4JAVA

Structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
246
structure length
246
Chain Sequence
NVTESKELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine kinase
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
total genus 79
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4javA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4javA02
4ZKIA 3Q5JA 2XJGA 1MU5A 1L0OA 1BGQA 3CGYA 1PVGA 2HKJA 4XE2A 4O07A 4MOTA 2YKIA 1AM1A 4ASBA 4XIRA 1S16A 4FPPA 2YEEA 1JOYA 4E01A 1Z59A 2O1WA 4HXWA 4MTXA 1US7A 3TK1A 5M4KA 4KP4A 1UY6A 4EMVA 2YE4A 2BZ5A 5FNFA 2YE8A 3HZ1A 3HEKA 5M4EA 4JYCA 1I59A 3ZRVA 2WI6A 2XHRA 4CWOA 2XJJA 1UYCA 4URNA 3TZ5A 1UYFA 1Y8NA 1ZXMA 2WEQA 3T1KA 3O0IA 4ZVIA 5IN9A 2UWDA 3B25A 3R4MA 3B24A 1Z5CA 3A0WA 3VADA 1YT1A 2JJCA 2VW5A 4BXIA 2H55A 2IOQA 5IDMA 4WUBA 3H4LA 4H7QA 2QG2A 4CWSA 1NHIA 4EGKA 2FTKA 2YK9A 2YJXA 3RLPA 4LWEA 5CTWA 4CE1A 4JQLA 2XDSA 4XTJA 4KSHA 2BU8A 4YKUA 2H8MA 2YI6A 3D36A 1ID0A 4EGHA 2WI2A 5FWKA 3NXSA 2XX5A 5GGZA 1I5DA 3O2FA 1TILA 3T0ZA 4BIZA 5FNDA 3LPSA 4KSGA 4GT8A 2XDUA 2IORA 2Q2EB 2XDXA 3K60A 2CH4A 3B28A 2BU2A 1YC3A 1H7SA 4L93A 4EEHA 4MB9A 3EHFA 2YEIA 2FWYA 2XHTA 2XX4A 2PNRA 5D6QA 2ZDYA 4MPEA 4GEEA 4HXZA 1I5AA 4H85A 3EHHA 3CRKA 3FT8A 3HZ5A 3SL2A 1UY9A 3WHAA 1Y8OA 4CWQA 2YEHA 3OMUA 1YC1A 2O1UA 5M4PA 5D7RA 2WI1A 4ASAA 2Q8IA 2YEDA 1UYEA 3A0ZA 1BXDA 4HY1A 3PEHA 4B6CA 3ZRWA 4I3HA 2BTZA 4FCRA 3LNUA 4XKKA 2Q8GA 2K5BA 4EM7A 1Z5AA 4PU9A 3T2SA 1MX0A 3FV5A 4AS9A 4B7PA 4CE2A 4O04A 2WERA 3ZRXA 1UYMA 4PL9A 3MD0A 2XD6A 2Q8HA 3K97A 4XCJA 1YT0A 4GT1A 5CPHA 3ZXQA 1AJ6A 3A0TA 2YK2A 3C0EA 2YE7A 4HYPA 4YKTA 3R91A 3OPDA 4NH7A 2HCHA 3U2DA 2BYHA 2ZBKB 1B62A 4XIPA 1I58A 3ZKBA 2EXLA 4HZ5A 2BU5A 4CWPA 2QM7A 2BT0A 4GCZA 2YEFA 4JAVA 3K98A 4XDMA 4BIUA 4E02A 3OWDA 4CWTA 4YKXA 4DZYA 1TH8A 3Q5LA 4I5SA 1KZNA 3TTZA 4MBCA 4CWNA 3EKRA 2XK2A 2QFOA 5CTUA 4V26A 2ZDXA 1THNA 1KIJA 2XHXA 4PRXA 4FMTA 4HY6A 2CCSA 4QPJA 4X9LA 2WEPA 4JASA 2XJXA 2ESAA 2YI5A 2YKJA 2WI3A 3TZ2A 1B3QA 2YEGA 3A0RA 1TIDA 4QPKA 2CCUA 4R1FA 2FXSA 2VCJA 4ASFA 5C93A 1B63A 4H81A 4P8OA 3TUHA 1UYHA 1GJVA 1R62A 3R4NA 4L8ZA 4KFGA 4URLA 1TC6A 2YE6A 3ZRWB 2YE3A 4AWQA 1ZW9A 1OSFA 3B27A 1QY8A 2YGEA 4P7AA 3D0BA 2C2AA 3D2RA 4EGIA 1EA6A 4L90A 4XD8A 1YETA 2BREA 2YGFA 4HYMA 3OW6A 5M4MA 4BQJA 4LWGA 1YESA 4URMA 1YERA 2YJWA 4MPNA 2YE2A 3OWBA 2YKBA 4O05A 4LC1A 2IOPA 1UY7A 3GIGA 4EFTA 2FWZA 5B1NA 2O1VA 4XKAA 2YEAA 3GIEA 5D7CA 2YEJA 4YKZA 1ZXNA 4LP0A 3EHGA 3ZCCA 4YKRA 4BQGA 1TC0A 2XDKA 1UYLA 4Q20A 4XCLA 3QTFA 3P32A 3G7EA 5L3JA 3K99A 4V25A 2QM8A 3PEJA 4XKOA 2IWSA 2GQPA 3JZ3A 3ZM7A 1H7UA 3RKZA 3RLRA 5CTYA 3EHJA 2LFSA 3KE6A 4FCPA 4GFNA 1QYEA 4MP2A 3DGEA 1YC4A 2YE5A 3Q5KA 4R3AA 1YSZA 2YI0A 4BAEA 5F5RA 2GFDA 2WWWA 4PRVA 4YKQA 4ASGA 4NH9A 2XX2A 4WUCA 2CGFA 1A4HA 1YSRA 3CWVA 4LWHA 2QG0A 3C11A 1I5CA 1EI1A 5IDJA 3BMYA 3GIFA 2XDLA 4GQTA 4L94A 5D6PA 3BM9A 5BOCA 2FYPA 4E00A 1I5BA 4YKWA 4DUHA 1UYIA 4U7OA 1BYQA 4LPBA 2HG1A 3O6OA 2YKEA 5M4NA 2QF6A 1GKXA 4CWRA 5D7DA 5CF0A 3R4OA 1UYGA 1UYKA 3U67A 2YI7A 2WI7A 3WQ9A 2VWCA 2XABA 4XC0A 1Y8PA 4LWFA 3CRLA 1Y4UA 4U93A 2WI4A 3INWA 4XITA 2YKCA 3G7BA 4UROA 4AWPA 1AH6A 4MT8A 4AWOA 4XIQA 3U2KA 2JKIA 2CCTA 4GGLA 1Y4SA 1Z5BA 3A0XA 1YT2A 5J71A 1F51A 4CWFA 3ZXOA 4JAUA 3MNRP 4L91A 1NHHA 3VHCA 2BYIA 3GIGB 2IWUA 3ZKDA 2BU7A 1U0ZA 3T10A 4KQVA 1BKNA 4WUDA 5J6AA 5B1OA 3H80A 4O0BA 4MPCA 1GKZA 5M4HA 5FNCA 2BRCA 1UYDA 2WI5A 3HYYA 4KTNA 1ZWHA 2E0AA 1S14A 2BSMA 4NH8A 3VHDA 4K4OA 1AMWA 5F3KA 2YEBA 5CTXA 3VHAA 4CE3A 5BODA 3NMQA 3QDDA 4MP7A 3TZ4A 2VCIA 2LFRA 3B26A 3FT5A 3INXA 3HYZA 3R4PA 3TZ0A 3CGZA 2AKPA 4O09A 4W7TA 1UY8A 2YGAA 1QZRA 4EFUA 2XCMA 3T0HA 4U7NA 2YE9A 2Q8FA 2IWXA 4JYBA 3RLQA 1AH8A 1IXMA 4LWIA 3R92A 1YS3A 3A0YA 3G75A 2YECA 1JM6A 3IEDA 4FCQA 4HZ0A 3HHUA 2P67A 2BU6A 4YKYA 4R3MA 2ZKJA 1NHJA 1TBWA 3EKOA 1U2OA 2CG9A
chains in the Genus database with same CATH superfamily
2A9HA 3ZHVA 4OX9O 1X59A 4N23A 2XJGA 1MU5A 3KZIZ 4JI7B 2QWRB 1YJNV 3ASNB 1PD3A 1SQFA 2EIKC 5KAFZ 4GUNA 1XBLA 4DV5B 4JI7O 1AM1A 4LFAB 3M99B 4KFMA 2V7QG 5BXZA 4DV0B 4JI6B 2Q9LA 3JATB 4HXWA 4MTXA 2GUZB 1US7A 1R6NA 3JAWA 4DV0O 1ROPA 4KHPB 3CCEV 1VQNV 2YE8A 2KKWA 2A7WA 2WLHA 3HZ1A 3OW2U 3ZX6A 4C7UA 3W7WA 4KHPO 4TSFG 4CWOA 2R9RB 4FFBA 2B5UA 1AB3A 5JJJB 1UYFA 4MS2A 2ZR3A 2WEQA 3T1KA 4X20B 2JJ2G 4B3MB 4FLWA 3B25A 2BTQB 3B24A 4FFKA 4QJFB 4NXNB 1SQVH 4RUEA 3LDCA 3CWBH 3LSSA 1HWYA 1RFYA 1AP6A 4EGKA 2CTRA 4NTWA 1V55B 4DR6B 3K0DA 2PUSA 3RLPA 4JI2B 5CTWA 5IJ0B 1NR7A 2M6YA 3U10A 4KSHA 4XTJA 2KB1A 3SPHA 3THOA 2H8MA 4DR6O 3D36A 1ID0A 4EGHA 1Q6UA 2AZ2A 1P4RA 1M57C 3T0ZA 1ZLZA 1DGSA 5FNDA 1V54B 2MW2B 3K58A 3LPSA 1FXVA 2B1IA 5DEDA 4IYIA 5L3FA 2XDUA 4DUYO 2BU2A 4LF6O 2RCVA 2C1IA 1JJOA 1FPOA 4J41A 1OCCB 1S0VA 2FWYA 1N32B 4YHHB 2PNRA 5D6QA 3G71V 2YICA 3AG1C 5KHHA 3E8BA 4IL6Z 3EHHA 3CRKA 3HZ5A 4H85A 3AK3A 4F6RA 4LCUC 1HR0B 3KCXA 1YC1A 2O1UA 4K35A 5D7RA 4B7EA 3A0ZA 3OFNG 1KMIZ 4JI1B 1OCOB 4B6CA 2EINC 2YXYA 2H8PC 2BTZA 5H6RA 3TXQA 5CB4B 4FCRA 1GM9A 1JQ0A 4YJ2A 4ABMA 1S5LZ 3STLC 1JJ2U 3EVKA 5ITZB 4CH3A 1FAFA 5CN0A 4CE2A 4X1YA 1RPRA 4O04A 1F4MA 4YXWG 4MSWC 1BCCH 5GTIZ 4X66B 3K03A 2EIKB 1YI2V 2CGNA 3K97A 5F2VO 2X7RB 2DJVA 4X66O 3QO5A 3TXSA 1NTZH 4E2LA 2DQ0A 3T1CA 2ZD9A 4YJ3B 2WLKA 3N2GB 2BU5A 2BT0A 1XMQO 4J9ZB 2AXTZ 3K98A 1Y4MA 3D3IA 2LP7A 1I08A 2QSAA 3K9AA 3NR7A 3AG3C 2F43G 4E02A 3ZHUA 3D3QA 4O4HA 3VQVA 2R9IA 3CCUV 1EN6A 1S5JA 2UXDB 4I5SA 3B4SA 3EKRA 1D2DA 4X8AA 1GN6A 2Y48A 1YEWA 2QFOA 5CTUA 1QVFU 4O2AB 1BQZA 2EIJB 2YI5A 2UU9B 2BSKA 4Z1VA 1S76D 2YIBD 3N2KA 3K9SA 3R66A 2UU9O 3JALA 1GAXA 1KB9F 2YDEA 4RQEA 4U3JA 2ZDIC 3IC7A 4PDVA 1Q43A 4N21A 5C93A 5FPOA 2GUZA 2QM4A 4Z1MG 1GJVA 3CCVV 1K34A 4DR2B 1R62A 1GKFA 2HVJC 2QDOA 2A79B 1BMFG 1S3JA 2AGAA 3ZRWB 1A32A 4P7AA 1XL6A 2QWQB 4IGGA 1W2BU 1OCZB 3RT3C 5DM6V 3ETDA 4RQFA 1K4DC 1MSWD 3K79A 5B1AC 4TUYA 2ZE7A 4X20A 5E79Z 4BW5A 5KA6A 5J2TA 4UVBA 2ZM6B 3WB1A 4F4LA 2EJ7A 5HFLA 1QVGU 1BZKA 4OPHA 3OW6A 5M4MA 2HHIA 3ZN0A 3OGCC 1Q90D 4RUFA 5GW7A 4GX2A 2ZM6O 2OIEA 4URMA 2BOBC 2PGGA 3AG4C 4MPNA 1WJZA 1NVPD 1UY7A 3LDEA 5B1NA 1HNWO 4XKAA 4D6TH 3CRRA 2XT9A 2YEJA 3CJHB 5H6QA 4GX0A 1MA1A 2DE0X 2AZ0A 3EHGA 2HJDA 3T4DA 4H44B 1MZEA 2JK5C 3CPWU 1QR8A 2WLMA 2E75B 4Q20A 4XCLA 5LHIA 4GKKO 3P32A 5IT9N 3VOUA 3MAQA 2ZR2A 1FFXA 5L3JA 3L73H 4FLTA 4W4LA 4V25A 1H2MA 2QM8A 2HR3A 2IWSA 1HP8A 1WP7A 1AI4A 4PD4F 3IC9A 3L70H 2MK3A 2Z0AA 3RKZA 1E1RG 3CCRV 4GFNA 1IBMB 1GN2A 1JFFA 3DGEA 1KUQA 1YSZA 2YI0A 3IGAC 2CAZC 3LNMB 4ASGA 1SQPH 2CGFA 4X89A 4DV2O 3M7MX 3CWVA 4LWHA 4J11A 4L94A 4LF7B 4GQTA 4L8JA 2FYPA 3CRAA 5LGTA 4W4KA 4YKWA 3AG3B 3OTOO 1SZTA 4U7OA 4ZBMA 1S5HC 1SESA 3TETA 1VF5B 2QWNB 1R6KA 1WP8A 2KG7A 2HG1A 2UXCO 1I94O 4LFCB 1SA0B 1KP3A 1Y76B 2IJKA 3O65A 3ABKC 5CF0A 5CB4A 1UYKA 4ZOLB 2EBOA 1DLBA 2JIZG 2YI7A 3WQ9A 4GKJO 5LOVA 4LFCO 1DK1A 2WI4A 3UQ8A 4AWPA 2VWJA 1GRJA 1MG1A 4AWOA 5LMNB 5IYCO 3U2KA 1N0JA 2CCTA 4GGLA 3ABLC 2LGQA 1K8AW 2DMXA 2LW1A 3G80A 4I4TA 1WAZA 1H2GA 1XNRB 2WLLA 1SRYA 1YZBA 4MVQA 5LA6A 1NTMH 4GYCB 2UXXA 1NQTA 1F51A 1W0JG 3ZXOA 4JAUA 3MNRP 4GLXA 5EC2C 3N2GA 4KQVA 5J2UB 4WUDA 4DR4B 5DECA 5B1OA 3H80A 1Q7YW 4TV8B 4R50A 5J9PC 4FIPC 2ZINA 4YY3B 5M4HA 5KX5A 2QKCA 2BRCA 4DRXB 3E22A 1VQOV 3SPJA 2E0AA 2EZPA 1VQKV 2BSMA 1RSOB 1R3LC 4YY3O 3JAKB 1PL0A 3F5TA 1AMWA 3RYCA 3CP1A 4CE3A 3VHAA 4MP7A 1VIBA 3OM3B 1HW7A 4O2AA 4ASUG 3FKSG 3INXA 1JA8A 3TZ0A 5JQGB 3AG4B 3QF7A 5BMVB 2G38A 2YSUB 4TQDA 2XCMA 1SERA 4U7NA 2YE9A 2D3OW 1NKDA 2N04A 2IWXA 4DV7B 2EZOA 4I9QA 2WA4A 3G6BA 4LH7A 2YEVB 5LBQA 1AH8A 1IXMA 4LWIA 1US6A 3W7SA 4GX5A 5KA5A 4DV7O 3R92A 5L3BA 1Q81W 4IYHA 1JM6A 1T5EA 5A2QN 4DV3O 3HHUA 2CTQA 2WLIB 2IM9A 1YF2A 1OJHA 2EILB 1TBWA 3SDLA 4EB6B 3IJ4A 3UM7A 2QWPB 4ZHQB 4PI2A 1XHZA 3QVNA 3ASNC 3Q5JA 4QE7A 2XNDG 2WAMA 4AI8A 3ZHSA 3IAYA 4XE2A 1QR9A 3RYFB 4MVUA 2BCCH 3QO8A 1QLNA 3S3WA 2UXBB 3L9DA 1VQPV 2DN9A 1S77D 3SJCC 1SC5B 2M7WA 2V1DA 2JS3A 4P9PA 3SPGA 4J80A 2CTWA 1EBOA 5FNFA 1SF9A 2P4VA 2ARHA 4O2BA 3HEKA 1M56B 2PI5A 4WF9V 3ABKB 2VQFO 4JYCA 2IU3A 2XHRA 2RJZA 1YJWV 4URNA 5KHIA 3QTCA 3TZ5A 2ZT9B 2LGWA 3HB3B 1Y8NA 1ZXMA 2IH3C 4P9OA 2K1EA 4ZVIA 3ZEDA 2ADQB 5LXTA 2QTOA 3A0WA 3VADA 1IDSA 2W0FC 1YT1A 3ABLB 4NVPA 2BOCC 2H55A 5IDMA 2XAJA 3SPIA 4WUBA 1ORQC 4H7QA 1O9HA 2GTSA 1V55C 4O4LB 4R7CA 4I9WA 1NHIA 3QNEA 1ZSPA 2CTPA 1BSMA 2YJXA 4K0KB 1TUBA 1ZL8A 3S3XA 4NTYA 1VARA 2WI2A 1JR9A 5GGZA 3CX5F 2JEXA 3J80N 1TILA 3JCUZ 4WFEA 3D8CA 5EYPB 3UKMA 2QKAA 1AILA 4GT8A 3SYAA 2Q2EB 2XDXA 4ZOLA 1RP3B 4X62B 3WG7B 1H7SA 4EEHA 2VRZA 3TCUA 4MB9A 3U11A 1AR5A 4X62O 4K8ZA 4G2KA 4B3SB 2XAQA 1XREA 1O9GA 4GEEA 3SL2A 4PV1B 1XQ8A 4CWQA 4B3SO 2L6LA 1R3IC 2ZDIA 2JEUA 3JASA 3OAAG 5B5EZ 2WI1A 4ASAA 5H5NA 3W7UA 1UYEA 1J5EB 3ZRSA 4HY1A 3PEHA 2ZKOA 2R72A 4TV8A 5LGNA 4PA3A 1J5EO 2NN4A 5GONA 3K0GA 3OMNB 4PU9A 1RSOA 2W6IG 4MVMA 3JAKA 2EX3A 2X6CA 2WERA 2F95B 4I0XB 1PKXA 2UXNA 4PL9A 3MD0A 4EKWA 1YT0A 5CPHA 3K08A 2IBZH 4UUJC 1AJ6A 3A0TA 4PA4A 1AI5A 4YKTA 3R91A 1Q3EA 3OPDA 5KMGB 4DYLA 3U2DA 4NR1A 3K06A 2Y0PA 1TGOA 1B62A 4XIPA 1FXKA 3ZKBA 1W59A 2IW5A 4LWSA 3P3NA 1FYJA 4MTOA 4AILC 3FB6C 1URFA 1GH6A 1WPXA 5EC1C 5CA3A 1NVPB 3OWDA 4DZYA 2DW4A 3G4SV 1R73A 1KZNA 3TTZA 5D5QA 3J7AU 1F4NA 5KHGA 2EIJC 3LNNA 1CPYA 4B3TO 5FNVA 3BFRA 4X9LA 2CCSA 3BPZA 4MW8A 4HNAA 4CH6A 1N33O 3TZ2A 2FMLA 2Q69A 3SYQA 4FM0A 4QPKA 3RYFA 3B8MA 3O9OA 2CCUA 2IU0A 3H1JH 5IJ9B 3WB0A 4R1FA 5LYJB 1VQMV 2FXSA 4DUZO 2VCJA 3K3WA 2XOKG 1FJGO 4ASFA 1FXHA 5FL7G 4KXRA 4GX1A 1DF5A 5EZYA 4BIOA 1B63A 3W7XA 2Y4UA 4DUYB 5EK0A 4H81A 4LF6B 1UYHA 3JD2A 3FYEB 3R4NA 1SS3A 2NR5A 4NB5A 1FS0G 4LFBB 2YE3A 1OCZC 4AWQA 4DW1A 3B27A 1QY8A 4WBNA 2YGEA 3D2RA 4EGIA 1EA6A 4LNUA 3Q4HA 4LFBO 1Q6IA 4MVSA 3RN4A 2QKSA 4XD8A 1YETA 4JGSA 2JGDB 2BREA 3SPCA 1M5IA 4RO2A 4BQJA 4LWGA 2P90A 3PN1A 5H2FZ 2A06H 1ENVA 3F5WC 1MABG 1XL4A 2IOPA 4JAAA 4EFTA 2FWZA 1XOUA 1L1FA 2YEAA 3GIEA 5D7CA 1VQLV 1QLEC 4YKZA 1ZUQA 4DR5O 3ABTA 2IJHA 3CS5A 1UYLA 3CCQV 3IFXA 3QTFA 5KUMA 3G7EA 1N34B 1N36O 3K99A 5CA0A 3PEJA 1MNGA 5JH7B 2Y69C 4TWKA 1YDXA 1N34O 1FFTB 1H7UA 2RMKB 1Y6XA 5CTYA 3EHJA 3KE6A 2JJ1G 4FCPA 1KECA 4MP2A 3H9VA 3C3SA 5BZBA 1YC4A 1XMQB 3JARB 3Q5KA 1EM1A 4R3AA 4BAEA 4IIJB 1LR1A 1WNSA 3EFFK 3HKEB 1SETA 1S72V 4DV6B 1G6UA 1Y67A 1A4HA 1LUVA 4B3RB 3C11A 4E01A 5IDJA 4DV6O 1D5AA 2Q7HA 2H3OA 1BYQA 2HFEC 4B3RO 3WU2Z 5A9GA 3OGIB 1YTFD 3O6OA 4AQYB 4JZ2A 5JJEB 2PTMA 1M9NA 2HLDG 1XUQA 1I7FA 1NBMG 2ILMA 4CWRA 4B08A 1UYGA 3U67A 5L3GA 3SYPA 4AQYO 1H38A 1HDJA 4XC0A 1Y4UA 4U93A 2ZNJA 1DF4A 5KLVH 1AH6A 3CCLV 2CDYA 4OGQB 5LL6Y 5L3DA 4WFFA 1GMGA 2YUAA 2HG5C 1CP9A 1Y4SA 1AP5A 3DSQA 3BA9A 5KMGA 3JATA 3E8FA 5H9CA 1Z2GA 3LDDA 3E35A 1KC8W 3OR6C 3CMAV 1NHHA 2BYIA 1VF6C 1Y74B 3GIGB 3ZKDA 2BU7A 5CBHA 3UO2A 1Q82W 1BKNA 3CSXA 3SYOA 1KP2A 1GKZA 4MVOA 1R3KC 1IVSA 5CA1B 2YIAA 2WI5A 1GN3A 1S14A 4JTCB 2E5LO 2N74A 1UPGA 2BTQA 2JVDA 3CEIA 1Q86W 3QDDA 5JCOC 5EIBD 4JV5B 3SJBC 1HNWB 4D7SA 3HYZA 3R4PA 1IBKO 2ZNIA 1HNXO 4W7TA 4JV5O 3B77A 3F7YC 1VF7A 4X64O 1I0HA 4TV9B 4XDKA 2Q8FA 2PI4A 5IJ0A 4GKKB 4Z2WA 3OMAB 1TVKB 5EBMC 1G1XB 3CCMV 1QLEB 4MVRA 1EN5A 3A0YA 1XILA 1M4UA 2YECA 3VQWA 2VQEB 3IEDA 4FCQA 2P67A 2CH7B 2EILC 2B9ZA 4BW9A 2IH1C 2VQEO 1EFRG 2YXLA 1NHJA 4MW3A 2Y69B 3STZC 2UUBB 3ZMTA 2UUAB 2OWOA 1U2OA 1KYOF 3T4ZA 4ZKIA 3ML0A 3CC4V 4DV2B 5JJNB 2UUBO 2UUAO 2KQXA 1OZ0A 2JGDA 1PVGA 2HKJA 3A8TA 3X2QC 5K1PA 4NXMO 3OTOB 3P30A 5C8YB 4MOTA 2HVKC 4ICGA 2Q67A 4XIRA 4FPPA 2A0LA 2UXCB 1I94B 1Z59A 2O1WA 2N05A 4CS4A 3TK1A 4GZRB 1UY6A 4GKJB 2Q68A 4EMVA 2BZ5A 2F1MA 1M56C 3K57A 2F4VB 2ZE8A 3C90A 3DXRB 1B04A 4O4JB 5M4EA 4WCEV 4R6ZA 3D36C 1I59A 3ZRVA 2WI6A 2XJJA 1UYCA 4XDLA 4I50B 5ITZA 2F4VO 1P7GA 2P6JA 3KG2A 1E79G 4QGPA 3K5NA 3A0HZ 3CMEV 1SQQH 4LR3A 1I5YA 1Z5CA 1D5NA 1BS3A 2VW5A 1XNQO 4BXIA 1B06A 1WN7A 3H4LA 2ODMA 3JARA 1BE3H 4IIJA 1KBHA 2CK3G 3HKEA 3T1HB 2QG2A 2ZCEA 4D7TA 4CWSA 3HKBB 4YJ3A 3HKCB 2FTKA 3JSLA 4CE1A 1R3JC 3RYIB 3T1HO 3CC2V 4FZ0A 3A0BZ 2BU8A 2YI6A 2EIMB 5LMUB 1DTOA 1GM8A 1SKVA 1YITV 1H2KA 1WB8A 4RAIA 3O2FA 3G6EV 5LMUO 4HAMA 3WG7C 4O4IB 2CH4A 3B28A 1X4TA 2HHHB 2PZSA 1YC3A 4X65B 3ASOC 3SR2C 4QIWF 3GB7C 4J7ZA 3DC6A 1M93A 1PL4A 3VBBA 2YEIA 1MZFA 2XHTA 2HHHO 2P7TC 2XX4A 4X65O 1PPJH 3AG2C 3ABMC 4MPEA 3FT8A 3AEIA 1UY9A 4DV3B 1Y8OA 4UV8A 1BHAA 3E89A 5FLXN 4UVCA 2P5OA 3ZMVA 2OTLV 4EFEA 4WFBV 5M4PA 3H1HH 2LO1A 1Y74A 1KD1W 2YEDA 3ZHQA 4LF4O 1WA8B 1BXDA 4BR6A 3JAWB 3JD0A 1YJ9V 1AJNA 5KHJA 2GDSA 3ZRWA 4P30A 3LNUA 5CA1A 2K5BA 4EM7A 3T2SA 1U97A 3FV5A 4DW0A 2ITCC 2OYQA 2WA3A 2F93B 2A3QA 3BRCA 3A2FA 4DK0A 2DWEC 1UYMA 2XD6A 1PV0A 2Q8HA 3X2QB 2YC0A 4GT1A 5B1BB 4TQFA 5IYDO 1GO3F 4JTDB 3ZXQA 2DYRC 2YK2A 3C0EA 2YE7A 5D5PA 1HNZO 4NH7A 3E8GA 4MTFA 2BYHA 4LP8A 4NKGB 2JS5A 1OHHG 5EIBC 2XHBA 2VQFB 4LF9O 3CJHA 2EXLA 4HZ5A 1H8HG 1MSDA 4JF3A 2QM7A 4LF8B 1H2SB 5L3EA 2B1GA 2YEFA 1N0NA 2Q7EA 4QNHB 4BIUA 2QEXV 4LF8O 1AR4A 1TA8A 2CH7A 4MBCA 2PF4E 4JYYA 5JENA 1YIJV 3JYCA 2ZDXA 1THNA 1LUWA 1KIJA 4DV4O 3ETGA 2XHXA 3OR7C 3FB7C 3H01A 4FMTA 1AJPA 1FKAO 4HY6A 3OMIB 2WEPA 2XJXA 2ESAA 3OTFA 4CC5A 4E72A 1K33A 2WI3A 2GSMB 2YI9A 2YEGA 3OD4A 3A0RA 2PY5A 4PA6A 1K3EA 4WFHA 1K5SA 2VWKA 2QA4V 2XUMA 3PJSK 4F6RB 4X1KB 3KKYA 2OCCB 2YI8A 2XASA 3QG5A 1SA0A 3GVMA 3JD4A 1Y76A 3GWKC 2BE3A 4KFGA 1L8DA 1R6TA 4URLA 1BT8A 2YE6A 1NTKH 3VQYA 1K7DA 3D0BA 4I7ZB 4YJ2B 1YCIA 3RYHB 2Q0AA 2ZE6A 1U96A 3L71H 3ASOB 4DR3B 4MVZA 4L90A 1YTFB 4IT5A 3UT5B 3RVZA 2YGFA 4CS2A 1VMGA 4UCUA 4DR3O 3AG2B 3ABMB 1K4CC 1YESA 2Q7GA 1YERA 4P2ZA 2YJWA 3FB8C 1Y66A 3RGBA 2YE2A 3OWBA 2YKBA 4O05A 2WPDG 2VS0A 3HKCA 2O1VA 5J2UA 1VF6A 3BA8A 2PYJA 3E86A 3RYIA 1NH2B 4K8XA 3ZCCA 4YKRA 4DRXA 4L87A 5LP6C 3DTUB 2AHZA 4IHJB 3FAVB 4DR1B 4CS3A 4O4HB 3SJAC 3FB5C 1JPXA 3MDSA 5LGUA 4UFZA 5B3SC 4DR1O 1NZ6A 4CC6A 2OIGA 5JCOA 4ZIBA 4JI0B 5IE9A 1BL8A 5JQGA 3RLRA 5BMVA 4Q6GA 2DYRB 4FLXA 3KCYA 2ZXWB 4JI0O 4LF5B 1EZVH 2BSKB 1VQ7V 4H37A 2YEVA 2HKOA 1G4YB 3N2KB 1ZTEA 4UV9A 2QGNA 2XX2A 4WUCA 1JMKC 4LF5O 1XEQA 2Q6AA 3JALB 1YSRA 4FM1A 3I5DA 1I5CA 3OE7G 1QHTA 4U3JB 1MOFA 4J7JA 1EI1A 2XDLA 3BMYA 3GIFA 2AHYA 5D6PA 5BOCA 1K92A 4PDLA 2W0XA 4DUHA 2WLIA 4DV5O 1NJIW 4B3TB 1WA8A 4E4EA 3K5OA 4LFAO 4LPBA 3BHPA 4JI6O 3FYIB 4UCSA 3RWRD 2FYUH 1RM1B 4EB6A 4FLVA 5M4NA 2QF6A 1R1BA 2E74B 1N33B 1GKXA 3TJTA 5D7DA 4ZHQA 1H2LA 2WI7A 2Q5ZA 3J81N 4PA7A 2XABA 1Y8PA 4TOIA 2OTJV 3CRLA 2GHYA 3INWA 2YKCA 2KSDA 2QJ1A 3AK2A 4DUZB 1FJGB 3E83A 4TUYB 5J2TB 3TGUH 2JKIA 1BHBA 2HP8A 4H13B 3A0XA 4AHCA 4B3MO 3JCZA 1VP7A 5AG2A 4BAYA 1Z5WA 3H1LH 5E1AC 5J71A 1AVMA 4CWFA 5JVDB 4L91A 2DQ3A 1CEZA 1ZX3A 3UO3A 4NXNO 3RW0A 1U0ZA 3JSNA 3VQXA 3T10A 1CXZB 1YVWA 3F7VC 4O0BA 1QQCA 3K5LA 3OEEG 1UYDA 1NI8A 3HYYA 4JI2O 4PDRA 3S5TA 4NH8A 1IXBA 5F3KA 3RBZA 4FLZA 2YEBA 1FFXB 5BODA 2RN9A 3NMQA 3M8AA 4I55B 5IWAB 3B26A 3FT5A 3K59A 3I55V 2AKPA 4O09A 4O4LA 1NU1H 2ITDC 3T0HA 4EFUA 4DR5B 1JFFB 3MHSC 5IWAO 2X0LA 3SGIA 2XAHA 1GN4A 4JYBA 3RLQA 5L3CA 2GBOA 1N36B 2E76B 1VQ9V 1WLEA 3CCSV 4X1KA 4FLUA 1N32O 1YS3A 4YHHO 3BABA 5LP6B 1NT2B 5FPRA 5JWPA 3T1YB 3E2EA 2BU6A 5EYPA 1HR0O 3B8NA 4OXSA 2OCHA 4A5UB 4R3MA 2KG7B 2ZKJA 4YKYA 5B3SB 4X88A 3BCCH 5GTHZ 3CRQA 3T1YO 1PNLA 1K97A 1P49A 4JI1O 3RYHA 1M1KW 5LOVB 2ATKC 2JRIA 4X1IB 4DO2A 1L0OA 3UT5A 4YIOA 1BGQA 3CGYA 3RFRA 4O07A 3CYGA 1F23A 3ZS8C 3BY6A 2YKIA 2QE7G 4ASBA 1S16A 4I4TB 2YIDA 1LNQA 2WLLB 2YIBA 3L72H 1JOYA 5LA6B 2YEEA 5DN6G 5M4KA 4KP4A 2E3CA 2DOSA 4OPAA 2YE4A 1JVMA 1K73W 4EEQA 1N8RW 3B2EE 1GTOA 1G8MA 4IHJA 3P3PA 1COWG 3FAVA 5KX5B 2O57A 3E22B 3ZMUA 2ZIOA 4UCTA 1IX9A 4G27B 4I0XA 4UCVA 3O0IA 3RYCB 4FVMA 4PI0A 2UWDA 2D2CB 5IN9A 3R4MA 2Z5UA 4UB8Z 1NH2D 1YXBA 3WB2A 1XDCA 2UXDO 2JJCA 2IOQA 4RWUA 2NLJC 4DXWA 2Q73A 4DV1B 3DC5A 4BWAA 1L0LH 2YK9A 1AI6A 3ZHRA 4LWEA 4JQLA 2XDSA 2EIMC 2FB5A 4LBEC 2E5LB 1WPBA 4YKUA 4DV1O 3AG7A 5FWKA 1FD9A 4B7KA 3NXSA 2K9PA 2XX5A 1I5DA 5K1XA 3CRMA 4X9QA 2P4KA 2ZIMA 1UFIA 1M57B 4BIZA 3ZBHA 1W0KG 3QO7A 1IBKB 1HNXB 4R8CA 2WLJA 4KSGA 3CE2A 3CXHF 3K60A 1YSCA 2IORA 1AI7A 4X64B 1F7YA 4L93A 4DK1A 3WFVA 4DR2O 2L35A 2QR4A 3EHFA 5BR8B 2UUCB 4PHZA 5IJ9A 2ZDYA 4HXZA 1MMMA 5LYJA 1I5AA 2P06A 5BR8O 3WHAA 2UUCO 3AG1B 2YEHA 3OMUA 5JVDA 3JAMN 1E1QG 3CRCA 2YS8A 2CE4A 4CH5A 5KUKA 2Q8IA 1QU7A 1FXKC 3CHXA 3L75H 2PYLA 4EFBA 2JDIG 4I3HA 3MHHC 2XAGA 4UCRA 2EINB 2CUGA 4O2BB 5IY5C 4XKKA 2Q8GA 4XDJA 4MTGA 3W7TA 1Z5AA 1NR1A 4NXMB 5CBFA 1MX0A 4NTXA 4AS9A 4B7PA 1AROP 3ZRXA 1PNMA 2OT5A 5B1BC 4I55A 2XTAA 1VQ4V 4XCJA 5LXTB 2GTAA 1EN4A 5EBLC 3UCSC 4HYPA 1QCEA 4G28B 3CXCU 2WLNA 4PELA 3G67A 2HCHA 2WSSG 4FLYA 2ZBKB 3OUFA 1N4CA 1I58A 4YIPA 1QNMA 1IBMO 2NNUA 2W6JG 4CWPA 4GCZA 4JI8B 4JI4B 4JAVA 4XDMA 3SJQC 1TUBB 1XHXA 5B66Z 1ZL8B 1K5QA 5LP6A 5KHKA 2YXHA 2HEPA 4CWTA 4YKXA 1TUEB 1TH8A 4JI8O 4JI4O 4K3AA 3Q5LA 2FL4A 1VQ6V 1XNQB 4CWNA 2CGOA 4LF7O 5JH7A 2XK2A 4PDMA 3CD6V 4V26A 1THZA 1SQBH 3U0ZA 4PRXA 3B40A 2EJRA 4QPJA 4JASA 3LSUA 1GM7A 3C3TA 4X1IA 3ZHTA 4HYOA 4ZI7B 2YKJA 3HKDB 1B3QA 4UCOA 5LHGA 2Q0OC 4HZ3A 1J95A 1TIDA 2FKXA 3OEHG 3APOA 3BVOA 3CCJV 2Q8VA 2R70A 3BEHA 2OCCC 1PNKA 5LMNO 4FJCC 1QBZA 2EULA 3JASB 3ZMSA 1XNRO 1I5XA 4QE9A 4P8OA 4XBFA 3ZMZA 4TT3G 1YHQV 2AW9A 3ETEA 1M90W 3TUHA 4L8ZA 5IYZB 3ZIAG 1TC6A 4JYAB 2Z3YA 1ZW9A 1OSFA 2C2AA 5GONB 2F66C 1IURA 3OT7A 2DYSC 4DR4O 4WFAV 4JYAO 5B1AB 2ETNA 5HFMA 4HYMA 5KAIZ 1SQGA 3HR0A 4JTAB 4LF4B 3APQA 3CYOA 4KL1A 3H1KH 1JX9A 4CZZA 1TAEA 4LC1A 2IJIA 3GIGA 2ADPA 3LUTB 1JCHA 1FXKB 2RNBA 4KUMA 4LWSB 1ZXNA 1OV9A 4LP0A 5CMUA 4BQGA 1TC0A 2XDKA 1XI1A 2DWDC 3R65A 1K9MW 1V9PA 1OCRC 2F23A 3E8HA 4FFBB 1ZWIC 5IY5B 1Z5VA 1Q8IA 3SYCA 2BTOA 4XKOA 2GQPA 1HNZB 3JZ3A 1SZXA 3ZM7A 1P7BA 2QWOB 5FNVB 4LF9B 2ZQMA 1RPOA 2ZXWC 2LFSA 1P84F 3B09A 1QYEA 2QTSA 1Q5OA 2YE5A 5EBWC 4TV9A 1H8EG 4HNAB 3JD3A 4NYKA 3I56V 2WWWA 2GFDA 5F5RA 3EXAA 1BQ0A 4PRVA 4YKQA 1TVKA 4NH9A 4J42A 1L0NH 1BGYH 3ETQA 1ZAUA 2QG0A 2HJFC 3BM9A 4E00A 2IJJA 1I5BA 2XAFA 4DV4B 1UYIA 3ICXA 5EZYB 1GK9A 2UXBO 3FX7A 4UXNA 4FZ1A 1RM1C 2LJ2A 1AJQA 3K5MA 3GWOA 2YKEA 2Q4PA 3ZJZA 4WFGA 2V4DA 3R4OA 1PP9H 3OUSA 2VWCA 4WBNB 1XMOB 4LWFA 2LQTA 4XITA 3G7BA 4UROA 4LNUB 3JD1A 4J7KA 3Q4HB 4UB6Z 4MT8A 1Q6HA 5C8YA 2GV9A 4XIQA 1XMOO 1WB7A 2X6AA 3H1IH 3ABUA 1Z5BA 1UJWB 2C1GA 1YT2A 1KKDA 3T2MA 3ZN1A 4LH6A 1VEWA 3VHCA 3FD9A 4FK5C 4JI5B 2IWUA 4HBNA 1KKCA 3DXRA 3BAAA 5J6AA 4O4JA 2P22C 4JI5O 4MPCA 5BY1A 1H2NA 3CB2A 2Y4TA 5FNCA 4CBCA 4H33A 4JI3B 5CBGA 4I50A 1SQXH 3L74H 1ZWHA 4KTNA 3AK1A 4K0KO 3VHDA 5LHHA 2DYSB 4K4OA 1V54C 2RQ6A 4UVAA 4JI3O 3RVYA 5CTXA 4X1YB 3N27A 5CA0B 4J10A 3TZ4A 4PA9A 2VCIA 4FM2A 1VQ5V 4PJ0Z 2LFRA 1AR1B 3EHBB 1KU9A 4F6EA 3CGZA 4ZI7A 1UY8A 4DR7B 2YGAA 1OCCC 3HKDA 1QZRA 1VQ8V 4H0LB 4JPRA 3HKBA 4JZGA 4U3FH 2LW7A 3CC7V 2X6BA 3LMMA 4DR7O 4CH4A 2H94A 3HPLC 1EZJA 1B6QA 1PM9A 2Y0IA 2ZE5A 5TISZ 3G75A 1OCRB 4HZ0A 4J9YB 1IBLB 1NS1A 1OCOC 3K04A 1KQSU 5IYBO 3FFQA 5IYZA 2JGUA 1IZ3A 4O4IA 1IBLO 2R9AA 4OX9B 2RDCA 3EKOA 2CG9A 3LSQA
chains in the Genus database with same CATH topology
2A9HA 4N23A 2XJGA 1MU5A 1YJNV 3ASNB 1PD3A 2EIKC 1AM1A 3M99B 4KFMA 2V7QG 4HXWA 4MTXA 1US7A 1R6NA 1ROPA 3CCEV 1VQNV 2YE8A 3HZ1A 2WLHA 3OW2U 3W7WA 4TSFG 4CWOA 2R9RB 2B5UA 1UYFA 4MS2A 2ZR3A 2WEQA 3T1KA 2JJ2G 3B25A 3B24A 4QJFB 4RUEA 3LDCA 3LSSA 1HWYA 4EGKA 1V55B 3K0DA 3RLPA 5CTWA 1NR7A 4XTJA 4KSHA 2KB1A 3SPHA 2H8MA 3D36A 1ID0A 4EGHA 1P4RA 1M57C 3T0ZA 5FNDA 1V54B 3LPSA 1FXVA 2B1IA 5L3FA 2XDUA 2BU2A 1OCCB 1S0VA 2FWYA 2PNRA 5D6QA 3G71V 3AG1C 3E8BA 4H85A 3EHHA 3CRKA 3HZ5A 4LCUC 1YC1A 2O1UA 5D7RA 3A0ZA 3OFNG 1OCOB 4B6CA 2EINC 2H8PC 2BTZA 5H6RA 4FCRA 1GM9A 1JQ0A 3STLC 1JJ2U 5CN0A 4CE2A 1RPRA 4O04A 1F4MA 4YXWG 4MSWC 3K03A 2EIKB 1YI2V 3K97A 2X7RB 3QO5A 4E2LA 2DQ0A 3T1CA 2ZD9A 2WLKA 2BU5A 2BT0A 4J9ZB 3K98A 1Y4MA 3D3IA 2LP7A 3K9AA 3AG3C 2F43G 4E02A 2R9IA 3CCUV 4I5SA 3EKRA 4X8AA 2Y48A 2QFOA 5CTUA 1QVFU 2EIJB 2YI5A 1S76D 4RQEA 2ZDIC 3IC7A 4PDVA 4N21A 5C93A 4Z1MG 1GJVA 3CCVV 1K34A 1R62A 1GKFA 2HVJC 2A79B 1BMFG 1S3JA 3ZRWB 4P7AA 1XL6A 1W2BU 1OCZB 5DM6V 3ETDA 4RQFA 1K4DC 1MSWD 3K79A 5B1AC 4BW5A 5KA6A 4UVBA 4F4LA 5HFLA 1QVGU 3OW6A 5M4MA 3ZN0A 3OGCC 4RUFA 5GW7A 4GX2A 4URMA 2BOBC 3AG4C 4MPNA 1NVPD 1UY7A 3LDEA 5B1NA 4XKAA 2YEJA 5H6QA 4GX0A 3EHGA 3T4DA 2JK5C 3CPWU 1QR8A 2WLMA 4Q20A 4XCLA 5LHIA 3P32A 3VOUA 2ZR2A 5L3JA 4V25A 2QM8A 2HR3A 2IWSA 1AI4A 2MK3A 3RKZA 1E1RG 3CCRV 4GFNA 3DGEA 1YSZA 2YI0A 3IGAC 3LNMB 4ASGA 2CGFA 4X89A 3CWVA 4LWHA 4L94A 4GQTA 2FYPA 5LGTA 4YKWA 3AG3B 1SZTA 4U7OA 4ZBMA 1S5HC 1SESA 3TETA 1R6KA 2HG1A 1KP3A 2IJKA 3ABKC 5CF0A 1UYKA 2EBOA 1DLBA 2JIZG 2YI7A 3WQ9A 2WI4A 4AWPA 1MG1A 4AWOA 5IYCO 3U2KA 2CCTA 4GGLA 3ABLC 1K8AW 1H2GA 2WLLA 1SRYA 4MVQA 2UXXA 1NQTA 1F51A 1W0JG 3ZXOA 4JAUA 3MNRP 5EC2C 4KQVA 4WUDA 5B1OA 3H80A 1Q7YW 4R50A 5J9PC 4FIPC 5M4HA 2BRCA 1VQOV 3SPJA 2E0AA 2EZPA 1VQKV 2BSMA 1R3LC 1PL0A 1AMWA 3CP1A 4CE3A 3VHAA 4MP7A 3OM3B 4ASUG 3FKSG 3INXA 3TZ0A 3AG4B 2YSUB 2XCMA 1SERA 4U7NA 2YE9A 2D3OW 1NKDA 2IWXA 2EZOA 2YEVB 5LBQA 1AH8A 1IXMA 4LWIA 3W7SA 4GX5A 5KA5A 3R92A 5L3BA 1Q81W 1JM6A 3HHUA 2WLIB 2EILB 1TBWA 3UM7A 3ASNC 3Q5JA 4QE7A 2XNDG 2WAMA 4XE2A 1QR9A 4MVUA 1QLNA 3QO8A 1VQPV 1S77D 2M7WA 2V1DA 4P9PA 3SPGA 1EBOA 5FNFA 3HEKA 1M56B 2PI5A 4WF9V 3ABKB 4JYCA 2IU3A 2XHRA 1YJWV 4URNA 3TZ5A 3HB3B 1Y8NA 1ZXMA 2IH3C 4P9OA 2K1EA 4ZVIA 2QTOA 3A0WA 3VADA 2W0FC 1YT1A 3ABLB 2BOCC 2H55A 5IDMA 2XAJA 3SPIA 4WUBA 1ORQC 4H7QA 1V55C 4R7CA 4I9WA 1NHIA 3QNEA 2YJXA 2WI2A 5GGZA 2JEXA 1TILA 4WFEA 3UKMA 4GT8A 3SYAA 2Q2EB 2XDXA 3WG7B 1H7SA 4EEHA 3TCUA 4MB9A 4G2KA 2XAQA 4GEEA 3SL2A 4CWQA 1R3IC 2ZDIA 2JEUA 3OAAG 2WI1A 4ASAA 3W7UA 1UYEA 3ZRSA 4HY1A 3PEHA 5LGNA 4PA3A 3K0GA 3OMNB 4PU9A 2W6IG 4MVMA 2X6CA 2WERA 1PKXA 2UXNA 4PL9A 3MD0A 4EKWA 1YT0A 5CPHA 3K08A 4UUJC 1AJ6A 3A0TA 4PA4A 1AI5A 4YKTA 3R91A 3OPDA 3U2DA 3K06A 1B62A 4XIPA 1FXKA 3ZKBA 2IW5A 4MTOA 3FB6C 1WPXA 5EC1C 5CA3A 1NVPB 3OWDA 4DZYA 2DW4A 3G4SV 1R73A 1KZNA 3TTZA 1F4NA 2EIJC 1CPYA 4X9LA 2CCSA 4MW8A 3TZ2A 2Q69A 3SYQA 4QPKA 3B8MA 2CCUA 2IU0A 4R1FA 1VQMV 2FXSA 2VCJA 4ASFA 3K3WA 2XOKG 1FXHA 5FL7G 4GX1A 1DF5A 1B63A 3W7XA 5EK0A 4H81A 1UYHA 3JD2A 3FYEB 3R4NA 1FS0G 2YE3A 1OCZC 4AWQA 3B27A 1QY8A 2YGEA 3D2RA 4EGIA 1EA6A 4MVSA 2QKSA 4XD8A 1YETA 4JGSA 2BREA 3SPCA 4RO2A 4BQJA 4LWGA 2P90A 1ENVA 3F5WC 1MABG 1XL4A 2IOPA 4EFTA 2FWZA 1L1FA 2YEAA 3GIEA 5D7CA 1VQLV 1QLEC 4YKZA 3ABTA 2IJHA 1UYLA 3CCQV 3IFXA 3QTFA 5KUMA 3G7EA 3K99A 3PEJA 2Y69C 4TWKA 1FFTB 1H7UA 5CTYA 3EHJA 3KE6A 2JJ1G 4FCPA 1KECA 4MP2A 5BZBA 1YC4A 3Q5KA 4R3AA 4BAEA 3EFFK 1SETA 1S72V 1A4HA 3C11A 4E01A 5IDJA 1BYQA 2HFEC 1YTFD 3O6OA 1M9NA 2HLDG 1NBMG 4CWRA 1UYGA 3U67A 5L3GA 3SYPA 1H38A 4XC0A 1Y4UA 4U93A 1DF4A 1AH6A 3CCLV 5L3DA 4WFFA 1GMGA 2HG5C 1CP9A 1Y4SA 3E8FA 5H9CA 3LDDA 3E35A 1KC8W 3OR6C 3CMAV 1NHHA 2BYIA 3GIGB 3ZKDA 2BU7A 5CBHA 1Q82W 1BKNA 3SYOA 1KP2A 1GKZA 4MVOA 1R3KC 2WI5A 1S14A 4JTCB 1Q86W 3QDDA 3HYZA 3R4PA 4W7TA 3B77A 3F7YC 4XDKA 2Q8FA 2PI4A 3OMAB 5EBMC 3CCMV 1QLEB 4MVRA 3A0YA 2YECA 3IEDA 4FCQA 2P67A 2EILC 2IH1C 1EFRG 1NHJA 4MW3A 2Y69B 3STZC 3ZMTA 1U2OA 3T4ZA 4ZKIA 3ML0A 3CC4V 1OZ0A 1PVGA 2HKJA 3X2QC 3P30A 4MOTA 2HVKC 2Q67A 4XIRA 4FPPA 2A0LA 1Z59A 2O1WA 3TK1A 1UY6A 2Q68A 4EMVA 2BZ5A 1M56C 5M4EA 4WCEV 4R6ZA 1I59A 3ZRVA 2WI6A 2XJJA 1UYCA 4XDLA 2P6JA 3KG2A 1E79G 3CMEV 1I5YA 1Z5CA 2VW5A 4BXIA 3H4LA 2CK3G 2QG2A 4CWSA 2FTKA 4CE1A 1R3JC 3CC2V 2BU8A 2YI6A 2EIMB 1DTOA 1GM8A 1YITV 4RAIA 3O2FA 3G6EV 4HAMA 3WG7C 2CH4A 3B28A 1YC3A 3ASOC 4QIWF 3GB7C 2YEIA 3VBBA 2XHTA 2P7TC 2XX4A 3AG2C 3ABMC 4MPEA 3FT8A 3AEIA 1UY9A 1Y8OA 4UV8A 1BHAA 3E89A 4UVCA 3ZMVA 2OTLV 4WFBV 5M4PA 1KD1W 2YEDA 1BXDA 3JD0A 1YJ9V 1AJNA 3ZRWA 4P30A 3LNUA 2K5BA 4EM7A 3T2SA 3FV5A 2ITCC 2DWEC 1UYMA 2XD6A 2Q8HA 3X2QB 4GT1A 5B1BB 5IYDO 1GO3F 4JTDB 3ZXQA 2DYRC 2YK2A 3C0EA 2YE7A 4NH7A 3E8GA 4MTFA 2BYHA 4LP8A 1OHHG 2EXLA 4HZ5A 1H8HG 4JF3A 2QM7A 5L3EA 2B1GA 2YEFA 4QNHB 4BIUA 2QEXV 4MBCA 1YIJV 3JYCA 2ZDXA 1THNA 1KIJA 3ETGA 2XHXA 3OR7C 3FB7C 3H01A 4FMTA 1AJPA 4HY6A 3OMIB 2WEPA 2XJXA 2ESAA 1K33A 2WI3A 2GSMB 2YEGA 3A0RA 4PA6A 1K3EA 4WFHA 1K5SA 2QA4V 3PJSK 2OCCB 2XASA 3JD4A 4KFGA 4URLA 2YE6A 1K7DA 3D0BA 3ASOB 4MVZA 4L90A 1YTFB 3RVZA 2YGFA 3AG2B 3ABMB 1K4CC 1YESA 1YERA 4P2ZA 2YJWA 3FB8C 1Y66A 2YE2A 3OWBA 2YKBA 4O05A 2WPDG 2O1VA 3E86A 1NH2B 3ZCCA 4YKRA 4L87A 3DTUB 2AHZA 3FB5C 1JPXA 5LGUA 5B3SC 1BL8A 3RLRA 2DYRB 2ZXWB 1VQ7V 4H37A 2YEVA 2HKOA 1G4YB 4UV9A 2XX2A 4WUCA 2Q6AA 1YSRA 1I5CA 3OE7G 1EI1A 3BMYA 1MOFA 3GIFA 2XDLA 5D6PA 2AHYA 5BOCA 1K92A 4PDLA 4DUHA 2WLIA 1NJIW 4LPBA 3FYIB 1RM1B 5M4NA 2QF6A 1GKXA 5D7DA 2WI7A 4PA7A 2XABA 1Y8PA 2OTJV 3CRLA 2GHYA 3INWA 2YKCA 3E83A 2JKIA 1BHBA 3A0XA 3JCZA 4BAYA 5E1AC 5J71A 4CWFA 4L91A 2DQ3A 1CEZA 3RW0A 1U0ZA 3T10A 3F7VC 4O0BA 3OEEG 1UYDA 3HYYA 4PDRA 4NH8A 5F3KA 3RBZA 2YEBA 5BODA 3NMQA 3B26A 3FT5A 3I55V 2AKPA 4O09A 4EFUA 2ITDC 3T0HA 3MHSC 2X0LA 2XAHA 4JYBA 3RLQA 5L3CA 1VQ9V 1WLEA 3CCSV 1YS3A 2BU6A 3E2EA 3B8NA 4OXSA 4YKYA 4R3MA 2ZKJA 5B3SB 4X88A 1PNLA 1K97A 1M1KW 2ATKC 4DO2A 1L0OA 1BGQA 3CGYA 4O07A 1F23A 3BY6A 2YKIA 2QE7G 4ASBA 1S16A 1LNQA 2WLLB 1JOYA 2YEEA 5DN6G 5M4KA 4KP4A 2YE4A 1JVMA 1K73W 1N8RW 1GTOA 1G8MA 1COWG 3ZMUA 4G27B 3O0IA 5IN9A 2UWDA 3R4MA 2Z5UA 1NH2D 2JJCA 2IOQA 2NLJC 4DXWA 2YK9A 1AI6A 4LWEA 4JQLA 2XDSA 2EIMC 4LBEC 4YKUA 5FWKA 3NXSA 2XX5A 1I5DA 1M57B 4BIZA 1W0KG 3QO7A 4R8CA 2WLJA 4KSGA 3K60A 1YSCA 2IORA 1AI7A 4L93A 3WFVA 3EHFA 2ZDYA 4HXZA 1I5AA 3WHAA 3AG1B 2YEHA 3OMUA 1E1QG 5KUKA 2Q8IA 1FXKC 2JDIG 4I3HA 3MHHC 2XAGA 2EINB 5IY5C 4XKKA 2Q8GA 4XDJA 4MTGA 3W7TA 1Z5AA 1NR1A 5CBFA 1MX0A 4AS9A 4B7PA 1AROP 3ZRXA 1PNMA 2OT5A 5B1BC 1VQ4V 4XCJA 5EBLC 4HYPA 1QCEA 4G28B 3CXCU 2WLNA 4PELA 2HCHA 2WSSG 2ZBKB 3OUFA 1I58A 2NNUA 2W6JG 4CWPA 4GCZA 4JAVA 4XDMA 3SJQC 1K5QA 4CWTA 4YKXA 1TUEB 1TH8A 3Q5LA 1VQ6V 4CWNA 2XK2A 4PDMA 3CD6V 4V26A 1THZA 4PRXA 2EJRA 4QPJA 4JASA 1GM7A 4HYOA 2YKJA 1B3QA 5LHGA 4HZ3A 1J95A 1TIDA 3OEHG 3CCJV 3BEHA 2OCCC 1PNKA 4FJCC 1QBZA 3ZMSA 1I5XA 4QE9A 4P8OA 4XBFA 3ZMZA 4TT3G 1YHQV 3ETEA 1M90W 3TUHA 4L8ZA 3ZIAG 1TC6A 2Z3YA 1ZW9A 1OSFA 2C2AA 2DYSC 4WFAV 5B1AB 5HFMA 4HYMA 4JTAB 3CYOA 1JX9A 4CZZA 4LC1A 2IJIA 3GIGA 3LUTB 1JCHA 1FXKB 4KUMA 1ZXNA 4LP0A 5CMUA 4BQGA 1TC0A 2XDKA 2DWDC 3R65A 1K9MW 1OCRC 3E8HA 5IY5B 1ZWIC 3SYCA 4XKOA 2GQPA 3JZ3A 3ZM7A 1P7BA 2ZQMA 1RPOA 2ZXWC 2LFSA 1QYEA 2YE5A 5EBWC 1H8EG 3JD3A 5F5RA 3I56V 2WWWA 2GFDA 4PRVA 4YKQA 4NH9A 2QG0A 2HJFC 3BM9A 4E00A 2IJJA 1I5BA 2XAFA 1UYIA 1GK9A 4UXNA 1RM1C 1AJQA 3GWOA 2YKEA 3ZJZA 4WFGA 3R4OA 3OUSA 2VWCA 4LWFA 4XITA 3G7BA 4UROA 3JD1A 4MT8A 4XIQA 2X6AA 3ABUA 1Z5BA 1UJWB 1YT2A 1KKDA 3T2MA 3ZN1A 3VHCA 4FK5C 2IWUA 5J6AA 4MPCA 5FNCA 4CBCA 4H33A 5CBGA 4KTNA 1ZWHA 3VHDA 5LHHA 2DYSB 4K4OA 1V54C 4UVAA 3RVYA 5CTXA 3TZ4A 4PA9A 2VCIA 1VQ5V 2LFRA 1AR1B 3EHBB 3CGZA 1UY8A 2YGAA 1OCCC 1QZRA 1VQ8V 4JPRA 3CC7V 2X6BA 2H94A 3HPLC 1EZJA 1B6QA 3G75A 1OCRB 4HZ0A 4J9YB 1OCOC 3K04A 1KQSU 5IYBO 3EKOA 2CG9A 3LSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKI A;  3Q5J A;  2XJG A;  1MU5 A;  1L0O A;  1BGQ A;  3CGY A;  1PVG A;  2HKJ A;  4XE2 A;  4O07 A;  4MOT A;  2YKI A;  1AM1 A;  4ASB A;  4XIR A;  1S16 A;  4FPP A;  2YEE A;  1JOY A;  4E01 A;  1Z59 A;  2O1W A;  4HXW A;  4MTX A;  1US7 A;  3TK1 A;  5M4K A;  4KP4 A;  1UY6 A;  4EMV A;  2YE4 A;  2BZ5 A;  5FNF A;  2YE8 A;  3HZ1 A;  3HEK A;  5M4E A;  4JYC A;  1I59 A;  3ZRV A;  2WI6 A;  2XHR A;  4CWO A;  2XJJ A;  1UYC A;  4URN A;  3TZ5 A;  1UYF A;  1Y8N A;  1ZXM A;  2WEQ A;  3T1K A;  3O0I A;  4ZVI A;  5IN9 A;  2UWD A;  3B25 A;  3R4M A;  3B24 A;  1Z5C A;  3A0W A;  3VAD A;  1YT1 A;  2JJC A;  2VW5 A;  4BXI A;  2H55 A;  2IOQ A;  5IDM A;  4WUB A;  3H4L A;  4H7Q A;  2QG2 A;  4CWS A;  1NHI A;  4EGK A;  2FTK A;  2YK9 A;  2YJX A;  3RLP A;  4LWE A;  5CTW A;  4CE1 A;  4JQL A;  2XDS A;  4XTJ A;  4KSH A;  2BU8 A;  4YKU A;  2H8M A;  2YI6 A;  3D36 A;  1ID0 A;  4EGH A;  2WI2 A;  5FWK A;  3NXS A;  2XX5 A;  5GGZ A;  1I5D A;  3O2F A;  1TIL A;  3T0Z A;  4BIZ A;  5FND A;  3LPS A;  4KSG A;  4GT8 A;  2XDU A;  2IOR A;  2Q2E B;  2XDX A;  3K60 A;  2CH4 A;  3B28 A;  2BU2 A;  1YC3 A;  1H7S A;  4L93 A;  4EEH A;  4MB9 A;  3EHF A;  2YEI A;  2FWY A;  2XHT A;  2XX4 A;  2PNR A;  5D6Q A;  2ZDY A;  4MPE A;  4GEE A;  4HXZ A;  1I5A A;  4H85 A;  3EHH A;  3CRK A;  3FT8 A;  3HZ5 A;  3SL2 A;  1UY9 A;  3WHA A;  1Y8O A;  4CWQ A;  2YEH A;  3OMU A;  1YC1 A;  2O1U A;  5M4P A;  5D7R A;  2WI1 A;  4ASA A;  2Q8I A;  2YED A;  1UYE A;  3A0Z A;  1BXD A;  4HY1 A;  3PEH A;  4B6C A;  3ZRW A;  4I3H A;  2BTZ A;  4FCR A;  3LNU A;  4XKK A;  2Q8G A;  2K5B A;  4EM7 A;  1Z5A A;  4PU9 A;  3T2S A;  1MX0 A;  3FV5 A;  4AS9 A;  4B7P A;  4CE2 A;  4O04 A;  2WER A;  3ZRX A;  1UYM A;  4PL9 A;  3MD0 A;  2XD6 A;  2Q8H A;  3K97 A;  4XCJ A;  1YT0 A;  4GT1 A;  5CPH A;  3ZXQ A;  1AJ6 A;  3A0T A;  2YK2 A;  3C0E A;  2YE7 A;  4HYP A;  4YKT A;  3R91 A;  3OPD A;  4NH7 A;  2HCH A;  3U2D A;  2BYH A;  2ZBK B;  1B62 A;  4XIP A;  1I58 A;  3ZKB A;  2EXL A;  4HZ5 A;  2BU5 A;  4CWP A;  2QM7 A;  2BT0 A;  4GCZ A;  2YEF A;  4JAV A;  3K98 A;  4XDM A;  4BIU A;  4E02 A;  3OWD A;  4CWT A;  4YKX A;  4DZY A;  1TH8 A;  3Q5L A;  4I5S A;  1KZN A;  3TTZ A;  4MBC A;  4CWN A;  3EKR A;  2XK2 A;  2QFO A;  5CTU A;  4V26 A;  2ZDX A;  1THN A;  1KIJ A;  2XHX A;  4PRX A;  4FMT A;  4HY6 A;  2CCS A;  4QPJ A;  4X9L A;  2WEP A;  4JAS A;  2XJX A;  2ESA A;  2YI5 A;  2YKJ A;  2WI3 A;  3TZ2 A;  1B3Q A;  2YEG A;  3A0R A;  1TID A;  4QPK A;  2CCU A;  4R1F A;  2FXS A;  2VCJ A;  4ASF A;  5C93 A;  1B63 A;  4H81 A;  4P8O A;  3TUH A;  1UYH A;  1GJV A;  1R62 A;  3R4N A;  4L8Z A;  4KFG A;  4URL A;  1TC6 A;  2YE6 A;  3ZRW B;  2YE3 A;  4AWQ A;  1ZW9 A;  1OSF A;  3B27 A;  1QY8 A;  2YGE A;  4P7A A;  3D0B A;  2C2A A;  3D2R A;  4EGI A;  1EA6 A;  4L90 A;  4XD8 A;  1YET A;  2BRE A;  2YGF A;  4HYM A;  3OW6 A;  5M4M A;  4BQJ A;  4LWG A;  1YES A;  4URM A;  1YER A;  2YJW A;  4MPN A;  2YE2 A;  3OWB A;  2YKB A;  4O05 A;  4LC1 A;  2IOP A;  1UY7 A;  3GIG A;  4EFT A;  2FWZ A;  5B1N A;  2O1V A;  4XKA A;  2YEA A;  3GIE A;  5D7C A;  2YEJ A;  4YKZ A;  1ZXN A;  4LP0 A;  3EHG A;  3ZCC A;  4YKR A;  4BQG A;  1TC0 A;  2XDK A;  1UYL A;  4Q20 A;  4XCL A;  3QTF A;  3P32 A;  3G7E A;  5L3J A;  3K99 A;  4V25 A;  2QM8 A;  3PEJ A;  4XKO A;  2IWS A;  2GQP A;  3JZ3 A;  3ZM7 A;  1H7U A;  3RKZ A;  3RLR A;  5CTY A;  3EHJ A;  2LFS A;  3KE6 A;  4FCP A;  4GFN A;  1QYE A;  4MP2 A;  3DGE A;  1YC4 A;  2YE5 A;  3Q5K A;  4R3A A;  1YSZ A;  2YI0 A;  4BAE A;  5F5R A;  2GFD A;  2WWW A;  4PRV A;  4YKQ A;  4ASG A;  4NH9 A;  2XX2 A;  4WUC A;  2CGF A;  1A4H A;  1YSR A;  3CWV A;  4LWH A;  2QG0 A;  3C11 A;  1I5C A;  1EI1 A;  5IDJ A;  3BMY A;  3GIF A;  2XDL A;  4GQT A;  4L94 A;  5D6P A;  3BM9 A;  5BOC A;  2FYP A;  4E00 A;  1I5B A;  4YKW A;  4DUH A;  1UYI A;  4U7O A;  1BYQ A;  4LPB A;  2HG1 A;  3O6O A;  2YKE A;  5M4N A;  2QF6 A;  1GKX A;  4CWR A;  5D7D A;  5CF0 A;  3R4O A;  1UYG A;  1UYK A;  3U67 A;  2YI7 A;  2WI7 A;  3WQ9 A;  2VWC A;  2XAB A;  4XC0 A;  1Y8P A;  4LWF A;  3CRL A;  1Y4U A;  4U93 A;  2WI4 A;  3INW A;  4XIT A;  2YKC A;  3G7B A;  4URO A;  4AWP A;  1AH6 A;  4MT8 A;  4AWO A;  4XIQ A;  3U2K A;  2JKI A;  2CCT A;  4GGL A;  1Y4S A;  1Z5B A;  3A0X A;  1YT2 A;  5J71 A;  1F51 A;  4CWF A;  3ZXO A;  4JAU A;  3MNR P;  4L91 A;  1NHH A;  3VHC A;  2BYI A;  3GIG B;  2IWU A;  3ZKD A;  2BU7 A;  1U0Z A;  3T10 A;  4KQV A;  1BKN A;  4WUD A;  5J6A A;  5B1O A;  3H80 A;  4O0B A;  4MPC A;  1GKZ A;  5M4H A;  5FNC A;  2BRC A;  1UYD A;  2WI5 A;  3HYY A;  4KTN A;  1ZWH A;  2E0A A;  1S14 A;  2BSM A;  4NH8 A;  3VHD A;  4K4O A;  1AMW A;  5F3K A;  2YEB A;  5CTX A;  3VHA A;  4CE3 A;  5BOD A;  3NMQ A;  3QDD A;  4MP7 A;  3TZ4 A;  2VCI A;  2LFR A;  3B26 A;  3FT5 A;  3INX A;  3HYZ A;  3R4P A;  3TZ0 A;  3CGZ A;  2AKP A;  4O09 A;  4W7T A;  1UY8 A;  2YGA A;  1QZR A;  4EFU A;  2XCM A;  3T0H A;  4U7N A;  2YE9 A;  2Q8F A;  2IWX A;  4JYB A;  3RLQ A;  1AH8 A;  1IXM A;  4LWI A;  3R92 A;  1YS3 A;  3A0Y A;  3G75 A;  2YEC A;  1JM6 A;  3IED A;  4FCQ A;  4HZ0 A;  3HHU A;  2P67 A;  2BU6 A;  4YKY A;  4R3M A;  2ZKJ A;  1NHJ A;  1TBW A;  3EKO A;  1U2O A;  2CG9 A; 
#chains in the Genus database with same CATH topology
 2A9H A;  3ZHV A;  4OX9 O;  1X59 A;  4N23 A;  2XJG A;  1MU5 A;  3KZI Z;  4JI7 B;  2QWR B;  1YJN V;  3ASN B;  1PD3 A;  1SQF A;  2EIK C;  5KAF Z;  4GUN A;  1XBL A;  4DV5 B;  4JI7 O;  1AM1 A;  4LFA B;  3M99 B;  4KFM A;  2V7Q G;  5BXZ A;  4DV0 B;  4JI6 B;  2Q9L A;  3JAT B;  4HXW A;  4MTX A;  2GUZ B;  1US7 A;  1R6N A;  3JAW A;  4DV0 O;  1ROP A;  4KHP B;  3CCE V;  1VQN V;  2YE8 A;  2KKW A;  2A7W A;  2WLH A;  3HZ1 A;  3OW2 U;  3ZX6 A;  4C7U A;  3W7W A;  4KHP O;  4TSF G;  4CWO A;  2R9R B;  4FFB A;  2B5U A;  1AB3 A;  5JJJ B;  1UYF A;  4MS2 A;  2ZR3 A;  2WEQ A;  3T1K A;  4X20 B;  2JJ2 G;  4B3M B;  4FLW A;  3B25 A;  2BTQ B;  3B24 A;  4FFK A;  4QJF B;  4NXN B;  1SQV H;  4RUE A;  3LDC A;  3CWB H;  3LSS A;  1HWY A;  1RFY A;  1AP6 A;  4EGK A;  2CTR A;  4NTW A;  1V55 B;  4DR6 B;  3K0D A;  2PUS A;  3RLP A;  4JI2 B;  5CTW A;  5IJ0 B;  1NR7 A;  2M6Y A;  3U10 A;  4KSH A;  4XTJ A;  2KB1 A;  3SPH A;  3THO A;  2H8M A;  4DR6 O;  3D36 A;  1ID0 A;  4EGH A;  1Q6U A;  2AZ2 A;  1P4R A;  1M57 C;  3T0Z A;  1ZLZ A;  1DGS A;  5FND A;  1V54 B;  2MW2 B;  3K58 A;  3LPS A;  1FXV A;  2B1I A;  5DED A;  4IYI A;  5L3F A;  2XDU A;  4DUY O;  2BU2 A;  4LF6 O;  2RCV A;  2C1I A;  1JJO A;  1FPO A;  4J41 A;  1OCC B;  1S0V A;  2FWY A;  1N32 B;  4YHH B;  2PNR A;  5D6Q A;  3G71 V;  2YIC A;  3AG1 C;  5KHH A;  3E8B A;  4IL6 Z;  3EHH A;  3CRK A;  3HZ5 A;  4H85 A;  3AK3 A;  4F6R A;  4LCU C;  1HR0 B;  3KCX A;  1YC1 A;  2O1U A;  4K35 A;  5D7R A;  4B7E A;  3A0Z A;  3OFN G;  1KMI Z;  4JI1 B;  1OCO B;  4B6C A;  2EIN C;  2YXY A;  2H8P C;  2BTZ A;  5H6R A;  3TXQ A;  5CB4 B;  4FCR A;  1GM9 A;  1JQ0 A;  4YJ2 A;  4ABM A;  1S5L Z;  3STL C;  1JJ2 U;  3EVK A;  5ITZ B;  4CH3 A;  1FAF A;  5CN0 A;  4CE2 A;  4X1Y A;  1RPR A;  4O04 A;  1F4M A;  4YXW G;  4MSW C;  1BCC H;  5GTI Z;  4X66 B;  3K03 A;  2EIK B;  1YI2 V;  2CGN A;  3K97 A;  5F2V O;  2X7R B;  2DJV A;  4X66 O;  3QO5 A;  3TXS A;  1NTZ H;  4E2L A;  2DQ0 A;  3T1C A;  2ZD9 A;  4YJ3 B;  2WLK A;  3N2G B;  2BU5 A;  2BT0 A;  1XMQ O;  4J9Z B;  2AXT Z;  3K98 A;  1Y4M A;  3D3I A;  2LP7 A;  1I08 A;  2QSA A;  3K9A A;  3NR7 A;  3AG3 C;  2F43 G;  4E02 A;  3ZHU A;  3D3Q A;  4O4H A;  3VQV A;  2R9I A;  3CCU V;  1EN6 A;  1S5J A;  2UXD B;  4I5S A;  3B4S A;  3EKR A;  1D2D A;  4X8A A;  1GN6 A;  2Y48 A;  1YEW A;  2QFO A;  5CTU A;  1QVF U;  4O2A B;  1BQZ A;  2EIJ B;  2YI5 A;  2UU9 B;  2BSK A;  4Z1V A;  1S76 D;  2YIB D;  3N2K A;  3K9S A;  3R66 A;  2UU9 O;  3JAL A;  1GAX A;  1KB9 F;  2YDE A;  4RQE A;  4U3J A;  2ZDI C;  3IC7 A;  4PDV A;  1Q43 A;  4N21 A;  5C93 A;  5FPO A;  2GUZ A;  2QM4 A;  4Z1M G;  1GJV A;  3CCV V;  1K34 A;  4DR2 B;  1R62 A;  1GKF A;  2HVJ C;  2QDO A;  2A79 B;  1BMF G;  1S3J A;  2AGA A;  3ZRW B;  1A32 A;  4P7A A;  1XL6 A;  2QWQ B;  4IGG A;  1W2B U;  1OCZ B;  3RT3 C;  5DM6 V;  3ETD A;  4RQF A;  1K4D C;  1MSW D;  3K79 A;  5B1A C;  4TUY A;  2ZE7 A;  4X20 A;  5E79 Z;  4BW5 A;  5KA6 A;  5J2T A;  4UVB A;  2ZM6 B;  3WB1 A;  4F4L A;  2EJ7 A;  5HFL A;  1QVG U;  1BZK A;  4OPH A;  3OW6 A;  5M4M A;  2HHI A;  3ZN0 A;  3OGC C;  1Q90 D;  4RUF A;  5GW7 A;  4GX2 A;  2ZM6 O;  2OIE A;  4URM A;  2BOB C;  2PGG A;  3AG4 C;  4MPN A;  1WJZ A;  1NVP D;  1UY7 A;  3LDE A;  5B1N A;  1HNW O;  4XKA A;  4D6T H;  3CRR A;  2XT9 A;  2YEJ A;  3CJH B;  5H6Q A;  4GX0 A;  1MA1 A;  2DE0 X;  2AZ0 A;  3EHG A;  2HJD A;  3T4D A;  4H44 B;  1MZE A;  2JK5 C;  3CPW U;  1QR8 A;  2WLM A;  2E75 B;  4Q20 A;  4XCL A;  5LHI A;  4GKK O;  3P32 A;  5IT9 N;  3VOU A;  3MAQ A;  2ZR2 A;  1FFX A;  5L3J A;  3L73 H;  4FLT A;  4W4L A;  4V25 A;  1H2M A;  2QM8 A;  2HR3 A;  2IWS A;  1HP8 A;  1WP7 A;  1AI4 A;  4PD4 F;  3IC9 A;  3L70 H;  2MK3 A;  2Z0A A;  3RKZ A;  1E1R G;  3CCR V;  4GFN A;  1IBM B;  1GN2 A;  1JFF A;  3DGE A;  1KUQ A;  1YSZ A;  2YI0 A;  3IGA C;  2CAZ C;  3LNM B;  4ASG A;  1SQP H;  2CGF A;  4X89 A;  4DV2 O;  3M7M X;  3CWV A;  4LWH A;  4J11 A;  4L94 A;  4LF7 B;  4GQT A;  4L8J A;  2FYP A;  3CRA A;  5LGT A;  4W4K A;  4YKW A;  3AG3 B;  3OTO O;  1SZT A;  4U7O A;  4ZBM A;  1S5H C;  1SES A;  3TET A;  1VF5 B;  2QWN B;  1R6K A;  1WP8 A;  2KG7 A;  2HG1 A;  2UXC O;  1I94 O;  4LFC B;  1SA0 B;  1KP3 A;  1Y76 B;  2IJK A;  3O65 A;  3ABK C;  5CF0 A;  5CB4 A;  1UYK A;  4ZOL B;  2EBO A;  1DLB A;  2JIZ G;  2YI7 A;  3WQ9 A;  4GKJ O;  5LOV A;  4LFC O;  1DK1 A;  2WI4 A;  3UQ8 A;  4AWP A;  2VWJ A;  1GRJ A;  1MG1 A;  4AWO A;  5LMN B;  5IYC O;  3U2K A;  1N0J A;  2CCT A;  4GGL A;  3ABL C;  2LGQ A;  1K8A W;  2DMX A;  2LW1 A;  3G80 A;  4I4T A;  1WAZ A;  1H2G A;  1XNR B;  2WLL A;  1SRY A;  1YZB A;  4MVQ A;  5LA6 A;  1NTM H;  4GYC B;  2UXX A;  1NQT A;  1F51 A;  1W0J G;  3ZXO A;  4JAU A;  3MNR P;  4GLX A;  5EC2 C;  3N2G A;  4KQV A;  5J2U B;  4WUD A;  4DR4 B;  5DEC A;  5B1O A;  3H80 A;  1Q7Y W;  4TV8 B;  4R50 A;  5J9P C;  4FIP C;  2ZIN A;  4YY3 B;  5M4H A;  5KX5 A;  2QKC A;  2BRC A;  4DRX B;  3E22 A;  1VQO V;  3SPJ A;  2E0A A;  2EZP A;  1VQK V;  2BSM A;  1RSO B;  1R3L C;  4YY3 O;  3JAK B;  1PL0 A;  3F5T A;  1AMW A;  3RYC A;  3CP1 A;  4CE3 A;  3VHA A;  4MP7 A;  1VIB A;  3OM3 B;  1HW7 A;  4O2A A;  4ASU G;  3FKS G;  3INX A;  1JA8 A;  3TZ0 A;  5JQG B;  3AG4 B;  3QF7 A;  5BMV B;  2G38 A;  2YSU B;  4TQD A;  2XCM A;  1SER A;  4U7N A;  2YE9 A;  2D3O W;  1NKD A;  2N04 A;  2IWX A;  4DV7 B;  2EZO A;  4I9Q A;  2WA4 A;  3G6B A;  4LH7 A;  2YEV B;  5LBQ A;  1AH8 A;  1IXM A;  4LWI A;  1US6 A;  3W7S A;  4GX5 A;  5KA5 A;  4DV7 O;  3R92 A;  5L3B A;  1Q81 W;  4IYH A;  1JM6 A;  1T5E A;  5A2Q N;  4DV3 O;  3HHU A;  2CTQ A;  2WLI B;  2IM9 A;  1YF2 A;  1OJH A;  2EIL B;  1TBW A;  3SDL A;  4EB6 B;  3IJ4 A;  3UM7 A;  2QWP B;  4ZHQ B;  4PI2 A;  1XHZ A;  3QVN A;  3ASN C;  3Q5J A;  4QE7 A;  2XND G;  2WAM A;  4AI8 A;  3ZHS A;  3IAY A;  4XE2 A;  1QR9 A;  3RYF B;  4MVU A;  2BCC H;  3QO8 A;  1QLN A;  3S3W A;  2UXB B;  3L9D A;  1VQP V;  2DN9 A;  1S77 D;  3SJC C;  1SC5 B;  2M7W A;  2V1D A;  2JS3 A;  4P9P A;  3SPG A;  4J80 A;  2CTW A;  1EBO A;  5FNF A;  1SF9 A;  2P4V A;  2ARH A;  4O2B A;  3HEK A;  1M56 B;  2PI5 A;  4WF9 V;  3ABK B;  2VQF O;  4JYC A;  2IU3 A;  2XHR A;  2RJZ A;  1YJW V;  4URN A;  5KHI A;  3QTC A;  3TZ5 A;  2ZT9 B;  2LGW A;  3HB3 B;  1Y8N A;  1ZXM A;  2IH3 C;  4P9O A;  2K1E A;  4ZVI A;  3ZED A;  2ADQ B;  5LXT A;  2QTO A;  3A0W A;  3VAD A;  1IDS A;  2W0F C;  1YT1 A;  3ABL B;  4NVP A;  2BOC C;  2H55 A;  5IDM A;  2XAJ A;  3SPI A;  4WUB A;  1ORQ C;  4H7Q A;  1O9H A;  2GTS A;  1V55 C;  4O4L B;  4R7C A;  4I9W A;  1NHI A;  3QNE A;  1ZSP A;  2CTP A;  1BSM A;  2YJX A;  4K0K B;  1TUB A;  1ZL8 A;  3S3X A;  4NTY A;  1VAR A;  2WI2 A;  1JR9 A;  5GGZ A;  3CX5 F;  2JEX A;  3J80 N;  1TIL A;  3JCU Z;  4WFE A;  3D8C A;  5EYP B;  3UKM A;  2QKA A;  1AIL A;  4GT8 A;  3SYA A;  2Q2E B;  2XDX A;  4ZOL A;  1RP3 B;  4X62 B;  3WG7 B;  1H7S A;  4EEH A;  2VRZ A;  3TCU A;  4MB9 A;  3U11 A;  1AR5 A;  4X62 O;  4K8Z A;  4G2K A;  4B3S B;  2XAQ A;  1XRE A;  1O9G A;  4GEE A;  3SL2 A;  4PV1 B;  1XQ8 A;  4CWQ A;  4B3S O;  2L6L A;  1R3I C;  2ZDI A;  2JEU A;  3JAS A;  3OAA G;  5B5E Z;  2WI1 A;  4ASA A;  5H5N A;  3W7U A;  1UYE A;  1J5E B;  3ZRS A;  4HY1 A;  3PEH A;  2ZKO A;  2R72 A;  4TV8 A;  5LGN A;  4PA3 A;  1J5E O;  2NN4 A;  5GON A;  3K0G A;  3OMN B;  4PU9 A;  1RSO A;  2W6I G;  4MVM A;  3JAK A;  2EX3 A;  2X6C A;  2WER A;  2F95 B;  4I0X B;  1PKX A;  2UXN A;  4PL9 A;  3MD0 A;  4EKW A;  1YT0 A;  5CPH A;  3K08 A;  2IBZ H;  4UUJ C;  1AJ6 A;  3A0T A;  4PA4 A;  1AI5 A;  4YKT A;  3R91 A;  1Q3E A;  3OPD A;  5KMG B;  4DYL A;  3U2D A;  4NR1 A;  3K06 A;  2Y0P A;  1TGO A;  1B62 A;  4XIP A;  1FXK A;  3ZKB A;  1W59 A;  2IW5 A;  4LWS A;  3P3N A;  1FYJ A;  4MTO A;  4AIL C;  3FB6 C;  1URF A;  1GH6 A;  1WPX A;  5EC1 C;  5CA3 A;  1NVP B;  3OWD A;  4DZY A;  2DW4 A;  3G4S V;  1R73 A;  1KZN A;  3TTZ A;  5D5Q A;  3J7A U;  1F4N A;  5KHG A;  2EIJ C;  3LNN A;  1CPY A;  4B3T O;  5FNV A;  3BFR A;  4X9L A;  2CCS A;  3BPZ A;  4MW8 A;  4HNA A;  4CH6 A;  1N33 O;  3TZ2 A;  2FML A;  2Q69 A;  3SYQ A;  4FM0 A;  4QPK A;  3RYF A;  3B8M A;  3O9O A;  2CCU A;  2IU0 A;  3H1J H;  5IJ9 B;  3WB0 A;  4R1F A;  5LYJ B;  1VQM V;  2FXS A;  4DUZ O;  2VCJ A;  3K3W A;  2XOK G;  1FJG O;  4ASF A;  1FXH A;  5FL7 G;  4KXR A;  4GX1 A;  1DF5 A;  5EZY A;  4BIO A;  1B63 A;  3W7X A;  2Y4U A;  4DUY B;  5EK0 A;  4H81 A;  4LF6 B;  1UYH A;  3JD2 A;  3FYE B;  3R4N A;  1SS3 A;  2NR5 A;  4NB5 A;  1FS0 G;  4LFB B;  2YE3 A;  1OCZ C;  4AWQ A;  4DW1 A;  3B27 A;  1QY8 A;  4WBN A;  2YGE A;  3D2R A;  4EGI A;  1EA6 A;  4LNU A;  3Q4H A;  4LFB O;  1Q6I A;  4MVS A;  3RN4 A;  2QKS A;  4XD8 A;  1YET A;  4JGS A;  2JGD B;  2BRE A;  3SPC A;  1M5I A;  4RO2 A;  4BQJ A;  4LWG A;  2P90 A;  3PN1 A;  5H2F Z;  2A06 H;  1ENV A;  3F5W C;  1MAB G;  1XL4 A;  2IOP A;  4JAA A;  4EFT A;  2FWZ A;  1XOU A;  1L1F A;  2YEA A;  3GIE A;  5D7C A;  1VQL V;  1QLE C;  4YKZ A;  1ZUQ A;  4DR5 O;  3ABT A;  2IJH A;  3CS5 A;  1UYL A;  3CCQ V;  3IFX A;  3QTF A;  5KUM A;  3G7E A;  1N34 B;  1N36 O;  3K99 A;  5CA0 A;  3PEJ A;  1MNG A;  5JH7 B;  2Y69 C;  4TWK A;  1YDX A;  1N34 O;  1FFT B;  1H7U A;  2RMK B;  1Y6X A;  5CTY A;  3EHJ A;  3KE6 A;  2JJ1 G;  4FCP A;  1KEC A;  4MP2 A;  3H9V A;  3C3S A;  5BZB A;  1YC4 A;  1XMQ B;  3JAR B;  3Q5K A;  1EM1 A;  4R3A A;  4BAE A;  4IIJ B;  1LR1 A;  1WNS A;  3EFF K;  3HKE B;  1SET A;  1S72 V;  4DV6 B;  1G6U A;  1Y67 A;  1A4H A;  1LUV A;  4B3R B;  3C11 A;  4E01 A;  5IDJ A;  4DV6 O;  1D5A A;  2Q7H A;  2H3O A;  1BYQ A;  2HFE C;  4B3R O;  3WU2 Z;  5A9G A;  3OGI B;  1YTF D;  3O6O A;  4AQY B;  4JZ2 A;  5JJE B;  2PTM A;  1M9N A;  2HLD G;  1XUQ A;  1I7F A;  1NBM G;  2ILM A;  4CWR A;  4B08 A;  1UYG A;  3U67 A;  5L3G A;  3SYP A;  4AQY O;  1H38 A;  1HDJ A;  4XC0 A;  1Y4U A;  4U93 A;  2ZNJ A;  1DF4 A;  5KLV H;  1AH6 A;  3CCL V;  2CDY A;  4OGQ B;  5LL6 Y;  5L3D A;  4WFF A;  1GMG A;  2YUA A;  2HG5 C;  1CP9 A;  1Y4S A;  1AP5 A;  3DSQ A;  3BA9 A;  5KMG A;  3JAT A;  3E8F A;  5H9C A;  1Z2G A;  3LDD A;  3E35 A;  1KC8 W;  3OR6 C;  3CMA V;  1NHH A;  2BYI A;  1VF6 C;  1Y74 B;  3GIG B;  3ZKD A;  2BU7 A;  5CBH A;  3UO2 A;  1Q82 W;  1BKN A;  3CSX A;  3SYO A;  1KP2 A;  1GKZ A;  4MVO A;  1R3K C;  1IVS A;  5CA1 B;  2YIA A;  2WI5 A;  1GN3 A;  1S14 A;  4JTC B;  2E5L O;  2N74 A;  1UPG A;  2BTQ A;  2JVD A;  3CEI A;  1Q86 W;  3QDD A;  5JCO C;  5EIB D;  4JV5 B;  3SJB C;  1HNW B;  4D7S A;  3HYZ A;  3R4P A;  1IBK O;  2ZNI A;  1HNX O;  4W7T A;  4JV5 O;  3B77 A;  3F7Y C;  1VF7 A;  4X64 O;  1I0H A;  4TV9 B;  4XDK A;  2Q8F A;  2PI4 A;  5IJ0 A;  4GKK B;  4Z2W A;  3OMA B;  1TVK B;  5EBM C;  1G1X B;  3CCM V;  1QLE B;  4MVR A;  1EN5 A;  3A0Y A;  1XIL A;  1M4U A;  2YEC A;  3VQW A;  2VQE B;  3IED A;  4FCQ A;  2P67 A;  2CH7 B;  2EIL C;  2B9Z A;  4BW9 A;  2IH1 C;  2VQE O;  1EFR G;  2YXL A;  1NHJ A;  4MW3 A;  2Y69 B;  3STZ C;  2UUB B;  3ZMT A;  2UUA B;  2OWO A;  1U2O A;  1KYO F;  3T4Z A;  4ZKI A;  3ML0 A;  3CC4 V;  4DV2 B;  5JJN B;  2UUB O;  2UUA O;  2KQX A;  1OZ0 A;  2JGD A;  1PVG A;  2HKJ A;  3A8T A;  3X2Q C;  5K1P A;  4NXM O;  3OTO B;  3P30 A;  5C8Y B;  4MOT A;  2HVK C;  4ICG A;  2Q67 A;  4XIR A;  4FPP A;  2A0L A;  2UXC B;  1I94 B;  1Z59 A;  2O1W A;  2N05 A;  4CS4 A;  3TK1 A;  4GZR B;  1UY6 A;  4GKJ B;  2Q68 A;  4EMV A;  2BZ5 A;  2F1M A;  1M56 C;  3K57 A;  2F4V B;  2ZE8 A;  3C90 A;  3DXR B;  1B04 A;  4O4J B;  5M4E A;  4WCE V;  4R6Z A;  3D36 C;  1I59 A;  3ZRV A;  2WI6 A;  2XJJ A;  1UYC A;  4XDL A;  4I50 B;  5ITZ A;  2F4V O;  1P7G A;  2P6J A;  3KG2 A;  1E79 G;  4QGP A;  3K5N A;  3A0H Z;  3CME V;  1SQQ H;  4LR3 A;  1I5Y A;  1Z5C A;  1D5N A;  1BS3 A;  2VW5 A;  1XNQ O;  4BXI A;  1B06 A;  1WN7 A;  3H4L A;  2ODM A;  3JAR A;  1BE3 H;  4IIJ A;  1KBH A;  2CK3 G;  3HKE A;  3T1H B;  2QG2 A;  2ZCE A;  4D7T A;  4CWS A;  3HKB B;  4YJ3 A;  3HKC B;  2FTK A;  3JSL A;  4CE1 A;  1R3J C;  3RYI B;  3T1H O;  3CC2 V;  4FZ0 A;  3A0B Z;  2BU8 A;  2YI6 A;  2EIM B;  5LMU B;  1DTO A;  1GM8 A;  1SKV A;  1YIT V;  1H2K A;  1WB8 A;  4RAI A;  3O2F A;  3G6E V;  5LMU O;  4HAM A;  3WG7 C;  4O4I B;  2CH4 A;  3B28 A;  1X4T A;  2HHH B;  2PZS A;  1YC3 A;  4X65 B;  3ASO C;  3SR2 C;  4QIW F;  3GB7 C;  4J7Z A;  3DC6 A;  1M93 A;  1PL4 A;  3VBB A;  2YEI A;  1MZF A;  2XHT A;  2HHH O;  2P7T C;  2XX4 A;  4X65 O;  1PPJ H;  3AG2 C;  3ABM C;  4MPE A;  3FT8 A;  3AEI A;  1UY9 A;  4DV3 B;  1Y8O A;  4UV8 A;  1BHA A;  3E89 A;  5FLX N;  4UVC A;  2P5O A;  3ZMV A;  2OTL V;  4EFE A;  4WFB V;  5M4P A;  3H1H H;  2LO1 A;  1Y74 A;  1KD1 W;  2YED A;  3ZHQ A;  4LF4 O;  1WA8 B;  1BXD A;  4BR6 A;  3JAW B;  3JD0 A;  1YJ9 V;  1AJN A;  5KHJ A;  2GDS A;  3ZRW A;  4P30 A;  3LNU A;  5CA1 A;  2K5B A;  4EM7 A;  3T2S A;  1U97 A;  3FV5 A;  4DW0 A;  2ITC C;  2OYQ A;  2WA3 A;  2F93 B;  2A3Q A;  3BRC A;  3A2F A;  4DK0 A;  2DWE C;  1UYM A;  2XD6 A;  1PV0 A;  2Q8H A;  3X2Q B;  2YC0 A;  4GT1 A;  5B1B B;  4TQF A;  5IYD O;  1GO3 F;  4JTD B;  3ZXQ A;  2DYR C;  2YK2 A;  3C0E A;  2YE7 A;  5D5P A;  1HNZ O;  4NH7 A;  3E8G A;  4MTF A;  2BYH A;  4LP8 A;  4NKG B;  2JS5 A;  1OHH G;  5EIB C;  2XHB A;  2VQF B;  4LF9 O;  3CJH A;  2EXL A;  4HZ5 A;  1H8H G;  1MSD A;  4JF3 A;  2QM7 A;  4LF8 B;  1H2S B;  5L3E A;  2B1G A;  2YEF A;  1N0N A;  2Q7E A;  4QNH B;  4BIU A;  2QEX V;  4LF8 O;  1AR4 A;  1TA8 A;  2CH7 A;  4MBC A;  2PF4 E;  4JYY A;  5JEN A;  1YIJ V;  3JYC A;  2ZDX A;  1THN A;  1LUW A;  1KIJ A;  4DV4 O;  3ETG A;  2XHX A;  3OR7 C;  3FB7 C;  3H01 A;  4FMT A;  1AJP A;  1FKA O;  4HY6 A;  3OMI B;  2WEP A;  2XJX A;  2ESA A;  3OTF A;  4CC5 A;  4E72 A;  1K33 A;  2WI3 A;  2GSM B;  2YI9 A;  2YEG A;  3OD4 A;  3A0R A;  2PY5 A;  4PA6 A;  1K3E A;  4WFH A;  1K5S A;  2VWK A;  2QA4 V;  2XUM A;  3PJS K;  4F6R B;  4X1K B;  3KKY A;  2OCC B;  2YI8 A;  2XAS A;  3QG5 A;  1SA0 A;  3GVM A;  3JD4 A;  1Y76 A;  3GWK C;  2BE3 A;  4KFG A;  1L8D A;  1R6T A;  4URL A;  1BT8 A;  2YE6 A;  1NTK H;  3VQY A;  1K7D A;  3D0B A;  4I7Z B;  4YJ2 B;  1YCI A;  3RYH B;  2Q0A A;  2ZE6 A;  1U96 A;  3L71 H;  3ASO B;  4DR3 B;  4MVZ A;  4L90 A;  1YTF B;  4IT5 A;  3UT5 B;  3RVZ A;  2YGF A;  4CS2 A;  1VMG A;  4UCU A;  4DR3 O;  3AG2 B;  3ABM B;  1K4C C;  1YES A;  2Q7G A;  1YER A;  4P2Z A;  2YJW A;  3FB8 C;  1Y66 A;  3RGB A;  2YE2 A;  3OWB A;  2YKB A;  4O05 A;  2WPD G;  2VS0 A;  3HKC A;  2O1V A;  5J2U A;  1VF6 A;  3BA8 A;  2PYJ A;  3E86 A;  3RYI A;  1NH2 B;  4K8X A;  3ZCC A;  4YKR A;  4DRX A;  4L87 A;  5LP6 C;  3DTU B;  2AHZ A;  4IHJ B;  3FAV B;  4DR1 B;  4CS3 A;  4O4H B;  3SJA C;  3FB5 C;  1JPX A;  3MDS A;  5LGU A;  4UFZ A;  5B3S C;  4DR1 O;  1NZ6 A;  4CC6 A;  2OIG A;  5JCO A;  4ZIB A;  4JI0 B;  5IE9 A;  1BL8 A;  5JQG A;  3RLR A;  5BMV A;  4Q6G A;  2DYR B;  4FLX A;  3KCY A;  2ZXW B;  4JI0 O;  4LF5 B;  1EZV H;  2BSK B;  1VQ7 V;  4H37 A;  2YEV A;  2HKO A;  1G4Y B;  3N2K B;  1ZTE A;  4UV9 A;  2QGN A;  2XX2 A;  4WUC A;  1JMK C;  4LF5 O;  1XEQ A;  2Q6A A;  3JAL B;  1YSR A;  4FM1 A;  3I5D A;  1I5C A;  3OE7 G;  1QHT A;  4U3J B;  1MOF A;  4J7J A;  1EI1 A;  2XDL A;  3BMY A;  3GIF A;  2AHY A;  5D6P A;  5BOC A;  1K92 A;  4PDL A;  2W0X A;  4DUH A;  2WLI A;  4DV5 O;  1NJI W;  4B3T B;  1WA8 A;  4E4E A;  3K5O A;  4LFA O;  4LPB A;  3BHP A;  4JI6 O;  3FYI B;  4UCS A;  3RWR D;  2FYU H;  1RM1 B;  4EB6 A;  4FLV A;  5M4N A;  2QF6 A;  1R1B A;  2E74 B;  1N33 B;  1GKX A;  3TJT A;  5D7D A;  4ZHQ A;  1H2L A;  2WI7 A;  2Q5Z A;  3J81 N;  4PA7 A;  2XAB A;  1Y8P A;  4TOI A;  2OTJ V;  3CRL A;  2GHY A;  3INW A;  2YKC A;  2KSD A;  2QJ1 A;  3AK2 A;  4DUZ B;  1FJG B;  3E83 A;  4TUY B;  5J2T B;  3TGU H;  2JKI A;  1BHB A;  2HP8 A;  4H13 B;  3A0X A;  4AHC A;  4B3M O;  3JCZ A;  1VP7 A;  5AG2 A;  4BAY A;  1Z5W A;  3H1L H;  5E1A C;  5J71 A;  1AVM A;  4CWF A;  5JVD B;  4L91 A;  2DQ3 A;  1CEZ A;  1ZX3 A;  3UO3 A;  4NXN O;  3RW0 A;  1U0Z A;  3JSN A;  3VQX A;  3T10 A;  1CXZ B;  1YVW A;  3F7V C;  4O0B A;  1QQC A;  3K5L A;  3OEE G;  1UYD A;  1NI8 A;  3HYY A;  4JI2 O;  4PDR A;  3S5T A;  4NH8 A;  1IXB A;  5F3K A;  3RBZ A;  4FLZ A;  2YEB A;  1FFX B;  5BOD A;  2RN9 A;  3NMQ A;  3M8A A;  4I55 B;  5IWA B;  3B26 A;  3FT5 A;  3K59 A;  3I55 V;  2AKP A;  4O09 A;  4O4L A;  1NU1 H;  2ITD C;  3T0H A;  4EFU A;  4DR5 B;  1JFF B;  3MHS C;  5IWA O;  2X0L A;  3SGI A;  2XAH A;  1GN4 A;  4JYB A;  3RLQ A;  5L3C A;  2GBO A;  1N36 B;  2E76 B;  1VQ9 V;  1WLE A;  3CCS V;  4X1K A;  4FLU A;  1N32 O;  1YS3 A;  4YHH O;  3BAB A;  5LP6 B;  1NT2 B;  5FPR A;  5JWP A;  3T1Y B;  3E2E A;  2BU6 A;  5EYP A;  1HR0 O;  3B8N A;  4OXS A;  2OCH A;  4A5U B;  4R3M A;  2KG7 B;  2ZKJ A;  4YKY A;  5B3S B;  4X88 A;  3BCC H;  5GTH Z;  3CRQ A;  3T1Y O;  1PNL A;  1K97 A;  1P49 A;  4JI1 O;  3RYH A;  1M1K W;  5LOV B;  2ATK C;  2JRI A;  4X1I B;  4DO2 A;  1L0O A;  3UT5 A;  4YIO A;  1BGQ A;  3CGY A;  3RFR A;  4O07 A;  3CYG A;  1F23 A;  3ZS8 C;  3BY6 A;  2YKI A;  2QE7 G;  4ASB A;  1S16 A;  4I4T B;  2YID A;  1LNQ A;  2WLL B;  2YIB A;  3L72 H;  1JOY A;  5LA6 B;  2YEE A;  5DN6 G;  5M4K A;  4KP4 A;  2E3C A;  2DOS A;  4OPA A;  2YE4 A;  1JVM A;  1K73 W;  4EEQ A;  1N8R W;  3B2E E;  1GTO A;  1G8M A;  4IHJ A;  3P3P A;  1COW G;  3FAV A;  5KX5 B;  2O57 A;  3E22 B;  3ZMU A;  2ZIO A;  4UCT A;  1IX9 A;  4G27 B;  4I0X A;  4UCV A;  3O0I A;  3RYC B;  4FVM A;  4PI0 A;  2UWD A;  2D2C B;  5IN9 A;  3R4M A;  2Z5U A;  4UB8 Z;  1NH2 D;  1YXB A;  3WB2 A;  1XDC A;  2UXD O;  2JJC A;  2IOQ A;  4RWU A;  2NLJ C;  4DXW A;  2Q73 A;  4DV1 B;  3DC5 A;  4BWA A;  1L0L H;  2YK9 A;  1AI6 A;  3ZHR A;  4LWE A;  4JQL A;  2XDS A;  2EIM C;  2FB5 A;  4LBE C;  2E5L B;  1WPB A;  4YKU A;  4DV1 O;  3AG7 A;  5FWK A;  1FD9 A;  4B7K A;  3NXS A;  2K9P A;  2XX5 A;  1I5D A;  5K1X A;  3CRM A;  4X9Q A;  2P4K A;  2ZIM A;  1UFI A;  1M57 B;  4BIZ A;  3ZBH A;  1W0K G;  3QO7 A;  1IBK B;  1HNX B;  4R8C A;  2WLJ A;  4KSG A;  3CE2 A;  3CXH F;  3K60 A;  1YSC A;  2IOR A;  1AI7 A;  4X64 B;  1F7Y A;  4L93 A;  4DK1 A;  3WFV A;  4DR2 O;  2L35 A;  2QR4 A;  3EHF A;  5BR8 B;  2UUC B;  4PHZ A;  5IJ9 A;  2ZDY A;  4HXZ A;  1MMM A;  5LYJ A;  1I5A A;  2P06 A;  5BR8 O;  3WHA A;  2UUC O;  3AG1 B;  2YEH A;  3OMU A;  5JVD A;  3JAM N;  1E1Q G;  3CRC A;  2YS8 A;  2CE4 A;  4CH5 A;  5KUK A;  2Q8I A;  1QU7 A;  1FXK C;  3CHX A;  3L75 H;  2PYL A;  4EFB A;  2JDI G;  4I3H A;  3MHH C;  2XAG A;  4UCR A;  2EIN B;  2CUG A;  4O2B B;  5IY5 C;  4XKK A;  2Q8G A;  4XDJ A;  4MTG A;  3W7T A;  1Z5A A;  1NR1 A;  4NXM B;  5CBF A;  1MX0 A;  4NTX A;  4AS9 A;  4B7P A;  1ARO P;  3ZRX A;  1PNM A;  2OT5 A;  5B1B C;  4I55 A;  2XTA A;  1VQ4 V;  4XCJ A;  5LXT B;  2GTA A;  1EN4 A;  5EBL C;  3UCS C;  4HYP A;  1QCE A;  4G28 B;  3CXC U;  2WLN A;  4PEL A;  3G67 A;  2HCH A;  2WSS G;  4FLY A;  2ZBK B;  3OUF A;  1N4C A;  1I58 A;  4YIP A;  1QNM A;  1IBM O;  2NNU A;  2W6J G;  4CWP A;  4GCZ A;  4JI8 B;  4JI4 B;  4JAV A;  4XDM A;  3SJQ C;  1TUB B;  1XHX A;  5B66 Z;  1ZL8 B;  1K5Q A;  5LP6 A;  5KHK A;  2YXH A;  2HEP A;  4CWT A;  4YKX A;  1TUE B;  1TH8 A;  4JI8 O;  4JI4 O;  4K3A A;  3Q5L A;  2FL4 A;  1VQ6 V;  1XNQ B;  4CWN A;  2CGO A;  4LF7 O;  5JH7 A;  2XK2 A;  4PDM A;  3CD6 V;  4V26 A;  1THZ A;  1SQB H;  3U0Z A;  4PRX A;  3B40 A;  2EJR A;  4QPJ A;  4JAS A;  3LSU A;  1GM7 A;  3C3T A;  4X1I A;  3ZHT A;  4HYO A;  4ZI7 B;  2YKJ A;  3HKD B;  1B3Q A;  4UCO A;  5LHG A;  2Q0O C;  4HZ3 A;  1J95 A;  1TID A;  2FKX A;  3OEH G;  3APO A;  3BVO A;  3CCJ V;  2Q8V A;  2R70 A;  3BEH A;  2OCC C;  1PNK A;  5LMN O;  4FJC C;  1QBZ A;  2EUL A;  3JAS B;  3ZMS A;  1XNR O;  1I5X A;  4QE9 A;  4P8O A;  4XBF A;  3ZMZ A;  4TT3 G;  1YHQ V;  2AW9 A;  3ETE A;  1M90 W;  3TUH A;  4L8Z A;  5IYZ B;  3ZIA G;  1TC6 A;  4JYA B;  2Z3Y A;  1ZW9 A;  1OSF A;  2C2A A;  5GON B;  2F66 C;  1IUR A;  3OT7 A;  2DYS C;  4DR4 O;  4WFA V;  4JYA O;  5B1A B;  2ETN A;  5HFM A;  4HYM A;  5KAI Z;  1SQG A;  3HR0 A;  4JTA B;  4LF4 B;  3APQ A;  3CYO A;  4KL1 A;  3H1K H;  1JX9 A;  4CZZ A;  1TAE A;  4LC1 A;  2IJI A;  3GIG A;  2ADP A;  3LUT B;  1JCH A;  1FXK B;  2RNB A;  4KUM A;  4LWS B;  1ZXN A;  1OV9 A;  4LP0 A;  5CMU A;  4BQG A;  1TC0 A;  2XDK A;  1XI1 A;  2DWD C;  3R65 A;  1K9M W;  1V9P A;  1OCR C;  2F23 A;  3E8H A;  4FFB B;  1ZWI C;  5IY5 B;  1Z5V A;  1Q8I A;  3SYC A;  2BTO A;  4XKO A;  2GQP A;  1HNZ B;  3JZ3 A;  1SZX A;  3ZM7 A;  1P7B A;  2QWO B;  5FNV B;  4LF9 B;  2ZQM A;  1RPO A;  2ZXW C;  2LFS A;  1P84 F;  3B09 A;  1QYE A;  2QTS A;  1Q5O A;  2YE5 A;  5EBW C;  4TV9 A;  1H8E G;  4HNA B;  3JD3 A;  4NYK A;  3I56 V;  2WWW A;  2GFD A;  5F5R A;  3EXA A;  1BQ0 A;  4PRV A;  4YKQ A;  1TVK A;  4NH9 A;  4J42 A;  1L0N H;  1BGY H;  3ETQ A;  1ZAU A;  2QG0 A;  2HJF C;  3BM9 A;  4E00 A;  2IJJ A;  1I5B A;  2XAF A;  4DV4 B;  1UYI A;  3ICX A;  5EZY B;  1GK9 A;  2UXB O;  3FX7 A;  4UXN A;  4FZ1 A;  1RM1 C;  2LJ2 A;  1AJQ A;  3K5M A;  3GWO A;  2YKE A;  2Q4P A;  3ZJZ A;  4WFG A;  2V4D A;  3R4O A;  1PP9 H;  3OUS A;  2VWC A;  4WBN B;  1XMO B;  4LWF A;  2LQT A;  4XIT A;  3G7B A;  4URO A;  4LNU B;  3JD1 A;  4J7K A;  3Q4H B;  4UB6 Z;  4MT8 A;  1Q6H A;  5C8Y A;  2GV9 A;  4XIQ A;  1XMO O;  1WB7 A;  2X6A A;  3H1I H;  3ABU A;  1Z5B A;  1UJW B;  2C1G A;  1YT2 A;  1KKD A;  3T2M A;  3ZN1 A;  4LH6 A;  1VEW A;  3VHC A;  3FD9 A;  4FK5 C;  4JI5 B;  2IWU A;  4HBN A;  1KKC A;  3DXR A;  3BAA A;  5J6A A;  4O4J A;  2P22 C;  4JI5 O;  4MPC A;  5BY1 A;  1H2N A;  3CB2 A;  2Y4T A;  5FNC A;  4CBC A;  4H33 A;  4JI3 B;  5CBG A;  4I50 A;  1SQX H;  3L74 H;  1ZWH A;  4KTN A;  3AK1 A;  4K0K O;  3VHD A;  5LHH A;  2DYS B;  4K4O A;  1V54 C;  2RQ6 A;  4UVA A;  4JI3 O;  3RVY A;  5CTX A;  4X1Y B;  3N27 A;  5CA0 B;  4J10 A;  3TZ4 A;  4PA9 A;  2VCI A;  4FM2 A;  1VQ5 V;  4PJ0 Z;  2LFR A;  1AR1 B;  3EHB B;  1KU9 A;  4F6E A;  3CGZ A;  4ZI7 A;  1UY8 A;  4DR7 B;  2YGA A;  1OCC C;  3HKD A;  1QZR A;  1VQ8 V;  4H0L B;  4JPR A;  3HKB A;  4JZG A;  4U3F H;  2LW7 A;  3CC7 V;  2X6B A;  3LMM A;  4DR7 O;  4CH4 A;  2H94 A;  3HPL C;  1EZJ A;  1B6Q A;  1PM9 A;  2Y0I A;  2ZE5 A;  5TIS Z;  3G75 A;  1OCR B;  4HZ0 A;  4J9Y B;  1IBL B;  1NS1 A;  1OCO C;  3K04 A;  1KQS U;  5IYB O;  3FFQ A;  5IYZ A;  2JGU A;  1IZ3 A;  4O4I A;  1IBL O;  2R9A A;  4OX9 B;  2RDC A;  3EKO A;  2CG9 A;  3LSQ A; 
#chains in the Genus database with same CATH homology
 2A9H A;  4N23 A;  2XJG A;  1MU5 A;  1YJN V;  3ASN B;  1PD3 A;  2EIK C;  1AM1 A;  3M99 B;  4KFM A;  2V7Q G;  4HXW A;  4MTX A;  1US7 A;  1R6N A;  1ROP A;  3CCE V;  1VQN V;  2YE8 A;  3HZ1 A;  2WLH A;  3OW2 U;  3W7W A;  4TSF G;  4CWO A;  2R9R B;  2B5U A;  1UYF A;  4MS2 A;  2ZR3 A;  2WEQ A;  3T1K A;  2JJ2 G;  3B25 A;  3B24 A;  4QJF B;  4RUE A;  3LDC A;  3LSS A;  1HWY A;  4EGK A;  1V55 B;  3K0D A;  3RLP A;  5CTW A;  1NR7 A;  4XTJ A;  4KSH A;  2KB1 A;  3SPH A;  2H8M A;  3D36 A;  1ID0 A;  4EGH A;  1P4R A;  1M57 C;  3T0Z A;  5FND A;  1V54 B;  3LPS A;  1FXV A;  2B1I A;  5L3F A;  2XDU A;  2BU2 A;  1OCC B;  1S0V A;  2FWY A;  2PNR A;  5D6Q A;  3G71 V;  3AG1 C;  3E8B A;  4H85 A;  3EHH A;  3CRK A;  3HZ5 A;  4LCU C;  1YC1 A;  2O1U A;  5D7R A;  3A0Z A;  3OFN G;  1OCO B;  4B6C A;  2EIN C;  2H8P C;  2BTZ A;  5H6R A;  4FCR A;  1GM9 A;  1JQ0 A;  3STL C;  1JJ2 U;  5CN0 A;  4CE2 A;  1RPR A;  4O04 A;  1F4M A;  4YXW G;  4MSW C;  3K03 A;  2EIK B;  1YI2 V;  3K97 A;  2X7R B;  3QO5 A;  4E2L A;  2DQ0 A;  3T1C A;  2ZD9 A;  2WLK A;  2BU5 A;  2BT0 A;  4J9Z B;  3K98 A;  1Y4M A;  3D3I A;  2LP7 A;  3K9A A;  3AG3 C;  2F43 G;  4E02 A;  2R9I A;  3CCU V;  4I5S A;  3EKR A;  4X8A A;  2Y48 A;  2QFO A;  5CTU A;  1QVF U;  2EIJ B;  2YI5 A;  1S76 D;  4RQE A;  2ZDI C;  3IC7 A;  4PDV A;  4N21 A;  5C93 A;  4Z1M G;  1GJV A;  3CCV V;  1K34 A;  1R62 A;  1GKF A;  2HVJ C;  2A79 B;  1BMF G;  1S3J A;  3ZRW B;  4P7A A;  1XL6 A;  1W2B U;  1OCZ B;  5DM6 V;  3ETD A;  4RQF A;  1K4D C;  1MSW D;  3K79 A;  5B1A C;  4BW5 A;  5KA6 A;  4UVB A;  4F4L A;  5HFL A;  1QVG U;  3OW6 A;  5M4M A;  3ZN0 A;  3OGC C;  4RUF A;  5GW7 A;  4GX2 A;  4URM A;  2BOB C;  3AG4 C;  4MPN A;  1NVP D;  1UY7 A;  3LDE A;  5B1N A;  4XKA A;  2YEJ A;  5H6Q A;  4GX0 A;  3EHG A;  3T4D A;  2JK5 C;  3CPW U;  1QR8 A;  2WLM A;  4Q20 A;  4XCL A;  5LHI A;  3P32 A;  3VOU A;  2ZR2 A;  5L3J A;  4V25 A;  2QM8 A;  2HR3 A;  2IWS A;  1AI4 A;  2MK3 A;  3RKZ A;  1E1R G;  3CCR V;  4GFN A;  3DGE A;  1YSZ A;  2YI0 A;  3IGA C;  3LNM B;  4ASG A;  2CGF A;  4X89 A;  3CWV A;  4LWH A;  4L94 A;  4GQT A;  2FYP A;  5LGT A;  4YKW A;  3AG3 B;  1SZT A;  4U7O A;  4ZBM A;  1S5H C;  1SES A;  3TET A;  1R6K A;  2HG1 A;  1KP3 A;  2IJK A;  3ABK C;  5CF0 A;  1UYK A;  2EBO A;  1DLB A;  2JIZ G;  2YI7 A;  3WQ9 A;  2WI4 A;  4AWP A;  1MG1 A;  4AWO A;  5IYC O;  3U2K A;  2CCT A;  4GGL A;  3ABL C;  1K8A W;  1H2G A;  2WLL A;  1SRY A;  4MVQ A;  2UXX A;  1NQT A;  1F51 A;  1W0J G;  3ZXO A;  4JAU A;  3MNR P;  5EC2 C;  4KQV A;  4WUD A;  5B1O A;  3H80 A;  1Q7Y W;  4R50 A;  5J9P C;  4FIP C;  5M4H A;  2BRC A;  1VQO V;  3SPJ A;  2E0A A;  2EZP A;  1VQK V;  2BSM A;  1R3L C;  1PL0 A;  1AMW A;  3CP1 A;  4CE3 A;  3VHA A;  4MP7 A;  3OM3 B;  4ASU G;  3FKS G;  3INX A;  3TZ0 A;  3AG4 B;  2YSU B;  2XCM A;  1SER A;  4U7N A;  2YE9 A;  2D3O W;  1NKD A;  2IWX A;  2EZO A;  2YEV B;  5LBQ A;  1AH8 A;  1IXM A;  4LWI A;  3W7S A;  4GX5 A;  5KA5 A;  3R92 A;  5L3B A;  1Q81 W;  1JM6 A;  3HHU A;  2WLI B;  2EIL B;  1TBW A;  3UM7 A;  3ASN C;  3Q5J A;  4QE7 A;  2XND G;  2WAM A;  4XE2 A;  1QR9 A;  4MVU A;  1QLN A;  3QO8 A;  1VQP V;  1S77 D;  2M7W A;  2V1D A;  4P9P A;  3SPG A;  1EBO A;  5FNF A;  3HEK A;  1M56 B;  2PI5 A;  4WF9 V;  3ABK B;  4JYC A;  2IU3 A;  2XHR A;  1YJW V;  4URN A;  3TZ5 A;  3HB3 B;  1Y8N A;  1ZXM A;  2IH3 C;  4P9O A;  2K1E A;  4ZVI A;  2QTO A;  3A0W A;  3VAD A;  2W0F C;  1YT1 A;  3ABL B;  2BOC C;  2H55 A;  5IDM A;  2XAJ A;  3SPI A;  4WUB A;  1ORQ C;  4H7Q A;  1V55 C;  4R7C A;  4I9W A;  1NHI A;  3QNE A;  2YJX A;  2WI2 A;  5GGZ A;  2JEX A;  1TIL A;  4WFE A;  3UKM A;  4GT8 A;  3SYA A;  2Q2E B;  2XDX A;  3WG7 B;  1H7S A;  4EEH A;  3TCU A;  4MB9 A;  4G2K A;  2XAQ A;  4GEE A;  3SL2 A;  4CWQ A;  1R3I C;  2ZDI A;  2JEU A;  3OAA G;  2WI1 A;  4ASA A;  3W7U A;  1UYE A;  3ZRS A;  4HY1 A;  3PEH A;  5LGN A;  4PA3 A;  3K0G A;  3OMN B;  4PU9 A;  2W6I G;  4MVM A;  2X6C A;  2WER A;  1PKX A;  2UXN A;  4PL9 A;  3MD0 A;  4EKW A;  1YT0 A;  5CPH A;  3K08 A;  4UUJ C;  1AJ6 A;  3A0T A;  4PA4 A;  1AI5 A;  4YKT A;  3R91 A;  3OPD A;  3U2D A;  3K06 A;  1B62 A;  4XIP A;  1FXK A;  3ZKB A;  2IW5 A;  4MTO A;  3FB6 C;  1WPX A;  5EC1 C;  5CA3 A;  1NVP B;  3OWD A;  4DZY A;  2DW4 A;  3G4S V;  1R73 A;  1KZN A;  3TTZ A;  1F4N A;  2EIJ C;  1CPY A;  4X9L A;  2CCS A;  4MW8 A;  3TZ2 A;  2Q69 A;  3SYQ A;  4QPK A;  3B8M A;  2CCU A;  2IU0 A;  4R1F A;  1VQM V;  2FXS A;  2VCJ A;  4ASF A;  3K3W A;  2XOK G;  1FXH A;  5FL7 G;  4GX1 A;  1DF5 A;  1B63 A;  3W7X A;  5EK0 A;  4H81 A;  1UYH A;  3JD2 A;  3FYE B;  3R4N A;  1FS0 G;  2YE3 A;  1OCZ C;  4AWQ A;  3B27 A;  1QY8 A;  2YGE A;  3D2R A;  4EGI A;  1EA6 A;  4MVS A;  2QKS A;  4XD8 A;  1YET A;  4JGS A;  2BRE A;  3SPC A;  4RO2 A;  4BQJ A;  4LWG A;  2P90 A;  1ENV A;  3F5W C;  1MAB G;  1XL4 A;  2IOP A;  4EFT A;  2FWZ A;  1L1F A;  2YEA A;  3GIE A;  5D7C A;  1VQL V;  1QLE C;  4YKZ A;  3ABT A;  2IJH A;  1UYL A;  3CCQ V;  3IFX A;  3QTF A;  5KUM A;  3G7E A;  3K99 A;  3PEJ A;  2Y69 C;  4TWK A;  1FFT B;  1H7U A;  5CTY A;  3EHJ A;  3KE6 A;  2JJ1 G;  4FCP A;  1KEC A;  4MP2 A;  5BZB A;  1YC4 A;  3Q5K A;  4R3A A;  4BAE A;  3EFF K;  1SET A;  1S72 V;  1A4H A;  3C11 A;  4E01 A;  5IDJ A;  1BYQ A;  2HFE C;  1YTF D;  3O6O A;  1M9N A;  2HLD G;  1NBM G;  4CWR A;  1UYG A;  3U67 A;  5L3G A;  3SYP A;  1H38 A;  4XC0 A;  1Y4U A;  4U93 A;  1DF4 A;  1AH6 A;  3CCL V;  5L3D A;  4WFF A;  1GMG A;  2HG5 C;  1CP9 A;  1Y4S A;  3E8F A;  5H9C A;  3LDD A;  3E35 A;  1KC8 W;  3OR6 C;  3CMA V;  1NHH A;  2BYI A;  3GIG B;  3ZKD A;  2BU7 A;  5CBH A;  1Q82 W;  1BKN A;  3SYO A;  1KP2 A;  1GKZ A;  4MVO A;  1R3K C;  2WI5 A;  1S14 A;  4JTC B;  1Q86 W;  3QDD A;  3HYZ A;  3R4P A;  4W7T A;  3B77 A;  3F7Y C;  4XDK A;  2Q8F A;  2PI4 A;  3OMA B;  5EBM C;  3CCM V;  1QLE B;  4MVR A;  3A0Y A;  2YEC A;  3IED A;  4FCQ A;  2P67 A;  2EIL C;  2IH1 C;  1EFR G;  1NHJ A;  4MW3 A;  2Y69 B;  3STZ C;  3ZMT A;  1U2O A;  3T4Z A;  4ZKI A;  3ML0 A;  3CC4 V;  1OZ0 A;  1PVG A;  2HKJ A;  3X2Q C;  3P30 A;  4MOT A;  2HVK C;  2Q67 A;  4XIR A;  4FPP A;  2A0L A;  1Z59 A;  2O1W A;  3TK1 A;  1UY6 A;  2Q68 A;  4EMV A;  2BZ5 A;  1M56 C;  5M4E A;  4WCE V;  4R6Z A;  1I59 A;  3ZRV A;  2WI6 A;  2XJJ A;  1UYC A;  4XDL A;  2P6J A;  3KG2 A;  1E79 G;  3CME V;  1I5Y A;  1Z5C A;  2VW5 A;  4BXI A;  3H4L A;  2CK3 G;  2QG2 A;  4CWS A;  2FTK A;  4CE1 A;  1R3J C;  3CC2 V;  2BU8 A;  2YI6 A;  2EIM B;  1DTO A;  1GM8 A;  1YIT V;  4RAI A;  3O2F A;  3G6E V;  4HAM A;  3WG7 C;  2CH4 A;  3B28 A;  1YC3 A;  3ASO C;  4QIW F;  3GB7 C;  2YEI A;  3VBB A;  2XHT A;  2P7T C;  2XX4 A;  3AG2 C;  3ABM C;  4MPE A;  3FT8 A;  3AEI A;  1UY9 A;  1Y8O A;  4UV8 A;  1BHA A;  3E89 A;  4UVC A;  3ZMV A;  2OTL V;  4WFB V;  5M4P A;  1KD1 W;  2YED A;  1BXD A;  3JD0 A;  1YJ9 V;  1AJN A;  3ZRW A;  4P30 A;  3LNU A;  2K5B A;  4EM7 A;  3T2S A;  3FV5 A;  2ITC C;  2DWE C;  1UYM A;  2XD6 A;  2Q8H A;  3X2Q B;  4GT1 A;  5B1B B;  5IYD O;  1GO3 F;  4JTD B;  3ZXQ A;  2DYR C;  2YK2 A;  3C0E A;  2YE7 A;  4NH7 A;  3E8G A;  4MTF A;  2BYH A;  4LP8 A;  1OHH G;  2EXL A;  4HZ5 A;  1H8H G;  4JF3 A;  2QM7 A;  5L3E A;  2B1G A;  2YEF A;  4QNH B;  4BIU A;  2QEX V;  4MBC A;  1YIJ V;  3JYC A;  2ZDX A;  1THN A;  1KIJ A;  3ETG A;  2XHX A;  3OR7 C;  3FB7 C;  3H01 A;  4FMT A;  1AJP A;  4HY6 A;  3OMI B;  2WEP A;  2XJX A;  2ESA A;  1K33 A;  2WI3 A;  2GSM B;  2YEG A;  3A0R A;  4PA6 A;  1K3E A;  4WFH A;  1K5S A;  2QA4 V;  3PJS K;  2OCC B;  2XAS A;  3JD4 A;  4KFG A;  4URL A;  2YE6 A;  1K7D A;  3D0B A;  3ASO B;  4MVZ A;  4L90 A;  1YTF B;  3RVZ A;  2YGF A;  3AG2 B;  3ABM B;  1K4C C;  1YES A;  1YER A;  4P2Z A;  2YJW A;  3FB8 C;  1Y66 A;  2YE2 A;  3OWB A;  2YKB A;  4O05 A;  2WPD G;  2O1V A;  3E86 A;  1NH2 B;  3ZCC A;  4YKR A;  4L87 A;  3DTU B;  2AHZ A;  3FB5 C;  1JPX A;  5LGU A;  5B3S C;  1BL8 A;  3RLR A;  2DYR B;  2ZXW B;  1VQ7 V;  4H37 A;  2YEV A;  2HKO A;  1G4Y B;  4UV9 A;  2XX2 A;  4WUC A;  2Q6A A;  1YSR A;  1I5C A;  3OE7 G;  1EI1 A;  3BMY A;  1MOF A;  3GIF A;  2XDL A;  5D6P A;  2AHY A;  5BOC A;  1K92 A;  4PDL A;  4DUH A;  2WLI A;  1NJI W;  4LPB A;  3FYI B;  1RM1 B;  5M4N A;  2QF6 A;  1GKX A;  5D7D A;  2WI7 A;  4PA7 A;  2XAB A;  1Y8P A;  2OTJ V;  3CRL A;  2GHY A;  3INW A;  2YKC A;  3E83 A;  2JKI A;  1BHB A;  3A0X A;  3JCZ A;  4BAY A;  5E1A C;  5J71 A;  4CWF A;  4L91 A;  2DQ3 A;  1CEZ A;  3RW0 A;  1U0Z A;  3T10 A;  3F7V C;  4O0B A;  3OEE G;  1UYD A;  3HYY A;  4PDR A;  4NH8 A;  5F3K A;  3RBZ A;  2YEB A;  5BOD A;  3NMQ A;  3B26 A;  3FT5 A;  3I55 V;  2AKP A;  4O09 A;  4EFU A;  2ITD C;  3T0H A;  3MHS C;  2X0L A;  2XAH A;  4JYB A;  3RLQ A;  5L3C A;  1VQ9 V;  1WLE A;  3CCS V;  1YS3 A;  2BU6 A;  3E2E A;  3B8N A;  4OXS A;  4YKY A;  4R3M A;  2ZKJ A;  5B3S B;  4X88 A;  1PNL A;  1K97 A;  1M1K W;  2ATK C;  4DO2 A;  1L0O A;  1BGQ A;  3CGY A;  4O07 A;  1F23 A;  3BY6 A;  2YKI A;  2QE7 G;  4ASB A;  1S16 A;  1LNQ A;  2WLL B;  1JOY A;  2YEE A;  5DN6 G;  5M4K A;  4KP4 A;  2YE4 A;  1JVM A;  1K73 W;  1N8R W;  1GTO A;  1G8M A;  1COW G;  3ZMU A;  4G27 B;  3O0I A;  5IN9 A;  2UWD A;  3R4M A;  2Z5U A;  1NH2 D;  2JJC A;  2IOQ A;  2NLJ C;  4DXW A;  2YK9 A;  1AI6 A;  4LWE A;  4JQL A;  2XDS A;  2EIM C;  4LBE C;  4YKU A;  5FWK A;  3NXS A;  2XX5 A;  1I5D A;  1M57 B;  4BIZ A;  1W0K G;  3QO7 A;  4R8C A;  2WLJ A;  4KSG A;  3K60 A;  1YSC A;  2IOR A;  1AI7 A;  4L93 A;  3WFV A;  3EHF A;  2ZDY A;  4HXZ A;  1I5A A;  3WHA A;  3AG1 B;  2YEH A;  3OMU A;  1E1Q G;  5KUK A;  2Q8I A;  1FXK C;  2JDI G;  4I3H A;  3MHH C;  2XAG A;  2EIN B;  5IY5 C;  4XKK A;  2Q8G A;  4XDJ A;  4MTG A;  3W7T A;  1Z5A A;  1NR1 A;  5CBF A;  1MX0 A;  4AS9 A;  4B7P A;  1ARO P;  3ZRX A;  1PNM A;  2OT5 A;  5B1B C;  1VQ4 V;  4XCJ A;  5EBL C;  4HYP A;  1QCE A;  4G28 B;  3CXC U;  2WLN A;  4PEL A;  2HCH A;  2WSS G;  2ZBK B;  3OUF A;  1I58 A;  2NNU A;  2W6J G;  4CWP A;  4GCZ A;  4JAV A;  4XDM A;  3SJQ C;  1K5Q A;  4CWT A;  4YKX A;  1TUE B;  1TH8 A;  3Q5L A;  1VQ6 V;  4CWN A;  2XK2 A;  4PDM A;  3CD6 V;  4V26 A;  1THZ A;  4PRX A;  2EJR A;  4QPJ A;  4JAS A;  1GM7 A;  4HYO A;  2YKJ A;  1B3Q A;  5LHG A;  4HZ3 A;  1J95 A;  1TID A;  3OEH G;  3CCJ V;  3BEH A;  2OCC C;  1PNK A;  4FJC C;  1QBZ A;  3ZMS A;  1I5X A;  4QE9 A;  4P8O A;  4XBF A;  3ZMZ A;  4TT3 G;  1YHQ V;  3ETE A;  1M90 W;  3TUH A;  4L8Z A;  3ZIA G;  1TC6 A;  2Z3Y A;  1ZW9 A;  1OSF A;  2C2A A;  2DYS C;  4WFA V;  5B1A B;  5HFM A;  4HYM A;  4JTA B;  3CYO A;  1JX9 A;  4CZZ A;  4LC1 A;  2IJI A;  3GIG A;  3LUT B;  1JCH A;  1FXK B;  4KUM A;  1ZXN A;  4LP0 A;  5CMU A;  4BQG A;  1TC0 A;  2XDK A;  2DWD C;  3R65 A;  1K9M W;  1OCR C;  3E8H A;  5IY5 B;  1ZWI C;  3SYC A;  4XKO A;  2GQP A;  3JZ3 A;  3ZM7 A;  1P7B A;  2ZQM A;  1RPO A;  2ZXW C;  2LFS A;  1QYE A;  2YE5 A;  5EBW C;  1H8E G;  3JD3 A;  5F5R A;  3I56 V;  2WWW A;  2GFD A;  4PRV A;  4YKQ A;  4NH9 A;  2QG0 A;  2HJF C;  3BM9 A;  4E00 A;  2IJJ A;  1I5B A;  2XAF A;  1UYI A;  1GK9 A;  4UXN A;  1RM1 C;  1AJQ A;  3GWO A;  2YKE A;  3ZJZ A;  4WFG A;  3R4O A;  3OUS A;  2VWC A;  4LWF A;  4XIT A;  3G7B A;  4URO A;  3JD1 A;  4MT8 A;  4XIQ A;  2X6A A;  3ABU A;  1Z5B A;  1UJW B;  1YT2 A;  1KKD A;  3T2M A;  3ZN1 A;  3VHC A;  4FK5 C;  2IWU A;  5J6A A;  4MPC A;  5FNC A;  4CBC A;  4H33 A;  5CBG A;  4KTN A;  1ZWH A;  3VHD A;  5LHH A;  2DYS B;  4K4O A;  1V54 C;  4UVA A;  3RVY A;  5CTX A;  3TZ4 A;  4PA9 A;  2VCI A;  1VQ5 V;  2LFR A;  1AR1 B;  3EHB B;  3CGZ A;  1UY8 A;  2YGA A;  1OCC C;  1QZR A;  1VQ8 V;  4JPR A;  3CC7 V;  2X6B A;  2H94 A;  3HPL C;  1EZJ A;  1B6Q A;  3G75 A;  1OCR B;  4HZ0 A;  4J9Y B;  1OCO C;  3K04 A;  1KQS U;  5IYB O;  3EKO A;  2CG9 A;  3LSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...