1YT1A

Crystal structure of the unliganded form of grp94, the er hsp90: basis for nucleotide-induced conformational change, grp94n(delta)41 apo crystal
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
236
structure length
227
Chain Sequence
GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQEQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Unliganded GRP94, the Endoplasmic Reticulum Hsp90: BASIS FOR NUCLEOTIDE-INDUCED CONFORMATIONAL CHANGE
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 71
structure length 227
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1yt1A00
4JQLA 5F3KA 2YI5A 2AKPA 3OW6A 4H85A 2XJJA 1YETA 4FMTA 1BGQA 2VCJA 4DUHA 4WUDA 2WI3A 4GCZA 3A0XA 5BOCA 2YKCA 1JM6A 2FWZA 4YKYA 4FCQA 4LP0A 4LWIA 2YI6A 1I5AA 2UWDA 4B7PA 3JZ3A 2XHTA 3PEHA 2YE9A 3BM9A 5CTWA 2JJCA 5CTYA 4CWRA 3GIEA 2YI7A 3A0ZA 1MX0A 5CTXA 4AS9A 1YT0A 3CRKA 1AH6A 5CTUA 4YKRA 5FWKA 4PU9A 1YSZA 1B3QA 3LPSA 3Q5KA 4YKXA 1I5CA 2YGAA 4LWGA 1U2OA 5J6AA 2XX5A 3IEDA 4LWFA 1UYDA 2FWYA 3T0ZA 3A0YA 5D7CA 1ZXNA 3FV5A 2WI2A 1UY8A 3SL2A 2IWUA 4XKAA 4L90A 1YC4A 3R4OA 4O05A 1UYKA 3CGYA 4XCJA 2H8MA 4MPEA 4CWSA 2ESAA 3U67A 2YJXA 2YEIA 3G7EA 4NH7A 1S16A 4XE2A 3ZKDA 2YKJA 2IOQA 4L94A 5M4KA 3A0TA 4AWOA 2C2AA 4O04A 1ID0A 1TC0A 3ZM7A 4MP7A 4LWHA 2YGFA 3O0IA 3B24A 1ZW9A 4PRVA 3HZ1A 2YEJA 4HXWA 2WEPA 2XHXA 2BSMA 2YEBA 4EGHA 2BZ5A 1QYEA 2XDSA 5IDMA 1UYGA 1H7UA 1TILA 1Y8NA 2QF6A 3U2DA 2BU7A 2YK9A 2XX4A 3HYZA 4KTNA 2YJWA 1QY8A 2XK2A 2JKIA 3Q5JA 2Q8IA 2YE5A 2XDLA 2GQPA 4BIZA 4YKTA 3K99A 3EKRA 3RLQA 2WEQA 2WI6A 3B27A 5CPHA 4E02A 4CWPA 3T2SA 2CGFA 4XITA 1GJVA 5FNDA 4WUBA 5M4HA 1QZRA 3O2FA 4U7NA 1UY6A 3GIFA 4XCLA 4U7OA 3TUHA 2QFOA 2VW5A 1MU5A 5M4EA 2YKBA 4O09A 1UYCA 4L91A 4CWQA 3U2KA 3GIGB 3HZ5A 3CRLA 2WI5A 4P8OA 4LPBA 2HG1A 4HY6A 3H4LA 4YKUA 2CCTA 1B63A 3T1KA 3R4MA 2XJGA 4XD8A 1A4HA 5FNFA 2YE8A 2VWCA 1YC3A 1TC6A 1UYHA 1NHHA 2BRCA 3K97A 2BTZA 1BKNA 3H80A 1BXDA 4GEEA 1AJ6A 4I5SA 2YE6A 3INXA 4Q20A 2QG2A 4CWNA 2CCSA 2FXSA 2ZKJA 3T0HA 1YT1A 1Z5AA 1UY9A 2YE2A 2Q2EB 3OWBA 1I5BA 4CWOA 3G7BA 4XIPA 3R92A 2WI4A 1YT2A 4L8ZA 4V25A 1EA6A 1Z5BA 2E0AA 4PRXA 3FT5A 5F5RA 2ZBKB 4EMVA 4GT8A 5CF0A 2WI1A 4U93A 4EEHA 2Q8FA 1H7SA 1YESA 4JASA 4MB9A 1Y4SA 2YKEA 2BYIA 3ZXQA 2CCUA 2XCMA 2XDUA 3PEJA 3ZXOA 2BYHA 4HZ0A 4W7TA 3C11A 3K98A 3EKOA 3GIGA 4FCPA 4FCRA 4P7AA 5D7RA 4FPPA 4UROA 5D6PA 2YI0A 4ASBA 4EGIA 3DGEA 2BU8A 1EI1A 1UYFA 4LWEA 1THNA 1YS3A 3INWA 3WQ9A 3KE6A 1YERA 4URMA 1S14A 3RKZA 4DZYA 4CWTA 2FYPA 2BT0A 1AM1A 1Y8OA 4NH8A 5C93A 1AH8A 3OWDA 5D7DA 2GFDA 4L93A 3BMYA 3EHHA 4HY1A 5L3JA 2YE4A 3EHJA 2BU2A 2XDXA 1ZWHA 4BAEA 1ZXMA 4R1FA 4XTJA 4E01A 4H7QA 2Q8GA 3NMQA 3RLRA 3CGZA 4KP4A 4BQJA 5IDJA 4KFGA 3R91A 2IORA 2XJXA 4HZ5A 3D2RA 4HXZA 2VCIA 1R62A 4QPJA 3TZ0A 3HHUA 5GGZA 4R3AA 3TZ5A 3VHCA 2YKIA 1PVGA 4HYMA 1B62A 2IOPA 1TBWA 3A0WA 4YKWA 2WERA 3TTZA 4JAUA 4EFTA 1I5DA 4EM7A 4CE2A 4PL9A 2YECA 4YKZA 4NH9A 2YE7A 5M4MA 1YC1A 1Z59A 3RLPA 2XD6A 4O07A 2WI7A 3G75A 1UYEA 2BREA 2IWSA 3HYYA 1UY7A 3OMUA 3A0RA 4XKKA 2YGEA 3B25A 3Q5LA 3R4NA 3T10A 2BU5A 2IWXA 1OSFA 2CG9A 3VADA 4CE3A 4CE1A 1Z5CA 4BIUA 2K5BA 4AWPA 2ZDXA 2PNRA 5M4PA 5D6QA 3LNUA 4B6CA 1TIDA 1Y8PA 1TH8A 3EHGA 4ASGA 4ZKIA 4XDMA 2CH4A 1NHIA 4MP2A 1AMWA 2Q8HA 4XIQA 4ASAA 4KSGA 4I3HA 1GKZA 2YEAA 4MPCA 4MOTA 4KQVA 4ZVIA 1GKXA 1UYMA 2XABA 3TZ2A 2HCHA 3OPDA 3QTFA 2QG0A 1Y4UA 1BYQA 2YEDA 3B28A 4XKOA 1US7A 2YK2A 3K60A 3EHFA 4AWQA 4MPNA 2XHRA 1I59A 4GFNA 3MNRP 3TZ4A 5IN9A 4YKQA 2ZDYA 5J71A 2HKJA 1L0OA 3QDDA 3VHDA 4ASFA 3FT8A 5FNCA 1KIJA 4V26A 4XIRA 4URNA 5M4NA 4H81A 4K4OA 4R3MA 3O6OA 4EFUA 4O0BA 4WUCA 3D36A 4E00A 1U0ZA 1UYLA 4QPKA 4KSHA 4XC0A 2YEFA 2YEHA 1YSRA 4JAVA 4X9LA 3C0EA 2O1VA 2YEEA 2XX2A 5BODA 2EXLA 3ZKBA 3B26A 4GGLA 2O1WA 3R4PA 4EGKA 3VHAA 4GQTA 1UYIA 2O1UA 1KZNA 4MBCA 2BU6A 1NHJA 2H55A 3CWVA 3WHAA 2YE3A 4BQGA 2YEGA 4URLA 4HYPA 4BXIA 3D0BA 4CWFA 2XDKA 3HEKA 1I58A
chains in the Genus database with same CATH superfamily
4JQLA 5F3KA 2YI5A 2AKPA 3OW6A 4H85A 2XJJA 1YETA 4FMTA 1BGQA 2VCJA 4DUHA 4WUDA 2WI3A 4GCZA 3A0XA 5BOCA 2YKCA 1JM6A 2FWZA 4YKYA 4FCQA 4LP0A 4LWIA 2YI6A 1I5AA 2UWDA 4B7PA 3JZ3A 2XHTA 3PEHA 2YE9A 3BM9A 5CTWA 2JJCA 5CTYA 4CWRA 3GIEA 2YI7A 3A0ZA 1MX0A 5CTXA 4AS9A 5JENA 1YT0A 3CRKA 1AH6A 5CTUA 4YKRA 5FWKA 4PU9A 1YSZA 1B3QA 3LPSA 3Q5KA 4YKXA 1I5CA 2YGAA 4LWGA 1U2OA 5J6AA 2XX5A 3IEDA 4LWFA 1UYDA 2FWYA 3T0ZA 3A0YA 5D7CA 1ZXNA 3FV5A 2WI2A 1UY8A 3SL2A 2IWUA 4XKAA 4L90A 1YC4A 3R4OA 4O05A 1UYKA 3CGYA 3S5TA 4XCJA 2H8MA 4MPEA 4CWSA 2ESAA 3U67A 2YJXA 2YEIA 3G7EA 4NH7A 1S16A 4XE2A 3ZKDA 2YKJA 2IOQA 4L94A 5M4KA 3A0TA 4AWOA 2C2AA 4O04A 1ID0A 1TC0A 3ZM7A 4MP7A 4LWHA 4E72A 2YGFA 3O0IA 3B24A 2C1IA 1ZW9A 4PRVA 3HZ1A 2YEJA 4HXWA 2WEPA 2XHXA 2BSMA 2YEBA 4EGHA 2BZ5A 1QYEA 2XDSA 5IDMA 1UYGA 1H7UA 1TILA 1Y8NA 2QF6A 3U2DA 2BU7A 2YK9A 2XX4A 3HYZA 4KTNA 2YJWA 1QY8A 2XK2A 2JKIA 3Q5JA 2Q8IA 2YE5A 2XDLA 2GQPA 4BIZA 4YKTA 3K99A 3EKRA 3RLQA 2WEQA 2WI6A 3B27A 5CPHA 4E02A 4CWPA 3T2SA 2CGFA 4XITA 1GJVA 5FNDA 4WUBA 5M4HA 1QZRA 3O2FA 4U7NA 1UY6A 3GIFA 4XCLA 4U7OA 3TUHA 2QFOA 2VW5A 1MU5A 5M4EA 2YKBA 4O09A 1UYCA 4L91A 4CWQA 3U2KA 3GIGB 3HZ5A 3CRLA 2WI5A 4P8OA 4LPBA 2HG1A 4HY6A 3H4LA 4YKUA 2CCTA 1B63A 3T1KA 3R4MA 2XJGA 1F51A 4XD8A 1A4HA 5FNFA 2YE8A 2VWCA 1YC3A 1TC6A 1UYHA 1NHHA 2BRCA 3K97A 2BTZA 1BKNA 3H80A 1BXDA 4GEEA 1AJ6A 4I5SA 2YE6A 3INXA 4Q20A 2QG2A 4CWNA 2CCSA 2FXSA 2ZKJA 2FTKA 3T0HA 1YT1A 1Z5AA 1UY9A 2YE2A 2Q2EB 3OWBA 1I5BA 4CWOA 3G7BA 4XIPA 3R92A 2WI4A 1YT2A 4L8ZA 4V25A 1EA6A 1Z5BA 2E0AA 4PRXA 3FT5A 5F5RA 2ZBKB 4EMVA 4GT8A 5CF0A 2WI1A 4U93A 4EEHA 2Q8FA 1H7SA 1YESA 3CYGA 4JASA 4MB9A 1Y4SA 2YKEA 2BYIA 3ZXQA 2CCUA 2XCMA 2XDUA 3PEJA 3ZXOA 2BYHA 4HZ0A 4W7TA 3C11A 3K98A 2HHIA 3EKOA 3GIGA 4FCPA 4FCRA 4P7AA 5D7RA 4FPPA 4UROA 5D6PA 2YI0A 4ASBA 4EGIA 3DGEA 2BU8A 1UYFA 1EI1A 1IXMA 4LWEA 1THNA 1YS3A 3INWA 3WQ9A 3KE6A 1YERA 4URMA 1S14A 3RKZA 4DZYA 4CWTA 2FYPA 2BT0A 1AM1A 1Y8OA 4NH8A 5C93A 1AH8A 3OWDA 5D7DA 2GFDA 4L93A 3BMYA 3EHHA 4HY1A 5L3JA 2YE4A 3EHJA 2BU2A 2XDXA 1ZWHA 4BAEA 1ZXMA 4R1FA 4XTJA 4E01A 4H7QA 2Q8GA 3NMQA 3RLRA 3CGZA 4KP4A 4BQJA 5IDJA 4KFGA 3R91A 2IORA 2XJXA 4HZ5A 3D2RA 4HXZA 2VCIA 1R62A 4QPJA 3TZ0A 3HHUA 5GGZA 4R3AA 3TZ5A 3VHCA 2YKIA 1PVGA 4HYMA 1B62A 2IOPA 1TBWA 3A0WA 2C1GA 4YKWA 2WERA 3TTZA 4JAUA 4EFTA 1I5DA 4EM7A 4CE2A 4PL9A 2YECA 4YKZA 4NH9A 2YE7A 5M4MA 1YC1A 1Z59A 3RLPA 2XD6A 4O07A 2WI7A 3G75A 1UYEA 2BREA 2IWSA 3HYYA 1UY7A 3OMUA 3A0RA 4XKKA 2YGEA 3B25A 3Q5LA 3R4NA 3T10A 2BU5A 2IWXA 1OSFA 2CG9A 3VADA 4CE3A 4CE1A 1Z5CA 4BIUA 2K5BA 4AWPA 2ZDXA 2PNRA 5M4PA 5D6QA 3LNUA 4B6CA 1TIDA 1Y8PA 1TH8A 3EHGA 4ASGA 4ZKIA 4XDMA 2CH4A 1NHIA 4MP2A 1AMWA 2Q8HA 4XIQA 4ASAA 4KSGA 4I3HA 1GKZA 2YEAA 4MPCA 4MOTA 4KQVA 4ZVIA 1GKXA 1UYMA 2XABA 3TZ2A 2HCHA 3OPDA 3QTFA 2QG0A 1Y4UA 1BYQA 2YEDA 3B28A 4XKOA 1US7A 2YK2A 3K60A 3EHFA 4AWQA 4MPNA 2XHRA 1I59A 4GFNA 3MNRP 3TZ4A 5IN9A 4YKQA 2ZDYA 5J71A 2HKJA 1L0OA 3QDDA 3VHDA 4ASFA 3FT8A 5FNCA 1KIJA 4V26A 4XIRA 4URNA 5M4NA 4H81A 4K4OA 4R3MA 3O6OA 4EFUA 4O0BA 4WUCA 3D36A 4E00A 1U0ZA 1UYLA 4QPKA 4KSHA 4XC0A 2YEFA 2YEHA 1YSRA 4JAVA 4X9LA 3C0EA 2O1VA 2YEEA 2XX2A 5BODA 2EXLA 3ZKBA 3B26A 3LMMA 4GGLA 2O1WA 3R4PA 4EGKA 3VHAA 4GQTA 1UYIA 2O1UA 1KZNA 4MBCA 2BU6A 1NHJA 3CWVA 2H55A 3WHAA 2YE3A 4BQGA 2YEGA 4URLA 4HYPA 4BXIA 3D0BA 4CWFA 2XDKA 3HEKA 1I58A
chains in the Genus database with same CATH topology
4JQLA 5F3KA 2YI5A 2AKPA 3OW6A 4H85A 2XJJA 1YETA 4FMTA 1BGQA 2VCJA 4DUHA 4WUDA 2WI3A 4GCZA 3A0XA 5BOCA 2YKCA 1JM6A 2FWZA 4YKYA 4FCQA 4LP0A 4LWIA 2YI6A 1I5AA 2UWDA 4B7PA 3JZ3A 2XHTA 3PEHA 2YE9A 3BM9A 5CTWA 2JJCA 5CTYA 4CWRA 3GIEA 2YI7A 3A0ZA 1MX0A 5CTXA 4AS9A 1YT0A 3CRKA 1AH6A 5CTUA 4YKRA 5FWKA 4PU9A 1YSZA 1B3QA 3LPSA 3Q5KA 4YKXA 1I5CA 2YGAA 4LWGA 1U2OA 5J6AA 2XX5A 3IEDA 4LWFA 1UYDA 2FWYA 3T0ZA 3A0YA 5D7CA 1ZXNA 3FV5A 2WI2A 1UY8A 3SL2A 2IWUA 4XKAA 4L90A 1YC4A 3R4OA 4O05A 1UYKA 3CGYA 4XCJA 2H8MA 4MPEA 4CWSA 2ESAA 3U67A 2YJXA 2YEIA 3G7EA 4NH7A 1S16A 4XE2A 3ZKDA 2YKJA 2IOQA 4L94A 5M4KA 3A0TA 4AWOA 2C2AA 4O04A 1ID0A 1TC0A 3ZM7A 4MP7A 4LWHA 2YGFA 3O0IA 3B24A 1ZW9A 4PRVA 3HZ1A 2YEJA 4HXWA 2WEPA 2XHXA 2BSMA 2YEBA 4EGHA 2BZ5A 1QYEA 2XDSA 5IDMA 1UYGA 1H7UA 1TILA 1Y8NA 2QF6A 3U2DA 2BU7A 2YK9A 2XX4A 3HYZA 4KTNA 2YJWA 1QY8A 2XK2A 2JKIA 3Q5JA 2Q8IA 2YE5A 2XDLA 2GQPA 4BIZA 4YKTA 3K99A 3EKRA 3RLQA 2WEQA 2WI6A 3B27A 5CPHA 4E02A 4CWPA 3T2SA 2CGFA 4XITA 1GJVA 5FNDA 4WUBA 5M4HA 1QZRA 3O2FA 4U7NA 1UY6A 3GIFA 4XCLA 4U7OA 3TUHA 2QFOA 2VW5A 1MU5A 5M4EA 2YKBA 4O09A 1UYCA 4L91A 4CWQA 3U2KA 3GIGB 3HZ5A 3CRLA 2WI5A 4P8OA 4LPBA 2HG1A 4HY6A 3H4LA 4YKUA 2CCTA 1B63A 3T1KA 3R4MA 2XJGA 4XD8A 1A4HA 5FNFA 2YE8A 2VWCA 1YC3A 1TC6A 1UYHA 1NHHA 2BRCA 3K97A 2BTZA 1BKNA 3H80A 1BXDA 4GEEA 1AJ6A 4I5SA 2YE6A 3INXA 4Q20A 2QG2A 4CWNA 2CCSA 2FXSA 2ZKJA 3T0HA 1YT1A 1Z5AA 1UY9A 2YE2A 2Q2EB 3OWBA 1I5BA 4CWOA 3G7BA 4XIPA 3R92A 2WI4A 1YT2A 4L8ZA 4V25A 1EA6A 1Z5BA 2E0AA 4PRXA 3FT5A 5F5RA 2ZBKB 4EMVA 4GT8A 5CF0A 2WI1A 4U93A 4EEHA 2Q8FA 1H7SA 1YESA 4JASA 4MB9A 1Y4SA 2YKEA 2BYIA 3ZXQA 2CCUA 2XCMA 2XDUA 3PEJA 3ZXOA 2BYHA 4HZ0A 4W7TA 3C11A 3K98A 3EKOA 3GIGA 4FCPA 4FCRA 4P7AA 5D7RA 4FPPA 4UROA 5D6PA 2YI0A 4ASBA 4EGIA 3DGEA 2BU8A 1EI1A 1UYFA 4LWEA 1THNA 1YS3A 3INWA 3WQ9A 3KE6A 1YERA 4URMA 1S14A 3RKZA 4DZYA 4CWTA 2FYPA 2BT0A 1AM1A 1Y8OA 4NH8A 5C93A 1AH8A 3OWDA 5D7DA 2GFDA 4L93A 3BMYA 3EHHA 4HY1A 5L3JA 2YE4A 3EHJA 2BU2A 2XDXA 1ZWHA 4BAEA 1ZXMA 4R1FA 4XTJA 4E01A 4H7QA 2Q8GA 3NMQA 3RLRA 3CGZA 4KP4A 4BQJA 5IDJA 4KFGA 3R91A 2IORA 2XJXA 4HZ5A 3D2RA 4HXZA 2VCIA 1R62A 4QPJA 3TZ0A 3HHUA 5GGZA 4R3AA 3TZ5A 3VHCA 2YKIA 1PVGA 4HYMA 1B62A 2IOPA 1TBWA 3A0WA 4YKWA 2WERA 3TTZA 4JAUA 4EFTA 1I5DA 4EM7A 4CE2A 4PL9A 2YECA 4YKZA 4NH9A 2YE7A 5M4MA 1YC1A 1Z59A 3RLPA 2XD6A 4O07A 2WI7A 3G75A 1UYEA 2BREA 2IWSA 3HYYA 1UY7A 3OMUA 3A0RA 4XKKA 2YGEA 3B25A 3Q5LA 3R4NA 3T10A 2BU5A 2IWXA 1OSFA 2CG9A 3VADA 4CE3A 4CE1A 1Z5CA 4BIUA 2K5BA 4AWPA 2ZDXA 2PNRA 5M4PA 5D6QA 3LNUA 4B6CA 1TIDA 1Y8PA 1TH8A 3EHGA 4ASGA 4ZKIA 4XDMA 2CH4A 1NHIA 4MP2A 1AMWA 2Q8HA 4XIQA 4ASAA 4KSGA 4I3HA 1GKZA 2YEAA 4MPCA 4MOTA 4KQVA 4ZVIA 1GKXA 1UYMA 2XABA 3TZ2A 2HCHA 3OPDA 3QTFA 2QG0A 1Y4UA 1BYQA 2YEDA 3B28A 4XKOA 1US7A 2YK2A 3K60A 3EHFA 4AWQA 4MPNA 2XHRA 1I59A 4GFNA 3MNRP 3TZ4A 5IN9A 4YKQA 2ZDYA 5J71A 2HKJA 1L0OA 3QDDA 3VHDA 4ASFA 3FT8A 5FNCA 1KIJA 4V26A 4XIRA 4URNA 5M4NA 4H81A 4K4OA 4R3MA 3O6OA 4EFUA 4O0BA 4WUCA 3D36A 4E00A 1U0ZA 1UYLA 4QPKA 4KSHA 4XC0A 2YEFA 2YEHA 1YSRA 4JAVA 4X9LA 3C0EA 2O1VA 2YEEA 2XX2A 5BODA 2EXLA 3ZKBA 3B26A 4GGLA 2O1WA 3R4PA 4EGKA 3VHAA 4GQTA 1UYIA 2O1UA 1KZNA 4MBCA 2BU6A 1NHJA 2H55A 3CWVA 3WHAA 2YE3A 4BQGA 2YEGA 4URLA 4HYPA 4BXIA 3D0BA 4CWFA 2XDKA 3HEKA 1I58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JQL A;  5F3K A;  2YI5 A;  2AKP A;  3OW6 A;  4H85 A;  2XJJ A;  1YET A;  4FMT A;  1BGQ A;  2VCJ A;  4DUH A;  4WUD A;  2WI3 A;  4GCZ A;  3A0X A;  5BOC A;  2YKC A;  1JM6 A;  2FWZ A;  4YKY A;  4FCQ A;  4LP0 A;  4LWI A;  2YI6 A;  1I5A A;  2UWD A;  4B7P A;  3JZ3 A;  2XHT A;  3PEH A;  2YE9 A;  3BM9 A;  5CTW A;  2JJC A;  5CTY A;  4CWR A;  3GIE A;  2YI7 A;  3A0Z A;  1MX0 A;  5CTX A;  4AS9 A;  1YT0 A;  3CRK A;  1AH6 A;  5CTU A;  4YKR A;  5FWK A;  4PU9 A;  1YSZ A;  1B3Q A;  3LPS A;  3Q5K A;  4YKX A;  1I5C A;  2YGA A;  4LWG A;  1U2O A;  5J6A A;  2XX5 A;  3IED A;  4LWF A;  1UYD A;  2FWY A;  3T0Z A;  3A0Y A;  5D7C A;  1ZXN A;  3FV5 A;  2WI2 A;  1UY8 A;  3SL2 A;  2IWU A;  4XKA A;  4L90 A;  1YC4 A;  3R4O A;  4O05 A;  1UYK A;  3CGY A;  4XCJ A;  2H8M A;  4MPE A;  4CWS A;  2ESA A;  3U67 A;  2YJX A;  2YEI A;  3G7E A;  4NH7 A;  1S16 A;  4XE2 A;  3ZKD A;  2YKJ A;  2IOQ A;  4L94 A;  5M4K A;  3A0T A;  4AWO A;  2C2A A;  4O04 A;  1ID0 A;  1TC0 A;  3ZM7 A;  4MP7 A;  4LWH A;  2YGF A;  3O0I A;  3B24 A;  1ZW9 A;  4PRV A;  3HZ1 A;  2YEJ A;  4HXW A;  2WEP A;  2XHX A;  2BSM A;  2YEB A;  4EGH A;  2BZ5 A;  1QYE A;  2XDS A;  5IDM A;  1UYG A;  1H7U A;  1TIL A;  1Y8N A;  2QF6 A;  3U2D A;  2BU7 A;  2YK9 A;  2XX4 A;  3HYZ A;  4KTN A;  2YJW A;  1QY8 A;  2XK2 A;  2JKI A;  3Q5J A;  2Q8I A;  2YE5 A;  2XDL A;  2GQP A;  4BIZ A;  4YKT A;  3K99 A;  3EKR A;  3RLQ A;  2WEQ A;  2WI6 A;  3B27 A;  5CPH A;  4E02 A;  4CWP A;  3T2S A;  2CGF A;  4XIT A;  1GJV A;  5FND A;  4WUB A;  5M4H A;  1QZR A;  3O2F A;  4U7N A;  1UY6 A;  3GIF A;  4XCL A;  4U7O A;  3TUH A;  2QFO A;  2VW5 A;  1MU5 A;  5M4E A;  2YKB A;  4O09 A;  1UYC A;  4L91 A;  4CWQ A;  3U2K A;  3GIG B;  3HZ5 A;  3CRL A;  2WI5 A;  4P8O A;  4LPB A;  2HG1 A;  4HY6 A;  3H4L A;  4YKU A;  2CCT A;  1B63 A;  3T1K A;  3R4M A;  2XJG A;  4XD8 A;  1A4H A;  5FNF A;  2YE8 A;  2VWC A;  1YC3 A;  1TC6 A;  1UYH A;  1NHH A;  2BRC A;  3K97 A;  2BTZ A;  1BKN A;  3H80 A;  1BXD A;  4GEE A;  1AJ6 A;  4I5S A;  2YE6 A;  3INX A;  4Q20 A;  2QG2 A;  4CWN A;  2CCS A;  2FXS A;  2ZKJ A;  3T0H A;  1YT1 A;  1Z5A A;  1UY9 A;  2YE2 A;  2Q2E B;  3OWB A;  1I5B A;  4CWO A;  3G7B A;  4XIP A;  3R92 A;  2WI4 A;  1YT2 A;  4L8Z A;  4V25 A;  1EA6 A;  1Z5B A;  2E0A A;  4PRX A;  3FT5 A;  5F5R A;  2ZBK B;  4EMV A;  4GT8 A;  5CF0 A;  2WI1 A;  4U93 A;  4EEH A;  2Q8F A;  1H7S A;  1YES A;  4JAS A;  4MB9 A;  1Y4S A;  2YKE A;  2BYI A;  3ZXQ A;  2CCU A;  2XCM A;  2XDU A;  3PEJ A;  3ZXO A;  2BYH A;  4HZ0 A;  4W7T A;  3C11 A;  3K98 A;  3EKO A;  3GIG A;  4FCP A;  4FCR A;  4P7A A;  5D7R A;  4FPP A;  4URO A;  5D6P A;  2YI0 A;  4ASB A;  4EGI A;  3DGE A;  2BU8 A;  1EI1 A;  1UYF A;  4LWE A;  1THN A;  1YS3 A;  3INW A;  3WQ9 A;  3KE6 A;  1YER A;  4URM A;  1S14 A;  3RKZ A;  4DZY A;  4CWT A;  2FYP A;  2BT0 A;  1AM1 A;  1Y8O A;  4NH8 A;  5C93 A;  1AH8 A;  3OWD A;  5D7D A;  2GFD A;  4L93 A;  3BMY A;  3EHH A;  4HY1 A;  5L3J A;  2YE4 A;  3EHJ A;  2BU2 A;  2XDX A;  1ZWH A;  4BAE A;  1ZXM A;  4R1F A;  4XTJ A;  4E01 A;  4H7Q A;  2Q8G A;  3NMQ A;  3RLR A;  3CGZ A;  4KP4 A;  4BQJ A;  5IDJ A;  4KFG A;  3R91 A;  2IOR A;  2XJX A;  4HZ5 A;  3D2R A;  4HXZ A;  2VCI A;  1R62 A;  4QPJ A;  3TZ0 A;  3HHU A;  5GGZ A;  4R3A A;  3TZ5 A;  3VHC A;  2YKI A;  1PVG A;  4HYM A;  1B62 A;  2IOP A;  1TBW A;  3A0W A;  4YKW A;  2WER A;  3TTZ A;  4JAU A;  4EFT A;  1I5D A;  4EM7 A;  4CE2 A;  4PL9 A;  2YEC A;  4YKZ A;  4NH9 A;  2YE7 A;  5M4M A;  1YC1 A;  1Z59 A;  3RLP A;  2XD6 A;  4O07 A;  2WI7 A;  3G75 A;  1UYE A;  2BRE A;  2IWS A;  3HYY A;  1UY7 A;  3OMU A;  3A0R A;  4XKK A;  2YGE A;  3B25 A;  3Q5L A;  3R4N A;  3T10 A;  2BU5 A;  2IWX A;  1OSF A;  2CG9 A;  3VAD A;  4CE3 A;  4CE1 A;  1Z5C A;  4BIU A;  2K5B A;  4AWP A;  2ZDX A;  2PNR A;  5M4P A;  5D6Q A;  3LNU A;  4B6C A;  1TID A;  1Y8P A;  1TH8 A;  3EHG A;  4ASG A;  4ZKI A;  4XDM A;  2CH4 A;  1NHI A;  4MP2 A;  1AMW A;  2Q8H A;  4XIQ A;  4ASA A;  4KSG A;  4I3H A;  1GKZ A;  2YEA A;  4MPC A;  4MOT A;  4KQV A;  4ZVI A;  1GKX A;  1UYM A;  2XAB A;  3TZ2 A;  2HCH A;  3OPD A;  3QTF A;  2QG0 A;  1Y4U A;  1BYQ A;  2YED A;  3B28 A;  4XKO A;  1US7 A;  2YK2 A;  3K60 A;  3EHF A;  4AWQ A;  4MPN A;  2XHR A;  1I59 A;  4GFN A;  3MNR P;  3TZ4 A;  5IN9 A;  4YKQ A;  2ZDY A;  5J71 A;  2HKJ A;  1L0O A;  3QDD A;  3VHD A;  4ASF A;  3FT8 A;  5FNC A;  1KIJ A;  4V26 A;  4XIR A;  4URN A;  5M4N A;  4H81 A;  4K4O A;  4R3M A;  3O6O A;  4EFU A;  4O0B A;  4WUC A;  3D36 A;  4E00 A;  1U0Z A;  1UYL A;  4QPK A;  4KSH A;  4XC0 A;  2YEF A;  2YEH A;  1YSR A;  4JAV A;  4X9L A;  3C0E A;  2O1V A;  2YEE A;  2XX2 A;  5BOD A;  2EXL A;  3ZKB A;  3B26 A;  4GGL A;  2O1W A;  3R4P A;  4EGK A;  3VHA A;  4GQT A;  1UYI A;  2O1U A;  1KZN A;  4MBC A;  2BU6 A;  1NHJ A;  2H55 A;  3CWV A;  3WHA A;  2YE3 A;  4BQG A;  2YEG A;  4URL A;  4HYP A;  4BXI A;  3D0B A;  4CWF A;  2XDK A;  3HEK A;  1I58 A; 
#chains in the Genus database with same CATH topology
 4JQL A;  5F3K A;  2YI5 A;  2AKP A;  3OW6 A;  4H85 A;  2XJJ A;  1YET A;  4FMT A;  1BGQ A;  2VCJ A;  4DUH A;  4WUD A;  2WI3 A;  4GCZ A;  3A0X A;  5BOC A;  2YKC A;  1JM6 A;  2FWZ A;  4YKY A;  4FCQ A;  4LP0 A;  4LWI A;  2YI6 A;  1I5A A;  2UWD A;  4B7P A;  3JZ3 A;  2XHT A;  3PEH A;  2YE9 A;  3BM9 A;  5CTW A;  2JJC A;  5CTY A;  4CWR A;  3GIE A;  2YI7 A;  3A0Z A;  1MX0 A;  5CTX A;  4AS9 A;  5JEN A;  1YT0 A;  3CRK A;  1AH6 A;  5CTU A;  4YKR A;  5FWK A;  4PU9 A;  1YSZ A;  1B3Q A;  3LPS A;  3Q5K A;  4YKX A;  1I5C A;  2YGA A;  4LWG A;  1U2O A;  5J6A A;  2XX5 A;  3IED A;  4LWF A;  1UYD A;  2FWY A;  3T0Z A;  3A0Y A;  5D7C A;  1ZXN A;  3FV5 A;  2WI2 A;  1UY8 A;  3SL2 A;  2IWU A;  4XKA A;  4L90 A;  1YC4 A;  3R4O A;  4O05 A;  1UYK A;  3CGY A;  3S5T A;  4XCJ A;  2H8M A;  4MPE A;  4CWS A;  2ESA A;  3U67 A;  2YJX A;  2YEI A;  3G7E A;  4NH7 A;  1S16 A;  4XE2 A;  3ZKD A;  2YKJ A;  2IOQ A;  4L94 A;  5M4K A;  3A0T A;  4AWO A;  2C2A A;  4O04 A;  1ID0 A;  1TC0 A;  3ZM7 A;  4MP7 A;  4LWH A;  4E72 A;  2YGF A;  3O0I A;  3B24 A;  2C1I A;  1ZW9 A;  4PRV A;  3HZ1 A;  2YEJ A;  4HXW A;  2WEP A;  2XHX A;  2BSM A;  2YEB A;  4EGH A;  2BZ5 A;  1QYE A;  2XDS A;  5IDM A;  1UYG A;  1H7U A;  1TIL A;  1Y8N A;  2QF6 A;  3U2D A;  2BU7 A;  2YK9 A;  2XX4 A;  3HYZ A;  4KTN A;  2YJW A;  1QY8 A;  2XK2 A;  2JKI A;  3Q5J A;  2Q8I A;  2YE5 A;  2XDL A;  2GQP A;  4BIZ A;  4YKT A;  3K99 A;  3EKR A;  3RLQ A;  2WEQ A;  2WI6 A;  3B27 A;  5CPH A;  4E02 A;  4CWP A;  3T2S A;  2CGF A;  4XIT A;  1GJV A;  5FND A;  4WUB A;  5M4H A;  1QZR A;  3O2F A;  4U7N A;  1UY6 A;  3GIF A;  4XCL A;  4U7O A;  3TUH A;  2QFO A;  2VW5 A;  1MU5 A;  5M4E A;  2YKB A;  4O09 A;  1UYC A;  4L91 A;  4CWQ A;  3U2K A;  3GIG B;  3HZ5 A;  3CRL A;  2WI5 A;  4P8O A;  4LPB A;  2HG1 A;  4HY6 A;  3H4L A;  4YKU A;  2CCT A;  1B63 A;  3T1K A;  3R4M A;  2XJG A;  1F51 A;  4XD8 A;  1A4H A;  5FNF A;  2YE8 A;  2VWC A;  1YC3 A;  1TC6 A;  1UYH A;  1NHH A;  2BRC A;  3K97 A;  2BTZ A;  1BKN A;  3H80 A;  1BXD A;  4GEE A;  1AJ6 A;  4I5S A;  2YE6 A;  3INX A;  4Q20 A;  2QG2 A;  4CWN A;  2CCS A;  2FXS A;  2ZKJ A;  2FTK A;  3T0H A;  1YT1 A;  1Z5A A;  1UY9 A;  2YE2 A;  2Q2E B;  3OWB A;  1I5B A;  4CWO A;  3G7B A;  4XIP A;  3R92 A;  2WI4 A;  1YT2 A;  4L8Z A;  4V25 A;  1EA6 A;  1Z5B A;  2E0A A;  4PRX A;  3FT5 A;  5F5R A;  2ZBK B;  4EMV A;  4GT8 A;  5CF0 A;  2WI1 A;  4U93 A;  4EEH A;  2Q8F A;  1H7S A;  1YES A;  3CYG A;  4JAS A;  4MB9 A;  1Y4S A;  2YKE A;  2BYI A;  3ZXQ A;  2CCU A;  2XCM A;  2XDU A;  3PEJ A;  3ZXO A;  2BYH A;  4HZ0 A;  4W7T A;  3C11 A;  3K98 A;  2HHI A;  3EKO A;  3GIG A;  4FCP A;  4FCR A;  4P7A A;  5D7R A;  4FPP A;  4URO A;  5D6P A;  2YI0 A;  4ASB A;  4EGI A;  3DGE A;  2BU8 A;  1UYF A;  1EI1 A;  1IXM A;  4LWE A;  1THN A;  1YS3 A;  3INW A;  3WQ9 A;  3KE6 A;  1YER A;  4URM A;  1S14 A;  3RKZ A;  4DZY A;  4CWT A;  2FYP A;  2BT0 A;  1AM1 A;  1Y8O A;  4NH8 A;  5C93 A;  1AH8 A;  3OWD A;  5D7D A;  2GFD A;  4L93 A;  3BMY A;  3EHH A;  4HY1 A;  5L3J A;  2YE4 A;  3EHJ A;  2BU2 A;  2XDX A;  1ZWH A;  4BAE A;  1ZXM A;  4R1F A;  4XTJ A;  4E01 A;  4H7Q A;  2Q8G A;  3NMQ A;  3RLR A;  3CGZ A;  4KP4 A;  4BQJ A;  5IDJ A;  4KFG A;  3R91 A;  2IOR A;  2XJX A;  4HZ5 A;  3D2R A;  4HXZ A;  2VCI A;  1R62 A;  4QPJ A;  3TZ0 A;  3HHU A;  5GGZ A;  4R3A A;  3TZ5 A;  3VHC A;  2YKI A;  1PVG A;  4HYM A;  1B62 A;  2IOP A;  1TBW A;  3A0W A;  2C1G A;  4YKW A;  2WER A;  3TTZ A;  4JAU A;  4EFT A;  1I5D A;  4EM7 A;  4CE2 A;  4PL9 A;  2YEC A;  4YKZ A;  4NH9 A;  2YE7 A;  5M4M A;  1YC1 A;  1Z59 A;  3RLP A;  2XD6 A;  4O07 A;  2WI7 A;  3G75 A;  1UYE A;  2BRE A;  2IWS A;  3HYY A;  1UY7 A;  3OMU A;  3A0R A;  4XKK A;  2YGE A;  3B25 A;  3Q5L A;  3R4N A;  3T10 A;  2BU5 A;  2IWX A;  1OSF A;  2CG9 A;  3VAD A;  4CE3 A;  4CE1 A;  1Z5C A;  4BIU A;  2K5B A;  4AWP A;  2ZDX A;  2PNR A;  5M4P A;  5D6Q A;  3LNU A;  4B6C A;  1TID A;  1Y8P A;  1TH8 A;  3EHG A;  4ASG A;  4ZKI A;  4XDM A;  2CH4 A;  1NHI A;  4MP2 A;  1AMW A;  2Q8H A;  4XIQ A;  4ASA A;  4KSG A;  4I3H A;  1GKZ A;  2YEA A;  4MPC A;  4MOT A;  4KQV A;  4ZVI A;  1GKX A;  1UYM A;  2XAB A;  3TZ2 A;  2HCH A;  3OPD A;  3QTF A;  2QG0 A;  1Y4U A;  1BYQ A;  2YED A;  3B28 A;  4XKO A;  1US7 A;  2YK2 A;  3K60 A;  3EHF A;  4AWQ A;  4MPN A;  2XHR A;  1I59 A;  4GFN A;  3MNR P;  3TZ4 A;  5IN9 A;  4YKQ A;  2ZDY A;  5J71 A;  2HKJ A;  1L0O A;  3QDD A;  3VHD A;  4ASF A;  3FT8 A;  5FNC A;  1KIJ A;  4V26 A;  4XIR A;  4URN A;  5M4N A;  4H81 A;  4K4O A;  4R3M A;  3O6O A;  4EFU A;  4O0B A;  4WUC A;  3D36 A;  4E00 A;  1U0Z A;  1UYL A;  4QPK A;  4KSH A;  4XC0 A;  2YEF A;  2YEH A;  1YSR A;  4JAV A;  4X9L A;  3C0E A;  2O1V A;  2YEE A;  2XX2 A;  5BOD A;  2EXL A;  3ZKB A;  3B26 A;  3LMM A;  4GGL A;  2O1W A;  3R4P A;  4EGK A;  3VHA A;  4GQT A;  1UYI A;  2O1U A;  1KZN A;  4MBC A;  2BU6 A;  1NHJ A;  3CWV A;  2H55 A;  3WHA A;  2YE3 A;  4BQG A;  2YEG A;  4URL A;  4HYP A;  4BXI A;  3D0B A;  4CWF A;  2XDK A;  3HEK A;  1I58 A; 
#chains in the Genus database with same CATH homology
 4JQL A;  5F3K A;  2YI5 A;  2AKP A;  3OW6 A;  4H85 A;  2XJJ A;  1YET A;  4FMT A;  1BGQ A;  2VCJ A;  4DUH A;  4WUD A;  2WI3 A;  4GCZ A;  3A0X A;  5BOC A;  2YKC A;  1JM6 A;  2FWZ A;  4YKY A;  4FCQ A;  4LP0 A;  4LWI A;  2YI6 A;  1I5A A;  2UWD A;  4B7P A;  3JZ3 A;  2XHT A;  3PEH A;  2YE9 A;  3BM9 A;  5CTW A;  2JJC A;  5CTY A;  4CWR A;  3GIE A;  2YI7 A;  3A0Z A;  1MX0 A;  5CTX A;  4AS9 A;  1YT0 A;  3CRK A;  1AH6 A;  5CTU A;  4YKR A;  5FWK A;  4PU9 A;  1YSZ A;  1B3Q A;  3LPS A;  3Q5K A;  4YKX A;  1I5C A;  2YGA A;  4LWG A;  1U2O A;  5J6A A;  2XX5 A;  3IED A;  4LWF A;  1UYD A;  2FWY A;  3T0Z A;  3A0Y A;  5D7C A;  1ZXN A;  3FV5 A;  2WI2 A;  1UY8 A;  3SL2 A;  2IWU A;  4XKA A;  4L90 A;  1YC4 A;  3R4O A;  4O05 A;  1UYK A;  3CGY A;  4XCJ A;  2H8M A;  4MPE A;  4CWS A;  2ESA A;  3U67 A;  2YJX A;  2YEI A;  3G7E A;  4NH7 A;  1S16 A;  4XE2 A;  3ZKD A;  2YKJ A;  2IOQ A;  4L94 A;  5M4K A;  3A0T A;  4AWO A;  2C2A A;  4O04 A;  1ID0 A;  1TC0 A;  3ZM7 A;  4MP7 A;  4LWH A;  2YGF A;  3O0I A;  3B24 A;  1ZW9 A;  4PRV A;  3HZ1 A;  2YEJ A;  4HXW A;  2WEP A;  2XHX A;  2BSM A;  2YEB A;  4EGH A;  2BZ5 A;  1QYE A;  2XDS A;  5IDM A;  1UYG A;  1H7U A;  1TIL A;  1Y8N A;  2QF6 A;  3U2D A;  2BU7 A;  2YK9 A;  2XX4 A;  3HYZ A;  4KTN A;  2YJW A;  1QY8 A;  2XK2 A;  2JKI A;  3Q5J A;  2Q8I A;  2YE5 A;  2XDL A;  2GQP A;  4BIZ A;  4YKT A;  3K99 A;  3EKR A;  3RLQ A;  2WEQ A;  2WI6 A;  3B27 A;  5CPH A;  4E02 A;  4CWP A;  3T2S A;  2CGF A;  4XIT A;  1GJV A;  5FND A;  4WUB A;  5M4H A;  1QZR A;  3O2F A;  4U7N A;  1UY6 A;  3GIF A;  4XCL A;  4U7O A;  3TUH A;  2QFO A;  2VW5 A;  1MU5 A;  5M4E A;  2YKB A;  4O09 A;  1UYC A;  4L91 A;  4CWQ A;  3U2K A;  3GIG B;  3HZ5 A;  3CRL A;  2WI5 A;  4P8O A;  4LPB A;  2HG1 A;  4HY6 A;  3H4L A;  4YKU A;  2CCT A;  1B63 A;  3T1K A;  3R4M A;  2XJG A;  4XD8 A;  1A4H A;  5FNF A;  2YE8 A;  2VWC A;  1YC3 A;  1TC6 A;  1UYH A;  1NHH A;  2BRC A;  3K97 A;  2BTZ A;  1BKN A;  3H80 A;  1BXD A;  4GEE A;  1AJ6 A;  4I5S A;  2YE6 A;  3INX A;  4Q20 A;  2QG2 A;  4CWN A;  2CCS A;  2FXS A;  2ZKJ A;  3T0H A;  1YT1 A;  1Z5A A;  1UY9 A;  2YE2 A;  2Q2E B;  3OWB A;  1I5B A;  4CWO A;  3G7B A;  4XIP A;  3R92 A;  2WI4 A;  1YT2 A;  4L8Z A;  4V25 A;  1EA6 A;  1Z5B A;  2E0A A;  4PRX A;  3FT5 A;  5F5R A;  2ZBK B;  4EMV A;  4GT8 A;  5CF0 A;  2WI1 A;  4U93 A;  4EEH A;  2Q8F A;  1H7S A;  1YES A;  4JAS A;  4MB9 A;  1Y4S A;  2YKE A;  2BYI A;  3ZXQ A;  2CCU A;  2XCM A;  2XDU A;  3PEJ A;  3ZXO A;  2BYH A;  4HZ0 A;  4W7T A;  3C11 A;  3K98 A;  3EKO A;  3GIG A;  4FCP A;  4FCR A;  4P7A A;  5D7R A;  4FPP A;  4URO A;  5D6P A;  2YI0 A;  4ASB A;  4EGI A;  3DGE A;  2BU8 A;  1EI1 A;  1UYF A;  4LWE A;  1THN A;  1YS3 A;  3INW A;  3WQ9 A;  3KE6 A;  1YER A;  4URM A;  1S14 A;  3RKZ A;  4DZY A;  4CWT A;  2FYP A;  2BT0 A;  1AM1 A;  1Y8O A;  4NH8 A;  5C93 A;  1AH8 A;  3OWD A;  5D7D A;  2GFD A;  4L93 A;  3BMY A;  3EHH A;  4HY1 A;  5L3J A;  2YE4 A;  3EHJ A;  2BU2 A;  2XDX A;  1ZWH A;  4BAE A;  1ZXM A;  4R1F A;  4XTJ A;  4E01 A;  4H7Q A;  2Q8G A;  3NMQ A;  3RLR A;  3CGZ A;  4KP4 A;  4BQJ A;  5IDJ A;  4KFG A;  3R91 A;  2IOR A;  2XJX A;  4HZ5 A;  3D2R A;  4HXZ A;  2VCI A;  1R62 A;  4QPJ A;  3TZ0 A;  3HHU A;  5GGZ A;  4R3A A;  3TZ5 A;  3VHC A;  2YKI A;  1PVG A;  4HYM A;  1B62 A;  2IOP A;  1TBW A;  3A0W A;  4YKW A;  2WER A;  3TTZ A;  4JAU A;  4EFT A;  1I5D A;  4EM7 A;  4CE2 A;  4PL9 A;  2YEC A;  4YKZ A;  4NH9 A;  2YE7 A;  5M4M A;  1YC1 A;  1Z59 A;  3RLP A;  2XD6 A;  4O07 A;  2WI7 A;  3G75 A;  1UYE A;  2BRE A;  2IWS A;  3HYY A;  1UY7 A;  3OMU A;  3A0R A;  4XKK A;  2YGE A;  3B25 A;  3Q5L A;  3R4N A;  3T10 A;  2BU5 A;  2IWX A;  1OSF A;  2CG9 A;  3VAD A;  4CE3 A;  4CE1 A;  1Z5C A;  4BIU A;  2K5B A;  4AWP A;  2ZDX A;  2PNR A;  5M4P A;  5D6Q A;  3LNU A;  4B6C A;  1TID A;  1Y8P A;  1TH8 A;  3EHG A;  4ASG A;  4ZKI A;  4XDM A;  2CH4 A;  1NHI A;  4MP2 A;  1AMW A;  2Q8H A;  4XIQ A;  4ASA A;  4KSG A;  4I3H A;  1GKZ A;  2YEA A;  4MPC A;  4MOT A;  4KQV A;  4ZVI A;  1GKX A;  1UYM A;  2XAB A;  3TZ2 A;  2HCH A;  3OPD A;  3QTF A;  2QG0 A;  1Y4U A;  1BYQ A;  2YED A;  3B28 A;  4XKO A;  1US7 A;  2YK2 A;  3K60 A;  3EHF A;  4AWQ A;  4MPN A;  2XHR A;  1I59 A;  4GFN A;  3MNR P;  3TZ4 A;  5IN9 A;  4YKQ A;  2ZDY A;  5J71 A;  2HKJ A;  1L0O A;  3QDD A;  3VHD A;  4ASF A;  3FT8 A;  5FNC A;  1KIJ A;  4V26 A;  4XIR A;  4URN A;  5M4N A;  4H81 A;  4K4O A;  4R3M A;  3O6O A;  4EFU A;  4O0B A;  4WUC A;  3D36 A;  4E00 A;  1U0Z A;  1UYL A;  4QPK A;  4KSH A;  4XC0 A;  2YEF A;  2YEH A;  1YSR A;  4JAV A;  4X9L A;  3C0E A;  2O1V A;  2YEE A;  2XX2 A;  5BOD A;  2EXL A;  3ZKB A;  3B26 A;  4GGL A;  2O1W A;  3R4P A;  4EGK A;  3VHA A;  4GQT A;  1UYI A;  2O1U A;  1KZN A;  4MBC A;  2BU6 A;  1NHJ A;  2H55 A;  3CWV A;  3WHA A;  2YE3 A;  4BQG A;  2YEG A;  4URL A;  4HYP A;  4BXI A;  3D0B A;  4CWF A;  2XDK A;  3HEK A;  1I58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...