4U7NA

Inactive structure of histidine kinase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
225
structure length
211
Chain Sequence
VSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine protein kinase sensor protein
publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Transferase
total genus 69
structure length 211
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4u7nA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4u7nA02
4URNA 2YKJA 5B1OA 3OWBA 1B62A 1S14A 4AS9A 4QPJA 2O1WA 4H85A 1R62A 3T2SA 2PNRA 4LWHA 2YEBA 3INWA 2XX2A 2WI2A 2YI6A 1YESA 5M4HA 3HZ1A 2FWYA 3HHUA 5IDJA 1BGQA 1GKXA 4GEEA 2XDLA 2YK2A 4CWRA 3ZCCA 2YEAA 1UYKA 1YC1A 2VCJA 2HKJA 4PU9A 4XITA 4K4OA 3D0BA 4JQLA 4LPBA 4YKTA 4FCRA 4QPKA 2WI3A 1I58A 4CE3A 2XJXA 5BODA 1Z59A 1AM1A 5L3JA 1MU5A 4P7AA 4AWQA 3G7BA 3O6OA 1EA6A 4I3HA 1AH8A 3R4MA 2XJGA 3CRLA 5M4KA 3B24A 1Z5BA 4FPPA 2FXSA 3K99A 3P32A 1NHJA 1QY8A 1Z5CA 1H7SA 3PEJA 4E00A 4KFGA 4EFUA 4XIPA 1B63A 4LWFA 3IEDA 2K5BA 3RKZA 4CWFA 3BM9A 3TTZA 4YKXA 2YKCA 2XJJA 2WI4A 5M4PA 3HZ5A 4KSGA 3ZM7A 3A0ZA 2O1UA 4L94A 2QM8A 1Y4SA 2BREA 3VHDA 2Q8IA 5FNDA 4X9LA 4R3AA 3LPSA 3OMUA 4ASGA 2ZDXA 4YKUA 4EEHA 3EKRA 1I5DA 2YKIA 2ZKJA 1YT2A 1BYQA 3EHHA 2H55A 1U2OA 4JAVA 2XK2A 4P8OA 1ID0A 3BMYA 3EHFA 4MP7A 4XIRA 2WEQA 1UY9A 2CG9A 2XHXA 1TIDA 1MX0A 4L90A 3VHAA 4XKKA 2XX4A 2CCUA 2IOPA 5F5RA 4FCPA 3ZXQA 1YS3A 4KP4A 1UYLA 1AJ6A 3R4NA 2BTZA 2YEIA 3FT5A 1YC4A 2ZBKB 3OPDA 4MPCA 2WI6A 3B26A 1AMWA 4L8ZA 3RLPA 3H80A 2YE9A 1A4HA 1TC6A 2YE2A 3A0XA 1TILA 4BQJA 5D7CA 4FCQA 4L93A 2CGFA 4NH8A 3K97A 2YE6A 3T1KA 4LC1A 3ZRWB 1PVGA 4BIUA 4GCZA 1KIJA 2BU5A 2QF6A 4NH9A 3O2FA 1UY6A 1YSZA 3A0TA 3TZ5A 1Y8NA 5GGZA 1H7UA 1YT1A 3VHCA 2IWUA 1ZWHA 1GJVA 3Q5KA 1QYEA 1JM6A 2BU2A 1Y4UA 1F51A 2YI7A 2YGAA 2YE7A 2BYIA 4HXZA 4BIZA 3T0ZA 1AH6A 1YETA 1NHIA 2WERA 4GFNA 3VADA 5D7RA 4MPEA 5CTXA 4XIQA 4V26A 4JAUA 1I5CA 2BU6A 1L0OA 5CTWA 5IN9A 2IWXA 2YGEA 4DZYA 2Q2EB 4LWGA 1Z5AA 5D6PA 4O04A 1I5BA 1ZXNA 4CE2A 3A0WA 1UYFA 3C11A 3EKOA 4XKOA 4CWSA 4O09A 4O07A 4CWPA 3K60A 3Q5LA 2CH4A 2JJCA 2XDSA 3H4LA 4H81A 5FWKA 1OSFA 3ZKDA 5CPHA 4XC0A 2Q8GA 4W7TA 4U93A 2VCIA 2EXLA 4UROA 3TZ0A 3EHGA 4MPNA 1UYIA 4PRVA 3GIGB 4WUDA 3OWDA 1UYGA 2YJXA 4E01A 1IXMA 4H7QA 2IOQA 4ASBA 2BU8A 5B1NA 2Q8HA 4XTJA 1YC3A 4CWQA 4EGIA 2XCMA 2YKBA 3HYYA 2BSMA 1B3QA 2YE5A 5F3KA 2IWSA 4HZ0A 4JYBA 2YJWA 2QG2A 1Y8OA 4R1FA 3D36A 3ZKBA 1UYMA 1BKNA 3ZRWA 3T0HA 4CE1A 1UYCA 3OW6A 5M4MA 3K98A 4HXWA 4YKZA 4HYPA 2FWZA 3WHAA 3R92A 2AKPA 2BZ5A 1Y8PA 3TZ2A 4YKRA 2YEDA 3EHJA 4XE2A 3MNRP 2GQPA 1U0ZA 2WI5A 3HYZA 2XDUA 2ZDYA 4LWIA 4GT1A 3U67A 2CCTA 2YEEA 2YGFA 4EMVA 3NXSA 2E0AA 5J6AA 3R4OA 2YEHA 4GT8A 4PL9A 3CWVA 2Q8FA 1EI1A 2YI5A 3A0RA 1UYHA 1KZNA 2BYHA 4KSHA 1NHHA 2LFRA 2YK9A 5M4EA 2YE3A 1YT0A 5D6QA 2WWWA 3DGEA 3C0EA 4ASFA 3TUHA 2FYPA 3U2KA 1I59A 2YI0A 2WEPA 2HCHA 4LWEA 2IORA 4U7OA 3MD0A 3U2DA 2YEGA 1YERA 2XHRA 2WI1A 2YECA 3GIGA 3LNUA 2YE4A 5CTYA 1TH8A 4WUCA 4XCLA 4GGLA 4JYCA 1ZW9A 3D2RA 4R3MA 4Q20A 3B25A 3A0YA 2JKIA 1YSRA 1ZXMA 4EFTA 3RLRA 3NMQA 4B7PA 3SL2A 1UYEA 3FV5A 5BOCA 4URLA 3Q5JA 5IDMA 4ZKIA 4CWOA 4E02A 3CRKA 2QG0A 2WI7A 2VW5A 4URMA 2YKEA 4MOTA 3KE6A 1BXDA 4XKAA 2YEJA 2BU7A 3B28A 2GFDA 2YE8A 3INXA 5M4NA 2UWDA 4L91A 4NH7A 2BRCA 1JOYA 3T10A 1GKZA 2P67A 4BAEA 2BT0A 3QTFA 2XDKA 4DUHA 4U7NA 3HEKA 3B27A 4EGKA 2QFOA 4CWTA 3R4PA 3G75A 4AWPA 4LP0A 4BXIA 2FTKA 2HG1A 1I5AA 4JASA 1UY7A 4MTXA 4FMTA 3CGYA 4HY6A 1S16A 4V25A 4HZ5A 4HYMA 4MP2A 2VWCA 1THNA 2XX5A 3GIEA 5D7DA 4O05A 3GIFA 2XDXA 2QM7A 4XDMA 4XD8A 5CF0A 3ZRXA 2XHTA 2C2AA 1UY8A 4CWNA 3TZ4A 1QZRA 3TK1A 2LFSA 4O0BA 2H8MA 2CCSA 5FNFA 2ESAA 4ZVIA 4EM7A 3G7EA 4MT8A 4YKYA 2YEFA 5FNCA 1UYDA 3QDDA 4XCJA 4EGHA 4YKWA 2XABA 4MB9A 5C93A 4PRXA 3O0IA 4MBCA 3FT8A 2O1VA 1TBWA 1TC0A 4B6CA 3PEHA 3WQ9A 3ZXOA 5J71A 4HY1A 4WUBA 4ASAA 4AWOA 4BQGA 3R91A 4YKQA 4KTNA 3RLQA 5CTUA 4KQVA 3ZRVA 4I5SA 2XD6A 4GQTA 3CGZA 3JZ3A 1US7A
chains in the Genus database with same CATH superfamily
4URNA 2YKJA 5B1OA 4EEQA 2NNUA 3W7WA 2UUBO 2DN9A 5KAIZ 2ZM6B 3PN1A 4I50A 5J2TA 4QPJA 2P4KA 2O1WA 1Y66A 4AI8A 1ZL8A 4A5UB 4H85A 3F7YC 1L1FA 3QNEA 3T2SA 4DR4B 3O65A 3CSXA 4JZ2A 2YEBA 3INWA 2WSSG 4MVZA 2DYRB 2YI6A 2A79B 1VQ6V 1DTOA 2F4VB 3JD3A 2RJZA 2ZIMA 5FPRA 3CCLV 4LP8A 2PY5A 2E5LB 5IDJA 1GKXA 1S5HC 4GEEA 1U96A 2XDLA 4DR1O 1WLEA 1OZ0A 4X88A 1YC1A 5KX5B 1OV9A 5E79Z 2JJ2G 2RCVA 4PU9A 4X8AA 3D0BA 1M93A 4FCRA 1B6QA 2WI3A 2OWOA 4Q6GA 3KCXA 3SPHA 2XJXA 4UCUA 4MVUA 5L3JA 1XHZA 3LSQA 2LGWA 1TGOA 1AH8A 3ETDA 2QR4A 3RVYA 4FPPA 1D5NA 2JVDA 2IW5A 3UO3A 1H7SA 2L6LA 4CH5A 4X66B 4KFGA 3DXRA 4R8CA 4EFUA 2A3QA 4LCUC 4XIPA 4LFCB 5EBLC 3RKZA 4CWFA 3TTZA 4DW1A 5JJNB 1YDXA 4PA6A 5KUMA 3E22A 3HZ5A 1XI1A 3DC6A 4KSGA 2O1UA 2QM8A 2WLJA 2Q6AA 1VP7A 4MW8A 2K9PA 5LMNB 1FFTB 4QNHB 1QLNA 4R3AA 4X9LA 1S5LZ 3APQA 1ZWIC 2ZDXA 1FXKB 4FM2A 4YKUA 3EKRA 2BCCH 2EINB 1URFA 3JAMN 4DK0A 1U2OA 4JAVA 3WB1A 2H55A 2XK2A 3FX7A 1M56C 2E3CA 1VMGA 4YHHB 3EHFA 1XDCA 1YJ9V 1KQSU 1ZSPA 2WEQA 3UO2A 3JD2A 2CG9A 2DJVA 2HVKC 4KUMA 2EX3A 4UCRA 4NTYA 2CCUA 2OT5A 3UCSC 4UB6Z 5H9CA 2E75B 4FJCC 3T1YO 4KP4A 1AJ6A 5KAFZ 3E86A 4NXNO 3FT5A 1TAEA 3A0BZ 1XMOB 4TWKA 3JCUZ 1ORQC 3MAQA 2E76B 5KHIA 2A7WA 1I94B 1FFXA 4FLYA 3G67A 4TSFG 4E72A 1VARA 2PI4A 4P9OA 3LNNA 4BQJA 3ZHUA 4NH8A 4G28B 3JSNA 2DYSC 1NR7A 4GKKO 2O57A 1BT8A 2FB5A 3DTUB 5BMVA 2BU5A 4B3RO 4X1KA 2PF4E 4ZIBA 1R1BA 5JCOC 1OCRC 3FB5C 4UCSA 1H7UA 3OM3B 2YIDA 4O4IA 1NU1H 4CS2A 1OCOC 2X6AA 4YY3O 1JM6A 1HNZB 1F23A 2YI7A 1GKFA 4HXZA 5JVDA 4FLZA 1FFXB 1AI6A 1XBLA 1NTMH 2ZDIA 5KHKA 5D7RA 4AILC 5CTXA 4DR3B 4JAUA 3I56V 1PL4A 2YGEA 4NR1A 1G6UA 2ZIOA 4DR2O 3N27A 4O04A 1I5BA 1SRYA 1ZXNA 1L0NH 4O09A 1GN6A 1TUBA 2JJCA 4FZ0A 5JWPA 2XDSA 3VOUA 5IWAO 4I9WA 1K33A 4W7TA 1H2GA 5IT9N 1GAXA 4X65O 1Q81W 3K58A 4EKWA 4G27B 5IJ0A 4JI4O 3H1KH 1P84F 1TUEB 1WP8A 3AG2C 1UYGA 1XMQO 2YJXA 1JJ2U 1AI7A 4JI5O 3VBBA 4H7QA 3SGIA 4JGSA 2BU8A 3RGBA 3OW2U 5K1PA 4EGIA 4P2ZA 2QM4A 2XCMA 2KG7B 2BSMA 1B3QA 2YE5A 5H2FZ 4JI8B 2IWSA 3QG5A 3SPGA 3K04A 1IXBA 1NI8A 2QG2A 1AB3A 4XDJA 3JARA 3CEIA 4DV6O 1PL0A 1IBKB 1TUBB 4LF5B 5EC1C 4HYPA 3OFNG 4R50A 4LF4B 4QE7A 1NVPB 2BZ5A 5LGNA 5LXTA 3TZ2A 2KQXA 2EJ7A 1QR9A 2OIGA 3EHJA 4XE2A 4L87A 3MNRP 1U0ZA 3EVKA 2WI5A 3JASB 3E8GA 1QNMA 3H1IH 3T2MA 1PKXA 1AR1B 5IJ9A 2ZDYA 4YJ3A 4LWIA 1RSOA 2F1MA 2N74A 1Q7YW 1H8EG 1LUVA 2UXCB 2YGFA 3R4OA 2YEHA 4DUYO 3CRAA 4H13B 1OCRB 3ZMUA 4JI7B 1EI1A 2P22C 4JI2O 2YI5A 3W7SA 1OCOB 5ITZA 4DV0O 5L3CA 3D3IA 3K5LA 2BYHA 2CUGA 1VIBA 1CPYA 1VQ8V 2IJIA 3LMMA 3K79A 4I55A 3OR6C 4LWSA 3U2KA 4X64O 1HNWO 2P06A 2GTSA 2WLHA 2YSUB 3CHXA 4LWEA 4XBFA 4U7OA 3JYCA 1YERA 3ZRSA 2N04A 5KLVH 3G6BA 1N34B 1ZX3A 4O4LB 4DK1A 4YJ3B 4DV4B 2EZOA 2YE4A 1TH8A 4WUCA 1V55C 4GGLA 3SPJA 1YCIA 3D2RA 1WNSA 2YIBD 3A0YA 4JF3A 5LOVA 4QIWF 4CS4A 3K5NA 4FK5C 1HR0O 1ZXMA 4EFEA 2LJ2A 3NMQA 1M9NA 5JQGA 1UYEA 3SL2A 4DV2B 3R66A 3JAKA 2HEPA 3AG2B 4CWOA 1GM8A 2MK3A 2ZD9A 4I55B 4GX0A 2QG0A 2HJFC 4URMA 2IJHA 3C90A 3T4DA 4PA9A 3T4ZA 3L74H 3KE6A 1W0JG 2ETNA 2M7WA 4TV9A 3B28A 1I5YA 2GDSA 2YE8A 4GUNA 4MTOA 2HHHB 3CYGA 4NH7A 2BOCC 2DQ3A 2OTLV 2WLNA 4DR6B 1JOYA 2BRCA 4K8XA 4RAIA 1Q90D 1GKZA 2P67A 2R9IA 1WA8B 3OGIB 2BT0A 4K0KB 3SR2C 1XNRB 3HEKA 3CC4V 2F95B 4X20A 3RBZA 1I5AA 1MSDA 4JASA 2GV9A 3CRMA 1XUQA 3K08A 4FMTA 2UXNA 1AR4A 2Q7HA 3P3PA 2ZM6O 2VQEB 3CGYA 4HY6A 3JALA 1JFFB 5JQGB 4UVAA 4HZ5A 4HYMA 4DR4O 4HZ3A 2XX5A 3ABKC 4FM1A 3H1LH 1V54C 2Q0OC 2K1EA 2WLLB 3G71V 2ZE6A 1QVFU 2QM7A 2F4VO 4NB5A 4TV9B 1WP7A 2QKAA 2E5LO 1UY8A 2HKOA 3SJBC 4CWNA 1MZEA 3WB0A 2PZSA 4K3AA 1Q8IA 1RM1C 1WB7A 3TK1A 3RT3C 4O0BA 2H8MA 4GX2A 4DV5O 2ESAA 2R9RB 4I4TB 4YKYA 2YEFA 2HFEC 3QDDA 3T1CA 2D3OW 1K4DC 4MB9A 1MMMA 4MBCA 3H9VA 5LA6A 5C8YA 1TBWA 4B6CA 1H2LA 4QGPA 5J71A 1RP3B 4JI1B 4WUBA 1TA8A 4JI0B 3K0GA 4RQEA 4AWOA 2XUMA 3RLQA 4MTGA 1HWYA 4I5SA 1US7A 4FZ1A 2RDCA 3OD4A 4X66O 1V55B 3TJTA 5CN0A 3KZIZ 4LF7B 4MSWC 4LFCO 1P7GA 1B62A 4WFAV 1S14A 1M90W 1R73A 4AS9A 3H1HH 4F6EA 4LF9O 1QVGU 1R3LC 4HBNA 1SA0B 2WPDG 1M1KW 3KG2A 2DWDC 2XX2A 5FNVA 1SC5B 1IBMO 1YESA 5M4HA 1SERA 4P30A 3HKDA 5LHGA 3HB3B 5LMNO 3E89A 4IIJA 4O4JA 1YJWV 3ZCCA 4NVPA 3WU2Z 2JS5A 4J11A 4TQFA 4AQYB 5IYDO 4XITA 4J7KA 3T1HB 3CWBH 3D36C 1I58A 3CD6V 3CCRV 5BODA 2R9AA 4GYCB 4YHHO 1Z59A 1AM1A 4AWQA 1AP6A 3G7BA 4CBCA 2CDYA 3M8AA 3OUFA 1MZFA 3AK3A 1NR1A 3ABTA 4WCEV 3CRLA 4U3JB 4FFBA 1SZXA 5LYJB 2FXSA 3K99A 1AVMA 1NHJA 3S3WA 3MDSA 1I08A 3PEJA 2BTQA 3ABKB 1V54B 3JD0A 1B63A 4MS2A 1XMOO 2VWJA 2W6JG 2JS3A 4Z2WA 3BM9A 3O9OA 2GUZA 1VQMV 4PV1B 3FB8C 2WI4A 4BIOA 3L72H 1RM1B 2UUCO 4ZHQB 4J7JA 4TQDA 4FLTA 3LDCA 3W7XA 1Q6IA 1M5IA 3ZM7A 1Y4SA 4HAMA 1L8DA 1VQ9V 1E79G 4LF6B 2BREA 5CBGA 1SF9A 4KHPO 1KBHA 4P9PA 1DGSA 1J5EO 4ASGA 2QEXV 1I5DA 2YKIA 3LDEA 5DM6V 3G4SV 3CCJV 1W59A 3TETA 2XHBA 2ZQMA 1BZKA 5K1XA 3H01A 4LH6A 2GTAA 4WBNB 4P8OA 4PELA 1ID0A 3BMYA 3K59A 2C1GA 1HNZO 2ZINA 2WLMA 4MVSA 1I5XA 2G38A 3GB7C 1TIDA 1MX0A 2AHZA 4EB6B 1A32A 3OEHG 4JV5B 1NTKH 1M57C 1GTOA 4DR3O 5KX5A 1YS3A 2HLDG 2YDEA 5EZYB 5CBFA 2BTZA 5FL7G 5H6RA 1VQLV 2LW7A 3AG1C 4B7KA 2YXLA 2QDOA 3CX5F 4MPCA 5CA3A 3UQ8A 3B26A 4L8ZA 3OEEG 3B77A 2YE9A 3PJSK 4ZI7B 1I0HA 1TC6A 3FD9A 5E1AC 2CTRA 5D7CA 3TCUA 3ZX6A 3K3WA 4DRXA 4FCQA 4L93A 1N0NA 3OTFA 4WF9V 3K97A 2L35A 4LC1A 3ZRWB 4GCZA 3L9DA 3F5TA 2Y0IA 3APOA 5KHHA 1KIJA 2EULA 2CAZC 2XAJA 4NH9A 5H6QA 3JD4A 1UY6A 3A0TA 5GGZA 2NR5A 1FPOA 1S76D 1ZWHA 4E2LA 5J2UB 1QYEA 2KB1A 4JI8O 3CP1A 1XL4A 1BHAA 1SQBH 2YE7A 2QTOA 2BYIA 4KL1A 1AR5A 4BIZA 1EZVH 5D5QA 3G6EV 1YETA 1GMGA 5EBWC 2WERA 1IBKO 1S3JA 4R6ZA 4LF5O 3OGCC 3GWOA 2R72A 4LF4O 3F5WC 3FYIB 1FXKA 2HVJC 1KMIZ 4V26A 1I5CA 1L0OA 5IN9A 3VQYA 4DRXB 4LWGA 1Z5AA 3QVNA 1O9HA 5D6PA 4RUEA 3EKOA 2B5UA 4O07A 4CWPA 4L8JA 1BGYH 3K60A 3Q5LA 1K4CC 1NH2B 1BE3H 2ITDC 3CMEV 2F23A 4IGGA 2UXCO 3LSUA 2P6JA 4NKGB 4OGQB 1OSFA 5CPHA 2Q8GA 3K03A 5CA1A 4NXMB 2BE3A 3CJHB 4U93A 2VCIA 3BFRA 3ZN0A 1JA8A 1FS0G 2QWPB 4YIPA 4DV1B 4WUDA 2XT9A 1XQ8A 2ODMA 3B09A 1IXMA 1GN2A 3C3SA 1N36O 2FYUH 4ASBA 1OCCC 1O9GA 4XTJA 2CK3G 4CWQA 2KKWA 3ZIAG 1AI4A 1Y74B 3AEIA 1M57B 3FB7C 1Y67A 4HZ0A 4JYBA 3A8TA 2YJWA 1SQFA 2E74B 1SQPH 1MNGA 4CE1A 3WB2A 1N34O 3AG1B 1UYCA 3BHPA 2ZNJA 4DV4O 4YKZA 4UCVA 2XNDG 5DEDA 3WHAA 2ITCC 2Q5ZA 1AI5A 5CA1B 1NZ6A 3CRQA 3HR0A 1EFRG 3CCEV 4LFBB 1IURA 2QE7G 4RWUA 4JTAB 1QCEA 1Q3EA 4O2BA 2ARHA 4DV2O 5EYPB 4UFZA 2GSMB 2D2CB 1K8AW 3U67A 2CCTA 3K5MA 2IJJA 3ABUA 3NXSA 3B40A 4E4EA 1KP2A 1R6TA 2H8PC 4RUFA 3AG7A 3CWVA 2Q8FA 2HHHO 2UUAO 1UYHA 4DR6O 3EFFK 3X2QC 4KSHA 4HNAB 3NR7A 2YK9A 1P7BA 1XNRO 1YT0A 1JX9A 3DGEA 4ASFA 4OPHA 2FYPA 4WFEA 5TISZ 2WEPA 2PI5A 2HCHA 3J80N 2P4VA 1PNLA 2VQEO 2YEGA 4O2BB 2UXDB 3BVOA 2LP7A 2UXBB 4N21A 3CCSV 1YTFD 5L3FA 2WLIB 3CC7V 4UVBA 3B25A 1ENVA 5B1BC 5BZBA 5LHIA 2JKIA 4UV9A 2KG7A 2BOBC 4EFTA 2X0LA 4B7PA 2PUSA 2EILC 1GM9A 3CRCA 4LBEC 4D7SA 2DW4A 3Q5JA 4CH3A 5IDMA 2Q4PA 5D5PA 1ZAUA 2RNBA 1N32B 2WI7A 1VQNV 1XNQB 4MOTA 1BXDA 1BCCH 1OCCB 1KYOF 1DK1A 2ZXWC 4KFMA 1BS3A 4JAAA 1JVMA 2LQTA 4FIPC 4U3FH 2B1IA 1Y6XA 4JI0O 1VQKV 3LSSA 3JASA 3SPIA 4U7NA 2UUBB 1Z2GA 3E8FA 4AWPA 3K9AA 2HG1A 4LF7O 4DV3O 2M6YA 1WAZA 1S16A 3MHSC 4MW3A 5JCOA 3CXCU 2XAGA 1Q86W 1PV0A 3W7UA 2DOSA 2PTMA 4PD4F 1W0KG 2WAMA 1LNQA 2VQFB 5D7DA 1N33B 2H94A 3GIFA 2IJKA 1FJGB 2QKCA 3Q4HB 4I7ZB 4J41A 3ZRXA 1QBZA 4F4LA 4X62B 3CYOA 4MVRA 4JTCB 3QTCA 1QZRA 3CB2A 4AQYO 3X2QB 4ZVIA 5FNFA 4EM7A 3G7EA 3T1HO 4UVCA 2XASA 1UYDA 4O4LA 4EGHA 2XAHA 5C93A 2JIZG 5BXZA 1MG1A 4PRXA 3O0IA 1ROPA 3FT8A 3RN4A 2EBOA 4B3MO 1TC0A 3WQ9A 1YI2V 3SYAA 1K73W 3ZXOA 4RQFA 3OE7G 2DE0X 3UM7A 4ASAA 4KTNA 2JJ1G 5CTUA 3EXAA 3BRCA 1UJWB 4GQTA 3P30A 1R3KC 3JZ3A 4XDLA 3ZHQA 4CZZA 4DYLA 1IBLB 2V7QG 5DN6G 3OMAB 3RYCA 1AJNA 1EBOA 3CS5A 3HKBB 5B1BB 3TXSA 4B3TB 3CRRA 3BA9A 1R62A 3GWKC 4DUZO 4K35A 2EILB 4DR5B 2V1DA 2YUAA 4MVMA 4F6RB 1KUQA 1WA8A 4WFHA 2AGAA 3ZS8C 4MVQA 2QWQB 4DR7B 2RMKB 3HZ1A 2FWYA 3HHUA 4UCTA 2ZXWB 2IH3C 4PI2A 2HKJA 4K4OA 1JFFA 4YKTA 2AW9A 1ZLZA 1N0JA 1JPXA 2YI9A 1NKDA 1Q6HA 4CE3A 1PPJH 3RW0A 1D5AA 2WLLA 4QE9A 5IE9A 3RYCB 1MU5A 4P7AA 3O6OA 1COWG 1OJHA 1EN5A 1QQCA 2W6IG 2Y0PA 4I3HA 2PYJA 1PM9A 2XJGA 5M4KA 5IYBO 3B24A 4JV5O 3P32A 1Z5CA 4JTDB 1K7DA 3ZHRA 4RO2A 1KD1W 4I4TA 3JATB 4E00A 2A0LA 5CA0B 3IEDA 2JK5C 5F2VO 2Y4TA 4YJ2B 5GONB 3RVZA 4J7ZA 4IHJB 1CP9A 3A0ZA 2B1GA 2JEUA 4UV8A 1XHXA 3E8HA 3VHDA 1XOUA 2CTPA 4J42A 2RN9A 3RYFB 3LPSA 3OMUA 3QO8A 2EZPA 2QWNB 2ZKJA 5EC2C 5EIBC 1F4MA 2EIMC 2IBZH 3SYOA 4CH4A 4YY3B 2R70A 3I5DA 2CTQA 2CH7B 1SA0A 1FXHA 2ADQB 4PDMA 3ZMVA 4MP7A 4XIRA 4B3SB 1EM1A 3WG7C 2XHXA 4ABMA 4ASUG 4L90A 3VHAA 4PDRA 5CMUA 1GO3F 4UXNA 4FCPA 1RPRA 3ZXQA 3FB6C 5CB4B 1UYLA 1XILA 3ETEA 5KMGB 5IYZB 4K8ZA 1HP8A 2DMXA 1YC4A 2ZBKB 5KHGA 4LNUB 5IWAB 1AMWA 3BA8A 3H80A 1A4HA 2C1IA 3A0XA 1T5EA 4U3JA 3MHHC 4X65B 3U0ZA 5LYJA 1EN6A 2CGFA 1V9PA 1XMQB 3T1KA 3B8NA 4BW9A 2YS8A 4BIUA 1US6A 4QJFB 4JI6B 4CH6A 2JDIG 4DV1O 4GX5A 2QF6A 1NT2B 3O2FA 2HJDA 1N8RW 4D6TH 2WA3A 3FAVB 1DF5A 1GN4A 1YT1A 1G8MA 2A06H 4ZHQA 5CBHA 1GJVA 3Q5KA 1HNXB 1K3EA 3D3QA 1Y4UA 4X89A 3T0ZA 5EBMC 5A2QN 2Q68A 3IJ4A 1NHIA 5LP6C 2ZE5A 1R6NA 4TUYA 2ZR2A 3VADA 3OTOB 3RYIB 4MPEA 2BU6A 3OMIB 5FPOA 2IWXA 2EJRA 1VQ5V 2HP8A 4LFBO 4WBNA 4UCOA 4B7EA 4CE2A 1SQXH 1X59A 3C11A 1UYFA 4LH7A 4XKOA 4CWSA 4J9ZB 2JGDB 5B5EZ 4BR6A 3I55V 1YITV 4WFFA 3H4LA 1RFYA 3TGUH 4EB6A 1I94O 3K9SA 3ZKDA 4XC0A 3L75H 4HYOA 1YEWA 5B1AC 2EIMB 3K06A 4YXWG 4UROA 1RPOA 3TZ0A 3B4SA 2F43G 5EZYA 4W4KA 4MPNA 1UYIA 4PRVA 3GIGB 4X1IA 3HKCB 3OWDA 3H1JH 5IYCO 3E8BA 3VQVA 3WG7B 4TUYB 4JYAB 3JAWA 1HNWB 1FD9A 2IOQA 2AXTZ 1QU7A 5B1NA 2Q8HA 1LUWA 1W2BU 4O2AB 2ATKC 2OTJV 1OCZC 2YKBA 4NTWA 4ZI7A 1KU9A 1UFIA 1PP9H 1H2SB 1I7FA 3CCUV 4R1FA 3D36A 3ZKBA 2UXBO 1UYMA 1BKNA 3ZRWA 3T0HA 4GLXA 1B04A 5KA5A 5M4MA 4HXWA 4CC6A 3U11A 4NYKA 2ILMA 3R92A 3N2GA 2AKPA 2AZ2A 3A0HZ 1VF6C 1Y8PA 1HR0B 1H8HG 4YKRA 2YEDA 2Y4UA 1YVWA 3ABMB 1VQ7V 3DC5A 5J2UA 4X1IB 3FFQA 2BSKB 3F7VC 3HYZA 2X6BA 2XDUA 1MOFA 2YXHA 1VQ4V 3UT5B 1EN4A 4GT1A 4OX9B 1N32O 3JAWB 3ZHSA 2YEEA 1HDJA 4EMVA 4B08A 3HKEB 1S0VA 1BMFG 1SZTA 1P4RA 4PL9A 1VQOV 3J7AU 2OCCC 1KZNA 1NHHA 3RYHB 1QLEC 2IU0A 2QA4V 1TVKA 4JI3B 2IH1C 5D6QA 1KKDA 5LP6B 2WWWA 4FLUA 4OPAA 3C0EA 3G80A 3TUHA 3N2GB 1VQPV 5AG2A 3ETGA 3K57A 2PYLA 4W4LA 1JR9A 3CJHA 2IORA 3U2DA 2XHRA 2UXXA 2WI1A 2YECA 4BAYA 5LL6Y 1IDSA 1Y76B 2W0FC 3LDDA 5CTYA 4XCLA 2VQFO 1GN3A 4JYCA 1N33O 2NLJC 2FL4A 3ASOB 1FJGO 1Q43A 2DWEC 1SS3A 1VF6A 3N2KB 4X62O 5B1AB 1YSRA 1Y74A 4DV5B 4DXWA 4TV8B 1S72V 3RLRA 3FV5A 5BOCA 1NTZH 4LFAB 1TVKB 3OR7C 1Q5OA 2YEVA 2IM9A 4E02A 3THOA 2YKEA 3QO7A 2AZ0A 1WPXA 4LR3A 4JZGA 1BQ0A 4XKAA 2EIKC 3CXHF 2BU7A 3FKSG 2GFDA 4I50B 5J2TB 1SESA 3INXA 5M4NA 1OCZB 1ZL8B 5LBQA 1CXZB 3S5TA 3T10A 4H0LB 2QSAA 4JI7O 2XOKG 1NVPD 1WJZA 3RFRA 4FLWA 2YXYA 3QTFA 3D8CA 3K5OA 2XDKA 2EIJC 5EYPA 2UU9B 4CWTA 3R4PA 4BXIA 2QWOB 1PD3A 1IBLO 5LGUA 4ZOLA 1Q82W 4LF9B 4MTXA 1H2NA 4Z1VA 5B3SC 1AP5A 4V25A 3K0DA 4B3TO 2P7TC 4GKJB 4O4HA 5BY1A 1X4TA 1HW7A 1IBMB 4HNAA 2YEVB 1THNA 2Q67A 4DR5O 3GIEA 1FYJA 4O05A 2ZNIA 1K92A 3C3TA 3E2EA 4DR7O 1ZTEA 5IY5C 2F66C 2QJ1A 2C2AA 3CCVV 1KP3A 1H38A 3TZ4A 2DQ0A 2LFSA 2OCCB 2CCSA 3ZMZA 4X9QA 1KECA 1QLEB 3DXRB 1AJQA 2H3OA 4XCJA 2WLIA 2XTAA 1FAFA 1KC8W 2ZDIC 1G1XB 3R65A 4H37A 5LMUB 4ZOLB 3GVMA 1U97A 1D2DA 2P90A 2O1VA 3CCMV 1K9MW 2YICA 3PEHA 1BQZA 3E22B 4O4HB 4BQGA 3R91A 2Z3YA 2XD6A 2VRZA 3CGZA 1BSMA 4G2KA 4K0KO 3SJQC 4LF8B 1WPBA 2P5OA 3OWBA 3VQXA 2UUCB 5BR8B 1E1RG 5GTHZ 2PNRA 2FMLA 2ZR3A 1KB9F 4TT3G 4LWHA 1PNKA 3ML0A 2Y69C 2MW2B 2WI2A 4KHPB 2CTWA 4GZRB 1J5EB 1VF5B 2EIKB 1GRJA 1BGQA 4WFBV 2YK2A 4CWRA 2Q9LA 2YEAA 2Q69A 1UYKA 1K34A 3TXQA 2VCJA 4DO2A 1YJNV 1B06A 3KKYA 5EK0A 3VQWA 4JQLA 4LPBA 3IC7A 3AK2A 2CGOA 2Q7GA 4QPKA 1YIJV 2EIJB 5JJJB 1K5QA 4B3SO 1EA6A 1YF2A 3Q4HA 3ZBHA 4UUJC 3R4MA 2Z0AA 4DV7B 3ZMTA 1Z5BA 5B3SB 3FYEB 1J95A 1QY8A 3BABA 4WFGA 1NJIW 4JI1O 2ZE7A 3IFXA 3CC2V 3SYCA 3EHBB 4LWFA 5BMVB 2K5BA 3U10A 3E35A 1AILA 5IY5B 4X1KB 3L73H 1WN7A 4YKXA 2CE4A 2YKCA 2XJJA 1N4CA 5L3DA 3OMNB 4O4IB 4D7TA 5M4PA 3B8MA 3P3NA 5L3GA 1M56B 4L94A 5JVDB 4I9QA 1JMKC 4JI6O 2Q8IA 3ICXA 5FNDA 4DR1B 3HKBA 4EEHA 4KXRA 2N05A 4PA7A 3SYPA 1YT2A 4PJ0Z 1SQQH 1BYQA 1H2MA 1F4NA 2B9ZA 3EHHA 2WLKA 2CGNA 4IL6Z 1SQVH 4F6RA 2PGGA 1FKAO 1HNXO 1UPGA 2ZT9B 3AG3C 1QHTA 1UY9A 1SQGA 4XKKA 2XX4A 2IOPA 3SYQA 3OTOO 5F5RA 4FFKA 1IVSA 5IJ0B 3IC9A 3R4NA 1MABG 2YEIA 3ETQA 2DYSB 3OUSA 2Y69B 2A9HA 2WA4A 2VS0A 5A9GA 3OPDA 5JH7A 2GBOA 2WI6A 2OCHA 1GH6A 4NTXA 3RLPA 3STLC 2QTSA 1QR8A 4CC5A 2YE2A 2F93B 3RWRD 1TILA 1VF7A 3JARB 2Q0AA 3CMAV 3B2EE 2YE6A 4H33A 3L71H 3JD1A 1PVGA 4TOIA 3JATA 1GK9A 1N36B 2V4DA 1BHBA 1Z5VA 5CA0A 4OXSA 4LF6O 4N23A 1DLBA 1YSZA 4PA3A 4JYAO 5LXTB 3W7TA 3TZ5A 4PHZA 1Y8NA 1JJOA 4J10A 3E83A 1P49A 3VHCA 2GHYA 2IWUA 3IGAC 4YJ2A 5GONA 1R3IC 4IHJA 4JYYA 2BU2A 1F51A 2YGAA 5IJ9B 1RSOB 1AH6A 1K5SA 5EIBD 5JH7B 2XAQA 1SKVA 2LO1A 4I0XA 5B66Z 4GFNA 3RYFA 4PDLA 1K97A 4XIQA 4IYIA 3SPCA 5CTWA 3T1YB 1SETA 5ITZB 4DZYA 2Q2EB 2Q7EA 4NXNB 3J81N 2CH7A 3A0WA 3ZN1A 4LWSB 3ZMSA 2CH4A 4OX9O 4H81A 4AHCA 3LNMB 5FWKA 2LW1A 1YTFB 1M4UA 3BCCH 2LGQA 3STZC 2UUAB 2X6CA 5HFLA 2EXLA 4ZBMA 5DECA 5CB4A 5HFMA 3EHGA 5GTIZ 4GKKB 5J9PC 5KMGA 3M7MX 1YZBA 5LGTA 4E01A 5IYZA 4FLXA 4FVMA 3AG3B 4I0XB 4JI3O 4B3RB 1NQTA 5H5NA 5GW7A 4LNUA 1XREA 3UKMA 3ZHTA 4C7UA 2OIEA 5LOVB 1YC3A 3DSQA 1G4YB 3BEHA 4CS3A 3SJCC 3HYYA 2OYQA 2YI8A 3CCQV 5F3KA 1BL8A 1JCHA 1Q6UA 3JAKB 1R3JC 1Y8OA 1IX9A 4IT5A 2IU3A 2HHIA 3ABLC 4FLVA 4DW0A 3OW6A 3K98A 2XAFA 2FWZA 1MA1A 1F7YA 3BAAA 1XL6A 4GX1A 3WFVA 1THZA 4H44B 3FAVA 4DR2B 4YIOA 4J80A 2HG5C 1JQ0A 2BTOA 3ZEDA 2GQPA 1OHHG 3L70H 4MVOA 3S3XA 4LFAO 2Q73A 4EFBA 4X20B 3AG4C 2YIAA 4X1YA 4XDKA 2E0AA 4BW5A 5J6AA 3CE2A 3RYIA 3JALB 5JJEB 4GT8A 4J9YB 3ABMC 1VEWA 4NXMO 2FKXA 3A0RA 4JI4B 2NN4A 1R6KA 3ASNC 2ADPA 1L0LH 2LFRA 5M4EA 2YE3A 4JI5B 2JGDA 4MTFA 2UU9O 3HPLC 4DV3B 2JEXA 1H2KA 1YXBA 1I59A 2YI0A 3M99B 1KKCA 1Y4MA 3MD0A 1NH2D 4DV6B 1CEZA 1PNMA 2YIBA 4GKJO 4ICGA 1YHQV 3SDLA 3GIGA 3LNUA 3HKCA 1YSCA 1WB8A 1Z5WA 4X1YB 4PA4A 1ZW9A 1XEQA 2AHYA 4R3MA 4Q20A 5LA6B 5C8YB 4O2AA 3QF7A 3QO5A 4URLA 4ZKIA 3ZHVA 2YC0A 3CRKA 2QWRB 2DYRC 2VW5A 1ZUQA 5JENA 4B3MB 2YEJA 3ASOC 4DUYB 3BY6A 5LMUO 2ZCEA 2UWDA 4L91A 5L3BA 4PDVA 4JI2B 4DV0B 1S77D 1LR1A 1NS1A 4BAEA 5L3EA 4Z1MG 1AJPA 1NBMG 5FNVB 3ABLB 2BSKA 4DUHA 4EGKA 3B27A 2QFOA 1IZ3A 3UT5A 3G75A 3HKDB 4X64B 4LP0A 2FTKA 1MSWD 4IIJB 4O4JB 5KHJA 4LF8O 3HKEA 3IAYA 1UY7A 5KUKA 4DUZB 2Q8VA 2W0XA 5BR8O 2HR3A 4MP2A 2VWCA 2UXDO 2QKSA 3RYHA 2ZKOA 3OAAG 3JSLA 2Y48A 4IYHA 4JPRA 3A2FA 3AG4B 2XDXA 4XDMA 4XD8A 5LP6A 2Z5UA 5CF0A 2XHTA 2JGUA 4FFBB 3ZJZA 4FM0A 1S5JA 2RQ6A 4R7CA 2JRIA 3ASNB 1AROP 2BTQB 4UB8Z 4MT8A 5FNCA 1GM7A 3JCZA 3AK1A 2KSDA 2X7RB 1Y76A 4YKWA 3KCYA 4BWAA 2XABA 3BPZA 5LHHA 1XNQO 2GUZB 5FLXN 3OT7A 1FXKC 3LUTB 1DF4A 2EINC 2QGNA 3N2KA 4HY1A 5KA6A 2VWKA 4DV7O 3SJAC 4TV8A 2ZE8A 3CPWU 4YKQA 4KQVA 1EZJA 1FXVA 3ZRVA 1E1QG 4PI0A
chains in the Genus database with same CATH topology
4URNA 2YKJA 5B1OA 2NNUA 3W7WA 4QPJA 2O1WA 1Y66A 4H85A 3F7YC 1L1FA 3QNEA 3T2SA 2YEBA 3INWA 2WSSG 4MVZA 2DYRB 2YI6A 2A79B 1VQ6V 1DTOA 3JD3A 3CCLV 4LP8A 5IDJA 1GKXA 1S5HC 4GEEA 2XDLA 1WLEA 1OZ0A 4X88A 1YC1A 2JJ2G 4PU9A 4X8AA 3D0BA 4FCRA 1B6QA 2WI3A 3SPHA 2XJXA 4MVUA 5L3JA 3LSQA 1AH8A 3ETDA 3RVYA 4FPPA 2IW5A 1H7SA 4KFGA 4R8CA 4EFUA 4LCUC 4XIPA 5EBLC 3RKZA 4CWFA 3TTZA 4PA6A 5KUMA 3HZ5A 4KSGA 2O1UA 2QM8A 2WLJA 2Q6AA 4MW8A 4X9LA 1FFTB 4QNHB 1QLNA 4R3AA 2ZDXA 1ZWIC 1FXKB 4YKUA 3EKRA 2EINB 1U2OA 4JAVA 2H55A 2XK2A 1M56C 3EHFA 1YJ9V 1KQSU 2WEQA 3JD2A 2CG9A 2HVKC 4KUMA 2CCUA 2OT5A 5H9CA 4FJCC 4KP4A 1AJ6A 3E86A 3FT5A 4TWKA 1ORQC 4TSFG 2PI4A 4P9OA 4BQJA 4NH8A 4G28B 2DYSC 1NR7A 3DTUB 2BU5A 1OCRC 3FB5C 1H7UA 3OM3B 1OCOC 2X6AA 1JM6A 1F23A 2YI7A 1GKFA 4HXZA 1AI6A 2ZDIA 5D7RA 5CTXA 4JAUA 3I56V 2YGEA 4O04A 1I5BA 1SRYA 1ZXNA 4O09A 2JJCA 2XDSA 3VOUA 4I9WA 1K33A 4W7TA 1H2GA 1Q81W 4EKWA 4G27B 1TUEB 3AG2C 1UYGA 2YJXA 1JJ2U 1AI7A 3VBBA 4H7QA 4JGSA 2BU8A 3OW2U 4EGIA 4P2ZA 2XCMA 2BSMA 1B3QA 2YE5A 2IWSA 3SPGA 3K04A 2QG2A 4XDJA 1PL0A 5EC1C 4HYPA 3OFNG 4R50A 4QE7A 1NVPB 2BZ5A 5LGNA 3TZ2A 1QR9A 3EHJA 4XE2A 4L87A 3MNRP 1U0ZA 2WI5A 3E8GA 3T2MA 1PKXA 1AR1B 2ZDYA 4LWIA 1Q7YW 1H8EG 2YGFA 3R4OA 2YEHA 1OCRB 3ZMUA 1EI1A 2YI5A 3W7SA 1OCOB 5L3CA 3D3IA 2BYHA 1CPYA 1VQ8V 2IJIA 3K79A 3OR6C 3U2KA 2YSUB 2WLHA 4LWEA 4XBFA 4U7OA 3JYCA 1YERA 3ZRSA 2EZOA 2YE4A 1TH8A 4WUCA 1V55C 4GGLA 3SPJA 3D2RA 3A0YA 4JF3A 4QIWF 4FK5C 1ZXMA 3NMQA 1M9NA 3SL2A 1UYEA 3AG2B 4CWOA 1GM8A 2MK3A 2ZD9A 4GX0A 2QG0A 2HJFC 4URMA 2IJHA 3T4DA 4PA9A 3T4ZA 3KE6A 1W0JG 2M7WA 3B28A 1I5YA 2YE8A 4MTOA 4NH7A 2BOCC 2DQ3A 2OTLV 2WLNA 1JOYA 2BRCA 4RAIA 1GKZA 2P67A 2R9IA 2BT0A 3HEKA 3CC4V 3RBZA 1I5AA 4JASA 3K08A 4FMTA 2UXNA 3CGYA 4HY6A 4UVAA 4HZ5A 4HYMA 4HZ3A 2XX5A 3ABKC 1V54C 2K1EA 2WLLB 3G71V 1QVFU 2QM7A 1UY8A 2HKOA 4CWNA 1RM1C 3TK1A 4O0BA 2H8MA 4GX2A 2ESAA 2R9RB 4YKYA 2YEFA 2HFEC 3QDDA 3T1CA 2D3OW 1K4DC 4MB9A 4MBCA 1TBWA 4B6CA 5J71A 4WUBA 3K0GA 4RQEA 4AWOA 3RLQA 4MTGA 1HWYA 4I5SA 1US7A 1V55B 5CN0A 4MSWC 1B62A 4WFAV 1S14A 1M90W 1R73A 4AS9A 1QVGU 1R3LC 2WPDG 1M1KW 3KG2A 2DWDC 2XX2A 1YESA 5M4HA 1SERA 4P30A 5LHGA 3HB3B 1YJWV 3E89A 3ZCCA 5IYDO 4XITA 1I58A 3CD6V 3CCRV 5BODA 1Z59A 1AM1A 4AWQA 3G7BA 4CBCA 3OUFA 1NR1A 3ABTA 4WCEV 3CRLA 2FXSA 3K99A 1NHJA 3PEJA 3ABKB 1V54B 3JD0A 1B63A 4MS2A 2W6JG 3BM9A 1VQMV 3FB8C 2WI4A 1RM1B 3LDCA 3W7XA 3ZM7A 1Y4SA 4HAMA 1VQ9V 1E79G 2BREA 5CBGA 4P9PA 4ASGA 2QEXV 1I5DA 2YKIA 3LDEA 5DM6V 3G4SV 3CCJV 3TETA 2ZQMA 3H01A 4P8OA 4PELA 1ID0A 3BMYA 2WLMA 4MVSA 1I5XA 3GB7C 1TIDA 1MX0A 2AHZA 3OEHG 1M57C 1GTOA 1YS3A 2HLDG 5CBFA 2BTZA 5FL7G 5H6RA 1VQLV 3AG1C 4MPCA 5CA3A 3B26A 4L8ZA 3OEEG 3B77A 2YE9A 3PJSK 1TC6A 5E1AC 5D7CA 3TCUA 3K3WA 4FCQA 4L93A 4WF9V 3K97A 4LC1A 3ZRWB 4GCZA 1KIJA 2XAJA 4NH9A 5H6QA 3JD4A 1UY6A 3A0TA 5GGZA 1S76D 1ZWHA 4E2LA 1QYEA 2KB1A 3CP1A 1XL4A 1BHAA 2YE7A 2QTOA 2BYIA 4BIZA 1YETA 3G6EV 1GMGA 5EBWC 2WERA 1S3JA 4R6ZA 3OGCC 3GWOA 3F5WC 3FYIB 1FXKA 2HVJC 4V26A 1I5CA 1L0OA 5IN9A 4LWGA 1Z5AA 5D6PA 4RUEA 3EKOA 2B5UA 4O07A 4CWPA 3K60A 3Q5LA 1K4CC 1NH2B 2ITDC 3CMEV 2P6JA 1OSFA 5CPHA 2Q8GA 3K03A 4U93A 2VCIA 3ZN0A 1FS0G 4WUDA 1IXMA 4ASBA 1OCCC 4XTJA 2CK3G 4CWQA 3ZIAG 1AI4A 3AEIA 1M57B 3FB7C 4HZ0A 4JYBA 2YJWA 4CE1A 3AG1B 1UYCA 4YKZA 2XNDG 3WHAA 2ITCC 1AI5A 1EFRG 3CCEV 2QE7G 4JTAB 1QCEA 2GSMB 1K8AW 3U67A 2CCTA 2IJJA 3ABUA 3NXSA 1KP2A 2H8PC 4RUFA 3CWVA 2Q8FA 1UYHA 3EFFK 3X2QC 4KSHA 2YK9A 1P7BA 1YT0A 1JX9A 3DGEA 4ASFA 2FYPA 4WFEA 2WEPA 2PI5A 2HCHA 1PNLA 2YEGA 2LP7A 4N21A 3CCSV 1YTFD 5L3FA 2WLIB 3CC7V 4UVBA 3B25A 1ENVA 5B1BC 5BZBA 5LHIA 2JKIA 4UV9A 2BOBC 4EFTA 2X0LA 4B7PA 2EILC 1GM9A 4LBEC 2DW4A 3Q5JA 5IDMA 2WI7A 1VQNV 4MOTA 1BXDA 1OCCB 2ZXWC 4KFMA 1JVMA 4FIPC 2B1IA 1VQKV 3LSSA 3SPIA 4U7NA 3E8FA 4AWPA 3K9AA 2HG1A 1S16A 3MHSC 4MW3A 3CXCU 2XAGA 1Q86W 3W7UA 1W0KG 2WAMA 1LNQA 5D7DA 2H94A 3GIFA 2IJKA 3ZRXA 1QBZA 4F4LA 3CYOA 4MVRA 4JTCB 1QZRA 3X2QB 4ZVIA 5FNFA 4EM7A 3G7EA 4UVCA 2XASA 1UYDA 4EGHA 2XAHA 5C93A 2JIZG 1MG1A 4PRXA 3O0IA 1ROPA 3FT8A 2EBOA 1TC0A 3WQ9A 1YI2V 3SYAA 1K73W 3ZXOA 4RQFA 3OE7G 3UM7A 4ASAA 4KTNA 2JJ1G 5CTUA 1UJWB 4GQTA 3P30A 3JZ3A 1R3KC 4XDLA 4CZZA 2V7QG 5DN6G 3OMAB 1AJNA 1EBOA 5B1BB 1R62A 2EILB 2V1DA 4MVMA 4WFHA 4MVQA 3HZ1A 2FWYA 3HHUA 2ZXWB 2IH3C 2HKJA 4K4OA 4YKTA 1JPXA 1NKDA 4CE3A 3RW0A 2WLLA 4QE9A 1MU5A 4P7AA 3O6OA 1COWG 2W6IG 4I3HA 2XJGA 5M4KA 5IYBO 3B24A 3P32A 1Z5CA 4JTDB 1K7DA 4RO2A 1KD1W 4E00A 2A0LA 3IEDA 2JK5C 3RVZA 1CP9A 3A0ZA 2B1GA 2JEUA 4UV8A 3E8HA 3VHDA 3LPSA 3OMUA 3QO8A 2EZPA 2ZKJA 5EC2C 1F4MA 2EIMC 3SYOA 1FXHA 4PDMA 3ZMVA 4MP7A 4XIRA 3WG7C 2XHXA 4ASUG 4L90A 3VHAA 4PDRA 5CMUA 1GO3F 4UXNA 4FCPA 1RPRA 3ZXQA 3FB6C 1UYLA 3ETEA 1YC4A 2ZBKB 1AMWA 3H80A 1A4HA 3A0XA 3MHHC 2CGFA 3T1KA 3B8NA 4QJFB 4BIUA 2JDIG 4GX5A 2QF6A 3O2FA 1N8RW 1DF5A 1YT1A 1G8MA 5CBHA 1GJVA 3Q5KA 1K3EA 1Y4UA 4X89A 3T0ZA 5EBMC 2Q68A 1NHIA 1R6NA 2ZR2A 3VADA 4MPEA 2BU6A 3OMIB 2IWXA 2EJRA 1VQ5V 4CE2A 3C11A 1UYFA 4XKOA 4CWSA 4J9ZB 3I55V 1YITV 4WFFA 3H4LA 3ZKDA 4XC0A 4HYOA 5B1AC 2EIMB 3K06A 4YXWG 4UROA 1RPOA 3TZ0A 2F43G 4MPNA 1UYIA 4PRVA 3GIGB 3OWDA 5IYCO 3E8BA 3WG7B 2IOQA 5B1NA 2Q8HA 1W2BU 2ATKC 2OTJV 1OCZC 2YKBA 3CCUV 4R1FA 3D36A 3ZKBA 1UYMA 1BKNA 3ZRWA 3T0HA 5KA5A 5M4MA 4HXWA 3R92A 2AKPA 1Y8PA 1H8HG 4YKRA 2YEDA 3ABMB 1VQ7V 3F7VC 3HYZA 2X6BA 2XDUA 1MOFA 1VQ4V 4GT1A 2YEEA 4EMVA 1S0VA 1BMFG 1SZTA 1P4RA 4PL9A 1VQOV 2OCCC 1KZNA 1NHHA 1QLEC 2IU0A 2QA4V 2IH1C 5D6QA 1KKDA 2WWWA 3C0EA 3TUHA 1VQPV 3ETGA 2IORA 3U2DA 2XHRA 2UXXA 2WI1A 2YECA 4BAYA 2W0FC 3LDDA 5CTYA 4XCLA 4JYCA 2NLJC 3ASOB 2DWEC 5B1AB 1YSRA 4DXWA 1S72V 3RLRA 3FV5A 5BOCA 3OR7C 2YEVA 4E02A 2YKEA 3QO7A 1WPXA 4XKAA 2EIKC 2BU7A 3FKSG 2GFDA 1SESA 3INXA 5M4NA 1OCZB 5LBQA 3T10A 2XOKG 1NVPD 3QTFA 2XDKA 2EIJC 4CWTA 3R4PA 4BXIA 1PD3A 5LGUA 1Q82W 4MTXA 5B3SC 4V25A 3K0DA 2P7TC 2YEVB 1THNA 2Q67A 3GIEA 4O05A 1K92A 3E2EA 5IY5C 2C2AA 3CCVV 1KP3A 1H38A 3TZ4A 2DQ0A 2LFSA 2OCCB 2CCSA 3ZMZA 1KECA 1QLEB 1AJQA 4XCJA 2WLIA 1KC8W 2ZDIC 3R65A 4H37A 2P90A 2O1VA 3CCMV 1K9MW 3PEHA 4BQGA 3R91A 2Z3YA 2XD6A 3CGZA 4G2KA 3SJQC 3OWBA 1E1RG 2PNRA 2ZR3A 4TT3G 4LWHA 1PNKA 3ML0A 2Y69C 2WI2A 2EIKB 1BGQA 4WFBV 2YK2A 4CWRA 2YEAA 2Q69A 1UYKA 1K34A 2VCJA 4DO2A 1YJNV 5EK0A 4JQLA 4LPBA 3IC7A 4QPKA 1YIJV 2EIJB 1K5QA 1EA6A 4UUJC 3R4MA 3ZMTA 1Z5BA 5B3SB 3FYEB 1J95A 1QY8A 4WFGA 1NJIW 3IFXA 3CC2V 3SYCA 3EHBB 4LWFA 2K5BA 3E35A 5IY5B 4YKXA 2YKCA 2XJJA 5L3DA 3OMNB 5M4PA 3B8MA 5L3GA 1M56B 4L94A 2Q8IA 5FNDA 4EEHA 4PA7A 3SYPA 1YT2A 1BYQA 1F4NA 3EHHA 2WLKA 3AG3C 1UY9A 4XKKA 2XX4A 2IOPA 3SYQA 5F5RA 3R4NA 1MABG 2YEIA 2DYSB 3OUSA 2Y69B 2A9HA 3OPDA 2WI6A 3RLPA 3STLC 1QR8A 2YE2A 1TILA 3CMAV 2YE6A 4H33A 3JD1A 1PVGA 1GK9A 1BHBA 4OXSA 4N23A 1DLBA 1YSZA 4PA3A 3W7TA 3TZ5A 1Y8NA 3E83A 3VHCA 2GHYA 2IWUA 3IGAC 1R3IC 2BU2A 1F51A 2YGAA 1AH6A 1K5SA 2XAQA 4GFNA 4PDLA 1K97A 4XIQA 3SPCA 5CTWA 1SETA 4DZYA 2Q2EB 3A0WA 3ZN1A 3ZMSA 2CH4A 4H81A 3LNMB 5FWKA 1YTFB 3STZC 2X6CA 5HFLA 2EXLA 4ZBMA 5HFMA 3EHGA 5J9PC 5LGTA 4E01A 3AG3B 1NQTA 5GW7A 3UKMA 1YC3A 1G4YB 3BEHA 3HYYA 3CCQV 5F3KA 1BL8A 1JCHA 1R3JC 1Y8OA 2IU3A 3ABLC 3OW6A 3K98A 2XAFA 2FWZA 4GX1A 1XL6A 3WFVA 1THZA 2HG5C 1JQ0A 2GQPA 1OHHG 4MVOA 3AG4C 4XDKA 2E0AA 4BW5A 5J6AA 4GT8A 4J9YB 3ABMC 3A0RA 1R6KA 3ASNC 2LFRA 5M4EA 2YE3A 4MTFA 3HPLC 2JEXA 1I59A 2YI0A 3M99B 1Y4MA 3MD0A 1NH2D 1CEZA 1PNMA 1YHQV 3GIGA 3LNUA 1YSCA 4PA4A 1ZW9A 2AHYA 4R3MA 4Q20A 3QO5A 4URLA 4ZKIA 3CRKA 2DYRC 2VW5A 2YEJA 3ASOC 3BY6A 2UWDA 4L91A 5L3BA 4PDVA 1S77D 4BAEA 5L3EA 4Z1MG 1AJPA 1NBMG 3ABLB 4DUHA 4EGKA 3B27A 2QFOA 3G75A 4LP0A 2FTKA 1MSWD 1UY7A 5KUKA 2HR3A 4MP2A 2VWCA 2QKSA 3OAAG 2Y48A 4JPRA 3AG4B 2XDXA 4XDMA 4XD8A 2Z5UA 5CF0A 2XHTA 3ZJZA 4R7CA 3ASNB 1AROP 4MT8A 5FNCA 1GM7A 3JCZA 2X7RB 4YKWA 2XABA 5LHHA 1FXKC 3LUTB 1DF4A 2EINC 4HY1A 5KA6A 3CPWU 4YKQA 4KQVA 1EZJA 1FXVA 3ZRVA 1E1QG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4URN A;  2YKJ A;  5B1O A;  3OWB A;  1B62 A;  1S14 A;  4AS9 A;  4QPJ A;  2O1W A;  4H85 A;  1R62 A;  3T2S A;  2PNR A;  4LWH A;  2YEB A;  3INW A;  2XX2 A;  2WI2 A;  2YI6 A;  1YES A;  5M4H A;  3HZ1 A;  2FWY A;  3HHU A;  5IDJ A;  1BGQ A;  1GKX A;  4GEE A;  2XDL A;  2YK2 A;  4CWR A;  3ZCC A;  2YEA A;  1UYK A;  1YC1 A;  2VCJ A;  2HKJ A;  4PU9 A;  4XIT A;  4K4O A;  3D0B A;  4JQL A;  4LPB A;  4YKT A;  4FCR A;  4QPK A;  2WI3 A;  1I58 A;  4CE3 A;  2XJX A;  5BOD A;  1Z59 A;  1AM1 A;  5L3J A;  1MU5 A;  4P7A A;  4AWQ A;  3G7B A;  3O6O A;  1EA6 A;  4I3H A;  1AH8 A;  3R4M A;  2XJG A;  3CRL A;  5M4K A;  3B24 A;  1Z5B A;  4FPP A;  2FXS A;  3K99 A;  3P32 A;  1NHJ A;  1QY8 A;  1Z5C A;  1H7S A;  3PEJ A;  4E00 A;  4KFG A;  4EFU A;  4XIP A;  1B63 A;  4LWF A;  3IED A;  2K5B A;  3RKZ A;  4CWF A;  3BM9 A;  3TTZ A;  4YKX A;  2YKC A;  2XJJ A;  2WI4 A;  5M4P A;  3HZ5 A;  4KSG A;  3ZM7 A;  3A0Z A;  2O1U A;  4L94 A;  2QM8 A;  1Y4S A;  2BRE A;  3VHD A;  2Q8I A;  5FND A;  4X9L A;  4R3A A;  3LPS A;  3OMU A;  4ASG A;  2ZDX A;  4YKU A;  4EEH A;  3EKR A;  1I5D A;  2YKI A;  2ZKJ A;  1YT2 A;  1BYQ A;  3EHH A;  2H55 A;  1U2O A;  4JAV A;  2XK2 A;  4P8O A;  1ID0 A;  3BMY A;  3EHF A;  4MP7 A;  4XIR A;  2WEQ A;  1UY9 A;  2CG9 A;  2XHX A;  1TID A;  1MX0 A;  4L90 A;  3VHA A;  4XKK A;  2XX4 A;  2CCU A;  2IOP A;  5F5R A;  4FCP A;  3ZXQ A;  1YS3 A;  4KP4 A;  1UYL A;  1AJ6 A;  3R4N A;  2BTZ A;  2YEI A;  3FT5 A;  1YC4 A;  2ZBK B;  3OPD A;  4MPC A;  2WI6 A;  3B26 A;  1AMW A;  4L8Z A;  3RLP A;  3H80 A;  2YE9 A;  1A4H A;  1TC6 A;  2YE2 A;  3A0X A;  1TIL A;  4BQJ A;  5D7C A;  4FCQ A;  4L93 A;  2CGF A;  4NH8 A;  3K97 A;  2YE6 A;  3T1K A;  4LC1 A;  3ZRW B;  1PVG A;  4BIU A;  4GCZ A;  1KIJ A;  2BU5 A;  2QF6 A;  4NH9 A;  3O2F A;  1UY6 A;  1YSZ A;  3A0T A;  3TZ5 A;  1Y8N A;  5GGZ A;  1H7U A;  1YT1 A;  3VHC A;  2IWU A;  1ZWH A;  1GJV A;  3Q5K A;  1QYE A;  1JM6 A;  2BU2 A;  1Y4U A;  1F51 A;  2YI7 A;  2YGA A;  2YE7 A;  2BYI A;  4HXZ A;  4BIZ A;  3T0Z A;  1AH6 A;  1YET A;  1NHI A;  2WER A;  4GFN A;  3VAD A;  5D7R A;  4MPE A;  5CTX A;  4XIQ A;  4V26 A;  4JAU A;  1I5C A;  2BU6 A;  1L0O A;  5CTW A;  5IN9 A;  2IWX A;  2YGE A;  4DZY A;  2Q2E B;  4LWG A;  1Z5A A;  5D6P A;  4O04 A;  1I5B A;  1ZXN A;  4CE2 A;  3A0W A;  1UYF A;  3C11 A;  3EKO A;  4XKO A;  4CWS A;  4O09 A;  4O07 A;  4CWP A;  3K60 A;  3Q5L A;  2CH4 A;  2JJC A;  2XDS A;  3H4L A;  4H81 A;  5FWK A;  1OSF A;  3ZKD A;  5CPH A;  4XC0 A;  2Q8G A;  4W7T A;  4U93 A;  2VCI A;  2EXL A;  4URO A;  3TZ0 A;  3EHG A;  4MPN A;  1UYI A;  4PRV A;  3GIG B;  4WUD A;  3OWD A;  1UYG A;  2YJX A;  4E01 A;  1IXM A;  4H7Q A;  2IOQ A;  4ASB A;  2BU8 A;  5B1N A;  2Q8H A;  4XTJ A;  1YC3 A;  4CWQ A;  4EGI A;  2XCM A;  2YKB A;  3HYY A;  2BSM A;  1B3Q A;  2YE5 A;  5F3K A;  2IWS A;  4HZ0 A;  4JYB A;  2YJW A;  2QG2 A;  1Y8O A;  4R1F A;  3D36 A;  3ZKB A;  1UYM A;  1BKN A;  3ZRW A;  3T0H A;  4CE1 A;  1UYC A;  3OW6 A;  5M4M A;  3K98 A;  4HXW A;  4YKZ A;  4HYP A;  2FWZ A;  3WHA A;  3R92 A;  2AKP A;  2BZ5 A;  1Y8P A;  3TZ2 A;  4YKR A;  2YED A;  3EHJ A;  4XE2 A;  3MNR P;  2GQP A;  1U0Z A;  2WI5 A;  3HYZ A;  2XDU A;  2ZDY A;  4LWI A;  4GT1 A;  3U67 A;  2CCT A;  2YEE A;  2YGF A;  4EMV A;  3NXS A;  2E0A A;  5J6A A;  3R4O A;  2YEH A;  4GT8 A;  4PL9 A;  3CWV A;  2Q8F A;  1EI1 A;  2YI5 A;  3A0R A;  1UYH A;  1KZN A;  2BYH A;  4KSH A;  1NHH A;  2LFR A;  2YK9 A;  5M4E A;  2YE3 A;  1YT0 A;  5D6Q A;  2WWW A;  3DGE A;  3C0E A;  4ASF A;  3TUH A;  2FYP A;  3U2K A;  1I59 A;  2YI0 A;  2WEP A;  2HCH A;  4LWE A;  2IOR A;  4U7O A;  3MD0 A;  3U2D A;  2YEG A;  1YER A;  2XHR A;  2WI1 A;  2YEC A;  3GIG A;  3LNU A;  2YE4 A;  5CTY A;  1TH8 A;  4WUC A;  4XCL A;  4GGL A;  4JYC A;  1ZW9 A;  3D2R A;  4R3M A;  4Q20 A;  3B25 A;  3A0Y A;  2JKI A;  1YSR A;  1ZXM A;  4EFT A;  3RLR A;  3NMQ A;  4B7P A;  3SL2 A;  1UYE A;  3FV5 A;  5BOC A;  4URL A;  3Q5J A;  5IDM A;  4ZKI A;  4CWO A;  4E02 A;  3CRK A;  2QG0 A;  2WI7 A;  2VW5 A;  4URM A;  2YKE A;  4MOT A;  3KE6 A;  1BXD A;  4XKA A;  2YEJ A;  2BU7 A;  3B28 A;  2GFD A;  2YE8 A;  3INX A;  5M4N A;  2UWD A;  4L91 A;  4NH7 A;  2BRC A;  1JOY A;  3T10 A;  1GKZ A;  2P67 A;  4BAE A;  2BT0 A;  3QTF A;  2XDK A;  4DUH A;  4U7N A;  3HEK A;  3B27 A;  4EGK A;  2QFO A;  4CWT A;  3R4P A;  3G75 A;  4AWP A;  4LP0 A;  4BXI A;  2FTK A;  2HG1 A;  1I5A A;  4JAS A;  1UY7 A;  4MTX A;  4FMT A;  3CGY A;  4HY6 A;  1S16 A;  4V25 A;  4HZ5 A;  4HYM A;  4MP2 A;  2VWC A;  1THN A;  2XX5 A;  3GIE A;  5D7D A;  4O05 A;  3GIF A;  2XDX A;  2QM7 A;  4XDM A;  4XD8 A;  5CF0 A;  3ZRX A;  2XHT A;  2C2A A;  1UY8 A;  4CWN A;  3TZ4 A;  1QZR A;  3TK1 A;  2LFS A;  4O0B A;  2H8M A;  2CCS A;  5FNF A;  2ESA A;  4ZVI A;  4EM7 A;  3G7E A;  4MT8 A;  4YKY A;  2YEF A;  5FNC A;  1UYD A;  3QDD A;  4XCJ A;  4EGH A;  4YKW A;  2XAB A;  4MB9 A;  5C93 A;  4PRX A;  3O0I A;  4MBC A;  3FT8 A;  2O1V A;  1TBW A;  1TC0 A;  4B6C A;  3PEH A;  3WQ9 A;  3ZXO A;  5J71 A;  4HY1 A;  4WUB A;  4ASA A;  4AWO A;  4BQG A;  3R91 A;  4YKQ A;  4KTN A;  3RLQ A;  5CTU A;  4KQV A;  3ZRV A;  4I5S A;  2XD6 A;  4GQT A;  3CGZ A;  3JZ3 A;  1US7 A; 
#chains in the Genus database with same CATH topology
 4URN A;  2YKJ A;  5B1O A;  4EEQ A;  2NNU A;  3W7W A;  2UUB O;  2DN9 A;  5KAI Z;  2ZM6 B;  3PN1 A;  4I50 A;  5J2T A;  4QPJ A;  2P4K A;  2O1W A;  1Y66 A;  4AI8 A;  1ZL8 A;  4A5U B;  4H85 A;  3F7Y C;  1L1F A;  3QNE A;  3T2S A;  4DR4 B;  3O65 A;  3CSX A;  4JZ2 A;  2YEB A;  3INW A;  2WSS G;  4MVZ A;  2DYR B;  2YI6 A;  2A79 B;  1VQ6 V;  1DTO A;  2F4V B;  3JD3 A;  2RJZ A;  2ZIM A;  5FPR A;  3CCL V;  4LP8 A;  2PY5 A;  2E5L B;  5IDJ A;  1GKX A;  1S5H C;  4GEE A;  1U96 A;  2XDL A;  4DR1 O;  1WLE A;  1OZ0 A;  4X88 A;  1YC1 A;  5KX5 B;  1OV9 A;  5E79 Z;  2JJ2 G;  2RCV A;  4PU9 A;  4X8A A;  3D0B A;  1M93 A;  4FCR A;  1B6Q A;  2WI3 A;  2OWO A;  4Q6G A;  3KCX A;  3SPH A;  2XJX A;  4UCU A;  4MVU A;  5L3J A;  1XHZ A;  3LSQ A;  2LGW A;  1TGO A;  1AH8 A;  3ETD A;  2QR4 A;  3RVY A;  4FPP A;  1D5N A;  2JVD A;  2IW5 A;  3UO3 A;  1H7S A;  2L6L A;  4CH5 A;  4X66 B;  4KFG A;  3DXR A;  4R8C A;  4EFU A;  2A3Q A;  4LCU C;  4XIP A;  4LFC B;  5EBL C;  3RKZ A;  4CWF A;  3TTZ A;  4DW1 A;  5JJN B;  1YDX A;  4PA6 A;  5KUM A;  3E22 A;  3HZ5 A;  1XI1 A;  3DC6 A;  4KSG A;  2O1U A;  2QM8 A;  2WLJ A;  2Q6A A;  1VP7 A;  4MW8 A;  2K9P A;  5LMN B;  1FFT B;  4QNH B;  1QLN A;  4R3A A;  4X9L A;  1S5L Z;  3APQ A;  1ZWI C;  2ZDX A;  1FXK B;  4FM2 A;  4YKU A;  3EKR A;  2BCC H;  2EIN B;  1URF A;  3JAM N;  4DK0 A;  1U2O A;  4JAV A;  3WB1 A;  2H55 A;  2XK2 A;  3FX7 A;  1M56 C;  2E3C A;  1VMG A;  4YHH B;  3EHF A;  1XDC A;  1YJ9 V;  1KQS U;  1ZSP A;  2WEQ A;  3UO2 A;  3JD2 A;  2CG9 A;  2DJV A;  2HVK C;  4KUM A;  2EX3 A;  4UCR A;  4NTY A;  2CCU A;  2OT5 A;  3UCS C;  4UB6 Z;  5H9C A;  2E75 B;  4FJC C;  3T1Y O;  4KP4 A;  1AJ6 A;  5KAF Z;  3E86 A;  4NXN O;  3FT5 A;  1TAE A;  3A0B Z;  1XMO B;  4TWK A;  3JCU Z;  1ORQ C;  3MAQ A;  2E76 B;  5KHI A;  2A7W A;  1I94 B;  1FFX A;  4FLY A;  3G67 A;  4TSF G;  4E72 A;  1VAR A;  2PI4 A;  4P9O A;  3LNN A;  4BQJ A;  3ZHU A;  4NH8 A;  4G28 B;  3JSN A;  2DYS C;  1NR7 A;  4GKK O;  2O57 A;  1BT8 A;  2FB5 A;  3DTU B;  5BMV A;  2BU5 A;  4B3R O;  4X1K A;  2PF4 E;  4ZIB A;  1R1B A;  5JCO C;  1OCR C;  3FB5 C;  4UCS A;  1H7U A;  3OM3 B;  2YID A;  4O4I A;  1NU1 H;  4CS2 A;  1OCO C;  2X6A A;  4YY3 O;  1JM6 A;  1HNZ B;  1F23 A;  2YI7 A;  1GKF A;  4HXZ A;  5JVD A;  4FLZ A;  1FFX B;  1AI6 A;  1XBL A;  1NTM H;  2ZDI A;  5KHK A;  5D7R A;  4AIL C;  5CTX A;  4DR3 B;  4JAU A;  3I56 V;  1PL4 A;  2YGE A;  4NR1 A;  1G6U A;  2ZIO A;  4DR2 O;  3N27 A;  4O04 A;  1I5B A;  1SRY A;  1ZXN A;  1L0N H;  4O09 A;  1GN6 A;  1TUB A;  2JJC A;  4FZ0 A;  5JWP A;  2XDS A;  3VOU A;  5IWA O;  4I9W A;  1K33 A;  4W7T A;  1H2G A;  5IT9 N;  1GAX A;  4X65 O;  1Q81 W;  3K58 A;  4EKW A;  4G27 B;  5IJ0 A;  4JI4 O;  3H1K H;  1P84 F;  1TUE B;  1WP8 A;  3AG2 C;  1UYG A;  1XMQ O;  2YJX A;  1JJ2 U;  1AI7 A;  4JI5 O;  3VBB A;  4H7Q A;  3SGI A;  4JGS A;  2BU8 A;  3RGB A;  3OW2 U;  5K1P A;  4EGI A;  4P2Z A;  2QM4 A;  2XCM A;  2KG7 B;  2BSM A;  1B3Q A;  2YE5 A;  5H2F Z;  4JI8 B;  2IWS A;  3QG5 A;  3SPG A;  3K04 A;  1IXB A;  1NI8 A;  2QG2 A;  1AB3 A;  4XDJ A;  3JAR A;  3CEI A;  4DV6 O;  1PL0 A;  1IBK B;  1TUB B;  4LF5 B;  5EC1 C;  4HYP A;  3OFN G;  4R50 A;  4LF4 B;  4QE7 A;  1NVP B;  2BZ5 A;  5LGN A;  5LXT A;  3TZ2 A;  2KQX A;  2EJ7 A;  1QR9 A;  2OIG A;  3EHJ A;  4XE2 A;  4L87 A;  3MNR P;  1U0Z A;  3EVK A;  2WI5 A;  3JAS B;  3E8G A;  1QNM A;  3H1I H;  3T2M A;  1PKX A;  1AR1 B;  5IJ9 A;  2ZDY A;  4YJ3 A;  4LWI A;  1RSO A;  2F1M A;  2N74 A;  1Q7Y W;  1H8E G;  1LUV A;  2UXC B;  2YGF A;  3R4O A;  2YEH A;  4DUY O;  3CRA A;  4H13 B;  1OCR B;  3ZMU A;  4JI7 B;  1EI1 A;  2P22 C;  4JI2 O;  2YI5 A;  3W7S A;  1OCO B;  5ITZ A;  4DV0 O;  5L3C A;  3D3I A;  3K5L A;  2BYH A;  2CUG A;  1VIB A;  1CPY A;  1VQ8 V;  2IJI A;  3LMM A;  3K79 A;  4I55 A;  3OR6 C;  4LWS A;  3U2K A;  4X64 O;  1HNW O;  2P06 A;  2GTS A;  2WLH A;  2YSU B;  3CHX A;  4LWE A;  4XBF A;  4U7O A;  3JYC A;  1YER A;  3ZRS A;  2N04 A;  5KLV H;  3G6B A;  1N34 B;  1ZX3 A;  4O4L B;  4DK1 A;  4YJ3 B;  4DV4 B;  2EZO A;  2YE4 A;  1TH8 A;  4WUC A;  1V55 C;  4GGL A;  3SPJ A;  1YCI A;  3D2R A;  1WNS A;  2YIB D;  3A0Y A;  4JF3 A;  5LOV A;  4QIW F;  4CS4 A;  3K5N A;  4FK5 C;  1HR0 O;  1ZXM A;  4EFE A;  2LJ2 A;  3NMQ A;  1M9N A;  5JQG A;  1UYE A;  3SL2 A;  4DV2 B;  3R66 A;  3JAK A;  2HEP A;  3AG2 B;  4CWO A;  1GM8 A;  2MK3 A;  2ZD9 A;  4I55 B;  4GX0 A;  2QG0 A;  2HJF C;  4URM A;  2IJH A;  3C90 A;  3T4D A;  4PA9 A;  3T4Z A;  3L74 H;  3KE6 A;  1W0J G;  2ETN A;  2M7W A;  4TV9 A;  3B28 A;  1I5Y A;  2GDS A;  2YE8 A;  4GUN A;  4MTO A;  2HHH B;  3CYG A;  4NH7 A;  2BOC C;  2DQ3 A;  2OTL V;  2WLN A;  4DR6 B;  1JOY A;  2BRC A;  4K8X A;  4RAI A;  1Q90 D;  1GKZ A;  2P67 A;  2R9I A;  1WA8 B;  3OGI B;  2BT0 A;  4K0K B;  3SR2 C;  1XNR B;  3HEK A;  3CC4 V;  2F95 B;  4X20 A;  3RBZ A;  1I5A A;  1MSD A;  4JAS A;  2GV9 A;  3CRM A;  1XUQ A;  3K08 A;  4FMT A;  2UXN A;  1AR4 A;  2Q7H A;  3P3P A;  2ZM6 O;  2VQE B;  3CGY A;  4HY6 A;  3JAL A;  1JFF B;  5JQG B;  4UVA A;  4HZ5 A;  4HYM A;  4DR4 O;  4HZ3 A;  2XX5 A;  3ABK C;  4FM1 A;  3H1L H;  1V54 C;  2Q0O C;  2K1E A;  2WLL B;  3G71 V;  2ZE6 A;  1QVF U;  2QM7 A;  2F4V O;  4NB5 A;  4TV9 B;  1WP7 A;  2QKA A;  2E5L O;  1UY8 A;  2HKO A;  3SJB C;  4CWN A;  1MZE A;  3WB0 A;  2PZS A;  4K3A A;  1Q8I A;  1RM1 C;  1WB7 A;  3TK1 A;  3RT3 C;  4O0B A;  2H8M A;  4GX2 A;  4DV5 O;  2ESA A;  2R9R B;  4I4T B;  4YKY A;  2YEF A;  2HFE C;  3QDD A;  3T1C A;  2D3O W;  1K4D C;  4MB9 A;  1MMM A;  4MBC A;  3H9V A;  5LA6 A;  5C8Y A;  1TBW A;  4B6C A;  1H2L A;  4QGP A;  5J71 A;  1RP3 B;  4JI1 B;  4WUB A;  1TA8 A;  4JI0 B;  3K0G A;  4RQE A;  4AWO A;  2XUM A;  3RLQ A;  4MTG A;  1HWY A;  4I5S A;  1US7 A;  4FZ1 A;  2RDC A;  3OD4 A;  4X66 O;  1V55 B;  3TJT A;  5CN0 A;  3KZI Z;  4LF7 B;  4MSW C;  4LFC O;  1P7G A;  1B62 A;  4WFA V;  1S14 A;  1M90 W;  1R73 A;  4AS9 A;  3H1H H;  4F6E A;  4LF9 O;  1QVG U;  1R3L C;  4HBN A;  1SA0 B;  2WPD G;  1M1K W;  3KG2 A;  2DWD C;  2XX2 A;  5FNV A;  1SC5 B;  1IBM O;  1YES A;  5M4H A;  1SER A;  4P30 A;  3HKD A;  5LHG A;  3HB3 B;  5LMN O;  3E89 A;  4IIJ A;  4O4J A;  1YJW V;  3ZCC A;  4NVP A;  3WU2 Z;  2JS5 A;  4J11 A;  4TQF A;  4AQY B;  5IYD O;  4XIT A;  4J7K A;  3T1H B;  3CWB H;  3D36 C;  1I58 A;  3CD6 V;  3CCR V;  5BOD A;  2R9A A;  4GYC B;  4YHH O;  1Z59 A;  1AM1 A;  4AWQ A;  1AP6 A;  3G7B A;  4CBC A;  2CDY A;  3M8A A;  3OUF A;  1MZF A;  3AK3 A;  1NR1 A;  3ABT A;  4WCE V;  3CRL A;  4U3J B;  4FFB A;  1SZX A;  5LYJ B;  2FXS A;  3K99 A;  1AVM A;  1NHJ A;  3S3W A;  3MDS A;  1I08 A;  3PEJ A;  2BTQ A;  3ABK B;  1V54 B;  3JD0 A;  1B63 A;  4MS2 A;  1XMO O;  2VWJ A;  2W6J G;  2JS3 A;  4Z2W A;  3BM9 A;  3O9O A;  2GUZ A;  1VQM V;  4PV1 B;  3FB8 C;  2WI4 A;  4BIO A;  3L72 H;  1RM1 B;  2UUC O;  4ZHQ B;  4J7J A;  4TQD A;  4FLT A;  3LDC A;  3W7X A;  1Q6I A;  1M5I A;  3ZM7 A;  1Y4S A;  4HAM A;  1L8D A;  1VQ9 V;  1E79 G;  4LF6 B;  2BRE A;  5CBG A;  1SF9 A;  4KHP O;  1KBH A;  4P9P A;  1DGS A;  1J5E O;  4ASG A;  2QEX V;  1I5D A;  2YKI A;  3LDE A;  5DM6 V;  3G4S V;  3CCJ V;  1W59 A;  3TET A;  2XHB A;  2ZQM A;  1BZK A;  5K1X A;  3H01 A;  4LH6 A;  2GTA A;  4WBN B;  4P8O A;  4PEL A;  1ID0 A;  3BMY A;  3K59 A;  2C1G A;  1HNZ O;  2ZIN A;  2WLM A;  4MVS A;  1I5X A;  2G38 A;  3GB7 C;  1TID A;  1MX0 A;  2AHZ A;  4EB6 B;  1A32 A;  3OEH G;  4JV5 B;  1NTK H;  1M57 C;  1GTO A;  4DR3 O;  5KX5 A;  1YS3 A;  2HLD G;  2YDE A;  5EZY B;  5CBF A;  2BTZ A;  5FL7 G;  5H6R A;  1VQL V;  2LW7 A;  3AG1 C;  4B7K A;  2YXL A;  2QDO A;  3CX5 F;  4MPC A;  5CA3 A;  3UQ8 A;  3B26 A;  4L8Z A;  3OEE G;  3B77 A;  2YE9 A;  3PJS K;  4ZI7 B;  1I0H A;  1TC6 A;  3FD9 A;  5E1A C;  2CTR A;  5D7C A;  3TCU A;  3ZX6 A;  3K3W A;  4DRX A;  4FCQ A;  4L93 A;  1N0N A;  3OTF A;  4WF9 V;  3K97 A;  2L35 A;  4LC1 A;  3ZRW B;  4GCZ A;  3L9D A;  3F5T A;  2Y0I A;  3APO A;  5KHH A;  1KIJ A;  2EUL A;  2CAZ C;  2XAJ A;  4NH9 A;  5H6Q A;  3JD4 A;  1UY6 A;  3A0T A;  5GGZ A;  2NR5 A;  1FPO A;  1S76 D;  1ZWH A;  4E2L A;  5J2U B;  1QYE A;  2KB1 A;  4JI8 O;  3CP1 A;  1XL4 A;  1BHA A;  1SQB H;  2YE7 A;  2QTO A;  2BYI A;  4KL1 A;  1AR5 A;  4BIZ A;  1EZV H;  5D5Q A;  3G6E V;  1YET A;  1GMG A;  5EBW C;  2WER A;  1IBK O;  1S3J A;  4R6Z A;  4LF5 O;  3OGC C;  3GWO A;  2R72 A;  4LF4 O;  3F5W C;  3FYI B;  1FXK A;  2HVJ C;  1KMI Z;  4V26 A;  1I5C A;  1L0O A;  5IN9 A;  3VQY A;  4DRX B;  4LWG A;  1Z5A A;  3QVN A;  1O9H A;  5D6P A;  4RUE A;  3EKO A;  2B5U A;  4O07 A;  4CWP A;  4L8J A;  1BGY H;  3K60 A;  3Q5L A;  1K4C C;  1NH2 B;  1BE3 H;  2ITD C;  3CME V;  2F23 A;  4IGG A;  2UXC O;  3LSU A;  2P6J A;  4NKG B;  4OGQ B;  1OSF A;  5CPH A;  2Q8G A;  3K03 A;  5CA1 A;  4NXM B;  2BE3 A;  3CJH B;  4U93 A;  2VCI A;  3BFR A;  3ZN0 A;  1JA8 A;  1FS0 G;  2QWP B;  4YIP A;  4DV1 B;  4WUD A;  2XT9 A;  1XQ8 A;  2ODM A;  3B09 A;  1IXM A;  1GN2 A;  3C3S A;  1N36 O;  2FYU H;  4ASB A;  1OCC C;  1O9G A;  4XTJ A;  2CK3 G;  4CWQ A;  2KKW A;  3ZIA G;  1AI4 A;  1Y74 B;  3AEI A;  1M57 B;  3FB7 C;  1Y67 A;  4HZ0 A;  4JYB A;  3A8T A;  2YJW A;  1SQF A;  2E74 B;  1SQP H;  1MNG A;  4CE1 A;  3WB2 A;  1N34 O;  3AG1 B;  1UYC A;  3BHP A;  2ZNJ A;  4DV4 O;  4YKZ A;  4UCV A;  2XND G;  5DED A;  3WHA A;  2ITC C;  2Q5Z A;  1AI5 A;  5CA1 B;  1NZ6 A;  3CRQ A;  3HR0 A;  1EFR G;  3CCE V;  4LFB B;  1IUR A;  2QE7 G;  4RWU A;  4JTA B;  1QCE A;  1Q3E A;  4O2B A;  2ARH A;  4DV2 O;  5EYP B;  4UFZ A;  2GSM B;  2D2C B;  1K8A W;  3U67 A;  2CCT A;  3K5M A;  2IJJ A;  3ABU A;  3NXS A;  3B40 A;  4E4E A;  1KP2 A;  1R6T A;  2H8P C;  4RUF A;  3AG7 A;  3CWV A;  2Q8F A;  2HHH O;  2UUA O;  1UYH A;  4DR6 O;  3EFF K;  3X2Q C;  4KSH A;  4HNA B;  3NR7 A;  2YK9 A;  1P7B A;  1XNR O;  1YT0 A;  1JX9 A;  3DGE A;  4ASF A;  4OPH A;  2FYP A;  4WFE A;  5TIS Z;  2WEP A;  2PI5 A;  2HCH A;  3J80 N;  2P4V A;  1PNL A;  2VQE O;  2YEG A;  4O2B B;  2UXD B;  3BVO A;  2LP7 A;  2UXB B;  4N21 A;  3CCS V;  1YTF D;  5L3F A;  2WLI B;  3CC7 V;  4UVB A;  3B25 A;  1ENV A;  5B1B C;  5BZB A;  5LHI A;  2JKI A;  4UV9 A;  2KG7 A;  2BOB C;  4EFT A;  2X0L A;  4B7P A;  2PUS A;  2EIL C;  1GM9 A;  3CRC A;  4LBE C;  4D7S A;  2DW4 A;  3Q5J A;  4CH3 A;  5IDM A;  2Q4P A;  5D5P A;  1ZAU A;  2RNB A;  1N32 B;  2WI7 A;  1VQN V;  1XNQ B;  4MOT A;  1BXD A;  1BCC H;  1OCC B;  1KYO F;  1DK1 A;  2ZXW C;  4KFM A;  1BS3 A;  4JAA A;  1JVM A;  2LQT A;  4FIP C;  4U3F H;  2B1I A;  1Y6X A;  4JI0 O;  1VQK V;  3LSS A;  3JAS A;  3SPI A;  4U7N A;  2UUB B;  1Z2G A;  3E8F A;  4AWP A;  3K9A A;  2HG1 A;  4LF7 O;  4DV3 O;  2M6Y A;  1WAZ A;  1S16 A;  3MHS C;  4MW3 A;  5JCO A;  3CXC U;  2XAG A;  1Q86 W;  1PV0 A;  3W7U A;  2DOS A;  2PTM A;  4PD4 F;  1W0K G;  2WAM A;  1LNQ A;  2VQF B;  5D7D A;  1N33 B;  2H94 A;  3GIF A;  2IJK A;  1FJG B;  2QKC A;  3Q4H B;  4I7Z B;  4J41 A;  3ZRX A;  1QBZ A;  4F4L A;  4X62 B;  3CYO A;  4MVR A;  4JTC B;  3QTC A;  1QZR A;  3CB2 A;  4AQY O;  3X2Q B;  4ZVI A;  5FNF A;  4EM7 A;  3G7E A;  3T1H O;  4UVC A;  2XAS A;  1UYD A;  4O4L A;  4EGH A;  2XAH A;  5C93 A;  2JIZ G;  5BXZ A;  1MG1 A;  4PRX A;  3O0I A;  1ROP A;  3FT8 A;  3RN4 A;  2EBO A;  4B3M O;  1TC0 A;  3WQ9 A;  1YI2 V;  3SYA A;  1K73 W;  3ZXO A;  4RQF A;  3OE7 G;  2DE0 X;  3UM7 A;  4ASA A;  4KTN A;  2JJ1 G;  5CTU A;  3EXA A;  3BRC A;  1UJW B;  4GQT A;  3P30 A;  1R3K C;  3JZ3 A;  4XDL A;  3ZHQ A;  4CZZ A;  4DYL A;  1IBL B;  2V7Q G;  5DN6 G;  3OMA B;  3RYC A;  1AJN A;  1EBO A;  3CS5 A;  3HKB B;  5B1B B;  3TXS A;  4B3T B;  3CRR A;  3BA9 A;  1R62 A;  3GWK C;  4DUZ O;  4K35 A;  2EIL B;  4DR5 B;  2V1D A;  2YUA A;  4MVM A;  4F6R B;  1KUQ A;  1WA8 A;  4WFH A;  2AGA A;  3ZS8 C;  4MVQ A;  2QWQ B;  4DR7 B;  2RMK B;  3HZ1 A;  2FWY A;  3HHU A;  4UCT A;  2ZXW B;  2IH3 C;  4PI2 A;  2HKJ A;  4K4O A;  1JFF A;  4YKT A;  2AW9 A;  1ZLZ A;  1N0J A;  1JPX A;  2YI9 A;  1NKD A;  1Q6H A;  4CE3 A;  1PPJ H;  3RW0 A;  1D5A A;  2WLL A;  4QE9 A;  5IE9 A;  3RYC B;  1MU5 A;  4P7A A;  3O6O A;  1COW G;  1OJH A;  1EN5 A;  1QQC A;  2W6I G;  2Y0P A;  4I3H A;  2PYJ A;  1PM9 A;  2XJG A;  5M4K A;  5IYB O;  3B24 A;  4JV5 O;  3P32 A;  1Z5C A;  4JTD B;  1K7D A;  3ZHR A;  4RO2 A;  1KD1 W;  4I4T A;  3JAT B;  4E00 A;  2A0L A;  5CA0 B;  3IED A;  2JK5 C;  5F2V O;  2Y4T A;  4YJ2 B;  5GON B;  3RVZ A;  4J7Z A;  4IHJ B;  1CP9 A;  3A0Z A;  2B1G A;  2JEU A;  4UV8 A;  1XHX A;  3E8H A;  3VHD A;  1XOU A;  2CTP A;  4J42 A;  2RN9 A;  3RYF B;  3LPS A;  3OMU A;  3QO8 A;  2EZP A;  2QWN B;  2ZKJ A;  5EC2 C;  5EIB C;  1F4M A;  2EIM C;  2IBZ H;  3SYO A;  4CH4 A;  4YY3 B;  2R70 A;  3I5D A;  2CTQ A;  2CH7 B;  1SA0 A;  1FXH A;  2ADQ B;  4PDM A;  3ZMV A;  4MP7 A;  4XIR A;  4B3S B;  1EM1 A;  3WG7 C;  2XHX A;  4ABM A;  4ASU G;  4L90 A;  3VHA A;  4PDR A;  5CMU A;  1GO3 F;  4UXN A;  4FCP A;  1RPR A;  3ZXQ A;  3FB6 C;  5CB4 B;  1UYL A;  1XIL A;  3ETE A;  5KMG B;  5IYZ B;  4K8Z A;  1HP8 A;  2DMX A;  1YC4 A;  2ZBK B;  5KHG A;  4LNU B;  5IWA B;  1AMW A;  3BA8 A;  3H80 A;  1A4H A;  2C1I A;  3A0X A;  1T5E A;  4U3J A;  3MHH C;  4X65 B;  3U0Z A;  5LYJ A;  1EN6 A;  2CGF A;  1V9P A;  1XMQ B;  3T1K A;  3B8N A;  4BW9 A;  2YS8 A;  4BIU A;  1US6 A;  4QJF B;  4JI6 B;  4CH6 A;  2JDI G;  4DV1 O;  4GX5 A;  2QF6 A;  1NT2 B;  3O2F A;  2HJD A;  1N8R W;  4D6T H;  2WA3 A;  3FAV B;  1DF5 A;  1GN4 A;  1YT1 A;  1G8M A;  2A06 H;  4ZHQ A;  5CBH A;  1GJV A;  3Q5K A;  1HNX B;  1K3E A;  3D3Q A;  1Y4U A;  4X89 A;  3T0Z A;  5EBM C;  5A2Q N;  2Q68 A;  3IJ4 A;  1NHI A;  5LP6 C;  2ZE5 A;  1R6N A;  4TUY A;  2ZR2 A;  3VAD A;  3OTO B;  3RYI B;  4MPE A;  2BU6 A;  3OMI B;  5FPO A;  2IWX A;  2EJR A;  1VQ5 V;  2HP8 A;  4LFB O;  4WBN A;  4UCO A;  4B7E A;  4CE2 A;  1SQX H;  1X59 A;  3C11 A;  1UYF A;  4LH7 A;  4XKO A;  4CWS A;  4J9Z B;  2JGD B;  5B5E Z;  4BR6 A;  3I55 V;  1YIT V;  4WFF A;  3H4L A;  1RFY A;  3TGU H;  4EB6 A;  1I94 O;  3K9S A;  3ZKD A;  4XC0 A;  3L75 H;  4HYO A;  1YEW A;  5B1A C;  2EIM B;  3K06 A;  4YXW G;  4URO A;  1RPO A;  3TZ0 A;  3B4S A;  2F43 G;  5EZY A;  4W4K A;  4MPN A;  1UYI A;  4PRV A;  3GIG B;  4X1I A;  3HKC B;  3OWD A;  3H1J H;  5IYC O;  3E8B A;  3VQV A;  3WG7 B;  4TUY B;  4JYA B;  3JAW A;  1HNW B;  1FD9 A;  2IOQ A;  2AXT Z;  1QU7 A;  5B1N A;  2Q8H A;  1LUW A;  1W2B U;  4O2A B;  2ATK C;  2OTJ V;  1OCZ C;  2YKB A;  4NTW A;  4ZI7 A;  1KU9 A;  1UFI A;  1PP9 H;  1H2S B;  1I7F A;  3CCU V;  4R1F A;  3D36 A;  3ZKB A;  2UXB O;  1UYM A;  1BKN A;  3ZRW A;  3T0H A;  4GLX A;  1B04 A;  5KA5 A;  5M4M A;  4HXW A;  4CC6 A;  3U11 A;  4NYK A;  2ILM A;  3R92 A;  3N2G A;  2AKP A;  2AZ2 A;  3A0H Z;  1VF6 C;  1Y8P A;  1HR0 B;  1H8H G;  4YKR A;  2YED A;  2Y4U A;  1YVW A;  3ABM B;  1VQ7 V;  3DC5 A;  5J2U A;  4X1I B;  3FFQ A;  2BSK B;  3F7V C;  3HYZ A;  2X6B A;  2XDU A;  1MOF A;  2YXH A;  1VQ4 V;  3UT5 B;  1EN4 A;  4GT1 A;  4OX9 B;  1N32 O;  3JAW B;  3ZHS A;  2YEE A;  1HDJ A;  4EMV A;  4B08 A;  3HKE B;  1S0V A;  1BMF G;  1SZT A;  1P4R A;  4PL9 A;  1VQO V;  3J7A U;  2OCC C;  1KZN A;  1NHH A;  3RYH B;  1QLE C;  2IU0 A;  2QA4 V;  1TVK A;  4JI3 B;  2IH1 C;  5D6Q A;  1KKD A;  5LP6 B;  2WWW A;  4FLU A;  4OPA A;  3C0E A;  3G80 A;  3TUH A;  3N2G B;  1VQP V;  5AG2 A;  3ETG A;  3K57 A;  2PYL A;  4W4L A;  1JR9 A;  3CJH A;  2IOR A;  3U2D A;  2XHR A;  2UXX A;  2WI1 A;  2YEC A;  4BAY A;  5LL6 Y;  1IDS A;  1Y76 B;  2W0F C;  3LDD A;  5CTY A;  4XCL A;  2VQF O;  1GN3 A;  4JYC A;  1N33 O;  2NLJ C;  2FL4 A;  3ASO B;  1FJG O;  1Q43 A;  2DWE C;  1SS3 A;  1VF6 A;  3N2K B;  4X62 O;  5B1A B;  1YSR A;  1Y74 A;  4DV5 B;  4DXW A;  4TV8 B;  1S72 V;  3RLR A;  3FV5 A;  5BOC A;  1NTZ H;  4LFA B;  1TVK B;  3OR7 C;  1Q5O A;  2YEV A;  2IM9 A;  4E02 A;  3THO A;  2YKE A;  3QO7 A;  2AZ0 A;  1WPX A;  4LR3 A;  4JZG A;  1BQ0 A;  4XKA A;  2EIK C;  3CXH F;  2BU7 A;  3FKS G;  2GFD A;  4I50 B;  5J2T B;  1SES A;  3INX A;  5M4N A;  1OCZ B;  1ZL8 B;  5LBQ A;  1CXZ B;  3S5T A;  3T10 A;  4H0L B;  2QSA A;  4JI7 O;  2XOK G;  1NVP D;  1WJZ A;  3RFR A;  4FLW A;  2YXY A;  3QTF A;  3D8C A;  3K5O A;  2XDK A;  2EIJ C;  5EYP A;  2UU9 B;  4CWT A;  3R4P A;  4BXI A;  2QWO B;  1PD3 A;  1IBL O;  5LGU A;  4ZOL A;  1Q82 W;  4LF9 B;  4MTX A;  1H2N A;  4Z1V A;  5B3S C;  1AP5 A;  4V25 A;  3K0D A;  4B3T O;  2P7T C;  4GKJ B;  4O4H A;  5BY1 A;  1X4T A;  1HW7 A;  1IBM B;  4HNA A;  2YEV B;  1THN A;  2Q67 A;  4DR5 O;  3GIE A;  1FYJ A;  4O05 A;  2ZNI A;  1K92 A;  3C3T A;  3E2E A;  4DR7 O;  1ZTE A;  5IY5 C;  2F66 C;  2QJ1 A;  2C2A A;  3CCV V;  1KP3 A;  1H38 A;  3TZ4 A;  2DQ0 A;  2LFS A;  2OCC B;  2CCS A;  3ZMZ A;  4X9Q A;  1KEC A;  1QLE B;  3DXR B;  1AJQ A;  2H3O A;  4XCJ A;  2WLI A;  2XTA A;  1FAF A;  1KC8 W;  2ZDI C;  1G1X B;  3R65 A;  4H37 A;  5LMU B;  4ZOL B;  3GVM A;  1U97 A;  1D2D A;  2P90 A;  2O1V A;  3CCM V;  1K9M W;  2YIC A;  3PEH A;  1BQZ A;  3E22 B;  4O4H B;  4BQG A;  3R91 A;  2Z3Y A;  2XD6 A;  2VRZ A;  3CGZ A;  1BSM A;  4G2K A;  4K0K O;  3SJQ C;  4LF8 B;  1WPB A;  2P5O A;  3OWB A;  3VQX A;  2UUC B;  5BR8 B;  1E1R G;  5GTH Z;  2PNR A;  2FML A;  2ZR3 A;  1KB9 F;  4TT3 G;  4LWH A;  1PNK A;  3ML0 A;  2Y69 C;  2MW2 B;  2WI2 A;  4KHP B;  2CTW A;  4GZR B;  1J5E B;  1VF5 B;  2EIK B;  1GRJ A;  1BGQ A;  4WFB V;  2YK2 A;  4CWR A;  2Q9L A;  2YEA A;  2Q69 A;  1UYK A;  1K34 A;  3TXQ A;  2VCJ A;  4DO2 A;  1YJN V;  1B06 A;  3KKY A;  5EK0 A;  3VQW A;  4JQL A;  4LPB A;  3IC7 A;  3AK2 A;  2CGO A;  2Q7G A;  4QPK A;  1YIJ V;  2EIJ B;  5JJJ B;  1K5Q A;  4B3S O;  1EA6 A;  1YF2 A;  3Q4H A;  3ZBH A;  4UUJ C;  3R4M A;  2Z0A A;  4DV7 B;  3ZMT A;  1Z5B A;  5B3S B;  3FYE B;  1J95 A;  1QY8 A;  3BAB A;  4WFG A;  1NJI W;  4JI1 O;  2ZE7 A;  3IFX A;  3CC2 V;  3SYC A;  3EHB B;  4LWF A;  5BMV B;  2K5B A;  3U10 A;  3E35 A;  1AIL A;  5IY5 B;  4X1K B;  3L73 H;  1WN7 A;  4YKX A;  2CE4 A;  2YKC A;  2XJJ A;  1N4C A;  5L3D A;  3OMN B;  4O4I B;  4D7T A;  5M4P A;  3B8M A;  3P3N A;  5L3G A;  1M56 B;  4L94 A;  5JVD B;  4I9Q A;  1JMK C;  4JI6 O;  2Q8I A;  3ICX A;  5FND A;  4DR1 B;  3HKB A;  4EEH A;  4KXR A;  2N05 A;  4PA7 A;  3SYP A;  1YT2 A;  4PJ0 Z;  1SQQ H;  1BYQ A;  1H2M A;  1F4N A;  2B9Z A;  3EHH A;  2WLK A;  2CGN A;  4IL6 Z;  1SQV H;  4F6R A;  2PGG A;  1FKA O;  1HNX O;  1UPG A;  2ZT9 B;  3AG3 C;  1QHT A;  1UY9 A;  1SQG A;  4XKK A;  2XX4 A;  2IOP A;  3SYQ A;  3OTO O;  5F5R A;  4FFK A;  1IVS A;  5IJ0 B;  3IC9 A;  3R4N A;  1MAB G;  2YEI A;  3ETQ A;  2DYS B;  3OUS A;  2Y69 B;  2A9H A;  2WA4 A;  2VS0 A;  5A9G A;  3OPD A;  5JH7 A;  2GBO A;  2WI6 A;  2OCH A;  1GH6 A;  4NTX A;  3RLP A;  3STL C;  2QTS A;  1QR8 A;  4CC5 A;  2YE2 A;  2F93 B;  3RWR D;  1TIL A;  1VF7 A;  3JAR B;  2Q0A A;  3CMA V;  3B2E E;  2YE6 A;  4H33 A;  3L71 H;  3JD1 A;  1PVG A;  4TOI A;  3JAT A;  1GK9 A;  1N36 B;  2V4D A;  1BHB A;  1Z5V A;  5CA0 A;  4OXS A;  4LF6 O;  4N23 A;  1DLB A;  1YSZ A;  4PA3 A;  4JYA O;  5LXT B;  3W7T A;  3TZ5 A;  4PHZ A;  1Y8N A;  1JJO A;  4J10 A;  3E83 A;  1P49 A;  3VHC A;  2GHY A;  2IWU A;  3IGA C;  4YJ2 A;  5GON A;  1R3I C;  4IHJ A;  4JYY A;  2BU2 A;  1F51 A;  2YGA A;  5IJ9 B;  1RSO B;  1AH6 A;  1K5S A;  5EIB D;  5JH7 B;  2XAQ A;  1SKV A;  2LO1 A;  4I0X A;  5B66 Z;  4GFN A;  3RYF A;  4PDL A;  1K97 A;  4XIQ A;  4IYI A;  3SPC A;  5CTW A;  3T1Y B;  1SET A;  5ITZ B;  4DZY A;  2Q2E B;  2Q7E A;  4NXN B;  3J81 N;  2CH7 A;  3A0W A;  3ZN1 A;  4LWS B;  3ZMS A;  2CH4 A;  4OX9 O;  4H81 A;  4AHC A;  3LNM B;  5FWK A;  2LW1 A;  1YTF B;  1M4U A;  3BCC H;  2LGQ A;  3STZ C;  2UUA B;  2X6C A;  5HFL A;  2EXL A;  4ZBM A;  5DEC A;  5CB4 A;  5HFM A;  3EHG A;  5GTI Z;  4GKK B;  5J9P C;  5KMG A;  3M7M X;  1YZB A;  5LGT A;  4E01 A;  5IYZ A;  4FLX A;  4FVM A;  3AG3 B;  4I0X B;  4JI3 O;  4B3R B;  1NQT A;  5H5N A;  5GW7 A;  4LNU A;  1XRE A;  3UKM A;  3ZHT A;  4C7U A;  2OIE A;  5LOV B;  1YC3 A;  3DSQ A;  1G4Y B;  3BEH A;  4CS3 A;  3SJC C;  3HYY A;  2OYQ A;  2YI8 A;  3CCQ V;  5F3K A;  1BL8 A;  1JCH A;  1Q6U A;  3JAK B;  1R3J C;  1Y8O A;  1IX9 A;  4IT5 A;  2IU3 A;  2HHI A;  3ABL C;  4FLV A;  4DW0 A;  3OW6 A;  3K98 A;  2XAF A;  2FWZ A;  1MA1 A;  1F7Y A;  3BAA A;  1XL6 A;  4GX1 A;  3WFV A;  1THZ A;  4H44 B;  3FAV A;  4DR2 B;  4YIO A;  4J80 A;  2HG5 C;  1JQ0 A;  2BTO A;  3ZED A;  2GQP A;  1OHH G;  3L70 H;  4MVO A;  3S3X A;  4LFA O;  2Q73 A;  4EFB A;  4X20 B;  3AG4 C;  2YIA A;  4X1Y A;  4XDK A;  2E0A A;  4BW5 A;  5J6A A;  3CE2 A;  3RYI A;  3JAL B;  5JJE B;  4GT8 A;  4J9Y B;  3ABM C;  1VEW A;  4NXM O;  2FKX A;  3A0R A;  4JI4 B;  2NN4 A;  1R6K A;  3ASN C;  2ADP A;  1L0L H;  2LFR A;  5M4E A;  2YE3 A;  4JI5 B;  2JGD A;  4MTF A;  2UU9 O;  3HPL C;  4DV3 B;  2JEX A;  1H2K A;  1YXB A;  1I59 A;  2YI0 A;  3M99 B;  1KKC A;  1Y4M A;  3MD0 A;  1NH2 D;  4DV6 B;  1CEZ A;  1PNM A;  2YIB A;  4GKJ O;  4ICG A;  1YHQ V;  3SDL A;  3GIG A;  3LNU A;  3HKC A;  1YSC A;  1WB8 A;  1Z5W A;  4X1Y B;  4PA4 A;  1ZW9 A;  1XEQ A;  2AHY A;  4R3M A;  4Q20 A;  5LA6 B;  5C8Y B;  4O2A A;  3QF7 A;  3QO5 A;  4URL A;  4ZKI A;  3ZHV A;  2YC0 A;  3CRK A;  2QWR B;  2DYR C;  2VW5 A;  1ZUQ A;  5JEN A;  4B3M B;  2YEJ A;  3ASO C;  4DUY B;  3BY6 A;  5LMU O;  2ZCE A;  2UWD A;  4L91 A;  5L3B A;  4PDV A;  4JI2 B;  4DV0 B;  1S77 D;  1LR1 A;  1NS1 A;  4BAE A;  5L3E A;  4Z1M G;  1AJP A;  1NBM G;  5FNV B;  3ABL B;  2BSK A;  4DUH A;  4EGK A;  3B27 A;  2QFO A;  1IZ3 A;  3UT5 A;  3G75 A;  3HKD B;  4X64 B;  4LP0 A;  2FTK A;  1MSW D;  4IIJ B;  4O4J B;  5KHJ A;  4LF8 O;  3HKE A;  3IAY A;  1UY7 A;  5KUK A;  4DUZ B;  2Q8V A;  2W0X A;  5BR8 O;  2HR3 A;  4MP2 A;  2VWC A;  2UXD O;  2QKS A;  3RYH A;  2ZKO A;  3OAA G;  3JSL A;  2Y48 A;  4IYH A;  4JPR A;  3A2F A;  3AG4 B;  2XDX A;  4XDM A;  4XD8 A;  5LP6 A;  2Z5U A;  5CF0 A;  2XHT A;  2JGU A;  4FFB B;  3ZJZ A;  4FM0 A;  1S5J A;  2RQ6 A;  4R7C A;  2JRI A;  3ASN B;  1ARO P;  2BTQ B;  4UB8 Z;  4MT8 A;  5FNC A;  1GM7 A;  3JCZ A;  3AK1 A;  2KSD A;  2X7R B;  1Y76 A;  4YKW A;  3KCY A;  4BWA A;  2XAB A;  3BPZ A;  5LHH A;  1XNQ O;  2GUZ B;  5FLX N;  3OT7 A;  1FXK C;  3LUT B;  1DF4 A;  2EIN C;  2QGN A;  3N2K A;  4HY1 A;  5KA6 A;  2VWK A;  4DV7 O;  3SJA C;  4TV8 A;  2ZE8 A;  3CPW U;  4YKQ A;  4KQV A;  1EZJ A;  1FXV A;  3ZRV A;  1E1Q G;  4PI0 A; 
#chains in the Genus database with same CATH homology
 4URN A;  2YKJ A;  5B1O A;  2NNU A;  3W7W A;  4QPJ A;  2O1W A;  1Y66 A;  4H85 A;  3F7Y C;  1L1F A;  3QNE A;  3T2S A;  2YEB A;  3INW A;  2WSS G;  4MVZ A;  2DYR B;  2YI6 A;  2A79 B;  1VQ6 V;  1DTO A;  3JD3 A;  3CCL V;  4LP8 A;  5IDJ A;  1GKX A;  1S5H C;  4GEE A;  2XDL A;  1WLE A;  1OZ0 A;  4X88 A;  1YC1 A;  2JJ2 G;  4PU9 A;  4X8A A;  3D0B A;  4FCR A;  1B6Q A;  2WI3 A;  3SPH A;  2XJX A;  4MVU A;  5L3J A;  3LSQ A;  1AH8 A;  3ETD A;  3RVY A;  4FPP A;  2IW5 A;  1H7S A;  4KFG A;  4R8C A;  4EFU A;  4LCU C;  4XIP A;  5EBL C;  3RKZ A;  4CWF A;  3TTZ A;  4PA6 A;  5KUM A;  3HZ5 A;  4KSG A;  2O1U A;  2QM8 A;  2WLJ A;  2Q6A A;  4MW8 A;  4X9L A;  1FFT B;  4QNH B;  1QLN A;  4R3A A;  2ZDX A;  1ZWI C;  1FXK B;  4YKU A;  3EKR A;  2EIN B;  1U2O A;  4JAV A;  2H55 A;  2XK2 A;  1M56 C;  3EHF A;  1YJ9 V;  1KQS U;  2WEQ A;  3JD2 A;  2CG9 A;  2HVK C;  4KUM A;  2CCU A;  2OT5 A;  5H9C A;  4FJC C;  4KP4 A;  1AJ6 A;  3E86 A;  3FT5 A;  4TWK A;  1ORQ C;  4TSF G;  2PI4 A;  4P9O A;  4BQJ A;  4NH8 A;  4G28 B;  2DYS C;  1NR7 A;  3DTU B;  2BU5 A;  1OCR C;  3FB5 C;  1H7U A;  3OM3 B;  1OCO C;  2X6A A;  1JM6 A;  1F23 A;  2YI7 A;  1GKF A;  4HXZ A;  1AI6 A;  2ZDI A;  5D7R A;  5CTX A;  4JAU A;  3I56 V;  2YGE A;  4O04 A;  1I5B A;  1SRY A;  1ZXN A;  4O09 A;  2JJC A;  2XDS A;  3VOU A;  4I9W A;  1K33 A;  4W7T A;  1H2G A;  1Q81 W;  4EKW A;  4G27 B;  1TUE B;  3AG2 C;  1UYG A;  2YJX A;  1JJ2 U;  1AI7 A;  3VBB A;  4H7Q A;  4JGS A;  2BU8 A;  3OW2 U;  4EGI A;  4P2Z A;  2XCM A;  2BSM A;  1B3Q A;  2YE5 A;  2IWS A;  3SPG A;  3K04 A;  2QG2 A;  4XDJ A;  1PL0 A;  5EC1 C;  4HYP A;  3OFN G;  4R50 A;  4QE7 A;  1NVP B;  2BZ5 A;  5LGN A;  3TZ2 A;  1QR9 A;  3EHJ A;  4XE2 A;  4L87 A;  3MNR P;  1U0Z A;  2WI5 A;  3E8G A;  3T2M A;  1PKX A;  1AR1 B;  2ZDY A;  4LWI A;  1Q7Y W;  1H8E G;  2YGF A;  3R4O A;  2YEH A;  1OCR B;  3ZMU A;  1EI1 A;  2YI5 A;  3W7S A;  1OCO B;  5L3C A;  3D3I A;  2BYH A;  1CPY A;  1VQ8 V;  2IJI A;  3K79 A;  3OR6 C;  3U2K A;  2YSU B;  2WLH A;  4LWE A;  4XBF A;  4U7O A;  3JYC A;  1YER A;  3ZRS A;  2EZO A;  2YE4 A;  1TH8 A;  4WUC A;  1V55 C;  4GGL A;  3SPJ A;  3D2R A;  3A0Y A;  4JF3 A;  4QIW F;  4FK5 C;  1ZXM A;  3NMQ A;  1M9N A;  3SL2 A;  1UYE A;  3AG2 B;  4CWO A;  1GM8 A;  2MK3 A;  2ZD9 A;  4GX0 A;  2QG0 A;  2HJF C;  4URM A;  2IJH A;  3T4D A;  4PA9 A;  3T4Z A;  3KE6 A;  1W0J G;  2M7W A;  3B28 A;  1I5Y A;  2YE8 A;  4MTO A;  4NH7 A;  2BOC C;  2DQ3 A;  2OTL V;  2WLN A;  1JOY A;  2BRC A;  4RAI A;  1GKZ A;  2P67 A;  2R9I A;  2BT0 A;  3HEK A;  3CC4 V;  3RBZ A;  1I5A A;  4JAS A;  3K08 A;  4FMT A;  2UXN A;  3CGY A;  4HY6 A;  4UVA A;  4HZ5 A;  4HYM A;  4HZ3 A;  2XX5 A;  3ABK C;  1V54 C;  2K1E A;  2WLL B;  3G71 V;  1QVF U;  2QM7 A;  1UY8 A;  2HKO A;  4CWN A;  1RM1 C;  3TK1 A;  4O0B A;  2H8M A;  4GX2 A;  2ESA A;  2R9R B;  4YKY A;  2YEF A;  2HFE C;  3QDD A;  3T1C A;  2D3O W;  1K4D C;  4MB9 A;  4MBC A;  1TBW A;  4B6C A;  5J71 A;  4WUB A;  3K0G A;  4RQE A;  4AWO A;  3RLQ A;  4MTG A;  1HWY A;  4I5S A;  1US7 A;  1V55 B;  5CN0 A;  4MSW C;  1B62 A;  4WFA V;  1S14 A;  1M90 W;  1R73 A;  4AS9 A;  1QVG U;  1R3L C;  2WPD G;  1M1K W;  3KG2 A;  2DWD C;  2XX2 A;  1YES A;  5M4H A;  1SER A;  4P30 A;  5LHG A;  3HB3 B;  1YJW V;  3E89 A;  3ZCC A;  5IYD O;  4XIT A;  1I58 A;  3CD6 V;  3CCR V;  5BOD A;  1Z59 A;  1AM1 A;  4AWQ A;  3G7B A;  4CBC A;  3OUF A;  1NR1 A;  3ABT A;  4WCE V;  3CRL A;  2FXS A;  3K99 A;  1NHJ A;  3PEJ A;  3ABK B;  1V54 B;  3JD0 A;  1B63 A;  4MS2 A;  2W6J G;  3BM9 A;  1VQM V;  3FB8 C;  2WI4 A;  1RM1 B;  3LDC A;  3W7X A;  3ZM7 A;  1Y4S A;  4HAM A;  1VQ9 V;  1E79 G;  2BRE A;  5CBG A;  4P9P A;  4ASG A;  2QEX V;  1I5D A;  2YKI A;  3LDE A;  5DM6 V;  3G4S V;  3CCJ V;  3TET A;  2ZQM A;  3H01 A;  4P8O A;  4PEL A;  1ID0 A;  3BMY A;  2WLM A;  4MVS A;  1I5X A;  3GB7 C;  1TID A;  1MX0 A;  2AHZ A;  3OEH G;  1M57 C;  1GTO A;  1YS3 A;  2HLD G;  5CBF A;  2BTZ A;  5FL7 G;  5H6R A;  1VQL V;  3AG1 C;  4MPC A;  5CA3 A;  3B26 A;  4L8Z A;  3OEE G;  3B77 A;  2YE9 A;  3PJS K;  1TC6 A;  5E1A C;  5D7C A;  3TCU A;  3K3W A;  4FCQ A;  4L93 A;  4WF9 V;  3K97 A;  4LC1 A;  3ZRW B;  4GCZ A;  1KIJ A;  2XAJ A;  4NH9 A;  5H6Q A;  3JD4 A;  1UY6 A;  3A0T A;  5GGZ A;  1S76 D;  1ZWH A;  4E2L A;  1QYE A;  2KB1 A;  3CP1 A;  1XL4 A;  1BHA A;  2YE7 A;  2QTO A;  2BYI A;  4BIZ A;  1YET A;  3G6E V;  1GMG A;  5EBW C;  2WER A;  1S3J A;  4R6Z A;  3OGC C;  3GWO A;  3F5W C;  3FYI B;  1FXK A;  2HVJ C;  4V26 A;  1I5C A;  1L0O A;  5IN9 A;  4LWG A;  1Z5A A;  5D6P A;  4RUE A;  3EKO A;  2B5U A;  4O07 A;  4CWP A;  3K60 A;  3Q5L A;  1K4C C;  1NH2 B;  2ITD C;  3CME V;  2P6J A;  1OSF A;  5CPH A;  2Q8G A;  3K03 A;  4U93 A;  2VCI A;  3ZN0 A;  1FS0 G;  4WUD A;  1IXM A;  4ASB A;  1OCC C;  4XTJ A;  2CK3 G;  4CWQ A;  3ZIA G;  1AI4 A;  3AEI A;  1M57 B;  3FB7 C;  4HZ0 A;  4JYB A;  2YJW A;  4CE1 A;  3AG1 B;  1UYC A;  4YKZ A;  2XND G;  3WHA A;  2ITC C;  1AI5 A;  1EFR G;  3CCE V;  2QE7 G;  4JTA B;  1QCE A;  2GSM B;  1K8A W;  3U67 A;  2CCT A;  2IJJ A;  3ABU A;  3NXS A;  1KP2 A;  2H8P C;  4RUF A;  3CWV A;  2Q8F A;  1UYH A;  3EFF K;  3X2Q C;  4KSH A;  2YK9 A;  1P7B A;  1YT0 A;  1JX9 A;  3DGE A;  4ASF A;  2FYP A;  4WFE A;  2WEP A;  2PI5 A;  2HCH A;  1PNL A;  2YEG A;  2LP7 A;  4N21 A;  3CCS V;  1YTF D;  5L3F A;  2WLI B;  3CC7 V;  4UVB A;  3B25 A;  1ENV A;  5B1B C;  5BZB A;  5LHI A;  2JKI A;  4UV9 A;  2BOB C;  4EFT A;  2X0L A;  4B7P A;  2EIL C;  1GM9 A;  4LBE C;  2DW4 A;  3Q5J A;  5IDM A;  2WI7 A;  1VQN V;  4MOT A;  1BXD A;  1OCC B;  2ZXW C;  4KFM A;  1JVM A;  4FIP C;  2B1I A;  1VQK V;  3LSS A;  3SPI A;  4U7N A;  3E8F A;  4AWP A;  3K9A A;  2HG1 A;  1S16 A;  3MHS C;  4MW3 A;  3CXC U;  2XAG A;  1Q86 W;  3W7U A;  1W0K G;  2WAM A;  1LNQ A;  5D7D A;  2H94 A;  3GIF A;  2IJK A;  3ZRX A;  1QBZ A;  4F4L A;  3CYO A;  4MVR A;  4JTC B;  1QZR A;  3X2Q B;  4ZVI A;  5FNF A;  4EM7 A;  3G7E A;  4UVC A;  2XAS A;  1UYD A;  4EGH A;  2XAH A;  5C93 A;  2JIZ G;  1MG1 A;  4PRX A;  3O0I A;  1ROP A;  3FT8 A;  2EBO A;  1TC0 A;  3WQ9 A;  1YI2 V;  3SYA A;  1K73 W;  3ZXO A;  4RQF A;  3OE7 G;  3UM7 A;  4ASA A;  4KTN A;  2JJ1 G;  5CTU A;  1UJW B;  4GQT A;  3P30 A;  3JZ3 A;  1R3K C;  4XDL A;  4CZZ A;  2V7Q G;  5DN6 G;  3OMA B;  1AJN A;  1EBO A;  5B1B B;  1R62 A;  2EIL B;  2V1D A;  4MVM A;  4WFH A;  4MVQ A;  3HZ1 A;  2FWY A;  3HHU A;  2ZXW B;  2IH3 C;  2HKJ A;  4K4O A;  4YKT A;  1JPX A;  1NKD A;  4CE3 A;  3RW0 A;  2WLL A;  4QE9 A;  1MU5 A;  4P7A A;  3O6O A;  1COW G;  2W6I G;  4I3H A;  2XJG A;  5M4K A;  5IYB O;  3B24 A;  3P32 A;  1Z5C A;  4JTD B;  1K7D A;  4RO2 A;  1KD1 W;  4E00 A;  2A0L A;  3IED A;  2JK5 C;  3RVZ A;  1CP9 A;  3A0Z A;  2B1G A;  2JEU A;  4UV8 A;  3E8H A;  3VHD A;  3LPS A;  3OMU A;  3QO8 A;  2EZP A;  2ZKJ A;  5EC2 C;  1F4M A;  2EIM C;  3SYO A;  1FXH A;  4PDM A;  3ZMV A;  4MP7 A;  4XIR A;  3WG7 C;  2XHX A;  4ASU G;  4L90 A;  3VHA A;  4PDR A;  5CMU A;  1GO3 F;  4UXN A;  4FCP A;  1RPR A;  3ZXQ A;  3FB6 C;  1UYL A;  3ETE A;  1YC4 A;  2ZBK B;  1AMW A;  3H80 A;  1A4H A;  3A0X A;  3MHH C;  2CGF A;  3T1K A;  3B8N A;  4QJF B;  4BIU A;  2JDI G;  4GX5 A;  2QF6 A;  3O2F A;  1N8R W;  1DF5 A;  1YT1 A;  1G8M A;  5CBH A;  1GJV A;  3Q5K A;  1K3E A;  1Y4U A;  4X89 A;  3T0Z A;  5EBM C;  2Q68 A;  1NHI A;  1R6N A;  2ZR2 A;  3VAD A;  4MPE A;  2BU6 A;  3OMI B;  2IWX A;  2EJR A;  1VQ5 V;  4CE2 A;  3C11 A;  1UYF A;  4XKO A;  4CWS A;  4J9Z B;  3I55 V;  1YIT V;  4WFF A;  3H4L A;  3ZKD A;  4XC0 A;  4HYO A;  5B1A C;  2EIM B;  3K06 A;  4YXW G;  4URO A;  1RPO A;  3TZ0 A;  2F43 G;  4MPN A;  1UYI A;  4PRV A;  3GIG B;  3OWD A;  5IYC O;  3E8B A;  3WG7 B;  2IOQ A;  5B1N A;  2Q8H A;  1W2B U;  2ATK C;  2OTJ V;  1OCZ C;  2YKB A;  3CCU V;  4R1F A;  3D36 A;  3ZKB A;  1UYM A;  1BKN A;  3ZRW A;  3T0H A;  5KA5 A;  5M4M A;  4HXW A;  3R92 A;  2AKP A;  1Y8P A;  1H8H G;  4YKR A;  2YED A;  3ABM B;  1VQ7 V;  3F7V C;  3HYZ A;  2X6B A;  2XDU A;  1MOF A;  1VQ4 V;  4GT1 A;  2YEE A;  4EMV A;  1S0V A;  1BMF G;  1SZT A;  1P4R A;  4PL9 A;  1VQO V;  2OCC C;  1KZN A;  1NHH A;  1QLE C;  2IU0 A;  2QA4 V;  2IH1 C;  5D6Q A;  1KKD A;  2WWW A;  3C0E A;  3TUH A;  1VQP V;  3ETG A;  2IOR A;  3U2D A;  2XHR A;  2UXX A;  2WI1 A;  2YEC A;  4BAY A;  2W0F C;  3LDD A;  5CTY A;  4XCL A;  4JYC A;  2NLJ C;  3ASO B;  2DWE C;  5B1A B;  1YSR A;  4DXW A;  1S72 V;  3RLR A;  3FV5 A;  5BOC A;  3OR7 C;  2YEV A;  4E02 A;  2YKE A;  3QO7 A;  1WPX A;  4XKA A;  2EIK C;  2BU7 A;  3FKS G;  2GFD A;  1SES A;  3INX A;  5M4N A;  1OCZ B;  5LBQ A;  3T10 A;  2XOK G;  1NVP D;  3QTF A;  2XDK A;  2EIJ C;  4CWT A;  3R4P A;  4BXI A;  1PD3 A;  5LGU A;  1Q82 W;  4MTX A;  5B3S C;  4V25 A;  3K0D A;  2P7T C;  2YEV B;  1THN A;  2Q67 A;  3GIE A;  4O05 A;  1K92 A;  3E2E A;  5IY5 C;  2C2A A;  3CCV V;  1KP3 A;  1H38 A;  3TZ4 A;  2DQ0 A;  2LFS A;  2OCC B;  2CCS A;  3ZMZ A;  1KEC A;  1QLE B;  1AJQ A;  4XCJ A;  2WLI A;  1KC8 W;  2ZDI C;  3R65 A;  4H37 A;  2P90 A;  2O1V A;  3CCM V;  1K9M W;  3PEH A;  4BQG A;  3R91 A;  2Z3Y A;  2XD6 A;  3CGZ A;  4G2K A;  3SJQ C;  3OWB A;  1E1R G;  2PNR A;  2ZR3 A;  4TT3 G;  4LWH A;  1PNK A;  3ML0 A;  2Y69 C;  2WI2 A;  2EIK B;  1BGQ A;  4WFB V;  2YK2 A;  4CWR A;  2YEA A;  2Q69 A;  1UYK A;  1K34 A;  2VCJ A;  4DO2 A;  1YJN V;  5EK0 A;  4JQL A;  4LPB A;  3IC7 A;  4QPK A;  1YIJ V;  2EIJ B;  1K5Q A;  1EA6 A;  4UUJ C;  3R4M A;  3ZMT A;  1Z5B A;  5B3S B;  3FYE B;  1J95 A;  1QY8 A;  4WFG A;  1NJI W;  3IFX A;  3CC2 V;  3SYC A;  3EHB B;  4LWF A;  2K5B A;  3E35 A;  5IY5 B;  4YKX A;  2YKC A;  2XJJ A;  5L3D A;  3OMN B;  5M4P A;  3B8M A;  5L3G A;  1M56 B;  4L94 A;  2Q8I A;  5FND A;  4EEH A;  4PA7 A;  3SYP A;  1YT2 A;  1BYQ A;  1F4N A;  3EHH A;  2WLK A;  3AG3 C;  1UY9 A;  4XKK A;  2XX4 A;  2IOP A;  3SYQ A;  5F5R A;  3R4N A;  1MAB G;  2YEI A;  2DYS B;  3OUS A;  2Y69 B;  2A9H A;  3OPD A;  2WI6 A;  3RLP A;  3STL C;  1QR8 A;  2YE2 A;  1TIL A;  3CMA V;  2YE6 A;  4H33 A;  3JD1 A;  1PVG A;  1GK9 A;  1BHB A;  4OXS A;  4N23 A;  1DLB A;  1YSZ A;  4PA3 A;  3W7T A;  3TZ5 A;  1Y8N A;  3E83 A;  3VHC A;  2GHY A;  2IWU A;  3IGA C;  1R3I C;  2BU2 A;  1F51 A;  2YGA A;  1AH6 A;  1K5S A;  2XAQ A;  4GFN A;  4PDL A;  1K97 A;  4XIQ A;  3SPC A;  5CTW A;  1SET A;  4DZY A;  2Q2E B;  3A0W A;  3ZN1 A;  3ZMS A;  2CH4 A;  4H81 A;  3LNM B;  5FWK A;  1YTF B;  3STZ C;  2X6C A;  5HFL A;  2EXL A;  4ZBM A;  5HFM A;  3EHG A;  5J9P C;  5LGT A;  4E01 A;  3AG3 B;  1NQT A;  5GW7 A;  3UKM A;  1YC3 A;  1G4Y B;  3BEH A;  3HYY A;  3CCQ V;  5F3K A;  1BL8 A;  1JCH A;  1R3J C;  1Y8O A;  2IU3 A;  3ABL C;  3OW6 A;  3K98 A;  2XAF A;  2FWZ A;  4GX1 A;  1XL6 A;  3WFV A;  1THZ A;  2HG5 C;  1JQ0 A;  2GQP A;  1OHH G;  4MVO A;  3AG4 C;  4XDK A;  2E0A A;  4BW5 A;  5J6A A;  4GT8 A;  4J9Y B;  3ABM C;  3A0R A;  1R6K A;  3ASN C;  2LFR A;  5M4E A;  2YE3 A;  4MTF A;  3HPL C;  2JEX A;  1I59 A;  2YI0 A;  3M99 B;  1Y4M A;  3MD0 A;  1NH2 D;  1CEZ A;  1PNM A;  1YHQ V;  3GIG A;  3LNU A;  1YSC A;  4PA4 A;  1ZW9 A;  2AHY A;  4R3M A;  4Q20 A;  3QO5 A;  4URL A;  4ZKI A;  3CRK A;  2DYR C;  2VW5 A;  2YEJ A;  3ASO C;  3BY6 A;  2UWD A;  4L91 A;  5L3B A;  4PDV A;  1S77 D;  4BAE A;  5L3E A;  4Z1M G;  1AJP A;  1NBM G;  3ABL B;  4DUH A;  4EGK A;  3B27 A;  2QFO A;  3G75 A;  4LP0 A;  2FTK A;  1MSW D;  1UY7 A;  5KUK A;  2HR3 A;  4MP2 A;  2VWC A;  2QKS A;  3OAA G;  2Y48 A;  4JPR A;  3AG4 B;  2XDX A;  4XDM A;  4XD8 A;  2Z5U A;  5CF0 A;  2XHT A;  3ZJZ A;  4R7C A;  3ASN B;  1ARO P;  4MT8 A;  5FNC A;  1GM7 A;  3JCZ A;  2X7R B;  4YKW A;  2XAB A;  5LHH A;  1FXK C;  3LUT B;  1DF4 A;  2EIN C;  4HY1 A;  5KA6 A;  3CPW U;  4YKQ A;  4KQV A;  1EZJ A;  1FXV A;  3ZRV A;  1E1Q G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...