3O2FA

Structure of the n-domain of grp94 bound to the hsp90 inhibitor pu-h54
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
232
structure length
228
Chain Sequence
b'LREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title Paralog-selective Hsp90 inhibitors define tumor-specific regulation of HER2.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone/inhibitor
total genus 70
structure length 228
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3o2fA00
2XJXA 4B7PA 2VWCA 1Y4UA 2EXLA 1UYIA 4QPJA 4MP7A 1A4HA 2XJGA 2CCSA 2H55A 1US7A 4URLA 3LPSA 1UYFA 4GFNA 3K97A 5J71A 3G7BA 3T0HA 5D6PA 5M4MA 2JKIA 2QG0A 4CE3A 4V25A 3B24A 3BMYA 4L90A 4PRVA 4MPNA 4FPPA 5D7DA 3RLPA 4P7AA 2XX5A 3SL2A 1UYDA 3EHGA 2E0AA 1OSFA 4L91A 4ASFA 1TH8A 4GCZA 4KTNA 4R3MA 4CWNA 3PEJA 5M4HA 5FNFA 4P8OA 3B27A 2YK2A 4HXWA 3A0WA 3KE6A 4KQVA 2BZ5A 2XDLA 4LPBA 1Z59A 4GT8A 4CE2A 3T10A 5CTWA 2O1UA 1YT2A 2XX2A 3GIEA 5L3JA 2YI7A 3T0ZA 1B63A 5BODA 4V26A 4O05A 2YKJA 3R4NA 4XIRA 4B6CA 4BIZA 2HG1A 3RLQA 4BAEA 5M4PA 4O0BA 3TZ2A 5FNCA 3B26A 2PNRA 4CWFA 4FCRA 3H4LA 4I3HA 3ZKDA 1UYLA 1U2OA 1Z5BA 2YE3A 2YI0A 4AWQA 2BU2A 2YI6A 2IOQA 1QY8A 3OWDA 1AM1A 2YK9A 4PU9A 4EGIA 3TUHA 1MX0A 2FWZA 3O2FA 2Q2EB 2CCUA 4FCPA 3A0XA 4YKYA 2ZDXA 4L94A 5IDJA 4U7OA 1UY8A 2XHTA 1B3QA 1QYEA 1I5DA 4FMTA 3CGYA 2ZKJA 1BYQA 1QZRA 4HZ0A 4XKAA 2YE9A 2JJCA 4AWOA 1ZW9A 3K60A 4EM7A 3CWVA 4GEEA 4EEHA 4AWPA 4BQGA 4YKQA 4GQTA 4EFTA 4R3AA 2WI4A 1UYHA 2YEBA 1YESA 1UYEA 3T2SA 3TTZA 1YERA 1ZWHA 5IN9A 5CTUA 1H7UA 5F5RA 3VADA 5FWKA 4XIQA 3K98A 2BT0A 1I5AA 1YS3A 3D2RA 2XHXA 4EFUA 4WUDA 4ZVIA 4CWOA 1UYCA 2BRCA 5M4NA 1UYGA 1I59A 3EKOA 2BU5A 4XKKA 2K5BA 1YC3A 1L0OA 1S16A 3D36A 2VCIA 1Y8NA 1GKXA 2BU7A 1YC1A 3FT8A 4NH9A 4W7TA 1Z5CA 2XJJA 4L93A 1ZXMA 1I5BA 5CTXA 1TC0A 2O1VA 1I58A 3A0ZA 4CWQA 2YEHA 4Q20A 2IOPA 3OMUA 1AH8A 4EGKA 2BYHA 4XDMA 4KSHA 2YJXA 3ZXOA 2ZBKB 2WI7A 2XABA 4HYMA 4ASGA 4LP0A 3JZ3A 4R1FA 2HCHA 2H8MA 5J6AA 4U93A 3OW6A 3C11A 2YGEA 1NHJA 3O0IA 2ESAA 4XCJA 4KP4A 1BXDA 3FV5A 3Q5KA 3QDDA 3VHCA 1BGQA 2IWUA 1UYKA 3A0RA 2YEJA 2GFDA 2YE7A 4CWSA 1TC6A 3GIGA 5CF0A 2GQPA 4CWTA 1AJ6A 1Y8PA 4LWIA 3MNRP 5CTYA 2IWSA 3OPDA 4MB9A 5D7RA 4ASAA 2YEFA 4NH8A 2YE6A 4PL9A 3INWA 2QF6A 5D7CA 3INXA 1B62A 4XITA 2YE4A 3ZM7A 1S14A 4E00A 2BREA 4FCQA 4KFGA 5D6QA 3Q5LA 2C2AA 2YGFA 4YKTA 2WEQA 4GGLA 2BTZA 2XCMA 3R4PA 2YJWA 3TZ4A 3RLRA 1YT0A 3R4MA 1GJVA 4YKUA 1YT1A 3OWBA 2WI1A 2VCJA 3T1KA 4MOTA 1UYMA 4X9LA 4LWGA 4YKZA 4U7NA 3CRLA 3Q5JA 4H7QA 4H81A 2BU6A 2YEIA 3DGEA 3GIGB 3HZ1A 3HZ5A 4H85A 2AKPA 4E01A 1GKZA 2BYIA 1YSZA 2YEGA 2XK2A 4DUHA 4BIUA 4BQJA 1EI1A 3R4OA 1H7SA 3C0EA 1UY9A 1TILA 1ZXNA 2CGFA 1U0ZA 3TZ0A 2XDSA 1I5CA 2YKIA 4O04A 2VW5A 3HHUA 4YKWA 3BM9A 1YSRA 1BKNA 1NHHA 3G75A 4LWHA 4YKRA 2YKEA 2QG2A 2XDUA 1TIDA 3GIFA 5IDMA 3A0YA 2YKBA 3EHFA 1JM6A 4MP2A 2FXSA 2O1WA 2CG9A 4XC0A 4ASBA 4EGHA 2ZDYA 3HEKA 3CGZA 1R62A 3EHHA 2FWYA 4KSGA 4JAUA 3IEDA 1MU5A 3B25A 3HYYA 2WERA 4DZYA 1PVGA 2XHRA 5CPHA 2UWDA 1TBWA 3RKZA 1THNA 3WHAA 4O09A 1KZNA 3ZKBA 1Y8OA 5M4EA 3WQ9A 2YGAA 3HYZA 2YE2A 2CCTA 4E02A 2WI5A 3U2DA 2IWXA 4JASA 4URNA 3O6OA 4HYPA 3EHJA 4CWRA 1Y4SA 3LNUA 1UY7A 1KIJA 4HXZA 2YI5A 1Z5AA 4URMA 4XIPA 4AS9A 4EMVA 3EKRA 2FYPA 4LWFA 2YEDA 5M4KA 4I5SA 4YKXA 5FNDA 2CH4A 3VHAA 4MPCA 3VHDA 2XD6A 4XTJA 3U67A 3K99A 3ZXQA 2WI2A 2XDKA 4JQLA 2HKJA 4JAVA 1ID0A 2Q8GA 4HZ5A 2WI6A 2Q8IA 4XE2A 4UROA 4XD8A 3R91A 1AH6A 1YC4A 1AMWA 5F3KA 4WUBA 3QTFA 3TZ5A 2XX4A 4L8ZA 2QFOA 1NHIA 2YE8A 3PEHA 3U2KA 3D0BA 4BXIA 5C93A 2YE5A 2Q8FA 3R92A 3A0TA 4HY1A 1UY6A 4LWEA 4PRXA 2WI3A 4K4OA 4XCLA 2IORA 4HY6A 4CWPA 2YECA 3G7EA 4QPKA 4ZKIA 2Q8HA 2BU8A 3B28A 4CE1A 1EA6A 3NMQA 5GGZA 3FT5A 2YEAA 3H80A 3CRKA 2BSMA 2WEPA 2YKCA 4MPEA 1YETA 4O07A 5BOCA 2XDXA 4WUCA 4XKOA 2YEEA 4MBCA 4NH7A
chains in the Genus database with same CATH superfamily
2XJXA 4B7PA 2VWCA 1Y4UA 2EXLA 1UYIA 4QPJA 4MP7A 1A4HA 2XJGA 2CCSA 2H55A 1US7A 4URLA 3LPSA 1UYFA 4GFNA 3K97A 5J71A 3G7BA 3T0HA 5D6PA 5M4MA 2JKIA 2QG0A 4CE3A 4V25A 3B24A 3BMYA 4L90A 4PRVA 4MPNA 4FPPA 5D7DA 3RLPA 4P7AA 2XX5A 3SL2A 1UYDA 3EHGA 2E0AA 1OSFA 4L91A 4ASFA 1TH8A 4GCZA 4KTNA 4R3MA 4CWNA 3PEJA 5M4HA 5FNFA 4P8OA 3B27A 2YK2A 4HXWA 3A0WA 3KE6A 4KQVA 2BZ5A 2XDLA 2HHIA 4LPBA 1Z59A 4GT8A 4CE2A 3T10A 5CTWA 2O1UA 1YT2A 2XX2A 3GIEA 5L3JA 2YI7A 3T0ZA 1B63A 5BODA 4V26A 4O05A 2YKJA 3R4NA 4XIRA 4B6CA 4BIZA 2HG1A 3RLQA 4BAEA 5M4PA 4O0BA 3TZ2A 5FNCA 3B26A 2PNRA 4CWFA 4FCRA 3H4LA 4I3HA 3ZKDA 1UYLA 1U2OA 1Z5BA 2YE3A 2YI0A 4AWQA 3CYGA 2BU2A 2YI6A 2IOQA 1QY8A 3OWDA 1AM1A 2YK9A 4PU9A 4EGIA 3TUHA 1MX0A 2FWZA 3O2FA 2Q2EB 2CCUA 4FCPA 3A0XA 4YKYA 2ZDXA 4L94A 5IDJA 4U7OA 1UY8A 2XHTA 1B3QA 1QYEA 1I5DA 4FMTA 3CGYA 2ZKJA 1BYQA 1QZRA 4HZ0A 4XKAA 2YE9A 2JJCA 4AWOA 1ZW9A 3K60A 4EM7A 3CWVA 4GEEA 4EEHA 4AWPA 4BQGA 4YKQA 4GQTA 4EFTA 4R3AA 2WI4A 1UYHA 2YEBA 1YESA 1UYEA 3T2SA 3TTZA 1YERA 1ZWHA 5IN9A 5CTUA 1H7UA 5F5RA 3VADA 5FWKA 4XIQA 3K98A 2BT0A 1I5AA 1YS3A 3D2RA 2XHXA 4EFUA 4WUDA 4ZVIA 4CWOA 1UYCA 2BRCA 5M4NA 1UYGA 1I59A 3EKOA 2BU5A 4XKKA 2K5BA 4E72A 1YC3A 1L0OA 1S16A 3D36A 3LMMA 2VCIA 1Y8NA 1GKXA 2BU7A 1YC1A 3FT8A 4NH9A 4W7TA 1Z5CA 2XJJA 4L93A 1ZXMA 1I5BA 5CTXA 1TC0A 2O1VA 1I58A 3A0ZA 4CWQA 2YEHA 4Q20A 2IOPA 3OMUA 1AH8A 4EGKA 2BYHA 4XDMA 4KSHA 2YJXA 3ZXOA 2ZBKB 2WI7A 2XABA 4HYMA 4ASGA 4LP0A 1F51A 3JZ3A 4R1FA 2HCHA 2H8MA 5J6AA 4U93A 3OW6A 3C11A 2YGEA 1NHJA 3O0IA 2ESAA 4XCJA 4KP4A 1BXDA 3FV5A 3Q5KA 3QDDA 3VHCA 1BGQA 2IWUA 1UYKA 3A0RA 2YEJA 2GFDA 2YE7A 4CWSA 1TC6A 3GIGA 5CF0A 2GQPA 4CWTA 1AJ6A 1Y8PA 4LWIA 3MNRP 5CTYA 2IWSA 3OPDA 4MB9A 5D7RA 4ASAA 2C1GA 2YEFA 4NH8A 2YE6A 4PL9A 3INWA 2QF6A 5D7CA 3INXA 1B62A 4XITA 2YE4A 3ZM7A 1S14A 4E00A 2BREA 4FCQA 4KFGA 5D6QA 3Q5LA 2C2AA 2YGFA 4YKTA 2WEQA 4GGLA 2BTZA 2XCMA 3R4PA 2YJWA 3TZ4A 3RLRA 1YT0A 3R4MA 1GJVA 4YKUA 1YT1A 3OWBA 2WI1A 2VCJA 3T1KA 4MOTA 1UYMA 4X9LA 4LWGA 4YKZA 4U7NA 3CRLA 3Q5JA 4H7QA 4H81A 2BU6A 2YEIA 3DGEA 3GIGB 3HZ1A 3HZ5A 4H85A 2AKPA 4E01A 1IXMA 1GKZA 5JENA 2BYIA 1YSZA 2YEGA 2XK2A 4DUHA 4BIUA 4BQJA 1EI1A 3R4OA 1H7SA 3C0EA 1UY9A 1TILA 1ZXNA 2CGFA 1U0ZA 3TZ0A 2XDSA 1I5CA 2YKIA 4O04A 2VW5A 3HHUA 4YKWA 3BM9A 1YSRA 1BKNA 1NHHA 3G75A 4LWHA 4YKRA 2YKEA 2QG2A 2XDUA 1TIDA 3GIFA 5IDMA 3A0YA 2YKBA 3EHFA 1JM6A 4MP2A 2FXSA 2O1WA 2CG9A 4XC0A 4ASBA 4EGHA 2ZDYA 3HEKA 3CGZA 1R62A 3EHHA 2FWYA 4KSGA 4JAUA 3IEDA 1MU5A 3B25A 3HYYA 2WERA 4DZYA 1PVGA 2XHRA 5CPHA 2UWDA 1TBWA 3RKZA 1THNA 3WHAA 2C1IA 4O09A 1KZNA 3ZKBA 1Y8OA 5M4EA 3WQ9A 2YGAA 3HYZA 2YE2A 2CCTA 4E02A 2WI5A 3U2DA 2IWXA 4JASA 4URNA 3O6OA 4HYPA 3EHJA 4CWRA 1Y4SA 3LNUA 1UY7A 2FTKA 1KIJA 4HXZA 2YI5A 1Z5AA 4URMA 4XIPA 4AS9A 4EMVA 3EKRA 2FYPA 4LWFA 2YEDA 5M4KA 4I5SA 4YKXA 5FNDA 2CH4A 3VHAA 4MPCA 3VHDA 2XD6A 4XTJA 3U67A 3K99A 3ZXQA 2WI2A 2XDKA 4JQLA 2HKJA 4JAVA 1ID0A 2Q8GA 4HZ5A 2WI6A 2Q8IA 4XE2A 4UROA 4XD8A 3R91A 1AH6A 1YC4A 1AMWA 5F3KA 4WUBA 3QTFA 3TZ5A 2XX4A 4L8ZA 2QFOA 1NHIA 2YE8A 3PEHA 3U2KA 3D0BA 4BXIA 5C93A 2YE5A 2Q8FA 3R92A 3A0TA 4HY1A 1UY6A 4LWEA 4PRXA 2WI3A 4K4OA 4XCLA 2IORA 4HY6A 4CWPA 2YECA 3G7EA 4QPKA 4ZKIA 2Q8HA 2BU8A 3B28A 3S5TA 4CE1A 1EA6A 3NMQA 5GGZA 3FT5A 2YEAA 3H80A 3CRKA 2BSMA 2WEPA 2YKCA 4MPEA 1YETA 4O07A 5BOCA 2XDXA 4WUCA 4XKOA 2YEEA 4MBCA 4NH7A
chains in the Genus database with same CATH topology
2XJXA 4B7PA 2VWCA 1Y4UA 2EXLA 1UYIA 4QPJA 4MP7A 1A4HA 2XJGA 2CCSA 2H55A 1US7A 4URLA 3LPSA 1UYFA 4GFNA 3K97A 5J71A 3G7BA 3T0HA 5D6PA 5M4MA 2JKIA 2QG0A 4CE3A 4V25A 3B24A 3BMYA 4L90A 4PRVA 4MPNA 4FPPA 5D7DA 3RLPA 4P7AA 2XX5A 3SL2A 1UYDA 3EHGA 2E0AA 1OSFA 4L91A 4ASFA 1TH8A 4GCZA 4KTNA 4R3MA 4CWNA 3PEJA 5M4HA 5FNFA 4P8OA 3B27A 2YK2A 4HXWA 3A0WA 3KE6A 4KQVA 2BZ5A 2XDLA 4LPBA 1Z59A 4GT8A 4CE2A 3T10A 5CTWA 2O1UA 1YT2A 2XX2A 3GIEA 5L3JA 2YI7A 3T0ZA 1B63A 5BODA 4V26A 4O05A 2YKJA 3R4NA 4XIRA 4B6CA 4BIZA 2HG1A 3RLQA 4BAEA 5M4PA 4O0BA 3TZ2A 5FNCA 3B26A 2PNRA 4CWFA 4FCRA 3H4LA 4I3HA 3ZKDA 1UYLA 1U2OA 1Z5BA 2YE3A 2YI0A 4AWQA 2BU2A 2YI6A 2IOQA 1QY8A 3OWDA 1AM1A 2YK9A 4PU9A 4EGIA 3TUHA 1MX0A 2FWZA 3O2FA 2Q2EB 2CCUA 4FCPA 3A0XA 4YKYA 2ZDXA 4L94A 5IDJA 4U7OA 1UY8A 2XHTA 1B3QA 1QYEA 1I5DA 4FMTA 3CGYA 2ZKJA 1BYQA 1QZRA 4HZ0A 4XKAA 2YE9A 2JJCA 4AWOA 1ZW9A 3K60A 4EM7A 3CWVA 4GEEA 4EEHA 4AWPA 4BQGA 4YKQA 4GQTA 4EFTA 4R3AA 2WI4A 1UYHA 2YEBA 1YESA 1UYEA 3T2SA 3TTZA 1YERA 1ZWHA 5IN9A 5CTUA 1H7UA 5F5RA 3VADA 5FWKA 4XIQA 3K98A 2BT0A 1I5AA 1YS3A 3D2RA 2XHXA 4EFUA 4WUDA 4ZVIA 4CWOA 1UYCA 2BRCA 5M4NA 1UYGA 1I59A 3EKOA 2BU5A 4XKKA 2K5BA 1YC3A 1L0OA 1S16A 3D36A 2VCIA 1Y8NA 1GKXA 2BU7A 1YC1A 3FT8A 4NH9A 4W7TA 1Z5CA 2XJJA 4L93A 1ZXMA 1I5BA 5CTXA 1TC0A 2O1VA 1I58A 3A0ZA 4CWQA 2YEHA 4Q20A 2IOPA 3OMUA 1AH8A 4EGKA 2BYHA 4XDMA 4KSHA 2YJXA 3ZXOA 2ZBKB 2WI7A 2XABA 4HYMA 4ASGA 4LP0A 3JZ3A 4R1FA 2HCHA 2H8MA 5J6AA 4U93A 3OW6A 3C11A 2YGEA 1NHJA 3O0IA 2ESAA 4XCJA 4KP4A 1BXDA 3FV5A 3Q5KA 3QDDA 3VHCA 1BGQA 2IWUA 1UYKA 3A0RA 2YEJA 2GFDA 2YE7A 4CWSA 1TC6A 3GIGA 5CF0A 2GQPA 4CWTA 1AJ6A 1Y8PA 4LWIA 3MNRP 5CTYA 2IWSA 3OPDA 4MB9A 5D7RA 4ASAA 2YEFA 4NH8A 2YE6A 4PL9A 3INWA 2QF6A 5D7CA 3INXA 1B62A 4XITA 2YE4A 3ZM7A 1S14A 4E00A 2BREA 4FCQA 4KFGA 5D6QA 3Q5LA 2C2AA 2YGFA 4YKTA 2WEQA 4GGLA 2BTZA 2XCMA 3R4PA 2YJWA 3TZ4A 3RLRA 1YT0A 3R4MA 1GJVA 4YKUA 1YT1A 3OWBA 2WI1A 2VCJA 3T1KA 4MOTA 1UYMA 4X9LA 4LWGA 4YKZA 4U7NA 3CRLA 3Q5JA 4H7QA 4H81A 2BU6A 2YEIA 3DGEA 3GIGB 3HZ1A 3HZ5A 4H85A 2AKPA 4E01A 1GKZA 2BYIA 1YSZA 2YEGA 2XK2A 4DUHA 4BIUA 4BQJA 1EI1A 3R4OA 1H7SA 3C0EA 1UY9A 1TILA 1ZXNA 2CGFA 1U0ZA 3TZ0A 2XDSA 1I5CA 2YKIA 4O04A 2VW5A 3HHUA 4YKWA 3BM9A 1YSRA 1BKNA 1NHHA 3G75A 4LWHA 4YKRA 2YKEA 2QG2A 2XDUA 1TIDA 3GIFA 5IDMA 3A0YA 2YKBA 3EHFA 1JM6A 4MP2A 2FXSA 2O1WA 2CG9A 4XC0A 4ASBA 4EGHA 2ZDYA 3HEKA 3CGZA 1R62A 3EHHA 2FWYA 4KSGA 4JAUA 3IEDA 1MU5A 3B25A 3HYYA 2WERA 4DZYA 1PVGA 2XHRA 5CPHA 2UWDA 1TBWA 3RKZA 1THNA 3WHAA 4O09A 1KZNA 3ZKBA 1Y8OA 5M4EA 3WQ9A 2YGAA 3HYZA 2YE2A 2CCTA 4E02A 2WI5A 3U2DA 2IWXA 4JASA 4URNA 3O6OA 4HYPA 3EHJA 4CWRA 1Y4SA 3LNUA 1UY7A 1KIJA 4HXZA 2YI5A 1Z5AA 4URMA 4XIPA 4AS9A 4EMVA 3EKRA 2FYPA 4LWFA 2YEDA 5M4KA 4I5SA 4YKXA 5FNDA 2CH4A 3VHAA 4MPCA 3VHDA 2XD6A 4XTJA 3U67A 3K99A 3ZXQA 2WI2A 2XDKA 4JQLA 2HKJA 4JAVA 1ID0A 2Q8GA 4HZ5A 2WI6A 2Q8IA 4XE2A 4UROA 4XD8A 3R91A 1AH6A 1YC4A 1AMWA 5F3KA 4WUBA 3QTFA 3TZ5A 2XX4A 4L8ZA 2QFOA 1NHIA 2YE8A 3PEHA 3U2KA 3D0BA 4BXIA 5C93A 2YE5A 2Q8FA 3R92A 3A0TA 4HY1A 1UY6A 4LWEA 4PRXA 2WI3A 4K4OA 4XCLA 2IORA 4HY6A 4CWPA 2YECA 3G7EA 4QPKA 4ZKIA 2Q8HA 2BU8A 3B28A 4CE1A 1EA6A 3NMQA 5GGZA 3FT5A 2YEAA 3H80A 3CRKA 2BSMA 2WEPA 2YKCA 4MPEA 1YETA 4O07A 5BOCA 2XDXA 4WUCA 4XKOA 2YEEA 4MBCA 4NH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XJX A;  4B7P A;  2VWC A;  1Y4U A;  2EXL A;  1UYI A;  4QPJ A;  4MP7 A;  1A4H A;  2XJG A;  2CCS A;  2H55 A;  1US7 A;  4URL A;  3LPS A;  1UYF A;  4GFN A;  3K97 A;  5J71 A;  3G7B A;  3T0H A;  5D6P A;  5M4M A;  2JKI A;  2QG0 A;  4CE3 A;  4V25 A;  3B24 A;  3BMY A;  4L90 A;  4PRV A;  4MPN A;  4FPP A;  5D7D A;  3RLP A;  4P7A A;  2XX5 A;  3SL2 A;  1UYD A;  3EHG A;  2E0A A;  1OSF A;  4L91 A;  4ASF A;  1TH8 A;  4GCZ A;  4KTN A;  4R3M A;  4CWN A;  3PEJ A;  5M4H A;  5FNF A;  4P8O A;  3B27 A;  2YK2 A;  4HXW A;  3A0W A;  3KE6 A;  4KQV A;  2BZ5 A;  2XDL A;  4LPB A;  1Z59 A;  4GT8 A;  4CE2 A;  3T10 A;  5CTW A;  2O1U A;  1YT2 A;  2XX2 A;  3GIE A;  5L3J A;  2YI7 A;  3T0Z A;  1B63 A;  5BOD A;  4V26 A;  4O05 A;  2YKJ A;  3R4N A;  4XIR A;  4B6C A;  4BIZ A;  2HG1 A;  3RLQ A;  4BAE A;  5M4P A;  4O0B A;  3TZ2 A;  5FNC A;  3B26 A;  2PNR A;  4CWF A;  4FCR A;  3H4L A;  4I3H A;  3ZKD A;  1UYL A;  1U2O A;  1Z5B A;  2YE3 A;  2YI0 A;  4AWQ A;  2BU2 A;  2YI6 A;  2IOQ A;  1QY8 A;  3OWD A;  1AM1 A;  2YK9 A;  4PU9 A;  4EGI A;  3TUH A;  1MX0 A;  2FWZ A;  3O2F A;  2Q2E B;  2CCU A;  4FCP A;  3A0X A;  4YKY A;  2ZDX A;  4L94 A;  5IDJ A;  4U7O A;  1UY8 A;  2XHT A;  1B3Q A;  1QYE A;  1I5D A;  4FMT A;  3CGY A;  2ZKJ A;  1BYQ A;  1QZR A;  4HZ0 A;  4XKA A;  2YE9 A;  2JJC A;  4AWO A;  1ZW9 A;  3K60 A;  4EM7 A;  3CWV A;  4GEE A;  4EEH A;  4AWP A;  4BQG A;  4YKQ A;  4GQT A;  4EFT A;  4R3A A;  2WI4 A;  1UYH A;  2YEB A;  1YES A;  1UYE A;  3T2S A;  3TTZ A;  1YER A;  1ZWH A;  5IN9 A;  5CTU A;  1H7U A;  5F5R A;  3VAD A;  5FWK A;  4XIQ A;  3K98 A;  2BT0 A;  1I5A A;  1YS3 A;  3D2R A;  2XHX A;  4EFU A;  4WUD A;  4ZVI A;  4CWO A;  1UYC A;  2BRC A;  5M4N A;  1UYG A;  1I59 A;  3EKO A;  2BU5 A;  4XKK A;  2K5B A;  1YC3 A;  1L0O A;  1S16 A;  3D36 A;  2VCI A;  1Y8N A;  1GKX A;  2BU7 A;  1YC1 A;  3FT8 A;  4NH9 A;  4W7T A;  1Z5C A;  2XJJ A;  4L93 A;  1ZXM A;  1I5B A;  5CTX A;  1TC0 A;  2O1V A;  1I58 A;  3A0Z A;  4CWQ A;  2YEH A;  4Q20 A;  2IOP A;  3OMU A;  1AH8 A;  4EGK A;  2BYH A;  4XDM A;  4KSH A;  2YJX A;  3ZXO A;  2ZBK B;  2WI7 A;  2XAB A;  4HYM A;  4ASG A;  4LP0 A;  3JZ3 A;  4R1F A;  2HCH A;  2H8M A;  5J6A A;  4U93 A;  3OW6 A;  3C11 A;  2YGE A;  1NHJ A;  3O0I A;  2ESA A;  4XCJ A;  4KP4 A;  1BXD A;  3FV5 A;  3Q5K A;  3QDD A;  3VHC A;  1BGQ A;  2IWU A;  1UYK A;  3A0R A;  2YEJ A;  2GFD A;  2YE7 A;  4CWS A;  1TC6 A;  3GIG A;  5CF0 A;  2GQP A;  4CWT A;  1AJ6 A;  1Y8P A;  4LWI A;  3MNR P;  5CTY A;  2IWS A;  3OPD A;  4MB9 A;  5D7R A;  4ASA A;  2YEF A;  4NH8 A;  2YE6 A;  4PL9 A;  3INW A;  2QF6 A;  5D7C A;  3INX A;  1B62 A;  4XIT A;  2YE4 A;  3ZM7 A;  1S14 A;  4E00 A;  2BRE A;  4FCQ A;  4KFG A;  5D6Q A;  3Q5L A;  2C2A A;  2YGF A;  4YKT A;  2WEQ A;  4GGL A;  2BTZ A;  2XCM A;  3R4P A;  2YJW A;  3TZ4 A;  3RLR A;  1YT0 A;  3R4M A;  1GJV A;  4YKU A;  1YT1 A;  3OWB A;  2WI1 A;  2VCJ A;  3T1K A;  4MOT A;  1UYM A;  4X9L A;  4LWG A;  4YKZ A;  4U7N A;  3CRL A;  3Q5J A;  4H7Q A;  4H81 A;  2BU6 A;  2YEI A;  3DGE A;  3GIG B;  3HZ1 A;  3HZ5 A;  4H85 A;  2AKP A;  4E01 A;  1GKZ A;  2BYI A;  1YSZ A;  2YEG A;  2XK2 A;  4DUH A;  4BIU A;  4BQJ A;  1EI1 A;  3R4O A;  1H7S A;  3C0E A;  1UY9 A;  1TIL A;  1ZXN A;  2CGF A;  1U0Z A;  3TZ0 A;  2XDS A;  1I5C A;  2YKI A;  4O04 A;  2VW5 A;  3HHU A;  4YKW A;  3BM9 A;  1YSR A;  1BKN A;  1NHH A;  3G75 A;  4LWH A;  4YKR A;  2YKE A;  2QG2 A;  2XDU A;  1TID A;  3GIF A;  5IDM A;  3A0Y A;  2YKB A;  3EHF A;  1JM6 A;  4MP2 A;  2FXS A;  2O1W A;  2CG9 A;  4XC0 A;  4ASB A;  4EGH A;  2ZDY A;  3HEK A;  3CGZ A;  1R62 A;  3EHH A;  2FWY A;  4KSG A;  4JAU A;  3IED A;  1MU5 A;  3B25 A;  3HYY A;  2WER A;  4DZY A;  1PVG A;  2XHR A;  5CPH A;  2UWD A;  1TBW A;  3RKZ A;  1THN A;  3WHA A;  4O09 A;  1KZN A;  3ZKB A;  1Y8O A;  5M4E A;  3WQ9 A;  2YGA A;  3HYZ A;  2YE2 A;  2CCT A;  4E02 A;  2WI5 A;  3U2D A;  2IWX A;  4JAS A;  4URN A;  3O6O A;  4HYP A;  3EHJ A;  4CWR A;  1Y4S A;  3LNU A;  1UY7 A;  1KIJ A;  4HXZ A;  2YI5 A;  1Z5A A;  4URM A;  4XIP A;  4AS9 A;  4EMV A;  3EKR A;  2FYP A;  4LWF A;  2YED A;  5M4K A;  4I5S A;  4YKX A;  5FND A;  2CH4 A;  3VHA A;  4MPC A;  3VHD A;  2XD6 A;  4XTJ A;  3U67 A;  3K99 A;  3ZXQ A;  2WI2 A;  2XDK A;  4JQL A;  2HKJ A;  4JAV A;  1ID0 A;  2Q8G A;  4HZ5 A;  2WI6 A;  2Q8I A;  4XE2 A;  4URO A;  4XD8 A;  3R91 A;  1AH6 A;  1YC4 A;  1AMW A;  5F3K A;  4WUB A;  3QTF A;  3TZ5 A;  2XX4 A;  4L8Z A;  2QFO A;  1NHI A;  2YE8 A;  3PEH A;  3U2K A;  3D0B A;  4BXI A;  5C93 A;  2YE5 A;  2Q8F A;  3R92 A;  3A0T A;  4HY1 A;  1UY6 A;  4LWE A;  4PRX A;  2WI3 A;  4K4O A;  4XCL A;  2IOR A;  4HY6 A;  4CWP A;  2YEC A;  3G7E A;  4QPK A;  4ZKI A;  2Q8H A;  2BU8 A;  3B28 A;  4CE1 A;  1EA6 A;  3NMQ A;  5GGZ A;  3FT5 A;  2YEA A;  3H80 A;  3CRK A;  2BSM A;  2WEP A;  2YKC A;  4MPE A;  1YET A;  4O07 A;  5BOC A;  2XDX A;  4WUC A;  4XKO A;  2YEE A;  4MBC A;  4NH7 A; 
#chains in the Genus database with same CATH topology
 2XJX A;  4B7P A;  2VWC A;  1Y4U A;  2EXL A;  1UYI A;  4QPJ A;  4MP7 A;  1A4H A;  2XJG A;  2CCS A;  2H55 A;  1US7 A;  4URL A;  3LPS A;  1UYF A;  4GFN A;  3K97 A;  5J71 A;  3G7B A;  3T0H A;  5D6P A;  5M4M A;  2JKI A;  2QG0 A;  4CE3 A;  4V25 A;  3B24 A;  3BMY A;  4L90 A;  4PRV A;  4MPN A;  4FPP A;  5D7D A;  3RLP A;  4P7A A;  2XX5 A;  3SL2 A;  1UYD A;  3EHG A;  2E0A A;  1OSF A;  4L91 A;  4ASF A;  1TH8 A;  4GCZ A;  4KTN A;  4R3M A;  4CWN A;  3PEJ A;  5M4H A;  5FNF A;  4P8O A;  3B27 A;  2YK2 A;  4HXW A;  3A0W A;  3KE6 A;  4KQV A;  2BZ5 A;  2XDL A;  2HHI A;  4LPB A;  1Z59 A;  4GT8 A;  4CE2 A;  3T10 A;  5CTW A;  2O1U A;  1YT2 A;  2XX2 A;  3GIE A;  5L3J A;  2YI7 A;  3T0Z A;  1B63 A;  5BOD A;  4V26 A;  4O05 A;  2YKJ A;  3R4N A;  4XIR A;  4B6C A;  4BIZ A;  2HG1 A;  3RLQ A;  4BAE A;  5M4P A;  4O0B A;  3TZ2 A;  5FNC A;  3B26 A;  2PNR A;  4CWF A;  4FCR A;  3H4L A;  4I3H A;  3ZKD A;  1UYL A;  1U2O A;  1Z5B A;  2YE3 A;  2YI0 A;  4AWQ A;  3CYG A;  2BU2 A;  2YI6 A;  2IOQ A;  1QY8 A;  3OWD A;  1AM1 A;  2YK9 A;  4PU9 A;  4EGI A;  3TUH A;  1MX0 A;  2FWZ A;  3O2F A;  2Q2E B;  2CCU A;  4FCP A;  3A0X A;  4YKY A;  2ZDX A;  4L94 A;  5IDJ A;  4U7O A;  1UY8 A;  2XHT A;  1B3Q A;  1QYE A;  1I5D A;  4FMT A;  3CGY A;  2ZKJ A;  1BYQ A;  1QZR A;  4HZ0 A;  4XKA A;  2YE9 A;  2JJC A;  4AWO A;  1ZW9 A;  3K60 A;  4EM7 A;  3CWV A;  4GEE A;  4EEH A;  4AWP A;  4BQG A;  4YKQ A;  4GQT A;  4EFT A;  4R3A A;  2WI4 A;  1UYH A;  2YEB A;  1YES A;  1UYE A;  3T2S A;  3TTZ A;  1YER A;  1ZWH A;  5IN9 A;  5CTU A;  1H7U A;  5F5R A;  3VAD A;  5FWK A;  4XIQ A;  3K98 A;  2BT0 A;  1I5A A;  1YS3 A;  3D2R A;  2XHX A;  4EFU A;  4WUD A;  4ZVI A;  4CWO A;  1UYC A;  2BRC A;  5M4N A;  1UYG A;  1I59 A;  3EKO A;  2BU5 A;  4XKK A;  2K5B A;  4E72 A;  1YC3 A;  1L0O A;  1S16 A;  3D36 A;  3LMM A;  2VCI A;  1Y8N A;  1GKX A;  2BU7 A;  1YC1 A;  3FT8 A;  4NH9 A;  4W7T A;  1Z5C A;  2XJJ A;  4L93 A;  1ZXM A;  1I5B A;  5CTX A;  1TC0 A;  2O1V A;  1I58 A;  3A0Z A;  4CWQ A;  2YEH A;  4Q20 A;  2IOP A;  3OMU A;  1AH8 A;  4EGK A;  2BYH A;  4XDM A;  4KSH A;  2YJX A;  3ZXO A;  2ZBK B;  2WI7 A;  2XAB A;  4HYM A;  4ASG A;  4LP0 A;  1F51 A;  3JZ3 A;  4R1F A;  2HCH A;  2H8M A;  5J6A A;  4U93 A;  3OW6 A;  3C11 A;  2YGE A;  1NHJ A;  3O0I A;  2ESA A;  4XCJ A;  4KP4 A;  1BXD A;  3FV5 A;  3Q5K A;  3QDD A;  3VHC A;  1BGQ A;  2IWU A;  1UYK A;  3A0R A;  2YEJ A;  2GFD A;  2YE7 A;  4CWS A;  1TC6 A;  3GIG A;  5CF0 A;  2GQP A;  4CWT A;  1AJ6 A;  1Y8P A;  4LWI A;  3MNR P;  5CTY A;  2IWS A;  3OPD A;  4MB9 A;  5D7R A;  4ASA A;  2C1G A;  2YEF A;  4NH8 A;  2YE6 A;  4PL9 A;  3INW A;  2QF6 A;  5D7C A;  3INX A;  1B62 A;  4XIT A;  2YE4 A;  3ZM7 A;  1S14 A;  4E00 A;  2BRE A;  4FCQ A;  4KFG A;  5D6Q A;  3Q5L A;  2C2A A;  2YGF A;  4YKT A;  2WEQ A;  4GGL A;  2BTZ A;  2XCM A;  3R4P A;  2YJW A;  3TZ4 A;  3RLR A;  1YT0 A;  3R4M A;  1GJV A;  4YKU A;  1YT1 A;  3OWB A;  2WI1 A;  2VCJ A;  3T1K A;  4MOT A;  1UYM A;  4X9L A;  4LWG A;  4YKZ A;  4U7N A;  3CRL A;  3Q5J A;  4H7Q A;  4H81 A;  2BU6 A;  2YEI A;  3DGE A;  3GIG B;  3HZ1 A;  3HZ5 A;  4H85 A;  2AKP A;  4E01 A;  1IXM A;  1GKZ A;  5JEN A;  2BYI A;  1YSZ A;  2YEG A;  2XK2 A;  4DUH A;  4BIU A;  4BQJ A;  1EI1 A;  3R4O A;  1H7S A;  3C0E A;  1UY9 A;  1TIL A;  1ZXN A;  2CGF A;  1U0Z A;  3TZ0 A;  2XDS A;  1I5C A;  2YKI A;  4O04 A;  2VW5 A;  3HHU A;  4YKW A;  3BM9 A;  1YSR A;  1BKN A;  1NHH A;  3G75 A;  4LWH A;  4YKR A;  2YKE A;  2QG2 A;  2XDU A;  1TID A;  3GIF A;  5IDM A;  3A0Y A;  2YKB A;  3EHF A;  1JM6 A;  4MP2 A;  2FXS A;  2O1W A;  2CG9 A;  4XC0 A;  4ASB A;  4EGH A;  2ZDY A;  3HEK A;  3CGZ A;  1R62 A;  3EHH A;  2FWY A;  4KSG A;  4JAU A;  3IED A;  1MU5 A;  3B25 A;  3HYY A;  2WER A;  4DZY A;  1PVG A;  2XHR A;  5CPH A;  2UWD A;  1TBW A;  3RKZ A;  1THN A;  3WHA A;  2C1I A;  4O09 A;  1KZN A;  3ZKB A;  1Y8O A;  5M4E A;  3WQ9 A;  2YGA A;  3HYZ A;  2YE2 A;  2CCT A;  4E02 A;  2WI5 A;  3U2D A;  2IWX A;  4JAS A;  4URN A;  3O6O A;  4HYP A;  3EHJ A;  4CWR A;  1Y4S A;  3LNU A;  1UY7 A;  2FTK A;  1KIJ A;  4HXZ A;  2YI5 A;  1Z5A A;  4URM A;  4XIP A;  4AS9 A;  4EMV A;  3EKR A;  2FYP A;  4LWF A;  2YED A;  5M4K A;  4I5S A;  4YKX A;  5FND A;  2CH4 A;  3VHA A;  4MPC A;  3VHD A;  2XD6 A;  4XTJ A;  3U67 A;  3K99 A;  3ZXQ A;  2WI2 A;  2XDK A;  4JQL A;  2HKJ A;  4JAV A;  1ID0 A;  2Q8G A;  4HZ5 A;  2WI6 A;  2Q8I A;  4XE2 A;  4URO A;  4XD8 A;  3R91 A;  1AH6 A;  1YC4 A;  1AMW A;  5F3K A;  4WUB A;  3QTF A;  3TZ5 A;  2XX4 A;  4L8Z A;  2QFO A;  1NHI A;  2YE8 A;  3PEH A;  3U2K A;  3D0B A;  4BXI A;  5C93 A;  2YE5 A;  2Q8F A;  3R92 A;  3A0T A;  4HY1 A;  1UY6 A;  4LWE A;  4PRX A;  2WI3 A;  4K4O A;  4XCL A;  2IOR A;  4HY6 A;  4CWP A;  2YEC A;  3G7E A;  4QPK A;  4ZKI A;  2Q8H A;  2BU8 A;  3B28 A;  3S5T A;  4CE1 A;  1EA6 A;  3NMQ A;  5GGZ A;  3FT5 A;  2YEA A;  3H80 A;  3CRK A;  2BSM A;  2WEP A;  2YKC A;  4MPE A;  1YET A;  4O07 A;  5BOC A;  2XDX A;  4WUC A;  4XKO A;  2YEE A;  4MBC A;  4NH7 A; 
#chains in the Genus database with same CATH homology
 2XJX A;  4B7P A;  2VWC A;  1Y4U A;  2EXL A;  1UYI A;  4QPJ A;  4MP7 A;  1A4H A;  2XJG A;  2CCS A;  2H55 A;  1US7 A;  4URL A;  3LPS A;  1UYF A;  4GFN A;  3K97 A;  5J71 A;  3G7B A;  3T0H A;  5D6P A;  5M4M A;  2JKI A;  2QG0 A;  4CE3 A;  4V25 A;  3B24 A;  3BMY A;  4L90 A;  4PRV A;  4MPN A;  4FPP A;  5D7D A;  3RLP A;  4P7A A;  2XX5 A;  3SL2 A;  1UYD A;  3EHG A;  2E0A A;  1OSF A;  4L91 A;  4ASF A;  1TH8 A;  4GCZ A;  4KTN A;  4R3M A;  4CWN A;  3PEJ A;  5M4H A;  5FNF A;  4P8O A;  3B27 A;  2YK2 A;  4HXW A;  3A0W A;  3KE6 A;  4KQV A;  2BZ5 A;  2XDL A;  4LPB A;  1Z59 A;  4GT8 A;  4CE2 A;  3T10 A;  5CTW A;  2O1U A;  1YT2 A;  2XX2 A;  3GIE A;  5L3J A;  2YI7 A;  3T0Z A;  1B63 A;  5BOD A;  4V26 A;  4O05 A;  2YKJ A;  3R4N A;  4XIR A;  4B6C A;  4BIZ A;  2HG1 A;  3RLQ A;  4BAE A;  5M4P A;  4O0B A;  3TZ2 A;  5FNC A;  3B26 A;  2PNR A;  4CWF A;  4FCR A;  3H4L A;  4I3H A;  3ZKD A;  1UYL A;  1U2O A;  1Z5B A;  2YE3 A;  2YI0 A;  4AWQ A;  2BU2 A;  2YI6 A;  2IOQ A;  1QY8 A;  3OWD A;  1AM1 A;  2YK9 A;  4PU9 A;  4EGI A;  3TUH A;  1MX0 A;  2FWZ A;  3O2F A;  2Q2E B;  2CCU A;  4FCP A;  3A0X A;  4YKY A;  2ZDX A;  4L94 A;  5IDJ A;  4U7O A;  1UY8 A;  2XHT A;  1B3Q A;  1QYE A;  1I5D A;  4FMT A;  3CGY A;  2ZKJ A;  1BYQ A;  1QZR A;  4HZ0 A;  4XKA A;  2YE9 A;  2JJC A;  4AWO A;  1ZW9 A;  3K60 A;  4EM7 A;  3CWV A;  4GEE A;  4EEH A;  4AWP A;  4BQG A;  4YKQ A;  4GQT A;  4EFT A;  4R3A A;  2WI4 A;  1UYH A;  2YEB A;  1YES A;  1UYE A;  3T2S A;  3TTZ A;  1YER A;  1ZWH A;  5IN9 A;  5CTU A;  1H7U A;  5F5R A;  3VAD A;  5FWK A;  4XIQ A;  3K98 A;  2BT0 A;  1I5A A;  1YS3 A;  3D2R A;  2XHX A;  4EFU A;  4WUD A;  4ZVI A;  4CWO A;  1UYC A;  2BRC A;  5M4N A;  1UYG A;  1I59 A;  3EKO A;  2BU5 A;  4XKK A;  2K5B A;  1YC3 A;  1L0O A;  1S16 A;  3D36 A;  2VCI A;  1Y8N A;  1GKX A;  2BU7 A;  1YC1 A;  3FT8 A;  4NH9 A;  4W7T A;  1Z5C A;  2XJJ A;  4L93 A;  1ZXM A;  1I5B A;  5CTX A;  1TC0 A;  2O1V A;  1I58 A;  3A0Z A;  4CWQ A;  2YEH A;  4Q20 A;  2IOP A;  3OMU A;  1AH8 A;  4EGK A;  2BYH A;  4XDM A;  4KSH A;  2YJX A;  3ZXO A;  2ZBK B;  2WI7 A;  2XAB A;  4HYM A;  4ASG A;  4LP0 A;  3JZ3 A;  4R1F A;  2HCH A;  2H8M A;  5J6A A;  4U93 A;  3OW6 A;  3C11 A;  2YGE A;  1NHJ A;  3O0I A;  2ESA A;  4XCJ A;  4KP4 A;  1BXD A;  3FV5 A;  3Q5K A;  3QDD A;  3VHC A;  1BGQ A;  2IWU A;  1UYK A;  3A0R A;  2YEJ A;  2GFD A;  2YE7 A;  4CWS A;  1TC6 A;  3GIG A;  5CF0 A;  2GQP A;  4CWT A;  1AJ6 A;  1Y8P A;  4LWI A;  3MNR P;  5CTY A;  2IWS A;  3OPD A;  4MB9 A;  5D7R A;  4ASA A;  2YEF A;  4NH8 A;  2YE6 A;  4PL9 A;  3INW A;  2QF6 A;  5D7C A;  3INX A;  1B62 A;  4XIT A;  2YE4 A;  3ZM7 A;  1S14 A;  4E00 A;  2BRE A;  4FCQ A;  4KFG A;  5D6Q A;  3Q5L A;  2C2A A;  2YGF A;  4YKT A;  2WEQ A;  4GGL A;  2BTZ A;  2XCM A;  3R4P A;  2YJW A;  3TZ4 A;  3RLR A;  1YT0 A;  3R4M A;  1GJV A;  4YKU A;  1YT1 A;  3OWB A;  2WI1 A;  2VCJ A;  3T1K A;  4MOT A;  1UYM A;  4X9L A;  4LWG A;  4YKZ A;  4U7N A;  3CRL A;  3Q5J A;  4H7Q A;  4H81 A;  2BU6 A;  2YEI A;  3DGE A;  3GIG B;  3HZ1 A;  3HZ5 A;  4H85 A;  2AKP A;  4E01 A;  1GKZ A;  2BYI A;  1YSZ A;  2YEG A;  2XK2 A;  4DUH A;  4BIU A;  4BQJ A;  1EI1 A;  3R4O A;  1H7S A;  3C0E A;  1UY9 A;  1TIL A;  1ZXN A;  2CGF A;  1U0Z A;  3TZ0 A;  2XDS A;  1I5C A;  2YKI A;  4O04 A;  2VW5 A;  3HHU A;  4YKW A;  3BM9 A;  1YSR A;  1BKN A;  1NHH A;  3G75 A;  4LWH A;  4YKR A;  2YKE A;  2QG2 A;  2XDU A;  1TID A;  3GIF A;  5IDM A;  3A0Y A;  2YKB A;  3EHF A;  1JM6 A;  4MP2 A;  2FXS A;  2O1W A;  2CG9 A;  4XC0 A;  4ASB A;  4EGH A;  2ZDY A;  3HEK A;  3CGZ A;  1R62 A;  3EHH A;  2FWY A;  4KSG A;  4JAU A;  3IED A;  1MU5 A;  3B25 A;  3HYY A;  2WER A;  4DZY A;  1PVG A;  2XHR A;  5CPH A;  2UWD A;  1TBW A;  3RKZ A;  1THN A;  3WHA A;  4O09 A;  1KZN A;  3ZKB A;  1Y8O A;  5M4E A;  3WQ9 A;  2YGA A;  3HYZ A;  2YE2 A;  2CCT A;  4E02 A;  2WI5 A;  3U2D A;  2IWX A;  4JAS A;  4URN A;  3O6O A;  4HYP A;  3EHJ A;  4CWR A;  1Y4S A;  3LNU A;  1UY7 A;  1KIJ A;  4HXZ A;  2YI5 A;  1Z5A A;  4URM A;  4XIP A;  4AS9 A;  4EMV A;  3EKR A;  2FYP A;  4LWF A;  2YED A;  5M4K A;  4I5S A;  4YKX A;  5FND A;  2CH4 A;  3VHA A;  4MPC A;  3VHD A;  2XD6 A;  4XTJ A;  3U67 A;  3K99 A;  3ZXQ A;  2WI2 A;  2XDK A;  4JQL A;  2HKJ A;  4JAV A;  1ID0 A;  2Q8G A;  4HZ5 A;  2WI6 A;  2Q8I A;  4XE2 A;  4URO A;  4XD8 A;  3R91 A;  1AH6 A;  1YC4 A;  1AMW A;  5F3K A;  4WUB A;  3QTF A;  3TZ5 A;  2XX4 A;  4L8Z A;  2QFO A;  1NHI A;  2YE8 A;  3PEH A;  3U2K A;  3D0B A;  4BXI A;  5C93 A;  2YE5 A;  2Q8F A;  3R92 A;  3A0T A;  4HY1 A;  1UY6 A;  4LWE A;  4PRX A;  2WI3 A;  4K4O A;  4XCL A;  2IOR A;  4HY6 A;  4CWP A;  2YEC A;  3G7E A;  4QPK A;  4ZKI A;  2Q8H A;  2BU8 A;  3B28 A;  4CE1 A;  1EA6 A;  3NMQ A;  5GGZ A;  3FT5 A;  2YEA A;  3H80 A;  3CRK A;  2BSM A;  2WEP A;  2YKC A;  4MPE A;  1YET A;  4O07 A;  5BOC A;  2XDX A;  4WUC A;  4XKO A;  2YEE A;  4MBC A;  4NH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...