4U7NA

Inactive structure of histidine kinase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
225
structure length
211
Chain Sequence
VSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine protein kinase sensor protein
publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Transferase
total genus 69
structure length 211
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4u7nA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4u7nA02
5FNFA 3T10A 4V26A 3EHJA 2IWUA 4MT8A 2XABA 2WI6A 4NH9A 5CTWA 4NH7A 4R1FA 2BU2A 3IEDA 1L0OA 4XCLA 4AS9A 4XCJA 2XDKA 3WHAA 1YETA 3A0TA 4WUBA 1IXMA 4V25A 4E00A 1YERA 3PEHA 4JYBA 2XJXA 5J71A 2BU6A 3U2DA 2K5BA 4GGLA 3D36A 2QF6A 2IOQA 2YECA 4LP0A 1UYKA 3R91A 4O04A 1B3QA 3B24A 3EHGA 4JQLA 2Q8IA 2YEBA 4MOTA 2YEJA 4L8ZA 3TK1A 3HYYA 1YT0A 5BODA 3INWA 4BIZA 1AH8A 2FXSA 4PRVA 4MB9A 4KSHA 4GFNA 3G75A 4YKQA 1I5DA 3VHDA 5F3KA 5CTUA 5D6QA 1YT1A 4O0BA 4CE3A 2XJGA 1JOYA 2BU8A 1AJ6A 3H80A 1Z5AA 3GIFA 2ZBKB 4ASGA 4AWPA 2IWSA 2XX4A 3PEJA 4HXZA 3H4LA 1BKNA 4CE2A 4O07A 4ASBA 4QPKA 2CH4A 1U2OA 2CCSA 3ZRVA 2YGEA 1NHHA 4EGIA 2YI7A 4MPEA 2GFDA 5D7RA 2XHTA 2Q8HA 2LFRA 1A4HA 5IDMA 4LWGA 4E01A 5C93A 4CWNA 3RKZA 4UROA 1QY8A 3HZ5A 1EA6A 3KE6A 5GGZA 1U0ZA 4BIUA 2YEDA 4HY6A 4KSGA 3D0BA 1S14A 1QZRA 2IOPA 4GT8A 4MP7A 1I58A 2JJCA 1UYCA 3EHFA 4ZVIA 3GIGA 4KFGA 4MPCA 1UYDA 1TC0A 4DUHA 1UY7A 2YE2A 1YC1A 4LWFA 2YEFA 2Q2EB 2WI3A 4XC0A 1Z5BA 3BMYA 2WI4A 1I5CA 2BT0A 3OMUA 4L90A 1YESA 5BOCA 1H7SA 4WUCA 5D6PA 2P67A 1TIDA 2XDXA 2XDLA 4MPNA 2WI5A 2BYHA 3GIGB 4YKZA 4H85A 5M4MA 4U7NA 3O0IA 4AWQA 3OPDA 3HHUA 4FCPA 2WI2A 4KP4A 4XIRA 3QTFA 1Y4SA 3HYZA 2LFSA 3ZCCA 4CWRA 2XDSA 1OSFA 2HKJA 5CPHA 2VCJA 4YKYA 2QG2A 1YC4A 2XD6A 3TZ5A 1Z5CA 4ZKIA 2YEGA 1R62A 3CGYA 4K4OA 3TZ0A 3K60A 2HG1A 1MX0A 2QG0A 4NH8A 4LWEA 4BQGA 4LWHA 2CG9A 2QM8A 1UYLA 1THNA 1YSRA 4B6CA 2YKJA 2YEIA 5B1OA 3NMQA 2WI7A 2VWCA 4FCRA 3TZ4A 4LWIA 4MP2A 1YT2A 1Y8PA 3VHCA 4U7OA 2BTZA 4L91A 3R4MA 3TTZA 1YSZA 1B63A 4B7PA 3CWVA 4O09A 4XKKA 4EGKA 3K99A 3TUHA 4PU9A 3U2KA 4LC1A 4CWSA 2H8MA 4KTNA 2FYPA 1NHIA 4PRXA 2XHXA 4HZ5A 1NHJA 4XKOA 2O1WA 1UY9A 3BM9A 3T1KA 1KZNA 4CWTA 1UY8A 3OW6A 4JASA 1ZXMA 3A0RA 2QM7A 4L93A 4AWOA 1QYEA 3NXSA 5F5RA 2YK2A 2YE9A 4YKUA 3WQ9A 1AM1A 4I5SA 2YE5A 4I3HA 3CGZA 1YS3A 2CCTA 4X9LA 5FNDA 4QPJA 5D7DA 1ZW9A 3INXA 2CCUA 2YKBA 1AH6A 3FT5A 2Q8GA 2XX2A 4HYMA 3QDDA 5IN9A 2H55A 1UYHA 2EXLA 3RLQA 1YC3A 2YI0A 3K97A 4HXWA 4HZ0A 2O1VA 1I5AA 4O05A 4URNA 3ZXQA 5M4NA 2YE8A 1EI1A 3RLRA 3Q5LA 4WUDA 3FT8A 4JYCA 5D7CA 2PNRA 2XHRA 4URLA 2YKEA 3RLPA 2IWXA 3K98A 4XKAA 1UYGA 5FWKA 1JM6A 4R3AA 4HYPA 3EHHA 5M4EA 5FNCA 4R3MA 2XK2A 3TZ2A 1TBWA 4LPBA 1TILA 2BU5A 3HZ1A 4FCQA 3EKOA 4CE1A 2YEEA 3FV5A 4XD8A 3D2RA 4XITA 4CWOA 1Y8NA 2YJXA 5M4PA 3ZM7A 1ZXNA 3GIEA 4HY1A 4BXIA 1KIJA 3EKRA 2BZ5A 1TC6A 3VADA 2YGFA 1US7A 2YE6A 2ZKJA 2YE7A 5IDJA 1AMWA 3T0ZA 4EGHA 4XTJA 4YKXA 4L94A 4XIPA 5B1NA 3B27A 3O2FA 3SL2A 2XDUA 2CGFA 3OWDA 3ZXOA 4H81A 3R4PA 3P32A 2QFOA 1ID0A 2Q8FA 5L3JA 2WEPA 1H7UA 2YKIA 1PVGA 2BSMA 4BAEA 4GT1A 5M4HA 3ZRWA 1UYFA 3MNRP 5CTXA 2O1UA 4P8OA 2YEAA 3ZRXA 4Q20A 4ASAA 1UYEA 5M4KA 2YI6A 2YJWA 3ZKDA 4EFUA 2YEHA 2VW5A 3HEKA 4EEHA 4YKTA 1TH8A 3T0HA 5CF0A 4FPPA 3A0XA 1B62A 4GEEA 3CRLA 4YKWA 3LPSA 1ZWHA 5CTYA 1UYMA 2BYIA 1I59A 2YK9A 5J6AA 4ASFA 3B25A 3T2SA 4GCZA 2XCMA 4YKRA 3ZRWB 2ZDXA 1BYQA 4MBCA 2WEQA 3CRKA 3C11A 3Q5KA 4H7QA 4EMVA 1UYIA 3A0WA 3JZ3A 1MU5A 1BXDA 1GKZA 2WERA 3U67A 3ZKBA 3G7BA 3MD0A 4DZYA 2WWWA 2E0AA 3B26A 2XX5A 3R4OA 2HCHA 4MTXA 2GQPA 4GQTA 2VCIA 4E02A 1Z59A 3A0ZA 1F51A 4FMTA 4PL9A 4BQJA 2YE3A 1UY6A 2FWZA 1Y8OA 4EFTA 4EM7A 2YKCA 4CWPA 3C0EA 2ZDYA 4CWFA 4JAVA 2BRCA 4XE2A 2C2AA 2FTKA 4JAUA 4XIQA 2UWDA 4URMA 1GKXA 2BU7A 4CWQA 2XJJA 3OWBA 2YE4A 2ESAA 2BREA 4P7AA 4U93A 3DGEA 1Y4UA 2WI1A 1GJVA 3A0YA 3Q5JA 3R92A 3VHAA 1BGQA 4W7TA 4KQVA 3B28A 3G7EA 3LNUA 2FWYA 1I5BA 4XDMA 2AKPA 2JKIA 2YI5A 1S16A 3R4NA 2IORA 2YGAA 3O6OA
chains in the Genus database with same CATH superfamily
4O2AB 2CUGA 3T10A 4WFFA 2VWJA 1Q8IA 2WSSG 5CA0A 4V26A 4MT8A 2XABA 1E79G 3E83A 4NH7A 4TQFA 4R1FA 3IEDA 1VQ4V 1K7DA 1GKFA 1OCCB 3A0TA 2IH3C 1XQ8A 1IBMO 4ZBMA 3CC7V 4GX0A 2K5BA 1OCZB 4J42A 4MTOA 4UCRA 2IOQA 1UYKA 4IIJB 3R91A 1W0KG 3K9AA 4O4HA 4LF7B 3B24A 3EHGA 4JQLA 4MVZA 1R1BA 2YEBA 2YEJA 3K0DA 3BVOA 3Q4HA 4L8ZA 1WAZA 3A0HZ 3INWA 1AH8A 2B5UA 3H1KH 2WA4A 4LNUA 1OCCC 3CJHA 3ZBHA 1EN6A 4CZZA 3K59A 1I5DA 3VHDA 1MNGA 1ZTEA 5D6QA 4IYHA 5KHHA 2XJGA 5LBQA 4WCEV 2BU8A 1OCZC 1Q82W 1Z5AA 3TCUA 3HKCA 1I7FA 1G4YB 4ASGA 1KBHA 1G6UA 5GTHZ 3ZRSA 4NVPA 4HXZA 2RJZA 4CE2A 1SA0B 4QPKA 3TXSA 1U2OA 2ZT9B 5FLXN 3LMMA 2YGEA 4AQYO 1NHHA 5D7RA 4DV0B 5F2VO 2LFRA 2DQ3A 4IYIA 4ICGA 1R3LC 4JZGA 4K35A 3SDLA 2K1EA 4UROA 4PI0A 3RKZA 1TVKB 3CP1A 2CGNA 3OT7A 4ZHQB 3KE6A 1AI5A 4PA6A 1K3EA 4HY6A 1PPJH 2BOBC 3JAKB 3CD6V 2ZE7A 1QVGU 4GT8A 3DXRA 5IYCO 2JJCA 1X59A 5LOVA 3H01A 1DGSA 1UYDA 1Q7YW 3QF7A 5LL6Y 2OCCB 3ZHUA 1MG1A 2DMXA 4WBNA 4O4JB 4JI6B 3G71V 1YJWV 1YC1A 3RYHB 4UCSA 4LWFA 3JSNA 3VQXA 1NR7A 4TV8B 3DSQA 5L3BA 3N2KA 4X9QA 1MZFA 2N74A 1XMOB 1VIBA 1I5CA 1LUVA 3IC9A 4JI6O 3OMUA 2OWOA 2A3QA 1R6NA 3B8MA 5J2TA 2W6IG 4H44B 2C1GA 5LXTB 2IJKA 3R66A 3TJTA 1Q6IA 1XI1A 4JF3A 4I0XA 4YKZA 4DR6B 2OCCC 3JASA 3CRMA 4FCPA 2WI2A 2VRZA 4DW1A 3RYFB 4X1KB 3HKDA 5CBFA 1P4RA 3HKEB 4DR6O 1IZ3A 2K9PA 4F4LA 2P06A 2XDSA 3OE7G 1XOUA 1WJZA 4DYLA 1FJGO 4FLUA 1OSFA 2JIZG 5FNVA 2JS3A 3L71H 5IYDO 2QG2A 2X6AA 3LDDA 2Y4TA 5J2UB 4ZKIA 2YEGA 3E35A 1FFXA 2LGWA 2UUBB 3TZ0A 1XDCA 4B7KA 3RYCA 2ZE5A 2QG0A 2CE4A 2QWRB 4LWHA 5JCOC 2CG9A 1DLBA 3SJBC 2UUBO 3E22A 1JJ2U 2M6YA 3ICXA 4B3TB 3K08A 3NMQA 3T4ZA 3CSXA 2VWCA 4FCRA 2UUAB 1K5SA 2ZINA 1AP6A 1Y66A 1NBMG 4YXWG 4TV9A 3UCSC 4HBNA 3TTZA 2CH7A 5GW7A 1IBLO 1YSZA 1XHXA 4HYOA 1K33A 4XKKA 4UXNA 4DV7B 2QM4A 3ASOB 3U2KA 2D2CB 4B3RB 1IXBA 1OCOB 3ASNC 1W59A 1I5YA 3BPZA 4KTNA 4BW9A 1Q6HA 1XL4A 5IJ0A 1RSOA 5JJNB 3SYQA 5EZYA 3FB7C 4AHCA 1P84F 2R72A 3T1KA 4DV7O 4B3RO 4TT3G 2B9ZA 4IHJA 3T1HB 2O57A 2AW9A 3U10A 2QM7A 4EB6B 2Q67A 4WF9V 2QWQB 4WFGA 2Q8VA 4AWOA 1QHTA 5F5RA 2YI8A 3A2FA 2YK2A 1AM1A 4I5SA 3T1HO 1S3JA 1OCOC 3RN4A 4JV5B 4NXMB 2X7RB 5D7DA 4FLVA 3RW0A 5HFLA 1M56C 2ZKOA 3INXA 2GDSA 2YKBA 2HR3A 1HNZB 1NTZH 3K0GA 4KL1A 1AH6A 5BMVA 1QNMA 3AK1A 5EC2C 3M7MX 4JV5O 2EJ7A 2XX2A 3QDDA 1WP8A 1HNZO 3CE2A 3ZMSA 1YC3A 3K97A 2YE8A 4CS2A 1KECA 3RLRA 3Q5LA 3KG2A 5KUMA 1Q3EA 4WUDA 3FT8A 4B3SB 2WAMA 4FZ1A 2XHRA 3GWOA 2YKEA 1XILA 2IWXA 1GM7A 3K98A 4U3JA 1UYGA 5FWKA 1JM6A 3CRRA 3E86A 2DJVA 2ITCC 3EHHA 4P9PA 4B3SO 5M4EA 4UV9A 1AROP 5IYZB 1EM1A 4X62B 4YJ2B 1JFFA 5IE9A 1ZSPA 3LDEA 3HZ1A 4QIWF 3EKOA 1AP5A 1HNXB 3D8CA 4XD8A 4X62O 2YJXA 1THZA 5BXZA 4BXIA 3EKRA 2IU0A 2XHBA 1TGOA 1XNQB 2YI9A 4DUZB 3CWBH 1HNXO 1SZXA 5LP6B 4CH5A 1V55B 4MVRA 3FAVB 1MZEA 1SQGA 4L94A 1XNQO 1SKVA 2PI4A 3AG2C 1YJ9V 1S77D 3B27A 2P22C 4PV1B 2N05A 3OWDA 3TXQA 1BSMA 4ZOLB 3C3TA 2UXNA 1GRJA 1Q6UA 1NT2B 4CH3A 1BZKA 5L3JA 2JGDB 2WEPA 1W0JG 3K5LA 1YJNV 4GT1A 1AJQA 5CBHA 2EIMC 1N36B 2H3OA 4GKJB 4LFAB 5LP6C 2BTQA 1Y76A 4FJCC 1H8EG 1MABG 3ZRXA 3CPWU 3SJAC 1UYEA 1YF2A 1K4DC 3ZKDA 3CCRV 2EINB 1WA8B 4GKJO 4LFAO 2CDYA 3HEKA 3T0HA 1RPOA 4TQDA 3B77A 1I5XA 4WFHA 3AK2A 2PF4E 2WPDG 1H2GA 3CRLA 5DECA 1WB8A 1ZWHA 5CTYA 4PHZA 2BYIA 1UFIA 1CEZA 2QJ1A 1I59A 1SETA 2HP8A 1M93A 1LNQA 4J10A 4RO2A 3HB3B 1L0NH 1HDJA 4X64B 2DOSA 3CXCU 2WEQA 5C8YB 3CRKA 1BL8A 1SS3A 1MU5A 2XASA 1AR5A 4NXNB 5CA1B 4X64O 3RWRD 4B7EA 2Q69A 3N2GA 5JQGB 2WWWA 2HHIA 2E0AA 3CXHF 3J80N 2XX5A 1JJOA 4NXNO 1YCIA 1Z59A 1Q86W 1JR9A 2Q7HA 3ETGA 2Q6AA 1KU9A 4PL9A 1ZL8B 4MVSA 2HKOA 4K8ZA 2FWZA 4IL6Z 2EIJC 3C0EA 4XDLA 2BRCA 2PY5A 3QVNA 2UWDA 3OR7C 1QR9A 2WLHA 5KHJA 4LF6B 3L75H 3QNEA 2AHZA 1NZ6A 2Q73A 3FYEB 5B3SB 2G38A 3ZMUA 4LF6O 4KQVA 1HNWO 5GTIZ 3G7EA 2FWYA 1I5BA 2AKPA 2JKIA 4AI8A 3GWKC 3O6OA 5FL7G 5FNFA 1HWYA 4LFBB 1Z5VA 4PA7A 2P5OA 2IWUA 4LF9B 1L8DA 3BA8A 3JD3A 3B2EE 4LCUC 3A0BZ 2BU2A 4XCLA 4LFBO 2XDKA 3WHAA 1XUQA 1O9HA 3OFNG 3JAWB 5B3SC 2FYUH 4JYBA 2Y0PA 4H37A 1N33B 1YIJV 3U2DA 3D36A 5H5NA 2QF6A 3X2QB 4MVUA 4O04A 2YEVB 1N33O 1US6A 2V7QG 4FLZA 4FFBA 2Q8IA 5JENA 2DYSB 5CA0B 4MOTA 3HYYA 2F43G 5BODA 3RVYA 2FXSA 4UB8Z 4PRVA 4Z1VA 4BIOA 3RYIA 5GONA 2P90A 3ZMTA 2Y69B 5L3CA 2CK3G 1GMGA 2JRIA 5LMNO 4GFNA 2E5LB 3WFVA 4OGQB 5CTUA 4J7JA 1FKAO 3F7VC 1EN4A 3EHBB 3L70H 1RP3B 2CTWA 4DR5B 3OM3B 4J9YB 4MS2A 2E5LO 1WPBA 1NS1A 3ZX6A 1Y67A 4DRXA 4O4IB 2DYSC 2IWSA 3H4LA 3PEJA 1VEWA 4E2LA 4FZ0A 4O07A 2Q7GA 4LR3A 5JH7B 2LP7A 2F95B 4MSWC 1S76D 2A0LA 2BSKA 3ZRVA 2VS0A 2CCSA 2YI7A 4NTWA 2XHTA 1AB3A 3KKYA 1A4HA 2N04A 3JATB 1SESA 2H8PC 3QO8A 1QY8A 2IW5A 3HZ5A 5GGZA 1XNRB 1U0ZA 4HZ3A 4BIUA 4F6RB 4YY3B 1NJIW 3VQWA 3CX5F 3CHXA 4DR4B 3D0BA 3HKCB 5LHIA 1S14A 1QZRA 4NR1A 1COWG 4ZVIA 2WLJA 4UCVA 3N27A 2YXLA 2YIBA 4DR4O 2EULA 4JI2B 2HVKC 1UY7A 1AR1B 1NI8A 1R6KA 2Q9LA 3AG4C 5H6QA 5EYPA 2WI3A 3UQ8A 2YS8A 1Z5BA 3BMYA 2WI4A 2BT0A 1N4CA 4K8XA 4L90A 1YESA 3H1HH 4WUCA 1A32A 4H33A 4LF4B 2P67A 1R3KC 3CMAV 4ZI7B 2XDLA 4XDJA 4JI5O 4I4TB 3FD9A 4U7NA 3O0IA 4TUYB 3OPDA 1SF9A 2ITDC 4P2ZA 4LF4O 3BA9A 3CCUV 4KP4A 1YITV 4XIRA 2X0LA 4WBNB 1IBKB 3QTFA 5IWAB 2NR5A 2OTLV 3ZCCA 4E72A 2UU9B 1Y74B 4CWRA 4CBCA 3ETDA 1SERA 4H13B 1TUBA 4YKYA 1BS3A 3F7YC 1ZWIC 1RM1B 1EFRG 1VQPV 1Z5CA 2UU9O 4CH4A 1L0LH 3RVZA 4G2KA 2UXXA 4NH8A 4LWEA 1V54B 1G1XB 2HJFC 3UT5A 1RFYA 1GN3A 1UYLA 2JJ1G 1THNA 4LF7O 2YKJA 2YEIA 3W7SA 1NTMH 1GM8A 5KLVH 4LWIA 3L74H 4J41A 1NH2D 3ETQA 4I50A 2OIEA 3IFXA 1RM1C 5KHIA 1SZTA 3K58A 1FXKA 3PJSK 4LFCB 5LYJB 1R73A 4DR3B 1MOFA 4FK5C 4YHHB 1B63A 1P49A 4O09A 3E8FA 1VQOV 4X65B 4R7CA 2QWNB 4BR6A 1V54C 3K99A 2Q68A 3APQA 5K1PA 2ZNIA 2ZR3A 4LFCO 4DR3O 4YHHO 1NHIA 2QDOA 4HZ5A 5LMUB 1UY9A 3E22B 1G8MA 4JI3B 4UVBA 4CWTA 4O2BA 1NTKH 1WLEA 1GH6A 3K57A 3VQVA 3HKBA 3G6EV 3SR2C 3EFFK 3K03A 5LMUO 5BY1A 1QYEA 4TV9B 3NXSA 4DV0O 4JI3O 1J95A 3UKMA 4I3HA 1BQ0A 4GLXA 1YS3A 1YVWA 4F6EA 1KD1W 3BEHA 1YEWA 5KAFZ 4D7SA 1F4MA 4LF8B 1ZW9A 2ZXWC 2CCUA 3JARA 4DV6B 5EZYB 1SQVH 1KKDA 2W0XA 4JAAA 3JD1A 1AI7A 4LF8O 2YUAA 5IN9A 3SJQC 2H55A 4DV6O 4X66B 1KC8W 1Q81W 4HXWA 2O1VA 1I5AA 3OEEG 5M4NA 4H0LB 1EI1A 2JJ2G 4JYCA 2GUZB 3ABMC 3EVKA 4O2AA 5D7CA 1FD9A 1XMOO 1WB7A 2A79B 3TETA 4QJFB 1QLEB 5FNCA 2EIKC 1FXVA 4JI0B 5BMVB 1HR0B 2ATKC 3F5WC 3JD4A 1GN2A 2BU5A 5EK0A 4L8JA 2OYQA 5CB4B 4NYKA 2YEEA 4JYAB 3AEIA 4JI0O 5AG2A 3H1IH 3B4SA 4JI1B 1HR0O 4CWOA 1U96A 4HY1A 1JMKC 2L35A 3JAMN 2EZPA 4PDRA 2BZ5A 1K34A 4HNAB 4FLYA 3JCUZ 3G4SV 2RNBA 3ABKC 2YGFA 1R3JC 1QLEC 5EC1C 1US7A 2LQTA 5DM6V 2VWKA 5H2FZ 1AILA 3ETEA 2YE7A 2GSMB 4EGHA 3ASNB 3SGIA 4XIPA 3OUFA 3O2FA 3SL2A 4R50A 5L3DA 2XOKG 1NVPB 2JVDA 4RUEA 1MSDA 1TA8A 5JJJB 5E1AC 3CCMV 1FS0G 3CMEV 1K5QA 4U3FH 1H7UA 2YKIA 1PVGA 1FPOA 5KAIZ 3K79A 5H6RA 1K97A 3MHSC 3ZRWA 4B3TO 1UYFA 3MNRP 1T5EA 2UUAO 2ZQMA 2KG7B 2O1UA 3CCVV 2YEAA 1I0HA 4ASAA 1EZVH 1OV9A 5M4KA 3AK3A 2YI6A 2YJWA 2DWEC 2F4VB 2VW5A 1TVKA 1M56B 4EEHA 2MW2B 1TH8A 2JK5C 5CF0A 4ZHQA 4FPPA 3A0XA 4D7TA 1FXHA 3LSUA 5FPOA 3LPSA 3SPGA 2YK9A 3SPCA 4LH7A 4ASFA 3T2SA 2XCMA 5CN0A 5DEDA 1ZUQA 3JCZA 2ZDXA 1UPGA 2PYJA 1BYQA 3RBZA 1KP2A 4LWSB 3BFRA 1VARA 2Z0AA 3SPHA 4O4JA 3O65A 3JALB 1LUWA 3SJCC 2MK3A 3LDCA 1FYJA 2WERA 3U67A 4TV8A 3G7BA 1K9MW 2YICA 4DR1B 1VQ9V 3ZMZA 3ZHQA 4N23A 3VQYA 4NXMO 2XNDG 3GVMA 2XAHA 4GKKB 4GQTA 2Q7EA 4DR1O 2IJIA 3ZN0A 3ZN1A 1VQ6V 1NKDA 1PM9A 4FMTA 2PGGA 4JI7B 3KZIZ 1S5LZ 4DK1A 4DO2A 4GKKO 4EM7A 4CWFA 4JAVA 3RYFA 4X1KA 1OCRC 3I56V 4URMA 2JGUA 2BU7A 5KX5A 3HKEA 3THOA 4CWQA 2XJJA 3OWBA 4JYYA 2YE4A 5EBMC 2ESAA 3N2GB 4FLXA 5KHKA 1Y4UA 1N34B 3A0YA 3K5NA 2BOCC 2F93B 4Z1MG 4PJ0Z 3AG2B 1BGQA 4DV3B 4QE9A 1HP8A 2WLLA 3LNUA 1N34O 2ARHA 1S16A 2BU6A 2YGAA 4DV3O 3VBBA 2EIMB 4X88A 2IU3A 3EHJA 5KA6A 4O4LA 3APOA 4NH9A 3WG7B 5D5PA 1HW7A 3K06A 2Y4UA 1L0OA 1D5AA 4WUBA 2GBOA 4V25A 4E00A 1YERA 4DUZO 3PEHA 4UVCA 4YJ3A 2WLMA 3E8BA 1S5HC 3OW2U 3ZEDA 4GGLA 3WB0A 4R8CA 4JPRA 4MVQA 4X89A 5LGUA 3G6BA 2P6JA 2F1MA 3WG7C 2OCHA 4L87A 2IJJA 1KYOF 2EJRA 4CC6A 4BIZA 1YI2V 4OXSA 4I9QA 2FB5A 1N36O 4MB9A 1B04A 3B09A 1GN4A 5F3KA 4GYCB 4X20B 3FB6C 4RQEA 4UCOA 4X1YB 1GAXA 1AJ6A 2JS5A 3T1CA 4PA3A 1BT8A 1R6TA 5B66Z 4BW5A 3GIFA 3CCSV 2QKCA 2XX4A 3LUTB 3FB8C 1BKNA 1QCEA 2EILC 4FFBB 3RGBA 2E3CA 3JSLA 2CH4A 5LGNA 2OT5A 3JYCA 2PZSA 3OGIB 4MPEA 2EIJB 4J11A 5IJ9A 3RYIB 4AILC 5GONB 3CCLV 2CTRA 5C93A 4LH6A 1VF6A 1KB9F 1EA6A 1SQFA 2Z5UA 1FAFA 3D36C 3T4DA 2YEDA 1D2DA 2WLIA 4BAYA 4KSGA 2FL4A 3FKSG 5HFMA 3W7WA 1I58A 2DWDC 1UYCA 1R3IC 2DYRC 2XAQA 3GIGA 1BGYH 4MPCA 1TC0A 2BSKB 1KP3A 3LSQA 4B3MB 1VQNV 1QVFU 5IYZA 2YE2A 4TSFG 1AVMA 3UO2A 4JTAB 5KMGB 2HJDA 2YEFA 1M4UA 1ORQC 2Q2EB 1IVSA 1O9GA 1P7GA 2QR4A 2A7WA 3SYCA 4B3MO 4FM2A 4X1IB 5BOCA 5D6PA 3CRAA 3E8HA 4CS3A 4UCTA 3DC5A 1TIDA 4WFBV 3DC6A 3CC2V 4H85A 2LJ2A 4PA4A 4AWQA 3FAVA 5J9PC 4J9ZB 2ZCEA 4MW3A 5KA5A 1Y4SA 3HYZA 3CC4V 1H2SB 2W6JG 5IY5B 5EYPB 1AJPA 4ZOLA 3SPJA 2HKJA 5CPHA 2JGDA 2VCJA 2JEXA 4LF9O 1YC4A 2XD6A 4YIOA 2E76B 1F7YA 3K60A 5EBLC 4DV4B 4KHPB 3NR7A 3OAAG 3S3WA 4NTXA 2XAFA 4BQGA 1WA8A 3B8NA 2ZDIA 2IJHA 2RDCA 1XEQA 5L3FA 5IY5C 1YSRA 4KHPO 3CB2A 5B1OA 5L3GA 2WI7A 4J7ZA 3TZ4A 3T1YB 5A2QN 2X6BA 4U7OA 3OUSA 2BTZA 4L91A 3R4MA 2Y48A 3OGCC 1S0VA 4B7PA 4G27B 2GTAA 4QGPA 1Z5WA 3T1YO 4O4HB 1M57C 4PU9A 2IM9A 4CWSA 1GN6A 2NLJC 4DR5O 4PRXA 1GO3F 3Q4HB 3EXAA 5ITZA 2O1WA 4IGGA 3OMIB 1X4TA 5EIBC 4X8AA 4LNUB 4DR2B 4DR7B 3CJHB 3OW6A 4JASA 3ABUA 4JZ2A 2F66C 3A0RA 2QTSA 1ZXMA 2QWPB 2KQXA 1SQBH 3AG4B 4MTGA 1FXKB 3L9DA 2YE9A 4DR2O 3T2MA 4DR7O 4OX9B 1ZL8A 4WFAV 2YE5A 1H2NA 4FVMA 2M7WA 2P4KA 2CCTA 2GV9A 4GX1A 3R65A 4QPJA 2HEPA 5IYBO 1XNRO 3K3WA 4J7KA 2NN4A 4YY3O 5B1BB 4OX9O 4MTFA 1XL6A 2XTAA 1CXZB 3FT5A 4HYMA 1GK9A 1NQTA 4UV8A 1UYHA 1FXKC 2YSUB 1JX9A 1I08A 2HVJC 4JI2O 2YI0A 3D3QA 3ZXQA 2ZE6A 2YXYA 4NB5A 4UCUA 2E75B 3TGUH 3W7UA 3RLPA 3DXRB 2ILMA 4DV1B 2QKSA 5B1BC 3UM7A 4XKAA 5LOVB 1PNLA 4HYPA 3ZMVA 2ZM6B 1IURA 1YTFB 3TZ2A 3WB2A 4CC5A 1TBWA 3ML0A 4LPBA 3JAWA 2Q0AA 1SQXH 4A5UB 2ZM6O 4CE1A 2Q5ZA 3N2KB 3P3NA 2HLDG 1PV0A 3P30A 4IT5A 1L1FA 3FV5A 1YHQV 4J80A 4XITA 1Y8NA 1IBKO 5IWAO 5M4PA 2CTPA 2YEVA 3GIEA 5J2TB 4I55A 3VADA 5JJEB 1IBMB 1JPXA 4I0XB 3CCEV 1WN7A 2UUCB 4GZRB 3JASB 2YE6A 1AI4A 1QLNA 1AMWA 2PI5A 2LW7A 3T0ZA 4YKXA 3AG3C 4FIPC 3KCYA 1S5JA 3CYGA 3HKDB 3P3PA 2BE3A 4DV5B 2QKAA 2CGFA 2UUCO 3IC7A 4FM0A 4H81A 1BQZA 1P7BA 4NTYA 4EEQA 3OR6C 5FNVB 1ID0A 1BMFG 4DV5O 4O4IA 1YTFD 2DN9A 5CTXA 3HPLC 2C1IA 1FFXB 4PI2A 4P8OA 1GM9A 5JH7A 4BWAA 3U0ZA 4Q20A 3RYCB 3RT3C 3IGAC 4XBFA 2YC0A 3JATA 1J5EB 3G67A 1XHZA 2ZXWB 4X65O 1B62A 4GEEA 1UJWB 4F6RA 1J5EO 1UYMA 4GX5A 3JD0A 4GX2A 4AQYB 1JQ0A 3B25A 1ENVA 4GCZA 3J81N 2CH7B 2FKXA 4FLWA 3ZRWB 3STLC 1BHBA 1QQCA 1MA1A 3RFRA 3AG1B 3BABA 3ABMB 3Q5KA 4H7QA 3A0WA 1Q43A 5IJ0B 1RSOB 1F23A 3ZJZA 3ABTA 3MD0A 2QEXV 4DZYA 1K4CC 1ZX3A 5JVDA 2EIKB 1WP7A 4IHJB 3OMAB 3B26A 2VQFB 4MTXA 2GQPA 2VCIA 3A0ZA 1SQQH 1H38A 4ZI7A 1VMGA 4I4TA 1PL4A 3AG1C 5LA6A 1UY6A 2YE3A 4TUYA 2VQFO 2YKCA 4CWPA 2WLKA 4X66O 2ZDYA 1PD3A 2C2AA 2LW1A 2FTKA 2JEUA 3C3SA 1Q5OA 1GKXA 3ABKB 2CTQA 1PP9H 1Y74A 4P7AA 2BREA 3OD4A 2IH1C 2B1IA 2WI1A 1GJVA 3Q5JA 3R92A 1QBZA 4WFEA 2KKWA 4E4EA 4W7TA 1DF4A 2ZIOA 2X6CA 5L3EA 1BHAA 4IIJA 3M99B 2YI5A 3PN1A 2IORA 3IJ4A 1GTOA 3H1LH 1E1RG 2RMKB 4XDKA 1FJGB 4JYAO 1BCCH 3OEHG 2ZE8A 2WI6A 2OIGA 3C90A 4U3JB 5CTWA 4JI1O 5KX5B 3KCXA 4PDMA 1QR8A 4AS9A 4XCJA 2A06H 1YETA 3S5TA 1IXMA 1JFFB 4RAIA 5BR8B 5TISZ 2XJXA 4PD4F 5LYJA 5J71A 1PNMA 2WLNA 2WLLB 4RUFA 2ZNJA 1LR1A 2YECA 4LP0A 3AG7A 1M5IA 2RQ6A 5BR8O 1B3QA 5FPRA 2HHHB 1SA0A 1YXBA 4O4LB 3TK1A 3QO7A 1YT0A 3K9SA 1IBLB 1K8AW 3O9OA 4KSHA 1YZBA 4LBEC 2HG5C 3IAYA 4G28B 3G75A 2HHHO 4KFMA 4YKQA 2ADPA 4RWUA 3HR0A 2LO1A 4LF5B 4YJ3B 1YT1A 4O0BA 4CE3A 1ZLZA 3LNMB 1JOYA 1W2BU 5KHGA 3H80A 2F4VO 3CRQA 1B06A 2R9IA 2QSAA 3JAKA 4NKGB 2ZBKB 4AWPA 4LF5O 2A9HA 3BRCA 4RQFA 2PTMA 2BTQB 2KSDA 1Y76B 4JI8B 4ASBA 2ZD9A 4I7ZB 3H1JH 4QNHB 4ASUG 1SRYA 2B1GA 1H8HG 4EGIA 4C7UA 2GFDA 2Q8HA 1NVPD 1ZAUA 5IDMA 4LWGA 3L73H 4E01A 3RYHA 4CWNA 1JVMA 1OCRB 4UB6Z 4PELA 3ZHSA 1EZJA 4JI8O 3DTUB 1AJNA 2L6LA 4K0KB 3CRCA 4QE7A 3U11A 1YSCA 1DK1A 1KMIZ 3OTOB 3ASOC 2GUZA 2IBZH 2UXBB 1U97A 2IOPA 4MP7A 3ZHRA 5LXTA 4K0KO 2UXDB 2EZOA 3EHFA 1Y4MA 4KFGA 3CCJV 3FB5C 1E1QG 3WB1A 4HAMA 3CEIA 1K92A 3OTOO 2UXBO 4DUHA 5IJ9B 2LGQA 5JCOA 2UXDO 2QGNA 4JI7O 5CB4A 4XC0A 1N8RW 1IDSA 2XAJA 5D5QA 4UFZA 3STZC 2WLIB 3WU2Z 1H7SA 3OMNB 4MVOA 1WPXA 2CGOA 5J2UA 2XDXA 1EBOA 1Y6XA 4HNAA 3B40A 4MPNA 1H2LA 2WI5A 2BYHA 3GIGB 5M4MA 2YIDA 3HHUA 3CYOA 1XREA 1VQ8V 1VF6C 2XAGA 2AZ0A 3SYAA 2LFSA 3K5MA 4KXRA 2ZIMA 3D3IA 1VQKV 1M1KW 3ZIAG 1VF5B 5BZBA 1CPYA 3TZ5A 1JCHA 1R62A 3CGYA 2CAZC 2KG7A 4K4OA 2HG1A 1MX0A 1BE3H 3CS5A 5DN6G 4PDVA 3FYIB 4OPHA 1MSWD 2GTSA 2EILB 5H9CA 2QM8A 3LSSA 4GUNA 4B6CA 1IX9A 5B5EZ 2AXTZ 1S72V 2V4DA 4B08A 4MP2A 2ADQB 1YT2A 4OPAA 4EB6A 3K5OA 1Y8PA 1I94B 3VHCA 2OTJV 1FFTB 1V9PA 4EFEA 1VP7A 3BHPA 3GB7C 4DV2B 1V55C 4LWSA 3CWVA 3W7XA 1H2KA 4EGKA 3TUHA 1I94O 5EBWC 2PUSA 2EBOA 4LC1A 3JALA 4Z2WA 2H8MA 1AR4A 4DV2O 4P30A 2FYPA 1WNSA 5LHGA 2DYRB 2XHXA 1NHJA 4XKOA 4R6ZA 1SQPH 2W0FC 1KZNA 1UY8A 4UUJC 3W7TA 3K04A 3OTFA 2ETNA 4L93A 2YDEA 2HFEC 2BTOA 4N21A 4YKUA 3WQ9A 3F5TA 3E8GA 1KUQA 3S3XA 5B1AB 3CGZA 3VOUA 2EINC 4X9LA 1PL0A 5FNDA 4DRXB 3E2EA 2ZDIC 4DXWA 3I5DA 4DK0A 2V1DA 5ITZB 1Q90D 2Q8GA 4YJ2A 5KUKA 2Z3YA 2EXLA 3RLQA 2XUMA 2GHYA 4HZ0A 3E89A 4O05A 4URNA 3BAAA 5B1AC 1H2MA 2PNRA 4URLA 4DUYB 2F23A 3A8TA 5LP6A 4R3AA 4JTDB 1VQLV 1EN5A 3UO3A 4R3MA 2XK2A 4W4KA 1HNWB 2RCVA 4DW0A 4DUYO 3QG5A 3QO5A 1TILA 5CMUA 3FFQA 2YIAA 1D5NA 4FCQA 5IT9N 4YIPA 4JGSA 3D2RA 3MHHC 3ZM7A 3LNNA 1ZXNA 4PDLA 2EX3A 2DW4A 1KIJA 1TC6A 2ODMA 2JDIG 2P7TC 1PNKA 3FX7A 4EFBA 5CA3A 1QU7A 2WA3A 5K1XA 2ZKJA 1DF5A 1M57B 1YDXA 5CBGA 5IDJA 4XTJA 3ZHTA 4Q6GA 5B1NA 1KQSU 2XDUA 4DV4O 4X20A 4X1YA 3ZXOA 2UXCB 3R4PA 3P32A 2QFOA 1TUBB 1VQMV 2FMLA 2Q8FA 2KB1A 4MW8A 4BAEA 2BSMA 4TWKA 2QA4V 5M4HA 4FM1A 2YIBD 4PA9A 1XBLA 1AI6A 5LMNB 4I55B 2UXCO 1RPRA 1OJHA 1PKXA 4LP8A 2QE7G 5C8YA 1DTOA 2AZ2A 2R70A 4UVAA 4TOIA 4EFUA 2YEHA 3SYOA 3CCQV 5LGTA 3UT5B 5CA1A 4W4LA 4YKTA 5JQGA 1N0NA 2Q4PA 3QTCA 4CS4A 2Q0OC 4YKWA 1NR1A 2AGAA 1SC5B 3X2QC 4I50B 5J6AA 4FFKA 2DE0X 3SPIA 1TUEB 2QTOA 1K73W 4YKRA 1N0JA 1URFA 1VQ5V 3BCCH 3J7AU 4MBCA 3ABLB 1MMMA 3M8AA 1VQ7V 3H9VA 4P9OA 4D6TH 2AHYA 2R9AA 1OHHG 2Y0IA 3C11A 2Y69C 4EMVA 5EIBD 1UYIA 2VQEB 3JZ3A 2P4VA 5KMGA 1BXDA 1GKZA 2BCCH 1TAEA 3ZKBA 3MDSA 2R9RB 4CH6A 3SYPA 1OZ0A 3ZHVA 3I55V 2NNUA 4FLTA 1B6QA 5LHHA 4O2BB 4X1IA 2VQEO 3R4OA 2HCHA 3JD2A 3HKBB 3G80A 4E02A 2PYLA 2RN9A 2XT9A 2D3OW 3ABLC 1F51A 1M9NA 5A9GA 1ROPA 3MAQA 4BQJA 2DQ0A 1F4NA 1Z2GA 1Y8OA 4EFTA 4EKWA 2YXHA 1JA8A 5JWPA 4XE2A 4JI4B 4JAUA 4XIQA 4MVMA 4KUMA 4ABMA 5E79Z 1XMQB 3JARB 1N32B 2QWOB 1M90W 5JVDB 1CP9A 4U93A 3DGEA 2E74B 4ZIBA 4JTCB 4DV1O 4JI5B 4JI4O 3AG3B 1NU1H 1N32O 1XMQO 3VHAA 2H94A 2ZR2A 3BY6A 3ZS8C 4K3AA 3B28A 4I9WA 1NH2B 4XDMA 1VF7A 3L72H 3R4NA 5LA6B 1KKCA 3BM9A
chains in the Genus database with same CATH topology
3T10A 4WFFA 2WSSG 4V26A 4MT8A 2XABA 1E79G 3E83A 4NH7A 4R1FA 3IEDA 1VQ4V 1K7DA 1GKFA 1OCCB 3A0TA 2IH3C 4ZBMA 3CC7V 4GX0A 2K5BA 1OCZB 4MTOA 2IOQA 1UYKA 3R91A 1W0KG 3K9AA 3B24A 3EHGA 4JQLA 4MVZA 2YEBA 2YEJA 3K0DA 4L8ZA 3INWA 1AH8A 2B5UA 1OCCC 4CZZA 1I5DA 3VHDA 5D6QA 2XJGA 5LBQA 4WCEV 2BU8A 1OCZC 1Q82W 1Z5AA 3TCUA 4ASGA 1G4YB 3ZRSA 4HXZA 4CE2A 4QPKA 1U2OA 2YGEA 1NHHA 5D7RA 2LFRA 2DQ3A 1R3LC 2K1EA 4UROA 3RKZA 3CP1A 3KE6A 1AI5A 4PA6A 1K3EA 4HY6A 2BOBC 3CD6V 1QVGU 4GT8A 5IYCO 2JJCA 3H01A 1UYDA 1Q7YW 2OCCB 1MG1A 3G71V 1YJWV 1YC1A 4LWFA 1NR7A 5L3BA 1I5CA 3OMUA 1R6NA 3B8MA 2W6IG 2IJKA 4JF3A 4YKZA 2OCCC 4FCPA 2WI2A 5CBFA 1P4RA 4F4LA 2XDSA 3OE7G 1OSFA 2JIZG 5IYDO 2QG2A 2X6AA 3LDDA 4ZKIA 2YEGA 3E35A 3TZ0A 2QG0A 4LWHA 2CG9A 1DLBA 1JJ2U 3NMQA 3K08A 3T4ZA 2VWCA 4FCRA 1K5SA 1Y66A 1NBMG 4YXWG 3TTZA 5GW7A 1YSZA 4HYOA 1K33A 4XKKA 4UXNA 3ASOB 3U2KA 1OCOB 3ASNC 1I5YA 4KTNA 1XL4A 3SYQA 3FB7C 3T1KA 4TT3G 2QM7A 2Q67A 4WF9V 4AWOA 4WFGA 5F5RA 2YK2A 1AM1A 4I5SA 1S3JA 1OCOC 2X7RB 5D7DA 3RW0A 5HFLA 1M56C 3INXA 2YKBA 2HR3A 3K0GA 1AH6A 5EC2C 2XX2A 3QDDA 3ZMSA 1YC3A 3K97A 2YE8A 1KECA 3RLRA 3Q5LA 3KG2A 5KUMA 4WUDA 3FT8A 2WAMA 2XHRA 3GWOA 2YKEA 2IWXA 1GM7A 3K98A 1UYGA 5FWKA 1JM6A 3E86A 2ITCC 3EHHA 4P9PA 5M4EA 4UV9A 1AROP 3LDEA 3HZ1A 4QIWF 3EKOA 4XD8A 2YJXA 1THZA 4BXIA 3EKRA 2IU0A 1V55B 4MVRA 4L94A 2PI4A 3AG2C 1YJ9V 1S77D 3B27A 3OWDA 2UXNA 5L3JA 2WEPA 1W0JG 1YJNV 4GT1A 1AJQA 5CBHA 2EIMC 4FJCC 1H8EG 1MABG 3ZRXA 3CPWU 1UYEA 1K4DC 3ZKDA 3CCRV 2EINB 3HEKA 3T0HA 1RPOA 3B77A 1I5XA 4WFHA 2WPDG 1H2GA 3CRLA 1ZWHA 5CTYA 2BYIA 1CEZA 1I59A 1SETA 1LNQA 4RO2A 3HB3B 3CXCU 2WEQA 3CRKA 1BL8A 1MU5A 2XASA 2Q69A 2WWWA 2E0AA 2XX5A 1Z59A 1Q86W 3ETGA 2Q6AA 4PL9A 4MVSA 2HKOA 2FWZA 2EIJC 3C0EA 4XDLA 2BRCA 2UWDA 3OR7C 1QR9A 2WLHA 3QNEA 2AHZA 5B3SB 3FYEB 3ZMUA 4KQVA 3G7EA 2FWYA 1I5BA 2AKPA 2JKIA 3O6OA 5FL7G 5FNFA 1HWYA 4PA7A 2IWUA 3JD3A 4LCUC 2BU2A 4XCLA 2XDKA 3WHAA 3OFNG 5B3SC 4JYBA 4H37A 1YIJV 3U2DA 3D36A 2QF6A 3X2QB 4MVUA 4O04A 2YEVB 2V7QG 2Q8IA 2DYSB 4MOTA 3HYYA 2F43G 5BODA 3RVYA 2FXSA 4PRVA 2P90A 3ZMTA 2Y69B 5L3CA 2CK3G 1GMGA 4GFNA 3WFVA 5CTUA 3F7VC 3EHBB 3OM3B 4J9YB 4MS2A 2IWSA 3PEJA 2DYSC 3H4LA 4E2LA 4O07A 2LP7A 4MSWC 1S76D 2CCSA 2A0LA 3ZRVA 2YI7A 2XHTA 1A4HA 1SESA 2H8PC 3QO8A 1QY8A 2IW5A 3HZ5A 5GGZA 1U0ZA 4HZ3A 4BIUA 1NJIW 3D0BA 5LHIA 1S14A 1QZRA 1COWG 4ZVIA 2WLJA 2HVKC 1UY7A 1AR1B 1R6KA 3AG4C 5H6QA 2WI3A 1Z5BA 3BMYA 2WI4A 2BT0A 4L90A 1YESA 4WUCA 4H33A 2P67A 1R3KC 3CMAV 2XDLA 4XDJA 4U7NA 3O0IA 3OPDA 2ITDC 4P2ZA 3CCUV 4KP4A 1YITV 4XIRA 2X0LA 3QTFA 2OTLV 3ZCCA 4CWRA 4CBCA 3ETDA 1SERA 4YKYA 3F7YC 1ZWIC 1RM1B 1EFRG 1VQPV 1Z5CA 3RVZA 4G2KA 2UXXA 4NH8A 4LWEA 1V54B 2HJFC 1UYLA 2JJ1G 1THNA 2YKJA 2YEIA 3W7SA 1GM8A 4LWIA 1NH2D 3IFXA 1RM1C 1SZTA 1FXKA 3PJSK 1R73A 1MOFA 4FK5C 1B63A 4O09A 3E8FA 1VQOV 4R7CA 3K99A 1V54C 2Q68A 2ZR3A 1NHIA 4HZ5A 1UY9A 1G8MA 4UVBA 4CWTA 1WLEA 3G6EV 3EFFK 3K03A 1QYEA 3NXSA 1J95A 3UKMA 4I3HA 1YS3A 1KD1W 3BEHA 1F4MA 1ZW9A 2ZXWC 2CCUA 1KKDA 3JD1A 1AI7A 5IN9A 3SJQC 2H55A 1KC8W 1Q81W 4HXWA 2O1VA 1I5AA 3OEEG 5M4NA 1EI1A 2JJ2G 4JYCA 3ABMC 5D7CA 2A79B 3TETA 4QJFB 1QLEB 5FNCA 2EIKC 1FXVA 2ATKC 3F5WC 3JD4A 2BU5A 5EK0A 2YEEA 3AEIA 4CWOA 4HY1A 2EZPA 4PDRA 2BZ5A 1K34A 3G4SV 3ABKC 2YGFA 1R3JC 1QLEC 5EC1C 1US7A 5DM6V 3ETEA 2YE7A 2GSMB 4EGHA 3ASNB 4XIPA 3OUFA 3O2FA 3SL2A 4R50A 5L3DA 2XOKG 1NVPB 4RUEA 5E1AC 3CCMV 1FS0G 3CMEV 1K5QA 1H7UA 2YKIA 1PVGA 3K79A 5H6RA 1K97A 3MHSC 3ZRWA 1UYFA 3MNRP 2O1UA 2ZQMA 3CCVV 2YEAA 4ASAA 5M4KA 2YI6A 2YJWA 2DWEC 2VW5A 1M56B 4EEHA 1TH8A 2JK5C 5CF0A 4FPPA 3A0XA 1FXHA 3LPSA 3SPGA 2YK9A 3SPCA 4ASFA 3T2SA 2XCMA 5CN0A 3JCZA 2ZDXA 1BYQA 3RBZA 1KP2A 3SPHA 2MK3A 3LDCA 2WERA 3U67A 3G7BA 1K9MW 1VQ9V 3ZMZA 4N23A 2XNDG 2XAHA 4GQTA 2IJIA 3ZN0A 3ZN1A 1VQ6V 1NKDA 4FMTA 4DO2A 4EM7A 4CWFA 4JAVA 1OCRC 3I56V 4URMA 2BU7A 4CWQA 2XJJA 3OWBA 2YE4A 5EBMC 2ESAA 1Y4UA 3A0YA 2BOCC 4Z1MG 3AG2B 1BGQA 4QE9A 2WLLA 3LNUA 1S16A 2YGAA 2BU6A 3VBBA 2EIMB 4X88A 2IU3A 3EHJA 5KA6A 4NH9A 3WG7B 3K06A 1L0OA 4WUBA 4V25A 4E00A 1YERA 3PEHA 4UVCA 2WLMA 3E8BA 1S5HC 3OW2U 4GGLA 4R8CA 4JPRA 4MVQA 4X89A 5LGUA 2P6JA 3WG7C 4L87A 2IJJA 2EJRA 4BIZA 1YI2V 4OXSA 4MB9A 5F3KA 3FB6C 4RQEA 1AJ6A 3T1CA 4PA3A 4BW5A 3GIFA 3CCSV 2XX4A 3LUTB 3FB8C 1BKNA 1QCEA 2EILC 2CH4A 5LGNA 2OT5A 3JYCA 4MPEA 2EIJB 3CCLV 5C93A 1EA6A 2Z5UA 3T4DA 2YEDA 2WLIA 4BAYA 4KSGA 3FKSG 5HFMA 3W7WA 1I58A 2DWDC 1UYCA 1R3IC 2DYRC 2XAQA 3GIGA 4MPCA 1TC0A 1KP3A 3LSQA 1VQNV 1QVFU 2YE2A 4TSFG 4JTAB 2YEFA 1ORQC 2Q2EB 3SYCA 5BOCA 5D6PA 3E8HA 1TIDA 4WFBV 3CC2V 4H85A 4AWQA 4PA4A 5J9PC 4J9ZB 4MW3A 5KA5A 1Y4SA 3HYZA 3CC4V 2W6JG 5IY5B 1AJPA 3SPJA 2HKJA 5CPHA 2VCJA 2JEXA 1YC4A 2XD6A 3K60A 5EBLC 3OAAG 2XAFA 4BQGA 3B8NA 2ZDIA 2IJHA 5L3FA 5IY5C 1YSRA 5B1OA 5L3GA 2WI7A 3TZ4A 2X6BA 4U7OA 3OUSA 2BTZA 4L91A 3R4MA 2Y48A 3OGCC 1S0VA 4B7PA 4G27B 1M57C 4PU9A 4CWSA 2NLJC 4PRXA 1GO3F 2O1WA 3OMIB 4X8AA 3OW6A 4JASA 3ABUA 1ZXMA 3A0RA 3AG4B 4MTGA 1FXKB 2YE9A 3T2MA 4WFAV 2YE5A 2M7WA 2CCTA 4GX1A 3R65A 4QPJA 5IYBO 3K3WA 5B1BB 4MTFA 1XL6A 3FT5A 4HYMA 1GK9A 1NQTA 4UV8A 1UYHA 1FXKC 2YSUB 1JX9A 2HVJC 2YI0A 3ZXQA 3W7UA 3RLPA 2QKSA 5B1BC 3UM7A 4XKAA 1PNLA 4HYPA 3ZMVA 1YTFB 3TZ2A 1TBWA 3ML0A 4LPBA 4CE1A 2HLDG 3P30A 1L1FA 3FV5A 1YHQV 4XITA 1Y8NA 5M4PA 2YEVA 3GIEA 3VADA 1JPXA 3CCEV 2YE6A 1AI4A 1QLNA 1AMWA 2PI5A 3T0ZA 4YKXA 3AG3C 4FIPC 2CGFA 3IC7A 4H81A 1P7BA 3OR6C 1ID0A 1BMFG 1YTFD 5CTXA 3HPLC 4P8OA 1GM9A 4Q20A 3IGAC 4XBFA 2ZXWB 1B62A 4GEEA 1UJWB 1UYMA 4GX5A 3JD0A 4GX2A 1JQ0A 3B25A 1ENVA 4GCZA 3ZRWB 3STLC 1BHBA 3AG1B 3ABMB 3Q5KA 4H7QA 3A0WA 1F23A 3ZJZA 3ABTA 4DZYA 3MD0A 2QEXV 1K4CC 2EIKB 3OMAB 3B26A 4MTXA 2GQPA 2VCIA 3A0ZA 1H38A 3AG1C 2YE3A 1UY6A 2YKCA 4CWPA 2WLKA 2ZDYA 1PD3A 2C2AA 2FTKA 2JEUA 1GKXA 3ABKB 4P7AA 2BREA 2IH1C 2B1IA 2WI1A 1GJVA 3Q5JA 3R92A 1QBZA 4WFEA 4W7TA 1DF4A 2X6CA 5L3EA 1BHAA 3M99B 2YI5A 2IORA 1GTOA 1E1RG 4XDKA 3OEHG 2WI6A 5CTWA 4PDMA 1QR8A 4AS9A 4XCJA 1YETA 1IXMA 4RAIA 2XJXA 5J71A 1PNMA 2WLNA 2WLLB 4RUFA 4LP0A 2YECA 1B3QA 3TK1A 3QO7A 1YT0A 1K8AW 4KSHA 4LBEC 2HG5C 4G28B 3G75A 4KFMA 4YKQA 1YT1A 4O0BA 4CE3A 3LNMB 1JOYA 1W2BU 3H80A 2R9IA 2ZBKB 4AWPA 2A9HA 4RQFA 4ASBA 2ZD9A 4QNHB 4ASUG 1SRYA 2B1GA 1H8HG 4EGIA 2GFDA 2Q8HA 1NVPD 5IDMA 4LWGA 4E01A 4CWNA 1JVMA 1OCRB 4PELA 1EZJA 3DTUB 1AJNA 4QE7A 1YSCA 3ASOC 2IOPA 4MP7A 3EHFA 2EZOA 1Y4MA 4KFGA 3CCJV 3FB5C 1E1QG 4HAMA 1K92A 4DUHA 4XC0A 1N8RW 2XAJA 3STZC 2WLIB 1H7SA 3OMNB 4MVOA 1WPXA 2XDXA 1EBOA 4MPNA 2WI5A 2BYHA 3GIGB 5M4MA 3HHUA 3CYOA 1VQ8V 2XAGA 3SYAA 2LFSA 3D3IA 1VQKV 1M1KW 3ZIAG 5BZBA 1CPYA 3TZ5A 1JCHA 1R62A 3CGYA 4K4OA 2HG1A 1MX0A 5DN6G 4PDVA 3FYIB 1MSWD 2EILB 5H9CA 2QM8A 3LSSA 4B6CA 1S72V 4MP2A 1YT2A 1Y8PA 3VHCA 2OTJV 1FFTB 3GB7C 1V55C 3CWVA 3W7XA 4EGKA 3TUHA 5EBWC 2EBOA 4LC1A 2H8MA 2FYPA 4P30A 5LHGA 2DYRB 2XHXA 1NHJA 4XKOA 4R6ZA 2W0FC 1KZNA 1UY8A 4UUJC 3W7TA 3K04A 4L93A 2HFEC 4N21A 4YKUA 3WQ9A 3E8GA 5B1AB 3CGZA 3VOUA 2EINC 4X9LA 1PL0A 5FNDA 3E2EA 2ZDIC 4DXWA 2V1DA 2Q8GA 5KUKA 2Z3YA 2EXLA 3RLQA 2GHYA 4HZ0A 3E89A 4O05A 4URNA 5B1AC 2PNRA 4URLA 4R3AA 4JTDB 1VQLV 4R3MA 2XK2A 3QO5A 1TILA 5CMUA 4FCQA 4JGSA 3D2RA 3MHHC 3ZM7A 1ZXNA 4PDLA 2DW4A 1KIJA 1TC6A 2JDIG 2P7TC 1PNKA 5CA3A 2ZKJA 1DF5A 1M57B 5CBGA 5IDJA 4XTJA 5B1NA 1KQSU 2XDUA 3ZXOA 3R4PA 3P32A 2QFOA 1VQMV 2Q8FA 2KB1A 4MW8A 4BAEA 2BSMA 4TWKA 2QA4V 5M4HA 4PA9A 1AI6A 1RPRA 1PKXA 4LP8A 2QE7G 1DTOA 4UVAA 4EFUA 2YEHA 3SYOA 3CCQV 5LGTA 4YKTA 4YKWA 1NR1A 3X2QC 5J6AA 3SPIA 1TUEB 2QTOA 1K73W 4YKRA 1VQ5V 4MBCA 3ABLB 1VQ7V 4P9OA 2AHYA 1OHHG 3C11A 2Y69C 4EMVA 1UYIA 3JZ3A 1BXDA 1GKZA 3ZKBA 2R9RB 3SYPA 1OZ0A 3I55V 2NNUA 1B6QA 5LHHA 3R4OA 2HCHA 3JD2A 4E02A 2D3OW 3ABLC 1F51A 1M9NA 1ROPA 4BQJA 2DQ0A 1F4NA 1Y8OA 4EFTA 4EKWA 4XE2A 4XIQA 4JAUA 4MVMA 4KUMA 1M90W 1CP9A 4U93A 3DGEA 4JTCB 3AG3B 3VHAA 2H94A 2ZR2A 3BY6A 3B28A 4I9WA 1NH2B 4XDMA 3R4NA 3BM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FNF A;  3T10 A;  4V26 A;  3EHJ A;  2IWU A;  4MT8 A;  2XAB A;  2WI6 A;  4NH9 A;  5CTW A;  4NH7 A;  4R1F A;  2BU2 A;  3IED A;  1L0O A;  4XCL A;  4AS9 A;  4XCJ A;  2XDK A;  3WHA A;  1YET A;  3A0T A;  4WUB A;  1IXM A;  4V25 A;  4E00 A;  1YER A;  3PEH A;  4JYB A;  2XJX A;  5J71 A;  2BU6 A;  3U2D A;  2K5B A;  4GGL A;  3D36 A;  2QF6 A;  2IOQ A;  2YEC A;  4LP0 A;  1UYK A;  3R91 A;  4O04 A;  1B3Q A;  3B24 A;  3EHG A;  4JQL A;  2Q8I A;  2YEB A;  4MOT A;  2YEJ A;  4L8Z A;  3TK1 A;  3HYY A;  1YT0 A;  5BOD A;  3INW A;  4BIZ A;  1AH8 A;  2FXS A;  4PRV A;  4MB9 A;  4KSH A;  4GFN A;  3G75 A;  4YKQ A;  1I5D A;  3VHD A;  5F3K A;  5CTU A;  5D6Q A;  1YT1 A;  4O0B A;  4CE3 A;  2XJG A;  1JOY A;  2BU8 A;  1AJ6 A;  3H80 A;  1Z5A A;  3GIF A;  2ZBK B;  4ASG A;  4AWP A;  2IWS A;  2XX4 A;  3PEJ A;  4HXZ A;  3H4L A;  1BKN A;  4CE2 A;  4O07 A;  4ASB A;  4QPK A;  2CH4 A;  1U2O A;  2CCS A;  3ZRV A;  2YGE A;  1NHH A;  4EGI A;  2YI7 A;  4MPE A;  2GFD A;  5D7R A;  2XHT A;  2Q8H A;  2LFR A;  1A4H A;  5IDM A;  4LWG A;  4E01 A;  5C93 A;  4CWN A;  3RKZ A;  4URO A;  1QY8 A;  3HZ5 A;  1EA6 A;  3KE6 A;  5GGZ A;  1U0Z A;  4BIU A;  2YED A;  4HY6 A;  4KSG A;  3D0B A;  1S14 A;  1QZR A;  2IOP A;  4GT8 A;  4MP7 A;  1I58 A;  2JJC A;  1UYC A;  3EHF A;  4ZVI A;  3GIG A;  4KFG A;  4MPC A;  1UYD A;  1TC0 A;  4DUH A;  1UY7 A;  2YE2 A;  1YC1 A;  4LWF A;  2YEF A;  2Q2E B;  2WI3 A;  4XC0 A;  1Z5B A;  3BMY A;  2WI4 A;  1I5C A;  2BT0 A;  3OMU A;  4L90 A;  1YES A;  5BOC A;  1H7S A;  4WUC A;  5D6P A;  2P67 A;  1TID A;  2XDX A;  2XDL A;  4MPN A;  2WI5 A;  2BYH A;  3GIG B;  4YKZ A;  4H85 A;  5M4M A;  4U7N A;  3O0I A;  4AWQ A;  3OPD A;  3HHU A;  4FCP A;  2WI2 A;  4KP4 A;  4XIR A;  3QTF A;  1Y4S A;  3HYZ A;  2LFS A;  3ZCC A;  4CWR A;  2XDS A;  1OSF A;  2HKJ A;  5CPH A;  2VCJ A;  4YKY A;  2QG2 A;  1YC4 A;  2XD6 A;  3TZ5 A;  1Z5C A;  4ZKI A;  2YEG A;  1R62 A;  3CGY A;  4K4O A;  3TZ0 A;  3K60 A;  2HG1 A;  1MX0 A;  2QG0 A;  4NH8 A;  4LWE A;  4BQG A;  4LWH A;  2CG9 A;  2QM8 A;  1UYL A;  1THN A;  1YSR A;  4B6C A;  2YKJ A;  2YEI A;  5B1O A;  3NMQ A;  2WI7 A;  2VWC A;  4FCR A;  3TZ4 A;  4LWI A;  4MP2 A;  1YT2 A;  1Y8P A;  3VHC A;  4U7O A;  2BTZ A;  4L91 A;  3R4M A;  3TTZ A;  1YSZ A;  1B63 A;  4B7P A;  3CWV A;  4O09 A;  4XKK A;  4EGK A;  3K99 A;  3TUH A;  4PU9 A;  3U2K A;  4LC1 A;  4CWS A;  2H8M A;  4KTN A;  2FYP A;  1NHI A;  4PRX A;  2XHX A;  4HZ5 A;  1NHJ A;  4XKO A;  2O1W A;  1UY9 A;  3BM9 A;  3T1K A;  1KZN A;  4CWT A;  1UY8 A;  3OW6 A;  4JAS A;  1ZXM A;  3A0R A;  2QM7 A;  4L93 A;  4AWO A;  1QYE A;  3NXS A;  5F5R A;  2YK2 A;  2YE9 A;  4YKU A;  3WQ9 A;  1AM1 A;  4I5S A;  2YE5 A;  4I3H A;  3CGZ A;  1YS3 A;  2CCT A;  4X9L A;  5FND A;  4QPJ A;  5D7D A;  1ZW9 A;  3INX A;  2CCU A;  2YKB A;  1AH6 A;  3FT5 A;  2Q8G A;  2XX2 A;  4HYM A;  3QDD A;  5IN9 A;  2H55 A;  1UYH A;  2EXL A;  3RLQ A;  1YC3 A;  2YI0 A;  3K97 A;  4HXW A;  4HZ0 A;  2O1V A;  1I5A A;  4O05 A;  4URN A;  3ZXQ A;  5M4N A;  2YE8 A;  1EI1 A;  3RLR A;  3Q5L A;  4WUD A;  3FT8 A;  4JYC A;  5D7C A;  2PNR A;  2XHR A;  4URL A;  2YKE A;  3RLP A;  2IWX A;  3K98 A;  4XKA A;  1UYG A;  5FWK A;  1JM6 A;  4R3A A;  4HYP A;  3EHH A;  5M4E A;  5FNC A;  4R3M A;  2XK2 A;  3TZ2 A;  1TBW A;  4LPB A;  1TIL A;  2BU5 A;  3HZ1 A;  4FCQ A;  3EKO A;  4CE1 A;  2YEE A;  3FV5 A;  4XD8 A;  3D2R A;  4XIT A;  4CWO A;  1Y8N A;  2YJX A;  5M4P A;  3ZM7 A;  1ZXN A;  3GIE A;  4HY1 A;  4BXI A;  1KIJ A;  3EKR A;  2BZ5 A;  1TC6 A;  3VAD A;  2YGF A;  1US7 A;  2YE6 A;  2ZKJ A;  2YE7 A;  5IDJ A;  1AMW A;  3T0Z A;  4EGH A;  4XTJ A;  4YKX A;  4L94 A;  4XIP A;  5B1N A;  3B27 A;  3O2F A;  3SL2 A;  2XDU A;  2CGF A;  3OWD A;  3ZXO A;  4H81 A;  3R4P A;  3P32 A;  2QFO A;  1ID0 A;  2Q8F A;  5L3J A;  2WEP A;  1H7U A;  2YKI A;  1PVG A;  2BSM A;  4BAE A;  4GT1 A;  5M4H A;  3ZRW A;  1UYF A;  3MNR P;  5CTX A;  2O1U A;  4P8O A;  2YEA A;  3ZRX A;  4Q20 A;  4ASA A;  1UYE A;  5M4K A;  2YI6 A;  2YJW A;  3ZKD A;  4EFU A;  2YEH A;  2VW5 A;  3HEK A;  4EEH A;  4YKT A;  1TH8 A;  3T0H A;  5CF0 A;  4FPP A;  3A0X A;  1B62 A;  4GEE A;  3CRL A;  4YKW A;  3LPS A;  1ZWH A;  5CTY A;  1UYM A;  2BYI A;  1I59 A;  2YK9 A;  5J6A A;  4ASF A;  3B25 A;  3T2S A;  4GCZ A;  2XCM A;  4YKR A;  3ZRW B;  2ZDX A;  1BYQ A;  4MBC A;  2WEQ A;  3CRK A;  3C11 A;  3Q5K A;  4H7Q A;  4EMV A;  1UYI A;  3A0W A;  3JZ3 A;  1MU5 A;  1BXD A;  1GKZ A;  2WER A;  3U67 A;  3ZKB A;  3G7B A;  3MD0 A;  4DZY A;  2WWW A;  2E0A A;  3B26 A;  2XX5 A;  3R4O A;  2HCH A;  4MTX A;  2GQP A;  4GQT A;  2VCI A;  4E02 A;  1Z59 A;  3A0Z A;  1F51 A;  4FMT A;  4PL9 A;  4BQJ A;  2YE3 A;  1UY6 A;  2FWZ A;  1Y8O A;  4EFT A;  4EM7 A;  2YKC A;  4CWP A;  3C0E A;  2ZDY A;  4CWF A;  4JAV A;  2BRC A;  4XE2 A;  2C2A A;  2FTK A;  4JAU A;  4XIQ A;  2UWD A;  4URM A;  1GKX A;  2BU7 A;  4CWQ A;  2XJJ A;  3OWB A;  2YE4 A;  2ESA A;  2BRE A;  4P7A A;  4U93 A;  3DGE A;  1Y4U A;  2WI1 A;  1GJV A;  3A0Y A;  3Q5J A;  3R92 A;  3VHA A;  1BGQ A;  4W7T A;  4KQV A;  3B28 A;  3G7E A;  3LNU A;  2FWY A;  1I5B A;  4XDM A;  2AKP A;  2JKI A;  2YI5 A;  1S16 A;  3R4N A;  2IOR A;  2YGA A;  3O6O A; 
#chains in the Genus database with same CATH topology
 4O2A B;  2CUG A;  3T10 A;  4WFF A;  2VWJ A;  1Q8I A;  2WSS G;  5CA0 A;  4V26 A;  4MT8 A;  2XAB A;  1E79 G;  3E83 A;  4NH7 A;  4TQF A;  4R1F A;  3IED A;  1VQ4 V;  1K7D A;  1GKF A;  1OCC B;  3A0T A;  2IH3 C;  1XQ8 A;  1IBM O;  4ZBM A;  3CC7 V;  4GX0 A;  2K5B A;  1OCZ B;  4J42 A;  4MTO A;  4UCR A;  2IOQ A;  1UYK A;  4IIJ B;  3R91 A;  1W0K G;  3K9A A;  4O4H A;  4LF7 B;  3B24 A;  3EHG A;  4JQL A;  4MVZ A;  1R1B A;  2YEB A;  2YEJ A;  3K0D A;  3BVO A;  3Q4H A;  4L8Z A;  1WAZ A;  3A0H Z;  3INW A;  1AH8 A;  2B5U A;  3H1K H;  2WA4 A;  4LNU A;  1OCC C;  3CJH A;  3ZBH A;  1EN6 A;  4CZZ A;  3K59 A;  1I5D A;  3VHD A;  1MNG A;  1ZTE A;  5D6Q A;  4IYH A;  5KHH A;  2XJG A;  5LBQ A;  4WCE V;  2BU8 A;  1OCZ C;  1Q82 W;  1Z5A A;  3TCU A;  3HKC A;  1I7F A;  1G4Y B;  4ASG A;  1KBH A;  1G6U A;  5GTH Z;  3ZRS A;  4NVP A;  4HXZ A;  2RJZ A;  4CE2 A;  1SA0 B;  4QPK A;  3TXS A;  1U2O A;  2ZT9 B;  5FLX N;  3LMM A;  2YGE A;  4AQY O;  1NHH A;  5D7R A;  4DV0 B;  5F2V O;  2LFR A;  2DQ3 A;  4IYI A;  4ICG A;  1R3L C;  4JZG A;  4K35 A;  3SDL A;  2K1E A;  4URO A;  4PI0 A;  3RKZ A;  1TVK B;  3CP1 A;  2CGN A;  3OT7 A;  4ZHQ B;  3KE6 A;  1AI5 A;  4PA6 A;  1K3E A;  4HY6 A;  1PPJ H;  2BOB C;  3JAK B;  3CD6 V;  2ZE7 A;  1QVG U;  4GT8 A;  3DXR A;  5IYC O;  2JJC A;  1X59 A;  5LOV A;  3H01 A;  1DGS A;  1UYD A;  1Q7Y W;  3QF7 A;  5LL6 Y;  2OCC B;  3ZHU A;  1MG1 A;  2DMX A;  4WBN A;  4O4J B;  4JI6 B;  3G71 V;  1YJW V;  1YC1 A;  3RYH B;  4UCS A;  4LWF A;  3JSN A;  3VQX A;  1NR7 A;  4TV8 B;  3DSQ A;  5L3B A;  3N2K A;  4X9Q A;  1MZF A;  2N74 A;  1XMO B;  1VIB A;  1I5C A;  1LUV A;  3IC9 A;  4JI6 O;  3OMU A;  2OWO A;  2A3Q A;  1R6N A;  3B8M A;  5J2T A;  2W6I G;  4H44 B;  2C1G A;  5LXT B;  2IJK A;  3R66 A;  3TJT A;  1Q6I A;  1XI1 A;  4JF3 A;  4I0X A;  4YKZ A;  4DR6 B;  2OCC C;  3JAS A;  3CRM A;  4FCP A;  2WI2 A;  2VRZ A;  4DW1 A;  3RYF B;  4X1K B;  3HKD A;  5CBF A;  1P4R A;  3HKE B;  4DR6 O;  1IZ3 A;  2K9P A;  4F4L A;  2P06 A;  2XDS A;  3OE7 G;  1XOU A;  1WJZ A;  4DYL A;  1FJG O;  4FLU A;  1OSF A;  2JIZ G;  5FNV A;  2JS3 A;  3L71 H;  5IYD O;  2QG2 A;  2X6A A;  3LDD A;  2Y4T A;  5J2U B;  4ZKI A;  2YEG A;  3E35 A;  1FFX A;  2LGW A;  2UUB B;  3TZ0 A;  1XDC A;  4B7K A;  3RYC A;  2ZE5 A;  2QG0 A;  2CE4 A;  2QWR B;  4LWH A;  5JCO C;  2CG9 A;  1DLB A;  3SJB C;  2UUB O;  3E22 A;  1JJ2 U;  2M6Y A;  3ICX A;  4B3T B;  3K08 A;  3NMQ A;  3T4Z A;  3CSX A;  2VWC A;  4FCR A;  2UUA B;  1K5S A;  2ZIN A;  1AP6 A;  1Y66 A;  1NBM G;  4YXW G;  4TV9 A;  3UCS C;  4HBN A;  3TTZ A;  2CH7 A;  5GW7 A;  1IBL O;  1YSZ A;  1XHX A;  4HYO A;  1K33 A;  4XKK A;  4UXN A;  4DV7 B;  2QM4 A;  3ASO B;  3U2K A;  2D2C B;  4B3R B;  1IXB A;  1OCO B;  3ASN C;  1W59 A;  1I5Y A;  3BPZ A;  4KTN A;  4BW9 A;  1Q6H A;  1XL4 A;  5IJ0 A;  1RSO A;  5JJN B;  3SYQ A;  5EZY A;  3FB7 C;  4AHC A;  1P84 F;  2R72 A;  3T1K A;  4DV7 O;  4B3R O;  4TT3 G;  2B9Z A;  4IHJ A;  3T1H B;  2O57 A;  2AW9 A;  3U10 A;  2QM7 A;  4EB6 B;  2Q67 A;  4WF9 V;  2QWQ B;  4WFG A;  2Q8V A;  4AWO A;  1QHT A;  5F5R A;  2YI8 A;  3A2F A;  2YK2 A;  1AM1 A;  4I5S A;  3T1H O;  1S3J A;  1OCO C;  3RN4 A;  4JV5 B;  4NXM B;  2X7R B;  5D7D A;  4FLV A;  3RW0 A;  5HFL A;  1M56 C;  2ZKO A;  3INX A;  2GDS A;  2YKB A;  2HR3 A;  1HNZ B;  1NTZ H;  3K0G A;  4KL1 A;  1AH6 A;  5BMV A;  1QNM A;  3AK1 A;  5EC2 C;  3M7M X;  4JV5 O;  2EJ7 A;  2XX2 A;  3QDD A;  1WP8 A;  1HNZ O;  3CE2 A;  3ZMS A;  1YC3 A;  3K97 A;  2YE8 A;  4CS2 A;  1KEC A;  3RLR A;  3Q5L A;  3KG2 A;  5KUM A;  1Q3E A;  4WUD A;  3FT8 A;  4B3S B;  2WAM A;  4FZ1 A;  2XHR A;  3GWO A;  2YKE A;  1XIL A;  2IWX A;  1GM7 A;  3K98 A;  4U3J A;  1UYG A;  5FWK A;  1JM6 A;  3CRR A;  3E86 A;  2DJV A;  2ITC C;  3EHH A;  4P9P A;  4B3S O;  5M4E A;  4UV9 A;  1ARO P;  5IYZ B;  1EM1 A;  4X62 B;  4YJ2 B;  1JFF A;  5IE9 A;  1ZSP A;  3LDE A;  3HZ1 A;  4QIW F;  3EKO A;  1AP5 A;  1HNX B;  3D8C A;  4XD8 A;  4X62 O;  2YJX A;  1THZ A;  5BXZ A;  4BXI A;  3EKR A;  2IU0 A;  2XHB A;  1TGO A;  1XNQ B;  2YI9 A;  4DUZ B;  3CWB H;  1HNX O;  1SZX A;  5LP6 B;  4CH5 A;  1V55 B;  4MVR A;  3FAV B;  1MZE A;  1SQG A;  4L94 A;  1XNQ O;  1SKV A;  2PI4 A;  3AG2 C;  1YJ9 V;  1S77 D;  3B27 A;  2P22 C;  4PV1 B;  2N05 A;  3OWD A;  3TXQ A;  1BSM A;  4ZOL B;  3C3T A;  2UXN A;  1GRJ A;  1Q6U A;  1NT2 B;  4CH3 A;  1BZK A;  5L3J A;  2JGD B;  2WEP A;  1W0J G;  3K5L A;  1YJN V;  4GT1 A;  1AJQ A;  5CBH A;  2EIM C;  1N36 B;  2H3O A;  4GKJ B;  4LFA B;  5LP6 C;  2BTQ A;  1Y76 A;  4FJC C;  1H8E G;  1MAB G;  3ZRX A;  3CPW U;  3SJA C;  1UYE A;  1YF2 A;  1K4D C;  3ZKD A;  3CCR V;  2EIN B;  1WA8 B;  4GKJ O;  4LFA O;  2CDY A;  3HEK A;  3T0H A;  1RPO A;  4TQD A;  3B77 A;  1I5X A;  4WFH A;  3AK2 A;  2PF4 E;  2WPD G;  1H2G A;  3CRL A;  5DEC A;  1WB8 A;  1ZWH A;  5CTY A;  4PHZ A;  2BYI A;  1UFI A;  1CEZ A;  2QJ1 A;  1I59 A;  1SET A;  2HP8 A;  1M93 A;  1LNQ A;  4J10 A;  4RO2 A;  3HB3 B;  1L0N H;  1HDJ A;  4X64 B;  2DOS A;  3CXC U;  2WEQ A;  5C8Y B;  3CRK A;  1BL8 A;  1SS3 A;  1MU5 A;  2XAS A;  1AR5 A;  4NXN B;  5CA1 B;  4X64 O;  3RWR D;  4B7E A;  2Q69 A;  3N2G A;  5JQG B;  2WWW A;  2HHI A;  2E0A A;  3CXH F;  3J80 N;  2XX5 A;  1JJO A;  4NXN O;  1YCI A;  1Z59 A;  1Q86 W;  1JR9 A;  2Q7H A;  3ETG A;  2Q6A A;  1KU9 A;  4PL9 A;  1ZL8 B;  4MVS A;  2HKO A;  4K8Z A;  2FWZ A;  4IL6 Z;  2EIJ C;  3C0E A;  4XDL A;  2BRC A;  2PY5 A;  3QVN A;  2UWD A;  3OR7 C;  1QR9 A;  2WLH A;  5KHJ A;  4LF6 B;  3L75 H;  3QNE A;  2AHZ A;  1NZ6 A;  2Q73 A;  3FYE B;  5B3S B;  2G38 A;  3ZMU A;  4LF6 O;  4KQV A;  1HNW O;  5GTI Z;  3G7E A;  2FWY A;  1I5B A;  2AKP A;  2JKI A;  4AI8 A;  3GWK C;  3O6O A;  5FL7 G;  5FNF A;  1HWY A;  4LFB B;  1Z5V A;  4PA7 A;  2P5O A;  2IWU A;  4LF9 B;  1L8D A;  3BA8 A;  3JD3 A;  3B2E E;  4LCU C;  3A0B Z;  2BU2 A;  4XCL A;  4LFB O;  2XDK A;  3WHA A;  1XUQ A;  1O9H A;  3OFN G;  3JAW B;  5B3S C;  2FYU H;  4JYB A;  2Y0P A;  4H37 A;  1N33 B;  1YIJ V;  3U2D A;  3D36 A;  5H5N A;  2QF6 A;  3X2Q B;  4MVU A;  4O04 A;  2YEV B;  1N33 O;  1US6 A;  2V7Q G;  4FLZ A;  4FFB A;  2Q8I A;  5JEN A;  2DYS B;  5CA0 B;  4MOT A;  3HYY A;  2F43 G;  5BOD A;  3RVY A;  2FXS A;  4UB8 Z;  4PRV A;  4Z1V A;  4BIO A;  3RYI A;  5GON A;  2P90 A;  3ZMT A;  2Y69 B;  5L3C A;  2CK3 G;  1GMG A;  2JRI A;  5LMN O;  4GFN A;  2E5L B;  3WFV A;  4OGQ B;  5CTU A;  4J7J A;  1FKA O;  3F7V C;  1EN4 A;  3EHB B;  3L70 H;  1RP3 B;  2CTW A;  4DR5 B;  3OM3 B;  4J9Y B;  4MS2 A;  2E5L O;  1WPB A;  1NS1 A;  3ZX6 A;  1Y67 A;  4DRX A;  4O4I B;  2DYS C;  2IWS A;  3H4L A;  3PEJ A;  1VEW A;  4E2L A;  4FZ0 A;  4O07 A;  2Q7G A;  4LR3 A;  5JH7 B;  2LP7 A;  2F95 B;  4MSW C;  1S76 D;  2A0L A;  2BSK A;  3ZRV A;  2VS0 A;  2CCS A;  2YI7 A;  4NTW A;  2XHT A;  1AB3 A;  3KKY A;  1A4H A;  2N04 A;  3JAT B;  1SES A;  2H8P C;  3QO8 A;  1QY8 A;  2IW5 A;  3HZ5 A;  5GGZ A;  1XNR B;  1U0Z A;  4HZ3 A;  4BIU A;  4F6R B;  4YY3 B;  1NJI W;  3VQW A;  3CX5 F;  3CHX A;  4DR4 B;  3D0B A;  3HKC B;  5LHI A;  1S14 A;  1QZR A;  4NR1 A;  1COW G;  4ZVI A;  2WLJ A;  4UCV A;  3N27 A;  2YXL A;  2YIB A;  4DR4 O;  2EUL A;  4JI2 B;  2HVK C;  1UY7 A;  1AR1 B;  1NI8 A;  1R6K A;  2Q9L A;  3AG4 C;  5H6Q A;  5EYP A;  2WI3 A;  3UQ8 A;  2YS8 A;  1Z5B A;  3BMY A;  2WI4 A;  2BT0 A;  1N4C A;  4K8X A;  4L90 A;  1YES A;  3H1H H;  4WUC A;  1A32 A;  4H33 A;  4LF4 B;  2P67 A;  1R3K C;  3CMA V;  4ZI7 B;  2XDL A;  4XDJ A;  4JI5 O;  4I4T B;  3FD9 A;  4U7N A;  3O0I A;  4TUY B;  3OPD A;  1SF9 A;  2ITD C;  4P2Z A;  4LF4 O;  3BA9 A;  3CCU V;  4KP4 A;  1YIT V;  4XIR A;  2X0L A;  4WBN B;  1IBK B;  3QTF A;  5IWA B;  2NR5 A;  2OTL V;  3ZCC A;  4E72 A;  2UU9 B;  1Y74 B;  4CWR A;  4CBC A;  3ETD A;  1SER A;  4H13 B;  1TUB A;  4YKY A;  1BS3 A;  3F7Y C;  1ZWI C;  1RM1 B;  1EFR G;  1VQP V;  1Z5C A;  2UU9 O;  4CH4 A;  1L0L H;  3RVZ A;  4G2K A;  2UXX A;  4NH8 A;  4LWE A;  1V54 B;  1G1X B;  2HJF C;  3UT5 A;  1RFY A;  1GN3 A;  1UYL A;  2JJ1 G;  1THN A;  4LF7 O;  2YKJ A;  2YEI A;  3W7S A;  1NTM H;  1GM8 A;  5KLV H;  4LWI A;  3L74 H;  4J41 A;  1NH2 D;  3ETQ A;  4I50 A;  2OIE A;  3IFX A;  1RM1 C;  5KHI A;  1SZT A;  3K58 A;  1FXK A;  3PJS K;  4LFC B;  5LYJ B;  1R73 A;  4DR3 B;  1MOF A;  4FK5 C;  4YHH B;  1B63 A;  1P49 A;  4O09 A;  3E8F A;  1VQO V;  4X65 B;  4R7C A;  2QWN B;  4BR6 A;  1V54 C;  3K99 A;  2Q68 A;  3APQ A;  5K1P A;  2ZNI A;  2ZR3 A;  4LFC O;  4DR3 O;  4YHH O;  1NHI A;  2QDO A;  4HZ5 A;  5LMU B;  1UY9 A;  3E22 B;  1G8M A;  4JI3 B;  4UVB A;  4CWT A;  4O2B A;  1NTK H;  1WLE A;  1GH6 A;  3K57 A;  3VQV A;  3HKB A;  3G6E V;  3SR2 C;  3EFF K;  3K03 A;  5LMU O;  5BY1 A;  1QYE A;  4TV9 B;  3NXS A;  4DV0 O;  4JI3 O;  1J95 A;  3UKM A;  4I3H A;  1BQ0 A;  4GLX A;  1YS3 A;  1YVW A;  4F6E A;  1KD1 W;  3BEH A;  1YEW A;  5KAF Z;  4D7S A;  1F4M A;  4LF8 B;  1ZW9 A;  2ZXW C;  2CCU A;  3JAR A;  4DV6 B;  5EZY B;  1SQV H;  1KKD A;  2W0X A;  4JAA A;  3JD1 A;  1AI7 A;  4LF8 O;  2YUA A;  5IN9 A;  3SJQ C;  2H55 A;  4DV6 O;  4X66 B;  1KC8 W;  1Q81 W;  4HXW A;  2O1V A;  1I5A A;  3OEE G;  5M4N A;  4H0L B;  1EI1 A;  2JJ2 G;  4JYC A;  2GUZ B;  3ABM C;  3EVK A;  4O2A A;  5D7C A;  1FD9 A;  1XMO O;  1WB7 A;  2A79 B;  3TET A;  4QJF B;  1QLE B;  5FNC A;  2EIK C;  1FXV A;  4JI0 B;  5BMV B;  1HR0 B;  2ATK C;  3F5W C;  3JD4 A;  1GN2 A;  2BU5 A;  5EK0 A;  4L8J A;  2OYQ A;  5CB4 B;  4NYK A;  2YEE A;  4JYA B;  3AEI A;  4JI0 O;  5AG2 A;  3H1I H;  3B4S A;  4JI1 B;  1HR0 O;  4CWO A;  1U96 A;  4HY1 A;  1JMK C;  2L35 A;  3JAM N;  2EZP A;  4PDR A;  2BZ5 A;  1K34 A;  4HNA B;  4FLY A;  3JCU Z;  3G4S V;  2RNB A;  3ABK C;  2YGF A;  1R3J C;  1QLE C;  5EC1 C;  1US7 A;  2LQT A;  5DM6 V;  2VWK A;  5H2F Z;  1AIL A;  3ETE A;  2YE7 A;  2GSM B;  4EGH A;  3ASN B;  3SGI A;  4XIP A;  3OUF A;  3O2F A;  3SL2 A;  4R50 A;  5L3D A;  2XOK G;  1NVP B;  2JVD A;  4RUE A;  1MSD A;  1TA8 A;  5JJJ B;  5E1A C;  3CCM V;  1FS0 G;  3CME V;  1K5Q A;  4U3F H;  1H7U A;  2YKI A;  1PVG A;  1FPO A;  5KAI Z;  3K79 A;  5H6R A;  1K97 A;  3MHS C;  3ZRW A;  4B3T O;  1UYF A;  3MNR P;  1T5E A;  2UUA O;  2ZQM A;  2KG7 B;  2O1U A;  3CCV V;  2YEA A;  1I0H A;  4ASA A;  1EZV H;  1OV9 A;  5M4K A;  3AK3 A;  2YI6 A;  2YJW A;  2DWE C;  2F4V B;  2VW5 A;  1TVK A;  1M56 B;  4EEH A;  2MW2 B;  1TH8 A;  2JK5 C;  5CF0 A;  4ZHQ A;  4FPP A;  3A0X A;  4D7T A;  1FXH A;  3LSU A;  5FPO A;  3LPS A;  3SPG A;  2YK9 A;  3SPC A;  4LH7 A;  4ASF A;  3T2S A;  2XCM A;  5CN0 A;  5DED A;  1ZUQ A;  3JCZ A;  2ZDX A;  1UPG A;  2PYJ A;  1BYQ A;  3RBZ A;  1KP2 A;  4LWS B;  3BFR A;  1VAR A;  2Z0A A;  3SPH A;  4O4J A;  3O65 A;  3JAL B;  1LUW A;  3SJC C;  2MK3 A;  3LDC A;  1FYJ A;  2WER A;  3U67 A;  4TV8 A;  3G7B A;  1K9M W;  2YIC A;  4DR1 B;  1VQ9 V;  3ZMZ A;  3ZHQ A;  4N23 A;  3VQY A;  4NXM O;  2XND G;  3GVM A;  2XAH A;  4GKK B;  4GQT A;  2Q7E A;  4DR1 O;  2IJI A;  3ZN0 A;  3ZN1 A;  1VQ6 V;  1NKD A;  1PM9 A;  4FMT A;  2PGG A;  4JI7 B;  3KZI Z;  1S5L Z;  4DK1 A;  4DO2 A;  4GKK O;  4EM7 A;  4CWF A;  4JAV A;  3RYF A;  4X1K A;  1OCR C;  3I56 V;  4URM A;  2JGU A;  2BU7 A;  5KX5 A;  3HKE A;  3THO A;  4CWQ A;  2XJJ A;  3OWB A;  4JYY A;  2YE4 A;  5EBM C;  2ESA A;  3N2G B;  4FLX A;  5KHK A;  1Y4U A;  1N34 B;  3A0Y A;  3K5N A;  2BOC C;  2F93 B;  4Z1M G;  4PJ0 Z;  3AG2 B;  1BGQ A;  4DV3 B;  4QE9 A;  1HP8 A;  2WLL A;  3LNU A;  1N34 O;  2ARH A;  1S16 A;  2BU6 A;  2YGA A;  4DV3 O;  3VBB A;  2EIM B;  4X88 A;  2IU3 A;  3EHJ A;  5KA6 A;  4O4L A;  3APO A;  4NH9 A;  3WG7 B;  5D5P A;  1HW7 A;  3K06 A;  2Y4U A;  1L0O A;  1D5A A;  4WUB A;  2GBO A;  4V25 A;  4E00 A;  1YER A;  4DUZ O;  3PEH A;  4UVC A;  4YJ3 A;  2WLM A;  3E8B A;  1S5H C;  3OW2 U;  3ZED A;  4GGL A;  3WB0 A;  4R8C A;  4JPR A;  4MVQ A;  4X89 A;  5LGU A;  3G6B A;  2P6J A;  2F1M A;  3WG7 C;  2OCH A;  4L87 A;  2IJJ A;  1KYO F;  2EJR A;  4CC6 A;  4BIZ A;  1YI2 V;  4OXS A;  4I9Q A;  2FB5 A;  1N36 O;  4MB9 A;  1B04 A;  3B09 A;  1GN4 A;  5F3K A;  4GYC B;  4X20 B;  3FB6 C;  4RQE A;  4UCO A;  4X1Y B;  1GAX A;  1AJ6 A;  2JS5 A;  3T1C A;  4PA3 A;  1BT8 A;  1R6T A;  5B66 Z;  4BW5 A;  3GIF A;  3CCS V;  2QKC A;  2XX4 A;  3LUT B;  3FB8 C;  1BKN A;  1QCE A;  2EIL C;  4FFB B;  3RGB A;  2E3C A;  3JSL A;  2CH4 A;  5LGN A;  2OT5 A;  3JYC A;  2PZS A;  3OGI B;  4MPE A;  2EIJ B;  4J11 A;  5IJ9 A;  3RYI B;  4AIL C;  5GON B;  3CCL V;  2CTR A;  5C93 A;  4LH6 A;  1VF6 A;  1KB9 F;  1EA6 A;  1SQF A;  2Z5U A;  1FAF A;  3D36 C;  3T4D A;  2YED A;  1D2D A;  2WLI A;  4BAY A;  4KSG A;  2FL4 A;  3FKS G;  5HFM A;  3W7W A;  1I58 A;  2DWD C;  1UYC A;  1R3I C;  2DYR C;  2XAQ A;  3GIG A;  1BGY H;  4MPC A;  1TC0 A;  2BSK B;  1KP3 A;  3LSQ A;  4B3M B;  1VQN V;  1QVF U;  5IYZ A;  2YE2 A;  4TSF G;  1AVM A;  3UO2 A;  4JTA B;  5KMG B;  2HJD A;  2YEF A;  1M4U A;  1ORQ C;  2Q2E B;  1IVS A;  1O9G A;  1P7G A;  2QR4 A;  2A7W A;  3SYC A;  4B3M O;  4FM2 A;  4X1I B;  5BOC A;  5D6P A;  3CRA A;  3E8H A;  4CS3 A;  4UCT A;  3DC5 A;  1TID A;  4WFB V;  3DC6 A;  3CC2 V;  4H85 A;  2LJ2 A;  4PA4 A;  4AWQ A;  3FAV A;  5J9P C;  4J9Z B;  2ZCE A;  4MW3 A;  5KA5 A;  1Y4S A;  3HYZ A;  3CC4 V;  1H2S B;  2W6J G;  5IY5 B;  5EYP B;  1AJP A;  4ZOL A;  3SPJ A;  2HKJ A;  5CPH A;  2JGD A;  2VCJ A;  2JEX A;  4LF9 O;  1YC4 A;  2XD6 A;  4YIO A;  2E76 B;  1F7Y A;  3K60 A;  5EBL C;  4DV4 B;  4KHP B;  3NR7 A;  3OAA G;  3S3W A;  4NTX A;  2XAF A;  4BQG A;  1WA8 A;  3B8N A;  2ZDI A;  2IJH A;  2RDC A;  1XEQ A;  5L3F A;  5IY5 C;  1YSR A;  4KHP O;  3CB2 A;  5B1O A;  5L3G A;  2WI7 A;  4J7Z A;  3TZ4 A;  3T1Y B;  5A2Q N;  2X6B A;  4U7O A;  3OUS A;  2BTZ A;  4L91 A;  3R4M A;  2Y48 A;  3OGC C;  1S0V A;  4B7P A;  4G27 B;  2GTA A;  4QGP A;  1Z5W A;  3T1Y O;  4O4H B;  1M57 C;  4PU9 A;  2IM9 A;  4CWS A;  1GN6 A;  2NLJ C;  4DR5 O;  4PRX A;  1GO3 F;  3Q4H B;  3EXA A;  5ITZ A;  2O1W A;  4IGG A;  3OMI B;  1X4T A;  5EIB C;  4X8A A;  4LNU B;  4DR2 B;  4DR7 B;  3CJH B;  3OW6 A;  4JAS A;  3ABU A;  4JZ2 A;  2F66 C;  3A0R A;  2QTS A;  1ZXM A;  2QWP B;  2KQX A;  1SQB H;  3AG4 B;  4MTG A;  1FXK B;  3L9D A;  2YE9 A;  4DR2 O;  3T2M A;  4DR7 O;  4OX9 B;  1ZL8 A;  4WFA V;  2YE5 A;  1H2N A;  4FVM A;  2M7W A;  2P4K A;  2CCT A;  2GV9 A;  4GX1 A;  3R65 A;  4QPJ A;  2HEP A;  5IYB O;  1XNR O;  3K3W A;  4J7K A;  2NN4 A;  4YY3 O;  5B1B B;  4OX9 O;  4MTF A;  1XL6 A;  2XTA A;  1CXZ B;  3FT5 A;  4HYM A;  1GK9 A;  1NQT A;  4UV8 A;  1UYH A;  1FXK C;  2YSU B;  1JX9 A;  1I08 A;  2HVJ C;  4JI2 O;  2YI0 A;  3D3Q A;  3ZXQ A;  2ZE6 A;  2YXY A;  4NB5 A;  4UCU A;  2E75 B;  3TGU H;  3W7U A;  3RLP A;  3DXR B;  2ILM A;  4DV1 B;  2QKS A;  5B1B C;  3UM7 A;  4XKA A;  5LOV B;  1PNL A;  4HYP A;  3ZMV A;  2ZM6 B;  1IUR A;  1YTF B;  3TZ2 A;  3WB2 A;  4CC5 A;  1TBW A;  3ML0 A;  4LPB A;  3JAW A;  2Q0A A;  1SQX H;  4A5U B;  2ZM6 O;  4CE1 A;  2Q5Z A;  3N2K B;  3P3N A;  2HLD G;  1PV0 A;  3P30 A;  4IT5 A;  1L1F A;  3FV5 A;  1YHQ V;  4J80 A;  4XIT A;  1Y8N A;  1IBK O;  5IWA O;  5M4P A;  2CTP A;  2YEV A;  3GIE A;  5J2T B;  4I55 A;  3VAD A;  5JJE B;  1IBM B;  1JPX A;  4I0X B;  3CCE V;  1WN7 A;  2UUC B;  4GZR B;  3JAS B;  2YE6 A;  1AI4 A;  1QLN A;  1AMW A;  2PI5 A;  2LW7 A;  3T0Z A;  4YKX A;  3AG3 C;  4FIP C;  3KCY A;  1S5J A;  3CYG A;  3HKD B;  3P3P A;  2BE3 A;  4DV5 B;  2QKA A;  2CGF A;  2UUC O;  3IC7 A;  4FM0 A;  4H81 A;  1BQZ A;  1P7B A;  4NTY A;  4EEQ A;  3OR6 C;  5FNV B;  1ID0 A;  1BMF G;  4DV5 O;  4O4I A;  1YTF D;  2DN9 A;  5CTX A;  3HPL C;  2C1I A;  1FFX B;  4PI2 A;  4P8O A;  1GM9 A;  5JH7 A;  4BWA A;  3U0Z A;  4Q20 A;  3RYC B;  3RT3 C;  3IGA C;  4XBF A;  2YC0 A;  3JAT A;  1J5E B;  3G67 A;  1XHZ A;  2ZXW B;  4X65 O;  1B62 A;  4GEE A;  1UJW B;  4F6R A;  1J5E O;  1UYM A;  4GX5 A;  3JD0 A;  4GX2 A;  4AQY B;  1JQ0 A;  3B25 A;  1ENV A;  4GCZ A;  3J81 N;  2CH7 B;  2FKX A;  4FLW A;  3ZRW B;  3STL C;  1BHB A;  1QQC A;  1MA1 A;  3RFR A;  3AG1 B;  3BAB A;  3ABM B;  3Q5K A;  4H7Q A;  3A0W A;  1Q43 A;  5IJ0 B;  1RSO B;  1F23 A;  3ZJZ A;  3ABT A;  3MD0 A;  2QEX V;  4DZY A;  1K4C C;  1ZX3 A;  5JVD A;  2EIK B;  1WP7 A;  4IHJ B;  3OMA B;  3B26 A;  2VQF B;  4MTX A;  2GQP A;  2VCI A;  3A0Z A;  1SQQ H;  1H38 A;  4ZI7 A;  1VMG A;  4I4T A;  1PL4 A;  3AG1 C;  5LA6 A;  1UY6 A;  2YE3 A;  4TUY A;  2VQF O;  2YKC A;  4CWP A;  2WLK A;  4X66 O;  2ZDY A;  1PD3 A;  2C2A A;  2LW1 A;  2FTK A;  2JEU A;  3C3S A;  1Q5O A;  1GKX A;  3ABK B;  2CTQ A;  1PP9 H;  1Y74 A;  4P7A A;  2BRE A;  3OD4 A;  2IH1 C;  2B1I A;  2WI1 A;  1GJV A;  3Q5J A;  3R92 A;  1QBZ A;  4WFE A;  2KKW A;  4E4E A;  4W7T A;  1DF4 A;  2ZIO A;  2X6C A;  5L3E A;  1BHA A;  4IIJ A;  3M99 B;  2YI5 A;  3PN1 A;  2IOR A;  3IJ4 A;  1GTO A;  3H1L H;  1E1R G;  2RMK B;  4XDK A;  1FJG B;  4JYA O;  1BCC H;  3OEH G;  2ZE8 A;  2WI6 A;  2OIG A;  3C90 A;  4U3J B;  5CTW A;  4JI1 O;  5KX5 B;  3KCX A;  4PDM A;  1QR8 A;  4AS9 A;  4XCJ A;  2A06 H;  1YET A;  3S5T A;  1IXM A;  1JFF B;  4RAI A;  5BR8 B;  5TIS Z;  2XJX A;  4PD4 F;  5LYJ A;  5J71 A;  1PNM A;  2WLN A;  2WLL B;  4RUF A;  2ZNJ A;  1LR1 A;  2YEC A;  4LP0 A;  3AG7 A;  1M5I A;  2RQ6 A;  5BR8 O;  1B3Q A;  5FPR A;  2HHH B;  1SA0 A;  1YXB A;  4O4L B;  3TK1 A;  3QO7 A;  1YT0 A;  3K9S A;  1IBL B;  1K8A W;  3O9O A;  4KSH A;  1YZB A;  4LBE C;  2HG5 C;  3IAY A;  4G28 B;  3G75 A;  2HHH O;  4KFM A;  4YKQ A;  2ADP A;  4RWU A;  3HR0 A;  2LO1 A;  4LF5 B;  4YJ3 B;  1YT1 A;  4O0B A;  4CE3 A;  1ZLZ A;  3LNM B;  1JOY A;  1W2B U;  5KHG A;  3H80 A;  2F4V O;  3CRQ A;  1B06 A;  2R9I A;  2QSA A;  3JAK A;  4NKG B;  2ZBK B;  4AWP A;  4LF5 O;  2A9H A;  3BRC A;  4RQF A;  2PTM A;  2BTQ B;  2KSD A;  1Y76 B;  4JI8 B;  4ASB A;  2ZD9 A;  4I7Z B;  3H1J H;  4QNH B;  4ASU G;  1SRY A;  2B1G A;  1H8H G;  4EGI A;  4C7U A;  2GFD A;  2Q8H A;  1NVP D;  1ZAU A;  5IDM A;  4LWG A;  3L73 H;  4E01 A;  3RYH A;  4CWN A;  1JVM A;  1OCR B;  4UB6 Z;  4PEL A;  3ZHS A;  1EZJ A;  4JI8 O;  3DTU B;  1AJN A;  2L6L A;  4K0K B;  3CRC A;  4QE7 A;  3U11 A;  1YSC A;  1DK1 A;  1KMI Z;  3OTO B;  3ASO C;  2GUZ A;  2IBZ H;  2UXB B;  1U97 A;  2IOP A;  4MP7 A;  3ZHR A;  5LXT A;  4K0K O;  2UXD B;  2EZO A;  3EHF A;  1Y4M A;  4KFG A;  3CCJ V;  3FB5 C;  1E1Q G;  3WB1 A;  4HAM A;  3CEI A;  1K92 A;  3OTO O;  2UXB O;  4DUH A;  5IJ9 B;  2LGQ A;  5JCO A;  2UXD O;  2QGN A;  4JI7 O;  5CB4 A;  4XC0 A;  1N8R W;  1IDS A;  2XAJ A;  5D5Q A;  4UFZ A;  3STZ C;  2WLI B;  3WU2 Z;  1H7S A;  3OMN B;  4MVO A;  1WPX A;  2CGO A;  5J2U A;  2XDX A;  1EBO A;  1Y6X A;  4HNA A;  3B40 A;  4MPN A;  1H2L A;  2WI5 A;  2BYH A;  3GIG B;  5M4M A;  2YID A;  3HHU A;  3CYO A;  1XRE A;  1VQ8 V;  1VF6 C;  2XAG A;  2AZ0 A;  3SYA A;  2LFS A;  3K5M A;  4KXR A;  2ZIM A;  3D3I A;  1VQK V;  1M1K W;  3ZIA G;  1VF5 B;  5BZB A;  1CPY A;  3TZ5 A;  1JCH A;  1R62 A;  3CGY A;  2CAZ C;  2KG7 A;  4K4O A;  2HG1 A;  1MX0 A;  1BE3 H;  3CS5 A;  5DN6 G;  4PDV A;  3FYI B;  4OPH A;  1MSW D;  2GTS A;  2EIL B;  5H9C A;  2QM8 A;  3LSS A;  4GUN A;  4B6C A;  1IX9 A;  5B5E Z;  2AXT Z;  1S72 V;  2V4D A;  4B08 A;  4MP2 A;  2ADQ B;  1YT2 A;  4OPA A;  4EB6 A;  3K5O A;  1Y8P A;  1I94 B;  3VHC A;  2OTJ V;  1FFT B;  1V9P A;  4EFE A;  1VP7 A;  3BHP A;  3GB7 C;  4DV2 B;  1V55 C;  4LWS A;  3CWV A;  3W7X A;  1H2K A;  4EGK A;  3TUH A;  1I94 O;  5EBW C;  2PUS A;  2EBO A;  4LC1 A;  3JAL A;  4Z2W A;  2H8M A;  1AR4 A;  4DV2 O;  4P30 A;  2FYP A;  1WNS A;  5LHG A;  2DYR B;  2XHX A;  1NHJ A;  4XKO A;  4R6Z A;  1SQP H;  2W0F C;  1KZN A;  1UY8 A;  4UUJ C;  3W7T A;  3K04 A;  3OTF A;  2ETN A;  4L93 A;  2YDE A;  2HFE C;  2BTO A;  4N21 A;  4YKU A;  3WQ9 A;  3F5T A;  3E8G A;  1KUQ A;  3S3X A;  5B1A B;  3CGZ A;  3VOU A;  2EIN C;  4X9L A;  1PL0 A;  5FND A;  4DRX B;  3E2E A;  2ZDI C;  4DXW A;  3I5D A;  4DK0 A;  2V1D A;  5ITZ B;  1Q90 D;  2Q8G A;  4YJ2 A;  5KUK A;  2Z3Y A;  2EXL A;  3RLQ A;  2XUM A;  2GHY A;  4HZ0 A;  3E89 A;  4O05 A;  4URN A;  3BAA A;  5B1A C;  1H2M A;  2PNR A;  4URL A;  4DUY B;  2F23 A;  3A8T A;  5LP6 A;  4R3A A;  4JTD B;  1VQL V;  1EN5 A;  3UO3 A;  4R3M A;  2XK2 A;  4W4K A;  1HNW B;  2RCV A;  4DW0 A;  4DUY O;  3QG5 A;  3QO5 A;  1TIL A;  5CMU A;  3FFQ A;  2YIA A;  1D5N A;  4FCQ A;  5IT9 N;  4YIP A;  4JGS A;  3D2R A;  3MHH C;  3ZM7 A;  3LNN A;  1ZXN A;  4PDL A;  2EX3 A;  2DW4 A;  1KIJ A;  1TC6 A;  2ODM A;  2JDI G;  2P7T C;  1PNK A;  3FX7 A;  4EFB A;  5CA3 A;  1QU7 A;  2WA3 A;  5K1X A;  2ZKJ A;  1DF5 A;  1M57 B;  1YDX A;  5CBG A;  5IDJ A;  4XTJ A;  3ZHT A;  4Q6G A;  5B1N A;  1KQS U;  2XDU A;  4DV4 O;  4X20 A;  4X1Y A;  3ZXO A;  2UXC B;  3R4P A;  3P32 A;  2QFO A;  1TUB B;  1VQM V;  2FML A;  2Q8F A;  2KB1 A;  4MW8 A;  4BAE A;  2BSM A;  4TWK A;  2QA4 V;  5M4H A;  4FM1 A;  2YIB D;  4PA9 A;  1XBL A;  1AI6 A;  5LMN B;  4I55 B;  2UXC O;  1RPR A;  1OJH A;  1PKX A;  4LP8 A;  2QE7 G;  5C8Y A;  1DTO A;  2AZ2 A;  2R70 A;  4UVA A;  4TOI A;  4EFU A;  2YEH A;  3SYO A;  3CCQ V;  5LGT A;  3UT5 B;  5CA1 A;  4W4L A;  4YKT A;  5JQG A;  1N0N A;  2Q4P A;  3QTC A;  4CS4 A;  2Q0O C;  4YKW A;  1NR1 A;  2AGA A;  1SC5 B;  3X2Q C;  4I50 B;  5J6A A;  4FFK A;  2DE0 X;  3SPI A;  1TUE B;  2QTO A;  1K73 W;  4YKR A;  1N0J A;  1URF A;  1VQ5 V;  3BCC H;  3J7A U;  4MBC A;  3ABL B;  1MMM A;  3M8A A;  1VQ7 V;  3H9V A;  4P9O A;  4D6T H;  2AHY A;  2R9A A;  1OHH G;  2Y0I A;  3C11 A;  2Y69 C;  4EMV A;  5EIB D;  1UYI A;  2VQE B;  3JZ3 A;  2P4V A;  5KMG A;  1BXD A;  1GKZ A;  2BCC H;  1TAE A;  3ZKB A;  3MDS A;  2R9R B;  4CH6 A;  3SYP A;  1OZ0 A;  3ZHV A;  3I55 V;  2NNU A;  4FLT A;  1B6Q A;  5LHH A;  4O2B B;  4X1I A;  2VQE O;  3R4O A;  2HCH A;  3JD2 A;  3HKB B;  3G80 A;  4E02 A;  2PYL A;  2RN9 A;  2XT9 A;  2D3O W;  3ABL C;  1F51 A;  1M9N A;  5A9G A;  1ROP A;  3MAQ A;  4BQJ A;  2DQ0 A;  1F4N A;  1Z2G A;  1Y8O A;  4EFT A;  4EKW A;  2YXH A;  1JA8 A;  5JWP A;  4XE2 A;  4JI4 B;  4JAU A;  4XIQ A;  4MVM A;  4KUM A;  4ABM A;  5E79 Z;  1XMQ B;  3JAR B;  1N32 B;  2QWO B;  1M90 W;  5JVD B;  1CP9 A;  4U93 A;  3DGE A;  2E74 B;  4ZIB A;  4JTC B;  4DV1 O;  4JI5 B;  4JI4 O;  3AG3 B;  1NU1 H;  1N32 O;  1XMQ O;  3VHA A;  2H94 A;  2ZR2 A;  3BY6 A;  3ZS8 C;  4K3A A;  3B28 A;  4I9W A;  1NH2 B;  4XDM A;  1VF7 A;  3L72 H;  3R4N A;  5LA6 B;  1KKC A;  3BM9 A; 
#chains in the Genus database with same CATH homology
 3T10 A;  4WFF A;  2WSS G;  4V26 A;  4MT8 A;  2XAB A;  1E79 G;  3E83 A;  4NH7 A;  4R1F A;  3IED A;  1VQ4 V;  1K7D A;  1GKF A;  1OCC B;  3A0T A;  2IH3 C;  4ZBM A;  3CC7 V;  4GX0 A;  2K5B A;  1OCZ B;  4MTO A;  2IOQ A;  1UYK A;  3R91 A;  1W0K G;  3K9A A;  3B24 A;  3EHG A;  4JQL A;  4MVZ A;  2YEB A;  2YEJ A;  3K0D A;  4L8Z A;  3INW A;  1AH8 A;  2B5U A;  1OCC C;  4CZZ A;  1I5D A;  3VHD A;  5D6Q A;  2XJG A;  5LBQ A;  4WCE V;  2BU8 A;  1OCZ C;  1Q82 W;  1Z5A A;  3TCU A;  4ASG A;  1G4Y B;  3ZRS A;  4HXZ A;  4CE2 A;  4QPK A;  1U2O A;  2YGE A;  1NHH A;  5D7R A;  2LFR A;  2DQ3 A;  1R3L C;  2K1E A;  4URO A;  3RKZ A;  3CP1 A;  3KE6 A;  1AI5 A;  4PA6 A;  1K3E A;  4HY6 A;  2BOB C;  3CD6 V;  1QVG U;  4GT8 A;  5IYC O;  2JJC A;  3H01 A;  1UYD A;  1Q7Y W;  2OCC B;  1MG1 A;  3G71 V;  1YJW V;  1YC1 A;  4LWF A;  1NR7 A;  5L3B A;  1I5C A;  3OMU A;  1R6N A;  3B8M A;  2W6I G;  2IJK A;  4JF3 A;  4YKZ A;  2OCC C;  4FCP A;  2WI2 A;  5CBF A;  1P4R A;  4F4L A;  2XDS A;  3OE7 G;  1OSF A;  2JIZ G;  5IYD O;  2QG2 A;  2X6A A;  3LDD A;  4ZKI A;  2YEG A;  3E35 A;  3TZ0 A;  2QG0 A;  4LWH A;  2CG9 A;  1DLB A;  1JJ2 U;  3NMQ A;  3K08 A;  3T4Z A;  2VWC A;  4FCR A;  1K5S A;  1Y66 A;  1NBM G;  4YXW G;  3TTZ A;  5GW7 A;  1YSZ A;  4HYO A;  1K33 A;  4XKK A;  4UXN A;  3ASO B;  3U2K A;  1OCO B;  3ASN C;  1I5Y A;  4KTN A;  1XL4 A;  3SYQ A;  3FB7 C;  3T1K A;  4TT3 G;  2QM7 A;  2Q67 A;  4WF9 V;  4AWO A;  4WFG A;  5F5R A;  2YK2 A;  1AM1 A;  4I5S A;  1S3J A;  1OCO C;  2X7R B;  5D7D A;  3RW0 A;  5HFL A;  1M56 C;  3INX A;  2YKB A;  2HR3 A;  3K0G A;  1AH6 A;  5EC2 C;  2XX2 A;  3QDD A;  3ZMS A;  1YC3 A;  3K97 A;  2YE8 A;  1KEC A;  3RLR A;  3Q5L A;  3KG2 A;  5KUM A;  4WUD A;  3FT8 A;  2WAM A;  2XHR A;  3GWO A;  2YKE A;  2IWX A;  1GM7 A;  3K98 A;  1UYG A;  5FWK A;  1JM6 A;  3E86 A;  2ITC C;  3EHH A;  4P9P A;  5M4E A;  4UV9 A;  1ARO P;  3LDE A;  3HZ1 A;  4QIW F;  3EKO A;  4XD8 A;  2YJX A;  1THZ A;  4BXI A;  3EKR A;  2IU0 A;  1V55 B;  4MVR A;  4L94 A;  2PI4 A;  3AG2 C;  1YJ9 V;  1S77 D;  3B27 A;  3OWD A;  2UXN A;  5L3J A;  2WEP A;  1W0J G;  1YJN V;  4GT1 A;  1AJQ A;  5CBH A;  2EIM C;  4FJC C;  1H8E G;  1MAB G;  3ZRX A;  3CPW U;  1UYE A;  1K4D C;  3ZKD A;  3CCR V;  2EIN B;  3HEK A;  3T0H A;  1RPO A;  3B77 A;  1I5X A;  4WFH A;  2WPD G;  1H2G A;  3CRL A;  1ZWH A;  5CTY A;  2BYI A;  1CEZ A;  1I59 A;  1SET A;  1LNQ A;  4RO2 A;  3HB3 B;  3CXC U;  2WEQ A;  3CRK A;  1BL8 A;  1MU5 A;  2XAS A;  2Q69 A;  2WWW A;  2E0A A;  2XX5 A;  1Z59 A;  1Q86 W;  3ETG A;  2Q6A A;  4PL9 A;  4MVS A;  2HKO A;  2FWZ A;  2EIJ C;  3C0E A;  4XDL A;  2BRC A;  2UWD A;  3OR7 C;  1QR9 A;  2WLH A;  3QNE A;  2AHZ A;  5B3S B;  3FYE B;  3ZMU A;  4KQV A;  3G7E A;  2FWY A;  1I5B A;  2AKP A;  2JKI A;  3O6O A;  5FL7 G;  5FNF A;  1HWY A;  4PA7 A;  2IWU A;  3JD3 A;  4LCU C;  2BU2 A;  4XCL A;  2XDK A;  3WHA A;  3OFN G;  5B3S C;  4JYB A;  4H37 A;  1YIJ V;  3U2D A;  3D36 A;  2QF6 A;  3X2Q B;  4MVU A;  4O04 A;  2YEV B;  2V7Q G;  2Q8I A;  2DYS B;  4MOT A;  3HYY A;  2F43 G;  5BOD A;  3RVY A;  2FXS A;  4PRV A;  2P90 A;  3ZMT A;  2Y69 B;  5L3C A;  2CK3 G;  1GMG A;  4GFN A;  3WFV A;  5CTU A;  3F7V C;  3EHB B;  3OM3 B;  4J9Y B;  4MS2 A;  2IWS A;  3PEJ A;  2DYS C;  3H4L A;  4E2L A;  4O07 A;  2LP7 A;  4MSW C;  1S76 D;  2CCS A;  2A0L A;  3ZRV A;  2YI7 A;  2XHT A;  1A4H A;  1SES A;  2H8P C;  3QO8 A;  1QY8 A;  2IW5 A;  3HZ5 A;  5GGZ A;  1U0Z A;  4HZ3 A;  4BIU A;  1NJI W;  3D0B A;  5LHI A;  1S14 A;  1QZR A;  1COW G;  4ZVI A;  2WLJ A;  2HVK C;  1UY7 A;  1AR1 B;  1R6K A;  3AG4 C;  5H6Q A;  2WI3 A;  1Z5B A;  3BMY A;  2WI4 A;  2BT0 A;  4L90 A;  1YES A;  4WUC A;  4H33 A;  2P67 A;  1R3K C;  3CMA V;  2XDL A;  4XDJ A;  4U7N A;  3O0I A;  3OPD A;  2ITD C;  4P2Z A;  3CCU V;  4KP4 A;  1YIT V;  4XIR A;  2X0L A;  3QTF A;  2OTL V;  3ZCC A;  4CWR A;  4CBC A;  3ETD A;  1SER A;  4YKY A;  3F7Y C;  1ZWI C;  1RM1 B;  1EFR G;  1VQP V;  1Z5C A;  3RVZ A;  4G2K A;  2UXX A;  4NH8 A;  4LWE A;  1V54 B;  2HJF C;  1UYL A;  2JJ1 G;  1THN A;  2YKJ A;  2YEI A;  3W7S A;  1GM8 A;  4LWI A;  1NH2 D;  3IFX A;  1RM1 C;  1SZT A;  1FXK A;  3PJS K;  1R73 A;  1MOF A;  4FK5 C;  1B63 A;  4O09 A;  3E8F A;  1VQO V;  4R7C A;  3K99 A;  1V54 C;  2Q68 A;  2ZR3 A;  1NHI A;  4HZ5 A;  1UY9 A;  1G8M A;  4UVB A;  4CWT A;  1WLE A;  3G6E V;  3EFF K;  3K03 A;  1QYE A;  3NXS A;  1J95 A;  3UKM A;  4I3H A;  1YS3 A;  1KD1 W;  3BEH A;  1F4M A;  1ZW9 A;  2ZXW C;  2CCU A;  1KKD A;  3JD1 A;  1AI7 A;  5IN9 A;  3SJQ C;  2H55 A;  1KC8 W;  1Q81 W;  4HXW A;  2O1V A;  1I5A A;  3OEE G;  5M4N A;  1EI1 A;  2JJ2 G;  4JYC A;  3ABM C;  5D7C A;  2A79 B;  3TET A;  4QJF B;  1QLE B;  5FNC A;  2EIK C;  1FXV A;  2ATK C;  3F5W C;  3JD4 A;  2BU5 A;  5EK0 A;  2YEE A;  3AEI A;  4CWO A;  4HY1 A;  2EZP A;  4PDR A;  2BZ5 A;  1K34 A;  3G4S V;  3ABK C;  2YGF A;  1R3J C;  1QLE C;  5EC1 C;  1US7 A;  5DM6 V;  3ETE A;  2YE7 A;  2GSM B;  4EGH A;  3ASN B;  4XIP A;  3OUF A;  3O2F A;  3SL2 A;  4R50 A;  5L3D A;  2XOK G;  1NVP B;  4RUE A;  5E1A C;  3CCM V;  1FS0 G;  3CME V;  1K5Q A;  1H7U A;  2YKI A;  1PVG A;  3K79 A;  5H6R A;  1K97 A;  3MHS C;  3ZRW A;  1UYF A;  3MNR P;  2O1U A;  2ZQM A;  3CCV V;  2YEA A;  4ASA A;  5M4K A;  2YI6 A;  2YJW A;  2DWE C;  2VW5 A;  1M56 B;  4EEH A;  1TH8 A;  2JK5 C;  5CF0 A;  4FPP A;  3A0X A;  1FXH A;  3LPS A;  3SPG A;  2YK9 A;  3SPC A;  4ASF A;  3T2S A;  2XCM A;  5CN0 A;  3JCZ A;  2ZDX A;  1BYQ A;  3RBZ A;  1KP2 A;  3SPH A;  2MK3 A;  3LDC A;  2WER A;  3U67 A;  3G7B A;  1K9M W;  1VQ9 V;  3ZMZ A;  4N23 A;  2XND G;  2XAH A;  4GQT A;  2IJI A;  3ZN0 A;  3ZN1 A;  1VQ6 V;  1NKD A;  4FMT A;  4DO2 A;  4EM7 A;  4CWF A;  4JAV A;  1OCR C;  3I56 V;  4URM A;  2BU7 A;  4CWQ A;  2XJJ A;  3OWB A;  2YE4 A;  5EBM C;  2ESA A;  1Y4U A;  3A0Y A;  2BOC C;  4Z1M G;  3AG2 B;  1BGQ A;  4QE9 A;  2WLL A;  3LNU A;  1S16 A;  2YGA A;  2BU6 A;  3VBB A;  2EIM B;  4X88 A;  2IU3 A;  3EHJ A;  5KA6 A;  4NH9 A;  3WG7 B;  3K06 A;  1L0O A;  4WUB A;  4V25 A;  4E00 A;  1YER A;  3PEH A;  4UVC A;  2WLM A;  3E8B A;  1S5H C;  3OW2 U;  4GGL A;  4R8C A;  4JPR A;  4MVQ A;  4X89 A;  5LGU A;  2P6J A;  3WG7 C;  4L87 A;  2IJJ A;  2EJR A;  4BIZ A;  1YI2 V;  4OXS A;  4MB9 A;  5F3K A;  3FB6 C;  4RQE A;  1AJ6 A;  3T1C A;  4PA3 A;  4BW5 A;  3GIF A;  3CCS V;  2XX4 A;  3LUT B;  3FB8 C;  1BKN A;  1QCE A;  2EIL C;  2CH4 A;  5LGN A;  2OT5 A;  3JYC A;  4MPE A;  2EIJ B;  3CCL V;  5C93 A;  1EA6 A;  2Z5U A;  3T4D A;  2YED A;  2WLI A;  4BAY A;  4KSG A;  3FKS G;  5HFM A;  3W7W A;  1I58 A;  2DWD C;  1UYC A;  1R3I C;  2DYR C;  2XAQ A;  3GIG A;  4MPC A;  1TC0 A;  1KP3 A;  3LSQ A;  1VQN V;  1QVF U;  2YE2 A;  4TSF G;  4JTA B;  2YEF A;  1ORQ C;  2Q2E B;  3SYC A;  5BOC A;  5D6P A;  3E8H A;  1TID A;  4WFB V;  3CC2 V;  4H85 A;  4AWQ A;  4PA4 A;  5J9P C;  4J9Z B;  4MW3 A;  5KA5 A;  1Y4S A;  3HYZ A;  3CC4 V;  2W6J G;  5IY5 B;  1AJP A;  3SPJ A;  2HKJ A;  5CPH A;  2VCJ A;  2JEX A;  1YC4 A;  2XD6 A;  3K60 A;  5EBL C;  3OAA G;  2XAF A;  4BQG A;  3B8N A;  2ZDI A;  2IJH A;  5L3F A;  5IY5 C;  1YSR A;  5B1O A;  5L3G A;  2WI7 A;  3TZ4 A;  2X6B A;  4U7O A;  3OUS A;  2BTZ A;  4L91 A;  3R4M A;  2Y48 A;  3OGC C;  1S0V A;  4B7P A;  4G27 B;  1M57 C;  4PU9 A;  4CWS A;  2NLJ C;  4PRX A;  1GO3 F;  2O1W A;  3OMI B;  4X8A A;  3OW6 A;  4JAS A;  3ABU A;  1ZXM A;  3A0R A;  3AG4 B;  4MTG A;  1FXK B;  2YE9 A;  3T2M A;  4WFA V;  2YE5 A;  2M7W A;  2CCT A;  4GX1 A;  3R65 A;  4QPJ A;  5IYB O;  3K3W A;  5B1B B;  4MTF A;  1XL6 A;  3FT5 A;  4HYM A;  1GK9 A;  1NQT A;  4UV8 A;  1UYH A;  1FXK C;  2YSU B;  1JX9 A;  2HVJ C;  2YI0 A;  3ZXQ A;  3W7U A;  3RLP A;  2QKS A;  5B1B C;  3UM7 A;  4XKA A;  1PNL A;  4HYP A;  3ZMV A;  1YTF B;  3TZ2 A;  1TBW A;  3ML0 A;  4LPB A;  4CE1 A;  2HLD G;  3P30 A;  1L1F A;  3FV5 A;  1YHQ V;  4XIT A;  1Y8N A;  5M4P A;  2YEV A;  3GIE A;  3VAD A;  1JPX A;  3CCE V;  2YE6 A;  1AI4 A;  1QLN A;  1AMW A;  2PI5 A;  3T0Z A;  4YKX A;  3AG3 C;  4FIP C;  2CGF A;  3IC7 A;  4H81 A;  1P7B A;  3OR6 C;  1ID0 A;  1BMF G;  1YTF D;  5CTX A;  3HPL C;  4P8O A;  1GM9 A;  4Q20 A;  3IGA C;  4XBF A;  2ZXW B;  1B62 A;  4GEE A;  1UJW B;  1UYM A;  4GX5 A;  3JD0 A;  4GX2 A;  1JQ0 A;  3B25 A;  1ENV A;  4GCZ A;  3ZRW B;  3STL C;  1BHB A;  3AG1 B;  3ABM B;  3Q5K A;  4H7Q A;  3A0W A;  1F23 A;  3ZJZ A;  3ABT A;  4DZY A;  3MD0 A;  2QEX V;  1K4C C;  2EIK B;  3OMA B;  3B26 A;  4MTX A;  2GQP A;  2VCI A;  3A0Z A;  1H38 A;  3AG1 C;  2YE3 A;  1UY6 A;  2YKC A;  4CWP A;  2WLK A;  2ZDY A;  1PD3 A;  2C2A A;  2FTK A;  2JEU A;  1GKX A;  3ABK B;  4P7A A;  2BRE A;  2IH1 C;  2B1I A;  2WI1 A;  1GJV A;  3Q5J A;  3R92 A;  1QBZ A;  4WFE A;  4W7T A;  1DF4 A;  2X6C A;  5L3E A;  1BHA A;  3M99 B;  2YI5 A;  2IOR A;  1GTO A;  1E1R G;  4XDK A;  3OEH G;  2WI6 A;  5CTW A;  4PDM A;  1QR8 A;  4AS9 A;  4XCJ A;  1YET A;  1IXM A;  4RAI A;  2XJX A;  5J71 A;  1PNM A;  2WLN A;  2WLL B;  4RUF A;  4LP0 A;  2YEC A;  1B3Q A;  3TK1 A;  3QO7 A;  1YT0 A;  1K8A W;  4KSH A;  4LBE C;  2HG5 C;  4G28 B;  3G75 A;  4KFM A;  4YKQ A;  1YT1 A;  4O0B A;  4CE3 A;  3LNM B;  1JOY A;  1W2B U;  3H80 A;  2R9I A;  2ZBK B;  4AWP A;  2A9H A;  4RQF A;  4ASB A;  2ZD9 A;  4QNH B;  4ASU G;  1SRY A;  2B1G A;  1H8H G;  4EGI A;  2GFD A;  2Q8H A;  1NVP D;  5IDM A;  4LWG A;  4E01 A;  4CWN A;  1JVM A;  1OCR B;  4PEL A;  1EZJ A;  3DTU B;  1AJN A;  4QE7 A;  1YSC A;  3ASO C;  2IOP A;  4MP7 A;  3EHF A;  2EZO A;  1Y4M A;  4KFG A;  3CCJ V;  3FB5 C;  1E1Q G;  4HAM A;  1K92 A;  4DUH A;  4XC0 A;  1N8R W;  2XAJ A;  3STZ C;  2WLI B;  1H7S A;  3OMN B;  4MVO A;  1WPX A;  2XDX A;  1EBO A;  4MPN A;  2WI5 A;  2BYH A;  3GIG B;  5M4M A;  3HHU A;  3CYO A;  1VQ8 V;  2XAG A;  3SYA A;  2LFS A;  3D3I A;  1VQK V;  1M1K W;  3ZIA G;  5BZB A;  1CPY A;  3TZ5 A;  1JCH A;  1R62 A;  3CGY A;  4K4O A;  2HG1 A;  1MX0 A;  5DN6 G;  4PDV A;  3FYI B;  1MSW D;  2EIL B;  5H9C A;  2QM8 A;  3LSS A;  4B6C A;  1S72 V;  4MP2 A;  1YT2 A;  1Y8P A;  3VHC A;  2OTJ V;  1FFT B;  3GB7 C;  1V55 C;  3CWV A;  3W7X A;  4EGK A;  3TUH A;  5EBW C;  2EBO A;  4LC1 A;  2H8M A;  2FYP A;  4P30 A;  5LHG A;  2DYR B;  2XHX A;  1NHJ A;  4XKO A;  4R6Z A;  2W0F C;  1KZN A;  1UY8 A;  4UUJ C;  3W7T A;  3K04 A;  4L93 A;  2HFE C;  4N21 A;  4YKU A;  3WQ9 A;  3E8G A;  5B1A B;  3CGZ A;  3VOU A;  2EIN C;  4X9L A;  1PL0 A;  5FND A;  3E2E A;  2ZDI C;  4DXW A;  2V1D A;  2Q8G A;  5KUK A;  2Z3Y A;  2EXL A;  3RLQ A;  2GHY A;  4HZ0 A;  3E89 A;  4O05 A;  4URN A;  5B1A C;  2PNR A;  4URL A;  4R3A A;  4JTD B;  1VQL V;  4R3M A;  2XK2 A;  3QO5 A;  1TIL A;  5CMU A;  4FCQ A;  4JGS A;  3D2R A;  3MHH C;  3ZM7 A;  1ZXN A;  4PDL A;  2DW4 A;  1KIJ A;  1TC6 A;  2JDI G;  2P7T C;  1PNK A;  5CA3 A;  2ZKJ A;  1DF5 A;  1M57 B;  5CBG A;  5IDJ A;  4XTJ A;  5B1N A;  1KQS U;  2XDU A;  3ZXO A;  3R4P A;  3P32 A;  2QFO A;  1VQM V;  2Q8F A;  2KB1 A;  4MW8 A;  4BAE A;  2BSM A;  4TWK A;  2QA4 V;  5M4H A;  4PA9 A;  1AI6 A;  1RPR A;  1PKX A;  4LP8 A;  2QE7 G;  1DTO A;  4UVA A;  4EFU A;  2YEH A;  3SYO A;  3CCQ V;  5LGT A;  4YKT A;  4YKW A;  1NR1 A;  3X2Q C;  5J6A A;  3SPI A;  1TUE B;  2QTO A;  1K73 W;  4YKR A;  1VQ5 V;  4MBC A;  3ABL B;  1VQ7 V;  4P9O A;  2AHY A;  1OHH G;  3C11 A;  2Y69 C;  4EMV A;  1UYI A;  3JZ3 A;  1BXD A;  1GKZ A;  3ZKB A;  2R9R B;  3SYP A;  1OZ0 A;  3I55 V;  2NNU A;  1B6Q A;  5LHH A;  3R4O A;  2HCH A;  3JD2 A;  4E02 A;  2D3O W;  3ABL C;  1F51 A;  1M9N A;  1ROP A;  4BQJ A;  2DQ0 A;  1F4N A;  1Y8O A;  4EFT A;  4EKW A;  4XE2 A;  4XIQ A;  4JAU A;  4MVM A;  4KUM A;  1M90 W;  1CP9 A;  4U93 A;  3DGE A;  4JTC B;  3AG3 B;  3VHA A;  2H94 A;  2ZR2 A;  3BY6 A;  3B28 A;  4I9W A;  1NH2 B;  4XDM A;  3R4N A;  3BM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...