4JAVA

Structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
246
structure length
246
Chain Sequence
NVTESKELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
molecule keywords Histidine kinase
total genus 79
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4javA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4javA02
5FNCA 3DGEA 3HZ5A 1I5BA 3Q5JA 4O09A 4R1FA 3INXA 1YT1A 5BODA 5B1OA 2HG1A 1AH8A 3HYYA 3A0TA 1IXMA 2CGFA 3RLPA 2YEFA 1S16A 4U7OA 4LC1A 2YGEA 3T10A 4HZ5A 4H7QA 2P67A 3ZXOA 1UYLA 3P32A 2H8MA 3G7BA 2IWXA 5B1NA 4Q20A 4XTJA 3D2RA 4O0BA 4HXWA 4BQJA 3O2FA 4CWPA 3VHDA 1ZW9A 3OWBA 2CCSA 3EHGA 3TTZA 2BU8A 3C0EA 5FNDA 1UYIA 2YEBA 1UYMA 1L0OA 4KSHA 2XJGA 2WI4A 1I5CA 4AWOA 3T2SA 2YKJA 3NMQA 3WHAA 3R91A 4O07A 4NH9A 3OMUA 4AWQA 2QM8A 1NHJA 1UYEA 5CF0A 3KE6A 4MPEA 4HYPA 4PRXA 2XDXA 4QPKA 5BOCA 4DUHA 2BYIA 4L8ZA 4BAEA 3R4MA 2QF6A 4MB9A 2CG9A 5C93A 2WI7A 4GEEA 4FCPA 4EGHA 1BXDA 2ZKJA 4CWSA 3CRKA 2IOQA 4JYCA 1Z5AA 4CWNA 2LFSA 4MP7A 1ID0A 3RLRA 4PL9A 3ZCCA 2PNRA 3CGYA 4KTNA 4P8OA 1JM6A 2IWSA 2YE3A 5D7CA 4XCLA 2WI1A 3ZRWA 4B6CA 1ZWHA 3BM9A 4YKXA 4ASFA 4BXIA 4XC0A 3CRLA 4EGIA 4HY1A 4KQVA 3EHHA 2VCJA 4PRVA 4GT8A 2BYHA 3H4LA 2YE8A 3O0IA 2Q8HA 4PU9A 4BIZA 1YERA 2JKIA 4LWEA 3ZKBA 2WI3A 2YECA 4XD8A 2BREA 3NXSA 1TBWA 2VCIA 4WUBA 4YKTA 4URLA 2XHRA 4LWFA 4LWHA 3CGZA 4BIUA 3T0ZA 1H7SA 2WEQA 2WERA 2YE7A 2VWCA 5GGZA 3TK1A 1Y4UA 1B62A 3B25A 3K99A 2H55A 4H81A 1Y8NA 2HKJA 2BSMA 2E0AA 4JAUA 2BZ5A 4I3HA 2YKEA 4V25A 4L93A 1GJVA 3R4OA 1AM1A 5FWKA 3ZRXA 2Q8IA 5M4PA 1UY9A 1KIJA 3A0RA 5L3JA 2XHTA 3K98A 2YEEA 2QFOA 4YKWA 4XIQA 4L91A 4R3AA 2JJCA 2YGAA 2XD6A 3K60A 4EM7A 3T1KA 3GIEA 4KFGA 4QPJA 3SL2A 4JYBA 2UWDA 1PVGA 1I5AA 5CTXA 4MT8A 3R4PA 4B7PA 4FPPA 2EXLA 4XKAA 3TZ4A 4HXZA 4HZ0A 1UY8A 4LWIA 1Y4SA 4E02A 1TIDA 2XX4A 3MNRP 4YKZA 5D6QA 4AWPA 3B27A 2XDKA 2CCTA 1H7UA 3TZ2A 1U0ZA 3IEDA 3GIGB 2ZDYA 3H80A 1UYKA 4MPNA 3VHCA 3FV5A 3ZRWB 3EHFA 3RKZA 4I5SA 4CWTA 1YSZA 2YEIA 1Z59A 1UYDA 4GQTA 3T0HA 2VW5A 4JAVA 5D6PA 1NHHA 4URMA 2BU7A 3WQ9A 3B24A 2YGFA 3HZ1A 3ZRVA 3HYZA 1MX0A 2C2AA 5M4NA 4FCQA 1YT0A 2XDLA 5M4EA 4NH7A 4E01A 3MD0A 2GQPA 1YS3A 3VADA 1BGQA 1F51A 2HCHA 3A0XA 2WI2A 3LNUA 2QM7A 4YKYA 4U7NA 3BMYA 1ZXNA 2K5BA 1ZXMA 5IN9A 1YETA 4P7AA 2XABA 4H85A 4XDMA 3EKRA 2YK2A 2IOPA 4O04A 1UY7A 4XITA 4ASGA 3B28A 4XCJA 1TC0A 4X9LA 1TILA 3CWVA 5IDMA 1BKNA 4CWOA 2AKPA 1GKXA 1THNA 2WEPA 3R4NA 4LP0A 1Y8OA 1EI1A 1TH8A 4EFTA 2YK9A 2LFRA 1I5DA 5F5RA 2IORA 3ZM7A 3A0WA 3GIFA 3Q5KA 2FXSA 3ZXQA 2IWUA 2YI7A 2FTKA 4YKUA 1I58A 3LPSA 2BRCA 5J71A 4NH8A 4HYMA 3G75A 1EA6A 2YI0A 2XJJA 2BU2A 4KSGA 2Q2EB 5J6AA 4XIPA 3JZ3A 1BYQA 1QYEA 2YI6A 4V26A 2O1VA 1AH6A 3QTFA 5D7RA 2XX5A 2WWWA 3VHAA 2XCMA 1QZRA 4UROA 2YKCA 4CWQA 1YESA 5M4KA 3EKOA 3Q5LA 2QG2A 2Q8GA 4MBCA 3OPDA 3QDDA 2YEGA 4FMTA 2YJXA 2YE2A 3R92A 2XX2A 2YE6A 2FWYA 1S14A 1OSFA 4CE1A 1JOYA 1UYHA 4ZVIA 5F3KA 2YI5A 4L90A 2ESAA 4MP2A 1UYCA 4MOTA 1YC1A 1YT2A 5CTWA 3GIGA 4K4OA 5CTYA 2BU6A 4EFUA 3O6OA 4LPBA 4ASAA 2YE4A 3HEKA 4R3MA 1TC6A 4ASBA 3EHJA 2WI5A 2ZDXA 4AS9A 3K97A 1US7A 4EEHA 1R62A 1Z5BA 2GFDA 3D36A 2XK2A 4CWFA 2FYPA 3B26A 5M4HA 4O05A 5FNFA 2YEAA 2XJXA 4CE2A 3A0YA 2YKBA 1U2OA 4LWGA 1MU5A 4YKQA 3U2DA 1B63A 4KP4A 2BU5A 3HHUA 1UY6A 1Z5CA 3OWDA 2XDUA 1YC3A 4MPCA 4YKRA 3TZ0A 4CWRA 4MTXA 3ZKDA 4EGKA 4U93A 5IDJA 2QG0A 1AMWA 5CTUA 4WUCA 2YEJA 3D0BA 4URNA 2YE5A 4W7TA 1KZNA 5M4MA 1B3QA 2CH4A 3PEHA 3INWA 1I59A 4XKKA 4GGLA 4XKOA 1YSRA 3U2KA 2Q8FA 2YJWA 3U67A 4HY6A 2YEDA 4WUDA 2BTZA 3TUHA 1GKZA 3FT8A 2O1UA 2CCUA 3C11A 4L94A 4GFNA 3OW6A 1YC4A 3FT5A 4EMVA 1UYFA 1UYGA 3PEJA 3A0ZA 1NHIA 2FWZA 2XHXA 1AJ6A 1A4HA 4FCRA 4E00A 4BQGA 4JASA 4GT1A 2O1WA 2ZBKB 3TZ5A 4XIRA 4DZYA 1Y8PA 4JQLA 2WI6A 2YE9A 5CPHA 2YEHA 2YKIA 5D7DA 4XE2A 4CE3A 3G7EA 2XDSA 1QY8A 4ZKIA 4GCZA 2BT0A 3RLQA
chains in the Genus database with same CATH superfamily
3ICXA 3U0ZA 5DECA 1I5BA 3Q5JA 4O09A 3AG2C 4DV0O 1Q81W 3AG4C 5EBMC 3ZIAG 2DMXA 1SQXH 4R7CA 2PYLA 1SS3A 1VQOV 3GWKC 2ZNJA 4U7OA 2QWPB 3LSUA 3M99B 4CS2A 2YGEA 1AI5A 4HZ5A 2EJ7A 2VQFB 3CRMA 1M9NA 5LMUB 3BEHA 2XAFA 2IWXA 2ZR3A 4Q20A 3OTFA 3VHDA 2ZDIA 3OWBA 4X1IB 2PI5A 4X89A 4B3TO 3EHGA 3BA9A 1L0LH 1UYIA 2WPDG 3T4ZA 1L0OA 3QVNA 1XL4A 2QE7G 1XI1A 1SA0A 1VQ9V 4K8ZA 1TUEB 2R70A 4YIPA 1CP9A 1GMGA 2Q6AA 3R91A 2Y69C 4NTWA 4F4LA 2GTAA 4IGGA 1GK9A 4AWQA 4Z2WA 5HFLA 3OM3B 3SPJA 4YHHB 5CF0A 3KE6A 4X1KB 4K3AA 4PA7A 4BW9A 1BHBA 4NTXA 5JENA 5CMUA 5BOCA 3G6EV 1WP7A 3DSQA 2YXYA 3ZHUA 2BOBC 1ORQC 2BYIA 1TGOA 2Y4UA 3R4MA 5C93A 2BTQA 2LJ2A 4DO2A 4DR6B 1XDCA 4JYCA 3R66A 2N04A 3L70H 4W4LA 3UQ8A 2ZQMA 2E75B 4EEQA 1NVPB 2CTQA 2L35A 4PL9A 2WAMA 1JM6A 2IWSA 1RSOB 2KQXA 4BR6A 4XCLA 1NBMG 4B6CA 2N05A 1YJ9V 1D2DA 3CRLA 2YIBD 4KQVA 2DJVA 3O0IA 4PU9A 3JAKA 4LWEA 1HNWB 2WI3A 4ZOLA 1KC8W 2YECA 2GHYA 3K59A 4YKTA 1S0VA 2XHRA 4LWFA 4BIUA 3T0ZA 4D6TH 1MNGA 4W4KA 5GGZA 4YY3B 4ZI7B 1B62A 1AROP 3WB0A 4DR3O 2YSUB 4DXWA 2E0AA 4JAUA 3K04A 2YKEA 1GN6A 2A0LA 4UVAA 3RW0A 1W2BU 1K9MW 3R4OA 1NJIW 1TAEA 1VF6C 2DE0X 3JCZA 3ZRXA 2Q8IA 1Y76A 4J7KA 3OW2U 3L73H 3STZC 2XHTA 3OUSA 2Y0IA 2EULA 1QBZA 4YKWA 2QGNA 2KKWA 3E35A 3WFVA 3STLC 3JASB 4B7EA 2F43G 3T1KA 2WA3A 2C1IA 3FB8C 2UWDA 1PVGA 3VOUA 2VRZA 4PA4A 1T5EA 2IJJA 4F6RB 4UCVA 4QNHB 3C3TA 5KUMA 1OCRC 3ZHRA 1TIDA 3MNRP 1SA0B 4PDMA 4AWPA 3U11A 1S5LZ 3F7YC 3B27A 3IC7A 1NS1A 3TETA 3TZ2A 4X66B 3VQXA 2ZDYA 3P30A 4RQEA 3FV5A 3E86A 1KU9A 2LW1A 1VQ7V 4DR1O 1JX9A 2IU3A 3L72H 1RP3B 1GN4A 3X2QC 5CB4B 3RKZA 1Y66A 1XOUA 2DQ0A 4I5SA 4DK1A 3W7SA 4CWTA 4HNAB 1K3EA 1UYDA 2N74A 2XAGA 4UB8Z 4YXWG 3RYHB 4WFHA 2AHYA 3WQ9A 3D36C 3W7TA 2K9PA 1WA8A 4B7KA 2D3OW 3F5WC 4LF4O 5M4EA 2M6YA 4PDRA 4PJ0Z 1JMKC 2RQ6A 1YS3A 3FB7C 1FYJA 3SYCA 3RN4A 4JF3A 5K1XA 2DYRC 3RYIA 2XABA 4H85A 3ZMZA 4O2BB 1I94B 4TUYB 3VQVA 4JI3B 4XITA 4ASGA 1TILA 3AK3A 3CWVA 3QF7A 3BA8A 2C1GA 4ZOLB 2HHIA 4FLZA 1THNA 4JYAO 4DRXA 2WEPA 3R4NA 4LP0A 4O4IA 1YHQV 2JS5A 2YK9A 2QJ1A 5LMUO 1V55C 4EFEA 5JQGA 2XNDG 1OCCB 2LFRA 5ITZA 4LF7O 3ZM7A 2RMKB 5LP6B 1PL0A 1I5YA 1U96A 4I9QA 3LSSA 4OGQB 3Q5KA 2ITCC 3B8NA 2FXSA 4WFEA 3BAAA 3KZIZ 1FD9A 2YI7A 3ZXQA 1HR0B 2FTKA 3EFFK 2UXCB 3CB2A 4IHJB 4LF6O 5A2QN 4UCUA 3X2QB 2UXCO 1EA6A 2XJJA 4UXNA 2BU2A 3ETGA 5EIBD 4KSGA 4FLYA 5J6AA 1H8EG 4MTFA 4PA9A 3AG1B 3PN1A 4ABMA 3OAAG 4TSFG 4UROA 2YKCA 3UO2A 1AB3A 2BOCC 3FB6C 3MAQA 1SQVH 1Y4MA 3OPDA 4LR3A 2F4VO 3LDDA 3OMNB 5H6RA 2YEGA 2YJXA 1GKFA 4BIOA 3R92A 1YJNV 3AK1A 1K5SA 4RUEA 4D7TA 2YE6A 4UCSA 3J7AU 2XASA 2DN9A 1MZEA 1SZTA 3E8HA 2XAHA 5KA6A 1JOYA 1UYHA 3M7MX 1JJOA 4ZVIA 5CA1A 3L75H 4QE9A 4MP2A 1NR1A 1YT2A 1HNZO 5CTWA 2PF4E 4H37A 2EIKC 3O6OA 4U3JB 4C7UA 4DV3B 3SPGA 2JVDA 4LF4B 2YE4A 2Q4PA 1DK1A 1TC6A 2AHZA 4DR7O 4EFBA 5KAFZ 3Q4HB 3TGUH 1XBLA 2JJ2G 2R72A 3K97A 1WJZA 1US7A 2XAJA 4DR2B 1LR1A 3RGBA 3OD4A 2HP8A 4L87A 3OGCC 2QKCA 1K92A 1P4RA 4X65O 5M4HA 4O05A 1AJQA 4UCOA 4GLXA 1ZL8A 2YKBA 2CTPA 1NH2D 4YKQA 4GKJO 3U2DA 4Z1VA 1B63A 2BU5A 5KUKA 4UFZA 3OWDA 3IFXA 3QO7A 4MPCA 4MTXA 1RSOA 2EIJC 1V9PA 4EGKA 4U93A 5IDJA 2YEJA 3D0BA 1UPGA 5DEDA 4MTOA 4LP8A 4LF8B 2YE5A 4KHPB 5IE9A 1KZNA 5M4MA 1MMMA 2IJKA 2BTQB 1I59A 4LF6B 4R50A 3SYAA 5HFMA 5LMNB 4K0KO 1L8DA 5L3GA 4JTAB 1SQPH 1YSRA 5LOVA 3FFQA 1HW7A 2Q8FA 3KG2A 1N0NA 5LP6A 1R6NA 1HP8A 4WUDA 3TCUA 2CTRA 2CCUA 3CCSV 1H2GA 2CTWA 3CYOA 4B08A 1YC4A 3FT5A 4EMVA 3VQWA 1AJ6A 1A4HA 2AW9A 4E00A 1H2LA 2HG5C 1SQQH 2ZBKB 4H0LB 3BRCA 4UVBA 4JYYA 5JCOA 1ROPA 4H44B 5CPHA 1W59A 4B3RO 4RQFA 1DF5A 4XE2A 1OHHG 1S72V 4CE3A 4CZZA 3UCSC 1M90W 4ZKIA 1IDSA 4JI4O 4GCZA 3M8AA 1QR8A 1QLEC 2P4KA 1E1QG 1FKAO 3INXA 5GTIZ 3K0DA 1K73W 2V7QG 3HYYA 3A0TA 2G38A 1OCZB 2DYRB 2YEFA 1VF5B 1YIJV 1PNLA 1B04A 3B40A 2P67A 2V4DA 2F93B 3RBZA 2LP7A 2UXDO 1BS3A 3CC2V 1UYLA 5CB4A 3GB7C 4U3JA 2YXLA 3JD0A 1NU1H 3E83A 4GUNA 3CCUV 4GKJB 4O0BA 3O2FA 2MK3A 1N4CA 4DV6O 3TTZA 3ZRSA 4X64B 3ZMVA 3C0EA 4CS4A 1Q6UA 1R73A 3KCXA 4FM0A 1N0JA 2XJGA 3RYCA 3W7XA 1ZX3A 4I50B 5EBWC 2FMLA 2ZR2A 1I5CA 4AWOA 3T2SA 1Q82W 1QNMA 4LF7B 4GX0A 3WHAA 2UXBB 1RM1C 2Q8VA 4NH9A 3CMAV 1FS0G 1H8HG 1FFXA 2QM8A 1NHJA 3FYIB 4OXSA 2IJIA 4MPEA 1SESA 2X6BA 1XREA 3DC6A 5LHIA 2GUZB 3S5TA 1EN5A 4EKWA 4X62O 4X1YB 4TV9B 2EILB 3BY6A 2UU9O 4KUMA 1QLNA 2WLIA 4LH6A 1HR0O 4OX9O 4MB9A 4BAEA 4EGHA 2BSKA 2ZKJA 2OCCB 3ZEDA 2WLJA 4TQDA 2VQEB 4PDVA 4MS2A 1J5EB 3JD3A 1Z5AA 4MSWC 5CBGA 1I08A 4P9OA 4MP7A 1UFIA 2H3OA 3ZCCA 1KP3A 2PNRA 2YE3A 2ARHA 2WI1A 3ZRWA 1KKCA 3BM9A 3QNEA 1KB9F 3JASA 4XC0A 4HBNA 3E89A 2FYUH 4HY1A 3HKDA 5EZYB 3B8MA 4EB6B 3JAKB 2Q7HA 1BHAA 4WFAV 2BYHA 2Q8HA 4J10A 1IBLB 1YERA 2JKIA 5CA1B 1CPYA 1MOFA 1O9GA 4DV6B 1GN3A 3ZKBA 2ZXWC 1AI7A 2GBOA 3NXSA 4WUBA 2ILMA 4LWHA 5LHGA 4YJ2B 3G67A 3N2GA 3G80A 3CGZA 4I55A 2WERA 2RNBA 1FXKB 3TK1A 5L3BA 3K99A 1JVMA 3A0BZ 4DK0A 4H81A 1N36B 1COWG 3UM7A 2HKJA 4RUFA 1EZVH 3OEHG 5FPRA 2GSMB 2JGDB 4V25A 2B9ZA 2FB5A 3AG2B 4HZ3A 3ETDA 5M4PA 4JI7B 1UY9A 4AQYB 2DQ3A 2Q0AA 1XHXA 3SDLA 5L3JA 3LNMB 4NB5A 4DW1A 3ETQA 4FFBA 1VP7A 4L91A 3CCEV 4R3AA 1MABG 1QR9A 4ZI7A 4X66O 2XD6A 3K57A 1PKXA 3JAWA 4KFGA 2NNUA 4DR5B 4QPJA 1FXKC 4JYBA 1NTMH 1S5JA 5CTXA 4X1KA 4E72A 4B7PA 4JZ2A 5CA0B 4XKAA 3TZ4A 1Y4SA 4E02A 5H2FZ 1MSWD 1ZSPA 5D6QA 3OTOO 1CEZA 2YI8A 1H7UA 4K35A 3BABA 3H80A 3R65A 1NI8A 1NTKH 3L71H 4MPNA 3VHCA 1MA1A 4RWUA 5EC1C 3ZMTA 2VQEO 1YSZA 4GX1A 5KHHA 4ZHQA 3K58A 2HJDA 1JR9A 1EN4A 4ZIBA 2W6IG 3LSQA 5IJ0B 2E3CA 1NHHA 1BCCH 4URMA 2BU7A 1SQGA 3ZRVA 2YGFA 1SQFA 1AP6A 4IHJA 1MX0A 2C2AA 4LNUA 4FCQA 3SYOA 1KBHA 4G2KA 4CH5A 2GQPA 4TWKA 1BGQA 1F51A 1R6KA 2WI2A 3K79A 2LGQA 3HKEB 5FNVB 1JA8A 2XTAA 3LNUA 2D2CB 4XBFA 1ZAUA 2ITDC 1GRJA 4FIPC 3T1YB 3L74H 4X88A 1ZXNA 3WB1A 1ZXMA 4X65B 5F2VO 4AQYO 3E8GA 1PNKA 1G1XB 5CBFA 3B4SA 1WAZA 3EKRA 1Y74B 3SPCA 2YK2A 2BE3A 2CDYA 4O2BA 4XCJA 4JI6O 2EINB 4YHHO 5EK0A 1Y6XA 5LBQA 4EFTA 5B5EZ 1AR1B 1I5DA 5F5RA 2HKOA 3AG3B 2XHBA 2OT5A 3ABLB 2IORA 4N21A 1KQSU 5IYCO 4JTDB 4YKUA 3LPSA 1MSDA 5J71A 5GW7A 3BHPA 5IY5B 5LMNO 4NH8A 3G75A 4N23A 4XIPA 4KFMA 3DTUB 1BYQA 1QYEA 4V26A 2JDIG 4X20A 2YICA 5J2TB 1H38A 2QWOB 4NR1A 5C8YA 3EVKA 3IGAC 2ZM6O 4JAAA 2OCCC 4O4JA 5M4KA 2ZDIC 3QTCA 3CCJV 3NR7A 3K5LA 1K33A 3T4DA 3CC7V 1WNSA 4NTYA 1IVSA 2FWYA 3ASNC 3OTOB 3W7WA 3AG1C 4D7SA 5IT9N 1M5IA 4L90A 5EBLC 1UYCA 4MOTA 4UVCA 1YC1A 1IX9A 4DV5B 5A9GA 4DYLA 1QVGU 2BU6A 4J9ZB 2Q9LA 4AILC 1N34B 1AP5A 1J5EO 3HKCB 2YXHA 1K8AW 1FJGO 1THZA 3JSLA 2M7WA 4ASBA 2P06A 1BL8A 2JJ1G 2E5LO 4LFCO 3K0GA 2WI5A 2ZDXA 3JARB 1R62A 4MVZA 3AG3C 3H1LH 2GFDA 3LDCA 2ZKOA 3B26A 1DLBA 2UUCB 1MZFA 4DV4O 1N34O 1VQ4V 3JD4A 2QSAA 5IYDO 5H9CA 4K8XA 1Z5CA 1I7FA 3TZ0A 1K4CC 4I4TB 2F66C 3H9VA 3OR6C 1R3LC 3JALA 4HYOA 2ADPA 4U3FH 1TVKB 4XDKA 1SQBH 3ZX6A 5BXZA 5CTUA 4WUCA 4URNA 4ZBMA 4W7TA 3EHBB 3UKMA 1G6UA 2X7RB 5AG2A 1YSCA 4GGLA 1HNXO 3ABLC 1JFFB 2UXNA 3JCUZ 3U2KA 5L3FA 1LNQA 1FFXB 3QG5A 3U67A 1SETA 2EBOA 2W0XA 2BTZA 2LGWA 3C11A 4L94A 5LHHA 3JALB 4FLUA 3S3WA 1BT8A 1WPXA 5J2UB 4X1YA 1Z5VA 2JEXA 2ZXWB 4CC5A 1F4MA 4FCRA 1VF6A 1SZXA 4JASA 3CD6V 4KL1A 1YCIA 5C8YB 1FXHA 2F95B 1VIBA 1Y8PA 4JQLA 2WI6A 2E5LB 4YIOA 4NXMO 4R8CA 1XL6A 1W0KG 1URFA 1DTOA 1K34A 3DXRA 2P5OA 2YEVB 1S77D 2BT0A 3JATA 2QKSA 3DGEA 3RYFB 4R1FA 2L6LA 3I5DA 4PA6A 1AJNA 1R6TA 2QWRB 5IWAB 1ENVA 1N36O 5BR8O 4DR7B 4NXNO 1IXMA 2CAZC 2CGFA 1BQZA 3E8BA 3OEEG 3ZN1A 3T10A 1B06A 4I7ZB 4H7QA 3RVZA 3J80N 3CSXA 5JCOC 3TXSA 4YY3O 1JPXA 4QIWF 3CP1A 2P6JA 3G7BA 4I55B 4XTJA 5KA5A 1BQ0A 1IBLO 1ZW9A 2OIGA 1HNWO 2CCSA 1SF9A 3HKBB 2BU8A 1XMQO 5FNDA 1OCZC 1UYMA 1FFTB 4KSHA 4JZGA 4JI0B 2WI4A 4LWSA 4EB6A 2F1MA 2KG7A 3CCVV 3NMQA 3CPWU 5KHGA 3DXRB 4O07A 2UXBO 3ZJZA 2X0LA 3N27A 3KCYA 4X9QA 4LFBO 4JI7O 5IYBO 1QHTA 2LO1A 1HWYA 2XUMA 4H33A 5JJJB 5GONA 3C3SA 5BMVB 4QPKA 3VBBA 1N33B 2P4VA 4DUHA 3CEIA 4KHPO 3O9OA 5LL6Y 2CGOA 2HHHB 1Q86W 3THOA 4L8ZA 4TV9A 4YJ3B 3ASNB 2CG9A 2QF6A 2WI7A 1KECA 2DYSC 4GEEA 3A0HZ 1XNRO 1BXDA 4P9PA 4CWSA 3CRKA 5LGUA 4WFBV 3HPLC 1Q3EA 4CWNA 3E22A 2LFSA 4JTCB 2KB1A 1YTFB 3I56V 1ID0A 3RLRA 5J9PC 4UV8A 3ZMSA 3CGYA 4KTNA 3K08A 5D7CA 5E1AC 5CBHA 4B3RB 2Q68A 4ASFA 4O2AB 5LXTB 1P49A 4XDJA 3Q4HA 4OX9B 2XAQA 4EGIA 2PUSA 3JSNA 4I50A 2UUAO 3APOA 4AI8A 4GT8A 3H4LA 2HLDG 2PI4A 2YE8A 1PL4A 2Y4TA 4YJ3A 4LFCB 4XD8A 3AG4B 4QGPA 3N2GB 1TBWA 2VCIA 4DRXB 1XHZA 1KMIZ 3B77A 1H7SA 3TXQA 4DV5O 2WEQA 2YE7A 4MTGA 1YZBA 1Y4UA 4DUZO 3B25A 3OMIB 3G6BA 2UUCO 2VS0A 1Y8NA 1WB7A 2EIMB 2BSMA 5EYPA 2RJZA 2BTOA 3JARA 4J7ZA 3QO8A 2BZ5A 4I3HA 4MVMA 2X6CA 4L93A 4PHZA 1GJVA 5L3DA 5D5QA 1AM1A 2CH7B 4OPAA 5LGNA 2B1IA 3FYEB 1KIJA 4LF9O 3A0RA 1F4NA 3K98A 4WFGA 1BMFG 2QFOA 2DWEC 3L9DA 3HR0A 1XQ8A 2JJCA 2YGAA 1R1BA 3H1IH 3K60A 4EM7A 2LQTA 5KX5A 1VF7A 4JI2O 2O57A 2HVJC 1I5AA 1XMOB 4MT8A 2PGGA 2OIEA 1ZWIC 3OUFA 1RFYA 4GX2A 4HZ0A 1UY8A 4LWIA 4CS3A 4DV1O 2HEPA 1TUBA 2XDKA 2CCTA 5LA6B 4FLWA 2B1GA 2R9AA 1Q43A 2KSDA 2UUBB 3RFRA 1P7BA 4RO2A 4IYHA 2GV9A 1NVPD 1BGYH 3CXCU 3T1HB 2A06H 3EHFA 3SPIA 3CC4V 4AHCA 4WBNA 1GM7A 1IZ3A 1PNMA 4LF5B 1M57C 3GVMA 2JGDA 2YEIA 3BPZA 1GM9A 5IYZB 4FZ0A 4JI5O 4GQTA 3T0HA 2VW5A 3AK2A 4TUYA 3ETEA 1P84F 2HHHO 4ASUG 2WSSG 1BE3H 2ADQB 5JJNB 3HYZA 2Y69B 1OCRB 4BWAA 5M4NA 1YT0A 2XDLA 1WP8A 4WFFA 4Z1MG 4DV7O 1YTFD 4NH7A 3MD0A 4E01A 2EILC 5CA3A 1QLEB 4CH4A 1WB8A 4DR4B 4DV7B 2R9IA 3SJCC 1FJGB 1GM8A 2EX3A 1QVFU 4JI6B 4MW8A 4LBEC 3LDEA 1JJ2U 4YKYA 3ABMC 1TVKA 3FD9A 5CA0A 4U7NA 2Q69A 2PY5A 4IT5A 4ZHQB 2IU0A 4DR2O 1YETA 2WA4A 1A32A 5B3SB 1Q7YW 1IBKO 3CJHA 4TV8B 4O4LB 4B3SB 2IOPA 3SYPA 5BY1A 5IWAO 1K97A 4LNUB 4PDLA 4DR3B 1K7DA 1VQLV 4X9LA 4JGSA 4BAYA 3MHSC 4B3TB 2IH1C 4X20B 1BKNA 4CWOA 2RN9A 2AKPA 2Q5ZA 1GKXA 1Y8OA 1X59A 2BSKB 4UV9A 3MDSA 3KKYA 1W0JG 1WN7A 3WU2Z 1JQ0A 2RDCA 3D3IA 5EYPB 1EBOA 4J42A 4FM1A 2ETNA 5JH7B 4IYIA 1GTOA 4F6RA 1R3KC 4I0XA 5IJ0A 1Y74A 4MVRA 1KYOF 1H2SB 4G28B 2YI0A 2YIDA 4JI2B 4O4LA 1OJHA 2Q2EB 5FPOA 3JZ3A 1RPOA 5LA6A 3SJBC 2CH7A 2YI6A 2AXTZ 4OPHA 1AH6A 1S5HC 3HKEA 5FNVA 3QTFA 2XX5A 2WWWA 5D7RA 2XCMA 1QZRA 4X1IA 4CWQA 5LOVB 1GN2A 1YESA 3SGIA 3EKOA 3Q5LA 3P3NA 3RYFA 4JI4B 3QDDA 2EIMC 4K0KB 3ZHTA 3HKCA 4FMTA 2YE2A 5BMVA 4J9YB 3OE7G 1XNRB 5FLXN 1S14A 1OSFA 2YS8A 3S3XA 1YXBA 3ABMB 4NXNB 4JI5B 2ZINA 1D5AA 5KMGA 1IBMO 1WLEA 1VARA 1SERA 4YJ2A 5F3KA 2YI5A 2ESAA 1NTZH 2OCHA 2KG7B 3F7VC 3CCRV 4A5UB 3FAVA 2CUGA 4DV3O 4EFUA 3CRAA 2EIJB 2H94A 4TT3G 4LPBA 4ASAA 5KAIZ 3RYIB 3CWBH 2OTJV 3EHJA 3ABTA 4AS9A 2WLLA 4XDLA 3K9AA 4EEHA 1WPBA 3G4SV 5DM6V 4P2ZA 3BFRA 2ZE7A 1I0HA 2QM4A 3K06A 3APQA 2QWNB 3JD2A 5FNFA 4B3SO 2OWOA 2XJXA 4CE2A 1VQNV 1NH2B 4PV1B 4LWGA 2P7TC 1MU5A 1X4TA 4PA3A 4KP4A 3HHUA 1UY6A 5JQGB 5GTHZ 2NLJC 3B09A 2XDUA 4UCTA 4O2AA 5LXTA 4YKRA 5LYJA 2ATKC 1SRYA 4LCUC 1N32B 3ZKDA 4JI0O 2YC0A 2QG0A 4DV1B 4CH6A 4GX5A 1R3JC 1N33O 2HVKC 3CRQA 2K1EA 1CXZB 5H5NA 3UT5A 2VWJA 2CH4A 1AR5A 3PEHA 2QA4V 1JFFA 2Y0PA 2Z3YA 4XKKA 2EJRA 4XKOA 5LP6C 1LUWA 1VQMV 1G8MA 2BCCH 1ZL8B 1IURA 2JIZG 2YJWA 1K5QA 1YJWV 2YEDA 3WG7C 5JVDA 5JJEB 4GFNA 3AEIA 2JS3A 5B1BB 4MVQA 2PZSA 1UYFA 1UYGA 4PI0A 3HKDB 5EZYA 2XHXA 2UU9B 3CMEV 3RVYA 2JGUA 1VQ8V 2EZPA 1AI6A 1US6A 3B2EE 5TISZ 4BQGA 3TZ5A 1Q6IA 4XIRA 1XEQA 4PD4F 1KUQA 5B1AC 1Y76B 4DUYB 5J2TA 4NKGB 3G7EA 4MVOA 2XDSA 3C90A 3CCMV 3RLQA 2X6AA 3A2FA 5FNCA 3QO5A 1M4UA 4UB6Z 3HZ5A 1HNZB 4FLTA 3LMMA 1YT1A 3ABKC 5BODA 2A7WA 5D5PA 5B1OA 2HG1A 1PV0A 1AH8A 2GUZA 3RLPA 4O4HA 1S16A 2A9HA 3SYQA 3IC9A 4LC1A 1SKVA 3OGIB 3ZXOA 4P30A 1AJPA 3JAMN 1FPOA 3P32A 2H8MA 5IJ9B 5B1NA 2CE4A 2P90A 3D2RA 4MVUA 4HXWA 5JWPA 4BQJA 4CWPA 5IYZA 2WLLB 3DC5A 5KHIA 1YITV 5CN0A 1NR7A 1O9HA 2Q73A 1OCCC 5L3EA 5GONB 2CK3G 2YEBA 1PD3A 3PJSK 2PYJA 1F7YA 1TUBB 3N2KB 4UUJC 2F23A 3K5NA 3K5OA 4J80A 4X62B 3F5TA 2YKJA 2EIKB 5EIBC 4FFKA 2Q67A 4LH7A 3WB2A 1M56C 3K3WA 4MW3A 2UUBO 3OMUA 3EXAA 4JI8O 4DR6O 4FJCC 2GDSA 1UYEA 4JI1O 1DGSA 4HYPA 3K9SA 4PRXA 1NT2B 3UO3A 1F23A 1V54B 3ASOB 3P3PA 4LF9B 2XDXA 3J81N 1IBMB 1VEWA 4LFAO 4R6ZA 4KXRA 1L1FA 4FLXA 2XT9A 2ZNIA 1OV9A 2Q7EA 1M1KW 1PM9A 4GZRB 2YIAA 4FCPA 3K03A 2ZE6A 1VQKV 2IOQA 3A8TA 2HR3A 3JD1A 4NXMB 1OZ0A 2YUAA 2HJFC 4P8OA 2ZM6B 1MG1A 1ZWHA 1Q90D 4YKXA 5B1AB 4I0XB 4BXIA 3CXHF 3CS5A 4O4HB 1YVWA 3EHHA 2Q0OC 2VCJA 1JCHA 4PRVA 4J41A 2DWDC 2JEUA 5BR8B 1GAXA 1Y67A 4BIZA 4BW5A 1VQ5V 1M93A 4LF5O 1V55B 5LGTA 4GKKB 4X64O 2BREA 1SC5B 3MHHC 4URLA 3SJQC 2A79B 1Q6HA 5B1BC 5B66Z 2YDEA 3JAWB 3CYGA 2VWCA 5E79Z 4JI3O 1M56B 2AGAA 1EFRG 2H55A 2XOKG 2EINC 3GWOA 2EZOA 3CJHB 4TV8A 4FK5C 1P7GA 2IBZH 3CHXA 3ZS8C 4J7JA 5J2UA 1N32O 2JRIA 4E2LA 1XMOO 1V54C 1QQCA 3ASOC 5FWKA 3ZMUA 1H2KA 4DV2O 3H1HH 1H2NA 4F6EA 3CE2A 4JYAB 1R3IC 1J95A 4WF9V 2YEEA 4CC6A 1VMGA 3K5MA 3CRRA 4MVSA 4XIQA 2AZ2A 3IJ4A 1Q8IA 1XNQO 5JH7A 3E2EA 4I9WA 4L8JA 3GIEA 4H13B 3SL2A 1YI2V 4PELA 3R4PA 2OYQA 4IIJB 4FPPA 3CCQV 1FXVA 2EXLA 4HXZA 3ABUA 3OFNG 2ODMA 2XX4A 3RYCB 4YKZA 1RPRA 4LF8O 2AZ0A 2IH3C 1E79G 3UT5B 1I5XA 1U0ZA 2F4VB 1EM1A 5LYJB 3IEDA 3GIGB 4DR5O 1YDXA 1UYKA 2Z0AA 3FX7A 1S76D 4QE7A 3ZRWB 1AR4A 3HB3B 2WLMA 4HAMA 4DR4O 2YI9A 1KP2A 4Q6GA 3D3QA 5BZBA 4FM2A 1Z59A 2GTSA 2ZE8A 1DF4A 2QEXV 4JV5B 1ZLZA 4JAVA 1PP9H 5D6PA 1BSMA 1K4DC 5KHKA 3B24A 3HZ1A 3ZHSA 4DV0B 2ZIMA 3CX5F 3FKSG 1WA8B 3TJTA 3ZHVA 5KLVH 3VADA 3H01A 3CCLV 1KD1W 2NN4A 2HCHA 3A0XA 1H2MA 3OT7A 2QM7A 3ZN0A 1YF2A 1NZ6A 1M57B 2VQFO 3I55V 3BMYA 1VQ6V 2K5BA 5IN9A 4I4TA 4P7AA 4XDMA 3LUTB 5IY5C 1I94O 4FZ1A 4IIJA 4O04A 1UY7A 1BZKA 3B28A 4TOIA 4LWSB 1TC0A 2R9RB 3WG7B 5IDMA 1B6QA 4X8AA 2QDOA 4O4JB 2JK5C 1EI1A 1TH8A 4NYKA 4E4EA 5FL7G 2H8PC 3FAVB 3SR2C 3BVOA 3IAYA 1U97A 2WLKA 2Q7GA 3A0WA 2VWKA 3GIFA 3RYHA 3LNNA 4CH3A 5B3SC 1HNXB 2IWUA 1I58A 2BRCA 3BCCH 4HYMA 5H6QA 2W6JG 3H1JH 1N8RW 3SPHA 3E8FA 1ZTEA 3AG7A 2O1VA 2A3QA 2PTMA 4QJFB 5EC2C 1ZUQA 3G71V 3VHAA 1OCOC 2QWQB 3RWRD 2QG2A 2Q8GA 4MBCA 1AVMA 1KKDA 3JATB 2ZT9B 1XUQA 1XILA 2XX2A 4CE1A 1L0NH 3FB5C 1UJWB 5KMGB 2DYSB 4GYCB 3N2KA 3CRCA 4LFAB 1D5NA 3W7UA 2MW2B 4G27B 3ML0A 5KHJA 1Q5OA 4B3MB 3GIGA 2V1DA 2FKXA 2IW5A 2ZD9A 2NR5A 4K4OA 5CTYA 2WLHA 4B3MO 4DV4B 1EZJA 2YIBA 3ZBHA 3OMAB 4GKKO 3HEKA 4R3MA 1AI4A 1G4YB 2CGNA 3T2MA 4JV5O 5JVDB 4DV2B 1RM1B 1Z5BA 1VQPV 2QKAA 3D36A 3ZHQA 4DUZB 3SJAC 1IBKB 2FYPA 2XK2A 4CWFA 5K1PA 2UUAB 1EN6A 2YEAA 5L3CA 1NKDA 4TQFA 3A0YA 1HDJA 2IM9A 1U2OA 2Z5UA 5KX5B 4DW0A 3VQYA 2YEVA 4FLVA 2ZIOA 4JI8B 1YC3A 2B5UA 4CWRA 2OTLV 1IXBA 5DN6G 2DOSA 5ITZB 2UXDB 2HFEC 2QR4A 1AMWA 1Z2GA 3U10A 4IL6Z 3OR7C 2IJHA 1GH6A 1B3QA 1GO3F 4FVMA 3INWA 1XNQB 2QTSA 1S3JA 3ABKB 2DW4A 4JI1B 2ZCEA 1XMQB 3T1CA 3T1HO 1NQTA 4NVPA 4CBCA 4WBNB 1FXKA 2QTOA 4FFBB 4LFBB 4HY6A 4HNAA 3JYCA 3RT3C 3HKBA 4DUYO 4O4IB 1GKZA 2O1UA 3FT8A 3TUHA 3E22B 2W0FC 1PPJH 1FAFA 3OW6A 1QCEA 4J11A 1E1RG 3PEJA 3A0ZA 1TA8A 1NHIA 1YEWA 2FWZA 1LUVA 1OCOB 2RCVA 1Z5WA 2Y48A 2WLNA 4RAIA 2WLIB 2LW7A 4PI2A 2UXXA 4GT1A 3H1KH 2O1WA 4DZYA 2ZE5A 2FL4A 4DR1B 2P22C 3D8CA 2E76B 4ICGA 2E74B 2YE9A 5D7DA 2YEHA 2YKIA 4WCEV 4UCRA 3T1YO 1AILA 1QU7A 4JPRA 1QY8A 5IJ9A 3O65A
chains in the Genus database with same CATH topology
2X6AA 5FNCA 3QO5A 2QKSA 3DGEA 3HZ5A 1I5BA 3Q5JA 4O09A 4R1FA 1E1QG 3AG2C 3INXA 1Q81W 3AG4C 5EBMC 3ZIAG 3ABKC 4PA6A 1YT1A 1AJNA 5BODA 4R7CA 3K0DA 1K73W 1ENVA 5B1OA 2HG1A 2V7QG 1AH8A 3HYYA 3A0TA 1IXMA 2CGFA 1OCZB 1VQOV 2DYRB 3RLPA 2YEFA 1S16A 3E8BA 2A9HA 4U7OA 1PNLA 3SYQA 1YIJV 3OEEG 3ZN1A 4LC1A 3M99B 2YGEA 1AI5A 4HZ5A 3T10A 4H7QA 2P67A 3RVZA 3ZXOA 4P30A 1AJPA 3RBZA 2LP7A 1M9NA 1JPXA 3CC2V 4CWFA 3BEHA 2XAFA 1UYLA 3P32A 3CP1A 4QIWF 2H8MA 2P6JA 2IWXA 3GB7C 5B1NA 3G7BA 2P90A 2ZR3A 4Q20A 4XTJA 3JD0A 3CCUV 3E83A 5KA5A 4MVUA 3D2RA 4O0BA 4HXWA 4BQJA 3O2FA 4CWPA 3VHDA 1ZW9A 2ZDIA 2MK3A 3OWBA 2WLLB 1YITV 2PI5A 2CCSA 4X89A 5CN0A 3EHGA 3TTZA 1NR7A 3ZRSA 2BU8A 3ZMVA 1OCCC 5L3EA 3C0EA 5FNDA 2CK3G 1UYIA 2YEBA 1PD3A 1OCZC 1R73A 2WPDG 3T4ZA 1UYMA 1L0OA 3PJSK 1XL4A 1FFTB 4KSHA 4UUJC 2XJGA 2QE7G 2WI4A 3W7XA 1VQ9V 5EBWC 1TUEB 2ZR2A 1I5CA 4AWOA 1CP9A 3T2SA 1Q82W 4GX0A 2EIKB 3CCVV 1GMGA 2Q6AA 2Q67A 3CPWU 2YKJA 3NMQA 3R91A 2Y69C 4O07A 1RM1C 1M56C 3K3WA 4MW3A 4F4LA 3OMUA 4NH9A 1GK9A 3ZJZA 3CMAV 2X0LA 1FS0G 4AWQA 1H8HG 4FJCC 2QM8A 1NHJA 5HFLA 3FYIB 3OM3B 3SPJA 4OXSA 1UYEA 3KE6A 5CF0A 2IJIA 4MPEA 5IYBO 4HYPA 1HWYA 1SESA 4H33A 4PRXA 4PA7A 1F23A 1V54B 2X6BA 3ASOB 1BHBA 5LHIA 2XDXA 4QPKA 5CMUA 3VBBA 5BOCA 4EKWA 4R6ZA 3G6EV 4DUHA 1L1FA 2EILB 2BOBC 1ORQC 3BY6A 1Q86W 2BYIA 4L8ZA 4KUMA 1QLNA 2WLIA 3R4MA 2QF6A 3ASNB 2CG9A 4MB9A 4BAEA 1M1KW 5C93A 2WI7A 1KECA 4DO2A 2DYSC 4FCPA 4GEEA 3K03A 4EGHA 1BXDA 2ZKJA 2OCCB 4P9PA 4CWSA 3CRKA 1VQKV 2IOQA 5LGUA 2WLJA 4WFBV 4PDVA 4JYCA 3HPLC 4MS2A 3JD3A 2HR3A 4MSWC 5CBGA 1Z5AA 4CWNA 4JTCB 2LFSA 2KB1A 4P9OA 2ZQMA 3JD1A 3I56V 1YTFB 1ID0A 4MP7A 3RLRA 5J9PC 1NVPB 1OZ0A 4PL9A 2WAMA 3ZCCA 1KP3A 2HJFC 4UV8A 3ZMSA 2PNRA 3CGYA 3K08A 1JM6A 5E1AC 2IWSA 2YE3A 4KTNA 4P8OA 1NBMG 2WI1A 1MG1A 3ZRWA 4XCLA 1ZWHA 3BM9A 5CBHA 3QNEA 4YKXA 4B6CA 2Q68A 4ASFA 1YJ9V 5B1AB 4BXIA 4XC0A 4XDJA 3CRLA 2XAQA 3E89A 4EGIA 4HY1A 4KQVA 3EHHA 3B8MA 2VCJA 1JCHA 4PRVA 4GT8A 2DWDC 2BYHA 1BHAA 2JEUA 4WFAV 3H4LA 2HLDG 2PI4A 2YE8A 3O0IA 2Q8HA 4PU9A 4BIZA 4BW5A 1YERA 1VQ5V 2JKIA 4LWEA 1CPYA 1MOFA 1V55B 5LGTA 3ZKBA 2WI3A 2ZXWC 1KC8W 2YECA 4XD8A 3AG4B 1AI7A 2BREA 3NXSA 2GHYA 1TBWA 2VCIA 4WUBA 4YKTA 3MHHC 4URLA 1S0VA 2XHRA 4LWFA 3SJQC 5LHGA 4LWHA 2A79B 3B77A 3CGZA 4BIUA 3T0ZA 1H7SA 3WHAA 5B1BC 2WEQA 2WERA 2YE7A 2VWCA 1FXKB 4MTGA 5GGZA 3TK1A 1Y4UA 1B62A 3B25A 1AROP 1M56B 3OMIB 5L3BA 1JVMA 1EFRG 3K99A 2H55A 4H81A 2YSUB 2XOKG 2EINC 3GWOA 1Y8NA 2EIMB 1COWG 2EZOA 3UM7A 4RUFA 2BSMA 4DXWA 2HKJA 3OEHG 3QO8A 4FK5C 2E0AA 4JAUA 3K04A 2BZ5A 4I3HA 2GSMB 4MVMA 2YKEA 4V25A 2A0LA 2X6CA 4UVAA 4L93A 1GJVA 5L3DA 3RW0A 1W2BU 3AG2B 4HZ3A 4E2LA 1K9MW 1AM1A 3R4OA 1NJIW 1V54C 3ASOC 5FWKA 3ZRXA 3JCZA 2B1IA 3ETDA 3ZMUA 5LGNA 2Q8IA 1UY9A 5M4PA 3FYEB 3OW2U 1KIJA 1R3IC 2DQ3A 3A0RA 1J95A 3STZC 1F4NA 5L3JA 3LNMB 2XHTA 4WF9V 3OUSA 2YEEA 3K98A 4WFGA 1BMFG 1QBZA 2QFOA 4YKWA 4MVSA 3STLC 4XIQA 3E35A 3WFVA 3CCEV 2DWEC 4L91A 4R3AA 1MABG 1QR9A 2JJCA 2XD6A 2YGAA 3K60A 2F43G 3E2EA 3T1KA 4EM7A 4I9WA 1PKXA 3FB8C 3GIEA 4KFGA 2NNUA 4QPJA 3SL2A 2HVJC 1FXKC 4JYBA 2UWDA 1YI2V 3VOUA 1I5AA 1PVGA 4PELA 5CTXA 4PA4A 4MT8A 3R4PA 4B7PA 4FPPA 2IJJA 1ZWIC 1FXVA 3OUFA 3CCQV 2EXLA 4XKAA 3TZ4A 4GX2A 4QNHB 4HXZA 4HZ0A 3ABUA 3OFNG 1UY8A 4LWIA 1Y4SA 4E02A 5KUMA 1MSWD 1OCRC 1TIDA 2XX4A 3MNRP 4PDMA 4YKZA 5D6QA 4AWPA 1RPRA 3F7YC 2XDKA 2CCTA 3B27A 1CEZA 2IH3C 1E79G 3IC7A 3TETA 2B1GA 1I5XA 1H7UA 3TZ2A 1U0ZA 3IEDA 3GIGB 2ZDYA 3H80A 3P30A 3R65A 4RQEA 1P7BA 4RO2A 1UYKA 4MPNA 3VHCA 1NVPD 1S76D 3FV5A 3E86A 3CXCU 4QE7A 3ZRWB 1VQ7V 3EHFA 1JX9A 2IU3A 3SPIA 3CC4V 3HB3B 2WLMA 3X2QC 1GM7A 5EC1C 3RKZA 4HAMA 1Y66A 1PNMA 3ZMTA 2DQ0A 4I5SA 1M57C 3W7SA 4CWTA 1KP2A 1YSZA 2YEIA 5BZBA 1GM9A 1Z59A 4GX1A 2QEXV 1DF4A 1K3EA 1UYDA 4GQTA 3T0HA 2VW5A 3JZ3A 2XAGA 4JAVA 3ETEA 4ASUG 2WSSG 2W6IG 3LSQA 1K4DC 4YXWG 4WFHA 2AHYA 1NHHA 4URMA 5D6PA 2BU7A 3WQ9A 3B24A 3ZRVA 2YGFA 3HZ1A 3HYZA 2Y69B 1OCRB 1MX0A 2C2AA 5M4NA 3W7TA 1YT0A 2XDLA 4FCQA 3SYOA 5M4EA 2D3OW 3F5WC 4WFFA 3FKSG 4Z1MG 4G2KA 1YTFD 4NH7A 4E01A 3MD0A 4PDRA 2EILC 5CA3A 1QLEB 2GQPA 1YS3A 3VADA 4TWKA 3H01A 1F51A 3CCLV 1KD1W 1R6KA 2R9IA 1BGQA 3K79A 2HCHA 2WI2A 1GM8A 3FB7C 3LNUA 1QVFU 4XBFA 4LBEC 2QM7A 3LDEA 2ITDC 4FIPC 4MW8A 3ZN0A 3ABMC 3SYCA 1JJ2U 4YKYA 1M57B 4U7NA 2Q69A 3BMYA 3I55V 4X88A 1VQ6V 1ZXNA 2K5BA 4JF3A 1ZXMA 2IU0A 5IN9A 2DYRC 3E8GA 1YETA 1PNKA 4P7AA 2XABA 5CBFA 4H85A 3ZMZA 4XDMA 3LUTB 5IY5C 5B3SB 1Q7YW 3EKRA 3SPCA 2YK2A 2IOPA 4O04A 1UY7A 3SYPA 4XITA 1K97A 4ASGA 4PDLA 3B28A 1K7DA 4XCJA 1VQLV 1TC0A 4X9LA 1TILA 3CWVA 4JGSA 4BAYA 3MHSC 2R9RB 3WG7B 5IDMA 2IH1C 1BKNA 1B6QA 4X8AA 4CWOA 2EINB 2AKPA 1GKXA 5EK0A 1THNA 2WEPA 3R4NA 4LP0A 2JK5C 1Y8OA 4UV9A 5LBQA 1EI1A 1TH8A 3A0XA 1YHQV 4EFTA 1W0JG 2YK9A 1V55C 1JQ0A 2XNDG 1AR1B 1OCCB 2LFRA 5FL7G 2H8PC 3D3IA 1I5DA 5F5RA 2HKOA 3AG3B 1EBOA 3ABLB 2OT5A 2IORA 3ZM7A 1PL0A 1I5YA 2WLKA 1GTOA 3A0WA 3GIFA 1R3KC 3LSSA 3Q5KA 2ITCC 3B8NA 4N21A 1KQSU 5B3SC 4MVRA 4WFEA 2FXSA 5IYCO 4JTDB 2IWUA 2YI7A 3ZXQA 2FTKA 3EFFK 4YKUA 1I58A 3LPSA 2BRCA 5J71A 5GW7A 5IY5B 4G28B 4HYMA 5H6QA 3X2QB 2W6JG 1EA6A 2YI0A 2XJJA 4N23A 4UXNA 3SPHA 1N8RW 3E8FA 3ETGA 2BU2A 4KSGA 2Q2EB 5J6AA 4XIPA 4KFMA 3DTUB 1RPOA 1H8EG 4MTFA 4PA9A 1BYQA 1QYEA 3AG1B 2JDIG 2YI6A 2O1VA 4V26A 4QJFB 1S5HC 1AH6A 5EC2C 1H38A 2XX5A 2WWWA 3QTFA 5D7RA 3G71V 3VHAA 1OCOC 3OAAG 4TSFG 2XCMA 1QZRA 4UROA 1S77D 3IGAC 2YKCA 4CWQA 2OCCC 1YESA 2BOCC 2ZDIC 3FB6C 3CCJV 3EKOA 3Q5LA 5M4KA 2QG2A 2Q8GA 4MBCA 1KKDA 1Y4MA 3OPDA 3QDDA 2EIMC 1K33A 3LDDA 3OMNB 3T4DA 5H6RA 4FMTA 2YEGA 2YJXA 2YE2A 1GKFA 3CC7V 3R92A 4J9YB 1YJNV 2XX2A 3OE7G 1K5SA 4RUEA 2FWYA 2YE6A 3CCMV 1OSFA 1S14A 4CE1A 3ASNC 3FB5C 2XASA 1UJWB 1SZTA 3ABMB 2DYSB 3E8HA 2XAHA 3W7WA 3AG1C 1WLEA 5KA6A 1JOYA 1UYHA 4ZVIA 1SERA 4QE9A 3W7UA 5F3KA 2YI5A 4L90A 5EBLC 2ESAA 4MP2A 1UYCA 3F7VC 4G27B 4MOTA 4UVCA 3CCRV 3ML0A 1YC1A 1NR1A 1YT2A 5CTWA 3GIGA 4H37A 2V1DA 1QVGU 2IW5A 2ZD9A 4K4OA 2BU6A 5CTYA 4EFUA 2WLHA 2EIKC 4J9ZB 3O6OA 2EIJB 1EZJA 2H94A 3SPGA 4TT3G 4LPBA 4ASAA 1K8AW 2YE4A 1THZA 3OMAB 2M7WA 3HEKA 4R3MA 1TC6A 4ASBA 1BL8A 2AHZA 2JJ1G 2OTJV 3EHJA 1AI4A 3K0GA 2WI5A 1G4YB 3T2MA 3ABTA 2JJ2G 2ZDXA 4AS9A 2WLLA 3K97A 4XDLA 1US7A 2XAJA 3K9AA 1R62A 4EEHA 3G4SV 4MVZA 1RM1B 1Z5BA 3AG3C 5DM6V 2GFDA 4L87A 3OGCC 3D36A 3K06A 3LDCA 4P2ZA 1K92A 1P4RA 1VQPV 2FYPA 2XK2A 3B26A 3JD2A 1AJQA 4O05A 5FNFA 5M4HA 1DLBA 2YEAA 5L3CA 2XJXA 1NKDA 4CE2A 3A0YA 2YKBA 1VQNV 1NH2B 1U2OA 1NH2D 2Z5UA 3JD4A 1VQ4V 2P7TC 5IYDO 1MU5A 4LWGA 4PA3A 4YKQA 5H9CA 3U2DA 1B63A 4KP4A 2BU5A 5KUKA 1UY6A 1Z5CA 3HHUA 2YEVA 2NLJC 2XDUA 3OWDA 3IFXA 3QO7A 1YC3A 1K4CC 4MPCA 2B5UA 2ATKC 1SRYA 4YKRA 3TZ0A 4CWRA 2OTLV 3OR6C 4LCUC 1R3LC 4HYOA 4MTXA 2EIJC 5DN6G 3ZKDA 4EGKA 4U93A 4XDKA 5IDJA 2HFEC 2QG0A 1AMWA 5CTUA 4GX5A 4WUCA 2YEJA 3D0BA 1R3JC 4URNA 2HVKC 2K1EA 4MTOA 4LP8A 4ZBMA 2YE5A 4W7TA 3EHBB 3OR7C 2IJHA 1KZNA 5M4MA 1B3QA 1GO3F 2CH4A 2IJKA 3UKMA 3INWA 3PEHA 1I59A 2X7RB 2QA4V 4R50A 3SYAA 5HFMA 5D7CA 2Z3YA 4XKKA 1YSCA 4GGLA 2EJRA 4XKOA 3ABLC 5L3GA 1S3JA 3ABKB 4JTAB 1VQMV 1G8MA 2UXNA 2DW4A 1YSRA 5L3FA 3U2KA 1QR8A 3T1CA 4NH8A 1LNQA 1NQTA 2Q8FA 2JIZG 2YJWA 4CBCA 1FXKA 1K5QA 2QTOA 3KG2A 1YJWV 3G75A 3U67A 1R6NA 4HY6A 2YEDA 4WUDA 3TCUA 1SETA 2EBOA 2BTZA 3JYCA 3TUHA 1GKZA 3WG7C 3FT8A 2O1UA 2CCUA 3C11A 2W0FC 4L94A 4GFNA 3CCSV 1H2GA 3CYOA 5LHHA 1YC4A 3FT5A 3AEIA 1QCEA 3OW6A 4EMVA 1E1RG 1WPXA 4MVQA 5B1BB 1UYFA 1UYGA 3PEJA 3A0ZA 1NHIA 2FWZA 1OCOB 2XHXA 2JEXA 2Y48A 2ZXWB 3CMEV 3RVYA 2WLNA 1AJ6A 4RAIA 1F4MA 2WLIB 1VQ8V 1A4HA 2EZPA 4FCRA 1AI6A 4E00A 4BQGA 2UXXA 4JASA 4GT1A 2HG5C 3CD6V 2O1WA 2ZBKB 3TZ5A 4XIRA 4DZYA 1FXHA 1Y8PA 4JQLA 5B1AC 2WI6A 4UVBA 2YE9A 1ROPA 5CPHA 2YEHA 2YKIA 5D7DA 4RQFA 1DF5A 4WCEV 1OHHG 4R8CA 1S72V 3G7EA 4XE2A 1XL6A 1DTOA 1K34A 1W0KG 4MVOA 4CE3A 4CZZA 4JPRA 2XDSA 1QY8A 1M90W 4ZKIA 2YEVB 4GCZA 2BT0A 1QLEC 3RLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FNC A;  3DGE A;  3HZ5 A;  1I5B A;  3Q5J A;  4O09 A;  4R1F A;  3INX A;  1YT1 A;  5BOD A;  5B1O A;  2HG1 A;  1AH8 A;  3HYY A;  3A0T A;  1IXM A;  2CGF A;  3RLP A;  2YEF A;  1S16 A;  4U7O A;  4LC1 A;  2YGE A;  3T10 A;  4HZ5 A;  4H7Q A;  2P67 A;  3ZXO A;  1UYL A;  3P32 A;  2H8M A;  3G7B A;  2IWX A;  5B1N A;  4Q20 A;  4XTJ A;  3D2R A;  4O0B A;  4HXW A;  4BQJ A;  3O2F A;  4CWP A;  3VHD A;  1ZW9 A;  3OWB A;  2CCS A;  3EHG A;  3TTZ A;  2BU8 A;  3C0E A;  5FND A;  1UYI A;  2YEB A;  1UYM A;  1L0O A;  4KSH A;  2XJG A;  2WI4 A;  1I5C A;  4AWO A;  3T2S A;  2YKJ A;  3NMQ A;  3WHA A;  3R91 A;  4O07 A;  4NH9 A;  3OMU A;  4AWQ A;  2QM8 A;  1NHJ A;  1UYE A;  5CF0 A;  3KE6 A;  4MPE A;  4HYP A;  4PRX A;  2XDX A;  4QPK A;  5BOC A;  4DUH A;  2BYI A;  4L8Z A;  4BAE A;  3R4M A;  2QF6 A;  4MB9 A;  2CG9 A;  5C93 A;  2WI7 A;  4GEE A;  4FCP A;  4EGH A;  1BXD A;  2ZKJ A;  4CWS A;  3CRK A;  2IOQ A;  4JYC A;  1Z5A A;  4CWN A;  2LFS A;  4MP7 A;  1ID0 A;  3RLR A;  4PL9 A;  3ZCC A;  2PNR A;  3CGY A;  4KTN A;  4P8O A;  1JM6 A;  2IWS A;  2YE3 A;  5D7C A;  4XCL A;  2WI1 A;  3ZRW A;  4B6C A;  1ZWH A;  3BM9 A;  4YKX A;  4ASF A;  4BXI A;  4XC0 A;  3CRL A;  4EGI A;  4HY1 A;  4KQV A;  3EHH A;  2VCJ A;  4PRV A;  4GT8 A;  2BYH A;  3H4L A;  2YE8 A;  3O0I A;  2Q8H A;  4PU9 A;  4BIZ A;  1YER A;  2JKI A;  4LWE A;  3ZKB A;  2WI3 A;  2YEC A;  4XD8 A;  2BRE A;  3NXS A;  1TBW A;  2VCI A;  4WUB A;  4YKT A;  4URL A;  2XHR A;  4LWF A;  4LWH A;  3CGZ A;  4BIU A;  3T0Z A;  1H7S A;  2WEQ A;  2WER A;  2YE7 A;  2VWC A;  5GGZ A;  3TK1 A;  1Y4U A;  1B62 A;  3B25 A;  3K99 A;  2H55 A;  4H81 A;  1Y8N A;  2HKJ A;  2BSM A;  2E0A A;  4JAU A;  2BZ5 A;  4I3H A;  2YKE A;  4V25 A;  4L93 A;  1GJV A;  3R4O A;  1AM1 A;  5FWK A;  3ZRX A;  2Q8I A;  5M4P A;  1UY9 A;  1KIJ A;  3A0R A;  5L3J A;  2XHT A;  3K98 A;  2YEE A;  2QFO A;  4YKW A;  4XIQ A;  4L91 A;  4R3A A;  2JJC A;  2YGA A;  2XD6 A;  3K60 A;  4EM7 A;  3T1K A;  3GIE A;  4KFG A;  4QPJ A;  3SL2 A;  4JYB A;  2UWD A;  1PVG A;  1I5A A;  5CTX A;  4MT8 A;  3R4P A;  4B7P A;  4FPP A;  2EXL A;  4XKA A;  3TZ4 A;  4HXZ A;  4HZ0 A;  1UY8 A;  4LWI A;  1Y4S A;  4E02 A;  1TID A;  2XX4 A;  3MNR P;  4YKZ A;  5D6Q A;  4AWP A;  3B27 A;  2XDK A;  2CCT A;  1H7U A;  3TZ2 A;  1U0Z A;  3IED A;  3GIG B;  2ZDY A;  3H80 A;  1UYK A;  4MPN A;  3VHC A;  3FV5 A;  3ZRW B;  3EHF A;  3RKZ A;  4I5S A;  4CWT A;  1YSZ A;  2YEI A;  1Z59 A;  1UYD A;  4GQT A;  3T0H A;  2VW5 A;  4JAV A;  5D6P A;  1NHH A;  4URM A;  2BU7 A;  3WQ9 A;  3B24 A;  2YGF A;  3HZ1 A;  3ZRV A;  3HYZ A;  1MX0 A;  2C2A A;  5M4N A;  4FCQ A;  1YT0 A;  2XDL A;  5M4E A;  4NH7 A;  4E01 A;  3MD0 A;  2GQP A;  1YS3 A;  3VAD A;  1BGQ A;  1F51 A;  2HCH A;  3A0X A;  2WI2 A;  3LNU A;  2QM7 A;  4YKY A;  4U7N A;  3BMY A;  1ZXN A;  2K5B A;  1ZXM A;  5IN9 A;  1YET A;  4P7A A;  2XAB A;  4H85 A;  4XDM A;  3EKR A;  2YK2 A;  2IOP A;  4O04 A;  1UY7 A;  4XIT A;  4ASG A;  3B28 A;  4XCJ A;  1TC0 A;  4X9L A;  1TIL A;  3CWV A;  5IDM A;  1BKN A;  4CWO A;  2AKP A;  1GKX A;  1THN A;  2WEP A;  3R4N A;  4LP0 A;  1Y8O A;  1EI1 A;  1TH8 A;  4EFT A;  2YK9 A;  2LFR A;  1I5D A;  5F5R A;  2IOR A;  3ZM7 A;  3A0W A;  3GIF A;  3Q5K A;  2FXS A;  3ZXQ A;  2IWU A;  2YI7 A;  2FTK A;  4YKU A;  1I58 A;  3LPS A;  2BRC A;  5J71 A;  4NH8 A;  4HYM A;  3G75 A;  1EA6 A;  2YI0 A;  2XJJ A;  2BU2 A;  4KSG A;  2Q2E B;  5J6A A;  4XIP A;  3JZ3 A;  1BYQ A;  1QYE A;  2YI6 A;  4V26 A;  2O1V A;  1AH6 A;  3QTF A;  5D7R A;  2XX5 A;  2WWW A;  3VHA A;  2XCM A;  1QZR A;  4URO A;  2YKC A;  4CWQ A;  1YES A;  5M4K A;  3EKO A;  3Q5L A;  2QG2 A;  2Q8G A;  4MBC A;  3OPD A;  3QDD A;  2YEG A;  4FMT A;  2YJX A;  2YE2 A;  3R92 A;  2XX2 A;  2YE6 A;  2FWY A;  1S14 A;  1OSF A;  4CE1 A;  1JOY A;  1UYH A;  4ZVI A;  5F3K A;  2YI5 A;  4L90 A;  2ESA A;  4MP2 A;  1UYC A;  4MOT A;  1YC1 A;  1YT2 A;  5CTW A;  3GIG A;  4K4O A;  5CTY A;  2BU6 A;  4EFU A;  3O6O A;  4LPB A;  4ASA A;  2YE4 A;  3HEK A;  4R3M A;  1TC6 A;  4ASB A;  3EHJ A;  2WI5 A;  2ZDX A;  4AS9 A;  3K97 A;  1US7 A;  4EEH A;  1R62 A;  1Z5B A;  2GFD A;  3D36 A;  2XK2 A;  4CWF A;  2FYP A;  3B26 A;  5M4H A;  4O05 A;  5FNF A;  2YEA A;  2XJX A;  4CE2 A;  3A0Y A;  2YKB A;  1U2O A;  4LWG A;  1MU5 A;  4YKQ A;  3U2D A;  1B63 A;  4KP4 A;  2BU5 A;  3HHU A;  1UY6 A;  1Z5C A;  3OWD A;  2XDU A;  1YC3 A;  4MPC A;  4YKR A;  3TZ0 A;  4CWR A;  4MTX A;  3ZKD A;  4EGK A;  4U93 A;  5IDJ A;  2QG0 A;  1AMW A;  5CTU A;  4WUC A;  2YEJ A;  3D0B A;  4URN A;  2YE5 A;  4W7T A;  1KZN A;  5M4M A;  1B3Q A;  2CH4 A;  3PEH A;  3INW A;  1I59 A;  4XKK A;  4GGL A;  4XKO A;  1YSR A;  3U2K A;  2Q8F A;  2YJW A;  3U67 A;  4HY6 A;  2YED A;  4WUD A;  2BTZ A;  3TUH A;  1GKZ A;  3FT8 A;  2O1U A;  2CCU A;  3C11 A;  4L94 A;  4GFN A;  3OW6 A;  1YC4 A;  3FT5 A;  4EMV A;  1UYF A;  1UYG A;  3PEJ A;  3A0Z A;  1NHI A;  2FWZ A;  2XHX A;  1AJ6 A;  1A4H A;  4FCR A;  4E00 A;  4BQG A;  4JAS A;  4GT1 A;  2O1W A;  2ZBK B;  3TZ5 A;  4XIR A;  4DZY A;  1Y8P A;  4JQL A;  2WI6 A;  2YE9 A;  5CPH A;  2YEH A;  2YKI A;  5D7D A;  4XE2 A;  4CE3 A;  3G7E A;  2XDS A;  1QY8 A;  4ZKI A;  4GCZ A;  2BT0 A;  3RLQ A; 
#chains in the Genus database with same CATH topology
 3ICX A;  3U0Z A;  5DEC A;  1I5B A;  3Q5J A;  4O09 A;  3AG2 C;  4DV0 O;  1Q81 W;  3AG4 C;  5EBM C;  3ZIA G;  2DMX A;  1SQX H;  4R7C A;  2PYL A;  1SS3 A;  1VQO V;  3GWK C;  2ZNJ A;  4U7O A;  2QWP B;  3LSU A;  3M99 B;  4CS2 A;  2YGE A;  1AI5 A;  4HZ5 A;  2EJ7 A;  2VQF B;  3CRM A;  1M9N A;  5LMU B;  3BEH A;  2XAF A;  2IWX A;  2ZR3 A;  4Q20 A;  3OTF A;  3VHD A;  2ZDI A;  3OWB A;  4X1I B;  2PI5 A;  4X89 A;  4B3T O;  3EHG A;  3BA9 A;  1L0L H;  1UYI A;  2WPD G;  3T4Z A;  1L0O A;  3QVN A;  1XL4 A;  2QE7 G;  1XI1 A;  1SA0 A;  1VQ9 V;  4K8Z A;  1TUE B;  2R70 A;  4YIP A;  1CP9 A;  1GMG A;  2Q6A A;  3R91 A;  2Y69 C;  4NTW A;  4F4L A;  2GTA A;  4IGG A;  1GK9 A;  4AWQ A;  4Z2W A;  5HFL A;  3OM3 B;  3SPJ A;  4YHH B;  5CF0 A;  3KE6 A;  4X1K B;  4K3A A;  4PA7 A;  4BW9 A;  1BHB A;  4NTX A;  5JEN A;  5CMU A;  5BOC A;  3G6E V;  1WP7 A;  3DSQ A;  2YXY A;  3ZHU A;  2BOB C;  1ORQ C;  2BYI A;  1TGO A;  2Y4U A;  3R4M A;  5C93 A;  2BTQ A;  2LJ2 A;  4DO2 A;  4DR6 B;  1XDC A;  4JYC A;  3R66 A;  2N04 A;  3L70 H;  4W4L A;  3UQ8 A;  2ZQM A;  2E75 B;  4EEQ A;  1NVP B;  2CTQ A;  2L35 A;  4PL9 A;  2WAM A;  1JM6 A;  2IWS A;  1RSO B;  2KQX A;  4BR6 A;  4XCL A;  1NBM G;  4B6C A;  2N05 A;  1YJ9 V;  1D2D A;  3CRL A;  2YIB D;  4KQV A;  2DJV A;  3O0I A;  4PU9 A;  3JAK A;  4LWE A;  1HNW B;  2WI3 A;  4ZOL A;  1KC8 W;  2YEC A;  2GHY A;  3K59 A;  4YKT A;  1S0V A;  2XHR A;  4LWF A;  4BIU A;  3T0Z A;  4D6T H;  1MNG A;  4W4K A;  5GGZ A;  4YY3 B;  4ZI7 B;  1B62 A;  1ARO P;  3WB0 A;  4DR3 O;  2YSU B;  4DXW A;  2E0A A;  4JAU A;  3K04 A;  2YKE A;  1GN6 A;  2A0L A;  4UVA A;  3RW0 A;  1W2B U;  1K9M W;  3R4O A;  1NJI W;  1TAE A;  1VF6 C;  2DE0 X;  3JCZ A;  3ZRX A;  2Q8I A;  1Y76 A;  4J7K A;  3OW2 U;  3L73 H;  3STZ C;  2XHT A;  3OUS A;  2Y0I A;  2EUL A;  1QBZ A;  4YKW A;  2QGN A;  2KKW A;  3E35 A;  3WFV A;  3STL C;  3JAS B;  4B7E A;  2F43 G;  3T1K A;  2WA3 A;  2C1I A;  3FB8 C;  2UWD A;  1PVG A;  3VOU A;  2VRZ A;  4PA4 A;  1T5E A;  2IJJ A;  4F6R B;  4UCV A;  4QNH B;  3C3T A;  5KUM A;  1OCR C;  3ZHR A;  1TID A;  3MNR P;  1SA0 B;  4PDM A;  4AWP A;  3U11 A;  1S5L Z;  3F7Y C;  3B27 A;  3IC7 A;  1NS1 A;  3TET A;  3TZ2 A;  4X66 B;  3VQX A;  2ZDY A;  3P30 A;  4RQE A;  3FV5 A;  3E86 A;  1KU9 A;  2LW1 A;  1VQ7 V;  4DR1 O;  1JX9 A;  2IU3 A;  3L72 H;  1RP3 B;  1GN4 A;  3X2Q C;  5CB4 B;  3RKZ A;  1Y66 A;  1XOU A;  2DQ0 A;  4I5S A;  4DK1 A;  3W7S A;  4CWT A;  4HNA B;  1K3E A;  1UYD A;  2N74 A;  2XAG A;  4UB8 Z;  4YXW G;  3RYH B;  4WFH A;  2AHY A;  3WQ9 A;  3D36 C;  3W7T A;  2K9P A;  1WA8 A;  4B7K A;  2D3O W;  3F5W C;  4LF4 O;  5M4E A;  2M6Y A;  4PDR A;  4PJ0 Z;  1JMK C;  2RQ6 A;  1YS3 A;  3FB7 C;  1FYJ A;  3SYC A;  3RN4 A;  4JF3 A;  5K1X A;  2DYR C;  3RYI A;  2XAB A;  4H85 A;  3ZMZ A;  4O2B B;  1I94 B;  4TUY B;  3VQV A;  4JI3 B;  4XIT A;  4ASG A;  1TIL A;  3AK3 A;  3CWV A;  3QF7 A;  3BA8 A;  2C1G A;  4ZOL B;  2HHI A;  4FLZ A;  1THN A;  4JYA O;  4DRX A;  2WEP A;  3R4N A;  4LP0 A;  4O4I A;  1YHQ V;  2JS5 A;  2YK9 A;  2QJ1 A;  5LMU O;  1V55 C;  4EFE A;  5JQG A;  2XND G;  1OCC B;  2LFR A;  5ITZ A;  4LF7 O;  3ZM7 A;  2RMK B;  5LP6 B;  1PL0 A;  1I5Y A;  1U96 A;  4I9Q A;  3LSS A;  4OGQ B;  3Q5K A;  2ITC C;  3B8N A;  2FXS A;  4WFE A;  3BAA A;  3KZI Z;  1FD9 A;  2YI7 A;  3ZXQ A;  1HR0 B;  2FTK A;  3EFF K;  2UXC B;  3CB2 A;  4IHJ B;  4LF6 O;  5A2Q N;  4UCU A;  3X2Q B;  2UXC O;  1EA6 A;  2XJJ A;  4UXN A;  2BU2 A;  3ETG A;  5EIB D;  4KSG A;  4FLY A;  5J6A A;  1H8E G;  4MTF A;  4PA9 A;  3AG1 B;  3PN1 A;  4ABM A;  3OAA G;  4TSF G;  4URO A;  2YKC A;  3UO2 A;  1AB3 A;  2BOC C;  3FB6 C;  3MAQ A;  1SQV H;  1Y4M A;  3OPD A;  4LR3 A;  2F4V O;  3LDD A;  3OMN B;  5H6R A;  2YEG A;  2YJX A;  1GKF A;  4BIO A;  3R92 A;  1YJN V;  3AK1 A;  1K5S A;  4RUE A;  4D7T A;  2YE6 A;  4UCS A;  3J7A U;  2XAS A;  2DN9 A;  1MZE A;  1SZT A;  3E8H A;  2XAH A;  5KA6 A;  1JOY A;  1UYH A;  3M7M X;  1JJO A;  4ZVI A;  5CA1 A;  3L75 H;  4QE9 A;  4MP2 A;  1NR1 A;  1YT2 A;  1HNZ O;  5CTW A;  2PF4 E;  4H37 A;  2EIK C;  3O6O A;  4U3J B;  4C7U A;  4DV3 B;  3SPG A;  2JVD A;  4LF4 B;  2YE4 A;  2Q4P A;  1DK1 A;  1TC6 A;  2AHZ A;  4DR7 O;  4EFB A;  5KAF Z;  3Q4H B;  3TGU H;  1XBL A;  2JJ2 G;  2R72 A;  3K97 A;  1WJZ A;  1US7 A;  2XAJ A;  4DR2 B;  1LR1 A;  3RGB A;  3OD4 A;  2HP8 A;  4L87 A;  3OGC C;  2QKC A;  1K92 A;  1P4R A;  4X65 O;  5M4H A;  4O05 A;  1AJQ A;  4UCO A;  4GLX A;  1ZL8 A;  2YKB A;  2CTP A;  1NH2 D;  4YKQ A;  4GKJ O;  3U2D A;  4Z1V A;  1B63 A;  2BU5 A;  5KUK A;  4UFZ A;  3OWD A;  3IFX A;  3QO7 A;  4MPC A;  4MTX A;  1RSO A;  2EIJ C;  1V9P A;  4EGK A;  4U93 A;  5IDJ A;  2YEJ A;  3D0B A;  1UPG A;  5DED A;  4MTO A;  4LP8 A;  4LF8 B;  2YE5 A;  4KHP B;  5IE9 A;  1KZN A;  5M4M A;  1MMM A;  2IJK A;  2BTQ B;  1I59 A;  4LF6 B;  4R50 A;  3SYA A;  5HFM A;  5LMN B;  4K0K O;  1L8D A;  5L3G A;  4JTA B;  1SQP H;  1YSR A;  5LOV A;  3FFQ A;  1HW7 A;  2Q8F A;  3KG2 A;  1N0N A;  5LP6 A;  1R6N A;  1HP8 A;  4WUD A;  3TCU A;  2CTR A;  2CCU A;  3CCS V;  1H2G A;  2CTW A;  3CYO A;  4B08 A;  1YC4 A;  3FT5 A;  4EMV A;  3VQW A;  1AJ6 A;  1A4H A;  2AW9 A;  4E00 A;  1H2L A;  2HG5 C;  1SQQ H;  2ZBK B;  4H0L B;  3BRC A;  4UVB A;  4JYY A;  5JCO A;  1ROP A;  4H44 B;  5CPH A;  1W59 A;  4B3R O;  4RQF A;  1DF5 A;  4XE2 A;  1OHH G;  1S72 V;  4CE3 A;  4CZZ A;  3UCS C;  1M90 W;  4ZKI A;  1IDS A;  4JI4 O;  4GCZ A;  3M8A A;  1QR8 A;  1QLE C;  2P4K A;  1E1Q G;  1FKA O;  3INX A;  5GTI Z;  3K0D A;  1K73 W;  2V7Q G;  3HYY A;  3A0T A;  2G38 A;  1OCZ B;  2DYR B;  2YEF A;  1VF5 B;  1YIJ V;  1PNL A;  1B04 A;  3B40 A;  2P67 A;  2V4D A;  2F93 B;  3RBZ A;  2LP7 A;  2UXD O;  1BS3 A;  3CC2 V;  1UYL A;  5CB4 A;  3GB7 C;  4U3J A;  2YXL A;  3JD0 A;  1NU1 H;  3E83 A;  4GUN A;  3CCU V;  4GKJ B;  4O0B A;  3O2F A;  2MK3 A;  1N4C A;  4DV6 O;  3TTZ A;  3ZRS A;  4X64 B;  3ZMV A;  3C0E A;  4CS4 A;  1Q6U A;  1R73 A;  3KCX A;  4FM0 A;  1N0J A;  2XJG A;  3RYC A;  3W7X A;  1ZX3 A;  4I50 B;  5EBW C;  2FML A;  2ZR2 A;  1I5C A;  4AWO A;  3T2S A;  1Q82 W;  1QNM A;  4LF7 B;  4GX0 A;  3WHA A;  2UXB B;  1RM1 C;  2Q8V A;  4NH9 A;  3CMA V;  1FS0 G;  1H8H G;  1FFX A;  2QM8 A;  1NHJ A;  3FYI B;  4OXS A;  2IJI A;  4MPE A;  1SES A;  2X6B A;  1XRE A;  3DC6 A;  5LHI A;  2GUZ B;  3S5T A;  1EN5 A;  4EKW A;  4X62 O;  4X1Y B;  4TV9 B;  2EIL B;  3BY6 A;  2UU9 O;  4KUM A;  1QLN A;  2WLI A;  4LH6 A;  1HR0 O;  4OX9 O;  4MB9 A;  4BAE A;  4EGH A;  2BSK A;  2ZKJ A;  2OCC B;  3ZED A;  2WLJ A;  4TQD A;  2VQE B;  4PDV A;  4MS2 A;  1J5E B;  3JD3 A;  1Z5A A;  4MSW C;  5CBG A;  1I08 A;  4P9O A;  4MP7 A;  1UFI A;  2H3O A;  3ZCC A;  1KP3 A;  2PNR A;  2YE3 A;  2ARH A;  2WI1 A;  3ZRW A;  1KKC A;  3BM9 A;  3QNE A;  1KB9 F;  3JAS A;  4XC0 A;  4HBN A;  3E89 A;  2FYU H;  4HY1 A;  3HKD A;  5EZY B;  3B8M A;  4EB6 B;  3JAK B;  2Q7H A;  1BHA A;  4WFA V;  2BYH A;  2Q8H A;  4J10 A;  1IBL B;  1YER A;  2JKI A;  5CA1 B;  1CPY A;  1MOF A;  1O9G A;  4DV6 B;  1GN3 A;  3ZKB A;  2ZXW C;  1AI7 A;  2GBO A;  3NXS A;  4WUB A;  2ILM A;  4LWH A;  5LHG A;  4YJ2 B;  3G67 A;  3N2G A;  3G80 A;  3CGZ A;  4I55 A;  2WER A;  2RNB A;  1FXK B;  3TK1 A;  5L3B A;  3K99 A;  1JVM A;  3A0B Z;  4DK0 A;  4H81 A;  1N36 B;  1COW G;  3UM7 A;  2HKJ A;  4RUF A;  1EZV H;  3OEH G;  5FPR A;  2GSM B;  2JGD B;  4V25 A;  2B9Z A;  2FB5 A;  3AG2 B;  4HZ3 A;  3ETD A;  5M4P A;  4JI7 B;  1UY9 A;  4AQY B;  2DQ3 A;  2Q0A A;  1XHX A;  3SDL A;  5L3J A;  3LNM B;  4NB5 A;  4DW1 A;  3ETQ A;  4FFB A;  1VP7 A;  4L91 A;  3CCE V;  4R3A A;  1MAB G;  1QR9 A;  4ZI7 A;  4X66 O;  2XD6 A;  3K57 A;  1PKX A;  3JAW A;  4KFG A;  2NNU A;  4DR5 B;  4QPJ A;  1FXK C;  4JYB A;  1NTM H;  1S5J A;  5CTX A;  4X1K A;  4E72 A;  4B7P A;  4JZ2 A;  5CA0 B;  4XKA A;  3TZ4 A;  1Y4S A;  4E02 A;  5H2F Z;  1MSW D;  1ZSP A;  5D6Q A;  3OTO O;  1CEZ A;  2YI8 A;  1H7U A;  4K35 A;  3BAB A;  3H80 A;  3R65 A;  1NI8 A;  1NTK H;  3L71 H;  4MPN A;  3VHC A;  1MA1 A;  4RWU A;  5EC1 C;  3ZMT A;  2VQE O;  1YSZ A;  4GX1 A;  5KHH A;  4ZHQ A;  3K58 A;  2HJD A;  1JR9 A;  1EN4 A;  4ZIB A;  2W6I G;  3LSQ A;  5IJ0 B;  2E3C A;  1NHH A;  1BCC H;  4URM A;  2BU7 A;  1SQG A;  3ZRV A;  2YGF A;  1SQF A;  1AP6 A;  4IHJ A;  1MX0 A;  2C2A A;  4LNU A;  4FCQ A;  3SYO A;  1KBH A;  4G2K A;  4CH5 A;  2GQP A;  4TWK A;  1BGQ A;  1F51 A;  1R6K A;  2WI2 A;  3K79 A;  2LGQ A;  3HKE B;  5FNV B;  1JA8 A;  2XTA A;  3LNU A;  2D2C B;  4XBF A;  1ZAU A;  2ITD C;  1GRJ A;  4FIP C;  3T1Y B;  3L74 H;  4X88 A;  1ZXN A;  3WB1 A;  1ZXM A;  4X65 B;  5F2V O;  4AQY O;  3E8G A;  1PNK A;  1G1X B;  5CBF A;  3B4S A;  1WAZ A;  3EKR A;  1Y74 B;  3SPC A;  2YK2 A;  2BE3 A;  2CDY A;  4O2B A;  4XCJ A;  4JI6 O;  2EIN B;  4YHH O;  5EK0 A;  1Y6X A;  5LBQ A;  4EFT A;  5B5E Z;  1AR1 B;  1I5D A;  5F5R A;  2HKO A;  3AG3 B;  2XHB A;  2OT5 A;  3ABL B;  2IOR A;  4N21 A;  1KQS U;  5IYC O;  4JTD B;  4YKU A;  3LPS A;  1MSD A;  5J71 A;  5GW7 A;  3BHP A;  5IY5 B;  5LMN O;  4NH8 A;  3G75 A;  4N23 A;  4XIP A;  4KFM A;  3DTU B;  1BYQ A;  1QYE A;  4V26 A;  2JDI G;  4X20 A;  2YIC A;  5J2T B;  1H38 A;  2QWO B;  4NR1 A;  5C8Y A;  3EVK A;  3IGA C;  2ZM6 O;  4JAA A;  2OCC C;  4O4J A;  5M4K A;  2ZDI C;  3QTC A;  3CCJ V;  3NR7 A;  3K5L A;  1K33 A;  3T4D A;  3CC7 V;  1WNS A;  4NTY A;  1IVS A;  2FWY A;  3ASN C;  3OTO B;  3W7W A;  3AG1 C;  4D7S A;  5IT9 N;  1M5I A;  4L90 A;  5EBL C;  1UYC A;  4MOT A;  4UVC A;  1YC1 A;  1IX9 A;  4DV5 B;  5A9G A;  4DYL A;  1QVG U;  2BU6 A;  4J9Z B;  2Q9L A;  4AIL C;  1N34 B;  1AP5 A;  1J5E O;  3HKC B;  2YXH A;  1K8A W;  1FJG O;  1THZ A;  3JSL A;  2M7W A;  4ASB A;  2P06 A;  1BL8 A;  2JJ1 G;  2E5L O;  4LFC O;  3K0G A;  2WI5 A;  2ZDX A;  3JAR B;  1R62 A;  4MVZ A;  3AG3 C;  3H1L H;  2GFD A;  3LDC A;  2ZKO A;  3B26 A;  1DLB A;  2UUC B;  1MZF A;  4DV4 O;  1N34 O;  1VQ4 V;  3JD4 A;  2QSA A;  5IYD O;  5H9C A;  4K8X A;  1Z5C A;  1I7F A;  3TZ0 A;  1K4C C;  4I4T B;  2F66 C;  3H9V A;  3OR6 C;  1R3L C;  3JAL A;  4HYO A;  2ADP A;  4U3F H;  1TVK B;  4XDK A;  1SQB H;  3ZX6 A;  5BXZ A;  5CTU A;  4WUC A;  4URN A;  4ZBM A;  4W7T A;  3EHB B;  3UKM A;  1G6U A;  2X7R B;  5AG2 A;  1YSC A;  4GGL A;  1HNX O;  3ABL C;  1JFF B;  2UXN A;  3JCU Z;  3U2K A;  5L3F A;  1LNQ A;  1FFX B;  3QG5 A;  3U67 A;  1SET A;  2EBO A;  2W0X A;  2BTZ A;  2LGW A;  3C11 A;  4L94 A;  5LHH A;  3JAL B;  4FLU A;  3S3W A;  1BT8 A;  1WPX A;  5J2U B;  4X1Y A;  1Z5V A;  2JEX A;  2ZXW B;  4CC5 A;  1F4M A;  4FCR A;  1VF6 A;  1SZX A;  4JAS A;  3CD6 V;  4KL1 A;  1YCI A;  5C8Y B;  1FXH A;  2F95 B;  1VIB A;  1Y8P A;  4JQL A;  2WI6 A;  2E5L B;  4YIO A;  4NXM O;  4R8C A;  1XL6 A;  1W0K G;  1URF A;  1DTO A;  1K34 A;  3DXR A;  2P5O A;  2YEV B;  1S77 D;  2BT0 A;  3JAT A;  2QKS A;  3DGE A;  3RYF B;  4R1F A;  2L6L A;  3I5D A;  4PA6 A;  1AJN A;  1R6T A;  2QWR B;  5IWA B;  1ENV A;  1N36 O;  5BR8 O;  4DR7 B;  4NXN O;  1IXM A;  2CAZ C;  2CGF A;  1BQZ A;  3E8B A;  3OEE G;  3ZN1 A;  3T10 A;  1B06 A;  4I7Z B;  4H7Q A;  3RVZ A;  3J80 N;  3CSX A;  5JCO C;  3TXS A;  4YY3 O;  1JPX A;  4QIW F;  3CP1 A;  2P6J A;  3G7B A;  4I55 B;  4XTJ A;  5KA5 A;  1BQ0 A;  1IBL O;  1ZW9 A;  2OIG A;  1HNW O;  2CCS A;  1SF9 A;  3HKB B;  2BU8 A;  1XMQ O;  5FND A;  1OCZ C;  1UYM A;  1FFT B;  4KSH A;  4JZG A;  4JI0 B;  2WI4 A;  4LWS A;  4EB6 A;  2F1M A;  2KG7 A;  3CCV V;  3NMQ A;  3CPW U;  5KHG A;  3DXR B;  4O07 A;  2UXB O;  3ZJZ A;  2X0L A;  3N27 A;  3KCY A;  4X9Q A;  4LFB O;  4JI7 O;  5IYB O;  1QHT A;  2LO1 A;  1HWY A;  2XUM A;  4H33 A;  5JJJ B;  5GON A;  3C3S A;  5BMV B;  4QPK A;  3VBB A;  1N33 B;  2P4V A;  4DUH A;  3CEI A;  4KHP O;  3O9O A;  5LL6 Y;  2CGO A;  2HHH B;  1Q86 W;  3THO A;  4L8Z A;  4TV9 A;  4YJ3 B;  3ASN B;  2CG9 A;  2QF6 A;  2WI7 A;  1KEC A;  2DYS C;  4GEE A;  3A0H Z;  1XNR O;  1BXD A;  4P9P A;  4CWS A;  3CRK A;  5LGU A;  4WFB V;  3HPL C;  1Q3E A;  4CWN A;  3E22 A;  2LFS A;  4JTC B;  2KB1 A;  1YTF B;  3I56 V;  1ID0 A;  3RLR A;  5J9P C;  4UV8 A;  3ZMS A;  3CGY A;  4KTN A;  3K08 A;  5D7C A;  5E1A C;  5CBH A;  4B3R B;  2Q68 A;  4ASF A;  4O2A B;  5LXT B;  1P49 A;  4XDJ A;  3Q4H A;  4OX9 B;  2XAQ A;  4EGI A;  2PUS A;  3JSN A;  4I50 A;  2UUA O;  3APO A;  4AI8 A;  4GT8 A;  3H4L A;  2HLD G;  2PI4 A;  2YE8 A;  1PL4 A;  2Y4T A;  4YJ3 A;  4LFC B;  4XD8 A;  3AG4 B;  4QGP A;  3N2G B;  1TBW A;  2VCI A;  4DRX B;  1XHZ A;  1KMI Z;  3B77 A;  1H7S A;  3TXQ A;  4DV5 O;  2WEQ A;  2YE7 A;  4MTG A;  1YZB A;  1Y4U A;  4DUZ O;  3B25 A;  3OMI B;  3G6B A;  2UUC O;  2VS0 A;  1Y8N A;  1WB7 A;  2EIM B;  2BSM A;  5EYP A;  2RJZ A;  2BTO A;  3JAR A;  4J7Z A;  3QO8 A;  2BZ5 A;  4I3H A;  4MVM A;  2X6C A;  4L93 A;  4PHZ A;  1GJV A;  5L3D A;  5D5Q A;  1AM1 A;  2CH7 B;  4OPA A;  5LGN A;  2B1I A;  3FYE B;  1KIJ A;  4LF9 O;  3A0R A;  1F4N A;  3K98 A;  4WFG A;  1BMF G;  2QFO A;  2DWE C;  3L9D A;  3HR0 A;  1XQ8 A;  2JJC A;  2YGA A;  1R1B A;  3H1I H;  3K60 A;  4EM7 A;  2LQT A;  5KX5 A;  1VF7 A;  4JI2 O;  2O57 A;  2HVJ C;  1I5A A;  1XMO B;  4MT8 A;  2PGG A;  2OIE A;  1ZWI C;  3OUF A;  1RFY A;  4GX2 A;  4HZ0 A;  1UY8 A;  4LWI A;  4CS3 A;  4DV1 O;  2HEP A;  1TUB A;  2XDK A;  2CCT A;  5LA6 B;  4FLW A;  2B1G A;  2R9A A;  1Q43 A;  2KSD A;  2UUB B;  3RFR A;  1P7B A;  4RO2 A;  4IYH A;  2GV9 A;  1NVP D;  1BGY H;  3CXC U;  3T1H B;  2A06 H;  3EHF A;  3SPI A;  3CC4 V;  4AHC A;  4WBN A;  1GM7 A;  1IZ3 A;  1PNM A;  4LF5 B;  1M57 C;  3GVM A;  2JGD A;  2YEI A;  3BPZ A;  1GM9 A;  5IYZ B;  4FZ0 A;  4JI5 O;  4GQT A;  3T0H A;  2VW5 A;  3AK2 A;  4TUY A;  3ETE A;  1P84 F;  2HHH O;  4ASU G;  2WSS G;  1BE3 H;  2ADQ B;  5JJN B;  3HYZ A;  2Y69 B;  1OCR B;  4BWA A;  5M4N A;  1YT0 A;  2XDL A;  1WP8 A;  4WFF A;  4Z1M G;  4DV7 O;  1YTF D;  4NH7 A;  3MD0 A;  4E01 A;  2EIL C;  5CA3 A;  1QLE B;  4CH4 A;  1WB8 A;  4DR4 B;  4DV7 B;  2R9I A;  3SJC C;  1FJG B;  1GM8 A;  2EX3 A;  1QVF U;  4JI6 B;  4MW8 A;  4LBE C;  3LDE A;  1JJ2 U;  4YKY A;  3ABM C;  1TVK A;  3FD9 A;  5CA0 A;  4U7N A;  2Q69 A;  2PY5 A;  4IT5 A;  4ZHQ B;  2IU0 A;  4DR2 O;  1YET A;  2WA4 A;  1A32 A;  5B3S B;  1Q7Y W;  1IBK O;  3CJH A;  4TV8 B;  4O4L B;  4B3S B;  2IOP A;  3SYP A;  5BY1 A;  5IWA O;  1K97 A;  4LNU B;  4PDL A;  4DR3 B;  1K7D A;  1VQL V;  4X9L A;  4JGS A;  4BAY A;  3MHS C;  4B3T B;  2IH1 C;  4X20 B;  1BKN A;  4CWO A;  2RN9 A;  2AKP A;  2Q5Z A;  1GKX A;  1Y8O A;  1X59 A;  2BSK B;  4UV9 A;  3MDS A;  3KKY A;  1W0J G;  1WN7 A;  3WU2 Z;  1JQ0 A;  2RDC A;  3D3I A;  5EYP B;  1EBO A;  4J42 A;  4FM1 A;  2ETN A;  5JH7 B;  4IYI A;  1GTO A;  4F6R A;  1R3K C;  4I0X A;  5IJ0 A;  1Y74 A;  4MVR A;  1KYO F;  1H2S B;  4G28 B;  2YI0 A;  2YID A;  4JI2 B;  4O4L A;  1OJH A;  2Q2E B;  5FPO A;  3JZ3 A;  1RPO A;  5LA6 A;  3SJB C;  2CH7 A;  2YI6 A;  2AXT Z;  4OPH A;  1AH6 A;  1S5H C;  3HKE A;  5FNV A;  3QTF A;  2XX5 A;  2WWW A;  5D7R A;  2XCM A;  1QZR A;  4X1I A;  4CWQ A;  5LOV B;  1GN2 A;  1YES A;  3SGI A;  3EKO A;  3Q5L A;  3P3N A;  3RYF A;  4JI4 B;  3QDD A;  2EIM C;  4K0K B;  3ZHT A;  3HKC A;  4FMT A;  2YE2 A;  5BMV A;  4J9Y B;  3OE7 G;  1XNR B;  5FLX N;  1S14 A;  1OSF A;  2YS8 A;  3S3X A;  1YXB A;  3ABM B;  4NXN B;  4JI5 B;  2ZIN A;  1D5A A;  5KMG A;  1IBM O;  1WLE A;  1VAR A;  1SER A;  4YJ2 A;  5F3K A;  2YI5 A;  2ESA A;  1NTZ H;  2OCH A;  2KG7 B;  3F7V C;  3CCR V;  4A5U B;  3FAV A;  2CUG A;  4DV3 O;  4EFU A;  3CRA A;  2EIJ B;  2H94 A;  4TT3 G;  4LPB A;  4ASA A;  5KAI Z;  3RYI B;  3CWB H;  2OTJ V;  3EHJ A;  3ABT A;  4AS9 A;  2WLL A;  4XDL A;  3K9A A;  4EEH A;  1WPB A;  3G4S V;  5DM6 V;  4P2Z A;  3BFR A;  2ZE7 A;  1I0H A;  2QM4 A;  3K06 A;  3APQ A;  2QWN B;  3JD2 A;  5FNF A;  4B3S O;  2OWO A;  2XJX A;  4CE2 A;  1VQN V;  1NH2 B;  4PV1 B;  4LWG A;  2P7T C;  1MU5 A;  1X4T A;  4PA3 A;  4KP4 A;  3HHU A;  1UY6 A;  5JQG B;  5GTH Z;  2NLJ C;  3B09 A;  2XDU A;  4UCT A;  4O2A A;  5LXT A;  4YKR A;  5LYJ A;  2ATK C;  1SRY A;  4LCU C;  1N32 B;  3ZKD A;  4JI0 O;  2YC0 A;  2QG0 A;  4DV1 B;  4CH6 A;  4GX5 A;  1R3J C;  1N33 O;  2HVK C;  3CRQ A;  2K1E A;  1CXZ B;  5H5N A;  3UT5 A;  2VWJ A;  2CH4 A;  1AR5 A;  3PEH A;  2QA4 V;  1JFF A;  2Y0P A;  2Z3Y A;  4XKK A;  2EJR A;  4XKO A;  5LP6 C;  1LUW A;  1VQM V;  1G8M A;  2BCC H;  1ZL8 B;  1IUR A;  2JIZ G;  2YJW A;  1K5Q A;  1YJW V;  2YED A;  3WG7 C;  5JVD A;  5JJE B;  4GFN A;  3AEI A;  2JS3 A;  5B1B B;  4MVQ A;  2PZS A;  1UYF A;  1UYG A;  4PI0 A;  3HKD B;  5EZY A;  2XHX A;  2UU9 B;  3CME V;  3RVY A;  2JGU A;  1VQ8 V;  2EZP A;  1AI6 A;  1US6 A;  3B2E E;  5TIS Z;  4BQG A;  3TZ5 A;  1Q6I A;  4XIR A;  1XEQ A;  4PD4 F;  1KUQ A;  5B1A C;  1Y76 B;  4DUY B;  5J2T A;  4NKG B;  3G7E A;  4MVO A;  2XDS A;  3C90 A;  3CCM V;  3RLQ A;  2X6A A;  3A2F A;  5FNC A;  3QO5 A;  1M4U A;  4UB6 Z;  3HZ5 A;  1HNZ B;  4FLT A;  3LMM A;  1YT1 A;  3ABK C;  5BOD A;  2A7W A;  5D5P A;  5B1O A;  2HG1 A;  1PV0 A;  1AH8 A;  2GUZ A;  3RLP A;  4O4H A;  1S16 A;  2A9H A;  3SYQ A;  3IC9 A;  4LC1 A;  1SKV A;  3OGI B;  3ZXO A;  4P30 A;  1AJP A;  3JAM N;  1FPO A;  3P32 A;  2H8M A;  5IJ9 B;  5B1N A;  2CE4 A;  2P90 A;  3D2R A;  4MVU A;  4HXW A;  5JWP A;  4BQJ A;  4CWP A;  5IYZ A;  2WLL B;  3DC5 A;  5KHI A;  1YIT V;  5CN0 A;  1NR7 A;  1O9H A;  2Q73 A;  1OCC C;  5L3E A;  5GON B;  2CK3 G;  2YEB A;  1PD3 A;  3PJS K;  2PYJ A;  1F7Y A;  1TUB B;  3N2K B;  4UUJ C;  2F23 A;  3K5N A;  3K5O A;  4J80 A;  4X62 B;  3F5T A;  2YKJ A;  2EIK B;  5EIB C;  4FFK A;  2Q67 A;  4LH7 A;  3WB2 A;  1M56 C;  3K3W A;  4MW3 A;  2UUB O;  3OMU A;  3EXA A;  4JI8 O;  4DR6 O;  4FJC C;  2GDS A;  1UYE A;  4JI1 O;  1DGS A;  4HYP A;  3K9S A;  4PRX A;  1NT2 B;  3UO3 A;  1F23 A;  1V54 B;  3ASO B;  3P3P A;  4LF9 B;  2XDX A;  3J81 N;  1IBM B;  1VEW A;  4LFA O;  4R6Z A;  4KXR A;  1L1F A;  4FLX A;  2XT9 A;  2ZNI A;  1OV9 A;  2Q7E A;  1M1K W;  1PM9 A;  4GZR B;  2YIA A;  4FCP A;  3K03 A;  2ZE6 A;  1VQK V;  2IOQ A;  3A8T A;  2HR3 A;  3JD1 A;  4NXM B;  1OZ0 A;  2YUA A;  2HJF C;  4P8O A;  2ZM6 B;  1MG1 A;  1ZWH A;  1Q90 D;  4YKX A;  5B1A B;  4I0X B;  4BXI A;  3CXH F;  3CS5 A;  4O4H B;  1YVW A;  3EHH A;  2Q0O C;  2VCJ A;  1JCH A;  4PRV A;  4J41 A;  2DWD C;  2JEU A;  5BR8 B;  1GAX A;  1Y67 A;  4BIZ A;  4BW5 A;  1VQ5 V;  1M93 A;  4LF5 O;  1V55 B;  5LGT A;  4GKK B;  4X64 O;  2BRE A;  1SC5 B;  3MHH C;  4URL A;  3SJQ C;  2A79 B;  1Q6H A;  5B1B C;  5B66 Z;  2YDE A;  3JAW B;  3CYG A;  2VWC A;  5E79 Z;  4JI3 O;  1M56 B;  2AGA A;  1EFR G;  2H55 A;  2XOK G;  2EIN C;  3GWO A;  2EZO A;  3CJH B;  4TV8 A;  4FK5 C;  1P7G A;  2IBZ H;  3CHX A;  3ZS8 C;  4J7J A;  5J2U A;  1N32 O;  2JRI A;  4E2L A;  1XMO O;  1V54 C;  1QQC A;  3ASO C;  5FWK A;  3ZMU A;  1H2K A;  4DV2 O;  3H1H H;  1H2N A;  4F6E A;  3CE2 A;  4JYA B;  1R3I C;  1J95 A;  4WF9 V;  2YEE A;  4CC6 A;  1VMG A;  3K5M A;  3CRR A;  4MVS A;  4XIQ A;  2AZ2 A;  3IJ4 A;  1Q8I A;  1XNQ O;  5JH7 A;  3E2E A;  4I9W A;  4L8J A;  3GIE A;  4H13 B;  3SL2 A;  1YI2 V;  4PEL A;  3R4P A;  2OYQ A;  4IIJ B;  4FPP A;  3CCQ V;  1FXV A;  2EXL A;  4HXZ A;  3ABU A;  3OFN G;  2ODM A;  2XX4 A;  3RYC B;  4YKZ A;  1RPR A;  4LF8 O;  2AZ0 A;  2IH3 C;  1E79 G;  3UT5 B;  1I5X A;  1U0Z A;  2F4V B;  1EM1 A;  5LYJ B;  3IED A;  3GIG B;  4DR5 O;  1YDX A;  1UYK A;  2Z0A A;  3FX7 A;  1S76 D;  4QE7 A;  3ZRW B;  1AR4 A;  3HB3 B;  2WLM A;  4HAM A;  4DR4 O;  2YI9 A;  1KP2 A;  4Q6G A;  3D3Q A;  5BZB A;  4FM2 A;  1Z59 A;  2GTS A;  2ZE8 A;  1DF4 A;  2QEX V;  4JV5 B;  1ZLZ A;  4JAV A;  1PP9 H;  5D6P A;  1BSM A;  1K4D C;  5KHK A;  3B24 A;  3HZ1 A;  3ZHS A;  4DV0 B;  2ZIM A;  3CX5 F;  3FKS G;  1WA8 B;  3TJT A;  3ZHV A;  5KLV H;  3VAD A;  3H01 A;  3CCL V;  1KD1 W;  2NN4 A;  2HCH A;  3A0X A;  1H2M A;  3OT7 A;  2QM7 A;  3ZN0 A;  1YF2 A;  1NZ6 A;  1M57 B;  2VQF O;  3I55 V;  3BMY A;  1VQ6 V;  2K5B A;  5IN9 A;  4I4T A;  4P7A A;  4XDM A;  3LUT B;  5IY5 C;  1I94 O;  4FZ1 A;  4IIJ A;  4O04 A;  1UY7 A;  1BZK A;  3B28 A;  4TOI A;  4LWS B;  1TC0 A;  2R9R B;  3WG7 B;  5IDM A;  1B6Q A;  4X8A A;  2QDO A;  4O4J B;  2JK5 C;  1EI1 A;  1TH8 A;  4NYK A;  4E4E A;  5FL7 G;  2H8P C;  3FAV B;  3SR2 C;  3BVO A;  3IAY A;  1U97 A;  2WLK A;  2Q7G A;  3A0W A;  2VWK A;  3GIF A;  3RYH A;  3LNN A;  4CH3 A;  5B3S C;  1HNX B;  2IWU A;  1I58 A;  2BRC A;  3BCC H;  4HYM A;  5H6Q A;  2W6J G;  3H1J H;  1N8R W;  3SPH A;  3E8F A;  1ZTE A;  3AG7 A;  2O1V A;  2A3Q A;  2PTM A;  4QJF B;  5EC2 C;  1ZUQ A;  3G71 V;  3VHA A;  1OCO C;  2QWQ B;  3RWR D;  2QG2 A;  2Q8G A;  4MBC A;  1AVM A;  1KKD A;  3JAT B;  2ZT9 B;  1XUQ A;  1XIL A;  2XX2 A;  4CE1 A;  1L0N H;  3FB5 C;  1UJW B;  5KMG B;  2DYS B;  4GYC B;  3N2K A;  3CRC A;  4LFA B;  1D5N A;  3W7U A;  2MW2 B;  4G27 B;  3ML0 A;  5KHJ A;  1Q5O A;  4B3M B;  3GIG A;  2V1D A;  2FKX A;  2IW5 A;  2ZD9 A;  2NR5 A;  4K4O A;  5CTY A;  2WLH A;  4B3M O;  4DV4 B;  1EZJ A;  2YIB A;  3ZBH A;  3OMA B;  4GKK O;  3HEK A;  4R3M A;  1AI4 A;  1G4Y B;  2CGN A;  3T2M A;  4JV5 O;  5JVD B;  4DV2 B;  1RM1 B;  1Z5B A;  1VQP V;  2QKA A;  3D36 A;  3ZHQ A;  4DUZ B;  3SJA C;  1IBK B;  2FYP A;  2XK2 A;  4CWF A;  5K1P A;  2UUA B;  1EN6 A;  2YEA A;  5L3C A;  1NKD A;  4TQF A;  3A0Y A;  1HDJ A;  2IM9 A;  1U2O A;  2Z5U A;  5KX5 B;  4DW0 A;  3VQY A;  2YEV A;  4FLV A;  2ZIO A;  4JI8 B;  1YC3 A;  2B5U A;  4CWR A;  2OTL V;  1IXB A;  5DN6 G;  2DOS A;  5ITZ B;  2UXD B;  2HFE C;  2QR4 A;  1AMW A;  1Z2G A;  3U10 A;  4IL6 Z;  3OR7 C;  2IJH A;  1GH6 A;  1B3Q A;  1GO3 F;  4FVM A;  3INW A;  1XNQ B;  2QTS A;  1S3J A;  3ABK B;  2DW4 A;  4JI1 B;  2ZCE A;  1XMQ B;  3T1C A;  3T1H O;  1NQT A;  4NVP A;  4CBC A;  4WBN B;  1FXK A;  2QTO A;  4FFB B;  4LFB B;  4HY6 A;  4HNA A;  3JYC A;  3RT3 C;  3HKB A;  4DUY O;  4O4I B;  1GKZ A;  2O1U A;  3FT8 A;  3TUH A;  3E22 B;  2W0F C;  1PPJ H;  1FAF A;  3OW6 A;  1QCE A;  4J11 A;  1E1R G;  3PEJ A;  3A0Z A;  1TA8 A;  1NHI A;  1YEW A;  2FWZ A;  1LUV A;  1OCO B;  2RCV A;  1Z5W A;  2Y48 A;  2WLN A;  4RAI A;  2WLI B;  2LW7 A;  4PI2 A;  2UXX A;  4GT1 A;  3H1K H;  2O1W A;  4DZY A;  2ZE5 A;  2FL4 A;  4DR1 B;  2P22 C;  3D8C A;  2E76 B;  4ICG A;  2E74 B;  2YE9 A;  5D7D A;  2YEH A;  2YKI A;  4WCE V;  4UCR A;  3T1Y O;  1AIL A;  1QU7 A;  4JPR A;  1QY8 A;  5IJ9 A;  3O65 A; 
#chains in the Genus database with same CATH homology
 2X6A A;  5FNC A;  3QO5 A;  2QKS A;  3DGE A;  3HZ5 A;  1I5B A;  3Q5J A;  4O09 A;  4R1F A;  1E1Q G;  3AG2 C;  3INX A;  1Q81 W;  3AG4 C;  5EBM C;  3ZIA G;  3ABK C;  4PA6 A;  1YT1 A;  1AJN A;  5BOD A;  4R7C A;  3K0D A;  1K73 W;  1ENV A;  5B1O A;  2HG1 A;  2V7Q G;  1AH8 A;  3HYY A;  3A0T A;  1IXM A;  2CGF A;  1OCZ B;  1VQO V;  2DYR B;  3RLP A;  2YEF A;  1S16 A;  3E8B A;  2A9H A;  4U7O A;  1PNL A;  3SYQ A;  1YIJ V;  3OEE G;  3ZN1 A;  4LC1 A;  3M99 B;  2YGE A;  1AI5 A;  4HZ5 A;  3T10 A;  4H7Q A;  2P67 A;  3RVZ A;  3ZXO A;  4P30 A;  1AJP A;  3RBZ A;  2LP7 A;  1M9N A;  1JPX A;  3CC2 V;  4CWF A;  3BEH A;  2XAF A;  1UYL A;  3P32 A;  3CP1 A;  4QIW F;  2H8M A;  2P6J A;  2IWX A;  3GB7 C;  5B1N A;  3G7B A;  2P90 A;  2ZR3 A;  4Q20 A;  4XTJ A;  3JD0 A;  3CCU V;  3E83 A;  5KA5 A;  4MVU A;  3D2R A;  4O0B A;  4HXW A;  4BQJ A;  3O2F A;  4CWP A;  3VHD A;  1ZW9 A;  2ZDI A;  2MK3 A;  3OWB A;  2WLL B;  1YIT V;  2PI5 A;  2CCS A;  4X89 A;  5CN0 A;  3EHG A;  3TTZ A;  1NR7 A;  3ZRS A;  2BU8 A;  3ZMV A;  1OCC C;  5L3E A;  3C0E A;  5FND A;  2CK3 G;  1UYI A;  2YEB A;  1PD3 A;  1OCZ C;  1R73 A;  2WPD G;  3T4Z A;  1UYM A;  1L0O A;  3PJS K;  1XL4 A;  1FFT B;  4KSH A;  4UUJ C;  2XJG A;  2QE7 G;  2WI4 A;  3W7X A;  1VQ9 V;  5EBW C;  1TUE B;  2ZR2 A;  1I5C A;  4AWO A;  1CP9 A;  3T2S A;  1Q82 W;  4GX0 A;  2EIK B;  3CCV V;  1GMG A;  2Q6A A;  2Q67 A;  3CPW U;  2YKJ A;  3NMQ A;  3R91 A;  2Y69 C;  4O07 A;  1RM1 C;  1M56 C;  3K3W A;  4MW3 A;  4F4L A;  3OMU A;  4NH9 A;  1GK9 A;  3ZJZ A;  3CMA V;  2X0L A;  1FS0 G;  4AWQ A;  1H8H G;  4FJC C;  2QM8 A;  1NHJ A;  5HFL A;  3FYI B;  3OM3 B;  3SPJ A;  4OXS A;  1UYE A;  3KE6 A;  5CF0 A;  2IJI A;  4MPE A;  5IYB O;  4HYP A;  1HWY A;  1SES A;  4H33 A;  4PRX A;  4PA7 A;  1F23 A;  1V54 B;  2X6B A;  3ASO B;  1BHB A;  5LHI A;  2XDX A;  4QPK A;  5CMU A;  3VBB A;  5BOC A;  4EKW A;  4R6Z A;  3G6E V;  4DUH A;  1L1F A;  2EIL B;  2BOB C;  1ORQ C;  3BY6 A;  1Q86 W;  2BYI A;  4L8Z A;  4KUM A;  1QLN A;  2WLI A;  3R4M A;  2QF6 A;  3ASN B;  2CG9 A;  4MB9 A;  4BAE A;  1M1K W;  5C93 A;  2WI7 A;  1KEC A;  4DO2 A;  2DYS C;  4FCP A;  4GEE A;  3K03 A;  4EGH A;  1BXD A;  2ZKJ A;  2OCC B;  4P9P A;  4CWS A;  3CRK A;  1VQK V;  2IOQ A;  5LGU A;  2WLJ A;  4WFB V;  4PDV A;  4JYC A;  3HPL C;  4MS2 A;  3JD3 A;  2HR3 A;  4MSW C;  5CBG A;  1Z5A A;  4CWN A;  4JTC B;  2LFS A;  2KB1 A;  4P9O A;  2ZQM A;  3JD1 A;  3I56 V;  1YTF B;  1ID0 A;  4MP7 A;  3RLR A;  5J9P C;  1NVP B;  1OZ0 A;  4PL9 A;  2WAM A;  3ZCC A;  1KP3 A;  2HJF C;  4UV8 A;  3ZMS A;  2PNR A;  3CGY A;  3K08 A;  1JM6 A;  5E1A C;  2IWS A;  2YE3 A;  4KTN A;  4P8O A;  1NBM G;  2WI1 A;  1MG1 A;  3ZRW A;  4XCL A;  1ZWH A;  3BM9 A;  5CBH A;  3QNE A;  4YKX A;  4B6C A;  2Q68 A;  4ASF A;  1YJ9 V;  5B1A B;  4BXI A;  4XC0 A;  4XDJ A;  3CRL A;  2XAQ A;  3E89 A;  4EGI A;  4HY1 A;  4KQV A;  3EHH A;  3B8M A;  2VCJ A;  1JCH A;  4PRV A;  4GT8 A;  2DWD C;  2BYH A;  1BHA A;  2JEU A;  4WFA V;  3H4L A;  2HLD G;  2PI4 A;  2YE8 A;  3O0I A;  2Q8H A;  4PU9 A;  4BIZ A;  4BW5 A;  1YER A;  1VQ5 V;  2JKI A;  4LWE A;  1CPY A;  1MOF A;  1V55 B;  5LGT A;  3ZKB A;  2WI3 A;  2ZXW C;  1KC8 W;  2YEC A;  4XD8 A;  3AG4 B;  1AI7 A;  2BRE A;  3NXS A;  2GHY A;  1TBW A;  2VCI A;  4WUB A;  4YKT A;  3MHH C;  4URL A;  1S0V A;  2XHR A;  4LWF A;  3SJQ C;  5LHG A;  4LWH A;  2A79 B;  3B77 A;  3CGZ A;  4BIU A;  3T0Z A;  1H7S A;  3WHA A;  5B1B C;  2WEQ A;  2WER A;  2YE7 A;  2VWC A;  1FXK B;  4MTG A;  5GGZ A;  3TK1 A;  1Y4U A;  1B62 A;  3B25 A;  1ARO P;  1M56 B;  3OMI B;  5L3B A;  1JVM A;  1EFR G;  3K99 A;  2H55 A;  4H81 A;  2YSU B;  2XOK G;  2EIN C;  3GWO A;  1Y8N A;  2EIM B;  1COW G;  2EZO A;  3UM7 A;  4RUF A;  2BSM A;  4DXW A;  2HKJ A;  3OEH G;  3QO8 A;  4FK5 C;  2E0A A;  4JAU A;  3K04 A;  2BZ5 A;  4I3H A;  2GSM B;  4MVM A;  2YKE A;  4V25 A;  2A0L A;  2X6C A;  4UVA A;  4L93 A;  1GJV A;  5L3D A;  3RW0 A;  1W2B U;  3AG2 B;  4HZ3 A;  4E2L A;  1K9M W;  1AM1 A;  3R4O A;  1NJI W;  1V54 C;  3ASO C;  5FWK A;  3ZRX A;  3JCZ A;  2B1I A;  3ETD A;  3ZMU A;  5LGN A;  2Q8I A;  1UY9 A;  5M4P A;  3FYE B;  3OW2 U;  1KIJ A;  1R3I C;  2DQ3 A;  3A0R A;  1J95 A;  3STZ C;  1F4N A;  5L3J A;  3LNM B;  2XHT A;  4WF9 V;  3OUS A;  2YEE A;  3K98 A;  4WFG A;  1BMF G;  1QBZ A;  2QFO A;  4YKW A;  4MVS A;  3STL C;  4XIQ A;  3E35 A;  3WFV A;  3CCE V;  2DWE C;  4L91 A;  4R3A A;  1MAB G;  1QR9 A;  2JJC A;  2XD6 A;  2YGA A;  3K60 A;  2F43 G;  3E2E A;  3T1K A;  4EM7 A;  4I9W A;  1PKX A;  3FB8 C;  3GIE A;  4KFG A;  2NNU A;  4QPJ A;  3SL2 A;  2HVJ C;  1FXK C;  4JYB A;  2UWD A;  1YI2 V;  3VOU A;  1I5A A;  1PVG A;  4PEL A;  5CTX A;  4PA4 A;  4MT8 A;  3R4P A;  4B7P A;  4FPP A;  2IJJ A;  1ZWI C;  1FXV A;  3OUF A;  3CCQ V;  2EXL A;  4XKA A;  3TZ4 A;  4GX2 A;  4QNH B;  4HXZ A;  4HZ0 A;  3ABU A;  3OFN G;  1UY8 A;  4LWI A;  1Y4S A;  4E02 A;  5KUM A;  1MSW D;  1OCR C;  1TID A;  2XX4 A;  3MNR P;  4PDM A;  4YKZ A;  5D6Q A;  4AWP A;  1RPR A;  3F7Y C;  2XDK A;  2CCT A;  3B27 A;  1CEZ A;  2IH3 C;  1E79 G;  3IC7 A;  3TET A;  2B1G A;  1I5X A;  1H7U A;  3TZ2 A;  1U0Z A;  3IED A;  3GIG B;  2ZDY A;  3H80 A;  3P30 A;  3R65 A;  4RQE A;  1P7B A;  4RO2 A;  1UYK A;  4MPN A;  3VHC A;  1NVP D;  1S76 D;  3FV5 A;  3E86 A;  3CXC U;  4QE7 A;  3ZRW B;  1VQ7 V;  3EHF A;  1JX9 A;  2IU3 A;  3SPI A;  3CC4 V;  3HB3 B;  2WLM A;  3X2Q C;  1GM7 A;  5EC1 C;  3RKZ A;  4HAM A;  1Y66 A;  1PNM A;  3ZMT A;  2DQ0 A;  4I5S A;  1M57 C;  3W7S A;  4CWT A;  1KP2 A;  1YSZ A;  2YEI A;  5BZB A;  1GM9 A;  1Z59 A;  4GX1 A;  2QEX V;  1DF4 A;  1K3E A;  1UYD A;  4GQT A;  3T0H A;  2VW5 A;  3JZ3 A;  2XAG A;  4JAV A;  3ETE A;  4ASU G;  2WSS G;  2W6I G;  3LSQ A;  1K4D C;  4YXW G;  4WFH A;  2AHY A;  1NHH A;  4URM A;  5D6P A;  2BU7 A;  3WQ9 A;  3B24 A;  3ZRV A;  2YGF A;  3HZ1 A;  3HYZ A;  2Y69 B;  1OCR B;  1MX0 A;  2C2A A;  5M4N A;  3W7T A;  1YT0 A;  2XDL A;  4FCQ A;  3SYO A;  5M4E A;  2D3O W;  3F5W C;  4WFF A;  3FKS G;  4Z1M G;  4G2K A;  1YTF D;  4NH7 A;  4E01 A;  3MD0 A;  4PDR A;  2EIL C;  5CA3 A;  1QLE B;  2GQP A;  1YS3 A;  3VAD A;  4TWK A;  3H01 A;  1F51 A;  3CCL V;  1KD1 W;  1R6K A;  2R9I A;  1BGQ A;  3K79 A;  2HCH A;  2WI2 A;  1GM8 A;  3FB7 C;  3LNU A;  1QVF U;  4XBF A;  4LBE C;  2QM7 A;  3LDE A;  2ITD C;  4FIP C;  4MW8 A;  3ZN0 A;  3ABM C;  3SYC A;  1JJ2 U;  4YKY A;  1M57 B;  4U7N A;  2Q69 A;  3BMY A;  3I55 V;  4X88 A;  1VQ6 V;  1ZXN A;  2K5B A;  4JF3 A;  1ZXM A;  2IU0 A;  5IN9 A;  2DYR C;  3E8G A;  1YET A;  1PNK A;  4P7A A;  2XAB A;  5CBF A;  4H85 A;  3ZMZ A;  4XDM A;  3LUT B;  5IY5 C;  5B3S B;  1Q7Y W;  3EKR A;  3SPC A;  2YK2 A;  2IOP A;  4O04 A;  1UY7 A;  3SYP A;  4XIT A;  1K97 A;  4ASG A;  4PDL A;  3B28 A;  1K7D A;  4XCJ A;  1VQL V;  1TC0 A;  4X9L A;  1TIL A;  3CWV A;  4JGS A;  4BAY A;  3MHS C;  2R9R B;  3WG7 B;  5IDM A;  2IH1 C;  1BKN A;  1B6Q A;  4X8A A;  4CWO A;  2EIN B;  2AKP A;  1GKX A;  5EK0 A;  1THN A;  2WEP A;  3R4N A;  4LP0 A;  2JK5 C;  1Y8O A;  4UV9 A;  5LBQ A;  1EI1 A;  1TH8 A;  3A0X A;  1YHQ V;  4EFT A;  1W0J G;  2YK9 A;  1V55 C;  1JQ0 A;  2XND G;  1AR1 B;  1OCC B;  2LFR A;  5FL7 G;  2H8P C;  3D3I A;  1I5D A;  5F5R A;  2HKO A;  3AG3 B;  1EBO A;  3ABL B;  2OT5 A;  2IOR A;  3ZM7 A;  1PL0 A;  1I5Y A;  2WLK A;  1GTO A;  3A0W A;  3GIF A;  1R3K C;  3LSS A;  3Q5K A;  2ITC C;  3B8N A;  4N21 A;  1KQS U;  5B3S C;  4MVR A;  4WFE A;  2FXS A;  5IYC O;  4JTD B;  2IWU A;  2YI7 A;  3ZXQ A;  2FTK A;  3EFF K;  4YKU A;  1I58 A;  3LPS A;  2BRC A;  5J71 A;  5GW7 A;  5IY5 B;  4G28 B;  4HYM A;  5H6Q A;  3X2Q B;  2W6J G;  1EA6 A;  2YI0 A;  2XJJ A;  4N23 A;  4UXN A;  3SPH A;  1N8R W;  3E8F A;  3ETG A;  2BU2 A;  4KSG A;  2Q2E B;  5J6A A;  4XIP A;  4KFM A;  3DTU B;  1RPO A;  1H8E G;  4MTF A;  4PA9 A;  1BYQ A;  1QYE A;  3AG1 B;  2JDI G;  2YI6 A;  2O1V A;  4V26 A;  4QJF B;  1S5H C;  1AH6 A;  5EC2 C;  1H38 A;  2XX5 A;  2WWW A;  3QTF A;  5D7R A;  3G71 V;  3VHA A;  1OCO C;  3OAA G;  4TSF G;  2XCM A;  1QZR A;  4URO A;  1S77 D;  3IGA C;  2YKC A;  4CWQ A;  2OCC C;  1YES A;  2BOC C;  2ZDI C;  3FB6 C;  3CCJ V;  3EKO A;  3Q5L A;  5M4K A;  2QG2 A;  2Q8G A;  4MBC A;  1KKD A;  1Y4M A;  3OPD A;  3QDD A;  2EIM C;  1K33 A;  3LDD A;  3OMN B;  3T4D A;  5H6R A;  4FMT A;  2YEG A;  2YJX A;  2YE2 A;  1GKF A;  3CC7 V;  3R92 A;  4J9Y B;  1YJN V;  2XX2 A;  3OE7 G;  1K5S A;  4RUE A;  2FWY A;  2YE6 A;  3CCM V;  1OSF A;  1S14 A;  4CE1 A;  3ASN C;  3FB5 C;  2XAS A;  1UJW B;  1SZT A;  3ABM B;  2DYS B;  3E8H A;  2XAH A;  3W7W A;  3AG1 C;  1WLE A;  5KA6 A;  1JOY A;  1UYH A;  4ZVI A;  1SER A;  4QE9 A;  3W7U A;  5F3K A;  2YI5 A;  4L90 A;  5EBL C;  2ESA A;  4MP2 A;  1UYC A;  3F7V C;  4G27 B;  4MOT A;  4UVC A;  3CCR V;  3ML0 A;  1YC1 A;  1NR1 A;  1YT2 A;  5CTW A;  3GIG A;  4H37 A;  2V1D A;  1QVG U;  2IW5 A;  2ZD9 A;  4K4O A;  2BU6 A;  5CTY A;  4EFU A;  2WLH A;  2EIK C;  4J9Z B;  3O6O A;  2EIJ B;  1EZJ A;  2H94 A;  3SPG A;  4TT3 G;  4LPB A;  4ASA A;  1K8A W;  2YE4 A;  1THZ A;  3OMA B;  2M7W A;  3HEK A;  4R3M A;  1TC6 A;  4ASB A;  1BL8 A;  2AHZ A;  2JJ1 G;  2OTJ V;  3EHJ A;  1AI4 A;  3K0G A;  2WI5 A;  1G4Y B;  3T2M A;  3ABT A;  2JJ2 G;  2ZDX A;  4AS9 A;  2WLL A;  3K97 A;  4XDL A;  1US7 A;  2XAJ A;  3K9A A;  1R62 A;  4EEH A;  3G4S V;  4MVZ A;  1RM1 B;  1Z5B A;  3AG3 C;  5DM6 V;  2GFD A;  4L87 A;  3OGC C;  3D36 A;  3K06 A;  3LDC A;  4P2Z A;  1K92 A;  1P4R A;  1VQP V;  2FYP A;  2XK2 A;  3B26 A;  3JD2 A;  1AJQ A;  4O05 A;  5FNF A;  5M4H A;  1DLB A;  2YEA A;  5L3C A;  2XJX A;  1NKD A;  4CE2 A;  3A0Y A;  2YKB A;  1VQN V;  1NH2 B;  1U2O A;  1NH2 D;  2Z5U A;  3JD4 A;  1VQ4 V;  2P7T C;  5IYD O;  1MU5 A;  4LWG A;  4PA3 A;  4YKQ A;  5H9C A;  3U2D A;  1B63 A;  4KP4 A;  2BU5 A;  5KUK A;  1UY6 A;  1Z5C A;  3HHU A;  2YEV A;  2NLJ C;  2XDU A;  3OWD A;  3IFX A;  3QO7 A;  1YC3 A;  1K4C C;  4MPC A;  2B5U A;  2ATK C;  1SRY A;  4YKR A;  3TZ0 A;  4CWR A;  2OTL V;  3OR6 C;  4LCU C;  1R3L C;  4HYO A;  4MTX A;  2EIJ C;  5DN6 G;  3ZKD A;  4EGK A;  4U93 A;  4XDK A;  5IDJ A;  2HFE C;  2QG0 A;  1AMW A;  5CTU A;  4GX5 A;  4WUC A;  2YEJ A;  3D0B A;  1R3J C;  4URN A;  2HVK C;  2K1E A;  4MTO A;  4LP8 A;  4ZBM A;  2YE5 A;  4W7T A;  3EHB B;  3OR7 C;  2IJH A;  1KZN A;  5M4M A;  1B3Q A;  1GO3 F;  2CH4 A;  2IJK A;  3UKM A;  3INW A;  3PEH A;  1I59 A;  2X7R B;  2QA4 V;  4R50 A;  3SYA A;  5HFM A;  5D7C A;  2Z3Y A;  4XKK A;  1YSC A;  4GGL A;  2EJR A;  4XKO A;  3ABL C;  5L3G A;  1S3J A;  3ABK B;  4JTA B;  1VQM V;  1G8M A;  2UXN A;  2DW4 A;  1YSR A;  5L3F A;  3U2K A;  1QR8 A;  3T1C A;  4NH8 A;  1LNQ A;  1NQT A;  2Q8F A;  2JIZ G;  2YJW A;  4CBC A;  1FXK A;  1K5Q A;  2QTO A;  3KG2 A;  1YJW V;  3G75 A;  3U67 A;  1R6N A;  4HY6 A;  2YED A;  4WUD A;  3TCU A;  1SET A;  2EBO A;  2BTZ A;  3JYC A;  3TUH A;  1GKZ A;  3WG7 C;  3FT8 A;  2O1U A;  2CCU A;  3C11 A;  2W0F C;  4L94 A;  4GFN A;  3CCS V;  1H2G A;  3CYO A;  5LHH A;  1YC4 A;  3FT5 A;  3AEI A;  1QCE A;  3OW6 A;  4EMV A;  1E1R G;  1WPX A;  4MVQ A;  5B1B B;  1UYF A;  1UYG A;  3PEJ A;  3A0Z A;  1NHI A;  2FWZ A;  1OCO B;  2XHX A;  2JEX A;  2Y48 A;  2ZXW B;  3CME V;  3RVY A;  2WLN A;  1AJ6 A;  4RAI A;  1F4M A;  2WLI B;  1VQ8 V;  1A4H A;  2EZP A;  4FCR A;  1AI6 A;  4E00 A;  4BQG A;  2UXX A;  4JAS A;  4GT1 A;  2HG5 C;  3CD6 V;  2O1W A;  2ZBK B;  3TZ5 A;  4XIR A;  4DZY A;  1FXH A;  1Y8P A;  4JQL A;  5B1A C;  2WI6 A;  4UVB A;  2YE9 A;  1ROP A;  5CPH A;  2YEH A;  2YKI A;  5D7D A;  4RQF A;  1DF5 A;  4WCE V;  1OHH G;  4R8C A;  1S72 V;  3G7E A;  4XE2 A;  1XL6 A;  1DTO A;  1K34 A;  1W0K G;  4MVO A;  4CE3 A;  4CZZ A;  4JPR A;  2XDS A;  1QY8 A;  1M90 W;  4ZKI A;  2YEV B;  4GCZ A;  2BT0 A;  1QLE C;  3RLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...