1I5AA

Structure of chea domain p4 in complex with adpcp and manganese
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
181
Chain Sequence
GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein, transferase
total genus 57
structure length 181
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i5aA00
2AKPA 2XDLA 4KSGA 3T0HA 4AS9A 1UY8A 5M4MA 1UYGA 4XE2A 4BQGA 3RLQA 2GQPA 4URMA 3HEKA 4DZYA 5CTUA 3A0XA 3JZ3A 3A0YA 4E02A 3Q5JA 2BREA 4EGHA 2YK2A 1ZWHA 2Q2EB 5M4NA 3CRKA 4MOTA 4KTNA 5D6PA 2UWDA 5BOCA 4L90A 5L3JA 4CE3A 2BU6A 3B26A 4HXWA 5IN9A 4PU9A 5D6QA 4CE1A 3H4LA 3TUHA 4ASGA 2BT0A 1YESA 4HZ0A 2ZDYA 3B24A 3R4MA 4HYPA 4PRVA 4HYMA 1BXDA 1TC0A 5D7DA 2YKCA 5FNDA 5IDMA 4HY6A 1I5DA 1I59A 1U0ZA 4JAUA 3ZKBA 2C2AA 2IORA 3FV5A 2XABA 1Y4UA 4EGKA 4YKUA 1KIJA 2WI5A 5J6AA 4KP4A 3B27A 3PEJA 2VCJA 1OSFA 3QTFA 2FWYA 2IWUA 2HCHA 2VW5A 3GIFA 1Y8PA 3HHUA 2YKEA 3OW6A 4KQVA 4XIRA 1AJ6A 1U2OA 3CRLA 4K4OA 5F3KA 3VHAA 1YC4A 5D7CA 2ZKJA 3TZ5A 3R4NA 3KE6A 3B25A 4LPBA 3RKZA 2YGEA 2HKJA 2BYIA 1Z5CA 5BODA 2E0AA 3GIGB 2BU5A 4XCLA 3HZ1A 3TZ0A 3G7BA 2XDKA 1UY6A 2XHXA 4XTJA 2XDSA 1UYFA 3EHFA 3TZ4A 3G75A 3C11A 4LWFA 4O07A 4EGIA 3O0IA 2XJXA 4CWOA 1I5AA 1MU5A 4ASAA 1ZXMA 3BMYA 4JAVA 2XX2A 1UYLA 2Q8FA 2YI5A 4L8ZA 1TC6A 3A0ZA 2O1UA 4P7AA 4U93A 4NH9A 1A4HA 1YT1A 3O2FA 4E00A 4CE2A 3WQ9A 4HY1A 4X9LA 2YKBA 1AMWA 1MX0A 1QYEA 4KSHA 4WUBA 1UYKA 5CPHA 1R62A 1S14A 4XDMA 4QPJA 4MBCA 2YECA 2CCTA 1B62A 3O6OA 4EM7A 2WI6A 4FMTA 1I5CA 2YE9A 1PVGA 3VHDA 2XJGA 2H8MA 4ASBA 4MPEA 1S16A 2FXSA 4R3AA 4PL9A 2WI4A 2BYHA 1Z5AA 4XIQA 1KZNA 2YE8A 4URNA 4H7QA 2IOPA 3NMQA 1QY8A 1UYDA 5M4PA 4YKTA 2YE5A 2BSMA 4EFUA 2XX4A 1TH8A 2YE7A 1UYHA 2CGFA 2WERA 4YKWA 2YKIA 1TILA 2JKIA 4EEHA 1I58A 4L93A 4LP0A 4NH8A 2XJJA 1Z5BA 2YEEA 4B7PA 1UY9A 3GIGA 3HYZA 1TBWA 1Y8OA 4CWQA 2WI7A 4FPPA 3VHCA 3EHJA 4CWPA 3HYYA 4GGLA 2ZDXA 4BQJA 3T0ZA 3DGEA 2XDXA 2YK9A 2WI3A 3BM9A 3D2RA 1Z59A 3OPDA 4GQTA 3EKOA 3WHAA 5CTYA 4URLA 1YT2A 3B28A 1NHIA 5F5RA 2HG1A 1NHJA 4U7NA 1THNA 4I5SA 4XKAA 4AWPA 2WEPA 4BIZA 4KFGA 2YEHA 3U67A 3RLPA 4I3HA 4JQLA 2WI1A 3INXA 4ASFA 3K60A 4CWRA 2XD6A 3T10A 4CWTA 2BZ5A 2QFOA 4EMVA 2YI0A 3R4OA 1BYQA 1UYCA 4XKKA 2O1VA 3VADA 2BU2A 2XCMA 4R1FA 4W7TA 2YJXA 3EHHA 3ZM7A 3K99A 5IDJA 4WUCA 2GFDA 1YC1A 2BU8A 4MB9A 1B3QA 3FT5A 4AWQA 3GIEA 3R92A 2YI6A 2YE3A 4Q20A 1YSRA 2YEGA 4V25A 4DUHA 4JASA 4GT8A 3PEHA 5FNCA 2YEDA 2CCUA 2ESAA 3ZKDA 1H7UA 4HXZA 4E01A 1UYMA 4GFNA 2YKJA 4XCJA 3HZ5A 3H80A 3A0RA 4L94A 3D0BA 1YT0A 1JM6A 5CTWA 1YERA 4EFTA 1B63A 4V26A 4B6CA 3LNUA 4FCQA 2Q8HA 2O1WA 1TIDA 3C0EA 3U2DA 4XIPA 1YS3A 3Q5KA 2YE2A 2YGFA 3RLRA 2XHRA 2PNRA 1UY7A 4MP2A 4GCZA 3CGZA 4PRXA 1ZXNA 4H85A 4YKXA 4ZVIA 1EI1A 4CWSA 1ID0A 1AH6A 4MP7A 4U7OA 3OMUA 4XC0A 3TZ2A 3U2KA 2IWXA 2QG0A 2JJCA 2CH4A 4YKQA 4H81A 2BTZA 2XK2A 2H55A 3ZXQA 3R4PA 3MNRP 1US7A 2EXLA 2BRCA 2YE4A 3EHGA 4HZ5A 1Y4SA 4CWFA 3G7EA 2WEQA 2QF6A 3T1KA 2BU7A 2YI7A 3FT8A 3QDDA 5FNFA 1UYEA 2YEIA 2CG9A 2ZBKB 4AWOA 2XX5A 4XKOA 2Q8IA 3OWBA 2XDUA 1GJVA 2YEFA 2K5BA 2IOQA 5D7RA 3LPSA 5FWKA 2YEAA 4P8OA 3T2SA 3R91A 4BAEA 4O05A 3CWVA 1ZW9A 4L91A 4QPKA 5M4HA 4FCRA 4YKRA 2YEJA 1GKXA 2VWCA 2YJWA 4FCPA 3ZXOA 2WI2A 2QG2A 4CWNA 2YEBA 3D36A 3K97A 4O09A 3CGYA 2VCIA 4R3MA 4XITA 3OWDA 4O0BA 4LWHA 2CCSA 4UROA 3K98A 3TTZA 4MPCA 3SL2A 2IWSA 2YGAA 2Q8GA 4YKYA 3INWA 3Q5LA 1QZRA 1H7SA 4MPNA 1EA6A 1UYIA 1L0OA 4YKZA 1AH8A 5CTXA 1Y8NA 5M4EA 5C93A 5J71A 4LWEA 5M4KA 2FYPA 4O04A 1YSZA 1YC3A 1AM1A 1YETA 4WUDA 2FWZA 4ZKIA 4BXIA 4XD8A 4LWIA 5GGZA 1NHHA 1GKZA 3IEDA 2YE6A 4BIUA 1I5BA 3A0WA 3A0TA 5CF0A 1BKNA 1BGQA 2XHTA 3EKRA 4NH7A 4LWGA 4GEEA
chains in the Genus database with same CATH superfamily
2AKPA 2XDLA 4KSGA 3T0HA 4AS9A 1UY8A 5M4MA 1UYGA 4XE2A 4BQGA 3RLQA 2GQPA 4URMA 3HEKA 4DZYA 5CTUA 3A0XA 3JZ3A 3A0YA 4E02A 3Q5JA 2BREA 4EGHA 2YK2A 1ZWHA 2Q2EB 5M4NA 3CRKA 4MOTA 4KTNA 5D6PA 2UWDA 5BOCA 4L90A 5L3JA 4CE3A 2BU6A 3B26A 4HXWA 5IN9A 4PU9A 5D6QA 4CE1A 3H4LA 2C1GA 4E72A 3TUHA 4ASGA 2BT0A 1YESA 4HZ0A 2ZDYA 3B24A 3R4MA 4HYPA 4PRVA 4HYMA 1BXDA 1TC0A 5D7DA 2YKCA 5FNDA 5IDMA 4HY6A 1I5DA 1I59A 1U0ZA 4JAUA 3ZKBA 2C2AA 2IORA 3FV5A 2XABA 1Y4UA 4EGKA 4YKUA 1KIJA 2WI5A 5J6AA 4KP4A 3B27A 3PEJA 2VCJA 1OSFA 3QTFA 2FWYA 2IWUA 2HCHA 2VW5A 3GIFA 1Y8PA 3HHUA 2YKEA 3OW6A 4KQVA 4XIRA 1AJ6A 1U2OA 3CRLA 4K4OA 5F3KA 3VHAA 1YC4A 5D7CA 2ZKJA 5JENA 3LMMA 3TZ5A 3R4NA 3KE6A 3B25A 4LPBA 3RKZA 2YGEA 2HKJA 2BYIA 1Z5CA 5BODA 2E0AA 3GIGB 2BU5A 4XCLA 3HZ1A 3TZ0A 3G7BA 2XDKA 1UY6A 2XHXA 4XTJA 2XDSA 1UYFA 3EHFA 3TZ4A 3G75A 3C11A 4LWFA 4O07A 4EGIA 3O0IA 2XJXA 4CWOA 1I5AA 1MU5A 4ASAA 1ZXMA 3BMYA 4JAVA 2XX2A 1UYLA 2Q8FA 2YI5A 4L8ZA 1TC6A 3A0ZA 2O1UA 4P7AA 4U93A 4NH9A 1A4HA 1YT1A 3O2FA 4E00A 4CE2A 3WQ9A 4HY1A 4X9LA 2YKBA 1AMWA 1MX0A 1QYEA 4KSHA 4WUBA 1UYKA 5CPHA 1R62A 1S14A 4XDMA 4QPJA 4MBCA 2YECA 2CCTA 1B62A 3O6OA 4EM7A 2WI6A 4FMTA 1I5CA 2YE9A 1PVGA 3VHDA 2XJGA 2H8MA 4ASBA 4MPEA 1S16A 2FXSA 4R3AA 4PL9A 2WI4A 2BYHA 1Z5AA 4XIQA 1KZNA 2YE8A 4URNA 4H7QA 2IOPA 3NMQA 1QY8A 1UYDA 5M4PA 4YKTA 2YE5A 2BSMA 4EFUA 2XX4A 1TH8A 2YE7A 1UYHA 2CGFA 2WERA 4YKWA 2YKIA 1TILA 2JKIA 4EEHA 1I58A 4L93A 4LP0A 4NH8A 2XJJA 1Z5BA 2YEEA 4B7PA 1UY9A 3GIGA 3HYZA 1TBWA 1Y8OA 4CWQA 2WI7A 4FPPA 3VHCA 3EHJA 4CWPA 3HYYA 4GGLA 2ZDXA 4BQJA 3T0ZA 3DGEA 2XDXA 2YK9A 2WI3A 3BM9A 3D2RA 1Z59A 3OPDA 4GQTA 3EKOA 3WHAA 5CTYA 4URLA 1YT2A 3B28A 1NHIA 5F5RA 2HG1A 1NHJA 4U7NA 1THNA 4I5SA 4XKAA 4AWPA 2WEPA 4BIZA 4KFGA 2YEHA 3U67A 3RLPA 4I3HA 1IXMA 4JQLA 2WI1A 3INXA 4ASFA 3K60A 4CWRA 2XD6A 2C1IA 3T10A 4CWTA 2BZ5A 2QFOA 4EMVA 2YI0A 3R4OA 1BYQA 1UYCA 4XKKA 2O1VA 3VADA 2BU2A 2XCMA 4R1FA 4W7TA 2YJXA 3EHHA 3ZM7A 3K99A 5IDJA 4WUCA 2GFDA 1YC1A 2BU8A 4MB9A 1B3QA 3FT5A 4AWQA 3GIEA 3R92A 2YI6A 2YE3A 4Q20A 1YSRA 2YEGA 4V25A 4DUHA 4JASA 4GT8A 3PEHA 5FNCA 2YEDA 2CCUA 1F51A 2ESAA 3ZKDA 1H7UA 4HXZA 4E01A 1UYMA 4GFNA 2YKJA 4XCJA 3HZ5A 3H80A 3A0RA 4L94A 3D0BA 1YT0A 1JM6A 5CTWA 1YERA 4EFTA 1B63A 4V26A 4B6CA 3LNUA 4FCQA 2Q8HA 2O1WA 1TIDA 3C0EA 3U2DA 4XIPA 1YS3A 3Q5KA 2YE2A 2YGFA 3RLRA 2XHRA 2PNRA 1UY7A 4MP2A 4GCZA 3CGZA 4PRXA 1ZXNA 4H85A 4YKXA 4ZVIA 1EI1A 4CWSA 1ID0A 1AH6A 4MP7A 4U7OA 3OMUA 4XC0A 3TZ2A 3U2KA 2IWXA 2QG0A 2JJCA 2CH4A 4YKQA 4H81A 2BTZA 2XK2A 2H55A 3ZXQA 3R4PA 3MNRP 1US7A 2EXLA 2BRCA 2YE4A 3EHGA 4HZ5A 1Y4SA 4CWFA 2FTKA 3G7EA 2WEQA 2QF6A 3T1KA 2BU7A 2YI7A 3FT8A 3QDDA 5FNFA 1UYEA 2YEIA 2CG9A 2ZBKB 4AWOA 2XX5A 4XKOA 2Q8IA 3OWBA 2XDUA 1GJVA 2YEFA 2K5BA 2IOQA 5D7RA 3LPSA 5FWKA 2YEAA 4P8OA 3T2SA 3R91A 4BAEA 4O05A 3CWVA 1ZW9A 4L91A 4QPKA 5M4HA 4FCRA 4YKRA 2YEJA 1GKXA 2VWCA 2YJWA 4FCPA 3ZXOA 2WI2A 2QG2A 4CWNA 2YEBA 3D36A 3K97A 4O09A 3CGYA 2VCIA 4R3MA 4XITA 3OWDA 4O0BA 4LWHA 2CCSA 4UROA 3K98A 3TTZA 4MPCA 3SL2A 2IWSA 2YGAA 2Q8GA 4YKYA 3INWA 3Q5LA 2HHIA 1QZRA 1H7SA 4MPNA 1EA6A 1UYIA 1L0OA 4YKZA 1AH8A 5CTXA 1Y8NA 5M4EA 5C93A 3CYGA 5J71A 4LWEA 3S5TA 2FYPA 5M4KA 4O04A 1YSZA 1YC3A 1AM1A 1YETA 4WUDA 2FWZA 4ZKIA 4BXIA 4XD8A 4LWIA 5GGZA 1NHHA 1GKZA 3IEDA 2YE6A 4BIUA 1I5BA 3A0WA 3A0TA 5CF0A 1BKNA 1BGQA 2XHTA 3EKRA 4NH7A 4LWGA 4GEEA
chains in the Genus database with same CATH topology
2AKPA 2XDLA 4KSGA 3T0HA 4AS9A 1UY8A 5M4MA 1UYGA 4XE2A 4BQGA 3RLQA 2GQPA 4URMA 3HEKA 4DZYA 5CTUA 3A0XA 3JZ3A 3A0YA 4E02A 3Q5JA 2BREA 4EGHA 2YK2A 1ZWHA 2Q2EB 5M4NA 3CRKA 4MOTA 4KTNA 5D6PA 2UWDA 5BOCA 4L90A 5L3JA 4CE3A 2BU6A 3B26A 4HXWA 5IN9A 4PU9A 5D6QA 4CE1A 3H4LA 3TUHA 4ASGA 2BT0A 1YESA 4HZ0A 2ZDYA 3B24A 3R4MA 4HYPA 4PRVA 4HYMA 1BXDA 1TC0A 5D7DA 2YKCA 5FNDA 5IDMA 4HY6A 1I5DA 1I59A 1U0ZA 4JAUA 3ZKBA 2C2AA 2IORA 3FV5A 2XABA 1Y4UA 4EGKA 4YKUA 1KIJA 2WI5A 5J6AA 4KP4A 3B27A 3PEJA 2VCJA 1OSFA 3QTFA 2FWYA 2IWUA 2HCHA 2VW5A 3GIFA 1Y8PA 3HHUA 2YKEA 3OW6A 4KQVA 4XIRA 1AJ6A 1U2OA 3CRLA 4K4OA 5F3KA 3VHAA 1YC4A 5D7CA 2ZKJA 3TZ5A 3R4NA 3KE6A 3B25A 4LPBA 3RKZA 2YGEA 2HKJA 2BYIA 1Z5CA 5BODA 2E0AA 3GIGB 2BU5A 4XCLA 3HZ1A 3TZ0A 3G7BA 2XDKA 1UY6A 2XHXA 4XTJA 2XDSA 1UYFA 3EHFA 3TZ4A 3G75A 3C11A 4LWFA 4O07A 4EGIA 3O0IA 2XJXA 4CWOA 1I5AA 1MU5A 4ASAA 1ZXMA 3BMYA 4JAVA 2XX2A 1UYLA 2Q8FA 2YI5A 4L8ZA 1TC6A 3A0ZA 2O1UA 4P7AA 4U93A 4NH9A 1A4HA 1YT1A 3O2FA 4E00A 4CE2A 3WQ9A 4HY1A 4X9LA 2YKBA 1AMWA 1MX0A 1QYEA 4KSHA 4WUBA 1UYKA 5CPHA 1R62A 1S14A 4XDMA 4QPJA 4MBCA 2YECA 2CCTA 1B62A 3O6OA 4EM7A 2WI6A 4FMTA 1I5CA 2YE9A 1PVGA 3VHDA 2XJGA 2H8MA 4ASBA 4MPEA 1S16A 2FXSA 4R3AA 4PL9A 2WI4A 2BYHA 1Z5AA 4XIQA 1KZNA 2YE8A 4URNA 4H7QA 2IOPA 3NMQA 1QY8A 1UYDA 5M4PA 4YKTA 2YE5A 2BSMA 4EFUA 2XX4A 1TH8A 2YE7A 1UYHA 2CGFA 2WERA 4YKWA 2YKIA 1TILA 2JKIA 4EEHA 1I58A 4L93A 4LP0A 4NH8A 2XJJA 1Z5BA 2YEEA 4B7PA 1UY9A 3GIGA 3HYZA 1TBWA 1Y8OA 4CWQA 2WI7A 4FPPA 3VHCA 3EHJA 4CWPA 3HYYA 4GGLA 2ZDXA 4BQJA 3T0ZA 3DGEA 2XDXA 2YK9A 2WI3A 3BM9A 3D2RA 1Z59A 3OPDA 4GQTA 3EKOA 3WHAA 5CTYA 4URLA 1YT2A 3B28A 1NHIA 5F5RA 2HG1A 1NHJA 4U7NA 1THNA 4I5SA 4XKAA 4AWPA 2WEPA 4BIZA 4KFGA 2YEHA 3U67A 3RLPA 4I3HA 4JQLA 2WI1A 3INXA 4ASFA 3K60A 4CWRA 2XD6A 3T10A 4CWTA 2BZ5A 2QFOA 4EMVA 2YI0A 3R4OA 1BYQA 1UYCA 4XKKA 2O1VA 3VADA 2BU2A 2XCMA 4R1FA 4W7TA 2YJXA 3EHHA 3ZM7A 3K99A 5IDJA 4WUCA 2GFDA 1YC1A 2BU8A 4MB9A 1B3QA 3FT5A 4AWQA 3GIEA 3R92A 2YI6A 2YE3A 4Q20A 1YSRA 2YEGA 4V25A 4DUHA 4JASA 4GT8A 3PEHA 5FNCA 2YEDA 2CCUA 2ESAA 3ZKDA 1H7UA 4HXZA 4E01A 1UYMA 4GFNA 2YKJA 4XCJA 3HZ5A 3H80A 3A0RA 4L94A 3D0BA 1YT0A 1JM6A 5CTWA 1YERA 4EFTA 1B63A 4V26A 4B6CA 3LNUA 4FCQA 2Q8HA 2O1WA 1TIDA 3C0EA 3U2DA 4XIPA 1YS3A 3Q5KA 2YE2A 2YGFA 3RLRA 2XHRA 2PNRA 1UY7A 4MP2A 4GCZA 3CGZA 4PRXA 1ZXNA 4H85A 4YKXA 4ZVIA 1EI1A 4CWSA 1ID0A 1AH6A 4MP7A 4U7OA 3OMUA 4XC0A 3TZ2A 3U2KA 2IWXA 2QG0A 2JJCA 2CH4A 4YKQA 4H81A 2BTZA 2XK2A 2H55A 3ZXQA 3R4PA 3MNRP 1US7A 2EXLA 2BRCA 2YE4A 3EHGA 4HZ5A 1Y4SA 4CWFA 3G7EA 2WEQA 2QF6A 3T1KA 2BU7A 2YI7A 3FT8A 3QDDA 5FNFA 1UYEA 2YEIA 2CG9A 2ZBKB 4AWOA 2XX5A 4XKOA 2Q8IA 3OWBA 2XDUA 1GJVA 2YEFA 2K5BA 2IOQA 5D7RA 3LPSA 5FWKA 2YEAA 4P8OA 3T2SA 3R91A 4BAEA 4O05A 3CWVA 1ZW9A 4L91A 4QPKA 5M4HA 4FCRA 4YKRA 2YEJA 1GKXA 2VWCA 2YJWA 4FCPA 3ZXOA 2WI2A 2QG2A 4CWNA 2YEBA 3D36A 3K97A 4O09A 3CGYA 2VCIA 4R3MA 4XITA 3OWDA 4O0BA 4LWHA 2CCSA 4UROA 3K98A 3TTZA 4MPCA 3SL2A 2IWSA 2YGAA 2Q8GA 4YKYA 3INWA 3Q5LA 1QZRA 1H7SA 4MPNA 1EA6A 1UYIA 1L0OA 4YKZA 1AH8A 5CTXA 1Y8NA 5M4EA 5C93A 5J71A 4LWEA 5M4KA 2FYPA 4O04A 1YSZA 1YC3A 1AM1A 1YETA 4WUDA 2FWZA 4ZKIA 4BXIA 4XD8A 4LWIA 5GGZA 1NHHA 1GKZA 3IEDA 2YE6A 4BIUA 1I5BA 3A0WA 3A0TA 5CF0A 1BKNA 1BGQA 2XHTA 3EKRA 4NH7A 4LWGA 4GEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AKP A;  2XDL A;  4KSG A;  3T0H A;  4AS9 A;  1UY8 A;  5M4M A;  1UYG A;  4XE2 A;  4BQG A;  3RLQ A;  2GQP A;  4URM A;  3HEK A;  4DZY A;  5CTU A;  3A0X A;  3JZ3 A;  3A0Y A;  4E02 A;  3Q5J A;  2BRE A;  4EGH A;  2YK2 A;  1ZWH A;  2Q2E B;  5M4N A;  3CRK A;  4MOT A;  4KTN A;  5D6P A;  2UWD A;  5BOC A;  4L90 A;  5L3J A;  4CE3 A;  2BU6 A;  3B26 A;  4HXW A;  5IN9 A;  4PU9 A;  5D6Q A;  4CE1 A;  3H4L A;  3TUH A;  4ASG A;  2BT0 A;  1YES A;  4HZ0 A;  2ZDY A;  3B24 A;  3R4M A;  4HYP A;  4PRV A;  4HYM A;  1BXD A;  1TC0 A;  5D7D A;  2YKC A;  5FND A;  5IDM A;  4HY6 A;  1I5D A;  1I59 A;  1U0Z A;  4JAU A;  3ZKB A;  2C2A A;  2IOR A;  3FV5 A;  2XAB A;  1Y4U A;  4EGK A;  4YKU A;  1KIJ A;  2WI5 A;  5J6A A;  4KP4 A;  3B27 A;  3PEJ A;  2VCJ A;  1OSF A;  3QTF A;  2FWY A;  2IWU A;  2HCH A;  2VW5 A;  3GIF A;  1Y8P A;  3HHU A;  2YKE A;  3OW6 A;  4KQV A;  4XIR A;  1AJ6 A;  1U2O A;  3CRL A;  4K4O A;  5F3K A;  3VHA A;  1YC4 A;  5D7C A;  2ZKJ A;  3TZ5 A;  3R4N A;  3KE6 A;  3B25 A;  4LPB A;  3RKZ A;  2YGE A;  2HKJ A;  2BYI A;  1Z5C A;  5BOD A;  2E0A A;  3GIG B;  2BU5 A;  4XCL A;  3HZ1 A;  3TZ0 A;  3G7B A;  2XDK A;  1UY6 A;  2XHX A;  4XTJ A;  2XDS A;  1UYF A;  3EHF A;  3TZ4 A;  3G75 A;  3C11 A;  4LWF A;  4O07 A;  4EGI A;  3O0I A;  2XJX A;  4CWO A;  1I5A A;  1MU5 A;  4ASA A;  1ZXM A;  3BMY A;  4JAV A;  2XX2 A;  1UYL A;  2Q8F A;  2YI5 A;  4L8Z A;  1TC6 A;  3A0Z A;  2O1U A;  4P7A A;  4U93 A;  4NH9 A;  1A4H A;  1YT1 A;  3O2F A;  4E00 A;  4CE2 A;  3WQ9 A;  4HY1 A;  4X9L A;  2YKB A;  1AMW A;  1MX0 A;  1QYE A;  4KSH A;  4WUB A;  1UYK A;  5CPH A;  1R62 A;  1S14 A;  4XDM A;  4QPJ A;  4MBC A;  2YEC A;  2CCT A;  1B62 A;  3O6O A;  4EM7 A;  2WI6 A;  4FMT A;  1I5C A;  2YE9 A;  1PVG A;  3VHD A;  2XJG A;  2H8M A;  4ASB A;  4MPE A;  1S16 A;  2FXS A;  4R3A A;  4PL9 A;  2WI4 A;  2BYH A;  1Z5A A;  4XIQ A;  1KZN A;  2YE8 A;  4URN A;  4H7Q A;  2IOP A;  3NMQ A;  1QY8 A;  1UYD A;  5M4P A;  4YKT A;  2YE5 A;  2BSM A;  4EFU A;  2XX4 A;  1TH8 A;  2YE7 A;  1UYH A;  2CGF A;  2WER A;  4YKW A;  2YKI A;  1TIL A;  2JKI A;  4EEH A;  1I58 A;  4L93 A;  4LP0 A;  4NH8 A;  2XJJ A;  1Z5B A;  2YEE A;  4B7P A;  1UY9 A;  3GIG A;  3HYZ A;  1TBW A;  1Y8O A;  4CWQ A;  2WI7 A;  4FPP A;  3VHC A;  3EHJ A;  4CWP A;  3HYY A;  4GGL A;  2ZDX A;  4BQJ A;  3T0Z A;  3DGE A;  2XDX A;  2YK9 A;  2WI3 A;  3BM9 A;  3D2R A;  1Z59 A;  3OPD A;  4GQT A;  3EKO A;  3WHA A;  5CTY A;  4URL A;  1YT2 A;  3B28 A;  1NHI A;  5F5R A;  2HG1 A;  1NHJ A;  4U7N A;  1THN A;  4I5S A;  4XKA A;  4AWP A;  2WEP A;  4BIZ A;  4KFG A;  2YEH A;  3U67 A;  3RLP A;  4I3H A;  4JQL A;  2WI1 A;  3INX A;  4ASF A;  3K60 A;  4CWR A;  2XD6 A;  3T10 A;  4CWT A;  2BZ5 A;  2QFO A;  4EMV A;  2YI0 A;  3R4O A;  1BYQ A;  1UYC A;  4XKK A;  2O1V A;  3VAD A;  2BU2 A;  2XCM A;  4R1F A;  4W7T A;  2YJX A;  3EHH A;  3ZM7 A;  3K99 A;  5IDJ A;  4WUC A;  2GFD A;  1YC1 A;  2BU8 A;  4MB9 A;  1B3Q A;  3FT5 A;  4AWQ A;  3GIE A;  3R92 A;  2YI6 A;  2YE3 A;  4Q20 A;  1YSR A;  2YEG A;  4V25 A;  4DUH A;  4JAS A;  4GT8 A;  3PEH A;  5FNC A;  2YED A;  2CCU A;  2ESA A;  3ZKD A;  1H7U A;  4HXZ A;  4E01 A;  1UYM A;  4GFN A;  2YKJ A;  4XCJ A;  3HZ5 A;  3H80 A;  3A0R A;  4L94 A;  3D0B A;  1YT0 A;  1JM6 A;  5CTW A;  1YER A;  4EFT A;  1B63 A;  4V26 A;  4B6C A;  3LNU A;  4FCQ A;  2Q8H A;  2O1W A;  1TID A;  3C0E A;  3U2D A;  4XIP A;  1YS3 A;  3Q5K A;  2YE2 A;  2YGF A;  3RLR A;  2XHR A;  2PNR A;  1UY7 A;  4MP2 A;  4GCZ A;  3CGZ A;  4PRX A;  1ZXN A;  4H85 A;  4YKX A;  4ZVI A;  1EI1 A;  4CWS A;  1ID0 A;  1AH6 A;  4MP7 A;  4U7O A;  3OMU A;  4XC0 A;  3TZ2 A;  3U2K A;  2IWX A;  2QG0 A;  2JJC A;  2CH4 A;  4YKQ A;  4H81 A;  2BTZ A;  2XK2 A;  2H55 A;  3ZXQ A;  3R4P A;  3MNR P;  1US7 A;  2EXL A;  2BRC A;  2YE4 A;  3EHG A;  4HZ5 A;  1Y4S A;  4CWF A;  3G7E A;  2WEQ A;  2QF6 A;  3T1K A;  2BU7 A;  2YI7 A;  3FT8 A;  3QDD A;  5FNF A;  1UYE A;  2YEI A;  2CG9 A;  2ZBK B;  4AWO A;  2XX5 A;  4XKO A;  2Q8I A;  3OWB A;  2XDU A;  1GJV A;  2YEF A;  2K5B A;  2IOQ A;  5D7R A;  3LPS A;  5FWK A;  2YEA A;  4P8O A;  3T2S A;  3R91 A;  4BAE A;  4O05 A;  3CWV A;  1ZW9 A;  4L91 A;  4QPK A;  5M4H A;  4FCR A;  4YKR A;  2YEJ A;  1GKX A;  2VWC A;  2YJW A;  4FCP A;  3ZXO A;  2WI2 A;  2QG2 A;  4CWN A;  2YEB A;  3D36 A;  3K97 A;  4O09 A;  3CGY A;  2VCI A;  4R3M A;  4XIT A;  3OWD A;  4O0B A;  4LWH A;  2CCS A;  4URO A;  3K98 A;  3TTZ A;  4MPC A;  3SL2 A;  2IWS A;  2YGA A;  2Q8G A;  4YKY A;  3INW A;  3Q5L A;  1QZR A;  1H7S A;  4MPN A;  1EA6 A;  1UYI A;  1L0O A;  4YKZ A;  1AH8 A;  5CTX A;  1Y8N A;  5M4E A;  5C93 A;  5J71 A;  4LWE A;  5M4K A;  2FYP A;  4O04 A;  1YSZ A;  1YC3 A;  1AM1 A;  1YET A;  4WUD A;  2FWZ A;  4ZKI A;  4BXI A;  4XD8 A;  4LWI A;  5GGZ A;  1NHH A;  1GKZ A;  3IED A;  2YE6 A;  4BIU A;  1I5B A;  3A0W A;  3A0T A;  5CF0 A;  1BKN A;  1BGQ A;  2XHT A;  3EKR A;  4NH7 A;  4LWG A;  4GEE A; 
#chains in the Genus database with same CATH topology
 2AKP A;  2XDL A;  4KSG A;  3T0H A;  4AS9 A;  1UY8 A;  5M4M A;  1UYG A;  4XE2 A;  4BQG A;  3RLQ A;  2GQP A;  4URM A;  3HEK A;  4DZY A;  5CTU A;  3A0X A;  3JZ3 A;  3A0Y A;  4E02 A;  3Q5J A;  2BRE A;  4EGH A;  2YK2 A;  1ZWH A;  2Q2E B;  5M4N A;  3CRK A;  4MOT A;  4KTN A;  5D6P A;  2UWD A;  5BOC A;  4L90 A;  5L3J A;  4CE3 A;  2BU6 A;  3B26 A;  4HXW A;  5IN9 A;  4PU9 A;  5D6Q A;  4CE1 A;  3H4L A;  2C1G A;  4E72 A;  3TUH A;  4ASG A;  2BT0 A;  1YES A;  4HZ0 A;  2ZDY A;  3B24 A;  3R4M A;  4HYP A;  4PRV A;  4HYM A;  1BXD A;  1TC0 A;  5D7D A;  2YKC A;  5FND A;  5IDM A;  4HY6 A;  1I5D A;  1I59 A;  1U0Z A;  4JAU A;  3ZKB A;  2C2A A;  2IOR A;  3FV5 A;  2XAB A;  1Y4U A;  4EGK A;  4YKU A;  1KIJ A;  2WI5 A;  5J6A A;  4KP4 A;  3B27 A;  3PEJ A;  2VCJ A;  1OSF A;  3QTF A;  2FWY A;  2IWU A;  2HCH A;  2VW5 A;  3GIF A;  1Y8P A;  3HHU A;  2YKE A;  3OW6 A;  4KQV A;  4XIR A;  1AJ6 A;  1U2O A;  3CRL A;  4K4O A;  5F3K A;  3VHA A;  1YC4 A;  5D7C A;  2ZKJ A;  5JEN A;  3LMM A;  3TZ5 A;  3R4N A;  3KE6 A;  3B25 A;  4LPB A;  3RKZ A;  2YGE A;  2HKJ A;  2BYI A;  1Z5C A;  5BOD A;  2E0A A;  3GIG B;  2BU5 A;  4XCL A;  3HZ1 A;  3TZ0 A;  3G7B A;  2XDK A;  1UY6 A;  2XHX A;  4XTJ A;  2XDS A;  1UYF A;  3EHF A;  3TZ4 A;  3G75 A;  3C11 A;  4LWF A;  4O07 A;  4EGI A;  3O0I A;  2XJX A;  4CWO A;  1I5A A;  1MU5 A;  4ASA A;  1ZXM A;  3BMY A;  4JAV A;  2XX2 A;  1UYL A;  2Q8F A;  2YI5 A;  4L8Z A;  1TC6 A;  3A0Z A;  2O1U A;  4P7A A;  4U93 A;  4NH9 A;  1A4H A;  1YT1 A;  3O2F A;  4E00 A;  4CE2 A;  3WQ9 A;  4HY1 A;  4X9L A;  2YKB A;  1AMW A;  1MX0 A;  1QYE A;  4KSH A;  4WUB A;  1UYK A;  5CPH A;  1R62 A;  1S14 A;  4XDM A;  4QPJ A;  4MBC A;  2YEC A;  2CCT A;  1B62 A;  3O6O A;  4EM7 A;  2WI6 A;  4FMT A;  1I5C A;  2YE9 A;  1PVG A;  3VHD A;  2XJG A;  2H8M A;  4ASB A;  4MPE A;  1S16 A;  2FXS A;  4R3A A;  4PL9 A;  2WI4 A;  2BYH A;  1Z5A A;  4XIQ A;  1KZN A;  2YE8 A;  4URN A;  4H7Q A;  2IOP A;  3NMQ A;  1QY8 A;  1UYD A;  5M4P A;  4YKT A;  2YE5 A;  2BSM A;  4EFU A;  2XX4 A;  1TH8 A;  2YE7 A;  1UYH A;  2CGF A;  2WER A;  4YKW A;  2YKI A;  1TIL A;  2JKI A;  4EEH A;  1I58 A;  4L93 A;  4LP0 A;  4NH8 A;  2XJJ A;  1Z5B A;  2YEE A;  4B7P A;  1UY9 A;  3GIG A;  3HYZ A;  1TBW A;  1Y8O A;  4CWQ A;  2WI7 A;  4FPP A;  3VHC A;  3EHJ A;  4CWP A;  3HYY A;  4GGL A;  2ZDX A;  4BQJ A;  3T0Z A;  3DGE A;  2XDX A;  2YK9 A;  2WI3 A;  3BM9 A;  3D2R A;  1Z59 A;  3OPD A;  4GQT A;  3EKO A;  3WHA A;  5CTY A;  4URL A;  1YT2 A;  3B28 A;  1NHI A;  5F5R A;  2HG1 A;  1NHJ A;  4U7N A;  1THN A;  4I5S A;  4XKA A;  4AWP A;  2WEP A;  4BIZ A;  4KFG A;  2YEH A;  3U67 A;  3RLP A;  4I3H A;  1IXM A;  4JQL A;  2WI1 A;  3INX A;  4ASF A;  3K60 A;  4CWR A;  2XD6 A;  2C1I A;  3T10 A;  4CWT A;  2BZ5 A;  2QFO A;  4EMV A;  2YI0 A;  3R4O A;  1BYQ A;  1UYC A;  4XKK A;  2O1V A;  3VAD A;  2BU2 A;  2XCM A;  4R1F A;  4W7T A;  2YJX A;  3EHH A;  3ZM7 A;  3K99 A;  5IDJ A;  4WUC A;  2GFD A;  1YC1 A;  2BU8 A;  4MB9 A;  1B3Q A;  3FT5 A;  4AWQ A;  3GIE A;  3R92 A;  2YI6 A;  2YE3 A;  4Q20 A;  1YSR A;  2YEG A;  4V25 A;  4DUH A;  4JAS A;  4GT8 A;  3PEH A;  5FNC A;  2YED A;  2CCU A;  1F51 A;  2ESA A;  3ZKD A;  1H7U A;  4HXZ A;  4E01 A;  1UYM A;  4GFN A;  2YKJ A;  4XCJ A;  3HZ5 A;  3H80 A;  3A0R A;  4L94 A;  3D0B A;  1YT0 A;  1JM6 A;  5CTW A;  1YER A;  4EFT A;  1B63 A;  4V26 A;  4B6C A;  3LNU A;  4FCQ A;  2Q8H A;  2O1W A;  1TID A;  3C0E A;  3U2D A;  4XIP A;  1YS3 A;  3Q5K A;  2YE2 A;  2YGF A;  3RLR A;  2XHR A;  2PNR A;  1UY7 A;  4MP2 A;  4GCZ A;  3CGZ A;  4PRX A;  1ZXN A;  4H85 A;  4YKX A;  4ZVI A;  1EI1 A;  4CWS A;  1ID0 A;  1AH6 A;  4MP7 A;  4U7O A;  3OMU A;  4XC0 A;  3TZ2 A;  3U2K A;  2IWX A;  2QG0 A;  2JJC A;  2CH4 A;  4YKQ A;  4H81 A;  2BTZ A;  2XK2 A;  2H55 A;  3ZXQ A;  3R4P A;  3MNR P;  1US7 A;  2EXL A;  2BRC A;  2YE4 A;  3EHG A;  4HZ5 A;  1Y4S A;  4CWF A;  2FTK A;  3G7E A;  2WEQ A;  2QF6 A;  3T1K A;  2BU7 A;  2YI7 A;  3FT8 A;  3QDD A;  5FNF A;  1UYE A;  2YEI A;  2CG9 A;  2ZBK B;  4AWO A;  2XX5 A;  4XKO A;  2Q8I A;  3OWB A;  2XDU A;  1GJV A;  2YEF A;  2K5B A;  2IOQ A;  5D7R A;  3LPS A;  5FWK A;  2YEA A;  4P8O A;  3T2S A;  3R91 A;  4BAE A;  4O05 A;  3CWV A;  1ZW9 A;  4L91 A;  4QPK A;  5M4H A;  4FCR A;  4YKR A;  2YEJ A;  1GKX A;  2VWC A;  2YJW A;  4FCP A;  3ZXO A;  2WI2 A;  2QG2 A;  4CWN A;  2YEB A;  3D36 A;  3K97 A;  4O09 A;  3CGY A;  2VCI A;  4R3M A;  4XIT A;  3OWD A;  4O0B A;  4LWH A;  2CCS A;  4URO A;  3K98 A;  3TTZ A;  4MPC A;  3SL2 A;  2IWS A;  2YGA A;  2Q8G A;  4YKY A;  3INW A;  3Q5L A;  2HHI A;  1QZR A;  1H7S A;  4MPN A;  1EA6 A;  1UYI A;  1L0O A;  4YKZ A;  1AH8 A;  5CTX A;  1Y8N A;  5M4E A;  5C93 A;  3CYG A;  5J71 A;  4LWE A;  3S5T A;  2FYP A;  5M4K A;  4O04 A;  1YSZ A;  1YC3 A;  1AM1 A;  1YET A;  4WUD A;  2FWZ A;  4ZKI A;  4BXI A;  4XD8 A;  4LWI A;  5GGZ A;  1NHH A;  1GKZ A;  3IED A;  2YE6 A;  4BIU A;  1I5B A;  3A0W A;  3A0T A;  5CF0 A;  1BKN A;  1BGQ A;  2XHT A;  3EKR A;  4NH7 A;  4LWG A;  4GEE A; 
#chains in the Genus database with same CATH homology
 2AKP A;  2XDL A;  4KSG A;  3T0H A;  4AS9 A;  1UY8 A;  5M4M A;  1UYG A;  4XE2 A;  4BQG A;  3RLQ A;  2GQP A;  4URM A;  3HEK A;  4DZY A;  5CTU A;  3A0X A;  3JZ3 A;  3A0Y A;  4E02 A;  3Q5J A;  2BRE A;  4EGH A;  2YK2 A;  1ZWH A;  2Q2E B;  5M4N A;  3CRK A;  4MOT A;  4KTN A;  5D6P A;  2UWD A;  5BOC A;  4L90 A;  5L3J A;  4CE3 A;  2BU6 A;  3B26 A;  4HXW A;  5IN9 A;  4PU9 A;  5D6Q A;  4CE1 A;  3H4L A;  3TUH A;  4ASG A;  2BT0 A;  1YES A;  4HZ0 A;  2ZDY A;  3B24 A;  3R4M A;  4HYP A;  4PRV A;  4HYM A;  1BXD A;  1TC0 A;  5D7D A;  2YKC A;  5FND A;  5IDM A;  4HY6 A;  1I5D A;  1I59 A;  1U0Z A;  4JAU A;  3ZKB A;  2C2A A;  2IOR A;  3FV5 A;  2XAB A;  1Y4U A;  4EGK A;  4YKU A;  1KIJ A;  2WI5 A;  5J6A A;  4KP4 A;  3B27 A;  3PEJ A;  2VCJ A;  1OSF A;  3QTF A;  2FWY A;  2IWU A;  2HCH A;  2VW5 A;  3GIF A;  1Y8P A;  3HHU A;  2YKE A;  3OW6 A;  4KQV A;  4XIR A;  1AJ6 A;  1U2O A;  3CRL A;  4K4O A;  5F3K A;  3VHA A;  1YC4 A;  5D7C A;  2ZKJ A;  3TZ5 A;  3R4N A;  3KE6 A;  3B25 A;  4LPB A;  3RKZ A;  2YGE A;  2HKJ A;  2BYI A;  1Z5C A;  5BOD A;  2E0A A;  3GIG B;  2BU5 A;  4XCL A;  3HZ1 A;  3TZ0 A;  3G7B A;  2XDK A;  1UY6 A;  2XHX A;  4XTJ A;  2XDS A;  1UYF A;  3EHF A;  3TZ4 A;  3G75 A;  3C11 A;  4LWF A;  4O07 A;  4EGI A;  3O0I A;  2XJX A;  4CWO A;  1I5A A;  1MU5 A;  4ASA A;  1ZXM A;  3BMY A;  4JAV A;  2XX2 A;  1UYL A;  2Q8F A;  2YI5 A;  4L8Z A;  1TC6 A;  3A0Z A;  2O1U A;  4P7A A;  4U93 A;  4NH9 A;  1A4H A;  1YT1 A;  3O2F A;  4E00 A;  4CE2 A;  3WQ9 A;  4HY1 A;  4X9L A;  2YKB A;  1AMW A;  1MX0 A;  1QYE A;  4KSH A;  4WUB A;  1UYK A;  5CPH A;  1R62 A;  1S14 A;  4XDM A;  4QPJ A;  4MBC A;  2YEC A;  2CCT A;  1B62 A;  3O6O A;  4EM7 A;  2WI6 A;  4FMT A;  1I5C A;  2YE9 A;  1PVG A;  3VHD A;  2XJG A;  2H8M A;  4ASB A;  4MPE A;  1S16 A;  2FXS A;  4R3A A;  4PL9 A;  2WI4 A;  2BYH A;  1Z5A A;  4XIQ A;  1KZN A;  2YE8 A;  4URN A;  4H7Q A;  2IOP A;  3NMQ A;  1QY8 A;  1UYD A;  5M4P A;  4YKT A;  2YE5 A;  2BSM A;  4EFU A;  2XX4 A;  1TH8 A;  2YE7 A;  1UYH A;  2CGF A;  2WER A;  4YKW A;  2YKI A;  1TIL A;  2JKI A;  4EEH A;  1I58 A;  4L93 A;  4LP0 A;  4NH8 A;  2XJJ A;  1Z5B A;  2YEE A;  4B7P A;  1UY9 A;  3GIG A;  3HYZ A;  1TBW A;  1Y8O A;  4CWQ A;  2WI7 A;  4FPP A;  3VHC A;  3EHJ A;  4CWP A;  3HYY A;  4GGL A;  2ZDX A;  4BQJ A;  3T0Z A;  3DGE A;  2XDX A;  2YK9 A;  2WI3 A;  3BM9 A;  3D2R A;  1Z59 A;  3OPD A;  4GQT A;  3EKO A;  3WHA A;  5CTY A;  4URL A;  1YT2 A;  3B28 A;  1NHI A;  5F5R A;  2HG1 A;  1NHJ A;  4U7N A;  1THN A;  4I5S A;  4XKA A;  4AWP A;  2WEP A;  4BIZ A;  4KFG A;  2YEH A;  3U67 A;  3RLP A;  4I3H A;  4JQL A;  2WI1 A;  3INX A;  4ASF A;  3K60 A;  4CWR A;  2XD6 A;  3T10 A;  4CWT A;  2BZ5 A;  2QFO A;  4EMV A;  2YI0 A;  3R4O A;  1BYQ A;  1UYC A;  4XKK A;  2O1V A;  3VAD A;  2BU2 A;  2XCM A;  4R1F A;  4W7T A;  2YJX A;  3EHH A;  3ZM7 A;  3K99 A;  5IDJ A;  4WUC A;  2GFD A;  1YC1 A;  2BU8 A;  4MB9 A;  1B3Q A;  3FT5 A;  4AWQ A;  3GIE A;  3R92 A;  2YI6 A;  2YE3 A;  4Q20 A;  1YSR A;  2YEG A;  4V25 A;  4DUH A;  4JAS A;  4GT8 A;  3PEH A;  5FNC A;  2YED A;  2CCU A;  2ESA A;  3ZKD A;  1H7U A;  4HXZ A;  4E01 A;  1UYM A;  4GFN A;  2YKJ A;  4XCJ A;  3HZ5 A;  3H80 A;  3A0R A;  4L94 A;  3D0B A;  1YT0 A;  1JM6 A;  5CTW A;  1YER A;  4EFT A;  1B63 A;  4V26 A;  4B6C A;  3LNU A;  4FCQ A;  2Q8H A;  2O1W A;  1TID A;  3C0E A;  3U2D A;  4XIP A;  1YS3 A;  3Q5K A;  2YE2 A;  2YGF A;  3RLR A;  2XHR A;  2PNR A;  1UY7 A;  4MP2 A;  4GCZ A;  3CGZ A;  4PRX A;  1ZXN A;  4H85 A;  4YKX A;  4ZVI A;  1EI1 A;  4CWS A;  1ID0 A;  1AH6 A;  4MP7 A;  4U7O A;  3OMU A;  4XC0 A;  3TZ2 A;  3U2K A;  2IWX A;  2QG0 A;  2JJC A;  2CH4 A;  4YKQ A;  4H81 A;  2BTZ A;  2XK2 A;  2H55 A;  3ZXQ A;  3R4P A;  3MNR P;  1US7 A;  2EXL A;  2BRC A;  2YE4 A;  3EHG A;  4HZ5 A;  1Y4S A;  4CWF A;  3G7E A;  2WEQ A;  2QF6 A;  3T1K A;  2BU7 A;  2YI7 A;  3FT8 A;  3QDD A;  5FNF A;  1UYE A;  2YEI A;  2CG9 A;  2ZBK B;  4AWO A;  2XX5 A;  4XKO A;  2Q8I A;  3OWB A;  2XDU A;  1GJV A;  2YEF A;  2K5B A;  2IOQ A;  5D7R A;  3LPS A;  5FWK A;  2YEA A;  4P8O A;  3T2S A;  3R91 A;  4BAE A;  4O05 A;  3CWV A;  1ZW9 A;  4L91 A;  4QPK A;  5M4H A;  4FCR A;  4YKR A;  2YEJ A;  1GKX A;  2VWC A;  2YJW A;  4FCP A;  3ZXO A;  2WI2 A;  2QG2 A;  4CWN A;  2YEB A;  3D36 A;  3K97 A;  4O09 A;  3CGY A;  2VCI A;  4R3M A;  4XIT A;  3OWD A;  4O0B A;  4LWH A;  2CCS A;  4URO A;  3K98 A;  3TTZ A;  4MPC A;  3SL2 A;  2IWS A;  2YGA A;  2Q8G A;  4YKY A;  3INW A;  3Q5L A;  1QZR A;  1H7S A;  4MPN A;  1EA6 A;  1UYI A;  1L0O A;  4YKZ A;  1AH8 A;  5CTX A;  1Y8N A;  5M4E A;  5C93 A;  5J71 A;  4LWE A;  5M4K A;  2FYP A;  4O04 A;  1YSZ A;  1YC3 A;  1AM1 A;  1YET A;  4WUD A;  2FWZ A;  4ZKI A;  4BXI A;  4XD8 A;  4LWI A;  5GGZ A;  1NHH A;  1GKZ A;  3IED A;  2YE6 A;  4BIU A;  1I5B A;  3A0W A;  3A0T A;  5CF0 A;  1BKN A;  1BGQ A;  2XHT A;  3EKR A;  4NH7 A;  4LWG A;  4GEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...