1YT1A

Crystal structure of the unliganded form of grp94, the er hsp90: basis for nucleotide-induced conformational change, grp94n(delta)41 apo crystal
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
236
structure length
227
Chain Sequence
b'GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQEQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title Structure of Unliganded GRP94, the Endoplasmic Reticulum Hsp90: BASIS FOR NUCLEOTIDE-INDUCED CONFORMATIONAL CHANGE
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 71
structure length 227
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1yt1A00
2YE2A 2XABA 4BIZA 1OSFA 3K99A 1ZWHA 2GFDA 2VWCA 4DZYA 4E00A 3EHFA 1UYFA 4MPNA 2WI7A 4U93A 3G7EA 1AH6A 4CWFA 4LWEA 1YSRA 4NH7A 1JM6A 1US7A 1TC0A 1I59A 1UYIA 2BU8A 4FCPA 3A0XA 5M4PA 4R3AA 2BU5A 2YI7A 3G7BA 4ASGA 2CGFA 3HYYA 5CPHA 4L91A 2E0AA 3B26A 1BKNA 1I5BA 3VADA 1AJ6A 3EHJA 1B62A 3R92A 3B25A 3IEDA 2Q8HA 2XX2A 4LWGA 5C93A 4AWQA 4KFGA 1YC3A 4AWPA 1I5CA 1MX0A 3ZKBA 2YI6A 5M4EA 4FPPA 2Q8FA 4MOTA 3OMUA 3B27A 2YK2A 4JQLA 4B7PA 5IDJA 3RKZA 4O0BA 3QTFA 2YEDA 3U67A 4X9LA 2JJCA 4O07A 4XKKA 2YKEA 2WI5A 2CCUA 2WI1A 1UYMA 2YEIA 4MPCA 4XCJA 3CGYA 5D7CA 5F3KA 3Q5LA 2BT0A 1BYQA 3VHAA 3RLQA 2YEHA 1NHHA 4ASBA 2IWSA 3OPDA 1NHJA 1QYEA 1GKXA 4KSHA 2BYHA 2XX5A 1Y8OA 2QG2A 3TTZA 3R4PA 3EKRA 1ZW9A 2YI0A 5J71A 2AKPA 4XIQA 2XHXA 1YS3A 1B63A 1Z59A 4WUCA 2YJXA 1Y4SA 2YJWA 4FCQA 3ZXQA 4DUHA 3A0RA 3K98A 4XKAA 1Z5CA 3A0WA 3GIEA 3PEJA 1MU5A 4YKZA 1BXDA 1S16A 1YC1A 4L94A 4H7QA 1EA6A 4I5SA 4URMA 5IDMA 4HXWA 1THNA 4LWIA 2YEEA 1GJVA 4EFTA 3CGZA 4E02A 1AM1A 2QG0A 1YC4A 4CWOA 3FT5A 2VCIA 4URLA 5CTXA 2YE3A 3T10A 2XJGA 4EM7A 2H55A 4LP0A 3GIFA 4LWHA 3R4NA 3JZ3A 1UYGA 3TZ5A 4KTNA 3RLPA 2YKCA 4AS9A 3KE6A 3WHAA 3OWBA 4ASAA 1KIJA 2YEJA 1S14A 4EFUA 3FT8A 1TILA 3BMYA 4YKQA 1YT1A 4XC0A 3GIGB 1I58A 5CTUA 2XDLA 4R3MA 3T0HA 2BYIA 1KZNA 2XCMA 2YECA 2BZ5A 3INXA 4YKRA 5FNFA 3GIGA 1Y4UA 2YGEA 4XKOA 1GKZA 2WERA 4BQJA 5FWKA 4MBCA 2QFOA 2XDSA 4W7TA 4ASFA 3Q5JA 2ESAA 2WEPA 2YE9A 3ZKDA 4CWTA 2BU2A 2HG1A 2BU6A 1YETA 1I5DA 1Z5AA 2BSMA 4MPEA 2XHRA 3PEHA 3K97A 2YE6A 3O6OA 3T0ZA 3EKOA 5BOCA 4YKTA 3CRKA 4CWNA 1AH8A 4YKWA 3U2KA 1EI1A 4NH9A 4WUBA 2EXLA 4PU9A 3SL2A 3TZ2A 2CG9A 4CWQA 3D0BA 4XITA 4YKYA 1TBWA 2YEGA 4MP7A 5M4HA 4FMTA 1NHIA 3TUHA 4HY6A 3NMQA 4JASA 1BGQA 2YKJA 2BRCA 1UY6A 1YERA 2XK2A 4PL9A 2HKJA 2K5BA 3QDDA 2XDXA 2YEAA 2GQPA 1A4HA 2BREA 4CE2A 1R62A 2FWYA 4HZ5A 4QPKA 4XE2A 4URNA 4QPJA 2XHTA 3C0EA 1UYHA 4GQTA 5J6AA 3R4OA 2ZDYA 2IWXA 4CWRA 3G75A 3K60A 4YKUA 3R4MA 4CE3A 4P8OA 4KP4A 4O05A 4HYPA 3LPSA 4EGIA 3ZM7A 4HZ0A 2WI4A 5M4KA 1U2OA 5FNDA 3LNUA 4XDMA 4V26A 4KSGA 2Q2EB 3U2DA 4BXIA 1TIDA 3A0YA 2JKIA 4LPBA 2IOPA 2XX4A 4EMVA 4XTJA 3TZ4A 1YT0A 3VHDA 3INWA 4BQGA 5D6PA 4EEHA 3HEKA 1H7UA 2QF6A 3EHHA 1TC6A 4PRVA 4BAEA 2CH4A 4L90A 2ZKJA 2YKBA 4H81A 4CWPA 4Q20A 5L3JA 2O1VA 3BM9A 5CF0A 5GGZA 2XJJA 5D6QA 4XD8A 4GGLA 2YKIA 3D36A 1AMWA 4BIUA 2BU7A 2FXSA 5BODA 4JAVA 1UYCA 1TH8A 3VHCA 5M4NA 2YGAA 2VCJA 4CWSA 5D7RA 2HCHA 4MB9A 4XIPA 2WI2A 4NH8A 4V25A 4O04A 4HXZA 3ZXOA 3HHUA 2YE8A 4AWOA 1Y8PA 2YE7A 2FWZA 4UROA 1ZXNA 4ZVIA 3B24A 3H4LA 1ID0A 4KQVA 2XDUA 4U7OA 5M4MA 2Q8IA 3TZ0A 2ZDXA 1L0OA 4CE1A 2VW5A 2WEQA 5FNCA 1B3QA 1YESA 2XDKA 3MNRP 4U7NA 2YGFA 3OWDA 4O09A 4B6CA 1QY8A 2WI6A 4MP2A 4GEEA 4EGKA 3HZ1A 3EHGA 4GFNA 4XCLA 2IOQA 1UY9A 3HZ5A 4L93A 4JAUA 3R91A 4YKXA 2WI3A 5CTWA 1Z5BA 3H80A 1UYKA 1ZXMA 3A0TA 2YEFA 2ZBKB 3OW6A 5D7DA 1UY8A 1YT2A 1UYDA 4ZKIA 4WUDA 1H7SA 4K4OA 3HYZA 1UY7A 4GCZA 3A0ZA 2O1WA 3D2RA 3C11A 5IN9A 1Y8NA 3CRLA 3O2FA 3T2SA 2YEBA 2C2AA 3Q5KA 3T1KA 2FYPA 2PNRA 3CWVA 2O1UA 4PRXA 2YK9A 2H8MA 4HYMA 3DGEA 1YSZA 1QZRA 3RLRA 1UYEA 2Q8GA 2XD6A 1I5AA 2XJXA 3B28A 4HY1A 2CCTA 3O0IA 4R1FA 2IORA 5CTYA 2YI5A 1UYLA 4E01A 2CCSA 4L8ZA 2IWUA 3FV5A 4FCRA 3WQ9A 1PVGA 4GT8A 2YE5A 4I3HA 2BTZA 4P7AA 4XIRA 5F5RA 4LWFA 2YE4A 4H85A 4EGHA 2UWDA 1U0ZA
chains in the Genus database with same CATH superfamily
2YE2A 2XABA 4BIZA 2HHIA 1OSFA 3K99A 1ZWHA 2GFDA 2VWCA 4DZYA 4E00A 3EHFA 1UYFA 4MPNA 2WI7A 4U93A 3G7EA 1AH6A 4CWFA 4LWEA 1YSRA 4NH7A 1JM6A 1US7A 1TC0A 1I59A 1UYIA 2BU8A 4FCPA 3A0XA 5M4PA 4R3AA 2BU5A 2YI7A 3G7BA 4ASGA 2CGFA 3HYYA 5CPHA 4L91A 2E0AA 3B26A 1BKNA 1I5BA 3VADA 1AJ6A 3EHJA 1B62A 3R92A 3B25A 3IEDA 2Q8HA 2XX2A 4LWGA 5C93A 4AWQA 4KFGA 1YC3A 4AWPA 1I5CA 1MX0A 3ZKBA 2YI6A 5M4EA 4FPPA 2Q8FA 4MOTA 3OMUA 3B27A 2YK2A 4JQLA 4B7PA 5IDJA 3RKZA 4O0BA 3QTFA 2YEDA 3U67A 4X9LA 2JJCA 4O07A 4XKKA 2YKEA 2WI5A 2CCUA 2WI1A 1UYMA 2YEIA 4MPCA 4XCJA 3CGYA 5D7CA 5F3KA 3Q5LA 2BT0A 1BYQA 3VHAA 3RLQA 2YEHA 1NHHA 4ASBA 2IWSA 3OPDA 1NHJA 1QYEA 1GKXA 4KSHA 2BYHA 2XX5A 1Y8OA 2QG2A 3TTZA 3R4PA 3EKRA 1ZW9A 2YI0A 5J71A 2AKPA 2C1GA 4XIQA 2XHXA 1YS3A 1B63A 1Z59A 4WUCA 2YJXA 1Y4SA 2YJWA 4FCQA 3ZXQA 4DUHA 3A0RA 3K98A 4XKAA 1IXMA 1Z5CA 3A0WA 3GIEA 3PEJA 1MU5A 4YKZA 1BXDA 1S16A 1YC1A 4L94A 4H7QA 1EA6A 4I5SA 4URMA 5IDMA 4HXWA 1THNA 4LWIA 2YEEA 1GJVA 4EFTA 3CGZA 4E02A 1AM1A 2QG0A 1YC4A 4CWOA 3FT5A 2VCIA 4URLA 5CTXA 2YE3A 3T10A 2XJGA 4EM7A 5JENA 2H55A 4LP0A 3GIFA 4LWHA 3R4NA 3JZ3A 1UYGA 3TZ5A 4KTNA 3RLPA 2YKCA 4AS9A 3KE6A 3WHAA 3OWBA 4ASAA 1KIJA 2YEJA 1S14A 4EFUA 3FT8A 1TILA 3BMYA 4YKQA 1YT1A 4XC0A 3GIGB 1I58A 5CTUA 2XDLA 4R3MA 3T0HA 2BYIA 1KZNA 2XCMA 2YECA 2BZ5A 3INXA 4YKRA 5FNFA 3GIGA 1Y4UA 2YGEA 4XKOA 1GKZA 2WERA 4BQJA 5FWKA 4MBCA 2QFOA 2XDSA 4W7TA 4ASFA 3Q5JA 2ESAA 2WEPA 2YE9A 3ZKDA 4CWTA 2BU2A 2HG1A 2BU6A 1YETA 1I5DA 1Z5AA 2BSMA 4MPEA 2XHRA 3PEHA 3K97A 2YE6A 3O6OA 3T0ZA 3EKOA 5BOCA 4YKTA 3CRKA 4CWNA 1AH8A 4YKWA 3U2KA 1EI1A 4NH9A 4WUBA 2EXLA 4PU9A 3SL2A 3TZ2A 2CG9A 4CWQA 3D0BA 4XITA 4YKYA 1TBWA 2YEGA 4MP7A 5M4HA 4FMTA 1NHIA 3TUHA 4HY6A 3NMQA 4JASA 1BGQA 2YKJA 2BRCA 1UY6A 1YERA 2XK2A 4PL9A 2HKJA 2K5BA 3QDDA 2XDXA 2YEAA 2GQPA 1A4HA 2BREA 4CE2A 1R62A 2FWYA 4HZ5A 4QPKA 4XE2A 4URNA 4QPJA 2XHTA 3C0EA 1UYHA 4GQTA 5J6AA 3R4OA 2ZDYA 2IWXA 4CWRA 3G75A 3K60A 4YKUA 3R4MA 4CE3A 4P8OA 4KP4A 4O05A 4HYPA 3LPSA 4EGIA 3ZM7A 4HZ0A 2WI4A 5M4KA 1U2OA 5FNDA 3LNUA 3LMMA 4XDMA 4V26A 4KSGA 2Q2EB 3U2DA 4BXIA 2C1IA 1TIDA 3A0YA 2JKIA 4LPBA 2IOPA 2XX4A 1F51A 4EMVA 4XTJA 3TZ4A 1YT0A 3VHDA 4E72A 3INWA 4BQGA 5D6PA 4EEHA 3HEKA 1H7UA 2QF6A 3EHHA 1TC6A 4PRVA 4BAEA 2CH4A 4L90A 2ZKJA 2YKBA 4H81A 4CWPA 4Q20A 5L3JA 2O1VA 3BM9A 5CF0A 5GGZA 2XJJA 5D6QA 4XD8A 4GGLA 2YKIA 3D36A 1AMWA 4BIUA 2BU7A 2FXSA 5BODA 4JAVA 1UYCA 1TH8A 3VHCA 5M4NA 3CYGA 2YGAA 2VCJA 4CWSA 5D7RA 2HCHA 4MB9A 4XIPA 2WI2A 4NH8A 4V25A 4O04A 4HXZA 3ZXOA 3HHUA 2YE8A 4AWOA 1Y8PA 2YE7A 2FWZA 4UROA 1ZXNA 4ZVIA 3B24A 3H4LA 1ID0A 4KQVA 2XDUA 4U7OA 5M4MA 2Q8IA 3TZ0A 2ZDXA 1L0OA 4CE1A 2VW5A 2WEQA 5FNCA 1B3QA 1YESA 2XDKA 3MNRP 4U7NA 2YGFA 3OWDA 4O09A 4B6CA 1QY8A 2WI6A 4MP2A 4GEEA 4EGKA 3HZ1A 3EHGA 4GFNA 4XCLA 2IOQA 1UY9A 3HZ5A 4L93A 4JAUA 3R91A 4YKXA 2WI3A 5CTWA 3S5TA 1Z5BA 3H80A 1UYKA 1ZXMA 3A0TA 2YEFA 2ZBKB 3OW6A 5D7DA 1UY8A 1YT2A 1UYDA 4ZKIA 4WUDA 1H7SA 4K4OA 3HYZA 1UY7A 4GCZA 2FTKA 3A0ZA 2O1WA 3D2RA 3C11A 5IN9A 1Y8NA 3CRLA 3O2FA 3T2SA 2YEBA 2C2AA 3Q5KA 3T1KA 2FYPA 2PNRA 3CWVA 2O1UA 4PRXA 2YK9A 2H8MA 4HYMA 3DGEA 1YSZA 1QZRA 3RLRA 1UYEA 2Q8GA 2XD6A 1I5AA 2XJXA 3B28A 4HY1A 2CCTA 3O0IA 4R1FA 2IORA 5CTYA 2YI5A 1UYLA 4E01A 2CCSA 4L8ZA 2IWUA 3FV5A 4FCRA 3WQ9A 1PVGA 4GT8A 2YE5A 4I3HA 2BTZA 4P7AA 4XIRA 5F5RA 4LWFA 2YE4A 4H85A 4EGHA 2UWDA 1U0ZA
chains in the Genus database with same CATH topology
2YE2A 2XABA 4BIZA 1OSFA 3K99A 1ZWHA 2GFDA 2VWCA 4DZYA 4E00A 3EHFA 1UYFA 4MPNA 2WI7A 4U93A 3G7EA 1AH6A 4CWFA 4LWEA 1YSRA 4NH7A 1JM6A 1US7A 1TC0A 1I59A 1UYIA 2BU8A 4FCPA 3A0XA 5M4PA 4R3AA 2BU5A 2YI7A 3G7BA 4ASGA 2CGFA 3HYYA 5CPHA 4L91A 2E0AA 3B26A 1BKNA 1I5BA 3VADA 1AJ6A 3EHJA 1B62A 3R92A 3B25A 3IEDA 2Q8HA 2XX2A 4LWGA 5C93A 4AWQA 4KFGA 1YC3A 4AWPA 1I5CA 1MX0A 3ZKBA 2YI6A 5M4EA 4FPPA 2Q8FA 4MOTA 3OMUA 3B27A 2YK2A 4JQLA 4B7PA 5IDJA 3RKZA 4O0BA 3QTFA 2YEDA 3U67A 4X9LA 2JJCA 4O07A 4XKKA 2YKEA 2WI5A 2CCUA 2WI1A 1UYMA 2YEIA 4MPCA 4XCJA 3CGYA 5D7CA 5F3KA 3Q5LA 2BT0A 1BYQA 3VHAA 3RLQA 2YEHA 1NHHA 4ASBA 2IWSA 3OPDA 1NHJA 1QYEA 1GKXA 4KSHA 2BYHA 2XX5A 1Y8OA 2QG2A 3TTZA 3R4PA 3EKRA 1ZW9A 2YI0A 5J71A 2AKPA 4XIQA 2XHXA 1YS3A 1B63A 1Z59A 4WUCA 2YJXA 1Y4SA 2YJWA 4FCQA 3ZXQA 4DUHA 3A0RA 3K98A 4XKAA 1Z5CA 3A0WA 3GIEA 3PEJA 1MU5A 4YKZA 1BXDA 1S16A 1YC1A 4L94A 4H7QA 1EA6A 4I5SA 4URMA 5IDMA 4HXWA 1THNA 4LWIA 2YEEA 1GJVA 4EFTA 3CGZA 4E02A 1AM1A 2QG0A 1YC4A 4CWOA 3FT5A 2VCIA 4URLA 5CTXA 2YE3A 3T10A 2XJGA 4EM7A 2H55A 4LP0A 3GIFA 4LWHA 3R4NA 3JZ3A 1UYGA 3TZ5A 4KTNA 3RLPA 2YKCA 4AS9A 3KE6A 3WHAA 3OWBA 4ASAA 1KIJA 2YEJA 1S14A 4EFUA 3FT8A 1TILA 3BMYA 4YKQA 1YT1A 4XC0A 3GIGB 1I58A 5CTUA 2XDLA 4R3MA 3T0HA 2BYIA 1KZNA 2XCMA 2YECA 2BZ5A 3INXA 4YKRA 5FNFA 3GIGA 1Y4UA 2YGEA 4XKOA 1GKZA 2WERA 4BQJA 5FWKA 4MBCA 2QFOA 2XDSA 4W7TA 4ASFA 3Q5JA 2ESAA 2WEPA 2YE9A 3ZKDA 4CWTA 2BU2A 2HG1A 2BU6A 1YETA 1I5DA 1Z5AA 2BSMA 4MPEA 2XHRA 3PEHA 3K97A 2YE6A 3O6OA 3T0ZA 3EKOA 5BOCA 4YKTA 3CRKA 4CWNA 1AH8A 4YKWA 3U2KA 1EI1A 4NH9A 4WUBA 2EXLA 4PU9A 3SL2A 3TZ2A 2CG9A 4CWQA 3D0BA 4XITA 4YKYA 1TBWA 2YEGA 4MP7A 5M4HA 4FMTA 1NHIA 3TUHA 4HY6A 3NMQA 4JASA 1BGQA 2YKJA 2BRCA 1UY6A 1YERA 2XK2A 4PL9A 2HKJA 2K5BA 3QDDA 2XDXA 2YEAA 2GQPA 1A4HA 2BREA 4CE2A 1R62A 2FWYA 4HZ5A 4QPKA 4XE2A 4URNA 4QPJA 2XHTA 3C0EA 1UYHA 4GQTA 5J6AA 3R4OA 2ZDYA 2IWXA 4CWRA 3G75A 3K60A 4YKUA 3R4MA 4CE3A 4P8OA 4KP4A 4O05A 4HYPA 3LPSA 4EGIA 3ZM7A 4HZ0A 2WI4A 5M4KA 1U2OA 5FNDA 3LNUA 4XDMA 4V26A 4KSGA 2Q2EB 3U2DA 4BXIA 1TIDA 3A0YA 2JKIA 4LPBA 2IOPA 2XX4A 4EMVA 4XTJA 3TZ4A 1YT0A 3VHDA 3INWA 4BQGA 5D6PA 4EEHA 3HEKA 1H7UA 2QF6A 3EHHA 1TC6A 4PRVA 4BAEA 2CH4A 4L90A 2ZKJA 2YKBA 4H81A 4CWPA 4Q20A 5L3JA 2O1VA 3BM9A 5CF0A 5GGZA 2XJJA 5D6QA 4XD8A 4GGLA 2YKIA 3D36A 1AMWA 4BIUA 2BU7A 2FXSA 5BODA 4JAVA 1UYCA 1TH8A 3VHCA 5M4NA 2YGAA 2VCJA 4CWSA 5D7RA 2HCHA 4MB9A 4XIPA 2WI2A 4NH8A 4V25A 4O04A 4HXZA 3ZXOA 3HHUA 2YE8A 4AWOA 1Y8PA 2YE7A 2FWZA 4UROA 1ZXNA 4ZVIA 3B24A 3H4LA 1ID0A 4KQVA 2XDUA 4U7OA 5M4MA 2Q8IA 3TZ0A 2ZDXA 1L0OA 4CE1A 2VW5A 2WEQA 5FNCA 1B3QA 1YESA 2XDKA 3MNRP 4U7NA 2YGFA 3OWDA 4O09A 4B6CA 1QY8A 2WI6A 4MP2A 4GEEA 4EGKA 3HZ1A 3EHGA 4GFNA 4XCLA 2IOQA 1UY9A 3HZ5A 4L93A 4JAUA 3R91A 4YKXA 2WI3A 5CTWA 1Z5BA 3H80A 1UYKA 1ZXMA 3A0TA 2YEFA 2ZBKB 3OW6A 5D7DA 1UY8A 1YT2A 1UYDA 4ZKIA 4WUDA 1H7SA 4K4OA 3HYZA 1UY7A 4GCZA 3A0ZA 2O1WA 3D2RA 3C11A 5IN9A 1Y8NA 3CRLA 3O2FA 3T2SA 2YEBA 2C2AA 3Q5KA 3T1KA 2FYPA 2PNRA 3CWVA 2O1UA 4PRXA 2YK9A 2H8MA 4HYMA 3DGEA 1YSZA 1QZRA 3RLRA 1UYEA 2Q8GA 2XD6A 1I5AA 2XJXA 3B28A 4HY1A 2CCTA 3O0IA 4R1FA 2IORA 5CTYA 2YI5A 1UYLA 4E01A 2CCSA 4L8ZA 2IWUA 3FV5A 4FCRA 3WQ9A 1PVGA 4GT8A 2YE5A 4I3HA 2BTZA 4P7AA 4XIRA 5F5RA 4LWFA 2YE4A 4H85A 4EGHA 2UWDA 1U0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YE2 A;  2XAB A;  4BIZ A;  1OSF A;  3K99 A;  1ZWH A;  2GFD A;  2VWC A;  4DZY A;  4E00 A;  3EHF A;  1UYF A;  4MPN A;  2WI7 A;  4U93 A;  3G7E A;  1AH6 A;  4CWF A;  4LWE A;  1YSR A;  4NH7 A;  1JM6 A;  1US7 A;  1TC0 A;  1I59 A;  1UYI A;  2BU8 A;  4FCP A;  3A0X A;  5M4P A;  4R3A A;  2BU5 A;  2YI7 A;  3G7B A;  4ASG A;  2CGF A;  3HYY A;  5CPH A;  4L91 A;  2E0A A;  3B26 A;  1BKN A;  1I5B A;  3VAD A;  1AJ6 A;  3EHJ A;  1B62 A;  3R92 A;  3B25 A;  3IED A;  2Q8H A;  2XX2 A;  4LWG A;  5C93 A;  4AWQ A;  4KFG A;  1YC3 A;  4AWP A;  1I5C A;  1MX0 A;  3ZKB A;  2YI6 A;  5M4E A;  4FPP A;  2Q8F A;  4MOT A;  3OMU A;  3B27 A;  2YK2 A;  4JQL A;  4B7P A;  5IDJ A;  3RKZ A;  4O0B A;  3QTF A;  2YED A;  3U67 A;  4X9L A;  2JJC A;  4O07 A;  4XKK A;  2YKE A;  2WI5 A;  2CCU A;  2WI1 A;  1UYM A;  2YEI A;  4MPC A;  4XCJ A;  3CGY A;  5D7C A;  5F3K A;  3Q5L A;  2BT0 A;  1BYQ A;  3VHA A;  3RLQ A;  2YEH A;  1NHH A;  4ASB A;  2IWS A;  3OPD A;  1NHJ A;  1QYE A;  1GKX A;  4KSH A;  2BYH A;  2XX5 A;  1Y8O A;  2QG2 A;  3TTZ A;  3R4P A;  3EKR A;  1ZW9 A;  2YI0 A;  5J71 A;  2AKP A;  4XIQ A;  2XHX A;  1YS3 A;  1B63 A;  1Z59 A;  4WUC A;  2YJX A;  1Y4S A;  2YJW A;  4FCQ A;  3ZXQ A;  4DUH A;  3A0R A;  3K98 A;  4XKA A;  1Z5C A;  3A0W A;  3GIE A;  3PEJ A;  1MU5 A;  4YKZ A;  1BXD A;  1S16 A;  1YC1 A;  4L94 A;  4H7Q A;  1EA6 A;  4I5S A;  4URM A;  5IDM A;  4HXW A;  1THN A;  4LWI A;  2YEE A;  1GJV A;  4EFT A;  3CGZ A;  4E02 A;  1AM1 A;  2QG0 A;  1YC4 A;  4CWO A;  3FT5 A;  2VCI A;  4URL A;  5CTX A;  2YE3 A;  3T10 A;  2XJG A;  4EM7 A;  2H55 A;  4LP0 A;  3GIF A;  4LWH A;  3R4N A;  3JZ3 A;  1UYG A;  3TZ5 A;  4KTN A;  3RLP A;  2YKC A;  4AS9 A;  3KE6 A;  3WHA A;  3OWB A;  4ASA A;  1KIJ A;  2YEJ A;  1S14 A;  4EFU A;  3FT8 A;  1TIL A;  3BMY A;  4YKQ A;  1YT1 A;  4XC0 A;  3GIG B;  1I58 A;  5CTU A;  2XDL A;  4R3M A;  3T0H A;  2BYI A;  1KZN A;  2XCM A;  2YEC A;  2BZ5 A;  3INX A;  4YKR A;  5FNF A;  3GIG A;  1Y4U A;  2YGE A;  4XKO A;  1GKZ A;  2WER A;  4BQJ A;  5FWK A;  4MBC A;  2QFO A;  2XDS A;  4W7T A;  4ASF A;  3Q5J A;  2ESA A;  2WEP A;  2YE9 A;  3ZKD A;  4CWT A;  2BU2 A;  2HG1 A;  2BU6 A;  1YET A;  1I5D A;  1Z5A A;  2BSM A;  4MPE A;  2XHR A;  3PEH A;  3K97 A;  2YE6 A;  3O6O A;  3T0Z A;  3EKO A;  5BOC A;  4YKT A;  3CRK A;  4CWN A;  1AH8 A;  4YKW A;  3U2K A;  1EI1 A;  4NH9 A;  4WUB A;  2EXL A;  4PU9 A;  3SL2 A;  3TZ2 A;  2CG9 A;  4CWQ A;  3D0B A;  4XIT A;  4YKY A;  1TBW A;  2YEG A;  4MP7 A;  5M4H A;  4FMT A;  1NHI A;  3TUH A;  4HY6 A;  3NMQ A;  4JAS A;  1BGQ A;  2YKJ A;  2BRC A;  1UY6 A;  1YER A;  2XK2 A;  4PL9 A;  2HKJ A;  2K5B A;  3QDD A;  2XDX A;  2YEA A;  2GQP A;  1A4H A;  2BRE A;  4CE2 A;  1R62 A;  2FWY A;  4HZ5 A;  4QPK A;  4XE2 A;  4URN A;  4QPJ A;  2XHT A;  3C0E A;  1UYH A;  4GQT A;  5J6A A;  3R4O A;  2ZDY A;  2IWX A;  4CWR A;  3G75 A;  3K60 A;  4YKU A;  3R4M A;  4CE3 A;  4P8O A;  4KP4 A;  4O05 A;  4HYP A;  3LPS A;  4EGI A;  3ZM7 A;  4HZ0 A;  2WI4 A;  5M4K A;  1U2O A;  5FND A;  3LNU A;  4XDM A;  4V26 A;  4KSG A;  2Q2E B;  3U2D A;  4BXI A;  1TID A;  3A0Y A;  2JKI A;  4LPB A;  2IOP A;  2XX4 A;  4EMV A;  4XTJ A;  3TZ4 A;  1YT0 A;  3VHD A;  3INW A;  4BQG A;  5D6P A;  4EEH A;  3HEK A;  1H7U A;  2QF6 A;  3EHH A;  1TC6 A;  4PRV A;  4BAE A;  2CH4 A;  4L90 A;  2ZKJ A;  2YKB A;  4H81 A;  4CWP A;  4Q20 A;  5L3J A;  2O1V A;  3BM9 A;  5CF0 A;  5GGZ A;  2XJJ A;  5D6Q A;  4XD8 A;  4GGL A;  2YKI A;  3D36 A;  1AMW A;  4BIU A;  2BU7 A;  2FXS A;  5BOD A;  4JAV A;  1UYC A;  1TH8 A;  3VHC A;  5M4N A;  2YGA A;  2VCJ A;  4CWS A;  5D7R A;  2HCH A;  4MB9 A;  4XIP A;  2WI2 A;  4NH8 A;  4V25 A;  4O04 A;  4HXZ A;  3ZXO A;  3HHU A;  2YE8 A;  4AWO A;  1Y8P A;  2YE7 A;  2FWZ A;  4URO A;  1ZXN A;  4ZVI A;  3B24 A;  3H4L A;  1ID0 A;  4KQV A;  2XDU A;  4U7O A;  5M4M A;  2Q8I A;  3TZ0 A;  2ZDX A;  1L0O A;  4CE1 A;  2VW5 A;  2WEQ A;  5FNC A;  1B3Q A;  1YES A;  2XDK A;  3MNR P;  4U7N A;  2YGF A;  3OWD A;  4O09 A;  4B6C A;  1QY8 A;  2WI6 A;  4MP2 A;  4GEE A;  4EGK A;  3HZ1 A;  3EHG A;  4GFN A;  4XCL A;  2IOQ A;  1UY9 A;  3HZ5 A;  4L93 A;  4JAU A;  3R91 A;  4YKX A;  2WI3 A;  5CTW A;  1Z5B A;  3H80 A;  1UYK A;  1ZXM A;  3A0T A;  2YEF A;  2ZBK B;  3OW6 A;  5D7D A;  1UY8 A;  1YT2 A;  1UYD A;  4ZKI A;  4WUD A;  1H7S A;  4K4O A;  3HYZ A;  1UY7 A;  4GCZ A;  3A0Z A;  2O1W A;  3D2R A;  3C11 A;  5IN9 A;  1Y8N A;  3CRL A;  3O2F A;  3T2S A;  2YEB A;  2C2A A;  3Q5K A;  3T1K A;  2FYP A;  2PNR A;  3CWV A;  2O1U A;  4PRX A;  2YK9 A;  2H8M A;  4HYM A;  3DGE A;  1YSZ A;  1QZR A;  3RLR A;  1UYE A;  2Q8G A;  2XD6 A;  1I5A A;  2XJX A;  3B28 A;  4HY1 A;  2CCT A;  3O0I A;  4R1F A;  2IOR A;  5CTY A;  2YI5 A;  1UYL A;  4E01 A;  2CCS A;  4L8Z A;  2IWU A;  3FV5 A;  4FCR A;  3WQ9 A;  1PVG A;  4GT8 A;  2YE5 A;  4I3H A;  2BTZ A;  4P7A A;  4XIR A;  5F5R A;  4LWF A;  2YE4 A;  4H85 A;  4EGH A;  2UWD A;  1U0Z A; 
#chains in the Genus database with same CATH topology
 2YE2 A;  2XAB A;  4BIZ A;  2HHI A;  1OSF A;  3K99 A;  1ZWH A;  2GFD A;  2VWC A;  4DZY A;  4E00 A;  3EHF A;  1UYF A;  4MPN A;  2WI7 A;  4U93 A;  3G7E A;  1AH6 A;  4CWF A;  4LWE A;  1YSR A;  4NH7 A;  1JM6 A;  1US7 A;  1TC0 A;  1I59 A;  1UYI A;  2BU8 A;  4FCP A;  3A0X A;  5M4P A;  4R3A A;  2BU5 A;  2YI7 A;  3G7B A;  4ASG A;  2CGF A;  3HYY A;  5CPH A;  4L91 A;  2E0A A;  3B26 A;  1BKN A;  1I5B A;  3VAD A;  1AJ6 A;  3EHJ A;  1B62 A;  3R92 A;  3B25 A;  3IED A;  2Q8H A;  2XX2 A;  4LWG A;  5C93 A;  4AWQ A;  4KFG A;  1YC3 A;  4AWP A;  1I5C A;  1MX0 A;  3ZKB A;  2YI6 A;  5M4E A;  4FPP A;  2Q8F A;  4MOT A;  3OMU A;  3B27 A;  2YK2 A;  4JQL A;  4B7P A;  5IDJ A;  3RKZ A;  4O0B A;  3QTF A;  2YED A;  3U67 A;  4X9L A;  2JJC A;  4O07 A;  4XKK A;  2YKE A;  2WI5 A;  2CCU A;  2WI1 A;  1UYM A;  2YEI A;  4MPC A;  4XCJ A;  3CGY A;  5D7C A;  5F3K A;  3Q5L A;  2BT0 A;  1BYQ A;  3VHA A;  3RLQ A;  2YEH A;  1NHH A;  4ASB A;  2IWS A;  3OPD A;  1NHJ A;  1QYE A;  1GKX A;  4KSH A;  2BYH A;  2XX5 A;  1Y8O A;  2QG2 A;  3TTZ A;  3R4P A;  3EKR A;  1ZW9 A;  2YI0 A;  5J71 A;  2AKP A;  2C1G A;  4XIQ A;  2XHX A;  1YS3 A;  1B63 A;  1Z59 A;  4WUC A;  2YJX A;  1Y4S A;  2YJW A;  4FCQ A;  3ZXQ A;  4DUH A;  3A0R A;  3K98 A;  4XKA A;  1IXM A;  1Z5C A;  3A0W A;  3GIE A;  3PEJ A;  1MU5 A;  4YKZ A;  1BXD A;  1S16 A;  1YC1 A;  4L94 A;  4H7Q A;  1EA6 A;  4I5S A;  4URM A;  5IDM A;  4HXW A;  1THN A;  4LWI A;  2YEE A;  1GJV A;  4EFT A;  3CGZ A;  4E02 A;  1AM1 A;  2QG0 A;  1YC4 A;  4CWO A;  3FT5 A;  2VCI A;  4URL A;  5CTX A;  2YE3 A;  3T10 A;  2XJG A;  4EM7 A;  5JEN A;  2H55 A;  4LP0 A;  3GIF A;  4LWH A;  3R4N A;  3JZ3 A;  1UYG A;  3TZ5 A;  4KTN A;  3RLP A;  2YKC A;  4AS9 A;  3KE6 A;  3WHA A;  3OWB A;  4ASA A;  1KIJ A;  2YEJ A;  1S14 A;  4EFU A;  3FT8 A;  1TIL A;  3BMY A;  4YKQ A;  1YT1 A;  4XC0 A;  3GIG B;  1I58 A;  5CTU A;  2XDL A;  4R3M A;  3T0H A;  2BYI A;  1KZN A;  2XCM A;  2YEC A;  2BZ5 A;  3INX A;  4YKR A;  5FNF A;  3GIG A;  1Y4U A;  2YGE A;  4XKO A;  1GKZ A;  2WER A;  4BQJ A;  5FWK A;  4MBC A;  2QFO A;  2XDS A;  4W7T A;  4ASF A;  3Q5J A;  2ESA A;  2WEP A;  2YE9 A;  3ZKD A;  4CWT A;  2BU2 A;  2HG1 A;  2BU6 A;  1YET A;  1I5D A;  1Z5A A;  2BSM A;  4MPE A;  2XHR A;  3PEH A;  3K97 A;  2YE6 A;  3O6O A;  3T0Z A;  3EKO A;  5BOC A;  4YKT A;  3CRK A;  4CWN A;  1AH8 A;  4YKW A;  3U2K A;  1EI1 A;  4NH9 A;  4WUB A;  2EXL A;  4PU9 A;  3SL2 A;  3TZ2 A;  2CG9 A;  4CWQ A;  3D0B A;  4XIT A;  4YKY A;  1TBW A;  2YEG A;  4MP7 A;  5M4H A;  4FMT A;  1NHI A;  3TUH A;  4HY6 A;  3NMQ A;  4JAS A;  1BGQ A;  2YKJ A;  2BRC A;  1UY6 A;  1YER A;  2XK2 A;  4PL9 A;  2HKJ A;  2K5B A;  3QDD A;  2XDX A;  2YEA A;  2GQP A;  1A4H A;  2BRE A;  4CE2 A;  1R62 A;  2FWY A;  4HZ5 A;  4QPK A;  4XE2 A;  4URN A;  4QPJ A;  2XHT A;  3C0E A;  1UYH A;  4GQT A;  5J6A A;  3R4O A;  2ZDY A;  2IWX A;  4CWR A;  3G75 A;  3K60 A;  4YKU A;  3R4M A;  4CE3 A;  4P8O A;  4KP4 A;  4O05 A;  4HYP A;  3LPS A;  4EGI A;  3ZM7 A;  4HZ0 A;  2WI4 A;  5M4K A;  1U2O A;  5FND A;  3LNU A;  3LMM A;  4XDM A;  4V26 A;  4KSG A;  2Q2E B;  3U2D A;  4BXI A;  2C1I A;  1TID A;  3A0Y A;  2JKI A;  4LPB A;  2IOP A;  2XX4 A;  1F51 A;  4EMV A;  4XTJ A;  3TZ4 A;  1YT0 A;  3VHD A;  4E72 A;  3INW A;  4BQG A;  5D6P A;  4EEH A;  3HEK A;  1H7U A;  2QF6 A;  3EHH A;  1TC6 A;  4PRV A;  4BAE A;  2CH4 A;  4L90 A;  2ZKJ A;  2YKB A;  4H81 A;  4CWP A;  4Q20 A;  5L3J A;  2O1V A;  3BM9 A;  5CF0 A;  5GGZ A;  2XJJ A;  5D6Q A;  4XD8 A;  4GGL A;  2YKI A;  3D36 A;  1AMW A;  4BIU A;  2BU7 A;  2FXS A;  5BOD A;  4JAV A;  1UYC A;  1TH8 A;  3VHC A;  5M4N A;  3CYG A;  2YGA A;  2VCJ A;  4CWS A;  5D7R A;  2HCH A;  4MB9 A;  4XIP A;  2WI2 A;  4NH8 A;  4V25 A;  4O04 A;  4HXZ A;  3ZXO A;  3HHU A;  2YE8 A;  4AWO A;  1Y8P A;  2YE7 A;  2FWZ A;  4URO A;  1ZXN A;  4ZVI A;  3B24 A;  3H4L A;  1ID0 A;  4KQV A;  2XDU A;  4U7O A;  5M4M A;  2Q8I A;  3TZ0 A;  2ZDX A;  1L0O A;  4CE1 A;  2VW5 A;  2WEQ A;  5FNC A;  1B3Q A;  1YES A;  2XDK A;  3MNR P;  4U7N A;  2YGF A;  3OWD A;  4O09 A;  4B6C A;  1QY8 A;  2WI6 A;  4MP2 A;  4GEE A;  4EGK A;  3HZ1 A;  3EHG A;  4GFN A;  4XCL A;  2IOQ A;  1UY9 A;  3HZ5 A;  4L93 A;  4JAU A;  3R91 A;  4YKX A;  2WI3 A;  5CTW A;  3S5T A;  1Z5B A;  3H80 A;  1UYK A;  1ZXM A;  3A0T A;  2YEF A;  2ZBK B;  3OW6 A;  5D7D A;  1UY8 A;  1YT2 A;  1UYD A;  4ZKI A;  4WUD A;  1H7S A;  4K4O A;  3HYZ A;  1UY7 A;  4GCZ A;  2FTK A;  3A0Z A;  2O1W A;  3D2R A;  3C11 A;  5IN9 A;  1Y8N A;  3CRL A;  3O2F A;  3T2S A;  2YEB A;  2C2A A;  3Q5K A;  3T1K A;  2FYP A;  2PNR A;  3CWV A;  2O1U A;  4PRX A;  2YK9 A;  2H8M A;  4HYM A;  3DGE A;  1YSZ A;  1QZR A;  3RLR A;  1UYE A;  2Q8G A;  2XD6 A;  1I5A A;  2XJX A;  3B28 A;  4HY1 A;  2CCT A;  3O0I A;  4R1F A;  2IOR A;  5CTY A;  2YI5 A;  1UYL A;  4E01 A;  2CCS A;  4L8Z A;  2IWU A;  3FV5 A;  4FCR A;  3WQ9 A;  1PVG A;  4GT8 A;  2YE5 A;  4I3H A;  2BTZ A;  4P7A A;  4XIR A;  5F5R A;  4LWF A;  2YE4 A;  4H85 A;  4EGH A;  2UWD A;  1U0Z A; 
#chains in the Genus database with same CATH homology
 2YE2 A;  2XAB A;  4BIZ A;  1OSF A;  3K99 A;  1ZWH A;  2GFD A;  2VWC A;  4DZY A;  4E00 A;  3EHF A;  1UYF A;  4MPN A;  2WI7 A;  4U93 A;  3G7E A;  1AH6 A;  4CWF A;  4LWE A;  1YSR A;  4NH7 A;  1JM6 A;  1US7 A;  1TC0 A;  1I59 A;  1UYI A;  2BU8 A;  4FCP A;  3A0X A;  5M4P A;  4R3A A;  2BU5 A;  2YI7 A;  3G7B A;  4ASG A;  2CGF A;  3HYY A;  5CPH A;  4L91 A;  2E0A A;  3B26 A;  1BKN A;  1I5B A;  3VAD A;  1AJ6 A;  3EHJ A;  1B62 A;  3R92 A;  3B25 A;  3IED A;  2Q8H A;  2XX2 A;  4LWG A;  5C93 A;  4AWQ A;  4KFG A;  1YC3 A;  4AWP A;  1I5C A;  1MX0 A;  3ZKB A;  2YI6 A;  5M4E A;  4FPP A;  2Q8F A;  4MOT A;  3OMU A;  3B27 A;  2YK2 A;  4JQL A;  4B7P A;  5IDJ A;  3RKZ A;  4O0B A;  3QTF A;  2YED A;  3U67 A;  4X9L A;  2JJC A;  4O07 A;  4XKK A;  2YKE A;  2WI5 A;  2CCU A;  2WI1 A;  1UYM A;  2YEI A;  4MPC A;  4XCJ A;  3CGY A;  5D7C A;  5F3K A;  3Q5L A;  2BT0 A;  1BYQ A;  3VHA A;  3RLQ A;  2YEH A;  1NHH A;  4ASB A;  2IWS A;  3OPD A;  1NHJ A;  1QYE A;  1GKX A;  4KSH A;  2BYH A;  2XX5 A;  1Y8O A;  2QG2 A;  3TTZ A;  3R4P A;  3EKR A;  1ZW9 A;  2YI0 A;  5J71 A;  2AKP A;  4XIQ A;  2XHX A;  1YS3 A;  1B63 A;  1Z59 A;  4WUC A;  2YJX A;  1Y4S A;  2YJW A;  4FCQ A;  3ZXQ A;  4DUH A;  3A0R A;  3K98 A;  4XKA A;  1Z5C A;  3A0W A;  3GIE A;  3PEJ A;  1MU5 A;  4YKZ A;  1BXD A;  1S16 A;  1YC1 A;  4L94 A;  4H7Q A;  1EA6 A;  4I5S A;  4URM A;  5IDM A;  4HXW A;  1THN A;  4LWI A;  2YEE A;  1GJV A;  4EFT A;  3CGZ A;  4E02 A;  1AM1 A;  2QG0 A;  1YC4 A;  4CWO A;  3FT5 A;  2VCI A;  4URL A;  5CTX A;  2YE3 A;  3T10 A;  2XJG A;  4EM7 A;  2H55 A;  4LP0 A;  3GIF A;  4LWH A;  3R4N A;  3JZ3 A;  1UYG A;  3TZ5 A;  4KTN A;  3RLP A;  2YKC A;  4AS9 A;  3KE6 A;  3WHA A;  3OWB A;  4ASA A;  1KIJ A;  2YEJ A;  1S14 A;  4EFU A;  3FT8 A;  1TIL A;  3BMY A;  4YKQ A;  1YT1 A;  4XC0 A;  3GIG B;  1I58 A;  5CTU A;  2XDL A;  4R3M A;  3T0H A;  2BYI A;  1KZN A;  2XCM A;  2YEC A;  2BZ5 A;  3INX A;  4YKR A;  5FNF A;  3GIG A;  1Y4U A;  2YGE A;  4XKO A;  1GKZ A;  2WER A;  4BQJ A;  5FWK A;  4MBC A;  2QFO A;  2XDS A;  4W7T A;  4ASF A;  3Q5J A;  2ESA A;  2WEP A;  2YE9 A;  3ZKD A;  4CWT A;  2BU2 A;  2HG1 A;  2BU6 A;  1YET A;  1I5D A;  1Z5A A;  2BSM A;  4MPE A;  2XHR A;  3PEH A;  3K97 A;  2YE6 A;  3O6O A;  3T0Z A;  3EKO A;  5BOC A;  4YKT A;  3CRK A;  4CWN A;  1AH8 A;  4YKW A;  3U2K A;  1EI1 A;  4NH9 A;  4WUB A;  2EXL A;  4PU9 A;  3SL2 A;  3TZ2 A;  2CG9 A;  4CWQ A;  3D0B A;  4XIT A;  4YKY A;  1TBW A;  2YEG A;  4MP7 A;  5M4H A;  4FMT A;  1NHI A;  3TUH A;  4HY6 A;  3NMQ A;  4JAS A;  1BGQ A;  2YKJ A;  2BRC A;  1UY6 A;  1YER A;  2XK2 A;  4PL9 A;  2HKJ A;  2K5B A;  3QDD A;  2XDX A;  2YEA A;  2GQP A;  1A4H A;  2BRE A;  4CE2 A;  1R62 A;  2FWY A;  4HZ5 A;  4QPK A;  4XE2 A;  4URN A;  4QPJ A;  2XHT A;  3C0E A;  1UYH A;  4GQT A;  5J6A A;  3R4O A;  2ZDY A;  2IWX A;  4CWR A;  3G75 A;  3K60 A;  4YKU A;  3R4M A;  4CE3 A;  4P8O A;  4KP4 A;  4O05 A;  4HYP A;  3LPS A;  4EGI A;  3ZM7 A;  4HZ0 A;  2WI4 A;  5M4K A;  1U2O A;  5FND A;  3LNU A;  4XDM A;  4V26 A;  4KSG A;  2Q2E B;  3U2D A;  4BXI A;  1TID A;  3A0Y A;  2JKI A;  4LPB A;  2IOP A;  2XX4 A;  4EMV A;  4XTJ A;  3TZ4 A;  1YT0 A;  3VHD A;  3INW A;  4BQG A;  5D6P A;  4EEH A;  3HEK A;  1H7U A;  2QF6 A;  3EHH A;  1TC6 A;  4PRV A;  4BAE A;  2CH4 A;  4L90 A;  2ZKJ A;  2YKB A;  4H81 A;  4CWP A;  4Q20 A;  5L3J A;  2O1V A;  3BM9 A;  5CF0 A;  5GGZ A;  2XJJ A;  5D6Q A;  4XD8 A;  4GGL A;  2YKI A;  3D36 A;  1AMW A;  4BIU A;  2BU7 A;  2FXS A;  5BOD A;  4JAV A;  1UYC A;  1TH8 A;  3VHC A;  5M4N A;  2YGA A;  2VCJ A;  4CWS A;  5D7R A;  2HCH A;  4MB9 A;  4XIP A;  2WI2 A;  4NH8 A;  4V25 A;  4O04 A;  4HXZ A;  3ZXO A;  3HHU A;  2YE8 A;  4AWO A;  1Y8P A;  2YE7 A;  2FWZ A;  4URO A;  1ZXN A;  4ZVI A;  3B24 A;  3H4L A;  1ID0 A;  4KQV A;  2XDU A;  4U7O A;  5M4M A;  2Q8I A;  3TZ0 A;  2ZDX A;  1L0O A;  4CE1 A;  2VW5 A;  2WEQ A;  5FNC A;  1B3Q A;  1YES A;  2XDK A;  3MNR P;  4U7N A;  2YGF A;  3OWD A;  4O09 A;  4B6C A;  1QY8 A;  2WI6 A;  4MP2 A;  4GEE A;  4EGK A;  3HZ1 A;  3EHG A;  4GFN A;  4XCL A;  2IOQ A;  1UY9 A;  3HZ5 A;  4L93 A;  4JAU A;  3R91 A;  4YKX A;  2WI3 A;  5CTW A;  1Z5B A;  3H80 A;  1UYK A;  1ZXM A;  3A0T A;  2YEF A;  2ZBK B;  3OW6 A;  5D7D A;  1UY8 A;  1YT2 A;  1UYD A;  4ZKI A;  4WUD A;  1H7S A;  4K4O A;  3HYZ A;  1UY7 A;  4GCZ A;  3A0Z A;  2O1W A;  3D2R A;  3C11 A;  5IN9 A;  1Y8N A;  3CRL A;  3O2F A;  3T2S A;  2YEB A;  2C2A A;  3Q5K A;  3T1K A;  2FYP A;  2PNR A;  3CWV A;  2O1U A;  4PRX A;  2YK9 A;  2H8M A;  4HYM A;  3DGE A;  1YSZ A;  1QZR A;  3RLR A;  1UYE A;  2Q8G A;  2XD6 A;  1I5A A;  2XJX A;  3B28 A;  4HY1 A;  2CCT A;  3O0I A;  4R1F A;  2IOR A;  5CTY A;  2YI5 A;  1UYL A;  4E01 A;  2CCS A;  4L8Z A;  2IWU A;  3FV5 A;  4FCR A;  3WQ9 A;  1PVG A;  4GT8 A;  2YE5 A;  4I3H A;  2BTZ A;  4P7A A;  4XIR A;  5F5R A;  4LWF A;  2YE4 A;  4H85 A;  4EGH A;  2UWD A;  1U0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...