5IDMA

Bifunctional histidine kinase ccka (domain, ca) in complex with c-di-gmp and amppnp/mg2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
177
structure length
177
Chain Sequence
VQREVLDLGELISEFEVLLRRLLREDVKLITDYGRDLPQVRADKSQLETAVMNLAVNARDAVRAAKGGGVVRIRTARLTRDEAIQLGFPAADGDTAFIEVSDDGPGIPPDVMGKIFDPFFTTKPVGEGTGLGLATVYGIVKQSDGWIHVHSRPNEGAAFRIFLPVYEAPAALEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic di-GMP mediates a histidine kinase/phosphatase switch by noncovalent domain cross-linking.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase
molecule keywords Cell cycle histidine kinase CckA
total genus 44
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5idmA00
2WEPA 2WI2A 1GKXA 2YEGA 1BXDA 4E01A 2BT0A 4QPKA 3CGZA 3VADA 3U2KA 3INXA 2XDSA 3A0YA 4LWIA 5IDMA 4XIQA 4AWOA 4X9LA 5M4HA 4JAUA 4ZVIA 4I3HA 4L93A 2UWDA 4BQGA 5C93A 4GEEA 2QF6A 2YKIA 3VHAA 4MP2A 4LP0A 2JKIA 1GJVA 3CGYA 2XX2A 2XX5A 2IWSA 3D0BA 2O1WA 4GGLA 2YE8A 2ESAA 2WI3A 4HYMA 4LPBA 5CTYA 2BYIA 1UYGA 3GIGA 3HYZA 1AMWA 2Q8FA 4H85A 4O04A 1H7SA 1I5DA 4CWNA 2GQPA 1B63A 4AWQA 3R91A 4ASBA 1BGQA 4XDMA 4FCQA 4YKWA 4MOTA 4YKUA 3KE6A 2YE6A 2Q8HA 4K4OA 4EGHA 2AKPA 4U7OA 3FV5A 3BMYA 3R4PA 1I5CA 1R62A 1US7A 2WI6A 4ASFA 3A0ZA 1KIJA 4PL9A 4GCZA 4YKXA 1AH6A 2CH4A 4XCJA 1Z5CA 3R4OA 3A0TA 5D7CA 1YSRA 5L3JA 4MB9A 3TZ2A 3R4NA 3K99A 4U7NA 4CE3A 3PEHA 1UY6A 3FT5A 3OWBA 2XJJA 1ZW9A 3EKOA 3H80A 3HHUA 4O0BA 1QZRA 2VCIA 3FT8A 4B7PA 4URNA 2Q2EB 3TZ5A 1UYIA 3DGEA 4ASGA 3A0RA 4H7QA 5D6PA 4PRXA 1EA6A 2HG1A 3EHGA 4AS9A 2WEQA 4YKYA 3TZ4A 5M4NA 1UYMA 4XE2A 4EGIA 3IEDA 2ZDXA 5M4MA 4E00A 3ZKBA 4AWPA 3TTZA 4FCRA 4FMTA 2YI0A 1YT1A 2IWUA 1NHIA 2XCMA 3R4MA 3T0ZA 2XDLA 2WERA 3D2RA 2YEAA 4LWHA 4XC0A 1UY8A 2YGAA 3HZ1A 4XIPA 2YI6A 2BU6A 1UYCA 1KZNA 2YKEA 2BYHA 1Z59A 4R1FA 1Z5AA 4KSGA 1NHJA 3T10A 4DZYA 2HKJA 4KP4A 3HZ5A 2YE4A 1UYDA 3CRLA 4LWFA 5F3KA 4MP7A 2FXSA 2IWXA 3INWA 2YEEA 4EFUA 4BIZA 2WI5A 1A4HA 2YKCA 2YEIA 4KFGA 1PVGA 4EFTA 4HXZA 2VWCA 4NH7A 4CWPA 3Q5JA 1AJ6A 1JM6A 2C2AA 1Z5BA 2XD6A 1Y8NA 4XKAA 2YE7A 2Q8GA 2BSMA 1U2OA 3R92A 2H55A 3QDDA 4EM7A 5D7RA 2CGFA 4I5SA 2YE3A 4EEHA 2YGFA 1YC3A 2BU7A 2FYPA 1MX0A 1TC0A 2YE5A 1YESA 1UYFA 5CTUA 2CG9A 3LPSA 4JASA 4Q20A 4NH9A 4BXIA 3EHHA 5BOCA 2XJXA 1UY7A 3ZM7A 1THNA 4XD8A 3QTFA 2YKJA 3T2SA 4E02A 4URMA 4U93A 2XHRA 3A0XA 2BREA 1YT0A 2CCUA 2XDXA 2ZDYA 2XK2A 3GIEA 1AH8A 1H7UA 3VHDA 3D36A 2XX4A 2QG0A 4CWQA 3ZKDA 3SL2A 3B25A 3A0WA 2BU5A 1BYQA 2XHXA 4HZ0A 4BQJA 4KTNA 2VW5A 2YEJA 5D6QA 2YI7A 2IORA 4CWFA 1UYKA 2YGEA 2CCTA 2K5BA 4BAEA 3G75A 3T1KA 3LNUA 2QFOA 1TC6A 5D7DA 4HY1A 2YEHA 2IOPA 5CF0A 1Y4UA 1AM1A 1YC1A 4CE2A 1S16A 4W7TA 1NHHA 5J6AA 4R3AA 4V25A 4XKKA 3G7BA 4L90A 4EGKA 1Y8PA 4LWGA 3OPDA 1TBWA 4L94A 4MBCA 5M4EA 3K97A 2BU8A 4XKOA 3OWDA 3Q5KA 4JAVA 1EI1A 3H4LA 2WI1A 1ZWHA 4URLA 3OW6A 1UY9A 2E0AA 3HEKA 5F5RA 3ZXQA 1Y8OA 3GIFA 1TIDA 3O0IA 2O1VA 2HCHA 4YKTA 2BU2A 4FPPA 2FWZA 4B6CA 5FNFA 4PRVA 1UYEA 1YC4A 3VHCA 4HZ5A 1YSZA 1ZXMA 2XHTA 4O07A 2JJCA 4DUHA 1ZXNA 4XCLA 4QPJA 2BTZA 4YKZA 1YT2A 4WUDA 1I59A 1GKZA 1OSFA 2YEBA 4XIRA 3ZXOA 4NH8A 4XTJA 1YERA 3O2FA 1B3QA 2CCSA 4HYPA 2WI4A 2ZBKB 3CWVA 3RLQA 2XDUA 3EHJA 4MPNA 4H81A 1YETA 5J71A 1UYLA 2YE2A 1S14A 2YK9A 5CPHA 2H8MA 4XITA 1I5BA 2O1UA 2VCJA 4CE1A 4V26A 2EXLA 3WHAA 3WQ9A 3BM9A 1YS3A 1MU5A 5IN9A 3RKZA 1B62A 3NMQA 3C0EA 2PNRA 3B28A 4CWSA 1QYEA 4LWEA 3K60A 2QG2A 4R3MA 3CRKA 2YJWA 5BODA 3Q5LA 2WI7A 4ZKIA 2XJGA 3RLRA 4WUCA 4WUBA 2BRCA 4HXWA 3C11A 4GQTA 4P8OA 4UROA 3JZ3A 1UYHA 5FNDA 1QY8A 4L8ZA 3TUHA 3TZ0A 3HYYA 4KQVA 5IDJA 4BIUA 1I5AA 3B24A 1ID0A 2YECA 3OMUA 2GFDA 5CTXA 3EHFA 1TH8A 3U2DA 2Q8IA 5GGZA 3K98A 4L91A 3U67A 2YE9A 3GIGB 5FNCA 2YJXA 2YK2A 4MPCA 5CTWA 3O6OA 4KSHA 2YEFA 1L0OA 4MPEA 2BZ5A 1I58A 4FCPA 4CWOA 2YEDA 2YKBA 4YKRA 4GFNA 4P7AA 4YKQA 4GT8A 1Y4SA 2XDKA 1TILA 2YI5A 3G7EA 4HY6A 4O05A 4ASAA 3RLPA 3B27A 3B26A 4EMVA 3PEJA 3T0HA 5M4KA 1BKNA 1U0ZA 2ZKJA 3EKRA 3MNRP 5M4PA 2IOQA 4JQLA 2FWYA 2XABA 4CWRA 4CWTA 4PU9A 5FWKA 4O09A
chains in the Genus database with same CATH superfamily
2WEPA 2WI2A 1GKXA 2YEGA 1BXDA 4E01A 2BT0A 4QPKA 3CGZA 3VADA 3U2KA 3INXA 2XDSA 3A0YA 4LWIA 5IDMA 4XIQA 4AWOA 4X9LA 5M4HA 4JAUA 4ZVIA 4I3HA 4L93A 2UWDA 4BQGA 5C93A 4GEEA 2QF6A 2YKIA 3VHAA 4MP2A 4LP0A 2JKIA 1GJVA 3CGYA 2XX2A 2XX5A 2IWSA 3D0BA 2O1WA 2C1IA 4GGLA 2YE8A 2ESAA 2WI3A 4HYMA 4LPBA 5CTYA 2BYIA 1UYGA 3GIGA 3HYZA 1AMWA 2Q8FA 4H85A 4O04A 1H7SA 1I5DA 4CWNA 2GQPA 1B63A 4AWQA 3R91A 4ASBA 1BGQA 4XDMA 4FCQA 4YKWA 4MOTA 4YKUA 3KE6A 2YE6A 2Q8HA 2HHIA 4K4OA 4EGHA 2AKPA 4U7OA 3FV5A 3BMYA 3R4PA 1I5CA 1R62A 1US7A 2WI6A 4ASFA 3A0ZA 1KIJA 4PL9A 4GCZA 4YKXA 1AH6A 2CH4A 4XCJA 1Z5CA 3R4OA 3A0TA 5D7CA 1YSRA 5L3JA 4MB9A 3TZ2A 3R4NA 3K99A 4U7NA 5JENA 4CE3A 3PEHA 1UY6A 3FT5A 3OWBA 2XJJA 1ZW9A 3EKOA 3H80A 3HHUA 4O0BA 1QZRA 2VCIA 3FT8A 4B7PA 4URNA 2Q2EB 3TZ5A 1UYIA 3DGEA 4ASGA 3A0RA 4H7QA 5D6PA 4PRXA 1EA6A 2HG1A 3EHGA 4AS9A 2WEQA 4YKYA 3TZ4A 5M4NA 1UYMA 4XE2A 4EGIA 3IEDA 2ZDXA 5M4MA 4E00A 3ZKBA 4AWPA 3TTZA 4FCRA 4FMTA 2FTKA 2YI0A 1YT1A 2IWUA 1NHIA 2XCMA 3R4MA 3T0ZA 2XDLA 2WERA 3D2RA 2YEAA 4LWHA 4XC0A 1UY8A 2YGAA 3HZ1A 4XIPA 2YI6A 2BU6A 1UYCA 1KZNA 2YKEA 2BYHA 1Z59A 4R1FA 1Z5AA 4KSGA 1NHJA 3T10A 4DZYA 2HKJA 4KP4A 3HZ5A 2YE4A 1UYDA 3CRLA 4LWFA 5F3KA 4MP7A 2FXSA 2IWXA 3INWA 2YEEA 4EFUA 4BIZA 2WI5A 1A4HA 2YKCA 2YEIA 4KFGA 1PVGA 4EFTA 4HXZA 2VWCA 4NH7A 4CWPA 3Q5JA 1AJ6A 1JM6A 2C2AA 1Z5BA 2XD6A 1Y8NA 4XKAA 2YE7A 2Q8GA 2BSMA 1U2OA 3R92A 2H55A 3QDDA 4EM7A 5D7RA 2CGFA 4I5SA 2YE3A 4EEHA 2YGFA 3S5TA 1YC3A 2BU7A 2FYPA 1MX0A 1TC0A 2YE5A 1YESA 1UYFA 5CTUA 2CG9A 3LPSA 4JASA 4Q20A 4NH9A 4E72A 4BXIA 3EHHA 5BOCA 2XJXA 1UY7A 3ZM7A 1THNA 4XD8A 3QTFA 2YKJA 3T2SA 4E02A 4URMA 4U93A 2XHRA 3A0XA 2BREA 1YT0A 2CCUA 2XDXA 2ZDYA 3CYGA 2XK2A 3GIEA 1AH8A 1H7UA 3VHDA 3D36A 2XX4A 2QG0A 4CWQA 3ZKDA 3SL2A 3B25A 3A0WA 2BU5A 1BYQA 2XHXA 4HZ0A 1IXMA 4BQJA 4KTNA 2VW5A 2YEJA 5D6QA 2YI7A 2IORA 4CWFA 1UYKA 2YGEA 2CCTA 2K5BA 4BAEA 3G75A 3T1KA 3LNUA 2QFOA 3LMMA 1TC6A 5D7DA 4HY1A 2YEHA 2IOPA 5CF0A 1Y4UA 1AM1A 1YC1A 4CE2A 1S16A 4W7TA 1NHHA 5J6AA 4R3AA 4V25A 4XKKA 3G7BA 4L90A 4EGKA 1Y8PA 4LWGA 3OPDA 1TBWA 4L94A 4MBCA 5M4EA 3K97A 2BU8A 4XKOA 3OWDA 3Q5KA 4JAVA 1EI1A 3H4LA 2WI1A 1ZWHA 4URLA 3OW6A 1UY9A 2E0AA 3HEKA 5F5RA 3ZXQA 1Y8OA 3GIFA 1TIDA 3O0IA 2O1VA 2HCHA 4YKTA 2BU2A 4FPPA 2FWZA 4B6CA 5FNFA 4PRVA 1UYEA 1YC4A 3VHCA 4HZ5A 1YSZA 1ZXMA 2XHTA 4O07A 2JJCA 4DUHA 1ZXNA 4XCLA 4QPJA 2BTZA 4YKZA 1YT2A 4WUDA 1I59A 1GKZA 1OSFA 2YEBA 4XIRA 3ZXOA 4NH8A 4XTJA 1YERA 3O2FA 1B3QA 2CCSA 4HYPA 2WI4A 2ZBKB 3CWVA 3RLQA 2XDUA 3EHJA 4MPNA 4H81A 1YETA 5J71A 1UYLA 2YE2A 1S14A 2YK9A 5CPHA 2H8MA 2C1GA 4XITA 1I5BA 2O1UA 2VCJA 4CE1A 4V26A 2EXLA 3WHAA 3WQ9A 3BM9A 1YS3A 1MU5A 5IN9A 3RKZA 1B62A 3NMQA 3C0EA 2PNRA 3B28A 4CWSA 1QYEA 4LWEA 3K60A 2QG2A 4R3MA 3CRKA 2YJWA 5BODA 3Q5LA 2WI7A 4ZKIA 2XJGA 3RLRA 4WUCA 4WUBA 2BRCA 4HXWA 3C11A 4GQTA 4P8OA 4UROA 3JZ3A 1UYHA 5FNDA 1QY8A 4L8ZA 3TUHA 3TZ0A 3HYYA 4KQVA 5IDJA 4BIUA 1I5AA 3B24A 1ID0A 2YECA 3OMUA 2GFDA 5CTXA 3EHFA 1TH8A 3U2DA 2Q8IA 5GGZA 3K98A 4L91A 3U67A 2YE9A 3GIGB 5FNCA 2YJXA 2YK2A 4MPCA 5CTWA 1F51A 3O6OA 4KSHA 2YEFA 1L0OA 4MPEA 2BZ5A 1I58A 4FCPA 4CWOA 2YEDA 2YKBA 4YKRA 4GFNA 4P7AA 4YKQA 4GT8A 1Y4SA 2XDKA 1TILA 2YI5A 3G7EA 4HY6A 4O05A 4ASAA 3RLPA 3B27A 3B26A 4EMVA 3PEJA 3T0HA 5M4KA 1BKNA 1U0ZA 2ZKJA 3EKRA 3MNRP 5M4PA 2IOQA 4JQLA 2FWYA 2XABA 4CWRA 4CWTA 4PU9A 5FWKA 4O09A
chains in the Genus database with same CATH topology
2WEPA 2WI2A 1GKXA 2YEGA 1BXDA 4E01A 2BT0A 4QPKA 3CGZA 3VADA 3U2KA 3INXA 2XDSA 3A0YA 4LWIA 5IDMA 4XIQA 4AWOA 4X9LA 5M4HA 4JAUA 4ZVIA 4I3HA 4L93A 2UWDA 4BQGA 5C93A 4GEEA 2QF6A 2YKIA 3VHAA 4MP2A 4LP0A 2JKIA 1GJVA 3CGYA 2XX2A 2XX5A 2IWSA 3D0BA 2O1WA 4GGLA 2YE8A 2ESAA 2WI3A 4HYMA 4LPBA 5CTYA 2BYIA 1UYGA 3GIGA 3HYZA 1AMWA 2Q8FA 4H85A 4O04A 1H7SA 1I5DA 4CWNA 2GQPA 1B63A 4AWQA 3R91A 4ASBA 1BGQA 4XDMA 4FCQA 4YKWA 4MOTA 4YKUA 3KE6A 2YE6A 2Q8HA 4K4OA 4EGHA 2AKPA 4U7OA 3FV5A 3BMYA 3R4PA 1I5CA 1R62A 1US7A 2WI6A 4ASFA 3A0ZA 1KIJA 4PL9A 4GCZA 4YKXA 1AH6A 2CH4A 4XCJA 1Z5CA 3R4OA 3A0TA 5D7CA 1YSRA 5L3JA 4MB9A 3TZ2A 3R4NA 3K99A 4U7NA 4CE3A 3PEHA 1UY6A 3FT5A 3OWBA 2XJJA 1ZW9A 3EKOA 3H80A 3HHUA 4O0BA 1QZRA 2VCIA 3FT8A 4B7PA 4URNA 2Q2EB 3TZ5A 1UYIA 3DGEA 4ASGA 3A0RA 4H7QA 5D6PA 4PRXA 1EA6A 2HG1A 3EHGA 4AS9A 2WEQA 4YKYA 3TZ4A 5M4NA 1UYMA 4XE2A 4EGIA 3IEDA 2ZDXA 5M4MA 4E00A 3ZKBA 4AWPA 3TTZA 4FCRA 4FMTA 2YI0A 1YT1A 2IWUA 1NHIA 2XCMA 3R4MA 3T0ZA 2XDLA 2WERA 3D2RA 2YEAA 4LWHA 4XC0A 1UY8A 2YGAA 3HZ1A 4XIPA 2YI6A 2BU6A 1UYCA 1KZNA 2YKEA 2BYHA 1Z59A 4R1FA 1Z5AA 4KSGA 1NHJA 3T10A 4DZYA 2HKJA 4KP4A 3HZ5A 2YE4A 1UYDA 3CRLA 4LWFA 5F3KA 4MP7A 2FXSA 2IWXA 3INWA 2YEEA 4EFUA 4BIZA 2WI5A 1A4HA 2YKCA 2YEIA 4KFGA 1PVGA 4EFTA 4HXZA 2VWCA 4NH7A 4CWPA 3Q5JA 1AJ6A 1JM6A 2C2AA 1Z5BA 2XD6A 1Y8NA 4XKAA 2YE7A 2Q8GA 2BSMA 1U2OA 3R92A 2H55A 3QDDA 4EM7A 5D7RA 2CGFA 4I5SA 2YE3A 4EEHA 2YGFA 1YC3A 2BU7A 2FYPA 1MX0A 1TC0A 2YE5A 1YESA 1UYFA 5CTUA 2CG9A 3LPSA 4JASA 4Q20A 4NH9A 4BXIA 3EHHA 5BOCA 2XJXA 1UY7A 3ZM7A 1THNA 4XD8A 3QTFA 2YKJA 3T2SA 4E02A 4URMA 4U93A 2XHRA 3A0XA 2BREA 1YT0A 2CCUA 2XDXA 2ZDYA 2XK2A 3GIEA 1AH8A 1H7UA 3VHDA 3D36A 2XX4A 2QG0A 4CWQA 3ZKDA 3SL2A 3B25A 3A0WA 2BU5A 1BYQA 2XHXA 4HZ0A 4BQJA 4KTNA 2VW5A 2YEJA 5D6QA 2YI7A 2IORA 4CWFA 1UYKA 2YGEA 2CCTA 2K5BA 4BAEA 3G75A 3T1KA 3LNUA 2QFOA 1TC6A 5D7DA 4HY1A 2YEHA 2IOPA 5CF0A 1Y4UA 1AM1A 1YC1A 4CE2A 1S16A 4W7TA 1NHHA 5J6AA 4R3AA 4V25A 4XKKA 3G7BA 4L90A 4EGKA 1Y8PA 4LWGA 3OPDA 1TBWA 4L94A 4MBCA 5M4EA 3K97A 2BU8A 4XKOA 3OWDA 3Q5KA 4JAVA 1EI1A 3H4LA 2WI1A 1ZWHA 4URLA 3OW6A 1UY9A 2E0AA 3HEKA 5F5RA 3ZXQA 1Y8OA 3GIFA 1TIDA 3O0IA 2O1VA 2HCHA 4YKTA 2BU2A 4FPPA 2FWZA 4B6CA 5FNFA 4PRVA 1UYEA 1YC4A 3VHCA 4HZ5A 1YSZA 1ZXMA 2XHTA 4O07A 2JJCA 4DUHA 1ZXNA 4XCLA 4QPJA 2BTZA 4YKZA 1YT2A 4WUDA 1I59A 1GKZA 1OSFA 2YEBA 4XIRA 3ZXOA 4NH8A 4XTJA 1YERA 3O2FA 1B3QA 2CCSA 4HYPA 2WI4A 2ZBKB 3CWVA 3RLQA 2XDUA 3EHJA 4MPNA 4H81A 1YETA 5J71A 1UYLA 2YE2A 1S14A 2YK9A 5CPHA 2H8MA 4XITA 1I5BA 2O1UA 2VCJA 4CE1A 4V26A 2EXLA 3WHAA 3WQ9A 3BM9A 1YS3A 1MU5A 5IN9A 3RKZA 1B62A 3NMQA 3C0EA 2PNRA 3B28A 4CWSA 1QYEA 4LWEA 3K60A 2QG2A 4R3MA 3CRKA 2YJWA 5BODA 3Q5LA 2WI7A 4ZKIA 2XJGA 3RLRA 4WUCA 4WUBA 2BRCA 4HXWA 3C11A 4GQTA 4P8OA 4UROA 3JZ3A 1UYHA 5FNDA 1QY8A 4L8ZA 3TUHA 3TZ0A 3HYYA 4KQVA 5IDJA 4BIUA 1I5AA 3B24A 1ID0A 2YECA 3OMUA 2GFDA 5CTXA 3EHFA 1TH8A 3U2DA 2Q8IA 5GGZA 3K98A 4L91A 3U67A 2YE9A 3GIGB 5FNCA 2YJXA 2YK2A 4MPCA 5CTWA 3O6OA 4KSHA 2YEFA 1L0OA 4MPEA 2BZ5A 1I58A 4FCPA 4CWOA 2YEDA 2YKBA 4YKRA 4GFNA 4P7AA 4YKQA 4GT8A 1Y4SA 2XDKA 1TILA 2YI5A 3G7EA 4HY6A 4O05A 4ASAA 3RLPA 3B27A 3B26A 4EMVA 3PEJA 3T0HA 5M4KA 1BKNA 1U0ZA 2ZKJA 3EKRA 3MNRP 5M4PA 2IOQA 4JQLA 2FWYA 2XABA 4CWRA 4CWTA 4PU9A 5FWKA 4O09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WEP A;  2WI2 A;  1GKX A;  2YEG A;  1BXD A;  4E01 A;  2BT0 A;  4QPK A;  3CGZ A;  3VAD A;  3U2K A;  3INX A;  2XDS A;  3A0Y A;  4LWI A;  5IDM A;  4XIQ A;  4AWO A;  4X9L A;  5M4H A;  4JAU A;  4ZVI A;  4I3H A;  4L93 A;  2UWD A;  4BQG A;  5C93 A;  4GEE A;  2QF6 A;  2YKI A;  3VHA A;  4MP2 A;  4LP0 A;  2JKI A;  1GJV A;  3CGY A;  2XX2 A;  2XX5 A;  2IWS A;  3D0B A;  2O1W A;  4GGL A;  2YE8 A;  2ESA A;  2WI3 A;  4HYM A;  4LPB A;  5CTY A;  2BYI A;  1UYG A;  3GIG A;  3HYZ A;  1AMW A;  2Q8F A;  4H85 A;  4O04 A;  1H7S A;  1I5D A;  4CWN A;  2GQP A;  1B63 A;  4AWQ A;  3R91 A;  4ASB A;  1BGQ A;  4XDM A;  4FCQ A;  4YKW A;  4MOT A;  4YKU A;  3KE6 A;  2YE6 A;  2Q8H A;  4K4O A;  4EGH A;  2AKP A;  4U7O A;  3FV5 A;  3BMY A;  3R4P A;  1I5C A;  1R62 A;  1US7 A;  2WI6 A;  4ASF A;  3A0Z A;  1KIJ A;  4PL9 A;  4GCZ A;  4YKX A;  1AH6 A;  2CH4 A;  4XCJ A;  1Z5C A;  3R4O A;  3A0T A;  5D7C A;  1YSR A;  5L3J A;  4MB9 A;  3TZ2 A;  3R4N A;  3K99 A;  4U7N A;  4CE3 A;  3PEH A;  1UY6 A;  3FT5 A;  3OWB A;  2XJJ A;  1ZW9 A;  3EKO A;  3H80 A;  3HHU A;  4O0B A;  1QZR A;  2VCI A;  3FT8 A;  4B7P A;  4URN A;  2Q2E B;  3TZ5 A;  1UYI A;  3DGE A;  4ASG A;  3A0R A;  4H7Q A;  5D6P A;  4PRX A;  1EA6 A;  2HG1 A;  3EHG A;  4AS9 A;  2WEQ A;  4YKY A;  3TZ4 A;  5M4N A;  1UYM A;  4XE2 A;  4EGI A;  3IED A;  2ZDX A;  5M4M A;  4E00 A;  3ZKB A;  4AWP A;  3TTZ A;  4FCR A;  4FMT A;  2YI0 A;  1YT1 A;  2IWU A;  1NHI A;  2XCM A;  3R4M A;  3T0Z A;  2XDL A;  2WER A;  3D2R A;  2YEA A;  4LWH A;  4XC0 A;  1UY8 A;  2YGA A;  3HZ1 A;  4XIP A;  2YI6 A;  2BU6 A;  1UYC A;  1KZN A;  2YKE A;  2BYH A;  1Z59 A;  4R1F A;  1Z5A A;  4KSG A;  1NHJ A;  3T10 A;  4DZY A;  2HKJ A;  4KP4 A;  3HZ5 A;  2YE4 A;  1UYD A;  3CRL A;  4LWF A;  5F3K A;  4MP7 A;  2FXS A;  2IWX A;  3INW A;  2YEE A;  4EFU A;  4BIZ A;  2WI5 A;  1A4H A;  2YKC A;  2YEI A;  4KFG A;  1PVG A;  4EFT A;  4HXZ A;  2VWC A;  4NH7 A;  4CWP A;  3Q5J A;  1AJ6 A;  1JM6 A;  2C2A A;  1Z5B A;  2XD6 A;  1Y8N A;  4XKA A;  2YE7 A;  2Q8G A;  2BSM A;  1U2O A;  3R92 A;  2H55 A;  3QDD A;  4EM7 A;  5D7R A;  2CGF A;  4I5S A;  2YE3 A;  4EEH A;  2YGF A;  1YC3 A;  2BU7 A;  2FYP A;  1MX0 A;  1TC0 A;  2YE5 A;  1YES A;  1UYF A;  5CTU A;  2CG9 A;  3LPS A;  4JAS A;  4Q20 A;  4NH9 A;  4BXI A;  3EHH A;  5BOC A;  2XJX A;  1UY7 A;  3ZM7 A;  1THN A;  4XD8 A;  3QTF A;  2YKJ A;  3T2S A;  4E02 A;  4URM A;  4U93 A;  2XHR A;  3A0X A;  2BRE A;  1YT0 A;  2CCU A;  2XDX A;  2ZDY A;  2XK2 A;  3GIE A;  1AH8 A;  1H7U A;  3VHD A;  3D36 A;  2XX4 A;  2QG0 A;  4CWQ A;  3ZKD A;  3SL2 A;  3B25 A;  3A0W A;  2BU5 A;  1BYQ A;  2XHX A;  4HZ0 A;  4BQJ A;  4KTN A;  2VW5 A;  2YEJ A;  5D6Q A;  2YI7 A;  2IOR A;  4CWF A;  1UYK A;  2YGE A;  2CCT A;  2K5B A;  4BAE A;  3G75 A;  3T1K A;  3LNU A;  2QFO A;  1TC6 A;  5D7D A;  4HY1 A;  2YEH A;  2IOP A;  5CF0 A;  1Y4U A;  1AM1 A;  1YC1 A;  4CE2 A;  1S16 A;  4W7T A;  1NHH A;  5J6A A;  4R3A A;  4V25 A;  4XKK A;  3G7B A;  4L90 A;  4EGK A;  1Y8P A;  4LWG A;  3OPD A;  1TBW A;  4L94 A;  4MBC A;  5M4E A;  3K97 A;  2BU8 A;  4XKO A;  3OWD A;  3Q5K A;  4JAV A;  1EI1 A;  3H4L A;  2WI1 A;  1ZWH A;  4URL A;  3OW6 A;  1UY9 A;  2E0A A;  3HEK A;  5F5R A;  3ZXQ A;  1Y8O A;  3GIF A;  1TID A;  3O0I A;  2O1V A;  2HCH A;  4YKT A;  2BU2 A;  4FPP A;  2FWZ A;  4B6C A;  5FNF A;  4PRV A;  1UYE A;  1YC4 A;  3VHC A;  4HZ5 A;  1YSZ A;  1ZXM A;  2XHT A;  4O07 A;  2JJC A;  4DUH A;  1ZXN A;  4XCL A;  4QPJ A;  2BTZ A;  4YKZ A;  1YT2 A;  4WUD A;  1I59 A;  1GKZ A;  1OSF A;  2YEB A;  4XIR A;  3ZXO A;  4NH8 A;  4XTJ A;  1YER A;  3O2F A;  1B3Q A;  2CCS A;  4HYP A;  2WI4 A;  2ZBK B;  3CWV A;  3RLQ A;  2XDU A;  3EHJ A;  4MPN A;  4H81 A;  1YET A;  5J71 A;  1UYL A;  2YE2 A;  1S14 A;  2YK9 A;  5CPH A;  2H8M A;  4XIT A;  1I5B A;  2O1U A;  2VCJ A;  4CE1 A;  4V26 A;  2EXL A;  3WHA A;  3WQ9 A;  3BM9 A;  1YS3 A;  1MU5 A;  5IN9 A;  3RKZ A;  1B62 A;  3NMQ A;  3C0E A;  2PNR A;  3B28 A;  4CWS A;  1QYE A;  4LWE A;  3K60 A;  2QG2 A;  4R3M A;  3CRK A;  2YJW A;  5BOD A;  3Q5L A;  2WI7 A;  4ZKI A;  2XJG A;  3RLR A;  4WUC A;  4WUB A;  2BRC A;  4HXW A;  3C11 A;  4GQT A;  4P8O A;  4URO A;  3JZ3 A;  1UYH A;  5FND A;  1QY8 A;  4L8Z A;  3TUH A;  3TZ0 A;  3HYY A;  4KQV A;  5IDJ A;  4BIU A;  1I5A A;  3B24 A;  1ID0 A;  2YEC A;  3OMU A;  2GFD A;  5CTX A;  3EHF A;  1TH8 A;  3U2D A;  2Q8I A;  5GGZ A;  3K98 A;  4L91 A;  3U67 A;  2YE9 A;  3GIG B;  5FNC A;  2YJX A;  2YK2 A;  4MPC A;  5CTW A;  3O6O A;  4KSH A;  2YEF A;  1L0O A;  4MPE A;  2BZ5 A;  1I58 A;  4FCP A;  4CWO A;  2YED A;  2YKB A;  4YKR A;  4GFN A;  4P7A A;  4YKQ A;  4GT8 A;  1Y4S A;  2XDK A;  1TIL A;  2YI5 A;  3G7E A;  4HY6 A;  4O05 A;  4ASA A;  3RLP A;  3B27 A;  3B26 A;  4EMV A;  3PEJ A;  3T0H A;  5M4K A;  1BKN A;  1U0Z A;  2ZKJ A;  3EKR A;  3MNR P;  5M4P A;  2IOQ A;  4JQL A;  2FWY A;  2XAB A;  4CWR A;  4CWT A;  4PU9 A;  5FWK A;  4O09 A; 
#chains in the Genus database with same CATH topology
 2WEP A;  2WI2 A;  1GKX A;  2YEG A;  1BXD A;  4E01 A;  2BT0 A;  4QPK A;  3CGZ A;  3VAD A;  3U2K A;  3INX A;  2XDS A;  3A0Y A;  4LWI A;  5IDM A;  4XIQ A;  4AWO A;  4X9L A;  5M4H A;  4JAU A;  4ZVI A;  4I3H A;  4L93 A;  2UWD A;  4BQG A;  5C93 A;  4GEE A;  2QF6 A;  2YKI A;  3VHA A;  4MP2 A;  4LP0 A;  2JKI A;  1GJV A;  3CGY A;  2XX2 A;  2XX5 A;  2IWS A;  3D0B A;  2O1W A;  2C1I A;  4GGL A;  2YE8 A;  2ESA A;  2WI3 A;  4HYM A;  4LPB A;  5CTY A;  2BYI A;  1UYG A;  3GIG A;  3HYZ A;  1AMW A;  2Q8F A;  4H85 A;  4O04 A;  1H7S A;  1I5D A;  4CWN A;  2GQP A;  1B63 A;  4AWQ A;  3R91 A;  4ASB A;  1BGQ A;  4XDM A;  4FCQ A;  4YKW A;  4MOT A;  4YKU A;  3KE6 A;  2YE6 A;  2Q8H A;  2HHI A;  4K4O A;  4EGH A;  2AKP A;  4U7O A;  3FV5 A;  3BMY A;  3R4P A;  1I5C A;  1R62 A;  1US7 A;  2WI6 A;  4ASF A;  3A0Z A;  1KIJ A;  4PL9 A;  4GCZ A;  4YKX A;  1AH6 A;  2CH4 A;  4XCJ A;  1Z5C A;  3R4O A;  3A0T A;  5D7C A;  1YSR A;  5L3J A;  4MB9 A;  3TZ2 A;  3R4N A;  3K99 A;  4U7N A;  5JEN A;  4CE3 A;  3PEH A;  1UY6 A;  3FT5 A;  3OWB A;  2XJJ A;  1ZW9 A;  3EKO A;  3H80 A;  3HHU A;  4O0B A;  1QZR A;  2VCI A;  3FT8 A;  4B7P A;  4URN A;  2Q2E B;  3TZ5 A;  1UYI A;  3DGE A;  4ASG A;  3A0R A;  4H7Q A;  5D6P A;  4PRX A;  1EA6 A;  2HG1 A;  3EHG A;  4AS9 A;  2WEQ A;  4YKY A;  3TZ4 A;  5M4N A;  1UYM A;  4XE2 A;  4EGI A;  3IED A;  2ZDX A;  5M4M A;  4E00 A;  3ZKB A;  4AWP A;  3TTZ A;  4FCR A;  4FMT A;  2FTK A;  2YI0 A;  1YT1 A;  2IWU A;  1NHI A;  2XCM A;  3R4M A;  3T0Z A;  2XDL A;  2WER A;  3D2R A;  2YEA A;  4LWH A;  4XC0 A;  1UY8 A;  2YGA A;  3HZ1 A;  4XIP A;  2YI6 A;  2BU6 A;  1UYC A;  1KZN A;  2YKE A;  2BYH A;  1Z59 A;  4R1F A;  1Z5A A;  4KSG A;  1NHJ A;  3T10 A;  4DZY A;  2HKJ A;  4KP4 A;  3HZ5 A;  2YE4 A;  1UYD A;  3CRL A;  4LWF A;  5F3K A;  4MP7 A;  2FXS A;  2IWX A;  3INW A;  2YEE A;  4EFU A;  4BIZ A;  2WI5 A;  1A4H A;  2YKC A;  2YEI A;  4KFG A;  1PVG A;  4EFT A;  4HXZ A;  2VWC A;  4NH7 A;  4CWP A;  3Q5J A;  1AJ6 A;  1JM6 A;  2C2A A;  1Z5B A;  2XD6 A;  1Y8N A;  4XKA A;  2YE7 A;  2Q8G A;  2BSM A;  1U2O A;  3R92 A;  2H55 A;  3QDD A;  4EM7 A;  5D7R A;  2CGF A;  4I5S A;  2YE3 A;  4EEH A;  2YGF A;  3S5T A;  1YC3 A;  2BU7 A;  2FYP A;  1MX0 A;  1TC0 A;  2YE5 A;  1YES A;  1UYF A;  5CTU A;  2CG9 A;  3LPS A;  4JAS A;  4Q20 A;  4NH9 A;  4E72 A;  4BXI A;  3EHH A;  5BOC A;  2XJX A;  1UY7 A;  3ZM7 A;  1THN A;  4XD8 A;  3QTF A;  2YKJ A;  3T2S A;  4E02 A;  4URM A;  4U93 A;  2XHR A;  3A0X A;  2BRE A;  1YT0 A;  2CCU A;  2XDX A;  2ZDY A;  3CYG A;  2XK2 A;  3GIE A;  1AH8 A;  1H7U A;  3VHD A;  3D36 A;  2XX4 A;  2QG0 A;  4CWQ A;  3ZKD A;  3SL2 A;  3B25 A;  3A0W A;  2BU5 A;  1BYQ A;  2XHX A;  4HZ0 A;  1IXM A;  4BQJ A;  4KTN A;  2VW5 A;  2YEJ A;  5D6Q A;  2YI7 A;  2IOR A;  4CWF A;  1UYK A;  2YGE A;  2CCT A;  2K5B A;  4BAE A;  3G75 A;  3T1K A;  3LNU A;  2QFO A;  3LMM A;  1TC6 A;  5D7D A;  4HY1 A;  2YEH A;  2IOP A;  5CF0 A;  1Y4U A;  1AM1 A;  1YC1 A;  4CE2 A;  1S16 A;  4W7T A;  1NHH A;  5J6A A;  4R3A A;  4V25 A;  4XKK A;  3G7B A;  4L90 A;  4EGK A;  1Y8P A;  4LWG A;  3OPD A;  1TBW A;  4L94 A;  4MBC A;  5M4E A;  3K97 A;  2BU8 A;  4XKO A;  3OWD A;  3Q5K A;  4JAV A;  1EI1 A;  3H4L A;  2WI1 A;  1ZWH A;  4URL A;  3OW6 A;  1UY9 A;  2E0A A;  3HEK A;  5F5R A;  3ZXQ A;  1Y8O A;  3GIF A;  1TID A;  3O0I A;  2O1V A;  2HCH A;  4YKT A;  2BU2 A;  4FPP A;  2FWZ A;  4B6C A;  5FNF A;  4PRV A;  1UYE A;  1YC4 A;  3VHC A;  4HZ5 A;  1YSZ A;  1ZXM A;  2XHT A;  4O07 A;  2JJC A;  4DUH A;  1ZXN A;  4XCL A;  4QPJ A;  2BTZ A;  4YKZ A;  1YT2 A;  4WUD A;  1I59 A;  1GKZ A;  1OSF A;  2YEB A;  4XIR A;  3ZXO A;  4NH8 A;  4XTJ A;  1YER A;  3O2F A;  1B3Q A;  2CCS A;  4HYP A;  2WI4 A;  2ZBK B;  3CWV A;  3RLQ A;  2XDU A;  3EHJ A;  4MPN A;  4H81 A;  1YET A;  5J71 A;  1UYL A;  2YE2 A;  1S14 A;  2YK9 A;  5CPH A;  2H8M A;  2C1G A;  4XIT A;  1I5B A;  2O1U A;  2VCJ A;  4CE1 A;  4V26 A;  2EXL A;  3WHA A;  3WQ9 A;  3BM9 A;  1YS3 A;  1MU5 A;  5IN9 A;  3RKZ A;  1B62 A;  3NMQ A;  3C0E A;  2PNR A;  3B28 A;  4CWS A;  1QYE A;  4LWE A;  3K60 A;  2QG2 A;  4R3M A;  3CRK A;  2YJW A;  5BOD A;  3Q5L A;  2WI7 A;  4ZKI A;  2XJG A;  3RLR A;  4WUC A;  4WUB A;  2BRC A;  4HXW A;  3C11 A;  4GQT A;  4P8O A;  4URO A;  3JZ3 A;  1UYH A;  5FND A;  1QY8 A;  4L8Z A;  3TUH A;  3TZ0 A;  3HYY A;  4KQV A;  5IDJ A;  4BIU A;  1I5A A;  3B24 A;  1ID0 A;  2YEC A;  3OMU A;  2GFD A;  5CTX A;  3EHF A;  1TH8 A;  3U2D A;  2Q8I A;  5GGZ A;  3K98 A;  4L91 A;  3U67 A;  2YE9 A;  3GIG B;  5FNC A;  2YJX A;  2YK2 A;  4MPC A;  5CTW A;  1F51 A;  3O6O A;  4KSH A;  2YEF A;  1L0O A;  4MPE A;  2BZ5 A;  1I58 A;  4FCP A;  4CWO A;  2YED A;  2YKB A;  4YKR A;  4GFN A;  4P7A A;  4YKQ A;  4GT8 A;  1Y4S A;  2XDK A;  1TIL A;  2YI5 A;  3G7E A;  4HY6 A;  4O05 A;  4ASA A;  3RLP A;  3B27 A;  3B26 A;  4EMV A;  3PEJ A;  3T0H A;  5M4K A;  1BKN A;  1U0Z A;  2ZKJ A;  3EKR A;  3MNR P;  5M4P A;  2IOQ A;  4JQL A;  2FWY A;  2XAB A;  4CWR A;  4CWT A;  4PU9 A;  5FWK A;  4O09 A; 
#chains in the Genus database with same CATH homology
 2WEP A;  2WI2 A;  1GKX A;  2YEG A;  1BXD A;  4E01 A;  2BT0 A;  4QPK A;  3CGZ A;  3VAD A;  3U2K A;  3INX A;  2XDS A;  3A0Y A;  4LWI A;  5IDM A;  4XIQ A;  4AWO A;  4X9L A;  5M4H A;  4JAU A;  4ZVI A;  4I3H A;  4L93 A;  2UWD A;  4BQG A;  5C93 A;  4GEE A;  2QF6 A;  2YKI A;  3VHA A;  4MP2 A;  4LP0 A;  2JKI A;  1GJV A;  3CGY A;  2XX2 A;  2XX5 A;  2IWS A;  3D0B A;  2O1W A;  4GGL A;  2YE8 A;  2ESA A;  2WI3 A;  4HYM A;  4LPB A;  5CTY A;  2BYI A;  1UYG A;  3GIG A;  3HYZ A;  1AMW A;  2Q8F A;  4H85 A;  4O04 A;  1H7S A;  1I5D A;  4CWN A;  2GQP A;  1B63 A;  4AWQ A;  3R91 A;  4ASB A;  1BGQ A;  4XDM A;  4FCQ A;  4YKW A;  4MOT A;  4YKU A;  3KE6 A;  2YE6 A;  2Q8H A;  4K4O A;  4EGH A;  2AKP A;  4U7O A;  3FV5 A;  3BMY A;  3R4P A;  1I5C A;  1R62 A;  1US7 A;  2WI6 A;  4ASF A;  3A0Z A;  1KIJ A;  4PL9 A;  4GCZ A;  4YKX A;  1AH6 A;  2CH4 A;  4XCJ A;  1Z5C A;  3R4O A;  3A0T A;  5D7C A;  1YSR A;  5L3J A;  4MB9 A;  3TZ2 A;  3R4N A;  3K99 A;  4U7N A;  4CE3 A;  3PEH A;  1UY6 A;  3FT5 A;  3OWB A;  2XJJ A;  1ZW9 A;  3EKO A;  3H80 A;  3HHU A;  4O0B A;  1QZR A;  2VCI A;  3FT8 A;  4B7P A;  4URN A;  2Q2E B;  3TZ5 A;  1UYI A;  3DGE A;  4ASG A;  3A0R A;  4H7Q A;  5D6P A;  4PRX A;  1EA6 A;  2HG1 A;  3EHG A;  4AS9 A;  2WEQ A;  4YKY A;  3TZ4 A;  5M4N A;  1UYM A;  4XE2 A;  4EGI A;  3IED A;  2ZDX A;  5M4M A;  4E00 A;  3ZKB A;  4AWP A;  3TTZ A;  4FCR A;  4FMT A;  2YI0 A;  1YT1 A;  2IWU A;  1NHI A;  2XCM A;  3R4M A;  3T0Z A;  2XDL A;  2WER A;  3D2R A;  2YEA A;  4LWH A;  4XC0 A;  1UY8 A;  2YGA A;  3HZ1 A;  4XIP A;  2YI6 A;  2BU6 A;  1UYC A;  1KZN A;  2YKE A;  2BYH A;  1Z59 A;  4R1F A;  1Z5A A;  4KSG A;  1NHJ A;  3T10 A;  4DZY A;  2HKJ A;  4KP4 A;  3HZ5 A;  2YE4 A;  1UYD A;  3CRL A;  4LWF A;  5F3K A;  4MP7 A;  2FXS A;  2IWX A;  3INW A;  2YEE A;  4EFU A;  4BIZ A;  2WI5 A;  1A4H A;  2YKC A;  2YEI A;  4KFG A;  1PVG A;  4EFT A;  4HXZ A;  2VWC A;  4NH7 A;  4CWP A;  3Q5J A;  1AJ6 A;  1JM6 A;  2C2A A;  1Z5B A;  2XD6 A;  1Y8N A;  4XKA A;  2YE7 A;  2Q8G A;  2BSM A;  1U2O A;  3R92 A;  2H55 A;  3QDD A;  4EM7 A;  5D7R A;  2CGF A;  4I5S A;  2YE3 A;  4EEH A;  2YGF A;  1YC3 A;  2BU7 A;  2FYP A;  1MX0 A;  1TC0 A;  2YE5 A;  1YES A;  1UYF A;  5CTU A;  2CG9 A;  3LPS A;  4JAS A;  4Q20 A;  4NH9 A;  4BXI A;  3EHH A;  5BOC A;  2XJX A;  1UY7 A;  3ZM7 A;  1THN A;  4XD8 A;  3QTF A;  2YKJ A;  3T2S A;  4E02 A;  4URM A;  4U93 A;  2XHR A;  3A0X A;  2BRE A;  1YT0 A;  2CCU A;  2XDX A;  2ZDY A;  2XK2 A;  3GIE A;  1AH8 A;  1H7U A;  3VHD A;  3D36 A;  2XX4 A;  2QG0 A;  4CWQ A;  3ZKD A;  3SL2 A;  3B25 A;  3A0W A;  2BU5 A;  1BYQ A;  2XHX A;  4HZ0 A;  4BQJ A;  4KTN A;  2VW5 A;  2YEJ A;  5D6Q A;  2YI7 A;  2IOR A;  4CWF A;  1UYK A;  2YGE A;  2CCT A;  2K5B A;  4BAE A;  3G75 A;  3T1K A;  3LNU A;  2QFO A;  1TC6 A;  5D7D A;  4HY1 A;  2YEH A;  2IOP A;  5CF0 A;  1Y4U A;  1AM1 A;  1YC1 A;  4CE2 A;  1S16 A;  4W7T A;  1NHH A;  5J6A A;  4R3A A;  4V25 A;  4XKK A;  3G7B A;  4L90 A;  4EGK A;  1Y8P A;  4LWG A;  3OPD A;  1TBW A;  4L94 A;  4MBC A;  5M4E A;  3K97 A;  2BU8 A;  4XKO A;  3OWD A;  3Q5K A;  4JAV A;  1EI1 A;  3H4L A;  2WI1 A;  1ZWH A;  4URL A;  3OW6 A;  1UY9 A;  2E0A A;  3HEK A;  5F5R A;  3ZXQ A;  1Y8O A;  3GIF A;  1TID A;  3O0I A;  2O1V A;  2HCH A;  4YKT A;  2BU2 A;  4FPP A;  2FWZ A;  4B6C A;  5FNF A;  4PRV A;  1UYE A;  1YC4 A;  3VHC A;  4HZ5 A;  1YSZ A;  1ZXM A;  2XHT A;  4O07 A;  2JJC A;  4DUH A;  1ZXN A;  4XCL A;  4QPJ A;  2BTZ A;  4YKZ A;  1YT2 A;  4WUD A;  1I59 A;  1GKZ A;  1OSF A;  2YEB A;  4XIR A;  3ZXO A;  4NH8 A;  4XTJ A;  1YER A;  3O2F A;  1B3Q A;  2CCS A;  4HYP A;  2WI4 A;  2ZBK B;  3CWV A;  3RLQ A;  2XDU A;  3EHJ A;  4MPN A;  4H81 A;  1YET A;  5J71 A;  1UYL A;  2YE2 A;  1S14 A;  2YK9 A;  5CPH A;  2H8M A;  4XIT A;  1I5B A;  2O1U A;  2VCJ A;  4CE1 A;  4V26 A;  2EXL A;  3WHA A;  3WQ9 A;  3BM9 A;  1YS3 A;  1MU5 A;  5IN9 A;  3RKZ A;  1B62 A;  3NMQ A;  3C0E A;  2PNR A;  3B28 A;  4CWS A;  1QYE A;  4LWE A;  3K60 A;  2QG2 A;  4R3M A;  3CRK A;  2YJW A;  5BOD A;  3Q5L A;  2WI7 A;  4ZKI A;  2XJG A;  3RLR A;  4WUC A;  4WUB A;  2BRC A;  4HXW A;  3C11 A;  4GQT A;  4P8O A;  4URO A;  3JZ3 A;  1UYH A;  5FND A;  1QY8 A;  4L8Z A;  3TUH A;  3TZ0 A;  3HYY A;  4KQV A;  5IDJ A;  4BIU A;  1I5A A;  3B24 A;  1ID0 A;  2YEC A;  3OMU A;  2GFD A;  5CTX A;  3EHF A;  1TH8 A;  3U2D A;  2Q8I A;  5GGZ A;  3K98 A;  4L91 A;  3U67 A;  2YE9 A;  3GIG B;  5FNC A;  2YJX A;  2YK2 A;  4MPC A;  5CTW A;  3O6O A;  4KSH A;  2YEF A;  1L0O A;  4MPE A;  2BZ5 A;  1I58 A;  4FCP A;  4CWO A;  2YED A;  2YKB A;  4YKR A;  4GFN A;  4P7A A;  4YKQ A;  4GT8 A;  1Y4S A;  2XDK A;  1TIL A;  2YI5 A;  3G7E A;  4HY6 A;  4O05 A;  4ASA A;  3RLP A;  3B27 A;  3B26 A;  4EMV A;  3PEJ A;  3T0H A;  5M4K A;  1BKN A;  1U0Z A;  2ZKJ A;  3EKR A;  3MNR P;  5M4P A;  2IOQ A;  4JQL A;  2FWY A;  2XAB A;  4CWR A;  4CWT A;  4PU9 A;  5FWK A;  4O09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...