1TBWA

Ligand induced conformational shift in the n-terminal domain of grp94, open conformation
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
225
structure length
222
Chain Sequence
b'FAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTGKTVWDWELMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title Ligand-induced Conformational Shift in the N-terminal Domain of GRP94, an Hsp90 Chaperone.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 75
structure length 222
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1tbwA00
3B24A 2IOPA 4CWRA 2VCIA 4MPNA 3MNRP 1AMWA 3TZ4A 3ZM7A 1QYEA 1GJVA 2YJWA 5F5RA 3R4MA 3PEJA 1Z5BA 2ESAA 2YE3A 4KFGA 4EFTA 4XE2A 3TZ5A 1Z5AA 2Q8GA 4I3HA 4JAVA 4MPCA 3KE6A 2HKJA 1UYKA 3O2FA 3K98A 1US7A 1B62A 2JJCA 4YKYA 2CG9A 5C93A 2O1VA 2YEEA 3R4NA 4JASA 3WQ9A 4GCZA 4O0BA 1EA6A 3K60A 4H81A 4NH8A 3TZ0A 1AH8A 3D0BA 1BXDA 2BYIA 2VCJA 4HZ0A 4KP4A 3O0IA 3A0TA 1KIJA 2IORA 2XDSA 4R1FA 1UYHA 4U7OA 3O6OA 2FXSA 1UYDA 5CF0A 1QZRA 3SL2A 1U0ZA 2CCTA 5D7RA 3T2SA 1B63A 3CGYA 2O1WA 1I5AA 1YESA 2XX2A 3HYYA 3C11A 4JAUA 1AJ6A 4CWOA 3Q5KA 4B7PA 4L94A 4XIPA 1UYIA 4LWHA 4NH9A 3RLPA 1TIDA 4AWQA 4R3AA 4EMVA 1EI1A 1A4HA 2XK2A 1ID0A 2BU2A 3CWVA 4EM7A 5D7DA 1TBWA 2YE5A 1GKXA 2YE7A 3OPDA 4QPJA 1YC4A 5D6QA 4GQTA 4GT8A 4MP7A 3T0HA 3RLRA 2O1UA 2BU5A 2BYHA 3Q5JA 3TTZA 2Q8HA 4ASFA 1YERA 4W7TA 3ZKBA 3EHGA 4XKKA 2HG1A 3GIGB 4MPEA 2QG2A 2YKBA 4ZKIA 4CE2A 2ZDXA 3QTFA 3GIGA 2CCUA 3OWDA 5J6AA 2BTZA 2WI1A 2H55A 3CRKA 3GIFA 4XCJA 1NHIA 1Z5CA 3CGZA 2CGFA 2YKJA 3HHUA 2YI5A 5CTUA 1OSFA 5BOCA 4EGHA 4GEEA 3QDDA 3T0ZA 4LPBA 1TILA 4CWSA 3U2DA 3OMUA 1R62A 2XHTA 2WI4A 4R3MA 4YKUA 4EGKA 5IDMA 2AKPA 4V26A 5FNCA 4MBCA 3PEHA 4WUDA 2WI6A 5IDJA 3ZXQA 4FCRA 2YKIA 2WI7A 1I5DA 1I5CA 2H8MA 3OWBA 4HY1A 1MX0A 2XABA 2YEFA 4YKZA 4XKAA 3BMYA 4URLA 2YEAA 2WEQA 2ZBKB 1NHJA 3OW6A 2WI2A 4XD8A 3B25A 4HXWA 2BSMA 4WUBA 3T10A 2EXLA 3A0XA 4CWFA 3G7EA 5FNDA 1YSZA 2Q8IA 1I5BA 4XDMA 2ZKJA 4UROA 5F3KA 2YI0A 1BKNA 1YETA 1S14A 3BM9A 5CPHA 4YKWA 1NHHA 4CE3A 3A0ZA 4ZVIA 3HZ1A 4P7AA 2C2AA 4XITA 4CWNA 4BIZA 4HYPA 3U2KA 3A0WA 4PRVA 3GIEA 4PU9A 2XJGA 3CRLA 2BZ5A 4CWPA 2XDUA 3VHAA 1UY7A 2YGEA 5M4EA 3R91A 2WERA 2YKCA 2PNRA 2K5BA 5CTYA 1UY8A 1ZWHA 4HZ5A 4ASAA 4XCLA 3B26A 2GQPA 2XDKA 2YEIA 2BU7A 1B3QA 4QPKA 5BODA 1UYEA 2CCSA 2XDXA 4PRXA 2YI7A 3T1KA 1BYQA 1YT2A 2HCHA 1UY6A 2WEPA 4O04A 4BXIA 4B6CA 2Q2EB 3ZXOA 2BU8A 1QY8A 4EEHA 4BQGA 1YT0A 2JKIA 3RKZA 4U93A 4HY6A 3K97A 4KTNA 2FWYA 2YK2A 4XKOA 4XIQA 2QFOA 5M4PA 4V25A 4Q20A 3R92A 3EKOA 2FYPA 2Q8FA 3VHCA 4DUHA 3R4OA 2GFDA 4BAEA 1Y4SA 4GFNA 3B27A 2YE6A 1Z59A 2VWCA 5FWKA 4CWQA 4KQVA 3EKRA 1YC3A 4H7QA 1Y8OA 3H4LA 5D7CA 5L3JA 5M4NA 1L0OA 4LWFA 3U67A 2YJXA 1THNA 1H7UA 4FPPA 4K4OA 5IN9A 4X9LA 3EHHA 4HYMA 1GKZA 2XJJA 4BIUA 1JM6A 3HEKA 4I5SA 2YEBA 2IOQA 2CH4A 4L90A 3LPSA 3Q5LA 3JZ3A 4E02A 1YC1A 1MU5A 5CTXA 4FCPA 4O09A 5FNFA 2WI5A 1BGQA 2XJXA 3G7BA 4HXZA 4KSGA 1Y8NA 2WI3A 4XC0A 2XX4A 1YSRA 2E0AA 3FT5A 2YKEA 3HZ5A 1AM1A 1I59A 3FV5A 3R4PA 4H85A 1YT1A 3INWA 3DGEA 5CTWA 1UYCA 1Y4UA 4KSHA 4L93A 2QF6A 1ZXMA 3FT8A 1U2OA 1TC6A 1ZXNA 5M4MA 4O05A 3H80A 4MOTA 1KZNA 3K99A 2FWZA 4LP0A 3ZKDA 3IEDA 1I58A 4DZYA 2YI6A 3B28A 1Y8PA 4XIRA 4PL9A 2IWXA 3VADA 4XTJA 4CE1A 3G75A 5M4HA 1UYMA 2YEGA 3A0RA 2YGAA 4MB9A 2IWSA 2YEJA 4EGIA 2XHRA 2YK9A 4YKRA 4O07A 4LWIA 2BRCA 1TC0A 3VHDA 3D36A 1S16A 3LNUA 4YKTA 4GGLA 1YS3A 4LWEA 2XD6A 4AWPA 2BU6A 1UYGA 3HYZA 2YEHA 4L8ZA 5M4KA 2XDLA 2BREA 2YE4A 4ASBA 4AS9A 1UYLA 2YGFA 3C0EA 2IWUA 4ASGA 4U7NA 2VW5A 2YE2A 4URMA 4YKXA 2QG0A 5GGZA 3RLQA 1H7SA 3NMQA 1PVGA 3EHFA 1UY9A 3TZ2A 2YE8A 1TH8A 3A0YA 4LWGA 4YKQA 4WUCA 2XX5A 3EHJA 2BT0A 4URNA 4BQJA 3INXA 4FCQA 4CWTA 4E01A 4E00A 1AH6A 4AWOA 2YE9A 5J71A 3TUHA 3D2RA 4MP2A 5D6PA 1ZW9A 2YECA 4P8OA 1UYFA 2UWDA 2XHXA 2ZDYA 2YEDA 2XCMA 4L91A 4NH7A 3WHAA 4EFUA 4JQLA 4FMTA
chains in the Genus database with same CATH superfamily
3B24A 2IOPA 4CWRA 2VCIA 4MPNA 3MNRP 1AMWA 3TZ4A 3ZM7A 1QYEA 1GJVA 2YJWA 5F5RA 3R4MA 3PEJA 1Z5BA 2ESAA 2YE3A 4KFGA 4EFTA 4XE2A 3TZ5A 1Z5AA 2C1IA 2Q8GA 4I3HA 4JAVA 4MPCA 3KE6A 2HKJA 1UYKA 3O2FA 3K98A 1US7A 1B62A 2JJCA 4YKYA 2CG9A 5C93A 2O1VA 2YEEA 3R4NA 4JASA 3WQ9A 4GCZA 4O0BA 1EA6A 3K60A 4H81A 4NH8A 3TZ0A 1AH8A 3D0BA 1BXDA 2BYIA 2VCJA 4HZ0A 4KP4A 3O0IA 3A0TA 1KIJA 2IORA 2XDSA 4R1FA 1UYHA 4U7OA 3O6OA 2FXSA 1UYDA 5CF0A 1QZRA 3SL2A 1U0ZA 2CCTA 5D7RA 3T2SA 1B63A 3CGYA 2O1WA 1I5AA 1YESA 2XX2A 3HYYA 3C11A 4JAUA 1AJ6A 4CWOA 3Q5KA 4B7PA 4L94A 4XIPA 1UYIA 4LWHA 4NH9A 3RLPA 1TIDA 4AWQA 4R3AA 4EMVA 1EI1A 1A4HA 2XK2A 1ID0A 2BU2A 3CWVA 4EM7A 5D7DA 1TBWA 2YE5A 1GKXA 2YE7A 3OPDA 4QPJA 1YC4A 5D6QA 4GQTA 4GT8A 4MP7A 3T0HA 3RLRA 2O1UA 2BU5A 2BYHA 3Q5JA 3TTZA 2Q8HA 4ASFA 1YERA 4W7TA 3ZKBA 3EHGA 3CYGA 4XKKA 2HG1A 3GIGB 4MPEA 2QG2A 2YKBA 4ZKIA 4CE2A 2ZDXA 3QTFA 3GIGA 2CCUA 3OWDA 5J6AA 2BTZA 2WI1A 2H55A 3CRKA 3GIFA 4XCJA 1NHIA 1Z5CA 3CGZA 2CGFA 2YKJA 3HHUA 2YI5A 5CTUA 1OSFA 5BOCA 4EGHA 4GEEA 3QDDA 3T0ZA 4LPBA 1TILA 4CWSA 3U2DA 3OMUA 1R62A 2XHTA 2WI4A 4R3MA 4YKUA 4EGKA 5IDMA 1F51A 2AKPA 4V26A 5FNCA 2HHIA 4MBCA 3PEHA 4WUDA 2WI6A 5IDJA 3ZXQA 4FCRA 2YKIA 2WI7A 1I5DA 1I5CA 2H8MA 3OWBA 4HY1A 1MX0A 2XABA 2YEFA 2FTKA 4YKZA 4XKAA 3BMYA 4URLA 2YEAA 2WEQA 2ZBKB 1NHJA 3OW6A 2WI2A 4XD8A 3B25A 4HXWA 2BSMA 4WUBA 3T10A 2EXLA 3A0XA 4CWFA 3G7EA 5FNDA 1YSZA 2Q8IA 1I5BA 4XDMA 2ZKJA 4UROA 5F3KA 2YI0A 1BKNA 1YETA 1S14A 3BM9A 5CPHA 4YKWA 1NHHA 4CE3A 3A0ZA 4ZVIA 3HZ1A 4P7AA 2C2AA 4XITA 4CWNA 4BIZA 4HYPA 3U2KA 3LMMA 3A0WA 4PRVA 3GIEA 4PU9A 2XJGA 3CRLA 2BZ5A 4CWPA 2XDUA 3VHAA 1UY7A 2YGEA 5M4EA 3R91A 1IXMA 2WERA 2YKCA 2PNRA 2K5BA 5CTYA 1UY8A 1ZWHA 4HZ5A 4ASAA 4XCLA 3B26A 2GQPA 2XDKA 2YEIA 2BU7A 1B3QA 4QPKA 5BODA 1UYEA 2CCSA 2XDXA 4PRXA 2YI7A 3T1KA 1BYQA 1YT2A 2HCHA 1UY6A 2WEPA 4O04A 4BXIA 4B6CA 2Q2EB 3ZXOA 2BU8A 1QY8A 4EEHA 4BQGA 1YT0A 2JKIA 3RKZA 4U93A 4HY6A 3K97A 4KTNA 2FWYA 2YK2A 4XKOA 4XIQA 2QFOA 5M4PA 4V25A 4Q20A 3R92A 3EKOA 2FYPA 2Q8FA 3VHCA 4DUHA 3R4OA 2GFDA 4BAEA 1Y4SA 4GFNA 3B27A 2YE6A 1Z59A 2VWCA 5FWKA 4CWQA 4KQVA 3EKRA 1YC3A 4H7QA 1Y8OA 3H4LA 5D7CA 5L3JA 5M4NA 1L0OA 4LWFA 3U67A 2YJXA 1THNA 1H7UA 4FPPA 4K4OA 5IN9A 4X9LA 3EHHA 4HYMA 1GKZA 2XJJA 4BIUA 1JM6A 3HEKA 4I5SA 2YEBA 2IOQA 2CH4A 4L90A 5JENA 3LPSA 2C1GA 3Q5LA 3JZ3A 4E02A 1YC1A 1MU5A 5CTXA 4FCPA 4O09A 5FNFA 2WI5A 1BGQA 2XJXA 3G7BA 4HXZA 4KSGA 1Y8NA 2WI3A 4XC0A 2XX4A 1YSRA 2E0AA 3FT5A 2YKEA 3HZ5A 1AM1A 3S5TA 1I59A 3FV5A 3R4PA 4H85A 1YT1A 3INWA 3DGEA 5CTWA 1UYCA 1Y4UA 4KSHA 4L93A 2QF6A 1ZXMA 3FT8A 1U2OA 1TC6A 1ZXNA 5M4MA 4O05A 3H80A 4MOTA 1KZNA 3K99A 2FWZA 4LP0A 3ZKDA 3IEDA 1I58A 4DZYA 2YI6A 3B28A 1Y8PA 4XIRA 4PL9A 2IWXA 3VADA 4XTJA 4CE1A 3G75A 5M4HA 1UYMA 2YEGA 3A0RA 2YGAA 4MB9A 2IWSA 2YEJA 4E72A 4EGIA 2XHRA 2YK9A 4YKRA 4O07A 4LWIA 2BRCA 1TC0A 3VHDA 3D36A 1S16A 3LNUA 4YKTA 4GGLA 1YS3A 4LWEA 2XD6A 4AWPA 2BU6A 1UYGA 3HYZA 2YEHA 4L8ZA 5M4KA 2XDLA 2BREA 2YE4A 4ASBA 4AS9A 1UYLA 2YGFA 3C0EA 2IWUA 4ASGA 4U7NA 2VW5A 2YE2A 4URMA 4YKXA 2QG0A 5GGZA 3RLQA 1H7SA 3NMQA 1PVGA 3EHFA 1UY9A 3TZ2A 2YE8A 1TH8A 3A0YA 4LWGA 4YKQA 4WUCA 2XX5A 3EHJA 2BT0A 4URNA 4BQJA 3INXA 4FCQA 4CWTA 4E01A 4E00A 1AH6A 4AWOA 2YE9A 5J71A 3TUHA 3D2RA 4MP2A 5D6PA 1ZW9A 2YECA 4P8OA 1UYFA 2UWDA 2XHXA 2ZDYA 2YEDA 2XCMA 4L91A 4NH7A 3WHAA 4EFUA 4JQLA 4FMTA
chains in the Genus database with same CATH topology
3B24A 2IOPA 4CWRA 2VCIA 4MPNA 3MNRP 1AMWA 3TZ4A 3ZM7A 1QYEA 1GJVA 2YJWA 5F5RA 3R4MA 3PEJA 1Z5BA 2ESAA 2YE3A 4KFGA 4EFTA 4XE2A 3TZ5A 1Z5AA 2Q8GA 4I3HA 4JAVA 4MPCA 3KE6A 2HKJA 1UYKA 3O2FA 3K98A 1US7A 1B62A 2JJCA 4YKYA 2CG9A 5C93A 2O1VA 2YEEA 3R4NA 4JASA 3WQ9A 4GCZA 4O0BA 1EA6A 3K60A 4H81A 4NH8A 3TZ0A 1AH8A 3D0BA 1BXDA 2BYIA 2VCJA 4HZ0A 4KP4A 3O0IA 3A0TA 1KIJA 2IORA 2XDSA 4R1FA 1UYHA 4U7OA 3O6OA 2FXSA 1UYDA 5CF0A 1QZRA 3SL2A 1U0ZA 2CCTA 5D7RA 3T2SA 1B63A 3CGYA 2O1WA 1I5AA 1YESA 2XX2A 3HYYA 3C11A 4JAUA 1AJ6A 4CWOA 3Q5KA 4B7PA 4L94A 4XIPA 1UYIA 4LWHA 4NH9A 3RLPA 1TIDA 4AWQA 4R3AA 4EMVA 1EI1A 1A4HA 2XK2A 1ID0A 2BU2A 3CWVA 4EM7A 5D7DA 1TBWA 2YE5A 1GKXA 2YE7A 3OPDA 4QPJA 1YC4A 5D6QA 4GQTA 4GT8A 4MP7A 3T0HA 3RLRA 2O1UA 2BU5A 2BYHA 3Q5JA 3TTZA 2Q8HA 4ASFA 1YERA 4W7TA 3ZKBA 3EHGA 4XKKA 2HG1A 3GIGB 4MPEA 2QG2A 2YKBA 4ZKIA 4CE2A 2ZDXA 3QTFA 3GIGA 2CCUA 3OWDA 5J6AA 2BTZA 2WI1A 2H55A 3CRKA 3GIFA 4XCJA 1NHIA 1Z5CA 3CGZA 2CGFA 2YKJA 3HHUA 2YI5A 5CTUA 1OSFA 5BOCA 4EGHA 4GEEA 3QDDA 3T0ZA 4LPBA 1TILA 4CWSA 3U2DA 3OMUA 1R62A 2XHTA 2WI4A 4R3MA 4YKUA 4EGKA 5IDMA 2AKPA 4V26A 5FNCA 4MBCA 3PEHA 4WUDA 2WI6A 5IDJA 3ZXQA 4FCRA 2YKIA 2WI7A 1I5DA 1I5CA 2H8MA 3OWBA 4HY1A 1MX0A 2XABA 2YEFA 4YKZA 4XKAA 3BMYA 4URLA 2YEAA 2WEQA 2ZBKB 1NHJA 3OW6A 2WI2A 4XD8A 3B25A 4HXWA 2BSMA 4WUBA 3T10A 2EXLA 3A0XA 4CWFA 3G7EA 5FNDA 1YSZA 2Q8IA 1I5BA 4XDMA 2ZKJA 4UROA 5F3KA 2YI0A 1BKNA 1YETA 1S14A 3BM9A 5CPHA 4YKWA 1NHHA 4CE3A 3A0ZA 4ZVIA 3HZ1A 4P7AA 2C2AA 4XITA 4CWNA 4BIZA 4HYPA 3U2KA 3A0WA 4PRVA 3GIEA 4PU9A 2XJGA 3CRLA 2BZ5A 4CWPA 2XDUA 3VHAA 1UY7A 2YGEA 5M4EA 3R91A 2WERA 2YKCA 2PNRA 2K5BA 5CTYA 1UY8A 1ZWHA 4HZ5A 4ASAA 4XCLA 3B26A 2GQPA 2XDKA 2YEIA 2BU7A 1B3QA 4QPKA 5BODA 1UYEA 2CCSA 2XDXA 4PRXA 2YI7A 3T1KA 1BYQA 1YT2A 2HCHA 1UY6A 2WEPA 4O04A 4BXIA 4B6CA 2Q2EB 3ZXOA 2BU8A 1QY8A 4EEHA 4BQGA 1YT0A 2JKIA 3RKZA 4U93A 4HY6A 3K97A 4KTNA 2FWYA 2YK2A 4XKOA 4XIQA 2QFOA 5M4PA 4V25A 4Q20A 3R92A 3EKOA 2FYPA 2Q8FA 3VHCA 4DUHA 3R4OA 2GFDA 4BAEA 1Y4SA 4GFNA 3B27A 2YE6A 1Z59A 2VWCA 5FWKA 4CWQA 4KQVA 3EKRA 1YC3A 4H7QA 1Y8OA 3H4LA 5D7CA 5L3JA 5M4NA 1L0OA 4LWFA 3U67A 2YJXA 1THNA 1H7UA 4FPPA 4K4OA 5IN9A 4X9LA 3EHHA 4HYMA 1GKZA 2XJJA 4BIUA 1JM6A 3HEKA 4I5SA 2YEBA 2IOQA 2CH4A 4L90A 3LPSA 3Q5LA 3JZ3A 4E02A 1YC1A 1MU5A 5CTXA 4FCPA 4O09A 5FNFA 2WI5A 1BGQA 2XJXA 3G7BA 4HXZA 4KSGA 1Y8NA 2WI3A 4XC0A 2XX4A 1YSRA 2E0AA 3FT5A 2YKEA 3HZ5A 1AM1A 1I59A 3FV5A 3R4PA 4H85A 1YT1A 3INWA 3DGEA 5CTWA 1UYCA 1Y4UA 4KSHA 4L93A 2QF6A 1ZXMA 3FT8A 1U2OA 1TC6A 1ZXNA 5M4MA 4O05A 3H80A 4MOTA 1KZNA 3K99A 2FWZA 4LP0A 3ZKDA 3IEDA 1I58A 4DZYA 2YI6A 3B28A 1Y8PA 4XIRA 4PL9A 2IWXA 3VADA 4XTJA 4CE1A 3G75A 5M4HA 1UYMA 2YEGA 3A0RA 2YGAA 4MB9A 2IWSA 2YEJA 4EGIA 2XHRA 2YK9A 4YKRA 4O07A 4LWIA 2BRCA 1TC0A 3VHDA 3D36A 1S16A 3LNUA 4YKTA 4GGLA 1YS3A 4LWEA 2XD6A 4AWPA 2BU6A 1UYGA 3HYZA 2YEHA 4L8ZA 5M4KA 2XDLA 2BREA 2YE4A 4ASBA 4AS9A 1UYLA 2YGFA 3C0EA 2IWUA 4ASGA 4U7NA 2VW5A 2YE2A 4URMA 4YKXA 2QG0A 5GGZA 3RLQA 1H7SA 3NMQA 1PVGA 3EHFA 1UY9A 3TZ2A 2YE8A 1TH8A 3A0YA 4LWGA 4YKQA 4WUCA 2XX5A 3EHJA 2BT0A 4URNA 4BQJA 3INXA 4FCQA 4CWTA 4E01A 4E00A 1AH6A 4AWOA 2YE9A 5J71A 3TUHA 3D2RA 4MP2A 5D6PA 1ZW9A 2YECA 4P8OA 1UYFA 2UWDA 2XHXA 2ZDYA 2YEDA 2XCMA 4L91A 4NH7A 3WHAA 4EFUA 4JQLA 4FMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B24 A;  2IOP A;  4CWR A;  2VCI A;  4MPN A;  3MNR P;  1AMW A;  3TZ4 A;  3ZM7 A;  1QYE A;  1GJV A;  2YJW A;  5F5R A;  3R4M A;  3PEJ A;  1Z5B A;  2ESA A;  2YE3 A;  4KFG A;  4EFT A;  4XE2 A;  3TZ5 A;  1Z5A A;  2Q8G A;  4I3H A;  4JAV A;  4MPC A;  3KE6 A;  2HKJ A;  1UYK A;  3O2F A;  3K98 A;  1US7 A;  1B62 A;  2JJC A;  4YKY A;  2CG9 A;  5C93 A;  2O1V A;  2YEE A;  3R4N A;  4JAS A;  3WQ9 A;  4GCZ A;  4O0B A;  1EA6 A;  3K60 A;  4H81 A;  4NH8 A;  3TZ0 A;  1AH8 A;  3D0B A;  1BXD A;  2BYI A;  2VCJ A;  4HZ0 A;  4KP4 A;  3O0I A;  3A0T A;  1KIJ A;  2IOR A;  2XDS A;  4R1F A;  1UYH A;  4U7O A;  3O6O A;  2FXS A;  1UYD A;  5CF0 A;  1QZR A;  3SL2 A;  1U0Z A;  2CCT A;  5D7R A;  3T2S A;  1B63 A;  3CGY A;  2O1W A;  1I5A A;  1YES A;  2XX2 A;  3HYY A;  3C11 A;  4JAU A;  1AJ6 A;  4CWO A;  3Q5K A;  4B7P A;  4L94 A;  4XIP A;  1UYI A;  4LWH A;  4NH9 A;  3RLP A;  1TID A;  4AWQ A;  4R3A A;  4EMV A;  1EI1 A;  1A4H A;  2XK2 A;  1ID0 A;  2BU2 A;  3CWV A;  4EM7 A;  5D7D A;  1TBW A;  2YE5 A;  1GKX A;  2YE7 A;  3OPD A;  4QPJ A;  1YC4 A;  5D6Q A;  4GQT A;  4GT8 A;  4MP7 A;  3T0H A;  3RLR A;  2O1U A;  2BU5 A;  2BYH A;  3Q5J A;  3TTZ A;  2Q8H A;  4ASF A;  1YER A;  4W7T A;  3ZKB A;  3EHG A;  4XKK A;  2HG1 A;  3GIG B;  4MPE A;  2QG2 A;  2YKB A;  4ZKI A;  4CE2 A;  2ZDX A;  3QTF A;  3GIG A;  2CCU A;  3OWD A;  5J6A A;  2BTZ A;  2WI1 A;  2H55 A;  3CRK A;  3GIF A;  4XCJ A;  1NHI A;  1Z5C A;  3CGZ A;  2CGF A;  2YKJ A;  3HHU A;  2YI5 A;  5CTU A;  1OSF A;  5BOC A;  4EGH A;  4GEE A;  3QDD A;  3T0Z A;  4LPB A;  1TIL A;  4CWS A;  3U2D A;  3OMU A;  1R62 A;  2XHT A;  2WI4 A;  4R3M A;  4YKU A;  4EGK A;  5IDM A;  2AKP A;  4V26 A;  5FNC A;  4MBC A;  3PEH A;  4WUD A;  2WI6 A;  5IDJ A;  3ZXQ A;  4FCR A;  2YKI A;  2WI7 A;  1I5D A;  1I5C A;  2H8M A;  3OWB A;  4HY1 A;  1MX0 A;  2XAB A;  2YEF A;  4YKZ A;  4XKA A;  3BMY A;  4URL A;  2YEA A;  2WEQ A;  2ZBK B;  1NHJ A;  3OW6 A;  2WI2 A;  4XD8 A;  3B25 A;  4HXW A;  2BSM A;  4WUB A;  3T10 A;  2EXL A;  3A0X A;  4CWF A;  3G7E A;  5FND A;  1YSZ A;  2Q8I A;  1I5B A;  4XDM A;  2ZKJ A;  4URO A;  5F3K A;  2YI0 A;  1BKN A;  1YET A;  1S14 A;  3BM9 A;  5CPH A;  4YKW A;  1NHH A;  4CE3 A;  3A0Z A;  4ZVI A;  3HZ1 A;  4P7A A;  2C2A A;  4XIT A;  4CWN A;  4BIZ A;  4HYP A;  3U2K A;  3A0W A;  4PRV A;  3GIE A;  4PU9 A;  2XJG A;  3CRL A;  2BZ5 A;  4CWP A;  2XDU A;  3VHA A;  1UY7 A;  2YGE A;  5M4E A;  3R91 A;  2WER A;  2YKC A;  2PNR A;  2K5B A;  5CTY A;  1UY8 A;  1ZWH A;  4HZ5 A;  4ASA A;  4XCL A;  3B26 A;  2GQP A;  2XDK A;  2YEI A;  2BU7 A;  1B3Q A;  4QPK A;  5BOD A;  1UYE A;  2CCS A;  2XDX A;  4PRX A;  2YI7 A;  3T1K A;  1BYQ A;  1YT2 A;  2HCH A;  1UY6 A;  2WEP A;  4O04 A;  4BXI A;  4B6C A;  2Q2E B;  3ZXO A;  2BU8 A;  1QY8 A;  4EEH A;  4BQG A;  1YT0 A;  2JKI A;  3RKZ A;  4U93 A;  4HY6 A;  3K97 A;  4KTN A;  2FWY A;  2YK2 A;  4XKO A;  4XIQ A;  2QFO A;  5M4P A;  4V25 A;  4Q20 A;  3R92 A;  3EKO A;  2FYP A;  2Q8F A;  3VHC A;  4DUH A;  3R4O A;  2GFD A;  4BAE A;  1Y4S A;  4GFN A;  3B27 A;  2YE6 A;  1Z59 A;  2VWC A;  5FWK A;  4CWQ A;  4KQV A;  3EKR A;  1YC3 A;  4H7Q A;  1Y8O A;  3H4L A;  5D7C A;  5L3J A;  5M4N A;  1L0O A;  4LWF A;  3U67 A;  2YJX A;  1THN A;  1H7U A;  4FPP A;  4K4O A;  5IN9 A;  4X9L A;  3EHH A;  4HYM A;  1GKZ A;  2XJJ A;  4BIU A;  1JM6 A;  3HEK A;  4I5S A;  2YEB A;  2IOQ A;  2CH4 A;  4L90 A;  3LPS A;  3Q5L A;  3JZ3 A;  4E02 A;  1YC1 A;  1MU5 A;  5CTX A;  4FCP A;  4O09 A;  5FNF A;  2WI5 A;  1BGQ A;  2XJX A;  3G7B A;  4HXZ A;  4KSG A;  1Y8N A;  2WI3 A;  4XC0 A;  2XX4 A;  1YSR A;  2E0A A;  3FT5 A;  2YKE A;  3HZ5 A;  1AM1 A;  1I59 A;  3FV5 A;  3R4P A;  4H85 A;  1YT1 A;  3INW A;  3DGE A;  5CTW A;  1UYC A;  1Y4U A;  4KSH A;  4L93 A;  2QF6 A;  1ZXM A;  3FT8 A;  1U2O A;  1TC6 A;  1ZXN A;  5M4M A;  4O05 A;  3H80 A;  4MOT A;  1KZN A;  3K99 A;  2FWZ A;  4LP0 A;  3ZKD A;  3IED A;  1I58 A;  4DZY A;  2YI6 A;  3B28 A;  1Y8P A;  4XIR A;  4PL9 A;  2IWX A;  3VAD A;  4XTJ A;  4CE1 A;  3G75 A;  5M4H A;  1UYM A;  2YEG A;  3A0R A;  2YGA A;  4MB9 A;  2IWS A;  2YEJ A;  4EGI A;  2XHR A;  2YK9 A;  4YKR A;  4O07 A;  4LWI A;  2BRC A;  1TC0 A;  3VHD A;  3D36 A;  1S16 A;  3LNU A;  4YKT A;  4GGL A;  1YS3 A;  4LWE A;  2XD6 A;  4AWP A;  2BU6 A;  1UYG A;  3HYZ A;  2YEH A;  4L8Z A;  5M4K A;  2XDL A;  2BRE A;  2YE4 A;  4ASB A;  4AS9 A;  1UYL A;  2YGF A;  3C0E A;  2IWU A;  4ASG A;  4U7N A;  2VW5 A;  2YE2 A;  4URM A;  4YKX A;  2QG0 A;  5GGZ A;  3RLQ A;  1H7S A;  3NMQ A;  1PVG A;  3EHF A;  1UY9 A;  3TZ2 A;  2YE8 A;  1TH8 A;  3A0Y A;  4LWG A;  4YKQ A;  4WUC A;  2XX5 A;  3EHJ A;  2BT0 A;  4URN A;  4BQJ A;  3INX A;  4FCQ A;  4CWT A;  4E01 A;  4E00 A;  1AH6 A;  4AWO A;  2YE9 A;  5J71 A;  3TUH A;  3D2R A;  4MP2 A;  5D6P A;  1ZW9 A;  2YEC A;  4P8O A;  1UYF A;  2UWD A;  2XHX A;  2ZDY A;  2YED A;  2XCM A;  4L91 A;  4NH7 A;  3WHA A;  4EFU A;  4JQL A;  4FMT A; 
#chains in the Genus database with same CATH topology
 3B24 A;  2IOP A;  4CWR A;  2VCI A;  4MPN A;  3MNR P;  1AMW A;  3TZ4 A;  3ZM7 A;  1QYE A;  1GJV A;  2YJW A;  5F5R A;  3R4M A;  3PEJ A;  1Z5B A;  2ESA A;  2YE3 A;  4KFG A;  4EFT A;  4XE2 A;  3TZ5 A;  1Z5A A;  2C1I A;  2Q8G A;  4I3H A;  4JAV A;  4MPC A;  3KE6 A;  2HKJ A;  1UYK A;  3O2F A;  3K98 A;  1US7 A;  1B62 A;  2JJC A;  4YKY A;  2CG9 A;  5C93 A;  2O1V A;  2YEE A;  3R4N A;  4JAS A;  3WQ9 A;  4GCZ A;  4O0B A;  1EA6 A;  3K60 A;  4H81 A;  4NH8 A;  3TZ0 A;  1AH8 A;  3D0B A;  1BXD A;  2BYI A;  2VCJ A;  4HZ0 A;  4KP4 A;  3O0I A;  3A0T A;  1KIJ A;  2IOR A;  2XDS A;  4R1F A;  1UYH A;  4U7O A;  3O6O A;  2FXS A;  1UYD A;  5CF0 A;  1QZR A;  3SL2 A;  1U0Z A;  2CCT A;  5D7R A;  3T2S A;  1B63 A;  3CGY A;  2O1W A;  1I5A A;  1YES A;  2XX2 A;  3HYY A;  3C11 A;  4JAU A;  1AJ6 A;  4CWO A;  3Q5K A;  4B7P A;  4L94 A;  4XIP A;  1UYI A;  4LWH A;  4NH9 A;  3RLP A;  1TID A;  4AWQ A;  4R3A A;  4EMV A;  1EI1 A;  1A4H A;  2XK2 A;  1ID0 A;  2BU2 A;  3CWV A;  4EM7 A;  5D7D A;  1TBW A;  2YE5 A;  1GKX A;  2YE7 A;  3OPD A;  4QPJ A;  1YC4 A;  5D6Q A;  4GQT A;  4GT8 A;  4MP7 A;  3T0H A;  3RLR A;  2O1U A;  2BU5 A;  2BYH A;  3Q5J A;  3TTZ A;  2Q8H A;  4ASF A;  1YER A;  4W7T A;  3ZKB A;  3EHG A;  3CYG A;  4XKK A;  2HG1 A;  3GIG B;  4MPE A;  2QG2 A;  2YKB A;  4ZKI A;  4CE2 A;  2ZDX A;  3QTF A;  3GIG A;  2CCU A;  3OWD A;  5J6A A;  2BTZ A;  2WI1 A;  2H55 A;  3CRK A;  3GIF A;  4XCJ A;  1NHI A;  1Z5C A;  3CGZ A;  2CGF A;  2YKJ A;  3HHU A;  2YI5 A;  5CTU A;  1OSF A;  5BOC A;  4EGH A;  4GEE A;  3QDD A;  3T0Z A;  4LPB A;  1TIL A;  4CWS A;  3U2D A;  3OMU A;  1R62 A;  2XHT A;  2WI4 A;  4R3M A;  4YKU A;  4EGK A;  5IDM A;  1F51 A;  2AKP A;  4V26 A;  5FNC A;  2HHI A;  4MBC A;  3PEH A;  4WUD A;  2WI6 A;  5IDJ A;  3ZXQ A;  4FCR A;  2YKI A;  2WI7 A;  1I5D A;  1I5C A;  2H8M A;  3OWB A;  4HY1 A;  1MX0 A;  2XAB A;  2YEF A;  2FTK A;  4YKZ A;  4XKA A;  3BMY A;  4URL A;  2YEA A;  2WEQ A;  2ZBK B;  1NHJ A;  3OW6 A;  2WI2 A;  4XD8 A;  3B25 A;  4HXW A;  2BSM A;  4WUB A;  3T10 A;  2EXL A;  3A0X A;  4CWF A;  3G7E A;  5FND A;  1YSZ A;  2Q8I A;  1I5B A;  4XDM A;  2ZKJ A;  4URO A;  5F3K A;  2YI0 A;  1BKN A;  1YET A;  1S14 A;  3BM9 A;  5CPH A;  4YKW A;  1NHH A;  4CE3 A;  3A0Z A;  4ZVI A;  3HZ1 A;  4P7A A;  2C2A A;  4XIT A;  4CWN A;  4BIZ A;  4HYP A;  3U2K A;  3LMM A;  3A0W A;  4PRV A;  3GIE A;  4PU9 A;  2XJG A;  3CRL A;  2BZ5 A;  4CWP A;  2XDU A;  3VHA A;  1UY7 A;  2YGE A;  5M4E A;  3R91 A;  1IXM A;  2WER A;  2YKC A;  2PNR A;  2K5B A;  5CTY A;  1UY8 A;  1ZWH A;  4HZ5 A;  4ASA A;  4XCL A;  3B26 A;  2GQP A;  2XDK A;  2YEI A;  2BU7 A;  1B3Q A;  4QPK A;  5BOD A;  1UYE A;  2CCS A;  2XDX A;  4PRX A;  2YI7 A;  3T1K A;  1BYQ A;  1YT2 A;  2HCH A;  1UY6 A;  2WEP A;  4O04 A;  4BXI A;  4B6C A;  2Q2E B;  3ZXO A;  2BU8 A;  1QY8 A;  4EEH A;  4BQG A;  1YT0 A;  2JKI A;  3RKZ A;  4U93 A;  4HY6 A;  3K97 A;  4KTN A;  2FWY A;  2YK2 A;  4XKO A;  4XIQ A;  2QFO A;  5M4P A;  4V25 A;  4Q20 A;  3R92 A;  3EKO A;  2FYP A;  2Q8F A;  3VHC A;  4DUH A;  3R4O A;  2GFD A;  4BAE A;  1Y4S A;  4GFN A;  3B27 A;  2YE6 A;  1Z59 A;  2VWC A;  5FWK A;  4CWQ A;  4KQV A;  3EKR A;  1YC3 A;  4H7Q A;  1Y8O A;  3H4L A;  5D7C A;  5L3J A;  5M4N A;  1L0O A;  4LWF A;  3U67 A;  2YJX A;  1THN A;  1H7U A;  4FPP A;  4K4O A;  5IN9 A;  4X9L A;  3EHH A;  4HYM A;  1GKZ A;  2XJJ A;  4BIU A;  1JM6 A;  3HEK A;  4I5S A;  2YEB A;  2IOQ A;  2CH4 A;  4L90 A;  5JEN A;  3LPS A;  2C1G A;  3Q5L A;  3JZ3 A;  4E02 A;  1YC1 A;  1MU5 A;  5CTX A;  4FCP A;  4O09 A;  5FNF A;  2WI5 A;  1BGQ A;  2XJX A;  3G7B A;  4HXZ A;  4KSG A;  1Y8N A;  2WI3 A;  4XC0 A;  2XX4 A;  1YSR A;  2E0A A;  3FT5 A;  2YKE A;  3HZ5 A;  1AM1 A;  3S5T A;  1I59 A;  3FV5 A;  3R4P A;  4H85 A;  1YT1 A;  3INW A;  3DGE A;  5CTW A;  1UYC A;  1Y4U A;  4KSH A;  4L93 A;  2QF6 A;  1ZXM A;  3FT8 A;  1U2O A;  1TC6 A;  1ZXN A;  5M4M A;  4O05 A;  3H80 A;  4MOT A;  1KZN A;  3K99 A;  2FWZ A;  4LP0 A;  3ZKD A;  3IED A;  1I58 A;  4DZY A;  2YI6 A;  3B28 A;  1Y8P A;  4XIR A;  4PL9 A;  2IWX A;  3VAD A;  4XTJ A;  4CE1 A;  3G75 A;  5M4H A;  1UYM A;  2YEG A;  3A0R A;  2YGA A;  4MB9 A;  2IWS A;  2YEJ A;  4E72 A;  4EGI A;  2XHR A;  2YK9 A;  4YKR A;  4O07 A;  4LWI A;  2BRC A;  1TC0 A;  3VHD A;  3D36 A;  1S16 A;  3LNU A;  4YKT A;  4GGL A;  1YS3 A;  4LWE A;  2XD6 A;  4AWP A;  2BU6 A;  1UYG A;  3HYZ A;  2YEH A;  4L8Z A;  5M4K A;  2XDL A;  2BRE A;  2YE4 A;  4ASB A;  4AS9 A;  1UYL A;  2YGF A;  3C0E A;  2IWU A;  4ASG A;  4U7N A;  2VW5 A;  2YE2 A;  4URM A;  4YKX A;  2QG0 A;  5GGZ A;  3RLQ A;  1H7S A;  3NMQ A;  1PVG A;  3EHF A;  1UY9 A;  3TZ2 A;  2YE8 A;  1TH8 A;  3A0Y A;  4LWG A;  4YKQ A;  4WUC A;  2XX5 A;  3EHJ A;  2BT0 A;  4URN A;  4BQJ A;  3INX A;  4FCQ A;  4CWT A;  4E01 A;  4E00 A;  1AH6 A;  4AWO A;  2YE9 A;  5J71 A;  3TUH A;  3D2R A;  4MP2 A;  5D6P A;  1ZW9 A;  2YEC A;  4P8O A;  1UYF A;  2UWD A;  2XHX A;  2ZDY A;  2YED A;  2XCM A;  4L91 A;  4NH7 A;  3WHA A;  4EFU A;  4JQL A;  4FMT A; 
#chains in the Genus database with same CATH homology
 3B24 A;  2IOP A;  4CWR A;  2VCI A;  4MPN A;  3MNR P;  1AMW A;  3TZ4 A;  3ZM7 A;  1QYE A;  1GJV A;  2YJW A;  5F5R A;  3R4M A;  3PEJ A;  1Z5B A;  2ESA A;  2YE3 A;  4KFG A;  4EFT A;  4XE2 A;  3TZ5 A;  1Z5A A;  2Q8G A;  4I3H A;  4JAV A;  4MPC A;  3KE6 A;  2HKJ A;  1UYK A;  3O2F A;  3K98 A;  1US7 A;  1B62 A;  2JJC A;  4YKY A;  2CG9 A;  5C93 A;  2O1V A;  2YEE A;  3R4N A;  4JAS A;  3WQ9 A;  4GCZ A;  4O0B A;  1EA6 A;  3K60 A;  4H81 A;  4NH8 A;  3TZ0 A;  1AH8 A;  3D0B A;  1BXD A;  2BYI A;  2VCJ A;  4HZ0 A;  4KP4 A;  3O0I A;  3A0T A;  1KIJ A;  2IOR A;  2XDS A;  4R1F A;  1UYH A;  4U7O A;  3O6O A;  2FXS A;  1UYD A;  5CF0 A;  1QZR A;  3SL2 A;  1U0Z A;  2CCT A;  5D7R A;  3T2S A;  1B63 A;  3CGY A;  2O1W A;  1I5A A;  1YES A;  2XX2 A;  3HYY A;  3C11 A;  4JAU A;  1AJ6 A;  4CWO A;  3Q5K A;  4B7P A;  4L94 A;  4XIP A;  1UYI A;  4LWH A;  4NH9 A;  3RLP A;  1TID A;  4AWQ A;  4R3A A;  4EMV A;  1EI1 A;  1A4H A;  2XK2 A;  1ID0 A;  2BU2 A;  3CWV A;  4EM7 A;  5D7D A;  1TBW A;  2YE5 A;  1GKX A;  2YE7 A;  3OPD A;  4QPJ A;  1YC4 A;  5D6Q A;  4GQT A;  4GT8 A;  4MP7 A;  3T0H A;  3RLR A;  2O1U A;  2BU5 A;  2BYH A;  3Q5J A;  3TTZ A;  2Q8H A;  4ASF A;  1YER A;  4W7T A;  3ZKB A;  3EHG A;  4XKK A;  2HG1 A;  3GIG B;  4MPE A;  2QG2 A;  2YKB A;  4ZKI A;  4CE2 A;  2ZDX A;  3QTF A;  3GIG A;  2CCU A;  3OWD A;  5J6A A;  2BTZ A;  2WI1 A;  2H55 A;  3CRK A;  3GIF A;  4XCJ A;  1NHI A;  1Z5C A;  3CGZ A;  2CGF A;  2YKJ A;  3HHU A;  2YI5 A;  5CTU A;  1OSF A;  5BOC A;  4EGH A;  4GEE A;  3QDD A;  3T0Z A;  4LPB A;  1TIL A;  4CWS A;  3U2D A;  3OMU A;  1R62 A;  2XHT A;  2WI4 A;  4R3M A;  4YKU A;  4EGK A;  5IDM A;  2AKP A;  4V26 A;  5FNC A;  4MBC A;  3PEH A;  4WUD A;  2WI6 A;  5IDJ A;  3ZXQ A;  4FCR A;  2YKI A;  2WI7 A;  1I5D A;  1I5C A;  2H8M A;  3OWB A;  4HY1 A;  1MX0 A;  2XAB A;  2YEF A;  4YKZ A;  4XKA A;  3BMY A;  4URL A;  2YEA A;  2WEQ A;  2ZBK B;  1NHJ A;  3OW6 A;  2WI2 A;  4XD8 A;  3B25 A;  4HXW A;  2BSM A;  4WUB A;  3T10 A;  2EXL A;  3A0X A;  4CWF A;  3G7E A;  5FND A;  1YSZ A;  2Q8I A;  1I5B A;  4XDM A;  2ZKJ A;  4URO A;  5F3K A;  2YI0 A;  1BKN A;  1YET A;  1S14 A;  3BM9 A;  5CPH A;  4YKW A;  1NHH A;  4CE3 A;  3A0Z A;  4ZVI A;  3HZ1 A;  4P7A A;  2C2A A;  4XIT A;  4CWN A;  4BIZ A;  4HYP A;  3U2K A;  3A0W A;  4PRV A;  3GIE A;  4PU9 A;  2XJG A;  3CRL A;  2BZ5 A;  4CWP A;  2XDU A;  3VHA A;  1UY7 A;  2YGE A;  5M4E A;  3R91 A;  2WER A;  2YKC A;  2PNR A;  2K5B A;  5CTY A;  1UY8 A;  1ZWH A;  4HZ5 A;  4ASA A;  4XCL A;  3B26 A;  2GQP A;  2XDK A;  2YEI A;  2BU7 A;  1B3Q A;  4QPK A;  5BOD A;  1UYE A;  2CCS A;  2XDX A;  4PRX A;  2YI7 A;  3T1K A;  1BYQ A;  1YT2 A;  2HCH A;  1UY6 A;  2WEP A;  4O04 A;  4BXI A;  4B6C A;  2Q2E B;  3ZXO A;  2BU8 A;  1QY8 A;  4EEH A;  4BQG A;  1YT0 A;  2JKI A;  3RKZ A;  4U93 A;  4HY6 A;  3K97 A;  4KTN A;  2FWY A;  2YK2 A;  4XKO A;  4XIQ A;  2QFO A;  5M4P A;  4V25 A;  4Q20 A;  3R92 A;  3EKO A;  2FYP A;  2Q8F A;  3VHC A;  4DUH A;  3R4O A;  2GFD A;  4BAE A;  1Y4S A;  4GFN A;  3B27 A;  2YE6 A;  1Z59 A;  2VWC A;  5FWK A;  4CWQ A;  4KQV A;  3EKR A;  1YC3 A;  4H7Q A;  1Y8O A;  3H4L A;  5D7C A;  5L3J A;  5M4N A;  1L0O A;  4LWF A;  3U67 A;  2YJX A;  1THN A;  1H7U A;  4FPP A;  4K4O A;  5IN9 A;  4X9L A;  3EHH A;  4HYM A;  1GKZ A;  2XJJ A;  4BIU A;  1JM6 A;  3HEK A;  4I5S A;  2YEB A;  2IOQ A;  2CH4 A;  4L90 A;  3LPS A;  3Q5L A;  3JZ3 A;  4E02 A;  1YC1 A;  1MU5 A;  5CTX A;  4FCP A;  4O09 A;  5FNF A;  2WI5 A;  1BGQ A;  2XJX A;  3G7B A;  4HXZ A;  4KSG A;  1Y8N A;  2WI3 A;  4XC0 A;  2XX4 A;  1YSR A;  2E0A A;  3FT5 A;  2YKE A;  3HZ5 A;  1AM1 A;  1I59 A;  3FV5 A;  3R4P A;  4H85 A;  1YT1 A;  3INW A;  3DGE A;  5CTW A;  1UYC A;  1Y4U A;  4KSH A;  4L93 A;  2QF6 A;  1ZXM A;  3FT8 A;  1U2O A;  1TC6 A;  1ZXN A;  5M4M A;  4O05 A;  3H80 A;  4MOT A;  1KZN A;  3K99 A;  2FWZ A;  4LP0 A;  3ZKD A;  3IED A;  1I58 A;  4DZY A;  2YI6 A;  3B28 A;  1Y8P A;  4XIR A;  4PL9 A;  2IWX A;  3VAD A;  4XTJ A;  4CE1 A;  3G75 A;  5M4H A;  1UYM A;  2YEG A;  3A0R A;  2YGA A;  4MB9 A;  2IWS A;  2YEJ A;  4EGI A;  2XHR A;  2YK9 A;  4YKR A;  4O07 A;  4LWI A;  2BRC A;  1TC0 A;  3VHD A;  3D36 A;  1S16 A;  3LNU A;  4YKT A;  4GGL A;  1YS3 A;  4LWE A;  2XD6 A;  4AWP A;  2BU6 A;  1UYG A;  3HYZ A;  2YEH A;  4L8Z A;  5M4K A;  2XDL A;  2BRE A;  2YE4 A;  4ASB A;  4AS9 A;  1UYL A;  2YGF A;  3C0E A;  2IWU A;  4ASG A;  4U7N A;  2VW5 A;  2YE2 A;  4URM A;  4YKX A;  2QG0 A;  5GGZ A;  3RLQ A;  1H7S A;  3NMQ A;  1PVG A;  3EHF A;  1UY9 A;  3TZ2 A;  2YE8 A;  1TH8 A;  3A0Y A;  4LWG A;  4YKQ A;  4WUC A;  2XX5 A;  3EHJ A;  2BT0 A;  4URN A;  4BQJ A;  3INX A;  4FCQ A;  4CWT A;  4E01 A;  4E00 A;  1AH6 A;  4AWO A;  2YE9 A;  5J71 A;  3TUH A;  3D2R A;  4MP2 A;  5D6P A;  1ZW9 A;  2YEC A;  4P8O A;  1UYF A;  2UWD A;  2XHX A;  2ZDY A;  2YED A;  2XCM A;  4L91 A;  4NH7 A;  3WHA A;  4EFU A;  4JQL A;  4FMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...