5IDMA

Bifunctional histidine kinase ccka (domain, ca) in complex with c-di-gmp and amppnp/mg2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
177
structure length
177
Chain Sequence
VQREVLDLGELISEFEVLLRRLLREDVKLITDYGRDLPQVRADKSQLETAVMNLAVNARDAVRAAKGGGVVRIRTARLTRDEAIQLGFPAADGDTAFIEVSDDGPGIPPDVMGKIFDPFFTTKPVGEGTGLGLATVYGIVKQSDGWIHVHSRPNEGAAFRIFLPVYEAPAALEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic di-GMP mediates a histidine kinase/phosphatase switch by noncovalent domain cross-linking.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase
molecule keywords Cell cycle histidine kinase CckA
total genus 44
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5idmA00
4NH7A 3O2FA 2YGFA 4I3HA 4MB9A 4YKWA 1GKXA 4P8OA 5CTXA 4MBCA 4URLA 2YE7A 1NHJA 2Q2EB 4PRVA 3DGEA 1I59A 4LWEA 2BU7A 3KE6A 2QFOA 4ZVIA 5FNFA 4XKOA 1B62A 4X9LA 4URMA 2WI5A 2YI5A 3FT5A 5D6QA 4BQGA 2YEIA 3R4NA 2XHXA 3T10A 5CTUA 3C0EA 4PRXA 4BAEA 4PL9A 4V26A 4MPCA 5M4PA 4K4OA 2HKJA 4L94A 3TZ5A 3R4OA 1Z59A 2VWCA 2XABA 1ZXMA 1AMWA 1BXDA 2YK2A 1ZW9A 3MNRP 2YK9A 4HY6A 5GGZA 2H55A 4FCPA 4R3MA 4HXZA 4DUHA 4HZ0A 2ESAA 1AH8A 4LWIA 1B3QA 3OWBA 2WEQA 1YC4A 2GFDA 3A0ZA 4YKXA 4BIUA 1YC1A 4HYMA 1EI1A 4LWFA 1H7SA 2YE3A 4MPNA 3OWDA 1QZRA 1AJ6A 2XDXA 2BU5A 2JJCA 2WI6A 4XCLA 2VCIA 4MPEA 4CWFA 4KFGA 3TZ0A 2YI7A 3EKOA 2YEHA 3EHGA 1UY7A 4FCQA 2AKPA 4MOTA 4QPJA 4L90A 1BKNA 2BYIA 3INWA 4WUCA 4E00A 2XX4A 3A0TA 4KSHA 4EGIA 4XIQA 2GQPA 2EXLA 3C11A 5CPHA 1TC6A 4PU9A 3O0IA 4WUDA 3GIFA 4XKKA 1UYKA 1YC3A 1JM6A 4O09A 3EHHA 1BYQA 3TZ2A 2WI7A 3Q5LA 1UYLA 4AWQA 4E02A 4MP7A 1YSZA 3LPSA 2YEGA 1Z5AA 2XX5A 2WI4A 1Z5BA 3PEHA 2YKBA 2YE6A 3A0WA 4U7NA 3R4MA 2VW5A 2ZKJA 2YI6A 1ZWHA 4R1FA 2XJGA 3R4PA 4L91A 3EHJA 4CWNA 2YEAA 1UYFA 4YKQA 3R92A 2XK2A 1I5BA 4BIZA 4KTNA 5D7RA 2XJJA 3OMUA 2QF6A 3G75A 4JQLA 2YEEA 2WI3A 2YE9A 2E0AA 5M4KA 3U2KA 2XCMA 1MX0A 4ASAA 2HCHA 1I5AA 2YGAA 4EGKA 2Q8HA 1TC0A 3WHAA 4LP0A 3PEJA 3BMYA 4BXIA 4CWPA 2FXSA 2YE8A 2BREA 5C93A 2JKIA 5M4NA 1ZXNA 3ZXQA 2WI1A 2ZDXA 1BGQA 4GQTA 3HYZA 2BU2A 2YI0A 3K97A 2YEDA 3HHUA 1U0ZA 4CWOA 4CE2A 3CRLA 2O1UA 3CRKA 3TZ4A 3FT8A 4XCJA 4ASFA 2BYHA 5L3JA 1QY8A 2XDUA 4XITA 4I5SA 3B28A 1B63A 1OSFA 2FWYA 3H4LA 1UY8A 1YESA 1QYEA 4HZ5A 1TIDA 4Q20A 1AM1A 4YKUA 2IORA 3A0XA 4U7OA 1THNA 3TTZA 2XJXA 3Q5KA 2WERA 4XIRA 5F3KA 2IWSA 2CH4A 4YKTA 2CG9A 3SL2A 4U93A 2YE4A 4XKAA 2FYPA 2IOPA 3D0BA 4H81A 1Y4UA 1UYCA 1EA6A 4JAVA 3QDDA 4KSGA 4ZKIA 1Y8NA 1KIJA 2XDSA 5BOCA 4YKZA 2BZ5A 3WQ9A 2BU8A 5M4HA 4O05A 5IDMA 4GGLA 1US7A 5F5RA 1U2OA 4B7PA 2PNRA 3B26A 4JASA 1TBWA 4FMTA 2QG0A 2YEFA 4GT8A 1UYDA 2BU6A 3EHFA 4GCZA 3Q5JA 3T0ZA 3R91A 3T0HA 3U2DA 1YT1A 2XHTA 2ZBKB 5M4MA 3RLPA 2YGEA 2C2AA 4GEEA 3EKRA 4XTJA 4O0BA 3K60A 2XHRA 3CGYA 3HEKA 4O04A 4HXWA 4AS9A 2BTZA 1KZNA 4HYPA 4FPPA 4EM7A 2YJXA 3GIGA 2XDKA 2YE5A 5BODA 4XD8A 1Y8OA 1Y8PA 3VHAA 2CCTA 2IWXA 4B6CA 3LNUA 5IDJA 2O1VA 2K5BA 1I5DA 5D6PA 3VHDA 3ZKBA 2HG1A 4EFTA 3QTFA 1UYEA 4E01A 4XE2A 4WUBA 1GKZA 2XDLA 3K99A 5IN9A 3ZM7A 1Z5CA 3OPDA 1YT2A 4EFUA 3TUHA 1UY6A 4CWQA 2CCUA 2YKCA 5D7CA 3A0YA 4NH8A 1I5CA 3D36A 3CWVA 1PVGA 4LWHA 1UYMA 4XIPA 1YETA 1Y4SA 3GIGB 5CTYA 4O07A 2BSMA 1UYGA 3JZ3A 4EMVA 3RLQA 4JAUA 4FCRA 2BRCA 3NMQA 2WEPA 1GJVA 4KQVA 2Q8IA 3GIEA 3HZ1A 3A0RA 2Q8FA 4KP4A 4GFNA 3ZXOA 3U67A 2XD6A 2XX2A 4LPBA 1R62A 2YKJA 4DZYA 3HZ5A 2ZDYA 3INXA 1ID0A 2QG2A 4P7AA 4MP2A 2Q8GA 4URNA 2YE2A 4L8ZA 1NHIA 2CCSA 2CGFA 5J6AA 4LWGA 5FNDA 3BM9A 1L0OA 5D7DA 2YEJA 3G7EA 1UYHA 4XDMA 4QPKA 2YJWA 4AWPA 2VCJA 2O1WA 5J71A 2H8MA 1MU5A 3IEDA 1H7UA 2YKEA 3HYYA 4CE1A 2WI2A 5CF0A 4NH9A 1UY9A 1UYIA 3RLRA 4L93A 4W7TA 3OW6A 4CWTA 3B25A 4ASGA 3T1KA 1TILA 3B27A 4EEHA 3B24A 4V25A 1YS3A 3O6OA 4CWRA 4H7QA 2IWUA 2FWZA 3H80A 5FWKA 1YT0A 4UROA 1A4HA 1YERA 1S14A 5FNCA 1NHHA 4YKYA 3VHCA 2YECA 4EGHA 3ZKDA 3RKZA 4BQJA 2UWDA 1S16A 3T2SA 4HY1A 3G7BA 4XC0A 3FV5A 3D2RA 2YKIA 1TH8A 5M4EA 4ASBA 4CWSA 4CE3A 3K98A 5CTWA 4R3AA 4H85A 2BT0A 4YKRA 2IOQA 2YEBA 4AWOA 1AH6A 3VADA 3CGZA 1YSRA 1I58A
chains in the Genus database with same CATH superfamily
4NH7A 3O2FA 2YGFA 4I3HA 4MB9A 4YKWA 1GKXA 3LMMA 4P8OA 5CTXA 4MBCA 4URLA 2YE7A 1NHJA 2Q2EB 4PRVA 3DGEA 1I59A 4LWEA 2BU7A 3KE6A 2QFOA 4ZVIA 5FNFA 4XKOA 1B62A 4X9LA 4URMA 2WI5A 2YI5A 3FT5A 5D6QA 4BQGA 2YEIA 3R4NA 2XHXA 3T10A 5CTUA 3C0EA 4PRXA 4BAEA 4PL9A 4V26A 4MPCA 5M4PA 4K4OA 2HKJA 4L94A 3TZ5A 3R4OA 1Z59A 4E72A 2VWCA 2XABA 1ZXMA 1AMWA 1BXDA 2YK2A 1ZW9A 3MNRP 2YK9A 4HY6A 5GGZA 2H55A 4FCPA 4R3MA 4HXZA 4DUHA 4HZ0A 2ESAA 1AH8A 4LWIA 1B3QA 3OWBA 2WEQA 1YC4A 2GFDA 3A0ZA 4YKXA 4BIUA 1YC1A 4HYMA 1EI1A 4LWFA 1H7SA 2YE3A 3CYGA 4MPNA 3OWDA 1QZRA 1AJ6A 2XDXA 2BU5A 2JJCA 2WI6A 4XCLA 2VCIA 4MPEA 4CWFA 4KFGA 3TZ0A 2YI7A 3EKOA 2YEHA 3EHGA 1UY7A 4FCQA 2AKPA 4MOTA 4QPJA 4L90A 1BKNA 2BYIA 3INWA 4WUCA 4E00A 2XX4A 3A0TA 4KSHA 4EGIA 4XIQA 2GQPA 2EXLA 3C11A 5CPHA 1TC6A 4PU9A 3O0IA 4WUDA 3GIFA 4XKKA 1UYKA 1YC3A 1JM6A 4O09A 3EHHA 1BYQA 3TZ2A 2WI7A 3Q5LA 1UYLA 4AWQA 4E02A 4MP7A 1YSZA 3LPSA 2YEGA 1Z5AA 2XX5A 2WI4A 1Z5BA 3PEHA 2YKBA 2YE6A 3A0WA 1IXMA 4U7NA 3R4MA 2VW5A 2ZKJA 2YI6A 1ZWHA 4R1FA 2XJGA 3R4PA 4L91A 3EHJA 4CWNA 2YEAA 1UYFA 4YKQA 3R92A 2XK2A 1I5BA 4BIZA 4KTNA 5D7RA 2XJJA 3OMUA 2QF6A 3G75A 1F51A 4JQLA 2YEEA 2WI3A 2YE9A 2E0AA 5M4KA 3U2KA 2XCMA 1MX0A 4ASAA 2HCHA 1I5AA 2YGAA 4EGKA 2Q8HA 1TC0A 3WHAA 4LP0A 3PEJA 3BMYA 4BXIA 4CWPA 2FXSA 2YE8A 2BREA 5C93A 5JENA 2JKIA 5M4NA 1ZXNA 3ZXQA 2WI1A 2ZDXA 1BGQA 4GQTA 3HYZA 2BU2A 2YI0A 3K97A 2YEDA 3HHUA 1U0ZA 4CWOA 4CE2A 3CRLA 2O1UA 3CRKA 3TZ4A 3FT8A 4XCJA 4ASFA 2BYHA 5L3JA 1QY8A 2XDUA 4XITA 4I5SA 3B28A 1B63A 1OSFA 2FWYA 3H4LA 1UY8A 1YESA 1QYEA 4HZ5A 1TIDA 4Q20A 1AM1A 4YKUA 2IORA 3A0XA 4U7OA 1THNA 3TTZA 2XJXA 3Q5KA 2WERA 4XIRA 5F3KA 2IWSA 2CH4A 4YKTA 2CG9A 3SL2A 4U93A 2YE4A 4XKAA 2FYPA 2IOPA 3D0BA 4H81A 1Y4UA 1UYCA 2C1GA 1EA6A 4JAVA 3QDDA 4KSGA 4ZKIA 1Y8NA 1KIJA 2FTKA 2XDSA 5BOCA 4YKZA 2BZ5A 3WQ9A 2BU8A 5M4HA 4O05A 5IDMA 4GGLA 1US7A 5F5RA 1U2OA 4B7PA 2PNRA 3B26A 4JASA 1TBWA 4FMTA 2C1IA 2QG0A 2YEFA 4GT8A 1UYDA 2BU6A 3EHFA 4GCZA 3Q5JA 3T0ZA 3R91A 3T0HA 3U2DA 1YT1A 2XHTA 2ZBKB 5M4MA 3RLPA 2YGEA 2C2AA 4GEEA 3EKRA 4XTJA 4O0BA 3K60A 2XHRA 3CGYA 3HEKA 4O04A 4HXWA 4AS9A 2BTZA 1KZNA 4HYPA 4FPPA 4EM7A 2YJXA 3GIGA 2XDKA 2YE5A 5BODA 4XD8A 1Y8OA 1Y8PA 3VHAA 2CCTA 2IWXA 4B6CA 3LNUA 5IDJA 2O1VA 2K5BA 1I5DA 5D6PA 3VHDA 3ZKBA 2HG1A 4EFTA 3QTFA 1UYEA 4E01A 4XE2A 4WUBA 1GKZA 2XDLA 3K99A 5IN9A 3ZM7A 1Z5CA 3OPDA 1YT2A 4EFUA 3TUHA 1UY6A 4CWQA 2CCUA 2YKCA 5D7CA 2HHIA 3A0YA 4NH8A 1I5CA 3D36A 3CWVA 1PVGA 4LWHA 1UYMA 4XIPA 1YETA 1Y4SA 3GIGB 5CTYA 4O07A 2BSMA 1UYGA 3JZ3A 4EMVA 3RLQA 4JAUA 4FCRA 2BRCA 3NMQA 2WEPA 1GJVA 4KQVA 2Q8IA 3GIEA 3HZ1A 3A0RA 2Q8FA 4KP4A 4GFNA 3ZXOA 3U67A 2XD6A 2XX2A 4LPBA 1R62A 2YKJA 4DZYA 3HZ5A 2ZDYA 3INXA 1ID0A 2QG2A 4P7AA 4MP2A 2Q8GA 4URNA 2YE2A 4L8ZA 1NHIA 2CCSA 2CGFA 5J6AA 4LWGA 5FNDA 3BM9A 1L0OA 5D7DA 2YEJA 3G7EA 1UYHA 4XDMA 4QPKA 2YJWA 4AWPA 2VCJA 2O1WA 5J71A 2H8MA 1MU5A 3IEDA 1H7UA 2YKEA 3HYYA 4CE1A 2WI2A 5CF0A 4NH9A 1UY9A 1UYIA 3RLRA 4L93A 4W7TA 3OW6A 4CWTA 3B25A 4ASGA 3T1KA 1TILA 3B27A 4EEHA 3B24A 4V25A 1YS3A 3O6OA 4CWRA 4H7QA 2IWUA 2FWZA 3H80A 5FWKA 1YT0A 4UROA 1A4HA 1YERA 1S14A 5FNCA 1NHHA 4YKYA 3VHCA 2YECA 4EGHA 3ZKDA 3RKZA 4BQJA 2UWDA 1S16A 3T2SA 4HY1A 3G7BA 3S5TA 4XC0A 3FV5A 3D2RA 2YKIA 1TH8A 5M4EA 4ASBA 4CWSA 4CE3A 3K98A 5CTWA 4R3AA 4H85A 2BT0A 4YKRA 2IOQA 2YEBA 4AWOA 1AH6A 3VADA 3CGZA 1YSRA 1I58A
chains in the Genus database with same CATH topology
4NH7A 3O2FA 2YGFA 4I3HA 4MB9A 4YKWA 1GKXA 4P8OA 5CTXA 4MBCA 4URLA 2YE7A 1NHJA 2Q2EB 4PRVA 3DGEA 1I59A 4LWEA 2BU7A 3KE6A 2QFOA 4ZVIA 5FNFA 4XKOA 1B62A 4X9LA 4URMA 2WI5A 2YI5A 3FT5A 5D6QA 4BQGA 2YEIA 3R4NA 2XHXA 3T10A 5CTUA 3C0EA 4PRXA 4BAEA 4PL9A 4V26A 4MPCA 5M4PA 4K4OA 2HKJA 4L94A 3TZ5A 3R4OA 1Z59A 2VWCA 2XABA 1ZXMA 1AMWA 1BXDA 2YK2A 1ZW9A 3MNRP 2YK9A 4HY6A 5GGZA 2H55A 4FCPA 4R3MA 4HXZA 4DUHA 4HZ0A 2ESAA 1AH8A 4LWIA 1B3QA 3OWBA 2WEQA 1YC4A 2GFDA 3A0ZA 4YKXA 4BIUA 1YC1A 4HYMA 1EI1A 4LWFA 1H7SA 2YE3A 4MPNA 3OWDA 1QZRA 1AJ6A 2XDXA 2BU5A 2JJCA 2WI6A 4XCLA 2VCIA 4MPEA 4CWFA 4KFGA 3TZ0A 2YI7A 3EKOA 2YEHA 3EHGA 1UY7A 4FCQA 2AKPA 4MOTA 4QPJA 4L90A 1BKNA 2BYIA 3INWA 4WUCA 4E00A 2XX4A 3A0TA 4KSHA 4EGIA 4XIQA 2GQPA 2EXLA 3C11A 5CPHA 1TC6A 4PU9A 3O0IA 4WUDA 3GIFA 4XKKA 1UYKA 1YC3A 1JM6A 4O09A 3EHHA 1BYQA 3TZ2A 2WI7A 3Q5LA 1UYLA 4AWQA 4E02A 4MP7A 1YSZA 3LPSA 2YEGA 1Z5AA 2XX5A 2WI4A 1Z5BA 3PEHA 2YKBA 2YE6A 3A0WA 4U7NA 3R4MA 2VW5A 2ZKJA 2YI6A 1ZWHA 4R1FA 2XJGA 3R4PA 4L91A 3EHJA 4CWNA 2YEAA 1UYFA 4YKQA 3R92A 2XK2A 1I5BA 4BIZA 4KTNA 5D7RA 2XJJA 3OMUA 2QF6A 3G75A 4JQLA 2YEEA 2WI3A 2YE9A 2E0AA 5M4KA 3U2KA 2XCMA 1MX0A 4ASAA 2HCHA 1I5AA 2YGAA 4EGKA 2Q8HA 1TC0A 3WHAA 4LP0A 3PEJA 3BMYA 4BXIA 4CWPA 2FXSA 2YE8A 2BREA 5C93A 2JKIA 5M4NA 1ZXNA 3ZXQA 2WI1A 2ZDXA 1BGQA 4GQTA 3HYZA 2BU2A 2YI0A 3K97A 2YEDA 3HHUA 1U0ZA 4CWOA 4CE2A 3CRLA 2O1UA 3CRKA 3TZ4A 3FT8A 4XCJA 4ASFA 2BYHA 5L3JA 1QY8A 2XDUA 4XITA 4I5SA 3B28A 1B63A 1OSFA 2FWYA 3H4LA 1UY8A 1YESA 1QYEA 4HZ5A 1TIDA 4Q20A 1AM1A 4YKUA 2IORA 3A0XA 4U7OA 1THNA 3TTZA 2XJXA 3Q5KA 2WERA 4XIRA 5F3KA 2IWSA 2CH4A 4YKTA 2CG9A 3SL2A 4U93A 2YE4A 4XKAA 2FYPA 2IOPA 3D0BA 4H81A 1Y4UA 1UYCA 1EA6A 4JAVA 3QDDA 4KSGA 4ZKIA 1Y8NA 1KIJA 2XDSA 5BOCA 4YKZA 2BZ5A 3WQ9A 2BU8A 5M4HA 4O05A 5IDMA 4GGLA 1US7A 5F5RA 1U2OA 4B7PA 2PNRA 3B26A 4JASA 1TBWA 4FMTA 2QG0A 2YEFA 4GT8A 1UYDA 2BU6A 3EHFA 4GCZA 3Q5JA 3T0ZA 3R91A 3T0HA 3U2DA 1YT1A 2XHTA 2ZBKB 5M4MA 3RLPA 2YGEA 2C2AA 4GEEA 3EKRA 4XTJA 4O0BA 3K60A 2XHRA 3CGYA 3HEKA 4O04A 4HXWA 4AS9A 2BTZA 1KZNA 4HYPA 4FPPA 4EM7A 2YJXA 3GIGA 2XDKA 2YE5A 5BODA 4XD8A 1Y8OA 1Y8PA 3VHAA 2CCTA 2IWXA 4B6CA 3LNUA 5IDJA 2O1VA 2K5BA 1I5DA 5D6PA 3VHDA 3ZKBA 2HG1A 4EFTA 3QTFA 1UYEA 4E01A 4XE2A 4WUBA 1GKZA 2XDLA 3K99A 5IN9A 3ZM7A 1Z5CA 3OPDA 1YT2A 4EFUA 3TUHA 1UY6A 4CWQA 2CCUA 2YKCA 5D7CA 3A0YA 4NH8A 1I5CA 3D36A 3CWVA 1PVGA 4LWHA 1UYMA 4XIPA 1YETA 1Y4SA 3GIGB 5CTYA 4O07A 2BSMA 1UYGA 3JZ3A 4EMVA 3RLQA 4JAUA 4FCRA 2BRCA 3NMQA 2WEPA 1GJVA 4KQVA 2Q8IA 3GIEA 3HZ1A 3A0RA 2Q8FA 4KP4A 4GFNA 3ZXOA 3U67A 2XD6A 2XX2A 4LPBA 1R62A 2YKJA 4DZYA 3HZ5A 2ZDYA 3INXA 1ID0A 2QG2A 4P7AA 4MP2A 2Q8GA 4URNA 2YE2A 4L8ZA 1NHIA 2CCSA 2CGFA 5J6AA 4LWGA 5FNDA 3BM9A 1L0OA 5D7DA 2YEJA 3G7EA 1UYHA 4XDMA 4QPKA 2YJWA 4AWPA 2VCJA 2O1WA 5J71A 2H8MA 1MU5A 3IEDA 1H7UA 2YKEA 3HYYA 4CE1A 2WI2A 5CF0A 4NH9A 1UY9A 1UYIA 3RLRA 4L93A 4W7TA 3OW6A 4CWTA 3B25A 4ASGA 3T1KA 1TILA 3B27A 4EEHA 3B24A 4V25A 1YS3A 3O6OA 4CWRA 4H7QA 2IWUA 2FWZA 3H80A 5FWKA 1YT0A 4UROA 1A4HA 1YERA 1S14A 5FNCA 1NHHA 4YKYA 3VHCA 2YECA 4EGHA 3ZKDA 3RKZA 4BQJA 2UWDA 1S16A 3T2SA 4HY1A 3G7BA 4XC0A 3FV5A 3D2RA 2YKIA 1TH8A 5M4EA 4ASBA 4CWSA 4CE3A 3K98A 5CTWA 4R3AA 4H85A 2BT0A 4YKRA 2IOQA 2YEBA 4AWOA 1AH6A 3VADA 3CGZA 1YSRA 1I58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NH7 A;  3O2F A;  2YGF A;  4I3H A;  4MB9 A;  4YKW A;  1GKX A;  4P8O A;  5CTX A;  4MBC A;  4URL A;  2YE7 A;  1NHJ A;  2Q2E B;  4PRV A;  3DGE A;  1I59 A;  4LWE A;  2BU7 A;  3KE6 A;  2QFO A;  4ZVI A;  5FNF A;  4XKO A;  1B62 A;  4X9L A;  4URM A;  2WI5 A;  2YI5 A;  3FT5 A;  5D6Q A;  4BQG A;  2YEI A;  3R4N A;  2XHX A;  3T10 A;  5CTU A;  3C0E A;  4PRX A;  4BAE A;  4PL9 A;  4V26 A;  4MPC A;  5M4P A;  4K4O A;  2HKJ A;  4L94 A;  3TZ5 A;  3R4O A;  1Z59 A;  2VWC A;  2XAB A;  1ZXM A;  1AMW A;  1BXD A;  2YK2 A;  1ZW9 A;  3MNR P;  2YK9 A;  4HY6 A;  5GGZ A;  2H55 A;  4FCP A;  4R3M A;  4HXZ A;  4DUH A;  4HZ0 A;  2ESA A;  1AH8 A;  4LWI A;  1B3Q A;  3OWB A;  2WEQ A;  1YC4 A;  2GFD A;  3A0Z A;  4YKX A;  4BIU A;  1YC1 A;  4HYM A;  1EI1 A;  4LWF A;  1H7S A;  2YE3 A;  4MPN A;  3OWD A;  1QZR A;  1AJ6 A;  2XDX A;  2BU5 A;  2JJC A;  2WI6 A;  4XCL A;  2VCI A;  4MPE A;  4CWF A;  4KFG A;  3TZ0 A;  2YI7 A;  3EKO A;  2YEH A;  3EHG A;  1UY7 A;  4FCQ A;  2AKP A;  4MOT A;  4QPJ A;  4L90 A;  1BKN A;  2BYI A;  3INW A;  4WUC A;  4E00 A;  2XX4 A;  3A0T A;  4KSH A;  4EGI A;  4XIQ A;  2GQP A;  2EXL A;  3C11 A;  5CPH A;  1TC6 A;  4PU9 A;  3O0I A;  4WUD A;  3GIF A;  4XKK A;  1UYK A;  1YC3 A;  1JM6 A;  4O09 A;  3EHH A;  1BYQ A;  3TZ2 A;  2WI7 A;  3Q5L A;  1UYL A;  4AWQ A;  4E02 A;  4MP7 A;  1YSZ A;  3LPS A;  2YEG A;  1Z5A A;  2XX5 A;  2WI4 A;  1Z5B A;  3PEH A;  2YKB A;  2YE6 A;  3A0W A;  4U7N A;  3R4M A;  2VW5 A;  2ZKJ A;  2YI6 A;  1ZWH A;  4R1F A;  2XJG A;  3R4P A;  4L91 A;  3EHJ A;  4CWN A;  2YEA A;  1UYF A;  4YKQ A;  3R92 A;  2XK2 A;  1I5B A;  4BIZ A;  4KTN A;  5D7R A;  2XJJ A;  3OMU A;  2QF6 A;  3G75 A;  4JQL A;  2YEE A;  2WI3 A;  2YE9 A;  2E0A A;  5M4K A;  3U2K A;  2XCM A;  1MX0 A;  4ASA A;  2HCH A;  1I5A A;  2YGA A;  4EGK A;  2Q8H A;  1TC0 A;  3WHA A;  4LP0 A;  3PEJ A;  3BMY A;  4BXI A;  4CWP A;  2FXS A;  2YE8 A;  2BRE A;  5C93 A;  2JKI A;  5M4N A;  1ZXN A;  3ZXQ A;  2WI1 A;  2ZDX A;  1BGQ A;  4GQT A;  3HYZ A;  2BU2 A;  2YI0 A;  3K97 A;  2YED A;  3HHU A;  1U0Z A;  4CWO A;  4CE2 A;  3CRL A;  2O1U A;  3CRK A;  3TZ4 A;  3FT8 A;  4XCJ A;  4ASF A;  2BYH A;  5L3J A;  1QY8 A;  2XDU A;  4XIT A;  4I5S A;  3B28 A;  1B63 A;  1OSF A;  2FWY A;  3H4L A;  1UY8 A;  1YES A;  1QYE A;  4HZ5 A;  1TID A;  4Q20 A;  1AM1 A;  4YKU A;  2IOR A;  3A0X A;  4U7O A;  1THN A;  3TTZ A;  2XJX A;  3Q5K A;  2WER A;  4XIR A;  5F3K A;  2IWS A;  2CH4 A;  4YKT A;  2CG9 A;  3SL2 A;  4U93 A;  2YE4 A;  4XKA A;  2FYP A;  2IOP A;  3D0B A;  4H81 A;  1Y4U A;  1UYC A;  1EA6 A;  4JAV A;  3QDD A;  4KSG A;  4ZKI A;  1Y8N A;  1KIJ A;  2XDS A;  5BOC A;  4YKZ A;  2BZ5 A;  3WQ9 A;  2BU8 A;  5M4H A;  4O05 A;  5IDM A;  4GGL A;  1US7 A;  5F5R A;  1U2O A;  4B7P A;  2PNR A;  3B26 A;  4JAS A;  1TBW A;  4FMT A;  2QG0 A;  2YEF A;  4GT8 A;  1UYD A;  2BU6 A;  3EHF A;  4GCZ A;  3Q5J A;  3T0Z A;  3R91 A;  3T0H A;  3U2D A;  1YT1 A;  2XHT A;  2ZBK B;  5M4M A;  3RLP A;  2YGE A;  2C2A A;  4GEE A;  3EKR A;  4XTJ A;  4O0B A;  3K60 A;  2XHR A;  3CGY A;  3HEK A;  4O04 A;  4HXW A;  4AS9 A;  2BTZ A;  1KZN A;  4HYP A;  4FPP A;  4EM7 A;  2YJX A;  3GIG A;  2XDK A;  2YE5 A;  5BOD A;  4XD8 A;  1Y8O A;  1Y8P A;  3VHA A;  2CCT A;  2IWX A;  4B6C A;  3LNU A;  5IDJ A;  2O1V A;  2K5B A;  1I5D A;  5D6P A;  3VHD A;  3ZKB A;  2HG1 A;  4EFT A;  3QTF A;  1UYE A;  4E01 A;  4XE2 A;  4WUB A;  1GKZ A;  2XDL A;  3K99 A;  5IN9 A;  3ZM7 A;  1Z5C A;  3OPD A;  1YT2 A;  4EFU A;  3TUH A;  1UY6 A;  4CWQ A;  2CCU A;  2YKC A;  5D7C A;  3A0Y A;  4NH8 A;  1I5C A;  3D36 A;  3CWV A;  1PVG A;  4LWH A;  1UYM A;  4XIP A;  1YET A;  1Y4S A;  3GIG B;  5CTY A;  4O07 A;  2BSM A;  1UYG A;  3JZ3 A;  4EMV A;  3RLQ A;  4JAU A;  4FCR A;  2BRC A;  3NMQ A;  2WEP A;  1GJV A;  4KQV A;  2Q8I A;  3GIE A;  3HZ1 A;  3A0R A;  2Q8F A;  4KP4 A;  4GFN A;  3ZXO A;  3U67 A;  2XD6 A;  2XX2 A;  4LPB A;  1R62 A;  2YKJ A;  4DZY A;  3HZ5 A;  2ZDY A;  3INX A;  1ID0 A;  2QG2 A;  4P7A A;  4MP2 A;  2Q8G A;  4URN A;  2YE2 A;  4L8Z A;  1NHI A;  2CCS A;  2CGF A;  5J6A A;  4LWG A;  5FND A;  3BM9 A;  1L0O A;  5D7D A;  2YEJ A;  3G7E A;  1UYH A;  4XDM A;  4QPK A;  2YJW A;  4AWP A;  2VCJ A;  2O1W A;  5J71 A;  2H8M A;  1MU5 A;  3IED A;  1H7U A;  2YKE A;  3HYY A;  4CE1 A;  2WI2 A;  5CF0 A;  4NH9 A;  1UY9 A;  1UYI A;  3RLR A;  4L93 A;  4W7T A;  3OW6 A;  4CWT A;  3B25 A;  4ASG A;  3T1K A;  1TIL A;  3B27 A;  4EEH A;  3B24 A;  4V25 A;  1YS3 A;  3O6O A;  4CWR A;  4H7Q A;  2IWU A;  2FWZ A;  3H80 A;  5FWK A;  1YT0 A;  4URO A;  1A4H A;  1YER A;  1S14 A;  5FNC A;  1NHH A;  4YKY A;  3VHC A;  2YEC A;  4EGH A;  3ZKD A;  3RKZ A;  4BQJ A;  2UWD A;  1S16 A;  3T2S A;  4HY1 A;  3G7B A;  4XC0 A;  3FV5 A;  3D2R A;  2YKI A;  1TH8 A;  5M4E A;  4ASB A;  4CWS A;  4CE3 A;  3K98 A;  5CTW A;  4R3A A;  4H85 A;  2BT0 A;  4YKR A;  2IOQ A;  2YEB A;  4AWO A;  1AH6 A;  3VAD A;  3CGZ A;  1YSR A;  1I58 A; 
#chains in the Genus database with same CATH topology
 4NH7 A;  3O2F A;  2YGF A;  4I3H A;  4MB9 A;  4YKW A;  1GKX A;  3LMM A;  4P8O A;  5CTX A;  4MBC A;  4URL A;  2YE7 A;  1NHJ A;  2Q2E B;  4PRV A;  3DGE A;  1I59 A;  4LWE A;  2BU7 A;  3KE6 A;  2QFO A;  4ZVI A;  5FNF A;  4XKO A;  1B62 A;  4X9L A;  4URM A;  2WI5 A;  2YI5 A;  3FT5 A;  5D6Q A;  4BQG A;  2YEI A;  3R4N A;  2XHX A;  3T10 A;  5CTU A;  3C0E A;  4PRX A;  4BAE A;  4PL9 A;  4V26 A;  4MPC A;  5M4P A;  4K4O A;  2HKJ A;  4L94 A;  3TZ5 A;  3R4O A;  1Z59 A;  4E72 A;  2VWC A;  2XAB A;  1ZXM A;  1AMW A;  1BXD A;  2YK2 A;  1ZW9 A;  3MNR P;  2YK9 A;  4HY6 A;  5GGZ A;  2H55 A;  4FCP A;  4R3M A;  4HXZ A;  4DUH A;  4HZ0 A;  2ESA A;  1AH8 A;  4LWI A;  1B3Q A;  3OWB A;  2WEQ A;  1YC4 A;  2GFD A;  3A0Z A;  4YKX A;  4BIU A;  1YC1 A;  4HYM A;  1EI1 A;  4LWF A;  1H7S A;  2YE3 A;  3CYG A;  4MPN A;  3OWD A;  1QZR A;  1AJ6 A;  2XDX A;  2BU5 A;  2JJC A;  2WI6 A;  4XCL A;  2VCI A;  4MPE A;  4CWF A;  4KFG A;  3TZ0 A;  2YI7 A;  3EKO A;  2YEH A;  3EHG A;  1UY7 A;  4FCQ A;  2AKP A;  4MOT A;  4QPJ A;  4L90 A;  1BKN A;  2BYI A;  3INW A;  4WUC A;  4E00 A;  2XX4 A;  3A0T A;  4KSH A;  4EGI A;  4XIQ A;  2GQP A;  2EXL A;  3C11 A;  5CPH A;  1TC6 A;  4PU9 A;  3O0I A;  4WUD A;  3GIF A;  4XKK A;  1UYK A;  1YC3 A;  1JM6 A;  4O09 A;  3EHH A;  1BYQ A;  3TZ2 A;  2WI7 A;  3Q5L A;  1UYL A;  4AWQ A;  4E02 A;  4MP7 A;  1YSZ A;  3LPS A;  2YEG A;  1Z5A A;  2XX5 A;  2WI4 A;  1Z5B A;  3PEH A;  2YKB A;  2YE6 A;  3A0W A;  1IXM A;  4U7N A;  3R4M A;  2VW5 A;  2ZKJ A;  2YI6 A;  1ZWH A;  4R1F A;  2XJG A;  3R4P A;  4L91 A;  3EHJ A;  4CWN A;  2YEA A;  1UYF A;  4YKQ A;  3R92 A;  2XK2 A;  1I5B A;  4BIZ A;  4KTN A;  5D7R A;  2XJJ A;  3OMU A;  2QF6 A;  3G75 A;  1F51 A;  4JQL A;  2YEE A;  2WI3 A;  2YE9 A;  2E0A A;  5M4K A;  3U2K A;  2XCM A;  1MX0 A;  4ASA A;  2HCH A;  1I5A A;  2YGA A;  4EGK A;  2Q8H A;  1TC0 A;  3WHA A;  4LP0 A;  3PEJ A;  3BMY A;  4BXI A;  4CWP A;  2FXS A;  2YE8 A;  2BRE A;  5C93 A;  5JEN A;  2JKI A;  5M4N A;  1ZXN A;  3ZXQ A;  2WI1 A;  2ZDX A;  1BGQ A;  4GQT A;  3HYZ A;  2BU2 A;  2YI0 A;  3K97 A;  2YED A;  3HHU A;  1U0Z A;  4CWO A;  4CE2 A;  3CRL A;  2O1U A;  3CRK A;  3TZ4 A;  3FT8 A;  4XCJ A;  4ASF A;  2BYH A;  5L3J A;  1QY8 A;  2XDU A;  4XIT A;  4I5S A;  3B28 A;  1B63 A;  1OSF A;  2FWY A;  3H4L A;  1UY8 A;  1YES A;  1QYE A;  4HZ5 A;  1TID A;  4Q20 A;  1AM1 A;  4YKU A;  2IOR A;  3A0X A;  4U7O A;  1THN A;  3TTZ A;  2XJX A;  3Q5K A;  2WER A;  4XIR A;  5F3K A;  2IWS A;  2CH4 A;  4YKT A;  2CG9 A;  3SL2 A;  4U93 A;  2YE4 A;  4XKA A;  2FYP A;  2IOP A;  3D0B A;  4H81 A;  1Y4U A;  1UYC A;  2C1G A;  1EA6 A;  4JAV A;  3QDD A;  4KSG A;  4ZKI A;  1Y8N A;  1KIJ A;  2FTK A;  2XDS A;  5BOC A;  4YKZ A;  2BZ5 A;  3WQ9 A;  2BU8 A;  5M4H A;  4O05 A;  5IDM A;  4GGL A;  1US7 A;  5F5R A;  1U2O A;  4B7P A;  2PNR A;  3B26 A;  4JAS A;  1TBW A;  4FMT A;  2C1I A;  2QG0 A;  2YEF A;  4GT8 A;  1UYD A;  2BU6 A;  3EHF A;  4GCZ A;  3Q5J A;  3T0Z A;  3R91 A;  3T0H A;  3U2D A;  1YT1 A;  2XHT A;  2ZBK B;  5M4M A;  3RLP A;  2YGE A;  2C2A A;  4GEE A;  3EKR A;  4XTJ A;  4O0B A;  3K60 A;  2XHR A;  3CGY A;  3HEK A;  4O04 A;  4HXW A;  4AS9 A;  2BTZ A;  1KZN A;  4HYP A;  4FPP A;  4EM7 A;  2YJX A;  3GIG A;  2XDK A;  2YE5 A;  5BOD A;  4XD8 A;  1Y8O A;  1Y8P A;  3VHA A;  2CCT A;  2IWX A;  4B6C A;  3LNU A;  5IDJ A;  2O1V A;  2K5B A;  1I5D A;  5D6P A;  3VHD A;  3ZKB A;  2HG1 A;  4EFT A;  3QTF A;  1UYE A;  4E01 A;  4XE2 A;  4WUB A;  1GKZ A;  2XDL A;  3K99 A;  5IN9 A;  3ZM7 A;  1Z5C A;  3OPD A;  1YT2 A;  4EFU A;  3TUH A;  1UY6 A;  4CWQ A;  2CCU A;  2YKC A;  5D7C A;  2HHI A;  3A0Y A;  4NH8 A;  1I5C A;  3D36 A;  3CWV A;  1PVG A;  4LWH A;  1UYM A;  4XIP A;  1YET A;  1Y4S A;  3GIG B;  5CTY A;  4O07 A;  2BSM A;  1UYG A;  3JZ3 A;  4EMV A;  3RLQ A;  4JAU A;  4FCR A;  2BRC A;  3NMQ A;  2WEP A;  1GJV A;  4KQV A;  2Q8I A;  3GIE A;  3HZ1 A;  3A0R A;  2Q8F A;  4KP4 A;  4GFN A;  3ZXO A;  3U67 A;  2XD6 A;  2XX2 A;  4LPB A;  1R62 A;  2YKJ A;  4DZY A;  3HZ5 A;  2ZDY A;  3INX A;  1ID0 A;  2QG2 A;  4P7A A;  4MP2 A;  2Q8G A;  4URN A;  2YE2 A;  4L8Z A;  1NHI A;  2CCS A;  2CGF A;  5J6A A;  4LWG A;  5FND A;  3BM9 A;  1L0O A;  5D7D A;  2YEJ A;  3G7E A;  1UYH A;  4XDM A;  4QPK A;  2YJW A;  4AWP A;  2VCJ A;  2O1W A;  5J71 A;  2H8M A;  1MU5 A;  3IED A;  1H7U A;  2YKE A;  3HYY A;  4CE1 A;  2WI2 A;  5CF0 A;  4NH9 A;  1UY9 A;  1UYI A;  3RLR A;  4L93 A;  4W7T A;  3OW6 A;  4CWT A;  3B25 A;  4ASG A;  3T1K A;  1TIL A;  3B27 A;  4EEH A;  3B24 A;  4V25 A;  1YS3 A;  3O6O A;  4CWR A;  4H7Q A;  2IWU A;  2FWZ A;  3H80 A;  5FWK A;  1YT0 A;  4URO A;  1A4H A;  1YER A;  1S14 A;  5FNC A;  1NHH A;  4YKY A;  3VHC A;  2YEC A;  4EGH A;  3ZKD A;  3RKZ A;  4BQJ A;  2UWD A;  1S16 A;  3T2S A;  4HY1 A;  3G7B A;  3S5T A;  4XC0 A;  3FV5 A;  3D2R A;  2YKI A;  1TH8 A;  5M4E A;  4ASB A;  4CWS A;  4CE3 A;  3K98 A;  5CTW A;  4R3A A;  4H85 A;  2BT0 A;  4YKR A;  2IOQ A;  2YEB A;  4AWO A;  1AH6 A;  3VAD A;  3CGZ A;  1YSR A;  1I58 A; 
#chains in the Genus database with same CATH homology
 4NH7 A;  3O2F A;  2YGF A;  4I3H A;  4MB9 A;  4YKW A;  1GKX A;  4P8O A;  5CTX A;  4MBC A;  4URL A;  2YE7 A;  1NHJ A;  2Q2E B;  4PRV A;  3DGE A;  1I59 A;  4LWE A;  2BU7 A;  3KE6 A;  2QFO A;  4ZVI A;  5FNF A;  4XKO A;  1B62 A;  4X9L A;  4URM A;  2WI5 A;  2YI5 A;  3FT5 A;  5D6Q A;  4BQG A;  2YEI A;  3R4N A;  2XHX A;  3T10 A;  5CTU A;  3C0E A;  4PRX A;  4BAE A;  4PL9 A;  4V26 A;  4MPC A;  5M4P A;  4K4O A;  2HKJ A;  4L94 A;  3TZ5 A;  3R4O A;  1Z59 A;  2VWC A;  2XAB A;  1ZXM A;  1AMW A;  1BXD A;  2YK2 A;  1ZW9 A;  3MNR P;  2YK9 A;  4HY6 A;  5GGZ A;  2H55 A;  4FCP A;  4R3M A;  4HXZ A;  4DUH A;  4HZ0 A;  2ESA A;  1AH8 A;  4LWI A;  1B3Q A;  3OWB A;  2WEQ A;  1YC4 A;  2GFD A;  3A0Z A;  4YKX A;  4BIU A;  1YC1 A;  4HYM A;  1EI1 A;  4LWF A;  1H7S A;  2YE3 A;  4MPN A;  3OWD A;  1QZR A;  1AJ6 A;  2XDX A;  2BU5 A;  2JJC A;  2WI6 A;  4XCL A;  2VCI A;  4MPE A;  4CWF A;  4KFG A;  3TZ0 A;  2YI7 A;  3EKO A;  2YEH A;  3EHG A;  1UY7 A;  4FCQ A;  2AKP A;  4MOT A;  4QPJ A;  4L90 A;  1BKN A;  2BYI A;  3INW A;  4WUC A;  4E00 A;  2XX4 A;  3A0T A;  4KSH A;  4EGI A;  4XIQ A;  2GQP A;  2EXL A;  3C11 A;  5CPH A;  1TC6 A;  4PU9 A;  3O0I A;  4WUD A;  3GIF A;  4XKK A;  1UYK A;  1YC3 A;  1JM6 A;  4O09 A;  3EHH A;  1BYQ A;  3TZ2 A;  2WI7 A;  3Q5L A;  1UYL A;  4AWQ A;  4E02 A;  4MP7 A;  1YSZ A;  3LPS A;  2YEG A;  1Z5A A;  2XX5 A;  2WI4 A;  1Z5B A;  3PEH A;  2YKB A;  2YE6 A;  3A0W A;  4U7N A;  3R4M A;  2VW5 A;  2ZKJ A;  2YI6 A;  1ZWH A;  4R1F A;  2XJG A;  3R4P A;  4L91 A;  3EHJ A;  4CWN A;  2YEA A;  1UYF A;  4YKQ A;  3R92 A;  2XK2 A;  1I5B A;  4BIZ A;  4KTN A;  5D7R A;  2XJJ A;  3OMU A;  2QF6 A;  3G75 A;  4JQL A;  2YEE A;  2WI3 A;  2YE9 A;  2E0A A;  5M4K A;  3U2K A;  2XCM A;  1MX0 A;  4ASA A;  2HCH A;  1I5A A;  2YGA A;  4EGK A;  2Q8H A;  1TC0 A;  3WHA A;  4LP0 A;  3PEJ A;  3BMY A;  4BXI A;  4CWP A;  2FXS A;  2YE8 A;  2BRE A;  5C93 A;  2JKI A;  5M4N A;  1ZXN A;  3ZXQ A;  2WI1 A;  2ZDX A;  1BGQ A;  4GQT A;  3HYZ A;  2BU2 A;  2YI0 A;  3K97 A;  2YED A;  3HHU A;  1U0Z A;  4CWO A;  4CE2 A;  3CRL A;  2O1U A;  3CRK A;  3TZ4 A;  3FT8 A;  4XCJ A;  4ASF A;  2BYH A;  5L3J A;  1QY8 A;  2XDU A;  4XIT A;  4I5S A;  3B28 A;  1B63 A;  1OSF A;  2FWY A;  3H4L A;  1UY8 A;  1YES A;  1QYE A;  4HZ5 A;  1TID A;  4Q20 A;  1AM1 A;  4YKU A;  2IOR A;  3A0X A;  4U7O A;  1THN A;  3TTZ A;  2XJX A;  3Q5K A;  2WER A;  4XIR A;  5F3K A;  2IWS A;  2CH4 A;  4YKT A;  2CG9 A;  3SL2 A;  4U93 A;  2YE4 A;  4XKA A;  2FYP A;  2IOP A;  3D0B A;  4H81 A;  1Y4U A;  1UYC A;  1EA6 A;  4JAV A;  3QDD A;  4KSG A;  4ZKI A;  1Y8N A;  1KIJ A;  2XDS A;  5BOC A;  4YKZ A;  2BZ5 A;  3WQ9 A;  2BU8 A;  5M4H A;  4O05 A;  5IDM A;  4GGL A;  1US7 A;  5F5R A;  1U2O A;  4B7P A;  2PNR A;  3B26 A;  4JAS A;  1TBW A;  4FMT A;  2QG0 A;  2YEF A;  4GT8 A;  1UYD A;  2BU6 A;  3EHF A;  4GCZ A;  3Q5J A;  3T0Z A;  3R91 A;  3T0H A;  3U2D A;  1YT1 A;  2XHT A;  2ZBK B;  5M4M A;  3RLP A;  2YGE A;  2C2A A;  4GEE A;  3EKR A;  4XTJ A;  4O0B A;  3K60 A;  2XHR A;  3CGY A;  3HEK A;  4O04 A;  4HXW A;  4AS9 A;  2BTZ A;  1KZN A;  4HYP A;  4FPP A;  4EM7 A;  2YJX A;  3GIG A;  2XDK A;  2YE5 A;  5BOD A;  4XD8 A;  1Y8O A;  1Y8P A;  3VHA A;  2CCT A;  2IWX A;  4B6C A;  3LNU A;  5IDJ A;  2O1V A;  2K5B A;  1I5D A;  5D6P A;  3VHD A;  3ZKB A;  2HG1 A;  4EFT A;  3QTF A;  1UYE A;  4E01 A;  4XE2 A;  4WUB A;  1GKZ A;  2XDL A;  3K99 A;  5IN9 A;  3ZM7 A;  1Z5C A;  3OPD A;  1YT2 A;  4EFU A;  3TUH A;  1UY6 A;  4CWQ A;  2CCU A;  2YKC A;  5D7C A;  3A0Y A;  4NH8 A;  1I5C A;  3D36 A;  3CWV A;  1PVG A;  4LWH A;  1UYM A;  4XIP A;  1YET A;  1Y4S A;  3GIG B;  5CTY A;  4O07 A;  2BSM A;  1UYG A;  3JZ3 A;  4EMV A;  3RLQ A;  4JAU A;  4FCR A;  2BRC A;  3NMQ A;  2WEP A;  1GJV A;  4KQV A;  2Q8I A;  3GIE A;  3HZ1 A;  3A0R A;  2Q8F A;  4KP4 A;  4GFN A;  3ZXO A;  3U67 A;  2XD6 A;  2XX2 A;  4LPB A;  1R62 A;  2YKJ A;  4DZY A;  3HZ5 A;  2ZDY A;  3INX A;  1ID0 A;  2QG2 A;  4P7A A;  4MP2 A;  2Q8G A;  4URN A;  2YE2 A;  4L8Z A;  1NHI A;  2CCS A;  2CGF A;  5J6A A;  4LWG A;  5FND A;  3BM9 A;  1L0O A;  5D7D A;  2YEJ A;  3G7E A;  1UYH A;  4XDM A;  4QPK A;  2YJW A;  4AWP A;  2VCJ A;  2O1W A;  5J71 A;  2H8M A;  1MU5 A;  3IED A;  1H7U A;  2YKE A;  3HYY A;  4CE1 A;  2WI2 A;  5CF0 A;  4NH9 A;  1UY9 A;  1UYI A;  3RLR A;  4L93 A;  4W7T A;  3OW6 A;  4CWT A;  3B25 A;  4ASG A;  3T1K A;  1TIL A;  3B27 A;  4EEH A;  3B24 A;  4V25 A;  1YS3 A;  3O6O A;  4CWR A;  4H7Q A;  2IWU A;  2FWZ A;  3H80 A;  5FWK A;  1YT0 A;  4URO A;  1A4H A;  1YER A;  1S14 A;  5FNC A;  1NHH A;  4YKY A;  3VHC A;  2YEC A;  4EGH A;  3ZKD A;  3RKZ A;  4BQJ A;  2UWD A;  1S16 A;  3T2S A;  4HY1 A;  3G7B A;  4XC0 A;  3FV5 A;  3D2R A;  2YKI A;  1TH8 A;  5M4E A;  4ASB A;  4CWS A;  4CE3 A;  3K98 A;  5CTW A;  4R3A A;  4H85 A;  2BT0 A;  4YKR A;  2IOQ A;  2YEB A;  4AWO A;  1AH6 A;  3VAD A;  3CGZ A;  1YSR A;  1I58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...