4JAVA

Structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
246
structure length
246
Chain Sequence
NVTESKELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine kinase
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
total genus 79
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4javA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4javA02
3A0ZA 4JAVA 3TZ2A 2BU5A 2WI6A 5C93A 3ZRXA 2WI7A 4KP4A 2YEIA 4QPJA 2BYHA 1KZNA 5CF0A 3B28A 2XDKA 1B63A 1UYMA 3BM9A 2CCUA 3ZM7A 2HG1A 4X9LA 4CWOA 2XDXA 1I5CA 4ASGA 4B7PA 3U2KA 2WEQA 4O04A 4YKWA 3FV5A 1I58A 3WHAA 2YGEA 2K5BA 1I5DA 1Z5BA 3B24A 4PL9A 3O6OA 4JAUA 1Z59A 4NH8A 3A0TA 3NMQA 4FCPA 5L3JA 2FXSA 3T10A 2E0AA 5F5RA 3K99A 3GIEA 1TC0A 3TTZA 3KE6A 2YEEA 1EI1A 1TH8A 5CTWA 5B1OA 4U7OA 3LPSA 4URMA 4AWPA 4CWQA 3O0IA 5CTUA 3R91A 3RLQA 3B26A 2GQPA 4KSHA 3T0HA 3EHHA 3CRKA 4H85A 1TC6A 4EFTA 1YT0A 2YEAA 4O05A 3CWVA 3GIGA 3ZKBA 4DUHA 4QPKA 2YI6A 4K4OA 4GCZA 2CH4A 2YEJA 3RLRA 3GIGB 4LWHA 3VHDA 1GKZA 2AKPA 4KTNA 2YI5A 4URLA 2YI7A 3EKRA 2BRCA 4MT8A 4BIZA 4GGLA 1A4HA 5D6PA 5BODA 3HZ5A 1ZW9A 4CE3A 2YJWA 4ZVIA 1AMWA 1I5BA 3HZ1A 2BZ5A 2XHXA 1PVGA 5IDMA 1I59A 4EMVA 1Z5AA 4LWFA 2BSMA 2QG2A 4XE2A 2XJJA 4BXIA 1QZRA 4XC0A 4CE2A 2WEPA 2QG0A 3G7EA 4H7QA 3A0YA 2Q8HA 2ZBKB 2ZKJA 4MBCA 4JASA 4LWIA 4YKUA 4HYMA 2LFSA 2C2AA 4HYPA 4XDMA 3B27A 1YC3A 5IN9A 4O09A 4XKAA 4MP2A 3RKZA 4L8ZA 4MPEA 5CPHA 2YEBA 2BU2A 4GEEA 2XDLA 5BOCA 3EKOA 3H80A 2YE7A 3FT5A 4V26A 2XHTA 4PRVA 2WI3A 2XX2A 4URNA 3D2RA 2XX5A 3R4MA 4GQTA 4EGHA 3T2SA 1H7UA 2IWUA 4YKYA 1ZWHA 1UY8A 2XJXA 3Q5JA 2IWSA 2BREA 4MOTA 4XCLA 4YKZA 5M4MA 3EHGA 4BQGA 2ZDYA 2FYPA 1YSZA 4E00A 3ZXOA 4CWFA 1EA6A 2QFOA 3T0ZA 2YEDA 4KQVA 4MTXA 2P67A 4YKXA 4MP7A 1B62A 3OPDA 1I5AA 3R4PA 1UYHA 2YKJA 4KSGA 4CWRA 2YKBA 1YT2A 1S16A 3EHJA 2UWDA 5M4EA 4KFGA 3JZ3A 1Y4UA 4XITA 2YE3A 4W7TA 3BMYA 1BKNA 2IWXA 4L94A 1BGQA 1U2OA 2WI5A 3HYYA 4XCJA 4EGIA 2Q8IA 1UYIA 4XIQA 5D7DA 2YEGA 4JQLA 4L90A 3QDDA 5J71A 1Y8OA 2YEHA 1YSRA 4H81A 1YERA 4GT8A 4ASFA 4P8OA 3T1KA 4GFNA 5FNCA 2XJGA 1Y8NA 2ESAA 3Q5LA 3SL2A 1UY7A 2YEFA 4ZKIA 3C11A 4U93A 3LNUA 3INXA 2Q8FA 2YE6A 2YGFA 2YE2A 4I3HA 4LP0A 3RLPA 5M4KA 2XK2A 1ZXMA 1YT1A 1QY8A 3B25A 4XIPA 4R1FA 1BYQA 4R3MA 1US7A 1YETA 3G7BA 1AH8A 4UROA 1UY6A 2XABA 2YKEA 5J6AA 5M4PA 2YKIA 5CTXA 4AS9A 1MX0A 4Q20A 3A0XA 2YK9A 3TK1A 1YC4A 4AWQA 1Y8PA 5FNDA 4EM7A 2YE9A 1AH6A 3Q5KA 4V25A 1B3QA 1UYFA 2YKCA 4HZ0A 2YI0A 4EEHA 3A0WA 3HHUA 5B1NA 2FTKA 4BQJA 4LWGA 4WUBA 2QM7A 1KIJA 2FWZA 3VHCA 4L91A 3DGEA 1UYKA 4PRXA 2VWCA 2CCSA 5M4NA 4EGKA 4WUDA 4JYCA 2WI2A 2BT0A 3H4LA 3R4OA 4P7AA 3OWBA 4XKOA 2LFRA 2GFDA 3PEJA 2QM8A 3OWDA 2IOQA 4XIRA 1UY9A 2YE5A 4ASBA 3K60A 4B6CA 2YGAA 3D0BA 3TZ4A 4CWPA 3G75A 4WUCA 2BYIA 3VADA 5D6QA 2JKIA 4MB9A 3IEDA 2XDUA 1MU5A 2WI1A 1UYGA 3ZKDA 4NH9A 4FCRA 2O1WA 3ZRVA 1AM1A 1ID0A 4LC1A 1GJVA 1UYCA 1Z5CA 3VHAA 4CWSA 3C0EA 4R3AA 4CE1A 4O07A 3HYZA 3WQ9A 4AWOA 2HCHA 4EFUA 1TBWA 2YE8A 3PEHA 3CGYA 3OW6A 1YS3A 2BU7A 2YECA 2CCTA 3INWA 4XTJA 4O0BA 3TZ0A 1Y4SA 3CRLA 5IDJA 2EXLA 4L93A 2JJCA 3U2DA 2CGFA 2ZDXA 3QTFA 4HY1A 2VCIA 2BU6A 2PNRA 2VCJA 3TZ5A 1TIDA 4ASAA 1H7SA 3A0RA 2O1UA 2WWWA 4CWNA 4FCQA 1BXDA 1YESA 3R92A 1THNA 2O1VA 3TUHA 3GIFA 2XDSA 3U67A 1GKXA 2QF6A 1OSFA 1IXMA 1UYDA 2YE4A 1ZXNA 5D7CA 2H55A 3MD0A 1JM6A 3K98A 4GT1A 2Q2EB 1S14A 2VW5A 2XCMA 1R62A 4FPPA 4BIUA 1F51A 1AJ6A 1QYEA 3O2FA 5M4HA 1UYLA 3NXSA 3P32A 4U7NA 1NHHA 2WERA 1UYEA 2HKJA 4E02A 2FWYA 3MNRP 1NHIA 4XD8A 4BAEA 4MPCA 2XD6A 4YKQA 5D7RA 3ZRWA 4NH7A 4YKRA 2H8MA 2CG9A 3ZRWB 3ZXQA 5F3KA 5FNFA 4HZ5A 2IORA 2YK2A 3OMUA 4CWTA 1L0OA 2XX4A 4E01A 1TILA 1U0ZA 2BTZA 4JYBA 4MPNA 2WI4A 3EHFA 1NHJA 2YJXA 5FWKA 3CGZA 4XKKA 3FT8A 2Q8GA 3HEKA 4LWEA 5CTYA 3R4NA 1YC1A 2BU8A 3K97A 2IOPA 1JOYA 4FMTA 4LPBA 4I5SA 4DZYA 4HXZA 3D36A 4HXWA 4HY6A 2XHRA 4PU9A 5GGZA 4YKTA 3ZCCA
chains in the Genus database with same CATH superfamily
3A0ZA 1SETA 2WI6A 2WI7A 3E22A 1N34B 3HKEB 4IL6Z 2K9PA 2BYHA 4OXSA 1KZNA 3B28A 2XDKA 1TUEB 3BM9A 2DMXA 2Q6AA 4KHPO 2CCUA 1TUBB 3STZC 4GX5A 2YI8A 4X9LA 2P22C 3U2KA 2UXBO 4IYHA 2GUZB 1NQTA 4O04A 1R6TA 3WHAA 2HFEC 1K5QA 2ZXWC 1PD3A 1EBOA 1G4YB 2BSKA 3FB7C 3MHSC 4X64O 4NB5A 5AG2A 2EILC 1FXVA 1AJPA 2Q0OC 4DV6B 1LNQA 3OMIB 2JJ1G 4JV5B 3A0TA 2FYUH 2NLJC 4LF6O 1K4DC 3HKBA 3K0DA 2Z0AA 2FXSA 2Z5UA 3JALA 4RWUA 2YEEA 2JS5A 2RMKB 2YDEA 4JAAA 1F4NA 4D6TH 1EI1A 2IJIA 2V4DA 3VQWA 4ZIBA 2HHIA 3LPSA 1FJGB 3CMAV 3O0IA 5CTUA 5B1AC 5EC2C 2GQPA 1XNRO 3FD9A 1WA8A 3FX7A 3DSQA 1R3KC 1BQZA 1P49A 4I0XB 2PTMA 2CK3G 3ZMVA 3CWVA 3CRQA 4JI8O 5LMNO 1OV9A 5CA0B 3ETQA 1BL8A 1MOFA 4GCZA 2YEJA 3ABTA 2FL4A 4X65B 1M4UA 4LBEC 1IDSA 2H94A 4KTNA 3UO3A 3CRMA 2YI5A 1XMOO 2A0LA 2UXCB 3E35A 4DV2B 4H44B 4TV9A 4MT8A 4BIZA 4GGLA 2W0XA 3BHPA 5BY1A 3A0BZ 1ZW9A 3ZHUA 2CTQA 2UXDO 5C8YB 5KA6A 1S0VA 3ZMSA 1AMWA 1Q8IA 4HAMA 2JIZG 4JTAB 1AJNA 5CN0A 1N36B 3VQVA 4MTOA 1PVGA 5IDMA 2CGNA 3BAAA 4B7KA 1KUQA 2ZXWB 1Z5AA 1TVKA 4I4TA 2QG2A 4CC6A 2QKSA 1NZ6A 2R9AA 2EILB 2UUAO 3RVZA 4JI6B 3GB7C 4MS2A 4CE2A 4NKGB 1E79G 1N0NA 4ABMA 2ZKJA 4LWSA 5BMVB 1Q7YW 4MTFA 4YXWG 3QO7A 3APQA 4DV5O 5EBMC 3ZS8C 2BOCC 3N27A 1SS3A 3CSXA 4HYMA 4BR6A 1NTZH 4PI0A 4ZHQA 4YJ2A 5B1AB 4WBNA 4XDMA 2JEUA 4DV1B 1YC3A 2VWKA 4XKAA 1ZL8A 4MP2A 1RP3B 4LP8A 3R66A 3RKZA 2EIMC 3WB0A 4PJ0Z 5CPHA 2VWJA 5BOCA 1YSCA 3EKOA 4X20B 4P2ZA 2WI3A 4O4HA 3TXSA 1H7UA 3BABA 2GTSA 2EBOA 3Q5JA 2IWSA 5H6QA 1FPOA 4XCLA 1Z5WA 3F7VC 4YKZA 1I5XA 4BQGA 2FYPA 3ABLC 3ZXOA 2DJVA 1EA6A 1Q6HA 5JJNB 3OFNG 4JZ2A 2N74A 2Y0IA 4DV0B 1YJ9V 4XDKA 4MP7A 5FNVB 1FFXB 4DR2O 4NXMB 4KXRA 3WB2A 4CWRA 3LDDA 4JZGA 1BMFG 1P7BA 1X4TA 1YT2A 1S16A 5M4EA 1BHBA 5GONA 1KC8W 4TT3G 3NR7A 2XAJA 1IURA 3BMYA 4OPHA 1KYOF 2XHBA 2Z3YA 3WFVA 1RFYA 4L94A 4JI1O 2QSAA 3GWKC 1I0HA 2D3OW 3KCXA 1WN7A 4XCJA 1CPYA 4EGIA 4JI4O 2Q8IA 4XIQA 4HYOA 1HW7A 4X62O 4YJ3B 5J71A 1YSRA 1HNXO 4DRXA 4GFNA 3OUFA 1EZJA 2Y69C 2ZIOA 1V55C 4LF4O 4U3JB 4ZKIA 3OR7C 1B04A 2Q8FA 3RLPA 2XK2A 1S5LZ 1ZXMA 2HKOA 4FZ0A 5B66Z 1YT1A 3B25A 1L0LH 3BEHA 3N2KA 3SDLA 2VRZA 3K9AA 2EIMB 4JTCB 2RJZA 5TISZ 2ODMA 2A79B 5LXTA 2XABA 4PDRA 5M4PA 3A0HZ 3JARA 2PUSA 2X6CA 4AS9A 2QJ1A 3A0XA 4FLZA 1Y67A 3E8HA 3QF7A 3TK1A 2AXTZ 5FNDA 3CRAA 3Q5KA 1B3QA 2YKCA 4HZ0A 3BFRA 4QNHB 3A2FA 3AG3C 2GHYA 1FAFA 5BR8B 4LWGA 4WUBA 1KIJA 5KHKA 2OCHA 2ZDIA 2F95B 4L91A 3RW0A 4GKJB 1F4MA 4JYAB 1WPXA 4ZI7A 4WUDA 4JYCA 4QGPA 4R8CA 5IYZB 3H4LA 3OWBA 4XKOA 2EZOA 2ZT9B 2QM8A 1BQ0A 5JJEB 1V9PA 2ILMA 4LFAO 1GK9A 4O2AB 4DV6O 4B6CA 2YGAA 3FAVB 3BRCA 4JI0O 4TV8A 3G75A 1IBKB 2UUBO 5KMGB 1PNMA 2PY5A 1UYGA 1HR0B 2M6YA 4NH9A 1MNGA 4FCRA 4O2BA 2QWRB 1FJGO 2WLIA 3HKCA 1Z5CA 2QWPB 2Y69B 4ASUG 1V55B 1AR4A 3T1CA 3RYCB 3OAAG 4AWOA 1AVMA 1SC5B 1AR5A 4EFUA 4L87A 1I08A 3PN1A 5IYBO 2GSMB 3J7AU 4PA4A 4FLWA 3CGYA 5GW7A 4O4IA 1F7YA 3H1LH 2CCTA 5DN6G 2YECA 3INWA 1EFRG 4X9QA 4X1IB 4KFMA 4X65O 2ZE7A 4FZ1A 3CJHA 2CGFA 1AI7A 3U11A 2A9HA 2ZDXA 5JH7B 3QTFA 4HY1A 3CE2A 2BU6A 2UXCO 3TZ5A 3BVOA 4DV2O 2CUGA 3A0RA 4LF5B 2KB1A 3R92A 3AG3B 4OPAA 3U67A 3E8BA 1IXMA 3G67A 4DR7O 1UYDA 2NR5A 5IJ0A 1S5HC 4FM1A 1N36O 2H55A 3MD0A 2W6IG 3LNMB 4GT1A 2Q2EB 2HJDA 3OMAB 4K3AA 4BAYA 1JJ2U 3AK1A 1AR1B 1R62A 1JMKC 4FPPA 1WAZA 4DR3O 3AG2C 1NT2B 1Q6UA 4JI6O 2P4VA 4U7NA 1YI2V 3A8TA 4DV4B 4I9QA 5LYJA 3P30A 4LF7B 4LFCB 1Q81W 2LQTA 1VF6A 3SPIA 4BAEA 3DC6A 5D5PA 2ZM6O 3CX5F 5LHGA 2XD6A 4I50A 4NTXA 1EN5A 2MW2B 3KKYA 3TXQA 3S3XA 4CBCA 4DR1B 3JD4A 2E75B 4DV1O 2BTQA 3S5TA 4YKRA 2UXNA 5L3BA 5C8YA 4C7UA 5JVDB 4B3RO 4EFBA 5FNFA 3KCYA 3UT5A 3LSUA 2PF4E 2CAZC 2QA4V 1AJQA 1H2MA 1K73W 4JYBA 1ROPA 1YTFD 1N4CA 1NH2D 5LMUO 3UM7A 4CS2A 4MPNA 4TUYA 1VQNV 2F4VO 2YJXA 3EHFA 3CGZA 4XKKA 4FFBB 1ZAUA 3FT8A 2Q8GA 3TJTA 2OTLV 2IOPA 4H0LB 3OTOB 3DTUB 3D36A 3W7UA 1QVFU 3JYCA 2XHRA 1BSMA 5GGZA 1VQ5V 3O65A 2HJFC 3G80A 3TZ2A 3ZRXA 4X1KA 5CF0A 1YJWV 4FVMA 3L70H 3JCZA 1VP7A 1KMIZ 5LA6B 5FLXN 3AG2B 4LH6A 2E3CA 3D8CA 1P7GA 2OIGA 1L8DA 4NR1A 2HG1A 4LF8B 2AHZA 4RAIA 1DLBA 2HHHO 5LHHA 1PKXA 2WEQA 4YKWA 1DGSA 3FB5C 4LFBB 5KA5A 2K5BA 3T1YB 1I5DA 1OCRC 1SQPH 4PL9A 3O6OA 1RSOB 4YY3B 4NH8A 1WNSA 3NMQA 5FNVA 5L3JA 5KHJA 1FFXA 5CB4B 3T10A 1VARA 1TAEA 4F6RA 1XUQA 1R6KA 4JI7O 3TTZA 3KE6A 1T5EA 1TH8A 3CRCA 5H6RA 4U7OA 3AK3A 5GTIZ 4AWPA 3VQYA 3ASOC 1QR9A 1EZVH 4GLXA 4XBFA 2JGDB 3CRKA 4H85A 2OYQA 3F5WC 1K92A 1WB8A 5JWPA 3JAWA 4J9ZB 1YT0A 4TQDA 1VF7A 2YEAA 4O05A 2YEVA 3UQ8A 5CA1B 3GIGA 5BR8O 4PA9A 4DUHA 4QPKA 2BE3A 2YI6A 4PV1B 5HFLA 4B08A 4EB6B 4GKJO 1VF5B 3BCCH 4LWHA 3VHDA 3P3PA 1GKZA 1R3LC 5JQGB 2YI7A 1ZLZA 4GX1A 2CTPA 2BRCA 3B77A 4JI2B 5H2FZ 1DTOA 1BGYH 1IBKO 2MK3A 4CE3A 4UFZA 3SYOA 1YZBA 2GBOA 1W2BU 3B40A 1YTFB 1HR0O 4CZZA 1JVMA 1K5SA 2Q67A 1NH2B 2RN9A 4ZVIA 2KKWA 4DV3B 1I5BA 5L3GA 1U96A 2FKXA 2ZE6A 2VQEB 2BZ5A 4IIJA 3RYHA 3T4DA 1OCRB 2QM4A 2JGUA 2ZINA 1H38A 4XE2A 4K8XA 2IH3C 1QZRA 4XC0A 2QG0A 3ABKC 1COWG 5IYZA 1IBLB 2Q8HA 4YHHB 1AP6A 2KG7B 4D7SA 4LNUA 5CBHA 1SRYA 4EKWA 1FXKA 4JASA 1G6UA 3N2GA 4O2AA 4LWIA 4YKUA 4CH4A 3FAVA 3ZMZA 3ASOB 4R6ZA 2XAQA 2LFSA 2C2AA 1W59A 1ZWIC 4MVQA 3B27A 5KMGA 1YIJV 3E89A 4IT5A 2XUMA 1QR8A 1UJWB 3K59A 4MPEA 1SF9A 2YEBA 4GEEA 1AILA 4UUJC 4B3SB 2XASA 1YDXA 3M8AA 3H80A 3APOA 2YE7A 2A7WA 2GTAA 3QO5A 3FT5A 4V26A 3IFXA 2XX2A 4URNA 3R4MA 1GKFA 1OJHA 4EGHA 3TETA 1QQCA 2IWUA 2XJXA 3CCJV 3IAYA 2BREA 1GRJA 3HKDB 3LDEA 4X88A 4I55B 5IWAB 4RQFA 2PYJA 1S77D 2QR4A 1YSZA 3VQXA 4E00A 1GM7A 3T0ZA 2Q8VA 5ITZA 4MTXA 2AGAA 1N0JA 4DV4O 4YKXA 4LF7O 4NXNB 5JH7A 1DF5A 1PL0A 2YI9A 1D5AA 5EK0A 3B4SA 1D5NA 2YE3A 4QJFB 1SA0B 3ABUA 4DO2A 3OE7G 4R50A 2IWXA 4RO2A 3L74H 3CXHF 5DM6V 4BW9A 1KU9A 1NR1A 2DE0X 2DYSC 1ZX3A 3ABKB 1OZ0A 2VQFB 2LJ2A 3QDDA 3M99B 4JQLA 2YEHA 2JS3A 2C1GA 1G8MA 2L6LA 4H81A 1YERA 2XJGA 2NN4A 3SPGA 1Y74B 1Y8NA 1UY7A 2YEFA 3THOA 2X7RB 5J9PC 4GKKO 4MW8A 3INXA 2YGFA 2YE2A 4UCSA 1QLNA 3OTOO 4XIPA 2YIBD 5KX5B 1MZFA 4O4JB 1BYQA 3JASA 1YETA 1AH8A 3IC7A 3OEHG 5LHIA 2ZNJA 2OTJV 4DV7B 2ETNA 5LP6C 3WG7C 1VQ6V 2WPDG 5IY5C 1SERA 3HPLC 2WLMA 2B5UA 4V25A 1OCCC 4EEHA 1YXBA 5B1NA 3SJBC 2E5LB 2CH7A 3CRRA 3VHCA 4CH6A 2HP8A 4LF8O 5EZYA 3DGEA 1IBMO 2B1GA 2VWCA 1MG1A 3K79A 4O4LB 2E76B 4ZOLB 3UCSC 3TCUA 4LFBO 3SR2C 3PEJA 4TOIA 1H2NA 4BW5A 3E86A 5J2UB 3K3WA 4YY3O 1LR1A 4LCUC 4CWPA 4JI3O 4GX0A 4UXNA 5D6QA 4MB9A 3ZX6A 3DXRA 2EZPA 1MU5A 4IHJB 1HDJA 2DYSB 1OCOC 4AQYO 4B3TB 2O1WA 3ZRVA 1VQMV 1JFFA 1AM1A 2Y48A 1UYCA 3T1HO 5IJ9A 2QEXV 3C0EA 4O07A 3HYZA 3K5LA 2Q7GA 2HCHA 2Q68A 2YUAA 2IW5A 3PEHA 1GN6A 2XAGA 3SYCA 1YS3A 4LF9B 3OW6A 2BU7A 1N32B 1FXHA 2ZQMA 4O0BA 4E72A 1N33B 2JJCA 1KECA 3U2DA 2CDYA 1CP9A 3EHBB 4GUNA 3WG7B 3L9DA 5LP6B 1B6QA 5IT9N 3FKSG 5IY5B 3OM3B 4MVZA 3JATB 1YF2A 1OCZC 5J2TA 1AI5A 1Q43A 1OCCB 3RFRA 2WWWA 3Q4HB 1Y76B 1THNA 3TUHA 2FB5A 2IM9A 1GMGA 4I9WA 4UCRA 3CEIA 4DV3O 1MSWD 2VQEO 4XDLA 3RYIB 1JM6A 5JCOA 4BIUA 4GYCB 1AJ6A 4EB6A 4NTYA 3F7YC 4H13B 4DUZB 1GN3A 2YXLA 4X1YA 3CYOA 2DOSA 1IBLO 3C3TA 1M57C 3JAKA 4YHHO 1YEWA 5K1PA 5JQGA 2ZKOA 4BIOA 2WERA 1GM8A 3ZHRA 2P4KA 2FWYA 2A06H 1VIBA 5HFMA 1K33A 3LMMA 4KL1A 1OCOB 5L3CA 2ZE8A 4R7CA 4WCEV 1N34O 4YKQA 5D7RA 2QKCA 3ZRWA 1AROP 2IJJA 2IH1C 3STLC 5EC1C 3ABMC 1GM9A 1H2LA 5F3KA 3IC9A 1KB9F 3RYFB 4B3SO 1XMQB 2LW7A 2QWNB 1BZKA 3KG2A 1KQSU 3QO8A 3CCVV 2JRIA 2XT9A 1VQOV 2PGGA 3UKMA 4FM2A 1U0ZA 2BTZA 4DR5B 1D2DA 3RT3C 2WI4A 3X2QC 4MVRA 1QNMA 5IWAO 5EYPB 5LGTA 2R72A 2GV9A 3K97A 2CGOA 3ML0A 1JOYA 4LPBA 4GZRB 4JV5O 3HR0A 1UFIA 3FB6C 1OCZB 3ETEA 4DZYA 3M7MX 5B5EZ 1K3EA 1MZEA 4AILC 3LSSA 2OIEA 3HKEA 4NXNO 4YKTA 3W7TA 2QTOA 3JSNA 1JPXA 4JAVA 2BU5A 5C93A 2QTSA 2DWDC 1TUBA 3E2EA 2DQ3A 3E22B 1B63A 1UYMA 5CBFA 4FLUA 2GUZA 4CWOA 2XDXA 5F2VO 2OWOA 1XNQB 4ASGA 2VQFO 1M57B 1SQGA 3D3IA 3HKDA 4EEQA 1I58A 1R1BA 3ZN0A 3CHXA 3ZEDA 4DUYB 1PNLA 2O57A 4DR4B 2YGEA 1XHXA 3BA9A 4X66B 1Z5BA 3UO2A 1P84F 4JAUA 1Z59A 1ENVA 4J11A 4FCPA 2BSKB 3EXAA 4G2KA 3ZHQA 1KBHA 1QHTA 3SPJA 4UV8A 1OHHG 1AI6A 1VMGA 3L72H 3ABMB 3K99A 5F5RA 3CS5A 3GIEA 1TC0A 2GDSA 3HKBB 3H01A 5B1OA 4DV7O 1ZSPA 3H1IH 4WFHA 1HNZB 1SA0A 3JALB 3RLQA 4X89A 3SJAC 3B26A 3MAQA 1EN4A 1NTKH 4I0XA 2HEPA 3EHHA 3SPCA 3X2QB 4FLYA 5CA0A 2P90A 1XHZA 3U10A 3G6BA 2LGQA 1WA8B 4F6EA 3ZKBA 1Q5OA 1K7DA 2RNBA 4TSFG 4K4OA 1Y74A 3RLRA 5KUKA 5DECA 4PA7A 3ZBHA 2AKPA 5BZBA 2JJ2G 2ZD9A 3VOUA 3SJCC 2JDIG 4LF6B 5FPRA 2IJKA 5D6PA 1JX9A 5BODA 4TV9B 2WLNA 2WAMA 1LUVA 2YJWA 3OGIB 4IYIA 4DW0A 3HZ1A 2M7WA 5B3SC 2W6JG 4J9YB 3H1KH 2XJJA 3CCRV 4BXIA 5BMVA 1TVKB 4I4TB 2WEPA 1B06A 4H7QA 3A0YA 1N32O 3D3QA 4DV0O 3ETGA 1N33O 4MBCA 1THZA 1JCHA 3ZMTA 4NXMO 1M93A 2IU0A 2K1EA 4LWSB 2JEXA 2IJHA 5L3EA 4B7EA 4WFEA 1UPGA 1SKVA 4X20A 4ZHQB 4WBNB 2IBZH 3PJSK 1KP2A 1JR9A 4J10A 3CP1A 4L8JA 2BU2A 2UXDB 4MVMA 1ZL8B 2Q73A 2CE4A 4OGQB 2UU9B 1NU1H 2XHTA 1S5JA 2Q4PA 3K03A 4YKYA 1ZWHA 1UY8A 1XILA 4DW1A 2JK5C 2CTRA 3J81N 1KKDA 5M4MA 1SESA 2UUAB 2ZDYA 2YIDA 4DUZO 1EN6A 4KQVA 2H3OA 1Z5VA 2HVKC 2ITCC 2Q69A 3E8FA 5LOVB 3E83A 2W0FC 2Q0AA 2WLLB 1UYHA 3R4PA 4KSGA 2WLHA 1NTMH 1SQVH 5A9GA 4KFGA 3JZ3A 2XAFA 5CA3A 2KQXA 2HLDG 3I56V 2EULA 1GN2A 2PI4A 5GONB 2WI5A 2JVDA 5B3SB 3LUTB 4YJ3A 5KLVH 1HWYA 1UYIA 3C3SA 1R3JC 5D7DA 2YEGA 1Y8OA 3R65A 4PDLA 4UVCA 4RQEA 3KZIZ 1NS1A 4U3JA 1F23A 4JYAO 4P8OA 2HVJC 3CCEV 1DF4A 2YIBA 2ESAA 3SL2A 3C11A 4DRXB 4JI5B 5IE9A 4U93A 3K5MA 1NBMG 2YE6A 4I3HA 5M4KA 2X6AA 3CB2A 4R1FA 4R3MA 3W7WA 3OT7A 3G7BA 4UROA 2YKEA 1W0KG 3N2KB 1XQ8A 4DXWA 4J7ZA 1MSDA 5CTXA 1SZXA 4Q20A 5LXTB 3WB1A 1V54C 4AWQA 3JARB 4EM7A 1IZ3A 1AP5A 1AH6A 4UVAA 2YE9A 4JF3A 5A2QN 4JI1B 1E1QG 1PM9A 2L35A 3OTFA 3A0WA 3HHUA 2EX3A 2D2CB 1H8HG 2R9IA 4BQJA 4HZ3A 4UCVA 4MW3A 5L3FA 4X62B 1XNQO 1UYKA 2C1IA 1VQ8V 4DYLA 1DK1A 1U97A 4DUYO 4FK5C 3CCLV 2P7TC 4LF4B 4DR4O 3CPWU 2LFRA 4ZI7B 1PP9H 3FB8C 4X66O 2IOQA 2P6JA 1UY9A 4PA6A 4LH7A 4ASBA 1YJNV 2X0LA 3D0BA 3K08A 1E1RG 1YVWA 1ORQC 4LF5O 4WUCA 2BYIA 1NVPD 1KKCA 3IEDA 3ICXA 2XDUA 4TV8B 1SZTA 2WI1A 3ZKDA 5B1BC 4UCTA 1HNZO 1VF6C 3RYCA 1GO3F 2YS8A 1ID0A 4LC1A 1SQFA 1GJVA 4QIWF 3VHAA 4CWSA 4O2BB 4R3AA 2Q9LA 2WLIB 3JCUZ 3HKCB 3CCUV 1XDCA 3WU2Z 1TBWA 4X1IA 4FLXA 2OT5A 3I5DA 2QDOA 1VQLV 2LP7A 3ETDA 1Y66A 3P3NA 1S3JA 4O4IB 4YIOA 5IDJA 4LFCO 4L93A 1I94B 1FS0G 2RQ6A 3CJHB 4LFAB 4FIPC 2VCIA 2QKAA 1V54B 1VQPV 2PNRA 4ASAA 1TIDA 4JI0B 4IGGA 4DR1O 1H7SA 3OMNB 1VQKV 3K04A 2BTOA 4PHZA 2UUBB 2WA4A 3AG1C 4FCQA 4E2LA 1BXDA 4J80A 3D36C 4DR6B 1GKXA 2QF6A 2AW9A 1OSFA 3J80N 5D7CA 2ZE5A 1VQ4V 2XAHA 5IYCO 2Y0PA 3W7XA 2XCMA 2DWEC 3VBBA 5IJ0B 3T4ZA 2ZNIA 4RUEA 1F51A 4PD4F 4TQFA 1QCEA 1L0NH 4NYKA 4GX2A 3LDCA 2ZIMA 4J7KA 1UYEA 2HKJA 4E02A 3AEIA 3MNRP 1QU7A 2Y4TA 1HNWB 1TGOA 3OGCC 5LYJB 1NHIA 4XD8A 4XDJA 1IX9A 5B1BB 4P9PA 5JVDA 4NH7A 1K34A 4UCUA 1PV0A 1K97A 5L3DA 2H8MA 2CG9A 4I50B 3RVYA 1I5YA 2XNDG 2XOKG 3E8GA 2AZ0A 3ZXQA 2BTQB 4HZ5A 2RDCA 2IORA 1HP8A 2F66C 2DW4A 2UU9O 4UB8Z 2YK2A 4CWTA 4DR7B 3K58A 1L0OA 3GWOA 3AG4C 1RPRA 3B2EE 1WB7A 4FFBA 3UT5B 3JSLA 4PELA 3T1YO 1NHJA 5FWKA 4DR3B 5CTYA 3R4NA 2KSDA 4QE7A 3JD3A 4K35A 4TUYB 1NVPB 5KHHA 1X59A 4PA3A 1H2KA 2P06A 1AB3A 5DEDA 1K4CC 4HXWA 3AG1B 4HY6A 4G28B 2EJ7A 1N8RW 1J5EB 3ZCCA 4CH3A 2ZM6B 1SQXH 5GTHZ 5LA6A 3ZJZA 4K0KB 4KP4A 2YEIA 4QPJA 1G1XB 1M56C 3FFQA 4X1KB 4B3RB 2Q5ZA 1AI4A 3ZM7A 1CEZA 2YXHA 1MABG 2WLKA 2YXYA 1I5CA 4B7PA 4WFGA 1ZTEA 3FV5A 2N04A 5LMUB 3G4SV 1RSOA 2F4VB 3RBZA 5FPOA 3B24A 5CB4A 3H1JH 4JI5O 5CBGA 3CC4V 2ATKC 4WFFA 1GN4A 5EIBD 3CMEV 4CS3A 5LOVA 4JI2O 1BT8A 2WLLA 3L71H 4FLVA 2E0AA 2OCCC 4B3MB 3ZHSA 2JGDA 5CTWA 4LR3A 4URMA 4F6RB 4J41A 3H9VA 4CWQA 3R91A 3AG4B 1FXKC 1BE3H 2AZ2A 4KSHA 3T0HA 2ZCEA 4ICGA 1TC6A 3ZHTA 1H8EG 5FL7G 5CA1A 4EFTA 3G71V 4P30A 3SJQC 2RCVA 2IU3A 4UV9A 4P9OA 4UVBA 3CWBH 4OX9B 1M5IA 2HHHB 3JAWB 2CTWA 4EFEA 5KHIA 2ITDC 2CH4A 1CXZB 2YEVB 2LO1A 3IJ4A 3GIGB 4JYYA 4MVSA 1MMMA 4W4LA 2F23A 1M1KW 3QTCA 1Y4MA 4URLA 1S76D 5EIBC 1Q90D 2P5OA 3EKRA 1NR7A 2R70A 5LGUA 1A4HA 4HNAB 1M56B 3S3WA 3HZ5A 3TGUH 4JI7B 1YITV 1XL6A 1FYJA 3CYGA 2ZR3A 1KD1W 2R9RB 2XHXA 3AK2A 1I59A 4EMVA 4LWFA 2BSMA 3K5NA 1R73A 4JPRA 4IIJB 3RYHB 2UUCB 2KG7A 3ABLB 5D5QA 2Q7HA 2WA3A 3G7EA 1IXBA 2F43G 1WPBA 1RPOA 2QE7G 2PYLA 1O9HA 5KAFZ 2ZBKB 1I7FA 4CC5A 2F1MA 2OCCB 4WF9V 4CH5A 1I94O 1XI1A 1H2GA 1BCCH 1VQ7V 4LNUB 3BPZA 4HYPA 1FXKB 3N2GB 5IN9A 4O09A 1XL4A 4JTDB 3AG7A 3HB3B 2QGNA 4L8ZA 4W4KA 1NKDA 2XDLA 1BHAA 4U3FH 1Q6IA 1J95A 5IYDO 2A3QA 4PRVA 3SYPA 1Q3EA 4DR6O 3D2RA 2XX5A 1Z2GA 1QBZA 1US6A 4I55A 5K1XA 4GQTA 3T2SA 2G38A 5LL6Y 4DK0A 1EM1A 4UCOA 4MOTA 1PL4A 2YICA 3MHHC 1WP8A 3EHGA 3ZRSA 3BA8A 4CWFA 1LUWA 3RN4A 2QFOA 2YEDA 3BY6A 1VEWA 2PZSA 3MDSA 4WFBV 2P67A 1B62A 3CCSV 4KUMA 3OPDA 5ITZB 2ADPA 1I5AA 2YC0A 2YKJA 5H9CA 1HNWO 2YKBA 1GAXA 3EFFK 2UWDA 3EHJA 4BWAA 1Y4UA 1GTOA 2ADQB 4XITA 4W7TA 2DN9A 2VS0A 3B8NA 1JQ0A 1BKNA 4H37A 3CD6V 4KHPB 1BGQA 1U2OA 4CS4A 1NI8A 3ZHVA 3HYYA 1XOUA 2EINC 2E5LO 2UXBB 4L90A 2EIJC 4DK1A 3JD1A 4GT8A 4WFAV 3T1KA 4ASFA 3CC7V 5FNCA 3GVMA 1PNKA 2AHYA 4NTWA 3Q5LA 4X64B 1RM1C 2HR3A 4ZBMA 1M90W 3SGIA 2HG5C 3B8MA 2WSSG 5KX5A 3LNUA 4O4JA 1XREA 3ZN1A 4LP0A 3CXCU 3CCMV 1QY8A 1JA8A 1P4RA 3K5OA 3F5TA 1US7A 5JENA 4X8AA 2EIKC 1UY6A 5J6AA 3LNNA 4MVOA 2YKIA 1J5EO 3JASB 4B3TO 1ZUQA 1MX0A 2YK9A 1BS3A 1YC4A 2WLJA 4A5UB 1XNRB 1Y8PA 4K0KO 3CC2V 1UYFA 2E74B 2YI0A 2V1DA 2FTKA 4JGSA 4JI8B 5LMNB 2QM7A 2FWZA 3W7SA 2QWOB 4LF9O 4O4LA 4ZOLA 4PRXA 4FLTA 1XEQA 2CCSA 5M4NA 3FYIB 4EGKA 4MSWC 5KUMA 2CH7B 4Q6GA 1XBLA 2WI2A 5EZYB 2BT0A 4Z1MG 2V7QG 2DYRC 5J2UA 3R4OA 3ASNC 1XMOB 4P7AA 4NVPA 2GFDA 1FFTB 3LSQA 4GKKB 3OWDA 4XIRA 3ZIAG 2LW1A 3JAMN 3SYAA 3L73H 1M9NA 2YE5A 5JCOC 4Z2WA 5LBQA 2YIAA 2Q7EA 3K60A 3I55V 3TZ4A 1KP3A 2UXXA 5CMUA 4YJ2B 1R3IC 4IHJA 3VADA 4N23A 2JKIA 1SQBH 4RUFA 4QE9A 2EINB 1S72V 4B3MO 3QNEA 4YIPA 1K9MW 2EIJB 3DXRB 4FJCC 2EJRA 3QG5A 2DQ0A 4H33A 4MTGA 4O4HB 2Y4UA 3K9SA 4CE1A 1RM1B 3WQ9A 1JFFB 1A32A 2YE8A 5IJ9B 1MA1A 4OX9O 1O9GA 1IBMB 4XTJA 3K06A 3TZ0A 4J42A 4PDVA 2XTAA 1Y4SA 2ZDIC 4AHCA 5LP6A 4DV5B 4MVUA 3CRLA 2EXLA 2EIKB 4E4EA 1SQQH 2LGWA 3JATA 4D7TA 3T2MA 3L75H 2YSUB 2X6BA 3ZMUA 4PDMA 3Q4HA 2VCJA 2B1IA 1W0JG 1Y76A 4FM0A 3H1HH 4JI3B 2O1UA 5H5NA 1GH6A 3OR6C 3OEEG 1WLEA 5E79Z 1QLEC 5EBLC 4CWNA 3JD2A 5KAIZ 1YESA 2ZR2A 1WP7A 4I7ZB 2O1VA 5J2TB 3GIFA 3K57A 1XMQO 2XDSA 4AQYB 2B9ZA 3K0GA 1PPJH 3SPHA 4F4LA 3RYIA 1VQ9V 2YE4A 1ZXNA 1YHQV 2FMLA 1WJZA 3G6EV 5BXZA 3T1HB 3K98A 2DYRB 4DR5O 1S14A 3ASNB 2VW5A 4J7JA 4UB6Z 4K8ZA 4N21A 1QYEA 1Q86W 3O2FA 5M4HA 4FFKA 1UYLA 3NXSA 3P32A 2UUCO 2H8PC 4TWKA 1NHHA 1IVSA 1QVGU 1K8AW 3C90A 2ARHA 4DR2B 1L1FA 4X1YB 2BCCH 3JAKB 4MPCA 1YCIA 3B09A 4HNAA 3FYEB 5EBWC 1NJIW 1Q82W 3RYFA 3SYQA 1URFA 1FD9A 2BOBC 4PI2A 1FKAO 1TA8A 3ZRWB 2NNUA 4JI4B 3CCQV 2QWQB 1JJOA 3OD4A 4G27B 3OUSA 3RWRD 3O9OA 1R6NA 3OMUA 2F93B 2XX4A 1HNXB 4E01A 5E1AC 1TILA 3QVNA 5EYPA 3RGBA 2PI5A 3HEKA 4LWEA 4AI8A 3DC5A 1YC1A 2BU8A 3IGAC 5KHGA 4FMTA 1H2SB 4Z1VA 3EVKA 4I5SA 1QLEB 2N05A 4HBNA 5LGNA 4HXZA 3OW2U 3JD0A 3U0ZA 5JJJB 4PU9A 1Y6XA
chains in the Genus database with same CATH topology
3A0ZA 1SETA 2WI6A 2WI7A 2BYHA 4OXSA 1KZNA 3B28A 2XDKA 1TUEB 3BM9A 2Q6AA 2CCUA 3STZC 4GX5A 4X9LA 3U2KA 1NQTA 4O04A 3WHAA 2HFEC 1K5QA 2ZXWC 1PD3A 1EBOA 1G4YB 3FB7C 3MHSC 2EILC 1FXVA 1AJPA 1LNQA 3OMIB 2JJ1G 3A0TA 2NLJC 1K4DC 3K0DA 2FXSA 2Z5UA 2YEEA 1EI1A 1F4NA 2IJIA 3LPSA 3CMAV 3O0IA 5CTUA 5B1AC 5EC2C 2GQPA 1R3KC 2CK3G 3ZMVA 3CWVA 1BL8A 1MOFA 4GCZA 2YEJA 3ABTA 4LBEC 2H94A 4KTNA 2YI5A 2A0LA 3E35A 4MT8A 4BIZA 4GGLA 1ZW9A 5KA6A 1S0VA 3ZMSA 1AMWA 4HAMA 2JIZG 4JTAB 1AJNA 5CN0A 4MTOA 1PVGA 5IDMA 2ZXWB 1Z5AA 2QG2A 2QKSA 2EILB 3RVZA 3GB7C 4MS2A 4CE2A 1E79G 2ZKJA 1Q7YW 4MTFA 4YXWG 3QO7A 5EBMC 2BOCC 4HYMA 5B1AB 4XDMA 2JEUA 1YC3A 4XKAA 4MP2A 4LP8A 3RKZA 2EIMC 5CPHA 5BOCA 1YSCA 3EKOA 4P2ZA 2WI3A 1H7UA 3Q5JA 2EBOA 2IWSA 5H6QA 4XCLA 3F7VC 4YKZA 1I5XA 4BQGA 2FYPA 3ABLC 3ZXOA 1EA6A 3OFNG 1YJ9V 4XDKA 4MP7A 4CWRA 3LDDA 1BMFG 1P7BA 1YT2A 1S16A 5M4EA 1BHBA 1KC8W 4TT3G 2XAJA 3BMYA 2Z3YA 3WFVA 4L94A 2D3OW 4XCJA 1CPYA 4EGIA 2Q8IA 4XIQA 4HYOA 5J71A 1YSRA 4GFNA 3OUFA 1EZJA 2Y69C 1V55C 4ZKIA 3OR7C 2Q8FA 3RLPA 2XK2A 1ZXMA 2HKOA 1YT1A 3B25A 3BEHA 3K9AA 2EIMB 4JTCB 2A79B 2XABA 4PDRA 5M4PA 2X6CA 4AS9A 3A0XA 3E8HA 3TK1A 5FNDA 3Q5KA 1B3QA 2YKCA 4HZ0A 4QNHB 3AG3C 2GHYA 4LWGA 4WUBA 1KIJA 2ZDIA 4L91A 3RW0A 1F4MA 1WPXA 4WUDA 4JYCA 4R8CA 3H4LA 3OWBA 4XKOA 2EZOA 2QM8A 1GK9A 4B6CA 2YGAA 3G75A 1PNMA 1UYGA 4NH9A 4FCRA 2WLIA 1Z5CA 2Y69B 4ASUG 1V55B 3T1CA 3OAAG 4AWOA 4EFUA 4L87A 5IYBO 2GSMB 4PA4A 3CGYA 5GW7A 2YECA 2CCTA 5DN6G 3INWA 1EFRG 4KFMA 2CGFA 1AI7A 2A9HA 2ZDXA 3QTFA 4HY1A 2BU6A 3TZ5A 3A0RA 2KB1A 3R92A 3AG3B 3U67A 3E8BA 1IXMA 1UYDA 1S5HC 2H55A 3MD0A 2W6IG 3LNMB 4GT1A 2Q2EB 3OMAB 4BAYA 1JJ2U 1AR1B 1R62A 4FPPA 3AG2C 4U7NA 1YI2V 3P30A 1Q81W 3SPIA 4BAEA 5LHGA 2XD6A 4CBCA 3JD4A 4YKRA 2UXNA 5L3BA 5FNFA 2QA4V 1AJQA 1K73W 4JYBA 1ROPA 1YTFD 1NH2D 4MPNA 3UM7A 1VQNV 3EHFA 2YJXA 3CGZA 4XKKA 3FT8A 2Q8GA 2OTLV 2IOPA 3DTUB 3D36A 3W7UA 1QVFU 3JYCA 2XHRA 5GGZA 1VQ5V 2HJFC 3TZ2A 3ZRXA 5CF0A 1YJWV 3JCZA 3AG2B 2HG1A 2AHZA 4RAIA 1DLBA 5LHHA 1PKXA 2WEQA 4YKWA 3FB5C 5KA5A 2K5BA 1I5DA 1OCRC 4PL9A 3O6OA 4NH8A 3NMQA 5L3JA 3T10A 1R6KA 3TTZA 3KE6A 1TH8A 5H6RA 4U7OA 4AWPA 3ASOC 1QR9A 4XBFA 3CRKA 4H85A 3F5WC 1K92A 4J9ZB 1YT0A 2YEAA 4O05A 2YEVA 3GIGA 4PA9A 4DUHA 4QPKA 2YI6A 5HFLA 4LWHA 3VHDA 1GKZA 1R3LC 2YI7A 4GX1A 2BRCA 3B77A 1DTOA 2MK3A 4CE3A 3SYOA 1W2BU 1YTFB 4CZZA 1JVMA 1K5SA 2Q67A 1NH2B 4ZVIA 1I5BA 5L3GA 2BZ5A 3T4DA 1OCRB 1H38A 4XE2A 2IH3C 1QZRA 4XC0A 2QG0A 3ABKC 1COWG 2Q8HA 5CBHA 1SRYA 4EKWA 1FXKA 4JASA 4LWIA 4YKUA 3ZMZA 3ASOB 4R6ZA 2XAQA 2LFSA 2C2AA 1ZWIC 4MVQA 3B27A 1YIJV 3E89A 1QR8A 1UJWB 4MPEA 2YEBA 4GEEA 4UUJC 2XASA 3H80A 2YE7A 3QO5A 3FT5A 4V26A 3IFXA 2XX2A 4URNA 3R4MA 1GKFA 4EGHA 3TETA 2IWUA 2XJXA 3CCJV 2BREA 3LDEA 4X88A 4RQFA 1S77D 1YSZA 4E00A 1GM7A 3T0ZA 4MTXA 4YKXA 1DF5A 1PL0A 5EK0A 2YE3A 4QJFB 3ABUA 4DO2A 3OE7G 4R50A 2IWXA 4RO2A 5DM6V 1NR1A 2DYSC 3ABKB 1OZ0A 4JQLA 3QDDA 3M99B 2YEHA 1G8MA 4H81A 1YERA 2XJGA 3SPGA 1Y8NA 1UY7A 2YEFA 2X7RB 5J9PC 4MW8A 3INXA 2YGFA 2YE2A 1QLNA 4XIPA 1BYQA 1YETA 1AH8A 3IC7A 3OEHG 5LHIA 2OTJV 1VQ6V 3WG7C 2WPDG 5IY5C 1SERA 3HPLC 2WLMA 2B5UA 4V25A 1OCCC 4EEHA 5B1NA 3VHCA 3DGEA 2B1GA 2VWCA 1MG1A 3K79A 3TCUA 3PEJA 4BW5A 3E86A 3K3WA 4LCUC 4CWPA 4GX0A 4UXNA 5D6QA 4MB9A 2EZPA 1MU5A 2DYSB 1OCOC 2O1WA 3ZRVA 1VQMV 1AM1A 2Y48A 1UYCA 3C0EA 2QEXV 4O07A 3HYZA 2HCHA 2Q68A 2IW5A 3PEHA 2XAGA 1YS3A 3SYCA 3OW6A 2BU7A 1FXHA 2ZQMA 4O0BA 2JJCA 1KECA 3U2DA 1CP9A 3EHBB 3WG7B 1B6QA 3FKSG 5IY5B 3OM3B 4MVZA 1OCZC 1AI5A 1OCCB 2WWWA 1THNA 3TUHA 1GMGA 4I9WA 1MSWD 1JM6A 4XDLA 4BIUA 1AJ6A 3F7YC 3CYOA 1M57C 2WERA 1GM8A 2FWYA 5HFMA 1K33A 1OCOB 5L3CA 4R7CA 4WCEV 4YKQA 5D7RA 3ZRWA 1AROP 2IJJA 2IH1C 3STLC 5EC1C 3ABMC 1GM9A 5F3KA 3KG2A 1KQSU 3QO8A 3CCVV 1VQOV 3UKMA 1U0ZA 2BTZA 2WI4A 3X2QC 4MVRA 5LGTA 3K97A 3ML0A 1JOYA 4LPBA 3FB6C 1OCZB 3ETEA 4DZYA 1K3EA 3LSSA 4YKTA 3W7TA 2QTOA 1JPXA 4JAVA 2BU5A 5C93A 2DWDC 3E2EA 2DQ3A 1B63A 1UYMA 5CBFA 4CWOA 2XDXA 4ASGA 1M57B 3D3IA 1I58A 3ZN0A 1PNLA 2YGEA 1Z5BA 4JAUA 1Z59A 1ENVA 4FCPA 4G2KA 3SPJA 4UV8A 1OHHG 1AI6A 5F5RA 3ABMB 3K99A 3GIEA 1TC0A 3H01A 5B1OA 4WFHA 3RLQA 4X89A 3B26A 3EHHA 3SPCA 3X2QB 2P90A 3ZKBA 1K7DA 4TSFG 4K4OA 3RLRA 5KUKA 4PA7A 2AKPA 5BZBA 2JJ2G 2ZD9A 3VOUA 2JDIG 2IJKA 5D6PA 1JX9A 5BODA 2WLNA 2WAMA 2YJWA 3HZ1A 2M7WA 5B3SC 2W6JG 4J9YB 2XJJA 4BXIA 3CCRV 2WEPA 4H7QA 3A0YA 3ETGA 4MBCA 1THZA 1JCHA 3ZMTA 2IU0A 2K1EA 2JEXA 2IJHA 5L3EA 4WFEA 3PJSK 1KP2A 3CP1A 2BU2A 4MVMA 2XHTA 3K03A 4YKYA 1ZWHA 1UY8A 2JK5C 1KKDA 5M4MA 1SESA 2ZDYA 4KQVA 2HVKC 2ITCC 2Q69A 3E8FA 3E83A 2W0FC 3R4PA 2WLLB 1UYHA 4KSGA 2WLHA 4KFGA 3JZ3A 2XAFA 5CA3A 2HLDG 3I56V 2PI4A 2WI5A 5B3SB 3LUTB 1HWYA 1UYIA 1R3JC 5D7DA 2YEGA 1Y8OA 3R65A 4PDLA 4UVCA 4RQEA 1F23A 4P8OA 2HVJC 3CCEV 1DF4A 2ESAA 3SL2A 3C11A 4U93A 1NBMG 2YE6A 4I3HA 5M4KA 2X6AA 4R1FA 4R3MA 3W7WA 3G7BA 4UROA 2YKEA 1W0KG 4DXWA 5CTXA 4Q20A 1V54C 4AWQA 4EM7A 2YE9A 1AH6A 4UVAA 4JF3A 1E1QG 3A0WA 3HHUA 1H8HG 2R9IA 4BQJA 4HZ3A 4MW3A 5L3FA 1UYKA 1VQ8V 4FK5C 3CCLV 2P7TC 3CPWU 2LFRA 3FB8C 2IOQA 2P6JA 1UY9A 4PA6A 4ASBA 1YJNV 2X0LA 3D0BA 3K08A 1E1RG 1ORQC 4WUCA 2BYIA 1NVPD 3IEDA 2XDUA 1SZTA 2WI1A 3ZKDA 5B1BC 1GO3F 1ID0A 4LC1A 1GJVA 4QIWF 3VHAA 4CWSA 4R3AA 2WLIB 3CCUV 1TBWA 2OT5A 1VQLV 2LP7A 3ETDA 1Y66A 1S3JA 5IDJA 4L93A 1FS0G 4FIPC 2VCIA 1V54B 1VQPV 4ASAA 2PNRA 1TIDA 1H7SA 3OMNB 1VQKV 3K04A 3AG1C 4FCQA 4E2LA 1BXDA 1GKXA 2QF6A 1OSFA 5D7CA 1VQ4V 2XAHA 5IYCO 3W7XA 2XCMA 2DWEC 3VBBA 3T4ZA 4RUEA 1F51A 1QCEA 4GX2A 3LDCA 1UYEA 2HKJA 4E02A 3AEIA 3MNRP 3OGCC 1NHIA 4XD8A 4XDJA 5B1BB 4P9PA 4NH7A 1K34A 1K97A 5L3DA 2H8MA 2CG9A 3RVYA 1I5YA 2XNDG 2XOKG 3E8GA 3ZXQA 4HZ5A 2IORA 2DW4A 2YK2A 4CWTA 1L0OA 3GWOA 3AG4C 1RPRA 4PELA 1NHJA 5FWKA 5CTYA 3R4NA 4QE7A 3JD3A 1NVPB 4PA3A 1K4CC 4HXWA 3AG1B 4HY6A 4G28B 1N8RW 3ZCCA 3ZJZA 4KP4A 2YEIA 4QPJA 1M56C 1AI4A 3ZM7A 1CEZA 1MABG 2WLKA 1I5CA 4B7PA 4WFGA 3FV5A 3G4SV 3RBZA 3B24A 5CBGA 3CC4V 2ATKC 4WFFA 3CMEV 2WLLA 2E0AA 2OCCC 5CTWA 4URMA 4CWQA 3R91A 3AG4B 1FXKC 4KSHA 3T0HA 1TC6A 1H8EG 5FL7G 4EFTA 3G71V 4P30A 3SJQC 4UV9A 2IU3A 4P9OA 4UVBA 2ITDC 2CH4A 2YEVB 3GIGB 4MVSA 1M1KW 1Y4MA 4URLA 1S76D 3EKRA 1NR7A 5LGUA 1A4HA 1M56B 3HZ5A 1YITV 1XL6A 2ZR3A 1KD1W 2R9RB 2XHXA 1I59A 4EMVA 4LWFA 2BSMA 1R73A 4JPRA 3ABLB 3G7EA 2F43G 1RPOA 2QE7G 2ZBKB 4WF9V 2OCCB 1H2GA 1VQ7V 4HYPA 1FXKB 5IN9A 4O09A 1XL4A 4JTDB 3HB3B 4L8ZA 1NKDA 2XDLA 1BHAA 1J95A 5IYDO 4PRVA 3SYPA 3D2RA 2XX5A 1QBZA 4GQTA 3T2SA 4MOTA 3MHHC 3EHGA 3ZRSA 4CWFA 2QFOA 2YEDA 3BY6A 4WFBV 2P67A 1B62A 3CCSV 4KUMA 3OPDA 1I5AA 2YKJA 5H9CA 2YKBA 3EFFK 2UWDA 3EHJA 1Y4UA 1GTOA 4XITA 4W7TA 3B8NA 1JQ0A 1BKNA 4H37A 3CD6V 1BGQA 1U2OA 3HYYA 2EINC 4L90A 2EIJC 3JD1A 4GT8A 4WFAV 3T1KA 4ASFA 3CC7V 5FNCA 1PNKA 2AHYA 3Q5LA 1RM1C 2HR3A 4ZBMA 1M90W 2HG5C 3B8MA 2WSSG 3LNUA 3ZN1A 4LP0A 3CXCU 3CCMV 1QY8A 1P4RA 1US7A 4X8AA 2EIKC 1UY6A 5J6AA 4MVOA 2YKIA 1MX0A 2YK9A 1YC4A 2WLJA 1Y8PA 3CC2V 1UYFA 2YI0A 2V1DA 2FTKA 4JGSA 2QM7A 2FWZA 3W7SA 4PRXA 2CCSA 5M4NA 3FYIB 4EGKA 4MSWC 5KUMA 2WI2A 2BT0A 4Z1MG 2V7QG 2DYRC 3R4OA 3ASNC 4P7AA 2GFDA 1FFTB 3LSQA 3OWDA 4XIRA 3ZIAG 3SYAA 1M9NA 2YE5A 3K60A 5LBQA 3I55V 3TZ4A 1KP3A 2UXXA 5CMUA 1R3IC 3VADA 4N23A 2JKIA 4RUFA 4QE9A 2EINB 1S72V 3QNEA 1K9MW 2EIJB 4FJCC 2EJRA 2DQ0A 4H33A 4MTGA 4CE1A 1RM1B 3WQ9A 2YE8A 4XTJA 3K06A 3TZ0A 4PDVA 1Y4SA 2ZDIC 4MVUA 3CRLA 2EXLA 2EIKB 3T2MA 2YSUB 2X6BA 3ZMUA 4PDMA 2VCJA 2B1IA 1W0JG 2O1UA 3OR6C 3OEEG 1WLEA 1QLEC 5EBLC 4CWNA 3JD2A 1YESA 2ZR2A 2O1VA 3GIFA 2XDSA 3K0GA 4F4LA 3SPHA 1VQ9V 2YE4A 1ZXNA 1YHQV 3G6EV 3K98A 2DYRB 1S14A 2VW5A 3ASNB 4N21A 1QYEA 1Q86W 3O2FA 5M4HA 1UYLA 3NXSA 3P32A 2H8PC 4TWKA 1NHHA 1QVGU 1K8AW 1L1FA 4MPCA 3FYEB 5EBWC 1NJIW 1Q82W 3SYQA 2BOBC 3ZRWB 2NNUA 3CCQV 4G27B 3OUSA 1R6NA 3OMUA 2XX4A 4E01A 5E1AC 1TILA 2PI5A 3HEKA 4LWEA 1YC1A 2BU8A 3IGAC 4FMTA 4I5SA 1QLEB 4HXZA 5LGNA 3OW2U 3JD0A 4PU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0Z A;  4JAV A;  3TZ2 A;  2BU5 A;  2WI6 A;  5C93 A;  3ZRX A;  2WI7 A;  4KP4 A;  2YEI A;  4QPJ A;  2BYH A;  1KZN A;  5CF0 A;  3B28 A;  2XDK A;  1B63 A;  1UYM A;  3BM9 A;  2CCU A;  3ZM7 A;  2HG1 A;  4X9L A;  4CWO A;  2XDX A;  1I5C A;  4ASG A;  4B7P A;  3U2K A;  2WEQ A;  4O04 A;  4YKW A;  3FV5 A;  1I58 A;  3WHA A;  2YGE A;  2K5B A;  1I5D A;  1Z5B A;  3B24 A;  4PL9 A;  3O6O A;  4JAU A;  1Z59 A;  4NH8 A;  3A0T A;  3NMQ A;  4FCP A;  5L3J A;  2FXS A;  3T10 A;  2E0A A;  5F5R A;  3K99 A;  3GIE A;  1TC0 A;  3TTZ A;  3KE6 A;  2YEE A;  1EI1 A;  1TH8 A;  5CTW A;  5B1O A;  4U7O A;  3LPS A;  4URM A;  4AWP A;  4CWQ A;  3O0I A;  5CTU A;  3R91 A;  3RLQ A;  3B26 A;  2GQP A;  4KSH A;  3T0H A;  3EHH A;  3CRK A;  4H85 A;  1TC6 A;  4EFT A;  1YT0 A;  2YEA A;  4O05 A;  3CWV A;  3GIG A;  3ZKB A;  4DUH A;  4QPK A;  2YI6 A;  4K4O A;  4GCZ A;  2CH4 A;  2YEJ A;  3RLR A;  3GIG B;  4LWH A;  3VHD A;  1GKZ A;  2AKP A;  4KTN A;  2YI5 A;  4URL A;  2YI7 A;  3EKR A;  2BRC A;  4MT8 A;  4BIZ A;  4GGL A;  1A4H A;  5D6P A;  5BOD A;  3HZ5 A;  1ZW9 A;  4CE3 A;  2YJW A;  4ZVI A;  1AMW A;  1I5B A;  3HZ1 A;  2BZ5 A;  2XHX A;  1PVG A;  5IDM A;  1I59 A;  4EMV A;  1Z5A A;  4LWF A;  2BSM A;  2QG2 A;  4XE2 A;  2XJJ A;  4BXI A;  1QZR A;  4XC0 A;  4CE2 A;  2WEP A;  2QG0 A;  3G7E A;  4H7Q A;  3A0Y A;  2Q8H A;  2ZBK B;  2ZKJ A;  4MBC A;  4JAS A;  4LWI A;  4YKU A;  4HYM A;  2LFS A;  2C2A A;  4HYP A;  4XDM A;  3B27 A;  1YC3 A;  5IN9 A;  4O09 A;  4XKA A;  4MP2 A;  3RKZ A;  4L8Z A;  4MPE A;  5CPH A;  2YEB A;  2BU2 A;  4GEE A;  2XDL A;  5BOC A;  3EKO A;  3H80 A;  2YE7 A;  3FT5 A;  4V26 A;  2XHT A;  4PRV A;  2WI3 A;  2XX2 A;  4URN A;  3D2R A;  2XX5 A;  3R4M A;  4GQT A;  4EGH A;  3T2S A;  1H7U A;  2IWU A;  4YKY A;  1ZWH A;  1UY8 A;  2XJX A;  3Q5J A;  2IWS A;  2BRE A;  4MOT A;  4XCL A;  4YKZ A;  5M4M A;  3EHG A;  4BQG A;  2ZDY A;  2FYP A;  1YSZ A;  4E00 A;  3ZXO A;  4CWF A;  1EA6 A;  2QFO A;  3T0Z A;  2YED A;  4KQV A;  4MTX A;  2P67 A;  4YKX A;  4MP7 A;  1B62 A;  3OPD A;  1I5A A;  3R4P A;  1UYH A;  2YKJ A;  4KSG A;  4CWR A;  2YKB A;  1YT2 A;  1S16 A;  3EHJ A;  2UWD A;  5M4E A;  4KFG A;  3JZ3 A;  1Y4U A;  4XIT A;  2YE3 A;  4W7T A;  3BMY A;  1BKN A;  2IWX A;  4L94 A;  1BGQ A;  1U2O A;  2WI5 A;  3HYY A;  4XCJ A;  4EGI A;  2Q8I A;  1UYI A;  4XIQ A;  5D7D A;  2YEG A;  4JQL A;  4L90 A;  3QDD A;  5J71 A;  1Y8O A;  2YEH A;  1YSR A;  4H81 A;  1YER A;  4GT8 A;  4ASF A;  4P8O A;  3T1K A;  4GFN A;  5FNC A;  2XJG A;  1Y8N A;  2ESA A;  3Q5L A;  3SL2 A;  1UY7 A;  2YEF A;  4ZKI A;  3C11 A;  4U93 A;  3LNU A;  3INX A;  2Q8F A;  2YE6 A;  2YGF A;  2YE2 A;  4I3H A;  4LP0 A;  3RLP A;  5M4K A;  2XK2 A;  1ZXM A;  1YT1 A;  1QY8 A;  3B25 A;  4XIP A;  4R1F A;  1BYQ A;  4R3M A;  1US7 A;  1YET A;  3G7B A;  1AH8 A;  4URO A;  1UY6 A;  2XAB A;  2YKE A;  5J6A A;  5M4P A;  2YKI A;  5CTX A;  4AS9 A;  1MX0 A;  4Q20 A;  3A0X A;  2YK9 A;  3TK1 A;  1YC4 A;  4AWQ A;  1Y8P A;  5FND A;  4EM7 A;  2YE9 A;  1AH6 A;  3Q5K A;  4V25 A;  1B3Q A;  1UYF A;  2YKC A;  4HZ0 A;  2YI0 A;  4EEH A;  3A0W A;  3HHU A;  5B1N A;  2FTK A;  4BQJ A;  4LWG A;  4WUB A;  2QM7 A;  1KIJ A;  2FWZ A;  3VHC A;  4L91 A;  3DGE A;  1UYK A;  4PRX A;  2VWC A;  2CCS A;  5M4N A;  4EGK A;  4WUD A;  4JYC A;  2WI2 A;  2BT0 A;  3H4L A;  3R4O A;  4P7A A;  3OWB A;  4XKO A;  2LFR A;  2GFD A;  3PEJ A;  2QM8 A;  3OWD A;  2IOQ A;  4XIR A;  1UY9 A;  2YE5 A;  4ASB A;  3K60 A;  4B6C A;  2YGA A;  3D0B A;  3TZ4 A;  4CWP A;  3G75 A;  4WUC A;  2BYI A;  3VAD A;  5D6Q A;  2JKI A;  4MB9 A;  3IED A;  2XDU A;  1MU5 A;  2WI1 A;  1UYG A;  3ZKD A;  4NH9 A;  4FCR A;  2O1W A;  3ZRV A;  1AM1 A;  1ID0 A;  4LC1 A;  1GJV A;  1UYC A;  1Z5C A;  3VHA A;  4CWS A;  3C0E A;  4R3A A;  4CE1 A;  4O07 A;  3HYZ A;  3WQ9 A;  4AWO A;  2HCH A;  4EFU A;  1TBW A;  2YE8 A;  3PEH A;  3CGY A;  3OW6 A;  1YS3 A;  2BU7 A;  2YEC A;  2CCT A;  3INW A;  4XTJ A;  4O0B A;  3TZ0 A;  1Y4S A;  3CRL A;  5IDJ A;  2EXL A;  4L93 A;  2JJC A;  3U2D A;  2CGF A;  2ZDX A;  3QTF A;  4HY1 A;  2VCI A;  2BU6 A;  2PNR A;  2VCJ A;  3TZ5 A;  1TID A;  4ASA A;  1H7S A;  3A0R A;  2O1U A;  2WWW A;  4CWN A;  4FCQ A;  1BXD A;  1YES A;  3R92 A;  1THN A;  2O1V A;  3TUH A;  3GIF A;  2XDS A;  3U67 A;  1GKX A;  2QF6 A;  1OSF A;  1IXM A;  1UYD A;  2YE4 A;  1ZXN A;  5D7C A;  2H55 A;  3MD0 A;  1JM6 A;  3K98 A;  4GT1 A;  2Q2E B;  1S14 A;  2VW5 A;  2XCM A;  1R62 A;  4FPP A;  4BIU A;  1F51 A;  1AJ6 A;  1QYE A;  3O2F A;  5M4H A;  1UYL A;  3NXS A;  3P32 A;  4U7N A;  1NHH A;  2WER A;  1UYE A;  2HKJ A;  4E02 A;  2FWY A;  3MNR P;  1NHI A;  4XD8 A;  4BAE A;  4MPC A;  2XD6 A;  4YKQ A;  5D7R A;  3ZRW A;  4NH7 A;  4YKR A;  2H8M A;  2CG9 A;  3ZRW B;  3ZXQ A;  5F3K A;  5FNF A;  4HZ5 A;  2IOR A;  2YK2 A;  3OMU A;  4CWT A;  1L0O A;  2XX4 A;  4E01 A;  1TIL A;  1U0Z A;  2BTZ A;  4JYB A;  4MPN A;  2WI4 A;  3EHF A;  1NHJ A;  2YJX A;  5FWK A;  3CGZ A;  4XKK A;  3FT8 A;  2Q8G A;  3HEK A;  4LWE A;  5CTY A;  3R4N A;  1YC1 A;  2BU8 A;  3K97 A;  2IOP A;  1JOY A;  4FMT A;  4LPB A;  4I5S A;  4DZY A;  4HXZ A;  3D36 A;  4HXW A;  4HY6 A;  2XHR A;  4PU9 A;  5GGZ A;  4YKT A;  3ZCC A; 
#chains in the Genus database with same CATH topology
 3A0Z A;  1SET A;  2WI6 A;  2WI7 A;  3E22 A;  1N34 B;  3HKE B;  4IL6 Z;  2K9P A;  2BYH A;  4OXS A;  1KZN A;  3B28 A;  2XDK A;  1TUE B;  3BM9 A;  2DMX A;  2Q6A A;  4KHP O;  2CCU A;  1TUB B;  3STZ C;  4GX5 A;  2YI8 A;  4X9L A;  2P22 C;  3U2K A;  2UXB O;  4IYH A;  2GUZ B;  1NQT A;  4O04 A;  1R6T A;  3WHA A;  2HFE C;  1K5Q A;  2ZXW C;  1PD3 A;  1EBO A;  1G4Y B;  2BSK A;  3FB7 C;  3MHS C;  4X64 O;  4NB5 A;  5AG2 A;  2EIL C;  1FXV A;  1AJP A;  2Q0O C;  4DV6 B;  1LNQ A;  3OMI B;  2JJ1 G;  4JV5 B;  3A0T A;  2FYU H;  2NLJ C;  4LF6 O;  1K4D C;  3HKB A;  3K0D A;  2Z0A A;  2FXS A;  2Z5U A;  3JAL A;  4RWU A;  2YEE A;  2JS5 A;  2RMK B;  2YDE A;  4JAA A;  1F4N A;  4D6T H;  1EI1 A;  2IJI A;  2V4D A;  3VQW A;  4ZIB A;  2HHI A;  3LPS A;  1FJG B;  3CMA V;  3O0I A;  5CTU A;  5B1A C;  5EC2 C;  2GQP A;  1XNR O;  3FD9 A;  1WA8 A;  3FX7 A;  3DSQ A;  1R3K C;  1BQZ A;  1P49 A;  4I0X B;  2PTM A;  2CK3 G;  3ZMV A;  3CWV A;  3CRQ A;  4JI8 O;  5LMN O;  1OV9 A;  5CA0 B;  3ETQ A;  1BL8 A;  1MOF A;  4GCZ A;  2YEJ A;  3ABT A;  2FL4 A;  4X65 B;  1M4U A;  4LBE C;  1IDS A;  2H94 A;  4KTN A;  3UO3 A;  3CRM A;  2YI5 A;  1XMO O;  2A0L A;  2UXC B;  3E35 A;  4DV2 B;  4H44 B;  4TV9 A;  4MT8 A;  4BIZ A;  4GGL A;  2W0X A;  3BHP A;  5BY1 A;  3A0B Z;  1ZW9 A;  3ZHU A;  2CTQ A;  2UXD O;  5C8Y B;  5KA6 A;  1S0V A;  3ZMS A;  1AMW A;  1Q8I A;  4HAM A;  2JIZ G;  4JTA B;  1AJN A;  5CN0 A;  1N36 B;  3VQV A;  4MTO A;  1PVG A;  5IDM A;  2CGN A;  3BAA A;  4B7K A;  1KUQ A;  2ZXW B;  1Z5A A;  1TVK A;  4I4T A;  2QG2 A;  4CC6 A;  2QKS A;  1NZ6 A;  2R9A A;  2EIL B;  2UUA O;  3RVZ A;  4JI6 B;  3GB7 C;  4MS2 A;  4CE2 A;  4NKG B;  1E79 G;  1N0N A;  4ABM A;  2ZKJ A;  4LWS A;  5BMV B;  1Q7Y W;  4MTF A;  4YXW G;  3QO7 A;  3APQ A;  4DV5 O;  5EBM C;  3ZS8 C;  2BOC C;  3N27 A;  1SS3 A;  3CSX A;  4HYM A;  4BR6 A;  1NTZ H;  4PI0 A;  4ZHQ A;  4YJ2 A;  5B1A B;  4WBN A;  4XDM A;  2JEU A;  4DV1 B;  1YC3 A;  2VWK A;  4XKA A;  1ZL8 A;  4MP2 A;  1RP3 B;  4LP8 A;  3R66 A;  3RKZ A;  2EIM C;  3WB0 A;  4PJ0 Z;  5CPH A;  2VWJ A;  5BOC A;  1YSC A;  3EKO A;  4X20 B;  4P2Z A;  2WI3 A;  4O4H A;  3TXS A;  1H7U A;  3BAB A;  2GTS A;  2EBO A;  3Q5J A;  2IWS A;  5H6Q A;  1FPO A;  4XCL A;  1Z5W A;  3F7V C;  4YKZ A;  1I5X A;  4BQG A;  2FYP A;  3ABL C;  3ZXO A;  2DJV A;  1EA6 A;  1Q6H A;  5JJN B;  3OFN G;  4JZ2 A;  2N74 A;  2Y0I A;  4DV0 B;  1YJ9 V;  4XDK A;  4MP7 A;  5FNV B;  1FFX B;  4DR2 O;  4NXM B;  4KXR A;  3WB2 A;  4CWR A;  3LDD A;  4JZG A;  1BMF G;  1P7B A;  1X4T A;  1YT2 A;  1S16 A;  5M4E A;  1BHB A;  5GON A;  1KC8 W;  4TT3 G;  3NR7 A;  2XAJ A;  1IUR A;  3BMY A;  4OPH A;  1KYO F;  2XHB A;  2Z3Y A;  3WFV A;  1RFY A;  4L94 A;  4JI1 O;  2QSA A;  3GWK C;  1I0H A;  2D3O W;  3KCX A;  1WN7 A;  4XCJ A;  1CPY A;  4EGI A;  4JI4 O;  2Q8I A;  4XIQ A;  4HYO A;  1HW7 A;  4X62 O;  4YJ3 B;  5J71 A;  1YSR A;  1HNX O;  4DRX A;  4GFN A;  3OUF A;  1EZJ A;  2Y69 C;  2ZIO A;  1V55 C;  4LF4 O;  4U3J B;  4ZKI A;  3OR7 C;  1B04 A;  2Q8F A;  3RLP A;  2XK2 A;  1S5L Z;  1ZXM A;  2HKO A;  4FZ0 A;  5B66 Z;  1YT1 A;  3B25 A;  1L0L H;  3BEH A;  3N2K A;  3SDL A;  2VRZ A;  3K9A A;  2EIM B;  4JTC B;  2RJZ A;  5TIS Z;  2ODM A;  2A79 B;  5LXT A;  2XAB A;  4PDR A;  5M4P A;  3A0H Z;  3JAR A;  2PUS A;  2X6C A;  4AS9 A;  2QJ1 A;  3A0X A;  4FLZ A;  1Y67 A;  3E8H A;  3QF7 A;  3TK1 A;  2AXT Z;  5FND A;  3CRA A;  3Q5K A;  1B3Q A;  2YKC A;  4HZ0 A;  3BFR A;  4QNH B;  3A2F A;  3AG3 C;  2GHY A;  1FAF A;  5BR8 B;  4LWG A;  4WUB A;  1KIJ A;  5KHK A;  2OCH A;  2ZDI A;  2F95 B;  4L91 A;  3RW0 A;  4GKJ B;  1F4M A;  4JYA B;  1WPX A;  4ZI7 A;  4WUD A;  4JYC A;  4QGP A;  4R8C A;  5IYZ B;  3H4L A;  3OWB A;  4XKO A;  2EZO A;  2ZT9 B;  2QM8 A;  1BQ0 A;  5JJE B;  1V9P A;  2ILM A;  4LFA O;  1GK9 A;  4O2A B;  4DV6 O;  4B6C A;  2YGA A;  3FAV B;  3BRC A;  4JI0 O;  4TV8 A;  3G75 A;  1IBK B;  2UUB O;  5KMG B;  1PNM A;  2PY5 A;  1UYG A;  1HR0 B;  2M6Y A;  4NH9 A;  1MNG A;  4FCR A;  4O2B A;  2QWR B;  1FJG O;  2WLI A;  3HKC A;  1Z5C A;  2QWP B;  2Y69 B;  4ASU G;  1V55 B;  1AR4 A;  3T1C A;  3RYC B;  3OAA G;  4AWO A;  1AVM A;  1SC5 B;  1AR5 A;  4EFU A;  4L87 A;  1I08 A;  3PN1 A;  5IYB O;  2GSM B;  3J7A U;  4PA4 A;  4FLW A;  3CGY A;  5GW7 A;  4O4I A;  1F7Y A;  3H1L H;  2CCT A;  5DN6 G;  2YEC A;  3INW A;  1EFR G;  4X9Q A;  4X1I B;  4KFM A;  4X65 O;  2ZE7 A;  4FZ1 A;  3CJH A;  2CGF A;  1AI7 A;  3U11 A;  2A9H A;  2ZDX A;  5JH7 B;  3QTF A;  4HY1 A;  3CE2 A;  2BU6 A;  2UXC O;  3TZ5 A;  3BVO A;  4DV2 O;  2CUG A;  3A0R A;  4LF5 B;  2KB1 A;  3R92 A;  3AG3 B;  4OPA A;  3U67 A;  3E8B A;  1IXM A;  3G67 A;  4DR7 O;  1UYD A;  2NR5 A;  5IJ0 A;  1S5H C;  4FM1 A;  1N36 O;  2H55 A;  3MD0 A;  2W6I G;  3LNM B;  4GT1 A;  2Q2E B;  2HJD A;  3OMA B;  4K3A A;  4BAY A;  1JJ2 U;  3AK1 A;  1AR1 B;  1R62 A;  1JMK C;  4FPP A;  1WAZ A;  4DR3 O;  3AG2 C;  1NT2 B;  1Q6U A;  4JI6 O;  2P4V A;  4U7N A;  1YI2 V;  3A8T A;  4DV4 B;  4I9Q A;  5LYJ A;  3P30 A;  4LF7 B;  4LFC B;  1Q81 W;  2LQT A;  1VF6 A;  3SPI A;  4BAE A;  3DC6 A;  5D5P A;  2ZM6 O;  3CX5 F;  5LHG A;  2XD6 A;  4I50 A;  4NTX A;  1EN5 A;  2MW2 B;  3KKY A;  3TXQ A;  3S3X A;  4CBC A;  4DR1 B;  3JD4 A;  2E75 B;  4DV1 O;  2BTQ A;  3S5T A;  4YKR A;  2UXN A;  5L3B A;  5C8Y A;  4C7U A;  5JVD B;  4B3R O;  4EFB A;  5FNF A;  3KCY A;  3UT5 A;  3LSU A;  2PF4 E;  2CAZ C;  2QA4 V;  1AJQ A;  1H2M A;  1K73 W;  4JYB A;  1ROP A;  1YTF D;  1N4C A;  1NH2 D;  5LMU O;  3UM7 A;  4CS2 A;  4MPN A;  4TUY A;  1VQN V;  2F4V O;  2YJX A;  3EHF A;  3CGZ A;  4XKK A;  4FFB B;  1ZAU A;  3FT8 A;  2Q8G A;  3TJT A;  2OTL V;  2IOP A;  4H0L B;  3OTO B;  3DTU B;  3D36 A;  3W7U A;  1QVF U;  3JYC A;  2XHR A;  1BSM A;  5GGZ A;  1VQ5 V;  3O65 A;  2HJF C;  3G80 A;  3TZ2 A;  3ZRX A;  4X1K A;  5CF0 A;  1YJW V;  4FVM A;  3L70 H;  3JCZ A;  1VP7 A;  1KMI Z;  5LA6 B;  5FLX N;  3AG2 B;  4LH6 A;  2E3C A;  3D8C A;  1P7G A;  2OIG A;  1L8D A;  4NR1 A;  2HG1 A;  4LF8 B;  2AHZ A;  4RAI A;  1DLB A;  2HHH O;  5LHH A;  1PKX A;  2WEQ A;  4YKW A;  1DGS A;  3FB5 C;  4LFB B;  5KA5 A;  2K5B A;  3T1Y B;  1I5D A;  1OCR C;  1SQP H;  4PL9 A;  3O6O A;  1RSO B;  4YY3 B;  4NH8 A;  1WNS A;  3NMQ A;  5FNV A;  5L3J A;  5KHJ A;  1FFX A;  5CB4 B;  3T10 A;  1VAR A;  1TAE A;  4F6R A;  1XUQ A;  1R6K A;  4JI7 O;  3TTZ A;  3KE6 A;  1T5E A;  1TH8 A;  3CRC A;  5H6R A;  4U7O A;  3AK3 A;  5GTI Z;  4AWP A;  3VQY A;  3ASO C;  1QR9 A;  1EZV H;  4GLX A;  4XBF A;  2JGD B;  3CRK A;  4H85 A;  2OYQ A;  3F5W C;  1K92 A;  1WB8 A;  5JWP A;  3JAW A;  4J9Z B;  1YT0 A;  4TQD A;  1VF7 A;  2YEA A;  4O05 A;  2YEV A;  3UQ8 A;  5CA1 B;  3GIG A;  5BR8 O;  4PA9 A;  4DUH A;  4QPK A;  2BE3 A;  2YI6 A;  4PV1 B;  5HFL A;  4B08 A;  4EB6 B;  4GKJ O;  1VF5 B;  3BCC H;  4LWH A;  3VHD A;  3P3P A;  1GKZ A;  1R3L C;  5JQG B;  2YI7 A;  1ZLZ A;  4GX1 A;  2CTP A;  2BRC A;  3B77 A;  4JI2 B;  5H2F Z;  1DTO A;  1BGY H;  1IBK O;  2MK3 A;  4CE3 A;  4UFZ A;  3SYO A;  1YZB A;  2GBO A;  1W2B U;  3B40 A;  1YTF B;  1HR0 O;  4CZZ A;  1JVM A;  1K5S A;  2Q67 A;  1NH2 B;  2RN9 A;  4ZVI A;  2KKW A;  4DV3 B;  1I5B A;  5L3G A;  1U96 A;  2FKX A;  2ZE6 A;  2VQE B;  2BZ5 A;  4IIJ A;  3RYH A;  3T4D A;  1OCR B;  2QM4 A;  2JGU A;  2ZIN A;  1H38 A;  4XE2 A;  4K8X A;  2IH3 C;  1QZR A;  4XC0 A;  2QG0 A;  3ABK C;  1COW G;  5IYZ A;  1IBL B;  2Q8H A;  4YHH B;  1AP6 A;  2KG7 B;  4D7S A;  4LNU A;  5CBH A;  1SRY A;  4EKW A;  1FXK A;  4JAS A;  1G6U A;  3N2G A;  4O2A A;  4LWI A;  4YKU A;  4CH4 A;  3FAV A;  3ZMZ A;  3ASO B;  4R6Z A;  2XAQ A;  2LFS A;  2C2A A;  1W59 A;  1ZWI C;  4MVQ A;  3B27 A;  5KMG A;  1YIJ V;  3E89 A;  4IT5 A;  2XUM A;  1QR8 A;  1UJW B;  3K59 A;  4MPE A;  1SF9 A;  2YEB A;  4GEE A;  1AIL A;  4UUJ C;  4B3S B;  2XAS A;  1YDX A;  3M8A A;  3H80 A;  3APO A;  2YE7 A;  2A7W A;  2GTA A;  3QO5 A;  3FT5 A;  4V26 A;  3IFX A;  2XX2 A;  4URN A;  3R4M A;  1GKF A;  1OJH A;  4EGH A;  3TET A;  1QQC A;  2IWU A;  2XJX A;  3CCJ V;  3IAY A;  2BRE A;  1GRJ A;  3HKD B;  3LDE A;  4X88 A;  4I55 B;  5IWA B;  4RQF A;  2PYJ A;  1S77 D;  2QR4 A;  1YSZ A;  3VQX A;  4E00 A;  1GM7 A;  3T0Z A;  2Q8V A;  5ITZ A;  4MTX A;  2AGA A;  1N0J A;  4DV4 O;  4YKX A;  4LF7 O;  4NXN B;  5JH7 A;  1DF5 A;  1PL0 A;  2YI9 A;  1D5A A;  5EK0 A;  3B4S A;  1D5N A;  2YE3 A;  4QJF B;  1SA0 B;  3ABU A;  4DO2 A;  3OE7 G;  4R50 A;  2IWX A;  4RO2 A;  3L74 H;  3CXH F;  5DM6 V;  4BW9 A;  1KU9 A;  1NR1 A;  2DE0 X;  2DYS C;  1ZX3 A;  3ABK B;  1OZ0 A;  2VQF B;  2LJ2 A;  3QDD A;  3M99 B;  4JQL A;  2YEH A;  2JS3 A;  2C1G A;  1G8M A;  2L6L A;  4H81 A;  1YER A;  2XJG A;  2NN4 A;  3SPG A;  1Y74 B;  1Y8N A;  1UY7 A;  2YEF A;  3THO A;  2X7R B;  5J9P C;  4GKK O;  4MW8 A;  3INX A;  2YGF A;  2YE2 A;  4UCS A;  1QLN A;  3OTO O;  4XIP A;  2YIB D;  5KX5 B;  1MZF A;  4O4J B;  1BYQ A;  3JAS A;  1YET A;  1AH8 A;  3IC7 A;  3OEH G;  5LHI A;  2ZNJ A;  2OTJ V;  4DV7 B;  2ETN A;  5LP6 C;  3WG7 C;  1VQ6 V;  2WPD G;  5IY5 C;  1SER A;  3HPL C;  2WLM A;  2B5U A;  4V25 A;  1OCC C;  4EEH A;  1YXB A;  5B1N A;  3SJB C;  2E5L B;  2CH7 A;  3CRR A;  3VHC A;  4CH6 A;  2HP8 A;  4LF8 O;  5EZY A;  3DGE A;  1IBM O;  2B1G A;  2VWC A;  1MG1 A;  3K79 A;  4O4L B;  2E76 B;  4ZOL B;  3UCS C;  3TCU A;  4LFB O;  3SR2 C;  3PEJ A;  4TOI A;  1H2N A;  4BW5 A;  3E86 A;  5J2U B;  3K3W A;  4YY3 O;  1LR1 A;  4LCU C;  4CWP A;  4JI3 O;  4GX0 A;  4UXN A;  5D6Q A;  4MB9 A;  3ZX6 A;  3DXR A;  2EZP A;  1MU5 A;  4IHJ B;  1HDJ A;  2DYS B;  1OCO C;  4AQY O;  4B3T B;  2O1W A;  3ZRV A;  1VQM V;  1JFF A;  1AM1 A;  2Y48 A;  1UYC A;  3T1H O;  5IJ9 A;  2QEX V;  3C0E A;  4O07 A;  3HYZ A;  3K5L A;  2Q7G A;  2HCH A;  2Q68 A;  2YUA A;  2IW5 A;  3PEH A;  1GN6 A;  2XAG A;  3SYC A;  1YS3 A;  4LF9 B;  3OW6 A;  2BU7 A;  1N32 B;  1FXH A;  2ZQM A;  4O0B A;  4E72 A;  1N33 B;  2JJC A;  1KEC A;  3U2D A;  2CDY A;  1CP9 A;  3EHB B;  4GUN A;  3WG7 B;  3L9D A;  5LP6 B;  1B6Q A;  5IT9 N;  3FKS G;  5IY5 B;  3OM3 B;  4MVZ A;  3JAT B;  1YF2 A;  1OCZ C;  5J2T A;  1AI5 A;  1Q43 A;  1OCC B;  3RFR A;  2WWW A;  3Q4H B;  1Y76 B;  1THN A;  3TUH A;  2FB5 A;  2IM9 A;  1GMG A;  4I9W A;  4UCR A;  3CEI A;  4DV3 O;  1MSW D;  2VQE O;  4XDL A;  3RYI B;  1JM6 A;  5JCO A;  4BIU A;  4GYC B;  1AJ6 A;  4EB6 A;  4NTY A;  3F7Y C;  4H13 B;  4DUZ B;  1GN3 A;  2YXL A;  4X1Y A;  3CYO A;  2DOS A;  1IBL O;  3C3T A;  1M57 C;  3JAK A;  4YHH O;  1YEW A;  5K1P A;  5JQG A;  2ZKO A;  4BIO A;  2WER A;  1GM8 A;  3ZHR A;  2P4K A;  2FWY A;  2A06 H;  1VIB A;  5HFM A;  1K33 A;  3LMM A;  4KL1 A;  1OCO B;  5L3C A;  2ZE8 A;  4R7C A;  4WCE V;  1N34 O;  4YKQ A;  5D7R A;  2QKC A;  3ZRW A;  1ARO P;  2IJJ A;  2IH1 C;  3STL C;  5EC1 C;  3ABM C;  1GM9 A;  1H2L A;  5F3K A;  3IC9 A;  1KB9 F;  3RYF B;  4B3S O;  1XMQ B;  2LW7 A;  2QWN B;  1BZK A;  3KG2 A;  1KQS U;  3QO8 A;  3CCV V;  2JRI A;  2XT9 A;  1VQO V;  2PGG A;  3UKM A;  4FM2 A;  1U0Z A;  2BTZ A;  4DR5 B;  1D2D A;  3RT3 C;  2WI4 A;  3X2Q C;  4MVR A;  1QNM A;  5IWA O;  5EYP B;  5LGT A;  2R72 A;  2GV9 A;  3K97 A;  2CGO A;  3ML0 A;  1JOY A;  4LPB A;  4GZR B;  4JV5 O;  3HR0 A;  1UFI A;  3FB6 C;  1OCZ B;  3ETE A;  4DZY A;  3M7M X;  5B5E Z;  1K3E A;  1MZE A;  4AIL C;  3LSS A;  2OIE A;  3HKE A;  4NXN O;  4YKT A;  3W7T A;  2QTO A;  3JSN A;  1JPX A;  4JAV A;  2BU5 A;  5C93 A;  2QTS A;  2DWD C;  1TUB A;  3E2E A;  2DQ3 A;  3E22 B;  1B63 A;  1UYM A;  5CBF A;  4FLU A;  2GUZ A;  4CWO A;  2XDX A;  5F2V O;  2OWO A;  1XNQ B;  4ASG A;  2VQF O;  1M57 B;  1SQG A;  3D3I A;  3HKD A;  4EEQ A;  1I58 A;  1R1B A;  3ZN0 A;  3CHX A;  3ZED A;  4DUY B;  1PNL A;  2O57 A;  4DR4 B;  2YGE A;  1XHX A;  3BA9 A;  4X66 B;  1Z5B A;  3UO2 A;  1P84 F;  4JAU A;  1Z59 A;  1ENV A;  4J11 A;  4FCP A;  2BSK B;  3EXA A;  4G2K A;  3ZHQ A;  1KBH A;  1QHT A;  3SPJ A;  4UV8 A;  1OHH G;  1AI6 A;  1VMG A;  3L72 H;  3ABM B;  3K99 A;  5F5R A;  3CS5 A;  3GIE A;  1TC0 A;  2GDS A;  3HKB B;  3H01 A;  5B1O A;  4DV7 O;  1ZSP A;  3H1I H;  4WFH A;  1HNZ B;  1SA0 A;  3JAL B;  3RLQ A;  4X89 A;  3SJA C;  3B26 A;  3MAQ A;  1EN4 A;  1NTK H;  4I0X A;  2HEP A;  3EHH A;  3SPC A;  3X2Q B;  4FLY A;  5CA0 A;  2P90 A;  1XHZ A;  3U10 A;  3G6B A;  2LGQ A;  1WA8 B;  4F6E A;  3ZKB A;  1Q5O A;  1K7D A;  2RNB A;  4TSF G;  4K4O A;  1Y74 A;  3RLR A;  5KUK A;  5DEC A;  4PA7 A;  3ZBH A;  2AKP A;  5BZB A;  2JJ2 G;  2ZD9 A;  3VOU A;  3SJC C;  2JDI G;  4LF6 B;  5FPR A;  2IJK A;  5D6P A;  1JX9 A;  5BOD A;  4TV9 B;  2WLN A;  2WAM A;  1LUV A;  2YJW A;  3OGI B;  4IYI A;  4DW0 A;  3HZ1 A;  2M7W A;  5B3S C;  2W6J G;  4J9Y B;  3H1K H;  2XJJ A;  3CCR V;  4BXI A;  5BMV A;  1TVK B;  4I4T B;  2WEP A;  1B06 A;  4H7Q A;  3A0Y A;  1N32 O;  3D3Q A;  4DV0 O;  3ETG A;  1N33 O;  4MBC A;  1THZ A;  1JCH A;  3ZMT A;  4NXM O;  1M93 A;  2IU0 A;  2K1E A;  4LWS B;  2JEX A;  2IJH A;  5L3E A;  4B7E A;  4WFE A;  1UPG A;  1SKV A;  4X20 A;  4ZHQ B;  4WBN B;  2IBZ H;  3PJS K;  1KP2 A;  1JR9 A;  4J10 A;  3CP1 A;  4L8J A;  2BU2 A;  2UXD B;  4MVM A;  1ZL8 B;  2Q73 A;  2CE4 A;  4OGQ B;  2UU9 B;  1NU1 H;  2XHT A;  1S5J A;  2Q4P A;  3K03 A;  4YKY A;  1ZWH A;  1UY8 A;  1XIL A;  4DW1 A;  2JK5 C;  2CTR A;  3J81 N;  1KKD A;  5M4M A;  1SES A;  2UUA B;  2ZDY A;  2YID A;  4DUZ O;  1EN6 A;  4KQV A;  2H3O A;  1Z5V A;  2HVK C;  2ITC C;  2Q69 A;  3E8F A;  5LOV B;  3E83 A;  2W0F C;  2Q0A A;  2WLL B;  1UYH A;  3R4P A;  4KSG A;  2WLH A;  1NTM H;  1SQV H;  5A9G A;  4KFG A;  3JZ3 A;  2XAF A;  5CA3 A;  2KQX A;  2HLD G;  3I56 V;  2EUL A;  1GN2 A;  2PI4 A;  5GON B;  2WI5 A;  2JVD A;  5B3S B;  3LUT B;  4YJ3 A;  5KLV H;  1HWY A;  1UYI A;  3C3S A;  1R3J C;  5D7D A;  2YEG A;  1Y8O A;  3R65 A;  4PDL A;  4UVC A;  4RQE A;  3KZI Z;  1NS1 A;  4U3J A;  1F23 A;  4JYA O;  4P8O A;  2HVJ C;  3CCE V;  1DF4 A;  2YIB A;  2ESA A;  3SL2 A;  3C11 A;  4DRX B;  4JI5 B;  5IE9 A;  4U93 A;  3K5M A;  1NBM G;  2YE6 A;  4I3H A;  5M4K A;  2X6A A;  3CB2 A;  4R1F A;  4R3M A;  3W7W A;  3OT7 A;  3G7B A;  4URO A;  2YKE A;  1W0K G;  3N2K B;  1XQ8 A;  4DXW A;  4J7Z A;  1MSD A;  5CTX A;  1SZX A;  4Q20 A;  5LXT B;  3WB1 A;  1V54 C;  4AWQ A;  3JAR B;  4EM7 A;  1IZ3 A;  1AP5 A;  1AH6 A;  4UVA A;  2YE9 A;  4JF3 A;  5A2Q N;  4JI1 B;  1E1Q G;  1PM9 A;  2L35 A;  3OTF A;  3A0W A;  3HHU A;  2EX3 A;  2D2C B;  1H8H G;  2R9I A;  4BQJ A;  4HZ3 A;  4UCV A;  4MW3 A;  5L3F A;  4X62 B;  1XNQ O;  1UYK A;  2C1I A;  1VQ8 V;  4DYL A;  1DK1 A;  1U97 A;  4DUY O;  4FK5 C;  3CCL V;  2P7T C;  4LF4 B;  4DR4 O;  3CPW U;  2LFR A;  4ZI7 B;  1PP9 H;  3FB8 C;  4X66 O;  2IOQ A;  2P6J A;  1UY9 A;  4PA6 A;  4LH7 A;  4ASB A;  1YJN V;  2X0L A;  3D0B A;  3K08 A;  1E1R G;  1YVW A;  1ORQ C;  4LF5 O;  4WUC A;  2BYI A;  1NVP D;  1KKC A;  3IED A;  3ICX A;  2XDU A;  4TV8 B;  1SZT A;  2WI1 A;  3ZKD A;  5B1B C;  4UCT A;  1HNZ O;  1VF6 C;  3RYC A;  1GO3 F;  2YS8 A;  1ID0 A;  4LC1 A;  1SQF A;  1GJV A;  4QIW F;  3VHA A;  4CWS A;  4O2B B;  4R3A A;  2Q9L A;  2WLI B;  3JCU Z;  3HKC B;  3CCU V;  1XDC A;  3WU2 Z;  1TBW A;  4X1I A;  4FLX A;  2OT5 A;  3I5D A;  2QDO A;  1VQL V;  2LP7 A;  3ETD A;  1Y66 A;  3P3N A;  1S3J A;  4O4I B;  4YIO A;  5IDJ A;  4LFC O;  4L93 A;  1I94 B;  1FS0 G;  2RQ6 A;  3CJH B;  4LFA B;  4FIP C;  2VCI A;  2QKA A;  1V54 B;  1VQP V;  2PNR A;  4ASA A;  1TID A;  4JI0 B;  4IGG A;  4DR1 O;  1H7S A;  3OMN B;  1VQK V;  3K04 A;  2BTO A;  4PHZ A;  2UUB B;  2WA4 A;  3AG1 C;  4FCQ A;  4E2L A;  1BXD A;  4J80 A;  3D36 C;  4DR6 B;  1GKX A;  2QF6 A;  2AW9 A;  1OSF A;  3J80 N;  5D7C A;  2ZE5 A;  1VQ4 V;  2XAH A;  5IYC O;  2Y0P A;  3W7X A;  2XCM A;  2DWE C;  3VBB A;  5IJ0 B;  3T4Z A;  2ZNI A;  4RUE A;  1F51 A;  4PD4 F;  4TQF A;  1QCE A;  1L0N H;  4NYK A;  4GX2 A;  3LDC A;  2ZIM A;  4J7K A;  1UYE A;  2HKJ A;  4E02 A;  3AEI A;  3MNR P;  1QU7 A;  2Y4T A;  1HNW B;  1TGO A;  3OGC C;  5LYJ B;  1NHI A;  4XD8 A;  4XDJ A;  1IX9 A;  5B1B B;  4P9P A;  5JVD A;  4NH7 A;  1K34 A;  4UCU A;  1PV0 A;  1K97 A;  5L3D A;  2H8M A;  2CG9 A;  4I50 B;  3RVY A;  1I5Y A;  2XND G;  2XOK G;  3E8G A;  2AZ0 A;  3ZXQ A;  2BTQ B;  4HZ5 A;  2RDC A;  2IOR A;  1HP8 A;  2F66 C;  2DW4 A;  2UU9 O;  4UB8 Z;  2YK2 A;  4CWT A;  4DR7 B;  3K58 A;  1L0O A;  3GWO A;  3AG4 C;  1RPR A;  3B2E E;  1WB7 A;  4FFB A;  3UT5 B;  3JSL A;  4PEL A;  3T1Y O;  1NHJ A;  5FWK A;  4DR3 B;  5CTY A;  3R4N A;  2KSD A;  4QE7 A;  3JD3 A;  4K35 A;  4TUY B;  1NVP B;  5KHH A;  1X59 A;  4PA3 A;  1H2K A;  2P06 A;  1AB3 A;  5DED A;  1K4C C;  4HXW A;  3AG1 B;  4HY6 A;  4G28 B;  2EJ7 A;  1N8R W;  1J5E B;  3ZCC A;  4CH3 A;  2ZM6 B;  1SQX H;  5GTH Z;  5LA6 A;  3ZJZ A;  4K0K B;  4KP4 A;  2YEI A;  4QPJ A;  1G1X B;  1M56 C;  3FFQ A;  4X1K B;  4B3R B;  2Q5Z A;  1AI4 A;  3ZM7 A;  1CEZ A;  2YXH A;  1MAB G;  2WLK A;  2YXY A;  1I5C A;  4B7P A;  4WFG A;  1ZTE A;  3FV5 A;  2N04 A;  5LMU B;  3G4S V;  1RSO A;  2F4V B;  3RBZ A;  5FPO A;  3B24 A;  5CB4 A;  3H1J H;  4JI5 O;  5CBG A;  3CC4 V;  2ATK C;  4WFF A;  1GN4 A;  5EIB D;  3CME V;  4CS3 A;  5LOV A;  4JI2 O;  1BT8 A;  2WLL A;  3L71 H;  4FLV A;  2E0A A;  2OCC C;  4B3M B;  3ZHS A;  2JGD A;  5CTW A;  4LR3 A;  4URM A;  4F6R B;  4J41 A;  3H9V A;  4CWQ A;  3R91 A;  3AG4 B;  1FXK C;  1BE3 H;  2AZ2 A;  4KSH A;  3T0H A;  2ZCE A;  4ICG A;  1TC6 A;  3ZHT A;  1H8E G;  5FL7 G;  5CA1 A;  4EFT A;  3G71 V;  4P30 A;  3SJQ C;  2RCV A;  2IU3 A;  4UV9 A;  4P9O A;  4UVB A;  3CWB H;  4OX9 B;  1M5I A;  2HHH B;  3JAW B;  2CTW A;  4EFE A;  5KHI A;  2ITD C;  2CH4 A;  1CXZ B;  2YEV B;  2LO1 A;  3IJ4 A;  3GIG B;  4JYY A;  4MVS A;  1MMM A;  4W4L A;  2F23 A;  1M1K W;  3QTC A;  1Y4M A;  4URL A;  1S76 D;  5EIB C;  1Q90 D;  2P5O A;  3EKR A;  1NR7 A;  2R70 A;  5LGU A;  1A4H A;  4HNA B;  1M56 B;  3S3W A;  3HZ5 A;  3TGU H;  4JI7 B;  1YIT V;  1XL6 A;  1FYJ A;  3CYG A;  2ZR3 A;  1KD1 W;  2R9R B;  2XHX A;  3AK2 A;  1I59 A;  4EMV A;  4LWF A;  2BSM A;  3K5N A;  1R73 A;  4JPR A;  4IIJ B;  3RYH B;  2UUC B;  2KG7 A;  3ABL B;  5D5Q A;  2Q7H A;  2WA3 A;  3G7E A;  1IXB A;  2F43 G;  1WPB A;  1RPO A;  2QE7 G;  2PYL A;  1O9H A;  5KAF Z;  2ZBK B;  1I7F A;  4CC5 A;  2F1M A;  2OCC B;  4WF9 V;  4CH5 A;  1I94 O;  1XI1 A;  1H2G A;  1BCC H;  1VQ7 V;  4LNU B;  3BPZ A;  4HYP A;  1FXK B;  3N2G B;  5IN9 A;  4O09 A;  1XL4 A;  4JTD B;  3AG7 A;  3HB3 B;  2QGN A;  4L8Z A;  4W4K A;  1NKD A;  2XDL A;  1BHA A;  4U3F H;  1Q6I A;  1J95 A;  5IYD O;  2A3Q A;  4PRV A;  3SYP A;  1Q3E A;  4DR6 O;  3D2R A;  2XX5 A;  1Z2G A;  1QBZ A;  1US6 A;  4I55 A;  5K1X A;  4GQT A;  3T2S A;  2G38 A;  5LL6 Y;  4DK0 A;  1EM1 A;  4UCO A;  4MOT A;  1PL4 A;  2YIC A;  3MHH C;  1WP8 A;  3EHG A;  3ZRS A;  3BA8 A;  4CWF A;  1LUW A;  3RN4 A;  2QFO A;  2YED A;  3BY6 A;  1VEW A;  2PZS A;  3MDS A;  4WFB V;  2P67 A;  1B62 A;  3CCS V;  4KUM A;  3OPD A;  5ITZ B;  2ADP A;  1I5A A;  2YC0 A;  2YKJ A;  5H9C A;  1HNW O;  2YKB A;  1GAX A;  3EFF K;  2UWD A;  3EHJ A;  4BWA A;  1Y4U A;  1GTO A;  2ADQ B;  4XIT A;  4W7T A;  2DN9 A;  2VS0 A;  3B8N A;  1JQ0 A;  1BKN A;  4H37 A;  3CD6 V;  4KHP B;  1BGQ A;  1U2O A;  4CS4 A;  1NI8 A;  3ZHV A;  3HYY A;  1XOU A;  2EIN C;  2E5L O;  2UXB B;  4L90 A;  2EIJ C;  4DK1 A;  3JD1 A;  4GT8 A;  4WFA V;  3T1K A;  4ASF A;  3CC7 V;  5FNC A;  3GVM A;  1PNK A;  2AHY A;  4NTW A;  3Q5L A;  4X64 B;  1RM1 C;  2HR3 A;  4ZBM A;  1M90 W;  3SGI A;  2HG5 C;  3B8M A;  2WSS G;  5KX5 A;  3LNU A;  4O4J A;  1XRE A;  3ZN1 A;  4LP0 A;  3CXC U;  3CCM V;  1QY8 A;  1JA8 A;  1P4R A;  3K5O A;  3F5T A;  1US7 A;  5JEN A;  4X8A A;  2EIK C;  1UY6 A;  5J6A A;  3LNN A;  4MVO A;  2YKI A;  1J5E O;  3JAS B;  4B3T O;  1ZUQ A;  1MX0 A;  2YK9 A;  1BS3 A;  1YC4 A;  2WLJ A;  4A5U B;  1XNR B;  1Y8P A;  4K0K O;  3CC2 V;  1UYF A;  2E74 B;  2YI0 A;  2V1D A;  2FTK A;  4JGS A;  4JI8 B;  5LMN B;  2QM7 A;  2FWZ A;  3W7S A;  2QWO B;  4LF9 O;  4O4L A;  4ZOL A;  4PRX A;  4FLT A;  1XEQ A;  2CCS A;  5M4N A;  3FYI B;  4EGK A;  4MSW C;  5KUM A;  2CH7 B;  4Q6G A;  1XBL A;  2WI2 A;  5EZY B;  2BT0 A;  4Z1M G;  2V7Q G;  2DYR C;  5J2U A;  3R4O A;  3ASN C;  1XMO B;  4P7A A;  4NVP A;  2GFD A;  1FFT B;  3LSQ A;  4GKK B;  3OWD A;  4XIR A;  3ZIA G;  2LW1 A;  3JAM N;  3SYA A;  3L73 H;  1M9N A;  2YE5 A;  5JCO C;  4Z2W A;  5LBQ A;  2YIA A;  2Q7E A;  3K60 A;  3I55 V;  3TZ4 A;  1KP3 A;  2UXX A;  5CMU A;  4YJ2 B;  1R3I C;  4IHJ A;  3VAD A;  4N23 A;  2JKI A;  1SQB H;  4RUF A;  4QE9 A;  2EIN B;  1S72 V;  4B3M O;  3QNE A;  4YIP A;  1K9M W;  2EIJ B;  3DXR B;  4FJC C;  2EJR A;  3QG5 A;  2DQ0 A;  4H33 A;  4MTG A;  4O4H B;  2Y4U A;  3K9S A;  4CE1 A;  1RM1 B;  3WQ9 A;  1JFF B;  1A32 A;  2YE8 A;  5IJ9 B;  1MA1 A;  4OX9 O;  1O9G A;  1IBM B;  4XTJ A;  3K06 A;  3TZ0 A;  4J42 A;  4PDV A;  2XTA A;  1Y4S A;  2ZDI C;  4AHC A;  5LP6 A;  4DV5 B;  4MVU A;  3CRL A;  2EXL A;  2EIK B;  4E4E A;  1SQQ H;  2LGW A;  3JAT A;  4D7T A;  3T2M A;  3L75 H;  2YSU B;  2X6B A;  3ZMU A;  4PDM A;  3Q4H A;  2VCJ A;  2B1I A;  1W0J G;  1Y76 A;  4FM0 A;  3H1H H;  4JI3 B;  2O1U A;  5H5N A;  1GH6 A;  3OR6 C;  3OEE G;  1WLE A;  5E79 Z;  1QLE C;  5EBL C;  4CWN A;  3JD2 A;  5KAI Z;  1YES A;  2ZR2 A;  1WP7 A;  4I7Z B;  2O1V A;  5J2T B;  3GIF A;  3K57 A;  1XMQ O;  2XDS A;  4AQY B;  2B9Z A;  3K0G A;  1PPJ H;  3SPH A;  4F4L A;  3RYI A;  1VQ9 V;  2YE4 A;  1ZXN A;  1YHQ V;  2FML A;  1WJZ A;  3G6E V;  5BXZ A;  3T1H B;  3K98 A;  2DYR B;  4DR5 O;  1S14 A;  3ASN B;  2VW5 A;  4J7J A;  4UB6 Z;  4K8Z A;  4N21 A;  1QYE A;  1Q86 W;  3O2F A;  5M4H A;  4FFK A;  1UYL A;  3NXS A;  3P32 A;  2UUC O;  2H8P C;  4TWK A;  1NHH A;  1IVS A;  1QVG U;  1K8A W;  3C90 A;  2ARH A;  4DR2 B;  1L1F A;  4X1Y B;  2BCC H;  3JAK B;  4MPC A;  1YCI A;  3B09 A;  4HNA A;  3FYE B;  5EBW C;  1NJI W;  1Q82 W;  3RYF A;  3SYQ A;  1URF A;  1FD9 A;  2BOB C;  4PI2 A;  1FKA O;  1TA8 A;  3ZRW B;  2NNU A;  4JI4 B;  3CCQ V;  2QWQ B;  1JJO A;  3OD4 A;  4G27 B;  3OUS A;  3RWR D;  3O9O A;  1R6N A;  3OMU A;  2F93 B;  2XX4 A;  1HNX B;  4E01 A;  5E1A C;  1TIL A;  3QVN A;  5EYP A;  3RGB A;  2PI5 A;  3HEK A;  4LWE A;  4AI8 A;  3DC5 A;  1YC1 A;  2BU8 A;  3IGA C;  5KHG A;  4FMT A;  1H2S B;  4Z1V A;  3EVK A;  4I5S A;  1QLE B;  2N05 A;  4HBN A;  5LGN A;  4HXZ A;  3OW2 U;  3JD0 A;  3U0Z A;  5JJJ B;  4PU9 A;  1Y6X A; 
#chains in the Genus database with same CATH homology
 3A0Z A;  1SET A;  2WI6 A;  2WI7 A;  2BYH A;  4OXS A;  1KZN A;  3B28 A;  2XDK A;  1TUE B;  3BM9 A;  2Q6A A;  2CCU A;  3STZ C;  4GX5 A;  4X9L A;  3U2K A;  1NQT A;  4O04 A;  3WHA A;  2HFE C;  1K5Q A;  2ZXW C;  1PD3 A;  1EBO A;  1G4Y B;  3FB7 C;  3MHS C;  2EIL C;  1FXV A;  1AJP A;  1LNQ A;  3OMI B;  2JJ1 G;  3A0T A;  2NLJ C;  1K4D C;  3K0D A;  2FXS A;  2Z5U A;  2YEE A;  1EI1 A;  1F4N A;  2IJI A;  3LPS A;  3CMA V;  3O0I A;  5CTU A;  5B1A C;  5EC2 C;  2GQP A;  1R3K C;  2CK3 G;  3ZMV A;  3CWV A;  1BL8 A;  1MOF A;  4GCZ A;  2YEJ A;  3ABT A;  4LBE C;  2H94 A;  4KTN A;  2YI5 A;  2A0L A;  3E35 A;  4MT8 A;  4BIZ A;  4GGL A;  1ZW9 A;  5KA6 A;  1S0V A;  3ZMS A;  1AMW A;  4HAM A;  2JIZ G;  4JTA B;  1AJN A;  5CN0 A;  4MTO A;  1PVG A;  5IDM A;  2ZXW B;  1Z5A A;  2QG2 A;  2QKS A;  2EIL B;  3RVZ A;  3GB7 C;  4MS2 A;  4CE2 A;  1E79 G;  2ZKJ A;  1Q7Y W;  4MTF A;  4YXW G;  3QO7 A;  5EBM C;  2BOC C;  4HYM A;  5B1A B;  4XDM A;  2JEU A;  1YC3 A;  4XKA A;  4MP2 A;  4LP8 A;  3RKZ A;  2EIM C;  5CPH A;  5BOC A;  1YSC A;  3EKO A;  4P2Z A;  2WI3 A;  1H7U A;  3Q5J A;  2EBO A;  2IWS A;  5H6Q A;  4XCL A;  3F7V C;  4YKZ A;  1I5X A;  4BQG A;  2FYP A;  3ABL C;  3ZXO A;  1EA6 A;  3OFN G;  1YJ9 V;  4XDK A;  4MP7 A;  4CWR A;  3LDD A;  1BMF G;  1P7B A;  1YT2 A;  1S16 A;  5M4E A;  1BHB A;  1KC8 W;  4TT3 G;  2XAJ A;  3BMY A;  2Z3Y A;  3WFV A;  4L94 A;  2D3O W;  4XCJ A;  1CPY A;  4EGI A;  2Q8I A;  4XIQ A;  4HYO A;  5J71 A;  1YSR A;  4GFN A;  3OUF A;  1EZJ A;  2Y69 C;  1V55 C;  4ZKI A;  3OR7 C;  2Q8F A;  3RLP A;  2XK2 A;  1ZXM A;  2HKO A;  1YT1 A;  3B25 A;  3BEH A;  3K9A A;  2EIM B;  4JTC B;  2A79 B;  2XAB A;  4PDR A;  5M4P A;  2X6C A;  4AS9 A;  3A0X A;  3E8H A;  3TK1 A;  5FND A;  3Q5K A;  1B3Q A;  2YKC A;  4HZ0 A;  4QNH B;  3AG3 C;  2GHY A;  4LWG A;  4WUB A;  1KIJ A;  2ZDI A;  4L91 A;  3RW0 A;  1F4M A;  1WPX A;  4WUD A;  4JYC A;  4R8C A;  3H4L A;  3OWB A;  4XKO A;  2EZO A;  2QM8 A;  1GK9 A;  4B6C A;  2YGA A;  3G75 A;  1PNM A;  1UYG A;  4NH9 A;  4FCR A;  2WLI A;  1Z5C A;  2Y69 B;  4ASU G;  1V55 B;  3T1C A;  3OAA G;  4AWO A;  4EFU A;  4L87 A;  5IYB O;  2GSM B;  4PA4 A;  3CGY A;  5GW7 A;  2YEC A;  2CCT A;  5DN6 G;  3INW A;  1EFR G;  4KFM A;  2CGF A;  1AI7 A;  2A9H A;  2ZDX A;  3QTF A;  4HY1 A;  2BU6 A;  3TZ5 A;  3A0R A;  2KB1 A;  3R92 A;  3AG3 B;  3U67 A;  3E8B A;  1IXM A;  1UYD A;  1S5H C;  2H55 A;  3MD0 A;  2W6I G;  3LNM B;  4GT1 A;  2Q2E B;  3OMA B;  4BAY A;  1JJ2 U;  1AR1 B;  1R62 A;  4FPP A;  3AG2 C;  4U7N A;  1YI2 V;  3P30 A;  1Q81 W;  3SPI A;  4BAE A;  5LHG A;  2XD6 A;  4CBC A;  3JD4 A;  4YKR A;  2UXN A;  5L3B A;  5FNF A;  2QA4 V;  1AJQ A;  1K73 W;  4JYB A;  1ROP A;  1YTF D;  1NH2 D;  4MPN A;  3UM7 A;  1VQN V;  3EHF A;  2YJX A;  3CGZ A;  4XKK A;  3FT8 A;  2Q8G A;  2OTL V;  2IOP A;  3DTU B;  3D36 A;  3W7U A;  1QVF U;  3JYC A;  2XHR A;  5GGZ A;  1VQ5 V;  2HJF C;  3TZ2 A;  3ZRX A;  5CF0 A;  1YJW V;  3JCZ A;  3AG2 B;  2HG1 A;  2AHZ A;  4RAI A;  1DLB A;  5LHH A;  1PKX A;  2WEQ A;  4YKW A;  3FB5 C;  5KA5 A;  2K5B A;  1I5D A;  1OCR C;  4PL9 A;  3O6O A;  4NH8 A;  3NMQ A;  5L3J A;  3T10 A;  1R6K A;  3TTZ A;  3KE6 A;  1TH8 A;  5H6R A;  4U7O A;  4AWP A;  3ASO C;  1QR9 A;  4XBF A;  3CRK A;  4H85 A;  3F5W C;  1K92 A;  4J9Z B;  1YT0 A;  2YEA A;  4O05 A;  2YEV A;  3GIG A;  4PA9 A;  4DUH A;  4QPK A;  2YI6 A;  5HFL A;  4LWH A;  3VHD A;  1GKZ A;  1R3L C;  2YI7 A;  4GX1 A;  2BRC A;  3B77 A;  1DTO A;  2MK3 A;  4CE3 A;  3SYO A;  1W2B U;  1YTF B;  4CZZ A;  1JVM A;  1K5S A;  2Q67 A;  1NH2 B;  4ZVI A;  1I5B A;  5L3G A;  2BZ5 A;  3T4D A;  1OCR B;  1H38 A;  4XE2 A;  2IH3 C;  1QZR A;  4XC0 A;  2QG0 A;  3ABK C;  1COW G;  2Q8H A;  5CBH A;  1SRY A;  4EKW A;  1FXK A;  4JAS A;  4LWI A;  4YKU A;  3ZMZ A;  3ASO B;  4R6Z A;  2XAQ A;  2LFS A;  2C2A A;  1ZWI C;  4MVQ A;  3B27 A;  1YIJ V;  3E89 A;  1QR8 A;  1UJW B;  4MPE A;  2YEB A;  4GEE A;  4UUJ C;  2XAS A;  3H80 A;  2YE7 A;  3QO5 A;  3FT5 A;  4V26 A;  3IFX A;  2XX2 A;  4URN A;  3R4M A;  1GKF A;  4EGH A;  3TET A;  2IWU A;  2XJX A;  3CCJ V;  2BRE A;  3LDE A;  4X88 A;  4RQF A;  1S77 D;  1YSZ A;  4E00 A;  1GM7 A;  3T0Z A;  4MTX A;  4YKX A;  1DF5 A;  1PL0 A;  5EK0 A;  2YE3 A;  4QJF B;  3ABU A;  4DO2 A;  3OE7 G;  4R50 A;  2IWX A;  4RO2 A;  5DM6 V;  1NR1 A;  2DYS C;  3ABK B;  1OZ0 A;  4JQL A;  3QDD A;  3M99 B;  2YEH A;  1G8M A;  4H81 A;  1YER A;  2XJG A;  3SPG A;  1Y8N A;  1UY7 A;  2YEF A;  2X7R B;  5J9P C;  4MW8 A;  3INX A;  2YGF A;  2YE2 A;  1QLN A;  4XIP A;  1BYQ A;  1YET A;  1AH8 A;  3IC7 A;  3OEH G;  5LHI A;  2OTJ V;  1VQ6 V;  3WG7 C;  2WPD G;  5IY5 C;  1SER A;  3HPL C;  2WLM A;  2B5U A;  4V25 A;  1OCC C;  4EEH A;  5B1N A;  3VHC A;  3DGE A;  2B1G A;  2VWC A;  1MG1 A;  3K79 A;  3TCU A;  3PEJ A;  4BW5 A;  3E86 A;  3K3W A;  4LCU C;  4CWP A;  4GX0 A;  4UXN A;  5D6Q A;  4MB9 A;  2EZP A;  1MU5 A;  2DYS B;  1OCO C;  2O1W A;  3ZRV A;  1VQM V;  1AM1 A;  2Y48 A;  1UYC A;  3C0E A;  2QEX V;  4O07 A;  3HYZ A;  2HCH A;  2Q68 A;  2IW5 A;  3PEH A;  2XAG A;  1YS3 A;  3SYC A;  3OW6 A;  2BU7 A;  1FXH A;  2ZQM A;  4O0B A;  2JJC A;  1KEC A;  3U2D A;  1CP9 A;  3EHB B;  3WG7 B;  1B6Q A;  3FKS G;  5IY5 B;  3OM3 B;  4MVZ A;  1OCZ C;  1AI5 A;  1OCC B;  2WWW A;  1THN A;  3TUH A;  1GMG A;  4I9W A;  1MSW D;  1JM6 A;  4XDL A;  4BIU A;  1AJ6 A;  3F7Y C;  3CYO A;  1M57 C;  2WER A;  1GM8 A;  2FWY A;  5HFM A;  1K33 A;  1OCO B;  5L3C A;  4R7C A;  4WCE V;  4YKQ A;  5D7R A;  3ZRW A;  1ARO P;  2IJJ A;  2IH1 C;  3STL C;  5EC1 C;  3ABM C;  1GM9 A;  5F3K A;  3KG2 A;  1KQS U;  3QO8 A;  3CCV V;  1VQO V;  3UKM A;  1U0Z A;  2BTZ A;  2WI4 A;  3X2Q C;  4MVR A;  5LGT A;  3K97 A;  3ML0 A;  1JOY A;  4LPB A;  3FB6 C;  1OCZ B;  3ETE A;  4DZY A;  1K3E A;  3LSS A;  4YKT A;  3W7T A;  2QTO A;  1JPX A;  4JAV A;  2BU5 A;  5C93 A;  2DWD C;  3E2E A;  2DQ3 A;  1B63 A;  1UYM A;  5CBF A;  4CWO A;  2XDX A;  4ASG A;  1M57 B;  3D3I A;  1I58 A;  3ZN0 A;  1PNL A;  2YGE A;  1Z5B A;  4JAU A;  1Z59 A;  1ENV A;  4FCP A;  4G2K A;  3SPJ A;  4UV8 A;  1OHH G;  1AI6 A;  5F5R A;  3ABM B;  3K99 A;  3GIE A;  1TC0 A;  3H01 A;  5B1O A;  4WFH A;  3RLQ A;  4X89 A;  3B26 A;  3EHH A;  3SPC A;  3X2Q B;  2P90 A;  3ZKB A;  1K7D A;  4TSF G;  4K4O A;  3RLR A;  5KUK A;  4PA7 A;  2AKP A;  5BZB A;  2JJ2 G;  2ZD9 A;  3VOU A;  2JDI G;  2IJK A;  5D6P A;  1JX9 A;  5BOD A;  2WLN A;  2WAM A;  2YJW A;  3HZ1 A;  2M7W A;  5B3S C;  2W6J G;  4J9Y B;  2XJJ A;  4BXI A;  3CCR V;  2WEP A;  4H7Q A;  3A0Y A;  3ETG A;  4MBC A;  1THZ A;  1JCH A;  3ZMT A;  2IU0 A;  2K1E A;  2JEX A;  2IJH A;  5L3E A;  4WFE A;  3PJS K;  1KP2 A;  3CP1 A;  2BU2 A;  4MVM A;  2XHT A;  3K03 A;  4YKY A;  1ZWH A;  1UY8 A;  2JK5 C;  1KKD A;  5M4M A;  1SES A;  2ZDY A;  4KQV A;  2HVK C;  2ITC C;  2Q69 A;  3E8F A;  3E83 A;  2W0F C;  3R4P A;  2WLL B;  1UYH A;  4KSG A;  2WLH A;  4KFG A;  3JZ3 A;  2XAF A;  5CA3 A;  2HLD G;  3I56 V;  2PI4 A;  2WI5 A;  5B3S B;  3LUT B;  1HWY A;  1UYI A;  1R3J C;  5D7D A;  2YEG A;  1Y8O A;  3R65 A;  4PDL A;  4UVC A;  4RQE A;  1F23 A;  4P8O A;  2HVJ C;  3CCE V;  1DF4 A;  2ESA A;  3SL2 A;  3C11 A;  4U93 A;  1NBM G;  2YE6 A;  4I3H A;  5M4K A;  2X6A A;  4R1F A;  4R3M A;  3W7W A;  3G7B A;  4URO A;  2YKE A;  1W0K G;  4DXW A;  5CTX A;  4Q20 A;  1V54 C;  4AWQ A;  4EM7 A;  2YE9 A;  1AH6 A;  4UVA A;  4JF3 A;  1E1Q G;  3A0W A;  3HHU A;  1H8H G;  2R9I A;  4BQJ A;  4HZ3 A;  4MW3 A;  5L3F A;  1UYK A;  1VQ8 V;  4FK5 C;  3CCL V;  2P7T C;  3CPW U;  2LFR A;  3FB8 C;  2IOQ A;  2P6J A;  1UY9 A;  4PA6 A;  4ASB A;  1YJN V;  2X0L A;  3D0B A;  3K08 A;  1E1R G;  1ORQ C;  4WUC A;  2BYI A;  1NVP D;  3IED A;  2XDU A;  1SZT A;  2WI1 A;  3ZKD A;  5B1B C;  1GO3 F;  1ID0 A;  4LC1 A;  1GJV A;  4QIW F;  3VHA A;  4CWS A;  4R3A A;  2WLI B;  3CCU V;  1TBW A;  2OT5 A;  1VQL V;  2LP7 A;  3ETD A;  1Y66 A;  1S3J A;  5IDJ A;  4L93 A;  1FS0 G;  4FIP C;  2VCI A;  1V54 B;  1VQP V;  4ASA A;  2PNR A;  1TID A;  1H7S A;  3OMN B;  1VQK V;  3K04 A;  3AG1 C;  4FCQ A;  4E2L A;  1BXD A;  1GKX A;  2QF6 A;  1OSF A;  5D7C A;  1VQ4 V;  2XAH A;  5IYC O;  3W7X A;  2XCM A;  2DWE C;  3VBB A;  3T4Z A;  4RUE A;  1F51 A;  1QCE A;  4GX2 A;  3LDC A;  1UYE A;  2HKJ A;  4E02 A;  3AEI A;  3MNR P;  3OGC C;  1NHI A;  4XD8 A;  4XDJ A;  5B1B B;  4P9P A;  4NH7 A;  1K34 A;  1K97 A;  5L3D A;  2H8M A;  2CG9 A;  3RVY A;  1I5Y A;  2XND G;  2XOK G;  3E8G A;  3ZXQ A;  4HZ5 A;  2IOR A;  2DW4 A;  2YK2 A;  4CWT A;  1L0O A;  3GWO A;  3AG4 C;  1RPR A;  4PEL A;  1NHJ A;  5FWK A;  5CTY A;  3R4N A;  4QE7 A;  3JD3 A;  1NVP B;  4PA3 A;  1K4C C;  4HXW A;  3AG1 B;  4HY6 A;  4G28 B;  1N8R W;  3ZCC A;  3ZJZ A;  4KP4 A;  2YEI A;  4QPJ A;  1M56 C;  1AI4 A;  3ZM7 A;  1CEZ A;  1MAB G;  2WLK A;  1I5C A;  4B7P A;  4WFG A;  3FV5 A;  3G4S V;  3RBZ A;  3B24 A;  5CBG A;  3CC4 V;  2ATK C;  4WFF A;  3CME V;  2WLL A;  2E0A A;  2OCC C;  5CTW A;  4URM A;  4CWQ A;  3R91 A;  3AG4 B;  1FXK C;  4KSH A;  3T0H A;  1TC6 A;  1H8E G;  5FL7 G;  4EFT A;  3G71 V;  4P30 A;  3SJQ C;  4UV9 A;  2IU3 A;  4P9O A;  4UVB A;  2ITD C;  2CH4 A;  2YEV B;  3GIG B;  4MVS A;  1M1K W;  1Y4M A;  4URL A;  1S76 D;  3EKR A;  1NR7 A;  5LGU A;  1A4H A;  1M56 B;  3HZ5 A;  1YIT V;  1XL6 A;  2ZR3 A;  1KD1 W;  2R9R B;  2XHX A;  1I59 A;  4EMV A;  4LWF A;  2BSM A;  1R73 A;  4JPR A;  3ABL B;  3G7E A;  2F43 G;  1RPO A;  2QE7 G;  2ZBK B;  4WF9 V;  2OCC B;  1H2G A;  1VQ7 V;  4HYP A;  1FXK B;  5IN9 A;  4O09 A;  1XL4 A;  4JTD B;  3HB3 B;  4L8Z A;  1NKD A;  2XDL A;  1BHA A;  1J95 A;  5IYD O;  4PRV A;  3SYP A;  3D2R A;  2XX5 A;  1QBZ A;  4GQT A;  3T2S A;  4MOT A;  3MHH C;  3EHG A;  3ZRS A;  4CWF A;  2QFO A;  2YED A;  3BY6 A;  4WFB V;  2P67 A;  1B62 A;  3CCS V;  4KUM A;  3OPD A;  1I5A A;  2YKJ A;  5H9C A;  2YKB A;  3EFF K;  2UWD A;  3EHJ A;  1Y4U A;  1GTO A;  4XIT A;  4W7T A;  3B8N A;  1JQ0 A;  1BKN A;  4H37 A;  3CD6 V;  1BGQ A;  1U2O A;  3HYY A;  2EIN C;  4L90 A;  2EIJ C;  3JD1 A;  4GT8 A;  4WFA V;  3T1K A;  4ASF A;  3CC7 V;  5FNC A;  1PNK A;  2AHY A;  3Q5L A;  1RM1 C;  2HR3 A;  4ZBM A;  1M90 W;  2HG5 C;  3B8M A;  2WSS G;  3LNU A;  3ZN1 A;  4LP0 A;  3CXC U;  3CCM V;  1QY8 A;  1P4R A;  1US7 A;  4X8A A;  2EIK C;  1UY6 A;  5J6A A;  4MVO A;  2YKI A;  1MX0 A;  2YK9 A;  1YC4 A;  2WLJ A;  1Y8P A;  3CC2 V;  1UYF A;  2YI0 A;  2V1D A;  2FTK A;  4JGS A;  2QM7 A;  2FWZ A;  3W7S A;  4PRX A;  2CCS A;  5M4N A;  3FYI B;  4EGK A;  4MSW C;  5KUM A;  2WI2 A;  2BT0 A;  4Z1M G;  2V7Q G;  2DYR C;  3R4O A;  3ASN C;  4P7A A;  2GFD A;  1FFT B;  3LSQ A;  3OWD A;  4XIR A;  3ZIA G;  3SYA A;  1M9N A;  2YE5 A;  3K60 A;  5LBQ A;  3I55 V;  3TZ4 A;  1KP3 A;  2UXX A;  5CMU A;  1R3I C;  3VAD A;  4N23 A;  2JKI A;  4RUF A;  4QE9 A;  2EIN B;  1S72 V;  3QNE A;  1K9M W;  2EIJ B;  4FJC C;  2EJR A;  2DQ0 A;  4H33 A;  4MTG A;  4CE1 A;  1RM1 B;  3WQ9 A;  2YE8 A;  4XTJ A;  3K06 A;  3TZ0 A;  4PDV A;  1Y4S A;  2ZDI C;  4MVU A;  3CRL A;  2EXL A;  2EIK B;  3T2M A;  2YSU B;  2X6B A;  3ZMU A;  4PDM A;  2VCJ A;  2B1I A;  1W0J G;  2O1U A;  3OR6 C;  3OEE G;  1WLE A;  1QLE C;  5EBL C;  4CWN A;  3JD2 A;  1YES A;  2ZR2 A;  2O1V A;  3GIF A;  2XDS A;  3K0G A;  4F4L A;  3SPH A;  1VQ9 V;  2YE4 A;  1ZXN A;  1YHQ V;  3G6E V;  3K98 A;  2DYR B;  1S14 A;  2VW5 A;  3ASN B;  4N21 A;  1QYE A;  1Q86 W;  3O2F A;  5M4H A;  1UYL A;  3NXS A;  3P32 A;  2H8P C;  4TWK A;  1NHH A;  1QVG U;  1K8A W;  1L1F A;  4MPC A;  3FYE B;  5EBW C;  1NJI W;  1Q82 W;  3SYQ A;  2BOB C;  3ZRW B;  2NNU A;  3CCQ V;  4G27 B;  3OUS A;  1R6N A;  3OMU A;  2XX4 A;  4E01 A;  5E1A C;  1TIL A;  2PI5 A;  3HEK A;  4LWE A;  1YC1 A;  2BU8 A;  3IGA C;  4FMT A;  4I5S A;  1QLE B;  4HXZ A;  5LGN A;  3OW2 U;  3JD0 A;  4PU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...