4JAVA

Structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
246
structure length
246
Chain Sequence
NVTESKELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
molecule keywords Histidine kinase
total genus 79
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4javA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4javA02
5B1NA 3OWDA 4BIUA 1A4HA 3RLPA 2YK9A 1NHIA 4L91A 4BAEA 1UYGA 3ZRVA 1B63A 2YE5A 3O0IA 2HG1A 4LWFA 3CRLA 4JAVA 2XDKA 3R92A 2FYPA 3GIGA 2YJWA 4CE2A 1UY7A 2FXSA 2H8MA 1UY6A 1GJVA 4CE3A 3HYZA 4GEEA 1L0OA 3RLRA 4O0BA 4I3HA 4AWQA 4DZYA 3EHFA 2CCSA 2LFSA 3T1KA 3K97A 4YKXA 4I5SA 4LWEA 4HXZA 3A0TA 3T2SA 2BREA 2CH4A 2XHTA 2YJXA 3BM9A 4PRXA 3GIEA 2YE6A 3G7BA 3IEDA 4EGKA 1PVGA 3CWVA 3INWA 4BQGA 4L93A 1BYQA 1Y8PA 5FNCA 3FV5A 3ZCCA 4QPJA 4Q20A 4XTJA 4ASFA 4AS9A 3RLQA 1UYCA 2YEBA 4PU9A 4CWPA 4KFGA 4UROA 2YEHA 4WUDA 3T10A 4BIZA 3HYYA 1Y8NA 1Z5CA 1S14A 2XCMA 2EXLA 2CGFA 1UYIA 3G75A 2YEIA 3O2FA 1TC6A 3TK1A 3B24A 4GT1A 2ZBKB 2QG0A 2E0AA 4XIPA 4XKAA 4HZ5A 1YSZA 3EKRA 4JAUA 2XDLA 2O1UA 1MU5A 4NH9A 4LWIA 2BU7A 2WWWA 4LWHA 2FTKA 3BMYA 3TUHA 1TIDA 2ZKJA 4HYPA 3Q5JA 2YKEA 3R4NA 3TTZA 2YE7A 4E01A 2QG2A 1UYHA 3HZ5A 1Z5AA 2JJCA 4ZVIA 4URNA 3NXSA 2YECA 4P7AA 3B27A 2O1VA 3K99A 4KQVA 4GGLA 4XKKA 4WUBA 1ZW9A 5J6AA 4XKOA 4KP4A 2XDSA 1B62A 2YEFA 4V25A 1Y4UA 1ZXMA 1Z59A 5F3KA 4FMTA 3ZRWA 3ZM7A 4EMVA 3NMQA 2IOQA 5BODA 2QF6A 2WI5A 4O09A 5J71A 3Q5KA 5L3JA 3B25A 3CRKA 4YKQA 4JYBA 1YESA 3H4LA 3LNUA 3OWBA 3T0ZA 4XITA 1Y8OA 1OSFA 3VHAA 3D0BA 2WEPA 2XX5A 3T0HA 4YKYA 4R3AA 3C11A 4E02A 3U2KA 3U2DA 4CWSA 4XD8A 1UYDA 3ZXQA 3U67A 4FCQA 2CG9A 4BQJA 1AH6A 4HZ0A 1H7UA 4FCPA 5BOCA 3B28A 5M4EA 2WI1A 1U0ZA 4URLA 4KSHA 4YKTA 4AWPA 3WHAA 3H80A 4U7OA 2CCUA 5GGZA 2YEDA 5F5RA 4ASBA 2VCIA 5C93A 2JKIA 5M4MA 3D36A 1KZNA 4EFTA 3ZXOA 3R91A 1B3QA 4H7QA 2WI2A 3OMUA 4BXIA 1I5BA 5FWKA 2WERA 3ZKBA 1S16A 2BSMA 5M4HA 3K98A 2H55A 2YI7A 2YEAA 2FWYA 4JASA 4XCLA 1NHHA 1I5DA 1Y4SA 3DGEA 4LC1A 3TZ2A 1EI1A 4EFUA 2IWUA 4E00A 4QPKA 2XDUA 2YE3A 2YGEA 1BGQA 1TBWA 2LFRA 2YE8A 3VHDA 2AKPA 1I5AA 1THNA 3GIFA 1JOYA 2IORA 4CE1A 2YE9A 2Q8GA 1QY8A 4P8OA 2FWZA 3WQ9A 4W7TA 5D7CA 2Q8HA 2BYIA 4MPCA 3OPDA 2BU5A 1YT1A 4MPNA 4LWGA 3LPSA 2YKBA 2YKJA 5D7DA 2XX2A 5IN9A 5CF0A 2Q2EB 1UYMA 3R4MA 1YT2A 2BTZA 1BKNA 5B1OA 1NHJA 1UYFA 2WEQA 1TILA 2XHRA 2CCTA 1UYLA 1YSRA 3TZ0A 2BT0A 3B26A 2Q8IA 1YS3A 5CTUA 4DUHA 2BU6A 3ZKDA 1I59A 4X9LA 2VW5A 1KIJA 3PEJA 2P67A 2VCJA 4ZKIA 4CWFA 2YI0A 3R4PA 2WI4A 2IOPA 4KSGA 3G7EA 3HHUA 1U2OA 4XDMA 3EHJA 2YGFA 4XIQA 4R1FA 2BYHA 3A0ZA 3Q5LA 4ASAA 5FNFA 3MD0A 3GIGB 5CTXA 5FNDA 2QM7A 5IDMA 4H81A 2YKIA 1AM1A 1UYEA 3HEKA 4XCJA 1JM6A 3PEHA 2BU8A 4H85A 2YEGA 3RKZA 2YEJA 4MOTA 4ASGA 1YC1A 3TZ5A 4CWTA 2XDXA 1QYEA 4MBCA 4EGHA 2O1WA 2PNRA 2XX4A 1US7A 3EKOA 3K60A 2XJGA 2YI6A 4PRVA 4B7PA 4MTXA 4GT8A 4LPBA 4MP7A 1YT0A 4XE2A 4YKRA 3SL2A 1ZXNA 3FT8A 4B6CA 1AH8A 3A0WA 4HXWA 3C0EA 2QFOA 2YK2A 2YGAA 2IWXA 4HY6A 4EGIA 3R4OA 4L90A 1ID0A 1R62A 5M4PA 2IWSA 5D6PA 2BZ5A 4HY1A 4O04A 5M4NA 3EHGA 3JZ3A 3VADA 3HZ1A 1AJ6A 1BXDA 1YERA 1GKXA 1MX0A 4MT8A 4LP0A 4AWOA 2QM8A 1IXMA 2Q8FA 3A0RA 1YC3A 4EEHA 2XK2A 1EA6A 4CWRA 3QTFA 1Z5BA 1GKZA 4GFNA 2HKJA 5D7RA 2K5BA 3CGYA 4GQTA 2VWCA 2GQPA 1I5CA 1H7SA 4CWNA 4MP2A 3D2RA 4R3MA 1ZWHA 4L8ZA 3TZ4A 2YI5A 2XJJA 1TC0A 3OW6A 4URMA 1F51A 4FCRA 2XD6A 4YKUA 5D6QA 1UYKA 1UY8A 4EM7A 1AMWA 5CPHA 4GCZA 5M4KA 4NH7A 2BRCA 4CWOA 3P32A 4JYCA 3VHCA 1TH8A 3QDDA 4WUCA 2XABA 3ZRWB 2XHXA 4KTNA 4MPEA 2ZDYA 4V26A 4XC0A 3FT5A 3CGZA 4CWQA 4PL9A 4YKWA 5CTYA 5IDJA 1QZRA 2XJXA 4O07A 2BU2A 2YE2A 4YKZA 1I58A 3INXA 3O6OA 4NH8A 2HCHA 2WI7A 2WI3A 2YEEA 3A0XA 3A0YA 1YC4A 2ESAA 4HYMA 3ZRXA 4MB9A 1YETA 3KE6A 4FPPA 3MNRP 4K4OA 1UY9A 2YKCA 4U93A 2UWDA 2C2AA 2WI6A 5CTWA 4JQLA 3EHHA 2GFDA 4XIRA 4O05A 2YE4A 2ZDXA 4U7NA 4L94A
chains in the Genus database with same CATH superfamily
1B04A 4LF7O 3OWDA 5H6QA 4BIUA 4DR2O 1YF2A 1F23A 3RFRA 4Z2WA 3JAKB 2BCCH 4DK1A 3AG7A 1K33A 2JS5A 4ABMA 3ZRVA 1AJPA 2YE5A 2DMXA 5TISZ 5LMNB 3R92A 1HNWB 2YJWA 4ZHQB 3GWKC 4AQYO 2Q69A 2XAQA 1UY7A 2FXSA 3UM7A 4LH7A 2EBOA 1GKFA 1YJ9V 1FS0G 4JV5B 1THZA 1U96A 4I55A 4KFMA 1SQVH 1CEZA 1H2GA 1P84F 3T1KA 5B5EZ 1S0VA 3K97A 2EJRA 4TOIA 4DR5B 4LWEA 4FFKA 1R73A 4IGGA 4OPAA 2HVJC 2YJXA 1SA0B 3BM9A 5F2VO 3GIEA 2YDEA 1MZFA 4EGKA 3E2EA 3K79A 1URFA 4L93A 1BYQA 3SPJA 2BTOA 1QBZA 1WN7A 4NVPA 4QPJA 1Q86W 2VS0A 1YDXA 4X1YA 2H94A 4AS9A 1UYCA 4PU9A 1GH6A 4CWPA 2LW7A 4K35A 4KFGA 4UROA 4BIZA 4DW1A 1IBKB 1S14A 2XCMA 1I5XA 2M7WA 1UFIA 2NN4A 4O4LB 2EXLA 3LUTB 4RQFA 3VBBA 1PNMA 3G75A 1XMOB 2CE4A 4X65O 1LNQA 4BWAA 2QG0A 2EIJB 1SKVA 5EBWC 1YSZA 3IGAC 3TJTA 2L35A 4UVBA 3OEHG 4NH9A 4D7SA 2BU7A 2FTKA 3ASNC 2Y0PA 2JDIG 2HEPA 4J41A 3FAVB 4HYPA 2P6JA 2DQ3A 3QVNA 4LFBB 2EJ7A 2F43G 4L87A 4E01A 2XT9A 2Q0AA 1Z5AA 4ZVIA 3RYIA 4DV7O 1FJGO 4J10A 1Q81W 1O9GA 1HWYA 3A0HZ 2FB5A 3ZEDA 2KG7A 1YVWA 4E4EA 2XDSA 1XBLA 2DQ0A 1M93A 1W0KG 3AG2B 1Z2GA 2K9PA 4V25A 1Y4UA 3W7SA 1WPBA 1IBMO 3ZRWA 4FMTA 3HKDB 3F7VC 4J9ZB 3NMQA 1VP7A 5BODA 2FYUH 2QF6A 4O09A 5L3JA 4DW0A 1JFFB 2A0LA 3ZMVA 5IJ0B 3LNUA 1Y8OA 3BEHA 3VHAA 3B2EE 3E22A 5KLVH 4X62O 4X1KB 1SZXA 2WEPA 2UXXA 1NTMH 2ITCC 3L70H 2KB1A 2YIAA 4UVAA 1HNZB 4NXMB 2B9ZA 1BHBA 3ZXQA 5LMUB 3U67A 3HKDA 1NI8A 2CG9A 1EN4A 1SERA 2XNDG 1JJ2U 3HKBA 1AH6A 4DUZO 5J9PC 4AQYB 5M4EA 2WI1A 3MDSA 4URLA 1AVMA 3ZHUA 2QWNB 2QWOB 3WHAA 3H80A 2W6JG 2YEDA 4DRXA 4CZZA 5GONA 1GM9A 3LDEA 2IM9A 4DR6B 4EFTA 3K08A 1TA8A 4MVZA 2A3QA 4MW3A 4X64B 2QKSA 1GN3A 1S16A 2C1IA 4E72A 2ZDIA 2JGDA 4PI0A 1NHHA 5LOVB 3C90A 4X89A 2ZXWC 4O2BA 3KZIZ 4B3SB 4LC1A 3TZ2A 1Q82W 3CCSV 2QWRB 3QO5A 4E00A 2XDUA 4LF5O 3H1LH 3BY6A 4CS2A 5KAIZ 1TVKA 1D5NA 3FB7C 2F1MA 2UXBO 2R72A 1XNRB 2AKPA 1THNA 3OMIB 2IORA 3JAMN 2Y69C 2YE9A 1OCZC 1QY8A 3SYQA 4P8OA 2DW4A 4MS2A 4EKWA 3WQ9A 1QVGU 2QKCA 2BYIA 5LMUO 2BU5A 4JI6B 5JJNB 1YT1A 1KP3A 3B8MA 4EFBA 4GKJB 5D7DA 1KU9A 5KHKA 2Z3YA 1UYMA 2Q73A 3CD6V 1YT2A 1IXBA 5EZYB 1NHJA 1Q90D 1IBKO 2XHRA 3G6EV 4JI8O 1MA1A 2UXNA 1YSRA 2CH7A 3EHBB 1K3EA 2YC0A 1CPYA 4I0XA 4B3MB 2XAFA 2Q8IA 1YS3A 5KHJA 5CTUA 3HB3B 1I59A 1QLNA 3FFQA 1KIJA 3LSUA 5KX5B 4DR4O 2VCJA 3H1KH 4DR7O 1NVPD 2EULA 3R4PA 2IOPA 4LFCB 4GX2A 1U2OA 2ZE5A 4MVQA 4XIQA 3ZHSA 2RCVA 4WFHA 3A0ZA 4ASAA 5FNFA 2DWDC 3MD0A 5CTXA 1LUWA 3LNNA 4WF9V 1I5YA 4QIWF 1OCOB 2X6BA 2ATKC 4QE7A 2E5LB 2PF4E 3PEHA 2P4VA 4UCRA 1WLEA 1E1RG 3TZ5A 2CTPA 2OT5A 4MBCA 3DC5A 4RAIA 1K4CC 3OD4A 2PNRA 1IBMB 3RN4A 3EKOA 1SETA 2F4VB 4ZOLA 3OGIB 4PRVA 4B7PA 3F5TA 3FT8A 2P5OA 4Q6GA 4P30A 3THOA 5FL7G 4IHJA 4J80A 2YK2A 2JK5C 2WLLA 4DV0O 2QE7G 1ID0A 1ZX3A 5M4PA 1EFRG 2YUAA 4HY1A 3ETDA 4O04A 3EHGA 4JTCB 1Y6XA 3D36C 3HZ1A 3ZN0A 2OTLV 2JRIA 1BXDA 4FFBB 3IFXA 4B3TB 3OEEG 4I4TB 2OCHA 1YC3A 3AG4B 1EA6A 3VQYA 2P22C 2C1GA 2NNUA 1WP7A 1G8MA 4BR6A 2UUCB 2HKJA 1MZEA 4GQTA 3BA8A 4DR5O 2WLIA 3E8HA 3QO7A 3K57A 3SYCA 2GQPA 1Y4MA 3AK2A 3L9DA 1PNLA 4DV5B 1NBMG 3I5DA 4X1YB 1K73W 1COWG 4OXSA 4L8ZA 1I94O 4FFBA 5FLXN 3DTUB 4I50B 1Y74B 4CH3A 5K1XA 1Q3EA 4O4LA 3ABLC 1J95A 4DR3O 1BSMA 4ZI7A 2XD6A 2IJHA 2OTJV 5D6QA 1UYKA 1V9PA 5C8YB 3FX7A 1IZ3A 5CPHA 3BAAA 3ZBHA 4NH7A 1SRYA 1N33B 1SQQH 1FFTB 3P32A 1IBLO 2Q5ZA 3VHCA 1TH8A 1OZ0A 4CC5A 1V55C 3CCJV 2XABA 5JCOC 1XUQA 2OIEA 3CC4V 3K59A 5LXTA 1GN2A 2UXBB 4PL9A 4OX9B 3CYGA 3N2KB 4X20B 2KKWA 5IDJA 5JH7A 2QSAA 2EIMB 4N21A 2GTSA 4GX0A 5DEDA 4PD4F 4NH8A 4JI4O 3A0XA 3A0YA 3LMMA 1YETA 1M57B 2Q8VA 4K4OA 2CTRA 4U93A 2LO1A 2WI6A 4ICGA 3EHHA 3GWOA 2QEXV 2YE4A 2ZDXA 3SPIA 3L71H 3JYCA 4L94A 4PA6A 3N2KA 1K5SA 2N05A 3T1YO 3RLPA 4JI2B 2PGGA 4UCUA 4TUYA 4K8ZA 4B7EA 1NHIA 1FXKB 3WU2Z 1GN6A 5IY5B 3ICXA 2W6IG 5DM6V 1B63A 3O0IA 4LWFA 2UXDO 4JV5O 5CB4A 3SPHA 4J7ZA 1OCZB 3FB5C 1ROPA 1R3LC 4CE2A 4EB6B 4X62B 2ZE7A 2JGUA 3HKCA 4CH6A 3OTOB 2W0XA 1AB3A 1Q43A 1AI4A 4FM1A 1SQXH 4NXMO 3EHFA 2CCSA 2LFSA 3SPCA 1WB7A 1K4DC 3OUSA 4L8JA 3RYIB 3C3TA 4HBNA 3SYPA 2BREA 2CH4A 1P4RA 2XHTA 2ZE6A 4B7KA 1IBLB 3IEDA 5EIBD 1PVGA 1BS3A 2ZIOA 1TAEA 3FV5A 1AILA 3ZMUA 4P2ZA 5LL6Y 2ARHA 4QNHB 2PTMA 3QTCA 2WLLB 3ZHTA 2YEHA 4FIPC 4FLUA 2GSMB 1NS1A 3HYYA 2Y4TA 4PA4A 1RPOA 1Z5CA 2BTQA 2JGDB 2YEIA 3O2FA 1TC6A 2B1IA 4GT1A 1AI6A 1BZKA 3M99B 4HZ5A 4MTOA 5KMGA 3EKRA 4JI3O 5BR8O 2XDLA 1S5HC 2XTAA 2O1UA 5L3FA 1BMFG 4LWIA 3TXSA 1RFYA 4A5UB 4LWHA 2PYJA 4YJ2B 5JQGA 5IWAO 4UFZA 4GYCB 2CUGA 1JJOA 4I9WA 1N33O 3ABMC 5KUMA 3JATB 3P30A 1MSWD 1UYHA 1Y74A 2JJCA 3WG7C 4LF4O 1DF4A 3NXSA 4C7UA 4P7AA 2O1VA 3K99A 1KB9F 3T4DA 4WUBA 1ZW9A 5J6AA 5C8YA 5KHHA 4P9PA 4YJ2A 5IYDO 3SDLA 1B62A 4NR1A 3G80A 2QKAA 1ZXMA 1VQ7V 5IJ9B 4GX5A 2YEVA 3I55V 3U10A 3L74H 4K0KO 2IOQA 2CH7B 4U3FH 3EVKA 3STLC 5J71A 2MW2B 2OWOA 4JYBA 1VQMV 1QLEB 3A0BZ 3Q4HB 4XITA 3OR7C 1OSFA 2DYRB 1R3JC 2X6CA 2WAMA 3DXRB 1QR9A 5IYZB 2CDYA 2UU9B 2M6YA 4R3AA 4E02A 1NH2D 4CWSA 4PDLA 1S3JA 1S72V 4MVSA 4JYAB 3JCUZ 4TSFG 1I7FA 3E8GA 4I55B 1P7BA 2HP8A 2O57A 2QTSA 4HZ0A 1HNWO 1H7UA 4FCPA 4QE9A 5CA0A 4LBEC 1V54C 4FVMA 4LWSB 3SYOA 1W59A 4DR6O 1XL4A 4U7OA 2AW9A 1H2SB 2XUMA 2IU0A 4ASBA 5C93A 2JKIA 1M1KW 2YXYA 2ZQMA 2OCCB 4J11A 1L0NH 4BW9A 5B1AB 4DR1B 3ZXOA 4B3RO 2LGWA 3T1YB 4B3SO 3F7YC 4BXIA 1I5BA 1Q8IA 2WERA 5M4HA 2BSMA 4DR3B 3N27A 1U97A 2QGNA 4BW5A 2H55A 1MMMA 4JASA 2R9RB 4LWSA 1DTOA 1AROP 1PPJH 1JFFA 4MVMA 3E8FA 4H13B 3JARA 2YGEA 3E22B 3K0GA 2GUZB 2HVKC 4PA7A 1TBWA 2L6LA 1NTKH 1NQTA 1K92A 3WG7B 4FLZA 1H8HG 1FFXB 4JTAB 2IU3A 3UQ8A 1SQPH 1YITV 1AP5A 1IVSA 2D2CB 1SZTA 2ZINA 1PP9H 3N2GA 4UXNA 1JOYA 4D6TH 3K58A 2ZNJA 4B3TO 3L73H 2KSDA 4HAMA 4UB8Z 5JCOA 3K04A 1OCRC 1TGOA 2P06A 2R9AA 4WFBV 1R3KC 3OPDA 4JPRA 4XDKA 5FPRA 3M8AA 4WCEV 2YKJA 2XX2A 5IN9A 5CF0A 4AI8A 1NU1H 1VQ9V 3C3SA 5BZBA 5B1OA 1SS3A 4K8XA 2CCTA 4O4HA 3OTFA 2BT0A 1AJQA 1N34B 4DR7B 2QJ1A 4JZGA 1XNRO 5L3DA 1K8AW 1QVFU 3WB1A 3B4SA 2WI4A 4I4TA 4XDMA 4JI0B 2YGFA 2YXHA 5FNVB 2A9HA 2ETNA 2CK3G 3DC6A 4NB5A 5D5PA 4OX9O 3OE7G 3CRMA 3K03A 3OTOO 3GIGB 1VEWA 2JJ2G 5EBMC 5FNDA 4MVUA 2QM7A 1AM1A 1R6NA 1N32B 1JM6A 2BU8A 1ZAUA 4GUNA 4H85A 3ETQA 1KMIZ 3PJSK 1YC1A 1SQFA 5IY5C 4YJ3A 3ASOB 1QYEA 4G28B 4LFBO 4IIJA 1MSDA 4H0LB 3R65A 1VQOV 2XX4A 1US7A 1MABG 3LDCA 1XHZA 2XJGA 2YI6A 4MTXA 2IJJA 4XE2A 4R8CA 4YKRA 4MTFA 4DV6O 3CRQA 3A0WA 1N8RW 3C0EA 3CS5A 5B3SC 3ZMZA 2QFOA 2YGAA 2IWXA 3RVZA 4LFCO 2ZDIC 1OCCB 1QQCA 1R62A 5LGTA 5J2TA 2BZ5A 3ZN1A 5JH7B 3HKCB 5M4NA 1TVKB 3VADA 3QNEA 1AJ6A 1MOFA 1XDCA 1H2MA 2JJ1G 1MX0A 4LF6B 4MT8A 5JJEB 2A79B 3ZHQA 3KG2A 5CBHA 4EEHA 4X64O 1AP6A 1NKDA 1YIJV 1M90W 4I9QA 2BE3A 3QO8A 3LDDA 2ZR3A 3K9SA 1Y67A 5H2FZ 1PD3A 1KBHA 5L3BA 4G27B 2PY5A 3T4ZA 4FZ0A 2HHHB 1I5CA 1H7SA 4CWNA 5IYBO 2YIBA 1L0LH 1M5IA 2ZCEA 3D2RA 1ZWHA 3TZ4A 2YI5A 3VQWA 3OUFA 4HZ3A 1F51A 3ETEA 4HNAA 1CXZB 1XOUA 4YIOA 4YKUA 3VQXA 4RUFA 2DYRC 5JVDB 5LA6A 1FFXA 3OR6C 4NTYA 2BRCA 4O4IA 4JYCA 2QM4A 5H9CA 1KYOF 4PV1B 5AG2A 2Q7GA 3ABUA 3JALB 4KTNA 2F23A 3VQVA 4MPEA 5BR8B 3FT5A 1R6KA 3W7WA 3AG2C 1BCCH 4O07A 2XJXA 4NXNB 3G71V 3H1JH 2BU2A 2YE2A 2OCCC 1YC4A 3B09A 2ESAA 3KE6A 1BL8A 2WA4A 1BQ0A 1UY9A 2YKCA 4JI0O 2UWDA 4AHCA 1XHXA 1EBOA 2C2AA 3KCYA 4JQLA 4JGSA 3U11A 1P49A 1FAFA 2XAHA 4PDMA 4LFAB 1OCCC 3SR2C 3JAWB 1AR5A 2BTQB 3IJ4A 3ZS8C 5B1NA 1N0NA 1O9HA 4JZ2A 2Q7EA 4TQFA 1EN6A 3OM3B 1A4HA 4LCUC 5JENA 4PJ0Z 2UXDB 2PI4A 2E5LO 2DYSC 2AZ2A 4DRXB 4L91A 2D3OW 1KC8W 5GONB 1WAZA 1UYGA 2EZPA 3B40A 4LF9O 4X1IA 3CRLA 4O4JA 1XMOO 4UCOA 4DV3O 4IHJB 2XDKA 2UXCB 2FYPA 3GIGA 2JS3A 5IYZA 3UT5A 4WFAV 4IYHA 3DSQA 2H8MA 4UV9A 2NLJC 2QA4V 1XMQB 4CE3A 3HYZA 4GEEA 1L0OA 3RLRA 3E83A 4O2BB 4DZYA 1YJWV 1BGYH 2Q6AA 2YXLA 4DXWA 4YKXA 4I5SA 1AJNA 4HXZA 3ML0A 3OW2U 1DLBA 4O4JB 3ZIAG 5JJJB 4FM0A 4PRXA 1SC5B 2YE6A 3G7BA 3IC9A 2X6AA 1Y8PA 1BT8A 2Q9LA 5FNCA 3UO2A 1FJGB 1I08A 3ZCCA 2YEVB 4PELA 4Q20A 4ASFA 2ITDC 5JWPA 3RLQA 5CA1B 4DYLA 3E8BA 4WUDA 2CAZC 3T10A 1Y8NA 2EILC 1VMGA 4DUYO 1R1BA 3CJHA 1UYIA 1XEQA 3O9OA 4U3JB 5IWAB 2ZBKB 3QF7A 2E0AA 4XIPA 1M9NA 3CX5F 2ZNIA 4XKAA 4DV1B 3ABMB 2UUCO 2GUZA 5H6RA 4UCVA 2WWWA 3K5LA 5CB4B 3BMYA 5E79Z 4LFAO 2HLDG 3TUHA 2G38A 5LXTB 5KUKA 1FPOA 1US6A 3SJQC 3OFNG 1JMKC 4XDLA 1J5EB 2YKEA 4KHPO 3AG3B 1HNZO 2YE7A 3RYCB 2QG2A 3K0DA 5IJ0A 4DUZB 3HZ5A 1FKAO 2ZT9B 2EILB 2YECA 5D5QA 3ZRSA 1K5QA 4Z1MG 3B27A 4XDJA 4NXNO 4GGLA 4KQVA 5GTIZ 4XKKA 1H2KA 4PDVA 3A8TA 4JI6O 4W4LA 5CMUA 4LF7B 3WB2A 3K5NA 3RVYA 2Q4PA 4NYKA 3VOUA 3JD0A 3CXCU 3CP1A 3CB2A 1Z59A 5F3KA 2F95B 1NR1A 2DE0X 3JALA 2WI5A 3ABTA 1PV0A 5E1AC 3Q5KA 4GKKB 1V55B 1WPXA 3G67A 4YKQA 3OWBA 3T0ZA 4NTWA 1QCEA 2VWJA 2QTOA 4I7ZB 2XX5A 4TWKA 3T0HA 4YKYA 1OJHA 3C11A 2WLMA 1GAXA 2ADQB 2RNBA 4IL6Z 3P3PA 1AI5A 4CBCA 3CXHF 4XD8A 1E1QG 1QHTA 3CCVV 4FCQA 4DV1O 2Q7HA 3T1HO 3W7UA 2ZM6O 4NTXA 2UUBO 1VF5B 5LYJA 4JI2O 5DN6G 1A32A 3B28A 2EIJC 4TV9B 1YHQV 2PI5A 4FLTA 2WA3A 4B3RB 1GM8A 5EBLC 1LUVA 2CCUA 5GGZA 2VQEO 2A7WA 5B1BC 4QJFB 1KKCA 2EINC 2GV9A 4UV8A 1KZNA 2VWKA 1BHAA 1H38A 1F4NA 2WLKA 3R91A 1B3QA 4O4HB 4H7QA 1BQZA 3OMUA 5FWKA 3HKBB 3L72H 1B06A 4UCSA 3K98A 1YTFD 1G4YB 4JAAA 3WFVA 3RT3C 2K1EA 4ZBMA 2VQFO 1AR1B 5CBGA 2IJIA 1DK1A 2XAGA 2FWYA 3BA9A 1ZWIC 1MG1A 4DK0A 2QWPB 4KL1A 4DV6B 2N74A 1N36B 2QWQB 3DGEA 1EI1A 4EFUA 2KQXA 4DO2A 2IWUA 4MVOA 5J2TB 2F66C 5H5NA 3Q4HA 4J7JA 4WFGA 5K1PA 2YE3A 4DV0B 3CCQV 1F7YA 3FB6C 1BGQA 3AG1C 4ZI7B 3ZMSA 1SA0A 3ABLB 3DXRA 3I56V 2YE8A 2XHBA 2AHZA 3CSXA 4J7KA 3GIFA 4WBNB 1P7GA 2BSKB 4CE1A 3SJBC 1NVPB 4LF6O 2LJ2A 3JD1A 2FWZA 4W7TA 5D7CA 2Q8HA 5EIBC 1NTZH 4MPCA 2EINB 2E75B 4MPNA 4LWGA 2UUBB 1YCIA 4CS4A 1GRJA 4R50A 1SQGA 3R4MA 1ORQC 2Q68A 2BTZA 1BKNA 2WEQA 4RO2A 5IJ9A 1IX9A 1TILA 1OHHG 2AGAA 5BXZA 2F4VO 1ZL8B 4UCTA 4LF5B 4H44B 4FK5C 1Q6IA 3B26A 3R66A 1RM1C 4FLWA 2YIDA 4DUHA 1WA8A 3CMAV 3UCSC 2BU6A 1XI1A 4X9LA 4TQDA 4KUMA 3RYCA 3PEJA 1KKDA 4ZKIA 1FXKA 2YI0A 1YTFB 4KSGA 2ZR2A 3G7EA 1QNMA 4JF3A 3E86A 3TCUA 3EHJA 2YICA 3OT7A 1N32O 5HFMA 4RQEA 3FD9A 2KG7B 1VQKV 1B6QA 2VQFB 3K5OA 4IYIA 5IDMA 4H81A 3CCUV 4I0XB 3WB0A 3X2QB 4D7TA 3GB7C 1E79G 2QR4A 1N4CA 1GM7A 1WA8B 2ZXWB 2RQ6A 4AILC 4XCJA 1LR1A 2DWEC 2YEGA 2YEJA 2Y69B 1ZLZA 3ASOC 2HJDA 3CCMV 4J9YB 4EGHA 2O1WA 5A2QN 1YZBA 3ABKC 5ITZB 4EFEA 3H9VA 2P90A 1K97A 5JVDA 4GT8A 4MP7A 2W0FC 3D8CA 3SL2A 3W7XA 1L8DA 2XAJA 1I94B 3BPZA 4F4LA 4DUYB 1JR9A 2EX3A 1ENVA 5KHIA 2DYSB 1D5AA 4HXWA 1YI2V 1G1XB 1DGSA 1VQ6V 4EGIA 2GDSA 3H1HH 5B1BB 2Y4UA 4DV3B 1ZUQA 4O2AB 2YI9A 3QG5A 4QGPA 3STZC 4MSWC 4GZRB 1GN4A 2ZKOA 1ZSPA 1YERA 4I50A 5IE9A 2E76B 1VQ8V 4LP0A 2QM8A 1IXMA 4F6RB 2Q8FA 1FXVA 1M57C 4FZ1A 4JYYA 1YSCA 3P3NA 3QTFA 2B5UA 2GBOA 2E3CA 5FPOA 1Z5BA 4IT5A 1GKZA 5B3SB 1VQ4V 4GFNA 3PN1A 2K5BA 4GKJO 2VWCA 4CC6A 3CE2A 3JASA 4MP2A 4LP8A 1H2LA 5LOVA 3CMEV 3TETA 3OMAB 2AHYA 1WNSA 1TC0A 3OW6A 3RYHA 4X20A 4URMA 4ZIBA 4FCRA 3CJHB 3CRCA 1UY8A 4DR2B 5GTHZ 1AMWA 4GCZA 4GKKO 3K5MA 1L1FA 2BSKA 3ASNB 5EC1C 5BMVA 4WUCA 3ZJZA 1JQ0A 3BRCA 2A06H 4XC0A 4PI2A 2F93B 3X2QC 3CGZA 4CWQA 3FAVA 3B8NA 3D3IA 4W4KA 4YKWA 5CTYA 5B66Z 2BOCC 2YIBD 4YKZA 1I58A 3INXA 1NR7A 1Y66A 4JI7O 1HNXO 1MNGA 2WI3A 3AG4C 5LGUA 2YEEA 1JA8A 4YXWG 3MNRP 5A9GA 1X4TA 5CTWA 4LR3A 2GFDA 2HHIA 4XIRA 2JEXA 3CHXA 1FXHA 2IJKA 4X66O 2VQEB 4U7NA 4DV4O 3SGIA 3AK1A 2WLNA 2HFEC 1AI7A 3F5WC 3RW0A 2HKOA 4G2KA 1HDJA 4TT3G 2Y0IA 2YK9A 2GHYA 1FD9A 3BHPA 1M56B 3HPLC 1XQ8A 3LSQA 4K0KB 2LP7A 4YHHB 4BAEA 1K34A 2R70A 4FJCC 4HNAB 4F6EA 2HG1A 4X1KA 4JAVA 1QR8A 3M7MX 1N36O 3CWBH 1JX9A 3EFFK 2ZD9A 1UY6A 4J42A 1GJVA 5LMNO 5J2UA 3JD4A 4O0BA 4I3HA 4TUYB 4AWQA 2OYQA 1OCOC 2AXTZ 1PKXA 3AG1B 4RWUA 3B77A 4E2LA 1VF6C 3KKYA 1EZJA 3BFRA 1HP8A 4JI1B 3LNMB 2RDCA 2V1DA 4DV2B 3A0TA 3T2SA 2YI8A 3S3XA 4ASUG 2PZSA 4CH4A 4JI8B 3ZHVA 3CWVA 3INWA 4BQGA 5KMGB 4PHZA 2IH1C 3CCLV 1S5LZ 3U0ZA 3CC7V 1BE3H 1S77D 1EZVH 4XTJA 3K3WA 5J2UB 5B1AC 2YEBA 2PUSA 3T2MA 3LSSA 4H33A 1SF9A 2WLJA 3JAWA 4O2AA 1XNQB 2R9IA 2IW5A 2H8PC 1HNXB 2HHHO 2UXCO 2CGFA 1PL0A 4LF8O 1NZ6A 4JTDB 3JAKA 1V54B 4TV8B 3TK1A 3B24A 4R7CA 2XOKG 1F4MA 4Z1VA 2RMKB 3S5TA 2XASA 4LH6A 2H3OA 3UO3A 1KECA 3H01A 1JCHA 2CGOA 4O4IB 4JAUA 4X1IB 1MU5A 3JSNA 1DF5A 2B1GA 4KHPB 4X66B 4MTGA 1TIDA 5CBFA 3JCZA 2IH3C 1Q6UA 3SYAA 2ZKJA 3JASB 2HJFC 1HR0O 3Q5JA 3ETGA 1VQNV 5KHGA 3R4NA 3TTZA 2GTAA 1H8EG 2FMLA 4UB6Z 1TUBB 4YHHO 4URNA 3AEIA 2YS8A 2LW1A 1VIBA 3GVMA 1QU7A 3G6BA 4KP4A 4XKOA 3G4SV 2Q0OC 1OV9A 5IT9N 5JQGB 2ZE8A 2YEFA 4H37A 1Q5OA 5EZYA 3W7TA 3OMNB 4OPHA 4DV7B 5BY1A 3ZM7A 4DR4B 1PM9A 4EMVA 4YY3O 1W2BU 4WFFA 4DR1O 1TUBA 3B25A 3CRKA 3ZX6A 1YESA 3H4LA 4DV4B 1NT2B 4LNUB 4DV2O 4PA9A 3JSLA 3AG3C 1RSOA 3E89A 4R6ZA 5KX5A 1KUQA 3D0BA 2YSUB 1GTOA 4JI5O 1NH2B 1NJIW 3U2KA 3U2DA 2JVDA 2EIKB 3CC2V 1UYDA 1IURA 2V4DA 2WLHA 3L75H 2PYLA 4LF4B 4BQJA 3HKEB 3MAQA 5BOCA 4XBFA 1OCRB 5IYCO 5L3CA 4LF8B 1U0ZA 1S5JA 4EEQA 1KD1W 4LNUA 2ADPA 4KSHA 1FXKC 3UKMA 4YKTA 4AWPA 1VQPV 3T1CA 1YEWA 2LGQA 3BVOA 1HR0B 5LGNA 5F5RA 2VCIA 5M4MA 1FYJA 1YJNV 2Q67A 4JI1O 3SJAC 3CCRV 3D36A 3FB8C 3KCXA 1UJWB 2WI2A 3BABA 2CGNA 3ZKBA 1QLEC 3N2GB 4X65B 5CA0B 2YI7A 5EK0A 4BIOA 2YEAA 4XCLA 1SQBH 4NKGB 1I5DA 1VARA 5LHGA 1Y4SA 3ABKB 1JPXA 4U3JA 2E74B 2RJZA 5GW7A 3O65A 3CEIA 5L3GA 3ZHRA 4QPKA 1UPGA 3J80N 3FYEB 1N34O 4PA3A 2ZIMA 2EZOA 2FKXA 1XREA 1WJZA 3K9AA 3RBZA 2LFRA 3VHDA 5EC2C 4MW8A 1I5AA 2N04A 4F6RA 2BOBC 4LF9B 3E35A 2DJVA 2Q8GA 2OIGA 3RYFB 2WLIB 4TV9A 4KXRA 3LPSA 1Y76A 4P9OA 3MHHC 2YKBA 1KP2A 4ZOLB 4TV8A 5KAFZ 2Q2EB 3IAYA 1Z5WA 1VF7A 3RYHB 3A2FA 2UUAB 2X0LA 1UYFA 5EYPA 4K3AA 1KQSU 5FNVA 1UYLA 2HG5C 4FLYA 3TZ0A 2VRZA 2WPDG 3RYFA 1RM1B 3FKSG 1D2DA 1EN5A 5BMVB 2DN9A 3CPWU 5KA6A 1WB8A 1Y76B 3JD2A 3ZKDA 5L3EA 2VW5A 4YY3B 1VQLV 3IC7A 1WP8A 2P67A 1GMGA 4B3MO 4CWFA 4B08A 1PL4A 4PDRA 4JYAO 4YJ3B 3HHUA 5DECA 1TUEB 4IIJB 1VF6A 3CRAA 4X8AA 4R1FA 2BYHA 1YXBA 3Q5LA 1XL6A 4CS3A 4ZHQA 2V7QG 3UT5B 2IBZH 2YKIA 5LYJB 3ZMTA 4WBNA 1UYEA 3HEKA 1RP3B 4JI7B 5LHHA 2ODMA 3OGCC 4GLXA 3RKZA 5HFLA 4MOTA 4ASGA 3CRRA 4CWTA 2XDXA 3D3QA 1J5EO 1M56C 4YIPA 3RGBA 1W0JG 2P7TC 3K60A 1RSOB 3BCCH 1S76D 4LPBA 1IDSA 1K7DA 2ILMA 1YT0A 1ZXNA 4B6CA 2DOSA 3APOA 1R3IC 1XNQO 1AH8A 1PNKA 2ZM6B 5LP6A 3TGUH 2FL4A 2UUAO 3CCEV 5CA1A 4HY6A 1N0JA 3AK3A 3R4OA 3EXAA 4L90A 4HYOA 3HKEA 3NR7A 2LQTA 3JD3A 4FLXA 4JI5B 1G6UA 2QDOA 2Y48A 2IWSA 5D6PA 3HR0A 3JZ3A 1AR4A 3J7AU 1GKXA 4GX1A 4AWOA 2HR3A 3A0RA 2CTWA 2XK2A 4CWRA 3SPGA 2CTQA 5LP6B 2EIMC 1RPRA 5D7RA 3CGYA 5CN0A 1GO3F 2Z5UA 1R6TA 4BAYA 5LBQA 3MHSC 1ZTEA 3T1HB 4R3MA 1Q6HA 2EIKC 4FM2A 2XJJA 4JI3B 1K9MW 2X7RB 3OAAG 3J81N 1VQ5V 3JARB 4DV5O 5ITZA 4X9QA 3CYOA 4N23A 4EM7A 1ZL8A 1XILA 3S3WA 5M4KA 4FLVA 4EB6A 4CWOA 1CP9A 3RWRD 5LHIA 1T5EA 1X59A 3QDDA 1GK9A 3ZRWB 2P4KA 3FYIB 4UVCA 2XHXA 2RN9A 2ZDYA 4V26A 1H2NA 4RUEA 3K06A 3APQA 2WSSG 1I0HA 4OGQB 1QZRA 5LP6C 3JATA 1EM1A 3TXQA 1XMQO 2HCHA 3O6OA 2WI7A 3SJCC 5KA5A 1Q7YW 5LA6B 4MB9A 4HYMA 1HW7A 3ZRXA 5CA3A 4FPPA 5EYPB 1SESA 4UUJC 2MK3A 3H1IH 1M4UA 2UU9O 4MVRA 4X88A 2JIZG 2AZ0A 4JI4B 2JEUA 4O05A 1Z5VA 2Z0AA 1JVMA 4WFEA 4CH5A 2NR5A
chains in the Genus database with same CATH topology
4PA6A 2WLNA 2HFEC 5B1NA 1AI7A 3F5WC 3RW0A 2HKOA 4G2KA 5H6QA 1K5SA 4BIUA 4TT3G 3OM3B 3OWDA 1A4HA 1F23A 2YK9A 3RLPA 4LCUC 2GHYA 2PI4A 1M56B 3HPLC 2DYSC 1NHIA 4L91A 1FXKB 2D3OW 1KC8W 5IY5B 3LSQA 1K33A 2LP7A 2W6IG 1K34A 4BAEA 1UYGA 4FJCC 3ZRVA 1AJPA 2EZPA 5DM6V 1B63A 2YE5A 2HG1A 3O0IA 4LWFA 3CRLA 4JAVA 1QR8A 2XDKA 3R92A 3SPHA 2FYPA 3GIGA 2YJWA 1OCZB 3FB5C 1ROPA 4WFAV 1R3LC 4CE2A 1JX9A 2Q69A 2XAQA 1UY7A 3EFFK 2FXSA 2ZD9A 2H8MA 4UV9A 3UM7A 1UY6A 2NLJC 2QA4V 2EBOA 1GJVA 1GKFA 1YJ9V 4CE3A 3HYZA 4GEEA 1FS0G 1L0OA 3RLRA 1THZA 3JD4A 4O0BA 4I3HA 4AWQA 3E83A 4DZYA 1OCOC 4KFMA 1PKXA 1AI4A 3AG1B 1YJWV 3B77A 3EHFA 4E2LA 2Q6AA 2CCSA 1CEZA 2LFSA 3SPCA 1EZJA 1H2GA 4DXWA 3T1KA 3LNMB 1S0VA 1K4DC 3K97A 2EJRA 3OUSA 4I5SA 4YKXA 1AJNA 4LWEA 2V1DA 4HXZA 1R73A 3ML0A 3OW2U 1DLBA 3A0TA 3SYPA 3T2SA 4ASUG 3ZIAG 2HVJC 2BREA 1P4RA 2CH4A 2XHTA 2YJXA 3BM9A 3GIEA 2YE6A 4PRXA 3G7BA 3IEDA 4EGKA 1PVGA 3CWVA 3E2EA 3K79A 3INWA 4BQGA 2X6AA 4L93A 1BYQA 1Y8PA 5FNCA 2IH1C 3SPJA 3CCLV 3FV5A 3CC7V 1S77D 1QBZA 4P2ZA 3ZCCA 4QPJA 2YEVB 3K3WA 4PELA 4Q20A 3ZMUA 4QNHB 2H94A 2ITDC 4XTJA 4ASFA 3RLQA 4AS9A 2WLLB 5B1AC 1UYCA 2YEBA 3E8BA 4PU9A 4CWPA 3T2MA 4KFGA 4UROA 2YEHA 4WUDA 4FIPC 3T10A 2GSMB 3LSSA 4H33A 4BIZA 3HYYA 4PA4A 2WLJA 1RPOA 1Y8NA 1Z5CA 1S14A 2EILC 2XCMA 1I5XA 2M7WA 2R9IA 2IW5A 2H8PC 2EXLA 3LUTB 1PL0A 4RQFA 3VBBA 1PNMA 1UYIA 2CGFA 2YEIA 3G75A 1TC6A 4JTDB 3O2FA 2B1IA 1V54B 3TK1A 3B24A 4GT1A 1LNQA 1F4MA 2XOKG 1AI6A 4R7CA 2ZBKB 2QG0A 2XASA 2E0AA 4XIPA 4XKAA 1M9NA 3M99B 4HZ5A 1KECA 4MTOA 2EIJB 3H01A 3ABMB 1JCHA 3IGAC 5EBWC 4JAUA 1YSZA 3EKRA 2XDLA 1S5HC 4UVBA 2O1UA 3OEHG 5H6RA 5L3FA 1MU5A 4NH9A 1BMFG 4LWIA 2BU7A 2WWWA 1DF5A 2FTKA 2B1GA 3BMYA 4LWHA 2HLDG 3ASNC 3TUHA 4MTGA 2JDIG 1TIDA 5CBFA 3JCZA 2IH3C 5KUKA 3SYAA 4I9WA 2ZKJA 3SJQC 3ABMC 5KUMA 3OFNG 2HJFC 2P6JA 4HYPA 2DQ3A 3Q5JA 4XDLA 3ETGA 2YKEA 3AG3B 1VQNV 3R4NA 3TTZA 2F43G 4L87A 2YE7A 2QG2A 4E01A 1H8EG 3K0DA 3P30A 1MSWD 1UYHA 3HZ5A 1Z5AA 2JJCA 4ZVIA 3WG7C 2EILB 4URNA 1DF4A 3NXSA 3AEIA 2YECA 3ZRSA 1K5QA 4Z1MG 4P7AA 3B27A 2O1VA 4XDJA 3K99A 4GGLA 1Q81W 4KQVA 4XKKA 3T4DA 4WUBA 4PDVA 1ZW9A 4XKOA 1HWYA 4KP4A 5J6AA 5CMUA 3G4SV 2XDSA 4P9PA 5IYDO 3RVYA 2DQ0A 1B62A 2YEFA 4H37A 1W0KG 3AG2B 4V25A 3VOUA 3JD0A 3CXCU 3CP1A 3W7SA 1Y4UA 3W7TA 1ZXMA 3OMNB 1VQ7V 4GX5A 1Z59A 5F3KA 4FMTA 2YEVA 3ZRWA 3F7VC 1NR1A 4J9ZB 3I55V 3ZM7A 4EMVA 3NMQA 2IOQA 5BODA 2QF6A 2WI5A 3ABTA 3STLC 4O09A 5E1AC 1W2BU 3Q5KA 5J71A 5L3JA 4WFFA 1V55B 2A0LA 1WPXA 3ZMVA 3B25A 3CRKA 4YKQA 4JYBA 1VQMV 1YESA 1QLEB 3H4LA 3LNUA 3OWBA 3T0ZA 4XITA 3OR7C 1OSFA 3BEHA 1Y8OA 3VHAA 2DYRB 1R3JC 1QCEA 4PA9A 2X6CA 3AG3C 2WAMA 3E89A 4R6ZA 3D0BA 2WEPA 2YSUB 1QR9A 1GTOA 2UXXA 2QTOA 2XX5A 4TWKA 3T0HA 1NH2B 2ITCC 4YKYA 2KB1A 4R3AA 4UVAA 3C11A 2WLMA 1NH2D 1NJIW 3U2KA 3U2DA 4E02A 4CWSA 4PDLA 1S3JA 2EIKB 3CC2V 1AI5A 4CBCA 1BHBA 4XD8A 1E1QG 1S72V 4MVSA 1UYDA 3ZXQA 3CCVV 4FCQA 3U67A 2CG9A 1SERA 2WLHA 4TSFG 2XNDG 3W7UA 1JJ2U 3E8GA 4BQJA 1P7BA 1AH6A 4HZ0A 1H7UA 5J9PC 4FCPA 4QE9A 4XBFA 1OCRB 5DN6G 5IYCO 2EIJC 5L3CA 2WI1A 3B28A 1U0ZA 5M4EA 1KD1W 4LBEC 4URLA 1V54C 1YHQV 2PI5A 1FXKC 3UKMA 4KSHA 4YKTA 4AWPA 1VQPV 3T1CA 5BOCA 1GM8A 5EBLC 3SYOA 3WHAA 3H80A 1XL4A 4U7OA 2CCUA 2W6JG 5GGZA 5LGNA 2YEDA 5F5RA 2IU0A 4ASBA 4CZZA 2VCIA 5C93A 2JKIA 1GM9A 5M4MA 3LDEA 5B1BC 1M1KW 4QJFB 2EINC 1YJNV 2Q67A 3CCRV 4UV8A 2ZQMA 2OCCB 3D36A 1KZNA 5B1AB 1BHAA 4EFTA 1H38A 3FB8C 1F4NA 3K08A 3ZXOA 2WLKA 4MVZA 3R91A 1UJWB 4MW3A 1B3QA 4H7QA 3F7YC 2WI2A 3OMUA 4BXIA 1I5BA 2QKSA 2WERA 3ZKBA 5FWKA 1S16A 2BSMA 5M4HA 3K98A 1QLEC 1YTFD 1G4YB 3WFVA 2K1EA 2ZDIA 4BW5A 4ZBMA 2H55A 1AR1B 5CBGA 2YI7A 5EK0A 2IJIA 2YEAA 2FWYA 2XAGA 4JASA 4XCLA 1NHHA 1I5DA 1ZWIC 1MG1A 2R9RB 5LHGA 1Y4SA 4X89A 3ABKB 1JPXA 2ZXWC 1DTOA 1AROP 3DGEA 4LC1A 5GW7A 3TZ2A 1EI1A 4MVMA 1Q82W 3CCSV 4EFUA 4DO2A 5L3GA 2IWUA 3QO5A 4E00A 4MVOA 4QPKA 4WFGA 3E8FA 2XDUA 2YE3A 3FYEB 3CCQV 4PA3A 2EZOA 3K0GA 3FB6C 2YGEA 2HVKC 3BY6A 1BGQA 4PA7A 3AG1C 3K9AA 1TBWA 3ZMSA 3ABLB 3I56V 3RBZA 3FB7C 1NQTA 1K92A 2LFRA 3WG7B 2YE8A 3VHDA 5EC2C 1H8HG 2AHZA 4MW8A 1I5AA 1THNA 2AKPA 4JTAB 2IU3A 3OMIB 1YITV 3GIFA 1JOYA 1SZTA 2IORA 2BOBC 4UXNA 2Y69C 3E35A 4CE1A 2YE9A 1NVPB 1OCZC 4HAMA 2Q8GA 1QY8A 3SYQA 4P8OA 3K04A 3JD1A 1OCRC 2DW4A 4MS2A 4EKWA 2FWZA 4W7TA 1QVGU 5D7CA 3WQ9A 2Q8HA 2BYIA 4MPCA 2WLIB 4WFBV 1R3KC 3OPDA 2EINB 2BU5A 1YT1A 4MPNA 4JPRA 4LWGA 4XDKA 3LPSA 1KP3A 4P9OA 3B8MA 3MHHC 2YKBA 1Q86W 4WCEV 2YKJA 5D7DA 1KP2A 4R50A 2XX2A 5IN9A 5CF0A 2Q2EB 2Z3YA 1UYMA 3R4MA 3CD6V 1VQ9V 1ORQC 2Q68A 1YT2A 5BZBA 2BTZA 1BKNA 5B1OA 2X0LA 1NHJA 1UYFA 2WEQA 4RO2A 1TILA 3G6EV 2XHRA 1OHHG 1KQSU 2CCTA 2UXNA 2HG5C 1UYLA 1YSRA 3TZ0A 2BT0A 3EHBB 1AJQA 1K3EA 2WPDG 1CPYA 4FK5C 3B26A 1RM1B 1RM1C 2XAFA 3FKSG 1YS3A 2Q8IA 3CPWU 5KA6A 5CTUA 4DUHA 3CMAV 2BU6A 3HB3B 3JD2A 3ZKDA 1I59A 4X9LA 1QLNA 5L3EA 4KUMA 2VW5A 1KIJA 1VQLV 5L3DA 3IC7A 1KKDA 3PEJA 2P67A 2VCJA 1GMGA 4ZKIA 1FXKA 1NVPD 4CWFA 1K8AW 2YI0A 1QVFU 3R4PA 2WI4A 4PDRA 1YTFB 2ZR2A 2IOPA 3G7EA 3HHUA 4KSGA 4JF3A 4GX2A 3E86A 1TUEB 4MVQA 3TCUA 1U2OA 2YGFA 3EHJA 4XDMA 4X8AA 4XIQA 4R1FA 5HFMA 4WFHA 2BYHA 3A0ZA 3Q5LA 4RQEA 2A9HA 2CK3G 4ASAA 3OE7G 1VQKV 3K03A 5FNFA 2DWDC 3MD0A 3GIGB 2JJ2G 1XL6A 5EBMC 1B6QA 5CTXA 5FNDA 2V7QG 4MVUA 2QM7A 5IDMA 4H81A 4WF9V 3CCUV 1I5YA 1AM1A 2YKIA 3ZMTA 1R6NA 3X2QB 1UYEA 3HEKA 4QIWF 3GB7C 1E79G 5LHHA 1OCOB 2ZXWB 1GM7A 2X6BA 2ATKC 4QE7A 4XCJA 3OGCC 1JM6A 2BU8A 2DWEC 3PEHA 4H85A 2YEGA 3RKZA 2YEJA 5HFLA 4MOTA 1WLEA 2Y69B 3PJSK 4ASGA 1YC1A 1E1RG 3TZ5A 5IY5C 4CWTA 3ASOC 3CCMV 2OT5A 3ASOB 4G28B 4J9YB 1QYEA 2XDXA 4RAIA 1K4CC 1M56C 4MBCA 4EGHA 2O1WA 2PNRA 1VQOV 3ABKC 3R65A 2XX4A 1US7A 1W0JG 1MABG 3LDCA 2P7TC 3EKOA 1SETA 2XJGA 3K60A 2YI6A 4PRVA 4B7PA 2P90A 4MTXA 1K97A 4GT8A 1S76D 4LPBA 2W0FC 4MP7A 1K7DA 2IJJA 1YT0A 4XE2A 4R8CA 4YKRA 1ZXNA 3SL2A 3W7XA 4MTFA 2XAJA 4F4LA 3FT8A 4B6CA 1R3IC 4P30A 1ENVA 1AH8A 1PNKA 3A0WA 2DYSB 1N8RW 4HXWA 3C0EA 1YI2V 5FL7G 5B3SC 3ZMZA 2QFOA 2YK2A 3CCEV 2JK5C 2WLLA 2IWXA 2YGAA 3RVZA 4HY6A 1VQ6V 4EGIA 3R4OA 4L90A 2QE7G 4HYOA 1ID0A 5B1BB 2ZDIC 1OCCB 1R62A 3JD3A 5LGTA 2Y48A 1EFRG 5M4PA 2IWSA 5D6PA 2BZ5A 3ZN1A 4HY1A 3ETDA 4O04A 3STZC 5M4NA 4MSWC 3EHGA 3JZ3A 4JTCB 3VADA 3HZ1A 3ZN0A 3QNEA 2OTLV 1AJ6A 1MOFA 1BXDA 1YERA 1GKXA 2JJ1G 3IFXA 1MX0A 3OEEG 4GX1A 1VQ8V 4MT8A 4LP0A 4AWOA 2QM8A 2A79B 1IXMA 2HR3A 3KG2A 3A0RA 5CBHA 1YC3A 1M57C 1FXVA 3AG4B 2XK2A 2Q8FA 4EEHA 1EA6A 1NKDA 1YIJV 1YSCA 1M90W 3SPGA 4CWRA 3QO8A 2NNUA 3LDDA 2B5UA 2ZR3A 3QTFA 1Z5BA 1GKZA 5B3SB 2EIMC 1RPRA 1G8MA 1VQ4V 1PD3A 4GFNA 2HKJA 5D7RA 5L3BA 2K5BA 3CGYA 4GQTA 4G27B 2VWCA 2WLIA 3E8HA 1GO3F 3QO7A 5CN0A 3SYCA 1Y4MA 3T4ZA 1I5CA 2Z5UA 2GQPA 1H7SA 1PNLA 4BAYA 4CWNA 1NBMG 5LBQA 4MP2A 3MHSC 4LP8A 5IYBO 1K73W 1COWG 4OXSA 3D2RA 4R3MA 1ZWHA 3CMEV 4L8ZA 3TZ4A 3TETA 2EIKC 2YI5A 3OMAB 3DTUB 2XJJA 1K9MW 2AHYA 1TC0A 3OW6A 2X7RB 3OAAG 3OUFA 4URMA 4HZ3A 1VQ5V 3ABLC 1J95A 1F51A 3ETEA 4FCRA 2XD6A 4YKUA 2IJHA 3CYOA 4N23A 2OTJV 5D6QA 1UYKA 1UY8A 4RUFA 4EM7A 2DYRC 1AMWA 5CPHA 4GCZA 3OR6C 5M4KA 4NH7A 1SRYA 2BRCA 1L1FA 4CWOA 1FFTB 3P32A 1CP9A 4JYCA 5H9CA 3VHCA 1TH8A 1OZ0A 5LHIA 1V55C 3ASNB 5EC1C 3QDDA 4WUCA 1GK9A 3CCJV 3ZJZA 2XABA 3ABUA 3ZRWB 1JQ0A 3FYIB 4UVCA 2XHXA 4KTNA 4MPEA 2ZDYA 4V26A 4XC0A 3CC4V 3FT5A 4RUEA 3K06A 3X2QC 3CGZA 4CWQA 1R6KA 3W7WA 3B8NA 4PL9A 3D3IA 3AG2C 2WSSG 4YKWA 5CTYA 5IDJA 1QZRA 2XJXA 4O07A 2BOCC 3G71V 2BU2A 2EIMB 2YE2A 4N21A 4YKZA 2OCCC 4GX0A 1I58A 1NR7A 1Y66A 2HCHA 3INXA 2WI7A 3O6OA 4NH8A 2WI3A 3AG4C 5KA5A 5LGUA 1Q7YW 1YC4A 2YEEA 2ESAA 3A0XA 3A0YA 3ZRXA 4HYMA 4MB9A 4YXWG 1M57B 1YETA 5CA3A 3KE6A 1BL8A 4FPPA 3MNRP 4K4OA 1UY9A 2YKCA 4U93A 2UWDA 1SESA 4UUJC 2MK3A 1EBOA 2C2AA 2WI6A 5CTWA 4JQLA 4MVRA 4X88A 2JIZG 3EHHA 2GFDA 3GWOA 2QEXV 4JGSA 4XIRA 4O05A 2JEUA 2YE4A 2XAHA 4PDMA 1JVMA 2JEXA 1FXHA 2IJKA 2ZDXA 1OCCC 4WFEA 4U7NA 3SPIA 3JYCA 4L94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1N A;  3OWD A;  4BIU A;  1A4H A;  3RLP A;  2YK9 A;  1NHI A;  4L91 A;  4BAE A;  1UYG A;  3ZRV A;  1B63 A;  2YE5 A;  3O0I A;  2HG1 A;  4LWF A;  3CRL A;  4JAV A;  2XDK A;  3R92 A;  2FYP A;  3GIG A;  2YJW A;  4CE2 A;  1UY7 A;  2FXS A;  2H8M A;  1UY6 A;  1GJV A;  4CE3 A;  3HYZ A;  4GEE A;  1L0O A;  3RLR A;  4O0B A;  4I3H A;  4AWQ A;  4DZY A;  3EHF A;  2CCS A;  2LFS A;  3T1K A;  3K97 A;  4YKX A;  4I5S A;  4LWE A;  4HXZ A;  3A0T A;  3T2S A;  2BRE A;  2CH4 A;  2XHT A;  2YJX A;  3BM9 A;  4PRX A;  3GIE A;  2YE6 A;  3G7B A;  3IED A;  4EGK A;  1PVG A;  3CWV A;  3INW A;  4BQG A;  4L93 A;  1BYQ A;  1Y8P A;  5FNC A;  3FV5 A;  3ZCC A;  4QPJ A;  4Q20 A;  4XTJ A;  4ASF A;  4AS9 A;  3RLQ A;  1UYC A;  2YEB A;  4PU9 A;  4CWP A;  4KFG A;  4URO A;  2YEH A;  4WUD A;  3T10 A;  4BIZ A;  3HYY A;  1Y8N A;  1Z5C A;  1S14 A;  2XCM A;  2EXL A;  2CGF A;  1UYI A;  3G75 A;  2YEI A;  3O2F A;  1TC6 A;  3TK1 A;  3B24 A;  4GT1 A;  2ZBK B;  2QG0 A;  2E0A A;  4XIP A;  4XKA A;  4HZ5 A;  1YSZ A;  3EKR A;  4JAU A;  2XDL A;  2O1U A;  1MU5 A;  4NH9 A;  4LWI A;  2BU7 A;  2WWW A;  4LWH A;  2FTK A;  3BMY A;  3TUH A;  1TID A;  2ZKJ A;  4HYP A;  3Q5J A;  2YKE A;  3R4N A;  3TTZ A;  2YE7 A;  4E01 A;  2QG2 A;  1UYH A;  3HZ5 A;  1Z5A A;  2JJC A;  4ZVI A;  4URN A;  3NXS A;  2YEC A;  4P7A A;  3B27 A;  2O1V A;  3K99 A;  4KQV A;  4GGL A;  4XKK A;  4WUB A;  1ZW9 A;  5J6A A;  4XKO A;  4KP4 A;  2XDS A;  1B62 A;  2YEF A;  4V25 A;  1Y4U A;  1ZXM A;  1Z59 A;  5F3K A;  4FMT A;  3ZRW A;  3ZM7 A;  4EMV A;  3NMQ A;  2IOQ A;  5BOD A;  2QF6 A;  2WI5 A;  4O09 A;  5J71 A;  3Q5K A;  5L3J A;  3B25 A;  3CRK A;  4YKQ A;  4JYB A;  1YES A;  3H4L A;  3LNU A;  3OWB A;  3T0Z A;  4XIT A;  1Y8O A;  1OSF A;  3VHA A;  3D0B A;  2WEP A;  2XX5 A;  3T0H A;  4YKY A;  4R3A A;  3C11 A;  4E02 A;  3U2K A;  3U2D A;  4CWS A;  4XD8 A;  1UYD A;  3ZXQ A;  3U67 A;  4FCQ A;  2CG9 A;  4BQJ A;  1AH6 A;  4HZ0 A;  1H7U A;  4FCP A;  5BOC A;  3B28 A;  5M4E A;  2WI1 A;  1U0Z A;  4URL A;  4KSH A;  4YKT A;  4AWP A;  3WHA A;  3H80 A;  4U7O A;  2CCU A;  5GGZ A;  2YED A;  5F5R A;  4ASB A;  2VCI A;  5C93 A;  2JKI A;  5M4M A;  3D36 A;  1KZN A;  4EFT A;  3ZXO A;  3R91 A;  1B3Q A;  4H7Q A;  2WI2 A;  3OMU A;  4BXI A;  1I5B A;  5FWK A;  2WER A;  3ZKB A;  1S16 A;  2BSM A;  5M4H A;  3K98 A;  2H55 A;  2YI7 A;  2YEA A;  2FWY A;  4JAS A;  4XCL A;  1NHH A;  1I5D A;  1Y4S A;  3DGE A;  4LC1 A;  3TZ2 A;  1EI1 A;  4EFU A;  2IWU A;  4E00 A;  4QPK A;  2XDU A;  2YE3 A;  2YGE A;  1BGQ A;  1TBW A;  2LFR A;  2YE8 A;  3VHD A;  2AKP A;  1I5A A;  1THN A;  3GIF A;  1JOY A;  2IOR A;  4CE1 A;  2YE9 A;  2Q8G A;  1QY8 A;  4P8O A;  2FWZ A;  3WQ9 A;  4W7T A;  5D7C A;  2Q8H A;  2BYI A;  4MPC A;  3OPD A;  2BU5 A;  1YT1 A;  4MPN A;  4LWG A;  3LPS A;  2YKB A;  2YKJ A;  5D7D A;  2XX2 A;  5IN9 A;  5CF0 A;  2Q2E B;  1UYM A;  3R4M A;  1YT2 A;  2BTZ A;  1BKN A;  5B1O A;  1NHJ A;  1UYF A;  2WEQ A;  1TIL A;  2XHR A;  2CCT A;  1UYL A;  1YSR A;  3TZ0 A;  2BT0 A;  3B26 A;  2Q8I A;  1YS3 A;  5CTU A;  4DUH A;  2BU6 A;  3ZKD A;  1I59 A;  4X9L A;  2VW5 A;  1KIJ A;  3PEJ A;  2P67 A;  2VCJ A;  4ZKI A;  4CWF A;  2YI0 A;  3R4P A;  2WI4 A;  2IOP A;  4KSG A;  3G7E A;  3HHU A;  1U2O A;  4XDM A;  3EHJ A;  2YGF A;  4XIQ A;  4R1F A;  2BYH A;  3A0Z A;  3Q5L A;  4ASA A;  5FNF A;  3MD0 A;  3GIG B;  5CTX A;  5FND A;  2QM7 A;  5IDM A;  4H81 A;  2YKI A;  1AM1 A;  1UYE A;  3HEK A;  4XCJ A;  1JM6 A;  3PEH A;  2BU8 A;  4H85 A;  2YEG A;  3RKZ A;  2YEJ A;  4MOT A;  4ASG A;  1YC1 A;  3TZ5 A;  4CWT A;  2XDX A;  1QYE A;  4MBC A;  4EGH A;  2O1W A;  2PNR A;  2XX4 A;  1US7 A;  3EKO A;  3K60 A;  2XJG A;  2YI6 A;  4PRV A;  4B7P A;  4MTX A;  4GT8 A;  4LPB A;  4MP7 A;  1YT0 A;  4XE2 A;  4YKR A;  3SL2 A;  1ZXN A;  3FT8 A;  4B6C A;  1AH8 A;  3A0W A;  4HXW A;  3C0E A;  2QFO A;  2YK2 A;  2YGA A;  2IWX A;  4HY6 A;  4EGI A;  3R4O A;  4L90 A;  1ID0 A;  1R62 A;  5M4P A;  2IWS A;  5D6P A;  2BZ5 A;  4HY1 A;  4O04 A;  5M4N A;  3EHG A;  3JZ3 A;  3VAD A;  3HZ1 A;  1AJ6 A;  1BXD A;  1YER A;  1GKX A;  1MX0 A;  4MT8 A;  4LP0 A;  4AWO A;  2QM8 A;  1IXM A;  2Q8F A;  3A0R A;  1YC3 A;  4EEH A;  2XK2 A;  1EA6 A;  4CWR A;  3QTF A;  1Z5B A;  1GKZ A;  4GFN A;  2HKJ A;  5D7R A;  2K5B A;  3CGY A;  4GQT A;  2VWC A;  2GQP A;  1I5C A;  1H7S A;  4CWN A;  4MP2 A;  3D2R A;  4R3M A;  1ZWH A;  4L8Z A;  3TZ4 A;  2YI5 A;  2XJJ A;  1TC0 A;  3OW6 A;  4URM A;  1F51 A;  4FCR A;  2XD6 A;  4YKU A;  5D6Q A;  1UYK A;  1UY8 A;  4EM7 A;  1AMW A;  5CPH A;  4GCZ A;  5M4K A;  4NH7 A;  2BRC A;  4CWO A;  3P32 A;  4JYC A;  3VHC A;  1TH8 A;  3QDD A;  4WUC A;  2XAB A;  3ZRW B;  2XHX A;  4KTN A;  4MPE A;  2ZDY A;  4V26 A;  4XC0 A;  3FT5 A;  3CGZ A;  4CWQ A;  4PL9 A;  4YKW A;  5CTY A;  5IDJ A;  1QZR A;  2XJX A;  4O07 A;  2BU2 A;  2YE2 A;  4YKZ A;  1I58 A;  3INX A;  3O6O A;  4NH8 A;  2HCH A;  2WI7 A;  2WI3 A;  2YEE A;  3A0X A;  3A0Y A;  1YC4 A;  2ESA A;  4HYM A;  3ZRX A;  4MB9 A;  1YET A;  3KE6 A;  4FPP A;  3MNR P;  4K4O A;  1UY9 A;  2YKC A;  4U93 A;  2UWD A;  2C2A A;  2WI6 A;  5CTW A;  4JQL A;  3EHH A;  2GFD A;  4XIR A;  4O05 A;  2YE4 A;  2ZDX A;  4U7N A;  4L94 A; 
#chains in the Genus database with same CATH topology
 1B04 A;  4LF7 O;  3OWD A;  5H6Q A;  4BIU A;  4DR2 O;  1YF2 A;  1F23 A;  3RFR A;  4Z2W A;  3JAK B;  2BCC H;  4DK1 A;  3AG7 A;  1K33 A;  2JS5 A;  4ABM A;  3ZRV A;  1AJP A;  2YE5 A;  2DMX A;  5TIS Z;  5LMN B;  3R92 A;  1HNW B;  2YJW A;  4ZHQ B;  3GWK C;  4AQY O;  2Q69 A;  2XAQ A;  1UY7 A;  2FXS A;  3UM7 A;  4LH7 A;  2EBO A;  1GKF A;  1YJ9 V;  1FS0 G;  4JV5 B;  1THZ A;  1U96 A;  4I55 A;  4KFM A;  1SQV H;  1CEZ A;  1H2G A;  1P84 F;  3T1K A;  5B5E Z;  1S0V A;  3K97 A;  2EJR A;  4TOI A;  4DR5 B;  4LWE A;  4FFK A;  1R73 A;  4IGG A;  4OPA A;  2HVJ C;  2YJX A;  1SA0 B;  3BM9 A;  5F2V O;  3GIE A;  2YDE A;  1MZF A;  4EGK A;  3E2E A;  3K79 A;  1URF A;  4L93 A;  1BYQ A;  3SPJ A;  2BTO A;  1QBZ A;  1WN7 A;  4NVP A;  4QPJ A;  1Q86 W;  2VS0 A;  1YDX A;  4X1Y A;  2H94 A;  4AS9 A;  1UYC A;  4PU9 A;  1GH6 A;  4CWP A;  2LW7 A;  4K35 A;  4KFG A;  4URO A;  4BIZ A;  4DW1 A;  1IBK B;  1S14 A;  2XCM A;  1I5X A;  2M7W A;  1UFI A;  2NN4 A;  4O4L B;  2EXL A;  3LUT B;  4RQF A;  3VBB A;  1PNM A;  3G75 A;  1XMO B;  2CE4 A;  4X65 O;  1LNQ A;  4BWA A;  2QG0 A;  2EIJ B;  1SKV A;  5EBW C;  1YSZ A;  3IGA C;  3TJT A;  2L35 A;  4UVB A;  3OEH G;  4NH9 A;  4D7S A;  2BU7 A;  2FTK A;  3ASN C;  2Y0P A;  2JDI G;  2HEP A;  4J41 A;  3FAV B;  4HYP A;  2P6J A;  2DQ3 A;  3QVN A;  4LFB B;  2EJ7 A;  2F43 G;  4L87 A;  4E01 A;  2XT9 A;  2Q0A A;  1Z5A A;  4ZVI A;  3RYI A;  4DV7 O;  1FJG O;  4J10 A;  1Q81 W;  1O9G A;  1HWY A;  3A0H Z;  2FB5 A;  3ZED A;  2KG7 A;  1YVW A;  4E4E A;  2XDS A;  1XBL A;  2DQ0 A;  1M93 A;  1W0K G;  3AG2 B;  1Z2G A;  2K9P A;  4V25 A;  1Y4U A;  3W7S A;  1WPB A;  1IBM O;  3ZRW A;  4FMT A;  3HKD B;  3F7V C;  4J9Z B;  3NMQ A;  1VP7 A;  5BOD A;  2FYU H;  2QF6 A;  4O09 A;  5L3J A;  4DW0 A;  1JFF B;  2A0L A;  3ZMV A;  5IJ0 B;  3LNU A;  1Y8O A;  3BEH A;  3VHA A;  3B2E E;  3E22 A;  5KLV H;  4X62 O;  4X1K B;  1SZX A;  2WEP A;  2UXX A;  1NTM H;  2ITC C;  3L70 H;  2KB1 A;  2YIA A;  4UVA A;  1HNZ B;  4NXM B;  2B9Z A;  1BHB A;  3ZXQ A;  5LMU B;  3U67 A;  3HKD A;  1NI8 A;  2CG9 A;  1EN4 A;  1SER A;  2XND G;  1JJ2 U;  3HKB A;  1AH6 A;  4DUZ O;  5J9P C;  4AQY B;  5M4E A;  2WI1 A;  3MDS A;  4URL A;  1AVM A;  3ZHU A;  2QWN B;  2QWO B;  3WHA A;  3H80 A;  2W6J G;  2YED A;  4DRX A;  4CZZ A;  5GON A;  1GM9 A;  3LDE A;  2IM9 A;  4DR6 B;  4EFT A;  3K08 A;  1TA8 A;  4MVZ A;  2A3Q A;  4MW3 A;  4X64 B;  2QKS A;  1GN3 A;  1S16 A;  2C1I A;  4E72 A;  2ZDI A;  2JGD A;  4PI0 A;  1NHH A;  5LOV B;  3C90 A;  4X89 A;  2ZXW C;  4O2B A;  3KZI Z;  4B3S B;  4LC1 A;  3TZ2 A;  1Q82 W;  3CCS V;  2QWR B;  3QO5 A;  4E00 A;  2XDU A;  4LF5 O;  3H1L H;  3BY6 A;  4CS2 A;  5KAI Z;  1TVK A;  1D5N A;  3FB7 C;  2F1M A;  2UXB O;  2R72 A;  1XNR B;  2AKP A;  1THN A;  3OMI B;  2IOR A;  3JAM N;  2Y69 C;  2YE9 A;  1OCZ C;  1QY8 A;  3SYQ A;  4P8O A;  2DW4 A;  4MS2 A;  4EKW A;  3WQ9 A;  1QVG U;  2QKC A;  2BYI A;  5LMU O;  2BU5 A;  4JI6 B;  5JJN B;  1YT1 A;  1KP3 A;  3B8M A;  4EFB A;  4GKJ B;  5D7D A;  1KU9 A;  5KHK A;  2Z3Y A;  1UYM A;  2Q73 A;  3CD6 V;  1YT2 A;  1IXB A;  5EZY B;  1NHJ A;  1Q90 D;  1IBK O;  2XHR A;  3G6E V;  4JI8 O;  1MA1 A;  2UXN A;  1YSR A;  2CH7 A;  3EHB B;  1K3E A;  2YC0 A;  1CPY A;  4I0X A;  4B3M B;  2XAF A;  2Q8I A;  1YS3 A;  5KHJ A;  5CTU A;  3HB3 B;  1I59 A;  1QLN A;  3FFQ A;  1KIJ A;  3LSU A;  5KX5 B;  4DR4 O;  2VCJ A;  3H1K H;  4DR7 O;  1NVP D;  2EUL A;  3R4P A;  2IOP A;  4LFC B;  4GX2 A;  1U2O A;  2ZE5 A;  4MVQ A;  4XIQ A;  3ZHS A;  2RCV A;  4WFH A;  3A0Z A;  4ASA A;  5FNF A;  2DWD C;  3MD0 A;  5CTX A;  1LUW A;  3LNN A;  4WF9 V;  1I5Y A;  4QIW F;  1OCO B;  2X6B A;  2ATK C;  4QE7 A;  2E5L B;  2PF4 E;  3PEH A;  2P4V A;  4UCR A;  1WLE A;  1E1R G;  3TZ5 A;  2CTP A;  2OT5 A;  4MBC A;  3DC5 A;  4RAI A;  1K4C C;  3OD4 A;  2PNR A;  1IBM B;  3RN4 A;  3EKO A;  1SET A;  2F4V B;  4ZOL A;  3OGI B;  4PRV A;  4B7P A;  3F5T A;  3FT8 A;  2P5O A;  4Q6G A;  4P30 A;  3THO A;  5FL7 G;  4IHJ A;  4J80 A;  2YK2 A;  2JK5 C;  2WLL A;  4DV0 O;  2QE7 G;  1ID0 A;  1ZX3 A;  5M4P A;  1EFR G;  2YUA A;  4HY1 A;  3ETD A;  4O04 A;  3EHG A;  4JTC B;  1Y6X A;  3D36 C;  3HZ1 A;  3ZN0 A;  2OTL V;  2JRI A;  1BXD A;  4FFB B;  3IFX A;  4B3T B;  3OEE G;  4I4T B;  2OCH A;  1YC3 A;  3AG4 B;  1EA6 A;  3VQY A;  2P22 C;  2C1G A;  2NNU A;  1WP7 A;  1G8M A;  4BR6 A;  2UUC B;  2HKJ A;  1MZE A;  4GQT A;  3BA8 A;  4DR5 O;  2WLI A;  3E8H A;  3QO7 A;  3K57 A;  3SYC A;  2GQP A;  1Y4M A;  3AK2 A;  3L9D A;  1PNL A;  4DV5 B;  1NBM G;  3I5D A;  4X1Y B;  1K73 W;  1COW G;  4OXS A;  4L8Z A;  1I94 O;  4FFB A;  5FLX N;  3DTU B;  4I50 B;  1Y74 B;  4CH3 A;  5K1X A;  1Q3E A;  4O4L A;  3ABL C;  1J95 A;  4DR3 O;  1BSM A;  4ZI7 A;  2XD6 A;  2IJH A;  2OTJ V;  5D6Q A;  1UYK A;  1V9P A;  5C8Y B;  3FX7 A;  1IZ3 A;  5CPH A;  3BAA A;  3ZBH A;  4NH7 A;  1SRY A;  1N33 B;  1SQQ H;  1FFT B;  3P32 A;  1IBL O;  2Q5Z A;  3VHC A;  1TH8 A;  1OZ0 A;  4CC5 A;  1V55 C;  3CCJ V;  2XAB A;  5JCO C;  1XUQ A;  2OIE A;  3CC4 V;  3K59 A;  5LXT A;  1GN2 A;  2UXB B;  4PL9 A;  4OX9 B;  3CYG A;  3N2K B;  4X20 B;  2KKW A;  5IDJ A;  5JH7 A;  2QSA A;  2EIM B;  4N21 A;  2GTS A;  4GX0 A;  5DED A;  4PD4 F;  4NH8 A;  4JI4 O;  3A0X A;  3A0Y A;  3LMM A;  1YET A;  1M57 B;  2Q8V A;  4K4O A;  2CTR A;  4U93 A;  2LO1 A;  2WI6 A;  4ICG A;  3EHH A;  3GWO A;  2QEX V;  2YE4 A;  2ZDX A;  3SPI A;  3L71 H;  3JYC A;  4L94 A;  4PA6 A;  3N2K A;  1K5S A;  2N05 A;  3T1Y O;  3RLP A;  4JI2 B;  2PGG A;  4UCU A;  4TUY A;  4K8Z A;  4B7E A;  1NHI A;  1FXK B;  3WU2 Z;  1GN6 A;  5IY5 B;  3ICX A;  2W6I G;  5DM6 V;  1B63 A;  3O0I A;  4LWF A;  2UXD O;  4JV5 O;  5CB4 A;  3SPH A;  4J7Z A;  1OCZ B;  3FB5 C;  1ROP A;  1R3L C;  4CE2 A;  4EB6 B;  4X62 B;  2ZE7 A;  2JGU A;  3HKC A;  4CH6 A;  3OTO B;  2W0X A;  1AB3 A;  1Q43 A;  1AI4 A;  4FM1 A;  1SQX H;  4NXM O;  3EHF A;  2CCS A;  2LFS A;  3SPC A;  1WB7 A;  1K4D C;  3OUS A;  4L8J A;  3RYI B;  3C3T A;  4HBN A;  3SYP A;  2BRE A;  2CH4 A;  1P4R A;  2XHT A;  2ZE6 A;  4B7K A;  1IBL B;  3IED A;  5EIB D;  1PVG A;  1BS3 A;  2ZIO A;  1TAE A;  3FV5 A;  1AIL A;  3ZMU A;  4P2Z A;  5LL6 Y;  2ARH A;  4QNH B;  2PTM A;  3QTC A;  2WLL B;  3ZHT A;  2YEH A;  4FIP C;  4FLU A;  2GSM B;  1NS1 A;  3HYY A;  2Y4T A;  4PA4 A;  1RPO A;  1Z5C A;  2BTQ A;  2JGD B;  2YEI A;  3O2F A;  1TC6 A;  2B1I A;  4GT1 A;  1AI6 A;  1BZK A;  3M99 B;  4HZ5 A;  4MTO A;  5KMG A;  3EKR A;  4JI3 O;  5BR8 O;  2XDL A;  1S5H C;  2XTA A;  2O1U A;  5L3F A;  1BMF G;  4LWI A;  3TXS A;  1RFY A;  4A5U B;  4LWH A;  2PYJ A;  4YJ2 B;  5JQG A;  5IWA O;  4UFZ A;  4GYC B;  2CUG A;  1JJO A;  4I9W A;  1N33 O;  3ABM C;  5KUM A;  3JAT B;  3P30 A;  1MSW D;  1UYH A;  1Y74 A;  2JJC A;  3WG7 C;  4LF4 O;  1DF4 A;  3NXS A;  4C7U A;  4P7A A;  2O1V A;  3K99 A;  1KB9 F;  3T4D A;  4WUB A;  1ZW9 A;  5J6A A;  5C8Y A;  5KHH A;  4P9P A;  4YJ2 A;  5IYD O;  3SDL A;  1B62 A;  4NR1 A;  3G80 A;  2QKA A;  1ZXM A;  1VQ7 V;  5IJ9 B;  4GX5 A;  2YEV A;  3I55 V;  3U10 A;  3L74 H;  4K0K O;  2IOQ A;  2CH7 B;  4U3F H;  3EVK A;  3STL C;  5J71 A;  2MW2 B;  2OWO A;  4JYB A;  1VQM V;  1QLE B;  3A0B Z;  3Q4H B;  4XIT A;  3OR7 C;  1OSF A;  2DYR B;  1R3J C;  2X6C A;  2WAM A;  3DXR B;  1QR9 A;  5IYZ B;  2CDY A;  2UU9 B;  2M6Y A;  4R3A A;  4E02 A;  1NH2 D;  4CWS A;  4PDL A;  1S3J A;  1S72 V;  4MVS A;  4JYA B;  3JCU Z;  4TSF G;  1I7F A;  3E8G A;  4I55 B;  1P7B A;  2HP8 A;  2O57 A;  2QTS A;  4HZ0 A;  1HNW O;  1H7U A;  4FCP A;  4QE9 A;  5CA0 A;  4LBE C;  1V54 C;  4FVM A;  4LWS B;  3SYO A;  1W59 A;  4DR6 O;  1XL4 A;  4U7O A;  2AW9 A;  1H2S B;  2XUM A;  2IU0 A;  4ASB A;  5C93 A;  2JKI A;  1M1K W;  2YXY A;  2ZQM A;  2OCC B;  4J11 A;  1L0N H;  4BW9 A;  5B1A B;  4DR1 B;  3ZXO A;  4B3R O;  2LGW A;  3T1Y B;  4B3S O;  3F7Y C;  4BXI A;  1I5B A;  1Q8I A;  2WER A;  5M4H A;  2BSM A;  4DR3 B;  3N27 A;  1U97 A;  2QGN A;  4BW5 A;  2H55 A;  1MMM A;  4JAS A;  2R9R B;  4LWS A;  1DTO A;  1ARO P;  1PPJ H;  1JFF A;  4MVM A;  3E8F A;  4H13 B;  3JAR A;  2YGE A;  3E22 B;  3K0G A;  2GUZ B;  2HVK C;  4PA7 A;  1TBW A;  2L6L A;  1NTK H;  1NQT A;  1K92 A;  3WG7 B;  4FLZ A;  1H8H G;  1FFX B;  4JTA B;  2IU3 A;  3UQ8 A;  1SQP H;  1YIT V;  1AP5 A;  1IVS A;  2D2C B;  1SZT A;  2ZIN A;  1PP9 H;  3N2G A;  4UXN A;  1JOY A;  4D6T H;  3K58 A;  2ZNJ A;  4B3T O;  3L73 H;  2KSD A;  4HAM A;  4UB8 Z;  5JCO A;  3K04 A;  1OCR C;  1TGO A;  2P06 A;  2R9A A;  4WFB V;  1R3K C;  3OPD A;  4JPR A;  4XDK A;  5FPR A;  3M8A A;  4WCE V;  2YKJ A;  2XX2 A;  5IN9 A;  5CF0 A;  4AI8 A;  1NU1 H;  1VQ9 V;  3C3S A;  5BZB A;  5B1O A;  1SS3 A;  4K8X A;  2CCT A;  4O4H A;  3OTF A;  2BT0 A;  1AJQ A;  1N34 B;  4DR7 B;  2QJ1 A;  4JZG A;  1XNR O;  5L3D A;  1K8A W;  1QVF U;  3WB1 A;  3B4S A;  2WI4 A;  4I4T A;  4XDM A;  4JI0 B;  2YGF A;  2YXH A;  5FNV B;  2A9H A;  2ETN A;  2CK3 G;  3DC6 A;  4NB5 A;  5D5P A;  4OX9 O;  3OE7 G;  3CRM A;  3K03 A;  3OTO O;  3GIG B;  1VEW A;  2JJ2 G;  5EBM C;  5FND A;  4MVU A;  2QM7 A;  1AM1 A;  1R6N A;  1N32 B;  1JM6 A;  2BU8 A;  1ZAU A;  4GUN A;  4H85 A;  3ETQ A;  1KMI Z;  3PJS K;  1YC1 A;  1SQF A;  5IY5 C;  4YJ3 A;  3ASO B;  1QYE A;  4G28 B;  4LFB O;  4IIJ A;  1MSD A;  4H0L B;  3R65 A;  1VQO V;  2XX4 A;  1US7 A;  1MAB G;  3LDC A;  1XHZ A;  2XJG A;  2YI6 A;  4MTX A;  2IJJ A;  4XE2 A;  4R8C A;  4YKR A;  4MTF A;  4DV6 O;  3CRQ A;  3A0W A;  1N8R W;  3C0E A;  3CS5 A;  5B3S C;  3ZMZ A;  2QFO A;  2YGA A;  2IWX A;  3RVZ A;  4LFC O;  2ZDI C;  1OCC B;  1QQC A;  1R62 A;  5LGT A;  5J2T A;  2BZ5 A;  3ZN1 A;  5JH7 B;  3HKC B;  5M4N A;  1TVK B;  3VAD A;  3QNE A;  1AJ6 A;  1MOF A;  1XDC A;  1H2M A;  2JJ1 G;  1MX0 A;  4LF6 B;  4MT8 A;  5JJE B;  2A79 B;  3ZHQ A;  3KG2 A;  5CBH A;  4EEH A;  4X64 O;  1AP6 A;  1NKD A;  1YIJ V;  1M90 W;  4I9Q A;  2BE3 A;  3QO8 A;  3LDD A;  2ZR3 A;  3K9S A;  1Y67 A;  5H2F Z;  1PD3 A;  1KBH A;  5L3B A;  4G27 B;  2PY5 A;  3T4Z A;  4FZ0 A;  2HHH B;  1I5C A;  1H7S A;  4CWN A;  5IYB O;  2YIB A;  1L0L H;  1M5I A;  2ZCE A;  3D2R A;  1ZWH A;  3TZ4 A;  2YI5 A;  3VQW A;  3OUF A;  4HZ3 A;  1F51 A;  3ETE A;  4HNA A;  1CXZ B;  1XOU A;  4YIO A;  4YKU A;  3VQX A;  4RUF A;  2DYR C;  5JVD B;  5LA6 A;  1FFX A;  3OR6 C;  4NTY A;  2BRC A;  4O4I A;  4JYC A;  2QM4 A;  5H9C A;  1KYO F;  4PV1 B;  5AG2 A;  2Q7G A;  3ABU A;  3JAL B;  4KTN A;  2F23 A;  3VQV A;  4MPE A;  5BR8 B;  3FT5 A;  1R6K A;  3W7W A;  3AG2 C;  1BCC H;  4O07 A;  2XJX A;  4NXN B;  3G71 V;  3H1J H;  2BU2 A;  2YE2 A;  2OCC C;  1YC4 A;  3B09 A;  2ESA A;  3KE6 A;  1BL8 A;  2WA4 A;  1BQ0 A;  1UY9 A;  2YKC A;  4JI0 O;  2UWD A;  4AHC A;  1XHX A;  1EBO A;  2C2A A;  3KCY A;  4JQL A;  4JGS A;  3U11 A;  1P49 A;  1FAF A;  2XAH A;  4PDM A;  4LFA B;  1OCC C;  3SR2 C;  3JAW B;  1AR5 A;  2BTQ B;  3IJ4 A;  3ZS8 C;  5B1N A;  1N0N A;  1O9H A;  4JZ2 A;  2Q7E A;  4TQF A;  1EN6 A;  3OM3 B;  1A4H A;  4LCU C;  5JEN A;  4PJ0 Z;  2UXD B;  2PI4 A;  2E5L O;  2DYS C;  2AZ2 A;  4DRX B;  4L91 A;  2D3O W;  1KC8 W;  5GON B;  1WAZ A;  1UYG A;  2EZP A;  3B40 A;  4LF9 O;  4X1I A;  3CRL A;  4O4J A;  1XMO O;  4UCO A;  4DV3 O;  4IHJ B;  2XDK A;  2UXC B;  2FYP A;  3GIG A;  2JS3 A;  5IYZ A;  3UT5 A;  4WFA V;  4IYH A;  3DSQ A;  2H8M A;  4UV9 A;  2NLJ C;  2QA4 V;  1XMQ B;  4CE3 A;  3HYZ A;  4GEE A;  1L0O A;  3RLR A;  3E83 A;  4O2B B;  4DZY A;  1YJW V;  1BGY H;  2Q6A A;  2YXL A;  4DXW A;  4YKX A;  4I5S A;  1AJN A;  4HXZ A;  3ML0 A;  3OW2 U;  1DLB A;  4O4J B;  3ZIA G;  5JJJ B;  4FM0 A;  4PRX A;  1SC5 B;  2YE6 A;  3G7B A;  3IC9 A;  2X6A A;  1Y8P A;  1BT8 A;  2Q9L A;  5FNC A;  3UO2 A;  1FJG B;  1I08 A;  3ZCC A;  2YEV B;  4PEL A;  4Q20 A;  4ASF A;  2ITD C;  5JWP A;  3RLQ A;  5CA1 B;  4DYL A;  3E8B A;  4WUD A;  2CAZ C;  3T10 A;  1Y8N A;  2EIL C;  1VMG A;  4DUY O;  1R1B A;  3CJH A;  1UYI A;  1XEQ A;  3O9O A;  4U3J B;  5IWA B;  2ZBK B;  3QF7 A;  2E0A A;  4XIP A;  1M9N A;  3CX5 F;  2ZNI A;  4XKA A;  4DV1 B;  3ABM B;  2UUC O;  2GUZ A;  5H6R A;  4UCV A;  2WWW A;  3K5L A;  5CB4 B;  3BMY A;  5E79 Z;  4LFA O;  2HLD G;  3TUH A;  2G38 A;  5LXT B;  5KUK A;  1FPO A;  1US6 A;  3SJQ C;  3OFN G;  1JMK C;  4XDL A;  1J5E B;  2YKE A;  4KHP O;  3AG3 B;  1HNZ O;  2YE7 A;  3RYC B;  2QG2 A;  3K0D A;  5IJ0 A;  4DUZ B;  3HZ5 A;  1FKA O;  2ZT9 B;  2EIL B;  2YEC A;  5D5Q A;  3ZRS A;  1K5Q A;  4Z1M G;  3B27 A;  4XDJ A;  4NXN O;  4GGL A;  4KQV A;  5GTI Z;  4XKK A;  1H2K A;  4PDV A;  3A8T A;  4JI6 O;  4W4L A;  5CMU A;  4LF7 B;  3WB2 A;  3K5N A;  3RVY A;  2Q4P A;  4NYK A;  3VOU A;  3JD0 A;  3CXC U;  3CP1 A;  3CB2 A;  1Z59 A;  5F3K A;  2F95 B;  1NR1 A;  2DE0 X;  3JAL A;  2WI5 A;  3ABT A;  1PV0 A;  5E1A C;  3Q5K A;  4GKK B;  1V55 B;  1WPX A;  3G67 A;  4YKQ A;  3OWB A;  3T0Z A;  4NTW A;  1QCE A;  2VWJ A;  2QTO A;  4I7Z B;  2XX5 A;  4TWK A;  3T0H A;  4YKY A;  1OJH A;  3C11 A;  2WLM A;  1GAX A;  2ADQ B;  2RNB A;  4IL6 Z;  3P3P A;  1AI5 A;  4CBC A;  3CXH F;  4XD8 A;  1E1Q G;  1QHT A;  3CCV V;  4FCQ A;  4DV1 O;  2Q7H A;  3T1H O;  3W7U A;  2ZM6 O;  4NTX A;  2UUB O;  1VF5 B;  5LYJ A;  4JI2 O;  5DN6 G;  1A32 A;  3B28 A;  2EIJ C;  4TV9 B;  1YHQ V;  2PI5 A;  4FLT A;  2WA3 A;  4B3R B;  1GM8 A;  5EBL C;  1LUV A;  2CCU A;  5GGZ A;  2VQE O;  2A7W A;  5B1B C;  4QJF B;  1KKC A;  2EIN C;  2GV9 A;  4UV8 A;  1KZN A;  2VWK A;  1BHA A;  1H38 A;  1F4N A;  2WLK A;  3R91 A;  1B3Q A;  4O4H B;  4H7Q A;  1BQZ A;  3OMU A;  5FWK A;  3HKB B;  3L72 H;  1B06 A;  4UCS A;  3K98 A;  1YTF D;  1G4Y B;  4JAA A;  3WFV A;  3RT3 C;  2K1E A;  4ZBM A;  2VQF O;  1AR1 B;  5CBG A;  2IJI A;  1DK1 A;  2XAG A;  2FWY A;  3BA9 A;  1ZWI C;  1MG1 A;  4DK0 A;  2QWP B;  4KL1 A;  4DV6 B;  2N74 A;  1N36 B;  2QWQ B;  3DGE A;  1EI1 A;  4EFU A;  2KQX A;  4DO2 A;  2IWU A;  4MVO A;  5J2T B;  2F66 C;  5H5N A;  3Q4H A;  4J7J A;  4WFG A;  5K1P A;  2YE3 A;  4DV0 B;  3CCQ V;  1F7Y A;  3FB6 C;  1BGQ A;  3AG1 C;  4ZI7 B;  3ZMS A;  1SA0 A;  3ABL B;  3DXR A;  3I56 V;  2YE8 A;  2XHB A;  2AHZ A;  3CSX A;  4J7K A;  3GIF A;  4WBN B;  1P7G A;  2BSK B;  4CE1 A;  3SJB C;  1NVP B;  4LF6 O;  2LJ2 A;  3JD1 A;  2FWZ A;  4W7T A;  5D7C A;  2Q8H A;  5EIB C;  1NTZ H;  4MPC A;  2EIN B;  2E75 B;  4MPN A;  4LWG A;  2UUB B;  1YCI A;  4CS4 A;  1GRJ A;  4R50 A;  1SQG A;  3R4M A;  1ORQ C;  2Q68 A;  2BTZ A;  1BKN A;  2WEQ A;  4RO2 A;  5IJ9 A;  1IX9 A;  1TIL A;  1OHH G;  2AGA A;  5BXZ A;  2F4V O;  1ZL8 B;  4UCT A;  4LF5 B;  4H44 B;  4FK5 C;  1Q6I A;  3B26 A;  3R66 A;  1RM1 C;  4FLW A;  2YID A;  4DUH A;  1WA8 A;  3CMA V;  3UCS C;  2BU6 A;  1XI1 A;  4X9L A;  4TQD A;  4KUM A;  3RYC A;  3PEJ A;  1KKD A;  4ZKI A;  1FXK A;  2YI0 A;  1YTF B;  4KSG A;  2ZR2 A;  3G7E A;  1QNM A;  4JF3 A;  3E86 A;  3TCU A;  3EHJ A;  2YIC A;  3OT7 A;  1N32 O;  5HFM A;  4RQE A;  3FD9 A;  2KG7 B;  1VQK V;  1B6Q A;  2VQF B;  3K5O A;  4IYI A;  5IDM A;  4H81 A;  3CCU V;  4I0X B;  3WB0 A;  3X2Q B;  4D7T A;  3GB7 C;  1E79 G;  2QR4 A;  1N4C A;  1GM7 A;  1WA8 B;  2ZXW B;  2RQ6 A;  4AIL C;  4XCJ A;  1LR1 A;  2DWE C;  2YEG A;  2YEJ A;  2Y69 B;  1ZLZ A;  3ASO C;  2HJD A;  3CCM V;  4J9Y B;  4EGH A;  2O1W A;  5A2Q N;  1YZB A;  3ABK C;  5ITZ B;  4EFE A;  3H9V A;  2P90 A;  1K97 A;  5JVD A;  4GT8 A;  4MP7 A;  2W0F C;  3D8C A;  3SL2 A;  3W7X A;  1L8D A;  2XAJ A;  1I94 B;  3BPZ A;  4F4L A;  4DUY B;  1JR9 A;  2EX3 A;  1ENV A;  5KHI A;  2DYS B;  1D5A A;  4HXW A;  1YI2 V;  1G1X B;  1DGS A;  1VQ6 V;  4EGI A;  2GDS A;  3H1H H;  5B1B B;  2Y4U A;  4DV3 B;  1ZUQ A;  4O2A B;  2YI9 A;  3QG5 A;  4QGP A;  3STZ C;  4MSW C;  4GZR B;  1GN4 A;  2ZKO A;  1ZSP A;  1YER A;  4I50 A;  5IE9 A;  2E76 B;  1VQ8 V;  4LP0 A;  2QM8 A;  1IXM A;  4F6R B;  2Q8F A;  1FXV A;  1M57 C;  4FZ1 A;  4JYY A;  1YSC A;  3P3N A;  3QTF A;  2B5U A;  2GBO A;  2E3C A;  5FPO A;  1Z5B A;  4IT5 A;  1GKZ A;  5B3S B;  1VQ4 V;  4GFN A;  3PN1 A;  2K5B A;  4GKJ O;  2VWC A;  4CC6 A;  3CE2 A;  3JAS A;  4MP2 A;  4LP8 A;  1H2L A;  5LOV A;  3CME V;  3TET A;  3OMA B;  2AHY A;  1WNS A;  1TC0 A;  3OW6 A;  3RYH A;  4X20 A;  4URM A;  4ZIB A;  4FCR A;  3CJH B;  3CRC A;  1UY8 A;  4DR2 B;  5GTH Z;  1AMW A;  4GCZ A;  4GKK O;  3K5M A;  1L1F A;  2BSK A;  3ASN B;  5EC1 C;  5BMV A;  4WUC A;  3ZJZ A;  1JQ0 A;  3BRC A;  2A06 H;  4XC0 A;  4PI2 A;  2F93 B;  3X2Q C;  3CGZ A;  4CWQ A;  3FAV A;  3B8N A;  3D3I A;  4W4K A;  4YKW A;  5CTY A;  5B66 Z;  2BOC C;  2YIB D;  4YKZ A;  1I58 A;  3INX A;  1NR7 A;  1Y66 A;  4JI7 O;  1HNX O;  1MNG A;  2WI3 A;  3AG4 C;  5LGU A;  2YEE A;  1JA8 A;  4YXW G;  3MNR P;  5A9G A;  1X4T A;  5CTW A;  4LR3 A;  2GFD A;  2HHI A;  4XIR A;  2JEX A;  3CHX A;  1FXH A;  2IJK A;  4X66 O;  2VQE B;  4U7N A;  4DV4 O;  3SGI A;  3AK1 A;  2WLN A;  2HFE C;  1AI7 A;  3F5W C;  3RW0 A;  2HKO A;  4G2K A;  1HDJ A;  4TT3 G;  2Y0I A;  2YK9 A;  2GHY A;  1FD9 A;  3BHP A;  1M56 B;  3HPL C;  1XQ8 A;  3LSQ A;  4K0K B;  2LP7 A;  4YHH B;  4BAE A;  1K34 A;  2R70 A;  4FJC C;  4HNA B;  4F6E A;  2HG1 A;  4X1K A;  4JAV A;  1QR8 A;  3M7M X;  1N36 O;  3CWB H;  1JX9 A;  3EFF K;  2ZD9 A;  1UY6 A;  4J42 A;  1GJV A;  5LMN O;  5J2U A;  3JD4 A;  4O0B A;  4I3H A;  4TUY B;  4AWQ A;  2OYQ A;  1OCO C;  2AXT Z;  1PKX A;  3AG1 B;  4RWU A;  3B77 A;  4E2L A;  1VF6 C;  3KKY A;  1EZJ A;  3BFR A;  1HP8 A;  4JI1 B;  3LNM B;  2RDC A;  2V1D A;  4DV2 B;  3A0T A;  3T2S A;  2YI8 A;  3S3X A;  4ASU G;  2PZS A;  4CH4 A;  4JI8 B;  3ZHV A;  3CWV A;  3INW A;  4BQG A;  5KMG B;  4PHZ A;  2IH1 C;  3CCL V;  1S5L Z;  3U0Z A;  3CC7 V;  1BE3 H;  1S77 D;  1EZV H;  4XTJ A;  3K3W A;  5J2U B;  5B1A C;  2YEB A;  2PUS A;  3T2M A;  3LSS A;  4H33 A;  1SF9 A;  2WLJ A;  3JAW A;  4O2A A;  1XNQ B;  2R9I A;  2IW5 A;  2H8P C;  1HNX B;  2HHH O;  2UXC O;  2CGF A;  1PL0 A;  4LF8 O;  1NZ6 A;  4JTD B;  3JAK A;  1V54 B;  4TV8 B;  3TK1 A;  3B24 A;  4R7C A;  2XOK G;  1F4M A;  4Z1V A;  2RMK B;  3S5T A;  2XAS A;  4LH6 A;  2H3O A;  3UO3 A;  1KEC A;  3H01 A;  1JCH A;  2CGO A;  4O4I B;  4JAU A;  4X1I B;  1MU5 A;  3JSN A;  1DF5 A;  2B1G A;  4KHP B;  4X66 B;  4MTG A;  1TID A;  5CBF A;  3JCZ A;  2IH3 C;  1Q6U A;  3SYA A;  2ZKJ A;  3JAS B;  2HJF C;  1HR0 O;  3Q5J A;  3ETG A;  1VQN V;  5KHG A;  3R4N A;  3TTZ A;  2GTA A;  1H8E G;  2FML A;  4UB6 Z;  1TUB B;  4YHH O;  4URN A;  3AEI A;  2YS8 A;  2LW1 A;  1VIB A;  3GVM A;  1QU7 A;  3G6B A;  4KP4 A;  4XKO A;  3G4S V;  2Q0O C;  1OV9 A;  5IT9 N;  5JQG B;  2ZE8 A;  2YEF A;  4H37 A;  1Q5O A;  5EZY A;  3W7T A;  3OMN B;  4OPH A;  4DV7 B;  5BY1 A;  3ZM7 A;  4DR4 B;  1PM9 A;  4EMV A;  4YY3 O;  1W2B U;  4WFF A;  4DR1 O;  1TUB A;  3B25 A;  3CRK A;  3ZX6 A;  1YES A;  3H4L A;  4DV4 B;  1NT2 B;  4LNU B;  4DV2 O;  4PA9 A;  3JSL A;  3AG3 C;  1RSO A;  3E89 A;  4R6Z A;  5KX5 A;  1KUQ A;  3D0B A;  2YSU B;  1GTO A;  4JI5 O;  1NH2 B;  1NJI W;  3U2K A;  3U2D A;  2JVD A;  2EIK B;  3CC2 V;  1UYD A;  1IUR A;  2V4D A;  2WLH A;  3L75 H;  2PYL A;  4LF4 B;  4BQJ A;  3HKE B;  3MAQ A;  5BOC A;  4XBF A;  1OCR B;  5IYC O;  5L3C A;  4LF8 B;  1U0Z A;  1S5J A;  4EEQ A;  1KD1 W;  4LNU A;  2ADP A;  4KSH A;  1FXK C;  3UKM A;  4YKT A;  4AWP A;  1VQP V;  3T1C A;  1YEW A;  2LGQ A;  3BVO A;  1HR0 B;  5LGN A;  5F5R A;  2VCI A;  5M4M A;  1FYJ A;  1YJN V;  2Q67 A;  4JI1 O;  3SJA C;  3CCR V;  3D36 A;  3FB8 C;  3KCX A;  1UJW B;  2WI2 A;  3BAB A;  2CGN A;  3ZKB A;  1QLE C;  3N2G B;  4X65 B;  5CA0 B;  2YI7 A;  5EK0 A;  4BIO A;  2YEA A;  4XCL A;  1SQB H;  4NKG B;  1I5D A;  1VAR A;  5LHG A;  1Y4S A;  3ABK B;  1JPX A;  4U3J A;  2E74 B;  2RJZ A;  5GW7 A;  3O65 A;  3CEI A;  5L3G A;  3ZHR A;  4QPK A;  1UPG A;  3J80 N;  3FYE B;  1N34 O;  4PA3 A;  2ZIM A;  2EZO A;  2FKX A;  1XRE A;  1WJZ A;  3K9A A;  3RBZ A;  2LFR A;  3VHD A;  5EC2 C;  4MW8 A;  1I5A A;  2N04 A;  4F6R A;  2BOB C;  4LF9 B;  3E35 A;  2DJV A;  2Q8G A;  2OIG A;  3RYF B;  2WLI B;  4TV9 A;  4KXR A;  3LPS A;  1Y76 A;  4P9O A;  3MHH C;  2YKB A;  1KP2 A;  4ZOL B;  4TV8 A;  5KAF Z;  2Q2E B;  3IAY A;  1Z5W A;  1VF7 A;  3RYH B;  3A2F A;  2UUA B;  2X0L A;  1UYF A;  5EYP A;  4K3A A;  1KQS U;  5FNV A;  1UYL A;  2HG5 C;  4FLY A;  3TZ0 A;  2VRZ A;  2WPD G;  3RYF A;  1RM1 B;  3FKS G;  1D2D A;  1EN5 A;  5BMV B;  2DN9 A;  3CPW U;  5KA6 A;  1WB8 A;  1Y76 B;  3JD2 A;  3ZKD A;  5L3E A;  2VW5 A;  4YY3 B;  1VQL V;  3IC7 A;  1WP8 A;  2P67 A;  1GMG A;  4B3M O;  4CWF A;  4B08 A;  1PL4 A;  4PDR A;  4JYA O;  4YJ3 B;  3HHU A;  5DEC A;  1TUE B;  4IIJ B;  1VF6 A;  3CRA A;  4X8A A;  4R1F A;  2BYH A;  1YXB A;  3Q5L A;  1XL6 A;  4CS3 A;  4ZHQ A;  2V7Q G;  3UT5 B;  2IBZ H;  2YKI A;  5LYJ B;  3ZMT A;  4WBN A;  1UYE A;  3HEK A;  1RP3 B;  4JI7 B;  5LHH A;  2ODM A;  3OGC C;  4GLX A;  3RKZ A;  5HFL A;  4MOT A;  4ASG A;  3CRR A;  4CWT A;  2XDX A;  3D3Q A;  1J5E O;  1M56 C;  4YIP A;  3RGB A;  1W0J G;  2P7T C;  3K60 A;  1RSO B;  3BCC H;  1S76 D;  4LPB A;  1IDS A;  1K7D A;  2ILM A;  1YT0 A;  1ZXN A;  4B6C A;  2DOS A;  3APO A;  1R3I C;  1XNQ O;  1AH8 A;  1PNK A;  2ZM6 B;  5LP6 A;  3TGU H;  2FL4 A;  2UUA O;  3CCE V;  5CA1 A;  4HY6 A;  1N0J A;  3AK3 A;  3R4O A;  3EXA A;  4L90 A;  4HYO A;  3HKE A;  3NR7 A;  2LQT A;  3JD3 A;  4FLX A;  4JI5 B;  1G6U A;  2QDO A;  2Y48 A;  2IWS A;  5D6P A;  3HR0 A;  3JZ3 A;  1AR4 A;  3J7A U;  1GKX A;  4GX1 A;  4AWO A;  2HR3 A;  3A0R A;  2CTW A;  2XK2 A;  4CWR A;  3SPG A;  2CTQ A;  5LP6 B;  2EIM C;  1RPR A;  5D7R A;  3CGY A;  5CN0 A;  1GO3 F;  2Z5U A;  1R6T A;  4BAY A;  5LBQ A;  3MHS C;  1ZTE A;  3T1H B;  4R3M A;  1Q6H A;  2EIK C;  4FM2 A;  2XJJ A;  4JI3 B;  1K9M W;  2X7R B;  3OAA G;  3J81 N;  1VQ5 V;  3JAR B;  4DV5 O;  5ITZ A;  4X9Q A;  3CYO A;  4N23 A;  4EM7 A;  1ZL8 A;  1XIL A;  3S3W A;  5M4K A;  4FLV A;  4EB6 A;  4CWO A;  1CP9 A;  3RWR D;  5LHI A;  1T5E A;  1X59 A;  3QDD A;  1GK9 A;  3ZRW B;  2P4K A;  3FYI B;  4UVC A;  2XHX A;  2RN9 A;  2ZDY A;  4V26 A;  1H2N A;  4RUE A;  3K06 A;  3APQ A;  2WSS G;  1I0H A;  4OGQ B;  1QZR A;  5LP6 C;  3JAT A;  1EM1 A;  3TXQ A;  1XMQ O;  2HCH A;  3O6O A;  2WI7 A;  3SJC C;  5KA5 A;  1Q7Y W;  5LA6 B;  4MB9 A;  4HYM A;  1HW7 A;  3ZRX A;  5CA3 A;  4FPP A;  5EYP B;  1SES A;  4UUJ C;  2MK3 A;  3H1I H;  1M4U A;  2UU9 O;  4MVR A;  4X88 A;  2JIZ G;  2AZ0 A;  4JI4 B;  2JEU A;  4O05 A;  1Z5V A;  2Z0A A;  1JVM A;  4WFE A;  4CH5 A;  2NR5 A; 
#chains in the Genus database with same CATH homology
 4PA6 A;  2WLN A;  2HFE C;  5B1N A;  1AI7 A;  3F5W C;  3RW0 A;  2HKO A;  4G2K A;  5H6Q A;  1K5S A;  4BIU A;  4TT3 G;  3OM3 B;  3OWD A;  1A4H A;  1F23 A;  2YK9 A;  3RLP A;  4LCU C;  2GHY A;  2PI4 A;  1M56 B;  3HPL C;  2DYS C;  1NHI A;  4L91 A;  1FXK B;  2D3O W;  1KC8 W;  5IY5 B;  3LSQ A;  1K33 A;  2LP7 A;  2W6I G;  1K34 A;  4BAE A;  1UYG A;  4FJC C;  3ZRV A;  1AJP A;  2EZP A;  5DM6 V;  1B63 A;  2YE5 A;  2HG1 A;  3O0I A;  4LWF A;  3CRL A;  4JAV A;  1QR8 A;  2XDK A;  3R92 A;  3SPH A;  2FYP A;  3GIG A;  2YJW A;  1OCZ B;  3FB5 C;  1ROP A;  4WFA V;  1R3L C;  4CE2 A;  1JX9 A;  2Q69 A;  2XAQ A;  1UY7 A;  3EFF K;  2FXS A;  2ZD9 A;  2H8M A;  4UV9 A;  3UM7 A;  1UY6 A;  2NLJ C;  2QA4 V;  2EBO A;  1GJV A;  1GKF A;  1YJ9 V;  4CE3 A;  3HYZ A;  4GEE A;  1FS0 G;  1L0O A;  3RLR A;  1THZ A;  3JD4 A;  4O0B A;  4I3H A;  4AWQ A;  3E83 A;  4DZY A;  1OCO C;  4KFM A;  1PKX A;  1AI4 A;  3AG1 B;  1YJW V;  3B77 A;  3EHF A;  4E2L A;  2Q6A A;  2CCS A;  1CEZ A;  2LFS A;  3SPC A;  1EZJ A;  1H2G A;  4DXW A;  3T1K A;  3LNM B;  1S0V A;  1K4D C;  3K97 A;  2EJR A;  3OUS A;  4I5S A;  4YKX A;  1AJN A;  4LWE A;  2V1D A;  4HXZ A;  1R73 A;  3ML0 A;  3OW2 U;  1DLB A;  3A0T A;  3SYP A;  3T2S A;  4ASU G;  3ZIA G;  2HVJ C;  2BRE A;  1P4R A;  2CH4 A;  2XHT A;  2YJX A;  3BM9 A;  3GIE A;  2YE6 A;  4PRX A;  3G7B A;  3IED A;  4EGK A;  1PVG A;  3CWV A;  3E2E A;  3K79 A;  3INW A;  4BQG A;  2X6A A;  4L93 A;  1BYQ A;  1Y8P A;  5FNC A;  2IH1 C;  3SPJ A;  3CCL V;  3FV5 A;  3CC7 V;  1S77 D;  1QBZ A;  4P2Z A;  3ZCC A;  4QPJ A;  2YEV B;  3K3W A;  4PEL A;  4Q20 A;  3ZMU A;  4QNH B;  2H94 A;  2ITD C;  4XTJ A;  4ASF A;  3RLQ A;  4AS9 A;  2WLL B;  5B1A C;  1UYC A;  2YEB A;  3E8B A;  4PU9 A;  4CWP A;  3T2M A;  4KFG A;  4URO A;  2YEH A;  4WUD A;  4FIP C;  3T10 A;  2GSM B;  3LSS A;  4H33 A;  4BIZ A;  3HYY A;  4PA4 A;  2WLJ A;  1RPO A;  1Y8N A;  1Z5C A;  1S14 A;  2EIL C;  2XCM A;  1I5X A;  2M7W A;  2R9I A;  2IW5 A;  2H8P C;  2EXL A;  3LUT B;  1PL0 A;  4RQF A;  3VBB A;  1PNM A;  1UYI A;  2CGF A;  2YEI A;  3G75 A;  1TC6 A;  4JTD B;  3O2F A;  2B1I A;  1V54 B;  3TK1 A;  3B24 A;  4GT1 A;  1LNQ A;  1F4M A;  2XOK G;  1AI6 A;  4R7C A;  2ZBK B;  2QG0 A;  2XAS A;  2E0A A;  4XIP A;  4XKA A;  1M9N A;  3M99 B;  4HZ5 A;  1KEC A;  4MTO A;  2EIJ B;  3H01 A;  3ABM B;  1JCH A;  3IGA C;  5EBW C;  4JAU A;  1YSZ A;  3EKR A;  2XDL A;  1S5H C;  4UVB A;  2O1U A;  3OEH G;  5H6R A;  5L3F A;  1MU5 A;  4NH9 A;  1BMF G;  4LWI A;  2BU7 A;  2WWW A;  1DF5 A;  2FTK A;  2B1G A;  3BMY A;  4LWH A;  2HLD G;  3ASN C;  3TUH A;  4MTG A;  2JDI G;  1TID A;  5CBF A;  3JCZ A;  2IH3 C;  5KUK A;  3SYA A;  4I9W A;  2ZKJ A;  3SJQ C;  3ABM C;  5KUM A;  3OFN G;  2HJF C;  2P6J A;  4HYP A;  2DQ3 A;  3Q5J A;  4XDL A;  3ETG A;  2YKE A;  3AG3 B;  1VQN V;  3R4N A;  3TTZ A;  2F43 G;  4L87 A;  2YE7 A;  2QG2 A;  4E01 A;  1H8E G;  3K0D A;  3P30 A;  1MSW D;  1UYH A;  3HZ5 A;  1Z5A A;  2JJC A;  4ZVI A;  3WG7 C;  2EIL B;  4URN A;  1DF4 A;  3NXS A;  3AEI A;  2YEC A;  3ZRS A;  1K5Q A;  4Z1M G;  4P7A A;  3B27 A;  2O1V A;  4XDJ A;  3K99 A;  4GGL A;  1Q81 W;  4KQV A;  4XKK A;  3T4D A;  4WUB A;  4PDV A;  1ZW9 A;  4XKO A;  1HWY A;  4KP4 A;  5J6A A;  5CMU A;  3G4S V;  2XDS A;  4P9P A;  5IYD O;  3RVY A;  2DQ0 A;  1B62 A;  2YEF A;  4H37 A;  1W0K G;  3AG2 B;  4V25 A;  3VOU A;  3JD0 A;  3CXC U;  3CP1 A;  3W7S A;  1Y4U A;  3W7T A;  1ZXM A;  3OMN B;  1VQ7 V;  4GX5 A;  1Z59 A;  5F3K A;  4FMT A;  2YEV A;  3ZRW A;  3F7V C;  1NR1 A;  4J9Z B;  3I55 V;  3ZM7 A;  4EMV A;  3NMQ A;  2IOQ A;  5BOD A;  2QF6 A;  2WI5 A;  3ABT A;  3STL C;  4O09 A;  5E1A C;  1W2B U;  3Q5K A;  5J71 A;  5L3J A;  4WFF A;  1V55 B;  2A0L A;  1WPX A;  3ZMV A;  3B25 A;  3CRK A;  4YKQ A;  4JYB A;  1VQM V;  1YES A;  1QLE B;  3H4L A;  3LNU A;  3OWB A;  3T0Z A;  4XIT A;  3OR7 C;  1OSF A;  3BEH A;  1Y8O A;  3VHA A;  2DYR B;  1R3J C;  1QCE A;  4PA9 A;  2X6C A;  3AG3 C;  2WAM A;  3E89 A;  4R6Z A;  3D0B A;  2WEP A;  2YSU B;  1QR9 A;  1GTO A;  2UXX A;  2QTO A;  2XX5 A;  4TWK A;  3T0H A;  1NH2 B;  2ITC C;  4YKY A;  2KB1 A;  4R3A A;  4UVA A;  3C11 A;  2WLM A;  1NH2 D;  1NJI W;  3U2K A;  3U2D A;  4E02 A;  4CWS A;  4PDL A;  1S3J A;  2EIK B;  3CC2 V;  1AI5 A;  4CBC A;  1BHB A;  4XD8 A;  1E1Q G;  1S72 V;  4MVS A;  1UYD A;  3ZXQ A;  3CCV V;  4FCQ A;  3U67 A;  2CG9 A;  1SER A;  2WLH A;  4TSF G;  2XND G;  3W7U A;  1JJ2 U;  3E8G A;  4BQJ A;  1P7B A;  1AH6 A;  4HZ0 A;  1H7U A;  5J9P C;  4FCP A;  4QE9 A;  4XBF A;  1OCR B;  5DN6 G;  5IYC O;  2EIJ C;  5L3C A;  2WI1 A;  3B28 A;  1U0Z A;  5M4E A;  1KD1 W;  4LBE C;  4URL A;  1V54 C;  1YHQ V;  2PI5 A;  1FXK C;  3UKM A;  4KSH A;  4YKT A;  4AWP A;  1VQP V;  3T1C A;  5BOC A;  1GM8 A;  5EBL C;  3SYO A;  3WHA A;  3H80 A;  1XL4 A;  4U7O A;  2CCU A;  2W6J G;  5GGZ A;  5LGN A;  2YED A;  5F5R A;  2IU0 A;  4ASB A;  4CZZ A;  2VCI A;  5C93 A;  2JKI A;  1GM9 A;  5M4M A;  3LDE A;  5B1B C;  1M1K W;  4QJF B;  2EIN C;  1YJN V;  2Q67 A;  3CCR V;  4UV8 A;  2ZQM A;  2OCC B;  3D36 A;  1KZN A;  5B1A B;  1BHA A;  4EFT A;  1H38 A;  3FB8 C;  1F4N A;  3K08 A;  3ZXO A;  2WLK A;  4MVZ A;  3R91 A;  1UJW B;  4MW3 A;  1B3Q A;  4H7Q A;  3F7Y C;  2WI2 A;  3OMU A;  4BXI A;  1I5B A;  2QKS A;  2WER A;  3ZKB A;  5FWK A;  1S16 A;  2BSM A;  5M4H A;  3K98 A;  1QLE C;  1YTF D;  1G4Y B;  3WFV A;  2K1E A;  2ZDI A;  4BW5 A;  4ZBM A;  2H55 A;  1AR1 B;  5CBG A;  2YI7 A;  5EK0 A;  2IJI A;  2YEA A;  2FWY A;  2XAG A;  4JAS A;  4XCL A;  1NHH A;  1I5D A;  1ZWI C;  1MG1 A;  2R9R B;  5LHG A;  1Y4S A;  4X89 A;  3ABK B;  1JPX A;  2ZXW C;  1DTO A;  1ARO P;  3DGE A;  4LC1 A;  5GW7 A;  3TZ2 A;  1EI1 A;  4MVM A;  1Q82 W;  3CCS V;  4EFU A;  4DO2 A;  5L3G A;  2IWU A;  3QO5 A;  4E00 A;  4MVO A;  4QPK A;  4WFG A;  3E8F A;  2XDU A;  2YE3 A;  3FYE B;  3CCQ V;  4PA3 A;  2EZO A;  3K0G A;  3FB6 C;  2YGE A;  2HVK C;  3BY6 A;  1BGQ A;  4PA7 A;  3AG1 C;  3K9A A;  1TBW A;  3ZMS A;  3ABL B;  3I56 V;  3RBZ A;  3FB7 C;  1NQT A;  1K92 A;  2LFR A;  3WG7 B;  2YE8 A;  3VHD A;  5EC2 C;  1H8H G;  2AHZ A;  4MW8 A;  1I5A A;  1THN A;  2AKP A;  4JTA B;  2IU3 A;  3OMI B;  1YIT V;  3GIF A;  1JOY A;  1SZT A;  2IOR A;  2BOB C;  4UXN A;  2Y69 C;  3E35 A;  4CE1 A;  2YE9 A;  1NVP B;  1OCZ C;  4HAM A;  2Q8G A;  1QY8 A;  3SYQ A;  4P8O A;  3K04 A;  3JD1 A;  1OCR C;  2DW4 A;  4MS2 A;  4EKW A;  2FWZ A;  4W7T A;  1QVG U;  5D7C A;  3WQ9 A;  2Q8H A;  2BYI A;  4MPC A;  2WLI B;  4WFB V;  1R3K C;  3OPD A;  2EIN B;  2BU5 A;  1YT1 A;  4MPN A;  4JPR A;  4LWG A;  4XDK A;  3LPS A;  1KP3 A;  4P9O A;  3B8M A;  3MHH C;  2YKB A;  1Q86 W;  4WCE V;  2YKJ A;  5D7D A;  1KP2 A;  4R50 A;  2XX2 A;  5IN9 A;  5CF0 A;  2Q2E B;  2Z3Y A;  1UYM A;  3R4M A;  3CD6 V;  1VQ9 V;  1ORQ C;  2Q68 A;  1YT2 A;  5BZB A;  2BTZ A;  1BKN A;  5B1O A;  2X0L A;  1NHJ A;  1UYF A;  2WEQ A;  4RO2 A;  1TIL A;  3G6E V;  2XHR A;  1OHH G;  1KQS U;  2CCT A;  2UXN A;  2HG5 C;  1UYL A;  1YSR A;  3TZ0 A;  2BT0 A;  3EHB B;  1AJQ A;  1K3E A;  2WPD G;  1CPY A;  4FK5 C;  3B26 A;  1RM1 B;  1RM1 C;  2XAF A;  3FKS G;  1YS3 A;  2Q8I A;  3CPW U;  5KA6 A;  5CTU A;  4DUH A;  3CMA V;  2BU6 A;  3HB3 B;  3JD2 A;  3ZKD A;  1I59 A;  4X9L A;  1QLN A;  5L3E A;  4KUM A;  2VW5 A;  1KIJ A;  1VQL V;  5L3D A;  3IC7 A;  1KKD A;  3PEJ A;  2P67 A;  2VCJ A;  1GMG A;  4ZKI A;  1FXK A;  1NVP D;  4CWF A;  1K8A W;  2YI0 A;  1QVF U;  3R4P A;  2WI4 A;  4PDR A;  1YTF B;  2ZR2 A;  2IOP A;  3G7E A;  3HHU A;  4KSG A;  4JF3 A;  4GX2 A;  3E86 A;  1TUE B;  4MVQ A;  3TCU A;  1U2O A;  2YGF A;  3EHJ A;  4XDM A;  4X8A A;  4XIQ A;  4R1F A;  5HFM A;  4WFH A;  2BYH A;  3A0Z A;  3Q5L A;  4RQE A;  2A9H A;  2CK3 G;  4ASA A;  3OE7 G;  1VQK V;  3K03 A;  5FNF A;  2DWD C;  3MD0 A;  3GIG B;  2JJ2 G;  1XL6 A;  5EBM C;  1B6Q A;  5CTX A;  5FND A;  2V7Q G;  4MVU A;  2QM7 A;  5IDM A;  4H81 A;  4WF9 V;  3CCU V;  1I5Y A;  1AM1 A;  2YKI A;  3ZMT A;  1R6N A;  3X2Q B;  1UYE A;  3HEK A;  4QIW F;  3GB7 C;  1E79 G;  5LHH A;  1OCO B;  2ZXW B;  1GM7 A;  2X6B A;  2ATK C;  4QE7 A;  4XCJ A;  3OGC C;  1JM6 A;  2BU8 A;  2DWE C;  3PEH A;  4H85 A;  2YEG A;  3RKZ A;  2YEJ A;  5HFL A;  4MOT A;  1WLE A;  2Y69 B;  3PJS K;  4ASG A;  1YC1 A;  1E1R G;  3TZ5 A;  5IY5 C;  4CWT A;  3ASO C;  3CCM V;  2OT5 A;  3ASO B;  4G28 B;  4J9Y B;  1QYE A;  2XDX A;  4RAI A;  1K4C C;  1M56 C;  4MBC A;  4EGH A;  2O1W A;  2PNR A;  1VQO V;  3ABK C;  3R65 A;  2XX4 A;  1US7 A;  1W0J G;  1MAB G;  3LDC A;  2P7T C;  3EKO A;  1SET A;  2XJG A;  3K60 A;  2YI6 A;  4PRV A;  4B7P A;  2P90 A;  4MTX A;  1K97 A;  4GT8 A;  1S76 D;  4LPB A;  2W0F C;  4MP7 A;  1K7D A;  2IJJ A;  1YT0 A;  4XE2 A;  4R8C A;  4YKR A;  1ZXN A;  3SL2 A;  3W7X A;  4MTF A;  2XAJ A;  4F4L A;  3FT8 A;  4B6C A;  1R3I C;  4P30 A;  1ENV A;  1AH8 A;  1PNK A;  3A0W A;  2DYS B;  1N8R W;  4HXW A;  3C0E A;  1YI2 V;  5FL7 G;  5B3S C;  3ZMZ A;  2QFO A;  2YK2 A;  3CCE V;  2JK5 C;  2WLL A;  2IWX A;  2YGA A;  3RVZ A;  4HY6 A;  1VQ6 V;  4EGI A;  3R4O A;  4L90 A;  2QE7 G;  4HYO A;  1ID0 A;  5B1B B;  2ZDI C;  1OCC B;  1R62 A;  3JD3 A;  5LGT A;  2Y48 A;  1EFR G;  5M4P A;  2IWS A;  5D6P A;  2BZ5 A;  3ZN1 A;  4HY1 A;  3ETD A;  4O04 A;  3STZ C;  5M4N A;  4MSW C;  3EHG A;  3JZ3 A;  4JTC B;  3VAD A;  3HZ1 A;  3ZN0 A;  3QNE A;  2OTL V;  1AJ6 A;  1MOF A;  1BXD A;  1YER A;  1GKX A;  2JJ1 G;  3IFX A;  1MX0 A;  3OEE G;  4GX1 A;  1VQ8 V;  4MT8 A;  4LP0 A;  4AWO A;  2QM8 A;  2A79 B;  1IXM A;  2HR3 A;  3KG2 A;  3A0R A;  5CBH A;  1YC3 A;  1M57 C;  1FXV A;  3AG4 B;  2XK2 A;  2Q8F A;  4EEH A;  1EA6 A;  1NKD A;  1YIJ V;  1YSC A;  1M90 W;  3SPG A;  4CWR A;  3QO8 A;  2NNU A;  3LDD A;  2B5U A;  2ZR3 A;  3QTF A;  1Z5B A;  1GKZ A;  5B3S B;  2EIM C;  1RPR A;  1G8M A;  1VQ4 V;  1PD3 A;  4GFN A;  2HKJ A;  5D7R A;  5L3B A;  2K5B A;  3CGY A;  4GQT A;  4G27 B;  2VWC A;  2WLI A;  3E8H A;  1GO3 F;  3QO7 A;  5CN0 A;  3SYC A;  1Y4M A;  3T4Z A;  1I5C A;  2Z5U A;  2GQP A;  1H7S A;  1PNL A;  4BAY A;  4CWN A;  1NBM G;  5LBQ A;  4MP2 A;  3MHS C;  4LP8 A;  5IYB O;  1K73 W;  1COW G;  4OXS A;  3D2R A;  4R3M A;  1ZWH A;  3CME V;  4L8Z A;  3TZ4 A;  3TET A;  2EIK C;  2YI5 A;  3OMA B;  3DTU B;  2XJJ A;  1K9M W;  2AHY A;  1TC0 A;  3OW6 A;  2X7R B;  3OAA G;  3OUF A;  4URM A;  4HZ3 A;  1VQ5 V;  3ABL C;  1J95 A;  1F51 A;  3ETE A;  4FCR A;  2XD6 A;  4YKU A;  2IJH A;  3CYO A;  4N23 A;  2OTJ V;  5D6Q A;  1UYK A;  1UY8 A;  4RUF A;  4EM7 A;  2DYR C;  1AMW A;  5CPH A;  4GCZ A;  3OR6 C;  5M4K A;  4NH7 A;  1SRY A;  2BRC A;  1L1F A;  4CWO A;  1FFT B;  3P32 A;  1CP9 A;  4JYC A;  5H9C A;  3VHC A;  1TH8 A;  1OZ0 A;  5LHI A;  1V55 C;  3ASN B;  5EC1 C;  3QDD A;  4WUC A;  1GK9 A;  3CCJ V;  3ZJZ A;  2XAB A;  3ABU A;  3ZRW B;  1JQ0 A;  3FYI B;  4UVC A;  2XHX A;  4KTN A;  4MPE A;  2ZDY A;  4V26 A;  4XC0 A;  3CC4 V;  3FT5 A;  4RUE A;  3K06 A;  3X2Q C;  3CGZ A;  4CWQ A;  1R6K A;  3W7W A;  3B8N A;  4PL9 A;  3D3I A;  3AG2 C;  2WSS G;  4YKW A;  5CTY A;  5IDJ A;  1QZR A;  2XJX A;  4O07 A;  2BOC C;  3G71 V;  2BU2 A;  2EIM B;  2YE2 A;  4N21 A;  4YKZ A;  2OCC C;  4GX0 A;  1I58 A;  1NR7 A;  1Y66 A;  2HCH A;  3INX A;  2WI7 A;  3O6O A;  4NH8 A;  2WI3 A;  3AG4 C;  5KA5 A;  5LGU A;  1Q7Y W;  1YC4 A;  2YEE A;  2ESA A;  3A0X A;  3A0Y A;  3ZRX A;  4HYM A;  4MB9 A;  4YXW G;  1M57 B;  1YET A;  5CA3 A;  3KE6 A;  1BL8 A;  4FPP A;  3MNR P;  4K4O A;  1UY9 A;  2YKC A;  4U93 A;  2UWD A;  1SES A;  4UUJ C;  2MK3 A;  1EBO A;  2C2A A;  2WI6 A;  5CTW A;  4JQL A;  4MVR A;  4X88 A;  2JIZ G;  3EHH A;  2GFD A;  3GWO A;  2QEX V;  4JGS A;  4XIR A;  4O05 A;  2JEU A;  2YE4 A;  2XAH A;  4PDM A;  1JVM A;  2JEX A;  1FXH A;  2IJK A;  2ZDX A;  1OCC C;  4WFE A;  4U7N A;  3SPI A;  3JYC A;  4L94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...