1YT0A

Crystal structure of the unliganded form of grp94, the er hsp90: basis for nucleotide-induced conformational change, grp94n(delta)41 apo crystal soaked with adp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
227
structure length
194
Chain Sequence
EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Endoplasmin
publication title Structure of Unliganded GRP94, the Endoplasmic Reticulum Hsp90: BASIS FOR NUCLEOTIDE-INDUCED CONFORMATIONAL CHANGE
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 57
structure length 194
sequence length 227
ec nomenclature
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1yt0A00
2WI2A 4MP7A 5GGZA 2Q8IA 4HYPA 3HYZA 1UYKA 1PVGA 1UYIA 5FWKA 4LWFA 2YEJA 2CGFA 1I58A 1NHHA 5FNFA 2VCIA 2WI4A 4GFNA 1US7A 1NHIA 3H80A 4BIZA 3Q5LA 5CTWA 2YKIA 1UYDA 4JAVA 3PEJA 2YGFA 4XKOA 3OPDA 2O1UA 4GQTA 3A0RA 2QG0A 3SL2A 4HY6A 4R3MA 3VHCA 4CWSA 3WHAA 4GCZA 4MPEA 2XCMA 3R4MA 2BREA 2YJWA 3B27A 2IORA 4W7TA 4L91A 1S14A 1TIDA 4B6CA 4MP2A 4CWOA 5F3KA 3K99A 3K98A 2YJXA 3CWVA 3A0WA 3T0ZA 2XX2A 5D6QA 3Q5KA 4MPNA 3D2RA 3R4NA 4NH8A 2YE3A 1OSFA 4ZVIA 4AWQA 2Q8HA 2YE9A 4PRVA 1AH8A 2YI5A 4UROA 1ZW9A 4GGLA 3NMQA 1MX0A 2HKJA 4KP4A 4MB9A 4HZ5A 3QTFA 4WUBA 2XDSA 3T1KA 4WUDA 2BYHA 4AS9A 5M4KA 1JM6A 3R4OA 4CWPA 3CGZA 2VW5A 3Q5JA 4PRXA 4YKYA 1QZRA 2ESAA 3OWBA 2YK9A 3CRLA 4EMVA 2YI0A 2XDLA 2EXLA 2CCSA 1B63A 3TUHA 4XE2A 3TZ5A 3ZXOA 5M4NA 3EHHA 3HEKA 4XKKA 1BXDA 2XHTA 2BYIA 3RLQA 4R3AA 1UY7A 2XJGA 3ZM7A 2GQPA 4CWTA 4KQVA 4PL9A 4ASGA 4LWEA 1S16A 5IN9A 3T2SA 3MNRP 1R62A 2YE7A 1UY6A 3EKOA 1UYMA 2XDXA 4JQLA 2YECA 5CTYA 3O2FA 4FCPA 1ID0A 5M4HA 1EI1A 2ZBKB 1Z59A 1EA6A 4XCJA 2WEQA 2IWXA 3T0HA 3O6OA 4BAEA 2O1WA 4YKZA 2VCJA 4LWHA 1UYLA 2YK2A 4FCRA 1BGQA 4EGIA 2O1VA 1I5CA 2XHRA 4BQGA 2YEGA 1YC1A 3RKZA 1Y8PA 2FXSA 4O0BA 2ZKJA 1U0ZA 2YEBA 2XDUA 3G75A 4URNA 2AKPA 4CWNA 3A0ZA 2FWZA 4NH9A 4EFUA 1KIJA 1AM1A 1I5AA 1YC3A 3TZ2A 3C0EA 2YE8A 1YT1A 4KTNA 1KZNA 3G7BA 4YKXA 1Y8OA 2IOQA 3GIGB 3JZ3A 4CWQA 2E0AA 3ZKBA 1BYQA 2CCUA 3TZ4A 5D7RA 2YEDA 4LPBA 5FNDA 5D6PA 4O04A 4P7AA 4R1FA 2JKIA 2BTZA 4URMA 2CCTA 2XX5A 4CE1A 1UY9A 3EHJA 2JJCA 5CPHA 2YKEA 3WQ9A 3DGEA 2YKJA 2YI6A 3EHGA 2BRCA 5CTXA 2K5BA 5M4PA 1B62A 3CRKA 4GT8A 2ZDYA 1I5DA 5CF0A 4YKTA 3K97A 4XITA 4CWRA 3A0XA 4HYMA 3R4PA 1ZWHA 4BQJA 3B26A 3B25A 4FPPA 3R91A 4XC0A 3BM9A 1YESA 3GIGA 2Q2EB 2YGAA 4FCQA 3TZ0A 3ZXQA 4MOTA 4HZ0A 1U2OA 2QF6A 3QDDA 1YERA 1GJVA 1L0OA 4KSHA 1I59A 2YE2A 2C2AA 1UYEA 2YEIA 2XABA 2WI7A 4JAUA 4O05A 3O0IA 3FT5A 3A0TA 4YKWA 1I5BA 5D7CA 5D7DA 3GIFA 2XJJA 5C93A 3OWDA 4AWPA 3U67A 4QPJA 2XX4A 2WEPA 2GFDA 2YEAA 1NHJA 2IOPA 4EGKA 3EKRA 2YEFA 5CTUA 1Z5BA 2IWSA 4E01A 1YS3A 4GEEA 1YT0A 3B28A 4H85A 4U93A 1TILA 4CWFA 4AWOA 2H55A 2WERA 1TBWA 3H4LA 3IEDA 1QYEA 2Q8FA 4Q20A 1B3QA 4QPKA 4ASAA 4V25A 3RLPA 4L93A 3INWA 1AJ6A 3LNUA 1YC4A 3VHAA 4EEHA 1YSZA 4JASA 3LPSA 1H7UA 5J71A 4KFGA 4MBCA 4LP0A 2YE4A 2YGEA 2YKBA 3G7EA 3OMUA 4BXIA 2YE6A 3C11A 1TC0A 2BU8A 4XKAA 4E00A 5BODA 3ZKDA 4YKUA 3INXA 1Y4SA 1YSRA 4HXWA 2ZDXA 1TC6A 4U7NA 4DZYA 1GKZA 3B24A 2QFOA 4K4OA 3D36A 2XD6A 4XDMA 1AMWA 4B7PA 2BU6A 2XDKA 3GIEA 2XJXA 3CGYA 3K60A 4ASBA 4HXZA 1MU5A 3HHUA 1Z5AA 2PNRA 4NH7A 5M4EA 1H7SA 2CH4A 1Y4UA 2QG2A 1QY8A 4I3HA 5L3JA 2HCHA 2CG9A 4XTJA 4ASFA 4YKRA 2XHXA 4H81A 2BSMA 2YKCA 4L94A 2YI7A 2WI1A 2YE5A 4L90A 1Z5CA 4XCLA 4L8ZA 2FYPA 2FWYA 3OW6A 1UYFA 2YEEA 4CE2A 2BU5A 2UWDA 3A0YA 4HY1A 2VWCA 3KE6A 4XD8A 2BU7A 4PU9A 2WI3A 4XIRA 5BOCA 4I5SA 4MPCA 1TH8A 1BKNA 4EM7A 5J6AA 4URLA 2WI5A 1UYCA 5F5RA 5M4MA 4H7QA 4P8OA 5IDMA 2BZ5A 3T10A 4BIUA 3VADA 3EHFA 3FV5A 4EGHA 2WI6A 2YEHA 4ZKIA 4WUCA 4XIQA 1THNA 5IDJA 4KSGA 3R92A 2XK2A 2IWUA 4O09A 2H8MA 2Q8GA 3RLRA 4LWGA 3PEHA 1UY8A 3FT8A 4FMTA 3HZ5A 4YKQA 1Y8NA 1ZXNA 4O07A 4V26A 5FNCA 2HG1A 3U2DA 3VHDA 1UYHA 3D0BA 2BU2A 3HZ1A 4DUHA 1YT2A 1A4HA 3HYYA 3TTZA 4E02A 4EFTA 1UYGA 3BMYA 1ZXMA 4XIPA 2BT0A 4U7OA 1YETA 1AH6A 4CE3A 1GKXA 4LWIA 3U2KA 4X9LA
chains in the Genus database with same CATH superfamily
2WI2A 4MP7A 5GGZA 2Q8IA 4HYPA 3HYZA 1UYKA 1PVGA 1UYIA 5FWKA 4LWFA 2YEJA 2CGFA 1I58A 1NHHA 5FNFA 2VCIA 2WI4A 2C1GA 4GFNA 1US7A 1NHIA 3H80A 4BIZA 3Q5LA 5CTWA 2YKIA 1UYDA 4JAVA 5JENA 3PEJA 2YGFA 4XKOA 3OPDA 2O1UA 4GQTA 3A0RA 2QG0A 3SL2A 4HY6A 4R3MA 3VHCA 4CWSA 3WHAA 4GCZA 4MPEA 2XCMA 3R4MA 2BREA 2YJWA 3B27A 2IORA 4W7TA 4L91A 1S14A 1TIDA 4B6CA 4MP2A 4CWOA 5F3KA 3K99A 3K98A 2YJXA 3CWVA 2C1IA 3A0WA 2XX2A 3T0ZA 5D6QA 3Q5KA 4MPNA 3D2RA 3R4NA 4NH8A 2YE3A 1OSFA 4ZVIA 4AWQA 2Q8HA 2YE9A 4PRVA 1AH8A 2YI5A 4UROA 1ZW9A 4GGLA 3NMQA 1MX0A 2HKJA 4KP4A 4MB9A 4HZ5A 3QTFA 4WUBA 2XDSA 3T1KA 4WUDA 2BYHA 4AS9A 5M4KA 1JM6A 3R4OA 4CWPA 3CGZA 2VW5A 3Q5JA 4PRXA 4YKYA 1QZRA 2ESAA 3OWBA 2YK9A 3CRLA 4EMVA 2YI0A 2XDLA 2EXLA 2CCSA 1B63A 3TUHA 4XE2A 3TZ5A 3ZXOA 5M4NA 3EHHA 3HEKA 4XKKA 1BXDA 2XHTA 2BYIA 4E72A 3RLQA 4R3AA 1UY7A 2XJGA 3ZM7A 2GQPA 4CWTA 4KQVA 4PL9A 4ASGA 4LWEA 1S16A 5IN9A 3T2SA 3MNRP 1R62A 2YE7A 1UY6A 3EKOA 1UYMA 2XDXA 4JQLA 2YECA 5CTYA 3O2FA 4FCPA 1ID0A 5M4HA 1EI1A 2ZBKB 1Z59A 1EA6A 4XCJA 2WEQA 2IWXA 3T0HA 3O6OA 4BAEA 2O1WA 4YKZA 2VCJA 4LWHA 1UYLA 2YK2A 4FCRA 1BGQA 4EGIA 2O1VA 1I5CA 2XHRA 4BQGA 2YEGA 1YC1A 3RKZA 1Y8PA 2FXSA 4O0BA 2ZKJA 1U0ZA 2YEBA 2XDUA 3G75A 4URNA 2AKPA 4CWNA 3A0ZA 2FWZA 4NH9A 4EFUA 1KIJA 1AM1A 1I5AA 1YC3A 3TZ2A 3C0EA 2YE8A 1YT1A 4KTNA 1KZNA 3G7BA 4YKXA 1Y8OA 2IOQA 3GIGB 3JZ3A 4CWQA 2E0AA 3ZKBA 1BYQA 2CCUA 3TZ4A 5D7RA 2YEDA 4LPBA 5FNDA 5D6PA 4O04A 4P7AA 4R1FA 2JKIA 2BTZA 4URMA 2CCTA 2XX5A 4CE1A 1UY9A 3EHJA 2JJCA 5CPHA 2YKEA 3WQ9A 3DGEA 2YKJA 2YI6A 3EHGA 2BRCA 5CTXA 2K5BA 5M4PA 1B62A 3CRKA 4GT8A 2ZDYA 1I5DA 5CF0A 4YKTA 3K97A 4XITA 4CWRA 3A0XA 4HYMA 3R4PA 1ZWHA 4BQJA 3B26A 3B25A 4FPPA 3R91A 4XC0A 3BM9A 1YESA 3GIGA 2Q2EB 2YGAA 4FCQA 3TZ0A 3ZXQA 4MOTA 4HZ0A 1U2OA 2QF6A 3QDDA 1YERA 1GJVA 1L0OA 4KSHA 1I59A 2YE2A 2C2AA 1UYEA 2YEIA 2XABA 1IXMA 2WI7A 4JAUA 4O05A 3O0IA 3FT5A 3A0TA 4YKWA 1I5BA 5D7CA 5D7DA 3GIFA 2XJJA 5C93A 3OWDA 4AWPA 3U67A 4QPJA 2XX4A 2WEPA 2GFDA 2YEAA 1NHJA 2IOPA 4EGKA 3EKRA 2YEFA 5CTUA 1Z5BA 2IWSA 4E01A 1YS3A 4GEEA 1YT0A 3B28A 4H85A 4U93A 1TILA 4CWFA 4AWOA 2H55A 2WERA 3CYGA 1TBWA 3H4LA 3IEDA 1QYEA 2Q8FA 4Q20A 1B3QA 4QPKA 3S5TA 4ASAA 4V25A 3RLPA 4L93A 3INWA 1AJ6A 3LNUA 1YC4A 3VHAA 4EEHA 1YSZA 4JASA 3LPSA 1H7UA 5J71A 4KFGA 4MBCA 4LP0A 2YE4A 2YGEA 2YKBA 3G7EA 2HHIA 3OMUA 4BXIA 2YE6A 3C11A 1TC0A 2BU8A 4XKAA 4E00A 5BODA 3ZKDA 4YKUA 3INXA 1Y4SA 1YSRA 4HXWA 2ZDXA 1TC6A 4U7NA 4DZYA 1GKZA 3B24A 2QFOA 4K4OA 3D36A 2XD6A 4XDMA 1AMWA 4B7PA 2BU6A 1F51A 2XDKA 3GIEA 2XJXA 3CGYA 2FTKA 3K60A 4ASBA 4HXZA 1MU5A 3HHUA 1Z5AA 2PNRA 4NH7A 5M4EA 1H7SA 2CH4A 1Y4UA 2QG2A 1QY8A 4I3HA 5L3JA 2HCHA 2CG9A 4XTJA 4ASFA 4YKRA 2XHXA 4H81A 2BSMA 2YKCA 4L94A 2YI7A 2WI1A 2YE5A 4L90A 1Z5CA 4XCLA 4L8ZA 2FYPA 2FWYA 3OW6A 1UYFA 2YEEA 4CE2A 2BU5A 2UWDA 3A0YA 4HY1A 2VWCA 3KE6A 3LMMA 4XD8A 2BU7A 4PU9A 2WI3A 4XIRA 5BOCA 4I5SA 4MPCA 1TH8A 1BKNA 4EM7A 5J6AA 4URLA 2WI5A 1UYCA 5F5RA 5M4MA 4H7QA 4P8OA 5IDMA 2BZ5A 3T10A 4BIUA 3VADA 3EHFA 3FV5A 4EGHA 2WI6A 2YEHA 4ZKIA 4WUCA 4XIQA 1THNA 5IDJA 4KSGA 3R92A 2XK2A 2IWUA 4O09A 2H8MA 2Q8GA 3RLRA 4LWGA 3PEHA 1UY8A 3FT8A 4FMTA 3HZ5A 4YKQA 1Y8NA 1ZXNA 4O07A 4V26A 5FNCA 2HG1A 3U2DA 3VHDA 1UYHA 3D0BA 2BU2A 3HZ1A 4DUHA 1YT2A 1A4HA 3HYYA 3TTZA 4E02A 4EFTA 1UYGA 3BMYA 1ZXMA 4XIPA 2BT0A 4U7OA 1YETA 1AH6A 4CE3A 1GKXA 4LWIA 3U2KA 4X9LA
chains in the Genus database with same CATH topology
2WI2A 4MP7A 5GGZA 2Q8IA 4HYPA 3HYZA 1UYKA 1PVGA 1UYIA 5FWKA 4LWFA 2YEJA 2CGFA 1I58A 1NHHA 5FNFA 2VCIA 2WI4A 4GFNA 1US7A 1NHIA 3H80A 4BIZA 3Q5LA 5CTWA 2YKIA 1UYDA 4JAVA 3PEJA 2YGFA 4XKOA 3OPDA 2O1UA 4GQTA 3A0RA 2QG0A 3SL2A 4HY6A 4R3MA 3VHCA 4CWSA 3WHAA 4GCZA 4MPEA 2XCMA 3R4MA 2BREA 2YJWA 3B27A 2IORA 4W7TA 4L91A 1S14A 1TIDA 4B6CA 4MP2A 4CWOA 5F3KA 3K99A 3K98A 2YJXA 3CWVA 3A0WA 3T0ZA 2XX2A 5D6QA 3Q5KA 4MPNA 3D2RA 3R4NA 4NH8A 2YE3A 1OSFA 4ZVIA 4AWQA 2Q8HA 2YE9A 4PRVA 1AH8A 2YI5A 4UROA 1ZW9A 4GGLA 3NMQA 1MX0A 2HKJA 4KP4A 4MB9A 4HZ5A 3QTFA 4WUBA 2XDSA 3T1KA 4WUDA 2BYHA 4AS9A 5M4KA 1JM6A 3R4OA 4CWPA 3CGZA 2VW5A 3Q5JA 4PRXA 4YKYA 1QZRA 2ESAA 3OWBA 2YK9A 3CRLA 4EMVA 2YI0A 2XDLA 2EXLA 2CCSA 1B63A 3TUHA 4XE2A 3TZ5A 3ZXOA 5M4NA 3EHHA 3HEKA 4XKKA 1BXDA 2XHTA 2BYIA 3RLQA 4R3AA 1UY7A 2XJGA 3ZM7A 2GQPA 4CWTA 4KQVA 4PL9A 4ASGA 4LWEA 1S16A 5IN9A 3T2SA 3MNRP 1R62A 2YE7A 1UY6A 3EKOA 1UYMA 2XDXA 4JQLA 2YECA 5CTYA 3O2FA 4FCPA 1ID0A 5M4HA 1EI1A 2ZBKB 1Z59A 1EA6A 4XCJA 2WEQA 2IWXA 3T0HA 3O6OA 4BAEA 2O1WA 4YKZA 2VCJA 4LWHA 1UYLA 2YK2A 4FCRA 1BGQA 4EGIA 2O1VA 1I5CA 2XHRA 4BQGA 2YEGA 1YC1A 3RKZA 1Y8PA 2FXSA 4O0BA 2ZKJA 1U0ZA 2YEBA 2XDUA 3G75A 4URNA 2AKPA 4CWNA 3A0ZA 2FWZA 4NH9A 4EFUA 1KIJA 1AM1A 1I5AA 1YC3A 3TZ2A 3C0EA 2YE8A 1YT1A 4KTNA 1KZNA 3G7BA 4YKXA 1Y8OA 2IOQA 3GIGB 3JZ3A 4CWQA 2E0AA 3ZKBA 1BYQA 2CCUA 3TZ4A 5D7RA 2YEDA 4LPBA 5FNDA 5D6PA 4O04A 4P7AA 4R1FA 2JKIA 2BTZA 4URMA 2CCTA 2XX5A 4CE1A 1UY9A 3EHJA 2JJCA 5CPHA 2YKEA 3WQ9A 3DGEA 2YKJA 2YI6A 3EHGA 2BRCA 5CTXA 2K5BA 5M4PA 1B62A 3CRKA 4GT8A 2ZDYA 1I5DA 5CF0A 4YKTA 3K97A 4XITA 4CWRA 3A0XA 4HYMA 3R4PA 1ZWHA 4BQJA 3B26A 3B25A 4FPPA 3R91A 4XC0A 3BM9A 1YESA 3GIGA 2Q2EB 2YGAA 4FCQA 3TZ0A 3ZXQA 4MOTA 4HZ0A 1U2OA 2QF6A 3QDDA 1YERA 1GJVA 1L0OA 4KSHA 1I59A 2YE2A 2C2AA 1UYEA 2YEIA 2XABA 2WI7A 4JAUA 4O05A 3O0IA 3FT5A 3A0TA 4YKWA 1I5BA 5D7CA 5D7DA 3GIFA 2XJJA 5C93A 3OWDA 4AWPA 3U67A 4QPJA 2XX4A 2WEPA 2GFDA 2YEAA 1NHJA 2IOPA 4EGKA 3EKRA 2YEFA 5CTUA 1Z5BA 2IWSA 4E01A 1YS3A 4GEEA 1YT0A 3B28A 4H85A 4U93A 1TILA 4CWFA 4AWOA 2H55A 2WERA 1TBWA 3H4LA 3IEDA 1QYEA 2Q8FA 4Q20A 1B3QA 4QPKA 4ASAA 4V25A 3RLPA 4L93A 3INWA 1AJ6A 3LNUA 1YC4A 3VHAA 4EEHA 1YSZA 4JASA 3LPSA 1H7UA 5J71A 4KFGA 4MBCA 4LP0A 2YE4A 2YGEA 2YKBA 3G7EA 3OMUA 4BXIA 2YE6A 3C11A 1TC0A 2BU8A 4XKAA 4E00A 5BODA 3ZKDA 4YKUA 3INXA 1Y4SA 1YSRA 4HXWA 2ZDXA 1TC6A 4U7NA 4DZYA 1GKZA 3B24A 2QFOA 4K4OA 3D36A 2XD6A 4XDMA 1AMWA 4B7PA 2BU6A 2XDKA 3GIEA 2XJXA 3CGYA 3K60A 4ASBA 4HXZA 1MU5A 3HHUA 1Z5AA 2PNRA 4NH7A 5M4EA 1H7SA 2CH4A 1Y4UA 2QG2A 1QY8A 4I3HA 5L3JA 2HCHA 2CG9A 4XTJA 4ASFA 4YKRA 2XHXA 4H81A 2BSMA 2YKCA 4L94A 2YI7A 2WI1A 2YE5A 4L90A 1Z5CA 4XCLA 4L8ZA 2FYPA 2FWYA 3OW6A 1UYFA 2YEEA 4CE2A 2BU5A 2UWDA 3A0YA 4HY1A 2VWCA 3KE6A 4XD8A 2BU7A 4PU9A 2WI3A 4XIRA 5BOCA 4I5SA 4MPCA 1TH8A 1BKNA 4EM7A 5J6AA 4URLA 2WI5A 1UYCA 5F5RA 5M4MA 4H7QA 4P8OA 5IDMA 2BZ5A 3T10A 4BIUA 3VADA 3EHFA 3FV5A 4EGHA 2WI6A 2YEHA 4ZKIA 4WUCA 4XIQA 1THNA 5IDJA 4KSGA 3R92A 2XK2A 2IWUA 4O09A 2H8MA 2Q8GA 3RLRA 4LWGA 3PEHA 1UY8A 3FT8A 4FMTA 3HZ5A 4YKQA 1Y8NA 1ZXNA 4O07A 4V26A 5FNCA 2HG1A 3U2DA 3VHDA 1UYHA 3D0BA 2BU2A 3HZ1A 4DUHA 1YT2A 1A4HA 3HYYA 3TTZA 4E02A 4EFTA 1UYGA 3BMYA 1ZXMA 4XIPA 2BT0A 4U7OA 1YETA 1AH6A 4CE3A 1GKXA 4LWIA 3U2KA 4X9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WI2 A;  4MP7 A;  5GGZ A;  2Q8I A;  4HYP A;  3HYZ A;  1UYK A;  1PVG A;  1UYI A;  5FWK A;  4LWF A;  2YEJ A;  2CGF A;  1I58 A;  1NHH A;  5FNF A;  2VCI A;  2WI4 A;  4GFN A;  1US7 A;  1NHI A;  3H80 A;  4BIZ A;  3Q5L A;  5CTW A;  2YKI A;  1UYD A;  4JAV A;  3PEJ A;  2YGF A;  4XKO A;  3OPD A;  2O1U A;  4GQT A;  3A0R A;  2QG0 A;  3SL2 A;  4HY6 A;  4R3M A;  3VHC A;  4CWS A;  3WHA A;  4GCZ A;  4MPE A;  2XCM A;  3R4M A;  2BRE A;  2YJW A;  3B27 A;  2IOR A;  4W7T A;  4L91 A;  1S14 A;  1TID A;  4B6C A;  4MP2 A;  4CWO A;  5F3K A;  3K99 A;  3K98 A;  2YJX A;  3CWV A;  3A0W A;  3T0Z A;  2XX2 A;  5D6Q A;  3Q5K A;  4MPN A;  3D2R A;  3R4N A;  4NH8 A;  2YE3 A;  1OSF A;  4ZVI A;  4AWQ A;  2Q8H A;  2YE9 A;  4PRV A;  1AH8 A;  2YI5 A;  4URO A;  1ZW9 A;  4GGL A;  3NMQ A;  1MX0 A;  2HKJ A;  4KP4 A;  4MB9 A;  4HZ5 A;  3QTF A;  4WUB A;  2XDS A;  3T1K A;  4WUD A;  2BYH A;  4AS9 A;  5M4K A;  1JM6 A;  3R4O A;  4CWP A;  3CGZ A;  2VW5 A;  3Q5J A;  4PRX A;  4YKY A;  1QZR A;  2ESA A;  3OWB A;  2YK9 A;  3CRL A;  4EMV A;  2YI0 A;  2XDL A;  2EXL A;  2CCS A;  1B63 A;  3TUH A;  4XE2 A;  3TZ5 A;  3ZXO A;  5M4N A;  3EHH A;  3HEK A;  4XKK A;  1BXD A;  2XHT A;  2BYI A;  3RLQ A;  4R3A A;  1UY7 A;  2XJG A;  3ZM7 A;  2GQP A;  4CWT A;  4KQV A;  4PL9 A;  4ASG A;  4LWE A;  1S16 A;  5IN9 A;  3T2S A;  3MNR P;  1R62 A;  2YE7 A;  1UY6 A;  3EKO A;  1UYM A;  2XDX A;  4JQL A;  2YEC A;  5CTY A;  3O2F A;  4FCP A;  1ID0 A;  5M4H A;  1EI1 A;  2ZBK B;  1Z59 A;  1EA6 A;  4XCJ A;  2WEQ A;  2IWX A;  3T0H A;  3O6O A;  4BAE A;  2O1W A;  4YKZ A;  2VCJ A;  4LWH A;  1UYL A;  2YK2 A;  4FCR A;  1BGQ A;  4EGI A;  2O1V A;  1I5C A;  2XHR A;  4BQG A;  2YEG A;  1YC1 A;  3RKZ A;  1Y8P A;  2FXS A;  4O0B A;  2ZKJ A;  1U0Z A;  2YEB A;  2XDU A;  3G75 A;  4URN A;  2AKP A;  4CWN A;  3A0Z A;  2FWZ A;  4NH9 A;  4EFU A;  1KIJ A;  1AM1 A;  1I5A A;  1YC3 A;  3TZ2 A;  3C0E A;  2YE8 A;  1YT1 A;  4KTN A;  1KZN A;  3G7B A;  4YKX A;  1Y8O A;  2IOQ A;  3GIG B;  3JZ3 A;  4CWQ A;  2E0A A;  3ZKB A;  1BYQ A;  2CCU A;  3TZ4 A;  5D7R A;  2YED A;  4LPB A;  5FND A;  5D6P A;  4O04 A;  4P7A A;  4R1F A;  2JKI A;  2BTZ A;  4URM A;  2CCT A;  2XX5 A;  4CE1 A;  1UY9 A;  3EHJ A;  2JJC A;  5CPH A;  2YKE A;  3WQ9 A;  3DGE A;  2YKJ A;  2YI6 A;  3EHG A;  2BRC A;  5CTX A;  2K5B A;  5M4P A;  1B62 A;  3CRK A;  4GT8 A;  2ZDY A;  1I5D A;  5CF0 A;  4YKT A;  3K97 A;  4XIT A;  4CWR A;  3A0X A;  4HYM A;  3R4P A;  1ZWH A;  4BQJ A;  3B26 A;  3B25 A;  4FPP A;  3R91 A;  4XC0 A;  3BM9 A;  1YES A;  3GIG A;  2Q2E B;  2YGA A;  4FCQ A;  3TZ0 A;  3ZXQ A;  4MOT A;  4HZ0 A;  1U2O A;  2QF6 A;  3QDD A;  1YER A;  1GJV A;  1L0O A;  4KSH A;  1I59 A;  2YE2 A;  2C2A A;  1UYE A;  2YEI A;  2XAB A;  2WI7 A;  4JAU A;  4O05 A;  3O0I A;  3FT5 A;  3A0T A;  4YKW A;  1I5B A;  5D7C A;  5D7D A;  3GIF A;  2XJJ A;  5C93 A;  3OWD A;  4AWP A;  3U67 A;  4QPJ A;  2XX4 A;  2WEP A;  2GFD A;  2YEA A;  1NHJ A;  2IOP A;  4EGK A;  3EKR A;  2YEF A;  5CTU A;  1Z5B A;  2IWS A;  4E01 A;  1YS3 A;  4GEE A;  1YT0 A;  3B28 A;  4H85 A;  4U93 A;  1TIL A;  4CWF A;  4AWO A;  2H55 A;  2WER A;  1TBW A;  3H4L A;  3IED A;  1QYE A;  2Q8F A;  4Q20 A;  1B3Q A;  4QPK A;  4ASA A;  4V25 A;  3RLP A;  4L93 A;  3INW A;  1AJ6 A;  3LNU A;  1YC4 A;  3VHA A;  4EEH A;  1YSZ A;  4JAS A;  3LPS A;  1H7U A;  5J71 A;  4KFG A;  4MBC A;  4LP0 A;  2YE4 A;  2YGE A;  2YKB A;  3G7E A;  3OMU A;  4BXI A;  2YE6 A;  3C11 A;  1TC0 A;  2BU8 A;  4XKA A;  4E00 A;  5BOD A;  3ZKD A;  4YKU A;  3INX A;  1Y4S A;  1YSR A;  4HXW A;  2ZDX A;  1TC6 A;  4U7N A;  4DZY A;  1GKZ A;  3B24 A;  2QFO A;  4K4O A;  3D36 A;  2XD6 A;  4XDM A;  1AMW A;  4B7P A;  2BU6 A;  2XDK A;  3GIE A;  2XJX A;  3CGY A;  3K60 A;  4ASB A;  4HXZ A;  1MU5 A;  3HHU A;  1Z5A A;  2PNR A;  4NH7 A;  5M4E A;  1H7S A;  2CH4 A;  1Y4U A;  2QG2 A;  1QY8 A;  4I3H A;  5L3J A;  2HCH A;  2CG9 A;  4XTJ A;  4ASF A;  4YKR A;  2XHX A;  4H81 A;  2BSM A;  2YKC A;  4L94 A;  2YI7 A;  2WI1 A;  2YE5 A;  4L90 A;  1Z5C A;  4XCL A;  4L8Z A;  2FYP A;  2FWY A;  3OW6 A;  1UYF A;  2YEE A;  4CE2 A;  2BU5 A;  2UWD A;  3A0Y A;  4HY1 A;  2VWC A;  3KE6 A;  4XD8 A;  2BU7 A;  4PU9 A;  2WI3 A;  4XIR A;  5BOC A;  4I5S A;  4MPC A;  1TH8 A;  1BKN A;  4EM7 A;  5J6A A;  4URL A;  2WI5 A;  1UYC A;  5F5R A;  5M4M A;  4H7Q A;  4P8O A;  5IDM A;  2BZ5 A;  3T10 A;  4BIU A;  3VAD A;  3EHF A;  3FV5 A;  4EGH A;  2WI6 A;  2YEH A;  4ZKI A;  4WUC A;  4XIQ A;  1THN A;  5IDJ A;  4KSG A;  3R92 A;  2XK2 A;  2IWU A;  4O09 A;  2H8M A;  2Q8G A;  3RLR A;  4LWG A;  3PEH A;  1UY8 A;  3FT8 A;  4FMT A;  3HZ5 A;  4YKQ A;  1Y8N A;  1ZXN A;  4O07 A;  4V26 A;  5FNC A;  2HG1 A;  3U2D A;  3VHD A;  1UYH A;  3D0B A;  2BU2 A;  3HZ1 A;  4DUH A;  1YT2 A;  1A4H A;  3HYY A;  3TTZ A;  4E02 A;  4EFT A;  1UYG A;  3BMY A;  1ZXM A;  4XIP A;  2BT0 A;  4U7O A;  1YET A;  1AH6 A;  4CE3 A;  1GKX A;  4LWI A;  3U2K A;  4X9L A; 
#chains in the Genus database with same CATH topology
 2WI2 A;  4MP7 A;  5GGZ A;  2Q8I A;  4HYP A;  3HYZ A;  1UYK A;  1PVG A;  1UYI A;  5FWK A;  4LWF A;  2YEJ A;  2CGF A;  1I58 A;  1NHH A;  5FNF A;  2VCI A;  2WI4 A;  2C1G A;  4GFN A;  1US7 A;  1NHI A;  3H80 A;  4BIZ A;  3Q5L A;  5CTW A;  2YKI A;  1UYD A;  4JAV A;  5JEN A;  3PEJ A;  2YGF A;  4XKO A;  3OPD A;  2O1U A;  4GQT A;  3A0R A;  2QG0 A;  3SL2 A;  4HY6 A;  4R3M A;  3VHC A;  4CWS A;  3WHA A;  4GCZ A;  4MPE A;  2XCM A;  3R4M A;  2BRE A;  2YJW A;  3B27 A;  2IOR A;  4W7T A;  4L91 A;  1S14 A;  1TID A;  4B6C A;  4MP2 A;  4CWO A;  5F3K A;  3K99 A;  3K98 A;  2YJX A;  3CWV A;  2C1I A;  3A0W A;  2XX2 A;  3T0Z A;  5D6Q A;  3Q5K A;  4MPN A;  3D2R A;  3R4N A;  4NH8 A;  2YE3 A;  1OSF A;  4ZVI A;  4AWQ A;  2Q8H A;  2YE9 A;  4PRV A;  1AH8 A;  2YI5 A;  4URO A;  1ZW9 A;  4GGL A;  3NMQ A;  1MX0 A;  2HKJ A;  4KP4 A;  4MB9 A;  4HZ5 A;  3QTF A;  4WUB A;  2XDS A;  3T1K A;  4WUD A;  2BYH A;  4AS9 A;  5M4K A;  1JM6 A;  3R4O A;  4CWP A;  3CGZ A;  2VW5 A;  3Q5J A;  4PRX A;  4YKY A;  1QZR A;  2ESA A;  3OWB A;  2YK9 A;  3CRL A;  4EMV A;  2YI0 A;  2XDL A;  2EXL A;  2CCS A;  1B63 A;  3TUH A;  4XE2 A;  3TZ5 A;  3ZXO A;  5M4N A;  3EHH A;  3HEK A;  4XKK A;  1BXD A;  2XHT A;  2BYI A;  4E72 A;  3RLQ A;  4R3A A;  1UY7 A;  2XJG A;  3ZM7 A;  2GQP A;  4CWT A;  4KQV A;  4PL9 A;  4ASG A;  4LWE A;  1S16 A;  5IN9 A;  3T2S A;  3MNR P;  1R62 A;  2YE7 A;  1UY6 A;  3EKO A;  1UYM A;  2XDX A;  4JQL A;  2YEC A;  5CTY A;  3O2F A;  4FCP A;  1ID0 A;  5M4H A;  1EI1 A;  2ZBK B;  1Z59 A;  1EA6 A;  4XCJ A;  2WEQ A;  2IWX A;  3T0H A;  3O6O A;  4BAE A;  2O1W A;  4YKZ A;  2VCJ A;  4LWH A;  1UYL A;  2YK2 A;  4FCR A;  1BGQ A;  4EGI A;  2O1V A;  1I5C A;  2XHR A;  4BQG A;  2YEG A;  1YC1 A;  3RKZ A;  1Y8P A;  2FXS A;  4O0B A;  2ZKJ A;  1U0Z A;  2YEB A;  2XDU A;  3G75 A;  4URN A;  2AKP A;  4CWN A;  3A0Z A;  2FWZ A;  4NH9 A;  4EFU A;  1KIJ A;  1AM1 A;  1I5A A;  1YC3 A;  3TZ2 A;  3C0E A;  2YE8 A;  1YT1 A;  4KTN A;  1KZN A;  3G7B A;  4YKX A;  1Y8O A;  2IOQ A;  3GIG B;  3JZ3 A;  4CWQ A;  2E0A A;  3ZKB A;  1BYQ A;  2CCU A;  3TZ4 A;  5D7R A;  2YED A;  4LPB A;  5FND A;  5D6P A;  4O04 A;  4P7A A;  4R1F A;  2JKI A;  2BTZ A;  4URM A;  2CCT A;  2XX5 A;  4CE1 A;  1UY9 A;  3EHJ A;  2JJC A;  5CPH A;  2YKE A;  3WQ9 A;  3DGE A;  2YKJ A;  2YI6 A;  3EHG A;  2BRC A;  5CTX A;  2K5B A;  5M4P A;  1B62 A;  3CRK A;  4GT8 A;  2ZDY A;  1I5D A;  5CF0 A;  4YKT A;  3K97 A;  4XIT A;  4CWR A;  3A0X A;  4HYM A;  3R4P A;  1ZWH A;  4BQJ A;  3B26 A;  3B25 A;  4FPP A;  3R91 A;  4XC0 A;  3BM9 A;  1YES A;  3GIG A;  2Q2E B;  2YGA A;  4FCQ A;  3TZ0 A;  3ZXQ A;  4MOT A;  4HZ0 A;  1U2O A;  2QF6 A;  3QDD A;  1YER A;  1GJV A;  1L0O A;  4KSH A;  1I59 A;  2YE2 A;  2C2A A;  1UYE A;  2YEI A;  2XAB A;  1IXM A;  2WI7 A;  4JAU A;  4O05 A;  3O0I A;  3FT5 A;  3A0T A;  4YKW A;  1I5B A;  5D7C A;  5D7D A;  3GIF A;  2XJJ A;  5C93 A;  3OWD A;  4AWP A;  3U67 A;  4QPJ A;  2XX4 A;  2WEP A;  2GFD A;  2YEA A;  1NHJ A;  2IOP A;  4EGK A;  3EKR A;  2YEF A;  5CTU A;  1Z5B A;  2IWS A;  4E01 A;  1YS3 A;  4GEE A;  1YT0 A;  3B28 A;  4H85 A;  4U93 A;  1TIL A;  4CWF A;  4AWO A;  2H55 A;  2WER A;  3CYG A;  1TBW A;  3H4L A;  3IED A;  1QYE A;  2Q8F A;  4Q20 A;  1B3Q A;  4QPK A;  3S5T A;  4ASA A;  4V25 A;  3RLP A;  4L93 A;  3INW A;  1AJ6 A;  3LNU A;  1YC4 A;  3VHA A;  4EEH A;  1YSZ A;  4JAS A;  3LPS A;  1H7U A;  5J71 A;  4KFG A;  4MBC A;  4LP0 A;  2YE4 A;  2YGE A;  2YKB A;  3G7E A;  2HHI A;  3OMU A;  4BXI A;  2YE6 A;  3C11 A;  1TC0 A;  2BU8 A;  4XKA A;  4E00 A;  5BOD A;  3ZKD A;  4YKU A;  3INX A;  1Y4S A;  1YSR A;  4HXW A;  2ZDX A;  1TC6 A;  4U7N A;  4DZY A;  1GKZ A;  3B24 A;  2QFO A;  4K4O A;  3D36 A;  2XD6 A;  4XDM A;  1AMW A;  4B7P A;  2BU6 A;  1F51 A;  2XDK A;  3GIE A;  2XJX A;  3CGY A;  2FTK A;  3K60 A;  4ASB A;  4HXZ A;  1MU5 A;  3HHU A;  1Z5A A;  2PNR A;  4NH7 A;  5M4E A;  1H7S A;  2CH4 A;  1Y4U A;  2QG2 A;  1QY8 A;  4I3H A;  5L3J A;  2HCH A;  2CG9 A;  4XTJ A;  4ASF A;  4YKR A;  2XHX A;  4H81 A;  2BSM A;  2YKC A;  4L94 A;  2YI7 A;  2WI1 A;  2YE5 A;  4L90 A;  1Z5C A;  4XCL A;  4L8Z A;  2FYP A;  2FWY A;  3OW6 A;  1UYF A;  2YEE A;  4CE2 A;  2BU5 A;  2UWD A;  3A0Y A;  4HY1 A;  2VWC A;  3KE6 A;  3LMM A;  4XD8 A;  2BU7 A;  4PU9 A;  2WI3 A;  4XIR A;  5BOC A;  4I5S A;  4MPC A;  1TH8 A;  1BKN A;  4EM7 A;  5J6A A;  4URL A;  2WI5 A;  1UYC A;  5F5R A;  5M4M A;  4H7Q A;  4P8O A;  5IDM A;  2BZ5 A;  3T10 A;  4BIU A;  3VAD A;  3EHF A;  3FV5 A;  4EGH A;  2WI6 A;  2YEH A;  4ZKI A;  4WUC A;  4XIQ A;  1THN A;  5IDJ A;  4KSG A;  3R92 A;  2XK2 A;  2IWU A;  4O09 A;  2H8M A;  2Q8G A;  3RLR A;  4LWG A;  3PEH A;  1UY8 A;  3FT8 A;  4FMT A;  3HZ5 A;  4YKQ A;  1Y8N A;  1ZXN A;  4O07 A;  4V26 A;  5FNC A;  2HG1 A;  3U2D A;  3VHD A;  1UYH A;  3D0B A;  2BU2 A;  3HZ1 A;  4DUH A;  1YT2 A;  1A4H A;  3HYY A;  3TTZ A;  4E02 A;  4EFT A;  1UYG A;  3BMY A;  1ZXM A;  4XIP A;  2BT0 A;  4U7O A;  1YET A;  1AH6 A;  4CE3 A;  1GKX A;  4LWI A;  3U2K A;  4X9L A; 
#chains in the Genus database with same CATH homology
 2WI2 A;  4MP7 A;  5GGZ A;  2Q8I A;  4HYP A;  3HYZ A;  1UYK A;  1PVG A;  1UYI A;  5FWK A;  4LWF A;  2YEJ A;  2CGF A;  1I58 A;  1NHH A;  5FNF A;  2VCI A;  2WI4 A;  4GFN A;  1US7 A;  1NHI A;  3H80 A;  4BIZ A;  3Q5L A;  5CTW A;  2YKI A;  1UYD A;  4JAV A;  3PEJ A;  2YGF A;  4XKO A;  3OPD A;  2O1U A;  4GQT A;  3A0R A;  2QG0 A;  3SL2 A;  4HY6 A;  4R3M A;  3VHC A;  4CWS A;  3WHA A;  4GCZ A;  4MPE A;  2XCM A;  3R4M A;  2BRE A;  2YJW A;  3B27 A;  2IOR A;  4W7T A;  4L91 A;  1S14 A;  1TID A;  4B6C A;  4MP2 A;  4CWO A;  5F3K A;  3K99 A;  3K98 A;  2YJX A;  3CWV A;  3A0W A;  3T0Z A;  2XX2 A;  5D6Q A;  3Q5K A;  4MPN A;  3D2R A;  3R4N A;  4NH8 A;  2YE3 A;  1OSF A;  4ZVI A;  4AWQ A;  2Q8H A;  2YE9 A;  4PRV A;  1AH8 A;  2YI5 A;  4URO A;  1ZW9 A;  4GGL A;  3NMQ A;  1MX0 A;  2HKJ A;  4KP4 A;  4MB9 A;  4HZ5 A;  3QTF A;  4WUB A;  2XDS A;  3T1K A;  4WUD A;  2BYH A;  4AS9 A;  5M4K A;  1JM6 A;  3R4O A;  4CWP A;  3CGZ A;  2VW5 A;  3Q5J A;  4PRX A;  4YKY A;  1QZR A;  2ESA A;  3OWB A;  2YK9 A;  3CRL A;  4EMV A;  2YI0 A;  2XDL A;  2EXL A;  2CCS A;  1B63 A;  3TUH A;  4XE2 A;  3TZ5 A;  3ZXO A;  5M4N A;  3EHH A;  3HEK A;  4XKK A;  1BXD A;  2XHT A;  2BYI A;  3RLQ A;  4R3A A;  1UY7 A;  2XJG A;  3ZM7 A;  2GQP A;  4CWT A;  4KQV A;  4PL9 A;  4ASG A;  4LWE A;  1S16 A;  5IN9 A;  3T2S A;  3MNR P;  1R62 A;  2YE7 A;  1UY6 A;  3EKO A;  1UYM A;  2XDX A;  4JQL A;  2YEC A;  5CTY A;  3O2F A;  4FCP A;  1ID0 A;  5M4H A;  1EI1 A;  2ZBK B;  1Z59 A;  1EA6 A;  4XCJ A;  2WEQ A;  2IWX A;  3T0H A;  3O6O A;  4BAE A;  2O1W A;  4YKZ A;  2VCJ A;  4LWH A;  1UYL A;  2YK2 A;  4FCR A;  1BGQ A;  4EGI A;  2O1V A;  1I5C A;  2XHR A;  4BQG A;  2YEG A;  1YC1 A;  3RKZ A;  1Y8P A;  2FXS A;  4O0B A;  2ZKJ A;  1U0Z A;  2YEB A;  2XDU A;  3G75 A;  4URN A;  2AKP A;  4CWN A;  3A0Z A;  2FWZ A;  4NH9 A;  4EFU A;  1KIJ A;  1AM1 A;  1I5A A;  1YC3 A;  3TZ2 A;  3C0E A;  2YE8 A;  1YT1 A;  4KTN A;  1KZN A;  3G7B A;  4YKX A;  1Y8O A;  2IOQ A;  3GIG B;  3JZ3 A;  4CWQ A;  2E0A A;  3ZKB A;  1BYQ A;  2CCU A;  3TZ4 A;  5D7R A;  2YED A;  4LPB A;  5FND A;  5D6P A;  4O04 A;  4P7A A;  4R1F A;  2JKI A;  2BTZ A;  4URM A;  2CCT A;  2XX5 A;  4CE1 A;  1UY9 A;  3EHJ A;  2JJC A;  5CPH A;  2YKE A;  3WQ9 A;  3DGE A;  2YKJ A;  2YI6 A;  3EHG A;  2BRC A;  5CTX A;  2K5B A;  5M4P A;  1B62 A;  3CRK A;  4GT8 A;  2ZDY A;  1I5D A;  5CF0 A;  4YKT A;  3K97 A;  4XIT A;  4CWR A;  3A0X A;  4HYM A;  3R4P A;  1ZWH A;  4BQJ A;  3B26 A;  3B25 A;  4FPP A;  3R91 A;  4XC0 A;  3BM9 A;  1YES A;  3GIG A;  2Q2E B;  2YGA A;  4FCQ A;  3TZ0 A;  3ZXQ A;  4MOT A;  4HZ0 A;  1U2O A;  2QF6 A;  3QDD A;  1YER A;  1GJV A;  1L0O A;  4KSH A;  1I59 A;  2YE2 A;  2C2A A;  1UYE A;  2YEI A;  2XAB A;  2WI7 A;  4JAU A;  4O05 A;  3O0I A;  3FT5 A;  3A0T A;  4YKW A;  1I5B A;  5D7C A;  5D7D A;  3GIF A;  2XJJ A;  5C93 A;  3OWD A;  4AWP A;  3U67 A;  4QPJ A;  2XX4 A;  2WEP A;  2GFD A;  2YEA A;  1NHJ A;  2IOP A;  4EGK A;  3EKR A;  2YEF A;  5CTU A;  1Z5B A;  2IWS A;  4E01 A;  1YS3 A;  4GEE A;  1YT0 A;  3B28 A;  4H85 A;  4U93 A;  1TIL A;  4CWF A;  4AWO A;  2H55 A;  2WER A;  1TBW A;  3H4L A;  3IED A;  1QYE A;  2Q8F A;  4Q20 A;  1B3Q A;  4QPK A;  4ASA A;  4V25 A;  3RLP A;  4L93 A;  3INW A;  1AJ6 A;  3LNU A;  1YC4 A;  3VHA A;  4EEH A;  1YSZ A;  4JAS A;  3LPS A;  1H7U A;  5J71 A;  4KFG A;  4MBC A;  4LP0 A;  2YE4 A;  2YGE A;  2YKB A;  3G7E A;  3OMU A;  4BXI A;  2YE6 A;  3C11 A;  1TC0 A;  2BU8 A;  4XKA A;  4E00 A;  5BOD A;  3ZKD A;  4YKU A;  3INX A;  1Y4S A;  1YSR A;  4HXW A;  2ZDX A;  1TC6 A;  4U7N A;  4DZY A;  1GKZ A;  3B24 A;  2QFO A;  4K4O A;  3D36 A;  2XD6 A;  4XDM A;  1AMW A;  4B7P A;  2BU6 A;  2XDK A;  3GIE A;  2XJX A;  3CGY A;  3K60 A;  4ASB A;  4HXZ A;  1MU5 A;  3HHU A;  1Z5A A;  2PNR A;  4NH7 A;  5M4E A;  1H7S A;  2CH4 A;  1Y4U A;  2QG2 A;  1QY8 A;  4I3H A;  5L3J A;  2HCH A;  2CG9 A;  4XTJ A;  4ASF A;  4YKR A;  2XHX A;  4H81 A;  2BSM A;  2YKC A;  4L94 A;  2YI7 A;  2WI1 A;  2YE5 A;  4L90 A;  1Z5C A;  4XCL A;  4L8Z A;  2FYP A;  2FWY A;  3OW6 A;  1UYF A;  2YEE A;  4CE2 A;  2BU5 A;  2UWD A;  3A0Y A;  4HY1 A;  2VWC A;  3KE6 A;  4XD8 A;  2BU7 A;  4PU9 A;  2WI3 A;  4XIR A;  5BOC A;  4I5S A;  4MPC A;  1TH8 A;  1BKN A;  4EM7 A;  5J6A A;  4URL A;  2WI5 A;  1UYC A;  5F5R A;  5M4M A;  4H7Q A;  4P8O A;  5IDM A;  2BZ5 A;  3T10 A;  4BIU A;  3VAD A;  3EHF A;  3FV5 A;  4EGH A;  2WI6 A;  2YEH A;  4ZKI A;  4WUC A;  4XIQ A;  1THN A;  5IDJ A;  4KSG A;  3R92 A;  2XK2 A;  2IWU A;  4O09 A;  2H8M A;  2Q8G A;  3RLR A;  4LWG A;  3PEH A;  1UY8 A;  3FT8 A;  4FMT A;  3HZ5 A;  4YKQ A;  1Y8N A;  1ZXN A;  4O07 A;  4V26 A;  5FNC A;  2HG1 A;  3U2D A;  3VHD A;  1UYH A;  3D0B A;  2BU2 A;  3HZ1 A;  4DUH A;  1YT2 A;  1A4H A;  3HYY A;  3TTZ A;  4E02 A;  4EFT A;  1UYG A;  3BMY A;  1ZXM A;  4XIP A;  2BT0 A;  4U7O A;  1YET A;  1AH6 A;  4CE3 A;  1GKX A;  4LWI A;  3U2K A;  4X9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...