1YT1A

Crystal structure of the unliganded form of grp94, the er hsp90: basis for nucleotide-induced conformational change, grp94n(delta)41 apo crystal
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
236
structure length
227
Chain Sequence
GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQEQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title Structure of Unliganded GRP94, the Endoplasmic Reticulum Hsp90: BASIS FOR NUCLEOTIDE-INDUCED CONFORMATIONAL CHANGE
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 71
structure length 227
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1yt1A00
1Z5AA 3QTFA 2O1UA 1KIJA 4DZYA 2YJWA 1JM6A 3T10A 1GKXA 3R91A 4BXIA 2CGFA 3GIFA 3QDDA 2IOPA 4EEHA 4V25A 1Y4SA 3T1KA 1BGQA 2YK2A 1BXDA 3TZ5A 4E00A 3OWDA 3O6OA 3JZ3A 3TZ2A 2XJGA 4EFTA 2IOQA 1EA6A 3R4MA 2YE8A 4MPEA 4FCQA 4NH7A 5CTUA 2WI7A 3A0WA 2VWCA 4FMTA 2Q8FA 2BT0A 3ZXOA 3HYYA 3HZ5A 3T0ZA 3K97A 3OPDA 1TBWA 3TZ0A 1NHJA 2WEQA 4EFUA 4EGIA 2BTZA 4YKTA 4YKUA 1Z5BA 1S16A 4URNA 2VCIA 3KE6A 4AS9A 2FXSA 3B28A 3HHUA 5C93A 3ZM7A 1EI1A 4JASA 3HYZA 1U2OA 2IWSA 1ZXNA 4PU9A 3Q5LA 2CCUA 4XKKA 4R1FA 1Y4UA 2XDXA 2YKBA 4E02A 3Q5KA 1ZW9A 2BREA 1KZNA 2BZ5A 5IDMA 4BQJA 2IWXA 2O1WA 4B6CA 2WI6A 2BU5A 2Q8IA 2UWDA 3R4NA 2XHTA 4CWFA 2XABA 2BU6A 4XD8A 1AH6A 2GFDA 4O09A 2K5BA 4LWFA 2ZDYA 2VCJA 4P7AA 1MX0A 2YGAA 3B27A 4KSGA 4BIUA 5L3JA 4CE2A 1QY8A 5CPHA 3ZKBA 4HYMA 4JAUA 1A4HA 4CWQA 1I59A 4URLA 4MP2A 2YGFA 3VHAA 4ZVIA 3R92A 4X9LA 4ASBA 3GIGB 1B3QA 2CCTA 2JKIA 3HEKA 2WI2A 1YC1A 1QZRA 4MPNA 4XKOA 3C0EA 4EM7A 3G7BA 3HZ1A 4EGKA 3B26A 3G75A 4XIQA 4I3HA 4H81A 2YEJA 1GJVA 1UYEA 1I5BA 4LWHA 1I58A 4KTNA 1YS3A 3INXA 4PRVA 4CWPA 2Q8HA 1I5AA 3PEJA 2YEIA 5FNDA 1YC3A 5GGZA 1B62A 5J6AA 4U7NA 3R4PA 1UYHA 1YC4A 4ASAA 1AM1A 3EHGA 4ASFA 1UYLA 4K4OA 1UY7A 4EGHA 3CRLA 4KSHA 4YKRA 3OW6A 4KFGA 1AH8A 2YI7A 2YE7A 5D7RA 3BMYA 2YKJA 2FWZA 1NHIA 3U2DA 2WERA 4O04A 4GT8A 4LWGA 4CE3A 5BOCA 2YKEA 4JQLA 2QG0A 3A0YA 2EXLA 2YE4A 4U93A 3OMUA 3D0BA 3GIGA 3OWBA 2YGEA 5D6PA 1U0ZA 4R3AA 3ZKDA 2YI5A 4GGLA 1OSFA 4XDMA 4DUHA 4O05A 4CWRA 2HCHA 2ESAA 1TC6A 4L93A 1TH8A 2CCSA 4HZ0A 1NHHA 2XX4A 1BYQA 4XIPA 5M4KA 3FT5A 3Q5JA 5M4MA 4MP7A 2ZBKB 3T2SA 4KQVA 4AWQA 4Q20A 2Q8GA 2XDKA 2E0AA 1MU5A 2YEGA 3CGZA 3RLPA 2WEPA 4CWSA 4XE2A 4YKXA 2XCMA 2XDSA 2XDUA 3D36A 4L90A 3TUHA 5BODA 4PRXA 5M4NA 1YSRA 4CE1A 3CWVA 3VHDA 4XITA 3SL2A 1UY6A 5FNCA 4L8ZA 4URMA 3O2FA 3RLRA 1L0OA 1B63A 2YEHA 3WQ9A 1Y8PA 2XX5A 3MNRP 4AWOA 3FT8A 2XD6A 2YE6A 1YT2A 2FYPA 1TC0A 2QFOA 2ZDXA 5IN9A 4ASGA 2QG2A 2YEBA 5CTWA 1UYMA 2YECA 2Q2EB 4CWOA 2YEEA 4I5SA 3TZ4A 3GIEA 3LPSA 4LPBA 4AWPA 2YE3A 5F5RA 4FCRA 3LNUA 1Y8NA 4NH8A 4V26A 4CWTA 2XX2A 1YERA 3PEHA 1UYIA 5IDJA 4XKAA 4EMVA 4JAVA 1ZXMA 5CTYA 2BU8A 3H80A 4GQTA 2FWYA 5J71A 4YKYA 3EHJA 1Z5CA 4O07A 2H8MA 2CH4A 3A0RA 4BAEA 2ZKJA 1UYGA 1YT1A 4WUDA 4FCPA 3VADA 3EKRA 5F3KA 4R3MA 4HY1A 3TTZA 2YE9A 3EHFA 4WUBA 2WI5A 3H4LA 4HYPA 2YI0A 4MBCA 3K98A 3R4OA 4BIZA 1GKZA 1QYEA 3NMQA 1TILA 1BKNA 4LWEA 3CGYA 1UYKA 2BYHA 2PNRA 4O0BA 4GCZA 4B7PA 1UY8A 5D7CA 2BYIA 4FPPA 1AMWA 5FNFA 4CWNA 1UYDA 4ZKIA 2O1VA 2YEAA 2YEFA 3BM9A 3O0IA 5D7DA 3C11A 2BRCA 2GQPA 4P8OA 2AKPA 4XC0A 4MPCA 1YETA 5M4HA 4GFNA 3K99A 4XCJA 2IWUA 3DGEA 4L94A 1ZWHA 5D6QA 1Z59A 2YK9A 3U2KA 2YKCA 4LWIA 4LP0A 3D2RA 1YSZA 2IORA 1PVGA 3VHCA 3U67A 3K60A 1I5CA 4H7QA 2HG1A 1R62A 4HXZA 3CRKA 5FWKA 3T0HA 4W7TA 2VW5A 3EKOA 2BSMA 4HY6A 3RKZA 2BU2A 2XK2A 3B24A 4MB9A 2JJCA 4UROA 1H7UA 2C2AA 4HZ5A 2XHRA 1UYCA 4HXWA 4MOTA 3IEDA 1Y8OA 3A0ZA 1S14A 4YKWA 2XJXA 3B25A 4H85A 4YKQA 1TIDA 2WI4A 2YJXA 5CF0A 4U7OA 2WI3A 2YEDA 5CTXA 2YE2A 4E01A 3G7EA 1ID0A 3EHHA 2XHXA 4QPJA 4XTJA 1UYFA 2XJJA 2YE5A 4XIRA 1I5DA 3INWA 2WI1A 4L91A 4XCLA 3WHAA 5M4PA 5M4EA 1US7A 2YI6A 4KP4A 3FV5A 1AJ6A 3RLQA 1H7SA 4BQGA 2CG9A 2QF6A 1THNA 4PL9A 1YESA 1UY9A 4GEEA 1YT0A 2HKJA 2XDLA 2BU7A 4NH9A 2YKIA 3ZXQA 3A0XA 4WUCA 2H55A 3A0TA 4YKZA 4QPKA
chains in the Genus database with same CATH superfamily
1Z5AA 3QTFA 2O1UA 1KIJA 4DZYA 2YJWA 1JM6A 3T10A 1GKXA 3R91A 4BXIA 3LMMA 2CGFA 3GIFA 3QDDA 2IOPA 4EEHA 4V25A 1Y4SA 3T1KA 1BGQA 2YK2A 1BXDA 3TZ5A 4E00A 3OWDA 3O6OA 3JZ3A 3TZ2A 2XJGA 4EFTA 2IOQA 1EA6A 3R4MA 2YE8A 4MPEA 4FCQA 4NH7A 5CTUA 2WI7A 3A0WA 2VWCA 4FMTA 2Q8FA 2BT0A 3ZXOA 3HYYA 3HZ5A 3T0ZA 3K97A 3OPDA 1TBWA 3TZ0A 1NHJA 2WEQA 4EFUA 4EGIA 2BTZA 4YKTA 4YKUA 1Z5BA 1S16A 4URNA 2VCIA 3KE6A 4AS9A 2FXSA 3B28A 3HHUA 5C93A 3ZM7A 1EI1A 4JASA 3HYZA 1U2OA 2IWSA 1ZXNA 4PU9A 3Q5LA 2CCUA 4XKKA 4R1FA 1Y4UA 2XDXA 2YKBA 4E02A 3Q5KA 1ZW9A 2BREA 1KZNA 2BZ5A 5IDMA 4BQJA 2IWXA 2O1WA 4B6CA 2WI6A 2BU5A 2Q8IA 2UWDA 3R4NA 2XHTA 4CWFA 2XABA 2BU6A 4XD8A 1AH6A 2GFDA 4O09A 2K5BA 4LWFA 2ZDYA 2VCJA 4P7AA 1MX0A 2YGAA 3B27A 4KSGA 4BIUA 5L3JA 4CE2A 1QY8A 5CPHA 3ZKBA 4HYMA 4JAUA 1A4HA 4CWQA 1I59A 4URLA 4MP2A 2YGFA 3VHAA 4ZVIA 3R92A 4X9LA 4ASBA 3GIGB 1B3QA 2CCTA 2JKIA 3HEKA 2WI2A 1YC1A 1QZRA 4MPNA 4XKOA 3C0EA 3CYGA 4EM7A 3G7BA 3HZ1A 4EGKA 3B26A 3G75A 4XIQA 4I3HA 4H81A 2YEJA 1GJVA 1UYEA 1I5BA 4LWHA 1I58A 4KTNA 1YS3A 3INXA 4PRVA 4CWPA 2Q8HA 1I5AA 3PEJA 2YEIA 5FNDA 1YC3A 5GGZA 1B62A 5J6AA 4U7NA 3R4PA 1UYHA 1YC4A 4ASAA 1AM1A 3EHGA 4ASFA 1UYLA 4K4OA 1UY7A 4EGHA 3CRLA 3S5TA 4KSHA 4YKRA 3OW6A 4KFGA 1AH8A 2YI7A 2YE7A 5D7RA 3BMYA 2YKJA 2FWZA 1NHIA 3U2DA 2WERA 4O04A 4GT8A 4LWGA 4CE3A 5BOCA 2YKEA 4JQLA 2QG0A 3A0YA 2EXLA 2YE4A 4U93A 3OMUA 3D0BA 3GIGA 3OWBA 2YGEA 5D6PA 1U0ZA 4R3AA 2C1GA 3ZKDA 2YI5A 4GGLA 1OSFA 4XDMA 4DUHA 4O05A 4CWRA 2HCHA 2ESAA 1TC6A 4L93A 1F51A 1TH8A 2CCSA 4HZ0A 1NHHA 2XX4A 1BYQA 4XIPA 5M4KA 3FT5A 3Q5JA 5M4MA 4MP7A 2ZBKB 3T2SA 4KQVA 4AWQA 4Q20A 2Q8GA 2XDKA 2E0AA 1MU5A 2YEGA 3CGZA 3RLPA 2WEPA 4CWSA 4XE2A 4YKXA 2XCMA 2XDSA 2XDUA 3D36A 4L90A 3TUHA 5BODA 4PRXA 5M4NA 1YSRA 4CE1A 3CWVA 3VHDA 4XITA 3SL2A 1UY6A 5FNCA 4L8ZA 4URMA 3O2FA 3RLRA 1L0OA 1B63A 2YEHA 3WQ9A 1Y8PA 2XX5A 3MNRP 4AWOA 3FT8A 2XD6A 2YE6A 1YT2A 2FYPA 1TC0A 2QFOA 2ZDXA 5IN9A 4ASGA 2QG2A 2YEBA 5CTWA 1UYMA 2YECA 2Q2EB 4CWOA 2YEEA 4I5SA 3TZ4A 3GIEA 3LPSA 4LPBA 4AWPA 2YE3A 5F5RA 4FCRA 3LNUA 1Y8NA 4NH8A 4V26A 4CWTA 2XX2A 1YERA 3PEHA 1UYIA 5IDJA 4XKAA 4EMVA 4JAVA 1ZXMA 5CTYA 2BU8A 3H80A 4GQTA 2FWYA 5J71A 2C1IA 4YKYA 3EHJA 1Z5CA 4O07A 2H8MA 2CH4A 3A0RA 4BAEA 2ZKJA 1UYGA 1YT1A 4WUDA 4FCPA 3VADA 3EKRA 5F3KA 4R3MA 4HY1A 3TTZA 2YE9A 3EHFA 4WUBA 2WI5A 3H4LA 4HYPA 2YI0A 4MBCA 3K98A 3R4OA 4BIZA 1GKZA 1QYEA 3NMQA 1TILA 1BKNA 4LWEA 3CGYA 1UYKA 2BYHA 2PNRA 4O0BA 4GCZA 4B7PA 2HHIA 1UY8A 5D7CA 2BYIA 4FPPA 1AMWA 5FNFA 4CWNA 1UYDA 4ZKIA 2O1VA 2YEAA 2YEFA 3BM9A 3O0IA 5D7DA 3C11A 2BRCA 2GQPA 4P8OA 2AKPA 4XC0A 4MPCA 1YETA 5M4HA 4GFNA 3K99A 4XCJA 2IWUA 3DGEA 4L94A 1ZWHA 5D6QA 1Z59A 2YK9A 3U2KA 2YKCA 4LWIA 4LP0A 3D2RA 1YSZA 2IORA 1PVGA 3VHCA 3U67A 3K60A 1I5CA 2FTKA 4H7QA 2HG1A 1R62A 4HXZA 3CRKA 5FWKA 5JENA 3T0HA 4W7TA 2VW5A 3EKOA 2BSMA 4HY6A 3RKZA 2BU2A 2XK2A 3B24A 4MB9A 2JJCA 4UROA 1H7UA 2C2AA 4HZ5A 2XHRA 1UYCA 4HXWA 4MOTA 3IEDA 1IXMA 1Y8OA 3A0ZA 1S14A 4YKWA 2XJXA 3B25A 4E72A 4H85A 4YKQA 1TIDA 2WI4A 2YJXA 5CF0A 4U7OA 2WI3A 2YEDA 5CTXA 2YE2A 4E01A 3G7EA 1ID0A 3EHHA 2XHXA 4QPJA 4XTJA 1UYFA 2XJJA 2YE5A 4XIRA 1I5DA 3INWA 2WI1A 4L91A 4XCLA 3WHAA 5M4PA 5M4EA 1US7A 2YI6A 4KP4A 3FV5A 1AJ6A 3RLQA 1H7SA 4BQGA 2CG9A 2QF6A 1THNA 4PL9A 1YESA 1UY9A 4GEEA 1YT0A 2HKJA 2XDLA 2BU7A 4NH9A 2YKIA 3ZXQA 3A0XA 4WUCA 2H55A 3A0TA 4YKZA 4QPKA
chains in the Genus database with same CATH topology
1Z5AA 3QTFA 2O1UA 1KIJA 4DZYA 2YJWA 1JM6A 3T10A 1GKXA 3R91A 4BXIA 2CGFA 3GIFA 3QDDA 2IOPA 4EEHA 4V25A 1Y4SA 3T1KA 1BGQA 2YK2A 1BXDA 3TZ5A 4E00A 3OWDA 3O6OA 3JZ3A 3TZ2A 2XJGA 4EFTA 2IOQA 1EA6A 3R4MA 2YE8A 4MPEA 4FCQA 4NH7A 5CTUA 2WI7A 3A0WA 2VWCA 4FMTA 2Q8FA 2BT0A 3ZXOA 3HYYA 3HZ5A 3T0ZA 3K97A 3OPDA 1TBWA 3TZ0A 1NHJA 2WEQA 4EFUA 4EGIA 2BTZA 4YKTA 4YKUA 1Z5BA 1S16A 4URNA 2VCIA 3KE6A 4AS9A 2FXSA 3B28A 3HHUA 5C93A 3ZM7A 1EI1A 4JASA 3HYZA 1U2OA 2IWSA 1ZXNA 4PU9A 3Q5LA 2CCUA 4XKKA 4R1FA 1Y4UA 2XDXA 2YKBA 4E02A 3Q5KA 1ZW9A 2BREA 1KZNA 2BZ5A 5IDMA 4BQJA 2IWXA 2O1WA 4B6CA 2WI6A 2BU5A 2Q8IA 2UWDA 3R4NA 2XHTA 4CWFA 2XABA 2BU6A 4XD8A 1AH6A 2GFDA 4O09A 2K5BA 4LWFA 2ZDYA 2VCJA 4P7AA 1MX0A 2YGAA 3B27A 4KSGA 4BIUA 5L3JA 4CE2A 1QY8A 5CPHA 3ZKBA 4HYMA 4JAUA 1A4HA 4CWQA 1I59A 4URLA 4MP2A 2YGFA 3VHAA 4ZVIA 3R92A 4X9LA 4ASBA 3GIGB 1B3QA 2CCTA 2JKIA 3HEKA 2WI2A 1YC1A 1QZRA 4MPNA 4XKOA 3C0EA 4EM7A 3G7BA 3HZ1A 4EGKA 3B26A 3G75A 4XIQA 4I3HA 4H81A 2YEJA 1GJVA 1UYEA 1I5BA 4LWHA 1I58A 4KTNA 1YS3A 3INXA 4PRVA 4CWPA 2Q8HA 1I5AA 3PEJA 2YEIA 5FNDA 1YC3A 5GGZA 1B62A 5J6AA 4U7NA 3R4PA 1UYHA 1YC4A 4ASAA 1AM1A 3EHGA 4ASFA 1UYLA 4K4OA 1UY7A 4EGHA 3CRLA 4KSHA 4YKRA 3OW6A 4KFGA 1AH8A 2YI7A 2YE7A 5D7RA 3BMYA 2YKJA 2FWZA 1NHIA 3U2DA 2WERA 4O04A 4GT8A 4LWGA 4CE3A 5BOCA 2YKEA 4JQLA 2QG0A 3A0YA 2EXLA 2YE4A 4U93A 3OMUA 3D0BA 3GIGA 3OWBA 2YGEA 5D6PA 1U0ZA 4R3AA 3ZKDA 2YI5A 4GGLA 1OSFA 4XDMA 4DUHA 4O05A 4CWRA 2HCHA 2ESAA 1TC6A 4L93A 1TH8A 2CCSA 4HZ0A 1NHHA 2XX4A 1BYQA 4XIPA 5M4KA 3FT5A 3Q5JA 5M4MA 4MP7A 2ZBKB 3T2SA 4KQVA 4AWQA 4Q20A 2Q8GA 2XDKA 2E0AA 1MU5A 2YEGA 3CGZA 3RLPA 2WEPA 4CWSA 4XE2A 4YKXA 2XCMA 2XDSA 2XDUA 3D36A 4L90A 3TUHA 5BODA 4PRXA 5M4NA 1YSRA 4CE1A 3CWVA 3VHDA 4XITA 3SL2A 1UY6A 5FNCA 4L8ZA 4URMA 3O2FA 3RLRA 1L0OA 1B63A 2YEHA 3WQ9A 1Y8PA 2XX5A 3MNRP 4AWOA 3FT8A 2XD6A 2YE6A 1YT2A 2FYPA 1TC0A 2QFOA 2ZDXA 5IN9A 4ASGA 2QG2A 2YEBA 5CTWA 1UYMA 2YECA 2Q2EB 4CWOA 2YEEA 4I5SA 3TZ4A 3GIEA 3LPSA 4LPBA 4AWPA 2YE3A 5F5RA 4FCRA 3LNUA 1Y8NA 4NH8A 4V26A 4CWTA 2XX2A 1YERA 3PEHA 1UYIA 5IDJA 4XKAA 4EMVA 4JAVA 1ZXMA 5CTYA 2BU8A 3H80A 4GQTA 2FWYA 5J71A 4YKYA 3EHJA 1Z5CA 4O07A 2H8MA 2CH4A 3A0RA 4BAEA 2ZKJA 1UYGA 1YT1A 4WUDA 4FCPA 3VADA 3EKRA 5F3KA 4R3MA 4HY1A 3TTZA 2YE9A 3EHFA 4WUBA 2WI5A 3H4LA 4HYPA 2YI0A 4MBCA 3K98A 3R4OA 4BIZA 1GKZA 1QYEA 3NMQA 1TILA 1BKNA 4LWEA 3CGYA 1UYKA 2BYHA 2PNRA 4O0BA 4GCZA 4B7PA 1UY8A 5D7CA 2BYIA 4FPPA 1AMWA 5FNFA 4CWNA 1UYDA 4ZKIA 2O1VA 2YEAA 2YEFA 3BM9A 3O0IA 5D7DA 3C11A 2BRCA 2GQPA 4P8OA 2AKPA 4XC0A 4MPCA 1YETA 5M4HA 4GFNA 3K99A 4XCJA 2IWUA 3DGEA 4L94A 1ZWHA 5D6QA 1Z59A 2YK9A 3U2KA 2YKCA 4LWIA 4LP0A 3D2RA 1YSZA 2IORA 1PVGA 3VHCA 3U67A 3K60A 1I5CA 4H7QA 2HG1A 1R62A 4HXZA 3CRKA 5FWKA 3T0HA 4W7TA 2VW5A 3EKOA 2BSMA 4HY6A 3RKZA 2BU2A 2XK2A 3B24A 4MB9A 2JJCA 4UROA 1H7UA 2C2AA 4HZ5A 2XHRA 1UYCA 4HXWA 4MOTA 3IEDA 1Y8OA 3A0ZA 1S14A 4YKWA 2XJXA 3B25A 4H85A 4YKQA 1TIDA 2WI4A 2YJXA 5CF0A 4U7OA 2WI3A 2YEDA 5CTXA 2YE2A 4E01A 3G7EA 1ID0A 3EHHA 2XHXA 4QPJA 4XTJA 1UYFA 2XJJA 2YE5A 4XIRA 1I5DA 3INWA 2WI1A 4L91A 4XCLA 3WHAA 5M4PA 5M4EA 1US7A 2YI6A 4KP4A 3FV5A 1AJ6A 3RLQA 1H7SA 4BQGA 2CG9A 2QF6A 1THNA 4PL9A 1YESA 1UY9A 4GEEA 1YT0A 2HKJA 2XDLA 2BU7A 4NH9A 2YKIA 3ZXQA 3A0XA 4WUCA 2H55A 3A0TA 4YKZA 4QPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5A A;  3QTF A;  2O1U A;  1KIJ A;  4DZY A;  2YJW A;  1JM6 A;  3T10 A;  1GKX A;  3R91 A;  4BXI A;  2CGF A;  3GIF A;  3QDD A;  2IOP A;  4EEH A;  4V25 A;  1Y4S A;  3T1K A;  1BGQ A;  2YK2 A;  1BXD A;  3TZ5 A;  4E00 A;  3OWD A;  3O6O A;  3JZ3 A;  3TZ2 A;  2XJG A;  4EFT A;  2IOQ A;  1EA6 A;  3R4M A;  2YE8 A;  4MPE A;  4FCQ A;  4NH7 A;  5CTU A;  2WI7 A;  3A0W A;  2VWC A;  4FMT A;  2Q8F A;  2BT0 A;  3ZXO A;  3HYY A;  3HZ5 A;  3T0Z A;  3K97 A;  3OPD A;  1TBW A;  3TZ0 A;  1NHJ A;  2WEQ A;  4EFU A;  4EGI A;  2BTZ A;  4YKT A;  4YKU A;  1Z5B A;  1S16 A;  4URN A;  2VCI A;  3KE6 A;  4AS9 A;  2FXS A;  3B28 A;  3HHU A;  5C93 A;  3ZM7 A;  1EI1 A;  4JAS A;  3HYZ A;  1U2O A;  2IWS A;  1ZXN A;  4PU9 A;  3Q5L A;  2CCU A;  4XKK A;  4R1F A;  1Y4U A;  2XDX A;  2YKB A;  4E02 A;  3Q5K A;  1ZW9 A;  2BRE A;  1KZN A;  2BZ5 A;  5IDM A;  4BQJ A;  2IWX A;  2O1W A;  4B6C A;  2WI6 A;  2BU5 A;  2Q8I A;  2UWD A;  3R4N A;  2XHT A;  4CWF A;  2XAB A;  2BU6 A;  4XD8 A;  1AH6 A;  2GFD A;  4O09 A;  2K5B A;  4LWF A;  2ZDY A;  2VCJ A;  4P7A A;  1MX0 A;  2YGA A;  3B27 A;  4KSG A;  4BIU A;  5L3J A;  4CE2 A;  1QY8 A;  5CPH A;  3ZKB A;  4HYM A;  4JAU A;  1A4H A;  4CWQ A;  1I59 A;  4URL A;  4MP2 A;  2YGF A;  3VHA A;  4ZVI A;  3R92 A;  4X9L A;  4ASB A;  3GIG B;  1B3Q A;  2CCT A;  2JKI A;  3HEK A;  2WI2 A;  1YC1 A;  1QZR A;  4MPN A;  4XKO A;  3C0E A;  4EM7 A;  3G7B A;  3HZ1 A;  4EGK A;  3B26 A;  3G75 A;  4XIQ A;  4I3H A;  4H81 A;  2YEJ A;  1GJV A;  1UYE A;  1I5B A;  4LWH A;  1I58 A;  4KTN A;  1YS3 A;  3INX A;  4PRV A;  4CWP A;  2Q8H A;  1I5A A;  3PEJ A;  2YEI A;  5FND A;  1YC3 A;  5GGZ A;  1B62 A;  5J6A A;  4U7N A;  3R4P A;  1UYH A;  1YC4 A;  4ASA A;  1AM1 A;  3EHG A;  4ASF A;  1UYL A;  4K4O A;  1UY7 A;  4EGH A;  3CRL A;  4KSH A;  4YKR A;  3OW6 A;  4KFG A;  1AH8 A;  2YI7 A;  2YE7 A;  5D7R A;  3BMY A;  2YKJ A;  2FWZ A;  1NHI A;  3U2D A;  2WER A;  4O04 A;  4GT8 A;  4LWG A;  4CE3 A;  5BOC A;  2YKE A;  4JQL A;  2QG0 A;  3A0Y A;  2EXL A;  2YE4 A;  4U93 A;  3OMU A;  3D0B A;  3GIG A;  3OWB A;  2YGE A;  5D6P A;  1U0Z A;  4R3A A;  3ZKD A;  2YI5 A;  4GGL A;  1OSF A;  4XDM A;  4DUH A;  4O05 A;  4CWR A;  2HCH A;  2ESA A;  1TC6 A;  4L93 A;  1TH8 A;  2CCS A;  4HZ0 A;  1NHH A;  2XX4 A;  1BYQ A;  4XIP A;  5M4K A;  3FT5 A;  3Q5J A;  5M4M A;  4MP7 A;  2ZBK B;  3T2S A;  4KQV A;  4AWQ A;  4Q20 A;  2Q8G A;  2XDK A;  2E0A A;  1MU5 A;  2YEG A;  3CGZ A;  3RLP A;  2WEP A;  4CWS A;  4XE2 A;  4YKX A;  2XCM A;  2XDS A;  2XDU A;  3D36 A;  4L90 A;  3TUH A;  5BOD A;  4PRX A;  5M4N A;  1YSR A;  4CE1 A;  3CWV A;  3VHD A;  4XIT A;  3SL2 A;  1UY6 A;  5FNC A;  4L8Z A;  4URM A;  3O2F A;  3RLR A;  1L0O A;  1B63 A;  2YEH A;  3WQ9 A;  1Y8P A;  2XX5 A;  3MNR P;  4AWO A;  3FT8 A;  2XD6 A;  2YE6 A;  1YT2 A;  2FYP A;  1TC0 A;  2QFO A;  2ZDX A;  5IN9 A;  4ASG A;  2QG2 A;  2YEB A;  5CTW A;  1UYM A;  2YEC A;  2Q2E B;  4CWO A;  2YEE A;  4I5S A;  3TZ4 A;  3GIE A;  3LPS A;  4LPB A;  4AWP A;  2YE3 A;  5F5R A;  4FCR A;  3LNU A;  1Y8N A;  4NH8 A;  4V26 A;  4CWT A;  2XX2 A;  1YER A;  3PEH A;  1UYI A;  5IDJ A;  4XKA A;  4EMV A;  4JAV A;  1ZXM A;  5CTY A;  2BU8 A;  3H80 A;  4GQT A;  2FWY A;  5J71 A;  4YKY A;  3EHJ A;  1Z5C A;  4O07 A;  2H8M A;  2CH4 A;  3A0R A;  4BAE A;  2ZKJ A;  1UYG A;  1YT1 A;  4WUD A;  4FCP A;  3VAD A;  3EKR A;  5F3K A;  4R3M A;  4HY1 A;  3TTZ A;  2YE9 A;  3EHF A;  4WUB A;  2WI5 A;  3H4L A;  4HYP A;  2YI0 A;  4MBC A;  3K98 A;  3R4O A;  4BIZ A;  1GKZ A;  1QYE A;  3NMQ A;  1TIL A;  1BKN A;  4LWE A;  3CGY A;  1UYK A;  2BYH A;  2PNR A;  4O0B A;  4GCZ A;  4B7P A;  1UY8 A;  5D7C A;  2BYI A;  4FPP A;  1AMW A;  5FNF A;  4CWN A;  1UYD A;  4ZKI A;  2O1V A;  2YEA A;  2YEF A;  3BM9 A;  3O0I A;  5D7D A;  3C11 A;  2BRC A;  2GQP A;  4P8O A;  2AKP A;  4XC0 A;  4MPC A;  1YET A;  5M4H A;  4GFN A;  3K99 A;  4XCJ A;  2IWU A;  3DGE A;  4L94 A;  1ZWH A;  5D6Q A;  1Z59 A;  2YK9 A;  3U2K A;  2YKC A;  4LWI A;  4LP0 A;  3D2R A;  1YSZ A;  2IOR A;  1PVG A;  3VHC A;  3U67 A;  3K60 A;  1I5C A;  4H7Q A;  2HG1 A;  1R62 A;  4HXZ A;  3CRK A;  5FWK A;  3T0H A;  4W7T A;  2VW5 A;  3EKO A;  2BSM A;  4HY6 A;  3RKZ A;  2BU2 A;  2XK2 A;  3B24 A;  4MB9 A;  2JJC A;  4URO A;  1H7U A;  2C2A A;  4HZ5 A;  2XHR A;  1UYC A;  4HXW A;  4MOT A;  3IED A;  1Y8O A;  3A0Z A;  1S14 A;  4YKW A;  2XJX A;  3B25 A;  4H85 A;  4YKQ A;  1TID A;  2WI4 A;  2YJX A;  5CF0 A;  4U7O A;  2WI3 A;  2YED A;  5CTX A;  2YE2 A;  4E01 A;  3G7E A;  1ID0 A;  3EHH A;  2XHX A;  4QPJ A;  4XTJ A;  1UYF A;  2XJJ A;  2YE5 A;  4XIR A;  1I5D A;  3INW A;  2WI1 A;  4L91 A;  4XCL A;  3WHA A;  5M4P A;  5M4E A;  1US7 A;  2YI6 A;  4KP4 A;  3FV5 A;  1AJ6 A;  3RLQ A;  1H7S A;  4BQG A;  2CG9 A;  2QF6 A;  1THN A;  4PL9 A;  1YES A;  1UY9 A;  4GEE A;  1YT0 A;  2HKJ A;  2XDL A;  2BU7 A;  4NH9 A;  2YKI A;  3ZXQ A;  3A0X A;  4WUC A;  2H55 A;  3A0T A;  4YKZ A;  4QPK A; 
#chains in the Genus database with same CATH topology
 1Z5A A;  3QTF A;  2O1U A;  1KIJ A;  4DZY A;  2YJW A;  1JM6 A;  3T10 A;  1GKX A;  3R91 A;  4BXI A;  3LMM A;  2CGF A;  3GIF A;  3QDD A;  2IOP A;  4EEH A;  4V25 A;  1Y4S A;  3T1K A;  1BGQ A;  2YK2 A;  1BXD A;  3TZ5 A;  4E00 A;  3OWD A;  3O6O A;  3JZ3 A;  3TZ2 A;  2XJG A;  4EFT A;  2IOQ A;  1EA6 A;  3R4M A;  2YE8 A;  4MPE A;  4FCQ A;  4NH7 A;  5CTU A;  2WI7 A;  3A0W A;  2VWC A;  4FMT A;  2Q8F A;  2BT0 A;  3ZXO A;  3HYY A;  3HZ5 A;  3T0Z A;  3K97 A;  3OPD A;  1TBW A;  3TZ0 A;  1NHJ A;  2WEQ A;  4EFU A;  4EGI A;  2BTZ A;  4YKT A;  4YKU A;  1Z5B A;  1S16 A;  4URN A;  2VCI A;  3KE6 A;  4AS9 A;  2FXS A;  3B28 A;  3HHU A;  5C93 A;  3ZM7 A;  1EI1 A;  4JAS A;  3HYZ A;  1U2O A;  2IWS A;  1ZXN A;  4PU9 A;  3Q5L A;  2CCU A;  4XKK A;  4R1F A;  1Y4U A;  2XDX A;  2YKB A;  4E02 A;  3Q5K A;  1ZW9 A;  2BRE A;  1KZN A;  2BZ5 A;  5IDM A;  4BQJ A;  2IWX A;  2O1W A;  4B6C A;  2WI6 A;  2BU5 A;  2Q8I A;  2UWD A;  3R4N A;  2XHT A;  4CWF A;  2XAB A;  2BU6 A;  4XD8 A;  1AH6 A;  2GFD A;  4O09 A;  2K5B A;  4LWF A;  2ZDY A;  2VCJ A;  4P7A A;  1MX0 A;  2YGA A;  3B27 A;  4KSG A;  4BIU A;  5L3J A;  4CE2 A;  1QY8 A;  5CPH A;  3ZKB A;  4HYM A;  4JAU A;  1A4H A;  4CWQ A;  1I59 A;  4URL A;  4MP2 A;  2YGF A;  3VHA A;  4ZVI A;  3R92 A;  4X9L A;  4ASB A;  3GIG B;  1B3Q A;  2CCT A;  2JKI A;  3HEK A;  2WI2 A;  1YC1 A;  1QZR A;  4MPN A;  4XKO A;  3C0E A;  3CYG A;  4EM7 A;  3G7B A;  3HZ1 A;  4EGK A;  3B26 A;  3G75 A;  4XIQ A;  4I3H A;  4H81 A;  2YEJ A;  1GJV A;  1UYE A;  1I5B A;  4LWH A;  1I58 A;  4KTN A;  1YS3 A;  3INX A;  4PRV A;  4CWP A;  2Q8H A;  1I5A A;  3PEJ A;  2YEI A;  5FND A;  1YC3 A;  5GGZ A;  1B62 A;  5J6A A;  4U7N A;  3R4P A;  1UYH A;  1YC4 A;  4ASA A;  1AM1 A;  3EHG A;  4ASF A;  1UYL A;  4K4O A;  1UY7 A;  4EGH A;  3CRL A;  3S5T A;  4KSH A;  4YKR A;  3OW6 A;  4KFG A;  1AH8 A;  2YI7 A;  2YE7 A;  5D7R A;  3BMY A;  2YKJ A;  2FWZ A;  1NHI A;  3U2D A;  2WER A;  4O04 A;  4GT8 A;  4LWG A;  4CE3 A;  5BOC A;  2YKE A;  4JQL A;  2QG0 A;  3A0Y A;  2EXL A;  2YE4 A;  4U93 A;  3OMU A;  3D0B A;  3GIG A;  3OWB A;  2YGE A;  5D6P A;  1U0Z A;  4R3A A;  2C1G A;  3ZKD A;  2YI5 A;  4GGL A;  1OSF A;  4XDM A;  4DUH A;  4O05 A;  4CWR A;  2HCH A;  2ESA A;  1TC6 A;  4L93 A;  1F51 A;  1TH8 A;  2CCS A;  4HZ0 A;  1NHH A;  2XX4 A;  1BYQ A;  4XIP A;  5M4K A;  3FT5 A;  3Q5J A;  5M4M A;  4MP7 A;  2ZBK B;  3T2S A;  4KQV A;  4AWQ A;  4Q20 A;  2Q8G A;  2XDK A;  2E0A A;  1MU5 A;  2YEG A;  3CGZ A;  3RLP A;  2WEP A;  4CWS A;  4XE2 A;  4YKX A;  2XCM A;  2XDS A;  2XDU A;  3D36 A;  4L90 A;  3TUH A;  5BOD A;  4PRX A;  5M4N A;  1YSR A;  4CE1 A;  3CWV A;  3VHD A;  4XIT A;  3SL2 A;  1UY6 A;  5FNC A;  4L8Z A;  4URM A;  3O2F A;  3RLR A;  1L0O A;  1B63 A;  2YEH A;  3WQ9 A;  1Y8P A;  2XX5 A;  3MNR P;  4AWO A;  3FT8 A;  2XD6 A;  2YE6 A;  1YT2 A;  2FYP A;  1TC0 A;  2QFO A;  2ZDX A;  5IN9 A;  4ASG A;  2QG2 A;  2YEB A;  5CTW A;  1UYM A;  2YEC A;  2Q2E B;  4CWO A;  2YEE A;  4I5S A;  3TZ4 A;  3GIE A;  3LPS A;  4LPB A;  4AWP A;  2YE3 A;  5F5R A;  4FCR A;  3LNU A;  1Y8N A;  4NH8 A;  4V26 A;  4CWT A;  2XX2 A;  1YER A;  3PEH A;  1UYI A;  5IDJ A;  4XKA A;  4EMV A;  4JAV A;  1ZXM A;  5CTY A;  2BU8 A;  3H80 A;  4GQT A;  2FWY A;  5J71 A;  2C1I A;  4YKY A;  3EHJ A;  1Z5C A;  4O07 A;  2H8M A;  2CH4 A;  3A0R A;  4BAE A;  2ZKJ A;  1UYG A;  1YT1 A;  4WUD A;  4FCP A;  3VAD A;  3EKR A;  5F3K A;  4R3M A;  4HY1 A;  3TTZ A;  2YE9 A;  3EHF A;  4WUB A;  2WI5 A;  3H4L A;  4HYP A;  2YI0 A;  4MBC A;  3K98 A;  3R4O A;  4BIZ A;  1GKZ A;  1QYE A;  3NMQ A;  1TIL A;  1BKN A;  4LWE A;  3CGY A;  1UYK A;  2BYH A;  2PNR A;  4O0B A;  4GCZ A;  4B7P A;  2HHI A;  1UY8 A;  5D7C A;  2BYI A;  4FPP A;  1AMW A;  5FNF A;  4CWN A;  1UYD A;  4ZKI A;  2O1V A;  2YEA A;  2YEF A;  3BM9 A;  3O0I A;  5D7D A;  3C11 A;  2BRC A;  2GQP A;  4P8O A;  2AKP A;  4XC0 A;  4MPC A;  1YET A;  5M4H A;  4GFN A;  3K99 A;  4XCJ A;  2IWU A;  3DGE A;  4L94 A;  1ZWH A;  5D6Q A;  1Z59 A;  2YK9 A;  3U2K A;  2YKC A;  4LWI A;  4LP0 A;  3D2R A;  1YSZ A;  2IOR A;  1PVG A;  3VHC A;  3U67 A;  3K60 A;  1I5C A;  2FTK A;  4H7Q A;  2HG1 A;  1R62 A;  4HXZ A;  3CRK A;  5FWK A;  5JEN A;  3T0H A;  4W7T A;  2VW5 A;  3EKO A;  2BSM A;  4HY6 A;  3RKZ A;  2BU2 A;  2XK2 A;  3B24 A;  4MB9 A;  2JJC A;  4URO A;  1H7U A;  2C2A A;  4HZ5 A;  2XHR A;  1UYC A;  4HXW A;  4MOT A;  3IED A;  1IXM A;  1Y8O A;  3A0Z A;  1S14 A;  4YKW A;  2XJX A;  3B25 A;  4E72 A;  4H85 A;  4YKQ A;  1TID A;  2WI4 A;  2YJX A;  5CF0 A;  4U7O A;  2WI3 A;  2YED A;  5CTX A;  2YE2 A;  4E01 A;  3G7E A;  1ID0 A;  3EHH A;  2XHX A;  4QPJ A;  4XTJ A;  1UYF A;  2XJJ A;  2YE5 A;  4XIR A;  1I5D A;  3INW A;  2WI1 A;  4L91 A;  4XCL A;  3WHA A;  5M4P A;  5M4E A;  1US7 A;  2YI6 A;  4KP4 A;  3FV5 A;  1AJ6 A;  3RLQ A;  1H7S A;  4BQG A;  2CG9 A;  2QF6 A;  1THN A;  4PL9 A;  1YES A;  1UY9 A;  4GEE A;  1YT0 A;  2HKJ A;  2XDL A;  2BU7 A;  4NH9 A;  2YKI A;  3ZXQ A;  3A0X A;  4WUC A;  2H55 A;  3A0T A;  4YKZ A;  4QPK A; 
#chains in the Genus database with same CATH homology
 1Z5A A;  3QTF A;  2O1U A;  1KIJ A;  4DZY A;  2YJW A;  1JM6 A;  3T10 A;  1GKX A;  3R91 A;  4BXI A;  2CGF A;  3GIF A;  3QDD A;  2IOP A;  4EEH A;  4V25 A;  1Y4S A;  3T1K A;  1BGQ A;  2YK2 A;  1BXD A;  3TZ5 A;  4E00 A;  3OWD A;  3O6O A;  3JZ3 A;  3TZ2 A;  2XJG A;  4EFT A;  2IOQ A;  1EA6 A;  3R4M A;  2YE8 A;  4MPE A;  4FCQ A;  4NH7 A;  5CTU A;  2WI7 A;  3A0W A;  2VWC A;  4FMT A;  2Q8F A;  2BT0 A;  3ZXO A;  3HYY A;  3HZ5 A;  3T0Z A;  3K97 A;  3OPD A;  1TBW A;  3TZ0 A;  1NHJ A;  2WEQ A;  4EFU A;  4EGI A;  2BTZ A;  4YKT A;  4YKU A;  1Z5B A;  1S16 A;  4URN A;  2VCI A;  3KE6 A;  4AS9 A;  2FXS A;  3B28 A;  3HHU A;  5C93 A;  3ZM7 A;  1EI1 A;  4JAS A;  3HYZ A;  1U2O A;  2IWS A;  1ZXN A;  4PU9 A;  3Q5L A;  2CCU A;  4XKK A;  4R1F A;  1Y4U A;  2XDX A;  2YKB A;  4E02 A;  3Q5K A;  1ZW9 A;  2BRE A;  1KZN A;  2BZ5 A;  5IDM A;  4BQJ A;  2IWX A;  2O1W A;  4B6C A;  2WI6 A;  2BU5 A;  2Q8I A;  2UWD A;  3R4N A;  2XHT A;  4CWF A;  2XAB A;  2BU6 A;  4XD8 A;  1AH6 A;  2GFD A;  4O09 A;  2K5B A;  4LWF A;  2ZDY A;  2VCJ A;  4P7A A;  1MX0 A;  2YGA A;  3B27 A;  4KSG A;  4BIU A;  5L3J A;  4CE2 A;  1QY8 A;  5CPH A;  3ZKB A;  4HYM A;  4JAU A;  1A4H A;  4CWQ A;  1I59 A;  4URL A;  4MP2 A;  2YGF A;  3VHA A;  4ZVI A;  3R92 A;  4X9L A;  4ASB A;  3GIG B;  1B3Q A;  2CCT A;  2JKI A;  3HEK A;  2WI2 A;  1YC1 A;  1QZR A;  4MPN A;  4XKO A;  3C0E A;  4EM7 A;  3G7B A;  3HZ1 A;  4EGK A;  3B26 A;  3G75 A;  4XIQ A;  4I3H A;  4H81 A;  2YEJ A;  1GJV A;  1UYE A;  1I5B A;  4LWH A;  1I58 A;  4KTN A;  1YS3 A;  3INX A;  4PRV A;  4CWP A;  2Q8H A;  1I5A A;  3PEJ A;  2YEI A;  5FND A;  1YC3 A;  5GGZ A;  1B62 A;  5J6A A;  4U7N A;  3R4P A;  1UYH A;  1YC4 A;  4ASA A;  1AM1 A;  3EHG A;  4ASF A;  1UYL A;  4K4O A;  1UY7 A;  4EGH A;  3CRL A;  4KSH A;  4YKR A;  3OW6 A;  4KFG A;  1AH8 A;  2YI7 A;  2YE7 A;  5D7R A;  3BMY A;  2YKJ A;  2FWZ A;  1NHI A;  3U2D A;  2WER A;  4O04 A;  4GT8 A;  4LWG A;  4CE3 A;  5BOC A;  2YKE A;  4JQL A;  2QG0 A;  3A0Y A;  2EXL A;  2YE4 A;  4U93 A;  3OMU A;  3D0B A;  3GIG A;  3OWB A;  2YGE A;  5D6P A;  1U0Z A;  4R3A A;  3ZKD A;  2YI5 A;  4GGL A;  1OSF A;  4XDM A;  4DUH A;  4O05 A;  4CWR A;  2HCH A;  2ESA A;  1TC6 A;  4L93 A;  1TH8 A;  2CCS A;  4HZ0 A;  1NHH A;  2XX4 A;  1BYQ A;  4XIP A;  5M4K A;  3FT5 A;  3Q5J A;  5M4M A;  4MP7 A;  2ZBK B;  3T2S A;  4KQV A;  4AWQ A;  4Q20 A;  2Q8G A;  2XDK A;  2E0A A;  1MU5 A;  2YEG A;  3CGZ A;  3RLP A;  2WEP A;  4CWS A;  4XE2 A;  4YKX A;  2XCM A;  2XDS A;  2XDU A;  3D36 A;  4L90 A;  3TUH A;  5BOD A;  4PRX A;  5M4N A;  1YSR A;  4CE1 A;  3CWV A;  3VHD A;  4XIT A;  3SL2 A;  1UY6 A;  5FNC A;  4L8Z A;  4URM A;  3O2F A;  3RLR A;  1L0O A;  1B63 A;  2YEH A;  3WQ9 A;  1Y8P A;  2XX5 A;  3MNR P;  4AWO A;  3FT8 A;  2XD6 A;  2YE6 A;  1YT2 A;  2FYP A;  1TC0 A;  2QFO A;  2ZDX A;  5IN9 A;  4ASG A;  2QG2 A;  2YEB A;  5CTW A;  1UYM A;  2YEC A;  2Q2E B;  4CWO A;  2YEE A;  4I5S A;  3TZ4 A;  3GIE A;  3LPS A;  4LPB A;  4AWP A;  2YE3 A;  5F5R A;  4FCR A;  3LNU A;  1Y8N A;  4NH8 A;  4V26 A;  4CWT A;  2XX2 A;  1YER A;  3PEH A;  1UYI A;  5IDJ A;  4XKA A;  4EMV A;  4JAV A;  1ZXM A;  5CTY A;  2BU8 A;  3H80 A;  4GQT A;  2FWY A;  5J71 A;  4YKY A;  3EHJ A;  1Z5C A;  4O07 A;  2H8M A;  2CH4 A;  3A0R A;  4BAE A;  2ZKJ A;  1UYG A;  1YT1 A;  4WUD A;  4FCP A;  3VAD A;  3EKR A;  5F3K A;  4R3M A;  4HY1 A;  3TTZ A;  2YE9 A;  3EHF A;  4WUB A;  2WI5 A;  3H4L A;  4HYP A;  2YI0 A;  4MBC A;  3K98 A;  3R4O A;  4BIZ A;  1GKZ A;  1QYE A;  3NMQ A;  1TIL A;  1BKN A;  4LWE A;  3CGY A;  1UYK A;  2BYH A;  2PNR A;  4O0B A;  4GCZ A;  4B7P A;  1UY8 A;  5D7C A;  2BYI A;  4FPP A;  1AMW A;  5FNF A;  4CWN A;  1UYD A;  4ZKI A;  2O1V A;  2YEA A;  2YEF A;  3BM9 A;  3O0I A;  5D7D A;  3C11 A;  2BRC A;  2GQP A;  4P8O A;  2AKP A;  4XC0 A;  4MPC A;  1YET A;  5M4H A;  4GFN A;  3K99 A;  4XCJ A;  2IWU A;  3DGE A;  4L94 A;  1ZWH A;  5D6Q A;  1Z59 A;  2YK9 A;  3U2K A;  2YKC A;  4LWI A;  4LP0 A;  3D2R A;  1YSZ A;  2IOR A;  1PVG A;  3VHC A;  3U67 A;  3K60 A;  1I5C A;  4H7Q A;  2HG1 A;  1R62 A;  4HXZ A;  3CRK A;  5FWK A;  3T0H A;  4W7T A;  2VW5 A;  3EKO A;  2BSM A;  4HY6 A;  3RKZ A;  2BU2 A;  2XK2 A;  3B24 A;  4MB9 A;  2JJC A;  4URO A;  1H7U A;  2C2A A;  4HZ5 A;  2XHR A;  1UYC A;  4HXW A;  4MOT A;  3IED A;  1Y8O A;  3A0Z A;  1S14 A;  4YKW A;  2XJX A;  3B25 A;  4H85 A;  4YKQ A;  1TID A;  2WI4 A;  2YJX A;  5CF0 A;  4U7O A;  2WI3 A;  2YED A;  5CTX A;  2YE2 A;  4E01 A;  3G7E A;  1ID0 A;  3EHH A;  2XHX A;  4QPJ A;  4XTJ A;  1UYF A;  2XJJ A;  2YE5 A;  4XIR A;  1I5D A;  3INW A;  2WI1 A;  4L91 A;  4XCL A;  3WHA A;  5M4P A;  5M4E A;  1US7 A;  2YI6 A;  4KP4 A;  3FV5 A;  1AJ6 A;  3RLQ A;  1H7S A;  4BQG A;  2CG9 A;  2QF6 A;  1THN A;  4PL9 A;  1YES A;  1UY9 A;  4GEE A;  1YT0 A;  2HKJ A;  2XDL A;  2BU7 A;  4NH9 A;  2YKI A;  3ZXQ A;  3A0X A;  4WUC A;  2H55 A;  3A0T A;  4YKZ A;  4QPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...