3O2FA

Structure of the n-domain of grp94 bound to the hsp90 inhibitor pu-h54
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
232
structure length
228
Chain Sequence
LREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/inhibitor
molecule keywords Endoplasmin
publication title Paralog-selective Hsp90 inhibitors define tumor-specific regulation of HER2.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 70
structure length 228
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3o2fA00
2XDLA 1H7SA 2H8MA 4GT8A 3EHFA 3GIGB 3CWVA 3TUHA 2YKBA 4YKRA 5CF0A 5C93A 4JAVA 3VHDA 2PNRA 1KIJA 1PVGA 2O1VA 2WERA 5CTWA 5BODA 4O04A 4FCPA 1U0ZA 2YI5A 4CWQA 5CTYA 4U7OA 2YEBA 2YI7A 4XKKA 1EA6A 3U67A 5BOCA 4DZYA 3C11A 5D6PA 4GEEA 2BU6A 2IWXA 5J6AA 4R1FA 2CCTA 1I5DA 1I5AA 2XHRA 5FNDA 3T0ZA 1I59A 2YGFA 4XCLA 1UY6A 3B26A 4W7TA 1Y4SA 4YKWA 1YESA 4HXWA 4WUDA 3OMUA 2XJJA 4UROA 4LWIA 1YS3A 2BU7A 2XX4A 2BREA 4O0BA 4BIZA 4V25A 5M4KA 1ZW9A 2YE3A 3CGZA 1MX0A 3TZ5A 4E02A 4EGHA 1JM6A 3A0WA 3WQ9A 4I5SA 1UY7A 4PRVA 3TZ2A 1MU5A 4HYPA 3RLRA 1YSZA 3WHAA 3H80A 3EHGA 5M4MA 4FCRA 1NHHA 3NMQA 1UYGA 4NH7A 3VHAA 4P7AA 4LWHA 2YE6A 2FXSA 5D7CA 2Q2EB 2YKJA 1AJ6A 4MBCA 4L93A 2H55A 3R92A 1Y8OA 1I5CA 2XDXA 3ZKDA 4CE2A 1S14A 2FWZA 4ZKIA 3TTZA 2XDUA 5D7RA 3U2KA 2XJXA 3GIEA 3GIGA 4EEHA 1U2OA 4B7PA 2BU8A 4GFNA 4YKYA 5IDMA 3HYZA 4CWNA 5FNFA 2FWYA 5M4NA 2ZDYA 2ZDXA 3KE6A 3R4OA 3ZXQA 1UYKA 4MP2A 4EFTA 2FYPA 2Q8FA 1UY9A 2YEAA 1NHIA 2WI6A 4ASGA 1Y4UA 2YE5A 2CCSA 2WI5A 4YKQA 1YERA 2YE4A 2HKJA 5M4PA 2XABA 1I58A 2YK2A 2WI3A 4KQVA 3HZ1A 2XK2A 3R4NA 3U2DA 2WI4A 4EGIA 5F3KA 4BAEA 4CWRA 4R3MA 2YJXA 3T2SA 2IOPA 1Y8PA 1TILA 3RLPA 1UYFA 1BXDA 4XTJA 4CWTA 4KP4A 4KTNA 2WEPA 3FV5A 2JJCA 2IOQA 1Z5BA 3IEDA 4L91A 4CWPA 3EKOA 2ZBKB 4LWEA 2Q8HA 4AWQA 1YC4A 4LP0A 3LPSA 2YE9A 5L3JA 4FCQA 2YK9A 2YEJA 2BTZA 2XHTA 4ASBA 4CWOA 2XX2A 5CTXA 5FWKA 3ZM7A 4XIQA 2YEDA 4ASAA 1ID0A 2BSMA 2YEFA 3CGYA 2WI1A 3K60A 4XDMA 2YI6A 1UYDA 4CE1A 2HG1A 4YKTA 3HZ5A 2GQPA 2XX5A 3FT8A 4B6CA 4H7QA 1UYCA 1QYEA 4HXZA 2VW5A 4AS9A 3C0EA 1Z5CA 3R91A 2C2AA 4P8OA 4O09A 1AH6A 4K4OA 4E00A 2CH4A 4GQTA 2BYIA 3Q5LA 1AMWA 1US7A 4EFUA 2BZ5A 5GGZA 1UY8A 4H81A 2QFOA 4XIRA 4EM7A 3VHCA 1GKZA 3A0ZA 2Q8IA 1H7UA 3B24A 2BYHA 4KFGA 1UYHA 1UYIA 2VWCA 3OWBA 4HYMA 3EKRA 2QF6A 4DUHA 5CPHA 3T0HA 4R3AA 2O1UA 2YGEA 4JAUA 4HY6A 1UYLA 1THNA 2IWSA 5FNCA 1BYQA 1NHJA 4FPPA 4L94A 2YKCA 4URMA 2YEIA 2WEQA 2YE8A 3K97A 4WUCA 4WUBA 4MP7A 4E01A 3SL2A 2YE2A 4H85A 2XD6A 1TC0A 1GJVA 3A0RA 4GGLA 3RKZA 1OSFA 3PEJA 3O0IA 1R62A 3BMYA 4U7NA 1TIDA 2YEGA 3D0BA 2E0AA 3R4MA 2XHXA 3FT5A 3T1KA 3G7EA 3D2RA 3G75A 3K99A 4L8ZA 2YI0A 4BXIA 4ASFA 1YETA 3ZKBA 3R4PA 4MOTA 3O6OA 4YKUA 2BT0A 3O2FA 2CCUA 5M4HA 1S16A 2YECA 4EMVA 4XE2A 3JZ3A 2WI2A 4EGKA 4PU9A 3OWDA 1YT2A 2EXLA 4URLA 2CGFA 2VCJA 3INWA 3T10A 1YC1A 4LPBA 5F5RA 2O1WA 3G7BA 4YKZA 2BU2A 2CG9A 4KSHA 2BRCA 4BQJA 1Z59A 1TC6A 5IDJA 1BKNA 3CRLA 1A4HA 4MB9A 4O07A 4BQGA 4X9LA 2K5BA 1YC3A 1YT1A 3A0TA 4JASA 3PEHA 4XITA 4LWFA 4URNA 1ZWHA 3TZ0A 4ZVIA 3H4LA 1L0OA 1Z5AA 1B63A 4U93A 2IWUA 1BGQA 4L90A 3OPDA 3QTFA 1QY8A 2HCHA 5CTUA 2XDSA 3B27A 3Q5KA 2QG2A 3BM9A 2XJGA 4PL9A 3ZXOA 2YKEA 2WI7A 3INXA 4FMTA 4CE3A 2XDKA 2JKIA 3B28A 3EHJA 4I3HA 3K98A 2YEHA 4XKOA 4CWFA 1TBWA 4XD8A 3OW6A 4HZ0A 3EHHA 1KZNA 4XKAA 1ZXNA 4QPKA 3GIFA 4YKXA 3HYYA 1QZRA 3A0XA 4CWSA 2IORA 4HY1A 2Q8GA 1EI1A 5D7DA 2UWDA 4MPNA 3RLQA 3HHUA 2YKIA 3D36A 4XCJA 3A0YA 1UYMA 1YT0A 4KSGA 2GFDA 2ZKJA 5IN9A 3HEKA 2XCMA 4BIUA 2YE7A 4NH9A 1YSRA 4XIPA 4PRXA 1B3QA 2YEEA 4GCZA 1GKXA 4MPCA 2ESAA 4NH8A 2QG0A 4V26A 3QDDA 4HZ5A 3TZ4A 3CRKA 2AKPA 1AH8A 3DGEA 4MPEA 3LNUA 1UYEA 2YGAA 3VADA 1Y8NA 1B62A 1ZXMA 2BU5A 4O05A 4Q20A 5D6QA 5M4EA 2VCIA 4LWGA 4AWOA 2YJWA 1I5BA 4AWPA 1TH8A 3B25A 4QPJA 5J71A 3Q5JA 1AM1A 4JQLA 4XC0A 3MNRP
chains in the Genus database with same CATH superfamily
2XDLA 1H7SA 2H8MA 4GT8A 3EHFA 3GIGB 3CWVA 3TUHA 2YKBA 4YKRA 5CF0A 5C93A 4JAVA 3VHDA 2PNRA 1KIJA 1PVGA 2O1VA 2WERA 5CTWA 5BODA 4O04A 4FCPA 1U0ZA 2YI5A 4CWQA 5CTYA 4U7OA 2YEBA 2YI7A 4XKKA 1EA6A 3U67A 5BOCA 4DZYA 3C11A 5D6PA 4GEEA 2BU6A 2IWXA 5J6AA 4R1FA 2CCTA 1I5DA 1I5AA 2XHRA 5FNDA 3T0ZA 1I59A 2YGFA 4XCLA 1UY6A 3B26A 4W7TA 1Y4SA 4YKWA 1YESA 4HXWA 4WUDA 3OMUA 2XJJA 4UROA 4LWIA 1YS3A 2BU7A 2XX4A 2BREA 4O0BA 4BIZA 4V25A 5M4KA 1ZW9A 2YE3A 3CGZA 1MX0A 3TZ5A 4E02A 4EGHA 1JM6A 3A0WA 3WQ9A 4I5SA 1UY7A 4PRVA 3TZ2A 1MU5A 4HYPA 3RLRA 1YSZA 3WHAA 3H80A 3EHGA 5M4MA 4FCRA 1NHHA 3NMQA 1UYGA 4NH7A 3VHAA 4P7AA 4LWHA 2YE6A 2FXSA 5D7CA 2Q2EB 2YKJA 1AJ6A 4MBCA 4L93A 2H55A 3R92A 1Y8OA 1I5CA 2XDXA 3ZKDA 2HHIA 4CE2A 1S14A 2FWZA 4ZKIA 3TTZA 2XDUA 5D7RA 3U2KA 2XJXA 3GIEA 3GIGA 4EEHA 1U2OA 4B7PA 2BU8A 4GFNA 4YKYA 5IDMA 3HYZA 4CWNA 5FNFA 2FWYA 5M4NA 2ZDYA 2ZDXA 3KE6A 3R4OA 3ZXQA 1UYKA 4MP2A 4EFTA 2FYPA 2Q8FA 1UY9A 2YEAA 1NHIA 2WI6A 4ASGA 1Y4UA 2YE5A 2CCSA 2WI5A 4YKQA 1YERA 2YE4A 2HKJA 2C1GA 5M4PA 2XABA 1I58A 2YK2A 2WI3A 4KQVA 3HZ1A 2XK2A 3R4NA 3U2DA 2WI4A 4EGIA 5F3KA 4BAEA 4CWRA 4R3MA 2YJXA 3T2SA 2IOPA 3S5TA 1Y8PA 1TILA 3RLPA 1UYFA 1BXDA 4XTJA 4CWTA 4KP4A 4KTNA 2WEPA 3FV5A 2JJCA 2IOQA 1Z5BA 3IEDA 4L91A 4CWPA 3EKOA 2ZBKB 4LWEA 1F51A 2Q8HA 4AWQA 1YC4A 4LP0A 3LPSA 2YE9A 5L3JA 4FCQA 2YK9A 2YEJA 2BTZA 2XHTA 4ASBA 4CWOA 2XX2A 5CTXA 5FWKA 3ZM7A 4XIQA 2YEDA 4ASAA 1ID0A 2BSMA 2YEFA 3CGYA 2WI1A 3K60A 4E72A 4XDMA 2YI6A 1UYDA 4CE1A 2HG1A 4YKTA 3HZ5A 2GQPA 2XX5A 3FT8A 4B6CA 4H7QA 1UYCA 1QYEA 4HXZA 2VW5A 4AS9A 3C0EA 1Z5CA 3R91A 2C2AA 4P8OA 4O09A 1AH6A 4K4OA 4E00A 2CH4A 4GQTA 2BYIA 3Q5LA 1AMWA 1US7A 4EFUA 2BZ5A 5GGZA 1UY8A 4H81A 2QFOA 4XIRA 4EM7A 3VHCA 1GKZA 3A0ZA 2Q8IA 1H7UA 3B24A 2BYHA 4KFGA 1UYHA 1UYIA 2VWCA 3OWBA 4HYMA 3EKRA 2QF6A 4DUHA 5CPHA 3T0HA 4R3AA 2O1UA 2YGEA 4JAUA 4HY6A 1UYLA 1THNA 2IWSA 5FNCA 1BYQA 1NHJA 4FPPA 4L94A 2YKCA 4URMA 2YEIA 2WEQA 2YE8A 3K97A 4WUCA 4WUBA 4MP7A 4E01A 3SL2A 2YE2A 4H85A 2XD6A 1TC0A 1GJVA 3A0RA 4GGLA 3RKZA 1OSFA 3PEJA 3O0IA 1R62A 3BMYA 4U7NA 1TIDA 2YEGA 3D0BA 2E0AA 3R4MA 2XHXA 3FT5A 3T1KA 3G7EA 3D2RA 3G75A 3K99A 4L8ZA 2YI0A 4BXIA 4ASFA 1YETA 3ZKBA 3R4PA 4MOTA 3O6OA 4YKUA 2BT0A 3O2FA 2CCUA 5M4HA 1S16A 2YECA 4EMVA 3LMMA 4XE2A 3JZ3A 2WI2A 5JENA 4EGKA 4PU9A 3OWDA 1YT2A 2EXLA 4URLA 2CGFA 2VCJA 3INWA 3T10A 1YC1A 4LPBA 5F5RA 2O1WA 3CYGA 3G7BA 4YKZA 2BU2A 2CG9A 4KSHA 2BRCA 4BQJA 1Z59A 1TC6A 5IDJA 1BKNA 3CRLA 1A4HA 4MB9A 4O07A 4BQGA 4X9LA 2K5BA 1YC3A 1YT1A 3A0TA 4JASA 3PEHA 4XITA 4LWFA 4URNA 1ZWHA 3TZ0A 4ZVIA 3H4LA 1L0OA 1Z5AA 1B63A 4U93A 2IWUA 1BGQA 4L90A 3OPDA 3QTFA 1QY8A 2HCHA 5CTUA 2XDSA 3B27A 3Q5KA 2QG2A 3BM9A 2XJGA 4PL9A 3ZXOA 2YKEA 2WI7A 3INXA 4FMTA 4CE3A 2XDKA 2JKIA 3B28A 3EHJA 4I3HA 3K98A 2YEHA 4XKOA 4CWFA 1TBWA 4XD8A 3OW6A 4HZ0A 3EHHA 1KZNA 4XKAA 1ZXNA 4QPKA 3GIFA 4YKXA 3HYYA 1QZRA 3A0XA 4CWSA 2IORA 4HY1A 2Q8GA 1EI1A 5D7DA 2UWDA 4MPNA 3RLQA 2FTKA 2YKIA 3HHUA 3D36A 4XCJA 3A0YA 1UYMA 1YT0A 4KSGA 2GFDA 2ZKJA 5IN9A 3HEKA 2XCMA 4BIUA 2YE7A 4NH9A 1YSRA 4XIPA 4PRXA 1B3QA 2YEEA 4GCZA 1GKXA 4MPCA 2C1IA 2ESAA 4NH8A 2QG0A 4V26A 3QDDA 4HZ5A 3TZ4A 3CRKA 2AKPA 1AH8A 3DGEA 4MPEA 3LNUA 1UYEA 1IXMA 2YGAA 3VADA 1Y8NA 1B62A 1ZXMA 2BU5A 4O05A 4Q20A 5D6QA 5M4EA 2VCIA 4LWGA 4AWOA 2YJWA 1I5BA 4AWPA 1TH8A 3B25A 4QPJA 5J71A 3Q5JA 1AM1A 4JQLA 4XC0A 3MNRP
chains in the Genus database with same CATH topology
2XDLA 1H7SA 2H8MA 4GT8A 3EHFA 3GIGB 3CWVA 3TUHA 2YKBA 4YKRA 5CF0A 5C93A 4JAVA 3VHDA 2PNRA 1KIJA 1PVGA 2O1VA 2WERA 5CTWA 5BODA 4O04A 4FCPA 1U0ZA 2YI5A 4CWQA 5CTYA 4U7OA 2YEBA 2YI7A 4XKKA 1EA6A 3U67A 5BOCA 4DZYA 3C11A 5D6PA 4GEEA 2BU6A 2IWXA 5J6AA 4R1FA 2CCTA 1I5DA 1I5AA 2XHRA 5FNDA 3T0ZA 1I59A 2YGFA 4XCLA 1UY6A 3B26A 4W7TA 1Y4SA 4YKWA 1YESA 4HXWA 4WUDA 3OMUA 2XJJA 4UROA 4LWIA 1YS3A 2BU7A 2XX4A 2BREA 4O0BA 4BIZA 4V25A 5M4KA 1ZW9A 2YE3A 3CGZA 1MX0A 3TZ5A 4E02A 4EGHA 1JM6A 3A0WA 3WQ9A 4I5SA 1UY7A 4PRVA 3TZ2A 1MU5A 4HYPA 3RLRA 1YSZA 3WHAA 3H80A 3EHGA 5M4MA 4FCRA 1NHHA 3NMQA 1UYGA 4NH7A 3VHAA 4P7AA 4LWHA 2YE6A 2FXSA 5D7CA 2Q2EB 2YKJA 1AJ6A 4MBCA 4L93A 2H55A 3R92A 1Y8OA 1I5CA 2XDXA 3ZKDA 4CE2A 1S14A 2FWZA 4ZKIA 3TTZA 2XDUA 5D7RA 3U2KA 2XJXA 3GIEA 3GIGA 4EEHA 1U2OA 4B7PA 2BU8A 4GFNA 4YKYA 5IDMA 3HYZA 4CWNA 5FNFA 2FWYA 5M4NA 2ZDYA 2ZDXA 3KE6A 3R4OA 3ZXQA 1UYKA 4MP2A 4EFTA 2FYPA 2Q8FA 1UY9A 2YEAA 1NHIA 2WI6A 4ASGA 1Y4UA 2YE5A 2CCSA 2WI5A 4YKQA 1YERA 2YE4A 2HKJA 5M4PA 2XABA 1I58A 2YK2A 2WI3A 4KQVA 3HZ1A 2XK2A 3R4NA 3U2DA 2WI4A 4EGIA 5F3KA 4BAEA 4CWRA 4R3MA 2YJXA 3T2SA 2IOPA 1Y8PA 1TILA 3RLPA 1UYFA 1BXDA 4XTJA 4CWTA 4KP4A 4KTNA 2WEPA 3FV5A 2JJCA 2IOQA 1Z5BA 3IEDA 4L91A 4CWPA 3EKOA 2ZBKB 4LWEA 2Q8HA 4AWQA 1YC4A 4LP0A 3LPSA 2YE9A 5L3JA 4FCQA 2YK9A 2YEJA 2BTZA 2XHTA 4ASBA 4CWOA 2XX2A 5CTXA 5FWKA 3ZM7A 4XIQA 2YEDA 4ASAA 1ID0A 2BSMA 2YEFA 3CGYA 2WI1A 3K60A 4XDMA 2YI6A 1UYDA 4CE1A 2HG1A 4YKTA 3HZ5A 2GQPA 2XX5A 3FT8A 4B6CA 4H7QA 1UYCA 1QYEA 4HXZA 2VW5A 4AS9A 3C0EA 1Z5CA 3R91A 2C2AA 4P8OA 4O09A 1AH6A 4K4OA 4E00A 2CH4A 4GQTA 2BYIA 3Q5LA 1AMWA 1US7A 4EFUA 2BZ5A 5GGZA 1UY8A 4H81A 2QFOA 4XIRA 4EM7A 3VHCA 1GKZA 3A0ZA 2Q8IA 1H7UA 3B24A 2BYHA 4KFGA 1UYHA 1UYIA 2VWCA 3OWBA 4HYMA 3EKRA 2QF6A 4DUHA 5CPHA 3T0HA 4R3AA 2O1UA 2YGEA 4JAUA 4HY6A 1UYLA 1THNA 2IWSA 5FNCA 1BYQA 1NHJA 4FPPA 4L94A 2YKCA 4URMA 2YEIA 2WEQA 2YE8A 3K97A 4WUCA 4WUBA 4MP7A 4E01A 3SL2A 2YE2A 4H85A 2XD6A 1TC0A 1GJVA 3A0RA 4GGLA 3RKZA 1OSFA 3PEJA 3O0IA 1R62A 3BMYA 4U7NA 1TIDA 2YEGA 3D0BA 2E0AA 3R4MA 2XHXA 3FT5A 3T1KA 3G7EA 3D2RA 3G75A 3K99A 4L8ZA 2YI0A 4BXIA 4ASFA 1YETA 3ZKBA 3R4PA 4MOTA 3O6OA 4YKUA 2BT0A 3O2FA 2CCUA 5M4HA 1S16A 2YECA 4EMVA 4XE2A 3JZ3A 2WI2A 4EGKA 4PU9A 3OWDA 1YT2A 2EXLA 4URLA 2CGFA 2VCJA 3INWA 3T10A 1YC1A 4LPBA 5F5RA 2O1WA 3G7BA 4YKZA 2BU2A 2CG9A 4KSHA 2BRCA 4BQJA 1Z59A 1TC6A 5IDJA 1BKNA 3CRLA 1A4HA 4MB9A 4O07A 4BQGA 4X9LA 2K5BA 1YC3A 1YT1A 3A0TA 4JASA 3PEHA 4XITA 4LWFA 4URNA 1ZWHA 3TZ0A 4ZVIA 3H4LA 1L0OA 1Z5AA 1B63A 4U93A 2IWUA 1BGQA 4L90A 3OPDA 3QTFA 1QY8A 2HCHA 5CTUA 2XDSA 3B27A 3Q5KA 2QG2A 3BM9A 2XJGA 4PL9A 3ZXOA 2YKEA 2WI7A 3INXA 4FMTA 4CE3A 2XDKA 2JKIA 3B28A 3EHJA 4I3HA 3K98A 2YEHA 4XKOA 4CWFA 1TBWA 4XD8A 3OW6A 4HZ0A 3EHHA 1KZNA 4XKAA 1ZXNA 4QPKA 3GIFA 4YKXA 3HYYA 1QZRA 3A0XA 4CWSA 2IORA 4HY1A 2Q8GA 1EI1A 5D7DA 2UWDA 4MPNA 3RLQA 3HHUA 2YKIA 3D36A 4XCJA 3A0YA 1UYMA 1YT0A 4KSGA 2GFDA 2ZKJA 5IN9A 3HEKA 2XCMA 4BIUA 2YE7A 4NH9A 1YSRA 4XIPA 4PRXA 1B3QA 2YEEA 4GCZA 1GKXA 4MPCA 2ESAA 4NH8A 2QG0A 4V26A 3QDDA 4HZ5A 3TZ4A 3CRKA 2AKPA 1AH8A 3DGEA 4MPEA 3LNUA 1UYEA 2YGAA 3VADA 1Y8NA 1B62A 1ZXMA 2BU5A 4O05A 4Q20A 5D6QA 5M4EA 2VCIA 4LWGA 4AWOA 2YJWA 1I5BA 4AWPA 1TH8A 3B25A 4QPJA 5J71A 3Q5JA 1AM1A 4JQLA 4XC0A 3MNRP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDL A;  1H7S A;  2H8M A;  4GT8 A;  3EHF A;  3GIG B;  3CWV A;  3TUH A;  2YKB A;  4YKR A;  5CF0 A;  5C93 A;  4JAV A;  3VHD A;  2PNR A;  1KIJ A;  1PVG A;  2O1V A;  2WER A;  5CTW A;  5BOD A;  4O04 A;  4FCP A;  1U0Z A;  2YI5 A;  4CWQ A;  5CTY A;  4U7O A;  2YEB A;  2YI7 A;  4XKK A;  1EA6 A;  3U67 A;  5BOC A;  4DZY A;  3C11 A;  5D6P A;  4GEE A;  2BU6 A;  2IWX A;  5J6A A;  4R1F A;  2CCT A;  1I5D A;  1I5A A;  2XHR A;  5FND A;  3T0Z A;  1I59 A;  2YGF A;  4XCL A;  1UY6 A;  3B26 A;  4W7T A;  1Y4S A;  4YKW A;  1YES A;  4HXW A;  4WUD A;  3OMU A;  2XJJ A;  4URO A;  4LWI A;  1YS3 A;  2BU7 A;  2XX4 A;  2BRE A;  4O0B A;  4BIZ A;  4V25 A;  5M4K A;  1ZW9 A;  2YE3 A;  3CGZ A;  1MX0 A;  3TZ5 A;  4E02 A;  4EGH A;  1JM6 A;  3A0W A;  3WQ9 A;  4I5S A;  1UY7 A;  4PRV A;  3TZ2 A;  1MU5 A;  4HYP A;  3RLR A;  1YSZ A;  3WHA A;  3H80 A;  3EHG A;  5M4M A;  4FCR A;  1NHH A;  3NMQ A;  1UYG A;  4NH7 A;  3VHA A;  4P7A A;  4LWH A;  2YE6 A;  2FXS A;  5D7C A;  2Q2E B;  2YKJ A;  1AJ6 A;  4MBC A;  4L93 A;  2H55 A;  3R92 A;  1Y8O A;  1I5C A;  2XDX A;  3ZKD A;  4CE2 A;  1S14 A;  2FWZ A;  4ZKI A;  3TTZ A;  2XDU A;  5D7R A;  3U2K A;  2XJX A;  3GIE A;  3GIG A;  4EEH A;  1U2O A;  4B7P A;  2BU8 A;  4GFN A;  4YKY A;  5IDM A;  3HYZ A;  4CWN A;  5FNF A;  2FWY A;  5M4N A;  2ZDY A;  2ZDX A;  3KE6 A;  3R4O A;  3ZXQ A;  1UYK A;  4MP2 A;  4EFT A;  2FYP A;  2Q8F A;  1UY9 A;  2YEA A;  1NHI A;  2WI6 A;  4ASG A;  1Y4U A;  2YE5 A;  2CCS A;  2WI5 A;  4YKQ A;  1YER A;  2YE4 A;  2HKJ A;  5M4P A;  2XAB A;  1I58 A;  2YK2 A;  2WI3 A;  4KQV A;  3HZ1 A;  2XK2 A;  3R4N A;  3U2D A;  2WI4 A;  4EGI A;  5F3K A;  4BAE A;  4CWR A;  4R3M A;  2YJX A;  3T2S A;  2IOP A;  1Y8P A;  1TIL A;  3RLP A;  1UYF A;  1BXD A;  4XTJ A;  4CWT A;  4KP4 A;  4KTN A;  2WEP A;  3FV5 A;  2JJC A;  2IOQ A;  1Z5B A;  3IED A;  4L91 A;  4CWP A;  3EKO A;  2ZBK B;  4LWE A;  2Q8H A;  4AWQ A;  1YC4 A;  4LP0 A;  3LPS A;  2YE9 A;  5L3J A;  4FCQ A;  2YK9 A;  2YEJ A;  2BTZ A;  2XHT A;  4ASB A;  4CWO A;  2XX2 A;  5CTX A;  5FWK A;  3ZM7 A;  4XIQ A;  2YED A;  4ASA A;  1ID0 A;  2BSM A;  2YEF A;  3CGY A;  2WI1 A;  3K60 A;  4XDM A;  2YI6 A;  1UYD A;  4CE1 A;  2HG1 A;  4YKT A;  3HZ5 A;  2GQP A;  2XX5 A;  3FT8 A;  4B6C A;  4H7Q A;  1UYC A;  1QYE A;  4HXZ A;  2VW5 A;  4AS9 A;  3C0E A;  1Z5C A;  3R91 A;  2C2A A;  4P8O A;  4O09 A;  1AH6 A;  4K4O A;  4E00 A;  2CH4 A;  4GQT A;  2BYI A;  3Q5L A;  1AMW A;  1US7 A;  4EFU A;  2BZ5 A;  5GGZ A;  1UY8 A;  4H81 A;  2QFO A;  4XIR A;  4EM7 A;  3VHC A;  1GKZ A;  3A0Z A;  2Q8I A;  1H7U A;  3B24 A;  2BYH A;  4KFG A;  1UYH A;  1UYI A;  2VWC A;  3OWB A;  4HYM A;  3EKR A;  2QF6 A;  4DUH A;  5CPH A;  3T0H A;  4R3A A;  2O1U A;  2YGE A;  4JAU A;  4HY6 A;  1UYL A;  1THN A;  2IWS A;  5FNC A;  1BYQ A;  1NHJ A;  4FPP A;  4L94 A;  2YKC A;  4URM A;  2YEI A;  2WEQ A;  2YE8 A;  3K97 A;  4WUC A;  4WUB A;  4MP7 A;  4E01 A;  3SL2 A;  2YE2 A;  4H85 A;  2XD6 A;  1TC0 A;  1GJV A;  3A0R A;  4GGL A;  3RKZ A;  1OSF A;  3PEJ A;  3O0I A;  1R62 A;  3BMY A;  4U7N A;  1TID A;  2YEG A;  3D0B A;  2E0A A;  3R4M A;  2XHX A;  3FT5 A;  3T1K A;  3G7E A;  3D2R A;  3G75 A;  3K99 A;  4L8Z A;  2YI0 A;  4BXI A;  4ASF A;  1YET A;  3ZKB A;  3R4P A;  4MOT A;  3O6O A;  4YKU A;  2BT0 A;  3O2F A;  2CCU A;  5M4H A;  1S16 A;  2YEC A;  4EMV A;  4XE2 A;  3JZ3 A;  2WI2 A;  4EGK A;  4PU9 A;  3OWD A;  1YT2 A;  2EXL A;  4URL A;  2CGF A;  2VCJ A;  3INW A;  3T10 A;  1YC1 A;  4LPB A;  5F5R A;  2O1W A;  3G7B A;  4YKZ A;  2BU2 A;  2CG9 A;  4KSH A;  2BRC A;  4BQJ A;  1Z59 A;  1TC6 A;  5IDJ A;  1BKN A;  3CRL A;  1A4H A;  4MB9 A;  4O07 A;  4BQG A;  4X9L A;  2K5B A;  1YC3 A;  1YT1 A;  3A0T A;  4JAS A;  3PEH A;  4XIT A;  4LWF A;  4URN A;  1ZWH A;  3TZ0 A;  4ZVI A;  3H4L A;  1L0O A;  1Z5A A;  1B63 A;  4U93 A;  2IWU A;  1BGQ A;  4L90 A;  3OPD A;  3QTF A;  1QY8 A;  2HCH A;  5CTU A;  2XDS A;  3B27 A;  3Q5K A;  2QG2 A;  3BM9 A;  2XJG A;  4PL9 A;  3ZXO A;  2YKE A;  2WI7 A;  3INX A;  4FMT A;  4CE3 A;  2XDK A;  2JKI A;  3B28 A;  3EHJ A;  4I3H A;  3K98 A;  2YEH A;  4XKO A;  4CWF A;  1TBW A;  4XD8 A;  3OW6 A;  4HZ0 A;  3EHH A;  1KZN A;  4XKA A;  1ZXN A;  4QPK A;  3GIF A;  4YKX A;  3HYY A;  1QZR A;  3A0X A;  4CWS A;  2IOR A;  4HY1 A;  2Q8G A;  1EI1 A;  5D7D A;  2UWD A;  4MPN A;  3RLQ A;  3HHU A;  2YKI A;  3D36 A;  4XCJ A;  3A0Y A;  1UYM A;  1YT0 A;  4KSG A;  2GFD A;  2ZKJ A;  5IN9 A;  3HEK A;  2XCM A;  4BIU A;  2YE7 A;  4NH9 A;  1YSR A;  4XIP A;  4PRX A;  1B3Q A;  2YEE A;  4GCZ A;  1GKX A;  4MPC A;  2ESA A;  4NH8 A;  2QG0 A;  4V26 A;  3QDD A;  4HZ5 A;  3TZ4 A;  3CRK A;  2AKP A;  1AH8 A;  3DGE A;  4MPE A;  3LNU A;  1UYE A;  2YGA A;  3VAD A;  1Y8N A;  1B62 A;  1ZXM A;  2BU5 A;  4O05 A;  4Q20 A;  5D6Q A;  5M4E A;  2VCI A;  4LWG A;  4AWO A;  2YJW A;  1I5B A;  4AWP A;  1TH8 A;  3B25 A;  4QPJ A;  5J71 A;  3Q5J A;  1AM1 A;  4JQL A;  4XC0 A;  3MNR P; 
#chains in the Genus database with same CATH topology
 2XDL A;  1H7S A;  2H8M A;  4GT8 A;  3EHF A;  3GIG B;  3CWV A;  3TUH A;  2YKB A;  4YKR A;  5CF0 A;  5C93 A;  4JAV A;  3VHD A;  2PNR A;  1KIJ A;  1PVG A;  2O1V A;  2WER A;  5CTW A;  5BOD A;  4O04 A;  4FCP A;  1U0Z A;  2YI5 A;  4CWQ A;  5CTY A;  4U7O A;  2YEB A;  2YI7 A;  4XKK A;  1EA6 A;  3U67 A;  5BOC A;  4DZY A;  3C11 A;  5D6P A;  4GEE A;  2BU6 A;  2IWX A;  5J6A A;  4R1F A;  2CCT A;  1I5D A;  1I5A A;  2XHR A;  5FND A;  3T0Z A;  1I59 A;  2YGF A;  4XCL A;  1UY6 A;  3B26 A;  4W7T A;  1Y4S A;  4YKW A;  1YES A;  4HXW A;  4WUD A;  3OMU A;  2XJJ A;  4URO A;  4LWI A;  1YS3 A;  2BU7 A;  2XX4 A;  2BRE A;  4O0B A;  4BIZ A;  4V25 A;  5M4K A;  1ZW9 A;  2YE3 A;  3CGZ A;  1MX0 A;  3TZ5 A;  4E02 A;  4EGH A;  1JM6 A;  3A0W A;  3WQ9 A;  4I5S A;  1UY7 A;  4PRV A;  3TZ2 A;  1MU5 A;  4HYP A;  3RLR A;  1YSZ A;  3WHA A;  3H80 A;  3EHG A;  5M4M A;  4FCR A;  1NHH A;  3NMQ A;  1UYG A;  4NH7 A;  3VHA A;  4P7A A;  4LWH A;  2YE6 A;  2FXS A;  5D7C A;  2Q2E B;  2YKJ A;  1AJ6 A;  4MBC A;  4L93 A;  2H55 A;  3R92 A;  1Y8O A;  1I5C A;  2XDX A;  3ZKD A;  2HHI A;  4CE2 A;  1S14 A;  2FWZ A;  4ZKI A;  3TTZ A;  2XDU A;  5D7R A;  3U2K A;  2XJX A;  3GIE A;  3GIG A;  4EEH A;  1U2O A;  4B7P A;  2BU8 A;  4GFN A;  4YKY A;  5IDM A;  3HYZ A;  4CWN A;  5FNF A;  2FWY A;  5M4N A;  2ZDY A;  2ZDX A;  3KE6 A;  3R4O A;  3ZXQ A;  1UYK A;  4MP2 A;  4EFT A;  2FYP A;  2Q8F A;  1UY9 A;  2YEA A;  1NHI A;  2WI6 A;  4ASG A;  1Y4U A;  2YE5 A;  2CCS A;  2WI5 A;  4YKQ A;  1YER A;  2YE4 A;  2HKJ A;  2C1G A;  5M4P A;  2XAB A;  1I58 A;  2YK2 A;  2WI3 A;  4KQV A;  3HZ1 A;  2XK2 A;  3R4N A;  3U2D A;  2WI4 A;  4EGI A;  5F3K A;  4BAE A;  4CWR A;  4R3M A;  2YJX A;  3T2S A;  2IOP A;  3S5T A;  1Y8P A;  1TIL A;  3RLP A;  1UYF A;  1BXD A;  4XTJ A;  4CWT A;  4KP4 A;  4KTN A;  2WEP A;  3FV5 A;  2JJC A;  2IOQ A;  1Z5B A;  3IED A;  4L91 A;  4CWP A;  3EKO A;  2ZBK B;  4LWE A;  1F51 A;  2Q8H A;  4AWQ A;  1YC4 A;  4LP0 A;  3LPS A;  2YE9 A;  5L3J A;  4FCQ A;  2YK9 A;  2YEJ A;  2BTZ A;  2XHT A;  4ASB A;  4CWO A;  2XX2 A;  5CTX A;  5FWK A;  3ZM7 A;  4XIQ A;  2YED A;  4ASA A;  1ID0 A;  2BSM A;  2YEF A;  3CGY A;  2WI1 A;  3K60 A;  4E72 A;  4XDM A;  2YI6 A;  1UYD A;  4CE1 A;  2HG1 A;  4YKT A;  3HZ5 A;  2GQP A;  2XX5 A;  3FT8 A;  4B6C A;  4H7Q A;  1UYC A;  1QYE A;  4HXZ A;  2VW5 A;  4AS9 A;  3C0E A;  1Z5C A;  3R91 A;  2C2A A;  4P8O A;  4O09 A;  1AH6 A;  4K4O A;  4E00 A;  2CH4 A;  4GQT A;  2BYI A;  3Q5L A;  1AMW A;  1US7 A;  4EFU A;  2BZ5 A;  5GGZ A;  1UY8 A;  4H81 A;  2QFO A;  4XIR A;  4EM7 A;  3VHC A;  1GKZ A;  3A0Z A;  2Q8I A;  1H7U A;  3B24 A;  2BYH A;  4KFG A;  1UYH A;  1UYI A;  2VWC A;  3OWB A;  4HYM A;  3EKR A;  2QF6 A;  4DUH A;  5CPH A;  3T0H A;  4R3A A;  2O1U A;  2YGE A;  4JAU A;  4HY6 A;  1UYL A;  1THN A;  2IWS A;  5FNC A;  1BYQ A;  1NHJ A;  4FPP A;  4L94 A;  2YKC A;  4URM A;  2YEI A;  2WEQ A;  2YE8 A;  3K97 A;  4WUC A;  4WUB A;  4MP7 A;  4E01 A;  3SL2 A;  2YE2 A;  4H85 A;  2XD6 A;  1TC0 A;  1GJV A;  3A0R A;  4GGL A;  3RKZ A;  1OSF A;  3PEJ A;  3O0I A;  1R62 A;  3BMY A;  4U7N A;  1TID A;  2YEG A;  3D0B A;  2E0A A;  3R4M A;  2XHX A;  3FT5 A;  3T1K A;  3G7E A;  3D2R A;  3G75 A;  3K99 A;  4L8Z A;  2YI0 A;  4BXI A;  4ASF A;  1YET A;  3ZKB A;  3R4P A;  4MOT A;  3O6O A;  4YKU A;  2BT0 A;  3O2F A;  2CCU A;  5M4H A;  1S16 A;  2YEC A;  4EMV A;  3LMM A;  4XE2 A;  3JZ3 A;  2WI2 A;  5JEN A;  4EGK A;  4PU9 A;  3OWD A;  1YT2 A;  2EXL A;  4URL A;  2CGF A;  2VCJ A;  3INW A;  3T10 A;  1YC1 A;  4LPB A;  5F5R A;  2O1W A;  3CYG A;  3G7B A;  4YKZ A;  2BU2 A;  2CG9 A;  4KSH A;  2BRC A;  4BQJ A;  1Z59 A;  1TC6 A;  5IDJ A;  1BKN A;  3CRL A;  1A4H A;  4MB9 A;  4O07 A;  4BQG A;  4X9L A;  2K5B A;  1YC3 A;  1YT1 A;  3A0T A;  4JAS A;  3PEH A;  4XIT A;  4LWF A;  4URN A;  1ZWH A;  3TZ0 A;  4ZVI A;  3H4L A;  1L0O A;  1Z5A A;  1B63 A;  4U93 A;  2IWU A;  1BGQ A;  4L90 A;  3OPD A;  3QTF A;  1QY8 A;  2HCH A;  5CTU A;  2XDS A;  3B27 A;  3Q5K A;  2QG2 A;  3BM9 A;  2XJG A;  4PL9 A;  3ZXO A;  2YKE A;  2WI7 A;  3INX A;  4FMT A;  4CE3 A;  2XDK A;  2JKI A;  3B28 A;  3EHJ A;  4I3H A;  3K98 A;  2YEH A;  4XKO A;  4CWF A;  1TBW A;  4XD8 A;  3OW6 A;  4HZ0 A;  3EHH A;  1KZN A;  4XKA A;  1ZXN A;  4QPK A;  3GIF A;  4YKX A;  3HYY A;  1QZR A;  3A0X A;  4CWS A;  2IOR A;  4HY1 A;  2Q8G A;  1EI1 A;  5D7D A;  2UWD A;  4MPN A;  3RLQ A;  2FTK A;  2YKI A;  3HHU A;  3D36 A;  4XCJ A;  3A0Y A;  1UYM A;  1YT0 A;  4KSG A;  2GFD A;  2ZKJ A;  5IN9 A;  3HEK A;  2XCM A;  4BIU A;  2YE7 A;  4NH9 A;  1YSR A;  4XIP A;  4PRX A;  1B3Q A;  2YEE A;  4GCZ A;  1GKX A;  4MPC A;  2C1I A;  2ESA A;  4NH8 A;  2QG0 A;  4V26 A;  3QDD A;  4HZ5 A;  3TZ4 A;  3CRK A;  2AKP A;  1AH8 A;  3DGE A;  4MPE A;  3LNU A;  1UYE A;  1IXM A;  2YGA A;  3VAD A;  1Y8N A;  1B62 A;  1ZXM A;  2BU5 A;  4O05 A;  4Q20 A;  5D6Q A;  5M4E A;  2VCI A;  4LWG A;  4AWO A;  2YJW A;  1I5B A;  4AWP A;  1TH8 A;  3B25 A;  4QPJ A;  5J71 A;  3Q5J A;  1AM1 A;  4JQL A;  4XC0 A;  3MNR P; 
#chains in the Genus database with same CATH homology
 2XDL A;  1H7S A;  2H8M A;  4GT8 A;  3EHF A;  3GIG B;  3CWV A;  3TUH A;  2YKB A;  4YKR A;  5CF0 A;  5C93 A;  4JAV A;  3VHD A;  2PNR A;  1KIJ A;  1PVG A;  2O1V A;  2WER A;  5CTW A;  5BOD A;  4O04 A;  4FCP A;  1U0Z A;  2YI5 A;  4CWQ A;  5CTY A;  4U7O A;  2YEB A;  2YI7 A;  4XKK A;  1EA6 A;  3U67 A;  5BOC A;  4DZY A;  3C11 A;  5D6P A;  4GEE A;  2BU6 A;  2IWX A;  5J6A A;  4R1F A;  2CCT A;  1I5D A;  1I5A A;  2XHR A;  5FND A;  3T0Z A;  1I59 A;  2YGF A;  4XCL A;  1UY6 A;  3B26 A;  4W7T A;  1Y4S A;  4YKW A;  1YES A;  4HXW A;  4WUD A;  3OMU A;  2XJJ A;  4URO A;  4LWI A;  1YS3 A;  2BU7 A;  2XX4 A;  2BRE A;  4O0B A;  4BIZ A;  4V25 A;  5M4K A;  1ZW9 A;  2YE3 A;  3CGZ A;  1MX0 A;  3TZ5 A;  4E02 A;  4EGH A;  1JM6 A;  3A0W A;  3WQ9 A;  4I5S A;  1UY7 A;  4PRV A;  3TZ2 A;  1MU5 A;  4HYP A;  3RLR A;  1YSZ A;  3WHA A;  3H80 A;  3EHG A;  5M4M A;  4FCR A;  1NHH A;  3NMQ A;  1UYG A;  4NH7 A;  3VHA A;  4P7A A;  4LWH A;  2YE6 A;  2FXS A;  5D7C A;  2Q2E B;  2YKJ A;  1AJ6 A;  4MBC A;  4L93 A;  2H55 A;  3R92 A;  1Y8O A;  1I5C A;  2XDX A;  3ZKD A;  4CE2 A;  1S14 A;  2FWZ A;  4ZKI A;  3TTZ A;  2XDU A;  5D7R A;  3U2K A;  2XJX A;  3GIE A;  3GIG A;  4EEH A;  1U2O A;  4B7P A;  2BU8 A;  4GFN A;  4YKY A;  5IDM A;  3HYZ A;  4CWN A;  5FNF A;  2FWY A;  5M4N A;  2ZDY A;  2ZDX A;  3KE6 A;  3R4O A;  3ZXQ A;  1UYK A;  4MP2 A;  4EFT A;  2FYP A;  2Q8F A;  1UY9 A;  2YEA A;  1NHI A;  2WI6 A;  4ASG A;  1Y4U A;  2YE5 A;  2CCS A;  2WI5 A;  4YKQ A;  1YER A;  2YE4 A;  2HKJ A;  5M4P A;  2XAB A;  1I58 A;  2YK2 A;  2WI3 A;  4KQV A;  3HZ1 A;  2XK2 A;  3R4N A;  3U2D A;  2WI4 A;  4EGI A;  5F3K A;  4BAE A;  4CWR A;  4R3M A;  2YJX A;  3T2S A;  2IOP A;  1Y8P A;  1TIL A;  3RLP A;  1UYF A;  1BXD A;  4XTJ A;  4CWT A;  4KP4 A;  4KTN A;  2WEP A;  3FV5 A;  2JJC A;  2IOQ A;  1Z5B A;  3IED A;  4L91 A;  4CWP A;  3EKO A;  2ZBK B;  4LWE A;  2Q8H A;  4AWQ A;  1YC4 A;  4LP0 A;  3LPS A;  2YE9 A;  5L3J A;  4FCQ A;  2YK9 A;  2YEJ A;  2BTZ A;  2XHT A;  4ASB A;  4CWO A;  2XX2 A;  5CTX A;  5FWK A;  3ZM7 A;  4XIQ A;  2YED A;  4ASA A;  1ID0 A;  2BSM A;  2YEF A;  3CGY A;  2WI1 A;  3K60 A;  4XDM A;  2YI6 A;  1UYD A;  4CE1 A;  2HG1 A;  4YKT A;  3HZ5 A;  2GQP A;  2XX5 A;  3FT8 A;  4B6C A;  4H7Q A;  1UYC A;  1QYE A;  4HXZ A;  2VW5 A;  4AS9 A;  3C0E A;  1Z5C A;  3R91 A;  2C2A A;  4P8O A;  4O09 A;  1AH6 A;  4K4O A;  4E00 A;  2CH4 A;  4GQT A;  2BYI A;  3Q5L A;  1AMW A;  1US7 A;  4EFU A;  2BZ5 A;  5GGZ A;  1UY8 A;  4H81 A;  2QFO A;  4XIR A;  4EM7 A;  3VHC A;  1GKZ A;  3A0Z A;  2Q8I A;  1H7U A;  3B24 A;  2BYH A;  4KFG A;  1UYH A;  1UYI A;  2VWC A;  3OWB A;  4HYM A;  3EKR A;  2QF6 A;  4DUH A;  5CPH A;  3T0H A;  4R3A A;  2O1U A;  2YGE A;  4JAU A;  4HY6 A;  1UYL A;  1THN A;  2IWS A;  5FNC A;  1BYQ A;  1NHJ A;  4FPP A;  4L94 A;  2YKC A;  4URM A;  2YEI A;  2WEQ A;  2YE8 A;  3K97 A;  4WUC A;  4WUB A;  4MP7 A;  4E01 A;  3SL2 A;  2YE2 A;  4H85 A;  2XD6 A;  1TC0 A;  1GJV A;  3A0R A;  4GGL A;  3RKZ A;  1OSF A;  3PEJ A;  3O0I A;  1R62 A;  3BMY A;  4U7N A;  1TID A;  2YEG A;  3D0B A;  2E0A A;  3R4M A;  2XHX A;  3FT5 A;  3T1K A;  3G7E A;  3D2R A;  3G75 A;  3K99 A;  4L8Z A;  2YI0 A;  4BXI A;  4ASF A;  1YET A;  3ZKB A;  3R4P A;  4MOT A;  3O6O A;  4YKU A;  2BT0 A;  3O2F A;  2CCU A;  5M4H A;  1S16 A;  2YEC A;  4EMV A;  4XE2 A;  3JZ3 A;  2WI2 A;  4EGK A;  4PU9 A;  3OWD A;  1YT2 A;  2EXL A;  4URL A;  2CGF A;  2VCJ A;  3INW A;  3T10 A;  1YC1 A;  4LPB A;  5F5R A;  2O1W A;  3G7B A;  4YKZ A;  2BU2 A;  2CG9 A;  4KSH A;  2BRC A;  4BQJ A;  1Z59 A;  1TC6 A;  5IDJ A;  1BKN A;  3CRL A;  1A4H A;  4MB9 A;  4O07 A;  4BQG A;  4X9L A;  2K5B A;  1YC3 A;  1YT1 A;  3A0T A;  4JAS A;  3PEH A;  4XIT A;  4LWF A;  4URN A;  1ZWH A;  3TZ0 A;  4ZVI A;  3H4L A;  1L0O A;  1Z5A A;  1B63 A;  4U93 A;  2IWU A;  1BGQ A;  4L90 A;  3OPD A;  3QTF A;  1QY8 A;  2HCH A;  5CTU A;  2XDS A;  3B27 A;  3Q5K A;  2QG2 A;  3BM9 A;  2XJG A;  4PL9 A;  3ZXO A;  2YKE A;  2WI7 A;  3INX A;  4FMT A;  4CE3 A;  2XDK A;  2JKI A;  3B28 A;  3EHJ A;  4I3H A;  3K98 A;  2YEH A;  4XKO A;  4CWF A;  1TBW A;  4XD8 A;  3OW6 A;  4HZ0 A;  3EHH A;  1KZN A;  4XKA A;  1ZXN A;  4QPK A;  3GIF A;  4YKX A;  3HYY A;  1QZR A;  3A0X A;  4CWS A;  2IOR A;  4HY1 A;  2Q8G A;  1EI1 A;  5D7D A;  2UWD A;  4MPN A;  3RLQ A;  3HHU A;  2YKI A;  3D36 A;  4XCJ A;  3A0Y A;  1UYM A;  1YT0 A;  4KSG A;  2GFD A;  2ZKJ A;  5IN9 A;  3HEK A;  2XCM A;  4BIU A;  2YE7 A;  4NH9 A;  1YSR A;  4XIP A;  4PRX A;  1B3Q A;  2YEE A;  4GCZ A;  1GKX A;  4MPC A;  2ESA A;  4NH8 A;  2QG0 A;  4V26 A;  3QDD A;  4HZ5 A;  3TZ4 A;  3CRK A;  2AKP A;  1AH8 A;  3DGE A;  4MPE A;  3LNU A;  1UYE A;  2YGA A;  3VAD A;  1Y8N A;  1B62 A;  1ZXM A;  2BU5 A;  4O05 A;  4Q20 A;  5D6Q A;  5M4E A;  2VCI A;  4LWG A;  4AWO A;  2YJW A;  1I5B A;  4AWP A;  1TH8 A;  3B25 A;  4QPJ A;  5J71 A;  3Q5J A;  1AM1 A;  4JQL A;  4XC0 A;  3MNR P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...