1I5AA

Structure of chea domain p4 in complex with adpcp and manganese
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
181
Chain Sequence
b'GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein, transferase
total genus 57
structure length 181
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i5aA00
4AWOA 1ID0A 3EHJA 2WEPA 5FNFA 4L94A 5CTXA 1BYQA 4XKAA 2Q8GA 5GGZA 1KZNA 4NH9A 1AM1A 2PNRA 3ZM7A 3FV5A 1Z5CA 4HYPA 3B26A 2IWXA 2Q8FA 3RLRA 1Z5AA 1UY6A 3B24A 2BT0A 4XIPA 2Q8HA 2YI5A 3R91A 2YECA 1KIJA 2XDUA 4H85A 3CGZA 2IWUA 4JAVA 4U7OA 4YKXA 1S14A 2FYPA 4MB9A 2YKBA 4L93A 4UROA 4BIUA 2ESAA 4CWRA 5IN9A 4WUDA 3RLPA 3D36A 2XDSA 1UY7A 4O0BA 4R1FA 3PEHA 3TTZA 5M4HA 1H7UA 1YETA 3D0BA 4KTNA 4Q20A 4WUCA 4L91A 3RLQA 5CPHA 3Q5JA 3H4LA 1B3QA 4U7NA 1UYIA 2YKCA 2XX4A 4LPBA 3DGEA 2YK9A 3HYYA 2YKJA 2XABA 3A0YA 4PRXA 1UYKA 5CTYA 5F5RA 4HXZA 3B27A 1BXDA 2WI4A 2BYHA 3OMUA 2O1UA 4FMTA 1EI1A 3KE6A 4EGIA 1U2OA 3B28A 3ZKDA 1Y4SA 3A0RA 4CE3A 1MU5A 1I59A 4L8ZA 4BQGA 1Y8OA 4CWTA 2YE3A 2YEGA 1US7A 1I5AA 4XTJA 1QYEA 3U2DA 3CRKA 1UY9A 2YGFA 3IEDA 2YE9A 1S16A 3EHHA 4NH7A 2HCHA 3INXA 4P8OA 4GGLA 3HHUA 1EA6A 3G75A 3OPDA 3PEJA 3H80A 1THNA 4XDMA 4FCPA 4LP0A 4WUBA 3T10A 5FNCA 3GIFA 1UY8A 5D7CA 1JM6A 4LWHA 3QDDA 2GFDA 4NH8A 4XKKA 3QTFA 3B25A 1NHHA 3EKRA 2O1WA 2YE7A 5BOCA 2XK2A 4GEEA 2YI0A 4LWFA 2EXLA 4O04A 2XX5A 2YEHA 4BXIA 2HG1A 3TZ4A 3ZKBA 4FPPA 4JASA 4HZ5A 1BKNA 4BAEA 5M4PA 2CGFA 2BU7A 3VHDA 2ZDYA 4ASAA 4EGHA 1I5DA 1QZRA 1YERA 1I5BA 1U0ZA 4GQTA 2FWYA 3MNRP 3C0EA 3TZ0A 3EKOA 1YSZA 4QPKA 3R4PA 4CWFA 3R4NA 3CGYA 1Z59A 4YKTA 2BZ5A 3ZXOA 2BU2A 3R4MA 3VADA 3SL2A 4CWSA 2BU5A 4K4OA 1OSFA 2O1VA 3Q5KA 4CE2A 4CWOA 1NHIA 4MPEA 2YGAA 5D6PA 1AH6A 3VHAA 4GFNA 4XKOA 3JZ3A 5M4EA 3R92A 3TUHA 2QFOA 3WHAA 3HYZA 2CH4A 4GT8A 4XIRA 4MPCA 2YI7A 4O09A 3A0TA 2YKIA 1ZXMA 2XHRA 1AH8A 1GJVA 2XX2A 4FCRA 3K60A 4ASGA 2BTZA 2VWCA 4KSHA 2YE8A 4ZKIA 1YSRA 3TZ5A 4YKYA 1TH8A 3EHGA 4EFUA 4KP4A 2BSMA 4B6CA 2CCTA 2XDXA 1UYCA 3A0XA 1TIDA 4O05A 3O6OA 4MPNA 3OWBA 1UYLA 2VW5A 4PU9A 4EMVA 4KSGA 5FWKA 3WQ9A 4ASFA 4I5SA 4AWQA 3BM9A 2YK2A 2VCIA 4HY6A 3FT5A 2CCUA 4LWEA 3T0ZA 4HXWA 4URLA 3ZXQA 1UYHA 2YE2A 4DUHA 4XD8A 2YEEA 1B62A 4E00A 4MP7A 3U67A 3EHFA 2XDLA 4JQLA 1PVGA 2JJCA 2IWSA 4KQVA 2VCJA 4XIQA 4JAUA 1UYGA 4BQJA 2YGEA 1AMWA 2YE4A 4P7AA 2YEIA 4LWIA 2WI1A 1TILA 5D7RA 2E0AA 1UYEA 1ZXNA 2XJJA 4GCZA 5M4NA 3CRLA 4HZ0A 4X9LA 1I5CA 3INWA 4MP2A 3LPSA 4U93A 4E01A 1QY8A 4V25A 4CE1A 2XHTA 5CF0A 2FWZA 1UYFA 1YESA 2YEJA 2YJXA 2XJXA 2BRCA 3O0IA 3R4OA 4MOTA 2GQPA 1H7SA 2QG2A 3LNUA 5CTWA 3RKZA 3K98A 4LWGA 5J71A 3G7EA 2XCMA 2YJWA 3HZ5A 2C2AA 2YEDA 2IORA 4BIZA 1AJ6A 3GIGA 3TZ2A 3T0HA 4EGKA 4R3MA 4AWPA 5M4MA 4E02A 4YKUA 2CCSA 4W7TA 1ZWHA 4PRVA 1YT1A 4L90A 4QPJA 4B7PA 3OWDA 4ZVIA 4PL9A 2Q2EB 2YE6A 4XITA 4YKQA 1L0OA 1GKZA 3D2RA 3CWVA 2WERA 4YKRA 2WI3A 2XD6A 4V26A 2WI5A 2YKEA 2YE5A 4CWNA 4URNA 4KFGA 3GIGB 4XCJA 2H55A 4XE2A 3NMQA 2QG0A 2ZKJA 2XJGA 3A0ZA 1Y4UA 2ZBKB 1ZW9A 5IDJA 4URMA 4H7QA 4EEHA 2H8MA 1B63A 2WI2A 2IOQA 2HKJA 2BU8A 3T1KA 1Y8PA 2YEBA 4H81A 5L3JA 3OW6A 5IDMA 2AKPA 3Q5LA 2WEQA 3U2KA 1Y8NA 4DZYA 4EFTA 5D7DA 1UYMA 2CG9A 2WI6A 2YI6A 3O2FA 4FCQA 1BGQA 2WI7A 4HY1A 3C11A 1TBWA 1YT2A 3HZ1A 4YKWA 1NHJA 5FNDA 4ASBA 4I3HA 5F3KA 3A0WA 1A4HA 1YT0A 2IOPA 1YC4A 3T2SA 5CTUA 2BREA 4O07A 1YS3A 2XHXA 2XDKA 4CWQA 2JKIA 3K97A 1I58A 5D6QA 1UYDA 4MBCA 3G7BA 4R3AA 2BU6A 3FT8A 2K5BA 2FXSA 4AS9A 2BYIA 3GIEA 3K99A 3HEKA 4YKZA 5BODA 1Z5BA 5M4KA 1GKXA 3BMYA 2UWDA 2YEAA 5C93A 4XCLA 1TC6A 1R62A 1YC3A 4EM7A 1MX0A 2YEFA 5J6AA 2Q8IA 1YC1A 2QF6A 4HYMA 4CWPA 2ZDXA 4XC0A 1TC0A 3VHCA
chains in the Genus database with same CATH superfamily
4AWOA 1ID0A 3EHJA 2WEPA 5FNFA 4L94A 2FTKA 5CTXA 1BYQA 4XKAA 2Q8GA 5GGZA 1KZNA 4NH9A 1AM1A 2PNRA 3ZM7A 3FV5A 1Z5CA 4HYPA 3B26A 2IWXA 2Q8FA 3RLRA 1Z5AA 1UY6A 3B24A 2BT0A 4XIPA 2Q8HA 2YI5A 3R91A 2YECA 1KIJA 2XDUA 4H85A 3CGZA 2IWUA 4JAVA 4U7OA 4YKXA 1S14A 2FYPA 4MB9A 2YKBA 4L93A 4UROA 4BIUA 2ESAA 4CWRA 5IN9A 4WUDA 3RLPA 3D36A 2XDSA 1UY7A 4O0BA 4R1FA 3PEHA 3TTZA 5M4HA 1H7UA 1YETA 3D0BA 4KTNA 4Q20A 3S5TA 4WUCA 4L91A 3RLQA 5CPHA 3Q5JA 3H4LA 1B3QA 4U7NA 1UYIA 2YKCA 2XX4A 4LPBA 3DGEA 2YK9A 3HYYA 2YKJA 2XABA 3A0YA 4PRXA 1UYKA 5CTYA 5F5RA 4HXZA 3B27A 1BXDA 2WI4A 2BYHA 3OMUA 2O1UA 4FMTA 1EI1A 3KE6A 4EGIA 2C1IA 1U2OA 3B28A 3ZKDA 1Y4SA 3A0RA 3LMMA 4CE3A 1MU5A 1I59A 4L8ZA 4BQGA 1Y8OA 4CWTA 2YE3A 2YEGA 1US7A 1I5AA 4XTJA 1QYEA 3U2DA 3CRKA 1UY9A 2YGFA 3IEDA 2YE9A 1S16A 3EHHA 4NH7A 2HCHA 3INXA 4P8OA 4GGLA 3HHUA 1EA6A 3G75A 3OPDA 3PEJA 3H80A 1THNA 4XDMA 4FCPA 4LP0A 4WUBA 3T10A 5FNCA 3GIFA 1UY8A 5D7CA 1JM6A 4LWHA 3QDDA 2GFDA 4NH8A 4XKKA 3QTFA 3B25A 1NHHA 3EKRA 2O1WA 2YE7A 5BOCA 2XK2A 4GEEA 2YI0A 4LWFA 2EXLA 4O04A 2XX5A 2YEHA 4BXIA 2HG1A 3TZ4A 3ZKBA 4FPPA 4JASA 4HZ5A 1BKNA 4BAEA 5M4PA 2CGFA 2BU7A 3VHDA 1IXMA 2ZDYA 4ASAA 4EGHA 1I5DA 1QZRA 1YERA 1I5BA 1U0ZA 4GQTA 2FWYA 3MNRP 3C0EA 3TZ0A 3EKOA 1YSZA 4QPKA 3R4PA 4CWFA 3R4NA 3CGYA 1Z59A 4YKTA 2BZ5A 3ZXOA 2BU2A 3R4MA 1F51A 3VADA 3SL2A 4CWSA 2BU5A 4K4OA 1OSFA 2O1VA 3Q5KA 4CE2A 4CWOA 1NHIA 4MPEA 2YGAA 5D6PA 1AH6A 3VHAA 4GFNA 4XKOA 3JZ3A 5M4EA 3R92A 3TUHA 2QFOA 3WHAA 3HYZA 2CH4A 4GT8A 4XIRA 4MPCA 2YI7A 4O09A 3A0TA 2YKIA 1ZXMA 2XHRA 1AH8A 1GJVA 2XX2A 4FCRA 3K60A 4ASGA 2BTZA 2VWCA 4KSHA 2YE8A 4ZKIA 1YSRA 3TZ5A 4YKYA 1TH8A 3EHGA 4EFUA 4KP4A 2BSMA 4B6CA 2CCTA 2XDXA 1UYCA 3A0XA 1TIDA 4O05A 3O6OA 4MPNA 3OWBA 1UYLA 2VW5A 4PU9A 4EMVA 4KSGA 5FWKA 3WQ9A 4ASFA 4I5SA 4AWQA 3BM9A 2YK2A 2VCIA 4HY6A 3FT5A 2CCUA 4LWEA 3T0ZA 4HXWA 4URLA 3ZXQA 1UYHA 2YE2A 4DUHA 4XD8A 2YEEA 1B62A 4E00A 4MP7A 3U67A 3EHFA 2XDLA 4JQLA 1PVGA 2JJCA 2IWSA 4KQVA 2VCJA 4XIQA 4JAUA 1UYGA 4BQJA 2YGEA 3CYGA 1AMWA 2YE4A 4P7AA 2YEIA 4LWIA 2WI1A 1TILA 5JENA 5D7RA 4E72A 2E0AA 1UYEA 1ZXNA 2XJJA 4GCZA 5M4NA 3CRLA 4HZ0A 4X9LA 1I5CA 3INWA 4MP2A 3LPSA 4U93A 4E01A 1QY8A 4V25A 4CE1A 2XHTA 5CF0A 2FWZA 1UYFA 1YESA 2YEJA 2YJXA 2XJXA 2BRCA 3O0IA 3R4OA 4MOTA 2GQPA 1H7SA 2QG2A 3LNUA 5CTWA 3RKZA 3K98A 4LWGA 5J71A 3G7EA 2XCMA 2YJWA 3HZ5A 2C2AA 2YEDA 2IORA 4BIZA 1AJ6A 3GIGA 3TZ2A 3T0HA 4EGKA 4R3MA 4AWPA 5M4MA 4E02A 4YKUA 2CCSA 2HHIA 4W7TA 1ZWHA 4PRVA 1YT1A 4L90A 4QPJA 4B7PA 3OWDA 4ZVIA 4PL9A 2Q2EB 2YE6A 4XITA 4YKQA 1L0OA 1GKZA 3D2RA 3CWVA 2WERA 4YKRA 2WI3A 2XD6A 4V26A 2WI5A 2YKEA 2YE5A 4CWNA 4URNA 2C1GA 4KFGA 3GIGB 4XCJA 2H55A 4XE2A 3NMQA 2QG0A 2ZKJA 2XJGA 3A0ZA 1Y4UA 2ZBKB 1ZW9A 5IDJA 4URMA 4H7QA 4EEHA 2H8MA 1B63A 2WI2A 2IOQA 2HKJA 2BU8A 3T1KA 1Y8PA 2YEBA 4H81A 5L3JA 3OW6A 5IDMA 2AKPA 3Q5LA 2WEQA 3U2KA 1Y8NA 4DZYA 4EFTA 5D7DA 1UYMA 2CG9A 2WI6A 2YI6A 3O2FA 4FCQA 1BGQA 2WI7A 4HY1A 3C11A 1TBWA 1YT2A 3HZ1A 4YKWA 1NHJA 5FNDA 4ASBA 4I3HA 5F3KA 3A0WA 1A4HA 1YT0A 2IOPA 1YC4A 3T2SA 5CTUA 2BREA 4O07A 1YS3A 2XHXA 2XDKA 4CWQA 2JKIA 3K97A 1I58A 5D6QA 1UYDA 4MBCA 3G7BA 4R3AA 2BU6A 3FT8A 2K5BA 2FXSA 4AS9A 2BYIA 3GIEA 3K99A 3HEKA 4YKZA 5BODA 1Z5BA 5M4KA 1GKXA 3BMYA 2UWDA 2YEAA 5C93A 4XCLA 1TC6A 1R62A 1YC3A 4EM7A 1MX0A 2YEFA 5J6AA 2Q8IA 1YC1A 2QF6A 4HYMA 4CWPA 2ZDXA 4XC0A 1TC0A 3VHCA
chains in the Genus database with same CATH topology
4AWOA 1ID0A 3EHJA 2WEPA 5FNFA 4L94A 5CTXA 1BYQA 4XKAA 2Q8GA 5GGZA 1KZNA 4NH9A 1AM1A 2PNRA 3ZM7A 3FV5A 1Z5CA 4HYPA 3B26A 2IWXA 2Q8FA 3RLRA 1Z5AA 1UY6A 3B24A 2BT0A 4XIPA 2Q8HA 2YI5A 3R91A 2YECA 1KIJA 2XDUA 4H85A 3CGZA 2IWUA 4JAVA 4U7OA 4YKXA 1S14A 2FYPA 4MB9A 2YKBA 4L93A 4UROA 4BIUA 2ESAA 4CWRA 5IN9A 4WUDA 3RLPA 3D36A 2XDSA 1UY7A 4O0BA 4R1FA 3PEHA 3TTZA 5M4HA 1H7UA 1YETA 3D0BA 4KTNA 4Q20A 4WUCA 4L91A 3RLQA 5CPHA 3Q5JA 3H4LA 1B3QA 4U7NA 1UYIA 2YKCA 2XX4A 4LPBA 3DGEA 2YK9A 3HYYA 2YKJA 2XABA 3A0YA 4PRXA 1UYKA 5CTYA 5F5RA 4HXZA 3B27A 1BXDA 2WI4A 2BYHA 3OMUA 2O1UA 4FMTA 1EI1A 3KE6A 4EGIA 1U2OA 3B28A 3ZKDA 1Y4SA 3A0RA 4CE3A 1MU5A 1I59A 4L8ZA 4BQGA 1Y8OA 4CWTA 2YE3A 2YEGA 1US7A 1I5AA 4XTJA 1QYEA 3U2DA 3CRKA 1UY9A 2YGFA 3IEDA 2YE9A 1S16A 3EHHA 4NH7A 2HCHA 3INXA 4P8OA 4GGLA 3HHUA 1EA6A 3G75A 3OPDA 3PEJA 3H80A 1THNA 4XDMA 4FCPA 4LP0A 4WUBA 3T10A 5FNCA 3GIFA 1UY8A 5D7CA 1JM6A 4LWHA 3QDDA 2GFDA 4NH8A 4XKKA 3QTFA 3B25A 1NHHA 3EKRA 2O1WA 2YE7A 5BOCA 2XK2A 4GEEA 2YI0A 4LWFA 2EXLA 4O04A 2XX5A 2YEHA 4BXIA 2HG1A 3TZ4A 3ZKBA 4FPPA 4JASA 4HZ5A 1BKNA 4BAEA 5M4PA 2CGFA 2BU7A 3VHDA 2ZDYA 4ASAA 4EGHA 1I5DA 1QZRA 1YERA 1I5BA 1U0ZA 4GQTA 2FWYA 3MNRP 3C0EA 3TZ0A 3EKOA 1YSZA 4QPKA 3R4PA 4CWFA 3R4NA 3CGYA 1Z59A 4YKTA 2BZ5A 3ZXOA 2BU2A 3R4MA 3VADA 3SL2A 4CWSA 2BU5A 4K4OA 1OSFA 2O1VA 3Q5KA 4CE2A 4CWOA 1NHIA 4MPEA 2YGAA 5D6PA 1AH6A 3VHAA 4GFNA 4XKOA 3JZ3A 5M4EA 3R92A 3TUHA 2QFOA 3WHAA 3HYZA 2CH4A 4GT8A 4XIRA 4MPCA 2YI7A 4O09A 3A0TA 2YKIA 1ZXMA 2XHRA 1AH8A 1GJVA 2XX2A 4FCRA 3K60A 4ASGA 2BTZA 2VWCA 4KSHA 2YE8A 4ZKIA 1YSRA 3TZ5A 4YKYA 1TH8A 3EHGA 4EFUA 4KP4A 2BSMA 4B6CA 2CCTA 2XDXA 1UYCA 3A0XA 1TIDA 4O05A 3O6OA 4MPNA 3OWBA 1UYLA 2VW5A 4PU9A 4EMVA 4KSGA 5FWKA 3WQ9A 4ASFA 4I5SA 4AWQA 3BM9A 2YK2A 2VCIA 4HY6A 3FT5A 2CCUA 4LWEA 3T0ZA 4HXWA 4URLA 3ZXQA 1UYHA 2YE2A 4DUHA 4XD8A 2YEEA 1B62A 4E00A 4MP7A 3U67A 3EHFA 2XDLA 4JQLA 1PVGA 2JJCA 2IWSA 4KQVA 2VCJA 4XIQA 4JAUA 1UYGA 4BQJA 2YGEA 1AMWA 2YE4A 4P7AA 2YEIA 4LWIA 2WI1A 1TILA 5D7RA 2E0AA 1UYEA 1ZXNA 2XJJA 4GCZA 5M4NA 3CRLA 4HZ0A 4X9LA 1I5CA 3INWA 4MP2A 3LPSA 4U93A 4E01A 1QY8A 4V25A 4CE1A 2XHTA 5CF0A 2FWZA 1UYFA 1YESA 2YEJA 2YJXA 2XJXA 2BRCA 3O0IA 3R4OA 4MOTA 2GQPA 1H7SA 2QG2A 3LNUA 5CTWA 3RKZA 3K98A 4LWGA 5J71A 3G7EA 2XCMA 2YJWA 3HZ5A 2C2AA 2YEDA 2IORA 4BIZA 1AJ6A 3GIGA 3TZ2A 3T0HA 4EGKA 4R3MA 4AWPA 5M4MA 4E02A 4YKUA 2CCSA 4W7TA 1ZWHA 4PRVA 1YT1A 4L90A 4QPJA 4B7PA 3OWDA 4ZVIA 4PL9A 2Q2EB 2YE6A 4XITA 4YKQA 1L0OA 1GKZA 3D2RA 3CWVA 2WERA 4YKRA 2WI3A 2XD6A 4V26A 2WI5A 2YKEA 2YE5A 4CWNA 4URNA 4KFGA 3GIGB 4XCJA 2H55A 4XE2A 3NMQA 2QG0A 2ZKJA 2XJGA 3A0ZA 1Y4UA 2ZBKB 1ZW9A 5IDJA 4URMA 4H7QA 4EEHA 2H8MA 1B63A 2WI2A 2IOQA 2HKJA 2BU8A 3T1KA 1Y8PA 2YEBA 4H81A 5L3JA 3OW6A 5IDMA 2AKPA 3Q5LA 2WEQA 3U2KA 1Y8NA 4DZYA 4EFTA 5D7DA 1UYMA 2CG9A 2WI6A 2YI6A 3O2FA 4FCQA 1BGQA 2WI7A 4HY1A 3C11A 1TBWA 1YT2A 3HZ1A 4YKWA 1NHJA 5FNDA 4ASBA 4I3HA 5F3KA 3A0WA 1A4HA 1YT0A 2IOPA 1YC4A 3T2SA 5CTUA 2BREA 4O07A 1YS3A 2XHXA 2XDKA 4CWQA 2JKIA 3K97A 1I58A 5D6QA 1UYDA 4MBCA 3G7BA 4R3AA 2BU6A 3FT8A 2K5BA 2FXSA 4AS9A 2BYIA 3GIEA 3K99A 3HEKA 4YKZA 5BODA 1Z5BA 5M4KA 1GKXA 3BMYA 2UWDA 2YEAA 5C93A 4XCLA 1TC6A 1R62A 1YC3A 4EM7A 1MX0A 2YEFA 5J6AA 2Q8IA 1YC1A 2QF6A 4HYMA 4CWPA 2ZDXA 4XC0A 1TC0A 3VHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AWO A;  1ID0 A;  3EHJ A;  2WEP A;  5FNF A;  4L94 A;  5CTX A;  1BYQ A;  4XKA A;  2Q8G A;  5GGZ A;  1KZN A;  4NH9 A;  1AM1 A;  2PNR A;  3ZM7 A;  3FV5 A;  1Z5C A;  4HYP A;  3B26 A;  2IWX A;  2Q8F A;  3RLR A;  1Z5A A;  1UY6 A;  3B24 A;  2BT0 A;  4XIP A;  2Q8H A;  2YI5 A;  3R91 A;  2YEC A;  1KIJ A;  2XDU A;  4H85 A;  3CGZ A;  2IWU A;  4JAV A;  4U7O A;  4YKX A;  1S14 A;  2FYP A;  4MB9 A;  2YKB A;  4L93 A;  4URO A;  4BIU A;  2ESA A;  4CWR A;  5IN9 A;  4WUD A;  3RLP A;  3D36 A;  2XDS A;  1UY7 A;  4O0B A;  4R1F A;  3PEH A;  3TTZ A;  5M4H A;  1H7U A;  1YET A;  3D0B A;  4KTN A;  4Q20 A;  4WUC A;  4L91 A;  3RLQ A;  5CPH A;  3Q5J A;  3H4L A;  1B3Q A;  4U7N A;  1UYI A;  2YKC A;  2XX4 A;  4LPB A;  3DGE A;  2YK9 A;  3HYY A;  2YKJ A;  2XAB A;  3A0Y A;  4PRX A;  1UYK A;  5CTY A;  5F5R A;  4HXZ A;  3B27 A;  1BXD A;  2WI4 A;  2BYH A;  3OMU A;  2O1U A;  4FMT A;  1EI1 A;  3KE6 A;  4EGI A;  1U2O A;  3B28 A;  3ZKD A;  1Y4S A;  3A0R A;  4CE3 A;  1MU5 A;  1I59 A;  4L8Z A;  4BQG A;  1Y8O A;  4CWT A;  2YE3 A;  2YEG A;  1US7 A;  1I5A A;  4XTJ A;  1QYE A;  3U2D A;  3CRK A;  1UY9 A;  2YGF A;  3IED A;  2YE9 A;  1S16 A;  3EHH A;  4NH7 A;  2HCH A;  3INX A;  4P8O A;  4GGL A;  3HHU A;  1EA6 A;  3G75 A;  3OPD A;  3PEJ A;  3H80 A;  1THN A;  4XDM A;  4FCP A;  4LP0 A;  4WUB A;  3T10 A;  5FNC A;  3GIF A;  1UY8 A;  5D7C A;  1JM6 A;  4LWH A;  3QDD A;  2GFD A;  4NH8 A;  4XKK A;  3QTF A;  3B25 A;  1NHH A;  3EKR A;  2O1W A;  2YE7 A;  5BOC A;  2XK2 A;  4GEE A;  2YI0 A;  4LWF A;  2EXL A;  4O04 A;  2XX5 A;  2YEH A;  4BXI A;  2HG1 A;  3TZ4 A;  3ZKB A;  4FPP A;  4JAS A;  4HZ5 A;  1BKN A;  4BAE A;  5M4P A;  2CGF A;  2BU7 A;  3VHD A;  2ZDY A;  4ASA A;  4EGH A;  1I5D A;  1QZR A;  1YER A;  1I5B A;  1U0Z A;  4GQT A;  2FWY A;  3MNR P;  3C0E A;  3TZ0 A;  3EKO A;  1YSZ A;  4QPK A;  3R4P A;  4CWF A;  3R4N A;  3CGY A;  1Z59 A;  4YKT A;  2BZ5 A;  3ZXO A;  2BU2 A;  3R4M A;  3VAD A;  3SL2 A;  4CWS A;  2BU5 A;  4K4O A;  1OSF A;  2O1V A;  3Q5K A;  4CE2 A;  4CWO A;  1NHI A;  4MPE A;  2YGA A;  5D6P A;  1AH6 A;  3VHA A;  4GFN A;  4XKO A;  3JZ3 A;  5M4E A;  3R92 A;  3TUH A;  2QFO A;  3WHA A;  3HYZ A;  2CH4 A;  4GT8 A;  4XIR A;  4MPC A;  2YI7 A;  4O09 A;  3A0T A;  2YKI A;  1ZXM A;  2XHR A;  1AH8 A;  1GJV A;  2XX2 A;  4FCR A;  3K60 A;  4ASG A;  2BTZ A;  2VWC A;  4KSH A;  2YE8 A;  4ZKI A;  1YSR A;  3TZ5 A;  4YKY A;  1TH8 A;  3EHG A;  4EFU A;  4KP4 A;  2BSM A;  4B6C A;  2CCT A;  2XDX A;  1UYC A;  3A0X A;  1TID A;  4O05 A;  3O6O A;  4MPN A;  3OWB A;  1UYL A;  2VW5 A;  4PU9 A;  4EMV A;  4KSG A;  5FWK A;  3WQ9 A;  4ASF A;  4I5S A;  4AWQ A;  3BM9 A;  2YK2 A;  2VCI A;  4HY6 A;  3FT5 A;  2CCU A;  4LWE A;  3T0Z A;  4HXW A;  4URL A;  3ZXQ A;  1UYH A;  2YE2 A;  4DUH A;  4XD8 A;  2YEE A;  1B62 A;  4E00 A;  4MP7 A;  3U67 A;  3EHF A;  2XDL A;  4JQL A;  1PVG A;  2JJC A;  2IWS A;  4KQV A;  2VCJ A;  4XIQ A;  4JAU A;  1UYG A;  4BQJ A;  2YGE A;  1AMW A;  2YE4 A;  4P7A A;  2YEI A;  4LWI A;  2WI1 A;  1TIL A;  5D7R A;  2E0A A;  1UYE A;  1ZXN A;  2XJJ A;  4GCZ A;  5M4N A;  3CRL A;  4HZ0 A;  4X9L A;  1I5C A;  3INW A;  4MP2 A;  3LPS A;  4U93 A;  4E01 A;  1QY8 A;  4V25 A;  4CE1 A;  2XHT A;  5CF0 A;  2FWZ A;  1UYF A;  1YES A;  2YEJ A;  2YJX A;  2XJX A;  2BRC A;  3O0I A;  3R4O A;  4MOT A;  2GQP A;  1H7S A;  2QG2 A;  3LNU A;  5CTW A;  3RKZ A;  3K98 A;  4LWG A;  5J71 A;  3G7E A;  2XCM A;  2YJW A;  3HZ5 A;  2C2A A;  2YED A;  2IOR A;  4BIZ A;  1AJ6 A;  3GIG A;  3TZ2 A;  3T0H A;  4EGK A;  4R3M A;  4AWP A;  5M4M A;  4E02 A;  4YKU A;  2CCS A;  4W7T A;  1ZWH A;  4PRV A;  1YT1 A;  4L90 A;  4QPJ A;  4B7P A;  3OWD A;  4ZVI A;  4PL9 A;  2Q2E B;  2YE6 A;  4XIT A;  4YKQ A;  1L0O A;  1GKZ A;  3D2R A;  3CWV A;  2WER A;  4YKR A;  2WI3 A;  2XD6 A;  4V26 A;  2WI5 A;  2YKE A;  2YE5 A;  4CWN A;  4URN A;  4KFG A;  3GIG B;  4XCJ A;  2H55 A;  4XE2 A;  3NMQ A;  2QG0 A;  2ZKJ A;  2XJG A;  3A0Z A;  1Y4U A;  2ZBK B;  1ZW9 A;  5IDJ A;  4URM A;  4H7Q A;  4EEH A;  2H8M A;  1B63 A;  2WI2 A;  2IOQ A;  2HKJ A;  2BU8 A;  3T1K A;  1Y8P A;  2YEB A;  4H81 A;  5L3J A;  3OW6 A;  5IDM A;  2AKP A;  3Q5L A;  2WEQ A;  3U2K A;  1Y8N A;  4DZY A;  4EFT A;  5D7D A;  1UYM A;  2CG9 A;  2WI6 A;  2YI6 A;  3O2F A;  4FCQ A;  1BGQ A;  2WI7 A;  4HY1 A;  3C11 A;  1TBW A;  1YT2 A;  3HZ1 A;  4YKW A;  1NHJ A;  5FND A;  4ASB A;  4I3H A;  5F3K A;  3A0W A;  1A4H A;  1YT0 A;  2IOP A;  1YC4 A;  3T2S A;  5CTU A;  2BRE A;  4O07 A;  1YS3 A;  2XHX A;  2XDK A;  4CWQ A;  2JKI A;  3K97 A;  1I58 A;  5D6Q A;  1UYD A;  4MBC A;  3G7B A;  4R3A A;  2BU6 A;  3FT8 A;  2K5B A;  2FXS A;  4AS9 A;  2BYI A;  3GIE A;  3K99 A;  3HEK A;  4YKZ A;  5BOD A;  1Z5B A;  5M4K A;  1GKX A;  3BMY A;  2UWD A;  2YEA A;  5C93 A;  4XCL A;  1TC6 A;  1R62 A;  1YC3 A;  4EM7 A;  1MX0 A;  2YEF A;  5J6A A;  2Q8I A;  1YC1 A;  2QF6 A;  4HYM A;  4CWP A;  2ZDX A;  4XC0 A;  1TC0 A;  3VHC A; 
#chains in the Genus database with same CATH topology
 4AWO A;  1ID0 A;  3EHJ A;  2WEP A;  5FNF A;  4L94 A;  2FTK A;  5CTX A;  1BYQ A;  4XKA A;  2Q8G A;  5GGZ A;  1KZN A;  4NH9 A;  1AM1 A;  2PNR A;  3ZM7 A;  3FV5 A;  1Z5C A;  4HYP A;  3B26 A;  2IWX A;  2Q8F A;  3RLR A;  1Z5A A;  1UY6 A;  3B24 A;  2BT0 A;  4XIP A;  2Q8H A;  2YI5 A;  3R91 A;  2YEC A;  1KIJ A;  2XDU A;  4H85 A;  3CGZ A;  2IWU A;  4JAV A;  4U7O A;  4YKX A;  1S14 A;  2FYP A;  4MB9 A;  2YKB A;  4L93 A;  4URO A;  4BIU A;  2ESA A;  4CWR A;  5IN9 A;  4WUD A;  3RLP A;  3D36 A;  2XDS A;  1UY7 A;  4O0B A;  4R1F A;  3PEH A;  3TTZ A;  5M4H A;  1H7U A;  1YET A;  3D0B A;  4KTN A;  4Q20 A;  3S5T A;  4WUC A;  4L91 A;  3RLQ A;  5CPH A;  3Q5J A;  3H4L A;  1B3Q A;  4U7N A;  1UYI A;  2YKC A;  2XX4 A;  4LPB A;  3DGE A;  2YK9 A;  3HYY A;  2YKJ A;  2XAB A;  3A0Y A;  4PRX A;  1UYK A;  5CTY A;  5F5R A;  4HXZ A;  3B27 A;  1BXD A;  2WI4 A;  2BYH A;  3OMU A;  2O1U A;  4FMT A;  1EI1 A;  3KE6 A;  4EGI A;  2C1I A;  1U2O A;  3B28 A;  3ZKD A;  1Y4S A;  3A0R A;  3LMM A;  4CE3 A;  1MU5 A;  1I59 A;  4L8Z A;  4BQG A;  1Y8O A;  4CWT A;  2YE3 A;  2YEG A;  1US7 A;  1I5A A;  4XTJ A;  1QYE A;  3U2D A;  3CRK A;  1UY9 A;  2YGF A;  3IED A;  2YE9 A;  1S16 A;  3EHH A;  4NH7 A;  2HCH A;  3INX A;  4P8O A;  4GGL A;  3HHU A;  1EA6 A;  3G75 A;  3OPD A;  3PEJ A;  3H80 A;  1THN A;  4XDM A;  4FCP A;  4LP0 A;  4WUB A;  3T10 A;  5FNC A;  3GIF A;  1UY8 A;  5D7C A;  1JM6 A;  4LWH A;  3QDD A;  2GFD A;  4NH8 A;  4XKK A;  3QTF A;  3B25 A;  1NHH A;  3EKR A;  2O1W A;  2YE7 A;  5BOC A;  2XK2 A;  4GEE A;  2YI0 A;  4LWF A;  2EXL A;  4O04 A;  2XX5 A;  2YEH A;  4BXI A;  2HG1 A;  3TZ4 A;  3ZKB A;  4FPP A;  4JAS A;  4HZ5 A;  1BKN A;  4BAE A;  5M4P A;  2CGF A;  2BU7 A;  3VHD A;  1IXM A;  2ZDY A;  4ASA A;  4EGH A;  1I5D A;  1QZR A;  1YER A;  1I5B A;  1U0Z A;  4GQT A;  2FWY A;  3MNR P;  3C0E A;  3TZ0 A;  3EKO A;  1YSZ A;  4QPK A;  3R4P A;  4CWF A;  3R4N A;  3CGY A;  1Z59 A;  4YKT A;  2BZ5 A;  3ZXO A;  2BU2 A;  3R4M A;  1F51 A;  3VAD A;  3SL2 A;  4CWS A;  2BU5 A;  4K4O A;  1OSF A;  2O1V A;  3Q5K A;  4CE2 A;  4CWO A;  1NHI A;  4MPE A;  2YGA A;  5D6P A;  1AH6 A;  3VHA A;  4GFN A;  4XKO A;  3JZ3 A;  5M4E A;  3R92 A;  3TUH A;  2QFO A;  3WHA A;  3HYZ A;  2CH4 A;  4GT8 A;  4XIR A;  4MPC A;  2YI7 A;  4O09 A;  3A0T A;  2YKI A;  1ZXM A;  2XHR A;  1AH8 A;  1GJV A;  2XX2 A;  4FCR A;  3K60 A;  4ASG A;  2BTZ A;  2VWC A;  4KSH A;  2YE8 A;  4ZKI A;  1YSR A;  3TZ5 A;  4YKY A;  1TH8 A;  3EHG A;  4EFU A;  4KP4 A;  2BSM A;  4B6C A;  2CCT A;  2XDX A;  1UYC A;  3A0X A;  1TID A;  4O05 A;  3O6O A;  4MPN A;  3OWB A;  1UYL A;  2VW5 A;  4PU9 A;  4EMV A;  4KSG A;  5FWK A;  3WQ9 A;  4ASF A;  4I5S A;  4AWQ A;  3BM9 A;  2YK2 A;  2VCI A;  4HY6 A;  3FT5 A;  2CCU A;  4LWE A;  3T0Z A;  4HXW A;  4URL A;  3ZXQ A;  1UYH A;  2YE2 A;  4DUH A;  4XD8 A;  2YEE A;  1B62 A;  4E00 A;  4MP7 A;  3U67 A;  3EHF A;  2XDL A;  4JQL A;  1PVG A;  2JJC A;  2IWS A;  4KQV A;  2VCJ A;  4XIQ A;  4JAU A;  1UYG A;  4BQJ A;  2YGE A;  3CYG A;  1AMW A;  2YE4 A;  4P7A A;  2YEI A;  4LWI A;  2WI1 A;  1TIL A;  5JEN A;  5D7R A;  4E72 A;  2E0A A;  1UYE A;  1ZXN A;  2XJJ A;  4GCZ A;  5M4N A;  3CRL A;  4HZ0 A;  4X9L A;  1I5C A;  3INW A;  4MP2 A;  3LPS A;  4U93 A;  4E01 A;  1QY8 A;  4V25 A;  4CE1 A;  2XHT A;  5CF0 A;  2FWZ A;  1UYF A;  1YES A;  2YEJ A;  2YJX A;  2XJX A;  2BRC A;  3O0I A;  3R4O A;  4MOT A;  2GQP A;  1H7S A;  2QG2 A;  3LNU A;  5CTW A;  3RKZ A;  3K98 A;  4LWG A;  5J71 A;  3G7E A;  2XCM A;  2YJW A;  3HZ5 A;  2C2A A;  2YED A;  2IOR A;  4BIZ A;  1AJ6 A;  3GIG A;  3TZ2 A;  3T0H A;  4EGK A;  4R3M A;  4AWP A;  5M4M A;  4E02 A;  4YKU A;  2CCS A;  2HHI A;  4W7T A;  1ZWH A;  4PRV A;  1YT1 A;  4L90 A;  4QPJ A;  4B7P A;  3OWD A;  4ZVI A;  4PL9 A;  2Q2E B;  2YE6 A;  4XIT A;  4YKQ A;  1L0O A;  1GKZ A;  3D2R A;  3CWV A;  2WER A;  4YKR A;  2WI3 A;  2XD6 A;  4V26 A;  2WI5 A;  2YKE A;  2YE5 A;  4CWN A;  4URN A;  2C1G A;  4KFG A;  3GIG B;  4XCJ A;  2H55 A;  4XE2 A;  3NMQ A;  2QG0 A;  2ZKJ A;  2XJG A;  3A0Z A;  1Y4U A;  2ZBK B;  1ZW9 A;  5IDJ A;  4URM A;  4H7Q A;  4EEH A;  2H8M A;  1B63 A;  2WI2 A;  2IOQ A;  2HKJ A;  2BU8 A;  3T1K A;  1Y8P A;  2YEB A;  4H81 A;  5L3J A;  3OW6 A;  5IDM A;  2AKP A;  3Q5L A;  2WEQ A;  3U2K A;  1Y8N A;  4DZY A;  4EFT A;  5D7D A;  1UYM A;  2CG9 A;  2WI6 A;  2YI6 A;  3O2F A;  4FCQ A;  1BGQ A;  2WI7 A;  4HY1 A;  3C11 A;  1TBW A;  1YT2 A;  3HZ1 A;  4YKW A;  1NHJ A;  5FND A;  4ASB A;  4I3H A;  5F3K A;  3A0W A;  1A4H A;  1YT0 A;  2IOP A;  1YC4 A;  3T2S A;  5CTU A;  2BRE A;  4O07 A;  1YS3 A;  2XHX A;  2XDK A;  4CWQ A;  2JKI A;  3K97 A;  1I58 A;  5D6Q A;  1UYD A;  4MBC A;  3G7B A;  4R3A A;  2BU6 A;  3FT8 A;  2K5B A;  2FXS A;  4AS9 A;  2BYI A;  3GIE A;  3K99 A;  3HEK A;  4YKZ A;  5BOD A;  1Z5B A;  5M4K A;  1GKX A;  3BMY A;  2UWD A;  2YEA A;  5C93 A;  4XCL A;  1TC6 A;  1R62 A;  1YC3 A;  4EM7 A;  1MX0 A;  2YEF A;  5J6A A;  2Q8I A;  1YC1 A;  2QF6 A;  4HYM A;  4CWP A;  2ZDX A;  4XC0 A;  1TC0 A;  3VHC A; 
#chains in the Genus database with same CATH homology
 4AWO A;  1ID0 A;  3EHJ A;  2WEP A;  5FNF A;  4L94 A;  5CTX A;  1BYQ A;  4XKA A;  2Q8G A;  5GGZ A;  1KZN A;  4NH9 A;  1AM1 A;  2PNR A;  3ZM7 A;  3FV5 A;  1Z5C A;  4HYP A;  3B26 A;  2IWX A;  2Q8F A;  3RLR A;  1Z5A A;  1UY6 A;  3B24 A;  2BT0 A;  4XIP A;  2Q8H A;  2YI5 A;  3R91 A;  2YEC A;  1KIJ A;  2XDU A;  4H85 A;  3CGZ A;  2IWU A;  4JAV A;  4U7O A;  4YKX A;  1S14 A;  2FYP A;  4MB9 A;  2YKB A;  4L93 A;  4URO A;  4BIU A;  2ESA A;  4CWR A;  5IN9 A;  4WUD A;  3RLP A;  3D36 A;  2XDS A;  1UY7 A;  4O0B A;  4R1F A;  3PEH A;  3TTZ A;  5M4H A;  1H7U A;  1YET A;  3D0B A;  4KTN A;  4Q20 A;  4WUC A;  4L91 A;  3RLQ A;  5CPH A;  3Q5J A;  3H4L A;  1B3Q A;  4U7N A;  1UYI A;  2YKC A;  2XX4 A;  4LPB A;  3DGE A;  2YK9 A;  3HYY A;  2YKJ A;  2XAB A;  3A0Y A;  4PRX A;  1UYK A;  5CTY A;  5F5R A;  4HXZ A;  3B27 A;  1BXD A;  2WI4 A;  2BYH A;  3OMU A;  2O1U A;  4FMT A;  1EI1 A;  3KE6 A;  4EGI A;  1U2O A;  3B28 A;  3ZKD A;  1Y4S A;  3A0R A;  4CE3 A;  1MU5 A;  1I59 A;  4L8Z A;  4BQG A;  1Y8O A;  4CWT A;  2YE3 A;  2YEG A;  1US7 A;  1I5A A;  4XTJ A;  1QYE A;  3U2D A;  3CRK A;  1UY9 A;  2YGF A;  3IED A;  2YE9 A;  1S16 A;  3EHH A;  4NH7 A;  2HCH A;  3INX A;  4P8O A;  4GGL A;  3HHU A;  1EA6 A;  3G75 A;  3OPD A;  3PEJ A;  3H80 A;  1THN A;  4XDM A;  4FCP A;  4LP0 A;  4WUB A;  3T10 A;  5FNC A;  3GIF A;  1UY8 A;  5D7C A;  1JM6 A;  4LWH A;  3QDD A;  2GFD A;  4NH8 A;  4XKK A;  3QTF A;  3B25 A;  1NHH A;  3EKR A;  2O1W A;  2YE7 A;  5BOC A;  2XK2 A;  4GEE A;  2YI0 A;  4LWF A;  2EXL A;  4O04 A;  2XX5 A;  2YEH A;  4BXI A;  2HG1 A;  3TZ4 A;  3ZKB A;  4FPP A;  4JAS A;  4HZ5 A;  1BKN A;  4BAE A;  5M4P A;  2CGF A;  2BU7 A;  3VHD A;  2ZDY A;  4ASA A;  4EGH A;  1I5D A;  1QZR A;  1YER A;  1I5B A;  1U0Z A;  4GQT A;  2FWY A;  3MNR P;  3C0E A;  3TZ0 A;  3EKO A;  1YSZ A;  4QPK A;  3R4P A;  4CWF A;  3R4N A;  3CGY A;  1Z59 A;  4YKT A;  2BZ5 A;  3ZXO A;  2BU2 A;  3R4M A;  3VAD A;  3SL2 A;  4CWS A;  2BU5 A;  4K4O A;  1OSF A;  2O1V A;  3Q5K A;  4CE2 A;  4CWO A;  1NHI A;  4MPE A;  2YGA A;  5D6P A;  1AH6 A;  3VHA A;  4GFN A;  4XKO A;  3JZ3 A;  5M4E A;  3R92 A;  3TUH A;  2QFO A;  3WHA A;  3HYZ A;  2CH4 A;  4GT8 A;  4XIR A;  4MPC A;  2YI7 A;  4O09 A;  3A0T A;  2YKI A;  1ZXM A;  2XHR A;  1AH8 A;  1GJV A;  2XX2 A;  4FCR A;  3K60 A;  4ASG A;  2BTZ A;  2VWC A;  4KSH A;  2YE8 A;  4ZKI A;  1YSR A;  3TZ5 A;  4YKY A;  1TH8 A;  3EHG A;  4EFU A;  4KP4 A;  2BSM A;  4B6C A;  2CCT A;  2XDX A;  1UYC A;  3A0X A;  1TID A;  4O05 A;  3O6O A;  4MPN A;  3OWB A;  1UYL A;  2VW5 A;  4PU9 A;  4EMV A;  4KSG A;  5FWK A;  3WQ9 A;  4ASF A;  4I5S A;  4AWQ A;  3BM9 A;  2YK2 A;  2VCI A;  4HY6 A;  3FT5 A;  2CCU A;  4LWE A;  3T0Z A;  4HXW A;  4URL A;  3ZXQ A;  1UYH A;  2YE2 A;  4DUH A;  4XD8 A;  2YEE A;  1B62 A;  4E00 A;  4MP7 A;  3U67 A;  3EHF A;  2XDL A;  4JQL A;  1PVG A;  2JJC A;  2IWS A;  4KQV A;  2VCJ A;  4XIQ A;  4JAU A;  1UYG A;  4BQJ A;  2YGE A;  1AMW A;  2YE4 A;  4P7A A;  2YEI A;  4LWI A;  2WI1 A;  1TIL A;  5D7R A;  2E0A A;  1UYE A;  1ZXN A;  2XJJ A;  4GCZ A;  5M4N A;  3CRL A;  4HZ0 A;  4X9L A;  1I5C A;  3INW A;  4MP2 A;  3LPS A;  4U93 A;  4E01 A;  1QY8 A;  4V25 A;  4CE1 A;  2XHT A;  5CF0 A;  2FWZ A;  1UYF A;  1YES A;  2YEJ A;  2YJX A;  2XJX A;  2BRC A;  3O0I A;  3R4O A;  4MOT A;  2GQP A;  1H7S A;  2QG2 A;  3LNU A;  5CTW A;  3RKZ A;  3K98 A;  4LWG A;  5J71 A;  3G7E A;  2XCM A;  2YJW A;  3HZ5 A;  2C2A A;  2YED A;  2IOR A;  4BIZ A;  1AJ6 A;  3GIG A;  3TZ2 A;  3T0H A;  4EGK A;  4R3M A;  4AWP A;  5M4M A;  4E02 A;  4YKU A;  2CCS A;  4W7T A;  1ZWH A;  4PRV A;  1YT1 A;  4L90 A;  4QPJ A;  4B7P A;  3OWD A;  4ZVI A;  4PL9 A;  2Q2E B;  2YE6 A;  4XIT A;  4YKQ A;  1L0O A;  1GKZ A;  3D2R A;  3CWV A;  2WER A;  4YKR A;  2WI3 A;  2XD6 A;  4V26 A;  2WI5 A;  2YKE A;  2YE5 A;  4CWN A;  4URN A;  4KFG A;  3GIG B;  4XCJ A;  2H55 A;  4XE2 A;  3NMQ A;  2QG0 A;  2ZKJ A;  2XJG A;  3A0Z A;  1Y4U A;  2ZBK B;  1ZW9 A;  5IDJ A;  4URM A;  4H7Q A;  4EEH A;  2H8M A;  1B63 A;  2WI2 A;  2IOQ A;  2HKJ A;  2BU8 A;  3T1K A;  1Y8P A;  2YEB A;  4H81 A;  5L3J A;  3OW6 A;  5IDM A;  2AKP A;  3Q5L A;  2WEQ A;  3U2K A;  1Y8N A;  4DZY A;  4EFT A;  5D7D A;  1UYM A;  2CG9 A;  2WI6 A;  2YI6 A;  3O2F A;  4FCQ A;  1BGQ A;  2WI7 A;  4HY1 A;  3C11 A;  1TBW A;  1YT2 A;  3HZ1 A;  4YKW A;  1NHJ A;  5FND A;  4ASB A;  4I3H A;  5F3K A;  3A0W A;  1A4H A;  1YT0 A;  2IOP A;  1YC4 A;  3T2S A;  5CTU A;  2BRE A;  4O07 A;  1YS3 A;  2XHX A;  2XDK A;  4CWQ A;  2JKI A;  3K97 A;  1I58 A;  5D6Q A;  1UYD A;  4MBC A;  3G7B A;  4R3A A;  2BU6 A;  3FT8 A;  2K5B A;  2FXS A;  4AS9 A;  2BYI A;  3GIE A;  3K99 A;  3HEK A;  4YKZ A;  5BOD A;  1Z5B A;  5M4K A;  1GKX A;  3BMY A;  2UWD A;  2YEA A;  5C93 A;  4XCL A;  1TC6 A;  1R62 A;  1YC3 A;  4EM7 A;  1MX0 A;  2YEF A;  5J6A A;  2Q8I A;  1YC1 A;  2QF6 A;  4HYM A;  4CWP A;  2ZDX A;  4XC0 A;  1TC0 A;  3VHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...