5IDMA

Bifunctional histidine kinase ccka (domain, ca) in complex with c-di-gmp and amppnp/mg2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
177
structure length
177
Chain Sequence
b'VQREVLDLGELISEFEVLLRRLLREDVKLITDYGRDLPQVRADKSQLETAVMNLAVNARDAVRAAKGGGVVRIRTARLTRDEAIQLGFPAADGDTAFIEVSDDGPGIPPDVMGKIFDPFFTTKPVGEGTGLGLATVYGIVKQSDGWIHVHSRPNEGAAFRIFLPVYEAPAALEHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell cycle histidine kinase CckA
publication title Cyclic di-GMP mediates a histidine kinase/phosphatase switch by noncovalent domain cross-linking.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase
total genus 44
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5idmA00
1YT0A 2WEPA 2XX2A 3R4PA 3GIEA 2YEAA 1QZRA 1H7UA 1NHIA 3Q5JA 2YKEA 1UYIA 1YC3A 3FT5A 4P7AA 1THNA 1Y8PA 2ZKJA 2CCSA 2YJXA 3CRLA 3D0BA 4AS9A 3INWA 4XKOA 3T0HA 3O2FA 5CF0A 4CE3A 1U0ZA 1YT2A 3TZ5A 2XABA 1I5BA 3IEDA 2YEDA 1JM6A 2BU2A 4O04A 1L0OA 4FCRA 2YK2A 1UY6A 4JAVA 4CWTA 2Q8HA 3K97A 2WI4A 4L93A 2YE9A 3T1KA 4I3HA 2XK2A 1A4HA 2YE2A 2YKIA 4L90A 4KSHA 4MP2A 3PEHA 4XIPA 4URNA 2Q8FA 4E02A 1BKNA 1TIDA 4NH9A 2E0AA 3RLRA 1NHHA 3EKRA 4CWRA 1Y4UA 4CWFA 2BTZA 4FMTA 5IDMA 1AM1A 4HXWA 3T10A 3GIGA 2WERA 3U2DA 4R3AA 2PNRA 3EKOA 4GCZA 4LWIA 2ZDXA 2YEGA 2IWSA 1AH6A 4NH8A 3CRKA 2O1VA 1ZW9A 1Z59A 4H85A 4H81A 4URLA 2XJGA 4FCPA 2Q8IA 5FWKA 4AWPA 2Q8GA 5D6PA 3C0EA 3D2RA 2QF6A 1B62A 2H8MA 3JZ3A 1UYGA 4GGLA 3MNRP 4YKUA 3A0RA 4I5SA 1GKZA 1Z5AA 4CWQA 1ID0A 1UYDA 4V26A 4YKYA 5D6QA 2UWDA 1S16A 4XIQA 1QY8A 3R91A 4HY6A 4ZKIA 4E01A 2BYHA 4MP7A 3O0IA 2CGFA 4XCLA 4L91A 1YC4A 4UROA 3OWDA 4BXIA 2CCTA 4R3MA 3U2KA 3D36A 5CTYA 3ZKDA 3G7EA 2YE6A 4AWOA 3EHHA 1I5AA 3ZXOA 3HYZA 4YKQA 3G75A 2ZBKB 4QPKA 3EHJA 4DZYA 4EMVA 5M4KA 2VCIA 1R62A 3K98A 5BOCA 1Z5BA 5M4NA 3LPSA 3HZ1A 2XJJA 4MBCA 4HY1A 1UY8A 2Q2EB 1Y8NA 1YSRA 3R4MA 4K4OA 4YKZA 4MB9A 2VW5A 5GGZA 1UYCA 4DUHA 5D7DA 4U93A 2BU7A 2FYPA 1PVGA 1Z5CA 2FXSA 1UYKA 1KIJA 3R4OA 4U7OA 2YEIA 3PEJA 3R4NA 3VHDA 1I58A 1UY7A 2HKJA 4MPEA 3O6OA 2ZDYA 5CTUA 3K99A 4KP4A 3HEKA 4WUBA 3GIFA 2WI2A 4ASGA 4EGHA 4O07A 2BU5A 4JASA 1US7A 5M4PA 2XHTA 4LWFA 5CTXA 3H4LA 1TC6A 4XCJA 3U67A 3BM9A 3HZ5A 4L8ZA 4YKTA 2BU8A 1Y4SA 4MOTA 2YI7A 3FV5A 4XKKA 2YEEA 4LPBA 4XC0A 4EFTA 4EFUA 2YGEA 1UYEA 3K60A 5M4HA 2BREA 4CWNA 1YS3A 2HCHA 4O09A 1Y8OA 4CWOA 4HXZA 3H80A 4CWPA 3ZKBA 3R92A 5L3JA 2JKIA 4E00A 2XHRA 4U7NA 1U2OA 2YI6A 3QDDA 2BT0A 1TILA 5FNFA 2GQPA 4EGIA 4KFGA 2JJCA 1EI1A 2QFOA 3C11A 1ZWHA 1BGQA 4FPPA 3CGZA 3QTFA 5F5RA 1AJ6A 2XD6A 2YI0A 2GFDA 3B27A 4QPJA 1GJVA 2XX4A 2YGFA 3CGYA 3HHUA 4BQJA 4ZVIA 4MPCA 1YT1A 4PRXA 3G7BA 1TBWA 1UYMA 2VCJA 1UYLA 4XITA 2YKJA 5J6AA 4BQGA 4H7QA 3RKZA 4GQTA 4WUCA 5IDJA 4YKRA 2YI5A 4LP0A 4O0BA 3B24A 4HYMA 2IWXA 2XX5A 3T0ZA 5M4MA 4PRVA 2O1UA 1YERA 2YE8A 3B26A 4Q20A 2BU6A 1UY9A 4XKAA 3A0ZA 2HG1A 1I5DA 1ZXMA 5D7RA 3HYYA 2WI3A 4LWGA 3T2SA 4HYPA 3GIGB 2YEJA 2K5BA 2YKCA 3OWBA 2CG9A 3DGEA 1YETA 1EA6A 3ZXQA 1MX0A 2IORA 3OW6A 2XJXA 2XDLA 4EEHA 2CH4A 3A0WA 3Q5LA 4KSGA 4R1FA 4O05A 3TZ4A 3TUHA 4ASBA 4BIUA 1H7SA 3B25A 1MU5A 2YGAA 4BAEA 1OSFA 4MPNA 1AH8A 2VWCA 2H55A 5CPHA 4GFNA 4NH7A 5F3KA 5IN9A 4HZ0A 2YKBA 4XE2A 4L94A 3LNUA 2YJWA 4V25A 3WHAA 2YE4A 4JAUA 2YEFA 3Q5KA 1NHJA 1QYEA 4XD8A 4PU9A 3NMQA 4GEEA 3WQ9A 3VHAA 2YECA 4GT8A 4XTJA 1YC1A 2WI5A 2IWUA 2WI6A 4LWHA 1YESA 1KZNA 2IOQA 3OPDA 4FCQA 4W7TA 2XDKA 2BRCA 4EGKA 2AKPA 4ASFA 2CCUA 2IOPA 2YK9A 4CWSA 4JQLA 2YE5A 4WUDA 5C93A 5M4EA 1BYQA 3A0YA 3FT8A 1GKXA 4XDMA 3TTZA 3OMUA 1AMWA 4KQVA 1I5CA 2FWYA 2XDSA 2ESAA 3EHFA 2EXLA 1B3QA 3TZ0A 1S14A 2WI7A 4AWQA 3VHCA 1UYHA 3EHGA 2QG0A 3TZ2A 2BZ5A 1UYFA 5CTWA 4EM7A 3A0TA 4X9LA 4B6CA 2BSMA 5FNCA 4LWEA 2YE7A 2WI1A 1BXDA 1TC0A 2C2AA 4B7PA 4CE1A 1B63A 1TH8A 3RLQA 5D7CA 4URMA 3RLPA 2XDXA 2XDUA 4BIZA 4CE2A 3A0XA 4ASAA 3VADA 5J71A 2BYIA 2XHXA 4P8OA 2O1WA 4HZ5A 1YSZA 3SL2A 2FWZA 2WEQA 3CWVA 4YKXA 1ZXNA 1I59A 3INXA 2YE3A 3KE6A 5BODA 2QG2A 2XCMA 4PL9A 2YEHA 3ZM7A 2YEBA 3B28A 3BMYA 4XIRA 5FNDA 4KTNA 4YKWA
chains in the Genus database with same CATH superfamily
1YT0A 2WEPA 2XX2A 3R4PA 3GIEA 2YEAA 1QZRA 1H7UA 1NHIA 3Q5JA 2YKEA 1UYIA 1YC3A 3FT5A 4P7AA 1THNA 1Y8PA 2ZKJA 2CCSA 2YJXA 3CRLA 3D0BA 1IXMA 4AS9A 3INWA 4XKOA 3T0HA 3O2FA 5CF0A 4CE3A 1U0ZA 1YT2A 3TZ5A 2XABA 1I5BA 3IEDA 2YEDA 1JM6A 2BU2A 4O04A 1L0OA 4FCRA 2YK2A 1UY6A 4JAVA 4CWTA 2Q8HA 3K97A 2WI4A 4L93A 2YE9A 3T1KA 4I3HA 2XK2A 1A4HA 2YE2A 2YKIA 4L90A 4KSHA 4MP2A 3PEHA 2C1IA 4XIPA 4URNA 2Q8FA 4E02A 1BKNA 1TIDA 2C1GA 4NH9A 2E0AA 3RLRA 1NHHA 3EKRA 4CWRA 1Y4UA 4CWFA 2BTZA 4FMTA 5IDMA 1AM1A 4HXWA 3T10A 3GIGA 2WERA 3U2DA 4R3AA 2PNRA 3EKOA 4GCZA 5JENA 4LWIA 2ZDXA 2YEGA 2IWSA 1AH6A 4NH8A 3CRKA 2O1VA 1ZW9A 1Z59A 4H85A 4H81A 4URLA 2XJGA 4FCPA 2Q8IA 5FWKA 4AWPA 2Q8GA 5D6PA 3C0EA 3D2RA 2QF6A 1B62A 2H8MA 3JZ3A 1UYGA 4GGLA 3MNRP 4YKUA 3A0RA 4I5SA 1GKZA 1Z5AA 4CWQA 1ID0A 1UYDA 4V26A 4YKYA 5D6QA 2UWDA 1S16A 4XIQA 1QY8A 3R91A 4HY6A 4ZKIA 4E01A 2BYHA 4MP7A 3O0IA 2CGFA 4XCLA 4L91A 1YC4A 4UROA 3OWDA 4BXIA 2CCTA 4R3MA 3U2KA 3D36A 5CTYA 3LMMA 3ZKDA 3G7EA 2YE6A 4AWOA 3EHHA 1I5AA 3ZXOA 3HYZA 4YKQA 3G75A 2ZBKB 4QPKA 3EHJA 4DZYA 4EMVA 5M4KA 2VCIA 1R62A 3K98A 5BOCA 1Z5BA 5M4NA 3LPSA 3HZ1A 2XJJA 4MBCA 4HY1A 1UY8A 2Q2EB 1Y8NA 1YSRA 3R4MA 4K4OA 4YKZA 4MB9A 2VW5A 5GGZA 1UYCA 2HHIA 4DUHA 5D7DA 4U93A 2BU7A 2FYPA 1PVGA 1Z5CA 2FXSA 1UYKA 1KIJA 3R4OA 4U7OA 2YEIA 3PEJA 3R4NA 3VHDA 1I58A 1UY7A 2HKJA 4MPEA 3O6OA 2ZDYA 5CTUA 3K99A 4KP4A 3HEKA 4WUBA 3GIFA 2WI2A 4ASGA 4EGHA 4O07A 2BU5A 4JASA 1US7A 5M4PA 2XHTA 4LWFA 5CTXA 3H4LA 1TC6A 4XCJA 3U67A 3BM9A 3HZ5A 4L8ZA 4YKTA 2BU8A 1Y4SA 4MOTA 2YI7A 1F51A 3FV5A 4XKKA 2YEEA 4LPBA 4XC0A 4EFTA 4EFUA 2YGEA 1UYEA 3K60A 5M4HA 2BREA 4CWNA 1YS3A 2HCHA 4O09A 1Y8OA 4CWOA 4HXZA 3H80A 4CWPA 3ZKBA 3R92A 5L3JA 2JKIA 4E00A 2XHRA 4U7NA 1U2OA 2YI6A 3QDDA 2BT0A 1TILA 5FNFA 2GQPA 4EGIA 4KFGA 2JJCA 1EI1A 2QFOA 3C11A 1ZWHA 1BGQA 3CGZA 3QTFA 4FPPA 5F5RA 1AJ6A 2XD6A 2YI0A 2GFDA 3B27A 4QPJA 3S5TA 1GJVA 2XX4A 2YGFA 3CGYA 3HHUA 4BQJA 4ZVIA 4MPCA 1YT1A 4PRXA 3G7BA 1TBWA 1UYMA 2VCJA 1UYLA 4XITA 2YKJA 5J6AA 4BQGA 4H7QA 3RKZA 4GQTA 4WUCA 5IDJA 4YKRA 2YI5A 4LP0A 4O0BA 3B24A 4HYMA 2IWXA 2XX5A 3T0ZA 5M4MA 4PRVA 2O1UA 1YERA 2YE8A 3B26A 4Q20A 2BU6A 1UY9A 4XKAA 3A0ZA 2HG1A 1I5DA 1ZXMA 5D7RA 3HYYA 2WI3A 4LWGA 3T2SA 4HYPA 3GIGB 2YEJA 2K5BA 2YKCA 3OWBA 2CG9A 3DGEA 1YETA 1EA6A 3ZXQA 1MX0A 2IORA 3OW6A 2XJXA 2XDLA 4EEHA 2CH4A 3A0WA 3Q5LA 4KSGA 4R1FA 4O05A 3TZ4A 3TUHA 4ASBA 4BIUA 1H7SA 3B25A 1MU5A 2YGAA 4BAEA 1OSFA 4E72A 4MPNA 1AH8A 2VWCA 2FTKA 2H55A 5CPHA 4GFNA 4NH7A 5F3KA 5IN9A 4HZ0A 2YKBA 4XE2A 4L94A 3LNUA 2YJWA 4V25A 3WHAA 2YE4A 4JAUA 2YEFA 3Q5KA 1NHJA 1QYEA 4XD8A 4PU9A 3NMQA 4GEEA 3WQ9A 3VHAA 2YECA 4GT8A 4XTJA 1YC1A 2WI5A 2IWUA 2WI6A 4LWHA 1YESA 1KZNA 2IOQA 3OPDA 4FCQA 4W7TA 2XDKA 2BRCA 4EGKA 2AKPA 4ASFA 2CCUA 2IOPA 2YK9A 4CWSA 4JQLA 2YE5A 4WUDA 5C93A 5M4EA 1BYQA 3A0YA 3FT8A 1GKXA 4XDMA 3TTZA 3OMUA 1AMWA 4KQVA 1I5CA 2FWYA 2XDSA 2ESAA 3EHFA 2EXLA 1B3QA 3TZ0A 1S14A 2WI7A 4AWQA 3CYGA 1UYHA 3VHCA 3EHGA 2QG0A 3TZ2A 2BZ5A 1UYFA 5CTWA 4EM7A 3A0TA 4X9LA 4B6CA 2BSMA 5FNCA 4LWEA 2YE7A 2WI1A 1BXDA 1TC0A 2C2AA 4B7PA 4CE1A 1B63A 1TH8A 3RLQA 5D7CA 4URMA 3RLPA 2XDXA 2XDUA 4BIZA 4CE2A 3A0XA 4ASAA 3VADA 5J71A 2BYIA 2XHXA 4P8OA 2O1WA 4HZ5A 1YSZA 3SL2A 2FWZA 2WEQA 3CWVA 4YKXA 1ZXNA 1I59A 3INXA 2YE3A 3KE6A 5BODA 2QG2A 2XCMA 4PL9A 2YEHA 3ZM7A 2YEBA 3B28A 3BMYA 4XIRA 5FNDA 4KTNA 4YKWA
chains in the Genus database with same CATH topology
1YT0A 2WEPA 2XX2A 3R4PA 3GIEA 2YEAA 1QZRA 1H7UA 1NHIA 3Q5JA 2YKEA 1UYIA 1YC3A 3FT5A 4P7AA 1THNA 1Y8PA 2ZKJA 2CCSA 2YJXA 3CRLA 3D0BA 4AS9A 3INWA 4XKOA 3T0HA 3O2FA 5CF0A 4CE3A 1U0ZA 1YT2A 3TZ5A 2XABA 1I5BA 3IEDA 2YEDA 1JM6A 2BU2A 4O04A 1L0OA 4FCRA 2YK2A 1UY6A 4JAVA 4CWTA 2Q8HA 3K97A 2WI4A 4L93A 2YE9A 3T1KA 4I3HA 2XK2A 1A4HA 2YE2A 2YKIA 4L90A 4KSHA 4MP2A 3PEHA 4XIPA 4URNA 2Q8FA 4E02A 1BKNA 1TIDA 4NH9A 2E0AA 3RLRA 1NHHA 3EKRA 4CWRA 1Y4UA 4CWFA 2BTZA 4FMTA 5IDMA 1AM1A 4HXWA 3T10A 3GIGA 2WERA 3U2DA 4R3AA 2PNRA 3EKOA 4GCZA 4LWIA 2ZDXA 2YEGA 2IWSA 1AH6A 4NH8A 3CRKA 2O1VA 1ZW9A 1Z59A 4H85A 4H81A 4URLA 2XJGA 4FCPA 2Q8IA 5FWKA 4AWPA 2Q8GA 5D6PA 3C0EA 3D2RA 2QF6A 1B62A 2H8MA 3JZ3A 1UYGA 4GGLA 3MNRP 4YKUA 3A0RA 4I5SA 1GKZA 1Z5AA 4CWQA 1ID0A 1UYDA 4V26A 4YKYA 5D6QA 2UWDA 1S16A 4XIQA 1QY8A 3R91A 4HY6A 4ZKIA 4E01A 2BYHA 4MP7A 3O0IA 2CGFA 4XCLA 4L91A 1YC4A 4UROA 3OWDA 4BXIA 2CCTA 4R3MA 3U2KA 3D36A 5CTYA 3ZKDA 3G7EA 2YE6A 4AWOA 3EHHA 1I5AA 3ZXOA 3HYZA 4YKQA 3G75A 2ZBKB 4QPKA 3EHJA 4DZYA 4EMVA 5M4KA 2VCIA 1R62A 3K98A 5BOCA 1Z5BA 5M4NA 3LPSA 3HZ1A 2XJJA 4MBCA 4HY1A 1UY8A 2Q2EB 1Y8NA 1YSRA 3R4MA 4K4OA 4YKZA 4MB9A 2VW5A 5GGZA 1UYCA 4DUHA 5D7DA 4U93A 2BU7A 2FYPA 1PVGA 1Z5CA 2FXSA 1UYKA 1KIJA 3R4OA 4U7OA 2YEIA 3PEJA 3R4NA 3VHDA 1I58A 1UY7A 2HKJA 4MPEA 3O6OA 2ZDYA 5CTUA 3K99A 4KP4A 3HEKA 4WUBA 3GIFA 2WI2A 4ASGA 4EGHA 4O07A 2BU5A 4JASA 1US7A 5M4PA 2XHTA 4LWFA 5CTXA 3H4LA 1TC6A 4XCJA 3U67A 3BM9A 3HZ5A 4L8ZA 4YKTA 2BU8A 1Y4SA 4MOTA 2YI7A 3FV5A 4XKKA 2YEEA 4LPBA 4XC0A 4EFTA 4EFUA 2YGEA 1UYEA 3K60A 5M4HA 2BREA 4CWNA 1YS3A 2HCHA 4O09A 1Y8OA 4CWOA 4HXZA 3H80A 4CWPA 3ZKBA 3R92A 5L3JA 2JKIA 4E00A 2XHRA 4U7NA 1U2OA 2YI6A 3QDDA 2BT0A 1TILA 5FNFA 2GQPA 4EGIA 4KFGA 2JJCA 1EI1A 2QFOA 3C11A 1ZWHA 1BGQA 4FPPA 3CGZA 3QTFA 5F5RA 1AJ6A 2XD6A 2YI0A 2GFDA 3B27A 4QPJA 1GJVA 2XX4A 2YGFA 3CGYA 3HHUA 4BQJA 4ZVIA 4MPCA 1YT1A 4PRXA 3G7BA 1TBWA 1UYMA 2VCJA 1UYLA 4XITA 2YKJA 5J6AA 4BQGA 4H7QA 3RKZA 4GQTA 4WUCA 5IDJA 4YKRA 2YI5A 4LP0A 4O0BA 3B24A 4HYMA 2IWXA 2XX5A 3T0ZA 5M4MA 4PRVA 2O1UA 1YERA 2YE8A 3B26A 4Q20A 2BU6A 1UY9A 4XKAA 3A0ZA 2HG1A 1I5DA 1ZXMA 5D7RA 3HYYA 2WI3A 4LWGA 3T2SA 4HYPA 3GIGB 2YEJA 2K5BA 2YKCA 3OWBA 2CG9A 3DGEA 1YETA 1EA6A 3ZXQA 1MX0A 2IORA 3OW6A 2XJXA 2XDLA 4EEHA 2CH4A 3A0WA 3Q5LA 4KSGA 4R1FA 4O05A 3TZ4A 3TUHA 4ASBA 4BIUA 1H7SA 3B25A 1MU5A 2YGAA 4BAEA 1OSFA 4MPNA 1AH8A 2VWCA 2H55A 5CPHA 4GFNA 4NH7A 5F3KA 5IN9A 4HZ0A 2YKBA 4XE2A 4L94A 3LNUA 2YJWA 4V25A 3WHAA 2YE4A 4JAUA 2YEFA 3Q5KA 1NHJA 1QYEA 4XD8A 4PU9A 3NMQA 4GEEA 3WQ9A 3VHAA 2YECA 4GT8A 4XTJA 1YC1A 2WI5A 2IWUA 2WI6A 4LWHA 1YESA 1KZNA 2IOQA 3OPDA 4FCQA 4W7TA 2XDKA 2BRCA 4EGKA 2AKPA 4ASFA 2CCUA 2IOPA 2YK9A 4CWSA 4JQLA 2YE5A 4WUDA 5C93A 5M4EA 1BYQA 3A0YA 3FT8A 1GKXA 4XDMA 3TTZA 3OMUA 1AMWA 4KQVA 1I5CA 2FWYA 2XDSA 2ESAA 3EHFA 2EXLA 1B3QA 3TZ0A 1S14A 2WI7A 4AWQA 3VHCA 1UYHA 3EHGA 2QG0A 3TZ2A 2BZ5A 1UYFA 5CTWA 4EM7A 3A0TA 4X9LA 4B6CA 2BSMA 5FNCA 4LWEA 2YE7A 2WI1A 1BXDA 1TC0A 2C2AA 4B7PA 4CE1A 1B63A 1TH8A 3RLQA 5D7CA 4URMA 3RLPA 2XDXA 2XDUA 4BIZA 4CE2A 3A0XA 4ASAA 3VADA 5J71A 2BYIA 2XHXA 4P8OA 2O1WA 4HZ5A 1YSZA 3SL2A 2FWZA 2WEQA 3CWVA 4YKXA 1ZXNA 1I59A 3INXA 2YE3A 3KE6A 5BODA 2QG2A 2XCMA 4PL9A 2YEHA 3ZM7A 2YEBA 3B28A 3BMYA 4XIRA 5FNDA 4KTNA 4YKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YT0 A;  2WEP A;  2XX2 A;  3R4P A;  3GIE A;  2YEA A;  1QZR A;  1H7U A;  1NHI A;  3Q5J A;  2YKE A;  1UYI A;  1YC3 A;  3FT5 A;  4P7A A;  1THN A;  1Y8P A;  2ZKJ A;  2CCS A;  2YJX A;  3CRL A;  3D0B A;  4AS9 A;  3INW A;  4XKO A;  3T0H A;  3O2F A;  5CF0 A;  4CE3 A;  1U0Z A;  1YT2 A;  3TZ5 A;  2XAB A;  1I5B A;  3IED A;  2YED A;  1JM6 A;  2BU2 A;  4O04 A;  1L0O A;  4FCR A;  2YK2 A;  1UY6 A;  4JAV A;  4CWT A;  2Q8H A;  3K97 A;  2WI4 A;  4L93 A;  2YE9 A;  3T1K A;  4I3H A;  2XK2 A;  1A4H A;  2YE2 A;  2YKI A;  4L90 A;  4KSH A;  4MP2 A;  3PEH A;  4XIP A;  4URN A;  2Q8F A;  4E02 A;  1BKN A;  1TID A;  4NH9 A;  2E0A A;  3RLR A;  1NHH A;  3EKR A;  4CWR A;  1Y4U A;  4CWF A;  2BTZ A;  4FMT A;  5IDM A;  1AM1 A;  4HXW A;  3T10 A;  3GIG A;  2WER A;  3U2D A;  4R3A A;  2PNR A;  3EKO A;  4GCZ A;  4LWI A;  2ZDX A;  2YEG A;  2IWS A;  1AH6 A;  4NH8 A;  3CRK A;  2O1V A;  1ZW9 A;  1Z59 A;  4H85 A;  4H81 A;  4URL A;  2XJG A;  4FCP A;  2Q8I A;  5FWK A;  4AWP A;  2Q8G A;  5D6P A;  3C0E A;  3D2R A;  2QF6 A;  1B62 A;  2H8M A;  3JZ3 A;  1UYG A;  4GGL A;  3MNR P;  4YKU A;  3A0R A;  4I5S A;  1GKZ A;  1Z5A A;  4CWQ A;  1ID0 A;  1UYD A;  4V26 A;  4YKY A;  5D6Q A;  2UWD A;  1S16 A;  4XIQ A;  1QY8 A;  3R91 A;  4HY6 A;  4ZKI A;  4E01 A;  2BYH A;  4MP7 A;  3O0I A;  2CGF A;  4XCL A;  4L91 A;  1YC4 A;  4URO A;  3OWD A;  4BXI A;  2CCT A;  4R3M A;  3U2K A;  3D36 A;  5CTY A;  3ZKD A;  3G7E A;  2YE6 A;  4AWO A;  3EHH A;  1I5A A;  3ZXO A;  3HYZ A;  4YKQ A;  3G75 A;  2ZBK B;  4QPK A;  3EHJ A;  4DZY A;  4EMV A;  5M4K A;  2VCI A;  1R62 A;  3K98 A;  5BOC A;  1Z5B A;  5M4N A;  3LPS A;  3HZ1 A;  2XJJ A;  4MBC A;  4HY1 A;  1UY8 A;  2Q2E B;  1Y8N A;  1YSR A;  3R4M A;  4K4O A;  4YKZ A;  4MB9 A;  2VW5 A;  5GGZ A;  1UYC A;  4DUH A;  5D7D A;  4U93 A;  2BU7 A;  2FYP A;  1PVG A;  1Z5C A;  2FXS A;  1UYK A;  1KIJ A;  3R4O A;  4U7O A;  2YEI A;  3PEJ A;  3R4N A;  3VHD A;  1I58 A;  1UY7 A;  2HKJ A;  4MPE A;  3O6O A;  2ZDY A;  5CTU A;  3K99 A;  4KP4 A;  3HEK A;  4WUB A;  3GIF A;  2WI2 A;  4ASG A;  4EGH A;  4O07 A;  2BU5 A;  4JAS A;  1US7 A;  5M4P A;  2XHT A;  4LWF A;  5CTX A;  3H4L A;  1TC6 A;  4XCJ A;  3U67 A;  3BM9 A;  3HZ5 A;  4L8Z A;  4YKT A;  2BU8 A;  1Y4S A;  4MOT A;  2YI7 A;  3FV5 A;  4XKK A;  2YEE A;  4LPB A;  4XC0 A;  4EFT A;  4EFU A;  2YGE A;  1UYE A;  3K60 A;  5M4H A;  2BRE A;  4CWN A;  1YS3 A;  2HCH A;  4O09 A;  1Y8O A;  4CWO A;  4HXZ A;  3H80 A;  4CWP A;  3ZKB A;  3R92 A;  5L3J A;  2JKI A;  4E00 A;  2XHR A;  4U7N A;  1U2O A;  2YI6 A;  3QDD A;  2BT0 A;  1TIL A;  5FNF A;  2GQP A;  4EGI A;  4KFG A;  2JJC A;  1EI1 A;  2QFO A;  3C11 A;  1ZWH A;  1BGQ A;  4FPP A;  3CGZ A;  3QTF A;  5F5R A;  1AJ6 A;  2XD6 A;  2YI0 A;  2GFD A;  3B27 A;  4QPJ A;  1GJV A;  2XX4 A;  2YGF A;  3CGY A;  3HHU A;  4BQJ A;  4ZVI A;  4MPC A;  1YT1 A;  4PRX A;  3G7B A;  1TBW A;  1UYM A;  2VCJ A;  1UYL A;  4XIT A;  2YKJ A;  5J6A A;  4BQG A;  4H7Q A;  3RKZ A;  4GQT A;  4WUC A;  5IDJ A;  4YKR A;  2YI5 A;  4LP0 A;  4O0B A;  3B24 A;  4HYM A;  2IWX A;  2XX5 A;  3T0Z A;  5M4M A;  4PRV A;  2O1U A;  1YER A;  2YE8 A;  3B26 A;  4Q20 A;  2BU6 A;  1UY9 A;  4XKA A;  3A0Z A;  2HG1 A;  1I5D A;  1ZXM A;  5D7R A;  3HYY A;  2WI3 A;  4LWG A;  3T2S A;  4HYP A;  3GIG B;  2YEJ A;  2K5B A;  2YKC A;  3OWB A;  2CG9 A;  3DGE A;  1YET A;  1EA6 A;  3ZXQ A;  1MX0 A;  2IOR A;  3OW6 A;  2XJX A;  2XDL A;  4EEH A;  2CH4 A;  3A0W A;  3Q5L A;  4KSG A;  4R1F A;  4O05 A;  3TZ4 A;  3TUH A;  4ASB A;  4BIU A;  1H7S A;  3B25 A;  1MU5 A;  2YGA A;  4BAE A;  1OSF A;  4MPN A;  1AH8 A;  2VWC A;  2H55 A;  5CPH A;  4GFN A;  4NH7 A;  5F3K A;  5IN9 A;  4HZ0 A;  2YKB A;  4XE2 A;  4L94 A;  3LNU A;  2YJW A;  4V25 A;  3WHA A;  2YE4 A;  4JAU A;  2YEF A;  3Q5K A;  1NHJ A;  1QYE A;  4XD8 A;  4PU9 A;  3NMQ A;  4GEE A;  3WQ9 A;  3VHA A;  2YEC A;  4GT8 A;  4XTJ A;  1YC1 A;  2WI5 A;  2IWU A;  2WI6 A;  4LWH A;  1YES A;  1KZN A;  2IOQ A;  3OPD A;  4FCQ A;  4W7T A;  2XDK A;  2BRC A;  4EGK A;  2AKP A;  4ASF A;  2CCU A;  2IOP A;  2YK9 A;  4CWS A;  4JQL A;  2YE5 A;  4WUD A;  5C93 A;  5M4E A;  1BYQ A;  3A0Y A;  3FT8 A;  1GKX A;  4XDM A;  3TTZ A;  3OMU A;  1AMW A;  4KQV A;  1I5C A;  2FWY A;  2XDS A;  2ESA A;  3EHF A;  2EXL A;  1B3Q A;  3TZ0 A;  1S14 A;  2WI7 A;  4AWQ A;  3VHC A;  1UYH A;  3EHG A;  2QG0 A;  3TZ2 A;  2BZ5 A;  1UYF A;  5CTW A;  4EM7 A;  3A0T A;  4X9L A;  4B6C A;  2BSM A;  5FNC A;  4LWE A;  2YE7 A;  2WI1 A;  1BXD A;  1TC0 A;  2C2A A;  4B7P A;  4CE1 A;  1B63 A;  1TH8 A;  3RLQ A;  5D7C A;  4URM A;  3RLP A;  2XDX A;  2XDU A;  4BIZ A;  4CE2 A;  3A0X A;  4ASA A;  3VAD A;  5J71 A;  2BYI A;  2XHX A;  4P8O A;  2O1W A;  4HZ5 A;  1YSZ A;  3SL2 A;  2FWZ A;  2WEQ A;  3CWV A;  4YKX A;  1ZXN A;  1I59 A;  3INX A;  2YE3 A;  3KE6 A;  5BOD A;  2QG2 A;  2XCM A;  4PL9 A;  2YEH A;  3ZM7 A;  2YEB A;  3B28 A;  3BMY A;  4XIR A;  5FND A;  4KTN A;  4YKW A; 
#chains in the Genus database with same CATH topology
 1YT0 A;  2WEP A;  2XX2 A;  3R4P A;  3GIE A;  2YEA A;  1QZR A;  1H7U A;  1NHI A;  3Q5J A;  2YKE A;  1UYI A;  1YC3 A;  3FT5 A;  4P7A A;  1THN A;  1Y8P A;  2ZKJ A;  2CCS A;  2YJX A;  3CRL A;  3D0B A;  1IXM A;  4AS9 A;  3INW A;  4XKO A;  3T0H A;  3O2F A;  5CF0 A;  4CE3 A;  1U0Z A;  1YT2 A;  3TZ5 A;  2XAB A;  1I5B A;  3IED A;  2YED A;  1JM6 A;  2BU2 A;  4O04 A;  1L0O A;  4FCR A;  2YK2 A;  1UY6 A;  4JAV A;  4CWT A;  2Q8H A;  3K97 A;  2WI4 A;  4L93 A;  2YE9 A;  3T1K A;  4I3H A;  2XK2 A;  1A4H A;  2YE2 A;  2YKI A;  4L90 A;  4KSH A;  4MP2 A;  3PEH A;  2C1I A;  4XIP A;  4URN A;  2Q8F A;  4E02 A;  1BKN A;  1TID A;  2C1G A;  4NH9 A;  2E0A A;  3RLR A;  1NHH A;  3EKR A;  4CWR A;  1Y4U A;  4CWF A;  2BTZ A;  4FMT A;  5IDM A;  1AM1 A;  4HXW A;  3T10 A;  3GIG A;  2WER A;  3U2D A;  4R3A A;  2PNR A;  3EKO A;  4GCZ A;  5JEN A;  4LWI A;  2ZDX A;  2YEG A;  2IWS A;  1AH6 A;  4NH8 A;  3CRK A;  2O1V A;  1ZW9 A;  1Z59 A;  4H85 A;  4H81 A;  4URL A;  2XJG A;  4FCP A;  2Q8I A;  5FWK A;  4AWP A;  2Q8G A;  5D6P A;  3C0E A;  3D2R A;  2QF6 A;  1B62 A;  2H8M A;  3JZ3 A;  1UYG A;  4GGL A;  3MNR P;  4YKU A;  3A0R A;  4I5S A;  1GKZ A;  1Z5A A;  4CWQ A;  1ID0 A;  1UYD A;  4V26 A;  4YKY A;  5D6Q A;  2UWD A;  1S16 A;  4XIQ A;  1QY8 A;  3R91 A;  4HY6 A;  4ZKI A;  4E01 A;  2BYH A;  4MP7 A;  3O0I A;  2CGF A;  4XCL A;  4L91 A;  1YC4 A;  4URO A;  3OWD A;  4BXI A;  2CCT A;  4R3M A;  3U2K A;  3D36 A;  5CTY A;  3LMM A;  3ZKD A;  3G7E A;  2YE6 A;  4AWO A;  3EHH A;  1I5A A;  3ZXO A;  3HYZ A;  4YKQ A;  3G75 A;  2ZBK B;  4QPK A;  3EHJ A;  4DZY A;  4EMV A;  5M4K A;  2VCI A;  1R62 A;  3K98 A;  5BOC A;  1Z5B A;  5M4N A;  3LPS A;  3HZ1 A;  2XJJ A;  4MBC A;  4HY1 A;  1UY8 A;  2Q2E B;  1Y8N A;  1YSR A;  3R4M A;  4K4O A;  4YKZ A;  4MB9 A;  2VW5 A;  5GGZ A;  1UYC A;  2HHI A;  4DUH A;  5D7D A;  4U93 A;  2BU7 A;  2FYP A;  1PVG A;  1Z5C A;  2FXS A;  1UYK A;  1KIJ A;  3R4O A;  4U7O A;  2YEI A;  3PEJ A;  3R4N A;  3VHD A;  1I58 A;  1UY7 A;  2HKJ A;  4MPE A;  3O6O A;  2ZDY A;  5CTU A;  3K99 A;  4KP4 A;  3HEK A;  4WUB A;  3GIF A;  2WI2 A;  4ASG A;  4EGH A;  4O07 A;  2BU5 A;  4JAS A;  1US7 A;  5M4P A;  2XHT A;  4LWF A;  5CTX A;  3H4L A;  1TC6 A;  4XCJ A;  3U67 A;  3BM9 A;  3HZ5 A;  4L8Z A;  4YKT A;  2BU8 A;  1Y4S A;  4MOT A;  2YI7 A;  1F51 A;  3FV5 A;  4XKK A;  2YEE A;  4LPB A;  4XC0 A;  4EFT A;  4EFU A;  2YGE A;  1UYE A;  3K60 A;  5M4H A;  2BRE A;  4CWN A;  1YS3 A;  2HCH A;  4O09 A;  1Y8O A;  4CWO A;  4HXZ A;  3H80 A;  4CWP A;  3ZKB A;  3R92 A;  5L3J A;  2JKI A;  4E00 A;  2XHR A;  4U7N A;  1U2O A;  2YI6 A;  3QDD A;  2BT0 A;  1TIL A;  5FNF A;  2GQP A;  4EGI A;  4KFG A;  2JJC A;  1EI1 A;  2QFO A;  3C11 A;  1ZWH A;  1BGQ A;  3CGZ A;  3QTF A;  4FPP A;  5F5R A;  1AJ6 A;  2XD6 A;  2YI0 A;  2GFD A;  3B27 A;  4QPJ A;  3S5T A;  1GJV A;  2XX4 A;  2YGF A;  3CGY A;  3HHU A;  4BQJ A;  4ZVI A;  4MPC A;  1YT1 A;  4PRX A;  3G7B A;  1TBW A;  1UYM A;  2VCJ A;  1UYL A;  4XIT A;  2YKJ A;  5J6A A;  4BQG A;  4H7Q A;  3RKZ A;  4GQT A;  4WUC A;  5IDJ A;  4YKR A;  2YI5 A;  4LP0 A;  4O0B A;  3B24 A;  4HYM A;  2IWX A;  2XX5 A;  3T0Z A;  5M4M A;  4PRV A;  2O1U A;  1YER A;  2YE8 A;  3B26 A;  4Q20 A;  2BU6 A;  1UY9 A;  4XKA A;  3A0Z A;  2HG1 A;  1I5D A;  1ZXM A;  5D7R A;  3HYY A;  2WI3 A;  4LWG A;  3T2S A;  4HYP A;  3GIG B;  2YEJ A;  2K5B A;  2YKC A;  3OWB A;  2CG9 A;  3DGE A;  1YET A;  1EA6 A;  3ZXQ A;  1MX0 A;  2IOR A;  3OW6 A;  2XJX A;  2XDL A;  4EEH A;  2CH4 A;  3A0W A;  3Q5L A;  4KSG A;  4R1F A;  4O05 A;  3TZ4 A;  3TUH A;  4ASB A;  4BIU A;  1H7S A;  3B25 A;  1MU5 A;  2YGA A;  4BAE A;  1OSF A;  4E72 A;  4MPN A;  1AH8 A;  2VWC A;  2FTK A;  2H55 A;  5CPH A;  4GFN A;  4NH7 A;  5F3K A;  5IN9 A;  4HZ0 A;  2YKB A;  4XE2 A;  4L94 A;  3LNU A;  2YJW A;  4V25 A;  3WHA A;  2YE4 A;  4JAU A;  2YEF A;  3Q5K A;  1NHJ A;  1QYE A;  4XD8 A;  4PU9 A;  3NMQ A;  4GEE A;  3WQ9 A;  3VHA A;  2YEC A;  4GT8 A;  4XTJ A;  1YC1 A;  2WI5 A;  2IWU A;  2WI6 A;  4LWH A;  1YES A;  1KZN A;  2IOQ A;  3OPD A;  4FCQ A;  4W7T A;  2XDK A;  2BRC A;  4EGK A;  2AKP A;  4ASF A;  2CCU A;  2IOP A;  2YK9 A;  4CWS A;  4JQL A;  2YE5 A;  4WUD A;  5C93 A;  5M4E A;  1BYQ A;  3A0Y A;  3FT8 A;  1GKX A;  4XDM A;  3TTZ A;  3OMU A;  1AMW A;  4KQV A;  1I5C A;  2FWY A;  2XDS A;  2ESA A;  3EHF A;  2EXL A;  1B3Q A;  3TZ0 A;  1S14 A;  2WI7 A;  4AWQ A;  3CYG A;  1UYH A;  3VHC A;  3EHG A;  2QG0 A;  3TZ2 A;  2BZ5 A;  1UYF A;  5CTW A;  4EM7 A;  3A0T A;  4X9L A;  4B6C A;  2BSM A;  5FNC A;  4LWE A;  2YE7 A;  2WI1 A;  1BXD A;  1TC0 A;  2C2A A;  4B7P A;  4CE1 A;  1B63 A;  1TH8 A;  3RLQ A;  5D7C A;  4URM A;  3RLP A;  2XDX A;  2XDU A;  4BIZ A;  4CE2 A;  3A0X A;  4ASA A;  3VAD A;  5J71 A;  2BYI A;  2XHX A;  4P8O A;  2O1W A;  4HZ5 A;  1YSZ A;  3SL2 A;  2FWZ A;  2WEQ A;  3CWV A;  4YKX A;  1ZXN A;  1I59 A;  3INX A;  2YE3 A;  3KE6 A;  5BOD A;  2QG2 A;  2XCM A;  4PL9 A;  2YEH A;  3ZM7 A;  2YEB A;  3B28 A;  3BMY A;  4XIR A;  5FND A;  4KTN A;  4YKW A; 
#chains in the Genus database with same CATH homology
 1YT0 A;  2WEP A;  2XX2 A;  3R4P A;  3GIE A;  2YEA A;  1QZR A;  1H7U A;  1NHI A;  3Q5J A;  2YKE A;  1UYI A;  1YC3 A;  3FT5 A;  4P7A A;  1THN A;  1Y8P A;  2ZKJ A;  2CCS A;  2YJX A;  3CRL A;  3D0B A;  4AS9 A;  3INW A;  4XKO A;  3T0H A;  3O2F A;  5CF0 A;  4CE3 A;  1U0Z A;  1YT2 A;  3TZ5 A;  2XAB A;  1I5B A;  3IED A;  2YED A;  1JM6 A;  2BU2 A;  4O04 A;  1L0O A;  4FCR A;  2YK2 A;  1UY6 A;  4JAV A;  4CWT A;  2Q8H A;  3K97 A;  2WI4 A;  4L93 A;  2YE9 A;  3T1K A;  4I3H A;  2XK2 A;  1A4H A;  2YE2 A;  2YKI A;  4L90 A;  4KSH A;  4MP2 A;  3PEH A;  4XIP A;  4URN A;  2Q8F A;  4E02 A;  1BKN A;  1TID A;  4NH9 A;  2E0A A;  3RLR A;  1NHH A;  3EKR A;  4CWR A;  1Y4U A;  4CWF A;  2BTZ A;  4FMT A;  5IDM A;  1AM1 A;  4HXW A;  3T10 A;  3GIG A;  2WER A;  3U2D A;  4R3A A;  2PNR A;  3EKO A;  4GCZ A;  4LWI A;  2ZDX A;  2YEG A;  2IWS A;  1AH6 A;  4NH8 A;  3CRK A;  2O1V A;  1ZW9 A;  1Z59 A;  4H85 A;  4H81 A;  4URL A;  2XJG A;  4FCP A;  2Q8I A;  5FWK A;  4AWP A;  2Q8G A;  5D6P A;  3C0E A;  3D2R A;  2QF6 A;  1B62 A;  2H8M A;  3JZ3 A;  1UYG A;  4GGL A;  3MNR P;  4YKU A;  3A0R A;  4I5S A;  1GKZ A;  1Z5A A;  4CWQ A;  1ID0 A;  1UYD A;  4V26 A;  4YKY A;  5D6Q A;  2UWD A;  1S16 A;  4XIQ A;  1QY8 A;  3R91 A;  4HY6 A;  4ZKI A;  4E01 A;  2BYH A;  4MP7 A;  3O0I A;  2CGF A;  4XCL A;  4L91 A;  1YC4 A;  4URO A;  3OWD A;  4BXI A;  2CCT A;  4R3M A;  3U2K A;  3D36 A;  5CTY A;  3ZKD A;  3G7E A;  2YE6 A;  4AWO A;  3EHH A;  1I5A A;  3ZXO A;  3HYZ A;  4YKQ A;  3G75 A;  2ZBK B;  4QPK A;  3EHJ A;  4DZY A;  4EMV A;  5M4K A;  2VCI A;  1R62 A;  3K98 A;  5BOC A;  1Z5B A;  5M4N A;  3LPS A;  3HZ1 A;  2XJJ A;  4MBC A;  4HY1 A;  1UY8 A;  2Q2E B;  1Y8N A;  1YSR A;  3R4M A;  4K4O A;  4YKZ A;  4MB9 A;  2VW5 A;  5GGZ A;  1UYC A;  4DUH A;  5D7D A;  4U93 A;  2BU7 A;  2FYP A;  1PVG A;  1Z5C A;  2FXS A;  1UYK A;  1KIJ A;  3R4O A;  4U7O A;  2YEI A;  3PEJ A;  3R4N A;  3VHD A;  1I58 A;  1UY7 A;  2HKJ A;  4MPE A;  3O6O A;  2ZDY A;  5CTU A;  3K99 A;  4KP4 A;  3HEK A;  4WUB A;  3GIF A;  2WI2 A;  4ASG A;  4EGH A;  4O07 A;  2BU5 A;  4JAS A;  1US7 A;  5M4P A;  2XHT A;  4LWF A;  5CTX A;  3H4L A;  1TC6 A;  4XCJ A;  3U67 A;  3BM9 A;  3HZ5 A;  4L8Z A;  4YKT A;  2BU8 A;  1Y4S A;  4MOT A;  2YI7 A;  3FV5 A;  4XKK A;  2YEE A;  4LPB A;  4XC0 A;  4EFT A;  4EFU A;  2YGE A;  1UYE A;  3K60 A;  5M4H A;  2BRE A;  4CWN A;  1YS3 A;  2HCH A;  4O09 A;  1Y8O A;  4CWO A;  4HXZ A;  3H80 A;  4CWP A;  3ZKB A;  3R92 A;  5L3J A;  2JKI A;  4E00 A;  2XHR A;  4U7N A;  1U2O A;  2YI6 A;  3QDD A;  2BT0 A;  1TIL A;  5FNF A;  2GQP A;  4EGI A;  4KFG A;  2JJC A;  1EI1 A;  2QFO A;  3C11 A;  1ZWH A;  1BGQ A;  4FPP A;  3CGZ A;  3QTF A;  5F5R A;  1AJ6 A;  2XD6 A;  2YI0 A;  2GFD A;  3B27 A;  4QPJ A;  1GJV A;  2XX4 A;  2YGF A;  3CGY A;  3HHU A;  4BQJ A;  4ZVI A;  4MPC A;  1YT1 A;  4PRX A;  3G7B A;  1TBW A;  1UYM A;  2VCJ A;  1UYL A;  4XIT A;  2YKJ A;  5J6A A;  4BQG A;  4H7Q A;  3RKZ A;  4GQT A;  4WUC A;  5IDJ A;  4YKR A;  2YI5 A;  4LP0 A;  4O0B A;  3B24 A;  4HYM A;  2IWX A;  2XX5 A;  3T0Z A;  5M4M A;  4PRV A;  2O1U A;  1YER A;  2YE8 A;  3B26 A;  4Q20 A;  2BU6 A;  1UY9 A;  4XKA A;  3A0Z A;  2HG1 A;  1I5D A;  1ZXM A;  5D7R A;  3HYY A;  2WI3 A;  4LWG A;  3T2S A;  4HYP A;  3GIG B;  2YEJ A;  2K5B A;  2YKC A;  3OWB A;  2CG9 A;  3DGE A;  1YET A;  1EA6 A;  3ZXQ A;  1MX0 A;  2IOR A;  3OW6 A;  2XJX A;  2XDL A;  4EEH A;  2CH4 A;  3A0W A;  3Q5L A;  4KSG A;  4R1F A;  4O05 A;  3TZ4 A;  3TUH A;  4ASB A;  4BIU A;  1H7S A;  3B25 A;  1MU5 A;  2YGA A;  4BAE A;  1OSF A;  4MPN A;  1AH8 A;  2VWC A;  2H55 A;  5CPH A;  4GFN A;  4NH7 A;  5F3K A;  5IN9 A;  4HZ0 A;  2YKB A;  4XE2 A;  4L94 A;  3LNU A;  2YJW A;  4V25 A;  3WHA A;  2YE4 A;  4JAU A;  2YEF A;  3Q5K A;  1NHJ A;  1QYE A;  4XD8 A;  4PU9 A;  3NMQ A;  4GEE A;  3WQ9 A;  3VHA A;  2YEC A;  4GT8 A;  4XTJ A;  1YC1 A;  2WI5 A;  2IWU A;  2WI6 A;  4LWH A;  1YES A;  1KZN A;  2IOQ A;  3OPD A;  4FCQ A;  4W7T A;  2XDK A;  2BRC A;  4EGK A;  2AKP A;  4ASF A;  2CCU A;  2IOP A;  2YK9 A;  4CWS A;  4JQL A;  2YE5 A;  4WUD A;  5C93 A;  5M4E A;  1BYQ A;  3A0Y A;  3FT8 A;  1GKX A;  4XDM A;  3TTZ A;  3OMU A;  1AMW A;  4KQV A;  1I5C A;  2FWY A;  2XDS A;  2ESA A;  3EHF A;  2EXL A;  1B3Q A;  3TZ0 A;  1S14 A;  2WI7 A;  4AWQ A;  3VHC A;  1UYH A;  3EHG A;  2QG0 A;  3TZ2 A;  2BZ5 A;  1UYF A;  5CTW A;  4EM7 A;  3A0T A;  4X9L A;  4B6C A;  2BSM A;  5FNC A;  4LWE A;  2YE7 A;  2WI1 A;  1BXD A;  1TC0 A;  2C2A A;  4B7P A;  4CE1 A;  1B63 A;  1TH8 A;  3RLQ A;  5D7C A;  4URM A;  3RLP A;  2XDX A;  2XDU A;  4BIZ A;  4CE2 A;  3A0X A;  4ASA A;  3VAD A;  5J71 A;  2BYI A;  2XHX A;  4P8O A;  2O1W A;  4HZ5 A;  1YSZ A;  3SL2 A;  2FWZ A;  2WEQ A;  3CWV A;  4YKX A;  1ZXN A;  1I59 A;  3INX A;  2YE3 A;  3KE6 A;  5BOD A;  2QG2 A;  2XCM A;  4PL9 A;  2YEH A;  3ZM7 A;  2YEB A;  3B28 A;  3BMY A;  4XIR A;  5FND A;  4KTN A;  4YKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...