3O2FA

Structure of the n-domain of grp94 bound to the hsp90 inhibitor pu-h54
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
232
structure length
228
Chain Sequence
LREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Paralog-selective Hsp90 inhibitors define tumor-specific regulation of HER2.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone/inhibitor
molecule keywords Endoplasmin
total genus 70
structure length 228
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3o2fA00
5M4PA 2PNRA 5CTUA 3T10A 4HYMA 1UYMA 3H80A 2YE8A 3G7EA 3HZ5A 1QZRA 2XDXA 2YE3A 4XC0A 4JASA 4ASBA 5IDJA 1ZXMA 4U93A 1KIJA 2BU7A 3K99A 1YERA 2UWDA 1QYEA 3B28A 4R3AA 2WI7A 1YT2A 2YE9A 4CE2A 1UYHA 3TZ5A 2BSMA 3RLRA 1Z59A 4Q20A 2BYHA 1UY9A 1YT0A 3HEKA 4PRXA 2IOQA 4L8ZA 2YGEA 4V25A 1YS3A 1US7A 3CGZA 1UYDA 4GCZA 3FT8A 4YKUA 3CWVA 3K97A 3GIFA 3EKRA 3HHUA 1I58A 3H4LA 2YEBA 4MB9A 5FNFA 2XABA 2YEAA 2Q8IA 2BU2A 2IORA 4MOTA 1ZXNA 4XE2A 1UYIA 3G75A 4KQVA 4PRVA 3KE6A 1ID0A 1UYCA 3T1KA 5L3JA 1QY8A 4WUDA 1UYEA 4B6CA 1TBWA 4BXIA 4V26A 4O09A 2YJXA 2H55A 2YEJA 3NMQA 1NHJA 2YE4A 4EGHA 3TUHA 4GGLA 4HXWA 4PU9A 2YKIA 2IWXA 1AH8A 4ZKIA 2Q8HA 2JJCA 4HZ0A 3ZKBA 3U2DA 1I5BA 1Y4SA 4YKRA 4L93A 4O07A 4URLA 5D6PA 5J71A 3D2RA 1R62A 1MU5A 1YSZA 4R1FA 1MX0A 3A0RA 5BOCA 2YKJA 1TIDA 4KTNA 2E0AA 4KFGA 2CCTA 3FT5A 1S16A 4KSGA 4ASGA 1YSRA 4MP2A 3HYZA 2ZDXA 3RKZA 4JQLA 2QF6A 2HCHA 4XTJA 3T0HA 4O0BA 4DZYA 3C11A 1I5DA 4WUCA 3O6OA 1UYFA 5D7DA 3EKOA 4BIUA 2YI0A 4E00A 3T2SA 1BGQA 4LWFA 2GFDA 4KP4A 2ESAA 2Q8FA 4BAEA 3OWDA 2XD6A 4EGIA 5CTXA 3U67A 3OWBA 3U2KA 1TILA 2YK2A 3A0YA 4CWPA 2K5BA 2FXSA 4EFTA 1Y8OA 3TTZA 3VHCA 5CPHA 4BQJA 2VCIA 1NHHA 2ZDYA 4CWFA 1UYKA 4XDMA 3PEJA 4E01A 3GIEA 2YE2A 4AWOA 2XDUA 4R3MA 1EA6A 1ZW9A 5D6QA 4NH9A 3T0ZA 1YC4A 1Y4UA 3INWA 4I5SA 4UROA 1AM1A 2XDKA 3R4OA 5J6AA 5M4HA 3ZKDA 2BZ5A 1UYLA 4NH8A 3EHFA 2YI6A 4XITA 4HY6A 3R4NA 4P7AA 2WI2A 4EEHA 2VCJA 2YE6A 1GKXA 4YKTA 1Z5AA 2XHTA 2YEFA 3GIGB 4U7OA 4HZ5A 3A0WA 1BXDA 3A0XA 4EGKA 4FCPA 2WI1A 2BU6A 3R91A 4XKKA 2BREA 3WHAA 2GQPA 4GFNA 1GKZA 4BIZA 2ZBKB 5D7RA 3CRKA 4YKXA 2YKEA 3VADA 4FMTA 4CE3A 2XK2A 2Q2EB 4EMVA 1NHIA 4P8OA 4CWQA 1BKNA 1JM6A 4LWIA 4ASFA 4EM7A 1GJVA 1U2OA 3QDDA 3OPDA 3LNUA 1H7UA 2FYPA 1UY6A 3R92A 2YKBA 2WEQA 3C0EA 4X9LA 5F3KA 2QFOA 1YETA 4AS9A 3CGYA 3GIGA 3RLQA 3PEHA 5CF0A 4FCQA 3CRLA 3B24A 4LP0A 1L0OA 2XX4A 3RLPA 2WI3A 1ZWHA 4H7QA 3TZ4A 2O1UA 1AMWA 1B3QA 2YEEA 3QTFA 4LWEA 5M4MA 5CTWA 2AKPA 1YC3A 4B7PA 2YGAA 3K98A 2QG0A 2EXLA 4NH7A 2C2AA 1EI1A 2WI4A 4H81A 3O0IA 4MBCA 3K60A 2XHRA 2BRCA 4HYPA 2WERA 2BYIA 3MNRP 2XX2A 3Q5JA 3O2FA 1OSFA 2H8MA 3IEDA 4EFUA 4XCJA 5FNCA 3ZM7A 3JZ3A 4URNA 3D36A 2IWSA 4LPBA 3OMUA 1UY8A 2BT0A 2XJXA 2YGFA 3ZXQA 5BODA 1KZNA 4ASAA 1S14A 3TZ0A 4YKZA 3HYYA 3R4PA 1Y8NA 4O04A 2WEPA 3Q5LA 4XD8A 1UYGA 4I3HA 2FWZA 5M4EA 5C93A 3A0TA 2YJWA 4WUBA 2YEGA 2YECA 4CWRA 2YK9A 2XX5A 2CCSA 4XCLA 4O05A 2QG2A 4FPPA 2XJJA 4GQTA 1AH6A 4GT8A 3INXA 1PVGA 2XDSA 1B63A 4JAVA 4XKAA 4ZVIA 4YKQA 3EHJA 3B25A 2YI7A 1B62A 2FWYA 4CE1A 4MPEA 4MPNA 4E02A 3WQ9A 2YE5A 4CWSA 1Z5CA 2VWCA 3BMYA 4U7NA 4MPCA 2YEHA 2IWUA 2YKCA 4XIRA 3ZXOA 3BM9A 2CH4A 1TC0A 4KSHA 5M4KA 4LWHA 2VW5A 5FWKA 2Q8GA 1YESA 4CWOA 3VHDA 2HG1A 4XIPA 4XIQA 2HKJA 5M4NA 5D7CA 3Q5KA 4PL9A 4JAUA 2WI5A 3LPSA 2XDLA 2YEIA 4MP7A 4LWGA 5F5RA 5IN9A 1AJ6A 1THNA 4H85A 2BU5A 5GGZA 3A0ZA 4QPKA 1TC6A 4YKYA 4DUHA 2BU8A 1I5CA 2YEDA 3B26A 4CWNA 4HXZA 2WI6A 3B27A 4FCRA 4L90A 2YE7A 1YC1A 4AWQA 2ZKJA 3DGEA 1Z5BA 4W7TA 3R4MA 4BQGA 2IOPA 4AWPA 3D0BA 4QPJA 3HZ1A 3SL2A 4CWTA 2CCUA 2XCMA 2XHXA 1BYQA 3VHAA 2O1WA 2YI5A 1H7SA 4XKOA 4URMA 1I5AA 4GEEA 2XJGA 3EHGA 1YT1A 5FNDA 5IDMA 4HY1A 2CG9A 3TZ2A 4K4OA 3EHHA 2BTZA 4L94A 1TH8A 2O1VA 5CTYA 2CGFA 3G7BA 1U0ZA 2JKIA 1Y8PA 4YKWA 1UY7A 3OW6A 1A4HA 3FV5A 4L91A 1I59A
chains in the Genus database with same CATH superfamily
5M4PA 2PNRA 5CTUA 3T10A 4HYMA 1UYMA 3H80A 2YE8A 3G7EA 3HZ5A 1QZRA 2XDXA 2YE3A 4XC0A 4JASA 4ASBA 5IDJA 1ZXMA 4U93A 1KIJA 2HHIA 2BU7A 3K99A 1YERA 2UWDA 1QYEA 3B28A 4R3AA 2WI7A 1YT2A 2YE9A 4CE2A 1UYHA 3TZ5A 2BSMA 3RLRA 1Z59A 4Q20A 2BYHA 1UY9A 1YT0A 3HEKA 4PRXA 2IOQA 4L8ZA 5JENA 2YGEA 4V25A 1YS3A 1US7A 3CGZA 1UYDA 4GCZA 3FT8A 4YKUA 3CWVA 3K97A 3GIFA 3EKRA 3HHUA 1I58A 3H4LA 2YEBA 4MB9A 5FNFA 2XABA 2YEAA 2Q8IA 2BU2A 2IORA 4MOTA 1ZXNA 4XE2A 1UYIA 3G75A 4KQVA 4PRVA 3KE6A 1ID0A 1UYCA 3T1KA 5L3JA 1QY8A 4WUDA 2FTKA 2C1GA 1IXMA 1UYEA 4E72A 4B6CA 1TBWA 4BXIA 4V26A 4O09A 2YJXA 2H55A 2YEJA 3NMQA 1NHJA 2YE4A 4EGHA 3TUHA 4GGLA 4HXWA 4PU9A 2YKIA 2IWXA 1AH8A 4ZKIA 2Q8HA 2JJCA 4HZ0A 3ZKBA 3U2DA 1I5BA 1Y4SA 4YKRA 4L93A 4O07A 4URLA 5D6PA 5J71A 3D2RA 1R62A 1MU5A 1YSZA 4R1FA 1MX0A 3A0RA 5BOCA 2YKJA 1TIDA 4KTNA 2E0AA 4KFGA 2CCTA 3FT5A 1S16A 4KSGA 4ASGA 1YSRA 4MP2A 3HYZA 2ZDXA 3RKZA 4JQLA 2QF6A 2HCHA 4XTJA 3T0HA 4O0BA 4DZYA 3C11A 1I5DA 4WUCA 3O6OA 1UYFA 5D7DA 3EKOA 4BIUA 2YI0A 4E00A 3T2SA 1BGQA 4LWFA 2GFDA 4KP4A 2ESAA 2Q8FA 4BAEA 3OWDA 2XD6A 4EGIA 5CTXA 3U67A 3OWBA 3U2KA 1TILA 2YK2A 3A0YA 4CWPA 2K5BA 2FXSA 4EFTA 1Y8OA 3TTZA 3VHCA 5CPHA 4BQJA 2VCIA 1NHHA 2ZDYA 4CWFA 1UYKA 4XDMA 3PEJA 4E01A 3GIEA 2YE2A 4AWOA 2XDUA 4R3MA 1EA6A 1ZW9A 5D6QA 4NH9A 3T0ZA 1YC4A 1Y4UA 3INWA 4I5SA 4UROA 1AM1A 2XDKA 3R4OA 5J6AA 5M4HA 3ZKDA 2BZ5A 1F51A 1UYLA 4NH8A 3EHFA 2YI6A 4XITA 4HY6A 3R4NA 4P7AA 2WI2A 4EEHA 2VCJA 2YE6A 1GKXA 4YKTA 1Z5AA 2XHTA 2YEFA 3GIGB 4U7OA 4HZ5A 3A0WA 1BXDA 3A0XA 4EGKA 4FCPA 2WI1A 2BU6A 3R91A 4XKKA 2BREA 3WHAA 2GQPA 4GFNA 1GKZA 4BIZA 2ZBKB 5D7RA 3CRKA 4YKXA 2YKEA 3VADA 4FMTA 4CE3A 2XK2A 2Q2EB 4EMVA 1NHIA 4P8OA 4CWQA 1BKNA 1JM6A 4LWIA 4ASFA 4EM7A 1GJVA 1U2OA 3QDDA 3OPDA 3LNUA 1H7UA 2FYPA 1UY6A 3R92A 2YKBA 2WEQA 3C0EA 4X9LA 5F3KA 2QFOA 1YETA 4AS9A 3CGYA 3GIGA 3RLQA 3PEHA 5CF0A 4FCQA 3CRLA 3B24A 4LP0A 1L0OA 2XX4A 3RLPA 2WI3A 1ZWHA 4H7QA 3TZ4A 2O1UA 1AMWA 1B3QA 2YEEA 3QTFA 4LWEA 5M4MA 5CTWA 2AKPA 1YC3A 4B7PA 2YGAA 3K98A 2QG0A 2EXLA 4NH7A 2C2AA 1EI1A 2WI4A 4H81A 3O0IA 4MBCA 3K60A 2XHRA 2BRCA 4HYPA 2WERA 2BYIA 3MNRP 2C1IA 2XX2A 3Q5JA 3O2FA 1OSFA 2H8MA 3IEDA 4EFUA 4XCJA 5FNCA 3ZM7A 3JZ3A 4URNA 3D36A 2IWSA 4LPBA 3OMUA 1UY8A 2BT0A 2XJXA 2YGFA 3ZXQA 5BODA 1KZNA 4ASAA 1S14A 3TZ0A 4YKZA 3HYYA 3R4PA 1Y8NA 4O04A 2WEPA 3Q5LA 4XD8A 1UYGA 4I3HA 2FWZA 5M4EA 5C93A 3A0TA 2YJWA 4WUBA 2YEGA 2YECA 4CWRA 2YK9A 2XX5A 2CCSA 4XCLA 4O05A 2QG2A 4FPPA 2XJJA 4GQTA 1AH6A 4GT8A 3INXA 1PVGA 2XDSA 1B63A 4JAVA 4XKAA 4ZVIA 4YKQA 3EHJA 3B25A 2YI7A 1B62A 2FWYA 4CE1A 4MPEA 4MPNA 4E02A 3WQ9A 2YE5A 4CWSA 3S5TA 1Z5CA 2VWCA 3BMYA 4U7NA 4MPCA 2YEHA 2IWUA 2YKCA 4XIRA 3ZXOA 3BM9A 2CH4A 1TC0A 4KSHA 5M4KA 4LWHA 2VW5A 5FWKA 2Q8GA 1YESA 4CWOA 3VHDA 2HG1A 4XIPA 4XIQA 2HKJA 5M4NA 5D7CA 3Q5KA 4PL9A 4JAUA 2WI5A 3LPSA 2XDLA 2YEIA 4MP7A 4LWGA 5F5RA 5IN9A 3LMMA 1AJ6A 1THNA 4H85A 2BU5A 5GGZA 3A0ZA 4QPKA 1TC6A 4YKYA 4DUHA 2BU8A 1I5CA 2YEDA 3B26A 4CWNA 4HXZA 2WI6A 3B27A 4FCRA 4L90A 2YE7A 1YC1A 4AWQA 2ZKJA 3DGEA 1Z5BA 4W7TA 3R4MA 4BQGA 2IOPA 4AWPA 3D0BA 4QPJA 3HZ1A 3SL2A 4CWTA 2CCUA 2XCMA 2XHXA 1BYQA 3VHAA 2O1WA 2YI5A 1H7SA 4XKOA 4URMA 1I5AA 4GEEA 2XJGA 3EHGA 1YT1A 5FNDA 5IDMA 4HY1A 2CG9A 3TZ2A 3CYGA 3EHHA 4K4OA 2BTZA 4L94A 1TH8A 2O1VA 5CTYA 2CGFA 3G7BA 1U0ZA 2JKIA 1Y8PA 4YKWA 1UY7A 3OW6A 1A4HA 3FV5A 4L91A 1I59A
chains in the Genus database with same CATH topology
5M4PA 2PNRA 5CTUA 3T10A 4HYMA 1UYMA 3H80A 2YE8A 3G7EA 3HZ5A 1QZRA 2XDXA 2YE3A 4XC0A 4JASA 4ASBA 5IDJA 1ZXMA 4U93A 1KIJA 2BU7A 3K99A 1YERA 2UWDA 1QYEA 3B28A 4R3AA 2WI7A 1YT2A 2YE9A 4CE2A 1UYHA 3TZ5A 2BSMA 3RLRA 1Z59A 4Q20A 2BYHA 1UY9A 1YT0A 3HEKA 4PRXA 2IOQA 4L8ZA 2YGEA 4V25A 1YS3A 1US7A 3CGZA 1UYDA 4GCZA 3FT8A 4YKUA 3CWVA 3K97A 3GIFA 3EKRA 3HHUA 1I58A 3H4LA 2YEBA 4MB9A 5FNFA 2XABA 2YEAA 2Q8IA 2BU2A 2IORA 4MOTA 1ZXNA 4XE2A 1UYIA 3G75A 4KQVA 4PRVA 3KE6A 1ID0A 1UYCA 3T1KA 5L3JA 1QY8A 4WUDA 1UYEA 4B6CA 1TBWA 4BXIA 4V26A 4O09A 2YJXA 2H55A 2YEJA 3NMQA 1NHJA 2YE4A 4EGHA 3TUHA 4GGLA 4HXWA 4PU9A 2YKIA 2IWXA 1AH8A 4ZKIA 2Q8HA 2JJCA 4HZ0A 3ZKBA 3U2DA 1I5BA 1Y4SA 4YKRA 4L93A 4O07A 4URLA 5D6PA 5J71A 3D2RA 1R62A 1MU5A 1YSZA 4R1FA 1MX0A 3A0RA 5BOCA 2YKJA 1TIDA 4KTNA 2E0AA 4KFGA 2CCTA 3FT5A 1S16A 4KSGA 4ASGA 1YSRA 4MP2A 3HYZA 2ZDXA 3RKZA 4JQLA 2QF6A 2HCHA 4XTJA 3T0HA 4O0BA 4DZYA 3C11A 1I5DA 4WUCA 3O6OA 1UYFA 5D7DA 3EKOA 4BIUA 2YI0A 4E00A 3T2SA 1BGQA 4LWFA 2GFDA 4KP4A 2ESAA 2Q8FA 4BAEA 3OWDA 2XD6A 4EGIA 5CTXA 3U67A 3OWBA 3U2KA 1TILA 2YK2A 3A0YA 4CWPA 2K5BA 2FXSA 4EFTA 1Y8OA 3TTZA 3VHCA 5CPHA 4BQJA 2VCIA 1NHHA 2ZDYA 4CWFA 1UYKA 4XDMA 3PEJA 4E01A 3GIEA 2YE2A 4AWOA 2XDUA 4R3MA 1EA6A 1ZW9A 5D6QA 4NH9A 3T0ZA 1YC4A 1Y4UA 3INWA 4I5SA 4UROA 1AM1A 2XDKA 3R4OA 5J6AA 5M4HA 3ZKDA 2BZ5A 1UYLA 4NH8A 3EHFA 2YI6A 4XITA 4HY6A 3R4NA 4P7AA 2WI2A 4EEHA 2VCJA 2YE6A 1GKXA 4YKTA 1Z5AA 2XHTA 2YEFA 3GIGB 4U7OA 4HZ5A 3A0WA 1BXDA 3A0XA 4EGKA 4FCPA 2WI1A 2BU6A 3R91A 4XKKA 2BREA 3WHAA 2GQPA 4GFNA 1GKZA 4BIZA 2ZBKB 5D7RA 3CRKA 4YKXA 2YKEA 3VADA 4FMTA 4CE3A 2XK2A 2Q2EB 4EMVA 1NHIA 4P8OA 4CWQA 1BKNA 1JM6A 4LWIA 4ASFA 4EM7A 1GJVA 1U2OA 3QDDA 3OPDA 3LNUA 1H7UA 2FYPA 1UY6A 3R92A 2YKBA 2WEQA 3C0EA 4X9LA 5F3KA 2QFOA 1YETA 4AS9A 3CGYA 3GIGA 3RLQA 3PEHA 5CF0A 4FCQA 3CRLA 3B24A 4LP0A 1L0OA 2XX4A 3RLPA 2WI3A 1ZWHA 4H7QA 3TZ4A 2O1UA 1AMWA 1B3QA 2YEEA 3QTFA 4LWEA 5M4MA 5CTWA 2AKPA 1YC3A 4B7PA 2YGAA 3K98A 2QG0A 2EXLA 4NH7A 2C2AA 1EI1A 2WI4A 4H81A 3O0IA 4MBCA 3K60A 2XHRA 2BRCA 4HYPA 2WERA 2BYIA 3MNRP 2XX2A 3Q5JA 3O2FA 1OSFA 2H8MA 3IEDA 4EFUA 4XCJA 5FNCA 3ZM7A 3JZ3A 4URNA 3D36A 2IWSA 4LPBA 3OMUA 1UY8A 2BT0A 2XJXA 2YGFA 3ZXQA 5BODA 1KZNA 4ASAA 1S14A 3TZ0A 4YKZA 3HYYA 3R4PA 1Y8NA 4O04A 2WEPA 3Q5LA 4XD8A 1UYGA 4I3HA 2FWZA 5M4EA 5C93A 3A0TA 2YJWA 4WUBA 2YEGA 2YECA 4CWRA 2YK9A 2XX5A 2CCSA 4XCLA 4O05A 2QG2A 4FPPA 2XJJA 4GQTA 1AH6A 4GT8A 3INXA 1PVGA 2XDSA 1B63A 4JAVA 4XKAA 4ZVIA 4YKQA 3EHJA 3B25A 2YI7A 1B62A 2FWYA 4CE1A 4MPEA 4MPNA 4E02A 3WQ9A 2YE5A 4CWSA 1Z5CA 2VWCA 3BMYA 4U7NA 4MPCA 2YEHA 2IWUA 2YKCA 4XIRA 3ZXOA 3BM9A 2CH4A 1TC0A 4KSHA 5M4KA 4LWHA 2VW5A 5FWKA 2Q8GA 1YESA 4CWOA 3VHDA 2HG1A 4XIPA 4XIQA 2HKJA 5M4NA 5D7CA 3Q5KA 4PL9A 4JAUA 2WI5A 3LPSA 2XDLA 2YEIA 4MP7A 4LWGA 5F5RA 5IN9A 1AJ6A 1THNA 4H85A 2BU5A 5GGZA 3A0ZA 4QPKA 1TC6A 4YKYA 4DUHA 2BU8A 1I5CA 2YEDA 3B26A 4CWNA 4HXZA 2WI6A 3B27A 4FCRA 4L90A 2YE7A 1YC1A 4AWQA 2ZKJA 3DGEA 1Z5BA 4W7TA 3R4MA 4BQGA 2IOPA 4AWPA 3D0BA 4QPJA 3HZ1A 3SL2A 4CWTA 2CCUA 2XCMA 2XHXA 1BYQA 3VHAA 2O1WA 2YI5A 1H7SA 4XKOA 4URMA 1I5AA 4GEEA 2XJGA 3EHGA 1YT1A 5FNDA 5IDMA 4HY1A 2CG9A 3TZ2A 4K4OA 3EHHA 2BTZA 4L94A 1TH8A 2O1VA 5CTYA 2CGFA 3G7BA 1U0ZA 2JKIA 1Y8PA 4YKWA 1UY7A 3OW6A 1A4HA 3FV5A 4L91A 1I59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M4P A;  2PNR A;  5CTU A;  3T10 A;  4HYM A;  1UYM A;  3H80 A;  2YE8 A;  3G7E A;  3HZ5 A;  1QZR A;  2XDX A;  2YE3 A;  4XC0 A;  4JAS A;  4ASB A;  5IDJ A;  1ZXM A;  4U93 A;  1KIJ A;  2BU7 A;  3K99 A;  1YER A;  2UWD A;  1QYE A;  3B28 A;  4R3A A;  2WI7 A;  1YT2 A;  2YE9 A;  4CE2 A;  1UYH A;  3TZ5 A;  2BSM A;  3RLR A;  1Z59 A;  4Q20 A;  2BYH A;  1UY9 A;  1YT0 A;  3HEK A;  4PRX A;  2IOQ A;  4L8Z A;  2YGE A;  4V25 A;  1YS3 A;  1US7 A;  3CGZ A;  1UYD A;  4GCZ A;  3FT8 A;  4YKU A;  3CWV A;  3K97 A;  3GIF A;  3EKR A;  3HHU A;  1I58 A;  3H4L A;  2YEB A;  4MB9 A;  5FNF A;  2XAB A;  2YEA A;  2Q8I A;  2BU2 A;  2IOR A;  4MOT A;  1ZXN A;  4XE2 A;  1UYI A;  3G75 A;  4KQV A;  4PRV A;  3KE6 A;  1ID0 A;  1UYC A;  3T1K A;  5L3J A;  1QY8 A;  4WUD A;  1UYE A;  4B6C A;  1TBW A;  4BXI A;  4V26 A;  4O09 A;  2YJX A;  2H55 A;  2YEJ A;  3NMQ A;  1NHJ A;  2YE4 A;  4EGH A;  3TUH A;  4GGL A;  4HXW A;  4PU9 A;  2YKI A;  2IWX A;  1AH8 A;  4ZKI A;  2Q8H A;  2JJC A;  4HZ0 A;  3ZKB A;  3U2D A;  1I5B A;  1Y4S A;  4YKR A;  4L93 A;  4O07 A;  4URL A;  5D6P A;  5J71 A;  3D2R A;  1R62 A;  1MU5 A;  1YSZ A;  4R1F A;  1MX0 A;  3A0R A;  5BOC A;  2YKJ A;  1TID A;  4KTN A;  2E0A A;  4KFG A;  2CCT A;  3FT5 A;  1S16 A;  4KSG A;  4ASG A;  1YSR A;  4MP2 A;  3HYZ A;  2ZDX A;  3RKZ A;  4JQL A;  2QF6 A;  2HCH A;  4XTJ A;  3T0H A;  4O0B A;  4DZY A;  3C11 A;  1I5D A;  4WUC A;  3O6O A;  1UYF A;  5D7D A;  3EKO A;  4BIU A;  2YI0 A;  4E00 A;  3T2S A;  1BGQ A;  4LWF A;  2GFD A;  4KP4 A;  2ESA A;  2Q8F A;  4BAE A;  3OWD A;  2XD6 A;  4EGI A;  5CTX A;  3U67 A;  3OWB A;  3U2K A;  1TIL A;  2YK2 A;  3A0Y A;  4CWP A;  2K5B A;  2FXS A;  4EFT A;  1Y8O A;  3TTZ A;  3VHC A;  5CPH A;  4BQJ A;  2VCI A;  1NHH A;  2ZDY A;  4CWF A;  1UYK A;  4XDM A;  3PEJ A;  4E01 A;  3GIE A;  2YE2 A;  4AWO A;  2XDU A;  4R3M A;  1EA6 A;  1ZW9 A;  5D6Q A;  4NH9 A;  3T0Z A;  1YC4 A;  1Y4U A;  3INW A;  4I5S A;  4URO A;  1AM1 A;  2XDK A;  3R4O A;  5J6A A;  5M4H A;  3ZKD A;  2BZ5 A;  1UYL A;  4NH8 A;  3EHF A;  2YI6 A;  4XIT A;  4HY6 A;  3R4N A;  4P7A A;  2WI2 A;  4EEH A;  2VCJ A;  2YE6 A;  1GKX A;  4YKT A;  1Z5A A;  2XHT A;  2YEF A;  3GIG B;  4U7O A;  4HZ5 A;  3A0W A;  1BXD A;  3A0X A;  4EGK A;  4FCP A;  2WI1 A;  2BU6 A;  3R91 A;  4XKK A;  2BRE A;  3WHA A;  2GQP A;  4GFN A;  1GKZ A;  4BIZ A;  2ZBK B;  5D7R A;  3CRK A;  4YKX A;  2YKE A;  3VAD A;  4FMT A;  4CE3 A;  2XK2 A;  2Q2E B;  4EMV A;  1NHI A;  4P8O A;  4CWQ A;  1BKN A;  1JM6 A;  4LWI A;  4ASF A;  4EM7 A;  1GJV A;  1U2O A;  3QDD A;  3OPD A;  3LNU A;  1H7U A;  2FYP A;  1UY6 A;  3R92 A;  2YKB A;  2WEQ A;  3C0E A;  4X9L A;  5F3K A;  2QFO A;  1YET A;  4AS9 A;  3CGY A;  3GIG A;  3RLQ A;  3PEH A;  5CF0 A;  4FCQ A;  3CRL A;  3B24 A;  4LP0 A;  1L0O A;  2XX4 A;  3RLP A;  2WI3 A;  1ZWH A;  4H7Q A;  3TZ4 A;  2O1U A;  1AMW A;  1B3Q A;  2YEE A;  3QTF A;  4LWE A;  5M4M A;  5CTW A;  2AKP A;  1YC3 A;  4B7P A;  2YGA A;  3K98 A;  2QG0 A;  2EXL A;  4NH7 A;  2C2A A;  1EI1 A;  2WI4 A;  4H81 A;  3O0I A;  4MBC A;  3K60 A;  2XHR A;  2BRC A;  4HYP A;  2WER A;  2BYI A;  3MNR P;  2XX2 A;  3Q5J A;  3O2F A;  1OSF A;  2H8M A;  3IED A;  4EFU A;  4XCJ A;  5FNC A;  3ZM7 A;  3JZ3 A;  4URN A;  3D36 A;  2IWS A;  4LPB A;  3OMU A;  1UY8 A;  2BT0 A;  2XJX A;  2YGF A;  3ZXQ A;  5BOD A;  1KZN A;  4ASA A;  1S14 A;  3TZ0 A;  4YKZ A;  3HYY A;  3R4P A;  1Y8N A;  4O04 A;  2WEP A;  3Q5L A;  4XD8 A;  1UYG A;  4I3H A;  2FWZ A;  5M4E A;  5C93 A;  3A0T A;  2YJW A;  4WUB A;  2YEG A;  2YEC A;  4CWR A;  2YK9 A;  2XX5 A;  2CCS A;  4XCL A;  4O05 A;  2QG2 A;  4FPP A;  2XJJ A;  4GQT A;  1AH6 A;  4GT8 A;  3INX A;  1PVG A;  2XDS A;  1B63 A;  4JAV A;  4XKA A;  4ZVI A;  4YKQ A;  3EHJ A;  3B25 A;  2YI7 A;  1B62 A;  2FWY A;  4CE1 A;  4MPE A;  4MPN A;  4E02 A;  3WQ9 A;  2YE5 A;  4CWS A;  1Z5C A;  2VWC A;  3BMY A;  4U7N A;  4MPC A;  2YEH A;  2IWU A;  2YKC A;  4XIR A;  3ZXO A;  3BM9 A;  2CH4 A;  1TC0 A;  4KSH A;  5M4K A;  4LWH A;  2VW5 A;  5FWK A;  2Q8G A;  1YES A;  4CWO A;  3VHD A;  2HG1 A;  4XIP A;  4XIQ A;  2HKJ A;  5M4N A;  5D7C A;  3Q5K A;  4PL9 A;  4JAU A;  2WI5 A;  3LPS A;  2XDL A;  2YEI A;  4MP7 A;  4LWG A;  5F5R A;  5IN9 A;  1AJ6 A;  1THN A;  4H85 A;  2BU5 A;  5GGZ A;  3A0Z A;  4QPK A;  1TC6 A;  4YKY A;  4DUH A;  2BU8 A;  1I5C A;  2YED A;  3B26 A;  4CWN A;  4HXZ A;  2WI6 A;  3B27 A;  4FCR A;  4L90 A;  2YE7 A;  1YC1 A;  4AWQ A;  2ZKJ A;  3DGE A;  1Z5B A;  4W7T A;  3R4M A;  4BQG A;  2IOP A;  4AWP A;  3D0B A;  4QPJ A;  3HZ1 A;  3SL2 A;  4CWT A;  2CCU A;  2XCM A;  2XHX A;  1BYQ A;  3VHA A;  2O1W A;  2YI5 A;  1H7S A;  4XKO A;  4URM A;  1I5A A;  4GEE A;  2XJG A;  3EHG A;  1YT1 A;  5FND A;  5IDM A;  4HY1 A;  2CG9 A;  3TZ2 A;  4K4O A;  3EHH A;  2BTZ A;  4L94 A;  1TH8 A;  2O1V A;  5CTY A;  2CGF A;  3G7B A;  1U0Z A;  2JKI A;  1Y8P A;  4YKW A;  1UY7 A;  3OW6 A;  1A4H A;  3FV5 A;  4L91 A;  1I59 A; 
#chains in the Genus database with same CATH topology
 5M4P A;  2PNR A;  5CTU A;  3T10 A;  4HYM A;  1UYM A;  3H80 A;  2YE8 A;  3G7E A;  3HZ5 A;  1QZR A;  2XDX A;  2YE3 A;  4XC0 A;  4JAS A;  4ASB A;  5IDJ A;  1ZXM A;  4U93 A;  1KIJ A;  2HHI A;  2BU7 A;  3K99 A;  1YER A;  2UWD A;  1QYE A;  3B28 A;  4R3A A;  2WI7 A;  1YT2 A;  2YE9 A;  4CE2 A;  1UYH A;  3TZ5 A;  2BSM A;  3RLR A;  1Z59 A;  4Q20 A;  2BYH A;  1UY9 A;  1YT0 A;  3HEK A;  4PRX A;  2IOQ A;  4L8Z A;  5JEN A;  2YGE A;  4V25 A;  1YS3 A;  1US7 A;  3CGZ A;  1UYD A;  4GCZ A;  3FT8 A;  4YKU A;  3CWV A;  3K97 A;  3GIF A;  3EKR A;  3HHU A;  1I58 A;  3H4L A;  2YEB A;  4MB9 A;  5FNF A;  2XAB A;  2YEA A;  2Q8I A;  2BU2 A;  2IOR A;  4MOT A;  1ZXN A;  4XE2 A;  1UYI A;  3G75 A;  4KQV A;  4PRV A;  3KE6 A;  1ID0 A;  1UYC A;  3T1K A;  5L3J A;  1QY8 A;  4WUD A;  2FTK A;  2C1G A;  1IXM A;  1UYE A;  4E72 A;  4B6C A;  1TBW A;  4BXI A;  4V26 A;  4O09 A;  2YJX A;  2H55 A;  2YEJ A;  3NMQ A;  1NHJ A;  2YE4 A;  4EGH A;  3TUH A;  4GGL A;  4HXW A;  4PU9 A;  2YKI A;  2IWX A;  1AH8 A;  4ZKI A;  2Q8H A;  2JJC A;  4HZ0 A;  3ZKB A;  3U2D A;  1I5B A;  1Y4S A;  4YKR A;  4L93 A;  4O07 A;  4URL A;  5D6P A;  5J71 A;  3D2R A;  1R62 A;  1MU5 A;  1YSZ A;  4R1F A;  1MX0 A;  3A0R A;  5BOC A;  2YKJ A;  1TID A;  4KTN A;  2E0A A;  4KFG A;  2CCT A;  3FT5 A;  1S16 A;  4KSG A;  4ASG A;  1YSR A;  4MP2 A;  3HYZ A;  2ZDX A;  3RKZ A;  4JQL A;  2QF6 A;  2HCH A;  4XTJ A;  3T0H A;  4O0B A;  4DZY A;  3C11 A;  1I5D A;  4WUC A;  3O6O A;  1UYF A;  5D7D A;  3EKO A;  4BIU A;  2YI0 A;  4E00 A;  3T2S A;  1BGQ A;  4LWF A;  2GFD A;  4KP4 A;  2ESA A;  2Q8F A;  4BAE A;  3OWD A;  2XD6 A;  4EGI A;  5CTX A;  3U67 A;  3OWB A;  3U2K A;  1TIL A;  2YK2 A;  3A0Y A;  4CWP A;  2K5B A;  2FXS A;  4EFT A;  1Y8O A;  3TTZ A;  3VHC A;  5CPH A;  4BQJ A;  2VCI A;  1NHH A;  2ZDY A;  4CWF A;  1UYK A;  4XDM A;  3PEJ A;  4E01 A;  3GIE A;  2YE2 A;  4AWO A;  2XDU A;  4R3M A;  1EA6 A;  1ZW9 A;  5D6Q A;  4NH9 A;  3T0Z A;  1YC4 A;  1Y4U A;  3INW A;  4I5S A;  4URO A;  1AM1 A;  2XDK A;  3R4O A;  5J6A A;  5M4H A;  3ZKD A;  2BZ5 A;  1F51 A;  1UYL A;  4NH8 A;  3EHF A;  2YI6 A;  4XIT A;  4HY6 A;  3R4N A;  4P7A A;  2WI2 A;  4EEH A;  2VCJ A;  2YE6 A;  1GKX A;  4YKT A;  1Z5A A;  2XHT A;  2YEF A;  3GIG B;  4U7O A;  4HZ5 A;  3A0W A;  1BXD A;  3A0X A;  4EGK A;  4FCP A;  2WI1 A;  2BU6 A;  3R91 A;  4XKK A;  2BRE A;  3WHA A;  2GQP A;  4GFN A;  1GKZ A;  4BIZ A;  2ZBK B;  5D7R A;  3CRK A;  4YKX A;  2YKE A;  3VAD A;  4FMT A;  4CE3 A;  2XK2 A;  2Q2E B;  4EMV A;  1NHI A;  4P8O A;  4CWQ A;  1BKN A;  1JM6 A;  4LWI A;  4ASF A;  4EM7 A;  1GJV A;  1U2O A;  3QDD A;  3OPD A;  3LNU A;  1H7U A;  2FYP A;  1UY6 A;  3R92 A;  2YKB A;  2WEQ A;  3C0E A;  4X9L A;  5F3K A;  2QFO A;  1YET A;  4AS9 A;  3CGY A;  3GIG A;  3RLQ A;  3PEH A;  5CF0 A;  4FCQ A;  3CRL A;  3B24 A;  4LP0 A;  1L0O A;  2XX4 A;  3RLP A;  2WI3 A;  1ZWH A;  4H7Q A;  3TZ4 A;  2O1U A;  1AMW A;  1B3Q A;  2YEE A;  3QTF A;  4LWE A;  5M4M A;  5CTW A;  2AKP A;  1YC3 A;  4B7P A;  2YGA A;  3K98 A;  2QG0 A;  2EXL A;  4NH7 A;  2C2A A;  1EI1 A;  2WI4 A;  4H81 A;  3O0I A;  4MBC A;  3K60 A;  2XHR A;  2BRC A;  4HYP A;  2WER A;  2BYI A;  3MNR P;  2C1I A;  2XX2 A;  3Q5J A;  3O2F A;  1OSF A;  2H8M A;  3IED A;  4EFU A;  4XCJ A;  5FNC A;  3ZM7 A;  3JZ3 A;  4URN A;  3D36 A;  2IWS A;  4LPB A;  3OMU A;  1UY8 A;  2BT0 A;  2XJX A;  2YGF A;  3ZXQ A;  5BOD A;  1KZN A;  4ASA A;  1S14 A;  3TZ0 A;  4YKZ A;  3HYY A;  3R4P A;  1Y8N A;  4O04 A;  2WEP A;  3Q5L A;  4XD8 A;  1UYG A;  4I3H A;  2FWZ A;  5M4E A;  5C93 A;  3A0T A;  2YJW A;  4WUB A;  2YEG A;  2YEC A;  4CWR A;  2YK9 A;  2XX5 A;  2CCS A;  4XCL A;  4O05 A;  2QG2 A;  4FPP A;  2XJJ A;  4GQT A;  1AH6 A;  4GT8 A;  3INX A;  1PVG A;  2XDS A;  1B63 A;  4JAV A;  4XKA A;  4ZVI A;  4YKQ A;  3EHJ A;  3B25 A;  2YI7 A;  1B62 A;  2FWY A;  4CE1 A;  4MPE A;  4MPN A;  4E02 A;  3WQ9 A;  2YE5 A;  4CWS A;  3S5T A;  1Z5C A;  2VWC A;  3BMY A;  4U7N A;  4MPC A;  2YEH A;  2IWU A;  2YKC A;  4XIR A;  3ZXO A;  3BM9 A;  2CH4 A;  1TC0 A;  4KSH A;  5M4K A;  4LWH A;  2VW5 A;  5FWK A;  2Q8G A;  1YES A;  4CWO A;  3VHD A;  2HG1 A;  4XIP A;  4XIQ A;  2HKJ A;  5M4N A;  5D7C A;  3Q5K A;  4PL9 A;  4JAU A;  2WI5 A;  3LPS A;  2XDL A;  2YEI A;  4MP7 A;  4LWG A;  5F5R A;  5IN9 A;  3LMM A;  1AJ6 A;  1THN A;  4H85 A;  2BU5 A;  5GGZ A;  3A0Z A;  4QPK A;  1TC6 A;  4YKY A;  4DUH A;  2BU8 A;  1I5C A;  2YED A;  3B26 A;  4CWN A;  4HXZ A;  2WI6 A;  3B27 A;  4FCR A;  4L90 A;  2YE7 A;  1YC1 A;  4AWQ A;  2ZKJ A;  3DGE A;  1Z5B A;  4W7T A;  3R4M A;  4BQG A;  2IOP A;  4AWP A;  3D0B A;  4QPJ A;  3HZ1 A;  3SL2 A;  4CWT A;  2CCU A;  2XCM A;  2XHX A;  1BYQ A;  3VHA A;  2O1W A;  2YI5 A;  1H7S A;  4XKO A;  4URM A;  1I5A A;  4GEE A;  2XJG A;  3EHG A;  1YT1 A;  5FND A;  5IDM A;  4HY1 A;  2CG9 A;  3TZ2 A;  3CYG A;  3EHH A;  4K4O A;  2BTZ A;  4L94 A;  1TH8 A;  2O1V A;  5CTY A;  2CGF A;  3G7B A;  1U0Z A;  2JKI A;  1Y8P A;  4YKW A;  1UY7 A;  3OW6 A;  1A4H A;  3FV5 A;  4L91 A;  1I59 A; 
#chains in the Genus database with same CATH homology
 5M4P A;  2PNR A;  5CTU A;  3T10 A;  4HYM A;  1UYM A;  3H80 A;  2YE8 A;  3G7E A;  3HZ5 A;  1QZR A;  2XDX A;  2YE3 A;  4XC0 A;  4JAS A;  4ASB A;  5IDJ A;  1ZXM A;  4U93 A;  1KIJ A;  2BU7 A;  3K99 A;  1YER A;  2UWD A;  1QYE A;  3B28 A;  4R3A A;  2WI7 A;  1YT2 A;  2YE9 A;  4CE2 A;  1UYH A;  3TZ5 A;  2BSM A;  3RLR A;  1Z59 A;  4Q20 A;  2BYH A;  1UY9 A;  1YT0 A;  3HEK A;  4PRX A;  2IOQ A;  4L8Z A;  2YGE A;  4V25 A;  1YS3 A;  1US7 A;  3CGZ A;  1UYD A;  4GCZ A;  3FT8 A;  4YKU A;  3CWV A;  3K97 A;  3GIF A;  3EKR A;  3HHU A;  1I58 A;  3H4L A;  2YEB A;  4MB9 A;  5FNF A;  2XAB A;  2YEA A;  2Q8I A;  2BU2 A;  2IOR A;  4MOT A;  1ZXN A;  4XE2 A;  1UYI A;  3G75 A;  4KQV A;  4PRV A;  3KE6 A;  1ID0 A;  1UYC A;  3T1K A;  5L3J A;  1QY8 A;  4WUD A;  1UYE A;  4B6C A;  1TBW A;  4BXI A;  4V26 A;  4O09 A;  2YJX A;  2H55 A;  2YEJ A;  3NMQ A;  1NHJ A;  2YE4 A;  4EGH A;  3TUH A;  4GGL A;  4HXW A;  4PU9 A;  2YKI A;  2IWX A;  1AH8 A;  4ZKI A;  2Q8H A;  2JJC A;  4HZ0 A;  3ZKB A;  3U2D A;  1I5B A;  1Y4S A;  4YKR A;  4L93 A;  4O07 A;  4URL A;  5D6P A;  5J71 A;  3D2R A;  1R62 A;  1MU5 A;  1YSZ A;  4R1F A;  1MX0 A;  3A0R A;  5BOC A;  2YKJ A;  1TID A;  4KTN A;  2E0A A;  4KFG A;  2CCT A;  3FT5 A;  1S16 A;  4KSG A;  4ASG A;  1YSR A;  4MP2 A;  3HYZ A;  2ZDX A;  3RKZ A;  4JQL A;  2QF6 A;  2HCH A;  4XTJ A;  3T0H A;  4O0B A;  4DZY A;  3C11 A;  1I5D A;  4WUC A;  3O6O A;  1UYF A;  5D7D A;  3EKO A;  4BIU A;  2YI0 A;  4E00 A;  3T2S A;  1BGQ A;  4LWF A;  2GFD A;  4KP4 A;  2ESA A;  2Q8F A;  4BAE A;  3OWD A;  2XD6 A;  4EGI A;  5CTX A;  3U67 A;  3OWB A;  3U2K A;  1TIL A;  2YK2 A;  3A0Y A;  4CWP A;  2K5B A;  2FXS A;  4EFT A;  1Y8O A;  3TTZ A;  3VHC A;  5CPH A;  4BQJ A;  2VCI A;  1NHH A;  2ZDY A;  4CWF A;  1UYK A;  4XDM A;  3PEJ A;  4E01 A;  3GIE A;  2YE2 A;  4AWO A;  2XDU A;  4R3M A;  1EA6 A;  1ZW9 A;  5D6Q A;  4NH9 A;  3T0Z A;  1YC4 A;  1Y4U A;  3INW A;  4I5S A;  4URO A;  1AM1 A;  2XDK A;  3R4O A;  5J6A A;  5M4H A;  3ZKD A;  2BZ5 A;  1UYL A;  4NH8 A;  3EHF A;  2YI6 A;  4XIT A;  4HY6 A;  3R4N A;  4P7A A;  2WI2 A;  4EEH A;  2VCJ A;  2YE6 A;  1GKX A;  4YKT A;  1Z5A A;  2XHT A;  2YEF A;  3GIG B;  4U7O A;  4HZ5 A;  3A0W A;  1BXD A;  3A0X A;  4EGK A;  4FCP A;  2WI1 A;  2BU6 A;  3R91 A;  4XKK A;  2BRE A;  3WHA A;  2GQP A;  4GFN A;  1GKZ A;  4BIZ A;  2ZBK B;  5D7R A;  3CRK A;  4YKX A;  2YKE A;  3VAD A;  4FMT A;  4CE3 A;  2XK2 A;  2Q2E B;  4EMV A;  1NHI A;  4P8O A;  4CWQ A;  1BKN A;  1JM6 A;  4LWI A;  4ASF A;  4EM7 A;  1GJV A;  1U2O A;  3QDD A;  3OPD A;  3LNU A;  1H7U A;  2FYP A;  1UY6 A;  3R92 A;  2YKB A;  2WEQ A;  3C0E A;  4X9L A;  5F3K A;  2QFO A;  1YET A;  4AS9 A;  3CGY A;  3GIG A;  3RLQ A;  3PEH A;  5CF0 A;  4FCQ A;  3CRL A;  3B24 A;  4LP0 A;  1L0O A;  2XX4 A;  3RLP A;  2WI3 A;  1ZWH A;  4H7Q A;  3TZ4 A;  2O1U A;  1AMW A;  1B3Q A;  2YEE A;  3QTF A;  4LWE A;  5M4M A;  5CTW A;  2AKP A;  1YC3 A;  4B7P A;  2YGA A;  3K98 A;  2QG0 A;  2EXL A;  4NH7 A;  2C2A A;  1EI1 A;  2WI4 A;  4H81 A;  3O0I A;  4MBC A;  3K60 A;  2XHR A;  2BRC A;  4HYP A;  2WER A;  2BYI A;  3MNR P;  2XX2 A;  3Q5J A;  3O2F A;  1OSF A;  2H8M A;  3IED A;  4EFU A;  4XCJ A;  5FNC A;  3ZM7 A;  3JZ3 A;  4URN A;  3D36 A;  2IWS A;  4LPB A;  3OMU A;  1UY8 A;  2BT0 A;  2XJX A;  2YGF A;  3ZXQ A;  5BOD A;  1KZN A;  4ASA A;  1S14 A;  3TZ0 A;  4YKZ A;  3HYY A;  3R4P A;  1Y8N A;  4O04 A;  2WEP A;  3Q5L A;  4XD8 A;  1UYG A;  4I3H A;  2FWZ A;  5M4E A;  5C93 A;  3A0T A;  2YJW A;  4WUB A;  2YEG A;  2YEC A;  4CWR A;  2YK9 A;  2XX5 A;  2CCS A;  4XCL A;  4O05 A;  2QG2 A;  4FPP A;  2XJJ A;  4GQT A;  1AH6 A;  4GT8 A;  3INX A;  1PVG A;  2XDS A;  1B63 A;  4JAV A;  4XKA A;  4ZVI A;  4YKQ A;  3EHJ A;  3B25 A;  2YI7 A;  1B62 A;  2FWY A;  4CE1 A;  4MPE A;  4MPN A;  4E02 A;  3WQ9 A;  2YE5 A;  4CWS A;  1Z5C A;  2VWC A;  3BMY A;  4U7N A;  4MPC A;  2YEH A;  2IWU A;  2YKC A;  4XIR A;  3ZXO A;  3BM9 A;  2CH4 A;  1TC0 A;  4KSH A;  5M4K A;  4LWH A;  2VW5 A;  5FWK A;  2Q8G A;  1YES A;  4CWO A;  3VHD A;  2HG1 A;  4XIP A;  4XIQ A;  2HKJ A;  5M4N A;  5D7C A;  3Q5K A;  4PL9 A;  4JAU A;  2WI5 A;  3LPS A;  2XDL A;  2YEI A;  4MP7 A;  4LWG A;  5F5R A;  5IN9 A;  1AJ6 A;  1THN A;  4H85 A;  2BU5 A;  5GGZ A;  3A0Z A;  4QPK A;  1TC6 A;  4YKY A;  4DUH A;  2BU8 A;  1I5C A;  2YED A;  3B26 A;  4CWN A;  4HXZ A;  2WI6 A;  3B27 A;  4FCR A;  4L90 A;  2YE7 A;  1YC1 A;  4AWQ A;  2ZKJ A;  3DGE A;  1Z5B A;  4W7T A;  3R4M A;  4BQG A;  2IOP A;  4AWP A;  3D0B A;  4QPJ A;  3HZ1 A;  3SL2 A;  4CWT A;  2CCU A;  2XCM A;  2XHX A;  1BYQ A;  3VHA A;  2O1W A;  2YI5 A;  1H7S A;  4XKO A;  4URM A;  1I5A A;  4GEE A;  2XJG A;  3EHG A;  1YT1 A;  5FND A;  5IDM A;  4HY1 A;  2CG9 A;  3TZ2 A;  4K4O A;  3EHH A;  2BTZ A;  4L94 A;  1TH8 A;  2O1V A;  5CTY A;  2CGF A;  3G7B A;  1U0Z A;  2JKI A;  1Y8P A;  4YKW A;  1UY7 A;  3OW6 A;  1A4H A;  3FV5 A;  4L91 A;  1I59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...