5IDMA

Bifunctional histidine kinase ccka (domain, ca) in complex with c-di-gmp and amppnp/mg2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
177
structure length
177
Chain Sequence
VQREVLDLGELISEFEVLLRRLLREDVKLITDYGRDLPQVRADKSQLETAVMNLAVNARDAVRAAKGGGVVRIRTARLTRDEAIQLGFPAADGDTAFIEVSDDGPGIPPDVMGKIFDPFFTTKPVGEGTGLGLATVYGIVKQSDGWIHVHSRPNEGAAFRIFLPVYEAPAALEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell cycle histidine kinase CckA
publication title Cyclic di-GMP mediates a histidine kinase/phosphatase switch by noncovalent domain cross-linking.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase
total genus 44
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5idmA00
2QG2A 4P8OA 4GQTA 1GKZA 1Z5AA 3B25A 4XDMA 4BAEA 2WI5A 2Q2EB 1U0ZA 2YKJA 2YI7A 3TZ4A 3R92A 4AWQA 3A0TA 1YT0A 2XK2A 4MOTA 3VADA 2YKBA 1NHIA 2YKCA 1ZXMA 1MU5A 4EM7A 2BZ5A 1UYLA 4KFGA 3IEDA 3CWVA 3R4OA 4MP2A 4FMTA 1TC6A 3H80A 2WERA 2Q8HA 4QPKA 1YC3A 2H8MA 1UY8A 4BIZA 3Q5LA 2XX5A 1TIDA 1QY8A 5C93A 2YEEA 3O0IA 4H81A 4U93A 4H85A 3WQ9A 1I5BA 1A4HA 1AJ6A 2JKIA 4JAVA 4YKQA 1I5DA 4FPPA 2BYHA 3QTFA 1YS3A 3R4MA 1KIJA 4YKXA 1I5AA 1Y4UA 2VW5A 4XCLA 4E00A 1THNA 3GIGB 3TZ5A 2GQPA 1ZXNA 5BODA 4EMVA 3SL2A 2CCTA 2YEIA 1NHJA 3EHJA 1AH6A 1JM6A 4CE2A 1YC4A 3INWA 2YEJA 1TH8A 1UYDA 4ASGA 3HYZA 3EHGA 1YESA 4LWFA 4H7QA 2IOQA 2VWCA 3OWDA 4U7NA 3TUHA 4XCJA 1BYQA 3R91A 3BMYA 3G75A 1YT2A 4L94A 4WUBA 4ASFA 2O1UA 3A0ZA 1BXDA 3FV5A 5D6PA 3VHDA 3RLQA 2AKPA 2YGAA 1I5CA 1YERA 2XHXA 1UYGA 3T0HA 1OSFA 4KSGA 2K5BA 3G7BA 1YT1A 4HY1A 4ZKIA 4HXWA 2XCMA 4MPEA 4O07A 4XITA 4GFNA 2YGFA 1TBWA 2YEFA 1ZWHA 2GFDA 1I59A 2YK2A 3D2RA 3A0WA 4BIUA 2BU5A 4GT8A 4BQGA 5IDJA 1UYKA 4EFTA 2YJXA 2YGEA 1UYFA 3BM9A 2WI2A 4NH9A 3ZXQA 4GCZA 1Y8OA 5CTWA 2BU2A 4KP4A 2YEBA 4ASAA 2WEPA 4CWNA 1GJVA 4L8ZA 4ZVIA 3PEHA 4DZYA 3T1KA 4LP0A 4LWGA 3ZKDA 1H7UA 5M4EA 4K4OA 5CTYA 1UYCA 3CGYA 4LPBA 4AWPA 4CWQA 4BXIA 2BRCA 2UWDA 2XD6A 3JZ3A 4YKYA 1QZRA 3CGZA 4CWPA 4EEHA 5CF0A 4HYMA 1ZW9A 2YE4A 1I58A 2H55A 2IWSA 2CCUA 3HHUA 1UYEA 4CE1A 2ZKJA 4GGLA 3Q5KA 1KZNA 4KQVA 1YSZA 1AM1A 2VCJA 3HYYA 5D7RA 4W7TA 3H4LA 4XIRA 3LNUA 4KTNA 2CCSA 4XC0A 3RLRA 3O6OA 4E02A 4DUHA 4PU9A 3EHHA 3C0EA 2O1VA 2CH4A 4FCPA 3D36A 4I5SA 1YSRA 4AS9A 1Z59A 1UY7A 5CPHA 2YE3A 1TC0A 2XJXA 5F3KA 2WI6A 2XJJA 4XKAA 4MPCA 4CWOA 1L0OA 2YE7A 4LWIA 4AWOA 3KE6A 4PRVA 4O05A 2IWUA 1U2OA 2EXLA 1H7SA 1B62A 2XX2A 2ESAA 4XKKA 4CWTA 5FWKA 3K98A 5J71A 4Q20A 4L93A 4NH8A 3A0XA 2FXSA 1US7A 2WI1A 4HZ5A 1B3QA 4EGIA 1Z5BA 2XDSA 3K99A 4O09A 1GKXA 2WI3A 4HY6A 2VCIA 2YK9A 3TTZA 2YE2A 1UY9A 2BYIA 2CG9A 4NH7A 4CWSA 3ZKBA 3TZ2A 1BKNA 3MNRP 2BU7A 4V25A 1TILA 1NHHA 4R3AA 1BGQA 2QF6A 2XHRA 1UYIA 3TZ0A 4KSHA 1UYHA 3D0BA 4URMA 2YEHA 4LWEA 4O04A 2IOPA 3A0YA 3QDDA 4CWFA 4EGKA 5FNDA 5L3JA 3A0RA 4XE2A 1QYEA 3FT8A 2YEAA 4YKZA 1S14A 3T10A 2ZDYA 3PEJA 2YECA 4YKUA 2YJWA 4URNA 4X9LA 2WEQA 2YE5A 4HZ0A 1Z5CA 1EI1A 5M4PA 5GGZA 1AH8A 4JAUA 4HXZA 4LWHA 5IN9A 2CGFA 2PNRA 3EKRA 3OW6A 3B27A 3O2FA 4XIQA 3T0ZA 3Q5JA 3RLPA 3ZM7A 4PRXA 4XIPA 2YE6A 3EKOA 2QG0A 1UY6A 5FNFA 3HZ1A 4EFUA 4MB9A 4EGHA 2ZDXA 3C11A 4FCRA 2JJCA 4YKTA 2FYPA 5D7DA 4CE3A 2Q8IA 3CRLA 5CTUA 4U7OA 4P7AA 4URLA 1PVGA 2C2AA 2XDLA 3G7EA 5M4NA 2BREA 2BSMA 1UYMA 1MX0A 3R4NA 4UROA 4JQLA 3ZXOA 3INXA 4CWRA 3FT5A 4B6CA 4WUDA 2XX4A 3R4PA 2YEDA 1Y4SA 2XDXA 4BQJA 3K97A 2XHTA 2IORA 1S16A 4E01A 2YI6A 5M4KA 5F5RA 5CTXA 3HEKA 5J6AA 4R1FA 2YI0A 4MPNA 4O0BA 2FWYA 4JASA 2E0AA 2QFOA 2IWXA 4V26A 1YETA 2BU8A 3B28A 1EA6A 4L91A 1AMWA 1Y8NA 4FCQA 2YE8A 4I3HA 3WHAA 3RKZA 2HG1A 1R62A 5FNCA 5BOCA 3DGEA 4YKRA 2XABA 4MBCA 3NMQA 2YKEA 3EHFA 4YKWA 5M4HA 3OPDA 4GEEA 3GIFA 4PL9A 3T2SA 4XKOA 4QPJA 2XDKA 2HCHA 2YEGA 2YKIA 2BT0A 2Q8GA 2FWZA 2HKJA 1Y8PA 3B26A 3U67A 4R3MA 3VHCA 3U2KA 3OMUA 4ASBA 2YI5A 2O1WA 1B63A 2WI7A 3VHAA 4XTJA 2ZBKB 1ID0A 3B24A 2XJGA 1YC1A 5IDMA 3U2DA 3CRKA 3K60A 2XDUA 3HZ5A 2BU6A 4HYPA 5D6QA 3GIGA 2Q8FA 4B7PA 4MP7A 4XD8A 2YE9A 2WI4A 4L90A 5D7CA 3LPSA 5M4MA 3GIEA 2BTZA 4WUCA 3OWBA
chains in the Genus database with same CATH superfamily
2QG2A 4P8OA 4GQTA 1GKZA 1Z5AA 3B25A 4XDMA 4BAEA 2WI5A 2Q2EB 1U0ZA 2YKJA 2YI7A 3TZ4A 3R92A 2FTKA 4AWQA 3A0TA 1YT0A 2XK2A 4MOTA 3VADA 2YKBA 1NHIA 2YKCA 1ZXMA 1MU5A 4EM7A 2BZ5A 1UYLA 4KFGA 3IEDA 3CWVA 3R4OA 4MP2A 4FMTA 1TC6A 3H80A 2WERA 2Q8HA 4QPKA 1YC3A 2H8MA 1UY8A 4BIZA 3Q5LA 2XX5A 1TIDA 1QY8A 5C93A 2YEEA 3O0IA 4H81A 4U93A 4H85A 3WQ9A 1I5BA 1A4HA 1AJ6A 2JKIA 4JAVA 4YKQA 1I5DA 4FPPA 2BYHA 3QTFA 1YS3A 3R4MA 1KIJA 4YKXA 1I5AA 1Y4UA 2VW5A 4XCLA 4E00A 1THNA 3GIGB 3TZ5A 2GQPA 1ZXNA 5BODA 5JENA 4EMVA 3SL2A 2CCTA 2YEIA 1NHJA 3EHJA 1AH6A 1JM6A 4CE2A 1YC4A 3INWA 2YEJA 1TH8A 1UYDA 4ASGA 3S5TA 3HYZA 3EHGA 1YESA 4LWFA 4H7QA 2IOQA 2VWCA 3OWDA 4U7NA 3TUHA 4XCJA 1BYQA 3R91A 3BMYA 3G75A 1YT2A 4L94A 4WUBA 4ASFA 2O1UA 3A0ZA 1BXDA 3FV5A 5D6PA 3VHDA 3RLQA 2AKPA 2YGAA 1I5CA 1YERA 2XHXA 1UYGA 3T0HA 1OSFA 4KSGA 2K5BA 3G7BA 1YT1A 4HY1A 4ZKIA 4HXWA 2XCMA 4MPEA 4O07A 4XITA 4GFNA 2YGFA 1TBWA 2YEFA 3CYGA 1ZWHA 2GFDA 1I59A 2YK2A 3D2RA 3A0WA 4BIUA 2BU5A 4GT8A 4BQGA 5IDJA 1UYKA 4EFTA 2YJXA 2YGEA 1UYFA 3BM9A 2WI2A 4NH9A 3ZXQA 4GCZA 1Y8OA 5CTWA 2BU2A 4KP4A 2YEBA 4ASAA 2WEPA 4CWNA 1GJVA 4L8ZA 4ZVIA 3PEHA 4DZYA 3T1KA 4LP0A 4LWGA 3ZKDA 1H7UA 5M4EA 4K4OA 5CTYA 1UYCA 3CGYA 4LPBA 4AWPA 4CWQA 4BXIA 2BRCA 2UWDA 2XD6A 3JZ3A 4YKYA 1QZRA 3CGZA 4CWPA 4EEHA 5CF0A 4HYMA 1ZW9A 2YE4A 1I58A 2H55A 2IWSA 2CCUA 3HHUA 1UYEA 4CE1A 1F51A 2ZKJA 4GGLA 3Q5KA 1KZNA 4KQVA 1YSZA 1AM1A 2C1GA 2VCJA 3HYYA 5D7RA 4W7TA 3H4LA 4XIRA 3LNUA 4KTNA 2CCSA 4XC0A 3RLRA 3O6OA 4E02A 2C1IA 4DUHA 4PU9A 3EHHA 3C0EA 2O1VA 2CH4A 4FCPA 3D36A 4I5SA 1YSRA 4AS9A 1Z59A 1UY7A 5CPHA 2YE3A 1TC0A 2XJXA 5F3KA 2WI6A 2XJJA 4XKAA 4MPCA 4CWOA 1L0OA 2YE7A 4LWIA 4AWOA 3KE6A 4PRVA 4O05A 2IWUA 1U2OA 2EXLA 1H7SA 1B62A 2XX2A 2ESAA 4XKKA 4CWTA 5FWKA 3K98A 5J71A 4Q20A 4L93A 4NH8A 3A0XA 2FXSA 1US7A 2WI1A 4HZ5A 1B3QA 4EGIA 1Z5BA 2XDSA 3K99A 4O09A 1GKXA 2WI3A 4HY6A 2VCIA 2YK9A 3TTZA 2YE2A 1UY9A 2BYIA 2CG9A 4NH7A 4CWSA 3ZKBA 3TZ2A 1BKNA 3MNRP 2BU7A 4V25A 1TILA 1NHHA 4R3AA 1BGQA 2QF6A 2XHRA 1UYIA 3TZ0A 4KSHA 1UYHA 3D0BA 4URMA 2YEHA 4LWEA 4O04A 2IOPA 3A0YA 3QDDA 4CWFA 4EGKA 5FNDA 5L3JA 3A0RA 4XE2A 1QYEA 3FT8A 2YEAA 4YKZA 1S14A 3T10A 2ZDYA 3PEJA 2YECA 4YKUA 2YJWA 4URNA 4X9LA 2WEQA 2YE5A 4HZ0A 1Z5CA 1EI1A 5M4PA 5GGZA 1AH8A 4JAUA 4HXZA 4LWHA 4E72A 5IN9A 2CGFA 2PNRA 3EKRA 3OW6A 3B27A 3O2FA 3LMMA 4XIQA 3T0ZA 3Q5JA 3RLPA 3ZM7A 4PRXA 4XIPA 2YE6A 3EKOA 2QG0A 1UY6A 5FNFA 3HZ1A 4EFUA 4MB9A 4EGHA 2ZDXA 3C11A 4FCRA 2JJCA 4YKTA 2FYPA 5D7DA 4CE3A 2Q8IA 3CRLA 5CTUA 4U7OA 4P7AA 4URLA 1PVGA 1IXMA 2C2AA 2XDLA 3G7EA 5M4NA 2BREA 2BSMA 1UYMA 1MX0A 3R4NA 4UROA 4JQLA 3ZXOA 3INXA 4CWRA 3FT5A 4B6CA 4WUDA 2XX4A 3R4PA 2YEDA 1Y4SA 2XDXA 4BQJA 3K97A 2XHTA 2IORA 1S16A 4E01A 2YI6A 5M4KA 5F5RA 5CTXA 3HEKA 5J6AA 4R1FA 2YI0A 4MPNA 4O0BA 2FWYA 4JASA 2E0AA 2QFOA 2IWXA 4V26A 1YETA 2BU8A 3B28A 1EA6A 4L91A 1AMWA 1Y8NA 4FCQA 2YE8A 4I3HA 3WHAA 3RKZA 2HG1A 1R62A 5FNCA 5BOCA 3DGEA 4YKRA 2XABA 4MBCA 3NMQA 2YKEA 3EHFA 4YKWA 5M4HA 3OPDA 4GEEA 3GIFA 4PL9A 3T2SA 4XKOA 4QPJA 2XDKA 2HCHA 2YEGA 2YKIA 2BT0A 2Q8GA 2FWZA 2HKJA 1Y8PA 3B26A 3U67A 4R3MA 3VHCA 3U2KA 3OMUA 4ASBA 2YI5A 2O1WA 1B63A 2WI7A 3VHAA 4XTJA 2ZBKB 1ID0A 3B24A 2XJGA 1YC1A 5IDMA 3U2DA 3CRKA 3K60A 2XDUA 3HZ5A 2BU6A 4HYPA 5D6QA 3GIGA 2Q8FA 4B7PA 4MP7A 4XD8A 2YE9A 2WI4A 4L90A 5D7CA 3LPSA 5M4MA 3GIEA 2BTZA 2HHIA 4WUCA 3OWBA
chains in the Genus database with same CATH topology
2QG2A 4P8OA 4GQTA 1GKZA 1Z5AA 3B25A 4XDMA 4BAEA 2WI5A 2Q2EB 1U0ZA 2YKJA 2YI7A 3TZ4A 3R92A 4AWQA 3A0TA 1YT0A 2XK2A 4MOTA 3VADA 2YKBA 1NHIA 2YKCA 1ZXMA 1MU5A 4EM7A 2BZ5A 1UYLA 4KFGA 3IEDA 3CWVA 3R4OA 4MP2A 4FMTA 1TC6A 3H80A 2WERA 2Q8HA 4QPKA 1YC3A 2H8MA 1UY8A 4BIZA 3Q5LA 2XX5A 1TIDA 1QY8A 5C93A 2YEEA 3O0IA 4H81A 4U93A 4H85A 3WQ9A 1I5BA 1A4HA 1AJ6A 2JKIA 4JAVA 4YKQA 1I5DA 4FPPA 2BYHA 3QTFA 1YS3A 3R4MA 1KIJA 4YKXA 1I5AA 1Y4UA 2VW5A 4XCLA 4E00A 1THNA 3GIGB 3TZ5A 2GQPA 1ZXNA 5BODA 4EMVA 3SL2A 2CCTA 2YEIA 1NHJA 3EHJA 1AH6A 1JM6A 4CE2A 1YC4A 3INWA 2YEJA 1TH8A 1UYDA 4ASGA 3HYZA 3EHGA 1YESA 4LWFA 4H7QA 2IOQA 2VWCA 3OWDA 4U7NA 3TUHA 4XCJA 1BYQA 3R91A 3BMYA 3G75A 1YT2A 4L94A 4WUBA 4ASFA 2O1UA 3A0ZA 1BXDA 3FV5A 5D6PA 3VHDA 3RLQA 2AKPA 2YGAA 1I5CA 1YERA 2XHXA 1UYGA 3T0HA 1OSFA 4KSGA 2K5BA 3G7BA 1YT1A 4HY1A 4ZKIA 4HXWA 2XCMA 4MPEA 4O07A 4XITA 4GFNA 2YGFA 1TBWA 2YEFA 1ZWHA 2GFDA 1I59A 2YK2A 3D2RA 3A0WA 4BIUA 2BU5A 4GT8A 4BQGA 5IDJA 1UYKA 4EFTA 2YJXA 2YGEA 1UYFA 3BM9A 2WI2A 4NH9A 3ZXQA 4GCZA 1Y8OA 5CTWA 2BU2A 4KP4A 2YEBA 4ASAA 2WEPA 4CWNA 1GJVA 4L8ZA 4ZVIA 3PEHA 4DZYA 3T1KA 4LP0A 4LWGA 3ZKDA 1H7UA 5M4EA 4K4OA 5CTYA 1UYCA 3CGYA 4LPBA 4AWPA 4CWQA 4BXIA 2BRCA 2UWDA 2XD6A 3JZ3A 4YKYA 1QZRA 3CGZA 4CWPA 4EEHA 5CF0A 4HYMA 1ZW9A 2YE4A 1I58A 2H55A 2IWSA 2CCUA 3HHUA 1UYEA 4CE1A 2ZKJA 4GGLA 3Q5KA 1KZNA 4KQVA 1YSZA 1AM1A 2VCJA 3HYYA 5D7RA 4W7TA 3H4LA 4XIRA 3LNUA 4KTNA 2CCSA 4XC0A 3RLRA 3O6OA 4E02A 4DUHA 4PU9A 3EHHA 3C0EA 2O1VA 2CH4A 4FCPA 3D36A 4I5SA 1YSRA 4AS9A 1Z59A 1UY7A 5CPHA 2YE3A 1TC0A 2XJXA 5F3KA 2WI6A 2XJJA 4XKAA 4MPCA 4CWOA 1L0OA 2YE7A 4LWIA 4AWOA 3KE6A 4PRVA 4O05A 2IWUA 1U2OA 2EXLA 1H7SA 1B62A 2XX2A 2ESAA 4XKKA 4CWTA 5FWKA 3K98A 5J71A 4Q20A 4L93A 4NH8A 3A0XA 2FXSA 1US7A 2WI1A 4HZ5A 1B3QA 4EGIA 1Z5BA 2XDSA 3K99A 4O09A 1GKXA 2WI3A 4HY6A 2VCIA 2YK9A 3TTZA 2YE2A 1UY9A 2BYIA 2CG9A 4NH7A 4CWSA 3ZKBA 3TZ2A 1BKNA 3MNRP 2BU7A 4V25A 1TILA 1NHHA 4R3AA 1BGQA 2QF6A 2XHRA 1UYIA 3TZ0A 4KSHA 1UYHA 3D0BA 4URMA 2YEHA 4LWEA 4O04A 2IOPA 3A0YA 3QDDA 4CWFA 4EGKA 5FNDA 5L3JA 3A0RA 4XE2A 1QYEA 3FT8A 2YEAA 4YKZA 1S14A 3T10A 2ZDYA 3PEJA 2YECA 4YKUA 2YJWA 4URNA 4X9LA 2WEQA 2YE5A 4HZ0A 1Z5CA 1EI1A 5M4PA 5GGZA 1AH8A 4JAUA 4HXZA 4LWHA 5IN9A 2CGFA 2PNRA 3EKRA 3OW6A 3B27A 3O2FA 4XIQA 3T0ZA 3Q5JA 3RLPA 3ZM7A 4PRXA 4XIPA 2YE6A 3EKOA 2QG0A 1UY6A 5FNFA 3HZ1A 4EFUA 4MB9A 4EGHA 2ZDXA 3C11A 4FCRA 2JJCA 4YKTA 2FYPA 5D7DA 4CE3A 2Q8IA 3CRLA 5CTUA 4U7OA 4P7AA 4URLA 1PVGA 2C2AA 2XDLA 3G7EA 5M4NA 2BREA 2BSMA 1UYMA 1MX0A 3R4NA 4UROA 4JQLA 3ZXOA 3INXA 4CWRA 3FT5A 4B6CA 4WUDA 2XX4A 3R4PA 2YEDA 1Y4SA 2XDXA 4BQJA 3K97A 2XHTA 2IORA 1S16A 4E01A 2YI6A 5M4KA 5F5RA 5CTXA 3HEKA 5J6AA 4R1FA 2YI0A 4MPNA 4O0BA 2FWYA 4JASA 2E0AA 2QFOA 2IWXA 4V26A 1YETA 2BU8A 3B28A 1EA6A 4L91A 1AMWA 1Y8NA 4FCQA 2YE8A 4I3HA 3WHAA 3RKZA 2HG1A 1R62A 5FNCA 5BOCA 3DGEA 4YKRA 2XABA 4MBCA 3NMQA 2YKEA 3EHFA 4YKWA 5M4HA 3OPDA 4GEEA 3GIFA 4PL9A 3T2SA 4XKOA 4QPJA 2XDKA 2HCHA 2YEGA 2YKIA 2BT0A 2Q8GA 2FWZA 2HKJA 1Y8PA 3B26A 3U67A 4R3MA 3VHCA 3U2KA 3OMUA 4ASBA 2YI5A 2O1WA 1B63A 2WI7A 3VHAA 4XTJA 2ZBKB 1ID0A 3B24A 2XJGA 1YC1A 5IDMA 3U2DA 3CRKA 3K60A 2XDUA 3HZ5A 2BU6A 4HYPA 5D6QA 3GIGA 2Q8FA 4B7PA 4MP7A 4XD8A 2YE9A 2WI4A 4L90A 5D7CA 3LPSA 5M4MA 3GIEA 2BTZA 4WUCA 3OWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QG2 A;  4P8O A;  4GQT A;  1GKZ A;  1Z5A A;  3B25 A;  4XDM A;  4BAE A;  2WI5 A;  2Q2E B;  1U0Z A;  2YKJ A;  2YI7 A;  3TZ4 A;  3R92 A;  4AWQ A;  3A0T A;  1YT0 A;  2XK2 A;  4MOT A;  3VAD A;  2YKB A;  1NHI A;  2YKC A;  1ZXM A;  1MU5 A;  4EM7 A;  2BZ5 A;  1UYL A;  4KFG A;  3IED A;  3CWV A;  3R4O A;  4MP2 A;  4FMT A;  1TC6 A;  3H80 A;  2WER A;  2Q8H A;  4QPK A;  1YC3 A;  2H8M A;  1UY8 A;  4BIZ A;  3Q5L A;  2XX5 A;  1TID A;  1QY8 A;  5C93 A;  2YEE A;  3O0I A;  4H81 A;  4U93 A;  4H85 A;  3WQ9 A;  1I5B A;  1A4H A;  1AJ6 A;  2JKI A;  4JAV A;  4YKQ A;  1I5D A;  4FPP A;  2BYH A;  3QTF A;  1YS3 A;  3R4M A;  1KIJ A;  4YKX A;  1I5A A;  1Y4U A;  2VW5 A;  4XCL A;  4E00 A;  1THN A;  3GIG B;  3TZ5 A;  2GQP A;  1ZXN A;  5BOD A;  4EMV A;  3SL2 A;  2CCT A;  2YEI A;  1NHJ A;  3EHJ A;  1AH6 A;  1JM6 A;  4CE2 A;  1YC4 A;  3INW A;  2YEJ A;  1TH8 A;  1UYD A;  4ASG A;  3HYZ A;  3EHG A;  1YES A;  4LWF A;  4H7Q A;  2IOQ A;  2VWC A;  3OWD A;  4U7N A;  3TUH A;  4XCJ A;  1BYQ A;  3R91 A;  3BMY A;  3G75 A;  1YT2 A;  4L94 A;  4WUB A;  4ASF A;  2O1U A;  3A0Z A;  1BXD A;  3FV5 A;  5D6P A;  3VHD A;  3RLQ A;  2AKP A;  2YGA A;  1I5C A;  1YER A;  2XHX A;  1UYG A;  3T0H A;  1OSF A;  4KSG A;  2K5B A;  3G7B A;  1YT1 A;  4HY1 A;  4ZKI A;  4HXW A;  2XCM A;  4MPE A;  4O07 A;  4XIT A;  4GFN A;  2YGF A;  1TBW A;  2YEF A;  1ZWH A;  2GFD A;  1I59 A;  2YK2 A;  3D2R A;  3A0W A;  4BIU A;  2BU5 A;  4GT8 A;  4BQG A;  5IDJ A;  1UYK A;  4EFT A;  2YJX A;  2YGE A;  1UYF A;  3BM9 A;  2WI2 A;  4NH9 A;  3ZXQ A;  4GCZ A;  1Y8O A;  5CTW A;  2BU2 A;  4KP4 A;  2YEB A;  4ASA A;  2WEP A;  4CWN A;  1GJV A;  4L8Z A;  4ZVI A;  3PEH A;  4DZY A;  3T1K A;  4LP0 A;  4LWG A;  3ZKD A;  1H7U A;  5M4E A;  4K4O A;  5CTY A;  1UYC A;  3CGY A;  4LPB A;  4AWP A;  4CWQ A;  4BXI A;  2BRC A;  2UWD A;  2XD6 A;  3JZ3 A;  4YKY A;  1QZR A;  3CGZ A;  4CWP A;  4EEH A;  5CF0 A;  4HYM A;  1ZW9 A;  2YE4 A;  1I58 A;  2H55 A;  2IWS A;  2CCU A;  3HHU A;  1UYE A;  4CE1 A;  2ZKJ A;  4GGL A;  3Q5K A;  1KZN A;  4KQV A;  1YSZ A;  1AM1 A;  2VCJ A;  3HYY A;  5D7R A;  4W7T A;  3H4L A;  4XIR A;  3LNU A;  4KTN A;  2CCS A;  4XC0 A;  3RLR A;  3O6O A;  4E02 A;  4DUH A;  4PU9 A;  3EHH A;  3C0E A;  2O1V A;  2CH4 A;  4FCP A;  3D36 A;  4I5S A;  1YSR A;  4AS9 A;  1Z59 A;  1UY7 A;  5CPH A;  2YE3 A;  1TC0 A;  2XJX A;  5F3K A;  2WI6 A;  2XJJ A;  4XKA A;  4MPC A;  4CWO A;  1L0O A;  2YE7 A;  4LWI A;  4AWO A;  3KE6 A;  4PRV A;  4O05 A;  2IWU A;  1U2O A;  2EXL A;  1H7S A;  1B62 A;  2XX2 A;  2ESA A;  4XKK A;  4CWT A;  5FWK A;  3K98 A;  5J71 A;  4Q20 A;  4L93 A;  4NH8 A;  3A0X A;  2FXS A;  1US7 A;  2WI1 A;  4HZ5 A;  1B3Q A;  4EGI A;  1Z5B A;  2XDS A;  3K99 A;  4O09 A;  1GKX A;  2WI3 A;  4HY6 A;  2VCI A;  2YK9 A;  3TTZ A;  2YE2 A;  1UY9 A;  2BYI A;  2CG9 A;  4NH7 A;  4CWS A;  3ZKB A;  3TZ2 A;  1BKN A;  3MNR P;  2BU7 A;  4V25 A;  1TIL A;  1NHH A;  4R3A A;  1BGQ A;  2QF6 A;  2XHR A;  1UYI A;  3TZ0 A;  4KSH A;  1UYH A;  3D0B A;  4URM A;  2YEH A;  4LWE A;  4O04 A;  2IOP A;  3A0Y A;  3QDD A;  4CWF A;  4EGK A;  5FND A;  5L3J A;  3A0R A;  4XE2 A;  1QYE A;  3FT8 A;  2YEA A;  4YKZ A;  1S14 A;  3T10 A;  2ZDY A;  3PEJ A;  2YEC A;  4YKU A;  2YJW A;  4URN A;  4X9L A;  2WEQ A;  2YE5 A;  4HZ0 A;  1Z5C A;  1EI1 A;  5M4P A;  5GGZ A;  1AH8 A;  4JAU A;  4HXZ A;  4LWH A;  5IN9 A;  2CGF A;  2PNR A;  3EKR A;  3OW6 A;  3B27 A;  3O2F A;  4XIQ A;  3T0Z A;  3Q5J A;  3RLP A;  3ZM7 A;  4PRX A;  4XIP A;  2YE6 A;  3EKO A;  2QG0 A;  1UY6 A;  5FNF A;  3HZ1 A;  4EFU A;  4MB9 A;  4EGH A;  2ZDX A;  3C11 A;  4FCR A;  2JJC A;  4YKT A;  2FYP A;  5D7D A;  4CE3 A;  2Q8I A;  3CRL A;  5CTU A;  4U7O A;  4P7A A;  4URL A;  1PVG A;  2C2A A;  2XDL A;  3G7E A;  5M4N A;  2BRE A;  2BSM A;  1UYM A;  1MX0 A;  3R4N A;  4URO A;  4JQL A;  3ZXO A;  3INX A;  4CWR A;  3FT5 A;  4B6C A;  4WUD A;  2XX4 A;  3R4P A;  2YED A;  1Y4S A;  2XDX A;  4BQJ A;  3K97 A;  2XHT A;  2IOR A;  1S16 A;  4E01 A;  2YI6 A;  5M4K A;  5F5R A;  5CTX A;  3HEK A;  5J6A A;  4R1F A;  2YI0 A;  4MPN A;  4O0B A;  2FWY A;  4JAS A;  2E0A A;  2QFO A;  2IWX A;  4V26 A;  1YET A;  2BU8 A;  3B28 A;  1EA6 A;  4L91 A;  1AMW A;  1Y8N A;  4FCQ A;  2YE8 A;  4I3H A;  3WHA A;  3RKZ A;  2HG1 A;  1R62 A;  5FNC A;  5BOC A;  3DGE A;  4YKR A;  2XAB A;  4MBC A;  3NMQ A;  2YKE A;  3EHF A;  4YKW A;  5M4H A;  3OPD A;  4GEE A;  3GIF A;  4PL9 A;  3T2S A;  4XKO A;  4QPJ A;  2XDK A;  2HCH A;  2YEG A;  2YKI A;  2BT0 A;  2Q8G A;  2FWZ A;  2HKJ A;  1Y8P A;  3B26 A;  3U67 A;  4R3M A;  3VHC A;  3U2K A;  3OMU A;  4ASB A;  2YI5 A;  2O1W A;  1B63 A;  2WI7 A;  3VHA A;  4XTJ A;  2ZBK B;  1ID0 A;  3B24 A;  2XJG A;  1YC1 A;  5IDM A;  3U2D A;  3CRK A;  3K60 A;  2XDU A;  3HZ5 A;  2BU6 A;  4HYP A;  5D6Q A;  3GIG A;  2Q8F A;  4B7P A;  4MP7 A;  4XD8 A;  2YE9 A;  2WI4 A;  4L90 A;  5D7C A;  3LPS A;  5M4M A;  3GIE A;  2BTZ A;  4WUC A;  3OWB A; 
#chains in the Genus database with same CATH topology
 2QG2 A;  4P8O A;  4GQT A;  1GKZ A;  1Z5A A;  3B25 A;  4XDM A;  4BAE A;  2WI5 A;  2Q2E B;  1U0Z A;  2YKJ A;  2YI7 A;  3TZ4 A;  3R92 A;  2FTK A;  4AWQ A;  3A0T A;  1YT0 A;  2XK2 A;  4MOT A;  3VAD A;  2YKB A;  1NHI A;  2YKC A;  1ZXM A;  1MU5 A;  4EM7 A;  2BZ5 A;  1UYL A;  4KFG A;  3IED A;  3CWV A;  3R4O A;  4MP2 A;  4FMT A;  1TC6 A;  3H80 A;  2WER A;  2Q8H A;  4QPK A;  1YC3 A;  2H8M A;  1UY8 A;  4BIZ A;  3Q5L A;  2XX5 A;  1TID A;  1QY8 A;  5C93 A;  2YEE A;  3O0I A;  4H81 A;  4U93 A;  4H85 A;  3WQ9 A;  1I5B A;  1A4H A;  1AJ6 A;  2JKI A;  4JAV A;  4YKQ A;  1I5D A;  4FPP A;  2BYH A;  3QTF A;  1YS3 A;  3R4M A;  1KIJ A;  4YKX A;  1I5A A;  1Y4U A;  2VW5 A;  4XCL A;  4E00 A;  1THN A;  3GIG B;  3TZ5 A;  2GQP A;  1ZXN A;  5BOD A;  5JEN A;  4EMV A;  3SL2 A;  2CCT A;  2YEI A;  1NHJ A;  3EHJ A;  1AH6 A;  1JM6 A;  4CE2 A;  1YC4 A;  3INW A;  2YEJ A;  1TH8 A;  1UYD A;  4ASG A;  3S5T A;  3HYZ A;  3EHG A;  1YES A;  4LWF A;  4H7Q A;  2IOQ A;  2VWC A;  3OWD A;  4U7N A;  3TUH A;  4XCJ A;  1BYQ A;  3R91 A;  3BMY A;  3G75 A;  1YT2 A;  4L94 A;  4WUB A;  4ASF A;  2O1U A;  3A0Z A;  1BXD A;  3FV5 A;  5D6P A;  3VHD A;  3RLQ A;  2AKP A;  2YGA A;  1I5C A;  1YER A;  2XHX A;  1UYG A;  3T0H A;  1OSF A;  4KSG A;  2K5B A;  3G7B A;  1YT1 A;  4HY1 A;  4ZKI A;  4HXW A;  2XCM A;  4MPE A;  4O07 A;  4XIT A;  4GFN A;  2YGF A;  1TBW A;  2YEF A;  3CYG A;  1ZWH A;  2GFD A;  1I59 A;  2YK2 A;  3D2R A;  3A0W A;  4BIU A;  2BU5 A;  4GT8 A;  4BQG A;  5IDJ A;  1UYK A;  4EFT A;  2YJX A;  2YGE A;  1UYF A;  3BM9 A;  2WI2 A;  4NH9 A;  3ZXQ A;  4GCZ A;  1Y8O A;  5CTW A;  2BU2 A;  4KP4 A;  2YEB A;  4ASA A;  2WEP A;  4CWN A;  1GJV A;  4L8Z A;  4ZVI A;  3PEH A;  4DZY A;  3T1K A;  4LP0 A;  4LWG A;  3ZKD A;  1H7U A;  5M4E A;  4K4O A;  5CTY A;  1UYC A;  3CGY A;  4LPB A;  4AWP A;  4CWQ A;  4BXI A;  2BRC A;  2UWD A;  2XD6 A;  3JZ3 A;  4YKY A;  1QZR A;  3CGZ A;  4CWP A;  4EEH A;  5CF0 A;  4HYM A;  1ZW9 A;  2YE4 A;  1I58 A;  2H55 A;  2IWS A;  2CCU A;  3HHU A;  1UYE A;  4CE1 A;  1F51 A;  2ZKJ A;  4GGL A;  3Q5K A;  1KZN A;  4KQV A;  1YSZ A;  1AM1 A;  2C1G A;  2VCJ A;  3HYY A;  5D7R A;  4W7T A;  3H4L A;  4XIR A;  3LNU A;  4KTN A;  2CCS A;  4XC0 A;  3RLR A;  3O6O A;  4E02 A;  2C1I A;  4DUH A;  4PU9 A;  3EHH A;  3C0E A;  2O1V A;  2CH4 A;  4FCP A;  3D36 A;  4I5S A;  1YSR A;  4AS9 A;  1Z59 A;  1UY7 A;  5CPH A;  2YE3 A;  1TC0 A;  2XJX A;  5F3K A;  2WI6 A;  2XJJ A;  4XKA A;  4MPC A;  4CWO A;  1L0O A;  2YE7 A;  4LWI A;  4AWO A;  3KE6 A;  4PRV A;  4O05 A;  2IWU A;  1U2O A;  2EXL A;  1H7S A;  1B62 A;  2XX2 A;  2ESA A;  4XKK A;  4CWT A;  5FWK A;  3K98 A;  5J71 A;  4Q20 A;  4L93 A;  4NH8 A;  3A0X A;  2FXS A;  1US7 A;  2WI1 A;  4HZ5 A;  1B3Q A;  4EGI A;  1Z5B A;  2XDS A;  3K99 A;  4O09 A;  1GKX A;  2WI3 A;  4HY6 A;  2VCI A;  2YK9 A;  3TTZ A;  2YE2 A;  1UY9 A;  2BYI A;  2CG9 A;  4NH7 A;  4CWS A;  3ZKB A;  3TZ2 A;  1BKN A;  3MNR P;  2BU7 A;  4V25 A;  1TIL A;  1NHH A;  4R3A A;  1BGQ A;  2QF6 A;  2XHR A;  1UYI A;  3TZ0 A;  4KSH A;  1UYH A;  3D0B A;  4URM A;  2YEH A;  4LWE A;  4O04 A;  2IOP A;  3A0Y A;  3QDD A;  4CWF A;  4EGK A;  5FND A;  5L3J A;  3A0R A;  4XE2 A;  1QYE A;  3FT8 A;  2YEA A;  4YKZ A;  1S14 A;  3T10 A;  2ZDY A;  3PEJ A;  2YEC A;  4YKU A;  2YJW A;  4URN A;  4X9L A;  2WEQ A;  2YE5 A;  4HZ0 A;  1Z5C A;  1EI1 A;  5M4P A;  5GGZ A;  1AH8 A;  4JAU A;  4HXZ A;  4LWH A;  4E72 A;  5IN9 A;  2CGF A;  2PNR A;  3EKR A;  3OW6 A;  3B27 A;  3O2F A;  3LMM A;  4XIQ A;  3T0Z A;  3Q5J A;  3RLP A;  3ZM7 A;  4PRX A;  4XIP A;  2YE6 A;  3EKO A;  2QG0 A;  1UY6 A;  5FNF A;  3HZ1 A;  4EFU A;  4MB9 A;  4EGH A;  2ZDX A;  3C11 A;  4FCR A;  2JJC A;  4YKT A;  2FYP A;  5D7D A;  4CE3 A;  2Q8I A;  3CRL A;  5CTU A;  4U7O A;  4P7A A;  4URL A;  1PVG A;  1IXM A;  2C2A A;  2XDL A;  3G7E A;  5M4N A;  2BRE A;  2BSM A;  1UYM A;  1MX0 A;  3R4N A;  4URO A;  4JQL A;  3ZXO A;  3INX A;  4CWR A;  3FT5 A;  4B6C A;  4WUD A;  2XX4 A;  3R4P A;  2YED A;  1Y4S A;  2XDX A;  4BQJ A;  3K97 A;  2XHT A;  2IOR A;  1S16 A;  4E01 A;  2YI6 A;  5M4K A;  5F5R A;  5CTX A;  3HEK A;  5J6A A;  4R1F A;  2YI0 A;  4MPN A;  4O0B A;  2FWY A;  4JAS A;  2E0A A;  2QFO A;  2IWX A;  4V26 A;  1YET A;  2BU8 A;  3B28 A;  1EA6 A;  4L91 A;  1AMW A;  1Y8N A;  4FCQ A;  2YE8 A;  4I3H A;  3WHA A;  3RKZ A;  2HG1 A;  1R62 A;  5FNC A;  5BOC A;  3DGE A;  4YKR A;  2XAB A;  4MBC A;  3NMQ A;  2YKE A;  3EHF A;  4YKW A;  5M4H A;  3OPD A;  4GEE A;  3GIF A;  4PL9 A;  3T2S A;  4XKO A;  4QPJ A;  2XDK A;  2HCH A;  2YEG A;  2YKI A;  2BT0 A;  2Q8G A;  2FWZ A;  2HKJ A;  1Y8P A;  3B26 A;  3U67 A;  4R3M A;  3VHC A;  3U2K A;  3OMU A;  4ASB A;  2YI5 A;  2O1W A;  1B63 A;  2WI7 A;  3VHA A;  4XTJ A;  2ZBK B;  1ID0 A;  3B24 A;  2XJG A;  1YC1 A;  5IDM A;  3U2D A;  3CRK A;  3K60 A;  2XDU A;  3HZ5 A;  2BU6 A;  4HYP A;  5D6Q A;  3GIG A;  2Q8F A;  4B7P A;  4MP7 A;  4XD8 A;  2YE9 A;  2WI4 A;  4L90 A;  5D7C A;  3LPS A;  5M4M A;  3GIE A;  2BTZ A;  2HHI A;  4WUC A;  3OWB A; 
#chains in the Genus database with same CATH homology
 2QG2 A;  4P8O A;  4GQT A;  1GKZ A;  1Z5A A;  3B25 A;  4XDM A;  4BAE A;  2WI5 A;  2Q2E B;  1U0Z A;  2YKJ A;  2YI7 A;  3TZ4 A;  3R92 A;  4AWQ A;  3A0T A;  1YT0 A;  2XK2 A;  4MOT A;  3VAD A;  2YKB A;  1NHI A;  2YKC A;  1ZXM A;  1MU5 A;  4EM7 A;  2BZ5 A;  1UYL A;  4KFG A;  3IED A;  3CWV A;  3R4O A;  4MP2 A;  4FMT A;  1TC6 A;  3H80 A;  2WER A;  2Q8H A;  4QPK A;  1YC3 A;  2H8M A;  1UY8 A;  4BIZ A;  3Q5L A;  2XX5 A;  1TID A;  1QY8 A;  5C93 A;  2YEE A;  3O0I A;  4H81 A;  4U93 A;  4H85 A;  3WQ9 A;  1I5B A;  1A4H A;  1AJ6 A;  2JKI A;  4JAV A;  4YKQ A;  1I5D A;  4FPP A;  2BYH A;  3QTF A;  1YS3 A;  3R4M A;  1KIJ A;  4YKX A;  1I5A A;  1Y4U A;  2VW5 A;  4XCL A;  4E00 A;  1THN A;  3GIG B;  3TZ5 A;  2GQP A;  1ZXN A;  5BOD A;  4EMV A;  3SL2 A;  2CCT A;  2YEI A;  1NHJ A;  3EHJ A;  1AH6 A;  1JM6 A;  4CE2 A;  1YC4 A;  3INW A;  2YEJ A;  1TH8 A;  1UYD A;  4ASG A;  3HYZ A;  3EHG A;  1YES A;  4LWF A;  4H7Q A;  2IOQ A;  2VWC A;  3OWD A;  4U7N A;  3TUH A;  4XCJ A;  1BYQ A;  3R91 A;  3BMY A;  3G75 A;  1YT2 A;  4L94 A;  4WUB A;  4ASF A;  2O1U A;  3A0Z A;  1BXD A;  3FV5 A;  5D6P A;  3VHD A;  3RLQ A;  2AKP A;  2YGA A;  1I5C A;  1YER A;  2XHX A;  1UYG A;  3T0H A;  1OSF A;  4KSG A;  2K5B A;  3G7B A;  1YT1 A;  4HY1 A;  4ZKI A;  4HXW A;  2XCM A;  4MPE A;  4O07 A;  4XIT A;  4GFN A;  2YGF A;  1TBW A;  2YEF A;  1ZWH A;  2GFD A;  1I59 A;  2YK2 A;  3D2R A;  3A0W A;  4BIU A;  2BU5 A;  4GT8 A;  4BQG A;  5IDJ A;  1UYK A;  4EFT A;  2YJX A;  2YGE A;  1UYF A;  3BM9 A;  2WI2 A;  4NH9 A;  3ZXQ A;  4GCZ A;  1Y8O A;  5CTW A;  2BU2 A;  4KP4 A;  2YEB A;  4ASA A;  2WEP A;  4CWN A;  1GJV A;  4L8Z A;  4ZVI A;  3PEH A;  4DZY A;  3T1K A;  4LP0 A;  4LWG A;  3ZKD A;  1H7U A;  5M4E A;  4K4O A;  5CTY A;  1UYC A;  3CGY A;  4LPB A;  4AWP A;  4CWQ A;  4BXI A;  2BRC A;  2UWD A;  2XD6 A;  3JZ3 A;  4YKY A;  1QZR A;  3CGZ A;  4CWP A;  4EEH A;  5CF0 A;  4HYM A;  1ZW9 A;  2YE4 A;  1I58 A;  2H55 A;  2IWS A;  2CCU A;  3HHU A;  1UYE A;  4CE1 A;  2ZKJ A;  4GGL A;  3Q5K A;  1KZN A;  4KQV A;  1YSZ A;  1AM1 A;  2VCJ A;  3HYY A;  5D7R A;  4W7T A;  3H4L A;  4XIR A;  3LNU A;  4KTN A;  2CCS A;  4XC0 A;  3RLR A;  3O6O A;  4E02 A;  4DUH A;  4PU9 A;  3EHH A;  3C0E A;  2O1V A;  2CH4 A;  4FCP A;  3D36 A;  4I5S A;  1YSR A;  4AS9 A;  1Z59 A;  1UY7 A;  5CPH A;  2YE3 A;  1TC0 A;  2XJX A;  5F3K A;  2WI6 A;  2XJJ A;  4XKA A;  4MPC A;  4CWO A;  1L0O A;  2YE7 A;  4LWI A;  4AWO A;  3KE6 A;  4PRV A;  4O05 A;  2IWU A;  1U2O A;  2EXL A;  1H7S A;  1B62 A;  2XX2 A;  2ESA A;  4XKK A;  4CWT A;  5FWK A;  3K98 A;  5J71 A;  4Q20 A;  4L93 A;  4NH8 A;  3A0X A;  2FXS A;  1US7 A;  2WI1 A;  4HZ5 A;  1B3Q A;  4EGI A;  1Z5B A;  2XDS A;  3K99 A;  4O09 A;  1GKX A;  2WI3 A;  4HY6 A;  2VCI A;  2YK9 A;  3TTZ A;  2YE2 A;  1UY9 A;  2BYI A;  2CG9 A;  4NH7 A;  4CWS A;  3ZKB A;  3TZ2 A;  1BKN A;  3MNR P;  2BU7 A;  4V25 A;  1TIL A;  1NHH A;  4R3A A;  1BGQ A;  2QF6 A;  2XHR A;  1UYI A;  3TZ0 A;  4KSH A;  1UYH A;  3D0B A;  4URM A;  2YEH A;  4LWE A;  4O04 A;  2IOP A;  3A0Y A;  3QDD A;  4CWF A;  4EGK A;  5FND A;  5L3J A;  3A0R A;  4XE2 A;  1QYE A;  3FT8 A;  2YEA A;  4YKZ A;  1S14 A;  3T10 A;  2ZDY A;  3PEJ A;  2YEC A;  4YKU A;  2YJW A;  4URN A;  4X9L A;  2WEQ A;  2YE5 A;  4HZ0 A;  1Z5C A;  1EI1 A;  5M4P A;  5GGZ A;  1AH8 A;  4JAU A;  4HXZ A;  4LWH A;  5IN9 A;  2CGF A;  2PNR A;  3EKR A;  3OW6 A;  3B27 A;  3O2F A;  4XIQ A;  3T0Z A;  3Q5J A;  3RLP A;  3ZM7 A;  4PRX A;  4XIP A;  2YE6 A;  3EKO A;  2QG0 A;  1UY6 A;  5FNF A;  3HZ1 A;  4EFU A;  4MB9 A;  4EGH A;  2ZDX A;  3C11 A;  4FCR A;  2JJC A;  4YKT A;  2FYP A;  5D7D A;  4CE3 A;  2Q8I A;  3CRL A;  5CTU A;  4U7O A;  4P7A A;  4URL A;  1PVG A;  2C2A A;  2XDL A;  3G7E A;  5M4N A;  2BRE A;  2BSM A;  1UYM A;  1MX0 A;  3R4N A;  4URO A;  4JQL A;  3ZXO A;  3INX A;  4CWR A;  3FT5 A;  4B6C A;  4WUD A;  2XX4 A;  3R4P A;  2YED A;  1Y4S A;  2XDX A;  4BQJ A;  3K97 A;  2XHT A;  2IOR A;  1S16 A;  4E01 A;  2YI6 A;  5M4K A;  5F5R A;  5CTX A;  3HEK A;  5J6A A;  4R1F A;  2YI0 A;  4MPN A;  4O0B A;  2FWY A;  4JAS A;  2E0A A;  2QFO A;  2IWX A;  4V26 A;  1YET A;  2BU8 A;  3B28 A;  1EA6 A;  4L91 A;  1AMW A;  1Y8N A;  4FCQ A;  2YE8 A;  4I3H A;  3WHA A;  3RKZ A;  2HG1 A;  1R62 A;  5FNC A;  5BOC A;  3DGE A;  4YKR A;  2XAB A;  4MBC A;  3NMQ A;  2YKE A;  3EHF A;  4YKW A;  5M4H A;  3OPD A;  4GEE A;  3GIF A;  4PL9 A;  3T2S A;  4XKO A;  4QPJ A;  2XDK A;  2HCH A;  2YEG A;  2YKI A;  2BT0 A;  2Q8G A;  2FWZ A;  2HKJ A;  1Y8P A;  3B26 A;  3U67 A;  4R3M A;  3VHC A;  3U2K A;  3OMU A;  4ASB A;  2YI5 A;  2O1W A;  1B63 A;  2WI7 A;  3VHA A;  4XTJ A;  2ZBK B;  1ID0 A;  3B24 A;  2XJG A;  1YC1 A;  5IDM A;  3U2D A;  3CRK A;  3K60 A;  2XDU A;  3HZ5 A;  2BU6 A;  4HYP A;  5D6Q A;  3GIG A;  2Q8F A;  4B7P A;  4MP7 A;  4XD8 A;  2YE9 A;  2WI4 A;  4L90 A;  5D7C A;  3LPS A;  5M4M A;  3GIE A;  2BTZ A;  4WUC A;  3OWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...