1YT1A

Crystal structure of the unliganded form of grp94, the er hsp90: basis for nucleotide-induced conformational change, grp94n(delta)41 apo crystal
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
236
structure length
227
Chain Sequence
GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQEQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Endoplasmin
publication title Structure of Unliganded GRP94, the Endoplasmic Reticulum Hsp90: BASIS FOR NUCLEOTIDE-INDUCED CONFORMATIONAL CHANGE
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 71
structure length 227
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1yt1A00
5CF0A 2BYIA 2YEHA 2YI6A 2VW5A 4HYMA 3CWVA 1YETA 2IWUA 3VHDA 1QYEA 4ASGA 1QY8A 4YKUA 2CCTA 1B62A 1U0ZA 3H80A 3O6OA 3R4NA 2Q8IA 3NMQA 4XIPA 5M4KA 1GJVA 4XKKA 5FNDA 3EHGA 3JZ3A 1OSFA 2YKIA 3B26A 3VADA 4O04A 1Z59A 3K97A 1TC0A 3CGYA 4EEHA 4WUDA 3GIFA 2YGEA 2UWDA 2YEAA 5IDMA 1R62A 4MBCA 4EFUA 4LWFA 4LP0A 4BXIA 2Q8HA 4ZKIA 4XITA 2Q8FA 3B24A 4BIZA 3TUHA 3T2SA 1UYGA 3FT5A 4XDMA 5BOCA 1YESA 4WUBA 4L8ZA 2BU7A 2PNRA 4MPCA 1BKNA 3HYZA 4JASA 4YKXA 1Z5AA 1UYCA 4I3HA 4HYPA 3A0ZA 3QTFA 2QFOA 3HYYA 2VCJA 3BM9A 2YE8A 4DUHA 1UYMA 4YKQA 3TZ2A 2ESAA 3HEKA 2WI7A 1YSRA 3CGZA 1TC6A 4B7PA 2AKPA 2YKBA 4MPEA 1AH6A 4CWPA 1NHHA 4EMVA 2XX4A 4YKWA 4ASFA 4URNA 2YKJA 5M4NA 3GIGB 1S14A 2XJJA 2YK9A 2FWYA 5CTUA 2E0AA 3ZXQA 3ZM7A 4CWSA 5FWKA 3DGEA 3KE6A 1ZXNA 4L90A 1UYEA 2YE7A 1US7A 1U2OA 4L93A 2YEBA 3R4PA 2XD6A 4MB9A 4R3AA 2YI5A 2WI6A 5FNFA 4PRXA 3INXA 1YS3A 2YE3A 3C11A 4AWOA 3U67A 3OW6A 2ZBKB 3WQ9A 5J6AA 1YC3A 5F5RA 1UY7A 3Q5JA 4AWQA 4URMA 4E02A 4YKYA 3G7EA 2QG2A 5F3KA 3EHJA 4FCPA 5D7RA 3TZ0A 2YEIA 5C93A 4ASBA 4XKAA 4FMTA 3FV5A 2CH4A 1KZNA 1AJ6A 4YKTA 3T0HA 2YI7A 3TZ4A 3ZKBA 2WI4A 4EGIA 2FWZA 1A4HA 2GQPA 4LWGA 5D7DA 2CG9A 4FPPA 2YE6A 4U7OA 3EKRA 4ZVIA 4V26A 2VCIA 4LWEA 2YKEA 2WERA 4NH9A 2YJWA 4E01A 1TH8A 3T10A 5CTYA 3RLRA 5D7CA 3GIGA 2QF6A 1ID0A 1UYHA 2YJXA 5FNCA 3HZ1A 1BXDA 1I59A 2C2AA 4GQTA 1I5DA 3LPSA 5D6PA 4HY6A 1I5BA 4DZYA 4EFTA 1TILA 2YI0A 1UYFA 4XCJA 2O1VA 1ZW9A 3K98A 2YEFA 3K60A 3U2DA 3HHUA 4V25A 4EM7A 4XKOA 1BGQA 2YGFA 4HZ5A 4QPKA 3C0EA 4JAVA 1AMWA 4U7NA 2WEQA 5L3JA 3Q5LA 2BU8A 2IOQA 5M4MA 4GFNA 4LWHA 1YC1A 3A0RA 5M4EA 3R92A 1AH8A 2O1UA 3ZKDA 2Q2EB 4PU9A 2XDUA 4KQVA 3A0WA 2WI5A 4XTJA 5GGZA 4W7TA 2YEDA 4U93A 3A0YA 3H4LA 3PEHA 5J71A 4GCZA 1H7SA 2FXSA 2BU6A 4MP7A 4AWPA 1Y8OA 2YE5A 4CWOA 1THNA 4MPNA 2YECA 1S16A 1AM1A 3GIEA 4E00A 1UY8A 3D0BA 4ASAA 3B25A 2Q8GA 3IEDA 3R91A 2IORA 4XD8A 2H8MA 3B28A 2WI1A 1YT2A 4B6CA 4GEEA 3K99A 3RLQA 2HCHA 4H7QA 4CWQA 1NHIA 2FYPA 2WEPA 1MU5A 1Y8NA 1Y4UA 3OWBA 2HG1A 2CCSA 4CWNA 2XX2A 4NH8A 2EXLA 3A0XA 5IN9A 4KTNA 3OPDA 2XJGA 2XK2A 4AS9A 2QG0A 2XCMA 4BQJA 2BZ5A 1I5CA 1YSZA 2VWCA 4NH7A 3VHAA 4CWRA 2GFDA 5BODA 4KFGA 1TIDA 4XIRA 3MNRP 4P8OA 3PEJA 4R1FA 4X9LA 1TBWA 2H55A 4WUCA 4HY1A 4XC0A 3D36A 3LNUA 2YK2A 3O0IA 4LWIA 1I58A 1YERA 1MX0A 2XX5A 5CTXA 4L91A 4XCLA 2IWXA 2WI3A 3TTZA 4GGLA 1ZXMA 4GT8A 2CGFA 1H7UA 3OWDA 3RLPA 4HXWA 4UROA 4H81A 3ZXOA 3TZ5A 3EKOA 2BU2A 3B27A 2BU5A 1ZWHA 1JM6A 4O07A 4BIUA 2BT0A 2YE2A 4O05A 1B3QA 5D6QA 2YE4A 5CPHA 4EGKA 2IOPA 1UYLA 2HKJA 3EHFA 2K5BA 1B63A 4O09A 1YT1A 3O2FA 3QDDA 4MOTA 4K4OA 3OMUA 1EI1A 3T1KA 3CRKA 3D2RA 4MP2A 4CWTA 1NHJA 2BYHA 1KIJA 1BYQA 4KSHA 2ZDYA 4BQGA 3VHCA 3T0ZA 1GKXA 4BAEA 2JJCA 4R3MA 4URLA 3RKZA 1PVGA 1Z5BA 4XIQA 4EGHA 3EHHA 3A0TA 2ZDXA 1YC4A 4YKRA 3SL2A 2XHTA 2BTZA 2XABA 5M4PA 3G75A 4I5SA 4KP4A 4CWFA 3WHAA 4XE2A 2O1WA 2YEJA 4LPBA 3BMYA 4QPJA 2WI2A 3R4MA 4PRVA 2BREA 4O0BA 1UY6A 3R4OA 4CE2A 4FCQA 4FCRA 4L94A 4Q20A 1EA6A 5CTWA 1UYKA 3FT8A 2CCUA 2XDKA 3Q5KA 4JAUA 4YKZA 2YEEA 2ZKJA 4HZ0A 2XHRA 4JQLA 2YGAA 3HZ5A 1Y8PA 2XDXA 1Z5CA 2IWSA 2XDSA 2YKCA 1GKZA 2XDLA 4PL9A 1UYIA 2XJXA 2YE9A 1UY9A 4P7AA 4CE3A 3G7BA 2BRCA 1L0OA 4H85A 3U2KA 2BSMA 3INWA 3CRLA 4CE1A 1UYDA 1I5AA 1YT0A 1Y4SA 5IDJA 4KSGA 2XHXA 5M4HA 2JKIA 2YEGA 1QZRA 4HXZA
chains in the Genus database with same CATH superfamily
5CF0A 2BYIA 2YEHA 2YI6A 2VW5A 4HYMA 3CWVA 1YETA 2IWUA 3VHDA 1QYEA 4ASGA 1QY8A 4YKUA 2CCTA 1B62A 1U0ZA 3H80A 3O6OA 3R4NA 2Q8IA 3NMQA 4XIPA 5M4KA 1GJVA 4XKKA 5FNDA 3EHGA 3JZ3A 1OSFA 2YKIA 3B26A 3S5TA 3VADA 4O04A 1Z59A 3K97A 1TC0A 3CGYA 4EEHA 4WUDA 3GIFA 2YGEA 2UWDA 2YEAA 5IDMA 1R62A 4MBCA 4EFUA 4LWFA 4LP0A 4BXIA 2Q8HA 4ZKIA 4XITA 2Q8FA 3B24A 4BIZA 3TUHA 3T2SA 1UYGA 3FT5A 4XDMA 5BOCA 1YESA 4WUBA 4L8ZA 2BU7A 2PNRA 4MPCA 1BKNA 3HYZA 4JASA 4YKXA 1Z5AA 1UYCA 4I3HA 4HYPA 3A0ZA 3QTFA 2QFOA 3HYYA 2VCJA 3BM9A 2YE8A 4DUHA 1UYMA 4YKQA 3TZ2A 2ESAA 3HEKA 2WI7A 1YSRA 3CGZA 1TC6A 4B7PA 2AKPA 2YKBA 4MPEA 1AH6A 4CWPA 1NHHA 4EMVA 2XX4A 4YKWA 4ASFA 4URNA 2YKJA 5M4NA 3GIGB 1S14A 2XJJA 2YK9A 2FWYA 5CTUA 2E0AA 3ZXQA 3ZM7A 4CWSA 5FWKA 3DGEA 3KE6A 1ZXNA 4L90A 1UYEA 2YE7A 1US7A 1U2OA 4L93A 2YEBA 3R4PA 2XD6A 4MB9A 4R3AA 2YI5A 2WI6A 3LMMA 5FNFA 4PRXA 3INXA 1YS3A 2YE3A 3C11A 4AWOA 3U67A 3OW6A 2ZBKB 3WQ9A 5J6AA 1YC3A 5F5RA 1UY7A 3Q5JA 4AWQA 4URMA 4E02A 4YKYA 3G7EA 2QG2A 5F3KA 3EHJA 4FCPA 5D7RA 3TZ0A 2YEIA 5C93A 4ASBA 4XKAA 4FMTA 3FV5A 2CH4A 1KZNA 1AJ6A 4YKTA 3T0HA 2YI7A 3TZ4A 3ZKBA 2WI4A 4EGIA 2FWZA 1A4HA 2GQPA 4LWGA 5D7DA 2CG9A 4FPPA 2YE6A 4U7OA 3EKRA 4ZVIA 4V26A 2VCIA 4LWEA 2YKEA 2WERA 4NH9A 2YJWA 4E01A 1TH8A 3T10A 5CTYA 3RLRA 5D7CA 3GIGA 2QF6A 1ID0A 1UYHA 2YJXA 5FNCA 3HZ1A 1BXDA 1I59A 2C2AA 4GQTA 1I5DA 3LPSA 5D6PA 4HY6A 1I5BA 4DZYA 4EFTA 1TILA 2YI0A 2FTKA 1UYFA 4XCJA 2O1VA 1ZW9A 3K98A 2YEFA 3K60A 3U2DA 3HHUA 4V25A 4EM7A 4XKOA 1BGQA 2YGFA 4HZ5A 4QPKA 3C0EA 4JAVA 1AMWA 4U7NA 2WEQA 5L3JA 3Q5LA 2BU8A 2IOQA 5M4MA 4GFNA 4LWHA 1YC1A 3A0RA 5M4EA 3R92A 1AH8A 2O1UA 3ZKDA 2Q2EB 4PU9A 2XDUA 4KQVA 3A0WA 2WI5A 4XTJA 5GGZA 4W7TA 2YEDA 4U93A 3A0YA 3H4LA 3PEHA 5J71A 4GCZA 1H7SA 2FXSA 2BU6A 4MP7A 4AWPA 1Y8OA 2YE5A 2HHIA 4CWOA 1THNA 4MPNA 2YECA 1S16A 1AM1A 3GIEA 4E00A 1UY8A 3CYGA 3D0BA 4ASAA 3B25A 2Q8GA 3IEDA 3R91A 2IORA 4XD8A 2H8MA 3B28A 2WI1A 1YT2A 4B6CA 4GEEA 3K99A 3RLQA 2HCHA 4H7QA 4CWQA 1NHIA 2FYPA 2WEPA 1MU5A 1Y8NA 1Y4UA 3OWBA 2HG1A 2CCSA 4CWNA 2XX2A 4NH8A 2EXLA 3A0XA 5IN9A 4KTNA 3OPDA 2XJGA 2XK2A 4AS9A 2QG0A 2XCMA 4BQJA 2BZ5A 1I5CA 1YSZA 2VWCA 4NH7A 3VHAA 4CWRA 2GFDA 5BODA 4KFGA 1TIDA 4XIRA 3MNRP 4P8OA 3PEJA 4R1FA 4X9LA 1TBWA 2H55A 4WUCA 4HY1A 4XC0A 3D36A 3LNUA 2YK2A 3O0IA 4LWIA 1I58A 1YERA 1MX0A 2XX5A 5CTXA 4L91A 4XCLA 2IWXA 2WI3A 3TTZA 4GGLA 1ZXMA 4GT8A 2CGFA 1H7UA 3OWDA 3RLPA 4HXWA 4UROA 4H81A 3ZXOA 3TZ5A 3EKOA 2BU2A 3B27A 2BU5A 1ZWHA 1JM6A 4O07A 4BIUA 2BT0A 2YE2A 4O05A 5JENA 1B3QA 5D6QA 2YE4A 5CPHA 4EGKA 2IOPA 1UYLA 2HKJA 3EHFA 2K5BA 1B63A 4O09A 1YT1A 3O2FA 3QDDA 4MOTA 4K4OA 3OMUA 1EI1A 3T1KA 3CRKA 3D2RA 2C1IA 4MP2A 4CWTA 1NHJA 2BYHA 1KIJA 1BYQA 4KSHA 2ZDYA 4BQGA 1IXMA 3VHCA 3T0ZA 1GKXA 4BAEA 2JJCA 2C1GA 4E72A 4R3MA 4URLA 3RKZA 1PVGA 1Z5BA 4XIQA 4EGHA 3EHHA 3A0TA 2ZDXA 1YC4A 4YKRA 3SL2A 2XHTA 2BTZA 2XABA 5M4PA 3G75A 4I5SA 4KP4A 4CWFA 3WHAA 4XE2A 2O1WA 2YEJA 4LPBA 3BMYA 4QPJA 2WI2A 3R4MA 4PRVA 2BREA 4O0BA 1UY6A 3R4OA 4CE2A 4FCQA 4FCRA 4L94A 4Q20A 1EA6A 5CTWA 1UYKA 3FT8A 2CCUA 2XDKA 3Q5KA 4JAUA 4YKZA 2YEEA 2ZKJA 4HZ0A 2XHRA 4JQLA 2YGAA 3HZ5A 1Y8PA 2XDXA 1Z5CA 2IWSA 2XDSA 2YKCA 1GKZA 2XDLA 4PL9A 1UYIA 2XJXA 2YE9A 1UY9A 4P7AA 4CE3A 3G7BA 2BRCA 1L0OA 4H85A 3U2KA 2BSMA 1F51A 3INWA 3CRLA 4CE1A 1UYDA 1I5AA 1YT0A 1Y4SA 5IDJA 4KSGA 2XHXA 5M4HA 2JKIA 2YEGA 1QZRA 4HXZA
chains in the Genus database with same CATH topology
5CF0A 2BYIA 2YEHA 2YI6A 2VW5A 4HYMA 3CWVA 1YETA 2IWUA 3VHDA 1QYEA 4ASGA 1QY8A 4YKUA 2CCTA 1B62A 1U0ZA 3H80A 3O6OA 3R4NA 2Q8IA 3NMQA 4XIPA 5M4KA 1GJVA 4XKKA 5FNDA 3EHGA 3JZ3A 1OSFA 2YKIA 3B26A 3VADA 4O04A 1Z59A 3K97A 1TC0A 3CGYA 4EEHA 4WUDA 3GIFA 2YGEA 2UWDA 2YEAA 5IDMA 1R62A 4MBCA 4EFUA 4LWFA 4LP0A 4BXIA 2Q8HA 4ZKIA 4XITA 2Q8FA 3B24A 4BIZA 3TUHA 3T2SA 1UYGA 3FT5A 4XDMA 5BOCA 1YESA 4WUBA 4L8ZA 2BU7A 2PNRA 4MPCA 1BKNA 3HYZA 4JASA 4YKXA 1Z5AA 1UYCA 4I3HA 4HYPA 3A0ZA 3QTFA 2QFOA 3HYYA 2VCJA 3BM9A 2YE8A 4DUHA 1UYMA 4YKQA 3TZ2A 2ESAA 3HEKA 2WI7A 1YSRA 3CGZA 1TC6A 4B7PA 2AKPA 2YKBA 4MPEA 1AH6A 4CWPA 1NHHA 4EMVA 2XX4A 4YKWA 4ASFA 4URNA 2YKJA 5M4NA 3GIGB 1S14A 2XJJA 2YK9A 2FWYA 5CTUA 2E0AA 3ZXQA 3ZM7A 4CWSA 5FWKA 3DGEA 3KE6A 1ZXNA 4L90A 1UYEA 2YE7A 1US7A 1U2OA 4L93A 2YEBA 3R4PA 2XD6A 4MB9A 4R3AA 2YI5A 2WI6A 5FNFA 4PRXA 3INXA 1YS3A 2YE3A 3C11A 4AWOA 3U67A 3OW6A 2ZBKB 3WQ9A 5J6AA 1YC3A 5F5RA 1UY7A 3Q5JA 4AWQA 4URMA 4E02A 4YKYA 3G7EA 2QG2A 5F3KA 3EHJA 4FCPA 5D7RA 3TZ0A 2YEIA 5C93A 4ASBA 4XKAA 4FMTA 3FV5A 2CH4A 1KZNA 1AJ6A 4YKTA 3T0HA 2YI7A 3TZ4A 3ZKBA 2WI4A 4EGIA 2FWZA 1A4HA 2GQPA 4LWGA 5D7DA 2CG9A 4FPPA 2YE6A 4U7OA 3EKRA 4ZVIA 4V26A 2VCIA 4LWEA 2YKEA 2WERA 4NH9A 2YJWA 4E01A 1TH8A 3T10A 5CTYA 3RLRA 5D7CA 3GIGA 2QF6A 1ID0A 1UYHA 2YJXA 5FNCA 3HZ1A 1BXDA 1I59A 2C2AA 4GQTA 1I5DA 3LPSA 5D6PA 4HY6A 1I5BA 4DZYA 4EFTA 1TILA 2YI0A 1UYFA 4XCJA 2O1VA 1ZW9A 3K98A 2YEFA 3K60A 3U2DA 3HHUA 4V25A 4EM7A 4XKOA 1BGQA 2YGFA 4HZ5A 4QPKA 3C0EA 4JAVA 1AMWA 4U7NA 2WEQA 5L3JA 3Q5LA 2BU8A 2IOQA 5M4MA 4GFNA 4LWHA 1YC1A 3A0RA 5M4EA 3R92A 1AH8A 2O1UA 3ZKDA 2Q2EB 4PU9A 2XDUA 4KQVA 3A0WA 2WI5A 4XTJA 5GGZA 4W7TA 2YEDA 4U93A 3A0YA 3H4LA 3PEHA 5J71A 4GCZA 1H7SA 2FXSA 2BU6A 4MP7A 4AWPA 1Y8OA 2YE5A 4CWOA 1THNA 4MPNA 2YECA 1S16A 1AM1A 3GIEA 4E00A 1UY8A 3D0BA 4ASAA 3B25A 2Q8GA 3IEDA 3R91A 2IORA 4XD8A 2H8MA 3B28A 2WI1A 1YT2A 4B6CA 4GEEA 3K99A 3RLQA 2HCHA 4H7QA 4CWQA 1NHIA 2FYPA 2WEPA 1MU5A 1Y8NA 1Y4UA 3OWBA 2HG1A 2CCSA 4CWNA 2XX2A 4NH8A 2EXLA 3A0XA 5IN9A 4KTNA 3OPDA 2XJGA 2XK2A 4AS9A 2QG0A 2XCMA 4BQJA 2BZ5A 1I5CA 1YSZA 2VWCA 4NH7A 3VHAA 4CWRA 2GFDA 5BODA 4KFGA 1TIDA 4XIRA 3MNRP 4P8OA 3PEJA 4R1FA 4X9LA 1TBWA 2H55A 4WUCA 4HY1A 4XC0A 3D36A 3LNUA 2YK2A 3O0IA 4LWIA 1I58A 1YERA 1MX0A 2XX5A 5CTXA 4L91A 4XCLA 2IWXA 2WI3A 3TTZA 4GGLA 1ZXMA 4GT8A 2CGFA 1H7UA 3OWDA 3RLPA 4HXWA 4UROA 4H81A 3ZXOA 3TZ5A 3EKOA 2BU2A 3B27A 2BU5A 1ZWHA 1JM6A 4O07A 4BIUA 2BT0A 2YE2A 4O05A 1B3QA 5D6QA 2YE4A 5CPHA 4EGKA 2IOPA 1UYLA 2HKJA 3EHFA 2K5BA 1B63A 4O09A 1YT1A 3O2FA 3QDDA 4MOTA 4K4OA 3OMUA 1EI1A 3T1KA 3CRKA 3D2RA 4MP2A 4CWTA 1NHJA 2BYHA 1KIJA 1BYQA 4KSHA 2ZDYA 4BQGA 3VHCA 3T0ZA 1GKXA 4BAEA 2JJCA 4R3MA 4URLA 3RKZA 1PVGA 1Z5BA 4XIQA 4EGHA 3EHHA 3A0TA 2ZDXA 1YC4A 4YKRA 3SL2A 2XHTA 2BTZA 2XABA 5M4PA 3G75A 4I5SA 4KP4A 4CWFA 3WHAA 4XE2A 2O1WA 2YEJA 4LPBA 3BMYA 4QPJA 2WI2A 3R4MA 4PRVA 2BREA 4O0BA 1UY6A 3R4OA 4CE2A 4FCQA 4FCRA 4L94A 4Q20A 1EA6A 5CTWA 1UYKA 3FT8A 2CCUA 2XDKA 3Q5KA 4JAUA 4YKZA 2YEEA 2ZKJA 4HZ0A 2XHRA 4JQLA 2YGAA 3HZ5A 1Y8PA 2XDXA 1Z5CA 2IWSA 2XDSA 2YKCA 1GKZA 2XDLA 4PL9A 1UYIA 2XJXA 2YE9A 1UY9A 4P7AA 4CE3A 3G7BA 2BRCA 1L0OA 4H85A 3U2KA 2BSMA 3INWA 3CRLA 4CE1A 1UYDA 1I5AA 1YT0A 1Y4SA 5IDJA 4KSGA 2XHXA 5M4HA 2JKIA 2YEGA 1QZRA 4HXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CF0 A;  2BYI A;  2YEH A;  2YI6 A;  2VW5 A;  4HYM A;  3CWV A;  1YET A;  2IWU A;  3VHD A;  1QYE A;  4ASG A;  1QY8 A;  4YKU A;  2CCT A;  1B62 A;  1U0Z A;  3H80 A;  3O6O A;  3R4N A;  2Q8I A;  3NMQ A;  4XIP A;  5M4K A;  1GJV A;  4XKK A;  5FND A;  3EHG A;  3JZ3 A;  1OSF A;  2YKI A;  3B26 A;  3VAD A;  4O04 A;  1Z59 A;  3K97 A;  1TC0 A;  3CGY A;  4EEH A;  4WUD A;  3GIF A;  2YGE A;  2UWD A;  2YEA A;  5IDM A;  1R62 A;  4MBC A;  4EFU A;  4LWF A;  4LP0 A;  4BXI A;  2Q8H A;  4ZKI A;  4XIT A;  2Q8F A;  3B24 A;  4BIZ A;  3TUH A;  3T2S A;  1UYG A;  3FT5 A;  4XDM A;  5BOC A;  1YES A;  4WUB A;  4L8Z A;  2BU7 A;  2PNR A;  4MPC A;  1BKN A;  3HYZ A;  4JAS A;  4YKX A;  1Z5A A;  1UYC A;  4I3H A;  4HYP A;  3A0Z A;  3QTF A;  2QFO A;  3HYY A;  2VCJ A;  3BM9 A;  2YE8 A;  4DUH A;  1UYM A;  4YKQ A;  3TZ2 A;  2ESA A;  3HEK A;  2WI7 A;  1YSR A;  3CGZ A;  1TC6 A;  4B7P A;  2AKP A;  2YKB A;  4MPE A;  1AH6 A;  4CWP A;  1NHH A;  4EMV A;  2XX4 A;  4YKW A;  4ASF A;  4URN A;  2YKJ A;  5M4N A;  3GIG B;  1S14 A;  2XJJ A;  2YK9 A;  2FWY A;  5CTU A;  2E0A A;  3ZXQ A;  3ZM7 A;  4CWS A;  5FWK A;  3DGE A;  3KE6 A;  1ZXN A;  4L90 A;  1UYE A;  2YE7 A;  1US7 A;  1U2O A;  4L93 A;  2YEB A;  3R4P A;  2XD6 A;  4MB9 A;  4R3A A;  2YI5 A;  2WI6 A;  5FNF A;  4PRX A;  3INX A;  1YS3 A;  2YE3 A;  3C11 A;  4AWO A;  3U67 A;  3OW6 A;  2ZBK B;  3WQ9 A;  5J6A A;  1YC3 A;  5F5R A;  1UY7 A;  3Q5J A;  4AWQ A;  4URM A;  4E02 A;  4YKY A;  3G7E A;  2QG2 A;  5F3K A;  3EHJ A;  4FCP A;  5D7R A;  3TZ0 A;  2YEI A;  5C93 A;  4ASB A;  4XKA A;  4FMT A;  3FV5 A;  2CH4 A;  1KZN A;  1AJ6 A;  4YKT A;  3T0H A;  2YI7 A;  3TZ4 A;  3ZKB A;  2WI4 A;  4EGI A;  2FWZ A;  1A4H A;  2GQP A;  4LWG A;  5D7D A;  2CG9 A;  4FPP A;  2YE6 A;  4U7O A;  3EKR A;  4ZVI A;  4V26 A;  2VCI A;  4LWE A;  2YKE A;  2WER A;  4NH9 A;  2YJW A;  4E01 A;  1TH8 A;  3T10 A;  5CTY A;  3RLR A;  5D7C A;  3GIG A;  2QF6 A;  1ID0 A;  1UYH A;  2YJX A;  5FNC A;  3HZ1 A;  1BXD A;  1I59 A;  2C2A A;  4GQT A;  1I5D A;  3LPS A;  5D6P A;  4HY6 A;  1I5B A;  4DZY A;  4EFT A;  1TIL A;  2YI0 A;  1UYF A;  4XCJ A;  2O1V A;  1ZW9 A;  3K98 A;  2YEF A;  3K60 A;  3U2D A;  3HHU A;  4V25 A;  4EM7 A;  4XKO A;  1BGQ A;  2YGF A;  4HZ5 A;  4QPK A;  3C0E A;  4JAV A;  1AMW A;  4U7N A;  2WEQ A;  5L3J A;  3Q5L A;  2BU8 A;  2IOQ A;  5M4M A;  4GFN A;  4LWH A;  1YC1 A;  3A0R A;  5M4E A;  3R92 A;  1AH8 A;  2O1U A;  3ZKD A;  2Q2E B;  4PU9 A;  2XDU A;  4KQV A;  3A0W A;  2WI5 A;  4XTJ A;  5GGZ A;  4W7T A;  2YED A;  4U93 A;  3A0Y A;  3H4L A;  3PEH A;  5J71 A;  4GCZ A;  1H7S A;  2FXS A;  2BU6 A;  4MP7 A;  4AWP A;  1Y8O A;  2YE5 A;  4CWO A;  1THN A;  4MPN A;  2YEC A;  1S16 A;  1AM1 A;  3GIE A;  4E00 A;  1UY8 A;  3D0B A;  4ASA A;  3B25 A;  2Q8G A;  3IED A;  3R91 A;  2IOR A;  4XD8 A;  2H8M A;  3B28 A;  2WI1 A;  1YT2 A;  4B6C A;  4GEE A;  3K99 A;  3RLQ A;  2HCH A;  4H7Q A;  4CWQ A;  1NHI A;  2FYP A;  2WEP A;  1MU5 A;  1Y8N A;  1Y4U A;  3OWB A;  2HG1 A;  2CCS A;  4CWN A;  2XX2 A;  4NH8 A;  2EXL A;  3A0X A;  5IN9 A;  4KTN A;  3OPD A;  2XJG A;  2XK2 A;  4AS9 A;  2QG0 A;  2XCM A;  4BQJ A;  2BZ5 A;  1I5C A;  1YSZ A;  2VWC A;  4NH7 A;  3VHA A;  4CWR A;  2GFD A;  5BOD A;  4KFG A;  1TID A;  4XIR A;  3MNR P;  4P8O A;  3PEJ A;  4R1F A;  4X9L A;  1TBW A;  2H55 A;  4WUC A;  4HY1 A;  4XC0 A;  3D36 A;  3LNU A;  2YK2 A;  3O0I A;  4LWI A;  1I58 A;  1YER A;  1MX0 A;  2XX5 A;  5CTX A;  4L91 A;  4XCL A;  2IWX A;  2WI3 A;  3TTZ A;  4GGL A;  1ZXM A;  4GT8 A;  2CGF A;  1H7U A;  3OWD A;  3RLP A;  4HXW A;  4URO A;  4H81 A;  3ZXO A;  3TZ5 A;  3EKO A;  2BU2 A;  3B27 A;  2BU5 A;  1ZWH A;  1JM6 A;  4O07 A;  4BIU A;  2BT0 A;  2YE2 A;  4O05 A;  1B3Q A;  5D6Q A;  2YE4 A;  5CPH A;  4EGK A;  2IOP A;  1UYL A;  2HKJ A;  3EHF A;  2K5B A;  1B63 A;  4O09 A;  1YT1 A;  3O2F A;  3QDD A;  4MOT A;  4K4O A;  3OMU A;  1EI1 A;  3T1K A;  3CRK A;  3D2R A;  4MP2 A;  4CWT A;  1NHJ A;  2BYH A;  1KIJ A;  1BYQ A;  4KSH A;  2ZDY A;  4BQG A;  3VHC A;  3T0Z A;  1GKX A;  4BAE A;  2JJC A;  4R3M A;  4URL A;  3RKZ A;  1PVG A;  1Z5B A;  4XIQ A;  4EGH A;  3EHH A;  3A0T A;  2ZDX A;  1YC4 A;  4YKR A;  3SL2 A;  2XHT A;  2BTZ A;  2XAB A;  5M4P A;  3G75 A;  4I5S A;  4KP4 A;  4CWF A;  3WHA A;  4XE2 A;  2O1W A;  2YEJ A;  4LPB A;  3BMY A;  4QPJ A;  2WI2 A;  3R4M A;  4PRV A;  2BRE A;  4O0B A;  1UY6 A;  3R4O A;  4CE2 A;  4FCQ A;  4FCR A;  4L94 A;  4Q20 A;  1EA6 A;  5CTW A;  1UYK A;  3FT8 A;  2CCU A;  2XDK A;  3Q5K A;  4JAU A;  4YKZ A;  2YEE A;  2ZKJ A;  4HZ0 A;  2XHR A;  4JQL A;  2YGA A;  3HZ5 A;  1Y8P A;  2XDX A;  1Z5C A;  2IWS A;  2XDS A;  2YKC A;  1GKZ A;  2XDL A;  4PL9 A;  1UYI A;  2XJX A;  2YE9 A;  1UY9 A;  4P7A A;  4CE3 A;  3G7B A;  2BRC A;  1L0O A;  4H85 A;  3U2K A;  2BSM A;  3INW A;  3CRL A;  4CE1 A;  1UYD A;  1I5A A;  1YT0 A;  1Y4S A;  5IDJ A;  4KSG A;  2XHX A;  5M4H A;  2JKI A;  2YEG A;  1QZR A;  4HXZ A; 
#chains in the Genus database with same CATH topology
 5CF0 A;  2BYI A;  2YEH A;  2YI6 A;  2VW5 A;  4HYM A;  3CWV A;  1YET A;  2IWU A;  3VHD A;  1QYE A;  4ASG A;  1QY8 A;  4YKU A;  2CCT A;  1B62 A;  1U0Z A;  3H80 A;  3O6O A;  3R4N A;  2Q8I A;  3NMQ A;  4XIP A;  5M4K A;  1GJV A;  4XKK A;  5FND A;  3EHG A;  3JZ3 A;  1OSF A;  2YKI A;  3B26 A;  3S5T A;  3VAD A;  4O04 A;  1Z59 A;  3K97 A;  1TC0 A;  3CGY A;  4EEH A;  4WUD A;  3GIF A;  2YGE A;  2UWD A;  2YEA A;  5IDM A;  1R62 A;  4MBC A;  4EFU A;  4LWF A;  4LP0 A;  4BXI A;  2Q8H A;  4ZKI A;  4XIT A;  2Q8F A;  3B24 A;  4BIZ A;  3TUH A;  3T2S A;  1UYG A;  3FT5 A;  4XDM A;  5BOC A;  1YES A;  4WUB A;  4L8Z A;  2BU7 A;  2PNR A;  4MPC A;  1BKN A;  3HYZ A;  4JAS A;  4YKX A;  1Z5A A;  1UYC A;  4I3H A;  4HYP A;  3A0Z A;  3QTF A;  2QFO A;  3HYY A;  2VCJ A;  3BM9 A;  2YE8 A;  4DUH A;  1UYM A;  4YKQ A;  3TZ2 A;  2ESA A;  3HEK A;  2WI7 A;  1YSR A;  3CGZ A;  1TC6 A;  4B7P A;  2AKP A;  2YKB A;  4MPE A;  1AH6 A;  4CWP A;  1NHH A;  4EMV A;  2XX4 A;  4YKW A;  4ASF A;  4URN A;  2YKJ A;  5M4N A;  3GIG B;  1S14 A;  2XJJ A;  2YK9 A;  2FWY A;  5CTU A;  2E0A A;  3ZXQ A;  3ZM7 A;  4CWS A;  5FWK A;  3DGE A;  3KE6 A;  1ZXN A;  4L90 A;  1UYE A;  2YE7 A;  1US7 A;  1U2O A;  4L93 A;  2YEB A;  3R4P A;  2XD6 A;  4MB9 A;  4R3A A;  2YI5 A;  2WI6 A;  3LMM A;  5FNF A;  4PRX A;  3INX A;  1YS3 A;  2YE3 A;  3C11 A;  4AWO A;  3U67 A;  3OW6 A;  2ZBK B;  3WQ9 A;  5J6A A;  1YC3 A;  5F5R A;  1UY7 A;  3Q5J A;  4AWQ A;  4URM A;  4E02 A;  4YKY A;  3G7E A;  2QG2 A;  5F3K A;  3EHJ A;  4FCP A;  5D7R A;  3TZ0 A;  2YEI A;  5C93 A;  4ASB A;  4XKA A;  4FMT A;  3FV5 A;  2CH4 A;  1KZN A;  1AJ6 A;  4YKT A;  3T0H A;  2YI7 A;  3TZ4 A;  3ZKB A;  2WI4 A;  4EGI A;  2FWZ A;  1A4H A;  2GQP A;  4LWG A;  5D7D A;  2CG9 A;  4FPP A;  2YE6 A;  4U7O A;  3EKR A;  4ZVI A;  4V26 A;  2VCI A;  4LWE A;  2YKE A;  2WER A;  4NH9 A;  2YJW A;  4E01 A;  1TH8 A;  3T10 A;  5CTY A;  3RLR A;  5D7C A;  3GIG A;  2QF6 A;  1ID0 A;  1UYH A;  2YJX A;  5FNC A;  3HZ1 A;  1BXD A;  1I59 A;  2C2A A;  4GQT A;  1I5D A;  3LPS A;  5D6P A;  4HY6 A;  1I5B A;  4DZY A;  4EFT A;  1TIL A;  2YI0 A;  2FTK A;  1UYF A;  4XCJ A;  2O1V A;  1ZW9 A;  3K98 A;  2YEF A;  3K60 A;  3U2D A;  3HHU A;  4V25 A;  4EM7 A;  4XKO A;  1BGQ A;  2YGF A;  4HZ5 A;  4QPK A;  3C0E A;  4JAV A;  1AMW A;  4U7N A;  2WEQ A;  5L3J A;  3Q5L A;  2BU8 A;  2IOQ A;  5M4M A;  4GFN A;  4LWH A;  1YC1 A;  3A0R A;  5M4E A;  3R92 A;  1AH8 A;  2O1U A;  3ZKD A;  2Q2E B;  4PU9 A;  2XDU A;  4KQV A;  3A0W A;  2WI5 A;  4XTJ A;  5GGZ A;  4W7T A;  2YED A;  4U93 A;  3A0Y A;  3H4L A;  3PEH A;  5J71 A;  4GCZ A;  1H7S A;  2FXS A;  2BU6 A;  4MP7 A;  4AWP A;  1Y8O A;  2YE5 A;  2HHI A;  4CWO A;  1THN A;  4MPN A;  2YEC A;  1S16 A;  1AM1 A;  3GIE A;  4E00 A;  1UY8 A;  3CYG A;  3D0B A;  4ASA A;  3B25 A;  2Q8G A;  3IED A;  3R91 A;  2IOR A;  4XD8 A;  2H8M A;  3B28 A;  2WI1 A;  1YT2 A;  4B6C A;  4GEE A;  3K99 A;  3RLQ A;  2HCH A;  4H7Q A;  4CWQ A;  1NHI A;  2FYP A;  2WEP A;  1MU5 A;  1Y8N A;  1Y4U A;  3OWB A;  2HG1 A;  2CCS A;  4CWN A;  2XX2 A;  4NH8 A;  2EXL A;  3A0X A;  5IN9 A;  4KTN A;  3OPD A;  2XJG A;  2XK2 A;  4AS9 A;  2QG0 A;  2XCM A;  4BQJ A;  2BZ5 A;  1I5C A;  1YSZ A;  2VWC A;  4NH7 A;  3VHA A;  4CWR A;  2GFD A;  5BOD A;  4KFG A;  1TID A;  4XIR A;  3MNR P;  4P8O A;  3PEJ A;  4R1F A;  4X9L A;  1TBW A;  2H55 A;  4WUC A;  4HY1 A;  4XC0 A;  3D36 A;  3LNU A;  2YK2 A;  3O0I A;  4LWI A;  1I58 A;  1YER A;  1MX0 A;  2XX5 A;  5CTX A;  4L91 A;  4XCL A;  2IWX A;  2WI3 A;  3TTZ A;  4GGL A;  1ZXM A;  4GT8 A;  2CGF A;  1H7U A;  3OWD A;  3RLP A;  4HXW A;  4URO A;  4H81 A;  3ZXO A;  3TZ5 A;  3EKO A;  2BU2 A;  3B27 A;  2BU5 A;  1ZWH A;  1JM6 A;  4O07 A;  4BIU A;  2BT0 A;  2YE2 A;  4O05 A;  5JEN A;  1B3Q A;  5D6Q A;  2YE4 A;  5CPH A;  4EGK A;  2IOP A;  1UYL A;  2HKJ A;  3EHF A;  2K5B A;  1B63 A;  4O09 A;  1YT1 A;  3O2F A;  3QDD A;  4MOT A;  4K4O A;  3OMU A;  1EI1 A;  3T1K A;  3CRK A;  3D2R A;  2C1I A;  4MP2 A;  4CWT A;  1NHJ A;  2BYH A;  1KIJ A;  1BYQ A;  4KSH A;  2ZDY A;  4BQG A;  1IXM A;  3VHC A;  3T0Z A;  1GKX A;  4BAE A;  2JJC A;  2C1G A;  4E72 A;  4R3M A;  4URL A;  3RKZ A;  1PVG A;  1Z5B A;  4XIQ A;  4EGH A;  3EHH A;  3A0T A;  2ZDX A;  1YC4 A;  4YKR A;  3SL2 A;  2XHT A;  2BTZ A;  2XAB A;  5M4P A;  3G75 A;  4I5S A;  4KP4 A;  4CWF A;  3WHA A;  4XE2 A;  2O1W A;  2YEJ A;  4LPB A;  3BMY A;  4QPJ A;  2WI2 A;  3R4M A;  4PRV A;  2BRE A;  4O0B A;  1UY6 A;  3R4O A;  4CE2 A;  4FCQ A;  4FCR A;  4L94 A;  4Q20 A;  1EA6 A;  5CTW A;  1UYK A;  3FT8 A;  2CCU A;  2XDK A;  3Q5K A;  4JAU A;  4YKZ A;  2YEE A;  2ZKJ A;  4HZ0 A;  2XHR A;  4JQL A;  2YGA A;  3HZ5 A;  1Y8P A;  2XDX A;  1Z5C A;  2IWS A;  2XDS A;  2YKC A;  1GKZ A;  2XDL A;  4PL9 A;  1UYI A;  2XJX A;  2YE9 A;  1UY9 A;  4P7A A;  4CE3 A;  3G7B A;  2BRC A;  1L0O A;  4H85 A;  3U2K A;  2BSM A;  1F51 A;  3INW A;  3CRL A;  4CE1 A;  1UYD A;  1I5A A;  1YT0 A;  1Y4S A;  5IDJ A;  4KSG A;  2XHX A;  5M4H A;  2JKI A;  2YEG A;  1QZR A;  4HXZ A; 
#chains in the Genus database with same CATH homology
 5CF0 A;  2BYI A;  2YEH A;  2YI6 A;  2VW5 A;  4HYM A;  3CWV A;  1YET A;  2IWU A;  3VHD A;  1QYE A;  4ASG A;  1QY8 A;  4YKU A;  2CCT A;  1B62 A;  1U0Z A;  3H80 A;  3O6O A;  3R4N A;  2Q8I A;  3NMQ A;  4XIP A;  5M4K A;  1GJV A;  4XKK A;  5FND A;  3EHG A;  3JZ3 A;  1OSF A;  2YKI A;  3B26 A;  3VAD A;  4O04 A;  1Z59 A;  3K97 A;  1TC0 A;  3CGY A;  4EEH A;  4WUD A;  3GIF A;  2YGE A;  2UWD A;  2YEA A;  5IDM A;  1R62 A;  4MBC A;  4EFU A;  4LWF A;  4LP0 A;  4BXI A;  2Q8H A;  4ZKI A;  4XIT A;  2Q8F A;  3B24 A;  4BIZ A;  3TUH A;  3T2S A;  1UYG A;  3FT5 A;  4XDM A;  5BOC A;  1YES A;  4WUB A;  4L8Z A;  2BU7 A;  2PNR A;  4MPC A;  1BKN A;  3HYZ A;  4JAS A;  4YKX A;  1Z5A A;  1UYC A;  4I3H A;  4HYP A;  3A0Z A;  3QTF A;  2QFO A;  3HYY A;  2VCJ A;  3BM9 A;  2YE8 A;  4DUH A;  1UYM A;  4YKQ A;  3TZ2 A;  2ESA A;  3HEK A;  2WI7 A;  1YSR A;  3CGZ A;  1TC6 A;  4B7P A;  2AKP A;  2YKB A;  4MPE A;  1AH6 A;  4CWP A;  1NHH A;  4EMV A;  2XX4 A;  4YKW A;  4ASF A;  4URN A;  2YKJ A;  5M4N A;  3GIG B;  1S14 A;  2XJJ A;  2YK9 A;  2FWY A;  5CTU A;  2E0A A;  3ZXQ A;  3ZM7 A;  4CWS A;  5FWK A;  3DGE A;  3KE6 A;  1ZXN A;  4L90 A;  1UYE A;  2YE7 A;  1US7 A;  1U2O A;  4L93 A;  2YEB A;  3R4P A;  2XD6 A;  4MB9 A;  4R3A A;  2YI5 A;  2WI6 A;  5FNF A;  4PRX A;  3INX A;  1YS3 A;  2YE3 A;  3C11 A;  4AWO A;  3U67 A;  3OW6 A;  2ZBK B;  3WQ9 A;  5J6A A;  1YC3 A;  5F5R A;  1UY7 A;  3Q5J A;  4AWQ A;  4URM A;  4E02 A;  4YKY A;  3G7E A;  2QG2 A;  5F3K A;  3EHJ A;  4FCP A;  5D7R A;  3TZ0 A;  2YEI A;  5C93 A;  4ASB A;  4XKA A;  4FMT A;  3FV5 A;  2CH4 A;  1KZN A;  1AJ6 A;  4YKT A;  3T0H A;  2YI7 A;  3TZ4 A;  3ZKB A;  2WI4 A;  4EGI A;  2FWZ A;  1A4H A;  2GQP A;  4LWG A;  5D7D A;  2CG9 A;  4FPP A;  2YE6 A;  4U7O A;  3EKR A;  4ZVI A;  4V26 A;  2VCI A;  4LWE A;  2YKE A;  2WER A;  4NH9 A;  2YJW A;  4E01 A;  1TH8 A;  3T10 A;  5CTY A;  3RLR A;  5D7C A;  3GIG A;  2QF6 A;  1ID0 A;  1UYH A;  2YJX A;  5FNC A;  3HZ1 A;  1BXD A;  1I59 A;  2C2A A;  4GQT A;  1I5D A;  3LPS A;  5D6P A;  4HY6 A;  1I5B A;  4DZY A;  4EFT A;  1TIL A;  2YI0 A;  1UYF A;  4XCJ A;  2O1V A;  1ZW9 A;  3K98 A;  2YEF A;  3K60 A;  3U2D A;  3HHU A;  4V25 A;  4EM7 A;  4XKO A;  1BGQ A;  2YGF A;  4HZ5 A;  4QPK A;  3C0E A;  4JAV A;  1AMW A;  4U7N A;  2WEQ A;  5L3J A;  3Q5L A;  2BU8 A;  2IOQ A;  5M4M A;  4GFN A;  4LWH A;  1YC1 A;  3A0R A;  5M4E A;  3R92 A;  1AH8 A;  2O1U A;  3ZKD A;  2Q2E B;  4PU9 A;  2XDU A;  4KQV A;  3A0W A;  2WI5 A;  4XTJ A;  5GGZ A;  4W7T A;  2YED A;  4U93 A;  3A0Y A;  3H4L A;  3PEH A;  5J71 A;  4GCZ A;  1H7S A;  2FXS A;  2BU6 A;  4MP7 A;  4AWP A;  1Y8O A;  2YE5 A;  4CWO A;  1THN A;  4MPN A;  2YEC A;  1S16 A;  1AM1 A;  3GIE A;  4E00 A;  1UY8 A;  3D0B A;  4ASA A;  3B25 A;  2Q8G A;  3IED A;  3R91 A;  2IOR A;  4XD8 A;  2H8M A;  3B28 A;  2WI1 A;  1YT2 A;  4B6C A;  4GEE A;  3K99 A;  3RLQ A;  2HCH A;  4H7Q A;  4CWQ A;  1NHI A;  2FYP A;  2WEP A;  1MU5 A;  1Y8N A;  1Y4U A;  3OWB A;  2HG1 A;  2CCS A;  4CWN A;  2XX2 A;  4NH8 A;  2EXL A;  3A0X A;  5IN9 A;  4KTN A;  3OPD A;  2XJG A;  2XK2 A;  4AS9 A;  2QG0 A;  2XCM A;  4BQJ A;  2BZ5 A;  1I5C A;  1YSZ A;  2VWC A;  4NH7 A;  3VHA A;  4CWR A;  2GFD A;  5BOD A;  4KFG A;  1TID A;  4XIR A;  3MNR P;  4P8O A;  3PEJ A;  4R1F A;  4X9L A;  1TBW A;  2H55 A;  4WUC A;  4HY1 A;  4XC0 A;  3D36 A;  3LNU A;  2YK2 A;  3O0I A;  4LWI A;  1I58 A;  1YER A;  1MX0 A;  2XX5 A;  5CTX A;  4L91 A;  4XCL A;  2IWX A;  2WI3 A;  3TTZ A;  4GGL A;  1ZXM A;  4GT8 A;  2CGF A;  1H7U A;  3OWD A;  3RLP A;  4HXW A;  4URO A;  4H81 A;  3ZXO A;  3TZ5 A;  3EKO A;  2BU2 A;  3B27 A;  2BU5 A;  1ZWH A;  1JM6 A;  4O07 A;  4BIU A;  2BT0 A;  2YE2 A;  4O05 A;  1B3Q A;  5D6Q A;  2YE4 A;  5CPH A;  4EGK A;  2IOP A;  1UYL A;  2HKJ A;  3EHF A;  2K5B A;  1B63 A;  4O09 A;  1YT1 A;  3O2F A;  3QDD A;  4MOT A;  4K4O A;  3OMU A;  1EI1 A;  3T1K A;  3CRK A;  3D2R A;  4MP2 A;  4CWT A;  1NHJ A;  2BYH A;  1KIJ A;  1BYQ A;  4KSH A;  2ZDY A;  4BQG A;  3VHC A;  3T0Z A;  1GKX A;  4BAE A;  2JJC A;  4R3M A;  4URL A;  3RKZ A;  1PVG A;  1Z5B A;  4XIQ A;  4EGH A;  3EHH A;  3A0T A;  2ZDX A;  1YC4 A;  4YKR A;  3SL2 A;  2XHT A;  2BTZ A;  2XAB A;  5M4P A;  3G75 A;  4I5S A;  4KP4 A;  4CWF A;  3WHA A;  4XE2 A;  2O1W A;  2YEJ A;  4LPB A;  3BMY A;  4QPJ A;  2WI2 A;  3R4M A;  4PRV A;  2BRE A;  4O0B A;  1UY6 A;  3R4O A;  4CE2 A;  4FCQ A;  4FCR A;  4L94 A;  4Q20 A;  1EA6 A;  5CTW A;  1UYK A;  3FT8 A;  2CCU A;  2XDK A;  3Q5K A;  4JAU A;  4YKZ A;  2YEE A;  2ZKJ A;  4HZ0 A;  2XHR A;  4JQL A;  2YGA A;  3HZ5 A;  1Y8P A;  2XDX A;  1Z5C A;  2IWS A;  2XDS A;  2YKC A;  1GKZ A;  2XDL A;  4PL9 A;  1UYI A;  2XJX A;  2YE9 A;  1UY9 A;  4P7A A;  4CE3 A;  3G7B A;  2BRC A;  1L0O A;  4H85 A;  3U2K A;  2BSM A;  3INW A;  3CRL A;  4CE1 A;  1UYD A;  1I5A A;  1YT0 A;  1Y4S A;  5IDJ A;  4KSG A;  2XHX A;  5M4H A;  2JKI A;  2YEG A;  1QZR A;  4HXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...