1TBWA

Ligand induced conformational shift in the n-terminal domain of grp94, open conformation
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
225
structure length
222
Chain Sequence
FAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTGKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title Ligand-induced Conformational Shift in the N-terminal Domain of GRP94, an Hsp90 Chaperone.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 75
structure length 222
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1tbwA00
3INXA 2JKIA 4O09A 3INWA 3RLPA 3TZ4A 3DGEA 3GIFA 1U0ZA 3H4LA 4O0BA 4O07A 3PEJA 2XX5A 4EGKA 4FCPA 3R4OA 4YKXA 2GQPA 3RLRA 1KIJA 4MPEA 4JASA 4L8ZA 3FT5A 5D6QA 2WI6A 4WUCA 1UY7A 1A4HA 4AWOA 4AWQA 2XDSA 4LWGA 1AH6A 4R3AA 4XIRA 5IDJA 5FNDA 2XDLA 1I5AA 2WEPA 1I59A 4GT8A 4HZ0A 5M4PA 4HXZA 1YC4A 4CWQA 4KFGA 4LWHA 2O1WA 4JAVA 4GGLA 3HYZA 3T0HA 1I5DA 4LPBA 5M4KA 4E01A 4L94A 4U93A 4BIUA 4DUHA 1UYCA 1UYFA 4HYMA 1THNA 2YI7A 2XJGA 4YKWA 4O05A 3TZ0A 4XKAA 2O1UA 2BRCA 3T10A 4FPPA 2UWDA 4XCLA 4V26A 4UROA 2VCJA 2YE4A 4KSGA 3LNUA 4XDMA 3WHAA 5CTWA 3U2DA 3RKZA 2BU2A 4LWIA 1BXDA 1ZXNA 1GKXA 5D7DA 3O6OA 2YEDA 3RLQA 1ZW9A 2XX4A 4L93A 1QY8A 5L3JA 4U7NA 3PEHA 2YKBA 1YS3A 2BYIA 2XHRA 3OPDA 3LPSA 4PRXA 5IDMA 3OW6A 3ZM7A 2BTZA 4BQGA 4CWNA 1QYEA 2IWXA 2XJJA 4AWPA 2YGFA 2IOQA 4LWEA 2BYHA 2QF6A 4MP2A 2H8MA 2YGAA 3FV5A 1AJ6A 5C93A 3VADA 1NHIA 4ZKIA 2IWUA 1UYLA 4HXWA 4PL9A 4ZVIA 4EFUA 1UYKA 5CTXA 3B27A 4JAUA 2XX2A 5F5RA 2Q8GA 4B6CA 2WI7A 3OWBA 2C2AA 4U7OA 2ZKJA 4QPKA 2BT0A 2WI1A 3B28A 4XTJA 3R92A 3CRKA 5D7RA 3B26A 4YKUA 2HCHA 2YE8A 2WI2A 4KP4A 3FT8A 3EHFA 1YSRA 1AH8A 1JM6A 4CE1A 3TUHA 1Y4UA 2VCIA 5CF0A 4XCJA 3H80A 5J71A 4YKYA 5D7CA 4EGIA 1YETA 3EHGA 1ZXMA 2HG1A 2H55A 1OSFA 1H7SA 2WERA 1YT2A 2FXSA 4YKZA 2YECA 3D2RA 3VHDA 3R91A 4P7AA 5BODA 4R1FA 4HZ5A 1EI1A 1Z5AA 2YE3A 4H81A 3GIGB 3GIEA 2PNRA 3QTFA 4CWSA 3TTZA 4R3MA 3D0BA 4CWTA 1EA6A 4GQTA 4WUDA 3EKRA 2WI5A 4CWFA 5CPHA 1MX0A 1U2OA 4YKQA 4KTNA 3CGYA 4URLA 3MNRP 2QG0A 3A0YA 3HHUA 2IORA 3KE6A 4EFTA 3R4PA 4ASGA 4H85A 4XITA 2YI6A 2ESAA 1S14A 5CTYA 3A0TA 2E0AA 3C11A 1YC3A 3G75A 1YT0A 2CGFA 1ID0A 4BQJA 2AKPA 3ZKDA 1TH8A 3HYYA 2IOPA 4XIQA 3Q5JA 1BYQA 3ZXOA 2YE5A 1UYEA 2YGEA 2XDXA 2FYPA 2YEEA 1YT1A 4W7TA 2EXLA 4BAEA 4DZYA 2ZDXA 4O04A 5M4MA 4P8OA 2YJWA 4X9LA 4URNA 4CWPA 2WEQA 2YE7A 1I5BA 2Q2EB 2ZDYA 4XIPA 3CRLA 1YSZA 4CE2A 2BU7A 4FCQA 1GJVA 1TC0A 3U67A 2YKCA 3K98A 1UYIA 2BU5A 1NHJA 2XHTA 4MPCA 1Y8PA 3TZ2A 3EHHA 3T0ZA 1PVGA 3IEDA 2YI5A 5FNCA 2BU8A 1UY8A 2ZBKB 4FMTA 4XKKA 2FWZA 3SL2A 4K4OA 4KQVA 1Z5BA 4GCZA 5CTUA 1MU5A 4JQLA 3CWVA 3QDDA 2CCTA 1YC1A 1TBWA 3HZ1A 4MPNA 2YEIA 3R4MA 4HY6A 4FCRA 4XE2A 2QG2A 3ZKBA 3A0WA 3JZ3A 2XJXA 2O1VA 2YKIA 2CCSA 3K99A 1H7UA 4I5SA 4HYPA 5GGZA 4YKTA 4EMVA 2XD6A 3G7EA 4PRVA 4CE3A 2BU6A 3A0XA 3TZ5A 1UY6A 1Y4SA 1NHHA 4MB9A 2YE6A 4BXIA 3NMQA 4V25A 3K60A 2WI3A 2XCMA 5FWKA 1TILA 5J6AA 2YE2A 4E02A 3VHAA 4CWOA 3CGZA 3ZXQA 1AM1A 4GEEA 5D6PA 4HY1A 4XD8A 4ASFA 1TIDA 2YEBA 5FNFA 2YEFA 4XC0A 4ASAA 3BM9A 3BMYA 3WQ9A 2YEJA 1B63A 2YI0A 2Q8FA 2CCUA 2HKJA 2YE9A 3HZ5A 3O2FA 5BOCA 1AMWA 2VWCA 4L90A 5M4EA 5M4HA 3B24A 4AS9A 2YEGA 4MP7A 2YEHA 2QFOA 3D36A 1US7A 1S16A 1BKNA 4H7QA 4L91A 2GFDA 1UY9A 2JJCA 1I5CA 3U2KA 4EGHA 1QZRA 2VW5A 5M4NA 4NH9A 4PU9A 3G7BA 1TC6A 4EM7A 3A0ZA 2FWYA 3OMUA 3T1KA 4URMA 2Q8IA 3A0RA 1UYDA 2K5BA 3GIGA 1UYMA 4B7PA 1YERA 2YK2A 3HEKA 2XHXA 2BSMA 5F3KA 2BZ5A 2YEAA 2XDUA 4BIZA 1Y8NA 1GKZA 1KZNA 3K97A 1B62A 1L0OA 4WUBA 2YKEA 1ZWHA 2XABA 2CH4A 4KSHA 3B25A 1B3QA 3O0IA 1Z59A 3OWDA 3T2SA 2YKJA 4MOTA 1YESA 1Y8OA 1UYGA 2YK9A 4E00A 4LP0A 4QPJA 1R62A 1Z5CA 4MBCA 4XKOA 2YJXA 2Q8HA 2CG9A 4NH7A 5IN9A 3VHCA 3Q5LA 3EKOA 2IWSA 4GFNA 2XDKA 4I3HA 4CWRA 3EHJA 2BREA 4EEHA 1UYHA 2WI4A 4Q20A 4YKRA 2XK2A 1I58A 1BGQA 3R4NA 4LWFA 4NH8A 3C0EA 4ASBA 3Q5KA
chains in the Genus database with same CATH superfamily
3INXA 2JKIA 4O09A 3INWA 3RLPA 3TZ4A 3DGEA 3GIFA 1U0ZA 3H4LA 4O0BA 4O07A 3PEJA 2XX5A 4EGKA 4FCPA 3R4OA 4YKXA 2GQPA 3RLRA 1KIJA 4MPEA 3LMMA 4JASA 4L8ZA 3FT5A 5D6QA 2WI6A 4WUCA 1UY7A 1A4HA 4AWOA 4AWQA 4E72A 2XDSA 4LWGA 1AH6A 4R3AA 4XIRA 5IDJA 5FNDA 2XDLA 1I5AA 2WEPA 1I59A 4GT8A 4HZ0A 5M4PA 4HXZA 1YC4A 4CWQA 4KFGA 4LWHA 2O1WA 4JAVA 2HHIA 4GGLA 3HYZA 3T0HA 1I5DA 4LPBA 5M4KA 4E01A 4L94A 4U93A 4BIUA 4DUHA 1UYCA 1UYFA 4HYMA 1THNA 2C1GA 2YI7A 2XJGA 4YKWA 4O05A 3TZ0A 4XKAA 2O1UA 2BRCA 3T10A 4FPPA 2UWDA 4XCLA 4V26A 4UROA 2VCJA 2YE4A 4KSGA 3LNUA 4XDMA 3WHAA 5CTWA 3U2DA 3RKZA 2BU2A 4LWIA 1BXDA 1ZXNA 1GKXA 5D7DA 3O6OA 2YEDA 3RLQA 1ZW9A 2XX4A 4L93A 1QY8A 5JENA 5L3JA 4U7NA 3PEHA 2YKBA 1YS3A 2BYIA 2XHRA 3OPDA 3LPSA 4PRXA 5IDMA 3OW6A 3ZM7A 2BTZA 4BQGA 4CWNA 1QYEA 2IWXA 2XJJA 4AWPA 2YGFA 2IOQA 4LWEA 2BYHA 2QF6A 4MP2A 2H8MA 2YGAA 3FV5A 1AJ6A 5C93A 3VADA 1NHIA 4ZKIA 2IWUA 1UYLA 4HXWA 4PL9A 4ZVIA 4EFUA 1UYKA 5CTXA 3B27A 4JAUA 2XX2A 5F5RA 2Q8GA 4B6CA 2WI7A 3OWBA 2C2AA 4U7OA 2ZKJA 4QPKA 2BT0A 2WI1A 3B28A 4XTJA 3R92A 3CRKA 5D7RA 3B26A 4YKUA 2HCHA 2YE8A 2WI2A 4KP4A 3FT8A 3EHFA 1YSRA 1AH8A 1JM6A 4CE1A 3TUHA 1Y4UA 2VCIA 5CF0A 4XCJA 3H80A 5J71A 4YKYA 5D7CA 4EGIA 1YETA 3EHGA 1ZXMA 2HG1A 2H55A 1OSFA 1H7SA 2WERA 1YT2A 2FXSA 4YKZA 2YECA 3D2RA 3VHDA 3R91A 4P7AA 5BODA 4R1FA 4HZ5A 1EI1A 1Z5AA 2YE3A 4H81A 3GIGB 3GIEA 2PNRA 3QTFA 4CWSA 3TTZA 4R3MA 3D0BA 4CWTA 1EA6A 4GQTA 4WUDA 3EKRA 2WI5A 4CWFA 5CPHA 1MX0A 1U2OA 4YKQA 4KTNA 3CGYA 4URLA 3MNRP 2QG0A 3A0YA 3HHUA 2IORA 3KE6A 4EFTA 3R4PA 3CYGA 4ASGA 4H85A 4XITA 2YI6A 2ESAA 1S14A 5CTYA 3A0TA 2E0AA 3C11A 1YC3A 3G75A 1YT0A 2CGFA 1ID0A 4BQJA 2AKPA 3ZKDA 1TH8A 3HYYA 2IOPA 4XIQA 3Q5JA 1BYQA 3ZXOA 2YE5A 1UYEA 2YGEA 2XDXA 2FYPA 2YEEA 1YT1A 4W7TA 2EXLA 4BAEA 4DZYA 2FTKA 2ZDXA 4O04A 5M4MA 4P8OA 2YJWA 4X9LA 4URNA 4CWPA 2WEQA 2YE7A 1I5BA 2Q2EB 2ZDYA 4XIPA 3CRLA 1YSZA 4CE2A 2BU7A 4FCQA 1GJVA 1TC0A 3U67A 2YKCA 3K98A 1UYIA 2BU5A 1NHJA 2XHTA 4MPCA 1Y8PA 3TZ2A 3EHHA 3T0ZA 1PVGA 3IEDA 2YI5A 5FNCA 2BU8A 1UY8A 2ZBKB 4FMTA 4XKKA 2FWZA 3SL2A 4K4OA 4KQVA 1Z5BA 4GCZA 5CTUA 1MU5A 4JQLA 3CWVA 3QDDA 2CCTA 1YC1A 1TBWA 3HZ1A 4MPNA 2YEIA 3R4MA 4HY6A 4FCRA 4XE2A 2QG2A 3ZKBA 3A0WA 3JZ3A 2XJXA 2O1VA 2YKIA 3S5TA 2CCSA 3K99A 1H7UA 4I5SA 4HYPA 5GGZA 4YKTA 4EMVA 2XD6A 3G7EA 4PRVA 4CE3A 2BU6A 3A0XA 3TZ5A 1UY6A 1Y4SA 1NHHA 4MB9A 2YE6A 4BXIA 3NMQA 4V25A 3K60A 2WI3A 2XCMA 5FWKA 1TILA 5J6AA 2YE2A 4E02A 3VHAA 4CWOA 3CGZA 3ZXQA 1AM1A 4GEEA 5D6PA 4HY1A 4XD8A 4ASFA 1TIDA 2YEBA 5FNFA 2YEFA 4XC0A 4ASAA 3BM9A 3BMYA 3WQ9A 2YEJA 1B63A 1IXMA 2YI0A 2Q8FA 2CCUA 2HKJA 2YE9A 3HZ5A 3O2FA 5BOCA 1AMWA 2VWCA 4L90A 5M4EA 5M4HA 3B24A 4AS9A 2YEGA 4MP7A 2YEHA 2QFOA 3D36A 1US7A 1S16A 1BKNA 4H7QA 4L91A 2GFDA 1UY9A 2JJCA 1I5CA 3U2KA 4EGHA 1QZRA 2VW5A 5M4NA 4NH9A 4PU9A 3G7BA 1TC6A 4EM7A 3A0ZA 2FWYA 3OMUA 3T1KA 4URMA 2Q8IA 3A0RA 1UYDA 2K5BA 3GIGA 1UYMA 4B7PA 1YERA 2YK2A 3HEKA 2XHXA 2BSMA 5F3KA 2BZ5A 2YEAA 2XDUA 4BIZA 1Y8NA 1F51A 1GKZA 1KZNA 3K97A 1B62A 1L0OA 4WUBA 2YKEA 1ZWHA 2XABA 2CH4A 4KSHA 3B25A 1B3QA 3O0IA 1Z59A 3OWDA 3T2SA 2YKJA 4MOTA 1YESA 1Y8OA 1UYGA 2YK9A 4E00A 4LP0A 4QPJA 1R62A 1Z5CA 4MBCA 4XKOA 2YJXA 2Q8HA 2CG9A 2C1IA 4NH7A 5IN9A 3VHCA 3Q5LA 3EKOA 2IWSA 4GFNA 2XDKA 4I3HA 4CWRA 3EHJA 2BREA 4EEHA 1UYHA 2WI4A 4Q20A 4YKRA 2XK2A 1I58A 1BGQA 3R4NA 4LWFA 4NH8A 3C0EA 4ASBA 3Q5KA
chains in the Genus database with same CATH topology
3INXA 2JKIA 4O09A 3INWA 3RLPA 3TZ4A 3DGEA 3GIFA 1U0ZA 3H4LA 4O0BA 4O07A 3PEJA 2XX5A 4EGKA 4FCPA 3R4OA 4YKXA 2GQPA 3RLRA 1KIJA 4MPEA 4JASA 4L8ZA 3FT5A 5D6QA 2WI6A 4WUCA 1UY7A 1A4HA 4AWOA 4AWQA 2XDSA 4LWGA 1AH6A 4R3AA 4XIRA 5IDJA 5FNDA 2XDLA 1I5AA 2WEPA 1I59A 4GT8A 4HZ0A 5M4PA 4HXZA 1YC4A 4CWQA 4KFGA 4LWHA 2O1WA 4JAVA 4GGLA 3HYZA 3T0HA 1I5DA 4LPBA 5M4KA 4E01A 4L94A 4U93A 4BIUA 4DUHA 1UYCA 1UYFA 4HYMA 1THNA 2YI7A 2XJGA 4YKWA 4O05A 3TZ0A 4XKAA 2O1UA 2BRCA 3T10A 4FPPA 2UWDA 4XCLA 4V26A 4UROA 2VCJA 2YE4A 4KSGA 3LNUA 4XDMA 3WHAA 5CTWA 3U2DA 3RKZA 2BU2A 4LWIA 1BXDA 1ZXNA 1GKXA 5D7DA 3O6OA 2YEDA 3RLQA 1ZW9A 2XX4A 4L93A 1QY8A 5L3JA 4U7NA 3PEHA 2YKBA 1YS3A 2BYIA 2XHRA 3OPDA 3LPSA 4PRXA 5IDMA 3OW6A 3ZM7A 2BTZA 4BQGA 4CWNA 1QYEA 2IWXA 2XJJA 4AWPA 2YGFA 2IOQA 4LWEA 2BYHA 2QF6A 4MP2A 2H8MA 2YGAA 3FV5A 1AJ6A 5C93A 3VADA 1NHIA 4ZKIA 2IWUA 1UYLA 4HXWA 4PL9A 4ZVIA 4EFUA 1UYKA 5CTXA 3B27A 4JAUA 2XX2A 5F5RA 2Q8GA 4B6CA 2WI7A 3OWBA 2C2AA 4U7OA 2ZKJA 4QPKA 2BT0A 2WI1A 3B28A 4XTJA 3R92A 3CRKA 5D7RA 3B26A 4YKUA 2HCHA 2YE8A 2WI2A 4KP4A 3FT8A 3EHFA 1YSRA 1AH8A 1JM6A 4CE1A 3TUHA 1Y4UA 2VCIA 5CF0A 4XCJA 3H80A 5J71A 4YKYA 5D7CA 4EGIA 1YETA 3EHGA 1ZXMA 2HG1A 2H55A 1OSFA 1H7SA 2WERA 1YT2A 2FXSA 4YKZA 2YECA 3D2RA 3VHDA 3R91A 4P7AA 5BODA 4R1FA 4HZ5A 1EI1A 1Z5AA 2YE3A 4H81A 3GIGB 3GIEA 2PNRA 3QTFA 4CWSA 3TTZA 4R3MA 3D0BA 4CWTA 1EA6A 4GQTA 4WUDA 3EKRA 2WI5A 4CWFA 5CPHA 1MX0A 1U2OA 4YKQA 4KTNA 3CGYA 4URLA 3MNRP 2QG0A 3A0YA 3HHUA 2IORA 3KE6A 4EFTA 3R4PA 4ASGA 4H85A 4XITA 2YI6A 2ESAA 1S14A 5CTYA 3A0TA 2E0AA 3C11A 1YC3A 3G75A 1YT0A 2CGFA 1ID0A 4BQJA 2AKPA 3ZKDA 1TH8A 3HYYA 2IOPA 4XIQA 3Q5JA 1BYQA 3ZXOA 2YE5A 1UYEA 2YGEA 2XDXA 2FYPA 2YEEA 1YT1A 4W7TA 2EXLA 4BAEA 4DZYA 2ZDXA 4O04A 5M4MA 4P8OA 2YJWA 4X9LA 4URNA 4CWPA 2WEQA 2YE7A 1I5BA 2Q2EB 2ZDYA 4XIPA 3CRLA 1YSZA 4CE2A 2BU7A 4FCQA 1GJVA 1TC0A 3U67A 2YKCA 3K98A 1UYIA 2BU5A 1NHJA 2XHTA 4MPCA 1Y8PA 3TZ2A 3EHHA 3T0ZA 1PVGA 3IEDA 2YI5A 5FNCA 2BU8A 1UY8A 2ZBKB 4FMTA 4XKKA 2FWZA 3SL2A 4K4OA 4KQVA 1Z5BA 4GCZA 5CTUA 1MU5A 4JQLA 3CWVA 3QDDA 2CCTA 1YC1A 1TBWA 3HZ1A 4MPNA 2YEIA 3R4MA 4HY6A 4FCRA 4XE2A 2QG2A 3ZKBA 3A0WA 3JZ3A 2XJXA 2O1VA 2YKIA 2CCSA 3K99A 1H7UA 4I5SA 4HYPA 5GGZA 4YKTA 4EMVA 2XD6A 3G7EA 4PRVA 4CE3A 2BU6A 3A0XA 3TZ5A 1UY6A 1Y4SA 1NHHA 4MB9A 2YE6A 4BXIA 3NMQA 4V25A 3K60A 2WI3A 2XCMA 5FWKA 1TILA 5J6AA 2YE2A 4E02A 3VHAA 4CWOA 3CGZA 3ZXQA 1AM1A 4GEEA 5D6PA 4HY1A 4XD8A 4ASFA 1TIDA 2YEBA 5FNFA 2YEFA 4XC0A 4ASAA 3BM9A 3BMYA 3WQ9A 2YEJA 1B63A 2YI0A 2Q8FA 2CCUA 2HKJA 2YE9A 3HZ5A 3O2FA 5BOCA 1AMWA 2VWCA 4L90A 5M4EA 5M4HA 3B24A 4AS9A 2YEGA 4MP7A 2YEHA 2QFOA 3D36A 1US7A 1S16A 1BKNA 4H7QA 4L91A 2GFDA 1UY9A 2JJCA 1I5CA 3U2KA 4EGHA 1QZRA 2VW5A 5M4NA 4NH9A 4PU9A 3G7BA 1TC6A 4EM7A 3A0ZA 2FWYA 3OMUA 3T1KA 4URMA 2Q8IA 3A0RA 1UYDA 2K5BA 3GIGA 1UYMA 4B7PA 1YERA 2YK2A 3HEKA 2XHXA 2BSMA 5F3KA 2BZ5A 2YEAA 2XDUA 4BIZA 1Y8NA 1GKZA 1KZNA 3K97A 1B62A 1L0OA 4WUBA 2YKEA 1ZWHA 2XABA 2CH4A 4KSHA 3B25A 1B3QA 3O0IA 1Z59A 3OWDA 3T2SA 2YKJA 4MOTA 1YESA 1Y8OA 1UYGA 2YK9A 4E00A 4LP0A 4QPJA 1R62A 1Z5CA 4MBCA 4XKOA 2YJXA 2Q8HA 2CG9A 4NH7A 5IN9A 3VHCA 3Q5LA 3EKOA 2IWSA 4GFNA 2XDKA 4I3HA 4CWRA 3EHJA 2BREA 4EEHA 1UYHA 2WI4A 4Q20A 4YKRA 2XK2A 1I58A 1BGQA 3R4NA 4LWFA 4NH8A 3C0EA 4ASBA 3Q5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3INX A;  2JKI A;  4O09 A;  3INW A;  3RLP A;  3TZ4 A;  3DGE A;  3GIF A;  1U0Z A;  3H4L A;  4O0B A;  4O07 A;  3PEJ A;  2XX5 A;  4EGK A;  4FCP A;  3R4O A;  4YKX A;  2GQP A;  3RLR A;  1KIJ A;  4MPE A;  4JAS A;  4L8Z A;  3FT5 A;  5D6Q A;  2WI6 A;  4WUC A;  1UY7 A;  1A4H A;  4AWO A;  4AWQ A;  2XDS A;  4LWG A;  1AH6 A;  4R3A A;  4XIR A;  5IDJ A;  5FND A;  2XDL A;  1I5A A;  2WEP A;  1I59 A;  4GT8 A;  4HZ0 A;  5M4P A;  4HXZ A;  1YC4 A;  4CWQ A;  4KFG A;  4LWH A;  2O1W A;  4JAV A;  4GGL A;  3HYZ A;  3T0H A;  1I5D A;  4LPB A;  5M4K A;  4E01 A;  4L94 A;  4U93 A;  4BIU A;  4DUH A;  1UYC A;  1UYF A;  4HYM A;  1THN A;  2YI7 A;  2XJG A;  4YKW A;  4O05 A;  3TZ0 A;  4XKA A;  2O1U A;  2BRC A;  3T10 A;  4FPP A;  2UWD A;  4XCL A;  4V26 A;  4URO A;  2VCJ A;  2YE4 A;  4KSG A;  3LNU A;  4XDM A;  3WHA A;  5CTW A;  3U2D A;  3RKZ A;  2BU2 A;  4LWI A;  1BXD A;  1ZXN A;  1GKX A;  5D7D A;  3O6O A;  2YED A;  3RLQ A;  1ZW9 A;  2XX4 A;  4L93 A;  1QY8 A;  5L3J A;  4U7N A;  3PEH A;  2YKB A;  1YS3 A;  2BYI A;  2XHR A;  3OPD A;  3LPS A;  4PRX A;  5IDM A;  3OW6 A;  3ZM7 A;  2BTZ A;  4BQG A;  4CWN A;  1QYE A;  2IWX A;  2XJJ A;  4AWP A;  2YGF A;  2IOQ A;  4LWE A;  2BYH A;  2QF6 A;  4MP2 A;  2H8M A;  2YGA A;  3FV5 A;  1AJ6 A;  5C93 A;  3VAD A;  1NHI A;  4ZKI A;  2IWU A;  1UYL A;  4HXW A;  4PL9 A;  4ZVI A;  4EFU A;  1UYK A;  5CTX A;  3B27 A;  4JAU A;  2XX2 A;  5F5R A;  2Q8G A;  4B6C A;  2WI7 A;  3OWB A;  2C2A A;  4U7O A;  2ZKJ A;  4QPK A;  2BT0 A;  2WI1 A;  3B28 A;  4XTJ A;  3R92 A;  3CRK A;  5D7R A;  3B26 A;  4YKU A;  2HCH A;  2YE8 A;  2WI2 A;  4KP4 A;  3FT8 A;  3EHF A;  1YSR A;  1AH8 A;  1JM6 A;  4CE1 A;  3TUH A;  1Y4U A;  2VCI A;  5CF0 A;  4XCJ A;  3H80 A;  5J71 A;  4YKY A;  5D7C A;  4EGI A;  1YET A;  3EHG A;  1ZXM A;  2HG1 A;  2H55 A;  1OSF A;  1H7S A;  2WER A;  1YT2 A;  2FXS A;  4YKZ A;  2YEC A;  3D2R A;  3VHD A;  3R91 A;  4P7A A;  5BOD A;  4R1F A;  4HZ5 A;  1EI1 A;  1Z5A A;  2YE3 A;  4H81 A;  3GIG B;  3GIE A;  2PNR A;  3QTF A;  4CWS A;  3TTZ A;  4R3M A;  3D0B A;  4CWT A;  1EA6 A;  4GQT A;  4WUD A;  3EKR A;  2WI5 A;  4CWF A;  5CPH A;  1MX0 A;  1U2O A;  4YKQ A;  4KTN A;  3CGY A;  4URL A;  3MNR P;  2QG0 A;  3A0Y A;  3HHU A;  2IOR A;  3KE6 A;  4EFT A;  3R4P A;  4ASG A;  4H85 A;  4XIT A;  2YI6 A;  2ESA A;  1S14 A;  5CTY A;  3A0T A;  2E0A A;  3C11 A;  1YC3 A;  3G75 A;  1YT0 A;  2CGF A;  1ID0 A;  4BQJ A;  2AKP A;  3ZKD A;  1TH8 A;  3HYY A;  2IOP A;  4XIQ A;  3Q5J A;  1BYQ A;  3ZXO A;  2YE5 A;  1UYE A;  2YGE A;  2XDX A;  2FYP A;  2YEE A;  1YT1 A;  4W7T A;  2EXL A;  4BAE A;  4DZY A;  2ZDX A;  4O04 A;  5M4M A;  4P8O A;  2YJW A;  4X9L A;  4URN A;  4CWP A;  2WEQ A;  2YE7 A;  1I5B A;  2Q2E B;  2ZDY A;  4XIP A;  3CRL A;  1YSZ A;  4CE2 A;  2BU7 A;  4FCQ A;  1GJV A;  1TC0 A;  3U67 A;  2YKC A;  3K98 A;  1UYI A;  2BU5 A;  1NHJ A;  2XHT A;  4MPC A;  1Y8P A;  3TZ2 A;  3EHH A;  3T0Z A;  1PVG A;  3IED A;  2YI5 A;  5FNC A;  2BU8 A;  1UY8 A;  2ZBK B;  4FMT A;  4XKK A;  2FWZ A;  3SL2 A;  4K4O A;  4KQV A;  1Z5B A;  4GCZ A;  5CTU A;  1MU5 A;  4JQL A;  3CWV A;  3QDD A;  2CCT A;  1YC1 A;  1TBW A;  3HZ1 A;  4MPN A;  2YEI A;  3R4M A;  4HY6 A;  4FCR A;  4XE2 A;  2QG2 A;  3ZKB A;  3A0W A;  3JZ3 A;  2XJX A;  2O1V A;  2YKI A;  2CCS A;  3K99 A;  1H7U A;  4I5S A;  4HYP A;  5GGZ A;  4YKT A;  4EMV A;  2XD6 A;  3G7E A;  4PRV A;  4CE3 A;  2BU6 A;  3A0X A;  3TZ5 A;  1UY6 A;  1Y4S A;  1NHH A;  4MB9 A;  2YE6 A;  4BXI A;  3NMQ A;  4V25 A;  3K60 A;  2WI3 A;  2XCM A;  5FWK A;  1TIL A;  5J6A A;  2YE2 A;  4E02 A;  3VHA A;  4CWO A;  3CGZ A;  3ZXQ A;  1AM1 A;  4GEE A;  5D6P A;  4HY1 A;  4XD8 A;  4ASF A;  1TID A;  2YEB A;  5FNF A;  2YEF A;  4XC0 A;  4ASA A;  3BM9 A;  3BMY A;  3WQ9 A;  2YEJ A;  1B63 A;  2YI0 A;  2Q8F A;  2CCU A;  2HKJ A;  2YE9 A;  3HZ5 A;  3O2F A;  5BOC A;  1AMW A;  2VWC A;  4L90 A;  5M4E A;  5M4H A;  3B24 A;  4AS9 A;  2YEG A;  4MP7 A;  2YEH A;  2QFO A;  3D36 A;  1US7 A;  1S16 A;  1BKN A;  4H7Q A;  4L91 A;  2GFD A;  1UY9 A;  2JJC A;  1I5C A;  3U2K A;  4EGH A;  1QZR A;  2VW5 A;  5M4N A;  4NH9 A;  4PU9 A;  3G7B A;  1TC6 A;  4EM7 A;  3A0Z A;  2FWY A;  3OMU A;  3T1K A;  4URM A;  2Q8I A;  3A0R A;  1UYD A;  2K5B A;  3GIG A;  1UYM A;  4B7P A;  1YER A;  2YK2 A;  3HEK A;  2XHX A;  2BSM A;  5F3K A;  2BZ5 A;  2YEA A;  2XDU A;  4BIZ A;  1Y8N A;  1GKZ A;  1KZN A;  3K97 A;  1B62 A;  1L0O A;  4WUB A;  2YKE A;  1ZWH A;  2XAB A;  2CH4 A;  4KSH A;  3B25 A;  1B3Q A;  3O0I A;  1Z59 A;  3OWD A;  3T2S A;  2YKJ A;  4MOT A;  1YES A;  1Y8O A;  1UYG A;  2YK9 A;  4E00 A;  4LP0 A;  4QPJ A;  1R62 A;  1Z5C A;  4MBC A;  4XKO A;  2YJX A;  2Q8H A;  2CG9 A;  4NH7 A;  5IN9 A;  3VHC A;  3Q5L A;  3EKO A;  2IWS A;  4GFN A;  2XDK A;  4I3H A;  4CWR A;  3EHJ A;  2BRE A;  4EEH A;  1UYH A;  2WI4 A;  4Q20 A;  4YKR A;  2XK2 A;  1I58 A;  1BGQ A;  3R4N A;  4LWF A;  4NH8 A;  3C0E A;  4ASB A;  3Q5K A; 
#chains in the Genus database with same CATH topology
 3INX A;  2JKI A;  4O09 A;  3INW A;  3RLP A;  3TZ4 A;  3DGE A;  3GIF A;  1U0Z A;  3H4L A;  4O0B A;  4O07 A;  3PEJ A;  2XX5 A;  4EGK A;  4FCP A;  3R4O A;  4YKX A;  2GQP A;  3RLR A;  1KIJ A;  4MPE A;  3LMM A;  4JAS A;  4L8Z A;  3FT5 A;  5D6Q A;  2WI6 A;  4WUC A;  1UY7 A;  1A4H A;  4AWO A;  4AWQ A;  4E72 A;  2XDS A;  4LWG A;  1AH6 A;  4R3A A;  4XIR A;  5IDJ A;  5FND A;  2XDL A;  1I5A A;  2WEP A;  1I59 A;  4GT8 A;  4HZ0 A;  5M4P A;  4HXZ A;  1YC4 A;  4CWQ A;  4KFG A;  4LWH A;  2O1W A;  4JAV A;  2HHI A;  4GGL A;  3HYZ A;  3T0H A;  1I5D A;  4LPB A;  5M4K A;  4E01 A;  4L94 A;  4U93 A;  4BIU A;  4DUH A;  1UYC A;  1UYF A;  4HYM A;  1THN A;  2C1G A;  2YI7 A;  2XJG A;  4YKW A;  4O05 A;  3TZ0 A;  4XKA A;  2O1U A;  2BRC A;  3T10 A;  4FPP A;  2UWD A;  4XCL A;  4V26 A;  4URO A;  2VCJ A;  2YE4 A;  4KSG A;  3LNU A;  4XDM A;  3WHA A;  5CTW A;  3U2D A;  3RKZ A;  2BU2 A;  4LWI A;  1BXD A;  1ZXN A;  1GKX A;  5D7D A;  3O6O A;  2YED A;  3RLQ A;  1ZW9 A;  2XX4 A;  4L93 A;  1QY8 A;  5JEN A;  5L3J A;  4U7N A;  3PEH A;  2YKB A;  1YS3 A;  2BYI A;  2XHR A;  3OPD A;  3LPS A;  4PRX A;  5IDM A;  3OW6 A;  3ZM7 A;  2BTZ A;  4BQG A;  4CWN A;  1QYE A;  2IWX A;  2XJJ A;  4AWP A;  2YGF A;  2IOQ A;  4LWE A;  2BYH A;  2QF6 A;  4MP2 A;  2H8M A;  2YGA A;  3FV5 A;  1AJ6 A;  5C93 A;  3VAD A;  1NHI A;  4ZKI A;  2IWU A;  1UYL A;  4HXW A;  4PL9 A;  4ZVI A;  4EFU A;  1UYK A;  5CTX A;  3B27 A;  4JAU A;  2XX2 A;  5F5R A;  2Q8G A;  4B6C A;  2WI7 A;  3OWB A;  2C2A A;  4U7O A;  2ZKJ A;  4QPK A;  2BT0 A;  2WI1 A;  3B28 A;  4XTJ A;  3R92 A;  3CRK A;  5D7R A;  3B26 A;  4YKU A;  2HCH A;  2YE8 A;  2WI2 A;  4KP4 A;  3FT8 A;  3EHF A;  1YSR A;  1AH8 A;  1JM6 A;  4CE1 A;  3TUH A;  1Y4U A;  2VCI A;  5CF0 A;  4XCJ A;  3H80 A;  5J71 A;  4YKY A;  5D7C A;  4EGI A;  1YET A;  3EHG A;  1ZXM A;  2HG1 A;  2H55 A;  1OSF A;  1H7S A;  2WER A;  1YT2 A;  2FXS A;  4YKZ A;  2YEC A;  3D2R A;  3VHD A;  3R91 A;  4P7A A;  5BOD A;  4R1F A;  4HZ5 A;  1EI1 A;  1Z5A A;  2YE3 A;  4H81 A;  3GIG B;  3GIE A;  2PNR A;  3QTF A;  4CWS A;  3TTZ A;  4R3M A;  3D0B A;  4CWT A;  1EA6 A;  4GQT A;  4WUD A;  3EKR A;  2WI5 A;  4CWF A;  5CPH A;  1MX0 A;  1U2O A;  4YKQ A;  4KTN A;  3CGY A;  4URL A;  3MNR P;  2QG0 A;  3A0Y A;  3HHU A;  2IOR A;  3KE6 A;  4EFT A;  3R4P A;  3CYG A;  4ASG A;  4H85 A;  4XIT A;  2YI6 A;  2ESA A;  1S14 A;  5CTY A;  3A0T A;  2E0A A;  3C11 A;  1YC3 A;  3G75 A;  1YT0 A;  2CGF A;  1ID0 A;  4BQJ A;  2AKP A;  3ZKD A;  1TH8 A;  3HYY A;  2IOP A;  4XIQ A;  3Q5J A;  1BYQ A;  3ZXO A;  2YE5 A;  1UYE A;  2YGE A;  2XDX A;  2FYP A;  2YEE A;  1YT1 A;  4W7T A;  2EXL A;  4BAE A;  4DZY A;  2FTK A;  2ZDX A;  4O04 A;  5M4M A;  4P8O A;  2YJW A;  4X9L A;  4URN A;  4CWP A;  2WEQ A;  2YE7 A;  1I5B A;  2Q2E B;  2ZDY A;  4XIP A;  3CRL A;  1YSZ A;  4CE2 A;  2BU7 A;  4FCQ A;  1GJV A;  1TC0 A;  3U67 A;  2YKC A;  3K98 A;  1UYI A;  2BU5 A;  1NHJ A;  2XHT A;  4MPC A;  1Y8P A;  3TZ2 A;  3EHH A;  3T0Z A;  1PVG A;  3IED A;  2YI5 A;  5FNC A;  2BU8 A;  1UY8 A;  2ZBK B;  4FMT A;  4XKK A;  2FWZ A;  3SL2 A;  4K4O A;  4KQV A;  1Z5B A;  4GCZ A;  5CTU A;  1MU5 A;  4JQL A;  3CWV A;  3QDD A;  2CCT A;  1YC1 A;  1TBW A;  3HZ1 A;  4MPN A;  2YEI A;  3R4M A;  4HY6 A;  4FCR A;  4XE2 A;  2QG2 A;  3ZKB A;  3A0W A;  3JZ3 A;  2XJX A;  2O1V A;  2YKI A;  3S5T A;  2CCS A;  3K99 A;  1H7U A;  4I5S A;  4HYP A;  5GGZ A;  4YKT A;  4EMV A;  2XD6 A;  3G7E A;  4PRV A;  4CE3 A;  2BU6 A;  3A0X A;  3TZ5 A;  1UY6 A;  1Y4S A;  1NHH A;  4MB9 A;  2YE6 A;  4BXI A;  3NMQ A;  4V25 A;  3K60 A;  2WI3 A;  2XCM A;  5FWK A;  1TIL A;  5J6A A;  2YE2 A;  4E02 A;  3VHA A;  4CWO A;  3CGZ A;  3ZXQ A;  1AM1 A;  4GEE A;  5D6P A;  4HY1 A;  4XD8 A;  4ASF A;  1TID A;  2YEB A;  5FNF A;  2YEF A;  4XC0 A;  4ASA A;  3BM9 A;  3BMY A;  3WQ9 A;  2YEJ A;  1B63 A;  1IXM A;  2YI0 A;  2Q8F A;  2CCU A;  2HKJ A;  2YE9 A;  3HZ5 A;  3O2F A;  5BOC A;  1AMW A;  2VWC A;  4L90 A;  5M4E A;  5M4H A;  3B24 A;  4AS9 A;  2YEG A;  4MP7 A;  2YEH A;  2QFO A;  3D36 A;  1US7 A;  1S16 A;  1BKN A;  4H7Q A;  4L91 A;  2GFD A;  1UY9 A;  2JJC A;  1I5C A;  3U2K A;  4EGH A;  1QZR A;  2VW5 A;  5M4N A;  4NH9 A;  4PU9 A;  3G7B A;  1TC6 A;  4EM7 A;  3A0Z A;  2FWY A;  3OMU A;  3T1K A;  4URM A;  2Q8I A;  3A0R A;  1UYD A;  2K5B A;  3GIG A;  1UYM A;  4B7P A;  1YER A;  2YK2 A;  3HEK A;  2XHX A;  2BSM A;  5F3K A;  2BZ5 A;  2YEA A;  2XDU A;  4BIZ A;  1Y8N A;  1F51 A;  1GKZ A;  1KZN A;  3K97 A;  1B62 A;  1L0O A;  4WUB A;  2YKE A;  1ZWH A;  2XAB A;  2CH4 A;  4KSH A;  3B25 A;  1B3Q A;  3O0I A;  1Z59 A;  3OWD A;  3T2S A;  2YKJ A;  4MOT A;  1YES A;  1Y8O A;  1UYG A;  2YK9 A;  4E00 A;  4LP0 A;  4QPJ A;  1R62 A;  1Z5C A;  4MBC A;  4XKO A;  2YJX A;  2Q8H A;  2CG9 A;  2C1I A;  4NH7 A;  5IN9 A;  3VHC A;  3Q5L A;  3EKO A;  2IWS A;  4GFN A;  2XDK A;  4I3H A;  4CWR A;  3EHJ A;  2BRE A;  4EEH A;  1UYH A;  2WI4 A;  4Q20 A;  4YKR A;  2XK2 A;  1I58 A;  1BGQ A;  3R4N A;  4LWF A;  4NH8 A;  3C0E A;  4ASB A;  3Q5K A; 
#chains in the Genus database with same CATH homology
 3INX A;  2JKI A;  4O09 A;  3INW A;  3RLP A;  3TZ4 A;  3DGE A;  3GIF A;  1U0Z A;  3H4L A;  4O0B A;  4O07 A;  3PEJ A;  2XX5 A;  4EGK A;  4FCP A;  3R4O A;  4YKX A;  2GQP A;  3RLR A;  1KIJ A;  4MPE A;  4JAS A;  4L8Z A;  3FT5 A;  5D6Q A;  2WI6 A;  4WUC A;  1UY7 A;  1A4H A;  4AWO A;  4AWQ A;  2XDS A;  4LWG A;  1AH6 A;  4R3A A;  4XIR A;  5IDJ A;  5FND A;  2XDL A;  1I5A A;  2WEP A;  1I59 A;  4GT8 A;  4HZ0 A;  5M4P A;  4HXZ A;  1YC4 A;  4CWQ A;  4KFG A;  4LWH A;  2O1W A;  4JAV A;  4GGL A;  3HYZ A;  3T0H A;  1I5D A;  4LPB A;  5M4K A;  4E01 A;  4L94 A;  4U93 A;  4BIU A;  4DUH A;  1UYC A;  1UYF A;  4HYM A;  1THN A;  2YI7 A;  2XJG A;  4YKW A;  4O05 A;  3TZ0 A;  4XKA A;  2O1U A;  2BRC A;  3T10 A;  4FPP A;  2UWD A;  4XCL A;  4V26 A;  4URO A;  2VCJ A;  2YE4 A;  4KSG A;  3LNU A;  4XDM A;  3WHA A;  5CTW A;  3U2D A;  3RKZ A;  2BU2 A;  4LWI A;  1BXD A;  1ZXN A;  1GKX A;  5D7D A;  3O6O A;  2YED A;  3RLQ A;  1ZW9 A;  2XX4 A;  4L93 A;  1QY8 A;  5L3J A;  4U7N A;  3PEH A;  2YKB A;  1YS3 A;  2BYI A;  2XHR A;  3OPD A;  3LPS A;  4PRX A;  5IDM A;  3OW6 A;  3ZM7 A;  2BTZ A;  4BQG A;  4CWN A;  1QYE A;  2IWX A;  2XJJ A;  4AWP A;  2YGF A;  2IOQ A;  4LWE A;  2BYH A;  2QF6 A;  4MP2 A;  2H8M A;  2YGA A;  3FV5 A;  1AJ6 A;  5C93 A;  3VAD A;  1NHI A;  4ZKI A;  2IWU A;  1UYL A;  4HXW A;  4PL9 A;  4ZVI A;  4EFU A;  1UYK A;  5CTX A;  3B27 A;  4JAU A;  2XX2 A;  5F5R A;  2Q8G A;  4B6C A;  2WI7 A;  3OWB A;  2C2A A;  4U7O A;  2ZKJ A;  4QPK A;  2BT0 A;  2WI1 A;  3B28 A;  4XTJ A;  3R92 A;  3CRK A;  5D7R A;  3B26 A;  4YKU A;  2HCH A;  2YE8 A;  2WI2 A;  4KP4 A;  3FT8 A;  3EHF A;  1YSR A;  1AH8 A;  1JM6 A;  4CE1 A;  3TUH A;  1Y4U A;  2VCI A;  5CF0 A;  4XCJ A;  3H80 A;  5J71 A;  4YKY A;  5D7C A;  4EGI A;  1YET A;  3EHG A;  1ZXM A;  2HG1 A;  2H55 A;  1OSF A;  1H7S A;  2WER A;  1YT2 A;  2FXS A;  4YKZ A;  2YEC A;  3D2R A;  3VHD A;  3R91 A;  4P7A A;  5BOD A;  4R1F A;  4HZ5 A;  1EI1 A;  1Z5A A;  2YE3 A;  4H81 A;  3GIG B;  3GIE A;  2PNR A;  3QTF A;  4CWS A;  3TTZ A;  4R3M A;  3D0B A;  4CWT A;  1EA6 A;  4GQT A;  4WUD A;  3EKR A;  2WI5 A;  4CWF A;  5CPH A;  1MX0 A;  1U2O A;  4YKQ A;  4KTN A;  3CGY A;  4URL A;  3MNR P;  2QG0 A;  3A0Y A;  3HHU A;  2IOR A;  3KE6 A;  4EFT A;  3R4P A;  4ASG A;  4H85 A;  4XIT A;  2YI6 A;  2ESA A;  1S14 A;  5CTY A;  3A0T A;  2E0A A;  3C11 A;  1YC3 A;  3G75 A;  1YT0 A;  2CGF A;  1ID0 A;  4BQJ A;  2AKP A;  3ZKD A;  1TH8 A;  3HYY A;  2IOP A;  4XIQ A;  3Q5J A;  1BYQ A;  3ZXO A;  2YE5 A;  1UYE A;  2YGE A;  2XDX A;  2FYP A;  2YEE A;  1YT1 A;  4W7T A;  2EXL A;  4BAE A;  4DZY A;  2ZDX A;  4O04 A;  5M4M A;  4P8O A;  2YJW A;  4X9L A;  4URN A;  4CWP A;  2WEQ A;  2YE7 A;  1I5B A;  2Q2E B;  2ZDY A;  4XIP A;  3CRL A;  1YSZ A;  4CE2 A;  2BU7 A;  4FCQ A;  1GJV A;  1TC0 A;  3U67 A;  2YKC A;  3K98 A;  1UYI A;  2BU5 A;  1NHJ A;  2XHT A;  4MPC A;  1Y8P A;  3TZ2 A;  3EHH A;  3T0Z A;  1PVG A;  3IED A;  2YI5 A;  5FNC A;  2BU8 A;  1UY8 A;  2ZBK B;  4FMT A;  4XKK A;  2FWZ A;  3SL2 A;  4K4O A;  4KQV A;  1Z5B A;  4GCZ A;  5CTU A;  1MU5 A;  4JQL A;  3CWV A;  3QDD A;  2CCT A;  1YC1 A;  1TBW A;  3HZ1 A;  4MPN A;  2YEI A;  3R4M A;  4HY6 A;  4FCR A;  4XE2 A;  2QG2 A;  3ZKB A;  3A0W A;  3JZ3 A;  2XJX A;  2O1V A;  2YKI A;  2CCS A;  3K99 A;  1H7U A;  4I5S A;  4HYP A;  5GGZ A;  4YKT A;  4EMV A;  2XD6 A;  3G7E A;  4PRV A;  4CE3 A;  2BU6 A;  3A0X A;  3TZ5 A;  1UY6 A;  1Y4S A;  1NHH A;  4MB9 A;  2YE6 A;  4BXI A;  3NMQ A;  4V25 A;  3K60 A;  2WI3 A;  2XCM A;  5FWK A;  1TIL A;  5J6A A;  2YE2 A;  4E02 A;  3VHA A;  4CWO A;  3CGZ A;  3ZXQ A;  1AM1 A;  4GEE A;  5D6P A;  4HY1 A;  4XD8 A;  4ASF A;  1TID A;  2YEB A;  5FNF A;  2YEF A;  4XC0 A;  4ASA A;  3BM9 A;  3BMY A;  3WQ9 A;  2YEJ A;  1B63 A;  2YI0 A;  2Q8F A;  2CCU A;  2HKJ A;  2YE9 A;  3HZ5 A;  3O2F A;  5BOC A;  1AMW A;  2VWC A;  4L90 A;  5M4E A;  5M4H A;  3B24 A;  4AS9 A;  2YEG A;  4MP7 A;  2YEH A;  2QFO A;  3D36 A;  1US7 A;  1S16 A;  1BKN A;  4H7Q A;  4L91 A;  2GFD A;  1UY9 A;  2JJC A;  1I5C A;  3U2K A;  4EGH A;  1QZR A;  2VW5 A;  5M4N A;  4NH9 A;  4PU9 A;  3G7B A;  1TC6 A;  4EM7 A;  3A0Z A;  2FWY A;  3OMU A;  3T1K A;  4URM A;  2Q8I A;  3A0R A;  1UYD A;  2K5B A;  3GIG A;  1UYM A;  4B7P A;  1YER A;  2YK2 A;  3HEK A;  2XHX A;  2BSM A;  5F3K A;  2BZ5 A;  2YEA A;  2XDU A;  4BIZ A;  1Y8N A;  1GKZ A;  1KZN A;  3K97 A;  1B62 A;  1L0O A;  4WUB A;  2YKE A;  1ZWH A;  2XAB A;  2CH4 A;  4KSH A;  3B25 A;  1B3Q A;  3O0I A;  1Z59 A;  3OWD A;  3T2S A;  2YKJ A;  4MOT A;  1YES A;  1Y8O A;  1UYG A;  2YK9 A;  4E00 A;  4LP0 A;  4QPJ A;  1R62 A;  1Z5C A;  4MBC A;  4XKO A;  2YJX A;  2Q8H A;  2CG9 A;  4NH7 A;  5IN9 A;  3VHC A;  3Q5L A;  3EKO A;  2IWS A;  4GFN A;  2XDK A;  4I3H A;  4CWR A;  3EHJ A;  2BRE A;  4EEH A;  1UYH A;  2WI4 A;  4Q20 A;  4YKR A;  2XK2 A;  1I58 A;  1BGQ A;  3R4N A;  4LWF A;  4NH8 A;  3C0E A;  4ASB A;  3Q5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...