1TBWA

Ligand induced conformational shift in the n-terminal domain of grp94, open conformation
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
225
structure length
222
Chain Sequence
FAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTGKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-induced Conformational Shift in the N-terminal Domain of GRP94, an Hsp90 Chaperone.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 75
structure length 222
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1tbwA00
5C93A 5D7CA 2YE5A 4GGLA 2YE6A 4EGHA 1THNA 1YC4A 1R62A 4LWEA 3HZ5A 3VHCA 3R4PA 4PRVA 4L90A 4GT8A 4KTNA 4NH7A 2XJXA 1Y8OA 1YS3A 2HG1A 4XC0A 1TH8A 3TUHA 4LWFA 3TZ5A 2YEDA 2YEEA 2YGAA 4KQVA 2XDUA 2HKJA 3TTZA 5J6AA 4XE2A 2Q8HA 1QY8A 2YEGA 4BQJA 5M4HA 2FYPA 4FPPA 1YT1A 3B24A 4AWOA 2E0AA 5IN9A 4ASAA 4CWFA 1UYIA 2O1WA 4L93A 1YC3A 3T10A 4NH8A 2PNRA 3O0IA 1UY7A 1BGQA 2CH4A 1AMWA 4I3HA 4LWHA 5CPHA 4GFNA 4MB9A 1BXDA 2XHTA 1AM1A 4KFGA 4XTJA 4FCRA 4R3AA 3K98A 2YE2A 2VW5A 5M4NA 3T0ZA 3CRKA 4HXWA 2BRCA 3D36A 4R1FA 1ZWHA 5CTWA 4FCQA 2XX2A 1KIJA 2XK2A 4CE3A 3O2FA 1UYEA 2IORA 2BYIA 2IWXA 5F5RA 4CE2A 4KP4A 3RLQA 4HYMA 4U93A 4EM7A 3EHHA 3FT8A 3PEJA 1PVGA 4W7TA 5J71A 2ZBKB 2HCHA 1TC0A 4LPBA 2ZDXA 3K97A 3Q5LA 3BMYA 3T1KA 3A0TA 2YI6A 4WUCA 4AWQA 4L8ZA 1GKXA 5GGZA 1ID0A 4PL9A 3MNRP 5D6PA 3C11A 3INXA 4B7PA 4MPCA 5IDJA 2WEPA 5M4PA 1GKZA 2JJCA 3A0ZA 2BSMA 3D2RA 2Q8IA 2XJGA 2ZDYA 3CGZA 1MU5A 2ZKJA 1US7A 2XJJA 2XX4A 1B3QA 1NHHA 3NMQA 3ZKBA 3KE6A 5CTYA 2BU6A 2XDKA 2BT0A 2FWYA 4GQTA 3H4LA 1UYCA 3G75A 5M4MA 1L0OA 3B26A 4E00A 1EI1A 1I58A 4QPJA 3GIGA 4CWOA 4CWRA 1UY6A 2YI0A 1UYLA 4V26A 2QG2A 1S16A 4MP2A 4HZ5A 5CF0A 4LWGA 2BU7A 2YKIA 4YKQA 5F3KA 1H7SA 1YETA 3HZ1A 4O0BA 2YKEA 2YGFA 2Q8GA 4CWSA 4XCJA 3ZKDA 4YKRA 2AKPA 1ZXMA 3CRLA 4XKKA 1I5DA 2BYHA 1AH8A 1NHIA 3B25A 1B62A 3G7BA 4MP7A 4XIQA 4B6CA 4ASFA 3K60A 2XHXA 3R4MA 4BIUA 2IOQA 1NHJA 2BREA 3RKZA 3CWVA 4FCPA 4JQLA 4EGIA 3HYZA 2XX5A 4YKZA 1Y8NA 2VCIA 2YEHA 1UYGA 4YKXA 1OSFA 1YESA 4XCLA 3ZM7A 1UYMA 2FWZA 2YKJA 2YKCA 3O6OA 3TZ4A 1Y4SA 2XABA 2UWDA 1A4HA 4URNA 3C0EA 4CE1A 1Z5BA 3PEHA 5M4KA 4XIPA 5CTUA 3IEDA 3QTFA 5FNDA 4YKYA 3R4NA 3GIFA 4MPEA 2Q2EB 4ASBA 4XKOA 1AJ6A 1TC6A 2YE9A 2XDSA 4EMVA 2CCTA 1YT0A 4MBCA 2WI6A 4BAEA 3WQ9A 1AH6A 2CGFA 3TZ0A 2C2AA 2XDXA 1YSRA 4ASGA 4PU9A 3VHDA 3U67A 4R3MA 4P7AA 1U0ZA 1QZRA 1Z5CA 4BXIA 3T0HA 3OWDA 2BU5A 4NH9A 4Q20A 2QG0A 4HY1A 4O04A 2K5BA 4GEEA 4FMTA 4GCZA 2QF6A 3B28A 5M4EA 1UY8A 4ZKIA 3R91A 3EKOA 2IWSA 3GIGB 3OMUA 2CG9A 4U7OA 1UYFA 4PRXA 2YEJA 1UYDA 4WUBA 2YEBA 2O1VA 5D7DA 1YERA 2BTZA 1BKNA 3EHJA 2XCMA 1TILA 4X9LA 3U2DA 4AS9A 1BYQA 2YE4A 2XD6A 2O1UA 4JAVA 5D6QA 1YC1A 4XITA 2CCSA 3EHFA 2YEFA 4YKWA 3OW6A 4UROA 5D7RA 3VADA 4HYPA 4YKUA 3QDDA 2CCUA 4HY6A 3H80A 3SL2A 2FXSA 2H8MA 2WI5A 4MOTA 2WI3A 3RLRA 4KSHA 2EXLA 4DUHA 4XKAA 1UYKA 5IDMA 4H81A 4JAUA 3HHUA 5FNCA 3EKRA 5L3JA 3VHAA 3FT5A 2YJXA 5FWKA 2WI7A 1GJVA 4EEHA 4L91A 4BIZA 1Y4UA 4V25A 3ZXOA 4EGKA 1EA6A 4L94A 5BODA 2YI7A 1JM6A 1UY9A 2YKBA 3INWA 3JZ3A 4EFUA 2WI4A 4HZ0A 4U7NA 3R4OA 2BU2A 1KZNA 4URMA 2GFDA 2YJWA 5CTXA 3Q5KA 4YKTA 2VWCA 2JKIA 2YI5A 1TBWA 2IOPA 4H85A 1YT2A 4CWPA 4O07A 2WERA 3D0BA 2IWUA 4CWNA 1UYHA 3FV5A 3LPSA 2WI1A 3BM9A 4XD8A 3K99A 3Q5JA 2VCJA 3ZXQA 3TZ2A 3A0WA 1I59A 5BOCA 3GIEA 4ZVIA 2XHRA 1MX0A 2BU8A 3U2KA 3DGEA 1QYEA 1U2OA 4JASA 3LNUA 4E02A 4O05A 4URLA 4I5SA 4QPKA 1B63A 3HEKA 4EFTA 3G7EA 4LWIA 4O09A 2WEQA 1I5CA 4MPNA 3EHGA 3CGYA 1I5AA 2YEIA 2YK2A 3T2SA 3HYYA 4K4OA 2YEAA 2YECA 1YSZA 3WHAA 3RLPA 3OWBA 4CWQA 2GQPA 1S14A 3A0RA 4P8OA 2Q8FA 3R92A 4AWPA 4HXZA 2YE3A 2WI2A 4LP0A 3B27A 4E01A 4BQGA 1TIDA 3A0YA 2H55A 2YE7A 1I5BA 1Y8PA 4XIRA 1ZW9A 2YE8A 2QFOA 3OPDA 2ESAA 1ZXNA 4XDMA 1H7UA 4WUDA 2XDLA 4CWTA 5FNFA 2YK9A 4DZYA 2BZ5A 4KSGA 4H7QA 1Z59A 1Z5AA 2YGEA 3A0XA
chains in the Genus database with same CATH superfamily
5C93A 5D7CA 2YE5A 4GGLA 2YE6A 4EGHA 1THNA 1YC4A 1R62A 4LWEA 3HZ5A 3VHCA 3R4PA 4PRVA 4L90A 4GT8A 4KTNA 4NH7A 2XJXA 1Y8OA 1YS3A 2HG1A 4XC0A 1TH8A 3TUHA 4LWFA 3TZ5A 2YEDA 2YEEA 2YGAA 4KQVA 2XDUA 2HKJA 3TTZA 5J6AA 4XE2A 2Q8HA 1QY8A 2YEGA 4BQJA 5M4HA 2FYPA 4FPPA 1YT1A 3B24A 4AWOA 2E0AA 5IN9A 4ASAA 4CWFA 1UYIA 2O1WA 4L93A 1YC3A 3T10A 4NH8A 2PNRA 3O0IA 1UY7A 1BGQA 2CH4A 1AMWA 4I3HA 4LWHA 5CPHA 4GFNA 4MB9A 1BXDA 2XHTA 1AM1A 4KFGA 4XTJA 4FCRA 4R3AA 3K98A 2YE2A 2VW5A 5M4NA 3T0ZA 3CRKA 4HXWA 2BRCA 3D36A 4R1FA 1ZWHA 5CTWA 4FCQA 2XX2A 1KIJA 2XK2A 4CE3A 3O2FA 1UYEA 2IORA 2BYIA 2IWXA 5F5RA 4CE2A 2FTKA 4KP4A 3RLQA 4HYMA 4U93A 4EM7A 3EHHA 3FT8A 3PEJA 1PVGA 4W7TA 5J71A 2ZBKB 2HCHA 1TC0A 4LPBA 2ZDXA 3K97A 3Q5LA 3BMYA 3T1KA 3A0TA 2YI6A 4WUCA 4AWQA 4L8ZA 1GKXA 5GGZA 1ID0A 4PL9A 3MNRP 5D6PA 3C11A 3INXA 4B7PA 4MPCA 5IDJA 2WEPA 5M4PA 1GKZA 2JJCA 3A0ZA 2BSMA 3D2RA 2Q8IA 2XJGA 2ZDYA 3CGZA 1MU5A 2ZKJA 1US7A 2XJJA 2XX4A 1B3QA 1NHHA 3NMQA 3ZKBA 3KE6A 5CTYA 3CYGA 2BU6A 2XDKA 2BT0A 2FWYA 4GQTA 3H4LA 1UYCA 3G75A 5M4MA 1L0OA 3B26A 4E00A 1EI1A 1I58A 4QPJA 3GIGA 4CWOA 4CWRA 1UY6A 2YI0A 1UYLA 4V26A 2QG2A 1S16A 4MP2A 4HZ5A 5CF0A 4LWGA 2BU7A 2YKIA 4YKQA 5F3KA 1H7SA 1YETA 3HZ1A 4O0BA 2YKEA 2YGFA 2Q8GA 4CWSA 4XCJA 3ZKDA 4YKRA 2AKPA 1ZXMA 3CRLA 4XKKA 1I5DA 2BYHA 1AH8A 1NHIA 3B25A 1B62A 3G7BA 4MP7A 4XIQA 4B6CA 4ASFA 3K60A 2XHXA 3R4MA 4BIUA 2IOQA 1NHJA 2BREA 3RKZA 3CWVA 4FCPA 4JQLA 4EGIA 3HYZA 2XX5A 4YKZA 1Y8NA 2VCIA 2YEHA 1UYGA 4YKXA 1OSFA 1YESA 4XCLA 3ZM7A 1IXMA 1UYMA 2FWZA 2YKJA 2YKCA 3O6OA 3TZ4A 1Y4SA 2XABA 2UWDA 1A4HA 4URNA 3C0EA 4CE1A 1Z5BA 3PEHA 5M4KA 4XIPA 5CTUA 3IEDA 3QTFA 5FNDA 4YKYA 4E72A 3R4NA 3GIFA 4MPEA 2Q2EB 4ASBA 4XKOA 1AJ6A 1TC6A 2YE9A 2XDSA 4EMVA 2CCTA 1YT0A 4MBCA 2WI6A 4BAEA 3WQ9A 1AH6A 2CGFA 3TZ0A 2C2AA 2XDXA 1YSRA 4ASGA 4PU9A 3VHDA 3U67A 4R3MA 4P7AA 1U0ZA 5JENA 1QZRA 1Z5CA 4BXIA 3T0HA 3OWDA 2BU5A 4NH9A 4Q20A 2QG0A 4HY1A 4O04A 2K5BA 4GEEA 4FMTA 4GCZA 2QF6A 3B28A 5M4EA 1UY8A 4ZKIA 3R91A 3EKOA 2IWSA 3GIGB 3OMUA 2CG9A 4U7OA 1UYFA 4PRXA 2YEJA 1UYDA 2C1GA 4WUBA 2YEBA 2O1VA 5D7DA 1YERA 2BTZA 1BKNA 3EHJA 2XCMA 1TILA 4X9LA 3U2DA 4AS9A 2C1IA 1BYQA 2YE4A 2XD6A 2O1UA 4JAVA 5D6QA 1YC1A 4XITA 2CCSA 3EHFA 2YEFA 4YKWA 3OW6A 4UROA 5D7RA 3VADA 4HYPA 4YKUA 3QDDA 2CCUA 4HY6A 3H80A 3SL2A 2FXSA 2H8MA 2WI5A 4MOTA 2WI3A 3RLRA 4KSHA 2EXLA 4DUHA 4XKAA 1UYKA 5IDMA 4H81A 4JAUA 3HHUA 5FNCA 3EKRA 5L3JA 3VHAA 3FT5A 2YJXA 5FWKA 2WI7A 1GJVA 4EEHA 4L91A 4BIZA 1Y4UA 4V25A 3ZXOA 4EGKA 1EA6A 4L94A 5BODA 2YI7A 1JM6A 1UY9A 2YKBA 3INWA 3JZ3A 4EFUA 2WI4A 4HZ0A 4U7NA 3R4OA 2BU2A 1KZNA 4URMA 2GFDA 2YJWA 5CTXA 3Q5KA 4YKTA 2VWCA 2JKIA 2YI5A 1TBWA 2IOPA 4H85A 1YT2A 4CWPA 4O07A 2WERA 3D0BA 2IWUA 4CWNA 1UYHA 3FV5A 3LPSA 2WI1A 3BM9A 4XD8A 3K99A 3Q5JA 3S5TA 2VCJA 3ZXQA 3TZ2A 3A0WA 1I59A 5BOCA 3GIEA 4ZVIA 2XHRA 1MX0A 2BU8A 3U2KA 3DGEA 1QYEA 1U2OA 4JASA 3LNUA 4E02A 4O05A 4URLA 4I5SA 4QPKA 1B63A 3HEKA 4EFTA 3G7EA 4LWIA 2HHIA 4O09A 2WEQA 1I5CA 4MPNA 3EHGA 3CGYA 1I5AA 2YEIA 2YK2A 3T2SA 3HYYA 4K4OA 2YEAA 2YECA 1YSZA 3WHAA 3RLPA 3OWBA 4CWQA 2GQPA 1S14A 3A0RA 4P8OA 2Q8FA 3R92A 4AWPA 4HXZA 2YE3A 2WI2A 4LP0A 3B27A 4E01A 4BQGA 1TIDA 3A0YA 3LMMA 2H55A 2YE7A 1I5BA 1Y8PA 4XIRA 1ZW9A 2YE8A 2QFOA 3OPDA 1F51A 1ZXNA 2ESAA 4XDMA 1H7UA 4WUDA 2XDLA 4CWTA 5FNFA 2YK9A 4DZYA 2BZ5A 4KSGA 4H7QA 1Z59A 1Z5AA 2YGEA 3A0XA
chains in the Genus database with same CATH topology
5C93A 5D7CA 2YE5A 4GGLA 2YE6A 4EGHA 1THNA 1YC4A 1R62A 4LWEA 3HZ5A 3VHCA 3R4PA 4PRVA 4L90A 4GT8A 4KTNA 4NH7A 2XJXA 1Y8OA 1YS3A 2HG1A 4XC0A 1TH8A 3TUHA 4LWFA 3TZ5A 2YEDA 2YEEA 2YGAA 4KQVA 2XDUA 2HKJA 3TTZA 5J6AA 4XE2A 2Q8HA 1QY8A 2YEGA 4BQJA 5M4HA 2FYPA 4FPPA 1YT1A 3B24A 4AWOA 2E0AA 5IN9A 4ASAA 4CWFA 1UYIA 2O1WA 4L93A 1YC3A 3T10A 4NH8A 2PNRA 3O0IA 1UY7A 1BGQA 2CH4A 1AMWA 4I3HA 4LWHA 5CPHA 4GFNA 4MB9A 1BXDA 2XHTA 1AM1A 4KFGA 4XTJA 4FCRA 4R3AA 3K98A 2YE2A 2VW5A 5M4NA 3T0ZA 3CRKA 4HXWA 2BRCA 3D36A 4R1FA 1ZWHA 5CTWA 4FCQA 2XX2A 1KIJA 2XK2A 4CE3A 3O2FA 1UYEA 2IORA 2BYIA 2IWXA 5F5RA 4CE2A 4KP4A 3RLQA 4HYMA 4U93A 4EM7A 3EHHA 3FT8A 3PEJA 1PVGA 4W7TA 5J71A 2ZBKB 2HCHA 1TC0A 4LPBA 2ZDXA 3K97A 3Q5LA 3BMYA 3T1KA 3A0TA 2YI6A 4WUCA 4AWQA 4L8ZA 1GKXA 5GGZA 1ID0A 4PL9A 3MNRP 5D6PA 3C11A 3INXA 4B7PA 4MPCA 5IDJA 2WEPA 5M4PA 1GKZA 2JJCA 3A0ZA 2BSMA 3D2RA 2Q8IA 2XJGA 2ZDYA 3CGZA 1MU5A 2ZKJA 1US7A 2XJJA 2XX4A 1B3QA 1NHHA 3NMQA 3ZKBA 3KE6A 5CTYA 2BU6A 2XDKA 2BT0A 2FWYA 4GQTA 3H4LA 1UYCA 3G75A 5M4MA 1L0OA 3B26A 4E00A 1EI1A 1I58A 4QPJA 3GIGA 4CWOA 4CWRA 1UY6A 2YI0A 1UYLA 4V26A 2QG2A 1S16A 4MP2A 4HZ5A 5CF0A 4LWGA 2BU7A 2YKIA 4YKQA 5F3KA 1H7SA 1YETA 3HZ1A 4O0BA 2YKEA 2YGFA 2Q8GA 4CWSA 4XCJA 3ZKDA 4YKRA 2AKPA 1ZXMA 3CRLA 4XKKA 1I5DA 2BYHA 1AH8A 1NHIA 3B25A 1B62A 3G7BA 4MP7A 4XIQA 4B6CA 4ASFA 3K60A 2XHXA 3R4MA 4BIUA 2IOQA 1NHJA 2BREA 3RKZA 3CWVA 4FCPA 4JQLA 4EGIA 3HYZA 2XX5A 4YKZA 1Y8NA 2VCIA 2YEHA 1UYGA 4YKXA 1OSFA 1YESA 4XCLA 3ZM7A 1UYMA 2FWZA 2YKJA 2YKCA 3O6OA 3TZ4A 1Y4SA 2XABA 2UWDA 1A4HA 4URNA 3C0EA 4CE1A 1Z5BA 3PEHA 5M4KA 4XIPA 5CTUA 3IEDA 3QTFA 5FNDA 4YKYA 3R4NA 3GIFA 4MPEA 2Q2EB 4ASBA 4XKOA 1AJ6A 1TC6A 2YE9A 2XDSA 4EMVA 2CCTA 1YT0A 4MBCA 2WI6A 4BAEA 3WQ9A 1AH6A 2CGFA 3TZ0A 2C2AA 2XDXA 1YSRA 4ASGA 4PU9A 3VHDA 3U67A 4R3MA 4P7AA 1U0ZA 1QZRA 1Z5CA 4BXIA 3T0HA 3OWDA 2BU5A 4NH9A 4Q20A 2QG0A 4HY1A 4O04A 2K5BA 4GEEA 4FMTA 4GCZA 2QF6A 3B28A 5M4EA 1UY8A 4ZKIA 3R91A 3EKOA 2IWSA 3GIGB 3OMUA 2CG9A 4U7OA 1UYFA 4PRXA 2YEJA 1UYDA 4WUBA 2YEBA 2O1VA 5D7DA 1YERA 2BTZA 1BKNA 3EHJA 2XCMA 1TILA 4X9LA 3U2DA 4AS9A 1BYQA 2YE4A 2XD6A 2O1UA 4JAVA 5D6QA 1YC1A 4XITA 2CCSA 3EHFA 2YEFA 4YKWA 3OW6A 4UROA 5D7RA 3VADA 4HYPA 4YKUA 3QDDA 2CCUA 4HY6A 3H80A 3SL2A 2FXSA 2H8MA 2WI5A 4MOTA 2WI3A 3RLRA 4KSHA 2EXLA 4DUHA 4XKAA 1UYKA 5IDMA 4H81A 4JAUA 3HHUA 5FNCA 3EKRA 5L3JA 3VHAA 3FT5A 2YJXA 5FWKA 2WI7A 1GJVA 4EEHA 4L91A 4BIZA 1Y4UA 4V25A 3ZXOA 4EGKA 1EA6A 4L94A 5BODA 2YI7A 1JM6A 1UY9A 2YKBA 3INWA 3JZ3A 4EFUA 2WI4A 4HZ0A 4U7NA 3R4OA 2BU2A 1KZNA 4URMA 2GFDA 2YJWA 5CTXA 3Q5KA 4YKTA 2VWCA 2JKIA 2YI5A 1TBWA 2IOPA 4H85A 1YT2A 4CWPA 4O07A 2WERA 3D0BA 2IWUA 4CWNA 1UYHA 3FV5A 3LPSA 2WI1A 3BM9A 4XD8A 3K99A 3Q5JA 2VCJA 3ZXQA 3TZ2A 3A0WA 1I59A 5BOCA 3GIEA 4ZVIA 2XHRA 1MX0A 2BU8A 3U2KA 3DGEA 1QYEA 1U2OA 4JASA 3LNUA 4E02A 4O05A 4URLA 4I5SA 4QPKA 1B63A 3HEKA 4EFTA 3G7EA 4LWIA 4O09A 2WEQA 1I5CA 4MPNA 3EHGA 3CGYA 1I5AA 2YEIA 2YK2A 3T2SA 3HYYA 4K4OA 2YEAA 2YECA 1YSZA 3WHAA 3RLPA 3OWBA 4CWQA 2GQPA 1S14A 3A0RA 4P8OA 2Q8FA 3R92A 4AWPA 4HXZA 2YE3A 2WI2A 4LP0A 3B27A 4E01A 4BQGA 1TIDA 3A0YA 2H55A 2YE7A 1I5BA 1Y8PA 4XIRA 1ZW9A 2YE8A 2QFOA 3OPDA 2ESAA 1ZXNA 4XDMA 1H7UA 4WUDA 2XDLA 4CWTA 5FNFA 2YK9A 4DZYA 2BZ5A 4KSGA 4H7QA 1Z59A 1Z5AA 2YGEA 3A0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C93 A;  5D7C A;  2YE5 A;  4GGL A;  2YE6 A;  4EGH A;  1THN A;  1YC4 A;  1R62 A;  4LWE A;  3HZ5 A;  3VHC A;  3R4P A;  4PRV A;  4L90 A;  4GT8 A;  4KTN A;  4NH7 A;  2XJX A;  1Y8O A;  1YS3 A;  2HG1 A;  4XC0 A;  1TH8 A;  3TUH A;  4LWF A;  3TZ5 A;  2YED A;  2YEE A;  2YGA A;  4KQV A;  2XDU A;  2HKJ A;  3TTZ A;  5J6A A;  4XE2 A;  2Q8H A;  1QY8 A;  2YEG A;  4BQJ A;  5M4H A;  2FYP A;  4FPP A;  1YT1 A;  3B24 A;  4AWO A;  2E0A A;  5IN9 A;  4ASA A;  4CWF A;  1UYI A;  2O1W A;  4L93 A;  1YC3 A;  3T10 A;  4NH8 A;  2PNR A;  3O0I A;  1UY7 A;  1BGQ A;  2CH4 A;  1AMW A;  4I3H A;  4LWH A;  5CPH A;  4GFN A;  4MB9 A;  1BXD A;  2XHT A;  1AM1 A;  4KFG A;  4XTJ A;  4FCR A;  4R3A A;  3K98 A;  2YE2 A;  2VW5 A;  5M4N A;  3T0Z A;  3CRK A;  4HXW A;  2BRC A;  3D36 A;  4R1F A;  1ZWH A;  5CTW A;  4FCQ A;  2XX2 A;  1KIJ A;  2XK2 A;  4CE3 A;  3O2F A;  1UYE A;  2IOR A;  2BYI A;  2IWX A;  5F5R A;  4CE2 A;  4KP4 A;  3RLQ A;  4HYM A;  4U93 A;  4EM7 A;  3EHH A;  3FT8 A;  3PEJ A;  1PVG A;  4W7T A;  5J71 A;  2ZBK B;  2HCH A;  1TC0 A;  4LPB A;  2ZDX A;  3K97 A;  3Q5L A;  3BMY A;  3T1K A;  3A0T A;  2YI6 A;  4WUC A;  4AWQ A;  4L8Z A;  1GKX A;  5GGZ A;  1ID0 A;  4PL9 A;  3MNR P;  5D6P A;  3C11 A;  3INX A;  4B7P A;  4MPC A;  5IDJ A;  2WEP A;  5M4P A;  1GKZ A;  2JJC A;  3A0Z A;  2BSM A;  3D2R A;  2Q8I A;  2XJG A;  2ZDY A;  3CGZ A;  1MU5 A;  2ZKJ A;  1US7 A;  2XJJ A;  2XX4 A;  1B3Q A;  1NHH A;  3NMQ A;  3ZKB A;  3KE6 A;  5CTY A;  2BU6 A;  2XDK A;  2BT0 A;  2FWY A;  4GQT A;  3H4L A;  1UYC A;  3G75 A;  5M4M A;  1L0O A;  3B26 A;  4E00 A;  1EI1 A;  1I58 A;  4QPJ A;  3GIG A;  4CWO A;  4CWR A;  1UY6 A;  2YI0 A;  1UYL A;  4V26 A;  2QG2 A;  1S16 A;  4MP2 A;  4HZ5 A;  5CF0 A;  4LWG A;  2BU7 A;  2YKI A;  4YKQ A;  5F3K A;  1H7S A;  1YET A;  3HZ1 A;  4O0B A;  2YKE A;  2YGF A;  2Q8G A;  4CWS A;  4XCJ A;  3ZKD A;  4YKR A;  2AKP A;  1ZXM A;  3CRL A;  4XKK A;  1I5D A;  2BYH A;  1AH8 A;  1NHI A;  3B25 A;  1B62 A;  3G7B A;  4MP7 A;  4XIQ A;  4B6C A;  4ASF A;  3K60 A;  2XHX A;  3R4M A;  4BIU A;  2IOQ A;  1NHJ A;  2BRE A;  3RKZ A;  3CWV A;  4FCP A;  4JQL A;  4EGI A;  3HYZ A;  2XX5 A;  4YKZ A;  1Y8N A;  2VCI A;  2YEH A;  1UYG A;  4YKX A;  1OSF A;  1YES A;  4XCL A;  3ZM7 A;  1UYM A;  2FWZ A;  2YKJ A;  2YKC A;  3O6O A;  3TZ4 A;  1Y4S A;  2XAB A;  2UWD A;  1A4H A;  4URN A;  3C0E A;  4CE1 A;  1Z5B A;  3PEH A;  5M4K A;  4XIP A;  5CTU A;  3IED A;  3QTF A;  5FND A;  4YKY A;  3R4N A;  3GIF A;  4MPE A;  2Q2E B;  4ASB A;  4XKO A;  1AJ6 A;  1TC6 A;  2YE9 A;  2XDS A;  4EMV A;  2CCT A;  1YT0 A;  4MBC A;  2WI6 A;  4BAE A;  3WQ9 A;  1AH6 A;  2CGF A;  3TZ0 A;  2C2A A;  2XDX A;  1YSR A;  4ASG A;  4PU9 A;  3VHD A;  3U67 A;  4R3M A;  4P7A A;  1U0Z A;  1QZR A;  1Z5C A;  4BXI A;  3T0H A;  3OWD A;  2BU5 A;  4NH9 A;  4Q20 A;  2QG0 A;  4HY1 A;  4O04 A;  2K5B A;  4GEE A;  4FMT A;  4GCZ A;  2QF6 A;  3B28 A;  5M4E A;  1UY8 A;  4ZKI A;  3R91 A;  3EKO A;  2IWS A;  3GIG B;  3OMU A;  2CG9 A;  4U7O A;  1UYF A;  4PRX A;  2YEJ A;  1UYD A;  4WUB A;  2YEB A;  2O1V A;  5D7D A;  1YER A;  2BTZ A;  1BKN A;  3EHJ A;  2XCM A;  1TIL A;  4X9L A;  3U2D A;  4AS9 A;  1BYQ A;  2YE4 A;  2XD6 A;  2O1U A;  4JAV A;  5D6Q A;  1YC1 A;  4XIT A;  2CCS A;  3EHF A;  2YEF A;  4YKW A;  3OW6 A;  4URO A;  5D7R A;  3VAD A;  4HYP A;  4YKU A;  3QDD A;  2CCU A;  4HY6 A;  3H80 A;  3SL2 A;  2FXS A;  2H8M A;  2WI5 A;  4MOT A;  2WI3 A;  3RLR A;  4KSH A;  2EXL A;  4DUH A;  4XKA A;  1UYK A;  5IDM A;  4H81 A;  4JAU A;  3HHU A;  5FNC A;  3EKR A;  5L3J A;  3VHA A;  3FT5 A;  2YJX A;  5FWK A;  2WI7 A;  1GJV A;  4EEH A;  4L91 A;  4BIZ A;  1Y4U A;  4V25 A;  3ZXO A;  4EGK A;  1EA6 A;  4L94 A;  5BOD A;  2YI7 A;  1JM6 A;  1UY9 A;  2YKB A;  3INW A;  3JZ3 A;  4EFU A;  2WI4 A;  4HZ0 A;  4U7N A;  3R4O A;  2BU2 A;  1KZN A;  4URM A;  2GFD A;  2YJW A;  5CTX A;  3Q5K A;  4YKT A;  2VWC A;  2JKI A;  2YI5 A;  1TBW A;  2IOP A;  4H85 A;  1YT2 A;  4CWP A;  4O07 A;  2WER A;  3D0B A;  2IWU A;  4CWN A;  1UYH A;  3FV5 A;  3LPS A;  2WI1 A;  3BM9 A;  4XD8 A;  3K99 A;  3Q5J A;  2VCJ A;  3ZXQ A;  3TZ2 A;  3A0W A;  1I59 A;  5BOC A;  3GIE A;  4ZVI A;  2XHR A;  1MX0 A;  2BU8 A;  3U2K A;  3DGE A;  1QYE A;  1U2O A;  4JAS A;  3LNU A;  4E02 A;  4O05 A;  4URL A;  4I5S A;  4QPK A;  1B63 A;  3HEK A;  4EFT A;  3G7E A;  4LWI A;  4O09 A;  2WEQ A;  1I5C A;  4MPN A;  3EHG A;  3CGY A;  1I5A A;  2YEI A;  2YK2 A;  3T2S A;  3HYY A;  4K4O A;  2YEA A;  2YEC A;  1YSZ A;  3WHA A;  3RLP A;  3OWB A;  4CWQ A;  2GQP A;  1S14 A;  3A0R A;  4P8O A;  2Q8F A;  3R92 A;  4AWP A;  4HXZ A;  2YE3 A;  2WI2 A;  4LP0 A;  3B27 A;  4E01 A;  4BQG A;  1TID A;  3A0Y A;  2H55 A;  2YE7 A;  1I5B A;  1Y8P A;  4XIR A;  1ZW9 A;  2YE8 A;  2QFO A;  3OPD A;  2ESA A;  1ZXN A;  4XDM A;  1H7U A;  4WUD A;  2XDL A;  4CWT A;  5FNF A;  2YK9 A;  4DZY A;  2BZ5 A;  4KSG A;  4H7Q A;  1Z59 A;  1Z5A A;  2YGE A;  3A0X A; 
#chains in the Genus database with same CATH topology
 5C93 A;  5D7C A;  2YE5 A;  4GGL A;  2YE6 A;  4EGH A;  1THN A;  1YC4 A;  1R62 A;  4LWE A;  3HZ5 A;  3VHC A;  3R4P A;  4PRV A;  4L90 A;  4GT8 A;  4KTN A;  4NH7 A;  2XJX A;  1Y8O A;  1YS3 A;  2HG1 A;  4XC0 A;  1TH8 A;  3TUH A;  4LWF A;  3TZ5 A;  2YED A;  2YEE A;  2YGA A;  4KQV A;  2XDU A;  2HKJ A;  3TTZ A;  5J6A A;  4XE2 A;  2Q8H A;  1QY8 A;  2YEG A;  4BQJ A;  5M4H A;  2FYP A;  4FPP A;  1YT1 A;  3B24 A;  4AWO A;  2E0A A;  5IN9 A;  4ASA A;  4CWF A;  1UYI A;  2O1W A;  4L93 A;  1YC3 A;  3T10 A;  4NH8 A;  2PNR A;  3O0I A;  1UY7 A;  1BGQ A;  2CH4 A;  1AMW A;  4I3H A;  4LWH A;  5CPH A;  4GFN A;  4MB9 A;  1BXD A;  2XHT A;  1AM1 A;  4KFG A;  4XTJ A;  4FCR A;  4R3A A;  3K98 A;  2YE2 A;  2VW5 A;  5M4N A;  3T0Z A;  3CRK A;  4HXW A;  2BRC A;  3D36 A;  4R1F A;  1ZWH A;  5CTW A;  4FCQ A;  2XX2 A;  1KIJ A;  2XK2 A;  4CE3 A;  3O2F A;  1UYE A;  2IOR A;  2BYI A;  2IWX A;  5F5R A;  4CE2 A;  2FTK A;  4KP4 A;  3RLQ A;  4HYM A;  4U93 A;  4EM7 A;  3EHH A;  3FT8 A;  3PEJ A;  1PVG A;  4W7T A;  5J71 A;  2ZBK B;  2HCH A;  1TC0 A;  4LPB A;  2ZDX A;  3K97 A;  3Q5L A;  3BMY A;  3T1K A;  3A0T A;  2YI6 A;  4WUC A;  4AWQ A;  4L8Z A;  1GKX A;  5GGZ A;  1ID0 A;  4PL9 A;  3MNR P;  5D6P A;  3C11 A;  3INX A;  4B7P A;  4MPC A;  5IDJ A;  2WEP A;  5M4P A;  1GKZ A;  2JJC A;  3A0Z A;  2BSM A;  3D2R A;  2Q8I A;  2XJG A;  2ZDY A;  3CGZ A;  1MU5 A;  2ZKJ A;  1US7 A;  2XJJ A;  2XX4 A;  1B3Q A;  1NHH A;  3NMQ A;  3ZKB A;  3KE6 A;  5CTY A;  3CYG A;  2BU6 A;  2XDK A;  2BT0 A;  2FWY A;  4GQT A;  3H4L A;  1UYC A;  3G75 A;  5M4M A;  1L0O A;  3B26 A;  4E00 A;  1EI1 A;  1I58 A;  4QPJ A;  3GIG A;  4CWO A;  4CWR A;  1UY6 A;  2YI0 A;  1UYL A;  4V26 A;  2QG2 A;  1S16 A;  4MP2 A;  4HZ5 A;  5CF0 A;  4LWG A;  2BU7 A;  2YKI A;  4YKQ A;  5F3K A;  1H7S A;  1YET A;  3HZ1 A;  4O0B A;  2YKE A;  2YGF A;  2Q8G A;  4CWS A;  4XCJ A;  3ZKD A;  4YKR A;  2AKP A;  1ZXM A;  3CRL A;  4XKK A;  1I5D A;  2BYH A;  1AH8 A;  1NHI A;  3B25 A;  1B62 A;  3G7B A;  4MP7 A;  4XIQ A;  4B6C A;  4ASF A;  3K60 A;  2XHX A;  3R4M A;  4BIU A;  2IOQ A;  1NHJ A;  2BRE A;  3RKZ A;  3CWV A;  4FCP A;  4JQL A;  4EGI A;  3HYZ A;  2XX5 A;  4YKZ A;  1Y8N A;  2VCI A;  2YEH A;  1UYG A;  4YKX A;  1OSF A;  1YES A;  4XCL A;  3ZM7 A;  1IXM A;  1UYM A;  2FWZ A;  2YKJ A;  2YKC A;  3O6O A;  3TZ4 A;  1Y4S A;  2XAB A;  2UWD A;  1A4H A;  4URN A;  3C0E A;  4CE1 A;  1Z5B A;  3PEH A;  5M4K A;  4XIP A;  5CTU A;  3IED A;  3QTF A;  5FND A;  4YKY A;  4E72 A;  3R4N A;  3GIF A;  4MPE A;  2Q2E B;  4ASB A;  4XKO A;  1AJ6 A;  1TC6 A;  2YE9 A;  2XDS A;  4EMV A;  2CCT A;  1YT0 A;  4MBC A;  2WI6 A;  4BAE A;  3WQ9 A;  1AH6 A;  2CGF A;  3TZ0 A;  2C2A A;  2XDX A;  1YSR A;  4ASG A;  4PU9 A;  3VHD A;  3U67 A;  4R3M A;  4P7A A;  1U0Z A;  5JEN A;  1QZR A;  1Z5C A;  4BXI A;  3T0H A;  3OWD A;  2BU5 A;  4NH9 A;  4Q20 A;  2QG0 A;  4HY1 A;  4O04 A;  2K5B A;  4GEE A;  4FMT A;  4GCZ A;  2QF6 A;  3B28 A;  5M4E A;  1UY8 A;  4ZKI A;  3R91 A;  3EKO A;  2IWS A;  3GIG B;  3OMU A;  2CG9 A;  4U7O A;  1UYF A;  4PRX A;  2YEJ A;  1UYD A;  2C1G A;  4WUB A;  2YEB A;  2O1V A;  5D7D A;  1YER A;  2BTZ A;  1BKN A;  3EHJ A;  2XCM A;  1TIL A;  4X9L A;  3U2D A;  4AS9 A;  2C1I A;  1BYQ A;  2YE4 A;  2XD6 A;  2O1U A;  4JAV A;  5D6Q A;  1YC1 A;  4XIT A;  2CCS A;  3EHF A;  2YEF A;  4YKW A;  3OW6 A;  4URO A;  5D7R A;  3VAD A;  4HYP A;  4YKU A;  3QDD A;  2CCU A;  4HY6 A;  3H80 A;  3SL2 A;  2FXS A;  2H8M A;  2WI5 A;  4MOT A;  2WI3 A;  3RLR A;  4KSH A;  2EXL A;  4DUH A;  4XKA A;  1UYK A;  5IDM A;  4H81 A;  4JAU A;  3HHU A;  5FNC A;  3EKR A;  5L3J A;  3VHA A;  3FT5 A;  2YJX A;  5FWK A;  2WI7 A;  1GJV A;  4EEH A;  4L91 A;  4BIZ A;  1Y4U A;  4V25 A;  3ZXO A;  4EGK A;  1EA6 A;  4L94 A;  5BOD A;  2YI7 A;  1JM6 A;  1UY9 A;  2YKB A;  3INW A;  3JZ3 A;  4EFU A;  2WI4 A;  4HZ0 A;  4U7N A;  3R4O A;  2BU2 A;  1KZN A;  4URM A;  2GFD A;  2YJW A;  5CTX A;  3Q5K A;  4YKT A;  2VWC A;  2JKI A;  2YI5 A;  1TBW A;  2IOP A;  4H85 A;  1YT2 A;  4CWP A;  4O07 A;  2WER A;  3D0B A;  2IWU A;  4CWN A;  1UYH A;  3FV5 A;  3LPS A;  2WI1 A;  3BM9 A;  4XD8 A;  3K99 A;  3Q5J A;  3S5T A;  2VCJ A;  3ZXQ A;  3TZ2 A;  3A0W A;  1I59 A;  5BOC A;  3GIE A;  4ZVI A;  2XHR A;  1MX0 A;  2BU8 A;  3U2K A;  3DGE A;  1QYE A;  1U2O A;  4JAS A;  3LNU A;  4E02 A;  4O05 A;  4URL A;  4I5S A;  4QPK A;  1B63 A;  3HEK A;  4EFT A;  3G7E A;  4LWI A;  2HHI A;  4O09 A;  2WEQ A;  1I5C A;  4MPN A;  3EHG A;  3CGY A;  1I5A A;  2YEI A;  2YK2 A;  3T2S A;  3HYY A;  4K4O A;  2YEA A;  2YEC A;  1YSZ A;  3WHA A;  3RLP A;  3OWB A;  4CWQ A;  2GQP A;  1S14 A;  3A0R A;  4P8O A;  2Q8F A;  3R92 A;  4AWP A;  4HXZ A;  2YE3 A;  2WI2 A;  4LP0 A;  3B27 A;  4E01 A;  4BQG A;  1TID A;  3A0Y A;  3LMM A;  2H55 A;  2YE7 A;  1I5B A;  1Y8P A;  4XIR A;  1ZW9 A;  2YE8 A;  2QFO A;  3OPD A;  1F51 A;  1ZXN A;  2ESA A;  4XDM A;  1H7U A;  4WUD A;  2XDL A;  4CWT A;  5FNF A;  2YK9 A;  4DZY A;  2BZ5 A;  4KSG A;  4H7Q A;  1Z59 A;  1Z5A A;  2YGE A;  3A0X A; 
#chains in the Genus database with same CATH homology
 5C93 A;  5D7C A;  2YE5 A;  4GGL A;  2YE6 A;  4EGH A;  1THN A;  1YC4 A;  1R62 A;  4LWE A;  3HZ5 A;  3VHC A;  3R4P A;  4PRV A;  4L90 A;  4GT8 A;  4KTN A;  4NH7 A;  2XJX A;  1Y8O A;  1YS3 A;  2HG1 A;  4XC0 A;  1TH8 A;  3TUH A;  4LWF A;  3TZ5 A;  2YED A;  2YEE A;  2YGA A;  4KQV A;  2XDU A;  2HKJ A;  3TTZ A;  5J6A A;  4XE2 A;  2Q8H A;  1QY8 A;  2YEG A;  4BQJ A;  5M4H A;  2FYP A;  4FPP A;  1YT1 A;  3B24 A;  4AWO A;  2E0A A;  5IN9 A;  4ASA A;  4CWF A;  1UYI A;  2O1W A;  4L93 A;  1YC3 A;  3T10 A;  4NH8 A;  2PNR A;  3O0I A;  1UY7 A;  1BGQ A;  2CH4 A;  1AMW A;  4I3H A;  4LWH A;  5CPH A;  4GFN A;  4MB9 A;  1BXD A;  2XHT A;  1AM1 A;  4KFG A;  4XTJ A;  4FCR A;  4R3A A;  3K98 A;  2YE2 A;  2VW5 A;  5M4N A;  3T0Z A;  3CRK A;  4HXW A;  2BRC A;  3D36 A;  4R1F A;  1ZWH A;  5CTW A;  4FCQ A;  2XX2 A;  1KIJ A;  2XK2 A;  4CE3 A;  3O2F A;  1UYE A;  2IOR A;  2BYI A;  2IWX A;  5F5R A;  4CE2 A;  4KP4 A;  3RLQ A;  4HYM A;  4U93 A;  4EM7 A;  3EHH A;  3FT8 A;  3PEJ A;  1PVG A;  4W7T A;  5J71 A;  2ZBK B;  2HCH A;  1TC0 A;  4LPB A;  2ZDX A;  3K97 A;  3Q5L A;  3BMY A;  3T1K A;  3A0T A;  2YI6 A;  4WUC A;  4AWQ A;  4L8Z A;  1GKX A;  5GGZ A;  1ID0 A;  4PL9 A;  3MNR P;  5D6P A;  3C11 A;  3INX A;  4B7P A;  4MPC A;  5IDJ A;  2WEP A;  5M4P A;  1GKZ A;  2JJC A;  3A0Z A;  2BSM A;  3D2R A;  2Q8I A;  2XJG A;  2ZDY A;  3CGZ A;  1MU5 A;  2ZKJ A;  1US7 A;  2XJJ A;  2XX4 A;  1B3Q A;  1NHH A;  3NMQ A;  3ZKB A;  3KE6 A;  5CTY A;  2BU6 A;  2XDK A;  2BT0 A;  2FWY A;  4GQT A;  3H4L A;  1UYC A;  3G75 A;  5M4M A;  1L0O A;  3B26 A;  4E00 A;  1EI1 A;  1I58 A;  4QPJ A;  3GIG A;  4CWO A;  4CWR A;  1UY6 A;  2YI0 A;  1UYL A;  4V26 A;  2QG2 A;  1S16 A;  4MP2 A;  4HZ5 A;  5CF0 A;  4LWG A;  2BU7 A;  2YKI A;  4YKQ A;  5F3K A;  1H7S A;  1YET A;  3HZ1 A;  4O0B A;  2YKE A;  2YGF A;  2Q8G A;  4CWS A;  4XCJ A;  3ZKD A;  4YKR A;  2AKP A;  1ZXM A;  3CRL A;  4XKK A;  1I5D A;  2BYH A;  1AH8 A;  1NHI A;  3B25 A;  1B62 A;  3G7B A;  4MP7 A;  4XIQ A;  4B6C A;  4ASF A;  3K60 A;  2XHX A;  3R4M A;  4BIU A;  2IOQ A;  1NHJ A;  2BRE A;  3RKZ A;  3CWV A;  4FCP A;  4JQL A;  4EGI A;  3HYZ A;  2XX5 A;  4YKZ A;  1Y8N A;  2VCI A;  2YEH A;  1UYG A;  4YKX A;  1OSF A;  1YES A;  4XCL A;  3ZM7 A;  1UYM A;  2FWZ A;  2YKJ A;  2YKC A;  3O6O A;  3TZ4 A;  1Y4S A;  2XAB A;  2UWD A;  1A4H A;  4URN A;  3C0E A;  4CE1 A;  1Z5B A;  3PEH A;  5M4K A;  4XIP A;  5CTU A;  3IED A;  3QTF A;  5FND A;  4YKY A;  3R4N A;  3GIF A;  4MPE A;  2Q2E B;  4ASB A;  4XKO A;  1AJ6 A;  1TC6 A;  2YE9 A;  2XDS A;  4EMV A;  2CCT A;  1YT0 A;  4MBC A;  2WI6 A;  4BAE A;  3WQ9 A;  1AH6 A;  2CGF A;  3TZ0 A;  2C2A A;  2XDX A;  1YSR A;  4ASG A;  4PU9 A;  3VHD A;  3U67 A;  4R3M A;  4P7A A;  1U0Z A;  1QZR A;  1Z5C A;  4BXI A;  3T0H A;  3OWD A;  2BU5 A;  4NH9 A;  4Q20 A;  2QG0 A;  4HY1 A;  4O04 A;  2K5B A;  4GEE A;  4FMT A;  4GCZ A;  2QF6 A;  3B28 A;  5M4E A;  1UY8 A;  4ZKI A;  3R91 A;  3EKO A;  2IWS A;  3GIG B;  3OMU A;  2CG9 A;  4U7O A;  1UYF A;  4PRX A;  2YEJ A;  1UYD A;  4WUB A;  2YEB A;  2O1V A;  5D7D A;  1YER A;  2BTZ A;  1BKN A;  3EHJ A;  2XCM A;  1TIL A;  4X9L A;  3U2D A;  4AS9 A;  1BYQ A;  2YE4 A;  2XD6 A;  2O1U A;  4JAV A;  5D6Q A;  1YC1 A;  4XIT A;  2CCS A;  3EHF A;  2YEF A;  4YKW A;  3OW6 A;  4URO A;  5D7R A;  3VAD A;  4HYP A;  4YKU A;  3QDD A;  2CCU A;  4HY6 A;  3H80 A;  3SL2 A;  2FXS A;  2H8M A;  2WI5 A;  4MOT A;  2WI3 A;  3RLR A;  4KSH A;  2EXL A;  4DUH A;  4XKA A;  1UYK A;  5IDM A;  4H81 A;  4JAU A;  3HHU A;  5FNC A;  3EKR A;  5L3J A;  3VHA A;  3FT5 A;  2YJX A;  5FWK A;  2WI7 A;  1GJV A;  4EEH A;  4L91 A;  4BIZ A;  1Y4U A;  4V25 A;  3ZXO A;  4EGK A;  1EA6 A;  4L94 A;  5BOD A;  2YI7 A;  1JM6 A;  1UY9 A;  2YKB A;  3INW A;  3JZ3 A;  4EFU A;  2WI4 A;  4HZ0 A;  4U7N A;  3R4O A;  2BU2 A;  1KZN A;  4URM A;  2GFD A;  2YJW A;  5CTX A;  3Q5K A;  4YKT A;  2VWC A;  2JKI A;  2YI5 A;  1TBW A;  2IOP A;  4H85 A;  1YT2 A;  4CWP A;  4O07 A;  2WER A;  3D0B A;  2IWU A;  4CWN A;  1UYH A;  3FV5 A;  3LPS A;  2WI1 A;  3BM9 A;  4XD8 A;  3K99 A;  3Q5J A;  2VCJ A;  3ZXQ A;  3TZ2 A;  3A0W A;  1I59 A;  5BOC A;  3GIE A;  4ZVI A;  2XHR A;  1MX0 A;  2BU8 A;  3U2K A;  3DGE A;  1QYE A;  1U2O A;  4JAS A;  3LNU A;  4E02 A;  4O05 A;  4URL A;  4I5S A;  4QPK A;  1B63 A;  3HEK A;  4EFT A;  3G7E A;  4LWI A;  4O09 A;  2WEQ A;  1I5C A;  4MPN A;  3EHG A;  3CGY A;  1I5A A;  2YEI A;  2YK2 A;  3T2S A;  3HYY A;  4K4O A;  2YEA A;  2YEC A;  1YSZ A;  3WHA A;  3RLP A;  3OWB A;  4CWQ A;  2GQP A;  1S14 A;  3A0R A;  4P8O A;  2Q8F A;  3R92 A;  4AWP A;  4HXZ A;  2YE3 A;  2WI2 A;  4LP0 A;  3B27 A;  4E01 A;  4BQG A;  1TID A;  3A0Y A;  2H55 A;  2YE7 A;  1I5B A;  1Y8P A;  4XIR A;  1ZW9 A;  2YE8 A;  2QFO A;  3OPD A;  2ESA A;  1ZXN A;  4XDM A;  1H7U A;  4WUD A;  2XDL A;  4CWT A;  5FNF A;  2YK9 A;  4DZY A;  2BZ5 A;  4KSG A;  4H7Q A;  1Z59 A;  1Z5A A;  2YGE A;  3A0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...