1TBWA

Ligand induced conformational shift in the n-terminal domain of grp94, open conformation
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
225
structure length
222
Chain Sequence
FAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTGKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-induced Conformational Shift in the N-terminal Domain of GRP94, an Hsp90 Chaperone.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 75
structure length 222
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1tbwA00
4CE1A 4BIUA 3QDDA 3B28A 4PRXA 3ZKBA 3TUHA 1UY7A 4MBCA 1NHHA 2O1VA 2QG2A 4O09A 4EFTA 2VCJA 2HG1A 1B3QA 4JAVA 3JZ3A 1BKNA 3A0YA 5D7DA 2IWXA 3C11A 4L91A 4CWPA 4FCRA 3Q5LA 2Q8FA 4CWNA 2GQPA 1UY9A 2FYPA 1YETA 2BZ5A 1TC6A 1U2OA 4URLA 3U2DA 1ID0A 2GFDA 3G7BA 4CWTA 4GT8A 2YJXA 1I5CA 5BODA 4MPCA 3H80A 3BM9A 5M4NA 4EFUA 4XIRA 3WHAA 4O0BA 4YKUA 2BYHA 1ZW9A 4UROA 5M4EA 1UYCA 2JJCA 4EM7A 3VHDA 2IORA 3H4LA 3R4MA 3GIEA 3WQ9A 4NH9A 4LWIA 3PEJA 2WI2A 4HY6A 2YE9A 3K60A 1Z5AA 1NHIA 1TIDA 1Y4SA 2BT0A 4XIPA 2Q8HA 1GKXA 4HY1A 3Q5KA 3GIFA 4QPJA 4HYPA 2IOQA 3OWBA 4B6CA 4XKKA 4LWEA 4ASAA 2YE4A 5FNFA 2CGFA 2E0AA 4XE2A 1UYMA 1UYGA 1AMWA 5J71A 3INXA 3EHJA 5M4KA 3R92A 1Y4UA 1UYHA 4EMVA 3A0WA 4L93A 5J6AA 3T0ZA 2BU2A 2ESAA 4PU9A 3O6OA 3Q5JA 1AM1A 2XDUA 4LP0A 2XDSA 5L3JA 4HXZA 2YK9A 4XITA 3LPSA 5FNCA 4CE3A 2Q8GA 5D6QA 1NHJA 5IDJA 2QFOA 1QYEA 3R4NA 3VADA 4KQVA 1GKZA 2QG0A 1H7SA 4H85A 4CWQA 3K97A 3K99A 4Q20A 2WEQA 4R3AA 1UYLA 3GIGB 3R4PA 4DZYA 4WUDA 1Y8PA 4ZVIA 4BQJA 4GGLA 3A0XA 3RLRA 1I5AA 4GFNA 2VWCA 5CPHA 2XD6A 3TZ2A 4YKXA 1BGQA 2XJXA 5BOCA 2H8MA 2WI7A 3A0ZA 4U93A 4I5SA 1BXDA 1B63A 3CWVA 3C0EA 3K98A 4L8ZA 4BIZA 5CTUA 2YKBA 2ZDXA 3NMQA 3T10A 2YEFA 2BREA 1YT1A 4YKQA 5D7RA 4EGIA 2ZDYA 4X9LA 2Q2EB 3OWDA 1QZRA 3B26A 3EHGA 3EHFA 4W7TA 2XDLA 1MU5A 4K4OA 2WI4A 3TZ5A 1EA6A 3VHCA 1Z5CA 2XHXA 3FT8A 2AKPA 3R91A 4GCZA 2WERA 4XKOA 4LWHA 2XX4A 4E00A 2WI5A 1H7UA 4WUCA 1MX0A 1YT2A 5CTYA 4PRVA 2YEBA 2WI3A 1PVGA 3ZKDA 4L94A 4YKTA 4XDMA 2YEAA 5C93A 2YEJA 2YI5A 3VHAA 3MNRP 3QTFA 1AH6A 4HXWA 1I59A 2YECA 3INWA 2YEDA 1B62A 4V26A 4MPNA 1YS3A 2YI6A 4XD8A 2H55A 4P7AA 1S14A 1I58A 2WI6A 1UY8A 4MP2A 4YKRA 5F3KA 1GJVA 3PEHA 4HYMA 3RLPA 3BMYA 1I5DA 2YKEA 4AWQA 3D36A 4O04A 2QF6A 5FWKA 4YKZA 2YKCA 3A0TA 5F5RA 4BQGA 5M4MA 3D2RA 3TZ0A 3RKZA 2ZKJA 2Q8IA 3TTZA 1US7A 2IOPA 4E02A 2XJGA 1KZNA 2WEPA 1R62A 1THNA 4LPBA 1YERA 4HZ5A 2PNRA 4YKYA 3SL2A 1L0OA 2O1UA 2FWZA 4WUBA 4GEEA 3T2SA 2BSMA 2CCTA 4I3HA 4URNA 3OMUA 1TILA 4R1FA 3EHHA 4AWPA 3EKOA 2YE2A 1ZXMA 2YEIA 3G75A 2BTZA 2BU7A 3FT5A 2WI1A 3B24A 4NH7A 3HEKA 1A4HA 3D0BA 1U0ZA 2IWUA 4FMTA 2CCUA 4ASGA 2YJWA 4V25A 4XTJA 2YKIA 5GGZA 2YK2A 4O05A 2YGEA 4MP7A 1I5BA 1UY6A 4E01A 2YEHA 5D7CA 2YKJA 5CF0A 2YE5A 2HCHA 1UYDA 3FV5A 4P8OA 4DUHA 2YE6A 2YI0A 3CGZA 4BXIA 2YI7A 1UYKA 1BYQA 2FWYA 2XK2A 1EI1A 1YC4A 2UWDA 1Y8NA 4NH8A 4U7OA 3IEDA 2YEEA 3T1KA 1S16A 1AH8A 3OPDA 4MOTA 2XX5A 4KSGA 3CRKA 1UYIA 1KIJA 2C2AA 4FCQA 1UYFA 4URMA 1YT0A 3CRLA 2EXLA 4YKWA 1ZXNA 3HZ1A 5FNDA 2CCSA 2YE3A 3GIGA 4XKAA 4AWOA 1Y8OA 2JKIA 5IDMA 2CH4A 2IWSA 4FPPA 3ZM7A 3HYZA 4H81A 4BAEA 4QPKA 3DGEA 4CWRA 2BYIA 2BU5A 1Z59A 1YSZA 2YGFA 3B25A 3B27A 4JQLA 4H7QA 2XDXA 3HHUA 2HKJA 1AJ6A 1TH8A 2XABA 4FCPA 5CTWA 4B7PA 3HZ5A 3U2KA 2XDKA 1YSRA 2O1WA 2CG9A 4PL9A 1TC0A 4MPEA 2K5BA 5IN9A 1YESA 3G7EA 3R4OA 3EKRA 3TZ4A 3KE6A 4KP4A 2FXSA 4XCJA 3LNUA 1Z5BA 2XCMA 3ZXQA 2BU8A 2YE7A 4CWFA 4ASBA 2VW5A 4GQTA 4EEHA 3OW6A 4XC0A 4HZ0A 2XHTA 4XCLA 3T0HA 2YGAA 5M4PA 2XX2A 1ZWHA 4CWOA 4AS9A 4XIQA 3HYYA 4ZKIA 4U7NA 4MB9A 3RLQA 4KSHA 1UYEA 1YC3A 4LWFA 4KTNA 4EGKA 4ASFA 3CGYA 5D6PA 4CE2A 4JAUA 4L90A 3U67A 1YC1A 2VCIA 4EGHA 5CTXA 4LWGA 2BRCA 4JASA 4O07A 2XHRA 2YEGA 2ZBKB 3O0IA 3ZXOA 3A0RA 1JM6A 4R3MA 2XJJA 2YE8A 1QY8A 5M4HA 1OSFA 1TBWA 4CWSA 3O2FA 4KFGA 2BU6A
chains in the Genus database with same CATH superfamily
4CE1A 4BIUA 3QDDA 3B28A 4PRXA 3ZKBA 3TUHA 1UY7A 4MBCA 1NHHA 2O1VA 2QG2A 4O09A 4EFTA 2VCJA 2HG1A 1B3QA 4JAVA 3JZ3A 1BKNA 3A0YA 5D7DA 2IWXA 3C11A 4L91A 4CWPA 4FCRA 3Q5LA 2Q8FA 4CWNA 2GQPA 1UY9A 2FYPA 1YETA 2BZ5A 1TC6A 1U2OA 4URLA 3U2DA 1ID0A 2GFDA 3G7BA 4CWTA 4GT8A 2YJXA 1I5CA 5BODA 4MPCA 3H80A 3BM9A 5M4NA 4EFUA 4XIRA 3WHAA 4O0BA 4YKUA 2BYHA 1ZW9A 4UROA 5M4EA 1UYCA 2JJCA 4EM7A 3VHDA 2IORA 3H4LA 3R4MA 3GIEA 3WQ9A 1IXMA 4NH9A 4LWIA 3PEJA 2WI2A 2FTKA 4HY6A 2YE9A 3K60A 1Z5AA 1NHIA 1TIDA 1Y4SA 2BT0A 4XIPA 2Q8HA 1GKXA 4HY1A 3Q5KA 3GIFA 4QPJA 4HYPA 2IOQA 3OWBA 4B6CA 4XKKA 4LWEA 4ASAA 2YE4A 5FNFA 2CGFA 2E0AA 4XE2A 1UYMA 1UYGA 1AMWA 5J71A 2HHIA 3INXA 3EHJA 5M4KA 3R92A 1Y4UA 1UYHA 4EMVA 3A0WA 4L93A 5J6AA 3T0ZA 2BU2A 2ESAA 4PU9A 3O6OA 3Q5JA 1AM1A 2XDUA 4LP0A 2XDSA 5L3JA 4HXZA 2YK9A 4XITA 3LPSA 5FNCA 4CE3A 2Q8GA 5D6QA 1NHJA 5IDJA 2QFOA 1QYEA 3R4NA 3VADA 4KQVA 1GKZA 2QG0A 1H7SA 4H85A 4CWQA 3K97A 3K99A 4Q20A 2WEQA 4R3AA 1UYLA 3GIGB 3R4PA 4DZYA 4WUDA 1Y8PA 4ZVIA 4BQJA 4GGLA 3A0XA 3RLRA 1I5AA 4GFNA 2VWCA 5CPHA 2XD6A 3TZ2A 4YKXA 1BGQA 2XJXA 5BOCA 2H8MA 2WI7A 3A0ZA 4U93A 4I5SA 1BXDA 1B63A 3CWVA 3C0EA 3K98A 4L8ZA 4BIZA 5CTUA 2YKBA 2ZDXA 3NMQA 3T10A 2YEFA 2BREA 1YT1A 4YKQA 5D7RA 4EGIA 2ZDYA 4X9LA 2Q2EB 3OWDA 1QZRA 3B26A 3EHGA 3EHFA 4W7TA 3S5TA 2XDLA 1MU5A 4K4OA 2WI4A 3TZ5A 1EA6A 3VHCA 1Z5CA 2XHXA 3FT8A 2AKPA 3R91A 4GCZA 2WERA 4XKOA 4LWHA 2XX4A 4E00A 2WI5A 1H7UA 4WUCA 1MX0A 1YT2A 5CTYA 4PRVA 2YEBA 2WI3A 4E72A 1PVGA 1F51A 3ZKDA 4L94A 4YKTA 4XDMA 2YEAA 5C93A 2YEJA 2YI5A 3VHAA 3MNRP 3QTFA 1AH6A 4HXWA 3CYGA 1I59A 2YECA 3INWA 2YEDA 1B62A 4V26A 4MPNA 1YS3A 2YI6A 4XD8A 2H55A 4P7AA 1S14A 1I58A 2WI6A 1UY8A 4MP2A 4YKRA 5F3KA 2C1GA 1GJVA 3PEHA 4HYMA 3RLPA 3BMYA 1I5DA 2YKEA 4AWQA 3D36A 4O04A 2QF6A 5FWKA 4YKZA 2YKCA 3A0TA 5F5RA 4BQGA 5M4MA 3D2RA 3TZ0A 3RKZA 2ZKJA 2Q8IA 3TTZA 1US7A 2IOPA 4E02A 2XJGA 1KZNA 2WEPA 1R62A 1THNA 4LPBA 1YERA 4HZ5A 2PNRA 4YKYA 3SL2A 1L0OA 2O1UA 2FWZA 4WUBA 4GEEA 3T2SA 2BSMA 2CCTA 4I3HA 4URNA 3OMUA 1TILA 4R1FA 3EHHA 4AWPA 3EKOA 2YE2A 1ZXMA 2YEIA 3G75A 2BTZA 2BU7A 3FT5A 2WI1A 3B24A 4NH7A 3HEKA 1A4HA 3D0BA 1U0ZA 2IWUA 4FMTA 2CCUA 4ASGA 2YJWA 4V25A 4XTJA 2YKIA 5GGZA 2YK2A 4O05A 2YGEA 4MP7A 1I5BA 1UY6A 4E01A 2YEHA 5D7CA 2YKJA 5CF0A 2YE5A 2HCHA 1UYDA 3FV5A 4P8OA 4DUHA 5JENA 2YE6A 2YI0A 3CGZA 4BXIA 2YI7A 1UYKA 1BYQA 2FWYA 2XK2A 1EI1A 1YC4A 2UWDA 1Y8NA 4NH8A 4U7OA 3IEDA 2YEEA 3T1KA 1S16A 1AH8A 3OPDA 4MOTA 2XX5A 4KSGA 3CRKA 1UYIA 1KIJA 2C2AA 4FCQA 1UYFA 4URMA 1YT0A 3CRLA 2EXLA 4YKWA 1ZXNA 3HZ1A 5FNDA 2CCSA 2YE3A 3GIGA 4XKAA 4AWOA 1Y8OA 2JKIA 5IDMA 2CH4A 2IWSA 4FPPA 3ZM7A 3HYZA 4H81A 4BAEA 4QPKA 3DGEA 2C1IA 2BYIA 4CWRA 2BU5A 3LMMA 1Z59A 1YSZA 2YGFA 3B25A 3B27A 4JQLA 4H7QA 2XDXA 3HHUA 2HKJA 1AJ6A 1TH8A 2XABA 4FCPA 5CTWA 4B7PA 3HZ5A 3U2KA 2XDKA 1YSRA 2O1WA 2CG9A 4PL9A 1TC0A 4MPEA 2K5BA 5IN9A 1YESA 3G7EA 3R4OA 3EKRA 3TZ4A 3KE6A 4KP4A 2FXSA 4XCJA 3LNUA 1Z5BA 2XCMA 3ZXQA 2BU8A 2YE7A 4CWFA 4ASBA 2VW5A 4GQTA 4EEHA 3OW6A 4XC0A 4HZ0A 2XHTA 4XCLA 3T0HA 2YGAA 5M4PA 2XX2A 1ZWHA 4CWOA 4AS9A 4XIQA 3HYYA 4ZKIA 4U7NA 4MB9A 3RLQA 4KSHA 1UYEA 1YC3A 4LWFA 4KTNA 4EGKA 4ASFA 3CGYA 5D6PA 4CE2A 4JAUA 4L90A 3U67A 1YC1A 2VCIA 4EGHA 5CTXA 4LWGA 2BRCA 4JASA 4O07A 2XHRA 2YEGA 2ZBKB 3O0IA 3ZXOA 3A0RA 1JM6A 4R3MA 2XJJA 2YE8A 1QY8A 5M4HA 1OSFA 1TBWA 4CWSA 3O2FA 4KFGA 2BU6A
chains in the Genus database with same CATH topology
4CE1A 4BIUA 3QDDA 3B28A 4PRXA 3ZKBA 3TUHA 1UY7A 4MBCA 1NHHA 2O1VA 2QG2A 4O09A 4EFTA 2VCJA 2HG1A 1B3QA 4JAVA 3JZ3A 1BKNA 3A0YA 5D7DA 2IWXA 3C11A 4L91A 4CWPA 4FCRA 3Q5LA 2Q8FA 4CWNA 2GQPA 1UY9A 2FYPA 1YETA 2BZ5A 1TC6A 1U2OA 4URLA 3U2DA 1ID0A 2GFDA 3G7BA 4CWTA 4GT8A 2YJXA 1I5CA 5BODA 4MPCA 3H80A 3BM9A 5M4NA 4EFUA 4XIRA 3WHAA 4O0BA 4YKUA 2BYHA 1ZW9A 4UROA 5M4EA 1UYCA 2JJCA 4EM7A 3VHDA 2IORA 3H4LA 3R4MA 3GIEA 3WQ9A 4NH9A 4LWIA 3PEJA 2WI2A 4HY6A 2YE9A 3K60A 1Z5AA 1NHIA 1TIDA 1Y4SA 2BT0A 4XIPA 2Q8HA 1GKXA 4HY1A 3Q5KA 3GIFA 4QPJA 4HYPA 2IOQA 3OWBA 4B6CA 4XKKA 4LWEA 4ASAA 2YE4A 5FNFA 2CGFA 2E0AA 4XE2A 1UYMA 1UYGA 1AMWA 5J71A 3INXA 3EHJA 5M4KA 3R92A 1Y4UA 1UYHA 4EMVA 3A0WA 4L93A 5J6AA 3T0ZA 2BU2A 2ESAA 4PU9A 3O6OA 3Q5JA 1AM1A 2XDUA 4LP0A 2XDSA 5L3JA 4HXZA 2YK9A 4XITA 3LPSA 5FNCA 4CE3A 2Q8GA 5D6QA 1NHJA 5IDJA 2QFOA 1QYEA 3R4NA 3VADA 4KQVA 1GKZA 2QG0A 1H7SA 4H85A 4CWQA 3K97A 3K99A 4Q20A 2WEQA 4R3AA 1UYLA 3GIGB 3R4PA 4DZYA 4WUDA 1Y8PA 4ZVIA 4BQJA 4GGLA 3A0XA 3RLRA 1I5AA 4GFNA 2VWCA 5CPHA 2XD6A 3TZ2A 4YKXA 1BGQA 2XJXA 5BOCA 2H8MA 2WI7A 3A0ZA 4U93A 4I5SA 1BXDA 1B63A 3CWVA 3C0EA 3K98A 4L8ZA 4BIZA 5CTUA 2YKBA 2ZDXA 3NMQA 3T10A 2YEFA 2BREA 1YT1A 4YKQA 5D7RA 4EGIA 2ZDYA 4X9LA 2Q2EB 3OWDA 1QZRA 3B26A 3EHGA 3EHFA 4W7TA 2XDLA 1MU5A 4K4OA 2WI4A 3TZ5A 1EA6A 3VHCA 1Z5CA 2XHXA 3FT8A 2AKPA 3R91A 4GCZA 2WERA 4XKOA 4LWHA 2XX4A 4E00A 2WI5A 1H7UA 4WUCA 1MX0A 1YT2A 5CTYA 4PRVA 2YEBA 2WI3A 1PVGA 3ZKDA 4L94A 4YKTA 4XDMA 2YEAA 5C93A 2YEJA 2YI5A 3VHAA 3MNRP 3QTFA 1AH6A 4HXWA 1I59A 2YECA 3INWA 2YEDA 1B62A 4V26A 4MPNA 1YS3A 2YI6A 4XD8A 2H55A 4P7AA 1S14A 1I58A 2WI6A 1UY8A 4MP2A 4YKRA 5F3KA 1GJVA 3PEHA 4HYMA 3RLPA 3BMYA 1I5DA 2YKEA 4AWQA 3D36A 4O04A 2QF6A 5FWKA 4YKZA 2YKCA 3A0TA 5F5RA 4BQGA 5M4MA 3D2RA 3TZ0A 3RKZA 2ZKJA 2Q8IA 3TTZA 1US7A 2IOPA 4E02A 2XJGA 1KZNA 2WEPA 1R62A 1THNA 4LPBA 1YERA 4HZ5A 2PNRA 4YKYA 3SL2A 1L0OA 2O1UA 2FWZA 4WUBA 4GEEA 3T2SA 2BSMA 2CCTA 4I3HA 4URNA 3OMUA 1TILA 4R1FA 3EHHA 4AWPA 3EKOA 2YE2A 1ZXMA 2YEIA 3G75A 2BTZA 2BU7A 3FT5A 2WI1A 3B24A 4NH7A 3HEKA 1A4HA 3D0BA 1U0ZA 2IWUA 4FMTA 2CCUA 4ASGA 2YJWA 4V25A 4XTJA 2YKIA 5GGZA 2YK2A 4O05A 2YGEA 4MP7A 1I5BA 1UY6A 4E01A 2YEHA 5D7CA 2YKJA 5CF0A 2YE5A 2HCHA 1UYDA 3FV5A 4P8OA 4DUHA 2YE6A 2YI0A 3CGZA 4BXIA 2YI7A 1UYKA 1BYQA 2FWYA 2XK2A 1EI1A 1YC4A 2UWDA 1Y8NA 4NH8A 4U7OA 3IEDA 2YEEA 3T1KA 1S16A 1AH8A 3OPDA 4MOTA 2XX5A 4KSGA 3CRKA 1UYIA 1KIJA 2C2AA 4FCQA 1UYFA 4URMA 1YT0A 3CRLA 2EXLA 4YKWA 1ZXNA 3HZ1A 5FNDA 2CCSA 2YE3A 3GIGA 4XKAA 4AWOA 1Y8OA 2JKIA 5IDMA 2CH4A 2IWSA 4FPPA 3ZM7A 3HYZA 4H81A 4BAEA 4QPKA 3DGEA 4CWRA 2BYIA 2BU5A 1Z59A 1YSZA 2YGFA 3B25A 3B27A 4JQLA 4H7QA 2XDXA 3HHUA 2HKJA 1AJ6A 1TH8A 2XABA 4FCPA 5CTWA 4B7PA 3HZ5A 3U2KA 2XDKA 1YSRA 2O1WA 2CG9A 4PL9A 1TC0A 4MPEA 2K5BA 5IN9A 1YESA 3G7EA 3R4OA 3EKRA 3TZ4A 3KE6A 4KP4A 2FXSA 4XCJA 3LNUA 1Z5BA 2XCMA 3ZXQA 2BU8A 2YE7A 4CWFA 4ASBA 2VW5A 4GQTA 4EEHA 3OW6A 4XC0A 4HZ0A 2XHTA 4XCLA 3T0HA 2YGAA 5M4PA 2XX2A 1ZWHA 4CWOA 4AS9A 4XIQA 3HYYA 4ZKIA 4U7NA 4MB9A 3RLQA 4KSHA 1UYEA 1YC3A 4LWFA 4KTNA 4EGKA 4ASFA 3CGYA 5D6PA 4CE2A 4JAUA 4L90A 3U67A 1YC1A 2VCIA 4EGHA 5CTXA 4LWGA 2BRCA 4JASA 4O07A 2XHRA 2YEGA 2ZBKB 3O0IA 3ZXOA 3A0RA 1JM6A 4R3MA 2XJJA 2YE8A 1QY8A 5M4HA 1OSFA 1TBWA 4CWSA 3O2FA 4KFGA 2BU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CE1 A;  4BIU A;  3QDD A;  3B28 A;  4PRX A;  3ZKB A;  3TUH A;  1UY7 A;  4MBC A;  1NHH A;  2O1V A;  2QG2 A;  4O09 A;  4EFT A;  2VCJ A;  2HG1 A;  1B3Q A;  4JAV A;  3JZ3 A;  1BKN A;  3A0Y A;  5D7D A;  2IWX A;  3C11 A;  4L91 A;  4CWP A;  4FCR A;  3Q5L A;  2Q8F A;  4CWN A;  2GQP A;  1UY9 A;  2FYP A;  1YET A;  2BZ5 A;  1TC6 A;  1U2O A;  4URL A;  3U2D A;  1ID0 A;  2GFD A;  3G7B A;  4CWT A;  4GT8 A;  2YJX A;  1I5C A;  5BOD A;  4MPC A;  3H80 A;  3BM9 A;  5M4N A;  4EFU A;  4XIR A;  3WHA A;  4O0B A;  4YKU A;  2BYH A;  1ZW9 A;  4URO A;  5M4E A;  1UYC A;  2JJC A;  4EM7 A;  3VHD A;  2IOR A;  3H4L A;  3R4M A;  3GIE A;  3WQ9 A;  4NH9 A;  4LWI A;  3PEJ A;  2WI2 A;  4HY6 A;  2YE9 A;  3K60 A;  1Z5A A;  1NHI A;  1TID A;  1Y4S A;  2BT0 A;  4XIP A;  2Q8H A;  1GKX A;  4HY1 A;  3Q5K A;  3GIF A;  4QPJ A;  4HYP A;  2IOQ A;  3OWB A;  4B6C A;  4XKK A;  4LWE A;  4ASA A;  2YE4 A;  5FNF A;  2CGF A;  2E0A A;  4XE2 A;  1UYM A;  1UYG A;  1AMW A;  5J71 A;  3INX A;  3EHJ A;  5M4K A;  3R92 A;  1Y4U A;  1UYH A;  4EMV A;  3A0W A;  4L93 A;  5J6A A;  3T0Z A;  2BU2 A;  2ESA A;  4PU9 A;  3O6O A;  3Q5J A;  1AM1 A;  2XDU A;  4LP0 A;  2XDS A;  5L3J A;  4HXZ A;  2YK9 A;  4XIT A;  3LPS A;  5FNC A;  4CE3 A;  2Q8G A;  5D6Q A;  1NHJ A;  5IDJ A;  2QFO A;  1QYE A;  3R4N A;  3VAD A;  4KQV A;  1GKZ A;  2QG0 A;  1H7S A;  4H85 A;  4CWQ A;  3K97 A;  3K99 A;  4Q20 A;  2WEQ A;  4R3A A;  1UYL A;  3GIG B;  3R4P A;  4DZY A;  4WUD A;  1Y8P A;  4ZVI A;  4BQJ A;  4GGL A;  3A0X A;  3RLR A;  1I5A A;  4GFN A;  2VWC A;  5CPH A;  2XD6 A;  3TZ2 A;  4YKX A;  1BGQ A;  2XJX A;  5BOC A;  2H8M A;  2WI7 A;  3A0Z A;  4U93 A;  4I5S A;  1BXD A;  1B63 A;  3CWV A;  3C0E A;  3K98 A;  4L8Z A;  4BIZ A;  5CTU A;  2YKB A;  2ZDX A;  3NMQ A;  3T10 A;  2YEF A;  2BRE A;  1YT1 A;  4YKQ A;  5D7R A;  4EGI A;  2ZDY A;  4X9L A;  2Q2E B;  3OWD A;  1QZR A;  3B26 A;  3EHG A;  3EHF A;  4W7T A;  2XDL A;  1MU5 A;  4K4O A;  2WI4 A;  3TZ5 A;  1EA6 A;  3VHC A;  1Z5C A;  2XHX A;  3FT8 A;  2AKP A;  3R91 A;  4GCZ A;  2WER A;  4XKO A;  4LWH A;  2XX4 A;  4E00 A;  2WI5 A;  1H7U A;  4WUC A;  1MX0 A;  1YT2 A;  5CTY A;  4PRV A;  2YEB A;  2WI3 A;  1PVG A;  3ZKD A;  4L94 A;  4YKT A;  4XDM A;  2YEA A;  5C93 A;  2YEJ A;  2YI5 A;  3VHA A;  3MNR P;  3QTF A;  1AH6 A;  4HXW A;  1I59 A;  2YEC A;  3INW A;  2YED A;  1B62 A;  4V26 A;  4MPN A;  1YS3 A;  2YI6 A;  4XD8 A;  2H55 A;  4P7A A;  1S14 A;  1I58 A;  2WI6 A;  1UY8 A;  4MP2 A;  4YKR A;  5F3K A;  1GJV A;  3PEH A;  4HYM A;  3RLP A;  3BMY A;  1I5D A;  2YKE A;  4AWQ A;  3D36 A;  4O04 A;  2QF6 A;  5FWK A;  4YKZ A;  2YKC A;  3A0T A;  5F5R A;  4BQG A;  5M4M A;  3D2R A;  3TZ0 A;  3RKZ A;  2ZKJ A;  2Q8I A;  3TTZ A;  1US7 A;  2IOP A;  4E02 A;  2XJG A;  1KZN A;  2WEP A;  1R62 A;  1THN A;  4LPB A;  1YER A;  4HZ5 A;  2PNR A;  4YKY A;  3SL2 A;  1L0O A;  2O1U A;  2FWZ A;  4WUB A;  4GEE A;  3T2S A;  2BSM A;  2CCT A;  4I3H A;  4URN A;  3OMU A;  1TIL A;  4R1F A;  3EHH A;  4AWP A;  3EKO A;  2YE2 A;  1ZXM A;  2YEI A;  3G75 A;  2BTZ A;  2BU7 A;  3FT5 A;  2WI1 A;  3B24 A;  4NH7 A;  3HEK A;  1A4H A;  3D0B A;  1U0Z A;  2IWU A;  4FMT A;  2CCU A;  4ASG A;  2YJW A;  4V25 A;  4XTJ A;  2YKI A;  5GGZ A;  2YK2 A;  4O05 A;  2YGE A;  4MP7 A;  1I5B A;  1UY6 A;  4E01 A;  2YEH A;  5D7C A;  2YKJ A;  5CF0 A;  2YE5 A;  2HCH A;  1UYD A;  3FV5 A;  4P8O A;  4DUH A;  2YE6 A;  2YI0 A;  3CGZ A;  4BXI A;  2YI7 A;  1UYK A;  1BYQ A;  2FWY A;  2XK2 A;  1EI1 A;  1YC4 A;  2UWD A;  1Y8N A;  4NH8 A;  4U7O A;  3IED A;  2YEE A;  3T1K A;  1S16 A;  1AH8 A;  3OPD A;  4MOT A;  2XX5 A;  4KSG A;  3CRK A;  1UYI A;  1KIJ A;  2C2A A;  4FCQ A;  1UYF A;  4URM A;  1YT0 A;  3CRL A;  2EXL A;  4YKW A;  1ZXN A;  3HZ1 A;  5FND A;  2CCS A;  2YE3 A;  3GIG A;  4XKA A;  4AWO A;  1Y8O A;  2JKI A;  5IDM A;  2CH4 A;  2IWS A;  4FPP A;  3ZM7 A;  3HYZ A;  4H81 A;  4BAE A;  4QPK A;  3DGE A;  4CWR A;  2BYI A;  2BU5 A;  1Z59 A;  1YSZ A;  2YGF A;  3B25 A;  3B27 A;  4JQL A;  4H7Q A;  2XDX A;  3HHU A;  2HKJ A;  1AJ6 A;  1TH8 A;  2XAB A;  4FCP A;  5CTW A;  4B7P A;  3HZ5 A;  3U2K A;  2XDK A;  1YSR A;  2O1W A;  2CG9 A;  4PL9 A;  1TC0 A;  4MPE A;  2K5B A;  5IN9 A;  1YES A;  3G7E A;  3R4O A;  3EKR A;  3TZ4 A;  3KE6 A;  4KP4 A;  2FXS A;  4XCJ A;  3LNU A;  1Z5B A;  2XCM A;  3ZXQ A;  2BU8 A;  2YE7 A;  4CWF A;  4ASB A;  2VW5 A;  4GQT A;  4EEH A;  3OW6 A;  4XC0 A;  4HZ0 A;  2XHT A;  4XCL A;  3T0H A;  2YGA A;  5M4P A;  2XX2 A;  1ZWH A;  4CWO A;  4AS9 A;  4XIQ A;  3HYY A;  4ZKI A;  4U7N A;  4MB9 A;  3RLQ A;  4KSH A;  1UYE A;  1YC3 A;  4LWF A;  4KTN A;  4EGK A;  4ASF A;  3CGY A;  5D6P A;  4CE2 A;  4JAU A;  4L90 A;  3U67 A;  1YC1 A;  2VCI A;  4EGH A;  5CTX A;  4LWG A;  2BRC A;  4JAS A;  4O07 A;  2XHR A;  2YEG A;  2ZBK B;  3O0I A;  3ZXO A;  3A0R A;  1JM6 A;  4R3M A;  2XJJ A;  2YE8 A;  1QY8 A;  5M4H A;  1OSF A;  1TBW A;  4CWS A;  3O2F A;  4KFG A;  2BU6 A; 
#chains in the Genus database with same CATH topology
 4CE1 A;  4BIU A;  3QDD A;  3B28 A;  4PRX A;  3ZKB A;  3TUH A;  1UY7 A;  4MBC A;  1NHH A;  2O1V A;  2QG2 A;  4O09 A;  4EFT A;  2VCJ A;  2HG1 A;  1B3Q A;  4JAV A;  3JZ3 A;  1BKN A;  3A0Y A;  5D7D A;  2IWX A;  3C11 A;  4L91 A;  4CWP A;  4FCR A;  3Q5L A;  2Q8F A;  4CWN A;  2GQP A;  1UY9 A;  2FYP A;  1YET A;  2BZ5 A;  1TC6 A;  1U2O A;  4URL A;  3U2D A;  1ID0 A;  2GFD A;  3G7B A;  4CWT A;  4GT8 A;  2YJX A;  1I5C A;  5BOD A;  4MPC A;  3H80 A;  3BM9 A;  5M4N A;  4EFU A;  4XIR A;  3WHA A;  4O0B A;  4YKU A;  2BYH A;  1ZW9 A;  4URO A;  5M4E A;  1UYC A;  2JJC A;  4EM7 A;  3VHD A;  2IOR A;  3H4L A;  3R4M A;  3GIE A;  3WQ9 A;  1IXM A;  4NH9 A;  4LWI A;  3PEJ A;  2WI2 A;  2FTK A;  4HY6 A;  2YE9 A;  3K60 A;  1Z5A A;  1NHI A;  1TID A;  1Y4S A;  2BT0 A;  4XIP A;  2Q8H A;  1GKX A;  4HY1 A;  3Q5K A;  3GIF A;  4QPJ A;  4HYP A;  2IOQ A;  3OWB A;  4B6C A;  4XKK A;  4LWE A;  4ASA A;  2YE4 A;  5FNF A;  2CGF A;  2E0A A;  4XE2 A;  1UYM A;  1UYG A;  1AMW A;  5J71 A;  2HHI A;  3INX A;  3EHJ A;  5M4K A;  3R92 A;  1Y4U A;  1UYH A;  4EMV A;  3A0W A;  4L93 A;  5J6A A;  3T0Z A;  2BU2 A;  2ESA A;  4PU9 A;  3O6O A;  3Q5J A;  1AM1 A;  2XDU A;  4LP0 A;  2XDS A;  5L3J A;  4HXZ A;  2YK9 A;  4XIT A;  3LPS A;  5FNC A;  4CE3 A;  2Q8G A;  5D6Q A;  1NHJ A;  5IDJ A;  2QFO A;  1QYE A;  3R4N A;  3VAD A;  4KQV A;  1GKZ A;  2QG0 A;  1H7S A;  4H85 A;  4CWQ A;  3K97 A;  3K99 A;  4Q20 A;  2WEQ A;  4R3A A;  1UYL A;  3GIG B;  3R4P A;  4DZY A;  4WUD A;  1Y8P A;  4ZVI A;  4BQJ A;  4GGL A;  3A0X A;  3RLR A;  1I5A A;  4GFN A;  2VWC A;  5CPH A;  2XD6 A;  3TZ2 A;  4YKX A;  1BGQ A;  2XJX A;  5BOC A;  2H8M A;  2WI7 A;  3A0Z A;  4U93 A;  4I5S A;  1BXD A;  1B63 A;  3CWV A;  3C0E A;  3K98 A;  4L8Z A;  4BIZ A;  5CTU A;  2YKB A;  2ZDX A;  3NMQ A;  3T10 A;  2YEF A;  2BRE A;  1YT1 A;  4YKQ A;  5D7R A;  4EGI A;  2ZDY A;  4X9L A;  2Q2E B;  3OWD A;  1QZR A;  3B26 A;  3EHG A;  3EHF A;  4W7T A;  3S5T A;  2XDL A;  1MU5 A;  4K4O A;  2WI4 A;  3TZ5 A;  1EA6 A;  3VHC A;  1Z5C A;  2XHX A;  3FT8 A;  2AKP A;  3R91 A;  4GCZ A;  2WER A;  4XKO A;  4LWH A;  2XX4 A;  4E00 A;  2WI5 A;  1H7U A;  4WUC A;  1MX0 A;  1YT2 A;  5CTY A;  4PRV A;  2YEB A;  2WI3 A;  4E72 A;  1PVG A;  1F51 A;  3ZKD A;  4L94 A;  4YKT A;  4XDM A;  2YEA A;  5C93 A;  2YEJ A;  2YI5 A;  3VHA A;  3MNR P;  3QTF A;  1AH6 A;  4HXW A;  3CYG A;  1I59 A;  2YEC A;  3INW A;  2YED A;  1B62 A;  4V26 A;  4MPN A;  1YS3 A;  2YI6 A;  4XD8 A;  2H55 A;  4P7A A;  1S14 A;  1I58 A;  2WI6 A;  1UY8 A;  4MP2 A;  4YKR A;  5F3K A;  2C1G A;  1GJV A;  3PEH A;  4HYM A;  3RLP A;  3BMY A;  1I5D A;  2YKE A;  4AWQ A;  3D36 A;  4O04 A;  2QF6 A;  5FWK A;  4YKZ A;  2YKC A;  3A0T A;  5F5R A;  4BQG A;  5M4M A;  3D2R A;  3TZ0 A;  3RKZ A;  2ZKJ A;  2Q8I A;  3TTZ A;  1US7 A;  2IOP A;  4E02 A;  2XJG A;  1KZN A;  2WEP A;  1R62 A;  1THN A;  4LPB A;  1YER A;  4HZ5 A;  2PNR A;  4YKY A;  3SL2 A;  1L0O A;  2O1U A;  2FWZ A;  4WUB A;  4GEE A;  3T2S A;  2BSM A;  2CCT A;  4I3H A;  4URN A;  3OMU A;  1TIL A;  4R1F A;  3EHH A;  4AWP A;  3EKO A;  2YE2 A;  1ZXM A;  2YEI A;  3G75 A;  2BTZ A;  2BU7 A;  3FT5 A;  2WI1 A;  3B24 A;  4NH7 A;  3HEK A;  1A4H A;  3D0B A;  1U0Z A;  2IWU A;  4FMT A;  2CCU A;  4ASG A;  2YJW A;  4V25 A;  4XTJ A;  2YKI A;  5GGZ A;  2YK2 A;  4O05 A;  2YGE A;  4MP7 A;  1I5B A;  1UY6 A;  4E01 A;  2YEH A;  5D7C A;  2YKJ A;  5CF0 A;  2YE5 A;  2HCH A;  1UYD A;  3FV5 A;  4P8O A;  4DUH A;  5JEN A;  2YE6 A;  2YI0 A;  3CGZ A;  4BXI A;  2YI7 A;  1UYK A;  1BYQ A;  2FWY A;  2XK2 A;  1EI1 A;  1YC4 A;  2UWD A;  1Y8N A;  4NH8 A;  4U7O A;  3IED A;  2YEE A;  3T1K A;  1S16 A;  1AH8 A;  3OPD A;  4MOT A;  2XX5 A;  4KSG A;  3CRK A;  1UYI A;  1KIJ A;  2C2A A;  4FCQ A;  1UYF A;  4URM A;  1YT0 A;  3CRL A;  2EXL A;  4YKW A;  1ZXN A;  3HZ1 A;  5FND A;  2CCS A;  2YE3 A;  3GIG A;  4XKA A;  4AWO A;  1Y8O A;  2JKI A;  5IDM A;  2CH4 A;  2IWS A;  4FPP A;  3ZM7 A;  3HYZ A;  4H81 A;  4BAE A;  4QPK A;  3DGE A;  2C1I A;  2BYI A;  4CWR A;  2BU5 A;  3LMM A;  1Z59 A;  1YSZ A;  2YGF A;  3B25 A;  3B27 A;  4JQL A;  4H7Q A;  2XDX A;  3HHU A;  2HKJ A;  1AJ6 A;  1TH8 A;  2XAB A;  4FCP A;  5CTW A;  4B7P A;  3HZ5 A;  3U2K A;  2XDK A;  1YSR A;  2O1W A;  2CG9 A;  4PL9 A;  1TC0 A;  4MPE A;  2K5B A;  5IN9 A;  1YES A;  3G7E A;  3R4O A;  3EKR A;  3TZ4 A;  3KE6 A;  4KP4 A;  2FXS A;  4XCJ A;  3LNU A;  1Z5B A;  2XCM A;  3ZXQ A;  2BU8 A;  2YE7 A;  4CWF A;  4ASB A;  2VW5 A;  4GQT A;  4EEH A;  3OW6 A;  4XC0 A;  4HZ0 A;  2XHT A;  4XCL A;  3T0H A;  2YGA A;  5M4P A;  2XX2 A;  1ZWH A;  4CWO A;  4AS9 A;  4XIQ A;  3HYY A;  4ZKI A;  4U7N A;  4MB9 A;  3RLQ A;  4KSH A;  1UYE A;  1YC3 A;  4LWF A;  4KTN A;  4EGK A;  4ASF A;  3CGY A;  5D6P A;  4CE2 A;  4JAU A;  4L90 A;  3U67 A;  1YC1 A;  2VCI A;  4EGH A;  5CTX A;  4LWG A;  2BRC A;  4JAS A;  4O07 A;  2XHR A;  2YEG A;  2ZBK B;  3O0I A;  3ZXO A;  3A0R A;  1JM6 A;  4R3M A;  2XJJ A;  2YE8 A;  1QY8 A;  5M4H A;  1OSF A;  1TBW A;  4CWS A;  3O2F A;  4KFG A;  2BU6 A; 
#chains in the Genus database with same CATH homology
 4CE1 A;  4BIU A;  3QDD A;  3B28 A;  4PRX A;  3ZKB A;  3TUH A;  1UY7 A;  4MBC A;  1NHH A;  2O1V A;  2QG2 A;  4O09 A;  4EFT A;  2VCJ A;  2HG1 A;  1B3Q A;  4JAV A;  3JZ3 A;  1BKN A;  3A0Y A;  5D7D A;  2IWX A;  3C11 A;  4L91 A;  4CWP A;  4FCR A;  3Q5L A;  2Q8F A;  4CWN A;  2GQP A;  1UY9 A;  2FYP A;  1YET A;  2BZ5 A;  1TC6 A;  1U2O A;  4URL A;  3U2D A;  1ID0 A;  2GFD A;  3G7B A;  4CWT A;  4GT8 A;  2YJX A;  1I5C A;  5BOD A;  4MPC A;  3H80 A;  3BM9 A;  5M4N A;  4EFU A;  4XIR A;  3WHA A;  4O0B A;  4YKU A;  2BYH A;  1ZW9 A;  4URO A;  5M4E A;  1UYC A;  2JJC A;  4EM7 A;  3VHD A;  2IOR A;  3H4L A;  3R4M A;  3GIE A;  3WQ9 A;  4NH9 A;  4LWI A;  3PEJ A;  2WI2 A;  4HY6 A;  2YE9 A;  3K60 A;  1Z5A A;  1NHI A;  1TID A;  1Y4S A;  2BT0 A;  4XIP A;  2Q8H A;  1GKX A;  4HY1 A;  3Q5K A;  3GIF A;  4QPJ A;  4HYP A;  2IOQ A;  3OWB A;  4B6C A;  4XKK A;  4LWE A;  4ASA A;  2YE4 A;  5FNF A;  2CGF A;  2E0A A;  4XE2 A;  1UYM A;  1UYG A;  1AMW A;  5J71 A;  3INX A;  3EHJ A;  5M4K A;  3R92 A;  1Y4U A;  1UYH A;  4EMV A;  3A0W A;  4L93 A;  5J6A A;  3T0Z A;  2BU2 A;  2ESA A;  4PU9 A;  3O6O A;  3Q5J A;  1AM1 A;  2XDU A;  4LP0 A;  2XDS A;  5L3J A;  4HXZ A;  2YK9 A;  4XIT A;  3LPS A;  5FNC A;  4CE3 A;  2Q8G A;  5D6Q A;  1NHJ A;  5IDJ A;  2QFO A;  1QYE A;  3R4N A;  3VAD A;  4KQV A;  1GKZ A;  2QG0 A;  1H7S A;  4H85 A;  4CWQ A;  3K97 A;  3K99 A;  4Q20 A;  2WEQ A;  4R3A A;  1UYL A;  3GIG B;  3R4P A;  4DZY A;  4WUD A;  1Y8P A;  4ZVI A;  4BQJ A;  4GGL A;  3A0X A;  3RLR A;  1I5A A;  4GFN A;  2VWC A;  5CPH A;  2XD6 A;  3TZ2 A;  4YKX A;  1BGQ A;  2XJX A;  5BOC A;  2H8M A;  2WI7 A;  3A0Z A;  4U93 A;  4I5S A;  1BXD A;  1B63 A;  3CWV A;  3C0E A;  3K98 A;  4L8Z A;  4BIZ A;  5CTU A;  2YKB A;  2ZDX A;  3NMQ A;  3T10 A;  2YEF A;  2BRE A;  1YT1 A;  4YKQ A;  5D7R A;  4EGI A;  2ZDY A;  4X9L A;  2Q2E B;  3OWD A;  1QZR A;  3B26 A;  3EHG A;  3EHF A;  4W7T A;  2XDL A;  1MU5 A;  4K4O A;  2WI4 A;  3TZ5 A;  1EA6 A;  3VHC A;  1Z5C A;  2XHX A;  3FT8 A;  2AKP A;  3R91 A;  4GCZ A;  2WER A;  4XKO A;  4LWH A;  2XX4 A;  4E00 A;  2WI5 A;  1H7U A;  4WUC A;  1MX0 A;  1YT2 A;  5CTY A;  4PRV A;  2YEB A;  2WI3 A;  1PVG A;  3ZKD A;  4L94 A;  4YKT A;  4XDM A;  2YEA A;  5C93 A;  2YEJ A;  2YI5 A;  3VHA A;  3MNR P;  3QTF A;  1AH6 A;  4HXW A;  1I59 A;  2YEC A;  3INW A;  2YED A;  1B62 A;  4V26 A;  4MPN A;  1YS3 A;  2YI6 A;  4XD8 A;  2H55 A;  4P7A A;  1S14 A;  1I58 A;  2WI6 A;  1UY8 A;  4MP2 A;  4YKR A;  5F3K A;  1GJV A;  3PEH A;  4HYM A;  3RLP A;  3BMY A;  1I5D A;  2YKE A;  4AWQ A;  3D36 A;  4O04 A;  2QF6 A;  5FWK A;  4YKZ A;  2YKC A;  3A0T A;  5F5R A;  4BQG A;  5M4M A;  3D2R A;  3TZ0 A;  3RKZ A;  2ZKJ A;  2Q8I A;  3TTZ A;  1US7 A;  2IOP A;  4E02 A;  2XJG A;  1KZN A;  2WEP A;  1R62 A;  1THN A;  4LPB A;  1YER A;  4HZ5 A;  2PNR A;  4YKY A;  3SL2 A;  1L0O A;  2O1U A;  2FWZ A;  4WUB A;  4GEE A;  3T2S A;  2BSM A;  2CCT A;  4I3H A;  4URN A;  3OMU A;  1TIL A;  4R1F A;  3EHH A;  4AWP A;  3EKO A;  2YE2 A;  1ZXM A;  2YEI A;  3G75 A;  2BTZ A;  2BU7 A;  3FT5 A;  2WI1 A;  3B24 A;  4NH7 A;  3HEK A;  1A4H A;  3D0B A;  1U0Z A;  2IWU A;  4FMT A;  2CCU A;  4ASG A;  2YJW A;  4V25 A;  4XTJ A;  2YKI A;  5GGZ A;  2YK2 A;  4O05 A;  2YGE A;  4MP7 A;  1I5B A;  1UY6 A;  4E01 A;  2YEH A;  5D7C A;  2YKJ A;  5CF0 A;  2YE5 A;  2HCH A;  1UYD A;  3FV5 A;  4P8O A;  4DUH A;  2YE6 A;  2YI0 A;  3CGZ A;  4BXI A;  2YI7 A;  1UYK A;  1BYQ A;  2FWY A;  2XK2 A;  1EI1 A;  1YC4 A;  2UWD A;  1Y8N A;  4NH8 A;  4U7O A;  3IED A;  2YEE A;  3T1K A;  1S16 A;  1AH8 A;  3OPD A;  4MOT A;  2XX5 A;  4KSG A;  3CRK A;  1UYI A;  1KIJ A;  2C2A A;  4FCQ A;  1UYF A;  4URM A;  1YT0 A;  3CRL A;  2EXL A;  4YKW A;  1ZXN A;  3HZ1 A;  5FND A;  2CCS A;  2YE3 A;  3GIG A;  4XKA A;  4AWO A;  1Y8O A;  2JKI A;  5IDM A;  2CH4 A;  2IWS A;  4FPP A;  3ZM7 A;  3HYZ A;  4H81 A;  4BAE A;  4QPK A;  3DGE A;  4CWR A;  2BYI A;  2BU5 A;  1Z59 A;  1YSZ A;  2YGF A;  3B25 A;  3B27 A;  4JQL A;  4H7Q A;  2XDX A;  3HHU A;  2HKJ A;  1AJ6 A;  1TH8 A;  2XAB A;  4FCP A;  5CTW A;  4B7P A;  3HZ5 A;  3U2K A;  2XDK A;  1YSR A;  2O1W A;  2CG9 A;  4PL9 A;  1TC0 A;  4MPE A;  2K5B A;  5IN9 A;  1YES A;  3G7E A;  3R4O A;  3EKR A;  3TZ4 A;  3KE6 A;  4KP4 A;  2FXS A;  4XCJ A;  3LNU A;  1Z5B A;  2XCM A;  3ZXQ A;  2BU8 A;  2YE7 A;  4CWF A;  4ASB A;  2VW5 A;  4GQT A;  4EEH A;  3OW6 A;  4XC0 A;  4HZ0 A;  2XHT A;  4XCL A;  3T0H A;  2YGA A;  5M4P A;  2XX2 A;  1ZWH A;  4CWO A;  4AS9 A;  4XIQ A;  3HYY A;  4ZKI A;  4U7N A;  4MB9 A;  3RLQ A;  4KSH A;  1UYE A;  1YC3 A;  4LWF A;  4KTN A;  4EGK A;  4ASF A;  3CGY A;  5D6P A;  4CE2 A;  4JAU A;  4L90 A;  3U67 A;  1YC1 A;  2VCI A;  4EGH A;  5CTX A;  4LWG A;  2BRC A;  4JAS A;  4O07 A;  2XHR A;  2YEG A;  2ZBK B;  3O0I A;  3ZXO A;  3A0R A;  1JM6 A;  4R3M A;  2XJJ A;  2YE8 A;  1QY8 A;  5M4H A;  1OSF A;  1TBW A;  4CWS A;  3O2F A;  4KFG A;  2BU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...