4JAVA

Structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
246
structure length
246
Chain Sequence
b'NVTESKELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine kinase
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
total genus 79
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4javA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4javA02
3VHDA 2E0AA 2CGFA 5J71A 1GJVA 4PL9A 4YKTA 2XX2A 4MOTA 4KP4A 1UYKA 2YGEA 3TZ0A 3HZ1A 4V26A 2H55A 1UY7A 1UYMA 2ZKJA 4MP7A 4LWGA 4K4OA 3RKZA 4P7AA 2YEFA 1NHHA 2YE8A 3EHHA 4P8OA 1KIJA 4CWOA 1AJ6A 4ZKIA 2ESAA 2YI7A 4MPNA 2YE6A 2XABA 4B7PA 4YKWA 3ZRWA 2YEEA 1B63A 2IWSA 2QM7A 2YJXA 4L8ZA 3NMQA 5B1OA 2XHTA 2YI5A 4LWIA 2YGAA 4ASGA 3ZCCA 2Q8IA 4HZ5A 2WEPA 2QFOA 2YKEA 3WHAA 4E00A 1Y4UA 4BQJA 2HKJA 2YI0A 3LPSA 3GIEA 4CWSA 5CTWA 4LWEA 4EGKA 3MD0A 2BTZA 4O04A 2XHXA 3A0XA 3K60A 4XD8A 3OWBA 3FT5A 4FCRA 1THNA 4GCZA 4LP0A 4AWPA 3U2DA 1UYHA 1Z5AA 3HHUA 2YEHA 3G75A 2CCSA 4XDMA 1GKZA 3G7EA 4XKOA 3RLPA 1UYCA 4JYCA 2BYIA 4AWOA 1YT2A 1TILA 1QZRA 4MT8A 2YKCA 3B25A 1AMWA 2YE4A 2QG0A 1JOYA 3R4OA 4PRXA 4E01A 1F51A 3FT8A 5M4HA 3TZ5A 3H4LA 3U67A 2BT0A 4XKKA 5D6QA 3A0TA 5IDJA 2XDSA 1I59A 3QTFA 3R91A 4KFGA 2GFDA 4JYBA 4L91A 5J6AA 2YK2A 2XX4A 4U7NA 3R4NA 4URLA 2O1VA 1H7UA 2WWWA 3B26A 3EHJA 3JZ3A 4GT8A 4CE2A 5FWKA 2YGFA 3CGZA 4MPCA 4MBCA 1PVGA 2BSMA 1UY6A 3RLQA 2VCIA 2XD6A 4FMTA 2BU7A 3R92A 4DZYA 2YKIA 1QY8A 2FWYA 2CH4A 2BZ5A 4KSHA 2YE3A 1YS3A 2XJXA 2K5BA 3INWA 5FNFA 4AWQA 3DGEA 3ZKBA 3O2FA 4W7TA 5D6PA 4ZVIA 1U2OA 4EMVA 4BQGA 1A4HA 4HXZA 3ZXOA 3T10A 1EI1A 2QF6A 4WUDA 2YE2A 1NHJA 2VWCA 4ASBA 4NH9A 4QPJA 2Q2EB 5M4PA 4LC1A 3ZXQA 3VADA 2IWUA 3HZ5A 3OMUA 1S16A 1YETA 2XK2A 2AKPA 2WI2A 4HYMA 1UYEA 3TUHA 4CWTA 4O0BA 1Y8OA 5F5RA 4O07A 4XIPA 3BM9A 4URMA 2VW5A 2YECA 2YEBA 3Q5KA 1B62A 4FCQA 2Q8HA 4CE3A 4LPBA 4HY1A 5M4NA 4EGIA 1I5AA 1TIDA 4MPEA 3MNRP 3T0HA 1H7SA 3U2KA 4O09A 4MTXA 2WI1A 2WI3A 4MP2A 4XE2A 4CWPA 5CTUA 3PEJA 4H85A 2XDLA 5F3KA 1YT0A 2VCJA 4CE1A 4KSGA 3QDDA 1TC6A 1TBWA 2WI4A 3K99A 4XC0A 1ZXMA 2PNRA 2O1UA 4FPPA 4WUBA 1ZW9A 3T2SA 3TZ4A 3EHFA 2XDKA 4XITA 1I5BA 2H8MA 4ASFA 1Z59A 4CWQA 5CPHA 5M4KA 2IWXA 4GEEA 4XCLA 3GIGA 1EA6A 4X9LA 3CRLA 2YJWA 1B3QA 2YEIA 3Q5JA 3R4MA 4YKYA 4BIZA 2XHRA 5IDMA 4GT1A 4GFNA 1Y8PA 5M4EA 4H81A 1BKNA 3LNUA 4WUCA 4LWHA 1UYGA 4Q20A 4L93A 3HEKA 4NH8A 5CTYA 2BRCA 3FV5A 2WI6A 3PEHA 4U7OA 3ZKDA 3EHGA 4HY6A 5GGZA 4YKQA 2YE9A 3OWDA 1YESA 1R62A 4KQVA 5CTXA 4HXWA 2ZDYA 2Q8GA 3T1KA 2LFSA 4PU9A 3D0BA 3TTZA 1AH8A 4YKUA 1BYQA 1YERA 3G7BA 5D7RA 4YKXA 4CWRA 4R3AA 4XCJA 2UWDA 3CRKA 2HG1A 2BU8A 1S14A 1GKXA 2XDUA 2YKBA 4QPKA 4H7QA 4LWFA 1UYLA 1YT1A 3EKOA 4URNA 3A0RA 4U93A 2O1WA 1ZWHA 3BMYA 4KTNA 3T0ZA 4NH7A 4XKAA 2C2AA 3ZRVA 2CG9A 2YEAA 2XCMA 5IN9A 4XIRA 4E02A 2BU5A 2LFRA 5BOCA 3O0IA 4R3MA 2FXSA 2IOPA 2QM8A 2WI5A 2JKIA 5D7CA 1TH8A 2ZBKB 4JAVA 1IXMA 2XDXA 4PRVA 3H80A 2WI7A 4I5SA 4XIQA 1YC1A 3K98A 3C11A 2BU2A 1BGQA 2P67A 4XTJA 1YC4A 5L3JA 3O6OA 2BYHA 4I3HA 4EGHA 3HYYA 1Y4SA 1MU5A 4AS9A 3INXA 4GGLA 2XJGA 5B1NA 4BXIA 3Q5LA 3OW6A 1AH6A 2WERA 4JASA 2HCHA 3OPDA 2GQPA 2YEGA 2ZDXA 3EKRA 3VHCA 4O05A 1YSZA 3ZRWB 1U0ZA 3B28A 5C93A 3GIFA 3B24A 3B27A 4UROA 3KE6A 1UY8A 1NHIA 5FNDA 1US7A 2YE7A 3A0ZA 1ID0A 1Z5BA 3K97A 4GQTA 1YC3A 4YKRA 2BU6A 4BAEA 3ZRXA 4L90A 1TC0A 3HYZA 4R1FA 3TZ2A 1UYFA 3C0EA 4B6CA 1UYDA 1UY9A 1OSFA 3CWVA 2WEQA 4MB9A 1I58A 3ZM7A 2FWZA 3P32A 2YKJA 3VHAA 2QG2A 1YSRA 4ASAA 1MX0A 4FCPA 5BODA 4L94A 4EFUA 1Y8NA 3A0WA 1BXDA 3D36A 2YEDA 2IORA 2XJJA 1AM1A 2YI6A 2FTKA 3A0YA 4CWNA 1ZXNA 4JAUA 2FYPA 2YEJA 1JM6A 1I5CA 3D2RA 3IEDA 1UYIA 2BREA 3SL2A 3GIGB 5D7DA 2XX5A 4EEHA 1QYEA 2JJCA 3WQ9A 2EXLA 1KZNA 2CCUA 3TK1A 4HZ0A 4V25A 1I5DA 4DUHA 2YE5A 4EM7A 2YK9A 4YKZA 5M4MA 1L0OA 3CGYA 5FNCA 4BIUA 2IOQA 3R4PA 5CF0A 4JQLA 4EFTA 3NXSA 2Q8FA 4CWFA 2CCTA 1Z5CA 3RLRA 4HYPA
chains in the Genus database with same CATH superfamily
4OGQB 2YSUB 1UFIA 2R9AA 2IM9A 3ZHUA 4MOTA 3R65A 4KP4A 1H2NA 5B5EZ 2YGEA 4B7KA 3HKEA 3SPGA 1UYMA 2YI8A 1QR9A 1XDCA 4K4OA 2WLIA 3H1IH 1AR5A 1WJZA 1Q81W 2YE8A 1NHHA 3EHHA 4P9PA 3RN4A 3X2QC 4CWOA 2IJJA 2QKCA 2YI7A 3FD9A 3JCZA 1OCRC 2XABA 4B7PA 4PELA 2YEEA 2HKOA 1S5JA 2YS8A 4LFBB 1XBLA 3NR7A 2YJXA 2QM7A 3SDLA 3K03A 3QO7A 2P4KA 5B1OA 3AG1B 3ETEA 2RN9A 3CS5A 2YC0A 4LWIA 3ZCCA 1AI6A 3JAMN 1XILA 3JYCA 2WEPA 2Y69B 1S5LZ 2HVJC 3SYPA 3EVKA 3K3WA 4E00A 2CTRA 4ABMA 1Y4UA 2B9ZA 3DTUB 3I55V 3GIEA 3WG7C 3JATA 4BW9A 4LWEA 4JPRA 1X59A 2XAHA 3CMEV 1GH6A 4NKGB 3OWBA 2QM4A 1RSOA 2HFEC 1LR1A 5BR8O 3OMNB 1H2LA 3G71V 2UUBB 4MS2A 3U2DA 3O9OA 1UYHA 4J80A 4WFFA 2A9HA 4GLXA 4HNAA 1JJ2U 1NQTA 2ITCC 3FB8C 4MTOA 3G7EA 1UYCA 2WLNA 2EIKB 3K9AA 2GHYA 3B25A 1AMWA 2QG0A 4O4JA 5B66Z 1BHAA 1FFXB 4PRXA 3ZHSA 4E01A 2VQEB 4Q6GA 1F51A 3CYOA 3CCJV 5M4HA 1ORQC 2BTOA 3TZ5A 3U67A 5D6QA 3JARB 5KUKA 4X9QA 1I59A 3JD1A 3QTFA 4JI1B 3RYIA 3R66A 1R3IC 3B09A 5EYPB 3DC6A 2Z0AA 1JCHA 2WWWA 3B26A 3EHJA 1NU1H 1O9HA 4CE2A 4A5UB 5CMUA 1PVGA 4MBCA 1WLEA 1UY6A 1M57C 3OMAB 3ABKC 3CCVV 1J95A 2VCIA 2EIMB 3L70H 1GRJA 3KCYA 5BY1A 1HR0O 2DYSC 3S3WA 4I7ZB 1W2BU 3G80A 4XDKA 5JJJB 2YE3A 4B3RB 2QGNA 4MVOA 2K5BA 3INWA 1OCOB 3ZKBA 4GKKO 3Q4HB 1EN5A 4BQGA 1R3LC 3D3QA 2UUCB 5LA6B 3VOUA 1M56B 1MA1A 3LMMA 4WUDA 1NHJA 5D5PA 2C1IA 1NR7A 2A06H 4NH9A 3EHBB 4NVPA 1AJNA 1JVMA 4DR6B 3TJTA 2BOCC 1YETA 1WP8A 3RYCA 4U3JB 1FAFA 4FM2A 5LGTA 2VQFB 3OTOB 1NVPD 4RQFA 1JFFA 3C3TA 2WA3A 4IHJA 3SPJA 3K5MA 4O07A 1K5SA 3CJHA 3Q5KA 1OHHG 2KG7A 1ZLZA 3LSUA 4DUZB 3CXCU 3CYGA 4I9QA 1QVFU 2Q8HA 4HY1A 1WB8A 5FPRA 3OGCC 4G2KA 4R8CA 3ZBHA 5IYDO 1I5AA 5B1AB 1NH2B 5GONA 3CEIA 1YSCA 3JAWA 3KKYA 3OTFA 2DYRC 5H6RA 4X66O 2LW7A 4DR1O 1YHQV 4MP2A 4YJ3A 5JWPA 4DR3O 4H85A 4RUFA 3HKEB 5KX5A 1JQ0A 5F3KA 2WLIB 3K79A 1KUQA 4KFMA 1H38A 1HNXO 4YY3B 2CGNA 1L1FA 4GUNA 3THOA 4B3TB 4TWKA 1SESA 4E2LA 2JGUA 1HWYA 3SJBC 2XDKA 1GM9A 4LWSA 1SQPH 2ZM6B 2KQXA 3CX5F 1SQBH 3JD3A 2Q0AA 4AI8A 2Q6AA 1UJWB 2YJWA 1B3QA 1K3EA 5FPOA 4PA4A 4YKYA 2XOKG 3FKSG 3BY6A 4GT1A 1VP7A 2HR3A 4DV5O 3LNNA 4H81A 4CZZA 1BKNA 2M6YA 3JATB 5IYBO 5IWAB 1B06A 4Q20A 3QG5A 2BRCA 1Q6UA 4LFCB 4EEQA 1L8DA 3PEHA 2PI4A 3EHGA 2XHBA 2Q7GA 4JF3A 2YE9A 3OWDA 4KQVA 3FB7C 5CTXA 1EZJA 2HG5C 3ABLC 2ZE6A 4HXWA 2Q8GA 1BQ0A 4MW3A 1RPRA 2LFSA 2QDOA 3T1KA 1RP3B 2ZXWB 4PI0A 3B2EE 1AH8A 3APOA 1LUVA 2R9RB 3RBZA 2QTOA 2YI9A 4DV2B 2YIBD 5CA3A 4R3AA 2M7WA 1A32A 2HG1A 2ITDC 1R3KC 5CA1A 5GTHZ 3EKOA 4LCUC 4URNA 1OCZB 2O1WA 3KZIZ 1ZWHA 4FFKA 1VMGA 4LNUB 3T0ZA 4NH7A 1KU9A 3CPWU 1HDJA 2D2CB 4H0LB 1V9PA 2LGWA 4AHCA 4DR5B 5CB4A 4XIRA 4FLWA 1ZSPA 2CGOA 2EINB 4DV1O 1OZ0A 3CD6V 2LFRA 1N34O 1K4CC 3O0IA 4TOIA 4R3MA 5A2QN 5GTIZ 2FXSA 4EB6A 4IIJA 1PM9A 4FLVA 2ZBKB 4WCEV 4JAVA 2YIBA 5ITZB 4JYAO 3RW0A 2XT9A 4I5SA 4XIQA 4G27B 4DUYO 4GZRB 3K98A 3AG7A 2IJKA 1YI2V 2OWOA 1H8HG 3X2QB 1K4DC 1KQSU 5L3DA 5L3JA 2BYHA 4EGHA 1KKCA 1OCRB 1MSWD 3INXA 1BL8A 4BXIA 3CCQV 2Z3YA 3OW6A 4PA6A 2WERA 4GX0A 2HCHA 2GQPA 3EKRA 5LP6A 3L9DA 1U0ZA 3RYCB 3B28A 3C3SA 2P22C 3K08A 3GIFA 2ZE7A 1XUQA 3BVOA 2FMLA 3AG4C 2A79B 1JFFB 3OD4A 4IHJB 3E8FA 1W0JG 4I50A 2YE7A 3CJHB 1ID0A 4FJCC 1Z5BA 1XMQB 3K97A 2KG7B 3WG7B 1EN6A 2YEVA 4TV9A 3OEHG 2EZOA 1Q90D 4NTXA 2BU6A 3F7YC 3ZRXA 2QKSA 5GONB 4R1FA 3TZ2A 3JAWB 4H37A 1VQMV 1OSFA 4JI8B 3CWVA 4TUYB 2BOBC 4YJ3B 4WF9V 1K92A 3U0ZA 4UCTA 5LMNO 5KX5B 2YKJA 2QG2A 4ZIBA 3W7XA 1MZFA 1AM1A 4OX9O 2IH3C 4K8XA 3SJAC 4J11A 4CWNA 4U3FH 1WA8B 4JGSA 3ZN0A 4LWSB 1JM6A 5LMUO 5JVDB 3UO2A 1NVPB 1Q43A 2JEXA 4R50A 3T4ZA 1P4RA 3SL2A 5D7DA 1US6A 2UXDO 1DGSA 3WQ9A 1SKVA 4D6TH 2BTQA 1M4UA 1EM1A 4DUHA 1MABG 1QU7A 2Q67A 1L0OA 3CGYA 4BIUA 3T1HO 1V55C 1SETA 3UT5A 4JQLA 4EFTA 4KHPB 2LO1A 1SRYA 1UPGA 2N05A 3RLRA 1M57B 4NXMB 3VHDA 3ABKB 3QNEA 5DEDA 2CGFA 4JAAA 4MVSA 1SERA 1GJVA 5J71A 3F7VC 4X8AA 4DO2A 2DYSB 1UYKA 3HZ1A 4DR4B 4V26A 2AW9A 2UUAB 3CCSV 1UY7A 5FNVA 2CDYA 4LF9O 1HNWO 2ZNJA 4LFAB 2YEFA 5J2TA 3OAAG 3E8BA 4GYCB 5CA0A 1AJ6A 2V4DA 4YIOA 4DR2B 2JDIG 1Q86W 2Q7EA 3N2GA 5CA1B 1MNGA 3D8CA 3WFVA 2IWSA 4L8JA 1VF6A 3NMQA 1N36O 3C90A 4X20B 2YGAA 4ASGA 1BZKA 1VQOV 3K06A 3MHHC 3H1LH 3SJCC 3J80N 4BQJA 4DW1A 3LPSA 5LXTA 1TVKA 5CB4B 2PYLA 1G1XB 1MSDA 3ZHQA 3AK3A 3BCCH 3MHSC 4XD8A 1F4MA 4ASUG 1KKDA 4IIJB 4JI2O 2WAMA 3UO3A 3FT5A 1P7BA 2DYRB 2XUMA 4LP0A 4AWPA 3GWOA 3ZRSA 3G75A 2AHYA 4XDMA 4XKOA 3VBBA 2HHHB 4DV7B 3BEHA 1FXVA 1JJOA 3RYFA 1SQVH 3R4OA 4R7CA 2BE3A 4I0XB 3H1HH 1N0NA 1ZL8A 4LP8A 4FLZA 1Y4MA 4UCRA 1XMOB 1IBLB 4XKKA 2LJ2A 2ADQB 3A0TA 2G38A 2AHZA 1PL4A 1THZA 3FX7A 4TQFA 4QNHB 4I50B 1HNZB 1WB7A 2YK2A 4U7NA 1JPXA 2V7QG 4RQEA 2DQ3A 2YEVB 3O65A 5L3FA 4TV9B 4MPCA 2EX3A 2Y48A 4UVBA 2QSAA 4IGGA 2C1GA 1SS3A 2CTPA 3SPHA 3AEIA 4LF6B 4DZYA 2WA4A 2E3CA 1QY8A 1KMIZ 3OUFA 2CH4A 4KSHA 3ABLB 3ZHTA 1Y6XA 2L6LA 3DSQA 2ZCEA 3CCEV 5EBLC 5FNFA 4BW5A 3A8TA 3DGEA 4W7TA 3FYEB 2RMKB 4EMVA 1SC5B 1A4HA 2XAFA 4HXZA 3ZXOA 3T10A 1EI1A 1YIJV 1VF5B 4GKJO 1DF5A 1KP2A 2VWCA 3E8HA 4I4TA 5C8YB 1GK9A 4QPJA 1AP5A 2Q2EB 5M4PA 1QLEC 3VADA 3K5LA 2IWUA 1S0VA 4H33A 4DV0O 1BGYH 1VIBA 2XK2A 2BSKB 4HYMA 3FAVA 2BTQB 2NNUA 1UYEA 5EBMC 4K35A 5IJ0A 2DWDC 4GX5A 3G67A 5F5RA 4XIPA 3BM9A 4F6EA 4URMA 2VW5A 4AILC 1LNQA 1B62A 1F23A 2PTMA 2QWNB 5J2UB 5DECA 1O9GA 3APQA 4LPBA 4PA3A 5M4NA 1QLNA 4J7ZA 4O4HA 1XNRB 2CAZC 1TUBB 3T1YO 3MNRP 4PD4F 1K5QA 4Z1MG 4CH3A 4O09A 3BPZA 4JYYA 4MTXA 1AR4A 2WI1A 4P30A 2WI3A 1SQGA 4LFBO 2QEXV 4UVCA 5FNVB 3J81N 1QVGU 3STZC 4J10A 1YT0A 1XHZA 4X1IB 4WFAV 2OTLV 1TC6A 3K99A 2WI4A 4WBNA 5J2TB 4XC0A 2LGQA 2EJRA 1NT2B 5CA0B 1VQKV 4B3MB 5H9CA 4WUBA 3T2SA 3EHFA 3G6EV 4IT5A 2JS5A 4XITA 2WLLA 4UVAA 3CRAA 3B8MA 2IU0A 2HLDG 4YHHB 3N2GB 5CPHA 4PHZA 4FLUA 2X6CA 1FFTB 2BCCH 4X1YA 4X9LA 3G4SV 3CRLA 1NS1A 3T2MA 1NTZH 5H6QA 2PGGA 3OW2U 2XHRA 1L0LH 4JI4B 4QGPA 3AG4B 1Y8PA 2QA4V 1M1KW 1OJHA 2CUGA 4WUCA 1TVKB 3L74H 2F4VB 1VQ6V 5IYCO 3HEKA 3FV5A 5B1BC 1DF4A 1JA8A 2ILMA 5GGZA 4YKQA 1R62A 1R3JC 5LYJA 1JX9A 4YIPA 1Y76B 2VQEO 4PU9A 1AP6A 2RDCA 4X1KB 1QBZA 1BYQA 1YERA 1IBKB 4G28B 4J9ZB 1AJQA 4JI1O 4CWRA 3RYFB 1FKAO 2BU8A 1S14A 1ZX3A 4FLTA 3E2EA 4DR7B 1RM1C 4QPKA 4LWFA 4DV3B 1W0KG 1I0HA 2IH1C 4U93A 1XNQB 2RCVA 3BMYA 2UXCB 1AI4A 4XKAA 2ZE5A 5CBGA 5JH7A 3CC4V 5IE9A 2EZPA 5J9PC 3M99B 3CWBH 3LSQA 3CCUV 4NXNO 1ZAUA 4B3RO 3IFXA 2F95B 3RWRD 1M90W 2UXNA 3P3PA 2YEAA 1V55B 2UXXA 1XREA 1YF2A 2GDSA 1FXKC 3JAKB 2E76B 5BOCA 4MTGA 2IOPA 4CS4A 2QM8A 4RUEA 3QO8A 2DMXA 2ETNA 1VEWA 1GO3F 2X0LA 4HAMA 4DR6O 4X66B 1OV9A 3A2FA 1YZBA 1Q82W 4PDMA 2BU2A 1FJGB 1Q6HA 3CC2V 4JZGA 2OCHA 2JGDA 2VQFO 3OTOO 5JJEB 3DC5A 3N2KA 2WPDG 2UXBB 1MU5A 4DV6B 1VQ9V 4I4TB 5B1NA 4X62B 1ZTEA 1F4NA 4AQYB 4DUZO 1BMFG 3Q5LA 1BE3H 2YEGA 4X64B 2F23A 5KHGA 3VHCA 3FAVB 2FKXA 3OMIB 3ABMB 3SR2C 3B24A 3B27A 2WLJA 1R6TA 1FD9A 5FNDA 3JSNA 5LP6C 1MZEA 2QE7G 5EC2C 1NTKH 3VQVA 1B04A 2NLJC 3UQ8A 1Q7YW 4YJ2A 3CCMV 4YY3O 4O4HB 4BAEA 3K0GA 3TXSA 4DXWA 4B3TO 3HYZA 4J7JA 2JEUA 3K0DA 4N21A 2WSSG 1UYFA 3C0EA 4B6CA 1UY9A 2ZM6O 4LR3A 1I58A 3ZM7A 3P32A 3J7AU 1XHXA 1TGOA 4ASAA 4FCPA 5BODA 1RSOB 1Y8NA 1BXDA 2GTSA 4WBNB 2CTWA 4MVMA 4D7TA 2XJJA 1N32B 1X4TA 3P30A 4LF4O 1M9NA 4HNAB 4UB6Z 1XL6A 2WLLB 3D2RA 1GTOA 3IEDA 4NYKA 2BREA 1U96A 1HW7A 4X1YB 1YJNV 2XX5A 4EEHA 2JJCA 2R70A 4KXRA 4LFCO 4O4JB 3ZN1A 1KZNA 1I94B 2CCUA 1ZWIC 2W6IG 4JI7O 4V25A 1FYJA 2X6AA 3JALA 1I5DA 2YK9A 1N4CA 5M4MA 5KAIZ 1PL0A 2ODMA 4BWAA 5F2VO 4JV5B 3K5NA 4B08A 1F7YA 2CTQA 2RNBA 1FXKA 4FLYA 3OT7A 1Z5CA 3RYIB 4DV2O 4HYPA 2JJ1G 3U11A 2E0AA 1KP3A 1MG1A 4LF7O 2B1IA 2P7TC 4FM0A 4YKTA 1CXZB 5EZYA 5JENA 2H55A 4LF8B 3I5DA 3CB2A 3JASA 2WLMA 5KHKA 4Z2WA 2OCCC 4P7AA 4FFBA 4P8OA 1VQ4V 4ZKIA 4Z1VA 4CBCA 4RAIA 2Q7HA 4LH7A 3L72H 1PD3A 3CE2A 2YE6A 1QR8A 5DN6G 4YKWA 3ZRWA 1I5XA 5LOVA 1B63A 4DR5O 3E8GA 1QLEB 3KG2A 2XHTA 2YI5A 2EULA 3F5TA 4RO2A 1GKFA 2Q8IA 4HZ5A 3MAQA 4F6RA 2QFOA 3BRCA 5KHJA 3K58A 1VF6C 3RFRA 5CTWA 4W4KA 1R73A 2BTZA 4O04A 3A0XA 2HHIA 3K60A 2OT5A 2P06A 5K1PA 2ZDIC 3L71H 1IVSA 4FCRA 2IBZH 2LW1A 4PV1B 1L0NH 1PNMA 3WB2A 2CCSA 4RWUA 3IC7A 5IY5C 1Z2GA 2BYIA 1XL4A 2GBOA 4AWOA 2JGDB 3N2KB 4MT8A 2YKCA 2F43G 5E1AC 2A3QA 1JOYA 2X6BA 2FYUH 3AK1A 3HKDA 1XMQO 3W7UA 4KUMA 4WFHA 3FT8A 3ASOC 5E79Z 1N33B 5B3SC 4FVMA 4B3SB 1WP7A 1TUEB 5EC1C 5LMUB 3CC7V 4DK0A 2UU9B 2LP7A 2WLKA 1PP9H 5IDJA 1VARA 4JI8O 3CRMA 3R91A 4KFGA 2GFDA 5J6AA 1B6QA 5BMVA 4PJ0Z 4J42A 4URLA 2O1VA 3CMAV 4GT8A 5FWKA 2YGFA 4UV8A 4YJ2B 4R6ZA 1I08A 3RLQA 5CBHA 3ZMSA 5B1BB 2Q9LA 4F4LA 3CRCA 3CP1A 3IGAC 2BU7A 4KL1A 2YDEA 2GSMB 2FWYA 1QQCA 3SPIA 3SYCA 3T1CA 2XASA 4JI6B 1YS3A 1IZ3A 2XJXA 1E79G 4AWQA 1YXBA 4ZVIA 5D6PA 4X65B 1CEZA 4ZBMA 4H44B 4I9WA 4LF9B 4DRXA 3GB7C 2QF6A 3E86A 2YE2A 5EIBD 1NBMG 2HP8A 4ASBA 3TXQA 4LC1A 1RM1B 5JCOC 4KHPO 1SA0A 4HZ3A 2MK3A 2DOSA 5LGUA 3QTCA 3HZ5A 3OMUA 1S16A 4NXMO 3RGBA 4TQDA 3TUHA 1GN6A 4P9OA 3S3XA 5H5NA 5KHIA 4O0BA 1IURA 3JALB 4LBEC 3AG3C 4DR4O 2ARHA 2UUAO 1G6UA 4CH5A 4FZ1A 2YEBA 1IBMB 2K9PA 4DV4B 3WB1A 4LFAO 1YEWA 2H3OA 5IYZA 3JCUZ 1FXKB 3GVMA 4P2ZA 4JI3B 4CC5A 4DR2O 4EGIA 3WB0A 1TIDA 1BS3A 4MPEA 3T0HA 3D3IA 1H7SA 2ZDIA 3U2KA 4N23A 2ATKC 1D5NA 2CE4A 5EZYB 2E5LB 3AK2A 4XE2A 4LF5B 3PEJA 1K33A 2EILC 1XI1A 2XDLA 4PI2A 2VCJA 2R72A 3SJQC 4EB6B 4FFBB 4JI0B 3FFQA 1ZXMA 4FPPA 4BR6A 3TZ4A 2DW4A 2DE0X 2Z5UA 1G4YB 4X89A 1JR9A 2ZD9A 2ZINA 1I5BA 2H8MA 3ICXA 4ASFA 3JARA 1Z59A 4CWQA 3W7WA 2IWXA 4PDVA 4XCLA 1IDSA 2DWEC 1M93A 4UCVA 1EA6A 3CRQA 4FZ0A 1SZXA 2IU3A 4F6RB 5IDMA 4K0KB 1D5AA 1J5EB 3M7MX 4MTFA 4GFNA 1S3JA 3RVYA 5M4EA 5LP6B 4QE7A 3E83A 4IL6Z 4LWHA 1UYGA 5JQGA 3OR7C 2HHHO 4DV7O 3E22A 4NH8A 5CTYA 2LQTA 2WI6A 2ZR2A 1I7FA 1URFA 1PNLA 5KA6A 4U7OA 3ABUA 1Z5VA 3Q4HA 2ZR3A 2L35A 3ZHRA 5L3BA 3LDEA 3H1KH 5LL6Y 5LBQA 1NKDA 4TV8A 4WFBV 3D36C 1IBLO 3EFFK 4YKUA 3JD0A 4JI5B 5KHHA 2UWDA 4XCJA 3K57A 1HNZO 3CRKA 4FLXA 2Y4UA 5IT9N 3QF7A 1GKXA 1WAZA 2XAGA 2PYJA 3HKDB 2XDUA 3QO5A 2YKBA 1RPOA 2VS0A 4NR1A 5JCOA 1YT1A 1AVMA 2A0LA 1GM8A 3ASNC 2FB5A 5IJ9A 4DV0B 4LF6O 2C2AA 4UCUA 3N27A 3ZRVA 5EK0A 5BMVB 3BABA 2QKAA 2XCMA 2AZ0A 4E02A 2BU5A 2OYQA 4NB5A 4EKWA 3HR0A 4UUJC 4CS3A 1AI7A 3ML0A 1MOFA 1EN4A 2WI5A 2JKIA 3ZIAG 1TH8A 5D5QA 1QHTA 1Z5WA 3UT5B 4XDJA 1IXMA 2PUSA 2XDXA 2Q68A 3SYQA 3H80A 4O2BA 3S5TA 2WLHA 3T1YB 4QIWF 4MSWC 1K73W 3C11A 1BGQA 2OCCB 1YTFD 2DN9A 2P67A 1TAEA 4XTJA 3ZMUA 3U10A 3BA8A 4H13B 3O6OA 1VF7A 4IYIA 4TSFG 4ZI7A 1PKXA 4DRXB 4I3HA 1BSMA 4JTCB 5BR8B 1Y4SA 1W59A 4GGLA 4X88A 2XJGA 2N74A 4UV9A 3LUTB 1SA0B 5GW7A 4JASA 1JMKC 2GUZA 3K9SA 2ADPA 4O05A 1XNRO 1YSZA 5C93A 1E1QG 4UROA 2F66C 3KE6A 3CCRV 1UY8A 5LHHA 1US7A 3T4DA 3A0ZA 1AR1B 5KMGA 2KSDA 4JTDB 2YXLA 3P3NA 5IYZB 4GQTA 2UUBO 4DYLA 4B3MO 3CRRA 4YKRA 2FL4A 2DQ0A 5LHGA 1TC0A 4C7UA 5LXTB 2WEQA 3HKBA 4YHHO 2FWZA 3OFNG 3TGUH 1YSRA 1MX0A 1WNSA 2JIZG 4EFUA 2F93B 3UCSC 1EBOA 2NR5A 3D36A 4FK5C 2IORA 3PJSK 5LGNA 5IY5B 4FM1A 4J9YB 4JTAB 1ZXNA 2FYPA 4JI4O 1U97A 1H8EG 1RFYA 2YEJA 4LNUA 1HR0B 2F4VO 4WFEA 2YIAA 2RJZA 5BXZA 1EZVH 3ASOB 4ZOLA 2W0XA 3OUSA 5B3SB 4PA9A 3W7SA 1XQ8A 1S72V 3SYOA 4GKKB 2EXLA 3M8AA 3FB5C 3TK1A 1WPBA 2P6JA 4HZ0A 2H8PC 2W0FC 4J7KA 3B4SA 4NTYA 1E1RG 4K3AA 1NI8A 2YE5A 1ZL8B 1DLBA 4ICGA 4YKZA 2CK3G 3SGIA 5FNCA 4ZHQA 1KD1W 5CF0A 5JQGB 5ITZA 3NXSA 3ETQA 2XNDG 4NXNB 2Q8FA 2CCTA 3PN1A 3E22B 3RT3C 1IBKO 2ZT9B 3E35A 2Q0OC 1NZ6A 1BQZA 4PL9A 2GTAA 3HB3B 1N8RW 2OTJV 2XX2A 3K5OA 3TZ0A 2XAJA 4DR7O 1KB9F 1H2MA 3OGIB 4B7EA 4DV3O 1I5YA 3QVNA 2ZKJA 1PV0A 1YCIA 2UUCO 4LWGA 4MP7A 3RKZA 4TV8B 1XNQO 2Q8VA 3TCUA 2UXCO 1KIJA 2ESAA 4MPNA 3BFRA 3KCXA 4DR1B 1ENVA 2X7RB 4DW0A 1OCCC 2JS3A 4DR3B 3CCLV 5TISZ 3ZS8C 3ZMTA 3FYIB 4L8ZA 1GN3A 4O4IA 3JSLA 5EBWC 1K8AW 1SZTA 3AG2C 1S76D 1HNXB 1VQPV 5IJ9B 1AJPA 3VQWA 2YKEA 3WHAA 3G6BA 3AG3B 2HKJA 2YICA 2YI0A 1K97A 4CWSA 4TUYA 1KECA 4UFZA 4CS2A 3MD0A 4D7SA 3H9VA 1FJGO 4EGKA 5IJ0B 2XHXA 2YUAA 3VQXA 3ETGA 1YJWV 4IYHA 3UM7A 3MDSA 5FLXN 3JD2A 2UXBO 1THNA 3RVZA 4GCZA 4DV6O 2B1GA 4X62O 4DV5B 1WA8A 1Z5AA 4AQYO 4O2BB 5A9GA 2ZE8A 2EILB 3E89A 4O4LA 3HHUA 4X64O 2YEHA 3BA9A 3RLPA 1GKZA 1NJIW 5JVDA 2VWKA 4MVUA 4EFEA 4JYCA 1YT2A 5HFMA 1TILA 4ZI7B 1VQNV 1QZRA 2Y0PA 2H94A 2O57A 2YE4A 1CPYA 1D2DA 3ZX6A 1V54C 3H01A 2AZ2A 4LF4B 3LSSA 2PZSA 1QNMA 2HEPA 3H4LA 2DJVA 2GUZB 2EIJC 2HJFC 1R6KA 3EXAA 2BT0A 1YDXA 4MVQA 2ZNIA 2XDSA 3LDCA 5IWAO 4O2AA 4JYBA 2PY5A 2JK5C 1K34A 4L91A 3R4NA 2XX4A 2Q73A 5KMGB 1LUWA 2ZIOA 4JI7B 1H7UA 3JZ3A 3CGZA 2BSMA 1PPJH 4XDLA 1N32O 2EJ7A 3CHXA 3LDDA 1BT8A 3ZMZA 3IAYA 1YTFB 2XD6A 4FMTA 5CBFA 1VQLV 2PI5A 3R92A 2YKIA 3HKBB 2PF4E 2F1MA 2BZ5A 4EFBA 3LNMB 1KYOF 3K59A 4LF7B 2B5UA 4HYOA 5L3GA 3O2FA 1AROP 1DTOA 1U2OA 4DV1B 2QWQB 2YIDA 1I94O 1N34B 5LYJB 4X20A 3IC9A 4YXWG 3STLC 1KBHA 1S5HC 4JYAB 3OEEG 4JV5O 2MW2B 5L3EA 3ZXQA 2IJIA 4ZOLB 3AG1C 2QTSA 1NTMH 4DUYB 3HKCA 4GX2A 1P7GA 4NTWA 3ASNB 2AKPA 2WI2A 2Y69C 2JRIA 1H2GA 4CWTA 1Y8OA 4BIOA 3RYHA 4LF8O 2YECA 1IXBA 4ZHQB 1ROPA 1GN4A 3ABTA 5JH7B 4FCQA 4CE3A 1S77D 1Q5OA 3BAAA 1VQ5V 2VWJA 4TT3G 2JJ2G 4MVZA 5KA5A 1KC8W 4I55A 4CWPA 5CTUA 4JZ2A 2Y0IA 4CE1A 4KSGA 3JD4A 3QDDA 4MVRA 1TBWA 2P4VA 4I0XA 2PNRA 2O1UA 5FL7G 5H2FZ 1ZW9A 3WU2Z 3DXRA 2QWRB 2EIKC 3VQYA 3F5WC 4BAYA 1GMGA 2CH7A 5EIBC 2EBOA 1SQQH 1Y74A 3W7TA 5M4KA 4GEEA 5LMNB 3GIGA 3HPLC 4O4IB 2P90A 1YJ9V 3OM3B 1H2KA 2YEIA 3Q5JA 4OX9B 3R4MA 1GM7A 4BIZA 1BCCH 2OIGA 2E75B 4GX1A 5BZBA 1BHBA 3SYAA 1N0JA 3LNUA 4L93A 1P49A 4QJFB 2P5OA 2UXDB 1XEQA 2EIMC 3L73H 3ZKDA 4DK1A 2KKWA 4HY6A 1YESA 4CH6A 2XAQA 1VQ7V 1FS0G 2HJDA 2ZDYA 4QE9A 5DM6V 4O4LB 1R1BA 3TETA 3T1HB 1N33O 3D0BA 1SQFA 4B3SO 1OCOC 2Q4PA 3TTZA 2Q69A 5C8YA 3UKMA 2XTAA 4OPAA 2NN4A 3GWKC 2UU9O 3G7BA 5D7RA 5HFLA 1M56C 4YKXA 1EFRG 2BSKA 2ZQMA 2W6JG 3FB6C 3CXHF 1ZUQA 4OPHA 4H7QA 1Q8IA 4CC6A 1H2SB 1TA8A 1UYLA 1GAXA 3A0RA 1HNWB 4KTNA 2D3OW 2IW5A 5LHIA 5J2UA 1CP9A 4O2AB 4PA7A 4E4EA 4JI6O 1TUBA 2CG9A 5IN9A 2Q5ZA 4E72A 1N36B 1QCEA 4X65O 5JJNB 2E74B 5B1AC 1Q3EA 2A7WA 4X1IA 4WFGA 2IJHA 5D7CA 1FPOA 1AI5A 4PRVA 4UXNA 4PDRA 1WPXA 4W4LA 1IX9A 2WI7A 2AXTZ 1T5EA 1YC1A 5KUMA 5AG2A 1YC4A 1AB3A 2RQ6A 1SQXH 2QWOB 3SPCA 3JASB 1SF9A 3B40A 5L3CA 4JI2B 3HYYA 2OIEA 4AS9A 2ZIMA 1FFXA 2HVKC 3ABMC 3ZHVA 1OCCB 4DV4O 1IBMO 1HP8A 4UB8Z 4XBFA 2YXYA 2R9IA 1WN7A 1AH6A 4K8ZA 4L87A 3OPDA 3HKCB 2ZDXA 4JI3O 2YXHA 1NR1A 3ZRWB 3AG2B 1YITV 1M5IA 5LOVB 3OR6C 3A0HZ 1MMMA 2E5LO 2ZKOA 3B77A 1NHIA 2JVDA 1GN2A 4LF5O 4UCOA 3ZJZA 3RYHB 5EYPA 5CN0A 3IJ4A 3L75H 2QJ1A 3K04A 4J41A 2KB1A 4JI0O 1Y76A 1YC3A 3ETDA 1FXHA 4PDLA 4L90A 1Y67A 1UYDA 4X1KA 4MB9A 3B8NA 4HBNA 4I55B 3ZEDA 2AGAA 2QR4A 2Y4TA 1K7DA 1Y66A 3VHAA 3BHPA 2ZXWC 4L94A 3H1JH 1NH2D 3A0WA 2YEDA 2YI6A 2FTKA 3A0YA 3CSXA 1COWG 3DXRB 4JAUA 4K0KO 5LA6A 1J5EO 2N04A 2CH7B 1Y74B 1PNKA 4UCSA 1K9MW 1XMOO 4MW8A 1I5CA 1Q6IA 1V54B 1UYIA 4OXSA 4FIPC 3GIGB 1QYEA 1OCZC 3OE7G 2EIJB 1YVWA 4CH4A 4U3JA 2V1DA 3I56V 1G8MA 3JAKA 1R6NA 1DK1A 4EM7A 4GKJB 2VRZA 1XOUA 3R4PA 4LH6A 2IOQA 3ZMVA 2GV9A 2K1EA 5K1XA 2QWPB 5KLVH 5KAFZ 2EINC 4CWFA 3A0BZ 1P84F 4JI5O 1VQ8V 1AILA
chains in the Genus database with same CATH topology
2YSUB 4MOTA 3R65A 4KP4A 2YGEA 3SPGA 1UYMA 1QR9A 4K4OA 2WLIA 1Q81W 2YE8A 1NHHA 3EHHA 4P9PA 4CWOA 3X2QC 2IJJA 2YI7A 3JCZA 1OCRC 2XABA 4B7PA 4PELA 2YEEA 2HKOA 2YJXA 2QM7A 3K03A 3QO7A 3AG1B 3ETEA 5B1OA 4LWIA 3ZCCA 1AI6A 3JYCA 2WEPA 2Y69B 2HVJC 3SYPA 3K3WA 4E00A 1Y4UA 3DTUB 3I55V 3GIEA 3WG7C 4LWEA 4JPRA 2XAHA 3CMEV 3OWBA 2HFEC 3OMNB 3G71V 4MS2A 3U2DA 1UYHA 4WFFA 1JJ2U 2A9HA 1NQTA 2ITCC 3FB8C 4MTOA 3G7EA 1UYCA 2WLNA 2EIKB 3K9AA 2GHYA 3B25A 1AMWA 2QG0A 1BHAA 4PRXA 4E01A 1F51A 3CYOA 3CCJV 5M4HA 1ORQC 3TZ5A 3U67A 5D6QA 5KUKA 1I59A 3JD1A 3QTFA 1R3IC 1JCHA 2WWWA 3B26A 3EHJA 4CE2A 4MBCA 5CMUA 1PVGA 1WLEA 1UY6A 1M57C 3OMAB 3ABKC 3CCVV 1J95A 2VCIA 2EIMB 2DYSC 1W2BU 4XDKA 2YE3A 4MVOA 2K5BA 3INWA 1OCOB 3ZKBA 4BQGA 1R3LC 3VOUA 1M56B 4WUDA 1NHJA 1NR7A 4NH9A 3EHBB 1AJNA 1JVMA 2BOCC 1YETA 5LGTA 1NVPD 4RQFA 3SPJA 4O07A 1K5SA 3Q5KA 1OHHG 3CXCU 1QVFU 2Q8HA 4HY1A 3OGCC 4G2KA 4R8CA 1I5AA 5IYDO 5B1AB 1NH2B 1YSCA 2DYRC 5H6RA 1YHQV 4MP2A 4H85A 4RUFA 1JQ0A 5F3KA 2WLIB 3K79A 4KFMA 1H38A 1L1FA 4TWKA 1SESA 4E2LA 2XDKA 1HWYA 1GM9A 3JD3A 2Q6AA 1UJWB 2YJWA 1B3QA 1K3EA 4PA4A 4YKYA 2XOKG 3FKSG 3BY6A 4GT1A 2HR3A 4H81A 4CZZA 1BKNA 5IYBO 4Q20A 2BRCA 3PEHA 2PI4A 3EHGA 4JF3A 2YE9A 3OWDA 4KQVA 3FB7C 5CTXA 1EZJA 2HG5C 3ABLC 4HXWA 2Q8GA 4MW3A 1RPRA 2LFSA 3T1KA 2ZXWB 1AH8A 2R9RB 3RBZA 2QTOA 5CA3A 4R3AA 2M7WA 2HG1A 2ITDC 1R3KC 3EKOA 4LCUC 4URNA 1OCZB 2O1WA 1ZWHA 3T0ZA 4NH7A 3CPWU 4XIRA 2EINB 3CD6V 1OZ0A 2LFRA 1K4CC 3O0IA 4R3MA 2FXSA 2ZBKB 4WCEV 4JAVA 3RW0A 4I5SA 4XIQA 4G27B 3K98A 2IJKA 1YI2V 1H8HG 3X2QB 1K4DC 1KQSU 5L3DA 5L3JA 2BYHA 4EGHA 1OCRB 1MSWD 3INXA 1BL8A 4BXIA 3CCQV 2Z3YA 3OW6A 4PA6A 2WERA 4GX0A 2HCHA 2GQPA 3EKRA 1U0ZA 3B28A 3K08A 3GIFA 3AG4C 2A79B 3E8FA 1W0JG 2YE7A 1ID0A 4FJCC 1Z5BA 3K97A 3WG7B 2YEVA 3OEHG 2EZOA 2BU6A 3F7YC 3ZRXA 2QKSA 4R1FA 3TZ2A 4H37A 1VQMV 1OSFA 3CWVA 2BOBC 4WF9V 1K92A 2YKJA 2QG2A 3W7XA 1AM1A 2IH3C 4CWNA 4JGSA 3ZN0A 1JM6A 1NVPB 2JEXA 4R50A 3T4ZA 1P4RA 3SL2A 5D7DA 3WQ9A 4DUHA 1MABG 2Q67A 1L0OA 3CGYA 4BIUA 1V55C 1SETA 4JQLA 4EFTA 1SRYA 3RLRA 1M57B 3VHDA 3ABKB 3QNEA 2CGFA 4MVSA 1SERA 1GJVA 5J71A 3F7VC 4X8AA 4DO2A 2DYSB 1UYKA 3HZ1A 4V26A 3CCSV 1UY7A 2YEFA 3OAAG 3E8BA 1AJ6A 2JDIG 1Q86W 3WFVA 2IWSA 3NMQA 2YGAA 4ASGA 1VQOV 3K06A 3MHHC 4BQJA 3LPSA 3MHSC 4XD8A 1F4MA 4ASUG 1KKDA 2WAMA 3FT5A 1P7BA 2DYRB 4LP0A 4AWPA 3GWOA 3ZRSA 3G75A 2AHYA 4XDMA 4XKOA 3VBBA 3BEHA 1FXVA 3R4OA 4R7CA 4LP8A 1Y4MA 4XKKA 3A0TA 2AHZA 1THZA 4QNHB 2YK2A 4U7NA 1JPXA 2V7QG 4RQEA 2DQ3A 2YEVB 4MPCA 5L3FA 2Y48A 4UVBA 3SPHA 3AEIA 4DZYA 1QY8A 3OUFA 2CH4A 4KSHA 3ABLB 3CCEV 5EBLC 5FNFA 4BW5A 3DGEA 4W7TA 3FYEB 4EMVA 1A4HA 2XAFA 4HXZA 3ZXOA 3T10A 1EI1A 1YIJV 1DF5A 1KP2A 2VWCA 3E8HA 1GK9A 4QPJA 2Q2EB 5M4PA 1QLEC 3VADA 2IWUA 1S0VA 4H33A 2XK2A 4HYMA 2NNUA 1UYEA 5EBMC 2DWDC 4GX5A 5F5RA 4XIPA 3BM9A 4URMA 2VW5A 1LNQA 1B62A 1F23A 4LPBA 4PA3A 5M4NA 1QLNA 3MNRP 1K5QA 4Z1MG 4O09A 4MTXA 2WI1A 4P30A 2WI3A 2QEXV 4UVCA 1QVGU 3STZC 1YT0A 4WFAV 2OTLV 1TC6A 3K99A 2WI4A 4XC0A 2EJRA 1VQKV 5H9CA 4WUBA 3T2SA 3EHFA 3G6EV 4XITA 2WLLA 4UVAA 3B8MA 2IU0A 2HLDG 5CPHA 2X6CA 1FFTB 4X9LA 3G4SV 3CRLA 3T2MA 5H6QA 3OW2U 2XHRA 3AG4B 1Y8PA 2QA4V 1M1KW 4WUCA 1VQ6V 5IYCO 3HEKA 3FV5A 5B1BC 1DF4A 5GGZA 4YKQA 1R62A 1R3JC 1JX9A 4PU9A 1QBZA 1BYQA 1YERA 4G28B 4J9ZB 1AJQA 4CWRA 2BU8A 1S14A 3E2EA 1RM1C 4QPKA 4LWFA 1W0KG 2IH1C 4U93A 3BMYA 1AI4A 4XKAA 5CBGA 3CC4V 2EZPA 5J9PC 3M99B 3LSQA 3CCUV 3IFXA 1M90W 2UXNA 2YEAA 1V55B 2UXXA 1FXKC 5BOCA 4MTGA 2IOPA 2QM8A 4RUEA 3QO8A 1GO3F 2X0LA 4HAMA 1Q82W 2BU2A 4PDMA 3CC2V 2WPDG 1MU5A 1VQ9V 5B1NA 1F4NA 3Q5LA 1BMFG 2YEGA 3VHCA 3OMIB 3ABMB 3B24A 3B27A 2WLJA 5FNDA 2QE7G 5EC2C 2NLJC 1Q7YW 3CCMV 4BAEA 3K0GA 4DXWA 3HYZA 4N21A 2JEUA 3K0DA 2WSSG 1UYFA 3C0EA 4B6CA 1UY9A 1I58A 3ZM7A 3P32A 4ASAA 4FCPA 5BODA 1Y8NA 1BXDA 2XJJA 4MVMA 3P30A 1M9NA 1XL6A 2WLLB 3D2RA 1GTOA 3IEDA 2BREA 1YJNV 2XX5A 4EEHA 2JJCA 3ZN1A 1KZNA 2CCUA 1ZWIC 2W6IG 4V25A 2X6AA 1I5DA 2YK9A 5M4MA 1PL0A 1FXKA 1Z5CA 4HYPA 2JJ1G 2E0AA 1KP3A 1MG1A 2B1IA 2P7TC 4YKTA 2H55A 2WLMA 2OCCC 4P7AA 4P8OA 1VQ4V 4ZKIA 4CBCA 4RAIA 1PD3A 2YE6A 1QR8A 5DN6G 4YKWA 3ZRWA 1I5XA 1B63A 3E8GA 1QLEB 3KG2A 2XHTA 2YI5A 4RO2A 1GKFA 2Q8IA 4HZ5A 2QFOA 5CTWA 1R73A 2BTZA 4O04A 3A0XA 3K60A 2OT5A 2ZDIC 4FCRA 1PNMA 2CCSA 3IC7A 5IY5C 2BYIA 1XL4A 4AWOA 4MT8A 2YKCA 2F43G 5E1AC 1JOYA 2X6BA 3W7UA 4KUMA 4WFHA 3FT8A 3ASOC 5B3SC 1TUEB 5EC1C 3CC7V 2LP7A 2WLKA 5IDJA 3R91A 4KFGA 2GFDA 5J6AA 1B6QA 4URLA 2O1VA 3CMAV 4GT8A 5FWKA 2YGFA 4UV8A 4R6ZA 3RLQA 5CBHA 3ZMSA 5B1BB 4F4LA 3IGAC 3CP1A 2BU7A 2GSMB 2FWYA 3SPIA 3SYCA 3T1CA 2XASA 1YS3A 2XJXA 1E79G 4AWQA 4ZVIA 5D6PA 1CEZA 4ZBMA 4I9WA 2QF6A 3GB7C 3E86A 2YE2A 1NBMG 4ASBA 4LC1A 1RM1B 4HZ3A 2MK3A 5LGUA 3HZ5A 3OMUA 1S16A 3TUHA 4P9OA 4O0BA 4LBEC 3AG3C 2YEBA 1FXKB 4P2ZA 4EGIA 1TIDA 4MPEA 3T0HA 3D3IA 1H7SA 2ZDIA 3U2KA 4N23A 2ATKC 4XE2A 3PEJA 1K33A 2EILC 2XDLA 2VCJA 3SJQC 1ZXMA 4FPPA 3TZ4A 2DW4A 2Z5UA 1G4YB 4X89A 2ZD9A 1I5BA 2H8MA 4ASFA 1Z59A 4CWQA 3W7WA 2IWXA 4PDVA 4XCLA 2DWEC 1EA6A 2IU3A 5IDMA 4MTFA 4GFNA 1S3JA 3RVYA 5M4EA 4QE7A 3E83A 4LWHA 1UYGA 3OR7C 4NH8A 5CTYA 2WI6A 2ZR2A 1PNLA 5KA6A 4U7OA 3ABUA 2ZR3A 5L3BA 3LDEA 5LBQA 1NKDA 4WFBV 3EFFK 4YKUA 3JD0A 4XCJA 2UWDA 3CRKA 1GKXA 2XAGA 2XDUA 2YKBA 3QO5A 1RPOA 1YT1A 2A0LA 1GM8A 3ASNC 2C2AA 3ZRVA 5EK0A 2XCMA 4E02A 2BU5A 4EKWA 4UUJC 1AI7A 3ML0A 1MOFA 2WI5A 2JKIA 3ZIAG 1TH8A 4XDJA 1IXMA 2XDXA 2Q68A 3SYQA 3H80A 2WLHA 4QIWF 4MSWC 1K73W 3C11A 1BGQA 2OCCB 1YTFD 2P67A 4XTJA 3ZMUA 3O6OA 4TSFG 1PKXA 4I3HA 1Y4SA 4JTCB 4GGLA 4X88A 2XJGA 4UV9A 3LUTB 5GW7A 4JASA 4O05A 1YSZA 5C93A 1E1QG 4UROA 3KE6A 3CCRV 1UY8A 5LHHA 1US7A 3T4DA 3A0ZA 1AR1B 4JTDB 4GQTA 4YKRA 2DQ0A 5LHGA 1TC0A 2WEQA 2FWZA 3OFNG 1YSRA 1MX0A 2JIZG 4EFUA 1EBOA 3D36A 4FK5C 2IORA 3PJSK 5LGNA 5IY5B 4J9YB 4JTAB 1ZXNA 2FYPA 1H8EG 2YEJA 4WFEA 3ASOB 3OUSA 5B3SB 4PA9A 3W7SA 1S72V 3SYOA 2EXLA 3FB5C 3TK1A 2P6JA 4HZ0A 2H8PC 2W0FC 1E1RG 2YE5A 1DLBA 4YKZA 2CK3G 5FNCA 1KD1W 5CF0A 3NXSA 2XNDG 2Q8FA 2CCTA 3E35A 4PL9A 2XX2A 3HB3B 1N8RW 2OTJV 3TZ0A 2XAJA 1I5YA 2ZKJA 4MP7A 4LWGA 3RKZA 3TCUA 1KIJA 2ESAA 4MPNA 1ENVA 2X7RB 1OCCC 3CCLV 3ZMTA 3FYIB 4L8ZA 5EBWC 1K8AW 1SZTA 3AG2C 1S76D 1VQPV 1AJPA 2YKEA 3WHAA 3AG3B 2HKJA 2YI0A 1K97A 4CWSA 1KECA 4EGKA 3MD0A 2XHXA 3ETGA 1YJWV 3UM7A 3JD2A 1THNA 3RVZA 4GCZA 2B1GA 1Z5AA 3E89A 2EILB 3HHUA 2YEHA 3RLPA 1GKZA 1NJIW 4MVUA 4JYCA 1YT2A 5HFMA 1TILA 1VQNV 1QZRA 2H94A 2YE4A 1CPYA 1V54C 3H01A 3LSSA 3H4LA 2EIJC 2HJFC 1R6KA 2BT0A 4MVQA 2XDSA 3LDCA 4JYBA 2JK5C 1K34A 4L91A 3R4NA 2XX4A 1H7UA 3JZ3A 3CGZA 2BSMA 4XDLA 3LDDA 3ZMZA 1YTFB 2XD6A 4FMTA 5CBFA 1VQLV 2PI5A 3R92A 2YKIA 2BZ5A 3LNMB 2B5UA 4HYOA 5L3GA 3O2FA 1AROP 1DTOA 1U2OA 4YXWG 3STLC 1S5HC 3OEEG 5L3EA 3ZXQA 2IJIA 3AG1C 4GX2A 3ASNB 2AKPA 2WI2A 2Y69C 1H2GA 4CWTA 1Y8OA 2YECA 1ROPA 3ABTA 4FCQA 4CE3A 1S77D 1VQ5V 4TT3G 2JJ2G 4MVZA 5KA5A 1KC8W 4CWPA 5CTUA 4CE1A 4KSGA 3JD4A 3QDDA 4MVRA 1TBWA 2PNRA 2O1UA 5FL7G 1ZW9A 2EIKC 3F5WC 4BAYA 1GMGA 2EBOA 3W7TA 5M4KA 4GEEA 3GIGA 3HPLC 2P90A 1YJ9V 3OM3B 2YEIA 3Q5JA 3R4MA 1GM7A 4BIZA 4GX1A 5BZBA 1BHBA 3SYAA 3LNUA 4L93A 4QJFB 2EIMC 3ZKDA 4HY6A 1YESA 2XAQA 1VQ7V 1FS0G 2ZDYA 4QE9A 5DM6V 3TETA 3D0BA 1OCOC 3TTZA 2Q69A 3UKMA 3G7BA 5D7RA 5HFLA 1M56C 4YKXA 1EFRG 2ZQMA 3FB6C 2W6JG 4H7QA 1UYLA 3A0RA 4KTNA 2D3OW 2IW5A 5LHIA 1CP9A 4PA7A 2CG9A 5IN9A 1QCEA 5B1AC 4WFGA 2IJHA 5D7CA 1AI5A 4PRVA 4UXNA 4PDRA 1WPXA 2WI7A 1YC1A 5KUMA 1YC4A 3SPCA 5L3CA 3HYYA 4AS9A 2HVKC 3ABMC 1OCCB 4XBFA 2R9IA 1AH6A 4L87A 3OPDA 2ZDXA 1NR1A 3ZRWB 3AG2B 1YITV 3OR6C 1NHIA 3B77A 3ZJZA 5CN0A 3K04A 2KB1A 1YC3A 3ETDA 4L90A 1FXHA 4PDLA 1UYDA 4MB9A 3B8NA 1K7DA 1Y66A 3VHAA 2ZXWC 4L94A 1NH2D 3A0WA 2YEDA 2YI6A 2FTKA 3A0YA 1COWG 4JAUA 1PNKA 1K9MW 1I5CA 4MW8A 1V54B 1UYIA 4OXSA 4FIPC 3GIGB 1QYEA 1OCZC 3OE7G 2EIJB 2V1DA 3I56V 1G8MA 1R6NA 4EM7A 3R4PA 2IOQA 3ZMVA 2K1EA 2EINC 4CWFA 1VQ8V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHD A;  2E0A A;  2CGF A;  5J71 A;  1GJV A;  4PL9 A;  4YKT A;  2XX2 A;  4MOT A;  4KP4 A;  1UYK A;  2YGE A;  3TZ0 A;  3HZ1 A;  4V26 A;  2H55 A;  1UY7 A;  1UYM A;  2ZKJ A;  4MP7 A;  4LWG A;  4K4O A;  3RKZ A;  4P7A A;  2YEF A;  1NHH A;  2YE8 A;  3EHH A;  4P8O A;  1KIJ A;  4CWO A;  1AJ6 A;  4ZKI A;  2ESA A;  2YI7 A;  4MPN A;  2YE6 A;  2XAB A;  4B7P A;  4YKW A;  3ZRW A;  2YEE A;  1B63 A;  2IWS A;  2QM7 A;  2YJX A;  4L8Z A;  3NMQ A;  5B1O A;  2XHT A;  2YI5 A;  4LWI A;  2YGA A;  4ASG A;  3ZCC A;  2Q8I A;  4HZ5 A;  2WEP A;  2QFO A;  2YKE A;  3WHA A;  4E00 A;  1Y4U A;  4BQJ A;  2HKJ A;  2YI0 A;  3LPS A;  3GIE A;  4CWS A;  5CTW A;  4LWE A;  4EGK A;  3MD0 A;  2BTZ A;  4O04 A;  2XHX A;  3A0X A;  3K60 A;  4XD8 A;  3OWB A;  3FT5 A;  4FCR A;  1THN A;  4GCZ A;  4LP0 A;  4AWP A;  3U2D A;  1UYH A;  1Z5A A;  3HHU A;  2YEH A;  3G75 A;  2CCS A;  4XDM A;  1GKZ A;  3G7E A;  4XKO A;  3RLP A;  1UYC A;  4JYC A;  2BYI A;  4AWO A;  1YT2 A;  1TIL A;  1QZR A;  4MT8 A;  2YKC A;  3B25 A;  1AMW A;  2YE4 A;  2QG0 A;  1JOY A;  3R4O A;  4PRX A;  4E01 A;  1F51 A;  3FT8 A;  5M4H A;  3TZ5 A;  3H4L A;  3U67 A;  2BT0 A;  4XKK A;  5D6Q A;  3A0T A;  5IDJ A;  2XDS A;  1I59 A;  3QTF A;  3R91 A;  4KFG A;  2GFD A;  4JYB A;  4L91 A;  5J6A A;  2YK2 A;  2XX4 A;  4U7N A;  3R4N A;  4URL A;  2O1V A;  1H7U A;  2WWW A;  3B26 A;  3EHJ A;  3JZ3 A;  4GT8 A;  4CE2 A;  5FWK A;  2YGF A;  3CGZ A;  4MPC A;  4MBC A;  1PVG A;  2BSM A;  1UY6 A;  3RLQ A;  2VCI A;  2XD6 A;  4FMT A;  2BU7 A;  3R92 A;  4DZY A;  2YKI A;  1QY8 A;  2FWY A;  2CH4 A;  2BZ5 A;  4KSH A;  2YE3 A;  1YS3 A;  2XJX A;  2K5B A;  3INW A;  5FNF A;  4AWQ A;  3DGE A;  3ZKB A;  3O2F A;  4W7T A;  5D6P A;  4ZVI A;  1U2O A;  4EMV A;  4BQG A;  1A4H A;  4HXZ A;  3ZXO A;  3T10 A;  1EI1 A;  2QF6 A;  4WUD A;  2YE2 A;  1NHJ A;  2VWC A;  4ASB A;  4NH9 A;  4QPJ A;  2Q2E B;  5M4P A;  4LC1 A;  3ZXQ A;  3VAD A;  2IWU A;  3HZ5 A;  3OMU A;  1S16 A;  1YET A;  2XK2 A;  2AKP A;  2WI2 A;  4HYM A;  1UYE A;  3TUH A;  4CWT A;  4O0B A;  1Y8O A;  5F5R A;  4O07 A;  4XIP A;  3BM9 A;  4URM A;  2VW5 A;  2YEC A;  2YEB A;  3Q5K A;  1B62 A;  4FCQ A;  2Q8H A;  4CE3 A;  4LPB A;  4HY1 A;  5M4N A;  4EGI A;  1I5A A;  1TID A;  4MPE A;  3MNR P;  3T0H A;  1H7S A;  3U2K A;  4O09 A;  4MTX A;  2WI1 A;  2WI3 A;  4MP2 A;  4XE2 A;  4CWP A;  5CTU A;  3PEJ A;  4H85 A;  2XDL A;  5F3K A;  1YT0 A;  2VCJ A;  4CE1 A;  4KSG A;  3QDD A;  1TC6 A;  1TBW A;  2WI4 A;  3K99 A;  4XC0 A;  1ZXM A;  2PNR A;  2O1U A;  4FPP A;  4WUB A;  1ZW9 A;  3T2S A;  3TZ4 A;  3EHF A;  2XDK A;  4XIT A;  1I5B A;  2H8M A;  4ASF A;  1Z59 A;  4CWQ A;  5CPH A;  5M4K A;  2IWX A;  4GEE A;  4XCL A;  3GIG A;  1EA6 A;  4X9L A;  3CRL A;  2YJW A;  1B3Q A;  2YEI A;  3Q5J A;  3R4M A;  4YKY A;  4BIZ A;  2XHR A;  5IDM A;  4GT1 A;  4GFN A;  1Y8P A;  5M4E A;  4H81 A;  1BKN A;  3LNU A;  4WUC A;  4LWH A;  1UYG A;  4Q20 A;  4L93 A;  3HEK A;  4NH8 A;  5CTY A;  2BRC A;  3FV5 A;  2WI6 A;  3PEH A;  4U7O A;  3ZKD A;  3EHG A;  4HY6 A;  5GGZ A;  4YKQ A;  2YE9 A;  3OWD A;  1YES A;  1R62 A;  4KQV A;  5CTX A;  4HXW A;  2ZDY A;  2Q8G A;  3T1K A;  2LFS A;  4PU9 A;  3D0B A;  3TTZ A;  1AH8 A;  4YKU A;  1BYQ A;  1YER A;  3G7B A;  5D7R A;  4YKX A;  4CWR A;  4R3A A;  4XCJ A;  2UWD A;  3CRK A;  2HG1 A;  2BU8 A;  1S14 A;  1GKX A;  2XDU A;  2YKB A;  4QPK A;  4H7Q A;  4LWF A;  1UYL A;  1YT1 A;  3EKO A;  4URN A;  3A0R A;  4U93 A;  2O1W A;  1ZWH A;  3BMY A;  4KTN A;  3T0Z A;  4NH7 A;  4XKA A;  2C2A A;  3ZRV A;  2CG9 A;  2YEA A;  2XCM A;  5IN9 A;  4XIR A;  4E02 A;  2BU5 A;  2LFR A;  5BOC A;  3O0I A;  4R3M A;  2FXS A;  2IOP A;  2QM8 A;  2WI5 A;  2JKI A;  5D7C A;  1TH8 A;  2ZBK B;  4JAV A;  1IXM A;  2XDX A;  4PRV A;  3H80 A;  2WI7 A;  4I5S A;  4XIQ A;  1YC1 A;  3K98 A;  3C11 A;  2BU2 A;  1BGQ A;  2P67 A;  4XTJ A;  1YC4 A;  5L3J A;  3O6O A;  2BYH A;  4I3H A;  4EGH A;  3HYY A;  1Y4S A;  1MU5 A;  4AS9 A;  3INX A;  4GGL A;  2XJG A;  5B1N A;  4BXI A;  3Q5L A;  3OW6 A;  1AH6 A;  2WER A;  4JAS A;  2HCH A;  3OPD A;  2GQP A;  2YEG A;  2ZDX A;  3EKR A;  3VHC A;  4O05 A;  1YSZ A;  3ZRW B;  1U0Z A;  3B28 A;  5C93 A;  3GIF A;  3B24 A;  3B27 A;  4URO A;  3KE6 A;  1UY8 A;  1NHI A;  5FND A;  1US7 A;  2YE7 A;  3A0Z A;  1ID0 A;  1Z5B A;  3K97 A;  4GQT A;  1YC3 A;  4YKR A;  2BU6 A;  4BAE A;  3ZRX A;  4L90 A;  1TC0 A;  3HYZ A;  4R1F A;  3TZ2 A;  1UYF A;  3C0E A;  4B6C A;  1UYD A;  1UY9 A;  1OSF A;  3CWV A;  2WEQ A;  4MB9 A;  1I58 A;  3ZM7 A;  2FWZ A;  3P32 A;  2YKJ A;  3VHA A;  2QG2 A;  1YSR A;  4ASA A;  1MX0 A;  4FCP A;  5BOD A;  4L94 A;  4EFU A;  1Y8N A;  3A0W A;  1BXD A;  3D36 A;  2YED A;  2IOR A;  2XJJ A;  1AM1 A;  2YI6 A;  2FTK A;  3A0Y A;  4CWN A;  1ZXN A;  4JAU A;  2FYP A;  2YEJ A;  1JM6 A;  1I5C A;  3D2R A;  3IED A;  1UYI A;  2BRE A;  3SL2 A;  3GIG B;  5D7D A;  2XX5 A;  4EEH A;  1QYE A;  2JJC A;  3WQ9 A;  2EXL A;  1KZN A;  2CCU A;  3TK1 A;  4HZ0 A;  4V25 A;  1I5D A;  4DUH A;  2YE5 A;  4EM7 A;  2YK9 A;  4YKZ A;  5M4M A;  1L0O A;  3CGY A;  5FNC A;  4BIU A;  2IOQ A;  3R4P A;  5CF0 A;  4JQL A;  4EFT A;  3NXS A;  2Q8F A;  4CWF A;  2CCT A;  1Z5C A;  3RLR A;  4HYP A; 
#chains in the Genus database with same CATH topology
 4OGQ B;  2YSU B;  1UFI A;  2R9A A;  2IM9 A;  3ZHU A;  4MOT A;  3R65 A;  4KP4 A;  1H2N A;  5B5E Z;  2YGE A;  4B7K A;  3HKE A;  3SPG A;  1UYM A;  2YI8 A;  1QR9 A;  1XDC A;  4K4O A;  2WLI A;  3H1I H;  1AR5 A;  1WJZ A;  1Q81 W;  2YE8 A;  1NHH A;  3EHH A;  4P9P A;  3RN4 A;  3X2Q C;  4CWO A;  2IJJ A;  2QKC A;  2YI7 A;  3FD9 A;  3JCZ A;  1OCR C;  2XAB A;  4B7P A;  4PEL A;  2YEE A;  2HKO A;  1S5J A;  2YS8 A;  4LFB B;  1XBL A;  3NR7 A;  2YJX A;  2QM7 A;  3SDL A;  3K03 A;  3QO7 A;  2P4K A;  5B1O A;  3AG1 B;  3ETE A;  2RN9 A;  3CS5 A;  2YC0 A;  4LWI A;  3ZCC A;  1AI6 A;  3JAM N;  1XIL A;  3JYC A;  2WEP A;  2Y69 B;  1S5L Z;  2HVJ C;  3SYP A;  3EVK A;  3K3W A;  4E00 A;  2CTR A;  4ABM A;  1Y4U A;  2B9Z A;  3DTU B;  3I55 V;  3GIE A;  3WG7 C;  3JAT A;  4BW9 A;  4LWE A;  4JPR A;  1X59 A;  2XAH A;  3CME V;  1GH6 A;  4NKG B;  3OWB A;  2QM4 A;  1RSO A;  2HFE C;  1LR1 A;  5BR8 O;  3OMN B;  1H2L A;  3G71 V;  2UUB B;  4MS2 A;  3U2D A;  3O9O A;  1UYH A;  4J80 A;  4WFF A;  2A9H A;  4GLX A;  4HNA A;  1JJ2 U;  1NQT A;  2ITC C;  3FB8 C;  4MTO A;  3G7E A;  1UYC A;  2WLN A;  2EIK B;  3K9A A;  2GHY A;  3B25 A;  1AMW A;  2QG0 A;  4O4J A;  5B66 Z;  1BHA A;  1FFX B;  4PRX A;  3ZHS A;  4E01 A;  2VQE B;  4Q6G A;  1F51 A;  3CYO A;  3CCJ V;  5M4H A;  1ORQ C;  2BTO A;  3TZ5 A;  3U67 A;  5D6Q A;  3JAR B;  5KUK A;  4X9Q A;  1I59 A;  3JD1 A;  3QTF A;  4JI1 B;  3RYI A;  3R66 A;  1R3I C;  3B09 A;  5EYP B;  3DC6 A;  2Z0A A;  1JCH A;  2WWW A;  3B26 A;  3EHJ A;  1NU1 H;  1O9H A;  4CE2 A;  4A5U B;  5CMU A;  1PVG A;  4MBC A;  1WLE A;  1UY6 A;  1M57 C;  3OMA B;  3ABK C;  3CCV V;  1J95 A;  2VCI A;  2EIM B;  3L70 H;  1GRJ A;  3KCY A;  5BY1 A;  1HR0 O;  2DYS C;  3S3W A;  4I7Z B;  1W2B U;  3G80 A;  4XDK A;  5JJJ B;  2YE3 A;  4B3R B;  2QGN A;  4MVO A;  2K5B A;  3INW A;  1OCO B;  3ZKB A;  4GKK O;  3Q4H B;  1EN5 A;  4BQG A;  1R3L C;  3D3Q A;  2UUC B;  5LA6 B;  3VOU A;  1M56 B;  1MA1 A;  3LMM A;  4WUD A;  1NHJ A;  5D5P A;  2C1I A;  1NR7 A;  2A06 H;  4NH9 A;  3EHB B;  4NVP A;  1AJN A;  1JVM A;  4DR6 B;  3TJT A;  2BOC C;  1YET A;  1WP8 A;  3RYC A;  4U3J B;  1FAF A;  4FM2 A;  5LGT A;  2VQF B;  3OTO B;  1NVP D;  4RQF A;  1JFF A;  3C3T A;  2WA3 A;  4IHJ A;  3SPJ A;  3K5M A;  4O07 A;  1K5S A;  3CJH A;  3Q5K A;  1OHH G;  2KG7 A;  1ZLZ A;  3LSU A;  4DUZ B;  3CXC U;  3CYG A;  4I9Q A;  1QVF U;  2Q8H A;  4HY1 A;  1WB8 A;  5FPR A;  3OGC C;  4G2K A;  4R8C A;  3ZBH A;  5IYD O;  1I5A A;  5B1A B;  1NH2 B;  5GON A;  3CEI A;  1YSC A;  3JAW A;  3KKY A;  3OTF A;  2DYR C;  5H6R A;  4X66 O;  2LW7 A;  4DR1 O;  1YHQ V;  4MP2 A;  4YJ3 A;  5JWP A;  4DR3 O;  4H85 A;  4RUF A;  3HKE B;  5KX5 A;  1JQ0 A;  5F3K A;  2WLI B;  3K79 A;  1KUQ A;  4KFM A;  1H38 A;  1HNX O;  4YY3 B;  2CGN A;  1L1F A;  4GUN A;  3THO A;  4B3T B;  4TWK A;  1SES A;  4E2L A;  2JGU A;  1HWY A;  3SJB C;  2XDK A;  1GM9 A;  4LWS A;  1SQP H;  2ZM6 B;  2KQX A;  3CX5 F;  1SQB H;  3JD3 A;  2Q0A A;  4AI8 A;  2Q6A A;  1UJW B;  2YJW A;  1B3Q A;  1K3E A;  5FPO A;  4PA4 A;  4YKY A;  2XOK G;  3FKS G;  3BY6 A;  4GT1 A;  1VP7 A;  2HR3 A;  4DV5 O;  3LNN A;  4H81 A;  4CZZ A;  1BKN A;  2M6Y A;  3JAT B;  5IYB O;  5IWA B;  1B06 A;  4Q20 A;  3QG5 A;  2BRC A;  1Q6U A;  4LFC B;  4EEQ A;  1L8D A;  3PEH A;  2PI4 A;  3EHG A;  2XHB A;  2Q7G A;  4JF3 A;  2YE9 A;  3OWD A;  4KQV A;  3FB7 C;  5CTX A;  1EZJ A;  2HG5 C;  3ABL C;  2ZE6 A;  4HXW A;  2Q8G A;  1BQ0 A;  4MW3 A;  1RPR A;  2LFS A;  2QDO A;  3T1K A;  1RP3 B;  2ZXW B;  4PI0 A;  3B2E E;  1AH8 A;  3APO A;  1LUV A;  2R9R B;  3RBZ A;  2QTO A;  2YI9 A;  4DV2 B;  2YIB D;  5CA3 A;  4R3A A;  2M7W A;  1A32 A;  2HG1 A;  2ITD C;  1R3K C;  5CA1 A;  5GTH Z;  3EKO A;  4LCU C;  4URN A;  1OCZ B;  2O1W A;  3KZI Z;  1ZWH A;  4FFK A;  1VMG A;  4LNU B;  3T0Z A;  4NH7 A;  1KU9 A;  3CPW U;  1HDJ A;  2D2C B;  4H0L B;  1V9P A;  2LGW A;  4AHC A;  4DR5 B;  5CB4 A;  4XIR A;  4FLW A;  1ZSP A;  2CGO A;  2EIN B;  4DV1 O;  1OZ0 A;  3CD6 V;  2LFR A;  1N34 O;  1K4C C;  3O0I A;  4TOI A;  4R3M A;  5A2Q N;  5GTI Z;  2FXS A;  4EB6 A;  4IIJ A;  1PM9 A;  4FLV A;  2ZBK B;  4WCE V;  4JAV A;  2YIB A;  5ITZ B;  4JYA O;  3RW0 A;  2XT9 A;  4I5S A;  4XIQ A;  4G27 B;  4DUY O;  4GZR B;  3K98 A;  3AG7 A;  2IJK A;  1YI2 V;  2OWO A;  1H8H G;  3X2Q B;  1K4D C;  1KQS U;  5L3D A;  5L3J A;  2BYH A;  4EGH A;  1KKC A;  1OCR B;  1MSW D;  3INX A;  1BL8 A;  4BXI A;  3CCQ V;  2Z3Y A;  3OW6 A;  4PA6 A;  2WER A;  4GX0 A;  2HCH A;  2GQP A;  3EKR A;  5LP6 A;  3L9D A;  1U0Z A;  3RYC B;  3B28 A;  3C3S A;  2P22 C;  3K08 A;  3GIF A;  2ZE7 A;  1XUQ A;  3BVO A;  2FML A;  3AG4 C;  2A79 B;  1JFF B;  3OD4 A;  4IHJ B;  3E8F A;  1W0J G;  4I50 A;  2YE7 A;  3CJH B;  1ID0 A;  4FJC C;  1Z5B A;  1XMQ B;  3K97 A;  2KG7 B;  3WG7 B;  1EN6 A;  2YEV A;  4TV9 A;  3OEH G;  2EZO A;  1Q90 D;  4NTX A;  2BU6 A;  3F7Y C;  3ZRX A;  2QKS A;  5GON B;  4R1F A;  3TZ2 A;  3JAW B;  4H37 A;  1VQM V;  1OSF A;  4JI8 B;  3CWV A;  4TUY B;  2BOB C;  4YJ3 B;  4WF9 V;  1K92 A;  3U0Z A;  4UCT A;  5LMN O;  5KX5 B;  2YKJ A;  2QG2 A;  4ZIB A;  3W7X A;  1MZF A;  1AM1 A;  4OX9 O;  2IH3 C;  4K8X A;  3SJA C;  4J11 A;  4CWN A;  4U3F H;  1WA8 B;  4JGS A;  3ZN0 A;  4LWS B;  1JM6 A;  5LMU O;  5JVD B;  3UO2 A;  1NVP B;  1Q43 A;  2JEX A;  4R50 A;  3T4Z A;  1P4R A;  3SL2 A;  5D7D A;  1US6 A;  2UXD O;  1DGS A;  3WQ9 A;  1SKV A;  4D6T H;  2BTQ A;  1M4U A;  1EM1 A;  4DUH A;  1MAB G;  1QU7 A;  2Q67 A;  1L0O A;  3CGY A;  4BIU A;  3T1H O;  1V55 C;  1SET A;  3UT5 A;  4JQL A;  4EFT A;  4KHP B;  2LO1 A;  1SRY A;  1UPG A;  2N05 A;  3RLR A;  1M57 B;  4NXM B;  3VHD A;  3ABK B;  3QNE A;  5DED A;  2CGF A;  4JAA A;  4MVS A;  1SER A;  1GJV A;  5J71 A;  3F7V C;  4X8A A;  4DO2 A;  2DYS B;  1UYK A;  3HZ1 A;  4DR4 B;  4V26 A;  2AW9 A;  2UUA B;  3CCS V;  1UY7 A;  5FNV A;  2CDY A;  4LF9 O;  1HNW O;  2ZNJ A;  4LFA B;  2YEF A;  5J2T A;  3OAA G;  3E8B A;  4GYC B;  5CA0 A;  1AJ6 A;  2V4D A;  4YIO A;  4DR2 B;  2JDI G;  1Q86 W;  2Q7E A;  3N2G A;  5CA1 B;  1MNG A;  3D8C A;  3WFV A;  2IWS A;  4L8J A;  1VF6 A;  3NMQ A;  1N36 O;  3C90 A;  4X20 B;  2YGA A;  4ASG A;  1BZK A;  1VQO V;  3K06 A;  3MHH C;  3H1L H;  3SJC C;  3J80 N;  4BQJ A;  4DW1 A;  3LPS A;  5LXT A;  1TVK A;  5CB4 B;  2PYL A;  1G1X B;  1MSD A;  3ZHQ A;  3AK3 A;  3BCC H;  3MHS C;  4XD8 A;  1F4M A;  4ASU G;  1KKD A;  4IIJ B;  4JI2 O;  2WAM A;  3UO3 A;  3FT5 A;  1P7B A;  2DYR B;  2XUM A;  4LP0 A;  4AWP A;  3GWO A;  3ZRS A;  3G75 A;  2AHY A;  4XDM A;  4XKO A;  3VBB A;  2HHH B;  4DV7 B;  3BEH A;  1FXV A;  1JJO A;  3RYF A;  1SQV H;  3R4O A;  4R7C A;  2BE3 A;  4I0X B;  3H1H H;  1N0N A;  1ZL8 A;  4LP8 A;  4FLZ A;  1Y4M A;  4UCR A;  1XMO B;  1IBL B;  4XKK A;  2LJ2 A;  2ADQ B;  3A0T A;  2G38 A;  2AHZ A;  1PL4 A;  1THZ A;  3FX7 A;  4TQF A;  4QNH B;  4I50 B;  1HNZ B;  1WB7 A;  2YK2 A;  4U7N A;  1JPX A;  2V7Q G;  4RQE A;  2DQ3 A;  2YEV B;  3O65 A;  5L3F A;  4TV9 B;  4MPC A;  2EX3 A;  2Y48 A;  4UVB A;  2QSA A;  4IGG A;  2C1G A;  1SS3 A;  2CTP A;  3SPH A;  3AEI A;  4LF6 B;  4DZY A;  2WA4 A;  2E3C A;  1QY8 A;  1KMI Z;  3OUF A;  2CH4 A;  4KSH A;  3ABL B;  3ZHT A;  1Y6X A;  2L6L A;  3DSQ A;  2ZCE A;  3CCE V;  5EBL C;  5FNF A;  4BW5 A;  3A8T A;  3DGE A;  4W7T A;  3FYE B;  2RMK B;  4EMV A;  1SC5 B;  1A4H A;  2XAF A;  4HXZ A;  3ZXO A;  3T10 A;  1EI1 A;  1YIJ V;  1VF5 B;  4GKJ O;  1DF5 A;  1KP2 A;  2VWC A;  3E8H A;  4I4T A;  5C8Y B;  1GK9 A;  4QPJ A;  1AP5 A;  2Q2E B;  5M4P A;  1QLE C;  3VAD A;  3K5L A;  2IWU A;  1S0V A;  4H33 A;  4DV0 O;  1BGY H;  1VIB A;  2XK2 A;  2BSK B;  4HYM A;  3FAV A;  2BTQ B;  2NNU A;  1UYE A;  5EBM C;  4K35 A;  5IJ0 A;  2DWD C;  4GX5 A;  3G67 A;  5F5R A;  4XIP A;  3BM9 A;  4F6E A;  4URM A;  2VW5 A;  4AIL C;  1LNQ A;  1B62 A;  1F23 A;  2PTM A;  2QWN B;  5J2U B;  5DEC A;  1O9G A;  3APQ A;  4LPB A;  4PA3 A;  5M4N A;  1QLN A;  4J7Z A;  4O4H A;  1XNR B;  2CAZ C;  1TUB B;  3T1Y O;  3MNR P;  4PD4 F;  1K5Q A;  4Z1M G;  4CH3 A;  4O09 A;  3BPZ A;  4JYY A;  4MTX A;  1AR4 A;  2WI1 A;  4P30 A;  2WI3 A;  1SQG A;  4LFB O;  2QEX V;  4UVC A;  5FNV B;  3J81 N;  1QVG U;  3STZ C;  4J10 A;  1YT0 A;  1XHZ A;  4X1I B;  4WFA V;  2OTL V;  1TC6 A;  3K99 A;  2WI4 A;  4WBN A;  5J2T B;  4XC0 A;  2LGQ A;  2EJR A;  1NT2 B;  5CA0 B;  1VQK V;  4B3M B;  5H9C A;  4WUB A;  3T2S A;  3EHF A;  3G6E V;  4IT5 A;  2JS5 A;  4XIT A;  2WLL A;  4UVA A;  3CRA A;  3B8M A;  2IU0 A;  2HLD G;  4YHH B;  3N2G B;  5CPH A;  4PHZ A;  4FLU A;  2X6C A;  1FFT B;  2BCC H;  4X1Y A;  4X9L A;  3G4S V;  3CRL A;  1NS1 A;  3T2M A;  1NTZ H;  5H6Q A;  2PGG A;  3OW2 U;  2XHR A;  1L0L H;  4JI4 B;  4QGP A;  3AG4 B;  1Y8P A;  2QA4 V;  1M1K W;  1OJH A;  2CUG A;  4WUC A;  1TVK B;  3L74 H;  2F4V B;  1VQ6 V;  5IYC O;  3HEK A;  3FV5 A;  5B1B C;  1DF4 A;  1JA8 A;  2ILM A;  5GGZ A;  4YKQ A;  1R62 A;  1R3J C;  5LYJ A;  1JX9 A;  4YIP A;  1Y76 B;  2VQE O;  4PU9 A;  1AP6 A;  2RDC A;  4X1K B;  1QBZ A;  1BYQ A;  1YER A;  1IBK B;  4G28 B;  4J9Z B;  1AJQ A;  4JI1 O;  4CWR A;  3RYF B;  1FKA O;  2BU8 A;  1S14 A;  1ZX3 A;  4FLT A;  3E2E A;  4DR7 B;  1RM1 C;  4QPK A;  4LWF A;  4DV3 B;  1W0K G;  1I0H A;  2IH1 C;  4U93 A;  1XNQ B;  2RCV A;  3BMY A;  2UXC B;  1AI4 A;  4XKA A;  2ZE5 A;  5CBG A;  5JH7 A;  3CC4 V;  5IE9 A;  2EZP A;  5J9P C;  3M99 B;  3CWB H;  3LSQ A;  3CCU V;  4NXN O;  1ZAU A;  4B3R O;  3IFX A;  2F95 B;  3RWR D;  1M90 W;  2UXN A;  3P3P A;  2YEA A;  1V55 B;  2UXX A;  1XRE A;  1YF2 A;  2GDS A;  1FXK C;  3JAK B;  2E76 B;  5BOC A;  4MTG A;  2IOP A;  4CS4 A;  2QM8 A;  4RUE A;  3QO8 A;  2DMX A;  2ETN A;  1VEW A;  1GO3 F;  2X0L A;  4HAM A;  4DR6 O;  4X66 B;  1OV9 A;  3A2F A;  1YZB A;  1Q82 W;  4PDM A;  2BU2 A;  1FJG B;  1Q6H A;  3CC2 V;  4JZG A;  2OCH A;  2JGD A;  2VQF O;  3OTO O;  5JJE B;  3DC5 A;  3N2K A;  2WPD G;  2UXB B;  1MU5 A;  4DV6 B;  1VQ9 V;  4I4T B;  5B1N A;  4X62 B;  1ZTE A;  1F4N A;  4AQY B;  4DUZ O;  1BMF G;  3Q5L A;  1BE3 H;  2YEG A;  4X64 B;  2F23 A;  5KHG A;  3VHC A;  3FAV B;  2FKX A;  3OMI B;  3ABM B;  3SR2 C;  3B24 A;  3B27 A;  2WLJ A;  1R6T A;  1FD9 A;  5FND A;  3JSN A;  5LP6 C;  1MZE A;  2QE7 G;  5EC2 C;  1NTK H;  3VQV A;  1B04 A;  2NLJ C;  3UQ8 A;  1Q7Y W;  4YJ2 A;  3CCM V;  4YY3 O;  4O4H B;  4BAE A;  3K0G A;  3TXS A;  4DXW A;  4B3T O;  3HYZ A;  4J7J A;  2JEU A;  3K0D A;  4N21 A;  2WSS G;  1UYF A;  3C0E A;  4B6C A;  1UY9 A;  2ZM6 O;  4LR3 A;  1I58 A;  3ZM7 A;  3P32 A;  3J7A U;  1XHX A;  1TGO A;  4ASA A;  4FCP A;  5BOD A;  1RSO B;  1Y8N A;  1BXD A;  2GTS A;  4WBN B;  2CTW A;  4MVM A;  4D7T A;  2XJJ A;  1N32 B;  1X4T A;  3P30 A;  4LF4 O;  1M9N A;  4HNA B;  4UB6 Z;  1XL6 A;  2WLL B;  3D2R A;  1GTO A;  3IED A;  4NYK A;  2BRE A;  1U96 A;  1HW7 A;  4X1Y B;  1YJN V;  2XX5 A;  4EEH A;  2JJC A;  2R70 A;  4KXR A;  4LFC O;  4O4J B;  3ZN1 A;  1KZN A;  1I94 B;  2CCU A;  1ZWI C;  2W6I G;  4JI7 O;  4V25 A;  1FYJ A;  2X6A A;  3JAL A;  1I5D A;  2YK9 A;  1N4C A;  5M4M A;  5KAI Z;  1PL0 A;  2ODM A;  4BWA A;  5F2V O;  4JV5 B;  3K5N A;  4B08 A;  1F7Y A;  2CTQ A;  2RNB A;  1FXK A;  4FLY A;  3OT7 A;  1Z5C A;  3RYI B;  4DV2 O;  4HYP A;  2JJ1 G;  3U11 A;  2E0A A;  1KP3 A;  1MG1 A;  4LF7 O;  2B1I A;  2P7T C;  4FM0 A;  4YKT A;  1CXZ B;  5EZY A;  5JEN A;  2H55 A;  4LF8 B;  3I5D A;  3CB2 A;  3JAS A;  2WLM A;  5KHK A;  4Z2W A;  2OCC C;  4P7A A;  4FFB A;  4P8O A;  1VQ4 V;  4ZKI A;  4Z1V A;  4CBC A;  4RAI A;  2Q7H A;  4LH7 A;  3L72 H;  1PD3 A;  3CE2 A;  2YE6 A;  1QR8 A;  5DN6 G;  4YKW A;  3ZRW A;  1I5X A;  5LOV A;  1B63 A;  4DR5 O;  3E8G A;  1QLE B;  3KG2 A;  2XHT A;  2YI5 A;  2EUL A;  3F5T A;  4RO2 A;  1GKF A;  2Q8I A;  4HZ5 A;  3MAQ A;  4F6R A;  2QFO A;  3BRC A;  5KHJ A;  3K58 A;  1VF6 C;  3RFR A;  5CTW A;  4W4K A;  1R73 A;  2BTZ A;  4O04 A;  3A0X A;  2HHI A;  3K60 A;  2OT5 A;  2P06 A;  5K1P A;  2ZDI C;  3L71 H;  1IVS A;  4FCR A;  2IBZ H;  2LW1 A;  4PV1 B;  1L0N H;  1PNM A;  3WB2 A;  2CCS A;  4RWU A;  3IC7 A;  5IY5 C;  1Z2G A;  2BYI A;  1XL4 A;  2GBO A;  4AWO A;  2JGD B;  3N2K B;  4MT8 A;  2YKC A;  2F43 G;  5E1A C;  2A3Q A;  1JOY A;  2X6B A;  2FYU H;  3AK1 A;  3HKD A;  1XMQ O;  3W7U A;  4KUM A;  4WFH A;  3FT8 A;  3ASO C;  5E79 Z;  1N33 B;  5B3S C;  4FVM A;  4B3S B;  1WP7 A;  1TUE B;  5EC1 C;  5LMU B;  3CC7 V;  4DK0 A;  2UU9 B;  2LP7 A;  2WLK A;  1PP9 H;  5IDJ A;  1VAR A;  4JI8 O;  3CRM A;  3R91 A;  4KFG A;  2GFD A;  5J6A A;  1B6Q A;  5BMV A;  4PJ0 Z;  4J42 A;  4URL A;  2O1V A;  3CMA V;  4GT8 A;  5FWK A;  2YGF A;  4UV8 A;  4YJ2 B;  4R6Z A;  1I08 A;  3RLQ A;  5CBH A;  3ZMS A;  5B1B B;  2Q9L A;  4F4L A;  3CRC A;  3CP1 A;  3IGA C;  2BU7 A;  4KL1 A;  2YDE A;  2GSM B;  2FWY A;  1QQC A;  3SPI A;  3SYC A;  3T1C A;  2XAS A;  4JI6 B;  1YS3 A;  1IZ3 A;  2XJX A;  1E79 G;  4AWQ A;  1YXB A;  4ZVI A;  5D6P A;  4X65 B;  1CEZ A;  4ZBM A;  4H44 B;  4I9W A;  4LF9 B;  4DRX A;  3GB7 C;  2QF6 A;  3E86 A;  2YE2 A;  5EIB D;  1NBM G;  2HP8 A;  4ASB A;  3TXQ A;  4LC1 A;  1RM1 B;  5JCO C;  4KHP O;  1SA0 A;  4HZ3 A;  2MK3 A;  2DOS A;  5LGU A;  3QTC A;  3HZ5 A;  3OMU A;  1S16 A;  4NXM O;  3RGB A;  4TQD A;  3TUH A;  1GN6 A;  4P9O A;  3S3X A;  5H5N A;  5KHI A;  4O0B A;  1IUR A;  3JAL B;  4LBE C;  3AG3 C;  4DR4 O;  2ARH A;  2UUA O;  1G6U A;  4CH5 A;  4FZ1 A;  2YEB A;  1IBM B;  2K9P A;  4DV4 B;  3WB1 A;  4LFA O;  1YEW A;  2H3O A;  5IYZ A;  3JCU Z;  1FXK B;  3GVM A;  4P2Z A;  4JI3 B;  4CC5 A;  4DR2 O;  4EGI A;  3WB0 A;  1TID A;  1BS3 A;  4MPE A;  3T0H A;  3D3I A;  1H7S A;  2ZDI A;  3U2K A;  4N23 A;  2ATK C;  1D5N A;  2CE4 A;  5EZY B;  2E5L B;  3AK2 A;  4XE2 A;  4LF5 B;  3PEJ A;  1K33 A;  2EIL C;  1XI1 A;  2XDL A;  4PI2 A;  2VCJ A;  2R72 A;  3SJQ C;  4EB6 B;  4FFB B;  4JI0 B;  3FFQ A;  1ZXM A;  4FPP A;  4BR6 A;  3TZ4 A;  2DW4 A;  2DE0 X;  2Z5U A;  1G4Y B;  4X89 A;  1JR9 A;  2ZD9 A;  2ZIN A;  1I5B A;  2H8M A;  3ICX A;  4ASF A;  3JAR A;  1Z59 A;  4CWQ A;  3W7W A;  2IWX A;  4PDV A;  4XCL A;  1IDS A;  2DWE C;  1M93 A;  4UCV A;  1EA6 A;  3CRQ A;  4FZ0 A;  1SZX A;  2IU3 A;  4F6R B;  5IDM A;  4K0K B;  1D5A A;  1J5E B;  3M7M X;  4MTF A;  4GFN A;  1S3J A;  3RVY A;  5M4E A;  5LP6 B;  4QE7 A;  3E83 A;  4IL6 Z;  4LWH A;  1UYG A;  5JQG A;  3OR7 C;  2HHH O;  4DV7 O;  3E22 A;  4NH8 A;  5CTY A;  2LQT A;  2WI6 A;  2ZR2 A;  1I7F A;  1URF A;  1PNL A;  5KA6 A;  4U7O A;  3ABU A;  1Z5V A;  3Q4H A;  2ZR3 A;  2L35 A;  3ZHR A;  5L3B A;  3LDE A;  3H1K H;  5LL6 Y;  5LBQ A;  1NKD A;  4TV8 A;  4WFB V;  3D36 C;  1IBL O;  3EFF K;  4YKU A;  3JD0 A;  4JI5 B;  5KHH A;  2UWD A;  4XCJ A;  3K57 A;  1HNZ O;  3CRK A;  4FLX A;  2Y4U A;  5IT9 N;  3QF7 A;  1GKX A;  1WAZ A;  2XAG A;  2PYJ A;  3HKD B;  2XDU A;  3QO5 A;  2YKB A;  1RPO A;  2VS0 A;  4NR1 A;  5JCO A;  1YT1 A;  1AVM A;  2A0L A;  1GM8 A;  3ASN C;  2FB5 A;  5IJ9 A;  4DV0 B;  4LF6 O;  2C2A A;  4UCU A;  3N27 A;  3ZRV A;  5EK0 A;  5BMV B;  3BAB A;  2QKA A;  2XCM A;  2AZ0 A;  4E02 A;  2BU5 A;  2OYQ A;  4NB5 A;  4EKW A;  3HR0 A;  4UUJ C;  4CS3 A;  1AI7 A;  3ML0 A;  1MOF A;  1EN4 A;  2WI5 A;  2JKI A;  3ZIA G;  1TH8 A;  5D5Q A;  1QHT A;  1Z5W A;  3UT5 B;  4XDJ A;  1IXM A;  2PUS A;  2XDX A;  2Q68 A;  3SYQ A;  3H80 A;  4O2B A;  3S5T A;  2WLH A;  3T1Y B;  4QIW F;  4MSW C;  1K73 W;  3C11 A;  1BGQ A;  2OCC B;  1YTF D;  2DN9 A;  2P67 A;  1TAE A;  4XTJ A;  3ZMU A;  3U10 A;  3BA8 A;  4H13 B;  3O6O A;  1VF7 A;  4IYI A;  4TSF G;  4ZI7 A;  1PKX A;  4DRX B;  4I3H A;  1BSM A;  4JTC B;  5BR8 B;  1Y4S A;  1W59 A;  4GGL A;  4X88 A;  2XJG A;  2N74 A;  4UV9 A;  3LUT B;  1SA0 B;  5GW7 A;  4JAS A;  1JMK C;  2GUZ A;  3K9S A;  2ADP A;  4O05 A;  1XNR O;  1YSZ A;  5C93 A;  1E1Q G;  4URO A;  2F66 C;  3KE6 A;  3CCR V;  1UY8 A;  5LHH A;  1US7 A;  3T4D A;  3A0Z A;  1AR1 B;  5KMG A;  2KSD A;  4JTD B;  2YXL A;  3P3N A;  5IYZ B;  4GQT A;  2UUB O;  4DYL A;  4B3M O;  3CRR A;  4YKR A;  2FL4 A;  2DQ0 A;  5LHG A;  1TC0 A;  4C7U A;  5LXT B;  2WEQ A;  3HKB A;  4YHH O;  2FWZ A;  3OFN G;  3TGU H;  1YSR A;  1MX0 A;  1WNS A;  2JIZ G;  4EFU A;  2F93 B;  3UCS C;  1EBO A;  2NR5 A;  3D36 A;  4FK5 C;  2IOR A;  3PJS K;  5LGN A;  5IY5 B;  4FM1 A;  4J9Y B;  4JTA B;  1ZXN A;  2FYP A;  4JI4 O;  1U97 A;  1H8E G;  1RFY A;  2YEJ A;  4LNU A;  1HR0 B;  2F4V O;  4WFE A;  2YIA A;  2RJZ A;  5BXZ A;  1EZV H;  3ASO B;  4ZOL A;  2W0X A;  3OUS A;  5B3S B;  4PA9 A;  3W7S A;  1XQ8 A;  1S72 V;  3SYO A;  4GKK B;  2EXL A;  3M8A A;  3FB5 C;  3TK1 A;  1WPB A;  2P6J A;  4HZ0 A;  2H8P C;  2W0F C;  4J7K A;  3B4S A;  4NTY A;  1E1R G;  4K3A A;  1NI8 A;  2YE5 A;  1ZL8 B;  1DLB A;  4ICG A;  4YKZ A;  2CK3 G;  3SGI A;  5FNC A;  4ZHQ A;  1KD1 W;  5CF0 A;  5JQG B;  5ITZ A;  3NXS A;  3ETQ A;  2XND G;  4NXN B;  2Q8F A;  2CCT A;  3PN1 A;  3E22 B;  3RT3 C;  1IBK O;  2ZT9 B;  3E35 A;  2Q0O C;  1NZ6 A;  1BQZ A;  4PL9 A;  2GTA A;  3HB3 B;  1N8R W;  2OTJ V;  2XX2 A;  3K5O A;  3TZ0 A;  2XAJ A;  4DR7 O;  1KB9 F;  1H2M A;  3OGI B;  4B7E A;  4DV3 O;  1I5Y A;  3QVN A;  2ZKJ A;  1PV0 A;  1YCI A;  2UUC O;  4LWG A;  4MP7 A;  3RKZ A;  4TV8 B;  1XNQ O;  2Q8V A;  3TCU A;  2UXC O;  1KIJ A;  2ESA A;  4MPN A;  3BFR A;  3KCX A;  4DR1 B;  1ENV A;  2X7R B;  4DW0 A;  1OCC C;  2JS3 A;  4DR3 B;  3CCL V;  5TIS Z;  3ZS8 C;  3ZMT A;  3FYI B;  4L8Z A;  1GN3 A;  4O4I A;  3JSL A;  5EBW C;  1K8A W;  1SZT A;  3AG2 C;  1S76 D;  1HNX B;  1VQP V;  5IJ9 B;  1AJP A;  3VQW A;  2YKE A;  3WHA A;  3G6B A;  3AG3 B;  2HKJ A;  2YIC A;  2YI0 A;  1K97 A;  4CWS A;  4TUY A;  1KEC A;  4UFZ A;  4CS2 A;  3MD0 A;  4D7S A;  3H9V A;  1FJG O;  4EGK A;  5IJ0 B;  2XHX A;  2YUA A;  3VQX A;  3ETG A;  1YJW V;  4IYH A;  3UM7 A;  3MDS A;  5FLX N;  3JD2 A;  2UXB O;  1THN A;  3RVZ A;  4GCZ A;  4DV6 O;  2B1G A;  4X62 O;  4DV5 B;  1WA8 A;  1Z5A A;  4AQY O;  4O2B B;  5A9G A;  2ZE8 A;  2EIL B;  3E89 A;  4O4L A;  3HHU A;  4X64 O;  2YEH A;  3BA9 A;  3RLP A;  1GKZ A;  1NJI W;  5JVD A;  2VWK A;  4MVU A;  4EFE A;  4JYC A;  1YT2 A;  5HFM A;  1TIL A;  4ZI7 B;  1VQN V;  1QZR A;  2Y0P A;  2H94 A;  2O57 A;  2YE4 A;  1CPY A;  1D2D A;  3ZX6 A;  1V54 C;  3H01 A;  2AZ2 A;  4LF4 B;  3LSS A;  2PZS A;  1QNM A;  2HEP A;  3H4L A;  2DJV A;  2GUZ B;  2EIJ C;  2HJF C;  1R6K A;  3EXA A;  2BT0 A;  1YDX A;  4MVQ A;  2ZNI A;  2XDS A;  3LDC A;  5IWA O;  4O2A A;  4JYB A;  2PY5 A;  2JK5 C;  1K34 A;  4L91 A;  3R4N A;  2XX4 A;  2Q73 A;  5KMG B;  1LUW A;  2ZIO A;  4JI7 B;  1H7U A;  3JZ3 A;  3CGZ A;  2BSM A;  1PPJ H;  4XDL A;  1N32 O;  2EJ7 A;  3CHX A;  3LDD A;  1BT8 A;  3ZMZ A;  3IAY A;  1YTF B;  2XD6 A;  4FMT A;  5CBF A;  1VQL V;  2PI5 A;  3R92 A;  2YKI A;  3HKB B;  2PF4 E;  2F1M A;  2BZ5 A;  4EFB A;  3LNM B;  1KYO F;  3K59 A;  4LF7 B;  2B5U A;  4HYO A;  5L3G A;  3O2F A;  1ARO P;  1DTO A;  1U2O A;  4DV1 B;  2QWQ B;  2YID A;  1I94 O;  1N34 B;  5LYJ B;  4X20 A;  3IC9 A;  4YXW G;  3STL C;  1KBH A;  1S5H C;  4JYA B;  3OEE G;  4JV5 O;  2MW2 B;  5L3E A;  3ZXQ A;  2IJI A;  4ZOL B;  3AG1 C;  2QTS A;  1NTM H;  4DUY B;  3HKC A;  4GX2 A;  1P7G A;  4NTW A;  3ASN B;  2AKP A;  2WI2 A;  2Y69 C;  2JRI A;  1H2G A;  4CWT A;  1Y8O A;  4BIO A;  3RYH A;  4LF8 O;  2YEC A;  1IXB A;  4ZHQ B;  1ROP A;  1GN4 A;  3ABT A;  5JH7 B;  4FCQ A;  4CE3 A;  1S77 D;  1Q5O A;  3BAA A;  1VQ5 V;  2VWJ A;  4TT3 G;  2JJ2 G;  4MVZ A;  5KA5 A;  1KC8 W;  4I55 A;  4CWP A;  5CTU A;  4JZ2 A;  2Y0I A;  4CE1 A;  4KSG A;  3JD4 A;  3QDD A;  4MVR A;  1TBW A;  2P4V A;  4I0X A;  2PNR A;  2O1U A;  5FL7 G;  5H2F Z;  1ZW9 A;  3WU2 Z;  3DXR A;  2QWR B;  2EIK C;  3VQY A;  3F5W C;  4BAY A;  1GMG A;  2CH7 A;  5EIB C;  2EBO A;  1SQQ H;  1Y74 A;  3W7T A;  5M4K A;  4GEE A;  5LMN B;  3GIG A;  3HPL C;  4O4I B;  2P90 A;  1YJ9 V;  3OM3 B;  1H2K A;  2YEI A;  3Q5J A;  4OX9 B;  3R4M A;  1GM7 A;  4BIZ A;  1BCC H;  2OIG A;  2E75 B;  4GX1 A;  5BZB A;  1BHB A;  3SYA A;  1N0J A;  3LNU A;  4L93 A;  1P49 A;  4QJF B;  2P5O A;  2UXD B;  1XEQ A;  2EIM C;  3L73 H;  3ZKD A;  4DK1 A;  2KKW A;  4HY6 A;  1YES A;  4CH6 A;  2XAQ A;  1VQ7 V;  1FS0 G;  2HJD A;  2ZDY A;  4QE9 A;  5DM6 V;  4O4L B;  1R1B A;  3TET A;  3T1H B;  1N33 O;  3D0B A;  1SQF A;  4B3S O;  1OCO C;  2Q4P A;  3TTZ A;  2Q69 A;  5C8Y A;  3UKM A;  2XTA A;  4OPA A;  2NN4 A;  3GWK C;  2UU9 O;  3G7B A;  5D7R A;  5HFL A;  1M56 C;  4YKX A;  1EFR G;  2BSK A;  2ZQM A;  2W6J G;  3FB6 C;  3CXH F;  1ZUQ A;  4OPH A;  4H7Q A;  1Q8I A;  4CC6 A;  1H2S B;  1TA8 A;  1UYL A;  1GAX A;  3A0R A;  1HNW B;  4KTN A;  2D3O W;  2IW5 A;  5LHI A;  5J2U A;  1CP9 A;  4O2A B;  4PA7 A;  4E4E A;  4JI6 O;  1TUB A;  2CG9 A;  5IN9 A;  2Q5Z A;  4E72 A;  1N36 B;  1QCE A;  4X65 O;  5JJN B;  2E74 B;  5B1A C;  1Q3E A;  2A7W A;  4X1I A;  4WFG A;  2IJH A;  5D7C A;  1FPO A;  1AI5 A;  4PRV A;  4UXN A;  4PDR A;  1WPX A;  4W4L A;  1IX9 A;  2WI7 A;  2AXT Z;  1T5E A;  1YC1 A;  5KUM A;  5AG2 A;  1YC4 A;  1AB3 A;  2RQ6 A;  1SQX H;  2QWO B;  3SPC A;  3JAS B;  1SF9 A;  3B40 A;  5L3C A;  4JI2 B;  3HYY A;  2OIE A;  4AS9 A;  2ZIM A;  1FFX A;  2HVK C;  3ABM C;  3ZHV A;  1OCC B;  4DV4 O;  1IBM O;  1HP8 A;  4UB8 Z;  4XBF A;  2YXY A;  2R9I A;  1WN7 A;  1AH6 A;  4K8Z A;  4L87 A;  3OPD A;  3HKC B;  2ZDX A;  4JI3 O;  2YXH A;  1NR1 A;  3ZRW B;  3AG2 B;  1YIT V;  1M5I A;  5LOV B;  3OR6 C;  3A0H Z;  1MMM A;  2E5L O;  2ZKO A;  3B77 A;  1NHI A;  2JVD A;  1GN2 A;  4LF5 O;  4UCO A;  3ZJZ A;  3RYH B;  5EYP A;  5CN0 A;  3IJ4 A;  3L75 H;  2QJ1 A;  3K04 A;  4J41 A;  2KB1 A;  4JI0 O;  1Y76 A;  1YC3 A;  3ETD A;  1FXH A;  4PDL A;  4L90 A;  1Y67 A;  1UYD A;  4X1K A;  4MB9 A;  3B8N A;  4HBN A;  4I55 B;  3ZED A;  2AGA A;  2QR4 A;  2Y4T A;  1K7D A;  1Y66 A;  3VHA A;  3BHP A;  2ZXW C;  4L94 A;  3H1J H;  1NH2 D;  3A0W A;  2YED A;  2YI6 A;  2FTK A;  3A0Y A;  3CSX A;  1COW G;  3DXR B;  4JAU A;  4K0K O;  5LA6 A;  1J5E O;  2N04 A;  2CH7 B;  1Y74 B;  1PNK A;  4UCS A;  1K9M W;  1XMO O;  4MW8 A;  1I5C A;  1Q6I A;  1V54 B;  1UYI A;  4OXS A;  4FIP C;  3GIG B;  1QYE A;  1OCZ C;  3OE7 G;  2EIJ B;  1YVW A;  4CH4 A;  4U3J A;  2V1D A;  3I56 V;  1G8M A;  3JAK A;  1R6N A;  1DK1 A;  4EM7 A;  4GKJ B;  2VRZ A;  1XOU A;  3R4P A;  4LH6 A;  2IOQ A;  3ZMV A;  2GV9 A;  2K1E A;  5K1X A;  2QWP B;  5KLV H;  5KAF Z;  2EIN C;  4CWF A;  3A0B Z;  1P84 F;  4JI5 O;  1VQ8 V;  1AIL A; 
#chains in the Genus database with same CATH homology
 2YSU B;  4MOT A;  3R65 A;  4KP4 A;  2YGE A;  3SPG A;  1UYM A;  1QR9 A;  4K4O A;  2WLI A;  1Q81 W;  2YE8 A;  1NHH A;  3EHH A;  4P9P A;  4CWO A;  3X2Q C;  2IJJ A;  2YI7 A;  3JCZ A;  1OCR C;  2XAB A;  4B7P A;  4PEL A;  2YEE A;  2HKO A;  2YJX A;  2QM7 A;  3K03 A;  3QO7 A;  3AG1 B;  3ETE A;  5B1O A;  4LWI A;  3ZCC A;  1AI6 A;  3JYC A;  2WEP A;  2Y69 B;  2HVJ C;  3SYP A;  3K3W A;  4E00 A;  1Y4U A;  3DTU B;  3I55 V;  3GIE A;  3WG7 C;  4LWE A;  4JPR A;  2XAH A;  3CME V;  3OWB A;  2HFE C;  3OMN B;  3G71 V;  4MS2 A;  3U2D A;  1UYH A;  4WFF A;  1JJ2 U;  2A9H A;  1NQT A;  2ITC C;  3FB8 C;  4MTO A;  3G7E A;  1UYC A;  2WLN A;  2EIK B;  3K9A A;  2GHY A;  3B25 A;  1AMW A;  2QG0 A;  1BHA A;  4PRX A;  4E01 A;  1F51 A;  3CYO A;  3CCJ V;  5M4H A;  1ORQ C;  3TZ5 A;  3U67 A;  5D6Q A;  5KUK A;  1I59 A;  3JD1 A;  3QTF A;  1R3I C;  1JCH A;  2WWW A;  3B26 A;  3EHJ A;  4CE2 A;  4MBC A;  5CMU A;  1PVG A;  1WLE A;  1UY6 A;  1M57 C;  3OMA B;  3ABK C;  3CCV V;  1J95 A;  2VCI A;  2EIM B;  2DYS C;  1W2B U;  4XDK A;  2YE3 A;  4MVO A;  2K5B A;  3INW A;  1OCO B;  3ZKB A;  4BQG A;  1R3L C;  3VOU A;  1M56 B;  4WUD A;  1NHJ A;  1NR7 A;  4NH9 A;  3EHB B;  1AJN A;  1JVM A;  2BOC C;  1YET A;  5LGT A;  1NVP D;  4RQF A;  3SPJ A;  4O07 A;  1K5S A;  3Q5K A;  1OHH G;  3CXC U;  1QVF U;  2Q8H A;  4HY1 A;  3OGC C;  4G2K A;  4R8C A;  1I5A A;  5IYD O;  5B1A B;  1NH2 B;  1YSC A;  2DYR C;  5H6R A;  1YHQ V;  4MP2 A;  4H85 A;  4RUF A;  1JQ0 A;  5F3K A;  2WLI B;  3K79 A;  4KFM A;  1H38 A;  1L1F A;  4TWK A;  1SES A;  4E2L A;  2XDK A;  1HWY A;  1GM9 A;  3JD3 A;  2Q6A A;  1UJW B;  2YJW A;  1B3Q A;  1K3E A;  4PA4 A;  4YKY A;  2XOK G;  3FKS G;  3BY6 A;  4GT1 A;  2HR3 A;  4H81 A;  4CZZ A;  1BKN A;  5IYB O;  4Q20 A;  2BRC A;  3PEH A;  2PI4 A;  3EHG A;  4JF3 A;  2YE9 A;  3OWD A;  4KQV A;  3FB7 C;  5CTX A;  1EZJ A;  2HG5 C;  3ABL C;  4HXW A;  2Q8G A;  4MW3 A;  1RPR A;  2LFS A;  3T1K A;  2ZXW B;  1AH8 A;  2R9R B;  3RBZ A;  2QTO A;  5CA3 A;  4R3A A;  2M7W A;  2HG1 A;  2ITD C;  1R3K C;  3EKO A;  4LCU C;  4URN A;  1OCZ B;  2O1W A;  1ZWH A;  3T0Z A;  4NH7 A;  3CPW U;  4XIR A;  2EIN B;  3CD6 V;  1OZ0 A;  2LFR A;  1K4C C;  3O0I A;  4R3M A;  2FXS A;  2ZBK B;  4WCE V;  4JAV A;  3RW0 A;  4I5S A;  4XIQ A;  4G27 B;  3K98 A;  2IJK A;  1YI2 V;  1H8H G;  3X2Q B;  1K4D C;  1KQS U;  5L3D A;  5L3J A;  2BYH A;  4EGH A;  1OCR B;  1MSW D;  3INX A;  1BL8 A;  4BXI A;  3CCQ V;  2Z3Y A;  3OW6 A;  4PA6 A;  2WER A;  4GX0 A;  2HCH A;  2GQP A;  3EKR A;  1U0Z A;  3B28 A;  3K08 A;  3GIF A;  3AG4 C;  2A79 B;  3E8F A;  1W0J G;  2YE7 A;  1ID0 A;  4FJC C;  1Z5B A;  3K97 A;  3WG7 B;  2YEV A;  3OEH G;  2EZO A;  2BU6 A;  3F7Y C;  3ZRX A;  2QKS A;  4R1F A;  3TZ2 A;  4H37 A;  1VQM V;  1OSF A;  3CWV A;  2BOB C;  4WF9 V;  1K92 A;  2YKJ A;  2QG2 A;  3W7X A;  1AM1 A;  2IH3 C;  4CWN A;  4JGS A;  3ZN0 A;  1JM6 A;  1NVP B;  2JEX A;  4R50 A;  3T4Z A;  1P4R A;  3SL2 A;  5D7D A;  3WQ9 A;  4DUH A;  1MAB G;  2Q67 A;  1L0O A;  3CGY A;  4BIU A;  1V55 C;  1SET A;  4JQL A;  4EFT A;  1SRY A;  3RLR A;  1M57 B;  3VHD A;  3ABK B;  3QNE A;  2CGF A;  4MVS A;  1SER A;  1GJV A;  5J71 A;  3F7V C;  4X8A A;  4DO2 A;  2DYS B;  1UYK A;  3HZ1 A;  4V26 A;  3CCS V;  1UY7 A;  2YEF A;  3OAA G;  3E8B A;  1AJ6 A;  2JDI G;  1Q86 W;  3WFV A;  2IWS A;  3NMQ A;  2YGA A;  4ASG A;  1VQO V;  3K06 A;  3MHH C;  4BQJ A;  3LPS A;  3MHS C;  4XD8 A;  1F4M A;  4ASU G;  1KKD A;  2WAM A;  3FT5 A;  1P7B A;  2DYR B;  4LP0 A;  4AWP A;  3GWO A;  3ZRS A;  3G75 A;  2AHY A;  4XDM A;  4XKO A;  3VBB A;  3BEH A;  1FXV A;  3R4O A;  4R7C A;  4LP8 A;  1Y4M A;  4XKK A;  3A0T A;  2AHZ A;  1THZ A;  4QNH B;  2YK2 A;  4U7N A;  1JPX A;  2V7Q G;  4RQE A;  2DQ3 A;  2YEV B;  4MPC A;  5L3F A;  2Y48 A;  4UVB A;  3SPH A;  3AEI A;  4DZY A;  1QY8 A;  3OUF A;  2CH4 A;  4KSH A;  3ABL B;  3CCE V;  5EBL C;  5FNF A;  4BW5 A;  3DGE A;  4W7T A;  3FYE B;  4EMV A;  1A4H A;  2XAF A;  4HXZ A;  3ZXO A;  3T10 A;  1EI1 A;  1YIJ V;  1DF5 A;  1KP2 A;  2VWC A;  3E8H A;  1GK9 A;  4QPJ A;  2Q2E B;  5M4P A;  1QLE C;  3VAD A;  2IWU A;  1S0V A;  4H33 A;  2XK2 A;  4HYM A;  2NNU A;  1UYE A;  5EBM C;  2DWD C;  4GX5 A;  5F5R A;  4XIP A;  3BM9 A;  4URM A;  2VW5 A;  1LNQ A;  1B62 A;  1F23 A;  4LPB A;  4PA3 A;  5M4N A;  1QLN A;  3MNR P;  1K5Q A;  4Z1M G;  4O09 A;  4MTX A;  2WI1 A;  4P30 A;  2WI3 A;  2QEX V;  4UVC A;  1QVG U;  3STZ C;  1YT0 A;  4WFA V;  2OTL V;  1TC6 A;  3K99 A;  2WI4 A;  4XC0 A;  2EJR A;  1VQK V;  5H9C A;  4WUB A;  3T2S A;  3EHF A;  3G6E V;  4XIT A;  2WLL A;  4UVA A;  3B8M A;  2IU0 A;  2HLD G;  5CPH A;  2X6C A;  1FFT B;  4X9L A;  3G4S V;  3CRL A;  3T2M A;  5H6Q A;  3OW2 U;  2XHR A;  3AG4 B;  1Y8P A;  2QA4 V;  1M1K W;  4WUC A;  1VQ6 V;  5IYC O;  3HEK A;  3FV5 A;  5B1B C;  1DF4 A;  5GGZ A;  4YKQ A;  1R62 A;  1R3J C;  1JX9 A;  4PU9 A;  1QBZ A;  1BYQ A;  1YER A;  4G28 B;  4J9Z B;  1AJQ A;  4CWR A;  2BU8 A;  1S14 A;  3E2E A;  1RM1 C;  4QPK A;  4LWF A;  1W0K G;  2IH1 C;  4U93 A;  3BMY A;  1AI4 A;  4XKA A;  5CBG A;  3CC4 V;  2EZP A;  5J9P C;  3M99 B;  3LSQ A;  3CCU V;  3IFX A;  1M90 W;  2UXN A;  2YEA A;  1V55 B;  2UXX A;  1FXK C;  5BOC A;  4MTG A;  2IOP A;  2QM8 A;  4RUE A;  3QO8 A;  1GO3 F;  2X0L A;  4HAM A;  1Q82 W;  2BU2 A;  4PDM A;  3CC2 V;  2WPD G;  1MU5 A;  1VQ9 V;  5B1N A;  1F4N A;  3Q5L A;  1BMF G;  2YEG A;  3VHC A;  3OMI B;  3ABM B;  3B24 A;  3B27 A;  2WLJ A;  5FND A;  2QE7 G;  5EC2 C;  2NLJ C;  1Q7Y W;  3CCM V;  4BAE A;  3K0G A;  4DXW A;  3HYZ A;  4N21 A;  2JEU A;  3K0D A;  2WSS G;  1UYF A;  3C0E A;  4B6C A;  1UY9 A;  1I58 A;  3ZM7 A;  3P32 A;  4ASA A;  4FCP A;  5BOD A;  1Y8N A;  1BXD A;  2XJJ A;  4MVM A;  3P30 A;  1M9N A;  1XL6 A;  2WLL B;  3D2R A;  1GTO A;  3IED A;  2BRE A;  1YJN V;  2XX5 A;  4EEH A;  2JJC A;  3ZN1 A;  1KZN A;  2CCU A;  1ZWI C;  2W6I G;  4V25 A;  2X6A A;  1I5D A;  2YK9 A;  5M4M A;  1PL0 A;  1FXK A;  1Z5C A;  4HYP A;  2JJ1 G;  2E0A A;  1KP3 A;  1MG1 A;  2B1I A;  2P7T C;  4YKT A;  2H55 A;  2WLM A;  2OCC C;  4P7A A;  4P8O A;  1VQ4 V;  4ZKI A;  4CBC A;  4RAI A;  1PD3 A;  2YE6 A;  1QR8 A;  5DN6 G;  4YKW A;  3ZRW A;  1I5X A;  1B63 A;  3E8G A;  1QLE B;  3KG2 A;  2XHT A;  2YI5 A;  4RO2 A;  1GKF A;  2Q8I A;  4HZ5 A;  2QFO A;  5CTW A;  1R73 A;  2BTZ A;  4O04 A;  3A0X A;  3K60 A;  2OT5 A;  2ZDI C;  4FCR A;  1PNM A;  2CCS A;  3IC7 A;  5IY5 C;  2BYI A;  1XL4 A;  4AWO A;  4MT8 A;  2YKC A;  2F43 G;  5E1A C;  1JOY A;  2X6B A;  3W7U A;  4KUM A;  4WFH A;  3FT8 A;  3ASO C;  5B3S C;  1TUE B;  5EC1 C;  3CC7 V;  2LP7 A;  2WLK A;  5IDJ A;  3R91 A;  4KFG A;  2GFD A;  5J6A A;  1B6Q A;  4URL A;  2O1V A;  3CMA V;  4GT8 A;  5FWK A;  2YGF A;  4UV8 A;  4R6Z A;  3RLQ A;  5CBH A;  3ZMS A;  5B1B B;  4F4L A;  3IGA C;  3CP1 A;  2BU7 A;  2GSM B;  2FWY A;  3SPI A;  3SYC A;  3T1C A;  2XAS A;  1YS3 A;  2XJX A;  1E79 G;  4AWQ A;  4ZVI A;  5D6P A;  1CEZ A;  4ZBM A;  4I9W A;  2QF6 A;  3GB7 C;  3E86 A;  2YE2 A;  1NBM G;  4ASB A;  4LC1 A;  1RM1 B;  4HZ3 A;  2MK3 A;  5LGU A;  3HZ5 A;  3OMU A;  1S16 A;  3TUH A;  4P9O A;  4O0B A;  4LBE C;  3AG3 C;  2YEB A;  1FXK B;  4P2Z A;  4EGI A;  1TID A;  4MPE A;  3T0H A;  3D3I A;  1H7S A;  2ZDI A;  3U2K A;  4N23 A;  2ATK C;  4XE2 A;  3PEJ A;  1K33 A;  2EIL C;  2XDL A;  2VCJ A;  3SJQ C;  1ZXM A;  4FPP A;  3TZ4 A;  2DW4 A;  2Z5U A;  1G4Y B;  4X89 A;  2ZD9 A;  1I5B A;  2H8M A;  4ASF A;  1Z59 A;  4CWQ A;  3W7W A;  2IWX A;  4PDV A;  4XCL A;  2DWE C;  1EA6 A;  2IU3 A;  5IDM A;  4MTF A;  4GFN A;  1S3J A;  3RVY A;  5M4E A;  4QE7 A;  3E83 A;  4LWH A;  1UYG A;  3OR7 C;  4NH8 A;  5CTY A;  2WI6 A;  2ZR2 A;  1PNL A;  5KA6 A;  4U7O A;  3ABU A;  2ZR3 A;  5L3B A;  3LDE A;  5LBQ A;  1NKD A;  4WFB V;  3EFF K;  4YKU A;  3JD0 A;  4XCJ A;  2UWD A;  3CRK A;  1GKX A;  2XAG A;  2XDU A;  2YKB A;  3QO5 A;  1RPO A;  1YT1 A;  2A0L A;  1GM8 A;  3ASN C;  2C2A A;  3ZRV A;  5EK0 A;  2XCM A;  4E02 A;  2BU5 A;  4EKW A;  4UUJ C;  1AI7 A;  3ML0 A;  1MOF A;  2WI5 A;  2JKI A;  3ZIA G;  1TH8 A;  4XDJ A;  1IXM A;  2XDX A;  2Q68 A;  3SYQ A;  3H80 A;  2WLH A;  4QIW F;  4MSW C;  1K73 W;  3C11 A;  1BGQ A;  2OCC B;  1YTF D;  2P67 A;  4XTJ A;  3ZMU A;  3O6O A;  4TSF G;  1PKX A;  4I3H A;  1Y4S A;  4JTC B;  4GGL A;  4X88 A;  2XJG A;  4UV9 A;  3LUT B;  5GW7 A;  4JAS A;  4O05 A;  1YSZ A;  5C93 A;  1E1Q G;  4URO A;  3KE6 A;  3CCR V;  1UY8 A;  5LHH A;  1US7 A;  3T4D A;  3A0Z A;  1AR1 B;  4JTD B;  4GQT A;  4YKR A;  2DQ0 A;  5LHG A;  1TC0 A;  2WEQ A;  2FWZ A;  3OFN G;  1YSR A;  1MX0 A;  2JIZ G;  4EFU A;  1EBO A;  3D36 A;  4FK5 C;  2IOR A;  3PJS K;  5LGN A;  5IY5 B;  4J9Y B;  4JTA B;  1ZXN A;  2FYP A;  1H8E G;  2YEJ A;  4WFE A;  3ASO B;  3OUS A;  5B3S B;  4PA9 A;  3W7S A;  1S72 V;  3SYO A;  2EXL A;  3FB5 C;  3TK1 A;  2P6J A;  4HZ0 A;  2H8P C;  2W0F C;  1E1R G;  2YE5 A;  1DLB A;  4YKZ A;  2CK3 G;  5FNC A;  1KD1 W;  5CF0 A;  3NXS A;  2XND G;  2Q8F A;  2CCT A;  3E35 A;  4PL9 A;  2XX2 A;  3HB3 B;  1N8R W;  2OTJ V;  3TZ0 A;  2XAJ A;  1I5Y A;  2ZKJ A;  4MP7 A;  4LWG A;  3RKZ A;  3TCU A;  1KIJ A;  2ESA A;  4MPN A;  1ENV A;  2X7R B;  1OCC C;  3CCL V;  3ZMT A;  3FYI B;  4L8Z A;  5EBW C;  1K8A W;  1SZT A;  3AG2 C;  1S76 D;  1VQP V;  1AJP A;  2YKE A;  3WHA A;  3AG3 B;  2HKJ A;  2YI0 A;  1K97 A;  4CWS A;  1KEC A;  4EGK A;  3MD0 A;  2XHX A;  3ETG A;  1YJW V;  3UM7 A;  3JD2 A;  1THN A;  3RVZ A;  4GCZ A;  2B1G A;  1Z5A A;  3E89 A;  2EIL B;  3HHU A;  2YEH A;  3RLP A;  1GKZ A;  1NJI W;  4MVU A;  4JYC A;  1YT2 A;  5HFM A;  1TIL A;  1VQN V;  1QZR A;  2H94 A;  2YE4 A;  1CPY A;  1V54 C;  3H01 A;  3LSS A;  3H4L A;  2EIJ C;  2HJF C;  1R6K A;  2BT0 A;  4MVQ A;  2XDS A;  3LDC A;  4JYB A;  2JK5 C;  1K34 A;  4L91 A;  3R4N A;  2XX4 A;  1H7U A;  3JZ3 A;  3CGZ A;  2BSM A;  4XDL A;  3LDD A;  3ZMZ A;  1YTF B;  2XD6 A;  4FMT A;  5CBF A;  1VQL V;  2PI5 A;  3R92 A;  2YKI A;  2BZ5 A;  3LNM B;  2B5U A;  4HYO A;  5L3G A;  3O2F A;  1ARO P;  1DTO A;  1U2O A;  4YXW G;  3STL C;  1S5H C;  3OEE G;  5L3E A;  3ZXQ A;  2IJI A;  3AG1 C;  4GX2 A;  3ASN B;  2AKP A;  2WI2 A;  2Y69 C;  1H2G A;  4CWT A;  1Y8O A;  2YEC A;  1ROP A;  3ABT A;  4FCQ A;  4CE3 A;  1S77 D;  1VQ5 V;  4TT3 G;  2JJ2 G;  4MVZ A;  5KA5 A;  1KC8 W;  4CWP A;  5CTU A;  4CE1 A;  4KSG A;  3JD4 A;  3QDD A;  4MVR A;  1TBW A;  2PNR A;  2O1U A;  5FL7 G;  1ZW9 A;  2EIK C;  3F5W C;  4BAY A;  1GMG A;  2EBO A;  3W7T A;  5M4K A;  4GEE A;  3GIG A;  3HPL C;  2P90 A;  1YJ9 V;  3OM3 B;  2YEI A;  3Q5J A;  3R4M A;  1GM7 A;  4BIZ A;  4GX1 A;  5BZB A;  1BHB A;  3SYA A;  3LNU A;  4L93 A;  4QJF B;  2EIM C;  3ZKD A;  4HY6 A;  1YES A;  2XAQ A;  1VQ7 V;  1FS0 G;  2ZDY A;  4QE9 A;  5DM6 V;  3TET A;  3D0B A;  1OCO C;  3TTZ A;  2Q69 A;  3UKM A;  3G7B A;  5D7R A;  5HFL A;  1M56 C;  4YKX A;  1EFR G;  2ZQM A;  3FB6 C;  2W6J G;  4H7Q A;  1UYL A;  3A0R A;  4KTN A;  2D3O W;  2IW5 A;  5LHI A;  1CP9 A;  4PA7 A;  2CG9 A;  5IN9 A;  1QCE A;  5B1A C;  4WFG A;  2IJH A;  5D7C A;  1AI5 A;  4PRV A;  4UXN A;  4PDR A;  1WPX A;  2WI7 A;  1YC1 A;  5KUM A;  1YC4 A;  3SPC A;  5L3C A;  3HYY A;  4AS9 A;  2HVK C;  3ABM C;  1OCC B;  4XBF A;  2R9I A;  1AH6 A;  4L87 A;  3OPD A;  2ZDX A;  1NR1 A;  3ZRW B;  3AG2 B;  1YIT V;  3OR6 C;  1NHI A;  3B77 A;  3ZJZ A;  5CN0 A;  3K04 A;  2KB1 A;  1YC3 A;  3ETD A;  4L90 A;  1FXH A;  4PDL A;  1UYD A;  4MB9 A;  3B8N A;  1K7D A;  1Y66 A;  3VHA A;  2ZXW C;  4L94 A;  1NH2 D;  3A0W A;  2YED A;  2YI6 A;  2FTK A;  3A0Y A;  1COW G;  4JAU A;  1PNK A;  1K9M W;  1I5C A;  4MW8 A;  1V54 B;  1UYI A;  4OXS A;  4FIP C;  3GIG B;  1QYE A;  1OCZ C;  3OE7 G;  2EIJ B;  2V1D A;  3I56 V;  1G8M A;  1R6N A;  4EM7 A;  3R4P A;  2IOQ A;  3ZMV A;  2K1E A;  2EIN C;  4CWF A;  1VQ8 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...