1I5AA

Structure of chea domain p4 in complex with adpcp and manganese
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
181
Chain Sequence
GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein, transferase
molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 57
structure length 181
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i5aA00
4XTJA 1YC4A 4L8ZA 2XHXA 2Q8HA 5BODA 2XCMA 4KQVA 1TC6A 1ZXNA 4GEEA 4U7NA 2O1VA 2PNRA 3HEKA 2VW5A 3PEJA 4KP4A 3LNUA 3TZ2A 2UWDA 5M4MA 1UY6A 3RKZA 4KSHA 3TZ4A 1YESA 3O2FA 3A0XA 4EGHA 1UY9A 1H7SA 2BU5A 4HZ0A 4HY6A 3T0HA 3U67A 1UY7A 5FNDA 2YE3A 2HCHA 2Q8FA 2XDXA 4YKXA 2Q8GA 4L94A 3CGZA 4FCPA 4AWQA 4BXIA 2H8MA 4HXWA 4ZVIA 2JJCA 5IDJA 4XC0A 2CGFA 3SL2A 1UYHA 4GCZA 3HZ1A 2ZKJA 3BM9A 5M4EA 4O0BA 1L0OA 4WUCA 4X9LA 2WI2A 3T2SA 3KE6A 2E0AA 1ZW9A 3EHHA 3FT8A 2BYHA 1B62A 1QZRA 1US7A 4FMTA 3C0EA 3TZ5A 2WEQA 3QTFA 3QDDA 4EM7A 4EEHA 3OW6A 3GIFA 4GT8A 3HYYA 1I5BA 1UYDA 2XDKA 1ZWHA 2FWYA 4H81A 4LWFA 1UYLA 3G75A 3RLQA 1GKXA 2YEDA 4GGLA 2YE5A 4URNA 3K97A 2YE4A 3G7BA 4MPCA 4LWHA 3R4NA 2WI7A 5FNFA 2YE7A 2CH4A 3BMYA 3T0ZA 2BSMA 1YT2A 1NHJA 2YEBA 2XDSA 4DZYA 5D6QA 2QG2A 3R4MA 1TH8A 3HZ5A 3PEHA 2YJXA 2YEGA 4ASFA 3EKOA 1UYGA 1U2OA 3TTZA 1Z5CA 4L90A 3NMQA 2HG1A 4YKYA 3VHDA 4AWOA 4O09A 5CTXA 3WHAA 2YKEA 3CRKA 5IN9A 2YEJA 1Y8PA 4HYMA 1I59A 3CRLA 2IWSA 4HY1A 3G7EA 4PU9A 1TILA 1YSZA 1UYEA 1H7UA 3OMUA 3RLRA 4E00A 2IORA 2BU2A 4O05A 2CG9A 4U93A 3GIGA 1UYIA 2YI0A 3ZKDA 4CWRA 4EGIA 4CWTA 2EXLA 4O07A 4EFUA 2YI7A 4YKWA 4XE2A 4DUHA 5J6AA 2Q2EB 4ASAA 1TBWA 2VWCA 2ZDYA 4H85A 2BRCA 1THNA 3FV5A 3OPDA 3TZ0A 2XX2A 2BU6A 2XDUA 2ZDXA 3B24A 4MBCA 2BYIA 3FT5A 4AWPA 3B27A 1TIDA 4QPKA 3T10A 4XKAA 4BAEA 3R91A 3C11A 3HYZA 3EKRA 5IDMA 1I58A 4AS9A 2VCJA 4ASGA 2WERA 4CWFA 5GGZA 4XCLA 1YC3A 2XJGA 5CTUA 4KFGA 3A0RA 2BU8A 4BQGA 4CE3A 3Q5KA 4WUBA 2ESAA 3ZKBA 1I5CA 1AH6A 4GQTA 5BOCA 4XITA 2AKPA 5M4PA 3EHFA 2YEEA 2XHRA 4I3HA 5L3JA 4WUDA 4MPNA 2GFDA 1PVGA 4MPEA 4XKOA 2XHTA 3DGEA 4XDMA 3D0BA 2XX5A 4R3MA 2QG0A 2YJWA 5C93A 1U0ZA 1EA6A 4QPJA 4EFTA 3B26A 3K60A 4PRVA 4CWNA 3EHJA 1YT1A 1BYQA 2YEFA 4K4OA 4YKTA 1ID0A 4CE2A 4EGKA 2XX4A 3U2KA 4NH8A 2FYPA 5M4NA 1BGQA 3ZM7A 3HHUA 2QFOA 2BREA 4LWIA 1MU5A 5M4KA 1KZNA 1B63A 2Q8IA 4NH7A 2YEIA 4XIQA 4MOTA 1EI1A 3MNRP 4CWPA 5CTWA 4XD8A 3OWBA 1UYKA 3EHGA 1OSFA 2BT0A 2YECA 2YEAA 1Z5BA 3A0WA 1AM1A 4L93A 4URMA 4URLA 1YT0A 4MP2A 3INWA 3A0YA 4HYPA 5D7CA 1GKZA 2XABA 3R4PA 1GJVA 3VHAA 4CWOA 1AH8A 2YGFA 2JKIA 1KIJA 3T1KA 2IWUA 4JASA 4YKQA 3A0ZA 1UYCA 2O1WA 1Z5AA 2BZ5A 4EMVA 1YS3A 4L91A 5F5RA 1YERA 4LWGA 4P7AA 4LPBA 4YKRA 2YI6A 3D36A 2FWZA 4V25A 2ZBKB 2C2AA 1QY8A 3ZXOA 2YKBA 3O0IA 4XIRA 3ZXQA 4W7TA 2WI5A 2YGEA 3JZ3A 2FXSA 3B28A 1Y8NA 2WEPA 5FWKA 4MB9A 2K5BA 3GIEA 2CCUA 5D6PA 3D2RA 4CWSA 1ZXMA 4XKKA 4XCJA 1AJ6A 1S14A 1Y4UA 3K99A 1BKNA 4GFNA 4LWEA 5J71A 2XJXA 4P8OA 1NHIA 4MP7A 1UYMA 1BXDA 3K98A 1Y4SA 5CF0A 2CCSA 2IOQA 3RLPA 2IWXA 2XK2A 4YKZA 4KTNA 3H4LA 1UYFA 5D7RA 2BU7A 4XIPA 1Y8OA 2BTZA 4FPPA 1I5AA 4NH9A 5CPHA 2YK2A 1AMWA 1Z59A 4BIZA 5FNCA 3Q5LA 4FCQA 4YKUA 3O6OA 4O04A 2GQPA 4Q20A 4HZ5A 4R3AA 1YC1A 2XDLA 1A4HA 2IOPA 4UROA 5D7DA 4B6CA 4BQJA 4ASBA 4V26A 2YGAA 2YKJA 2CCTA 2YI5A 2YKIA 2XJJA 2WI3A 3GIGB 1TC0A 2H55A 2WI1A 2VCIA 1YSRA 4E02A 1R62A 4KSGA 4CE1A 2WI6A 2HKJA 2XD6A 5M4HA 1S16A 4H7QA 2QF6A 4LP0A 4I5SA 5F3KA 1UY8A 4BIUA 4ZKIA 3H80A 3VADA 2YK9A 3LPSA 4JAUA 1NHHA 4R1FA 2WI4A 2YE2A 3CGYA 4FCRA 1I5DA 3A0TA 3WQ9A 3R4OA 2YE9A 1B3QA 4JQLA 4B7PA 1MX0A 1JM6A 1QYEA 5CTYA 4E01A 2YE8A 1YETA 3IEDA 2YEHA 3VHCA 3U2DA 4PL9A 4CWQA 3INXA 4HXZA 3R92A 2YKCA 4U7OA 3CWVA 3B25A 2O1UA 4PRXA 3OWDA 2YE6A 3TUHA 4JAVA 3Q5JA
chains in the Genus database with same CATH superfamily
4XTJA 1YC4A 4L8ZA 2XHXA 2Q8HA 5BODA 2XCMA 4KQVA 1TC6A 1ZXNA 4GEEA 4U7NA 2O1VA 2PNRA 3HEKA 2VW5A 3PEJA 4KP4A 3LNUA 3TZ2A 2UWDA 2C1GA 5M4MA 1UY6A 3RKZA 4KSHA 3LMMA 3TZ4A 1YESA 3O2FA 3A0XA 4EGHA 1UY9A 1H7SA 2BU5A 4HZ0A 4HY6A 3T0HA 3U67A 1UY7A 5FNDA 2YE3A 2HCHA 2Q8FA 2XDXA 4YKXA 2Q8GA 4L94A 3CGZA 4FCPA 4AWQA 4BXIA 2H8MA 4HXWA 4ZVIA 2JJCA 5IDJA 4XC0A 2CGFA 3SL2A 1UYHA 4GCZA 3HZ1A 2ZKJA 3BM9A 5M4EA 4O0BA 1L0OA 4WUCA 4X9LA 2WI2A 3T2SA 3KE6A 2E0AA 1ZW9A 3EHHA 3FT8A 2BYHA 1B62A 1QZRA 1US7A 4FMTA 3C0EA 3TZ5A 2WEQA 3QTFA 3QDDA 4EM7A 4EEHA 3OW6A 3GIFA 4GT8A 3HYYA 1I5BA 1UYDA 2XDKA 1ZWHA 2FWYA 4H81A 4LWFA 1UYLA 3G75A 3RLQA 1GKXA 2YEDA 4GGLA 2YE5A 4URNA 3K97A 2YE4A 3G7BA 4MPCA 4LWHA 3R4NA 2WI7A 5FNFA 2YE7A 2CH4A 3BMYA 3T0ZA 2BSMA 1YT2A 1NHJA 2YEBA 2XDSA 4DZYA 5D6QA 2QG2A 3R4MA 1TH8A 1IXMA 3HZ5A 3PEHA 2YJXA 2YEGA 4ASFA 3EKOA 1UYGA 1U2OA 3TTZA 1Z5CA 4L90A 3NMQA 2HG1A 4YKYA 3VHDA 4AWOA 4O09A 5CTXA 3WHAA 2YKEA 3CRKA 5IN9A 2YEJA 1Y8PA 4HYMA 1I59A 3CRLA 2IWSA 4HY1A 3G7EA 4PU9A 1TILA 1YSZA 1UYEA 1H7UA 3CYGA 3OMUA 3RLRA 4E00A 2IORA 2BU2A 4O05A 2CG9A 4U93A 3GIGA 1UYIA 2YI0A 3ZKDA 4CWRA 4EGIA 2FTKA 4CWTA 2EXLA 4O07A 4EFUA 2YI7A 4YKWA 4XE2A 4DUHA 5J6AA 2Q2EB 4ASAA 1TBWA 2VWCA 2ZDYA 4H85A 2BRCA 1THNA 3FV5A 3OPDA 3TZ0A 2XX2A 2BU6A 2XDUA 2ZDXA 3B24A 4MBCA 2BYIA 3FT5A 4AWPA 3B27A 1TIDA 4QPKA 3T10A 4XKAA 4BAEA 3R91A 3C11A 3HYZA 3EKRA 5IDMA 1I58A 4AS9A 2VCJA 4ASGA 2WERA 4CWFA 5GGZA 4XCLA 1YC3A 2XJGA 5CTUA 4KFGA 3A0RA 2BU8A 4BQGA 4CE3A 3Q5KA 4WUBA 2ESAA 3ZKBA 1I5CA 1AH6A 4GQTA 5BOCA 4XITA 2AKPA 5M4PA 3EHFA 2YEEA 2XHRA 4I3HA 5L3JA 4WUDA 4MPNA 2GFDA 1PVGA 4MPEA 4XKOA 2XHTA 3DGEA 4XDMA 1F51A 3D0BA 2XX5A 4R3MA 2QG0A 2YJWA 5C93A 1U0ZA 1EA6A 4QPJA 4EFTA 3B26A 3K60A 4PRVA 4CWNA 3EHJA 1YT1A 1BYQA 2YEFA 4K4OA 4YKTA 1ID0A 4CE2A 4EGKA 2XX4A 3U2KA 4NH8A 2FYPA 5M4NA 1BGQA 3ZM7A 3HHUA 2QFOA 2BREA 4LWIA 1MU5A 5M4KA 1KZNA 1B63A 2Q8IA 4NH7A 2YEIA 4XIQA 2HHIA 4MOTA 1EI1A 3MNRP 4CWPA 5CTWA 4XD8A 3OWBA 1UYKA 3EHGA 1OSFA 2BT0A 2YECA 2YEAA 1Z5BA 3A0WA 5JENA 1AM1A 4L93A 4URMA 4URLA 1YT0A 4MP2A 3INWA 3A0YA 4HYPA 5D7CA 1GKZA 2XABA 3R4PA 1GJVA 3VHAA 4CWOA 1AH8A 2YGFA 2JKIA 1KIJA 3T1KA 2IWUA 3S5TA 4JASA 4YKQA 3A0ZA 1UYCA 2O1WA 1Z5AA 2BZ5A 4EMVA 1YS3A 4L91A 5F5RA 1YERA 4LWGA 4P7AA 4LPBA 4YKRA 2YI6A 3D36A 2FWZA 4V25A 2ZBKB 2C2AA 1QY8A 3ZXOA 2YKBA 3O0IA 4XIRA 3ZXQA 4W7TA 2WI5A 2YGEA 3JZ3A 2FXSA 3B28A 1Y8NA 2WEPA 5FWKA 4MB9A 2K5BA 3GIEA 2CCUA 5D6PA 3D2RA 4CWSA 1ZXMA 4XKKA 4XCJA 1AJ6A 1S14A 1Y4UA 3K99A 1BKNA 4GFNA 4LWEA 5J71A 2XJXA 4P8OA 1NHIA 4MP7A 1UYMA 1BXDA 3K98A 1Y4SA 5CF0A 2CCSA 2IOQA 3RLPA 2IWXA 2XK2A 4YKZA 4KTNA 3H4LA 1UYFA 5D7RA 2BU7A 4XIPA 1Y8OA 2BTZA 4FPPA 1I5AA 4NH9A 5CPHA 2YK2A 1AMWA 1Z59A 4BIZA 5FNCA 3Q5LA 4FCQA 4YKUA 3O6OA 4O04A 2GQPA 4Q20A 4HZ5A 4R3AA 1YC1A 2XDLA 1A4HA 2IOPA 4UROA 5D7DA 4B6CA 4BQJA 4ASBA 4V26A 2YGAA 2YKJA 2CCTA 2YI5A 2YKIA 2XJJA 2WI3A 3GIGB 1TC0A 2H55A 2WI1A 2VCIA 1YSRA 4E02A 1R62A 4KSGA 4CE1A 2WI6A 2HKJA 2XD6A 5M4HA 1S16A 4H7QA 2QF6A 4LP0A 4I5SA 5F3KA 1UY8A 4BIUA 4ZKIA 3H80A 3VADA 2YK9A 3LPSA 4JAUA 1NHHA 4R1FA 2WI4A 2YE2A 3CGYA 2C1IA 4FCRA 1I5DA 3A0TA 3WQ9A 3R4OA 2YE9A 1B3QA 4JQLA 4B7PA 1MX0A 1JM6A 1QYEA 5CTYA 4E01A 2YE8A 1YETA 3IEDA 2YEHA 3VHCA 3U2DA 4PL9A 4CWQA 3INXA 4HXZA 4E72A 3R92A 2YKCA 4U7OA 3CWVA 3B25A 2O1UA 4PRXA 3OWDA 2YE6A 3TUHA 4JAVA 3Q5JA
chains in the Genus database with same CATH topology
4XTJA 1YC4A 4L8ZA 2XHXA 2Q8HA 5BODA 2XCMA 4KQVA 1TC6A 1ZXNA 4GEEA 4U7NA 2O1VA 2PNRA 3HEKA 2VW5A 3PEJA 4KP4A 3LNUA 3TZ2A 2UWDA 5M4MA 1UY6A 3RKZA 4KSHA 3TZ4A 1YESA 3O2FA 3A0XA 4EGHA 1UY9A 1H7SA 2BU5A 4HZ0A 4HY6A 3T0HA 3U67A 1UY7A 5FNDA 2YE3A 2HCHA 2Q8FA 2XDXA 4YKXA 2Q8GA 4L94A 3CGZA 4FCPA 4AWQA 4BXIA 2H8MA 4HXWA 4ZVIA 2JJCA 5IDJA 4XC0A 2CGFA 3SL2A 1UYHA 4GCZA 3HZ1A 2ZKJA 3BM9A 5M4EA 4O0BA 1L0OA 4WUCA 4X9LA 2WI2A 3T2SA 3KE6A 2E0AA 1ZW9A 3EHHA 3FT8A 2BYHA 1B62A 1QZRA 1US7A 4FMTA 3C0EA 3TZ5A 2WEQA 3QTFA 3QDDA 4EM7A 4EEHA 3OW6A 3GIFA 4GT8A 3HYYA 1I5BA 1UYDA 2XDKA 1ZWHA 2FWYA 4H81A 4LWFA 1UYLA 3G75A 3RLQA 1GKXA 2YEDA 4GGLA 2YE5A 4URNA 3K97A 2YE4A 3G7BA 4MPCA 4LWHA 3R4NA 2WI7A 5FNFA 2YE7A 2CH4A 3BMYA 3T0ZA 2BSMA 1YT2A 1NHJA 2YEBA 2XDSA 4DZYA 5D6QA 2QG2A 3R4MA 1TH8A 3HZ5A 3PEHA 2YJXA 2YEGA 4ASFA 3EKOA 1UYGA 1U2OA 3TTZA 1Z5CA 4L90A 3NMQA 2HG1A 4YKYA 3VHDA 4AWOA 4O09A 5CTXA 3WHAA 2YKEA 3CRKA 5IN9A 2YEJA 1Y8PA 4HYMA 1I59A 3CRLA 2IWSA 4HY1A 3G7EA 4PU9A 1TILA 1YSZA 1UYEA 1H7UA 3OMUA 3RLRA 4E00A 2IORA 2BU2A 4O05A 2CG9A 4U93A 3GIGA 1UYIA 2YI0A 3ZKDA 4CWRA 4EGIA 4CWTA 2EXLA 4O07A 4EFUA 2YI7A 4YKWA 4XE2A 4DUHA 5J6AA 2Q2EB 4ASAA 1TBWA 2VWCA 2ZDYA 4H85A 2BRCA 1THNA 3FV5A 3OPDA 3TZ0A 2XX2A 2BU6A 2XDUA 2ZDXA 3B24A 4MBCA 2BYIA 3FT5A 4AWPA 3B27A 1TIDA 4QPKA 3T10A 4XKAA 4BAEA 3R91A 3C11A 3HYZA 3EKRA 5IDMA 1I58A 4AS9A 2VCJA 4ASGA 2WERA 4CWFA 5GGZA 4XCLA 1YC3A 2XJGA 5CTUA 4KFGA 3A0RA 2BU8A 4BQGA 4CE3A 3Q5KA 4WUBA 2ESAA 3ZKBA 1I5CA 1AH6A 4GQTA 5BOCA 4XITA 2AKPA 5M4PA 3EHFA 2YEEA 2XHRA 4I3HA 5L3JA 4WUDA 4MPNA 2GFDA 1PVGA 4MPEA 4XKOA 2XHTA 3DGEA 4XDMA 3D0BA 2XX5A 4R3MA 2QG0A 2YJWA 5C93A 1U0ZA 1EA6A 4QPJA 4EFTA 3B26A 3K60A 4PRVA 4CWNA 3EHJA 1YT1A 1BYQA 2YEFA 4K4OA 4YKTA 1ID0A 4CE2A 4EGKA 2XX4A 3U2KA 4NH8A 2FYPA 5M4NA 1BGQA 3ZM7A 3HHUA 2QFOA 2BREA 4LWIA 1MU5A 5M4KA 1KZNA 1B63A 2Q8IA 4NH7A 2YEIA 4XIQA 4MOTA 1EI1A 3MNRP 4CWPA 5CTWA 4XD8A 3OWBA 1UYKA 3EHGA 1OSFA 2BT0A 2YECA 2YEAA 1Z5BA 3A0WA 1AM1A 4L93A 4URMA 4URLA 1YT0A 4MP2A 3INWA 3A0YA 4HYPA 5D7CA 1GKZA 2XABA 3R4PA 1GJVA 3VHAA 4CWOA 1AH8A 2YGFA 2JKIA 1KIJA 3T1KA 2IWUA 4JASA 4YKQA 3A0ZA 1UYCA 2O1WA 1Z5AA 2BZ5A 4EMVA 1YS3A 4L91A 5F5RA 1YERA 4LWGA 4P7AA 4LPBA 4YKRA 2YI6A 3D36A 2FWZA 4V25A 2ZBKB 2C2AA 1QY8A 3ZXOA 2YKBA 3O0IA 4XIRA 3ZXQA 4W7TA 2WI5A 2YGEA 3JZ3A 2FXSA 3B28A 1Y8NA 2WEPA 5FWKA 4MB9A 2K5BA 3GIEA 2CCUA 5D6PA 3D2RA 4CWSA 1ZXMA 4XKKA 4XCJA 1AJ6A 1S14A 1Y4UA 3K99A 1BKNA 4GFNA 4LWEA 5J71A 2XJXA 4P8OA 1NHIA 4MP7A 1UYMA 1BXDA 3K98A 1Y4SA 5CF0A 2CCSA 2IOQA 3RLPA 2IWXA 2XK2A 4YKZA 4KTNA 3H4LA 1UYFA 5D7RA 2BU7A 4XIPA 1Y8OA 2BTZA 4FPPA 1I5AA 4NH9A 5CPHA 2YK2A 1AMWA 1Z59A 4BIZA 5FNCA 3Q5LA 4FCQA 4YKUA 3O6OA 4O04A 2GQPA 4Q20A 4HZ5A 4R3AA 1YC1A 2XDLA 1A4HA 2IOPA 4UROA 5D7DA 4B6CA 4BQJA 4ASBA 4V26A 2YGAA 2YKJA 2CCTA 2YI5A 2YKIA 2XJJA 2WI3A 3GIGB 1TC0A 2H55A 2WI1A 2VCIA 1YSRA 4E02A 1R62A 4KSGA 4CE1A 2WI6A 2HKJA 2XD6A 5M4HA 1S16A 4H7QA 2QF6A 4LP0A 4I5SA 5F3KA 1UY8A 4BIUA 4ZKIA 3H80A 3VADA 2YK9A 3LPSA 4JAUA 1NHHA 4R1FA 2WI4A 2YE2A 3CGYA 4FCRA 1I5DA 3A0TA 3WQ9A 3R4OA 2YE9A 1B3QA 4JQLA 4B7PA 1MX0A 1JM6A 1QYEA 5CTYA 4E01A 2YE8A 1YETA 3IEDA 2YEHA 3VHCA 3U2DA 4PL9A 4CWQA 3INXA 4HXZA 3R92A 2YKCA 4U7OA 3CWVA 3B25A 2O1UA 4PRXA 3OWDA 2YE6A 3TUHA 4JAVA 3Q5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTJ A;  1YC4 A;  4L8Z A;  2XHX A;  2Q8H A;  5BOD A;  2XCM A;  4KQV A;  1TC6 A;  1ZXN A;  4GEE A;  4U7N A;  2O1V A;  2PNR A;  3HEK A;  2VW5 A;  3PEJ A;  4KP4 A;  3LNU A;  3TZ2 A;  2UWD A;  5M4M A;  1UY6 A;  3RKZ A;  4KSH A;  3TZ4 A;  1YES A;  3O2F A;  3A0X A;  4EGH A;  1UY9 A;  1H7S A;  2BU5 A;  4HZ0 A;  4HY6 A;  3T0H A;  3U67 A;  1UY7 A;  5FND A;  2YE3 A;  2HCH A;  2Q8F A;  2XDX A;  4YKX A;  2Q8G A;  4L94 A;  3CGZ A;  4FCP A;  4AWQ A;  4BXI A;  2H8M A;  4HXW A;  4ZVI A;  2JJC A;  5IDJ A;  4XC0 A;  2CGF A;  3SL2 A;  1UYH A;  4GCZ A;  3HZ1 A;  2ZKJ A;  3BM9 A;  5M4E A;  4O0B A;  1L0O A;  4WUC A;  4X9L A;  2WI2 A;  3T2S A;  3KE6 A;  2E0A A;  1ZW9 A;  3EHH A;  3FT8 A;  2BYH A;  1B62 A;  1QZR A;  1US7 A;  4FMT A;  3C0E A;  3TZ5 A;  2WEQ A;  3QTF A;  3QDD A;  4EM7 A;  4EEH A;  3OW6 A;  3GIF A;  4GT8 A;  3HYY A;  1I5B A;  1UYD A;  2XDK A;  1ZWH A;  2FWY A;  4H81 A;  4LWF A;  1UYL A;  3G75 A;  3RLQ A;  1GKX A;  2YED A;  4GGL A;  2YE5 A;  4URN A;  3K97 A;  2YE4 A;  3G7B A;  4MPC A;  4LWH A;  3R4N A;  2WI7 A;  5FNF A;  2YE7 A;  2CH4 A;  3BMY A;  3T0Z A;  2BSM A;  1YT2 A;  1NHJ A;  2YEB A;  2XDS A;  4DZY A;  5D6Q A;  2QG2 A;  3R4M A;  1TH8 A;  3HZ5 A;  3PEH A;  2YJX A;  2YEG A;  4ASF A;  3EKO A;  1UYG A;  1U2O A;  3TTZ A;  1Z5C A;  4L90 A;  3NMQ A;  2HG1 A;  4YKY A;  3VHD A;  4AWO A;  4O09 A;  5CTX A;  3WHA A;  2YKE A;  3CRK A;  5IN9 A;  2YEJ A;  1Y8P A;  4HYM A;  1I59 A;  3CRL A;  2IWS A;  4HY1 A;  3G7E A;  4PU9 A;  1TIL A;  1YSZ A;  1UYE A;  1H7U A;  3OMU A;  3RLR A;  4E00 A;  2IOR A;  2BU2 A;  4O05 A;  2CG9 A;  4U93 A;  3GIG A;  1UYI A;  2YI0 A;  3ZKD A;  4CWR A;  4EGI A;  4CWT A;  2EXL A;  4O07 A;  4EFU A;  2YI7 A;  4YKW A;  4XE2 A;  4DUH A;  5J6A A;  2Q2E B;  4ASA A;  1TBW A;  2VWC A;  2ZDY A;  4H85 A;  2BRC A;  1THN A;  3FV5 A;  3OPD A;  3TZ0 A;  2XX2 A;  2BU6 A;  2XDU A;  2ZDX A;  3B24 A;  4MBC A;  2BYI A;  3FT5 A;  4AWP A;  3B27 A;  1TID A;  4QPK A;  3T10 A;  4XKA A;  4BAE A;  3R91 A;  3C11 A;  3HYZ A;  3EKR A;  5IDM A;  1I58 A;  4AS9 A;  2VCJ A;  4ASG A;  2WER A;  4CWF A;  5GGZ A;  4XCL A;  1YC3 A;  2XJG A;  5CTU A;  4KFG A;  3A0R A;  2BU8 A;  4BQG A;  4CE3 A;  3Q5K A;  4WUB A;  2ESA A;  3ZKB A;  1I5C A;  1AH6 A;  4GQT A;  5BOC A;  4XIT A;  2AKP A;  5M4P A;  3EHF A;  2YEE A;  2XHR A;  4I3H A;  5L3J A;  4WUD A;  4MPN A;  2GFD A;  1PVG A;  4MPE A;  4XKO A;  2XHT A;  3DGE A;  4XDM A;  3D0B A;  2XX5 A;  4R3M A;  2QG0 A;  2YJW A;  5C93 A;  1U0Z A;  1EA6 A;  4QPJ A;  4EFT A;  3B26 A;  3K60 A;  4PRV A;  4CWN A;  3EHJ A;  1YT1 A;  1BYQ A;  2YEF A;  4K4O A;  4YKT A;  1ID0 A;  4CE2 A;  4EGK A;  2XX4 A;  3U2K A;  4NH8 A;  2FYP A;  5M4N A;  1BGQ A;  3ZM7 A;  3HHU A;  2QFO A;  2BRE A;  4LWI A;  1MU5 A;  5M4K A;  1KZN A;  1B63 A;  2Q8I A;  4NH7 A;  2YEI A;  4XIQ A;  4MOT A;  1EI1 A;  3MNR P;  4CWP A;  5CTW A;  4XD8 A;  3OWB A;  1UYK A;  3EHG A;  1OSF A;  2BT0 A;  2YEC A;  2YEA A;  1Z5B A;  3A0W A;  1AM1 A;  4L93 A;  4URM A;  4URL A;  1YT0 A;  4MP2 A;  3INW A;  3A0Y A;  4HYP A;  5D7C A;  1GKZ A;  2XAB A;  3R4P A;  1GJV A;  3VHA A;  4CWO A;  1AH8 A;  2YGF A;  2JKI A;  1KIJ A;  3T1K A;  2IWU A;  4JAS A;  4YKQ A;  3A0Z A;  1UYC A;  2O1W A;  1Z5A A;  2BZ5 A;  4EMV A;  1YS3 A;  4L91 A;  5F5R A;  1YER A;  4LWG A;  4P7A A;  4LPB A;  4YKR A;  2YI6 A;  3D36 A;  2FWZ A;  4V25 A;  2ZBK B;  2C2A A;  1QY8 A;  3ZXO A;  2YKB A;  3O0I A;  4XIR A;  3ZXQ A;  4W7T A;  2WI5 A;  2YGE A;  3JZ3 A;  2FXS A;  3B28 A;  1Y8N A;  2WEP A;  5FWK A;  4MB9 A;  2K5B A;  3GIE A;  2CCU A;  5D6P A;  3D2R A;  4CWS A;  1ZXM A;  4XKK A;  4XCJ A;  1AJ6 A;  1S14 A;  1Y4U A;  3K99 A;  1BKN A;  4GFN A;  4LWE A;  5J71 A;  2XJX A;  4P8O A;  1NHI A;  4MP7 A;  1UYM A;  1BXD A;  3K98 A;  1Y4S A;  5CF0 A;  2CCS A;  2IOQ A;  3RLP A;  2IWX A;  2XK2 A;  4YKZ A;  4KTN A;  3H4L A;  1UYF A;  5D7R A;  2BU7 A;  4XIP A;  1Y8O A;  2BTZ A;  4FPP A;  1I5A A;  4NH9 A;  5CPH A;  2YK2 A;  1AMW A;  1Z59 A;  4BIZ A;  5FNC A;  3Q5L A;  4FCQ A;  4YKU A;  3O6O A;  4O04 A;  2GQP A;  4Q20 A;  4HZ5 A;  4R3A A;  1YC1 A;  2XDL A;  1A4H A;  2IOP A;  4URO A;  5D7D A;  4B6C A;  4BQJ A;  4ASB A;  4V26 A;  2YGA A;  2YKJ A;  2CCT A;  2YI5 A;  2YKI A;  2XJJ A;  2WI3 A;  3GIG B;  1TC0 A;  2H55 A;  2WI1 A;  2VCI A;  1YSR A;  4E02 A;  1R62 A;  4KSG A;  4CE1 A;  2WI6 A;  2HKJ A;  2XD6 A;  5M4H A;  1S16 A;  4H7Q A;  2QF6 A;  4LP0 A;  4I5S A;  5F3K A;  1UY8 A;  4BIU A;  4ZKI A;  3H80 A;  3VAD A;  2YK9 A;  3LPS A;  4JAU A;  1NHH A;  4R1F A;  2WI4 A;  2YE2 A;  3CGY A;  4FCR A;  1I5D A;  3A0T A;  3WQ9 A;  3R4O A;  2YE9 A;  1B3Q A;  4JQL A;  4B7P A;  1MX0 A;  1JM6 A;  1QYE A;  5CTY A;  4E01 A;  2YE8 A;  1YET A;  3IED A;  2YEH A;  3VHC A;  3U2D A;  4PL9 A;  4CWQ A;  3INX A;  4HXZ A;  3R92 A;  2YKC A;  4U7O A;  3CWV A;  3B25 A;  2O1U A;  4PRX A;  3OWD A;  2YE6 A;  3TUH A;  4JAV A;  3Q5J A; 
#chains in the Genus database with same CATH topology
 4XTJ A;  1YC4 A;  4L8Z A;  2XHX A;  2Q8H A;  5BOD A;  2XCM A;  4KQV A;  1TC6 A;  1ZXN A;  4GEE A;  4U7N A;  2O1V A;  2PNR A;  3HEK A;  2VW5 A;  3PEJ A;  4KP4 A;  3LNU A;  3TZ2 A;  2UWD A;  2C1G A;  5M4M A;  1UY6 A;  3RKZ A;  4KSH A;  3LMM A;  3TZ4 A;  1YES A;  3O2F A;  3A0X A;  4EGH A;  1UY9 A;  1H7S A;  2BU5 A;  4HZ0 A;  4HY6 A;  3T0H A;  3U67 A;  1UY7 A;  5FND A;  2YE3 A;  2HCH A;  2Q8F A;  2XDX A;  4YKX A;  2Q8G A;  4L94 A;  3CGZ A;  4FCP A;  4AWQ A;  4BXI A;  2H8M A;  4HXW A;  4ZVI A;  2JJC A;  5IDJ A;  4XC0 A;  2CGF A;  3SL2 A;  1UYH A;  4GCZ A;  3HZ1 A;  2ZKJ A;  3BM9 A;  5M4E A;  4O0B A;  1L0O A;  4WUC A;  4X9L A;  2WI2 A;  3T2S A;  3KE6 A;  2E0A A;  1ZW9 A;  3EHH A;  3FT8 A;  2BYH A;  1B62 A;  1QZR A;  1US7 A;  4FMT A;  3C0E A;  3TZ5 A;  2WEQ A;  3QTF A;  3QDD A;  4EM7 A;  4EEH A;  3OW6 A;  3GIF A;  4GT8 A;  3HYY A;  1I5B A;  1UYD A;  2XDK A;  1ZWH A;  2FWY A;  4H81 A;  4LWF A;  1UYL A;  3G75 A;  3RLQ A;  1GKX A;  2YED A;  4GGL A;  2YE5 A;  4URN A;  3K97 A;  2YE4 A;  3G7B A;  4MPC A;  4LWH A;  3R4N A;  2WI7 A;  5FNF A;  2YE7 A;  2CH4 A;  3BMY A;  3T0Z A;  2BSM A;  1YT2 A;  1NHJ A;  2YEB A;  2XDS A;  4DZY A;  5D6Q A;  2QG2 A;  3R4M A;  1TH8 A;  1IXM A;  3HZ5 A;  3PEH A;  2YJX A;  2YEG A;  4ASF A;  3EKO A;  1UYG A;  1U2O A;  3TTZ A;  1Z5C A;  4L90 A;  3NMQ A;  2HG1 A;  4YKY A;  3VHD A;  4AWO A;  4O09 A;  5CTX A;  3WHA A;  2YKE A;  3CRK A;  5IN9 A;  2YEJ A;  1Y8P A;  4HYM A;  1I59 A;  3CRL A;  2IWS A;  4HY1 A;  3G7E A;  4PU9 A;  1TIL A;  1YSZ A;  1UYE A;  1H7U A;  3CYG A;  3OMU A;  3RLR A;  4E00 A;  2IOR A;  2BU2 A;  4O05 A;  2CG9 A;  4U93 A;  3GIG A;  1UYI A;  2YI0 A;  3ZKD A;  4CWR A;  4EGI A;  2FTK A;  4CWT A;  2EXL A;  4O07 A;  4EFU A;  2YI7 A;  4YKW A;  4XE2 A;  4DUH A;  5J6A A;  2Q2E B;  4ASA A;  1TBW A;  2VWC A;  2ZDY A;  4H85 A;  2BRC A;  1THN A;  3FV5 A;  3OPD A;  3TZ0 A;  2XX2 A;  2BU6 A;  2XDU A;  2ZDX A;  3B24 A;  4MBC A;  2BYI A;  3FT5 A;  4AWP A;  3B27 A;  1TID A;  4QPK A;  3T10 A;  4XKA A;  4BAE A;  3R91 A;  3C11 A;  3HYZ A;  3EKR A;  5IDM A;  1I58 A;  4AS9 A;  2VCJ A;  4ASG A;  2WER A;  4CWF A;  5GGZ A;  4XCL A;  1YC3 A;  2XJG A;  5CTU A;  4KFG A;  3A0R A;  2BU8 A;  4BQG A;  4CE3 A;  3Q5K A;  4WUB A;  2ESA A;  3ZKB A;  1I5C A;  1AH6 A;  4GQT A;  5BOC A;  4XIT A;  2AKP A;  5M4P A;  3EHF A;  2YEE A;  2XHR A;  4I3H A;  5L3J A;  4WUD A;  4MPN A;  2GFD A;  1PVG A;  4MPE A;  4XKO A;  2XHT A;  3DGE A;  4XDM A;  1F51 A;  3D0B A;  2XX5 A;  4R3M A;  2QG0 A;  2YJW A;  5C93 A;  1U0Z A;  1EA6 A;  4QPJ A;  4EFT A;  3B26 A;  3K60 A;  4PRV A;  4CWN A;  3EHJ A;  1YT1 A;  1BYQ A;  2YEF A;  4K4O A;  4YKT A;  1ID0 A;  4CE2 A;  4EGK A;  2XX4 A;  3U2K A;  4NH8 A;  2FYP A;  5M4N A;  1BGQ A;  3ZM7 A;  3HHU A;  2QFO A;  2BRE A;  4LWI A;  1MU5 A;  5M4K A;  1KZN A;  1B63 A;  2Q8I A;  4NH7 A;  2YEI A;  4XIQ A;  2HHI A;  4MOT A;  1EI1 A;  3MNR P;  4CWP A;  5CTW A;  4XD8 A;  3OWB A;  1UYK A;  3EHG A;  1OSF A;  2BT0 A;  2YEC A;  2YEA A;  1Z5B A;  3A0W A;  5JEN A;  1AM1 A;  4L93 A;  4URM A;  4URL A;  1YT0 A;  4MP2 A;  3INW A;  3A0Y A;  4HYP A;  5D7C A;  1GKZ A;  2XAB A;  3R4P A;  1GJV A;  3VHA A;  4CWO A;  1AH8 A;  2YGF A;  2JKI A;  1KIJ A;  3T1K A;  2IWU A;  3S5T A;  4JAS A;  4YKQ A;  3A0Z A;  1UYC A;  2O1W A;  1Z5A A;  2BZ5 A;  4EMV A;  1YS3 A;  4L91 A;  5F5R A;  1YER A;  4LWG A;  4P7A A;  4LPB A;  4YKR A;  2YI6 A;  3D36 A;  2FWZ A;  4V25 A;  2ZBK B;  2C2A A;  1QY8 A;  3ZXO A;  2YKB A;  3O0I A;  4XIR A;  3ZXQ A;  4W7T A;  2WI5 A;  2YGE A;  3JZ3 A;  2FXS A;  3B28 A;  1Y8N A;  2WEP A;  5FWK A;  4MB9 A;  2K5B A;  3GIE A;  2CCU A;  5D6P A;  3D2R A;  4CWS A;  1ZXM A;  4XKK A;  4XCJ A;  1AJ6 A;  1S14 A;  1Y4U A;  3K99 A;  1BKN A;  4GFN A;  4LWE A;  5J71 A;  2XJX A;  4P8O A;  1NHI A;  4MP7 A;  1UYM A;  1BXD A;  3K98 A;  1Y4S A;  5CF0 A;  2CCS A;  2IOQ A;  3RLP A;  2IWX A;  2XK2 A;  4YKZ A;  4KTN A;  3H4L A;  1UYF A;  5D7R A;  2BU7 A;  4XIP A;  1Y8O A;  2BTZ A;  4FPP A;  1I5A A;  4NH9 A;  5CPH A;  2YK2 A;  1AMW A;  1Z59 A;  4BIZ A;  5FNC A;  3Q5L A;  4FCQ A;  4YKU A;  3O6O A;  4O04 A;  2GQP A;  4Q20 A;  4HZ5 A;  4R3A A;  1YC1 A;  2XDL A;  1A4H A;  2IOP A;  4URO A;  5D7D A;  4B6C A;  4BQJ A;  4ASB A;  4V26 A;  2YGA A;  2YKJ A;  2CCT A;  2YI5 A;  2YKI A;  2XJJ A;  2WI3 A;  3GIG B;  1TC0 A;  2H55 A;  2WI1 A;  2VCI A;  1YSR A;  4E02 A;  1R62 A;  4KSG A;  4CE1 A;  2WI6 A;  2HKJ A;  2XD6 A;  5M4H A;  1S16 A;  4H7Q A;  2QF6 A;  4LP0 A;  4I5S A;  5F3K A;  1UY8 A;  4BIU A;  4ZKI A;  3H80 A;  3VAD A;  2YK9 A;  3LPS A;  4JAU A;  1NHH A;  4R1F A;  2WI4 A;  2YE2 A;  3CGY A;  2C1I A;  4FCR A;  1I5D A;  3A0T A;  3WQ9 A;  3R4O A;  2YE9 A;  1B3Q A;  4JQL A;  4B7P A;  1MX0 A;  1JM6 A;  1QYE A;  5CTY A;  4E01 A;  2YE8 A;  1YET A;  3IED A;  2YEH A;  3VHC A;  3U2D A;  4PL9 A;  4CWQ A;  3INX A;  4HXZ A;  4E72 A;  3R92 A;  2YKC A;  4U7O A;  3CWV A;  3B25 A;  2O1U A;  4PRX A;  3OWD A;  2YE6 A;  3TUH A;  4JAV A;  3Q5J A; 
#chains in the Genus database with same CATH homology
 4XTJ A;  1YC4 A;  4L8Z A;  2XHX A;  2Q8H A;  5BOD A;  2XCM A;  4KQV A;  1TC6 A;  1ZXN A;  4GEE A;  4U7N A;  2O1V A;  2PNR A;  3HEK A;  2VW5 A;  3PEJ A;  4KP4 A;  3LNU A;  3TZ2 A;  2UWD A;  5M4M A;  1UY6 A;  3RKZ A;  4KSH A;  3TZ4 A;  1YES A;  3O2F A;  3A0X A;  4EGH A;  1UY9 A;  1H7S A;  2BU5 A;  4HZ0 A;  4HY6 A;  3T0H A;  3U67 A;  1UY7 A;  5FND A;  2YE3 A;  2HCH A;  2Q8F A;  2XDX A;  4YKX A;  2Q8G A;  4L94 A;  3CGZ A;  4FCP A;  4AWQ A;  4BXI A;  2H8M A;  4HXW A;  4ZVI A;  2JJC A;  5IDJ A;  4XC0 A;  2CGF A;  3SL2 A;  1UYH A;  4GCZ A;  3HZ1 A;  2ZKJ A;  3BM9 A;  5M4E A;  4O0B A;  1L0O A;  4WUC A;  4X9L A;  2WI2 A;  3T2S A;  3KE6 A;  2E0A A;  1ZW9 A;  3EHH A;  3FT8 A;  2BYH A;  1B62 A;  1QZR A;  1US7 A;  4FMT A;  3C0E A;  3TZ5 A;  2WEQ A;  3QTF A;  3QDD A;  4EM7 A;  4EEH A;  3OW6 A;  3GIF A;  4GT8 A;  3HYY A;  1I5B A;  1UYD A;  2XDK A;  1ZWH A;  2FWY A;  4H81 A;  4LWF A;  1UYL A;  3G75 A;  3RLQ A;  1GKX A;  2YED A;  4GGL A;  2YE5 A;  4URN A;  3K97 A;  2YE4 A;  3G7B A;  4MPC A;  4LWH A;  3R4N A;  2WI7 A;  5FNF A;  2YE7 A;  2CH4 A;  3BMY A;  3T0Z A;  2BSM A;  1YT2 A;  1NHJ A;  2YEB A;  2XDS A;  4DZY A;  5D6Q A;  2QG2 A;  3R4M A;  1TH8 A;  3HZ5 A;  3PEH A;  2YJX A;  2YEG A;  4ASF A;  3EKO A;  1UYG A;  1U2O A;  3TTZ A;  1Z5C A;  4L90 A;  3NMQ A;  2HG1 A;  4YKY A;  3VHD A;  4AWO A;  4O09 A;  5CTX A;  3WHA A;  2YKE A;  3CRK A;  5IN9 A;  2YEJ A;  1Y8P A;  4HYM A;  1I59 A;  3CRL A;  2IWS A;  4HY1 A;  3G7E A;  4PU9 A;  1TIL A;  1YSZ A;  1UYE A;  1H7U A;  3OMU A;  3RLR A;  4E00 A;  2IOR A;  2BU2 A;  4O05 A;  2CG9 A;  4U93 A;  3GIG A;  1UYI A;  2YI0 A;  3ZKD A;  4CWR A;  4EGI A;  4CWT A;  2EXL A;  4O07 A;  4EFU A;  2YI7 A;  4YKW A;  4XE2 A;  4DUH A;  5J6A A;  2Q2E B;  4ASA A;  1TBW A;  2VWC A;  2ZDY A;  4H85 A;  2BRC A;  1THN A;  3FV5 A;  3OPD A;  3TZ0 A;  2XX2 A;  2BU6 A;  2XDU A;  2ZDX A;  3B24 A;  4MBC A;  2BYI A;  3FT5 A;  4AWP A;  3B27 A;  1TID A;  4QPK A;  3T10 A;  4XKA A;  4BAE A;  3R91 A;  3C11 A;  3HYZ A;  3EKR A;  5IDM A;  1I58 A;  4AS9 A;  2VCJ A;  4ASG A;  2WER A;  4CWF A;  5GGZ A;  4XCL A;  1YC3 A;  2XJG A;  5CTU A;  4KFG A;  3A0R A;  2BU8 A;  4BQG A;  4CE3 A;  3Q5K A;  4WUB A;  2ESA A;  3ZKB A;  1I5C A;  1AH6 A;  4GQT A;  5BOC A;  4XIT A;  2AKP A;  5M4P A;  3EHF A;  2YEE A;  2XHR A;  4I3H A;  5L3J A;  4WUD A;  4MPN A;  2GFD A;  1PVG A;  4MPE A;  4XKO A;  2XHT A;  3DGE A;  4XDM A;  3D0B A;  2XX5 A;  4R3M A;  2QG0 A;  2YJW A;  5C93 A;  1U0Z A;  1EA6 A;  4QPJ A;  4EFT A;  3B26 A;  3K60 A;  4PRV A;  4CWN A;  3EHJ A;  1YT1 A;  1BYQ A;  2YEF A;  4K4O A;  4YKT A;  1ID0 A;  4CE2 A;  4EGK A;  2XX4 A;  3U2K A;  4NH8 A;  2FYP A;  5M4N A;  1BGQ A;  3ZM7 A;  3HHU A;  2QFO A;  2BRE A;  4LWI A;  1MU5 A;  5M4K A;  1KZN A;  1B63 A;  2Q8I A;  4NH7 A;  2YEI A;  4XIQ A;  4MOT A;  1EI1 A;  3MNR P;  4CWP A;  5CTW A;  4XD8 A;  3OWB A;  1UYK A;  3EHG A;  1OSF A;  2BT0 A;  2YEC A;  2YEA A;  1Z5B A;  3A0W A;  1AM1 A;  4L93 A;  4URM A;  4URL A;  1YT0 A;  4MP2 A;  3INW A;  3A0Y A;  4HYP A;  5D7C A;  1GKZ A;  2XAB A;  3R4P A;  1GJV A;  3VHA A;  4CWO A;  1AH8 A;  2YGF A;  2JKI A;  1KIJ A;  3T1K A;  2IWU A;  4JAS A;  4YKQ A;  3A0Z A;  1UYC A;  2O1W A;  1Z5A A;  2BZ5 A;  4EMV A;  1YS3 A;  4L91 A;  5F5R A;  1YER A;  4LWG A;  4P7A A;  4LPB A;  4YKR A;  2YI6 A;  3D36 A;  2FWZ A;  4V25 A;  2ZBK B;  2C2A A;  1QY8 A;  3ZXO A;  2YKB A;  3O0I A;  4XIR A;  3ZXQ A;  4W7T A;  2WI5 A;  2YGE A;  3JZ3 A;  2FXS A;  3B28 A;  1Y8N A;  2WEP A;  5FWK A;  4MB9 A;  2K5B A;  3GIE A;  2CCU A;  5D6P A;  3D2R A;  4CWS A;  1ZXM A;  4XKK A;  4XCJ A;  1AJ6 A;  1S14 A;  1Y4U A;  3K99 A;  1BKN A;  4GFN A;  4LWE A;  5J71 A;  2XJX A;  4P8O A;  1NHI A;  4MP7 A;  1UYM A;  1BXD A;  3K98 A;  1Y4S A;  5CF0 A;  2CCS A;  2IOQ A;  3RLP A;  2IWX A;  2XK2 A;  4YKZ A;  4KTN A;  3H4L A;  1UYF A;  5D7R A;  2BU7 A;  4XIP A;  1Y8O A;  2BTZ A;  4FPP A;  1I5A A;  4NH9 A;  5CPH A;  2YK2 A;  1AMW A;  1Z59 A;  4BIZ A;  5FNC A;  3Q5L A;  4FCQ A;  4YKU A;  3O6O A;  4O04 A;  2GQP A;  4Q20 A;  4HZ5 A;  4R3A A;  1YC1 A;  2XDL A;  1A4H A;  2IOP A;  4URO A;  5D7D A;  4B6C A;  4BQJ A;  4ASB A;  4V26 A;  2YGA A;  2YKJ A;  2CCT A;  2YI5 A;  2YKI A;  2XJJ A;  2WI3 A;  3GIG B;  1TC0 A;  2H55 A;  2WI1 A;  2VCI A;  1YSR A;  4E02 A;  1R62 A;  4KSG A;  4CE1 A;  2WI6 A;  2HKJ A;  2XD6 A;  5M4H A;  1S16 A;  4H7Q A;  2QF6 A;  4LP0 A;  4I5S A;  5F3K A;  1UY8 A;  4BIU A;  4ZKI A;  3H80 A;  3VAD A;  2YK9 A;  3LPS A;  4JAU A;  1NHH A;  4R1F A;  2WI4 A;  2YE2 A;  3CGY A;  4FCR A;  1I5D A;  3A0T A;  3WQ9 A;  3R4O A;  2YE9 A;  1B3Q A;  4JQL A;  4B7P A;  1MX0 A;  1JM6 A;  1QYE A;  5CTY A;  4E01 A;  2YE8 A;  1YET A;  3IED A;  2YEH A;  3VHC A;  3U2D A;  4PL9 A;  4CWQ A;  3INX A;  4HXZ A;  3R92 A;  2YKC A;  4U7O A;  3CWV A;  3B25 A;  2O1U A;  4PRX A;  3OWD A;  2YE6 A;  3TUH A;  4JAV A;  3Q5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...