5IDMA

Bifunctional histidine kinase ccka (domain, ca) in complex with c-di-gmp and amppnp/mg2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
177
structure length
177
Chain Sequence
VQREVLDLGELISEFEVLLRRLLREDVKLITDYGRDLPQVRADKSQLETAVMNLAVNARDAVRAAKGGGVVRIRTARLTRDEAIQLGFPAADGDTAFIEVSDDGPGIPPDVMGKIFDPFFTTKPVGEGTGLGLATVYGIVKQSDGWIHVHSRPNEGAAFRIFLPVYEAPAALEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Cell cycle histidine kinase CckA
publication title Cyclic di-GMP mediates a histidine kinase/phosphatase switch by noncovalent domain cross-linking.
pubmed doi rcsb
source organism Caulobacter vibrioides
total genus 44
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5idmA00
1U0ZA 4P7AA 3K97A 1AM1A 2VWCA 3CRKA 2ZDXA 1TH8A 4QPJA 2HCHA 1TILA 4EMVA 5J71A 1S16A 1I58A 4HY1A 4HY6A 4XDMA 5D7RA 2GQPA 2YE5A 4ASFA 2BT0A 3U2KA 3C0EA 2YI6A 3TUHA 5FWKA 4EGHA 2YEDA 3ZM7A 2BU6A 4O07A 4MBCA 4CWFA 4BQJA 4KP4A 2XDSA 4WUDA 4KFGA 5BODA 2BSMA 5FNFA 4MOTA 2YE4A 4O04A 1L0OA 4GGLA 2XJJA 1NHJA 1ID0A 2WEPA 3RKZA 1UY6A 1TC6A 2WEQA 4NH7A 4UROA 3TZ2A 1UY7A 1AJ6A 1ZXNA 2XHRA 3HYZA 3H80A 5L3JA 2XDUA 1NHHA 3EHFA 4BXIA 3U67A 1GKXA 5M4EA 4JQLA 2O1UA 1JM6A 2YKIA 2XX4A 4DUHA 1TIDA 3SL2A 4Q20A 1YT0A 4ASBA 3OMUA 1UYKA 4WUBA 2VCJA 3Q5JA 2K5BA 4HZ0A 4EFUA 1I59A 2YE2A 4LWHA 3JZ3A 4BQGA 2YI7A 4ASAA 2XCMA 1KZNA 2HKJA 3B26A 2QG0A 2YKJA 1A4HA 1U2OA 4YKTA 2JJCA 3A0WA 4JAUA 3KE6A 4L94A 1EI1A 4CE1A 2AKPA 3A0RA 2BU5A 3GIGA 2JKIA 1EA6A 5D7CA 4EGKA 4CWNA 3O0IA 4YKXA 4PL9A 4HYMA 5F3KA 3HZ1A 4PU9A 4I5SA 4KSGA 4XIPA 4BAEA 3ZXOA 2O1VA 2YE6A 3R4MA 3HEKA 2VW5A 1Y8PA 4L90A 2WI3A 2QG2A 4YKUA 2YKCA 4QPKA 2YGEA 3QDDA 3NMQA 1BKNA 2CG9A 1I5AA 1YT2A 4JASA 4U7OA 4KQVA 4NH8A 5M4MA 3GIEA 4URNA 2HG1A 4KSHA 3A0XA 2YE7A 4CWRA 3IEDA 2ZKJA 1YSZA 2ESAA 3ZKDA 1UY9A 4H7QA 4L8ZA 4GT8A 4B7PA 1TBWA 2CGFA 3T1KA 1H7SA 4O05A 4CWSA 1NHIA 2IWSA 2Q8GA 3HZ5A 3ZKBA 3INWA 1QZRA 4E00A 1QY8A 4XITA 1S14A 2BRCA 4EM7A 3INXA 2XJXA 1MX0A 1UYLA 1ZXMA 1TC0A 4XTJA 4ZKIA 3B27A 3R4PA 2YE8A 2QF6A 3Q5LA 4WUCA 4AWQA 2YGFA 1AH8A 5CPHA 1YC4A 4GFNA 2E0AA 1Y8OA 3T2SA 3LPSA 2H55A 1KIJA 2CCSA 4XE2A 2YE9A 5CTXA 3K60A 1Z5BA 2WI6A 2WI7A 4YKZA 2YEIA 4E02A 3OWDA 2YJWA 2XK2A 2WERA 1QYEA 4BIUA 5F5RA 1PVGA 1US7A 3LNUA 4XIRA 2WI4A 2CH4A 4X9LA 4HXWA 1R62A 2YEJA 4O09A 3HYYA 4V25A 2FYPA 4NH9A 4R1FA 4CWQA 2Q8FA 4BIZA 5D6QA 4MB9A 4EFTA 1YERA 2YKBA 3CGZA 4XKOA 4K4OA 1BXDA 1Y4UA 4LWFA 5J6AA 4XKKA 2CCUA 4W7TA 2QFOA 2Q8HA 4HXZA 3K98A 5M4NA 4YKRA 3R4NA 4H85A 3B28A 3QTFA 3T0HA 3TTZA 2Q2EB 1UYIA 2YEBA 2ZBKB 3A0ZA 3H4LA 4I3HA 4FCPA 4LP0A 4AWPA 4ASGA 2CCTA 3RLPA 4R3AA 4YKWA 3OPDA 1B62A 2BREA 2YE3A 3EHGA 3O2FA 4LWGA 2BU2A 4FCQA 1B63A 1I5BA 2YK2A 3B25A 4R3MA 4CE3A 4CWTA 4EGIA 5CTYA 2ZDYA 4L91A 4XD8A 3CGYA 4GCZA 5CTUA 3K99A 2XDKA 5FNDA 4GEEA 1I5CA 3R92A 3FT5A 2FXSA 2YEFA 1OSFA 3CWVA 2BYHA 3BM9A 4P8OA 2YI0A 3G75A 3U2DA 4MPCA 4FPPA 5IDMA 3A0TA 2IWUA 4YKYA 2YEHA 3RLQA 1B3QA 5GGZA 2YEEA 3RLRA 1UYHA 4XCJA 2YJXA 4AWOA 4LWEA 3G7EA 1THNA 3FT8A 2YGAA 2XD6A 2WI5A 5CF0A 4MP7A 5M4HA 2XDXA 3PEHA 2IWXA 3C11A 1YSRA 2YECA 4LWIA 2YEGA 5M4KA 1Y8NA 1UY8A 3VHDA 1YC3A 1ZWHA 1YT1A 4FCRA 5BOCA 3ZXQA 2BZ5A 2XX2A 4DZYA 1BGQA 4MPNA 2WI1A 4LPBA 4PRVA 3TZ0A 3GIFA 3EKRA 1YETA 4MP2A 2XABA 4GQTA 4E01A 3VADA 4XIQA 1GJVA 1YESA 3GIGB 4B6CA 1H7UA 1AMWA 3FV5A 4U7NA 5IDJA 5D7DA 2XDLA 2YEAA 4URMA 4CWPA 1MU5A 2IOPA 1BYQA 2VCIA 2YKEA 3TZ4A 3VHAA 4XKAA 3VHCA 4H81A 3WQ9A 1UYMA 4FMTA 2PNRA 3WHAA 3BMYA 1YC1A 1YS3A 2GFDA 1UYEA 1Z5CA 4CWOA 4KTNA 1GKZA 3EHJA 1Z59A 4URLA 3EKOA 4XC0A 4O0BA 4JAVA 4CE2A 3EHHA 4HYPA 4MPEA 2XJGA 1AH6A 2H8MA 2FWZA 3HHUA 4AS9A 2XHTA 2IOQA 3MNRP 3D0BA 2IORA 3OW6A 2BTZA 2C2AA 2FWYA 4L93A 1I5DA 5D6PA 3R91A 3D36A 1Y4SA 4YKQA 3TZ5A 2XHXA 3R4OA 5FNCA 3A0YA 2UWDA 4ZVIA 1UYCA 3T0ZA 3PEJA 3Q5KA 3T10A 4HZ5A 1UYDA 2YI5A 3CRLA 5M4PA 1Z5AA 3O6OA 1UYFA 2Q8IA 2O1WA 2WI2A 2YK9A 3B24A 2BU8A 3DGEA 3OWBA 4EEHA 1UYGA 4V26A 5IN9A 2BYIA 5CTWA 5C93A 4XCLA 3G7BA 2EXLA 2XX5A 3D2RA 4U93A 2BU7A 4PRXA 1ZW9A
chains in the Genus database with same CATH superfamily
1U0ZA 4P7AA 3K97A 1AM1A 2VWCA 3CRKA 2ZDXA 1TH8A 4QPJA 2HCHA 1TILA 4EMVA 5J71A 1S16A 1I58A 4HY1A 4HY6A 4XDMA 5D7RA 2GQPA 2YE5A 4ASFA 2BT0A 3U2KA 3C0EA 2YI6A 3TUHA 3S5TA 5FWKA 4EGHA 2YEDA 3ZM7A 2BU6A 4O07A 4MBCA 4CWFA 4BQJA 4KP4A 2XDSA 4WUDA 4KFGA 5BODA 2BSMA 5FNFA 4MOTA 2YE4A 4O04A 1L0OA 4GGLA 2XJJA 1NHJA 1ID0A 2WEPA 3RKZA 1UY6A 1TC6A 2WEQA 4NH7A 4UROA 3TZ2A 1UY7A 1AJ6A 1ZXNA 2XHRA 3HYZA 3H80A 5L3JA 2XDUA 1NHHA 3EHFA 4BXIA 3U67A 1GKXA 5M4EA 4JQLA 2O1UA 1JM6A 2YKIA 2XX4A 4DUHA 1TIDA 3SL2A 4Q20A 1YT0A 4ASBA 3OMUA 1UYKA 4WUBA 2VCJA 3Q5JA 2K5BA 4HZ0A 4EFUA 1I59A 2YE2A 4LWHA 3JZ3A 4BQGA 2YI7A 4ASAA 2XCMA 1KZNA 2HKJA 3B26A 2QG0A 2YKJA 1A4HA 1U2OA 4YKTA 2JJCA 3A0WA 4JAUA 3KE6A 4L94A 1EI1A 4CE1A 2AKPA 3A0RA 2BU5A 3GIGA 2JKIA 1EA6A 5D7CA 4EGKA 4CWNA 3O0IA 4YKXA 4PL9A 4HYMA 5F3KA 3HZ1A 4PU9A 4I5SA 4KSGA 4XIPA 4BAEA 3ZXOA 2O1VA 2YE6A 3R4MA 3HEKA 2VW5A 1Y8PA 4L90A 2WI3A 2QG2A 4YKUA 2YKCA 4QPKA 2YGEA 3QDDA 3NMQA 1BKNA 2CG9A 1I5AA 1YT2A 4JASA 4U7OA 4KQVA 4NH8A 5M4MA 3GIEA 4URNA 2HG1A 4KSHA 3A0XA 2YE7A 4CWRA 3IEDA 2ZKJA 1YSZA 2ESAA 3ZKDA 1UY9A 4H7QA 4L8ZA 4GT8A 4E72A 4B7PA 1TBWA 2CGFA 3T1KA 1H7SA 4O05A 4CWSA 1NHIA 2IWSA 2Q8GA 3HZ5A 3ZKBA 3INWA 1QZRA 4E00A 1QY8A 4XITA 1S14A 2BRCA 4EM7A 3INXA 2XJXA 1MX0A 1UYLA 3CYGA 1ZXMA 1TC0A 4XTJA 4ZKIA 3B27A 2C1GA 3R4PA 2YE8A 2QF6A 3Q5LA 4WUCA 4AWQA 2YGFA 1AH8A 5CPHA 1YC4A 4GFNA 2E0AA 1Y8OA 3T2SA 3LPSA 2H55A 1KIJA 2CCSA 4XE2A 2YE9A 5CTXA 3K60A 1Z5BA 2WI6A 2WI7A 4YKZA 2YEIA 4E02A 3OWDA 2YJWA 2XK2A 2WERA 1F51A 1QYEA 4BIUA 5F5RA 1PVGA 1US7A 3LNUA 4XIRA 2WI4A 2CH4A 4X9LA 4HXWA 1R62A 2YEJA 4O09A 3HYYA 4V25A 2FYPA 4NH9A 4R1FA 4CWQA 2Q8FA 4BIZA 5D6QA 4MB9A 4EFTA 1YERA 2YKBA 3CGZA 4XKOA 4K4OA 1BXDA 1Y4UA 4LWFA 5J6AA 4XKKA 2CCUA 4W7TA 2QFOA 2Q8HA 4HXZA 3K98A 5M4NA 4YKRA 3R4NA 4H85A 3B28A 3QTFA 3T0HA 3TTZA 2Q2EB 1UYIA 2YEBA 2ZBKB 3A0ZA 3LMMA 3H4LA 4I3HA 4FCPA 4LP0A 4AWPA 4ASGA 2CCTA 3RLPA 4R3AA 4YKWA 3OPDA 1B62A 2BREA 2YE3A 3EHGA 3O2FA 4LWGA 2BU2A 4FCQA 1B63A 1I5BA 2YK2A 3B25A 4R3MA 4CE3A 4CWTA 4EGIA 5CTYA 2ZDYA 4L91A 4XD8A 3CGYA 4GCZA 5CTUA 3K99A 2XDKA 5FNDA 4GEEA 1I5CA 3R92A 3FT5A 2FXSA 2YEFA 1OSFA 3CWVA 2BYHA 3BM9A 4P8OA 2YI0A 3G75A 3U2DA 4MPCA 2C1IA 4FPPA 5IDMA 3A0TA 2IWUA 4YKYA 2YEHA 3RLQA 1B3QA 5GGZA 2YEEA 3RLRA 1UYHA 4XCJA 2YJXA 4AWOA 4LWEA 3G7EA 1THNA 3FT8A 2YGAA 2XD6A 2WI5A 5CF0A 4MP7A 5M4HA 2XDXA 3PEHA 2IWXA 3C11A 1YSRA 2YECA 4LWIA 2YEGA 5M4KA 1Y8NA 1UY8A 3VHDA 1YC3A 1ZWHA 1YT1A 4FCRA 5BOCA 3ZXQA 2BZ5A 2XX2A 4DZYA 1BGQA 4MPNA 2WI1A 4LPBA 4PRVA 3TZ0A 3GIFA 3EKRA 1YETA 2FTKA 4MP2A 2HHIA 2XABA 4GQTA 4E01A 3VADA 4XIQA 1GJVA 1YESA 3GIGB 4B6CA 1H7UA 1AMWA 3FV5A 4U7NA 5IDJA 5D7DA 2XDLA 2YEAA 4URMA 4CWPA 1MU5A 2IOPA 1BYQA 2VCIA 2YKEA 3TZ4A 3VHAA 4XKAA 3VHCA 4H81A 3WQ9A 1UYMA 4FMTA 2PNRA 3WHAA 3BMYA 1YC1A 1YS3A 2GFDA 5JENA 1IXMA 1UYEA 1Z5CA 4CWOA 4KTNA 1GKZA 3EHJA 1Z59A 4URLA 3EKOA 4XC0A 4O0BA 4JAVA 4CE2A 3EHHA 4HYPA 4MPEA 2XJGA 1AH6A 2H8MA 2FWZA 3HHUA 4AS9A 2XHTA 2IOQA 3MNRP 3D0BA 2IORA 3OW6A 2BTZA 2C2AA 2FWYA 4L93A 1I5DA 5D6PA 3R91A 3D36A 1Y4SA 4YKQA 3TZ5A 2XHXA 3R4OA 5FNCA 3A0YA 2UWDA 4ZVIA 1UYCA 3T0ZA 3PEJA 3Q5KA 3T10A 4HZ5A 1UYDA 2YI5A 3CRLA 5M4PA 1Z5AA 3O6OA 1UYFA 2Q8IA 2O1WA 2WI2A 2YK9A 3B24A 2BU8A 3DGEA 3OWBA 4EEHA 1UYGA 4V26A 5IN9A 2BYIA 5CTWA 5C93A 4XCLA 3G7BA 2EXLA 2XX5A 3D2RA 4U93A 2BU7A 4PRXA 1ZW9A
chains in the Genus database with same CATH topology
1U0ZA 4P7AA 3K97A 1AM1A 2VWCA 3CRKA 2ZDXA 1TH8A 4QPJA 2HCHA 1TILA 4EMVA 5J71A 1S16A 1I58A 4HY1A 4HY6A 4XDMA 5D7RA 2GQPA 2YE5A 4ASFA 2BT0A 3U2KA 3C0EA 2YI6A 3TUHA 5FWKA 4EGHA 2YEDA 3ZM7A 2BU6A 4O07A 4MBCA 4CWFA 4BQJA 4KP4A 2XDSA 4WUDA 4KFGA 5BODA 2BSMA 5FNFA 4MOTA 2YE4A 4O04A 1L0OA 4GGLA 2XJJA 1NHJA 1ID0A 2WEPA 3RKZA 1UY6A 1TC6A 2WEQA 4NH7A 4UROA 3TZ2A 1UY7A 1AJ6A 1ZXNA 2XHRA 3HYZA 3H80A 5L3JA 2XDUA 1NHHA 3EHFA 4BXIA 3U67A 1GKXA 5M4EA 4JQLA 2O1UA 1JM6A 2YKIA 2XX4A 4DUHA 1TIDA 3SL2A 4Q20A 1YT0A 4ASBA 3OMUA 1UYKA 4WUBA 2VCJA 3Q5JA 2K5BA 4HZ0A 4EFUA 1I59A 2YE2A 4LWHA 3JZ3A 4BQGA 2YI7A 4ASAA 2XCMA 1KZNA 2HKJA 3B26A 2QG0A 2YKJA 1A4HA 1U2OA 4YKTA 2JJCA 3A0WA 4JAUA 3KE6A 4L94A 1EI1A 4CE1A 2AKPA 3A0RA 2BU5A 3GIGA 2JKIA 1EA6A 5D7CA 4EGKA 4CWNA 3O0IA 4YKXA 4PL9A 4HYMA 5F3KA 3HZ1A 4PU9A 4I5SA 4KSGA 4XIPA 4BAEA 3ZXOA 2O1VA 2YE6A 3R4MA 3HEKA 2VW5A 1Y8PA 4L90A 2WI3A 2QG2A 4YKUA 2YKCA 4QPKA 2YGEA 3QDDA 3NMQA 1BKNA 2CG9A 1I5AA 1YT2A 4JASA 4U7OA 4KQVA 4NH8A 5M4MA 3GIEA 4URNA 2HG1A 4KSHA 3A0XA 2YE7A 4CWRA 3IEDA 2ZKJA 1YSZA 2ESAA 3ZKDA 1UY9A 4H7QA 4L8ZA 4GT8A 4B7PA 1TBWA 2CGFA 3T1KA 1H7SA 4O05A 4CWSA 1NHIA 2IWSA 2Q8GA 3HZ5A 3ZKBA 3INWA 1QZRA 4E00A 1QY8A 4XITA 1S14A 2BRCA 4EM7A 3INXA 2XJXA 1MX0A 1UYLA 1ZXMA 1TC0A 4XTJA 4ZKIA 3B27A 3R4PA 2YE8A 2QF6A 3Q5LA 4WUCA 4AWQA 2YGFA 1AH8A 5CPHA 1YC4A 4GFNA 2E0AA 1Y8OA 3T2SA 3LPSA 2H55A 1KIJA 2CCSA 4XE2A 2YE9A 5CTXA 3K60A 1Z5BA 2WI6A 2WI7A 4YKZA 2YEIA 4E02A 3OWDA 2YJWA 2XK2A 2WERA 1QYEA 4BIUA 5F5RA 1PVGA 1US7A 3LNUA 4XIRA 2WI4A 2CH4A 4X9LA 4HXWA 1R62A 2YEJA 4O09A 3HYYA 4V25A 2FYPA 4NH9A 4R1FA 4CWQA 2Q8FA 4BIZA 5D6QA 4MB9A 4EFTA 1YERA 2YKBA 3CGZA 4XKOA 4K4OA 1BXDA 1Y4UA 4LWFA 5J6AA 4XKKA 2CCUA 4W7TA 2QFOA 2Q8HA 4HXZA 3K98A 5M4NA 4YKRA 3R4NA 4H85A 3B28A 3QTFA 3T0HA 3TTZA 2Q2EB 1UYIA 2YEBA 2ZBKB 3A0ZA 3H4LA 4I3HA 4FCPA 4LP0A 4AWPA 4ASGA 2CCTA 3RLPA 4R3AA 4YKWA 3OPDA 1B62A 2BREA 2YE3A 3EHGA 3O2FA 4LWGA 2BU2A 4FCQA 1B63A 1I5BA 2YK2A 3B25A 4R3MA 4CE3A 4CWTA 4EGIA 5CTYA 2ZDYA 4L91A 4XD8A 3CGYA 4GCZA 5CTUA 3K99A 2XDKA 5FNDA 4GEEA 1I5CA 3R92A 3FT5A 2FXSA 2YEFA 1OSFA 3CWVA 2BYHA 3BM9A 4P8OA 2YI0A 3G75A 3U2DA 4MPCA 4FPPA 5IDMA 3A0TA 2IWUA 4YKYA 2YEHA 3RLQA 1B3QA 5GGZA 2YEEA 3RLRA 1UYHA 4XCJA 2YJXA 4AWOA 4LWEA 3G7EA 1THNA 3FT8A 2YGAA 2XD6A 2WI5A 5CF0A 4MP7A 5M4HA 2XDXA 3PEHA 2IWXA 3C11A 1YSRA 2YECA 4LWIA 2YEGA 5M4KA 1Y8NA 1UY8A 3VHDA 1YC3A 1ZWHA 1YT1A 4FCRA 5BOCA 3ZXQA 2BZ5A 2XX2A 4DZYA 1BGQA 4MPNA 2WI1A 4LPBA 4PRVA 3TZ0A 3GIFA 3EKRA 1YETA 4MP2A 2XABA 4GQTA 4E01A 3VADA 4XIQA 1GJVA 1YESA 3GIGB 4B6CA 1H7UA 1AMWA 3FV5A 4U7NA 5IDJA 5D7DA 2XDLA 2YEAA 4URMA 4CWPA 1MU5A 2IOPA 1BYQA 2VCIA 2YKEA 3TZ4A 3VHAA 4XKAA 3VHCA 4H81A 3WQ9A 1UYMA 4FMTA 2PNRA 3WHAA 3BMYA 1YC1A 1YS3A 2GFDA 1UYEA 1Z5CA 4CWOA 4KTNA 1GKZA 3EHJA 1Z59A 4URLA 3EKOA 4XC0A 4O0BA 4JAVA 4CE2A 3EHHA 4HYPA 4MPEA 2XJGA 1AH6A 2H8MA 2FWZA 3HHUA 4AS9A 2XHTA 2IOQA 3MNRP 3D0BA 2IORA 3OW6A 2BTZA 2C2AA 2FWYA 4L93A 1I5DA 5D6PA 3R91A 3D36A 1Y4SA 4YKQA 3TZ5A 2XHXA 3R4OA 5FNCA 3A0YA 2UWDA 4ZVIA 1UYCA 3T0ZA 3PEJA 3Q5KA 3T10A 4HZ5A 1UYDA 2YI5A 3CRLA 5M4PA 1Z5AA 3O6OA 1UYFA 2Q8IA 2O1WA 2WI2A 2YK9A 3B24A 2BU8A 3DGEA 3OWBA 4EEHA 1UYGA 4V26A 5IN9A 2BYIA 5CTWA 5C93A 4XCLA 3G7BA 2EXLA 2XX5A 3D2RA 4U93A 2BU7A 4PRXA 1ZW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U0Z A;  4P7A A;  3K97 A;  1AM1 A;  2VWC A;  3CRK A;  2ZDX A;  1TH8 A;  4QPJ A;  2HCH A;  1TIL A;  4EMV A;  5J71 A;  1S16 A;  1I58 A;  4HY1 A;  4HY6 A;  4XDM A;  5D7R A;  2GQP A;  2YE5 A;  4ASF A;  2BT0 A;  3U2K A;  3C0E A;  2YI6 A;  3TUH A;  5FWK A;  4EGH A;  2YED A;  3ZM7 A;  2BU6 A;  4O07 A;  4MBC A;  4CWF A;  4BQJ A;  4KP4 A;  2XDS A;  4WUD A;  4KFG A;  5BOD A;  2BSM A;  5FNF A;  4MOT A;  2YE4 A;  4O04 A;  1L0O A;  4GGL A;  2XJJ A;  1NHJ A;  1ID0 A;  2WEP A;  3RKZ A;  1UY6 A;  1TC6 A;  2WEQ A;  4NH7 A;  4URO A;  3TZ2 A;  1UY7 A;  1AJ6 A;  1ZXN A;  2XHR A;  3HYZ A;  3H80 A;  5L3J A;  2XDU A;  1NHH A;  3EHF A;  4BXI A;  3U67 A;  1GKX A;  5M4E A;  4JQL A;  2O1U A;  1JM6 A;  2YKI A;  2XX4 A;  4DUH A;  1TID A;  3SL2 A;  4Q20 A;  1YT0 A;  4ASB A;  3OMU A;  1UYK A;  4WUB A;  2VCJ A;  3Q5J A;  2K5B A;  4HZ0 A;  4EFU A;  1I59 A;  2YE2 A;  4LWH A;  3JZ3 A;  4BQG A;  2YI7 A;  4ASA A;  2XCM A;  1KZN A;  2HKJ A;  3B26 A;  2QG0 A;  2YKJ A;  1A4H A;  1U2O A;  4YKT A;  2JJC A;  3A0W A;  4JAU A;  3KE6 A;  4L94 A;  1EI1 A;  4CE1 A;  2AKP A;  3A0R A;  2BU5 A;  3GIG A;  2JKI A;  1EA6 A;  5D7C A;  4EGK A;  4CWN A;  3O0I A;  4YKX A;  4PL9 A;  4HYM A;  5F3K A;  3HZ1 A;  4PU9 A;  4I5S A;  4KSG A;  4XIP A;  4BAE A;  3ZXO A;  2O1V A;  2YE6 A;  3R4M A;  3HEK A;  2VW5 A;  1Y8P A;  4L90 A;  2WI3 A;  2QG2 A;  4YKU A;  2YKC A;  4QPK A;  2YGE A;  3QDD A;  3NMQ A;  1BKN A;  2CG9 A;  1I5A A;  1YT2 A;  4JAS A;  4U7O A;  4KQV A;  4NH8 A;  5M4M A;  3GIE A;  4URN A;  2HG1 A;  4KSH A;  3A0X A;  2YE7 A;  4CWR A;  3IED A;  2ZKJ A;  1YSZ A;  2ESA A;  3ZKD A;  1UY9 A;  4H7Q A;  4L8Z A;  4GT8 A;  4B7P A;  1TBW A;  2CGF A;  3T1K A;  1H7S A;  4O05 A;  4CWS A;  1NHI A;  2IWS A;  2Q8G A;  3HZ5 A;  3ZKB A;  3INW A;  1QZR A;  4E00 A;  1QY8 A;  4XIT A;  1S14 A;  2BRC A;  4EM7 A;  3INX A;  2XJX A;  1MX0 A;  1UYL A;  1ZXM A;  1TC0 A;  4XTJ A;  4ZKI A;  3B27 A;  3R4P A;  2YE8 A;  2QF6 A;  3Q5L A;  4WUC A;  4AWQ A;  2YGF A;  1AH8 A;  5CPH A;  1YC4 A;  4GFN A;  2E0A A;  1Y8O A;  3T2S A;  3LPS A;  2H55 A;  1KIJ A;  2CCS A;  4XE2 A;  2YE9 A;  5CTX A;  3K60 A;  1Z5B A;  2WI6 A;  2WI7 A;  4YKZ A;  2YEI A;  4E02 A;  3OWD A;  2YJW A;  2XK2 A;  2WER A;  1QYE A;  4BIU A;  5F5R A;  1PVG A;  1US7 A;  3LNU A;  4XIR A;  2WI4 A;  2CH4 A;  4X9L A;  4HXW A;  1R62 A;  2YEJ A;  4O09 A;  3HYY A;  4V25 A;  2FYP A;  4NH9 A;  4R1F A;  4CWQ A;  2Q8F A;  4BIZ A;  5D6Q A;  4MB9 A;  4EFT A;  1YER A;  2YKB A;  3CGZ A;  4XKO A;  4K4O A;  1BXD A;  1Y4U A;  4LWF A;  5J6A A;  4XKK A;  2CCU A;  4W7T A;  2QFO A;  2Q8H A;  4HXZ A;  3K98 A;  5M4N A;  4YKR A;  3R4N A;  4H85 A;  3B28 A;  3QTF A;  3T0H A;  3TTZ A;  2Q2E B;  1UYI A;  2YEB A;  2ZBK B;  3A0Z A;  3H4L A;  4I3H A;  4FCP A;  4LP0 A;  4AWP A;  4ASG A;  2CCT A;  3RLP A;  4R3A A;  4YKW A;  3OPD A;  1B62 A;  2BRE A;  2YE3 A;  3EHG A;  3O2F A;  4LWG A;  2BU2 A;  4FCQ A;  1B63 A;  1I5B A;  2YK2 A;  3B25 A;  4R3M A;  4CE3 A;  4CWT A;  4EGI A;  5CTY A;  2ZDY A;  4L91 A;  4XD8 A;  3CGY A;  4GCZ A;  5CTU A;  3K99 A;  2XDK A;  5FND A;  4GEE A;  1I5C A;  3R92 A;  3FT5 A;  2FXS A;  2YEF A;  1OSF A;  3CWV A;  2BYH A;  3BM9 A;  4P8O A;  2YI0 A;  3G75 A;  3U2D A;  4MPC A;  4FPP A;  5IDM A;  3A0T A;  2IWU A;  4YKY A;  2YEH A;  3RLQ A;  1B3Q A;  5GGZ A;  2YEE A;  3RLR A;  1UYH A;  4XCJ A;  2YJX A;  4AWO A;  4LWE A;  3G7E A;  1THN A;  3FT8 A;  2YGA A;  2XD6 A;  2WI5 A;  5CF0 A;  4MP7 A;  5M4H A;  2XDX A;  3PEH A;  2IWX A;  3C11 A;  1YSR A;  2YEC A;  4LWI A;  2YEG A;  5M4K A;  1Y8N A;  1UY8 A;  3VHD A;  1YC3 A;  1ZWH A;  1YT1 A;  4FCR A;  5BOC A;  3ZXQ A;  2BZ5 A;  2XX2 A;  4DZY A;  1BGQ A;  4MPN A;  2WI1 A;  4LPB A;  4PRV A;  3TZ0 A;  3GIF A;  3EKR A;  1YET A;  4MP2 A;  2XAB A;  4GQT A;  4E01 A;  3VAD A;  4XIQ A;  1GJV A;  1YES A;  3GIG B;  4B6C A;  1H7U A;  1AMW A;  3FV5 A;  4U7N A;  5IDJ A;  5D7D A;  2XDL A;  2YEA A;  4URM A;  4CWP A;  1MU5 A;  2IOP A;  1BYQ A;  2VCI A;  2YKE A;  3TZ4 A;  3VHA A;  4XKA A;  3VHC A;  4H81 A;  3WQ9 A;  1UYM A;  4FMT A;  2PNR A;  3WHA A;  3BMY A;  1YC1 A;  1YS3 A;  2GFD A;  1UYE A;  1Z5C A;  4CWO A;  4KTN A;  1GKZ A;  3EHJ A;  1Z59 A;  4URL A;  3EKO A;  4XC0 A;  4O0B A;  4JAV A;  4CE2 A;  3EHH A;  4HYP A;  4MPE A;  2XJG A;  1AH6 A;  2H8M A;  2FWZ A;  3HHU A;  4AS9 A;  2XHT A;  2IOQ A;  3MNR P;  3D0B A;  2IOR A;  3OW6 A;  2BTZ A;  2C2A A;  2FWY A;  4L93 A;  1I5D A;  5D6P A;  3R91 A;  3D36 A;  1Y4S A;  4YKQ A;  3TZ5 A;  2XHX A;  3R4O A;  5FNC A;  3A0Y A;  2UWD A;  4ZVI A;  1UYC A;  3T0Z A;  3PEJ A;  3Q5K A;  3T10 A;  4HZ5 A;  1UYD A;  2YI5 A;  3CRL A;  5M4P A;  1Z5A A;  3O6O A;  1UYF A;  2Q8I A;  2O1W A;  2WI2 A;  2YK9 A;  3B24 A;  2BU8 A;  3DGE A;  3OWB A;  4EEH A;  1UYG A;  4V26 A;  5IN9 A;  2BYI A;  5CTW A;  5C93 A;  4XCL A;  3G7B A;  2EXL A;  2XX5 A;  3D2R A;  4U93 A;  2BU7 A;  4PRX A;  1ZW9 A; 
#chains in the Genus database with same CATH topology
 1U0Z A;  4P7A A;  3K97 A;  1AM1 A;  2VWC A;  3CRK A;  2ZDX A;  1TH8 A;  4QPJ A;  2HCH A;  1TIL A;  4EMV A;  5J71 A;  1S16 A;  1I58 A;  4HY1 A;  4HY6 A;  4XDM A;  5D7R A;  2GQP A;  2YE5 A;  4ASF A;  2BT0 A;  3U2K A;  3C0E A;  2YI6 A;  3TUH A;  3S5T A;  5FWK A;  4EGH A;  2YED A;  3ZM7 A;  2BU6 A;  4O07 A;  4MBC A;  4CWF A;  4BQJ A;  4KP4 A;  2XDS A;  4WUD A;  4KFG A;  5BOD A;  2BSM A;  5FNF A;  4MOT A;  2YE4 A;  4O04 A;  1L0O A;  4GGL A;  2XJJ A;  1NHJ A;  1ID0 A;  2WEP A;  3RKZ A;  1UY6 A;  1TC6 A;  2WEQ A;  4NH7 A;  4URO A;  3TZ2 A;  1UY7 A;  1AJ6 A;  1ZXN A;  2XHR A;  3HYZ A;  3H80 A;  5L3J A;  2XDU A;  1NHH A;  3EHF A;  4BXI A;  3U67 A;  1GKX A;  5M4E A;  4JQL A;  2O1U A;  1JM6 A;  2YKI A;  2XX4 A;  4DUH A;  1TID A;  3SL2 A;  4Q20 A;  1YT0 A;  4ASB A;  3OMU A;  1UYK A;  4WUB A;  2VCJ A;  3Q5J A;  2K5B A;  4HZ0 A;  4EFU A;  1I59 A;  2YE2 A;  4LWH A;  3JZ3 A;  4BQG A;  2YI7 A;  4ASA A;  2XCM A;  1KZN A;  2HKJ A;  3B26 A;  2QG0 A;  2YKJ A;  1A4H A;  1U2O A;  4YKT A;  2JJC A;  3A0W A;  4JAU A;  3KE6 A;  4L94 A;  1EI1 A;  4CE1 A;  2AKP A;  3A0R A;  2BU5 A;  3GIG A;  2JKI A;  1EA6 A;  5D7C A;  4EGK A;  4CWN A;  3O0I A;  4YKX A;  4PL9 A;  4HYM A;  5F3K A;  3HZ1 A;  4PU9 A;  4I5S A;  4KSG A;  4XIP A;  4BAE A;  3ZXO A;  2O1V A;  2YE6 A;  3R4M A;  3HEK A;  2VW5 A;  1Y8P A;  4L90 A;  2WI3 A;  2QG2 A;  4YKU A;  2YKC A;  4QPK A;  2YGE A;  3QDD A;  3NMQ A;  1BKN A;  2CG9 A;  1I5A A;  1YT2 A;  4JAS A;  4U7O A;  4KQV A;  4NH8 A;  5M4M A;  3GIE A;  4URN A;  2HG1 A;  4KSH A;  3A0X A;  2YE7 A;  4CWR A;  3IED A;  2ZKJ A;  1YSZ A;  2ESA A;  3ZKD A;  1UY9 A;  4H7Q A;  4L8Z A;  4GT8 A;  4E72 A;  4B7P A;  1TBW A;  2CGF A;  3T1K A;  1H7S A;  4O05 A;  4CWS A;  1NHI A;  2IWS A;  2Q8G A;  3HZ5 A;  3ZKB A;  3INW A;  1QZR A;  4E00 A;  1QY8 A;  4XIT A;  1S14 A;  2BRC A;  4EM7 A;  3INX A;  2XJX A;  1MX0 A;  1UYL A;  3CYG A;  1ZXM A;  1TC0 A;  4XTJ A;  4ZKI A;  3B27 A;  2C1G A;  3R4P A;  2YE8 A;  2QF6 A;  3Q5L A;  4WUC A;  4AWQ A;  2YGF A;  1AH8 A;  5CPH A;  1YC4 A;  4GFN A;  2E0A A;  1Y8O A;  3T2S A;  3LPS A;  2H55 A;  1KIJ A;  2CCS A;  4XE2 A;  2YE9 A;  5CTX A;  3K60 A;  1Z5B A;  2WI6 A;  2WI7 A;  4YKZ A;  2YEI A;  4E02 A;  3OWD A;  2YJW A;  2XK2 A;  2WER A;  1F51 A;  1QYE A;  4BIU A;  5F5R A;  1PVG A;  1US7 A;  3LNU A;  4XIR A;  2WI4 A;  2CH4 A;  4X9L A;  4HXW A;  1R62 A;  2YEJ A;  4O09 A;  3HYY A;  4V25 A;  2FYP A;  4NH9 A;  4R1F A;  4CWQ A;  2Q8F A;  4BIZ A;  5D6Q A;  4MB9 A;  4EFT A;  1YER A;  2YKB A;  3CGZ A;  4XKO A;  4K4O A;  1BXD A;  1Y4U A;  4LWF A;  5J6A A;  4XKK A;  2CCU A;  4W7T A;  2QFO A;  2Q8H A;  4HXZ A;  3K98 A;  5M4N A;  4YKR A;  3R4N A;  4H85 A;  3B28 A;  3QTF A;  3T0H A;  3TTZ A;  2Q2E B;  1UYI A;  2YEB A;  2ZBK B;  3A0Z A;  3LMM A;  3H4L A;  4I3H A;  4FCP A;  4LP0 A;  4AWP A;  4ASG A;  2CCT A;  3RLP A;  4R3A A;  4YKW A;  3OPD A;  1B62 A;  2BRE A;  2YE3 A;  3EHG A;  3O2F A;  4LWG A;  2BU2 A;  4FCQ A;  1B63 A;  1I5B A;  2YK2 A;  3B25 A;  4R3M A;  4CE3 A;  4CWT A;  4EGI A;  5CTY A;  2ZDY A;  4L91 A;  4XD8 A;  3CGY A;  4GCZ A;  5CTU A;  3K99 A;  2XDK A;  5FND A;  4GEE A;  1I5C A;  3R92 A;  3FT5 A;  2FXS A;  2YEF A;  1OSF A;  3CWV A;  2BYH A;  3BM9 A;  4P8O A;  2YI0 A;  3G75 A;  3U2D A;  4MPC A;  2C1I A;  4FPP A;  5IDM A;  3A0T A;  2IWU A;  4YKY A;  2YEH A;  3RLQ A;  1B3Q A;  5GGZ A;  2YEE A;  3RLR A;  1UYH A;  4XCJ A;  2YJX A;  4AWO A;  4LWE A;  3G7E A;  1THN A;  3FT8 A;  2YGA A;  2XD6 A;  2WI5 A;  5CF0 A;  4MP7 A;  5M4H A;  2XDX A;  3PEH A;  2IWX A;  3C11 A;  1YSR A;  2YEC A;  4LWI A;  2YEG A;  5M4K A;  1Y8N A;  1UY8 A;  3VHD A;  1YC3 A;  1ZWH A;  1YT1 A;  4FCR A;  5BOC A;  3ZXQ A;  2BZ5 A;  2XX2 A;  4DZY A;  1BGQ A;  4MPN A;  2WI1 A;  4LPB A;  4PRV A;  3TZ0 A;  3GIF A;  3EKR A;  1YET A;  2FTK A;  4MP2 A;  2HHI A;  2XAB A;  4GQT A;  4E01 A;  3VAD A;  4XIQ A;  1GJV A;  1YES A;  3GIG B;  4B6C A;  1H7U A;  1AMW A;  3FV5 A;  4U7N A;  5IDJ A;  5D7D A;  2XDL A;  2YEA A;  4URM A;  4CWP A;  1MU5 A;  2IOP A;  1BYQ A;  2VCI A;  2YKE A;  3TZ4 A;  3VHA A;  4XKA A;  3VHC A;  4H81 A;  3WQ9 A;  1UYM A;  4FMT A;  2PNR A;  3WHA A;  3BMY A;  1YC1 A;  1YS3 A;  2GFD A;  5JEN A;  1IXM A;  1UYE A;  1Z5C A;  4CWO A;  4KTN A;  1GKZ A;  3EHJ A;  1Z59 A;  4URL A;  3EKO A;  4XC0 A;  4O0B A;  4JAV A;  4CE2 A;  3EHH A;  4HYP A;  4MPE A;  2XJG A;  1AH6 A;  2H8M A;  2FWZ A;  3HHU A;  4AS9 A;  2XHT A;  2IOQ A;  3MNR P;  3D0B A;  2IOR A;  3OW6 A;  2BTZ A;  2C2A A;  2FWY A;  4L93 A;  1I5D A;  5D6P A;  3R91 A;  3D36 A;  1Y4S A;  4YKQ A;  3TZ5 A;  2XHX A;  3R4O A;  5FNC A;  3A0Y A;  2UWD A;  4ZVI A;  1UYC A;  3T0Z A;  3PEJ A;  3Q5K A;  3T10 A;  4HZ5 A;  1UYD A;  2YI5 A;  3CRL A;  5M4P A;  1Z5A A;  3O6O A;  1UYF A;  2Q8I A;  2O1W A;  2WI2 A;  2YK9 A;  3B24 A;  2BU8 A;  3DGE A;  3OWB A;  4EEH A;  1UYG A;  4V26 A;  5IN9 A;  2BYI A;  5CTW A;  5C93 A;  4XCL A;  3G7B A;  2EXL A;  2XX5 A;  3D2R A;  4U93 A;  2BU7 A;  4PRX A;  1ZW9 A; 
#chains in the Genus database with same CATH homology
 1U0Z A;  4P7A A;  3K97 A;  1AM1 A;  2VWC A;  3CRK A;  2ZDX A;  1TH8 A;  4QPJ A;  2HCH A;  1TIL A;  4EMV A;  5J71 A;  1S16 A;  1I58 A;  4HY1 A;  4HY6 A;  4XDM A;  5D7R A;  2GQP A;  2YE5 A;  4ASF A;  2BT0 A;  3U2K A;  3C0E A;  2YI6 A;  3TUH A;  5FWK A;  4EGH A;  2YED A;  3ZM7 A;  2BU6 A;  4O07 A;  4MBC A;  4CWF A;  4BQJ A;  4KP4 A;  2XDS A;  4WUD A;  4KFG A;  5BOD A;  2BSM A;  5FNF A;  4MOT A;  2YE4 A;  4O04 A;  1L0O A;  4GGL A;  2XJJ A;  1NHJ A;  1ID0 A;  2WEP A;  3RKZ A;  1UY6 A;  1TC6 A;  2WEQ A;  4NH7 A;  4URO A;  3TZ2 A;  1UY7 A;  1AJ6 A;  1ZXN A;  2XHR A;  3HYZ A;  3H80 A;  5L3J A;  2XDU A;  1NHH A;  3EHF A;  4BXI A;  3U67 A;  1GKX A;  5M4E A;  4JQL A;  2O1U A;  1JM6 A;  2YKI A;  2XX4 A;  4DUH A;  1TID A;  3SL2 A;  4Q20 A;  1YT0 A;  4ASB A;  3OMU A;  1UYK A;  4WUB A;  2VCJ A;  3Q5J A;  2K5B A;  4HZ0 A;  4EFU A;  1I59 A;  2YE2 A;  4LWH A;  3JZ3 A;  4BQG A;  2YI7 A;  4ASA A;  2XCM A;  1KZN A;  2HKJ A;  3B26 A;  2QG0 A;  2YKJ A;  1A4H A;  1U2O A;  4YKT A;  2JJC A;  3A0W A;  4JAU A;  3KE6 A;  4L94 A;  1EI1 A;  4CE1 A;  2AKP A;  3A0R A;  2BU5 A;  3GIG A;  2JKI A;  1EA6 A;  5D7C A;  4EGK A;  4CWN A;  3O0I A;  4YKX A;  4PL9 A;  4HYM A;  5F3K A;  3HZ1 A;  4PU9 A;  4I5S A;  4KSG A;  4XIP A;  4BAE A;  3ZXO A;  2O1V A;  2YE6 A;  3R4M A;  3HEK A;  2VW5 A;  1Y8P A;  4L90 A;  2WI3 A;  2QG2 A;  4YKU A;  2YKC A;  4QPK A;  2YGE A;  3QDD A;  3NMQ A;  1BKN A;  2CG9 A;  1I5A A;  1YT2 A;  4JAS A;  4U7O A;  4KQV A;  4NH8 A;  5M4M A;  3GIE A;  4URN A;  2HG1 A;  4KSH A;  3A0X A;  2YE7 A;  4CWR A;  3IED A;  2ZKJ A;  1YSZ A;  2ESA A;  3ZKD A;  1UY9 A;  4H7Q A;  4L8Z A;  4GT8 A;  4B7P A;  1TBW A;  2CGF A;  3T1K A;  1H7S A;  4O05 A;  4CWS A;  1NHI A;  2IWS A;  2Q8G A;  3HZ5 A;  3ZKB A;  3INW A;  1QZR A;  4E00 A;  1QY8 A;  4XIT A;  1S14 A;  2BRC A;  4EM7 A;  3INX A;  2XJX A;  1MX0 A;  1UYL A;  1ZXM A;  1TC0 A;  4XTJ A;  4ZKI A;  3B27 A;  3R4P A;  2YE8 A;  2QF6 A;  3Q5L A;  4WUC A;  4AWQ A;  2YGF A;  1AH8 A;  5CPH A;  1YC4 A;  4GFN A;  2E0A A;  1Y8O A;  3T2S A;  3LPS A;  2H55 A;  1KIJ A;  2CCS A;  4XE2 A;  2YE9 A;  5CTX A;  3K60 A;  1Z5B A;  2WI6 A;  2WI7 A;  4YKZ A;  2YEI A;  4E02 A;  3OWD A;  2YJW A;  2XK2 A;  2WER A;  1QYE A;  4BIU A;  5F5R A;  1PVG A;  1US7 A;  3LNU A;  4XIR A;  2WI4 A;  2CH4 A;  4X9L A;  4HXW A;  1R62 A;  2YEJ A;  4O09 A;  3HYY A;  4V25 A;  2FYP A;  4NH9 A;  4R1F A;  4CWQ A;  2Q8F A;  4BIZ A;  5D6Q A;  4MB9 A;  4EFT A;  1YER A;  2YKB A;  3CGZ A;  4XKO A;  4K4O A;  1BXD A;  1Y4U A;  4LWF A;  5J6A A;  4XKK A;  2CCU A;  4W7T A;  2QFO A;  2Q8H A;  4HXZ A;  3K98 A;  5M4N A;  4YKR A;  3R4N A;  4H85 A;  3B28 A;  3QTF A;  3T0H A;  3TTZ A;  2Q2E B;  1UYI A;  2YEB A;  2ZBK B;  3A0Z A;  3H4L A;  4I3H A;  4FCP A;  4LP0 A;  4AWP A;  4ASG A;  2CCT A;  3RLP A;  4R3A A;  4YKW A;  3OPD A;  1B62 A;  2BRE A;  2YE3 A;  3EHG A;  3O2F A;  4LWG A;  2BU2 A;  4FCQ A;  1B63 A;  1I5B A;  2YK2 A;  3B25 A;  4R3M A;  4CE3 A;  4CWT A;  4EGI A;  5CTY A;  2ZDY A;  4L91 A;  4XD8 A;  3CGY A;  4GCZ A;  5CTU A;  3K99 A;  2XDK A;  5FND A;  4GEE A;  1I5C A;  3R92 A;  3FT5 A;  2FXS A;  2YEF A;  1OSF A;  3CWV A;  2BYH A;  3BM9 A;  4P8O A;  2YI0 A;  3G75 A;  3U2D A;  4MPC A;  4FPP A;  5IDM A;  3A0T A;  2IWU A;  4YKY A;  2YEH A;  3RLQ A;  1B3Q A;  5GGZ A;  2YEE A;  3RLR A;  1UYH A;  4XCJ A;  2YJX A;  4AWO A;  4LWE A;  3G7E A;  1THN A;  3FT8 A;  2YGA A;  2XD6 A;  2WI5 A;  5CF0 A;  4MP7 A;  5M4H A;  2XDX A;  3PEH A;  2IWX A;  3C11 A;  1YSR A;  2YEC A;  4LWI A;  2YEG A;  5M4K A;  1Y8N A;  1UY8 A;  3VHD A;  1YC3 A;  1ZWH A;  1YT1 A;  4FCR A;  5BOC A;  3ZXQ A;  2BZ5 A;  2XX2 A;  4DZY A;  1BGQ A;  4MPN A;  2WI1 A;  4LPB A;  4PRV A;  3TZ0 A;  3GIF A;  3EKR A;  1YET A;  4MP2 A;  2XAB A;  4GQT A;  4E01 A;  3VAD A;  4XIQ A;  1GJV A;  1YES A;  3GIG B;  4B6C A;  1H7U A;  1AMW A;  3FV5 A;  4U7N A;  5IDJ A;  5D7D A;  2XDL A;  2YEA A;  4URM A;  4CWP A;  1MU5 A;  2IOP A;  1BYQ A;  2VCI A;  2YKE A;  3TZ4 A;  3VHA A;  4XKA A;  3VHC A;  4H81 A;  3WQ9 A;  1UYM A;  4FMT A;  2PNR A;  3WHA A;  3BMY A;  1YC1 A;  1YS3 A;  2GFD A;  1UYE A;  1Z5C A;  4CWO A;  4KTN A;  1GKZ A;  3EHJ A;  1Z59 A;  4URL A;  3EKO A;  4XC0 A;  4O0B A;  4JAV A;  4CE2 A;  3EHH A;  4HYP A;  4MPE A;  2XJG A;  1AH6 A;  2H8M A;  2FWZ A;  3HHU A;  4AS9 A;  2XHT A;  2IOQ A;  3MNR P;  3D0B A;  2IOR A;  3OW6 A;  2BTZ A;  2C2A A;  2FWY A;  4L93 A;  1I5D A;  5D6P A;  3R91 A;  3D36 A;  1Y4S A;  4YKQ A;  3TZ5 A;  2XHX A;  3R4O A;  5FNC A;  3A0Y A;  2UWD A;  4ZVI A;  1UYC A;  3T0Z A;  3PEJ A;  3Q5K A;  3T10 A;  4HZ5 A;  1UYD A;  2YI5 A;  3CRL A;  5M4P A;  1Z5A A;  3O6O A;  1UYF A;  2Q8I A;  2O1W A;  2WI2 A;  2YK9 A;  3B24 A;  2BU8 A;  3DGE A;  3OWB A;  4EEH A;  1UYG A;  4V26 A;  5IN9 A;  2BYI A;  5CTW A;  5C93 A;  4XCL A;  3G7B A;  2EXL A;  2XX5 A;  3D2R A;  4U93 A;  2BU7 A;  4PRX A;  1ZW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...