5IN9A

Crystal structure of grp94 bound to methyl 3-chloro-2-(2-(1-((5-chlorofuran-2-yl)methyl)-1h-imidazol-2-yl)ethyl)-4,6-dihydroxybenzoate, an inhibitor based on the bnim and radamide scaffolds.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
217
Chain Sequence
EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEASTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/inhibitor
molecule keywords Endoplasmin
publication title Development of Glucose Regulated Protein 94-Selective Inhibitors Based on the BnIm and Radamide Scaffold.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 67
structure length 217
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5in9A00
2YJWA 4I5SA 4YKWA 4EGIA 3OWDA 4XKOA 1U2OA 4HYPA 4AWOA 4H7QA 4O05A 4CWNA 3RLPA 2WI3A 1UY8A 1NHIA 3OMUA 4X9LA 2H55A 1YC1A 2JKIA 2FWZA 1I58A 1ZWHA 4BQJA 4GGLA 2YKJA 2VW5A 4CE3A 4AWPA 3CGYA 2H8MA 4K4OA 4ASAA 1UYFA 2XX5A 5BODA 2YI0A 5M4EA 1GKXA 4CE1A 2PNRA 5J6AA 4E01A 3B24A 3MNRP 2QG0A 2Q2EB 2K5BA 5CTUA 5M4PA 3T0HA 2XX4A 1JM6A 3A0ZA 1QY8A 4BIUA 3CWVA 4JQLA 2IWSA 3CGZA 3HEKA 2XDXA 3C11A 3HHUA 2XABA 4GFNA 3CRKA 4CWPA 4QPKA 2YE3A 3G7BA 4KQVA 2Q8FA 2BU7A 2CCTA 4JAUA 5CTYA 1YS3A 5FNDA 4LWHA 1EA6A 1ZXNA 4XIPA 3T10A 4HZ5A 4EGKA 3U2KA 3T1KA 2XHRA 4AWQA 4R3MA 4YKTA 2BYIA 2HKJA 2VCJA 3A0YA 3R92A 2XDKA 4LPBA 3G75A 4PL9A 4YKXA 5FNCA 2WI1A 4H81A 2YEFA 1I5BA 2CCUA 1Y8NA 2XJJA 2VCIA 2YE4A 2XDLA 5C93A 3EKRA 4WUBA 4FPPA 3B28A 3H80A 3EKOA 5D7RA 1I5CA 3VHDA 3B27A 3QDDA 4GT8A 4P8OA 4LWIA 1L0OA 4BIZA 1TH8A 1TBWA 3CRLA 3D36A 3GIEA 2WI4A 2XD6A 5M4MA 3LNUA 1S16A 1UY6A 4O04A 4Q20A 4ZVIA 2FYPA 4O09A 2YJXA 3ZM7A 2YE2A 1H7SA 2JJCA 1YT2A 5CPHA 5CTXA 2YKEA 4FCPA 4LP0A 4XCLA 4LWGA 4XKAA 2ZBKB 1YETA 2YEEA 3Q5JA 3DGEA 1Z59A 2YKCA 2CGFA 4JAVA 1UYEA 2E0AA 1GKZA 5IDJA 1I5DA 1UY9A 4CWRA 3RLRA 1YSRA 1R62A 4B6CA 2YEHA 3Q5KA 4YKYA 3EHJA 4BQGA 3T2SA 2CH4A 1KZNA 4I3HA 4DUHA 4L93A 4KSHA 1UY7A 1TC0A 1ZW9A 2YKBA 3H4LA 5CTWA 2YI6A 2BRCA 2FXSA 2O1UA 3KE6A 1UYKA 4YKRA 3R91A 1ID0A 3EHGA 3D0BA 3TTZA 3ZXQA 5F3KA 3R4MA 4GEEA 1OSFA 1AH6A 2WEQA 3GIGB 3VHCA 1YT0A 1QYEA 3HYYA 4HXWA 2YGFA 4NH7A 2YKIA 4WUDA 3PEHA 4KTNA 4KSGA 2FWYA 4U7NA 3RLQA 2IOQA 1TILA 3G7EA 2YEBA 4QPJA 5FWKA 2AKPA 2YE5A 2YECA 4MP2A 4FMTA 4L90A 1BGQA 4XCJA 4HZ0A 5IN9A 3OW6A 3C0EA 4XE2A 4B7PA 1YC3A 5J71A 2CCSA 4P7AA 3A0TA 3U2DA 2BU5A 2HG1A 2YEIA 1TIDA 3VADA 4R3AA 1NHJA 1Z5CA 1PVGA 2XK2A 5CF0A 1I59A 3INXA 3VHAA 2XHXA 3A0WA 2QF6A 2QFOA 1Z5BA 4KFGA 3TZ0A 1AM1A 2YE7A 4BAEA 2GFDA 2EXLA 4CWOA 2YE9A 5GGZA 4YKUA 1B3QA 3TZ5A 3K99A 4U93A 3K97A 3PEJA 2O1VA 4H85A 4PRXA 4CWQA 3WHAA 1Y8PA 3TZ2A 1I5AA 4HY6A 1KIJA 3TZ4A 3R4OA 3R4PA 4MPEA 4ASFA 2Q8IA 2BTZA 1UYHA 4UROA 3NMQA 4XC0A 4ASGA 4JASA 5D7CA 5D7DA 3HZ5A 4WUCA 3EHFA 2O1WA 3QTFA 3IEDA 4URMA 1EI1A 1BXDA 1UYIA 2BU6A 3R4NA 1NHHA 3A0RA 4EEHA 1UYLA 1Y4SA 3K98A 4O0BA 1S14A 4XIRA 1YT1A 3BM9A 1BKNA 1UYGA 4MBCA 2IOPA 4V25A 5M4NA 4EM7A 4HY1A 4PU9A 4XD8A 4MB9A 4U7OA 2XDUA 4E00A 4L8ZA 2WI2A 3O2FA 3LPSA 1YC4A 2C2AA 2YGAA 2ZDYA 4LWFA 2UWDA 3INWA 4CWSA 4PRVA 3B26A 4NH9A 3GIGA 3RKZA 4CWTA 2BZ5A 3D2RA 4MPNA 2WEPA 3ZKDA 4CWFA 3FT5A 5D6QA 4R1FA 3O0IA 2WI5A 2WI6A 1B63A 1YSZA 1UYDA 4O07A 1Y4UA 1GJVA 3B25A 2XDSA 4HXZA 4KP4A 5BOCA 3JZ3A 2WI7A 4MOTA 2WERA 4LWEA 4FCRA 4EGHA 4HYMA 1AH8A 4YKQA 3ZKBA 3ZXOA 4FCQA 2YE8A 3FV5A 1QZRA 3T0ZA 2YE6A 1THNA 4DZYA 2XCMA 4YKZA 4EFUA 1BYQA 3HZ1A 2BSMA 4EFTA 2BREA 2VWCA 4AS9A 1H7UA 4URNA 1YESA 3EHHA 2Q8HA 2YI5A 2HCHA 2ZKJA 4XKKA 1AMWA 4L91A 1MX0A 2YGEA 2BU2A 5IDMA 4XDMA 3OWBA 3WQ9A 1UYMA 5FNFA 4NH8A 1ZXMA 4XTJA 5F5RA 4EMVA 1UYCA 4XIQA 2YK9A 2BYHA 5M4KA 3HYZA 4E02A 2CG9A 2YI7A 4L94A 2XJXA 2ZDXA 3U67A 3A0XA 5M4HA 1MU5A 2GQPA 1US7A 2BU8A 2YEJA 3O6OA 4GCZA 4CE2A 1Y8OA 4ZKIA 3GIFA 1AJ6A 4W7TA 1A4HA 2YEGA 4ASBA 1TC6A 2XHTA 2IORA 2BT0A 3FT8A 5L3JA 2IWUA 2QG2A 2YK2A 5D6PA 4XITA 2Q8GA 1B62A 2YEAA 2XJGA 2ESAA 2YEDA 3Q5LA 3SL2A 4MPCA 4MP7A 1U0ZA 3K60A 2IWXA 4V26A 1YERA 2XX2A 1Z5AA 3TUHA 4URLA 4GQTA 3BMYA 4BXIA 3OPDA
chains in the Genus database with same CATH superfamily
2YJWA 4I5SA 4YKWA 4EGIA 3OWDA 1IXMA 4XKOA 1U2OA 4HYPA 4AWOA 4H7QA 4O05A 4CWNA 3RLPA 2WI3A 1UY8A 1NHIA 3OMUA 4X9LA 1F51A 2H55A 1YC1A 2JKIA 2FWZA 1I58A 1ZWHA 4BQJA 4GGLA 2YKJA 2VW5A 4CE3A 4AWPA 3CGYA 2H8MA 4K4OA 4ASAA 1UYFA 2XX5A 5BODA 2YI0A 5M4EA 1GKXA 4CE1A 2PNRA 5J6AA 4E01A 3B24A 3MNRP 2QG0A 2Q2EB 2K5BA 5CTUA 5M4PA 3T0HA 2XX4A 3CYGA 1JM6A 3A0ZA 1QY8A 4BIUA 3CWVA 4JQLA 2IWSA 3CGZA 3HEKA 2XDXA 3C11A 3HHUA 2XABA 4GFNA 3CRKA 4CWPA 4QPKA 2YE3A 3G7BA 4KQVA 2Q8FA 2BU7A 2CCTA 4JAUA 5CTYA 1YS3A 5FNDA 4LWHA 1EA6A 1ZXNA 2FTKA 4XIPA 3T10A 4HZ5A 4EGKA 3U2KA 3T1KA 2XHRA 4AWQA 4R3MA 4YKTA 2BYIA 2HKJA 2VCJA 3A0YA 3R92A 2XDKA 4LPBA 3G75A 4PL9A 4YKXA 5FNCA 2WI1A 4H81A 2YEFA 1I5BA 2CCUA 1Y8NA 2XJJA 2VCIA 2YE4A 2XDLA 5C93A 3EKRA 4WUBA 4FPPA 3B28A 3H80A 3EKOA 5D7RA 1I5CA 3VHDA 3B27A 3QDDA 4GT8A 4P8OA 4LWIA 1L0OA 4BIZA 1TH8A 1TBWA 3CRLA 3D36A 3GIEA 2WI4A 2XD6A 5M4MA 3LNUA 1S16A 1UY6A 4O04A 4Q20A 4ZVIA 2FYPA 4O09A 2YJXA 3ZM7A 2YE2A 1H7SA 2JJCA 1YT2A 5CPHA 5CTXA 2YKEA 4FCPA 4LP0A 4XCLA 4LWGA 4XKAA 2ZBKB 1YETA 2YEEA 3Q5JA 3DGEA 1Z59A 2YKCA 2CGFA 4JAVA 1UYEA 2E0AA 1GKZA 5IDJA 1I5DA 1UY9A 4CWRA 3RLRA 1YSRA 2C1GA 1R62A 4B6CA 2YEHA 3Q5KA 4YKYA 3EHJA 4BQGA 3T2SA 2CH4A 1KZNA 4I3HA 4DUHA 4L93A 4KSHA 1UY7A 1TC0A 1ZW9A 2YKBA 3H4LA 5CTWA 2YI6A 2BRCA 2FXSA 2O1UA 3KE6A 1UYKA 4YKRA 3R91A 1ID0A 3EHGA 3D0BA 3TTZA 3ZXQA 5F3KA 3R4MA 1OSFA 3GIGB 1AH6A 2WEQA 4GEEA 3VHCA 1YT0A 3LMMA 1QYEA 3HYYA 4HXWA 2YGFA 4NH7A 2YKIA 4WUDA 3PEHA 4KTNA 4KSGA 2FWYA 4U7NA 3RLQA 2IOQA 1TILA 3G7EA 2YEBA 4QPJA 5FWKA 2AKPA 2YE5A 2YECA 4MP2A 4FMTA 4L90A 1BGQA 4XCJA 4HZ0A 5IN9A 3OW6A 3C0EA 4XE2A 4B7PA 1YC3A 5J71A 2CCSA 4P7AA 3A0TA 3U2DA 2BU5A 2HG1A 2YEIA 1TIDA 3VADA 4R3AA 1NHJA 1Z5CA 1PVGA 2XK2A 5CF0A 1I59A 3INXA 3VHAA 2XHXA 3A0WA 2QF6A 2QFOA 1Z5BA 4KFGA 3TZ0A 1AM1A 2YE7A 4BAEA 2GFDA 2EXLA 4CWOA 2YE9A 5GGZA 4YKUA 1B3QA 3TZ5A 3K99A 4U93A 3K97A 3PEJA 2O1VA 4H85A 4PRXA 4CWQA 3WHAA 1Y8PA 3TZ2A 1I5AA 4HY6A 1KIJA 3TZ4A 3R4OA 3R4PA 4MPEA 4ASFA 2Q8IA 2HHIA 2BTZA 1UYHA 4UROA 3NMQA 4XC0A 4ASGA 4JASA 5D7CA 5D7DA 3HZ5A 4WUCA 3EHFA 2O1WA 3QTFA 3IEDA 4URMA 1EI1A 1BXDA 1UYIA 2BU6A 3R4NA 1NHHA 3A0RA 4EEHA 1UYLA 1Y4SA 3K98A 4O0BA 1S14A 4XIRA 1YT1A 3BM9A 1BKNA 1UYGA 4MBCA 2IOPA 4V25A 5M4NA 4EM7A 4HY1A 4PU9A 4XD8A 4MB9A 4U7OA 2XDUA 4E00A 4L8ZA 2WI2A 3O2FA 3LPSA 1YC4A 2C2AA 2YGAA 2ZDYA 4LWFA 2UWDA 3INWA 4CWSA 4PRVA 3B26A 4NH9A 3GIGA 3RKZA 4CWTA 2BZ5A 3D2RA 4MPNA 2WEPA 3ZKDA 4CWFA 2C1IA 3FT5A 5D6QA 4R1FA 3O0IA 2WI5A 2WI6A 1B63A 1YSZA 1UYDA 4O07A 1Y4UA 1GJVA 3B25A 2XDSA 4HXZA 4KP4A 4E72A 5BOCA 3JZ3A 2WI7A 4MOTA 2WERA 4LWEA 4FCRA 4EGHA 4HYMA 1AH8A 4YKQA 3ZKBA 3ZXOA 4FCQA 2YE8A 3FV5A 1QZRA 3T0ZA 2YE6A 5JENA 1THNA 4DZYA 2XCMA 4YKZA 4EFUA 1BYQA 3HZ1A 2BSMA 4EFTA 2BREA 2VWCA 4AS9A 1H7UA 4URNA 1YESA 3EHHA 2Q8HA 2YI5A 2HCHA 2ZKJA 4XKKA 1AMWA 4L91A 1MX0A 2YGEA 2BU2A 5IDMA 3S5TA 4XDMA 3OWBA 3WQ9A 1UYMA 5FNFA 4NH8A 1ZXMA 4XTJA 5F5RA 4EMVA 1UYCA 4XIQA 2YK9A 2BYHA 5M4KA 3HYZA 4E02A 2CG9A 2YI7A 4L94A 2XJXA 2ZDXA 3U67A 3A0XA 5M4HA 1MU5A 2GQPA 1US7A 2BU8A 2YEJA 3O6OA 4GCZA 4CE2A 1Y8OA 4ZKIA 3GIFA 1AJ6A 4W7TA 1A4HA 2YEGA 4ASBA 1TC6A 2XHTA 2IORA 2BT0A 3FT8A 5L3JA 2IWUA 2QG2A 2YK2A 5D6PA 4XITA 2Q8GA 1B62A 2YEAA 2XJGA 2ESAA 2YEDA 3Q5LA 3SL2A 4MPCA 4MP7A 1U0ZA 3K60A 2IWXA 4V26A 1YERA 2XX2A 1Z5AA 3TUHA 4URLA 4GQTA 3BMYA 4BXIA 3OPDA
chains in the Genus database with same CATH topology
2YJWA 4I5SA 4YKWA 4EGIA 3OWDA 4XKOA 1U2OA 4HYPA 4AWOA 4H7QA 4O05A 4CWNA 3RLPA 2WI3A 1UY8A 1NHIA 3OMUA 4X9LA 2H55A 1YC1A 2JKIA 2FWZA 1I58A 1ZWHA 4BQJA 4GGLA 2YKJA 2VW5A 4CE3A 4AWPA 3CGYA 2H8MA 4K4OA 4ASAA 1UYFA 2XX5A 5BODA 2YI0A 5M4EA 1GKXA 4CE1A 2PNRA 5J6AA 4E01A 3B24A 3MNRP 2QG0A 2Q2EB 2K5BA 5CTUA 5M4PA 3T0HA 2XX4A 1JM6A 3A0ZA 1QY8A 4BIUA 3CWVA 4JQLA 2IWSA 3CGZA 3HEKA 2XDXA 3C11A 3HHUA 2XABA 4GFNA 3CRKA 4CWPA 4QPKA 2YE3A 3G7BA 4KQVA 2Q8FA 2BU7A 2CCTA 4JAUA 5CTYA 1YS3A 5FNDA 4LWHA 1EA6A 1ZXNA 4XIPA 3T10A 4HZ5A 4EGKA 3U2KA 3T1KA 2XHRA 4AWQA 4R3MA 4YKTA 2BYIA 2HKJA 2VCJA 3A0YA 3R92A 2XDKA 4LPBA 3G75A 4PL9A 4YKXA 5FNCA 2WI1A 4H81A 2YEFA 1I5BA 2CCUA 1Y8NA 2XJJA 2VCIA 2YE4A 2XDLA 5C93A 3EKRA 4WUBA 4FPPA 3B28A 3H80A 3EKOA 5D7RA 1I5CA 3VHDA 3B27A 3QDDA 4GT8A 4P8OA 4LWIA 1L0OA 4BIZA 1TH8A 1TBWA 3CRLA 3D36A 3GIEA 2WI4A 2XD6A 5M4MA 3LNUA 1S16A 1UY6A 4O04A 4Q20A 4ZVIA 2FYPA 4O09A 2YJXA 3ZM7A 2YE2A 1H7SA 2JJCA 1YT2A 5CPHA 5CTXA 2YKEA 4FCPA 4LP0A 4XCLA 4LWGA 4XKAA 2ZBKB 1YETA 2YEEA 3Q5JA 3DGEA 1Z59A 2YKCA 2CGFA 4JAVA 1UYEA 2E0AA 1GKZA 5IDJA 1I5DA 1UY9A 4CWRA 3RLRA 1YSRA 1R62A 4B6CA 2YEHA 3Q5KA 4YKYA 3EHJA 4BQGA 3T2SA 2CH4A 1KZNA 4I3HA 4DUHA 4L93A 4KSHA 1UY7A 1TC0A 1ZW9A 2YKBA 3H4LA 5CTWA 2YI6A 2BRCA 2FXSA 2O1UA 3KE6A 1UYKA 4YKRA 3R91A 1ID0A 3EHGA 3D0BA 3TTZA 3ZXQA 5F3KA 3R4MA 4GEEA 1OSFA 1AH6A 2WEQA 3GIGB 3VHCA 1YT0A 1QYEA 3HYYA 4HXWA 2YGFA 4NH7A 2YKIA 4WUDA 3PEHA 4KTNA 4KSGA 2FWYA 4U7NA 3RLQA 2IOQA 1TILA 3G7EA 2YEBA 4QPJA 5FWKA 2AKPA 2YE5A 2YECA 4MP2A 4FMTA 4L90A 1BGQA 4XCJA 4HZ0A 5IN9A 3OW6A 3C0EA 4XE2A 4B7PA 1YC3A 5J71A 2CCSA 4P7AA 3A0TA 3U2DA 2BU5A 2HG1A 2YEIA 1TIDA 3VADA 4R3AA 1NHJA 1Z5CA 1PVGA 2XK2A 5CF0A 1I59A 3INXA 3VHAA 2XHXA 3A0WA 2QF6A 2QFOA 1Z5BA 4KFGA 3TZ0A 1AM1A 2YE7A 4BAEA 2GFDA 2EXLA 4CWOA 2YE9A 5GGZA 4YKUA 1B3QA 3TZ5A 3K99A 4U93A 3K97A 3PEJA 2O1VA 4H85A 4PRXA 4CWQA 3WHAA 1Y8PA 3TZ2A 1I5AA 4HY6A 1KIJA 3TZ4A 3R4OA 3R4PA 4MPEA 4ASFA 2Q8IA 2BTZA 1UYHA 4UROA 3NMQA 4XC0A 4ASGA 4JASA 5D7CA 5D7DA 3HZ5A 4WUCA 3EHFA 2O1WA 3QTFA 3IEDA 4URMA 1EI1A 1BXDA 1UYIA 2BU6A 3R4NA 1NHHA 3A0RA 4EEHA 1UYLA 1Y4SA 3K98A 4O0BA 1S14A 4XIRA 1YT1A 3BM9A 1BKNA 1UYGA 4MBCA 2IOPA 4V25A 5M4NA 4EM7A 4HY1A 4PU9A 4XD8A 4MB9A 4U7OA 2XDUA 4E00A 4L8ZA 2WI2A 3O2FA 3LPSA 1YC4A 2C2AA 2YGAA 2ZDYA 4LWFA 2UWDA 3INWA 4CWSA 4PRVA 3B26A 4NH9A 3GIGA 3RKZA 4CWTA 2BZ5A 3D2RA 4MPNA 2WEPA 3ZKDA 4CWFA 3FT5A 5D6QA 4R1FA 3O0IA 2WI5A 2WI6A 1B63A 1YSZA 1UYDA 4O07A 1Y4UA 1GJVA 3B25A 2XDSA 4HXZA 4KP4A 5BOCA 3JZ3A 2WI7A 4MOTA 2WERA 4LWEA 4FCRA 4EGHA 4HYMA 1AH8A 4YKQA 3ZKBA 3ZXOA 4FCQA 2YE8A 3FV5A 1QZRA 3T0ZA 2YE6A 1THNA 4DZYA 2XCMA 4YKZA 4EFUA 1BYQA 3HZ1A 2BSMA 4EFTA 2BREA 2VWCA 4AS9A 1H7UA 4URNA 1YESA 3EHHA 2Q8HA 2YI5A 2HCHA 2ZKJA 4XKKA 1AMWA 4L91A 1MX0A 2YGEA 2BU2A 5IDMA 4XDMA 3OWBA 3WQ9A 1UYMA 5FNFA 4NH8A 1ZXMA 4XTJA 5F5RA 4EMVA 1UYCA 4XIQA 2YK9A 2BYHA 5M4KA 3HYZA 4E02A 2CG9A 2YI7A 4L94A 2XJXA 2ZDXA 3U67A 3A0XA 5M4HA 1MU5A 2GQPA 1US7A 2BU8A 2YEJA 3O6OA 4GCZA 4CE2A 1Y8OA 4ZKIA 3GIFA 1AJ6A 4W7TA 1A4HA 2YEGA 4ASBA 1TC6A 2XHTA 2IORA 2BT0A 3FT8A 5L3JA 2IWUA 2QG2A 2YK2A 5D6PA 4XITA 2Q8GA 1B62A 2YEAA 2XJGA 2ESAA 2YEDA 3Q5LA 3SL2A 4MPCA 4MP7A 1U0ZA 3K60A 2IWXA 4V26A 1YERA 2XX2A 1Z5AA 3TUHA 4URLA 4GQTA 3BMYA 4BXIA 3OPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJW A;  4I5S A;  4YKW A;  4EGI A;  3OWD A;  4XKO A;  1U2O A;  4HYP A;  4AWO A;  4H7Q A;  4O05 A;  4CWN A;  3RLP A;  2WI3 A;  1UY8 A;  1NHI A;  3OMU A;  4X9L A;  2H55 A;  1YC1 A;  2JKI A;  2FWZ A;  1I58 A;  1ZWH A;  4BQJ A;  4GGL A;  2YKJ A;  2VW5 A;  4CE3 A;  4AWP A;  3CGY A;  2H8M A;  4K4O A;  4ASA A;  1UYF A;  2XX5 A;  5BOD A;  2YI0 A;  5M4E A;  1GKX A;  4CE1 A;  2PNR A;  5J6A A;  4E01 A;  3B24 A;  3MNR P;  2QG0 A;  2Q2E B;  2K5B A;  5CTU A;  5M4P A;  3T0H A;  2XX4 A;  1JM6 A;  3A0Z A;  1QY8 A;  4BIU A;  3CWV A;  4JQL A;  2IWS A;  3CGZ A;  3HEK A;  2XDX A;  3C11 A;  3HHU A;  2XAB A;  4GFN A;  3CRK A;  4CWP A;  4QPK A;  2YE3 A;  3G7B A;  4KQV A;  2Q8F A;  2BU7 A;  2CCT A;  4JAU A;  5CTY A;  1YS3 A;  5FND A;  4LWH A;  1EA6 A;  1ZXN A;  4XIP A;  3T10 A;  4HZ5 A;  4EGK A;  3U2K A;  3T1K A;  2XHR A;  4AWQ A;  4R3M A;  4YKT A;  2BYI A;  2HKJ A;  2VCJ A;  3A0Y A;  3R92 A;  2XDK A;  4LPB A;  3G75 A;  4PL9 A;  4YKX A;  5FNC A;  2WI1 A;  4H81 A;  2YEF A;  1I5B A;  2CCU A;  1Y8N A;  2XJJ A;  2VCI A;  2YE4 A;  2XDL A;  5C93 A;  3EKR A;  4WUB A;  4FPP A;  3B28 A;  3H80 A;  3EKO A;  5D7R A;  1I5C A;  3VHD A;  3B27 A;  3QDD A;  4GT8 A;  4P8O A;  4LWI A;  1L0O A;  4BIZ A;  1TH8 A;  1TBW A;  3CRL A;  3D36 A;  3GIE A;  2WI4 A;  2XD6 A;  5M4M A;  3LNU A;  1S16 A;  1UY6 A;  4O04 A;  4Q20 A;  4ZVI A;  2FYP A;  4O09 A;  2YJX A;  3ZM7 A;  2YE2 A;  1H7S A;  2JJC A;  1YT2 A;  5CPH A;  5CTX A;  2YKE A;  4FCP A;  4LP0 A;  4XCL A;  4LWG A;  4XKA A;  2ZBK B;  1YET A;  2YEE A;  3Q5J A;  3DGE A;  1Z59 A;  2YKC A;  2CGF A;  4JAV A;  1UYE A;  2E0A A;  1GKZ A;  5IDJ A;  1I5D A;  1UY9 A;  4CWR A;  3RLR A;  1YSR A;  1R62 A;  4B6C A;  2YEH A;  3Q5K A;  4YKY A;  3EHJ A;  4BQG A;  3T2S A;  2CH4 A;  1KZN A;  4I3H A;  4DUH A;  4L93 A;  4KSH A;  1UY7 A;  1TC0 A;  1ZW9 A;  2YKB A;  3H4L A;  5CTW A;  2YI6 A;  2BRC A;  2FXS A;  2O1U A;  3KE6 A;  1UYK A;  4YKR A;  3R91 A;  1ID0 A;  3EHG A;  3D0B A;  3TTZ A;  3ZXQ A;  5F3K A;  3R4M A;  4GEE A;  1OSF A;  1AH6 A;  2WEQ A;  3GIG B;  3VHC A;  1YT0 A;  1QYE A;  3HYY A;  4HXW A;  2YGF A;  4NH7 A;  2YKI A;  4WUD A;  3PEH A;  4KTN A;  4KSG A;  2FWY A;  4U7N A;  3RLQ A;  2IOQ A;  1TIL A;  3G7E A;  2YEB A;  4QPJ A;  5FWK A;  2AKP A;  2YE5 A;  2YEC A;  4MP2 A;  4FMT A;  4L90 A;  1BGQ A;  4XCJ A;  4HZ0 A;  5IN9 A;  3OW6 A;  3C0E A;  4XE2 A;  4B7P A;  1YC3 A;  5J71 A;  2CCS A;  4P7A A;  3A0T A;  3U2D A;  2BU5 A;  2HG1 A;  2YEI A;  1TID A;  3VAD A;  4R3A A;  1NHJ A;  1Z5C A;  1PVG A;  2XK2 A;  5CF0 A;  1I59 A;  3INX A;  3VHA A;  2XHX A;  3A0W A;  2QF6 A;  2QFO A;  1Z5B A;  4KFG A;  3TZ0 A;  1AM1 A;  2YE7 A;  4BAE A;  2GFD A;  2EXL A;  4CWO A;  2YE9 A;  5GGZ A;  4YKU A;  1B3Q A;  3TZ5 A;  3K99 A;  4U93 A;  3K97 A;  3PEJ A;  2O1V A;  4H85 A;  4PRX A;  4CWQ A;  3WHA A;  1Y8P A;  3TZ2 A;  1I5A A;  4HY6 A;  1KIJ A;  3TZ4 A;  3R4O A;  3R4P A;  4MPE A;  4ASF A;  2Q8I A;  2BTZ A;  1UYH A;  4URO A;  3NMQ A;  4XC0 A;  4ASG A;  4JAS A;  5D7C A;  5D7D A;  3HZ5 A;  4WUC A;  3EHF A;  2O1W A;  3QTF A;  3IED A;  4URM A;  1EI1 A;  1BXD A;  1UYI A;  2BU6 A;  3R4N A;  1NHH A;  3A0R A;  4EEH A;  1UYL A;  1Y4S A;  3K98 A;  4O0B A;  1S14 A;  4XIR A;  1YT1 A;  3BM9 A;  1BKN A;  1UYG A;  4MBC A;  2IOP A;  4V25 A;  5M4N A;  4EM7 A;  4HY1 A;  4PU9 A;  4XD8 A;  4MB9 A;  4U7O A;  2XDU A;  4E00 A;  4L8Z A;  2WI2 A;  3O2F A;  3LPS A;  1YC4 A;  2C2A A;  2YGA A;  2ZDY A;  4LWF A;  2UWD A;  3INW A;  4CWS A;  4PRV A;  3B26 A;  4NH9 A;  3GIG A;  3RKZ A;  4CWT A;  2BZ5 A;  3D2R A;  4MPN A;  2WEP A;  3ZKD A;  4CWF A;  3FT5 A;  5D6Q A;  4R1F A;  3O0I A;  2WI5 A;  2WI6 A;  1B63 A;  1YSZ A;  1UYD A;  4O07 A;  1Y4U A;  1GJV A;  3B25 A;  2XDS A;  4HXZ A;  4KP4 A;  5BOC A;  3JZ3 A;  2WI7 A;  4MOT A;  2WER A;  4LWE A;  4FCR A;  4EGH A;  4HYM A;  1AH8 A;  4YKQ A;  3ZKB A;  3ZXO A;  4FCQ A;  2YE8 A;  3FV5 A;  1QZR A;  3T0Z A;  2YE6 A;  1THN A;  4DZY A;  2XCM A;  4YKZ A;  4EFU A;  1BYQ A;  3HZ1 A;  2BSM A;  4EFT A;  2BRE A;  2VWC A;  4AS9 A;  1H7U A;  4URN A;  1YES A;  3EHH A;  2Q8H A;  2YI5 A;  2HCH A;  2ZKJ A;  4XKK A;  1AMW A;  4L91 A;  1MX0 A;  2YGE A;  2BU2 A;  5IDM A;  4XDM A;  3OWB A;  3WQ9 A;  1UYM A;  5FNF A;  4NH8 A;  1ZXM A;  4XTJ A;  5F5R A;  4EMV A;  1UYC A;  4XIQ A;  2YK9 A;  2BYH A;  5M4K A;  3HYZ A;  4E02 A;  2CG9 A;  2YI7 A;  4L94 A;  2XJX A;  2ZDX A;  3U67 A;  3A0X A;  5M4H A;  1MU5 A;  2GQP A;  1US7 A;  2BU8 A;  2YEJ A;  3O6O A;  4GCZ A;  4CE2 A;  1Y8O A;  4ZKI A;  3GIF A;  1AJ6 A;  4W7T A;  1A4H A;  2YEG A;  4ASB A;  1TC6 A;  2XHT A;  2IOR A;  2BT0 A;  3FT8 A;  5L3J A;  2IWU A;  2QG2 A;  2YK2 A;  5D6P A;  4XIT A;  2Q8G A;  1B62 A;  2YEA A;  2XJG A;  2ESA A;  2YED A;  3Q5L A;  3SL2 A;  4MPC A;  4MP7 A;  1U0Z A;  3K60 A;  2IWX A;  4V26 A;  1YER A;  2XX2 A;  1Z5A A;  3TUH A;  4URL A;  4GQT A;  3BMY A;  4BXI A;  3OPD A; 
#chains in the Genus database with same CATH topology
 2YJW A;  4I5S A;  4YKW A;  4EGI A;  3OWD A;  1IXM A;  4XKO A;  1U2O A;  4HYP A;  4AWO A;  4H7Q A;  4O05 A;  4CWN A;  3RLP A;  2WI3 A;  1UY8 A;  1NHI A;  3OMU A;  4X9L A;  1F51 A;  2H55 A;  1YC1 A;  2JKI A;  2FWZ A;  1I58 A;  1ZWH A;  4BQJ A;  4GGL A;  2YKJ A;  2VW5 A;  4CE3 A;  4AWP A;  3CGY A;  2H8M A;  4K4O A;  4ASA A;  1UYF A;  2XX5 A;  5BOD A;  2YI0 A;  5M4E A;  1GKX A;  4CE1 A;  2PNR A;  5J6A A;  4E01 A;  3B24 A;  3MNR P;  2QG0 A;  2Q2E B;  2K5B A;  5CTU A;  5M4P A;  3T0H A;  2XX4 A;  3CYG A;  1JM6 A;  3A0Z A;  1QY8 A;  4BIU A;  3CWV A;  4JQL A;  2IWS A;  3CGZ A;  3HEK A;  2XDX A;  3C11 A;  3HHU A;  2XAB A;  4GFN A;  3CRK A;  4CWP A;  4QPK A;  2YE3 A;  3G7B A;  4KQV A;  2Q8F A;  2BU7 A;  2CCT A;  4JAU A;  5CTY A;  1YS3 A;  5FND A;  4LWH A;  1EA6 A;  1ZXN A;  2FTK A;  4XIP A;  3T10 A;  4HZ5 A;  4EGK A;  3U2K A;  3T1K A;  2XHR A;  4AWQ A;  4R3M A;  4YKT A;  2BYI A;  2HKJ A;  2VCJ A;  3A0Y A;  3R92 A;  2XDK A;  4LPB A;  3G75 A;  4PL9 A;  4YKX A;  5FNC A;  2WI1 A;  4H81 A;  2YEF A;  1I5B A;  2CCU A;  1Y8N A;  2XJJ A;  2VCI A;  2YE4 A;  2XDL A;  5C93 A;  3EKR A;  4WUB A;  4FPP A;  3B28 A;  3H80 A;  3EKO A;  5D7R A;  1I5C A;  3VHD A;  3B27 A;  3QDD A;  4GT8 A;  4P8O A;  4LWI A;  1L0O A;  4BIZ A;  1TH8 A;  1TBW A;  3CRL A;  3D36 A;  3GIE A;  2WI4 A;  2XD6 A;  5M4M A;  3LNU A;  1S16 A;  1UY6 A;  4O04 A;  4Q20 A;  4ZVI A;  2FYP A;  4O09 A;  2YJX A;  3ZM7 A;  2YE2 A;  1H7S A;  2JJC A;  1YT2 A;  5CPH A;  5CTX A;  2YKE A;  4FCP A;  4LP0 A;  4XCL A;  4LWG A;  4XKA A;  2ZBK B;  1YET A;  2YEE A;  3Q5J A;  3DGE A;  1Z59 A;  2YKC A;  2CGF A;  4JAV A;  1UYE A;  2E0A A;  1GKZ A;  5IDJ A;  1I5D A;  1UY9 A;  4CWR A;  3RLR A;  1YSR A;  2C1G A;  1R62 A;  4B6C A;  2YEH A;  3Q5K A;  4YKY A;  3EHJ A;  4BQG A;  3T2S A;  2CH4 A;  1KZN A;  4I3H A;  4DUH A;  4L93 A;  4KSH A;  1UY7 A;  1TC0 A;  1ZW9 A;  2YKB A;  3H4L A;  5CTW A;  2YI6 A;  2BRC A;  2FXS A;  2O1U A;  3KE6 A;  1UYK A;  4YKR A;  3R91 A;  1ID0 A;  3EHG A;  3D0B A;  3TTZ A;  3ZXQ A;  5F3K A;  3R4M A;  1OSF A;  3GIG B;  1AH6 A;  2WEQ A;  4GEE A;  3VHC A;  1YT0 A;  3LMM A;  1QYE A;  3HYY A;  4HXW A;  2YGF A;  4NH7 A;  2YKI A;  4WUD A;  3PEH A;  4KTN A;  4KSG A;  2FWY A;  4U7N A;  3RLQ A;  2IOQ A;  1TIL A;  3G7E A;  2YEB A;  4QPJ A;  5FWK A;  2AKP A;  2YE5 A;  2YEC A;  4MP2 A;  4FMT A;  4L90 A;  1BGQ A;  4XCJ A;  4HZ0 A;  5IN9 A;  3OW6 A;  3C0E A;  4XE2 A;  4B7P A;  1YC3 A;  5J71 A;  2CCS A;  4P7A A;  3A0T A;  3U2D A;  2BU5 A;  2HG1 A;  2YEI A;  1TID A;  3VAD A;  4R3A A;  1NHJ A;  1Z5C A;  1PVG A;  2XK2 A;  5CF0 A;  1I59 A;  3INX A;  3VHA A;  2XHX A;  3A0W A;  2QF6 A;  2QFO A;  1Z5B A;  4KFG A;  3TZ0 A;  1AM1 A;  2YE7 A;  4BAE A;  2GFD A;  2EXL A;  4CWO A;  2YE9 A;  5GGZ A;  4YKU A;  1B3Q A;  3TZ5 A;  3K99 A;  4U93 A;  3K97 A;  3PEJ A;  2O1V A;  4H85 A;  4PRX A;  4CWQ A;  3WHA A;  1Y8P A;  3TZ2 A;  1I5A A;  4HY6 A;  1KIJ A;  3TZ4 A;  3R4O A;  3R4P A;  4MPE A;  4ASF A;  2Q8I A;  2HHI A;  2BTZ A;  1UYH A;  4URO A;  3NMQ A;  4XC0 A;  4ASG A;  4JAS A;  5D7C A;  5D7D A;  3HZ5 A;  4WUC A;  3EHF A;  2O1W A;  3QTF A;  3IED A;  4URM A;  1EI1 A;  1BXD A;  1UYI A;  2BU6 A;  3R4N A;  1NHH A;  3A0R A;  4EEH A;  1UYL A;  1Y4S A;  3K98 A;  4O0B A;  1S14 A;  4XIR A;  1YT1 A;  3BM9 A;  1BKN A;  1UYG A;  4MBC A;  2IOP A;  4V25 A;  5M4N A;  4EM7 A;  4HY1 A;  4PU9 A;  4XD8 A;  4MB9 A;  4U7O A;  2XDU A;  4E00 A;  4L8Z A;  2WI2 A;  3O2F A;  3LPS A;  1YC4 A;  2C2A A;  2YGA A;  2ZDY A;  4LWF A;  2UWD A;  3INW A;  4CWS A;  4PRV A;  3B26 A;  4NH9 A;  3GIG A;  3RKZ A;  4CWT A;  2BZ5 A;  3D2R A;  4MPN A;  2WEP A;  3ZKD A;  4CWF A;  2C1I A;  3FT5 A;  5D6Q A;  4R1F A;  3O0I A;  2WI5 A;  2WI6 A;  1B63 A;  1YSZ A;  1UYD A;  4O07 A;  1Y4U A;  1GJV A;  3B25 A;  2XDS A;  4HXZ A;  4KP4 A;  4E72 A;  5BOC A;  3JZ3 A;  2WI7 A;  4MOT A;  2WER A;  4LWE A;  4FCR A;  4EGH A;  4HYM A;  1AH8 A;  4YKQ A;  3ZKB A;  3ZXO A;  4FCQ A;  2YE8 A;  3FV5 A;  1QZR A;  3T0Z A;  2YE6 A;  5JEN A;  1THN A;  4DZY A;  2XCM A;  4YKZ A;  4EFU A;  1BYQ A;  3HZ1 A;  2BSM A;  4EFT A;  2BRE A;  2VWC A;  4AS9 A;  1H7U A;  4URN A;  1YES A;  3EHH A;  2Q8H A;  2YI5 A;  2HCH A;  2ZKJ A;  4XKK A;  1AMW A;  4L91 A;  1MX0 A;  2YGE A;  2BU2 A;  5IDM A;  3S5T A;  4XDM A;  3OWB A;  3WQ9 A;  1UYM A;  5FNF A;  4NH8 A;  1ZXM A;  4XTJ A;  5F5R A;  4EMV A;  1UYC A;  4XIQ A;  2YK9 A;  2BYH A;  5M4K A;  3HYZ A;  4E02 A;  2CG9 A;  2YI7 A;  4L94 A;  2XJX A;  2ZDX A;  3U67 A;  3A0X A;  5M4H A;  1MU5 A;  2GQP A;  1US7 A;  2BU8 A;  2YEJ A;  3O6O A;  4GCZ A;  4CE2 A;  1Y8O A;  4ZKI A;  3GIF A;  1AJ6 A;  4W7T A;  1A4H A;  2YEG A;  4ASB A;  1TC6 A;  2XHT A;  2IOR A;  2BT0 A;  3FT8 A;  5L3J A;  2IWU A;  2QG2 A;  2YK2 A;  5D6P A;  4XIT A;  2Q8G A;  1B62 A;  2YEA A;  2XJG A;  2ESA A;  2YED A;  3Q5L A;  3SL2 A;  4MPC A;  4MP7 A;  1U0Z A;  3K60 A;  2IWX A;  4V26 A;  1YER A;  2XX2 A;  1Z5A A;  3TUH A;  4URL A;  4GQT A;  3BMY A;  4BXI A;  3OPD A; 
#chains in the Genus database with same CATH homology
 2YJW A;  4I5S A;  4YKW A;  4EGI A;  3OWD A;  4XKO A;  1U2O A;  4HYP A;  4AWO A;  4H7Q A;  4O05 A;  4CWN A;  3RLP A;  2WI3 A;  1UY8 A;  1NHI A;  3OMU A;  4X9L A;  2H55 A;  1YC1 A;  2JKI A;  2FWZ A;  1I58 A;  1ZWH A;  4BQJ A;  4GGL A;  2YKJ A;  2VW5 A;  4CE3 A;  4AWP A;  3CGY A;  2H8M A;  4K4O A;  4ASA A;  1UYF A;  2XX5 A;  5BOD A;  2YI0 A;  5M4E A;  1GKX A;  4CE1 A;  2PNR A;  5J6A A;  4E01 A;  3B24 A;  3MNR P;  2QG0 A;  2Q2E B;  2K5B A;  5CTU A;  5M4P A;  3T0H A;  2XX4 A;  1JM6 A;  3A0Z A;  1QY8 A;  4BIU A;  3CWV A;  4JQL A;  2IWS A;  3CGZ A;  3HEK A;  2XDX A;  3C11 A;  3HHU A;  2XAB A;  4GFN A;  3CRK A;  4CWP A;  4QPK A;  2YE3 A;  3G7B A;  4KQV A;  2Q8F A;  2BU7 A;  2CCT A;  4JAU A;  5CTY A;  1YS3 A;  5FND A;  4LWH A;  1EA6 A;  1ZXN A;  4XIP A;  3T10 A;  4HZ5 A;  4EGK A;  3U2K A;  3T1K A;  2XHR A;  4AWQ A;  4R3M A;  4YKT A;  2BYI A;  2HKJ A;  2VCJ A;  3A0Y A;  3R92 A;  2XDK A;  4LPB A;  3G75 A;  4PL9 A;  4YKX A;  5FNC A;  2WI1 A;  4H81 A;  2YEF A;  1I5B A;  2CCU A;  1Y8N A;  2XJJ A;  2VCI A;  2YE4 A;  2XDL A;  5C93 A;  3EKR A;  4WUB A;  4FPP A;  3B28 A;  3H80 A;  3EKO A;  5D7R A;  1I5C A;  3VHD A;  3B27 A;  3QDD A;  4GT8 A;  4P8O A;  4LWI A;  1L0O A;  4BIZ A;  1TH8 A;  1TBW A;  3CRL A;  3D36 A;  3GIE A;  2WI4 A;  2XD6 A;  5M4M A;  3LNU A;  1S16 A;  1UY6 A;  4O04 A;  4Q20 A;  4ZVI A;  2FYP A;  4O09 A;  2YJX A;  3ZM7 A;  2YE2 A;  1H7S A;  2JJC A;  1YT2 A;  5CPH A;  5CTX A;  2YKE A;  4FCP A;  4LP0 A;  4XCL A;  4LWG A;  4XKA A;  2ZBK B;  1YET A;  2YEE A;  3Q5J A;  3DGE A;  1Z59 A;  2YKC A;  2CGF A;  4JAV A;  1UYE A;  2E0A A;  1GKZ A;  5IDJ A;  1I5D A;  1UY9 A;  4CWR A;  3RLR A;  1YSR A;  1R62 A;  4B6C A;  2YEH A;  3Q5K A;  4YKY A;  3EHJ A;  4BQG A;  3T2S A;  2CH4 A;  1KZN A;  4I3H A;  4DUH A;  4L93 A;  4KSH A;  1UY7 A;  1TC0 A;  1ZW9 A;  2YKB A;  3H4L A;  5CTW A;  2YI6 A;  2BRC A;  2FXS A;  2O1U A;  3KE6 A;  1UYK A;  4YKR A;  3R91 A;  1ID0 A;  3EHG A;  3D0B A;  3TTZ A;  3ZXQ A;  5F3K A;  3R4M A;  4GEE A;  1OSF A;  1AH6 A;  2WEQ A;  3GIG B;  3VHC A;  1YT0 A;  1QYE A;  3HYY A;  4HXW A;  2YGF A;  4NH7 A;  2YKI A;  4WUD A;  3PEH A;  4KTN A;  4KSG A;  2FWY A;  4U7N A;  3RLQ A;  2IOQ A;  1TIL A;  3G7E A;  2YEB A;  4QPJ A;  5FWK A;  2AKP A;  2YE5 A;  2YEC A;  4MP2 A;  4FMT A;  4L90 A;  1BGQ A;  4XCJ A;  4HZ0 A;  5IN9 A;  3OW6 A;  3C0E A;  4XE2 A;  4B7P A;  1YC3 A;  5J71 A;  2CCS A;  4P7A A;  3A0T A;  3U2D A;  2BU5 A;  2HG1 A;  2YEI A;  1TID A;  3VAD A;  4R3A A;  1NHJ A;  1Z5C A;  1PVG A;  2XK2 A;  5CF0 A;  1I59 A;  3INX A;  3VHA A;  2XHX A;  3A0W A;  2QF6 A;  2QFO A;  1Z5B A;  4KFG A;  3TZ0 A;  1AM1 A;  2YE7 A;  4BAE A;  2GFD A;  2EXL A;  4CWO A;  2YE9 A;  5GGZ A;  4YKU A;  1B3Q A;  3TZ5 A;  3K99 A;  4U93 A;  3K97 A;  3PEJ A;  2O1V A;  4H85 A;  4PRX A;  4CWQ A;  3WHA A;  1Y8P A;  3TZ2 A;  1I5A A;  4HY6 A;  1KIJ A;  3TZ4 A;  3R4O A;  3R4P A;  4MPE A;  4ASF A;  2Q8I A;  2BTZ A;  1UYH A;  4URO A;  3NMQ A;  4XC0 A;  4ASG A;  4JAS A;  5D7C A;  5D7D A;  3HZ5 A;  4WUC A;  3EHF A;  2O1W A;  3QTF A;  3IED A;  4URM A;  1EI1 A;  1BXD A;  1UYI A;  2BU6 A;  3R4N A;  1NHH A;  3A0R A;  4EEH A;  1UYL A;  1Y4S A;  3K98 A;  4O0B A;  1S14 A;  4XIR A;  1YT1 A;  3BM9 A;  1BKN A;  1UYG A;  4MBC A;  2IOP A;  4V25 A;  5M4N A;  4EM7 A;  4HY1 A;  4PU9 A;  4XD8 A;  4MB9 A;  4U7O A;  2XDU A;  4E00 A;  4L8Z A;  2WI2 A;  3O2F A;  3LPS A;  1YC4 A;  2C2A A;  2YGA A;  2ZDY A;  4LWF A;  2UWD A;  3INW A;  4CWS A;  4PRV A;  3B26 A;  4NH9 A;  3GIG A;  3RKZ A;  4CWT A;  2BZ5 A;  3D2R A;  4MPN A;  2WEP A;  3ZKD A;  4CWF A;  3FT5 A;  5D6Q A;  4R1F A;  3O0I A;  2WI5 A;  2WI6 A;  1B63 A;  1YSZ A;  1UYD A;  4O07 A;  1Y4U A;  1GJV A;  3B25 A;  2XDS A;  4HXZ A;  4KP4 A;  5BOC A;  3JZ3 A;  2WI7 A;  4MOT A;  2WER A;  4LWE A;  4FCR A;  4EGH A;  4HYM A;  1AH8 A;  4YKQ A;  3ZKB A;  3ZXO A;  4FCQ A;  2YE8 A;  3FV5 A;  1QZR A;  3T0Z A;  2YE6 A;  1THN A;  4DZY A;  2XCM A;  4YKZ A;  4EFU A;  1BYQ A;  3HZ1 A;  2BSM A;  4EFT A;  2BRE A;  2VWC A;  4AS9 A;  1H7U A;  4URN A;  1YES A;  3EHH A;  2Q8H A;  2YI5 A;  2HCH A;  2ZKJ A;  4XKK A;  1AMW A;  4L91 A;  1MX0 A;  2YGE A;  2BU2 A;  5IDM A;  4XDM A;  3OWB A;  3WQ9 A;  1UYM A;  5FNF A;  4NH8 A;  1ZXM A;  4XTJ A;  5F5R A;  4EMV A;  1UYC A;  4XIQ A;  2YK9 A;  2BYH A;  5M4K A;  3HYZ A;  4E02 A;  2CG9 A;  2YI7 A;  4L94 A;  2XJX A;  2ZDX A;  3U67 A;  3A0X A;  5M4H A;  1MU5 A;  2GQP A;  1US7 A;  2BU8 A;  2YEJ A;  3O6O A;  4GCZ A;  4CE2 A;  1Y8O A;  4ZKI A;  3GIF A;  1AJ6 A;  4W7T A;  1A4H A;  2YEG A;  4ASB A;  1TC6 A;  2XHT A;  2IOR A;  2BT0 A;  3FT8 A;  5L3J A;  2IWU A;  2QG2 A;  2YK2 A;  5D6P A;  4XIT A;  2Q8G A;  1B62 A;  2YEA A;  2XJG A;  2ESA A;  2YED A;  3Q5L A;  3SL2 A;  4MPC A;  4MP7 A;  1U0Z A;  3K60 A;  2IWX A;  4V26 A;  1YER A;  2XX2 A;  1Z5A A;  3TUH A;  4URL A;  4GQT A;  3BMY A;  4BXI A;  3OPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...