A 5A2QN 2Q0OC 5JENA 3IFXA 4PDVA 3VHAA 4LFBO 1MA1A 1NHJA 4V26A 3O65A 1WPBA 2HHHO 4PA3A 4YJ2B 1PNLA 4LFAO 3CCMV 1I0HA 4H37A 1H2LA 2KG7A 1YT1A 3JCZA 3EHFA 3F5WC 1ROPA 2W6IG 4P9PA 1D5NA 1A32A 3SPCA 4EB6B 1OCCB 1N32O 4MTGA 3GIGB 1Q6UA 4NTYA 4DK0A 1UYLA 3K04A 1XMQO 3BEHA 1R6KA 4B6CA 4YKRA 4RO2A 2X6BA 2Y69C 2Y4TA 3E35A 1XDCA 2A79B 5LHIA 4U93A 4JI7B 4YKUA 3OGIB 3OEHG 5EIBC 2N74A 1KKCA 5FNFA 3FB5C 1KYOF 1TA8A 4XDMA 4KHPB 4WFGA 2K9PA 3P30A 2A7WA 1YT2A 1BT8A 2ZXWC 2BSKB 4O4LB 1TBWA 1VQKV 2HJDA 4AI8A 3A0WA 2BYIA 2L35A 3D3IA 5IT9N 3ZBHA 1COWG 3IC7A 3JZ3A 2GQPA 2R72A 4JTAB 3K59A 4QPJA 4YKZA 1OCRB 1AH6A 1XL6A 1YC4A 4J7JA 2JRIA 1W0KG 3OMIB 2E75B 5KHIA 4CS2A 3K0DA 2XHRA 2UXDO 1GMGA 2F43G 3BMYA 1FJGO 1BSMA 4MVMA 5FWKA 4JYCA 1Y67A 4OX9O 2YEBA 3SYOA 4R3AA 1IZ3A 4MVSA 4YJ3B 1QQCA 2RDCA 4NXNB 1U97A 2YXYA 3RYHB 1TAEA 1LR1A 1BGQA 4DV6O 2ILMA 2RMKB 1AJ6A 4HZ3A 1HNZO 3DGEA 3HKDA 1VQ9V 4G2KA 1Z5AA 4O07A 1QR9A 4MPEA 4AHCA 3OTFA 1NKDA 2BOCC 2WLIB 1XNRB 1EZVH 4JI4O 1I5CA 2Z3YA 1AP5A 2ARHA 4AQYO 1P84F 1Q5OA 2WLLA 3FAVA 2Q7GA 1HNXO 1AI4A 1AVMA 3E8BA 5CA1A 4U3JB 5C8YB 4B3MB 4CBCA 5M4EA 1NQTA 2WI3A 4Z1VA 2Q68A 1ZTEA 5D7DA 1H2NA 2ZDIA 1BGYH 2JK5C 2ZINA 1IURA 4MBCA 4DV5O 2QKSA 3CRAA 2KSDA 3E89A 4BR6A 4CWTA 4CWSA 1NR7A 2KG7B 1LUVA 4L93A 2OCCB 4KSGA 4P30A 1KD1W 2YI9A 5H9CA 4GYCB 3KCXA 5H6QA 4X8AA 2CGFA 4JI5O 1OCOC 1VARA 2ODMA 4F6RA 2EINB 4CWRA 4QJFB 1YJWV 3QG5A 1K3EA 3H9VA 3CRCA 4GX5A 1ZUQA 2HEPA 3KCYA 3B4SA 4DR5B 4OGQB 2V1DA 5CA3A 5JJEB 4UCOA 1IBLO 5GTHZ 1V54B 3AK1A 1PV0A 2LP7A 1P4RA 2JEUA 3JD3A 3K03A 4R6ZA 1WPXA 5TISZ 3AG3C 3B28A 4LF9O 4AWQA 2YGAA 1OCZC 2ZDXA 4FLXA 5EZYA 2YE9A 3IJ4A 1H2GA 5LMUO 3T1KA 3RVZA 3WB2A 2CH7A 4BWAA 1M1KW 1J5EB 1R1BA 5H6RA 4LF5O 5KLVH 2LW7A 4YKTA 4WUBA 1PP9H 4XBFA 1YXBA 1U2OA 1MSWD 2BRCA 5J6AA 3HKDB 1WJZA 3PJSK 4DZYA 4L8JA 1OSFA 4W4LA 2HG5C 2QWQB 5M4NA 3OTOB 1Y74A 4HXWA 2WLLB 3EHHA 2CCUA 3FAVB 1OJHA 3KG2A 2QM7A 1QLNA 1VF7A 1UY8A 2GV9A 4CWNA 1V9PA 3JD0A 4B7EA 4GCZA 4BW9A 1GK9A 2EZPA 2QWOB 3SYCA 3ABLC 4K4OA 3TZ4A 3BFRA 3APOA 4HY6A 5H2FZ 1UY9A 2VQEO 2WWWA 2Q8HA 3VQYA 4GKJO 1XI1A 4JF3A 2FMLA 2DWEC 1TUEB 4KFGA 2EIMC 3VBBA 2BZ5A 2XDUA 4UCVA 4L94A 2FWZA 3CEIA 2XABA 3LUTB 1NZ6A 2QTOA 4JI6B 3G6BA 4OPAA 3A0ZA 3ZRXA 2CAZC 2CTWA 1UYHA 4F6RB 1K9MW 5KA6A 1OCRC 4U3FH 1BL8A 2FL4A 4PA6A 1NTKH 3RLPA 4LPBA 4X64O 1Z5BA 4YHHB 1IBKO 4O4IA 3H1KH 3TJTA 2XNDG 1VQ7V 5JH7A 3BM9A 3N2GA 2LGQA 2Q73A 1TC0A 1N33B 2YE6A 4X20B 3CGZA 2EJRA 3C3SA 4JASA 4DV2O 1I5XA 3BABA 3OM3B 4BQGA 3GIEA 4WCEV 4I3HA 5KAIZ 2H8MA 4EFTA 2M6YA 4JPRA 4B7KA 4CE2A 3SJCC 4JTCB 1SQGA 5LL6Y 4DV3O 2Z5UA 4DR7O 1S5HC 4LR3A 1YZBA 4J80A 3TZ5A 3P32A 4DK1A 3SL2A 5B1BC 5CTXA 5EZYB 2X6CA 3T1HO 4U7OA 5LP6C 1AJQA 3RYIA 2CH7B 4MVUA 3RN4A 3G80A 2ZNIA 3I55V 4X62B 3K98A 3G6EV 2YECA 3OMNB 5CB4A 4B3RB 1Y8PA 2NNUA 3OR7C 4JTDB 4PA4A 5LBQA 1P7GA 4PV1B 5BR8B 1N34B 2AZ0A 3Q4HA 3MD0A 4B3SB 3EHGA 4XIRA 1SESA 3ZN0A 3ASNB 3K60A 2JKIA 2FB5A 3B40A 2UU9O 1S0VA 1HNWB 1Y74B 2OCCC 3RLRA 1GN3A 1MNGA 3ZHRA 3G4SV 2LFRA 1Z2GA 1H7SA 2BU2A 4O05A 1WAZA 5DM6V 2XTAA 1WB8A 1XEQA 1Y76B 4LFCB 5LXTA 4FCQA 1FFXA 4LP8A 1YERA 3OUSA 2LO1A 1G4YB 2WA4A 2F4VO 2JDIG 3MHSC 2XDSA 2QA4V 1Y4UA 1MZFA 3D36C 1YT0A 4JI8B 2QM4A 1H8HG 3BRCA 2B1GA 2ZCEA 1EFRG 3ICXA 4JZ2A 1MU5A 1S5JA 5D5QA 2WLMA 5B1AC 1AM1A 4E72A 2DYRC 3STZC 1NBMG 5BZBA 3T1YO 2IJJA 3VOUA 4DR6B 2GDSA 4FM1A 4B7PA 1Q82W 4J11A 4I9WA 1K73W 3B27A 1FXVA 4LF4B 2ZD9A 4O4IB 3RGBA 3E83A 2Y69B 2RCVA 3SJBC 1V55C 3N2GB 1U96A 5HFMA 2XK2A 5IWAB 2YKEA 4MPCA 3UM7A 2YK2A 4GKKO 2ATKC 4JAUA 3EXAA 3CSXA 3CS5A 4DR4O 2ZXWB 4O09A 2Q8VA 2F23A 4YKQA 4FM0A 4LWSA 5IYCO 2FTKA 2IOQA 3O0IA 2XJGA 1XOUA 3CRKA 4K35A 4Q20A 4DXWA 2ZE7A 4JI3B 3DC6A 2GUZA 4JI0B 4ZIBA 4UB6Z 2CE4A 4X65O 2XCMA 3SPJA 5KHKA 4X89A 1VQ5V 4PELA 1B04A 3TZ0A 3RYIB 4PRVA 3T1CA 3LNUA 4NXMO 4FMTA 1GN4A 1Q3EA 1ZL8A 4O2AA 5BMVA 5C93A 1KECA 5CB4B 2XD6A 5B3SC 5CMUA 4JI2B 1MG1A 2P4VA 3Q4HB 3B8MA 3IAYA 1US6A 2XASA 3SPGA 3ZKBA 3ZHSA 3ZEDA 4UCUA 1US7A 4EFUA 1G8MA 2XHXA 1VQPV 4WFEA 2YI8A 3JATA 4E2LA 4MPNA 3A0YA 1FAFA 1FFXB 3GIGA 1JR9A 1GN6A 2HFEC 3P3NA 3RYCB 4TQDA 4HBNA 1YDXA 1F51A 2XDLA 3WQ9A 2UUCB 4CE3A 2CGOA 4ZHQA 3W7SA 4WUDA 4FIPC 4EEQA 1NHIA 3R4OA 5CPHA 1Q81W 2YXLA 3KZIZ 1H2KA 4NR1A 2N04A 2YE2A 1JMKC 4EMVA 2Q8GA 4Z2WA 4ASGA 1P49A 2FXSA 2QR4A 1O9HA 1OCOB 2MW2B 2UXCB 2Q2EB 2O1UA 3JD4A 3EHJA 4MVQA 5IN9A 1XMOB 1GN2A 1UPGA 3ETDA 2UXNA 1DF5A 4DV1O 1SS3A 3RKZA 2YJWA 2ZM6B 4G27B 4I50A 5GONA 3U11A 1VP7A 2WI7A 1R3JC 4TQFA 2HKJA 3W7WA 4NKGB 4LWSB 2AHYA 1HR0B 3CE2A 2ITCC 4G28B 5LGUA 1I5YA 3C3TA 4L91A 2IBZH 1GAXA 3ASNC 2ETNA 1YS3A 2GUZB 2XT9A 1ZXNA 4DR3B 1CEZA 2NN4A 2UUAB 2WLIA 3FT5A 1SRYA 2JJ2G 3ZCCA 3QF7A 1WB7A 4UUJC 1FXKC 2EJ7A 3OMAB 4JI7O 4ASUG 3U10A 4K0KO 2YIDA 3CYOA 5LP6A 2YE4A 3ZMZA 1YHQV 3DTUB 4O2AB 1ZL8B 2M7WA 1VQOV 3JASB 4RAIA 1M56C 5JJNB 3ZMTA 5M4KA 2AW9A 4PD4F 2R70A 2V4DA 3R92A 2IWXA 4MW8A 5M4HA 4EFBA 4JAVA 2G38A 1K34A 2JS5A 4PDMA 4GX1A 1KC8W 4ICGA 3JATB 1KP3A 2QSAA 3IC9A 2YI5A 2YGFA 3WU2Z 1M57C 1IDSA 4W4KA 3PN1A 1AH8A 2WPDG 5EIBD 1E1RG 1A4HA 4UVBA 4X66O 4LH7A 4DR1B 3ZMVA 3ABLB 3JARB 4TV8A 3FD9A 4QNHB 1Q6IA 3CCRV 2UUBB 2PI4A 2DJVA 1E1QG 4ZHQB 2BCCH 5FPRA 2RN9A 5D7RA 2YEDA 3SPIA 1EBOA 3QO5A 5FNVA 3ABUA 1KZNA 2JGDB 1XNRO 5EBMC 1R3LC 2EIMB 2A3QA 3D36A 1N0NA 1X4TA 2N05A 4GZRB 1JQ0A 2GBOA 3CCEV 2P22C 1VF5B 4B3MO 4URLA 3A8TA 3LSSA 2LQTA 2AKPA 4GX2A 2HHIA 2YE7A 5FL7G 1NT2B 1UFIA 4RUEA 4P8OA 2HKOA 2LJ2A 1I5AA 5CTYA 4I50B 4J9ZB 5HFLA 5GONB 3STLC 4MVZA 4LFBB 1RSOA 3T4DA 1W59A 2VCJA 1N36B 1Y8NA 1K4DC 2H3OA 2PI5A 5L3CA 2F1MA 4O04A 3M7MX 4I7ZB 4CC5A 1OV9A 2OCHA 3RLQA 4B08A 3CX5F 3HKEA 4DUZB 1J95A 5FPOA 3K5MA 2VCIA 3HYZA 3ASOC 2XAQA 2ZR3A 2P90A 1FYJA 4CWFA 3CCVV 1SQXH 2E5LO 4XKAA 5B1BB 1CP9A 5LP6B 1EZJA 4I0XA 2DW4A 4FLZA 4RUFA 2H94A 4DO2A 4QGPA 3R91A 3JD1A 1R3IC 2HVJC 3NR7A 4DRXA 4F6EA 4HYMA 2A0LA 3CYGA 3FV5A 1Z5WA 2YEGA 3RWRD 2IWSA 3B2EE 1GO3F 1N0JA 3SYAA 1D5AA 4UB8Z 1KB9F 5ITZA 3ABKC 1L0LH 2EILC 2ADQB 2UWDA 3Q5LA 3U2KA 1QZRA 3HZ5A 3MAQA 4DV4B 2QFOA 1JX9A 1NH2D 3ABTA 2L6LA 2UXDB 4EGHA 3R4MA 4TT3G 3SYQA 3E86A 1J5EO 2QEXV 3HPLC 2KQXA 4OX9B 4TV8B 4FZ1A 2BT0A 1TILA 4X1IA 4FJCC 2EBOA 2Q5ZA 2E76B 3QO7A 5J9PC 1GKXA 3CCJV 1UYMA 5DN6G 4DV6B 4K8XA 3QTFA 2WI5A 5FNVB 2VS0A 3G67A 3DC5A 3OTOO 1HNZB 1YSZA 1ENVA 4EM7A 1S3JA 4X20A 5CTWA 1B3QA 2CGNA 3CRRA 5DEDA 4LBEC 3K57A 3L73H 4XKKA 4TSFG 3RT3C 1XREA 1ZSPA 4E01A 4WFFA 5B1AB 1OZ0A 1AI6A 3B8NA 1PNKA 1NTMH 4PA7A 4EGKA 1HNXB 2DYRB 4RQEA 3SGIA 1AI7A 3CCQV 1AJNA 4YKYA 3FB6C 4B3TO 1BXDA 5F5RA 1ZXMA 1MABG 4LF6B 3CRQA 2XX2A 1JJOA 4LC1A 1H2MA 2JEXA 3H4LA 4HYPA 1V55B 1Q6HA 3AG2C 3INWA 5IY5C 1UY7A 1URFA 2P7TC 1RSOB 1SZTA 3L74H 3TXQA 4DV5B 1S5LZ 4JI6O 2XX5A 4CH5A 1WP7A 2P5OA 3S5TA 5LMNO 3ABMC 5EBLC 4KXRA 3K5LA 4GT1A 3HKEB 3A0XA 1N4CA 1ZWIC 2LW1A 4RQFA 5KAFZ 4KFMA 3C11A 4ASBA 4YHHO 2DYSC 1MX0A 1BS3A 2OT5A 1GM7A 3K9AA 3CRLA 3U67A 4CS3A 1QHTA 3RVYA 3MDSA 1QR8A 3CB2A 3CRMA 4I0XB 1FXKA 1K5QA 3CWVA 1Y76A 4GLXA 1B06A 1FD9A 4DRXB 2YE3A 4DW0A 5IYBO 1HW7A 5B3SB 2HVKC 4XD8A 4WFBV 2ZT9B 4L87A 4H44B 4JV5B 4H85A 5LA6A 2WERA 5ITZB 2H8PC 4ZBMA 1YESA 5J2TA 2ZDYA 4EGIA 1YCIA 3ETEA 4HZ0A 1GJVA 1SERA 1M90W 2RJZA 5BOCA 2XJJA 1UYFA 1ZW9A 4NVPA 4UCTA 2IORA 3J7AU 1B63A 1XHZA 3LMMA 4B3RO 3C90A 3I5DA 5KUMA 3G75A 2A9HA 2OTLV 4V25A 4X1IB 1R3KC 5BR8O 1N34O 1M93A 2YGEA 2D2CB 3D3QA 1EN4A 2HR3A 1YITV 1F4MA 2LGWA 5CA0A 1GRJA 3OAAG 4QIWF 1VQMV 1I59A 1PPJH 5D7CA 5M4MA 1XL4A 2CCSA 4FZ0A 5LOVA 3ZXOA 4C7UA 3GWOA 4FFKA 1KU9A 4LFCO 3QDDA 3FYIB 1B6QA 4YXWG 2ZKJA 5KHJA 2PZSA 2XHTA 2KKWA 2PYJA 4XDKA 1NU1H 1QLEB 2EX3A 1MZEA 3ZMSA 4LF7B 3W7TA 1K5SA 3HR0A 3OW2U 2C1IA 1AP6A 1VEWA 4IYIA 1Z59A 1NTZH 2YEJA 1YC3A 4P2ZA 1KUQA 3LPSA 4CWQA 1XUQA 2YKIA 4UFZA 3S3XA 3THOA 3A0TA 4Q6GA 4BQJA 3SJQC 4J41A 3JCUZ 4CWPA 1QVGU 4J7ZA 1Y8OA 1BYQA 3BAAA 2XDKA 4FVMA 4DUHA 1TIDA 2CTRA 1O9GA 4DR6O 1I5BA 3L9DA 5KHGA 3ZHVA 1S76D 4IT5A 4LF4O 3JSLA 3QTCA 1PVGA 2GTAA 4LF8B 2YICA 2YJXA 4CH6A 4X64B 4OXSA 1FXKB 5IWAO 3EFFK 3EHBB 3FB8C 4XCJA 4ZI7A 4JI1B 2YDEA 3NXSA 1WNSA 4H0LB 2YC0A 4IIJA 2FKXA 3JAWA 5BXZA 3RYCA 1M56B 2PTMA 2PGGA 3O6OA 2UXBB 3ZRWA 2YE8A 5LA6B 4MW3A 4DV2B 2VWJA 1TVKA 1LUWA 4HYOA 4JI0O 1I94B 5J2TB 2PF4E 2IOPA 1EI1A 4X9LA 4NH9A 3E8FA 1QU7A 2BYHA 5LGTA 3QO8A 2W6JG 3HZ1A 3BCCH 4UCRA 4DV7B 2B1IA 2CH4A 4H13B 2D3OW 2IJIA 1M57B 3U2DA 2OYQA 2P67A 1K4CC 4JI2O 4BIUA 2NLJC 1G1XB 2LFSA 1BCCH 1TH8A 4MVRA 1YETA 1YVWA 2C2AA 3CHXA 1IX9A 4DV0B 4DYLA 3UT5A 5CA0B 5IJ0A 3JYCA 4P7AA 4ZOLA 5LOVB 4JYAO 3X2QC 2A06H 1PD3A 1GM9A 4FLUA 3R4PA 1THNA 2VRZA 3AG4C 5E1AC 4UXNA 4I55A 2YIBA 1K7DA 5JVDA 2YI6A 3OUFA 3T2SA 1F4NA 2XX4A 3FKSG 1RPOA 2UUCO 2ZIOA 5GTIZ 2NR5A 4CZZA 4MP2A 4J10A 2EXLA 2Q67A 3JASA 4CH3A 2IJHA 3RFRA 1DK1A 5CF0A 2CUGA 3CXCU 1S77D 2WLNA 2YUAA 3QVNA 4ASAA 4XDJA 1RM1C 3K0GA 1YIJV 1GKFA 4D6TH 3WG7C 5L3GA 4F4LA 1F7YA 1XMOO 4R3MA 4FCRA 3ASOB 2AXTZ 1WA8A 2DN9A 3G7EA 2O57A 3W7UA 4YIPA 5K1PA 3LNNA 2YI0A 3EKOA 3H1HH 4ZI7B 1THZA 2ZM6O 1VF6C 2XAGA 3ZHUA 4IIJB 1Z5CA 3JAWB 4GKKB 1Q8IA 2O1WA 1KMIZ 4MTXA 2GSMB 3JARA 1YI2V 1XBLA 3ZMUA 1HR0O 4OPHA 3ZRWB 5IE9A 4PI2A 1TVKB 1XNQO 1W2BU 3FYEB 3GVMA 2IH1C 4DR3O 1ZAUA 4XITA 3ABKB 2EILB 2UUAO 1SC5B 2JGDA 4IGGA 3ZIAG 1GH6A 2ZR2A 5EBWC 3B24A 2RQ6A 4NTWA 1M4UA 4QE7A 2JS3A 4YKWA 1L8DA 1QLEC 4TV9A 2ZKOA 3D0BA 3JAKA 1NH2B 1R6TA 3O2FA 4E00A 5LHGA 2E3CA 3TXSA 2UXXA 1FS0G 3UT5B 4FM2A 5IJ0B 2DQ3A 2DQ0A 2R9AA 3A2FA 1PKXA 1SQFA 4D7TA 2IW5A 2VQFB 4ZOLB 4H81A 2IWUA 4FLVA 1M5IA 1K97A 2ZNJA 1NR1A 4EKWA 2QWRB 3AG7A 2YKBA 4UVCA 5L3DA 2P4KA 4H7QA 2XHBA 1W0JG 4I55B 2Y0PA 3IGAC 2YKCA 4URMA 1P7BA 5JVDB 4LH6A 4CE1A 2BTQA 5CBGA 4BW5A 2UUBO 3TCUA 4JAAA 1BZKA 4J9YB 1BHBA 3C0EA 4LWEA 4LWFA 2YEIA 3EKRA 3CC7V 1SQQH 4KHPO 3OD4A 3AG2B 4FFBA 5IY5B 1N8RW 1L0OA 2R9IA 4CS4A 5LYJB 4PL9A 3L71H 1FFTB 1BE3H 2B9ZA 1CXZB 1IBMB 4ZVIA 5KMGA 1VQNV 5IYZB 4R8CA 3ABMB 4ASFA 4PRXA 5F2VO 2DWDC 1SETA 2Y0IA 1PL0A 2CTPA 4LNUB 2BU5A 1SZXA 4PHZA 4DR2B 1L0NH 1WA8B 4UV8A 3ZRVA 2DYSB 3R65A 2YS8A 4J42A 1EA6A 4LWGA 2DMXA 2OIGA 5DECA 4MP7A 3G7BA 3GWKC 3CMEV 5F3KA 2VW5A 4K8ZA 4WUCA 4R50A 2QE7G 4DUYB 4KP4A 1NJIW 4NXNO 4X1KA 4DV1B 2EIJC 4JYBA 2QDOA 1N36O 3J81N 3JD2A 2DE0X 3VHDA 1YJ9V 2AGAA 5JJJB 4YY3B 1YEWA 3CCLV 2PNRA 3K5OA 2YI7A 1HP8A 4DUZO 2GHYA 2HLDG 2E0AA 4FLTA 4XIQA 4H33A 3P3PA 4BAEA 4FLYA 2GFDA 4ZKIA 2QKAA 4E02A 1Y4MA 3SPHA 2X7RB 1F23A 2CTQA 2WLKA 2XAHA 3SJAC 5AG2A 1DGSA 1VQLV 2QTSA 3L75H 4K0KB 2Q69A 2JVDA 4MTFA 3CCUV 4TV9B 1Q7YW 2Z0AA 2ZE5A 3K9SA 3JAKB 3OGCC 1SF9A 1FXHA 1X59A 3ETGA 2YK9A 1I58A 2CCTA 4U7NA 1UYGA 4TOIA 3G71V 3E8HA 5CBHA 2HHHB 2QWNB 1Z5VA 3LSUA 4LFAB 3ZKDA 1FKAO 3JSNA 4DV4O 3N27A 4WBNA 5D6QA 3CC2V 5JCOC 4R7CA 4P9OA 1N32B 2BTQB 4DW1A 2QJ1A 2W0FC 2ZE6A 2K1EA 1QVFU 1BQZA 4X66B 4DR5O 3U0ZA 1XMQB 4XKOA 4L90A 3Q5KA 1RPRA 4FFBB 3AG1C 1SQVH 2BREA 3E22A 3W7XA 1XQ8A 4XE2A 3BA8A 2WLJA 5KMGB 4WFHA 3PEHA 3B26A 1Y4SA 1XHXA 5BODA 1SA0B 5B1NA 2XUMA 3GIFA 5JQGA 4UROA 2QM8A 1I7FA 5FNDA 5IYDO 4LF6O 3R4NA 1D2DA 1MMMA 3ETQA 3A0RA 1WN7A 1I08A 1TUBA 2WEPA 3TZ2A 3APQA 4FPPA 5FLXN 4LCUC 4HY1A 2OTJV 4X1KB 1VF6A 4QE9A 1FJGB 1UYIA 4O2BA 3F7VC 1SQBH 2WA3A 1IVSA 3VQVA 4JGSA 5J71A 2Q8FA 3HEKA 3HKBA 5CN0A 3OW6A 3SYPA 5IJ9A 2PY5A 3TK1A 2YXHA 3UCSC 2AHZA 3INXA 3O9OA 5KX5A 1ID0A 4O4JA 2YEEA 3TTZA 2EIKC 2YIBD 3CP1A 1GTOA 4J7KA 4HAMA 4IYHA 1DLBA 2QWPB 3HYYA 1ZX3A 4JI4B 4AQYB 3OEEG 1ZLZA 2E5LB 2F93B 3VQXA 5E79Z 4UV9A 5EC2C 1NVPD 3K08A 4K3AA 1SKVA 2HP8A 2P6JA 3TETA 3H1LH 4JV5O 4AWPA 4MS2A 5L3BA 4JYYA 4PA9A 3F7YC 2F66C 3DXRA 4TUYA 1MSDA 3ZX6A 2XAJA 3TUHA 3RYFA 4WBNB 2PYLA 2X6AA 1E79G 3N2KA 3X2QB 1TGOA 4PDLA 1YSCA 3WHAA 3AG4B 2YIAA 3VADA 2F95B 4JI5B 2XJXA 1VQ4V 1JVMA 3FFQA 4TWKA 2Q0AA 3H80A 2C1GA 3K79A 5IDJA 1N33O 4NYKA 4XTJA 2WSSG 3E22B 1B62A 3IEDA 2ZIMA 4KTNA 2BTZA 1DF4A 4CWOA 1IBLB 5LHHA 4HNAA 5EC1C 2DOSA 4BIZA 1DTOA 4I5SA 4URNA 2YEHA 1BQ0A 5JQGB 1RM1B 2BU8A 3K97A 1OCCC 1AB3A 1YC1A 2BU6A 5CA1B 3OE7G 1R6NA 4FK5C 4O4HA 2YE5A 4KUMA 3BA9A 3WG7B 3NMQA 1L1FA 1AI5A 3L70H 1YF2A 2YEFA 2ITDC 4LF7O 3DSQA 4NH8A 4B3TB 4I4TA 3I56V 4AS9A 3R66A 1TUBB 3H01A 4LF9B 1AJPA 3CCSV 1UY6A 3Q5JA 4X62O 1KP2A 3TGUH 4GFNA 4O2BB 5LMUB 1QYEA 2JJ1G 5CTUA 3MNRP 5CBFA 5B5EZ 2Y4UA 1S14A 3HKBB 4D7SA 1GM8A 5BY1A 5IJ9B 4B3SO 4LF5B 5B1OA 1LNQA 3H1IH 3FX7A 4X1YA 5KX5B 3BVOA 4O4JB 3ZJZA 2Y48A 5LMNB 1HNWO 3FT8A 1EN5A 1M9NA 3OFNG 3KE6A 3BY6A 4LF8O 4BIOA 1EM1A 4GGLA 1Y66A 4WF9V 4XDLA 1EN6A 4JI1O 3T10A 3K5NA 1PNMA 2FYUH 3E8GA 5JWPA 4MT8A 4X9QA 1RFYA 1NHHA 1UYCA 2WI2A 3LDDA 4HZ5A 2Q7HA 1XILA 3F5TA 3OWBA 2UXBO 3D2RA 5LGNA 2Q6AA 3ZRSA 1YTFB 4HXZA 1CPYA 4FLWA 1I94O 2EZOA 3DXRB 2VQEB 1K33A 4TUYB 4QPKA 4R1FA 4GKJB 4JI8O 2ADPA 1BMFG 3OMUA 2EULA 4LWIA 5L3EA 2YEVA 3RYFB 3UKMA 1Y6XA 1QY8A 3B09A 3LNMB 3H1JH 3JAMN 4DV7O 2ESAA 3ZXQA 4GEEA 3N2KB 1KBHA 5EK0A 4AILC 2BOBC 2JJCA 5JCOA 3S3WA 1ORQC 3L72H 4XCLA 1Q90D 4LWHA 4PJ0Z 1G6UA 2WAMA 2FYPA 1H2SB 2BSMA 3T0ZA 2R9RB 1IBKB 4DV0O 3ZM7A 2IJKA 1H38A 2Q9LA 3B25A 2HJFC 5D5PA 3SDLA 1Q86W 4HNAB 1VQ8V 3BPZA 2W0XA 2YEAA 1U0ZA 2JIZG 4MSWC 1K8AW 1UYEA 1AR4A 2VWKA 4GQTA 4JI3O 4IL6Z 1JM6A 1JPXA 3VHCA 4O4HB 2HCHA 3JALA 5IDMA 1IXMA 2EINC 3E2EA 3AEIA 4DV3B 4L8ZA 4DR7B 4I4TB 4E4EA 5L3JA 4AWOA 3MHHC 3T1HB 1BHAA 2MK3A 1V54C 2EIJB 5K1XA 2X0LA 2WI1A 4EEHA 3CGYA 1QBZA 3HB3B 2CDYA 2YKJA 5FNCA 4X1YB 4I9QA 1PM9A 2IU0A 4Z1MG 3A0HZ 1TC6A 3PEJA 4PDRA 2V7QG 2QF6A 4EFEA 4UVAA 1PL4A 2Q8IA 1OHHG 2JGUA 2YSUB 1KKDA 2VWCA 2XAFA 3T4ZA 3CD6V 2UU9B 2KB1A 3WB0A 3K58A 1JCHA 5JH7B 4N21A 2BTOA 4RWUA 3LDEA 3BHPA 5J2UA 4FCPA 2BE3A 2RNBA 2O1VA 1SQPH 2OWOA 1QNMA 3RW0A 3QNEA 4WFAV 5A9GA 1UYDA 4GX0A 3UO2A 4MOTA 2F4VB 2CG9A 2YEVB 3B77A 1UJWB 2QG2A 2WEQA 5LYJA 1YSRA 1VQ6V 2QGNA 4ABMA 3AK2A 2E74B 5IYZA 3CWBH 4YIOA 2UXCO 2HG1A 1JOYA 2ZBKB 3CJHA 4LNUA 5B66Z 4IHJA 1MOFA 3T1YB 3ZHTA 1JFFA 1R73A 5EYPA 4A5UB 3HKCA 4JQLA 4XIPA 2ZDIC 2K5BA 2WI6A 1VMGA 2WI4A 3AG1B 3ZN1A 3CC4V 4PI0A 4X88A 4YJ2A 2VQFO 1WLEA 4DR4B 2ZQMA 2Q7EA 1UYKA 4KSHA 3T2MA 4MB9A 4NH7A 3VQWA 1BKNA 4PU9A 2XOKG 1JJ2U 4JYAB 1HWYA 3JALB 4LP0A 4EB6A 4GT8A 4GUNA 5LXTB 1ZWHA 1RP3B 2FWYA 5M4PA 4N23A 1AR1B 4YKXA 4X65B 4MVOA 3T0HA 1YTFD 1S16A 3HHUA 1QCEA 3OWDA 1H8EG 5L3FA 2B5UA 1AILA 5KA5A 1NS1A 1JA8A 4XC0A 1VIBA 3K06A 3LSQA 4NXMB 1IBMO 1AROP 2QG0A 2BSKA 4O4LA 2WLHA 3CXHF 5H5NA 4CC6A 4JZGA 1IXBA 1HDJA 1KIJA 3EVKA 2P06A
chains in the Genus database with same CATH topology
2EIKB 2IU3A 5KUKA 3RBZA 1R62A 4BAYA 1KQSU 4O0BA 3M99B 3OR6C 2XDXA 3WFVA 2CK3G 3CMAV 1YJNV 4W7TA 1H7UA 3K99A 4BXIA 2H55A 3K3WA 3OPDA 2IH3C 1NVPB 3FB7C 5D6PA 1S72V 3AG3B 1K92A 4KQVA 4MTOA 3GB7C 1OCZB 3LDCA 3ML0A 3CPWU 5GGZA 2BU7A 1GKZA 1I5DA 1AMWA 5GW7A 3IFXA 4PDVA 3VHAA 1NHJA 4V26A 4PA3A 1PNLA 3CCMV 4H37A 1YT1A 3JCZA 3EHFA 3F5WC 1ROPA 2W6IG 4P9PA 3SPCA 1OCCB 4MTGA 3GIGB 1UYLA 3K04A 3BEHA 1R6KA 4B6CA 4YKRA 4RO2A 2X6BA 2Y69C 3E35A 2A79B 5LHIA 4U93A 4YKUA 3OEHG 5FNFA 3FB5C 4XDMA 4WFGA 3P30A 1YT2A 2ZXWC 1TBWA 1VQKV 3A0WA 2BYIA 3D3IA 1COWG 3IC7A 3JZ3A 2GQPA 4JTAB 4QPJA 4YKZA 1OCRB 1AH6A 1XL6A 1YC4A 1W0KG 3OMIB 3K0DA 2XHRA 1GMGA 2F43G 3BMYA 4MVMA 5FWKA 4JYCA 2YEBA 3SYOA 4R3AA 4MVSA 1BGQA 1AJ6A 4HZ3A 3DGEA 1VQ9V 4G2KA 1Z5AA 4O07A 1QR9A 4MPEA 1NKDA 2BOCC 2WLIB 1I5CA 2Z3YA 2WLLA 1AI4A 3E8BA 4CBCA 5M4EA 1NQTA 2WI3A 2Q68A 5D7DA 2ZDIA 2JK5C 4MBCA 2QKSA 3E89A 4CWTA 4CWSA 1NR7A 4L93A 2OCCB 4KSGA 4P30A 1KD1W 5H9CA 5H6QA 4X8AA 2CGFA 1OCOC 2EINB 4CWRA 4QJFB 1YJWV 1K3EA 4GX5A 2V1DA 5CA3A 1V54B 2LP7A 1P4RA 2JEUA 3JD3A 3K03A 4R6ZA 1WPXA 3AG3C 3B28A 4AWQA 2YGAA 1OCZC 2ZDXA 2YE9A 1H2GA 3T1KA 3RVZA 1M1KW 5H6RA 4YKTA 4WUBA 1U2OA 4XBFA 2BRCA 5J6AA 1MSWD 3PJSK 4DZYA 1OSFA 2HG5C 5M4NA 4HXWA 2WLLB 3EHHA 2CCUA 3KG2A 2QM7A 1QLNA 1UY8A 4CWNA 3JD0A 4GCZA 1GK9A 2EZPA 3SYCA 3ABLC 4K4OA 3TZ4A 4HY6A 1UY9A 2WWWA 2Q8HA 4JF3A 2DWEC 1TUEB 4KFGA 2EIMC 3VBBA 2BZ5A 2XDUA 4L94A 2FWZA 2XABA 3LUTB 2QTOA 3A0ZA 3ZRXA 1UYHA 1K9MW 5KA6A 1OCRC 1BL8A 4PA6A 3RLPA 4LPBA 1Z5BA 2XNDG 1VQ7V 3BM9A 1TC0A 2YE6A 3CGZA 2EJRA 4JASA 1I5XA 3OM3B 4BQGA 3GIEA 4WCEV 4I3HA 2H8MA 4EFTA 4JPRA 4CE2A 4JTCB 2Z5UA 1S5HC 3TZ5A 3P32A 3SL2A 5B1BC 5CTXA 2X6CA 4U7OA 1AJQA 4MVUA 3I55V 3K98A 3G6EV 2YECA 3OMNB 1Y8PA 2NNUA 3OR7C 4JTDB 4PA4A 5LBQA 3MD0A 3EHGA 4XIRA 1SESA 3ZN0A 3ASNB 3K60A 2JKIA 1S0VA 2OCCC 3RLRA 3G4SV 2LFRA 1H7SA 2BU2A 4O05A 5DM6V 4FCQA 4LP8A 1YERA 3OUSA 1G4YB 2JDIG 3MHSC 2XDSA 2QA4V 1Y4UA 1YT0A 1H8HG 2B1GA 1EFRG 1MU5A 2WLMA 5B1AC 1AM1A 2DYRC 3STZC 1NBMG 5BZBA 2IJJA 3VOUA 4B7PA 1Q82W 4I9WA 1K73W 3B27A 1FXVA 2ZD9A 3E83A 2Y69B 1V55C 5HFMA 2XK2A 2YKEA 4MPCA 3UM7A 2YK2A 2ATKC 4JAUA 2ZXWB 4O09A 4YKQA 5IYCO 2FTKA 2IOQA 3O0IA 2XJGA 3CRKA 4Q20A 4DXWA 2XCMA 3SPJA 4X89A 1VQ5V 4PELA 3TZ0A 4PRVA 3T1CA 3LNUA 4FMTA 5C93A 1KECA 2XD6A 5B3SC 5CMUA 1MG1A 3B8MA 2XASA 3SPGA 3ZKBA 1US7A 4EFUA 1G8MA 2XHXA 1VQPV 4WFEA 4E2LA 4MPNA 3A0YA 3GIGA 2HFEC 1F51A 2XDLA 3WQ9A 4CE3A 3W7SA 4WUDA 4FIPC 1NHIA 3R4OA 5CPHA 1Q81W 2YE2A 4EMVA 2Q8GA 4ASGA 2FXSA 1OCOB 2Q2EB 2O1UA 3JD4A 3EHJA 4MVQA 5IN9A 3ETDA 2UXNA 1DF5A 3RKZA 2YJWA 4G27B 2WI7A 1R3JC 2HKJA 3W7WA 2AHYA 2ITCC 4G28B 5LGUA 1I5YA 4L91A 3ASNC 1YS3A 1ZXNA 1CEZA 2WLIA 3FT5A 1SRYA 2JJ2G 3ZCCA 4UUJC 1FXKC 3OMAB 4ASUG 3CYOA 2YE4A 3ZMZA 1YHQV 3DTUB 2M7WA 1VQOV 4RAIA 1M56C 3ZMTA 5M4KA 3R92A 2IWXA 4MW8A 5M4HA 4JAVA 1K34A 4PDMA 4GX1A 1KC8W 1KP3A 2YI5A 2YGFA 1M57C 1AH8A 2WPDG 1E1RG 1A4HA 4UVBA 3ZMVA 3ABLB 4QNHB 2PI4A 3CCRV 1E1QG 5D7RA 2YEDA 3SPIA 1EBOA 3QO5A 3ABUA 1KZNA 5EBMC 1R3LC 2EIMB 3D36A 1JQ0A 3CCEV 4URLA 3LSSA 2AKPA 4GX2A 2YE7A 5FL7G 4RUEA 4P8OA 2HKOA 1I5AA 5CTYA 4J9ZB 5HFLA 3STLC 4MVZA 3T4DA 2VCJA 1Y8NA 1K4DC 2PI5A 5L3CA 4O04A 3RLQA 1J95A 2VCIA 3HYZA 3ASOC 2XAQA 2ZR3A 2P90A 4CWFA 3CCVV 4XKAA 5B1BB 1CP9A 1EZJA 2DW4A 4RUFA 2H94A 4DO2A 3R91A 3JD1A 1R3IC 2HVJC 4HYMA 2A0LA 3FV5A 2YEGA 2IWSA 1GO3F 3SYAA 3ABKC 2EILC 2UWDA 3Q5LA 3U2KA 1QZRA 3HZ5A 2QFOA 1JX9A 1NH2D 3ABTA 4EGHA 3R4MA 4TT3G 3SYQA 3E86A 2QEXV 3HPLC 2BT0A 1TILA 4FJCC 2EBOA 3QO7A 5J9PC 1GKXA 3CCJV 1UYMA 5DN6G 3QTFA 2WI5A 1YSZA 1ENVA 4EM7A 1S3JA 5CTWA 1B3QA 4LBEC 4XKKA 4TSFG 4E01A 4WFFA 5B1AB 1OZ0A 1AI6A 3B8NA 1PNKA 4PA7A 4EGKA 2DYRB 4RQEA 1AI7A 3CCQV 1AJNA 4YKYA 3FB6C 1BXDA 5F5RA 1ZXMA 1MABG 2XX2A 4LC1A 2JEXA 3H4LA 4HYPA 1V55B 3AG2C 3INWA 5IY5C 1UY7A 2P7TC 1SZTA 2XX5A 3ABMC 5EBLC 4GT1A 3A0XA 1ZWIC 4RQFA 4KFMA 3C11A 4ASBA 2DYSC 1MX0A 2OT5A 1GM7A 3K9AA 3CRLA 3U67A 3RVYA 1QR8A 1FXKA 1K5QA 3CWVA 2YE3A 5IYBO 5B3SB 2HVKC 4XD8A 4WFBV 4L87A 4H85A 2WERA 2H8PC 4ZBMA 1YESA 2ZDYA 4EGIA 3ETEA 4HZ0A 1GJVA 1SERA 1M90W 5BOCA 2XJJA 1UYFA 1ZW9A 2IORA 1B63A 5KUMA 3G75A 2A9HA 2OTLV 4V25A 1R3KC 2YGEA 2HR3A 1YITV 1F4MA 3OAAG 4QIWF 1VQMV 1I59A 5D7CA 5M4MA 1XL4A 2CCSA 3ZXOA 3GWOA 3QDDA 3FYIB 1B6QA 4YXWG 2ZKJA 2XHTA 4XDKA 1QLEB 3ZMSA 3W7TA 1K5SA 3OW2U 1Z59A 2YEJA 1YC3A 4P2ZA 3LPSA 4CWQA 2YKIA 3A0TA 4BQJA 3SJQC 4CWPA 1QVGU 1Y8OA 1BYQA 2XDKA 4DUHA 1TIDA 1I5BA 1S76D 1PVGA 2YJXA 4OXSA 1FXKB 3EFFK 3EHBB 3FB8C 4XCJA 3NXSA 1M56B 3O6OA 3ZRWA 2YE8A 4MW3A 4HYOA 2IOPA 1EI1A 4X9LA 4NH9A 3E8FA 2BYHA 5LGTA 3QO8A 2W6JG 3HZ1A 2B1IA 2CH4A 2D3OW 2IJIA 1M57B 3U2DA 2P67A 1K4CC 4BIUA 2NLJC 2LFSA 1TH8A 4MVRA 1YETA 2C2AA 3JYCA 4P7AA 3X2QC 1PD3A 1GM9A 3R4PA 1THNA 3AG4C 5E1AC 4UXNA 1K7DA 2YI6A 3OUFA 3T2SA 1F4NA 2XX4A 3FKSG 1RPOA 4CZZA 4MP2A 2EXLA 2Q67A 2IJHA 5CF0A 3CXCU 1S77D 2WLNA 4ASAA 4XDJA 1RM1C 3K0GA 1YIJV 1GKFA 3WG7C 5L3GA 4F4LA 4R3MA 4FCRA 3ASOB 3G7EA 3W7UA 2YI0A 3EKOA 1THZA 2XAGA 1Z5CA 2O1WA 4MTXA 2GSMB 1YI2V 3ZMUA 3ZRWB 1W2BU 3FYEB 2IH1C 4XITA 3ABKB 2EILB 3ZIAG 2ZR2A 5EBWC 3B24A 4QE7A 4YKWA 1QLEC 3D0BA 1NH2B 3O2FA 4E00A 5LHGA 2UXXA 1FS0G 2DQ3A 2DQ0A 4H81A 1PKXA 2IW5A 2IWUA 1K97A 1NR1A 4EKWA 2YKBA 4UVCA 5L3DA 4H7QA 1W0JG 3IGAC 2YKCA 4URMA 1P7BA 4CE1A 5CBGA 4BW5A 3TCUA 4J9YB 1BHBA 3C0EA 4LWEA 4LWFA 2YEIA 3EKRA 3CC7V 3AG2B 5IY5B 1N8RW 1L0OA 2R9IA 4PL9A 1FFTB 4ZVIA 1VQNV 4R8CA 3ABMB 4ASFA 4PRXA 2DWDC 1SETA 1PL0A 2BU5A 4UV8A 3ZRVA 2DYSB 3R65A 1EA6A 4LWGA 4MP7A 3G7BA 5F3KA 3CMEV 2VW5A 4WUCA 4R50A 2QE7G 4KP4A 1NJIW 2EIJC 4JYBA 3JD2A 3VHDA 1YJ9V 3CCLV 2PNRA 2YI7A 2GHYA 2HLDG 2E0AA 4XIQA 4H33A 4BAEA 2GFDA 4ZKIA 4E02A 1Y4MA 3SPHA 2X7RB 1F23A 2WLKA 2XAHA 1VQLV 2Q69A 4MTFA 3CCUV 1Q7YW 3OGCC 1FXHA 3ETGA 2YK9A 1I58A 2CCTA 4U7NA 1UYGA 3G71V 3E8HA 5CBHA 3ZKDA 5D6QA 3CC2V 4R7CA 4P9OA 2W0FC 2K1EA 1QVFU 4XKOA 4L90A 3Q5KA 1RPRA 3AG1C 2BREA 3W7XA 4XE2A 2WLJA 4WFHA 3PEHA 3B26A 1Y4SA 5BODA 5B1NA 3GIFA 4UROA 2QM8A 5FNDA 5IYDO 3R4NA 3A0RA 2WEPA 3TZ2A 4FPPA 4HY1A 4LCUC 2OTJV 4QE9A 1UYIA 3F7VC 4JGSA 5J71A 2Q8FA 3HEKA 5CN0A 3OW6A 3SYPA 3TK1A 2AHZA 3INXA 1ID0A 2YEEA 3TTZA 2EIKC 3CP1A 1GTOA 4HAMA 1DLBA 3HYYA 3OEEG 5EC2C 4UV9A 1NVPD 3K08A 2P6JA 3TETA 4AWPA 4MS2A 5L3BA 4PA9A 3F7YC 2XAJA 3TUHA 2X6AA 1E79G 3X2QB 4PDLA 1YSCA 3WHAA 3AG4B 3VADA 2XJXA 1VQ4V 1JVMA 4TWKA 3H80A 3K79A 5IDJA 4XTJA 2WSSG 1B62A 3IEDA 4KTNA 2BTZA 1DF4A 4CWOA 5LHHA 5EC1C 4BIZA 1DTOA 4I5SA 4URNA 2YEHA 1RM1B 2BU8A 3K97A 1OCCC 1YC1A 2BU6A 3OE7G 1R6NA 4FK5C 2YE5A 4KUMA 3WG7B 3NMQA 1L1FA 1AI5A 2YEFA 2ITDC 4NH8A 3I56V 4AS9A 3H01A 1AJPA 3CCSV 1UY6A 3Q5JA 1KP2A 4GFNA 1QYEA 2JJ1G 5CTUA 3MNRP 5CBFA 1S14A 1GM8A 5B1OA 1LNQA 3ZJZA 2Y48A 3FT8A 1M9NA 3OFNG 3KE6A 3BY6A 4GGLA 1Y66A 4WF9V 4XDLA 3T10A 1PNMA 3E8GA 4MT8A 1NHHA 1UYCA 2WI2A 3LDDA 4HZ5A 3OWBA 3D2RA 5LGNA 2Q6AA 3ZRSA 1YTFB 4HXZA 1CPYA 2EZOA 4R1FA 1K33A 4QPKA 1BMFG 3OMUA 4LWIA 5L3EA 2YEVA 3UKMA 1QY8A 3LNMB 2ESAA 3ZXQA 4GEEA 5EK0A 2BOBC 2JJCA 1ORQC 4XCLA 4LWHA 2WAMA 2FYPA 2BSMA 3T0ZA 2R9RB 3ZM7A 2IJKA 1H38A 3B25A 2HJFC 1Q86W 1VQ8V 2YEAA 1U0ZA 2JIZG 4MSWC 1K8AW 1UYEA 4GQTA 1JM6A 1JPXA 3VHCA 2HCHA 5IDMA 1IXMA 2EINC 3E2EA 3AEIA 4L8ZA 5L3JA 4AWOA 3MHHC 1BHAA 2MK3A 1V54C 2EIJB 2X0LA 2WI1A 4EEHA 3CGYA 1QBZA 3HB3B 2YKJA 5FNCA 2IU0A 4Z1MG 1TC6A 3PEJA 4PDRA 2V7QG 2QF6A 4UVAA 2Q8IA 1OHHG 2YSUB 1KKDA 2VWCA 2XAFA 3T4ZA 3CD6V 2KB1A 1JCHA 4N21A 3LDEA 4FCPA 2O1VA 3RW0A 3QNEA 4WFAV 1UYDA 4GX0A 4MOTA 2CG9A 2YEVB 3B77A 1UJWB 2QG2A 2WEQA 1YSRA 1VQ6V 2HG1A 1JOYA 2ZBKB 1MOFA 1R73A 4JQLA 4XIPA 2ZDIC 2K5BA 2WI6A 2WI4A 3AG1B 3ZN1A 3CC4V 4X88A 1WLEA 2ZQMA 4KSHA 1UYKA 4MB9A 3T2MA 4NH7A 4PU9A 1BKNA 2XOKG 1JJ2U 1HWYA 4LP0A 4GT8A 2FWYA 1ZWHA 5M4PA 4N23A 1AR1B 4YKXA 4MVOA 3T0HA 1YTFD 1S16A 3HHUA 1QCEA 3OWDA 1H8EG 5L3FA 2B5UA 5KA5A 4XC0A 3K06A 3LSQA 1AROP 2QG0A 2WLHA 1KIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDS A;  3CWV A;  1Y4U A;  1YT0 A;  2YE3 A;  1R62 A;  4O0B A;  2XDX A;  4XKO A;  1MU5 A;  4XD8 A;  4L90 A;  1AM1 A;  3Q5K A;  4H85 A;  4W7T A;  2WER A;  1H7U A;  1YES A;  2BRE A;  3K99 A;  2ZDY A;  4EGI A;  4HZ0 A;  4XE2 A;  4BXI A;  2H55 A;  4B7P A;  1GJV A;  3B27 A;  3OPD A;  5BOC A;  2XJJ A;  3PEH A;  3B26 A;  1UYF A;  1ZW9 A;  1Y4S A;  5BOD A;  5B1N A;  3GIF A;  2IOR A;  2XK2 A;  2YKE A;  4URO A;  4MPC A;  1B63 A;  2YK2 A;  2QM8 A;  5D6P A;  4JAU A;  5FND A;  3G75 A;  3R4N A;  4O09 A;  4V25 A;  4KQV A;  4YKQ A;  3A0R A;  2YGE A;  2FTK A;  2IOQ A;  3O0I A;  2XJG A;  2WEP A;  3TZ2 A;  3CRK A;  4FPP A;  4HY1 A;  5GGZ A;  4Q20 A;  1UYI A;  2BU7 A;  1GKZ A;  1I5D A;  5J71 A;  2Q8F A;  1AMW A;  3HEK A;  2XCM A;  1I59 A;  3OW6 A;  5D7C A;  5M4M A;  2CCS A;  3ZXO A;  3TK1 A;  3VHA A;  3TZ0 A;  3INX A;  1ID0 A;  1NHJ A;  3QDD A;  4PRV A;  2YEE A;  4V26 A;  3TTZ A;  3LNU A;  4FMT A;  2ZKJ A;  2XHT A;  5C93 A;  2XD6 A;  3HYY A;  1YT1 A;  3EHF A;  1Z59 A;  2YEJ A;  1YC3 A;  3LPS A;  4CWQ A;  2YKI A;  3GIG B;  3A0T A;  3ZKB A;  1UYL A;  4BQJ A;  4B6C A;  4YKR A;  4CWP A;  1US7 A;  1Y8O A;  4EFU A;  1BYQ A;  4AWP A;  2XDK A;  4DUH A;  2XHX A;  4U93 A;  4YKU A;  1TID A;  5FNF A;  4MPN A;  4XDM A;  3A0Y A;  1I5B A;  3TUH A;  3GIG A;  1YT2 A;  1TBW A;  1PVG A;  3A0W A;  2BYI A;  2YJX A;  1F51 A;  2XDL A;  4XCJ A;  3WQ9 A;  4CE3 A;  3JZ3 A;  3WHA A;  3NXS A;  2GQP A;  3VAD A;  4WUD A;  4QPJ A;  4YKZ A;  2XJX A;  1AH6 A;  1YC4 A;  1NHI A;  3R4O A;  3H80 A;  5CPH A;  2XHR A;  3O6O A;  3ZRW A;  2YE8 A;  5IDJ A;  2YE2 A;  3BMY A;  4EMV A;  2Q8G A;  4XTJ A;  4ASG A;  5FWK A;  4JYC A;  1B62 A;  3IED A;  2FXS A;  4KTN A;  2BTZ A;  2IOP A;  2YEB A;  1EI1 A;  4R3A A;  4X9L A;  2Q2E B;  4CWO A;  2O1U A;  4NH9 A;  3EHJ A;  2BYH A;  5IN9 A;  3HZ1 A;  4BIZ A;  4I5S A;  1BGQ A;  4URN A;  2YEH A;  1AJ6 A;  2CH4 A;  2BU8 A;  3K97 A;  3RKZ A;  1YC1 A;  3DGE A;  2BU6 A;  2YJW A;  1Z5A A;  4O07 A;  2WI7 A;  2YE5 A;  3U2D A;  3NMQ A;  4MPE A;  2P67 A;  2YEF A;  2HKJ A;  4NH8 A;  4BIU A;  1I5C A;  4AS9 A;  2LFS A;  1TH8 A;  1YET A;  1UY6 A;  2C2A A;  3Q5J A;  4L91 A;  1YS3 A;  4GFN A;  1QYE A;  1ZXN A;  5CTU A;  3MNR P;  1S14 A;  5M4E A;  3FT5 A;  4P7A A;  2WI3 A;  3ZCC A;  5B1O A;  5D7D A;  3R4P A;  1THN A;  2YE4 A;  4MBC A;  3FT8 A;  3KE6 A;  2YI6 A;  3T2S A;  4CWT A;  4CWS A;  2XX4 A;  4L93 A;  5M4K A;  4KSG A;  4GGL A;  3T10 A;  3R92 A;  2IWX A;  2CGF A;  4MT8 A;  4MP2 A;  5M4H A;  1NHH A;  4JAV A;  2EXL A;  1UYC A;  4CWR A;  2WI2 A;  4HZ5 A;  5CF0 A;  3OWB A;  3D2R A;  4ASA A;  4HXZ A;  2YI5 A;  2YGF A;  4R1F A;  4QPK A;  1AH8 A;  3OMU A;  4LWI A;  1A4H A;  1QY8 A;  4R3M A;  4FCR A;  3G7E A;  2ESA A;  3ZXQ A;  4GEE A;  2YI0 A;  3EKO A;  2JJC A;  5D7R A;  2YED A;  1Z5C A;  1KZN A;  3B28 A;  4XCL A;  4LWH A;  2O1W A;  4MTX A;  3D36 A;  2FYP A;  4AWQ A;  2YGA A;  2BSM A;  3ZRW B;  2ZDX A;  3T0Z A;  2YE9 A;  3ZM7 A;  3T1K A;  3B25 A;  4URL A;  2AKP A;  4XIT A;  2YE7 A;  2YEA A;  4YKT A;  1U0Z A;  4P8O A;  1UYE A;  4WUB A;  1U2O A;  2BRC A;  3B24 A;  5J6A A;  4GQT A;  1I5A A;  1JM6 A;  5CTY A;  3VHC A;  4YKW A;  2HCH A;  5IDM A;  1IXM A;  4DZY A;  1OSF A;  4L8Z A;  5M4N A;  2VCJ A;  3D0B A;  5L3J A;  1Y8N A;  4AWO A;  4HXW A;  3EHH A;  2CCU A;  3O2F A;  4E00 A;  2QM7 A;  4O04 A;  3RLQ A;  1UY8 A;  4CWN A;  4GCZ A;  2VCI A;  3HYZ A;  2WI1 A;  4K4O A;  3CGY A;  4H81 A;  3TZ4 A;  4EEH A;  2YKJ A;  4CWF A;  4HY6 A;  2IWU A;  5FNC A;  1UY9 A;  4XKA A;  2WWW A;  2Q8H A;  3PEJ A;  1TC6 A;  2YKB A;  2QF6 A;  4H7Q A;  2Q8I A;  2YKC A;  4URM A;  4CE1 A;  4KFG A;  3R91 A;  2VWC A;  2BZ5 A;  2XDU A;  4L94 A;  2FWZ A;  4HYM A;  2XAB A;  3FV5 A;  2YEG A;  2IWS A;  3C0E A;  4LWE A;  4LWF A;  2YEI A;  3EKR A;  3A0Z A;  3ZRX A;  1UYH A;  1L0O A;  4FCP A;  2O1V A;  4PL9 A;  2UWD A;  3RLP A;  3Q5L A;  4LPB A;  3U2K A;  1QZR A;  1Z5B A;  4ZVI A;  3HZ5 A;  2QFO A;  1UYD A;  3BM9 A;  4MOT A;  4ASF A;  4PRX A;  4EGH A;  2CG9 A;  3R4M A;  1TC0 A;  2QG2 A;  2WEQ A;  1YSR A;  2BU5 A;  2YE6 A;  3ZRV A;  3CGZ A;  2BT0 A;  4JAS A;  1TIL A;  1EA6 A;  4LWG A;  4BQG A;  3GIE A;  4MP7 A;  3G7B A;  4I3H A;  1GKX A;  2H8M A;  5F3K A;  1UYM A;  2VW5 A;  4EFT A;  4CE2 A;  4WUC A;  3QTF A;  2HG1 A;  4KP4 A;  1JOY A;  2WI5 A;  2ZBK B;  4JYB A;  1YSZ A;  4EM7 A;  5CTW A;  1B3Q A;  3TZ5 A;  3P32 A;  3VHD A;  3SL2 A;  4JQL A;  4XKK A;  4XIP A;  5CTX A;  2K5B A;  2WI6 A;  4U7O A;  4E01 A;  2PNR A;  2YI7 A;  2WI4 A;  4EGK A;  2E0A A;  4XIQ A;  3K98 A;  4YKY A;  4BAE A;  2YEC A;  1BXD A;  2GFD A;  5F5R A;  1ZXM A;  1Y8P A;  4ZKI A;  4E02 A;  2XX2 A;  4KSH A;  1UYK A;  4MB9 A;  4LC1 A;  4NH7 A;  3H4L A;  4HYP A;  1BKN A;  4PU9 A;  3MD0 A;  3INW A;  3EHG A;  4XIR A;  1UY7 A;  4LP0 A;  4GT8 A;  3K60 A;  2JKI A;  2FWY A;  1ZWH A;  5M4P A;  3RLR A;  2XX5 A;  4YKX A;  2LFR A;  3T0H A;  2YK9 A;  1H7S A;  1I58 A;  4GT1 A;  1S16 A;  2BU2 A;  3HHU A;  3OWD A;  4O05 A;  3A0X A;  2CCT A;  4U7N A;  1UYG A;  4XC0 A;  4FCQ A;  3C11 A;  4ASB A;  3ZKD A;  1YER A;  2QG0 A;  1MX0 A;  3U67 A;  3CRL A;  5D6Q A;  1KIJ A; 
#chains in the Genus database with same CATH topology
 1NI8 A;  3UQ8 A;  2IM9 A;  3ZHQ A;  4DR2 O;  2EIK B;  2IU3 A;  1T5E A;  5KUK A;  3RBZ A;  1R62 A;  4BAY A;  1KQS U;  4O0B A;  3M99 B;  3OR6 C;  2XDX A;  2OIE A;  3WFV A;  1FPO A;  2CK3 G;  3CMA V;  3WB1 A;  1YJN V;  4DUY O;  4W7T A;  1Q43 A;  2QKC A;  1H7U A;  5J2U B;  4DR1 O;  3K99 A;  4BXI A;  3D8C A;  2H55 A;  2ZE8 A;  4YJ3 A;  3K3W A;  4YY3 O;  3OPD A;  3AK3 A;  2IH3 C;  3RYH A;  2GTS A;  3OT7 A;  1NVP B;  1WP8 A;  3FB7 C;  3UO3 A;  4NTX A;  5D6P A;  1XNQ B;  4NB5 A;  1S72 V;  3AG3 B;  1K92 A;  4KQV A;  2PUS A;  4MTO A;  3A0B Z;  3GB7 C;  1SA0 A;  1OCZ B;  3J80 N;  3LDC A;  4CH4 A;  3ML0 A;  3CPW U;  5GGZ A;  3CJH B;  3ZS8 C;  4U3J A;  2BU7 A;  5C8Y A;  4UCS A;  4IHJ B;  3KKY A;  5KHH A;  5BMV B;  3SR2 C;  1JFF B;  1GKZ A;  1I5D A;  4KL1 A;  1AMW A;  5EYP B;  3M8A A;  3HKC B;  2Q4P A;  2AZ2 A;  5GW7 A;  1AR5 A;  5A2Q N;  2Q0O C;  5JEN A;  3IFX A;  4PDV A;  3VHA A;  4LFB O;  1MA1 A;  1NHJ A;  4V26 A;  3O65 A;  1WPB A;  2HHH O;  4PA3 A;  4YJ2 B;  1PNL A;  4LFA O;  3CCM V;  1I0H A;  4H37 A;  1H2L A;  2KG7 A;  1YT1 A;  3JCZ A;  3EHF A;  3F5W C;  1ROP A;  2W6I G;  4P9P A;  1D5N A;  1A32 A;  3SPC A;  4EB6 B;  1OCC B;  1N32 O;  4MTG A;  3GIG B;  1Q6U A;  4NTY A;  4DK0 A;  1UYL A;  3K04 A;  1XMQ O;  3BEH A;  1R6K A;  4B6C A;  4YKR A;  4RO2 A;  2X6B A;  2Y69 C;  2Y4T A;  3E35 A;  1XDC A;  2A79 B;  5LHI A;  4U93 A;  4JI7 B;  4YKU A;  3OGI B;  3OEH G;  5EIB C;  2N74 A;  1KKC A;  5FNF A;  3FB5 C;  1KYO F;  1TA8 A;  4XDM A;  4KHP B;  4WFG A;  2K9P A;  3P30 A;  2A7W A;  1YT2 A;  1BT8 A;  2ZXW C;  2BSK B;  4O4L B;  1TBW A;  1VQK V;  2HJD A;  4AI8 A;  3A0W A;  2BYI A;  2L35 A;  3D3I A;  5IT9 N;  3ZBH A;  1COW G;  3IC7 A;  3JZ3 A;  2GQP A;  2R72 A;  4JTA B;  3K59 A;  4QPJ A;  4YKZ A;  1OCR B;  1AH6 A;  1XL6 A;  1YC4 A;  4J7J A;  2JRI A;  1W0K G;  3OMI B;  2E75 B;  5KHI A;  4CS2 A;  3K0D A;  2XHR A;  2UXD O;  1GMG A;  2F43 G;  3BMY A;  1FJG O;  1BSM A;  4MVM A;  5FWK A;  4JYC A;  1Y67 A;  4OX9 O;  2YEB A;  3SYO A;  4R3A A;  1IZ3 A;  4MVS A;  4YJ3 B;  1QQC A;  2RDC A;  4NXN B;  1U97 A;  2YXY A;  3RYH B;  1TAE A;  1LR1 A;  1BGQ A;  4DV6 O;  2ILM A;  2RMK B;  1AJ6 A;  4HZ3 A;  1HNZ O;  3DGE A;  3HKD A;  1VQ9 V;  4G2K A;  1Z5A A;  4O07 A;  1QR9 A;  4MPE A;  4AHC A;  3OTF A;  1NKD A;  2BOC C;  2WLI B;  1XNR B;  1EZV H;  4JI4 O;  1I5C A;  2Z3Y A;  1AP5 A;  2ARH A;  4AQY O;  1P84 F;  1Q5O A;  2WLL A;  3FAV A;  2Q7G A;  1HNX O;  1AI4 A;  1AVM A;  3E8B A;  5CA1 A;  4U3J B;  5C8Y B;  4B3M B;  4CBC A;  5M4E A;  1NQT A;  2WI3 A;  4Z1V A;  2Q68 A;  1ZTE A;  5D7D A;  1H2N A;  2ZDI A;  1BGY H;  2JK5 C;  2ZIN A;  1IUR A;  4MBC A;  4DV5 O;  2QKS A;  3CRA A;  2KSD A;  3E89 A;  4BR6 A;  4CWT A;  4CWS A;  1NR7 A;  2KG7 B;  1LUV A;  4L93 A;  2OCC B;  4KSG A;  4P30 A;  1KD1 W;  2YI9 A;  5H9C A;  4GYC B;  3KCX A;  5H6Q A;  4X8A A;  2CGF A;  4JI5 O;  1OCO C;  1VAR A;  2ODM A;  4F6R A;  2EIN B;  4CWR A;  4QJF B;  1YJW V;  3QG5 A;  1K3E A;  3H9V A;  3CRC A;  4GX5 A;  1ZUQ A;  2HEP A;  3KCY A;  3B4S A;  4DR5 B;  4OGQ B;  2V1D A;  5CA3 A;  5JJE B;  4UCO A;  1IBL O;  5GTH Z;  1V54 B;  3AK1 A;  1PV0 A;  2LP7 A;  1P4R A;  2JEU A;  3JD3 A;  3K03 A;  4R6Z A;  1WPX A;  5TIS Z;  3AG3 C;  3B28 A;  4LF9 O;  4AWQ A;  2YGA A;  1OCZ C;  2ZDX A;  4FLX A;  5EZY A;  2YE9 A;  3IJ4 A;  1H2G A;  5LMU O;  3T1K A;  3RVZ A;  3WB2 A;  2CH7 A;  4BWA A;  1M1K W;  1J5E B;  1R1B A;  5H6R A;  4LF5 O;  5KLV H;  2LW7 A;  4YKT A;  4WUB A;  1PP9 H;  4XBF A;  1YXB A;  1U2O A;  1MSW D;  2BRC A;  5J6A A;  3HKD B;  1WJZ A;  3PJS K;  4DZY A;  4L8J A;  1OSF A;  4W4L A;  2HG5 C;  2QWQ B;  5M4N A;  3OTO B;  1Y74 A;  4HXW A;  2WLL B;  3EHH A;  2CCU A;  3FAV B;  1OJH A;  3KG2 A;  2QM7 A;  1QLN A;  1VF7 A;  1UY8 A;  2GV9 A;  4CWN A;  1V9P A;  3JD0 A;  4B7E A;  4GCZ A;  4BW9 A;  1GK9 A;  2EZP A;  2QWO B;  3SYC A;  3ABL C;  4K4O A;  3TZ4 A;  3BFR A;  3APO A;  4HY6 A;  5H2F Z;  1UY9 A;  2VQE O;  2WWW A;  2Q8H A;  3VQY A;  4GKJ O;  1XI1 A;  4JF3 A;  2FML A;  2DWE C;  1TUE B;  4KFG A;  2EIM C;  3VBB A;  2BZ5 A;  2XDU A;  4UCV A;  4L94 A;  2FWZ A;  3CEI A;  2XAB A;  3LUT B;  1NZ6 A;  2QTO A;  4JI6 B;  3G6B A;  4OPA A;  3A0Z A;  3ZRX A;  2CAZ C;  2CTW A;  1UYH A;  4F6R B;  1K9M W;  5KA6 A;  1OCR C;  4U3F H;  1BL8 A;  2FL4 A;  4PA6 A;  1NTK H;  3RLP A;  4LPB A;  4X64 O;  1Z5B A;  4YHH B;  1IBK O;  4O4I A;  3H1K H;  3TJT A;  2XND G;  1VQ7 V;  5JH7 A;  3BM9 A;  3N2G A;  2LGQ A;  2Q73 A;  1TC0 A;  1N33 B;  2YE6 A;  4X20 B;  3CGZ A;  2EJR A;  3C3S A;  4JAS A;  4DV2 O;  1I5X A;  3BAB A;  3OM3 B;  4BQG A;  3GIE A;  4WCE V;  4I3H A;  5KAI Z;  2H8M A;  4EFT A;  2M6Y A;  4JPR A;  4B7K A;  4CE2 A;  3SJC C;  4JTC B;  1SQG A;  5LL6 Y;  4DV3 O;  2Z5U A;  4DR7 O;  1S5H C;  4LR3 A;  1YZB A;  4J80 A;  3TZ5 A;  3P32 A;  4DK1 A;  3SL2 A;  5B1B C;  5CTX A;  5EZY B;  2X6C A;  3T1H O;  4U7O A;  5LP6 C;  1AJQ A;  3RYI A;  2CH7 B;  4MVU A;  3RN4 A;  3G80 A;  2ZNI A;  3I55 V;  4X62 B;  3K98 A;  3G6E V;  2YEC A;  3OMN B;  5CB4 A;  4B3R B;  1Y8P A;  2NNU A;  3OR7 C;  4JTD B;  4PA4 A;  5LBQ A;  1P7G A;  4PV1 B;  5BR8 B;  1N34 B;  2AZ0 A;  3Q4H A;  3MD0 A;  4B3S B;  3EHG A;  4XIR A;  1SES A;  3ZN0 A;  3ASN B;  3K60 A;  2JKI A;  2FB5 A;  3B40 A;  2UU9 O;  1S0V A;  1HNW B;  1Y74 B;  2OCC C;  3RLR A;  1GN3 A;  1MNG A;  3ZHR A;  3G4S V;  2LFR A;  1Z2G A;  1H7S A;  2BU2 A;  4O05 A;  1WAZ A;  5DM6 V;  2XTA A;  1WB8 A;  1XEQ A;  1Y76 B;  4LFC B;  5LXT A;  4FCQ A;  1FFX A;  4LP8 A;  1YER A;  3OUS A;  2LO1 A;  1G4Y B;  2WA4 A;  2F4V O;  2JDI G;  3MHS C;  2XDS A;  2QA4 V;  1Y4U A;  1MZF A;  3D36 C;  1YT0 A;  4JI8 B;  2QM4 A;  1H8H G;  3BRC A;  2B1G A;  2ZCE A;  1EFR G;  3ICX A;  4JZ2 A;  1MU5 A;  1S5J A;  5D5Q A;  2WLM A;  5B1A C;  1AM1 A;  4E72 A;  2DYR C;  3STZ C;  1NBM G;  5BZB A;  3T1Y O;  2IJJ A;  3VOU A;  4DR6 B;  2GDS A;  4FM1 A;  4B7P A;  1Q82 W;  4J11 A;  4I9W A;  1K73 W;  3B27 A;  1FXV A;  4LF4 B;  2ZD9 A;  4O4I B;  3RGB A;  3E83 A;  2Y69 B;  2RCV A;  3SJB C;  1V55 C;  3N2G B;  1U96 A;  5HFM A;  2XK2 A;  5IWA B;  2YKE A;  4MPC A;  3UM7 A;  2YK2 A;  4GKK O;  2ATK C;  4JAU A;  3EXA A;  3CSX A;  3CS5 A;  4DR4 O;  2ZXW B;  4O09 A;  2Q8V A;  2F23 A;  4YKQ A;  4FM0 A;  4LWS A;  5IYC O;  2FTK A;  2IOQ A;  3O0I A;  2XJG A;  1XOU A;  3CRK A;  4K35 A;  4Q20 A;  4DXW A;  2ZE7 A;  4JI3 B;  3DC6 A;  2GUZ A;  4JI0 B;  4ZIB A;  4UB6 Z;  2CE4 A;  4X65 O;  2XCM A;  3SPJ A;  5KHK A;  4X89 A;  1VQ5 V;  4PEL A;  1B04 A;  3TZ0 A;  3RYI B;  4PRV A;  3T1C A;  3LNU A;  4NXM O;  4FMT A;  1GN4 A;  1Q3E A;  1ZL8 A;  4O2A A;  5BMV A;  5C93 A;  1KEC A;  5CB4 B;  2XD6 A;  5B3S C;  5CMU A;  4JI2 B;  1MG1 A;  2P4V A;  3Q4H B;  3B8M A;  3IAY A;  1US6 A;  2XAS A;  3SPG A;  3ZKB A;  3ZHS A;  3ZED A;  4UCU A;  1US7 A;  4EFU A;  1G8M A;  2XHX A;  1VQP V;  4WFE A;  2YI8 A;  3JAT A;  4E2L A;  4MPN A;  3A0Y A;  1FAF A;  1FFX B;  3GIG A;  1JR9 A;  1GN6 A;  2HFE C;  3P3N A;  3RYC B;  4TQD A;  4HBN A;  1YDX A;  1F51 A;  2XDL A;  3WQ9 A;  2UUC B;  4CE3 A;  2CGO A;  4ZHQ A;  3W7S A;  4WUD A;  4FIP C;  4EEQ A;  1NHI A;  3R4O A;  5CPH A;  1Q81 W;  2YXL A;  3KZI Z;  1H2K A;  4NR1 A;  2N04 A;  2YE2 A;  1JMK C;  4EMV A;  2Q8G A;  4Z2W A;  4ASG A;  1P49 A;  2FXS A;  2QR4 A;  1O9H A;  1OCO B;  2MW2 B;  2UXC B;  2Q2E B;  2O1U A;  3JD4 A;  3EHJ A;  4MVQ A;  5IN9 A;  1XMO B;  1GN2 A;  1UPG A;  3ETD A;  2UXN A;  1DF5 A;  4DV1 O;  1SS3 A;  3RKZ A;  2YJW A;  2ZM6 B;  4G27 B;  4I50 A;  5GON A;  3U11 A;  1VP7 A;  2WI7 A;  1R3J C;  4TQF A;  2HKJ A;  3W7W A;  4NKG B;  4LWS B;  2AHY A;  1HR0 B;  3CE2 A;  2ITC C;  4G28 B;  5LGU A;  1I5Y A;  3C3T A;  4L91 A;  2IBZ H;  1GAX A;  3ASN C;  2ETN A;  1YS3 A;  2GUZ B;  2XT9 A;  1ZXN A;  4DR3 B;  1CEZ A;  2NN4 A;  2UUA B;  2WLI A;  3FT5 A;  1SRY A;  2JJ2 G;  3ZCC A;  3QF7 A;  1WB7 A;  4UUJ C;  1FXK C;  2EJ7 A;  3OMA B;  4JI7 O;  4ASU G;  3U10 A;  4K0K O;  2YID A;  3CYO A;  5LP6 A;  2YE4 A;  3ZMZ A;  1YHQ V;  3DTU B;  4O2A B;  1ZL8 B;  2M7W A;  1VQO V;  3JAS B;  4RAI A;  1M56 C;  5JJN B;  3ZMT A;  5M4K A;  2AW9 A;  4PD4 F;  2R70 A;  2V4D A;  3R92 A;  2IWX A;  4MW8 A;  5M4H A;  4EFB A;  4JAV A;  2G38 A;  1K34 A;  2JS5 A;  4PDM A;  4GX1 A;  1KC8 W;  4ICG A;  3JAT B;  1KP3 A;  2QSA A;  3IC9 A;  2YI5 A;  2YGF A;  3WU2 Z;  1M57 C;  1IDS A;  4W4K A;  3PN1 A;  1AH8 A;  2WPD G;  5EIB D;  1E1R G;  1A4H A;  4UVB A;  4X66 O;  4LH7 A;  4DR1 B;  3ZMV A;  3ABL B;  3JAR B;  4TV8 A;  3FD9 A;  4QNH B;  1Q6I A;  3CCR V;  2UUB B;  2PI4 A;  2DJV A;  1E1Q G;  4ZHQ B;  2BCC H;  5FPR A;  2RN9 A;  5D7R A;  2YED A;  3SPI A;  1EBO A;  3QO5 A;  5FNV A;  3ABU A;  1KZN A;  2JGD B;  1XNR O;  5EBM C;  1R3L C;  2EIM B;  2A3Q A;  3D36 A;  1N0N A;  1X4T A;  2N05 A;  4GZR B;  1JQ0 A;  2GBO A;  3CCE V;  2P22 C;  1VF5 B;  4B3M O;  4URL A;  3A8T A;  3LSS A;  2LQT A;  2AKP A;  4GX2 A;  2HHI A;  2YE7 A;  5FL7 G;  1NT2 B;  1UFI A;  4RUE A;  4P8O A;  2HKO A;  2LJ2 A;  1I5A A;  5CTY A;  4I50 B;  4J9Z B;  5HFL A;  5GON B;  3STL C;  4MVZ A;  4LFB B;  1RSO A;  3T4D A;  1W59 A;  2VCJ A;  1N36 B;  1Y8N A;  1K4D C;  2H3O A;  2PI5 A;  5L3C A;  2F1M A;  4O04 A;  3M7M X;  4I7Z B;  4CC5 A;  1OV9 A;  2OCH A;  3RLQ A;  4B08 A;  3CX5 F;  3HKE A;  4DUZ B;  1J95 A;  5FPO A;  3K5M A;  2VCI A;  3HYZ A;  3ASO C;  2XAQ A;  2ZR3 A;  2P90 A;  1FYJ A;  4CWF A;  3CCV V;  1SQX H;  2E5L O;  4XKA A;  5B1B B;  1CP9 A;  5LP6 B;  1EZJ A;  4I0X A;  2DW4 A;  4FLZ A;  4RUF A;  2H94 A;  4DO2 A;  4QGP A;  3R91 A;  3JD1 A;  1R3I C;  2HVJ C;  3NR7 A;  4DRX A;  4F6E A;  4HYM A;  2A0L A;  3CYG A;  3FV5 A;  1Z5W A;  2YEG A;  3RWR D;  2IWS A;  3B2E E;  1GO3 F;  1N0J A;  3SYA A;  1D5A A;  4UB8 Z;  1KB9 F;  5ITZ A;  3ABK C;  1L0L H;  2EIL C;  2ADQ B;  2UWD A;  3Q5L A;  3U2K A;  1QZR A;  3HZ5 A;  3MAQ A;  4DV4 B;  2QFO A;  1JX9 A;  1NH2 D;  3ABT A;  2L6L A;  2UXD B;  4EGH A;  3R4M A;  4TT3 G;  3SYQ A;  3E86 A;  1J5E O;  2QEX V;  3HPL C;  2KQX A;  4OX9 B;  4TV8 B;  4FZ1 A;  2BT0 A;  1TIL A;  4X1I A;  4FJC C;  2EBO A;  2Q5Z A;  2E76 B;  3QO7 A;  5J9P C;  1GKX A;  3CCJ V;  1UYM A;  5DN6 G;  4DV6 B;  4K8X A;  3QTF A;  2WI5 A;  5FNV B;  2VS0 A;  3G67 A;  3DC5 A;  3OTO O;  1HNZ B;  1YSZ A;  1ENV A;  4EM7 A;  1S3J A;  4X20 A;  5CTW A;  1B3Q A;  2CGN A;  3CRR A;  5DED A;  4LBE C;  3K57 A;  3L73 H;  4XKK A;  4TSF G;  3RT3 C;  1XRE A;  1ZSP A;  4E01 A;  4WFF A;  5B1A B;  1OZ0 A;  1AI6 A;  3B8N A;  1PNK A;  1NTM H;  4PA7 A;  4EGK A;  1HNX B;  2DYR B;  4RQE A;  3SGI A;  1AI7 A;  3CCQ V;  1AJN A;  4YKY A;  3FB6 C;  4B3T O;  1BXD A;  5F5R A;  1ZXM A;  1MAB G;  4LF6 B;  3CRQ A;  2XX2 A;  1JJO A;  4LC1 A;  1H2M A;  2JEX A;  3H4L A;  4HYP A;  1V55 B;  1Q6H A;  3AG2 C;  3INW A;  5IY5 C;  1UY7 A;  1URF A;  2P7T C;  1RSO B;  1SZT A;  3L74 H;  3TXQ A;  4DV5 B;  1S5L Z;  4JI6 O;  2XX5 A;  4CH5 A;  1WP7 A;  2P5O A;  3S5T A;  5LMN O;  3ABM C;  5EBL C;  4KXR A;  3K5L A;  4GT1 A;  3HKE B;  3A0X A;  1N4C A;  1ZWI C;  2LW1 A;  4RQF A;  5KAF Z;  4KFM A;  3C11 A;  4ASB A;  4YHH O;  2DYS C;  1MX0 A;  1BS3 A;  2OT5 A;  1GM7 A;  3K9A A;  3CRL A;  3U67 A;  4CS3 A;  1QHT A;  3RVY A;  3MDS A;  1QR8 A;  3CB2 A;  3CRM A;  4I0X B;  1FXK A;  1K5Q A;  3CWV A;  1Y76 A;  4GLX A;  1B06 A;  1FD9 A;  4DRX B;  2YE3 A;  4DW0 A;  5IYB O;  1HW7 A;  5B3S B;  2HVK C;  4XD8 A;  4WFB V;  2ZT9 B;  4L87 A;  4H44 B;  4JV5 B;  4H85 A;  5LA6 A;  2WER A;  5ITZ B;  2H8P C;  4ZBM A;  1YES A;  5J2T A;  2ZDY A;  4EGI A;  1YCI A;  3ETE A;  4HZ0 A;  1GJV A;  1SER A;  1M90 W;  2RJZ A;  5BOC A;  2XJJ A;  1UYF A;  1ZW9 A;  4NVP A;  4UCT A;  2IOR A;  3J7A U;  1B63 A;  1XHZ A;  3LMM A;  4B3R O;  3C90 A;  3I5D A;  5KUM A;  3G75 A;  2A9H A;  2OTL V;  4V25 A;  4X1I B;  1R3K C;  5BR8 O;  1N34 O;  1M93 A;  2YGE A;  2D2C B;  3D3Q A;  1EN4 A;  2HR3 A;  1YIT V;  1F4M A;  2LGW A;  5CA0 A;  1GRJ A;  3OAA G;  4QIW F;  1VQM V;  1I59 A;  1PPJ H;  5D7C A;  5M4M A;  1XL4 A;  2CCS A;  4FZ0 A;  5LOV A;  3ZXO A;  4C7U A;  3GWO A;  4FFK A;  1KU9 A;  4LFC O;  3QDD A;  3FYI B;  1B6Q A;  4YXW G;  2ZKJ A;  5KHJ A;  2PZS A;  2XHT A;  2KKW A;  2PYJ A;  4XDK A;  1NU1 H;  1QLE B;  2EX3 A;  1MZE A;  3ZMS A;  4LF7 B;  3W7T A;  1K5S A;  3HR0 A;  3OW2 U;  2C1I A;  1AP6 A;  1VEW A;  4IYI A;  1Z59 A;  1NTZ H;  2YEJ A;  1YC3 A;  4P2Z A;  1KUQ A;  3LPS A;  4CWQ A;  1XUQ A;  2YKI A;  4UFZ A;  3S3X A;  3THO A;  3A0T A;  4Q6G A;  4BQJ A;  3SJQ C;  4J41 A;  3JCU Z;  4CWP A;  1QVG U;  4J7Z A;  1Y8O A;  1BYQ A;  3BAA A;  2XDK A;  4FVM A;  4DUH A;  1TID A;  2CTR A;  1O9G A;  4DR6 O;  1I5B A;  3L9D A;  5KHG A;  3ZHV A;  1S76 D;  4IT5 A;  4LF4 O;  3JSL A;  3QTC A;  1PVG A;  2GTA A;  4LF8 B;  2YIC A;  2YJX A;  4CH6 A;  4X64 B;  4OXS A;  1FXK B;  5IWA O;  3EFF K;  3EHB B;  3FB8 C;  4XCJ A;  4ZI7 A;  4JI1 B;  2YDE A;  3NXS A;  1WNS A;  4H0L B;  2YC0 A;  4IIJ A;  2FKX A;  3JAW A;  5BXZ A;  3RYC A;  1M56 B;  2PTM A;  2PGG A;  3O6O A;  2UXB B;  3ZRW A;  2YE8 A;  5LA6 B;  4MW3 A;  4DV2 B;  2VWJ A;  1TVK A;  1LUW A;  4HYO A;  4JI0 O;  1I94 B;  5J2T B;  2PF4 E;  2IOP A;  1EI1 A;  4X9L A;  4NH9 A;  3E8F A;  1QU7 A;  2BYH A;  5LGT A;  3QO8 A;  2W6J G;  3HZ1 A;  3BCC H;  4UCR A;  4DV7 B;  2B1I A;  2CH4 A;  4H13 B;  2D3O W;  2IJI A;  1M57 B;  3U2D A;  2OYQ A;  2P67 A;  1K4C C;  4JI2 O;  4BIU A;  2NLJ C;  1G1X B;  2LFS A;  1BCC H;  1TH8 A;  4MVR A;  1YET A;  1YVW A;  2C2A A;  3CHX A;  1IX9 A;  4DV0 B;  4DYL A;  3UT5 A;  5CA0 B;  5IJ0 A;  3JYC A;  4P7A A;  4ZOL A;  5LOV B;  4JYA O;  3X2Q C;  2A06 H;  1PD3 A;  1GM9 A;  4FLU A;  3R4P A;  1THN A;  2VRZ A;  3AG4 C;  5E1A C;  4UXN A;  4I55 A;  2YIB A;  1K7D A;  5JVD A;  2YI6 A;  3OUF A;  3T2S A;  1F4N A;  2XX4 A;  3FKS G;  1RPO A;  2UUC O;  2ZIO A;  5GTI Z;  2NR5 A;  4CZZ A;  4MP2 A;  4J10 A;  2EXL A;  2Q67 A;  3JAS A;  4CH3 A;  2IJH A;  3RFR A;  1DK1 A;  5CF0 A;  2CUG A;  3CXC U;  1S77 D;  2WLN A;  2YUA A;  3QVN A;  4ASA A;  4XDJ A;  1RM1 C;  3K0G A;  1YIJ V;  1GKF A;  4D6T H;  3WG7 C;  5L3G A;  4F4L A;  1F7Y A;  1XMO O;  4R3M A;  4FCR A;  3ASO B;  2AXT Z;  1WA8 A;  2DN9 A;  3G7E A;  2O57 A;  3W7U A;  4YIP A;  5K1P A;  3LNN A;  2YI0 A;  3EKO A;  3H1H H;  4ZI7 B;  1THZ A;  2ZM6 O;  1VF6 C;  2XAG A;  3ZHU A;  4IIJ B;  1Z5C A;  3JAW B;  4GKK B;  1Q8I A;  2O1W A;  1KMI Z;  4MTX A;  2GSM B;  3JAR A;  1YI2 V;  1XBL A;  3ZMU A;  1HR0 O;  4OPH A;  3ZRW B;  5IE9 A;  4PI2 A;  1TVK B;  1XNQ O;  1W2B U;  3FYE B;  3GVM A;  2IH1 C;  4DR3 O;  1ZAU A;  4XIT A;  3ABK B;  2EIL B;  2UUA O;  1SC5 B;  2JGD A;  4IGG A;  3ZIA G;  1GH6 A;  2ZR2 A;  5EBW C;  3B24 A;  2RQ6 A;  4NTW A;  1M4U A;  4QE7 A;  2JS3 A;  4YKW A;  1L8D A;  1QLE C;  4TV9 A;  2ZKO A;  3D0B A;  3JAK A;  1NH2 B;  1R6T A;  3O2F A;  4E00 A;  5LHG A;  2E3C A;  3TXS A;  2UXX A;  1FS0 G;  3UT5 B;  4FM2 A;  5IJ0 B;  2DQ3 A;  2DQ0 A;  2R9A A;  3A2F A;  1PKX A;  1SQF A;  4D7T A;  2IW5 A;  2VQF B;  4ZOL B;  4H81 A;  2IWU A;  4FLV A;  1M5I A;  1K97 A;  2ZNJ A;  1NR1 A;  4EKW A;  2QWR B;  3AG7 A;  2YKB A;  4UVC A;  5L3D A;  2P4K A;  4H7Q A;  2XHB A;  1W0J G;  4I55 B;  2Y0P A;  3IGA C;  2YKC A;  4URM A;  1P7B A;  5JVD B;  4LH6 A;  4CE1 A;  2BTQ A;  5CBG A;  4BW5 A;  2UUB O;  3TCU A;  4JAA A;  1BZK A;  4J9Y B;  1BHB A;  3C0E A;  4LWE A;  4LWF A;  2YEI A;  3EKR A;  3CC7 V;  1SQQ H;  4KHP O;  3OD4 A;  3AG2 B;  4FFB A;  5IY5 B;  1N8R W;  1L0O A;  2R9I A;  4CS4 A;  5LYJ B;  4PL9 A;  3L71 H;  1FFT B;  1BE3 H;  2B9Z A;  1CXZ B;  1IBM B;  4ZVI A;  5KMG A;  1VQN V;  5IYZ B;  4R8C A;  3ABM B;  4ASF A;  4PRX A;  5F2V O;  2DWD C;  1SET A;  2Y0I A;  1PL0 A;  2CTP A;  4LNU B;  2BU5 A;  1SZX A;  4PHZ A;  4DR2 B;  1L0N H;  1WA8 B;  4UV8 A;  3ZRV A;  2DYS B;  3R65 A;  2YS8 A;  4J42 A;  1EA6 A;  4LWG A;  2DMX A;  2OIG A;  5DEC A;  4MP7 A;  3G7B A;  3GWK C;  3CME V;  5F3K A;  2VW5 A;  4K8Z A;  4WUC A;  4R50 A;  2QE7 G;  4DUY B;  4KP4 A;  1NJI W;  4NXN O;  4X1K A;  4DV1 B;  2EIJ C;  4JYB A;  2QDO A;  1N36 O;  3J81 N;  3JD2 A;  2DE0 X;  3VHD A;  1YJ9 V;  2AGA A;  5JJJ B;  4YY3 B;  1YEW A;  3CCL V;  2PNR A;  3K5O A;  2YI7 A;  1HP8 A;  4DUZ O;  2GHY A;  2HLD G;  2E0A A;  4FLT A;  4XIQ A;  4H33 A;  3P3P A;  4BAE A;  4FLY A;  2GFD A;  4ZKI A;  2QKA A;  4E02 A;  1Y4M A;  3SPH A;  2X7R B;  1F23 A;  2CTQ A;  2WLK A;  2XAH A;  3SJA C;  5AG2 A;  1DGS A;  1VQL V;  2QTS A;  3L75 H;  4K0K B;  2Q69 A;  2JVD A;  4MTF A;  3CCU V;  4TV9 B;  1Q7Y W;  2Z0A A;  2ZE5 A;  3K9S A;  3JAK B;  3OGC C;  1SF9 A;  1FXH A;  1X59 A;  3ETG A;  2YK9 A;  1I58 A;  2CCT A;  4U7N A;  1UYG A;  4TOI A;  3G71 V;  3E8H A;  5CBH A;  2HHH B;  2QWN B;  1Z5V A;  3LSU A;  4LFA B;  3ZKD A;  1FKA O;  3JSN A;  4DV4 O;  3N27 A;  4WBN A;  5D6Q A;  3CC2 V;  5JCO C;  4R7C A;  4P9O A;  1N32 B;  2BTQ B;  4DW1 A;  2QJ1 A;  2W0F C;  2ZE6 A;  2K1E A;  1QVF U;  1BQZ A;  4X66 B;  4DR5 O;  3U0Z A;  1XMQ B;  4XKO A;  4L90 A;  3Q5K A;  1RPR A;  4FFB B;  3AG1 C;  1SQV H;  2BRE A;  3E22 A;  3W7X A;  1XQ8 A;  4XE2 A;  3BA8 A;  2WLJ A;  5KMG B;  4WFH A;  3PEH A;  3B26 A;  1Y4S A;  1XHX A;  5BOD A;  1SA0 B;  5B1N A;  2XUM A;  3GIF A;  5JQG A;  4URO A;  2QM8 A;  1I7F A;  5FND A;  5IYD O;  4LF6 O;  3R4N A;  1D2D A;  1MMM A;  3ETQ A;  3A0R A;  1WN7 A;  1I08 A;  1TUB A;  2WEP A;  3TZ2 A;  3APQ A;  4FPP A;  5FLX N;  4LCU C;  4HY1 A;  2OTJ V;  4X1K B;  1VF6 A;  4QE9 A;  1FJG B;  1UYI A;  4O2B A;  3F7V C;  1SQB H;  2WA3 A;  1IVS A;  3VQV A;  4JGS A;  5J71 A;  2Q8F A;  3HEK A;  3HKB A;  5CN0 A;  3OW6 A;  3SYP A;  5IJ9 A;  2PY5 A;  3TK1 A;  2YXH A;  3UCS C;  2AHZ A;  3INX A;  3O9O A;  5KX5 A;  1ID0 A;  4O4J A;  2YEE A;  3TTZ A;  2EIK C;  2YIB D;  3CP1 A;  1GTO A;  4J7K A;  4HAM A;  4IYH A;  1DLB A;  2QWP B;  3HYY A;  1ZX3 A;  4JI4 B;  4AQY B;  3OEE G;  1ZLZ A;  2E5L B;  2F93 B;  3VQX A;  5E79 Z;  4UV9 A;  5EC2 C;  1NVP D;  3K08 A;  4K3A A;  1SKV A;  2HP8 A;  2P6J A;  3TET A;  3H1L H;  4JV5 O;  4AWP A;  4MS2 A;  5L3B A;  4JYY A;  4PA9 A;  3F7Y C;  2F66 C;  3DXR A;  4TUY A;  1MSD A;  3ZX6 A;  2XAJ A;  3TUH A;  3RYF A;  4WBN B;  2PYL A;  2X6A A;  1E79 G;  3N2K A;  3X2Q B;  1TGO A;  4PDL A;  1YSC A;  3WHA A;  3AG4 B;  2YIA A;  3VAD A;  2F95 B;  4JI5 B;  2XJX A;  1VQ4 V;  1JVM A;  3FFQ A;  4TWK A;  2Q0A A;  3H80 A;  2C1G A;  3K79 A;  5IDJ A;  1N33 O;  4NYK A;  4XTJ A;  2WSS G;  3E22 B;  1B62 A;  3IED A;  2ZIM A;  4KTN A;  2BTZ A;  1DF4 A;  4CWO A;  1IBL B;  5LHH A;  4HNA A;  5EC1 C;  2DOS A;  4BIZ A;  1DTO A;  4I5S A;  4URN A;  2YEH A;  1BQ0 A;  5JQG B;  1RM1 B;  2BU8 A;  3K97 A;  1OCC C;  1AB3 A;  1YC1 A;  2BU6 A;  5CA1 B;  3OE7 G;  1R6N A;  4FK5 C;  4O4H A;  2YE5 A;  4KUM A;  3BA9 A;  3WG7 B;  3NMQ A;  1L1F A;  1AI5 A;  3L70 H;  1YF2 A;  2YEF A;  2ITD C;  4LF7 O;  3DSQ A;  4NH8 A;  4B3T B;  4I4T A;  3I56 V;  4AS9 A;  3R66 A;  1TUB B;  3H01 A;  4LF9 B;  1AJP A;  3CCS V;  1UY6 A;  3Q5J A;  4X62 O;  1KP2 A;  3TGU H;  4GFN A;  4O2B B;  5LMU B;  1QYE A;  2JJ1 G;  5CTU A;  3MNR P;  5CBF A;  5B5E Z;  2Y4U A;  1S14 A;  3HKB B;  4D7S A;  1GM8 A;  5BY1 A;  5IJ9 B;  4B3S O;  4LF5 B;  5B1O A;  1LNQ A;  3H1I H;  3FX7 A;  4X1Y A;  5KX5 B;  3BVO A;  4O4J B;  3ZJZ A;  2Y48 A;  5LMN B;  1HNW O;  3FT8 A;  1EN5 A;  1M9N A;  3OFN G;  3KE6 A;  3BY6 A;  4LF8 O;  4BIO A;  1EM1 A;  4GGL A;  1Y66 A;  4WF9 V;  4XDL A;  1EN6 A;  4JI1 O;  3T10 A;  3K5N A;  1PNM A;  2FYU H;  3E8G A;  5JWP A;  4MT8 A;  4X9Q A;  1RFY A;  1NHH A;  1UYC A;  2WI2 A;  3LDD A;  4HZ5 A;  2Q7H A;  1XIL A;  3F5T A;  3OWB A;  2UXB O;  3D2R A;  5LGN A;  2Q6A A;  3ZRS A;  1YTF B;  4HXZ A;  1CPY A;  4FLW A;  1I94 O;  2EZO A;  3DXR B;  2VQE B;  1K33 A;  4TUY B;  4QPK A;  4R1F A;  4GKJ B;  4JI8 O;  2ADP A;  1BMF G;  3OMU A;  2EUL A;  4LWI A;  5L3E A;  2YEV A;  3RYF B;  3UKM A;  1Y6X A;  1QY8 A;  3B09 A;  3LNM B;  3H1J H;  3JAM N;  4DV7 O;  2ESA A;  3ZXQ A;  4GEE A;  3N2K B;  1KBH A;  5EK0 A;  4AIL C;  2BOB C;  2JJC A;  5JCO A;  3S3W A;  1ORQ C;  3L72 H;  4XCL A;  1Q90 D;  4LWH A;  4PJ0 Z;  1G6U A;  2WAM A;  2FYP A;  1H2S B;  2BSM A;  3T0Z A;  2R9R B;  1IBK B;  4DV0 O;  3ZM7 A;  2IJK A;  1H38 A;  2Q9L A;  3B25 A;  2HJF C;  5D5P A;  3SDL A;  1Q86 W;  4HNA B;  1VQ8 V;  3BPZ A;  2W0X A;  2YEA A;  1U0Z A;  2JIZ G;  4MSW C;  1K8A W;  1UYE A;  1AR4 A;  2VWK A;  4GQT A;  4JI3 O;  4IL6 Z;  1JM6 A;  1JPX A;  3VHC A;  4O4H B;  2HCH A;  3JAL A;  5IDM A;  1IXM A;  2EIN C;  3E2E A;  3AEI A;  4DV3 B;  4L8Z A;  4DR7 B;  4I4T B;  4E4E A;  5L3J A;  4AWO A;  3MHH C;  3T1H B;  1BHA A;  2MK3 A;  1V54 C;  2EIJ B;  5K1X A;  2X0L A;  2WI1 A;  4EEH A;  3CGY A;  1QBZ A;  3HB3 B;  2CDY A;  2YKJ A;  5FNC A;  4X1Y B;  4I9Q A;  1PM9 A;  2IU0 A;  4Z1M G;  3A0H Z;  1TC6 A;  3PEJ A;  4PDR A;  2V7Q G;  2QF6 A;  4EFE A;  4UVA A;  1PL4 A;  2Q8I A;  1OHH G;  2JGU A;  2YSU B;  1KKD A;  2VWC A;  2XAF A;  3T4Z A;  3CD6 V;  2UU9 B;  2KB1 A;  3WB0 A;  3K58 A;  1JCH A;  5JH7 B;  4N21 A;  2BTO A;  4RWU A;  3LDE A;  3BHP A;  5J2U A;  4FCP A;  2BE3 A;  2RNB A;  2O1V A;  1SQP H;  2OWO A;  1QNM A;  3RW0 A;  3QNE A;  4WFA V;  5A9G A;  1UYD A;  4GX0 A;  3UO2 A;  4MOT A;  2F4V B;  2CG9 A;  2YEV B;  3B77 A;  1UJW B;  2QG2 A;  2WEQ A;  5LYJ A;  1YSR A;  1VQ6 V;  2QGN A;  4ABM A;  3AK2 A;  2E74 B;  5IYZ A;  3CWB H;  4YIO A;  2UXC O;  2HG1 A;  1JOY A;  2ZBK B;  3CJH A;  4LNU A;  5B66 Z;  4IHJ A;  1MOF A;  3T1Y B;  3ZHT A;  1JFF A;  1R73 A;  5EYP A;  4A5U B;  3HKC A;  4JQL A;  4XIP A;  2ZDI C;  2K5B A;  2WI6 A;  1VMG A;  2WI4 A;  3AG1 B;  3ZN1 A;  3CC4 V;  4PI0 A;  4X88 A;  4YJ2 A;  2VQF O;  1WLE A;  4DR4 B;  2ZQM A;  2Q7E A;  1UYK A;  4KSH A;  3T2M A;  4MB9 A;  4NH7 A;  3VQW A;  1BKN A;  4PU9 A;  2XOK G;  1JJ2 U;  4JYA B;  1HWY A;  3JAL B;  4LP0 A;  4EB6 A;  4GT8 A;  4GUN A;  5LXT B;  1ZWH A;  1RP3 B;  2FWY A;  5M4P A;  4N23 A;  1AR1 B;  4YKX A;  4X65 B;  4MVO A;  3T0H A;  1YTF D;  1S16 A;  3HHU A;  1QCE A;  3OWD A;  1H8E G;  5L3F A;  2B5U A;  1AIL A;  5KA5 A;  1NS1 A;  1JA8 A;  4XC0 A;  1VIB A;  3K06 A;  3LSQ A;  4NXM B;  1IBM O;  1ARO P;  2QG0 A;  2BSK A;  4O4L A;  2WLH A;  3CXH F;  5H5N A;  4CC6 A;  4JZG A;  1IXB A;  1HDJ A;  1KIJ A;  3EVK A;  2P06 A; 
#chains in the Genus database with same CATH homology
 2EIK B;  2IU3 A;  5KUK A;  3RBZ A;  1R62 A;  4BAY A;  1KQS U;  4O0B A;  3M99 B;  3OR6 C;  2XDX A;  3WFV A;  2CK3 G;  3CMA V;  1YJN V;  4W7T A;  1H7U A;  3K99 A;  4BXI A;  2H55 A;  3K3W A;  3OPD A;  2IH3 C;  1NVP B;  3FB7 C;  5D6P A;  1S72 V;  3AG3 B;  1K92 A;  4KQV A;  4MTO A;  3GB7 C;  1OCZ B;  3LDC A;  3ML0 A;  3CPW U;  5GGZ A;  2BU7 A;  1GKZ A;  1I5D A;  1AMW A;  5GW7 A;  3IFX A;  4PDV A;  3VHA A;  1NHJ A;  4V26 A;  4PA3 A;  1PNL A;  3CCM V;  4H37 A;  1YT1 A;  3JCZ A;  3EHF A;  3F5W C;  1ROP A;  2W6I G;  4P9P A;  3SPC A;  1OCC B;  4MTG A;  3GIG B;  1UYL A;  3K04 A;  3BEH A;  1R6K A;  4B6C A;  4YKR A;  4RO2 A;  2X6B A;  2Y69 C;  3E35 A;  2A79 B;  5LHI A;  4U93 A;  4YKU A;  3OEH G;  5FNF A;  3FB5 C;  4XDM A;  4WFG A;  3P30 A;  1YT2 A;  2ZXW C;  1TBW A;  1VQK V;  3A0W A;  2BYI A;  3D3I A;  1COW G;  3IC7 A;  3JZ3 A;  2GQP A;  4JTA B;  4QPJ A;  4YKZ A;  1OCR B;  1AH6 A;  1XL6 A;  1YC4 A;  1W0K G;  3OMI B;  3K0D A;  2XHR A;  1GMG A;  2F43 G;  3BMY A;  4MVM A;  5FWK A;  4JYC A;  2YEB A;  3SYO A;  4R3A A;  4MVS A;  1BGQ A;  1AJ6 A;  4HZ3 A;  3DGE A;  1VQ9 V;  4G2K A;  1Z5A A;  4O07 A;  1QR9 A;  4MPE A;  1NKD A;  2BOC C;  2WLI B;  1I5C A;  2Z3Y A;  2WLL A;  1AI4 A;  3E8B A;  4CBC A;  5M4E A;  1NQT A;  2WI3 A;  2Q68 A;  5D7D A;  2ZDI A;  2JK5 C;  4MBC A;  2QKS A;  3E89 A;  4CWT A;  4CWS A;  1NR7 A;  4L93 A;  2OCC B;  4KSG A;  4P30 A;  1KD1 W;  5H9C A;  5H6Q A;  4X8A A;  2CGF A;  1OCO C;  2EIN B;  4CWR A;  4QJF B;  1YJW V;  1K3E A;  4GX5 A;  2V1D A;  5CA3 A;  1V54 B;  2LP7 A;  1P4R A;  2JEU A;  3JD3 A;  3K03 A;  4R6Z A;  1WPX A;  3AG3 C;  3B28 A;  4AWQ A;  2YGA A;  1OCZ C;  2ZDX A;  2YE9 A;  1H2G A;  3T1K A;  3RVZ A;  1M1K W;  5H6R A;  4YKT A;  4WUB A;  1U2O A;  4XBF A;  2BRC A;  5J6A A;  1MSW D;  3PJS K;  4DZY A;  1OSF A;  2HG5 C;  5M4N A;  4HXW A;  2WLL B;  3EHH A;  2CCU A;  3KG2 A;  2QM7 A;  1QLN A;  1UY8 A;  4CWN A;  3JD0 A;  4GCZ A;  1GK9 A;  2EZP A;  3SYC A;  3ABL C;  4K4O A;  3TZ4 A;  4HY6 A;  1UY9 A;  2WWW A;  2Q8H A;  4JF3 A;  2DWE C;  1TUE B;  4KFG A;  2EIM C;  3VBB A;  2BZ5 A;  2XDU A;  4L94 A;  2FWZ A;  2XAB A;  3LUT B;  2QTO A;  3A0Z A;  3ZRX A;  1UYH A;  1K9M W;  5KA6 A;  1OCR C;  1BL8 A;  4PA6 A;  3RLP A;  4LPB A;  1Z5B A;  2XND G;  1VQ7 V;  3BM9 A;  1TC0 A;  2YE6 A;  3CGZ A;  2EJR A;  4JAS A;  1I5X A;  3OM3 B;  4BQG A;  3GIE A;  4WCE V;  4I3H A;  2H8M A;  4EFT A;  4JPR A;  4CE2 A;  4JTC B;  2Z5U A;  1S5H C;  3TZ5 A;  3P32 A;  3SL2 A;  5B1B C;  5CTX A;  2X6C A;  4U7O A;  1AJQ A;  4MVU A;  3I55 V;  3K98 A;  3G6E V;  2YEC A;  3OMN B;  1Y8P A;  2NNU A;  3OR7 C;  4JTD B;  4PA4 A;  5LBQ A;  3MD0 A;  3EHG A;  4XIR A;  1SES A;  3ZN0 A;  3ASN B;  3K60 A;  2JKI A;  1S0V A;  2OCC C;  3RLR A;  3G4S V;  2LFR A;  1H7S A;  2BU2 A;  4O05 A;  5DM6 V;  4FCQ A;  4LP8 A;  1YER A;  3OUS A;  1G4Y B;  2JDI G;  3MHS C;  2XDS A;  2QA4 V;  1Y4U A;  1YT0 A;  1H8H G;  2B1G A;  1EFR G;  1MU5 A;  2WLM A;  5B1A C;  1AM1 A;  2DYR C;  3STZ C;  1NBM G;  5BZB A;  2IJJ A;  3VOU A;  4B7P A;  1Q82 W;  4I9W A;  1K73 W;  3B27 A;  1FXV A;  2ZD9 A;  3E83 A;  2Y69 B;  1V55 C;  5HFM A;  2XK2 A;  2YKE A;  4MPC A;  3UM7 A;  2YK2 A;  2ATK C;  4JAU A;  2ZXW B;  4O09 A;  4YKQ A;  5IYC O;  2FTK A;  2IOQ A;  3O0I A;  2XJG A;  3CRK A;  4Q20 A;  4DXW A;  2XCM A;  3SPJ A;  4X89 A;  1VQ5 V;  4PEL A;  3TZ0 A;  4PRV A;  3T1C A;  3LNU A;  4FMT A;  5C93 A;  1KEC A;  2XD6 A;  5B3S C;  5CMU A;  1MG1 A;  3B8M A;  2XAS A;  3SPG A;  3ZKB A;  1US7 A;  4EFU A;  1G8M A;  2XHX A;  1VQP V;  4WFE A;  4E2L A;  4MPN A;  3A0Y A;  3GIG A;  2HFE C;  1F51 A;  2XDL A;  3WQ9 A;  4CE3 A;  3W7S A;  4WUD A;  4FIP C;  1NHI A;  3R4O A;  5CPH A;  1Q81 W;  2YE2 A;  4EMV A;  2Q8G A;  4ASG A;  2FXS A;  1OCO B;  2Q2E B;  2O1U A;  3JD4 A;  3EHJ A;  4MVQ A;  5IN9 A;  3ETD A;  2UXN A;  1DF5 A;  3RKZ A;  2YJW A;  4G27 B;  2WI7 A;  1R3J C;  2HKJ A;  3W7W A;  2AHY A;  2ITC C;  4G28 B;  5LGU A;  1I5Y A;  4L91 A;  3ASN C;  1YS3 A;  1ZXN A;  1CEZ A;  2WLI A;  3FT5 A;  1SRY A;  2JJ2 G;  3ZCC A;  4UUJ C;  1FXK C;  3OMA B;  4ASU G;  3CYO A;  2YE4 A;  3ZMZ A;  1YHQ V;  3DTU B;  2M7W A;  1VQO V;  4RAI A;  1M56 C;  3ZMT A;  5M4K A;  3R92 A;  2IWX A;  4MW8 A;  5M4H A;  4JAV A;  1K34 A;  4PDM A;  4GX1 A;  1KC8 W;  1KP3 A;  2YI5 A;  2YGF A;  1M57 C;  1AH8 A;  2WPD G;  1E1R G;  1A4H A;  4UVB A;  3ZMV A;  3ABL B;  4QNH B;  2PI4 A;  3CCR V;  1E1Q G;  5D7R A;  2YED A;  3SPI A;  1EBO A;  3QO5 A;  3ABU A;  1KZN A;  5EBM C;  1R3L C;  2EIM B;  3D36 A;  1JQ0 A;  3CCE V;  4URL A;  3LSS A;  2AKP A;  4GX2 A;  2YE7 A;  5FL7 G;  4RUE A;  4P8O A;  2HKO A;  1I5A A;  5CTY A;  4J9Z B;  5HFL A;  3STL C;  4MVZ A;  3T4D A;  2VCJ A;  1Y8N A;  1K4D C;  2PI5 A;  5L3C A;  4O04 A;  3RLQ A;  1J95 A;  2VCI A;  3HYZ A;  3ASO C;  2XAQ A;  2ZR3 A;  2P90 A;  4CWF A;  3CCV V;  4XKA A;  5B1B B;  1CP9 A;  1EZJ A;  2DW4 A;  4RUF A;  2H94 A;  4DO2 A;  3R91 A;  3JD1 A;  1R3I C;  2HVJ C;  4HYM A;  2A0L A;  3FV5 A;  2YEG A;  2IWS A;  1GO3 F;  3SYA A;  3ABK C;  2EIL C;  2UWD A;  3Q5L A;  3U2K A;  1QZR A;  3HZ5 A;  2QFO A;  1JX9 A;  1NH2 D;  3ABT A;  4EGH A;  3R4M A;  4TT3 G;  3SYQ A;  3E86 A;  2QEX V;  3HPL C;  2BT0 A;  1TIL A;  4FJC C;  2EBO A;  3QO7 A;  5J9P C;  1GKX A;  3CCJ V;  1UYM A;  5DN6 G;  3QTF A;  2WI5 A;  1YSZ A;  1ENV A;  4EM7 A;  1S3J A;  5CTW A;  1B3Q A;  4LBE C;  4XKK A;  4TSF G;  4E01 A;  4WFF A;  5B1A B;  1OZ0 A;  1AI6 A;  3B8N A;  1PNK A;  4PA7 A;  4EGK A;  2DYR B;  4RQE A;  1AI7 A;  3CCQ V;  1AJN A;  4YKY A;  3FB6 C;  1BXD A;  5F5R A;  1ZXM A;  1MAB G;  2XX2 A;  4LC1 A;  2JEX A;  3H4L A;  4HYP A;  1V55 B;  3AG2 C;  3INW A;  5IY5 C;  1UY7 A;  2P7T C;  1SZT A;  2XX5 A;  3ABM C;  5EBL C;  4GT1 A;  3A0X A;  1ZWI C;  4RQF A;  4KFM A;  3C11 A;  4ASB A;  2DYS C;  1MX0 A;  2OT5 A;  1GM7 A;  3K9A A;  3CRL A;  3U67 A;  3RVY A;  1QR8 A;  1FXK A;  1K5Q A;  3CWV A;  2YE3 A;  5IYB O;  5B3S B;  2HVK C;  4XD8 A;  4WFB V;  4L87 A;  4H85 A;  2WER A;  2H8P C;  4ZBM A;  1YES A;  2ZDY A;  4EGI A;  3ETE A;  4HZ0 A;  1GJV A;  1SER A;  1M90 W;  5BOC A;  2XJJ A;  1UYF A;  1ZW9 A;  2IOR A;  1B63 A;  5KUM A;  3G75 A;  2A9H A;  2OTL V;  4V25 A;  1R3K C;  2YGE A;  2HR3 A;  1YIT V;  1F4M A;  3OAA G;  4QIW F;  1VQM V;  1I59 A;  5D7C A;  5M4M A;  1XL4 A;  2CCS A;  3ZXO A;  3GWO A;  3QDD A;  3FYI B;  1B6Q A;  4YXW G;  2ZKJ A;  2XHT A;  4XDK A;  1QLE B;  3ZMS A;  3W7T A;  1K5S A;  3OW2 U;  1Z59 A;  2YEJ A;  1YC3 A;  4P2Z A;  3LPS A;  4CWQ A;  2YKI A;  3A0T A;  4BQJ A;  3SJQ C;  4CWP A;  1QVG U;  1Y8O A;  1BYQ A;  2XDK A;  4DUH A;  1TID A;  1I5B A;  1S76 D;  1PVG A;  2YJX A;  4OXS A;  1FXK B;  3EFF K;  3EHB B;  3FB8 C;  4XCJ A;  3NXS A;  1M56 B;  3O6O A;  3ZRW A;  2YE8 A;  4MW3 A;  4HYO A;  2IOP A;  1EI1 A;  4X9L A;  4NH9 A;  3E8F A;  2BYH A;  5LGT A;  3QO8 A;  2W6J G;  3HZ1 A;  2B1I A;  2CH4 A;  2D3O W;  2IJI A;  1M57 B;  3U2D A;  2P67 A;  1K4C C;  4BIU A;  2NLJ C;  2LFS A;  1TH8 A;  4MVR A;  1YET A;  2C2A A;  3JYC A;  4P7A A;  3X2Q C;  1PD3 A;  1GM9 A;  3R4P A;  1THN A;  3AG4 C;  5E1A C;  4UXN A;  1K7D A;  2YI6 A;  3OUF A;  3T2S A;  1F4N A;  2XX4 A;  3FKS G;  1RPO A;  4CZZ A;  4MP2 A;  2EXL A;  2Q67 A;  2IJH A;  5CF0 A;  3CXC U;  1S77 D;  2WLN A;  4ASA A;  4XDJ A;  1RM1 C;  3K0G A;  1YIJ V;  1GKF A;  3WG7 C;  5L3G A;  4F4L A;  4R3M A;  4FCR A;  3ASO B;  3G7E A;  3W7U A;  2YI0 A;  3EKO A;  1THZ A;  2XAG A;  1Z5C A;  2O1W A;  4MTX A;  2GSM B;  1YI2 V;  3ZMU A;  3ZRW B;  1W2B U;  3FYE B;  2IH1 C;  4XIT A;  3ABK B;  2EIL B;  3ZIA G;  2ZR2 A;  5EBW C;  3B24 A;  4QE7 A;  4YKW A;  1QLE C;  3D0B A;  1NH2 B;  3O2F A;  4E00 A;  5LHG A;  2UXX A;  1FS0 G;  2DQ3 A;  2DQ0 A;  4H81 A;  1PKX A;  2IW5 A;  2IWU A;  1K97 A;  1NR1 A;  4EKW A;  2YKB A;  4UVC A;  5L3D A;  4H7Q A;  1W0J G;  3IGA C;  2YKC A;  4URM A;  1P7B A;  4CE1 A;  5CBG A;  4BW5 A;  3TCU A;  4J9Y B;  1BHB A;  3C0E A;  4LWE A;  4LWF A;  2YEI A;  3EKR A;  3CC7 V;  3AG2 B;  5IY5 B;  1N8R W;  1L0O A;  2R9I A;  4PL9 A;  1FFT B;  4ZVI A;  1VQN V;  4R8C A;  3ABM B;  4ASF A;  4PRX A;  2DWD C;  1SET A;  1PL0 A;  2BU5 A;  4UV8 A;  3ZRV A;  2DYS B;  3R65 A;  1EA6 A;  4LWG A;  4MP7 A;  3G7B A;  5F3K A;  3CME V;  2VW5 A;  4WUC A;  4R50 A;  2QE7 G;  4KP4 A;  1NJI W;  2EIJ C;  4JYB A;  3JD2 A;  3VHD A;  1YJ9 V;  3CCL V;  2PNR A;  2YI7 A;  2GHY A;  2HLD G;  2E0A A;  4XIQ A;  4H33 A;  4BAE A;  2GFD A;  4ZKI A;  4E02 A;  1Y4M A;  3SPH A;  2X7R B;  1F23 A;  2WLK A;  2XAH A;  1VQL V;  2Q69 A;  4MTF A;  3CCU V;  1Q7Y W;  3OGC C;  1FXH A;  3ETG A;  2YK9 A;  1I58 A;  2CCT A;  4U7N A;  1UYG A;  3G71 V;  3E8H A;  5CBH A;  3ZKD A;  5D6Q A;  3CC2 V;  4R7C A;  4P9O A;  2W0F C;  2K1E A;  1QVF U;  4XKO A;  4L90 A;  3Q5K A;  1RPR A;  3AG1 C;  2BRE A;  3W7X A;  4XE2 A;  2WLJ A;  4WFH A;  3PEH A;  3B26 A;  1Y4S A;  5BOD A;  5B1N A;  3GIF A;  4URO A;  2QM8 A;  5FND A;  5IYD O;  3R4N A;  3A0R A;  2WEP A;  3TZ2 A;  4FPP A;  4HY1 A;  4LCU C;  2OTJ V;  4QE9 A;  1UYI A;  3F7V C;  4JGS A;  5J71 A;  2Q8F A;  3HEK A;  5CN0 A;  3OW6 A;  3SYP A;  3TK1 A;  2AHZ A;  3INX A;  1ID0 A;  2YEE A;  3TTZ A;  2EIK C;  3CP1 A;  1GTO A;  4HAM A;  1DLB A;  3HYY A;  3OEE G;  5EC2 C;  4UV9 A;  1NVP D;  3K08 A;  2P6J A;  3TET A;  4AWP A;  4MS2 A;  5L3B A;  4PA9 A;  3F7Y C;  2XAJ A;  3TUH A;  2X6A A;  1E79 G;  3X2Q B;  4PDL A;  1YSC A;  3WHA A;  3AG4 B;  3VAD A;  2XJX A;  1VQ4 V;  1JVM A;  4TWK A;  3H80 A;  3K79 A;  5IDJ A;  4XTJ A;  2WSS G;  1B62 A;  3IED A;  4KTN A;  2BTZ A;  1DF4 A;  4CWO A;  5LHH A;  5EC1 C;  4BIZ A;  1DTO A;  4I5S A;  4URN A;  2YEH A;  1RM1 B;  2BU8 A;  3K97 A;  1OCC C;  1YC1 A;  2BU6 A;  3OE7 G;  1R6N A;  4FK5 C;  2YE5 A;  4KUM A;  3WG7 B;  3NMQ A;  1L1F A;  1AI5 A;  2YEF A;  2ITD C;  4NH8 A;  3I56 V;  4AS9 A;  3H01 A;  1AJP A;  3CCS V;  1UY6 A;  3Q5J A;  1KP2 A;  4GFN A;  1QYE A;  2JJ1 G;  5CTU A;  3MNR P;  5CBF A;  1S14 A;  1GM8 A;  5B1O A;  1LNQ A;  3ZJZ A;  2Y48 A;  3FT8 A;  1M9N A;  3OFN G;  3KE6 A;  3BY6 A;  4GGL A;  1Y66 A;  4WF9 V;  4XDL A;  3T10 A;  1PNM A;  3E8G A;  4MT8 A;  1NHH A;  1UYC A;  2WI2 A;  3LDD A;  4HZ5 A;  3OWB A;  3D2R A;  5LGN A;  2Q6A A;  3ZRS A;  1YTF B;  4HXZ A;  1CPY A;  2EZO A;  4R1F A;  1K33 A;  4QPK A;  1BMF G;  3OMU A;  4LWI A;  5L3E A;  2YEV A;  3UKM A;  1QY8 A;  3LNM B;  2ESA A;  3ZXQ A;  4GEE A;  5EK0 A;  2BOB C;  2JJC A;  1ORQ C;  4XCL A;  4LWH A;  2WAM A;  2FYP A;  2BSM A;  3T0Z A;  2R9R B;  3ZM7 A;  2IJK A;  1H38 A;  3B25 A;  2HJF C;  1Q86 W;  1VQ8 V;  2YEA A;  1U0Z A;  2JIZ G;  4MSW C;  1K8A W;  1UYE A;  4GQT A;  1JM6 A;  1JPX A;  3VHC A;  2HCH A;  5IDM A;  1IXM A;  2EIN C;  3E2E A;  3AEI A;  4L8Z A;  5L3J A;  4AWO A;  3MHH C;  1BHA A;  2MK3 A;  1V54 C;  2EIJ B;  2X0L A;  2WI1 A;  4EEH A;  3CGY A;  1QBZ A;  3HB3 B;  2YKJ A;  5FNC A;  2IU0 A;  4Z1M G;  1TC6 A;  3PEJ A;  4PDR A;  2V7Q G;  2QF6 A;  4UVA A;  2Q8I A;  1OHH G;  2YSU B;  1KKD A;  2VWC A;  2XAF A;  3T4Z A;  3CD6 V;  2KB1 A;  1JCH A;  4N21 A;  3LDE A;  4FCP A;  2O1V A;  3RW0 A;  3QNE A;  4WFA V;  1UYD A;  4GX0 A;  4MOT A;  2CG9 A;  2YEV B;  3B77 A;  1UJW B;  2QG2 A;  2WEQ A;  1YSR A;  1VQ6 V;  2HG1 A;  1JOY A;  2ZBK B;  1MOF A;  1R73 A;  4JQL A;  4XIP A;  2ZDI C;  2K5B A;  2WI6 A;  2WI4 A;  3AG1 B;  3ZN1 A;  3CC4 V;  4X88 A;  1WLE A;  2ZQM A;  4KSH A;  1UYK A;  4MB9 A;  3T2M A;  4NH7 A;  4PU9 A;  1BKN A;  2XOK G;  1JJ2 U;  1HWY A;  4LP0 A;  4GT8 A;  2FWY A;  1ZWH A;  5M4P A;  4N23 A;  1AR1 B;  4YKX A;  4MVO A;  3T0H A;  1YTF D;  1S16 A;  3HHU A;  1QCE A;  3OWD A;  1H8E G;  5L3F A;  2B5U A;  5KA5 A;  4XC0 A;  3K06 A;  3LSQ A;  1ARO P;  2QG0 A;  2WLH A;  1KIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...