4U7NA

Inactive structure of histidine kinase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
225
structure length
211
Chain Sequence
VSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Transferase
molecule keywords Histidine protein kinase sensor protein
total genus 69
structure length 211
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4u7nA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4u7nA02
1GKZA 2YGFA 2HKJA 2XDLA 1Y8PA 2XX5A 4DUHA 4HXZA 1EI1A 2O1UA 4QPKA 2WWWA 1Y8OA 2CCSA 3R4PA 2YI7A 2YECA 1NHIA 1IXMA 2YI0A 2GFDA 4PL9A 2IOPA 1Z5BA 1I58A 1S16A 2WI7A 2IWXA 4PRVA 2YKCA 4L90A 4XDMA 2YGEA 3ZRVA 5J6AA 3EHHA 1I5DA 4MOTA 1H7UA 2BRCA 3A0ZA 3EHJA 3R92A 4MP7A 3INXA 5M4KA 4LWHA 2FWYA 1UY9A 3MD0A 4XIPA 3TZ5A 1KZNA 1YC1A 1JOYA 3EKOA 4LC1A 3ZXQA 2QM8A 1UY8A 4GGLA 4V26A 2YK2A 3RLQA 5M4MA 4CWRA 3A0XA 4H7QA 3RLPA 3H80A 3CRLA 1MU5A 4CWPA 1TILA 4V25A 3T10A 4KTNA 3A0RA 4EMVA 1ZXMA 1H7SA 1UYGA 2P67A 2YGAA 4URNA 1YT2A 3B25A 3FV5A 2YE8A 4E02A 4BAEA 2BU6A 3P32A 4YKTA 4CE2A 2Q8FA 1BGQA 1L0OA 2ZKJA 4EGHA 4EEHA 2H55A 4I3HA 2YEGA 2XD6A 4GQTA 4KSHA 1UYLA 4JAUA 3OW6A 4LWFA 1UYIA 2FYPA 2XABA 1YSZA 2VW5A 2VWCA 4K4OA 3G7EA 3U67A 2YKIA 1TBWA 4XIRA 1MX0A 4L93A 2YEIA 4KQVA 1GKXA 2O1WA 2WEQA 2BT0A 3Q5LA 1TC6A 4HY1A 3IEDA 5D7CA 3EHGA 3DGEA 3G75A 4URLA 3H4LA 4MPCA 1I5CA 4O0BA 4YKXA 4JYBA 1AJ6A 3LPSA 3R4OA 4ZVIA 4B6CA 4BQJA 4U7NA 1ID0A 2XHXA 1KIJA 4QPJA 4O05A 4MP2A 3FT5A 4JQLA 4XITA 5CTXA 4XKAA 1UYKA 3BMYA 4W7TA 3QDDA 1Z5CA 2BSMA 1TC0A 1ZXNA 5IN9A 3K98A 3VHAA 4WUBA 2BYHA 5FNFA 2WI6A 1JM6A 4YKRA 1QYEA 4XD8A 3HYZA 4HYMA 4ASAA 4MB9A 4MPNA 2YEHA 2YJXA 3A0WA 2ZDXA 4XIQA 4XCLA 1UYCA 4X9LA 2BYIA 1YESA 3K97A 4P7AA 3O0IA 2XDSA 2YK9A 1YT0A 3HYYA 3OWDA 4JASA 4YKZA 3B26A 3HEKA 2CGFA 1U0ZA 3TUHA 4XKKA 3TZ0A 4JAVA 4FCQA 2YEEA 1PVGA 1YT1A 3VHCA 5M4PA 3C0EA 4LP0A 1YC3A 4R3MA 3U2DA 1AMWA 2FXSA 1R62A 1I5BA 3HHUA 2AKPA 3WQ9A 3PEJA 4ASBA 5CTYA 3T0HA 2XDKA 1I59A 1B62A 4WUDA 2YEFA 1YERA 2QFOA 2XK2A 2YJWA 2ZDYA 1BYQA 4DZYA 4YKUA 5F5RA 5B1NA 5L3JA 4MBCA 2BZ5A 1B63A 3GIGA 4BIZA 3B24A 3GIFA 2YKBA 2ESAA 2CCUA 3ZKBA 4R1FA 3SL2A 2BREA 2XX2A 2XJXA 2YE9A 3O6OA 1QZRA 3ZCCA 3GIGB 2WI2A 1ZWHA 4HZ5A 4AS9A 1NHHA 5GGZA 4FCPA 2YEDA 4XE2A 2WERA 5C93A 3OPDA 1QY8A 2YKEA 4O09A 2Q8GA 4PU9A 1BXDA 4EM7A 3LNUA 4EGKA 2VCJA 3D2RA 2CG9A 3INWA 4KP4A 1Y4UA 3K99A 4I5SA 2YE3A 2QG0A 4WUCA 1NHJA 4GT8A 3R4MA 3OWBA 4LWGA 1UYMA 4CWTA 4XTJA 2Q2EB 5D7DA 3A0YA 1UYFA 5F3KA 3ZRXA 2WI1A 4CWNA 4CWQA 5M4NA 3TK1A 4NH9A 5J71A 4FCRA 1US7A 3R91A 5FWKA 2VCIA 4AWOA 5M4HA 4GEEA 1F51A 3HZ5A 3D0BA 2QM7A 4CWFA 4H81A 4URMA 2YEJA 5BOCA 3KE6A 2E0AA 1Y4SA 4XCJA 2JKIA 1I5AA 4R3AA 3U2KA 4BXIA 2XHTA 3CGZA 1YETA 3B28A 3MNRP 1AH6A 4CWSA 3CGYA 2YE5A 2XJJA 2QG2A 3WHAA 2HCHA 2YE6A 2H8MA 5CF0A 4BQGA 2IOQA 3ZM7A 1UYEA 3VADA 4LWIA 5IDMA 4AWPA 1AM1A 3C11A 5BODA 2YEBA 4XC0A 1Y8NA 3RKZA 3T1KA 2XDUA 2YEAA 4MT8A 4P8OA 2XX4A 2LFRA 2BTZA 4O07A 4BIUA 4CWOA 2FWZA 2K5BA 4YKWA 1YS3A 2YKJA 5B1OA 2BU7A 4LPBA 2FTKA 3JZ3A 3O2FA 2WI3A 3QTFA 3K60A 1TIDA 2BU5A 4YKQA 4HZ0A 2IORA 3T0ZA 4L91A 1EA6A 3D36A 2XCMA 2WEPA 4L94A 4JYCA 5FNCA 1YC4A 4KFGA 2XHRA 2IWUA 2UWDA 4YKYA 3G7BA 4O04A 1B3QA 4GFNA 4HYPA 3NXSA 5M4EA 2BU8A 1OSFA 3CWVA 2GQPA 3VHDA 2BU2A 2YE4A 3ZKDA 2LFSA 1BKNA 3OMUA 4HY6A 2HG1A 3TZ2A 4NH7A 3Q5KA 5IDJA 3Q5JA 3NMQA 4Q20A 2PNRA 4H85A 1UYDA 3CRKA 3TTZA 4XKOA 2O1VA 3EHFA 4ASFA 2QF6A 5D6PA 4B7PA 1YSRA 2CH4A 4NH8A 1S14A 2IWSA 3ZXOA 5FNDA 1U2OA 4ASGA 1THNA 4UROA 4GCZA 2YE7A 3A0TA 1UYHA 1UY7A 2XJGA 4E00A 4U7OA 4KSGA 4FMTA 1GJVA 2WI5A 4E01A 1Z59A 3GIEA 4CE3A 4AWQA 3FT8A 2WI4A 4ZKIA 2CCTA 4CE1A 5CPHA 4HXWA 5D7RA 3ZRWA 2YI6A 3BM9A 1AH8A 1A4HA 1UY6A 2JJCA 3PEHA 2YE2A 2EXLA 5CTWA 5CTUA 4EGIA 3T2SA 2Q8IA 5D6QA 1TH8A 4EFTA 4MTXA 4FPPA 2C2AA 2Q8HA 4EFUA 3EKRA 4MPEA 4GT1A 3RLRA 3ZRWB 2YI5A 3R4NA 4LWEA 4U93A 4L8ZA 2ZBKB 3HZ1A 1Z5AA 1ZW9A 3B27A 3TZ4A 2XDXA 4PRXA
chains in the Genus database with same CATH superfamily
4D6TH 5LHGA 2HKJA 4JI7B 2XDLA 5JH7A 1B06A 4DUHA 4HXZA 4BR6A 2VS0A 1G8MA 3TJTA 1KMIZ 1ZL8A 1BSMA 2WWWA 5JJNB 2ZXWC 1NHIA 4P9OA 4PA4A 2YI0A 1QHTA 4RUEA 1EBOA 3FB8C 1SC5B 2GFDA 4LFBO 4PL9A 2A06H 2EINC 4J9ZB 2Q0OC 4DW0A 1HNWB 3CCJV 3ETEA 4PRVA 3B40A 5LMUO 2A79B 5EBWC 5KHGA 1ZSPA 3EFFK 2DQ0A 1IBMO 4UUJC 3JYCA 3D36C 2BTOA 1K9MW 4DV6O 2M6YA 2UXNA 4XDJA 4PI0A 4XIPA 2DQ3A 4X9QA 3TZ5A 2CH7B 2QM4A 3A0HZ 1JOYA 3EKOA 3ZXQA 2EIJC 4GGLA 1TUBA 3T2MA 3H1KH 4IYHA 3RLQA 4H7QA 4FZ1A 1V54C 4O2AB 3CRLA 2CTPA 4CWPA 1THZA 5B5EZ 5EIBC 2LJ2A 3S3WA 2P6JA 1RM1C 1WPXA 3B25A 3BFRA 3THOA 3MAQA 3RVYA 4YKTA 2RCVA 1BGQA 4JI6B 3ZIAG 3K9AA 2ZKJA 5IYZB 4I3HA 2YEGA 1OCOB 2XD6A 4GQTA 2E75B 4KSHA 1Y76A 2CTQA 4JAUA 2Y48A 4NXNB 2PUSA 4LFAB 2PZSA 1QU7A 1M5IA 4GKKO 1AR5A 3G7EA 1NQTA 1QNMA 4DR1O 2UUCO 1MX0A 4P9PA 3JSNA 4DV0B 1LUVA 4DO2A 3ABTA 2KG7A 4DR4B 1TC6A 1K34A 1UJWB 1Q90D 3UT5A 3ML0A 4F4LA 1IX9A 1M57B 1XI1A 4DR6O 1I7FA 4JV5B 1I5CA 1VQKV 3RW0A 5KHJA 4YKXA 1SQPH 1AJ6A 3LPSA 3R4OA 4BQJA 2FYUH 4U7NA 4OXSA 3TXSA 4ZHQA 5LP6B 1S5LZ 4O2BA 2XHXA 2W0FC 1H8HG 4QPJA 4WBNA 4O05A 3FT5A 3CHXA 3L70H 1GRJA 2K1EA 2P7TC 1UYKA 3BMYA 1MOFA 1Z5CA 4AQYO 1I5XA 4OX9B 5IN9A 4E72A 3K98A 4LF7B 2ZNJA 4U3JA 2BYHA 2FMLA 2XAGA 1JQ0A 3OD4A 1G4YB 1GH6A 3OM3B 2P4VA 4DR2O 1QYEA 4NXMB 4WFGA 3LMMA 2QA4V 4DR5B 4R8CA 4MPNA 2ITCC 2YEHA 5JCOC 3A0WA 2ZDXA 1SQXH 1UYCA 2AHZA 3JAKB 4FZ0A 4J11A 4P7AA 3BHPA 3B09A 1HDJA 4MVRA 4ZBMA 2XDSA 4YKZA 3B26A 3LSQA 1NBMG 1I94B 4ZHQB 5FPRA 2ARHA 1EN4A 4PJ0Z 2YEVB 2YEEA 4K8XA 3VBBA 3G6BA 2WA4A 1VQ7V 2AXTZ 3VHCA 1Q6UA 5M4PA 1SQVH 4QE9A 1DF4A 5LHIA 4HNAB 1I5BA 1E79G 1PV0A 2CK3G 3AK3A 3GVMA 4MVOA 3WQ9A 3OUFA 1BMFG 1CP9A 1Y4MA 3A2FA 1XMQO 1SA0B 3JARA 3M7MX 4WFHA 1AI5A 2YJWA 2GTSA 2ZDYA 2R9AA 2XT9A 4JI4O 4O4JA 1P84F 5F5RA 3LUTB 4GX1A 3WG7C 5IY5B 1MSDA 4F6RB 2NNUA 1JA8A 2YKBA 3CRRA 2ESAA 1YTFB 2Q67A 1JPXA 2RN9A 4E2LA 5CB4B 3SL2A 3PN1A 4W4KA 4AI8A 2P90A 2XJXA 2YE9A 1QZRA 1RPOA 3C90A 1PD3A 4UCTA 3CXCU 5LXTB 2EINB 5TISZ 2WERA 3FFQA 2EIKB 1AI6A 2GUZA 3CWBH 4Z1VA 2E76B 2B9ZA 3JD1A 1GKFA 2ZD9A 2ODMA 1H8EG 3RYHB 5CBFA 2BOCC 4LF9B 3HKDA 1YVWA 4KP4A 1M57C 1FFXA 3G67A 1X59A 4X66O 1NVPD 4QNHB 3K99A 2YE3A 1I5YA 3BA8A 2LW1A 3QO8A 1GN6A 2Q2EB 1VF6A 3HKBA 3A0YA 1UYFA 5LGUA 2XAFA 5BR8B 3CMAV 1P7BA 5M4NA 1UPGA 1IURA 3L74H 4TT3G 4NH9A 1H2LA 1PM9A 4FCRA 2P4KA 3AEIA 3RYFA 5FWKA 4JI8O 2VCIA 4AWOA 3CP1A 3BY6A 4LF4B 1KU9A 4LF6B 3D0BA 2CAZC 2QM7A 4MVUA 4CWFA 1GTOA 1G6UA 1US6A 5BOCA 1Y4SA 1SESA 5L3EA 4XCJA 2W0XA 3NR7A 5B3SB 1XMOB 1YETA 3B28A 1AH6A 2Q73A 3CGYA 2NR5A 1PL4A 1CEZA 3AG3B 1S72V 4YJ2B 4DV1B 2HCHA 3A0BZ 5LMNB 1UYEA 4LWIA 3SPHA 1XILA 1OCCC 2PYJA 4K3AA 4B3MB 4AWPA 4O2BB 5BODA 1GN2A 4YY3O 1F23A 4UVCA 4YJ3A 4X1KA 1F4NA 2ZM6B 1FJGO 1S0VA 1Y66A 2BTZA 4O07A 2DOSA 2Q0AA 2JDIG 2KB1A 2ZCEA 1L1FA 1B6QA 3H1LH 2FTKA 3L9DA 4DV5O 1JJ2U 3QTFA 1VARA 2EJ7A 1TIDA 1H2GA 1W0KG 2H94A 4K35A 4YKQA 4DV5B 4HZ0A 3F5WC 2IORA 3ZHSA 3K9SA 1SA0A 3D36A 2DN9A 2Y0PA 3I56V 1FS0G 4X20A 3S3XA 3X2QC 3OTOO 4KFGA 1M56C 4FM0A 1GO3F 3LDCA 4YKYA 2IJIA 3ASOB 1AI7A 2HG5C 4PI2A 1O9GA 2ZXWB 4J10A 5KX5B 5KA6A 3JSLA 4F6EA 4X1KB 1FJGB 1N36O 1B04A 3VHDA 3ZKDA 3KKYA 1A32A 1VQOV 3U0ZA 1SQQH 5DECA 1R3LC 3N2KA 4WFEA 2GV9A 3LSUA 4DV0O 4B3MO 2B1GA 1KC8W 4JI8B 3Q5KA 3Q5JA 3NMQA 2PNRA 3RYIA 4H85A 3TTZA 4QE7A 3LSSA 4B08A 5IJ9B 2YUAA 4NH8A 4PA7A 3D3IA 2IWSA 3OMIB 1NH2B 4MS2A 2UU9O 1U2OA 3GWOA 3CCUV 4ASGA 4UROA 4GCZA 3A0TA 1UY7A 4E00A 4U7OA 4KSGA 1GJVA 3AG4C 5D5QA 2F93B 4X8AA 2PI4A 3T1HO 1U97A 3SPCA 4CH6A 4LF4O 1MMMA 4B3RB 2X0LA 2YI6A 2LQTA 5H6RA 2WPDG 1PPJH 5LP6A 2P06A 1UY6A 5B1AC 4NVPA 3SYAA 1AP5A 1FYJA 5D6QA 4EFTA 1H2MA 2C2AA 4J80A 3G4SV 2Q8HA 3IAYA 4X1IB 2OCCB 3QG5A 3ZRWB 3AG3C 1HR0O 1PNLA 1MZEA 2QR4A 5L3FA 3CCVV 3K0GA 1N32O 1COWG 5EYPB 4I0XB 3AK2A 2CGOA 1VQ9V 2EILC 3ASNC 4DV6B 5J2UB 2XX5A 4H0LB 1EI1A 4CH5A 5JWPA 2IJKA 4WBNB 3ZMTA 2HP8A 2UUBB 1O9HA 3OR7C 1Y8OA 2CCSA 3R4PA 2YI7A 2YECA 2YI9A 3VQXA 1XREA 2P5OA 4O4HB 2IOPA 1Z5BA 1I58A 1WB7A 4LFBB 1S16A 2WI7A 3BEHA 2X6BA 3TCUA 1QVGU 4OPAA 1S5HC 3I5DA 4XDMA 4LF7O 3IC7A 2CDYA 2B1IA 4JI4B 4HBNA 3ZX6A 5B1AB 1I5DA 4MOTA 3CRMA 2UXBB 3P30A 3EHJA 4ABMA 1YXBA 2FWYA 5JQGB 5JENA 3MD0A 2UUAB 4I55B 2UXCB 1NTZH 3L72H 2JJ2G 2E74B 3CJHB 4NTWA 3CRAA 3FX7A 3WG7B 1OZ0A 2QM8A 1WA8B 4JV5O 2QKAA 2W6IG 3A0XA 1OCZB 3SJAC 3APOA 1Y74A 1IDSA 1YEWA 2MK3A 4ZI7B 3H80A 4UVBA 5JVDA 3K0DA 1JR9A 2GBOA 4KTNA 1E1QG 3A0RA 4YY3B 1S3JA 4EMVA 2QWOB 3SR2C 3FD9A 1SZTA 1RPRA 1Q6IA 5H2FZ 4BAEA 3E22A 2VRZA 2OWOA 4E02A 1IZ3A 1WPBA 2HR3A 1YJWV 4DK0A 1K33A 3AG2B 4NR1A 3WFVA 1Z5VA 1MA1A 4JPRA 5H9CA 3OR6C 1OV9A 2QKSA 4G27B 4JI2B 2WSSG 1JCHA 2FL4A 5KHIA 1UYIA 2WAMA 4DUYB 4J7ZA 5L3CA 2EZPA 3N2GB 1N4CA 2D3OW 1TBWA 4XIRA 3BAAA 2R70A 4K0KB 3T4ZA 2LO1A 3ZHQA 3KG2A 1QR8A 1VF7A 5KHHA 3G71V 2O1WA 2BT0A 1OHHG 2BOBC 3FAVA 4LFAO 4X1YB 1I0HA 4P30A 1R3JC 2VQEO 1GK9A 4C7UA 3CCSV 5FL7G 4AILC 5D7CA 2Q68A 3DGEA 5CA1A 1OCZC 2HVKC 4J9YB 2GHYA 1VQ5V 4MPCA 4O0BA 1L8DA 3WB1A 1UFIA 2F4VO 1NKDA 3CPWU 2HHHB 1N33O 4B6CA 2CGNA 2CTRA 2YXHA 3HB3B 1F7YA 2YC0A 4F6RA 1AR4A 2CH7A 1Q81W 4CC5A 3E83A 4W7TA 3WU2Z 3QNEA 1K8AW 3K06A 4YJ2A 2WLIA 4GKKB 1BGYH 4HZ3A 2UXXA 4G28B 4H44B 1XMQB 1JM6A 2KKWA 5IE9A 3JALB 3ZJZA 4LF8B 4XD8A 3MDSA 4ASAA 4MB9A 2HJFC 4GUNA 4EKWA 3ZEDA 1MG1A 4XCLA 3W7WA 3W7TA 2F95B 3CSXA 4I9QA 1XL4A 2DWEC 2ZINA 4BW9A 4X9LA 2EZOA 2WLLB 2CUGA 1YESA 3K97A 2IU3A 3O0IA 2IW5A 5LYJA 3AG4B 2GSMB 2CGFA 5JJJB 1U0ZA 3ABKC 4XKKA 4UV9A 4WFFA 4JI3B 1BQ0A 1NU1H 3TZ0A 1R3IC 3B8MA 2LW7A 2A7WA 2N74A 2E3CA 1BHBA 4ICGA 2DW4A 3C0EA 5LYJB 1YC3A 2QJ1A 3SDLA 4EFBA 1AMWA 5H6QA 3BRCA 4DR3B 4DV7O 5LGNA 4ASBA 1VF6C 2BSKA 2XHBA 2JVDA 1YERA 2V1DA 1FFXB 1N0JA 4DZYA 4YKUA 4UB8Z 2BZ5A 3O9OA 3CD6V 5KHKA 3GIGA 4BIZA 3B24A 3GIFA 4JI1O 1K5QA 3O65A 3OGCC 3ZKBA 4R1FA 4RWUA 3O6OA 1OCRB 3CCQV 3GIGB 3ABKB 3BCCH 4HZ5A 3F7VC 4IIJA 4FFBB 3TGUH 4UFZA 5C93A 2UUCB 3OPDA 4NTYA 2EX3A 2RDCA 4JF3A 4FK5C 5JVDB 1SKVA 4O09A 4PELA 4IIJB 2VCJA 3DSQA 4PDLA 4ZIBA 1Q3EA 1ZTEA 1LNQA 3B8NA 1K5SA 2ILMA 4X89A 4DR5O 2H3OA 1NHJA 2QG0A 4WUCA 4DR6B 4LWGA 1UYMA 4CWTA 4Z2WA 3OMAB 1JFFA 1HWYA 3HKCB 3TXQA 3ZRXA 1HNZB 2WI1A 4CWQA 4LF6O 3CE2A 2C1IA 4DR4O 2N04A 2PY5A 1M90W 1Z2GA 2Q8VA 5B3SC 4JYAB 1D2DA 3JD3A 2FKXA 4DV2O 3RVZA 3WB2A 1SQFA 1S76D 4URMA 3KE6A 2EILB 3ASNB 4RUFA 1YTFD 3BVOA 1XNQB 4FLVA 4X62O 2JKIA 4NB5A 2XHTA 4DR3O 3MNRP 4PD4F 1EZVH 2NN4A 5B1BB 4CWSA 1M93A 2YE6A 2H8MA 5CF0A 5CB4A 2IOQA 1GM7A 4UCOA 5IDMA 4D7SA 4UVAA 3C11A 1IBKB 5AG2A 1OCCB 1JVMA 1KP2A 1NS1A 3T1KA 4MT8A 1FXKC 2F66C 1AJQA 1VQ8V 5BZBA 4BIUA 4CWOA 1IBLB 4B7EA 1XNQO 5B1OA 3L75H 1QBZA 4MTGA 4LPBA 3JZ3A 2KQXA 3W7UA 5A2QN 2QGNA 2JS3A 4OGQB 2WI3A 4TQDA 5CA3A 2BU5A 1ZWIC 4MSWC 1AB3A 4X64O 1EA6A 3FKSG 5CBHA 4L94A 4JYCA 4GZRB 4DV4B 4LBEC 2LGQA 1FAFA 3G7BA 3ABLC 1B3QA 3M99B 4O04A 3NXSA 4BIOA 3G6EV 5J2UA 1NH2D 2N05A 2GQPA 3AG7A 3L71H 4UB6Z 4RO2A 3OMUA 5GTIZ 1KP3A 1Y67A 2DYRB 4X88A 2OIEA 1OJHA 3CYGA 4FIPC 1H2SB 4LCUC 4K0KO 3CRKA 4P2ZA 4XKOA 3ABLB 4ASFA 2BTQA 4B7PA 2PGGA 5K1PA 1S5JA 4EFEA 1S14A 3U10A 2ZNIA 4NKGB 3JARB 1FPOA 3DC6A 4FFBA 5FNDA 5EBMC 1TVKB 1Y6XA 1GN4A 4B3SO 1Q82W 2XJGA 3R65A 4JTAB 2ZT9B 3W7XA 4TQFA 5DN6G 2PYLA 4JZ2A 5IWAB 3L73H 4CBCA 3OE7G 3E8GA 1SQGA 4ZKIA 2CCTA 4CE1A 3CRQA 5A9GA 1W59A 4JYAO 1XUQA 2OTLV 4FM1A 2Y0IA 1L0LH 4W4LA 3K58A 3PEHA 3ZN0A 5HFMA 1Q86W 1YIJV 2YE2A 3E35A 3JASA 3T2SA 3CCLV 4UCSA 2EULA 4FPPA 2QTSA 4LH6A 4CZZA 2GUZB 1KUQA 2GDSA 4GT1A 1H2KA 3VOUA 2YI5A 4U93A 3VQYA 4L8ZA 2ZBKB 4GX5A 2OTJV 3B27A 3TZ4A 4MVSA 2JGDB 2IJJA 2YGFA 5IYZA 1SZXA 3OEEG 4GX2A 1V55B 1Y8PA 2XAHA 2ADPA 3KCYA 1VP7A 2Q5ZA 2OYQA 4QPKA 5EYPA 2EIMC 1NTMH 1MZFA 5JH7B 2WLLA 1PP9H 1MSWD 5BY1A 1IXMA 3RYCA 4TV8A 2QEXV 4JI1B 1JMKC 1Q8IA 3FYEB 1NR1A 3U11A 5LL6Y 1KQSU 1SS3A 1BE3H 2QWPB 4X1YA 4L90A 3EXAA 2UXDB 3CS5A 3ZHVA 2JK5C 3ZRVA 5J6AA 3JAWB 5GONA 3EHHA 3A8TA 4FLWA 1H7UA 5ITZB 3A0ZA 3JATB 3R92A 4MP7A 3INXA 5M4KA 4LWHA 1UY9A 1P7GA 1VQMV 1YCIA 3HKEB 2JRIA 4G2KA 1QCEA 2EIKC 1VQLV 4LC1A 4X62B 1UY8A 2YK2A 4KL1A 1AJNA 5M4MA 4CWRA 3RYHA 4X64B 2VQEB 5K1XA 4LWSA 2AW9A 4JI3O 4V25A 4R7CA 1IBKO 2CTWA 3Q4HB 5CA0A 3SYQA 4LFCB 3IFXA 1M1KW 4URNA 1YT2A 2DE0X 3ABUA 2GTAA 2BU6A 3P32A 4UXNA 5IYCO 4TOIA 5LGTA 5FNVA 4CE2A 4DUYO 1T5EA 1L0OA 1K4DC 1J5EO 2XTAA 1DTOA 1ZL8B 4UCVA 1TUEB 1UYLA 1N0NA 3KCXA 3HKEA 4CS4A 3AG1C 2UU9B 3SGIA 2WLKA 5IYDO 1VQPV 1YSZA 2VWCA 2IBZH 4I9WA 1NZ6A 1NR7A 1KKCA 3JASB 4L93A 2IH3C 3F7YC 2WEQA 2DYSC 2YDEA 1DK1A 2F4VB 3EHGA 3MHSC 4FLXA 2KSDA 4UV8A 5JCOA 3K08A 4YHHO 1F4MA 4JYBA 2WLJA 4ZVIA 1ID0A 3ETGA 3ABMB 1AVMA 1KIJA 3JD2A 1H38A 4XITA 3CXHF 4XDKA 4DYLA 4XKAA 2YSUB 3S5TA 1XOUA 3VHAA 3ICXA 5FNFA 1CXZB 4YKRA 1VQ4V 4JI2O 1YDXA 2ZE8A 1BCCH 1X4TA 4I4TA 5J2TA 4DW1A 4LF5O 4XIQA 5LP6C 5LOVB 3D3QA 1BHAA 4D7TA 5EK0A 4X65O 5BMVA 3RBZA 4IHJB 4TV9A 3HYYA 2PF4E 3HR0A 1YT0A 2C1GA 3JALA 4JASA 4DR7O 3HEKA 1ZUQA 2ZE7A 5LMNO 4JAVA 4FCQA 1PVGA 3UQ8A 1YT1A 2ZE6A 4LP0A 4R3MA 2Q4PA 3E8FA 1VF5B 3U2DA 4I0XA 2FXSA 1R62A 3HHUA 3H9VA 3ABMC 1VQNV 4DXWA 4CH3A 2LGWA 1XHZA 2UUBO 2UUAO 3FYIB 2XDKA 1I59A 4WUDA 2YEFA 2ZIOA 1R3KC 3ETDA 2QFOA 4Q6GA 2EIMB 4JYYA 4I4TB 5J2TB 3SJQC 4JTDB 1BQZA 2DMXA 4NYKA 4JI0O 5B1NA 4MBCA 2JS5A 2QWNB 3AG2C 2WLHA 4JI5O 5FPOA 2XOKG 2HLDG 3CEIA 1HR0B 4R6ZA 1IXBA 5JQGA 1WN7A 4QGPA 1GMGA 4AHCA 2BREA 3CB2A 2O57A 2AHYA 3T4DA 4LF8O 2XX2A 4YJ3B 2JJ1G 2WI2A 3FB7C 3MHHC 3SJBC 1ZWHA 3QTCA 4QIWF 3HPLC 4AS9A 4LF9O 4O4LA 2FB5A 4BW5A 2EIJB 4FCPA 4KHPO 4B3RO 3EVKA 2YKEA 1EFRG 4B3TO 5DEDA 4B7KA 4PU9A 2Q8GA 3BA9A 3K79A 4L8JA 4GYCB 4EGKA 1GN3A 2HEPA 1K4CC 1DF5A 4MW8A 1Y4UA 3R4MA 3OWBA 3APQA 3LNNA 4XTJA 5D7DA 2BE3A 2ZE5A 2WLIB 1KBHA 4CWNA 3OAAG 1BL8A 2ADQB 3M8AA 2YXYA 5J71A 1FXHA 2YICA 3X2QB 1US7A 4JI0B 5M4HA 4GEEA 1YSCA 3CX5F 5EBLC 2HVJC 3GB7C 5KMGA 3HZ5A 1JFFB 2M7WA 2HHHO 1N33B 5BMVB 2OT5A 2YEJA 4PHZA 3UO2A 1VIBA 4R3AA 3U2KA 1AP6A 1K92A 4J42A 3SYOA 2YE5A 2XJJA 4LR3A 2QG2A 3H1HH 2ZM6O 4MTOA 4BWAA 4O4HA 2Q6AA 1AR1B 2Y4UA 4GKJO 1KYOF 4DV3O 1TUBB 1TAEA 5LXTA 1GAXA 4PDMA 2E5LO 4XC0A 2Y4TA 2XUMA 3OT7A 3RKZA 2XDUA 2K9PA 1N36B 4P8OA 3DC5A 1V55C 2R9RB 3JAKA 1NI8A 2LFRA 1QVFU 3JAWA 5GONB 2YXLA 3SPJA 5IYBO 1XMOO 1FXKB 2FWZA 4ZOLA 2HHIA 2V7QG 5EZYA 2YKJA 1QLNA 3HKDB 3OTOB 2BU7A 1TGOA 3N27A 3ZMZA 3K03A 3O2FA 3E8BA 3K04A 2QE7G 3T1YB 3QO5A 5LOVA 4U3JB 3OGIB 2QWQB 1MABG 4GKJB 1S77D 4PA6A 3T1YO 2X6AA 2BCCH 4DV1O 3ZRSA 2F1MA 5FNCA 3ZMSA 4DV7B 2W6JG 1QR9A 3UKMA 3QO7A 4GFNA 1N34B 1P49A 4KFMA 1AROP 3FB6C 3OFNG 5KAIZ 3CWVA 1NT2B 4H33A 4X66B 2YE4A 1RP3B 2LFSA 1BKNA 4HY6A 2L35A 4IGGA 1YHQV 1WP7A 3DXRA 2G38A 4DRXA 2E5LB 3TZ2A 1RSOB 2VQFB 1P4RA 2KG7B 3K59A 5EZYB 4DUZB 3JCZA 4KXRA 4Q20A 2Z3YA 2OIGA 1W0JG 2O1VA 4LNUA 3EHFA 2QF6A 5D6PA 3ZHRA 1RM1B 1SERA 3F5TA 4TWKA 2YE7A 1R6NA 1XL6A 1UYHA 4GLXA 4FM2A 4FMTA 4I50A 5IT9N 1QQCA 4E01A 1Z59A 3GIEA 2Q69A 5ITZA 2QSAA 3FT8A 2ZQMA 1YJ9V 2ETNA 5KUMA 2WI4A 3CJHA 5CPHA 4PV1B 1SETA 2YIBD 4HXWA 3ZRWA 1ZLZA 1Y76B 3UO3A 1N32B 1I08A 2XNDG 1M56B 1AH8A 2ZDIC 3T1HB 3DXRB 4DRXB 1JJOA 3SYPA 2YIDA 4EGIA 1TH8A 1N34O 1WLEA 3H1JH 4EFUA 3EKRA 4J7KA 4MPEA 2JEXA 3LDDA 3RLRA 1VMGA 1KB9F 3R4NA 3Q4HA 4IL6Z 4CS3A 5EC2C 1MNGA 1Z5AA 1ZW9A 4HNAA 2RJZA 2DWDC 2XDXA 4X20B 1J95A 4PRXA 4FLZA 1GKZA 2IJHA 4DUZO 2Q7HA 3AG1B 4I50B 3ZS8C 3JAMN 1YZBA 2VQFO 4ASUG 2JGDA 1PNMA 2O1UA 2D2CB 5LMUB 3K3WA 5GW7A 1ENVA 4CH4A 4TV9B 1HNWO 3UCSC 1IVSA 2VWKA 1BZKA 2HKOA 1GM9A 4H13B 3RYIB 1ZX3A 4TUYB 5EC1C 4WFBV 2IWXA 3UT5B 2YKCA 1CPYA 2ZR3A 2JEUA 3PJSK 4JI5B 3SJCC 1OCRC 1I94O 2YGEA 3P3PA 1LUWA 5KA5A 2BRCA 4EEQA 2ZIMA 1Q5OA 4O2AA 1FKAO 3UM7A 4OPHA 5EIBD 5KAFZ 1KZNA 3RFRA 1YC1A 4Z1MG 3ETQA 3GWKC 4MW3A 4WFAV 2IH1C 1Q43A 4V26A 2UXCO 3CC7V 2Y69B 3FB5C 3P3NA 2Q7GA 1Z5WA 2BTQB 1PL0A 3TETA 3RLPA 2UXBO 4LNUB 1MU5A 1K73W 1TILA 3LNMB 2X6CA 4AQYB 2XAJA 3ZHTA 3T10A 3JCUZ 1ZXMA 1H7SA 4DR7B 1N8RW 2P67A 1UYGA 2YGAA 4J7JA 1KECA 3FV5A 1R73A 2YE8A 5KUKA 3OEHG 4LWSB 5GTHZ 4X65B 2Q8FA 1WB8A 3CC2V 1D5NA 4K8ZA 1Y74B 5E1AC 4LF5B 3RT3C 4EGHA 4EEHA 1V9PA 4MVMA 4R50A 2H55A 2RQ6A 3J7AU 5IY5C 4O4IA 3N2KB 3DTUB 3I55V 3QVNA 5L3DA 3OW6A 4LWFA 1J5EB 1AILA 2FYPA 3J81N 3H01A 3CC4V 2VW5A 2XABA 5H5NA 4K4OA 3U67A 2DYSB 3R66A 2YKIA 3IC9A 4KHPB 1M4UA 4E4EA 2YEIA 4KQVA 1GKXA 3RYCB 3K57A 3Q5LA 3EHBB 3AK1A 4HY1A 3STZC 3IEDA 5F2VO 5BR8O 5L3BA 3G75A 4URLA 3H4LA 4JTCB 5B66Z 5IJ0B 1G1XB 4JI6O 3OW2U 5KMGB 1H2NA 3CYOA 2LP7A 1QLEB 4MP2A 4O4IB 4YIPA 3WB0A 3E8HA 4JQLA 2IU0A 5CTXA 4DR1B 1XDCA 1K7DA 3HKBB 3QDDA 4L87A 2BSMA 1TC0A 1ZXNA 4WUBA 4NXNO 2WI6A 1YITV 2WLNA 1XEQA 4WCEV 3E22B 3HYZA 4HYMA 4PDVA 2ZR2A 2JGUA 3OUSA 3E2EA 3CMEV 2QWRB 4PA3A 2YJXA 3CCEV 2ZKOA 3T1CA 4HYOA 2YIAA 3ZHUA 4FLYA 4B3TB 2BYIA 1PNKA 2YK9A 3OWDA 4RQEA 1SQBH 3TUHA 1DLBA 3HKCA 3N2GA 4IHJA 5KX5A 3STLC 3ASOC 1TA8A 3B4SA 3SPIA 2F43G 5HFLA 4RAIA 4KUMA 4PDRA 2AZ0A 4EB6A 2AKPA 5CN0A 1AI4A 4O4JB 3FAVB 3PEJA 3CRCA 5CTYA 5JJEB 3ZMUA 3T0HA 2Z5UA 1B62A 2QTOA 5D5PA 1LR1A 4TUYA 2XK2A 3SPGA 1ZAUA 2A0LA 5IJ9A 3QF7A 3BPZA 1BYQA 2X7RB 1EN5A 1VEWA 1OCOC 5L3JA 1HW7A 2YS8A 1EM1A 1BT8A 4MVZA 1PKXA 1ROPA 1B63A 3LDEA 4H37A 4YHHB 4FFKA 3OTFA 2CCUA 3K5MA 5LBQA 3E86A 4J41A 2B5UA 1NTKH 4XBFA 3OMNB 1NVPB 3JATA 1SF9A 1WJZA 4DR2B 1K97A 4DK1A 1DGSA 1RFYA 3ZCCA 4BAYA 2OCHA 4DV3B 1NHHA 5GGZA 4X1IA 2YEDA 4XE2A 4FVMA 4FJCC 1QY8A 3ZN1A 3B77A 1L0NH 1BXDA 3VQWA 4EM7A 1FXVA 2L6LA 2XASA 4O4LB 4WF9V 3LNUA 1E1RG 2HJDA 3RWRD 4UCUA 3D2RA 2CG9A 3INWA 2JIZG 5CA0B 4I5SA 1XHXA 4GT8A 4NXMO 1HNXB 4GX0A 4XDLA 5F3KA 3K5OA 5L3GA 1V54B 5FLXN 1FFTB 2YEVA 3TK1A 2V4DA 4LH7A 5CBGA 1VQ6V 3ZMVA 3R91A 4MTFA 2OCCC 1R6KA 1Q7YW 5LA6B 1F51A 3CCMV 2VWJA 2P22C 2DYRC 3K5LA 4H81A 2R9IA 3KZIZ 4A5UB 5J9PC 3B2EE 1EN6A 2E0AA 1JX9A 1I5AA 4BXIA 3CGZA 3BABA 1RSOA 3WHAA 4BQGA 3C3SA 4TV8B 1WA8A 3ZM7A 3VADA 1GM8A 2EJRA 4NTXA 1R1BA 2A9HA 1K3EA 4I7ZB 4LP8A 4EB6B 1EZJA 4N23A 1AM1A 2R72A 5CMUA 2YEBA 4U3FH 3CCRV 2QDOA 4JZGA 1Y8NA 5IJ0A 1NJIW 2YEAA 3C3TA 4CC6A 2XX4A 3IGAC 1YF2A 2ZDIA 2K5BA 4YKWA 1YS3A 1QLEC 5C8YB 2YI8A 4DV4O 4IYIA 2H8PC 1FXKA 4TSFG 4LFCO 2CE4A 1KD1W 4UCRA 4JI7O 4ZOLB 1W2BU 3K60A 2RNBA 1IBMB 3SYCA 1ORQC 4CS2A 3T0ZA 2UXDO 2QKCA 4L91A 2XAQA 3G80A 2XCMA 2WEPA 4IT5A 2Y69C 1YC4A 2XHRA 2Q9LA 4FLUA 2IWUA 2UWDA 1HNZO 4HYPA 4QJFB 5B1BC 2IM9A 1FD9A 3RN4A 1IBLO 3IJ4A 5M4EA 2BU8A 1WNSA 1WP8A 4FLTA 2ITDC 4HAMA 5BXZA 3VQVA 1XQ8A 4JGSA 1OSFA 1URFA 5FNVB 2BU2A 5CA1B 4DV2B 1R6TA 2NLJC 2HG1A 4NH7A 2Q7EA 2MW2B 3E89A 1Q6HA 5KLVH 2WLMA 2WA3A 5C8YA 5IDJA 1UYDA 5LHHA 1U96A 1YSRA 2CH4A 3J80N 1YI2V 4ZI7A 3ZXOA 2BSKB 3W7SA 2AZ2A 1WAZA 5DM6V 4JAAA 1HNXO 1THNA 2RMKB 2YIBA 3RYFB 2EBOA 4I55A 4YXWG 2WI5A 1TVKA 2PI5A 1M9NA 2A3QA 4OX9O 3RGBA 4CE3A 4AWQA 3K5NA 1KKDA 2HFEC 1YJNV 5D7RA 2F23A 3BM9A 2AGAA 1XBLA 3JD0A 4N21A 1A4HA 2PTMA 2JJCA 5IWAO 3JD4A 5E79Z 1D5AA 1XNRO 2EXLA 5CTWA 1BS3A 2Z0AA 5CTUA 2Q8IA 3ZBHA 4RQFA 4MTXA 4PA9A 4B3SB 5LA6A 4MVQA 1XNRB 3D8CA 4LWEA 1SRYA 2DJVA 1AJPA 3HZ1A 1HP8A 4YIOA 2ATKC 3H1IH
chains in the Genus database with same CATH topology
1GKZA 2IJHA 2IJJA 2YGFA 3OEEG 1VQ9V 4GX2A 2EILC 3ASNC 5LHGA 3AG1B 2HKJA 1V55B 1Y8PA 2XDLA 2XX5A 4DUHA 4HXZA 2XAHA 4ASUG 1EI1A 1PNMA 2IJKA 2O1UA 1G8MA 3ZMTA 4QPKA 2EIMC 3OR7C 2WWWA 1Y8OA 2CCSA 3R4PA 2YI7A 3K3WA 2WLLA 2ZXWC 1ENVA 5GW7A 2YECA 1MSWD 4P9OA 1NHIA 1IXMA 4PA4A 4RUEA 2YI0A 1EBOA 3FB8C 2GFDA 4PL9A 2QEXV 2HKOA 1Z5BA 1GM9A 1I58A 2IOPA 5EC1C 2EINC 4WFBV 1S16A 2WI7A 3FYEB 4J9ZB 1NR1A 2IWXA 3BEHA 2X6BA 3CCJV 3ETEA 3TCUA 1QVGU 1KQSU 1CPYA 2ZR3A 2YKCA 4PRVA 2JEUA 3PJSK 2A79B 4L90A 5EBWC 1S5HC 1OCRC 4XDMA 3IC7A 2YGEA 2JK5C 3ZRVA 5J6AA 3EHHA 3EFFK 2DQ0A 4UUJC 2B1IA 5KA5A 3JYCA 1H7UA 5B1AB 1I5DA 2BRCA 1K9MW 4MOTA 3A0ZA 3P30A 3EHJA 2UXNA 4XDJA 3R92A 4MP7A 3INXA 5M4KA 4LWHA 3UM7A 2FWYA 1UY9A 3MD0A 4XIPA 1VQMV 2DQ3A 4G2KA 1QCEA 3TZ5A 1KZNA 2EIKC 2JJ2G 1YC1A 4Z1MG 1VQLV 4MW3A 4WFAV 3WG7B 1OZ0A 2EIJC 2IH1C 2QM8A 4LC1A 1JOYA 1UY8A 3EKOA 4GGLA 2YK2A 3CC7V 4V26A 3T2MA 2Y69B 1AJNA 3RLQA 2W6IG 3FB5C 4CWRA 5M4MA 3A0XA 1OCZB 4H7QA 1PL0A 3TETA 3RLPA 3H80A 1V54C 2MK3A 3CRLA 4UVBA 1MU5A 4CWPA 3K0DA 1K73W 1THZA 3LNMB 1TILA 2X6CA 4V25A 2XAJA 3T10A 4R7CA 1E1QG 3A0RA 4KTNA 1S3JA 3SYQA 4EMVA 1ZXMA 1H7SA 1N8RW 2P67A 1UYGA 1SZTA 2P6JA 1RM1C 2YGAA 3IFXA 1M1KW 1KECA 1WPXA 1YT2A 3B25A 3FV5A 3ABUA 4URNA 1R73A 2YE8A 1RPRA 4E02A 5KUKA 4BAEA 2BU6A 3OEHG 3P32A 3RVYA 4UXNA 5IYCO 4YKQA 4YKTA 5LGTA 4CE2A 2Q8FA 2HR3A 1YJWV 3CC2V 1BGQA 5E1AC 1L0OA 3ZIAG 1K33A 1K4DC 3AG2B 3K9AA 3WFVA 2ZKJA 4EEHA 4MVMA 4R50A 2H55A 4I3HA 2YEGA 1OCOB 4JPRA 5H9CA 1DTOA 3OR6C 5IY5C 2XD6A 3DTUB 4GQTA 4KSHA 2QKSA 3I55V 4G27B 1TUEB 1UYLA 4JAUA 5L3DA 2WSSG 1JCHA 3OW6A 4LWFA 1UYIA 3AG1C 2Y48A 2WAMA 2FYPA 2WLKA 3H01A 5L3CA 2EZPA 5IYDO 1VQPV 3CC4V 1YSZA 2VW5A 1NQTA 2VWCA 3G7EA 2DYSB 4K4OA 2YKIA 3U67A 2D3OW 4I9WA 1TBWA 1NR7A 4XIRA 1MX0A 4L93A 3T4ZA 2IH3C 4P9PA 3KG2A 2YEIA 1GKXA 4KQVA 3F7YC 1QR8A 3G71V 2O1WA 2WEQA 2BT0A 3Q5LA 4DO2A 3EHBB 1OHHG 3ABTA 2BOBC 1TC6A 2DYSC 3STZC 3IEDA 4HY1A 1K34A 4P30A 1UJWB 1R3JC 1GK9A 3CCSV 5FL7G 5D7CA 3ML0A 2Q68A 4F4LA 5L3BA 3MHSC 3DGEA 3EHGA 1M57B 1OCZC 2HVKC 4J9YB 2GHYA 4UV8A 1VQ5V 3G75A 4L94A 3H4LA 4MPCA 4URLA 4JTCB 1I5CA 4O0BA 1VQKV 3RW0A 4YKXA 1NKDA 3K08A 1F4MA 4JYBA 3CPWU 3OW2U 2WLJA 1AJ6A 3LPSA 3R4OA 4ZVIA 4U7NA 4B6CA 4BQJA 1ID0A 3HB3B 4OXSA 3ETGA 3CYOA 3ABMB 2XHXA 2LP7A 1KIJA 1QLEB 1H8HG 2W0FC 3JD2A 4QPJA 4MP2A 4O05A 3FT5A 3E8HA 1H38A 4JQLA 2IU0A 2K1EA 4XITA 2P7TC 1Q81W 4XDKA 5CTXA 1K7DA 2YSUB 3E83A 1UYKA 3BMYA 4XKAA 4W7TA 1MOFA 3QDDA 4L87A 3QNEA 1Z5CA 2BSMA 1I5XA 1K8AW 3K06A 1TC0A 2WLIA 1ZXNA 5IN9A 4HZ3A 3K98A 2UXXA 4G28B 3VHAA 4WUBA 2BYHA 5FNFA 2XAGA 1JQ0A 2WI6A 1YITV 1G4YB 2WLNA 1JM6A 3OM3B 4YKRA 1VQ4V 1QYEA 4WCEV 3ZJZA 4WFGA 4XD8A 2QA4V 3HYZA 4HYMA 4ASAA 4MB9A 2HJFC 4PDVA 4EKWA 4R8CA 2ZR2A 4MPNA 2ITCC 1MG1A 3OUSA 3E2EA 3CMEV 4PA3A 2YEHA 2YJXA 3CCEV 2ZDXA 3A0WA 4XIQA 4XCLA 3W7WA 3W7TA 3ZXQA 1BHAA 1UYCA 2AHZA 3T1CA 5EK0A 4HYOA 1XL4A 2DWEC 3RBZA 4X9LA 2EZOA 2WLLB 2BYIA 1YESA 3K97A 4P7AA 1PNKA 2IU3A 4MVRA 4ZBMA 2XDSA 2YK9A 1YT0A 3HYYA 3O0IA 3OWDA 4RQEA 4JASA 2IW5A 3B26A 3AG4B 2GSMB 3LSQA 4YKZA 3HEKA 1NBMG 2CGFA 1U0ZA 3ABKC 3TUHA 4XKKA 1DLBA 4UV9A 4WFFA 3TZ0A 1R3IC 2YEVB 3B8MA 4JAVA 2YEEA 4FCQA 1PVGA 3VBBA 3STLC 3ASOC 1BHBA 1YT1A 2DW4A 1VQ7V 3VHCA 3SPIA 5M4PA 3C0EA 4QE9A 4LP0A 1YC3A 1DF4A 3E8FA 4R3MA 5LHIA 2F43G 1AMWA 3U2DA 5HFLA 2FXSA 4RAIA 4KUMA 4PDRA 1E79G 5H6QA 1I5BA 1R62A 3HHUA 2AKPA 4EGHA 5CN0A 5LGNA 1AI4A 2CK3G 3ABMC 4MVOA 1VQNV 3WQ9A 3PEJA 3OUFA 1BMFG 1CP9A 5CTYA 4DXWA 1Y4MA 4ASBA 3ZMUA 3T0HA 2XDKA 3FYIB 2Z5UA 1B62A 2QTOA 1I59A 4WFHA 1AI5A 4WUDA 2YEFA 1YERA 1R3KC 3ETDA 2QFOA 2XK2A 3SPGA 2EIMB 2YJWA 2ZDYA 2A0LA 2V1DA 4PRXA 1BYQA 3SJQC 4DZYA 4YKUA 4JTDB 2X7RB 5F5RA 3LUTB 4GX1A 3WG7C 5B1NA 1OCOC 5IY5B 4MBCA 5L3JA 2BZ5A 2NNUA 3AG2C 4MVZA 2WLHA 1PKXA 1ROPA 3CD6V 1B63A 2XOKG 2HLDG 3GIGA 4BIZA 3LDEA 4H37A 3B24A 2YKBA 4R6ZA 3GIFA 2ESAA 1K5QA 1YTFB 2Q67A 2CCUA 1JPXA 3OGCC 4E2LA 4R1FA 3ZKBA 5LBQA 3SL2A 1GMGA 3E86A 2BREA 2B5UA 3OMNB 4XBFA 1NVPB 2AHYA 2P90A 3T4DA 2XX2A 1K97A 2XJXA 2YE9A 3O6OA 1QZRA 1OCRB 3CCQV 3ZCCA 2JJ1G 4BAYA 3GIGB 1RPOA 3FB7C 3ABKB 1PD3A 3MHHC 1ZWHA 2WI2A 4HZ5A 4QIWF 3CXCU 3HPLC 4AS9A 3F7VC 1NHHA 4BW5A 2EIJB 5GGZA 4FCPA 2YEDA 4XE2A 2EINB 2WERA 5C93A 3OPDA 2EIKB 4FJCC 1QY8A 1AI6A 2YKEA 1EFRG 4FK5C 4JF3A 3ZN1A 3B77A 4O09A 3JD1A 2Q8GA 1GKFA 2ZD9A 4PU9A 1BXDA 1H8EG 4PELA 4EM7A 3K79A 1FXVA 5CBFA 2XASA 4WF9V 3LNUA 4EGKA 1E1RG 2BOCC 2VCJA 4PDLA 3D2RA 2CG9A 3INWA 1K4CC 1M57C 2JIZG 1DF5A 4KP4A 1LNQA 4MW8A 1NVPD 1Y4UA 4I5SA 3B8NA 1K5SA 4X89A 4QNHB 2QG0A 2YE3A 1NHJA 3K99A 4GT8A 3R4MA 1I5YA 3OWBA 4LWGA 4WUCA 1UYMA 4CWTA 3QO8A 4GX0A 4XTJA 2Q2EB 5D7DA 3OMAB 4XDLA 3A0YA 1UYFA 5F3KA 3TTZA 1HWYA 5LGUA 2XAFA 1V54B 3ZRXA 2WLIB 5L3GA 3CMAV 2WI1A 3OAAG 1BL8A 1FFTB 4CWNA 1P7BA 2YEVA 4CWQA 5M4NA 3TK1A 4NH9A 4TT3G 5J71A 1FXHA 5CBGA 1VQ6V 4FCRA 3ZMVA 3X2QB 1M90W 1US7A 3AEIA 3R91A 5B3SC 5FWKA 4MTFA 2OCCC 2VCIA 4AWOA 1Q7YW 5M4HA 3CP1A 3JD3A 4GEEA 3BY6A 1YSCA 5EBLC 1F51A 2HVJC 3GB7C 3HZ5A 3CCMV 2M7WA 2QM7A 4MVUA 3D0BA 4CWFA 2DYRC 2OT5A 3RVZA 4H81A 2R9IA 1S76D 4URMA 2YEJA 1GTOA 5J9PC 5BOCA 3KE6A 2EILB 3ASNB 4RUFA 1YTFD 2E0AA 1Y4SA 1JX9A 1SESA 5L3EA 4XCJA 2JKIA 1I5AA 4R3AA 3U2KA 4BXIA 5B3SB 2XHTA 3CGZA 1YETA 3B28A 1K92A 3MNRP 1AH6A 3SYOA 5B1BB 4CWSA 3CGYA 2YE5A 2XJJA 1CEZA 3AG3B 1S72V 2QG2A 3WHAA 2HCHA 2YE6A 2H8MA 5CF0A 4MTOA 2Q6AA 1AR1B 4BQGA 2IOQA 3ZM7A 1GM7A 1UYEA 1GM8A 4LWIA 2EJRA 3VADA 3SPHA 1OCCC 1K3EA 2A9HA 5IDMA 4AWPA 4LP8A 4UVAA 1EZJA 4N23A 1AM1A 4PDMA 3C11A 5BODA 1F23A 5CMUA 2YEBA 1OCCB 4UVCA 1JVMA 3CCRV 4XC0A 1KP2A 1Y8NA 1F4NA 3RKZA 3T1KA 1NJIW 2XDUA 2YEAA 4MT8A 4P8OA 1S0VA 1V55C 1FXKC 2R9RB 1Y66A 2XX4A 1AJQA 2LFRA 3IGAC 5BZBA 1VQ8V 1QVFU 2BTZA 4BIUA 4O07A 4CWOA 3SPJA 5IYBO 1FXKB 2JDIG 2ZDIA 2FWZA 2K5BA 4YKWA 2V7QG 2KB1A 1YS3A 1QLEC 2YKJA 1L1FA 1B6QA 5B1OA 1QLNA 1QBZA 2BU7A 4MTGA 2FTKA 4LPBA 2H8PC 1FXKA 4TSFG 3JZ3A 3ZMZA 3K03A 1KD1W 3E8BA 3O2FA 3W7UA 3K04A 2QE7G 3QO5A 1JJ2U 2WI3A 3QTFA 1W2BU 3K60A 1MABG 5CA3A 1S77D 1TIDA 2BU5A 1H2GA 1W0KG 2H94A 4PA6A 1ZWIC 1ORQC 4MSWC 3SYCA 4HZ0A 3F5WC 2IORA 2X6AA 3T0ZA 4L91A 2XAQA 1EA6A 3FKSG 3D36A 5CBHA 3ZRSA 2WEPA 3I56V 1FS0G 4JYCA 3X2QC 1YC4A 2Y69C 3ZMSA 2XCMA 2XHRA 4KFGA 1M56C 4LBEC 2IWUA 2W6JG 1QR9A 2UWDA 1GO3F 3LDCA 3UKMA 3G7BA 2IJIA 4YKYA 3ASOB 3QO7A 1AI7A 2HG5C 3ABLC 3M99B 1B3QA 4QJFB 3NXSA 2ZXWB 5B1BC 4GFNA 4HYPA 4O04A 5M4EA 2BU8A 3G6EV 5KA6A 2ITDC 4HAMA 4KFMA 1NH2D 1AROP 4JGSA 3FB6C 3OFNG 1OSFA 2GQPA 3CWVA 3VHDA 4H33A 2BU2A 4RO2A 2YE4A 2LFSA 1BKNA 3ZKDA 3OMUA 1VQOV 4HY6A 1YHQV 1KP3A 2NLJC 1R3LC 2HG1A 3TZ2A 4X88A 2DYRB 4NH7A 4WFEA 1P4RA 3E89A 2XABA 4FIPC 2B1GA 2WLMA 2ATKC 1KC8W 3JCZA 5IDJA 3Q5JA 3Q5KA 3NMQA 4Q20A 2Z3YA 4LCUC 2PNRA 1UYDA 4H85A 3CRKA 1W0JG 4P2ZA 4QE7A 5LHHA 3ABLB 3LSSA 2O1VA 2QF6A 3EHFA 4XKOA 5D6PA 4ASFA 4B7PA 1YSRA 2CH4A 4PA7A 4NH8A 1RM1B 3D3IA 1SERA 1YI2V 1S14A 2IWSA 3OMIB 1NH2B 3ZXOA 4MS2A 3W7SA 5FNDA 5EBMC 1U2OA 5DM6V 4TWKA 3GWOA 3CCUV 4ASGA 1THNA 4UROA 4GCZA 2YE7A 1R6NA 1XL6A 1UYHA 1Q82W 3A0TA 1UY7A 2XJGA 4E00A 3R65A 4U7OA 4KSGA 2EBOA 4FMTA 4JTAB 4YXWG 1GJVA 2WI5A 2PI5A 3W7XA 4E01A 3AG4C 1M9NA 4X8AA 5DN6G 1Z59A 2PI4A 3GIEA 4CE3A 4AWQA 2Q69A 4CBCA 1KKDA 3SPCA 3FT8A 2HFEC 2ZQMA 1YJ9V 3OE7G 3E8GA 5KUMA 1YJNV 2WI4A 4ZKIA 2CCTA 5FNCA 5CPHA 4CE1A 4HXWA 1SETA 5D7RA 3ZRWA 2X0LA 2YI6A 3BM9A 5H6RA 2OTLV 2XNDG 2WPDG 1M56B 3JD0A 1AH8A 4N21A 1A4HA 1UY6A 2ZDIC 5B1AC 2JJCA 3PEHA 3SYAA 3ZN0A 5HFMA 3JD4A 1Q86W 1YIJV 3SYPA 2EXLA 2YE2A 3E35A 5CTWA 4EGIA 5CTUA 3T2SA 3CCLV 2Q8IA 5D6QA 4RQFA 1TH8A 4EFTA 4MTXA 1WLEA 4FPPA 2C2AA 2Q8HA 3G4SV 4PA9A 4CZZA 4EFUA 4MVQA 3EKRA 4MPEA 2OCCB 2JEXA 3LDDA 4GT1A 3RLRA 3ZRWB 3AG3C 1SRYA 3VOUA 2YI5A 3R4NA 4LWEA 4L8ZA 4U93A 2ZBKB 1PNLA 1AJPA 5EC2C 5L3FA 3CCVV 3HZ1A 4GX5A 3K0GA 1Z5AA 1COWG 2OTJV 1ZW9A 3B27A 3TZ4A 2DWDC 2XDXA 1J95A 4MVSA 1R6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKZ A;  2YGF A;  2HKJ A;  2XDL A;  1Y8P A;  2XX5 A;  4DUH A;  4HXZ A;  1EI1 A;  2O1U A;  4QPK A;  2WWW A;  1Y8O A;  2CCS A;  3R4P A;  2YI7 A;  2YEC A;  1NHI A;  1IXM A;  2YI0 A;  2GFD A;  4PL9 A;  2IOP A;  1Z5B A;  1I58 A;  1S16 A;  2WI7 A;  2IWX A;  4PRV A;  2YKC A;  4L90 A;  4XDM A;  2YGE A;  3ZRV A;  5J6A A;  3EHH A;  1I5D A;  4MOT A;  1H7U A;  2BRC A;  3A0Z A;  3EHJ A;  3R92 A;  4MP7 A;  3INX A;  5M4K A;  4LWH A;  2FWY A;  1UY9 A;  3MD0 A;  4XIP A;  3TZ5 A;  1KZN A;  1YC1 A;  1JOY A;  3EKO A;  4LC1 A;  3ZXQ A;  2QM8 A;  1UY8 A;  4GGL A;  4V26 A;  2YK2 A;  3RLQ A;  5M4M A;  4CWR A;  3A0X A;  4H7Q A;  3RLP A;  3H80 A;  3CRL A;  1MU5 A;  4CWP A;  1TIL A;  4V25 A;  3T10 A;  4KTN A;  3A0R A;  4EMV A;  1ZXM A;  1H7S A;  1UYG A;  2P67 A;  2YGA A;  4URN A;  1YT2 A;  3B25 A;  3FV5 A;  2YE8 A;  4E02 A;  4BAE A;  2BU6 A;  3P32 A;  4YKT A;  4CE2 A;  2Q8F A;  1BGQ A;  1L0O A;  2ZKJ A;  4EGH A;  4EEH A;  2H55 A;  4I3H A;  2YEG A;  2XD6 A;  4GQT A;  4KSH A;  1UYL A;  4JAU A;  3OW6 A;  4LWF A;  1UYI A;  2FYP A;  2XAB A;  1YSZ A;  2VW5 A;  2VWC A;  4K4O A;  3G7E A;  3U67 A;  2YKI A;  1TBW A;  4XIR A;  1MX0 A;  4L93 A;  2YEI A;  4KQV A;  1GKX A;  2O1W A;  2WEQ A;  2BT0 A;  3Q5L A;  1TC6 A;  4HY1 A;  3IED A;  5D7C A;  3EHG A;  3DGE A;  3G75 A;  4URL A;  3H4L A;  4MPC A;  1I5C A;  4O0B A;  4YKX A;  4JYB A;  1AJ6 A;  3LPS A;  3R4O A;  4ZVI A;  4B6C A;  4BQJ A;  4U7N A;  1ID0 A;  2XHX A;  1KIJ A;  4QPJ A;  4O05 A;  4MP2 A;  3FT5 A;  4JQL A;  4XIT A;  5CTX A;  4XKA A;  1UYK A;  3BMY A;  4W7T A;  3QDD A;  1Z5C A;  2BSM A;  1TC0 A;  1ZXN A;  5IN9 A;  3K98 A;  3VHA A;  4WUB A;  2BYH A;  5FNF A;  2WI6 A;  1JM6 A;  4YKR A;  1QYE A;  4XD8 A;  3HYZ A;  4HYM A;  4ASA A;  4MB9 A;  4MPN A;  2YEH A;  2YJX A;  3A0W A;  2ZDX A;  4XIQ A;  4XCL A;  1UYC A;  4X9L A;  2BYI A;  1YES A;  3K97 A;  4P7A A;  3O0I A;  2XDS A;  2YK9 A;  1YT0 A;  3HYY A;  3OWD A;  4JAS A;  4YKZ A;  3B26 A;  3HEK A;  2CGF A;  1U0Z A;  3TUH A;  4XKK A;  3TZ0 A;  4JAV A;  4FCQ A;  2YEE A;  1PVG A;  1YT1 A;  3VHC A;  5M4P A;  3C0E A;  4LP0 A;  1YC3 A;  4R3M A;  3U2D A;  1AMW A;  2FXS A;  1R62 A;  1I5B A;  3HHU A;  2AKP A;  3WQ9 A;  3PEJ A;  4ASB A;  5CTY A;  3T0H A;  2XDK A;  1I59 A;  1B62 A;  4WUD A;  2YEF A;  1YER A;  2QFO A;  2XK2 A;  2YJW A;  2ZDY A;  1BYQ A;  4DZY A;  4YKU A;  5F5R A;  5B1N A;  5L3J A;  4MBC A;  2BZ5 A;  1B63 A;  3GIG A;  4BIZ A;  3B24 A;  3GIF A;  2YKB A;  2ESA A;  2CCU A;  3ZKB A;  4R1F A;  3SL2 A;  2BRE A;  2XX2 A;  2XJX A;  2YE9 A;  3O6O A;  1QZR A;  3ZCC A;  3GIG B;  2WI2 A;  1ZWH A;  4HZ5 A;  4AS9 A;  1NHH A;  5GGZ A;  4FCP A;  2YED A;  4XE2 A;  2WER A;  5C93 A;  3OPD A;  1QY8 A;  2YKE A;  4O09 A;  2Q8G A;  4PU9 A;  1BXD A;  4EM7 A;  3LNU A;  4EGK A;  2VCJ A;  3D2R A;  2CG9 A;  3INW A;  4KP4 A;  1Y4U A;  3K99 A;  4I5S A;  2YE3 A;  2QG0 A;  4WUC A;  1NHJ A;  4GT8 A;  3R4M A;  3OWB A;  4LWG A;  1UYM A;  4CWT A;  4XTJ A;  2Q2E B;  5D7D A;  3A0Y A;  1UYF A;  5F3K A;  3ZRX A;  2WI1 A;  4CWN A;  4CWQ A;  5M4N A;  3TK1 A;  4NH9 A;  5J71 A;  4FCR A;  1US7 A;  3R91 A;  5FWK A;  2VCI A;  4AWO A;  5M4H A;  4GEE A;  1F51 A;  3HZ5 A;  3D0B A;  2QM7 A;  4CWF A;  4H81 A;  4URM A;  2YEJ A;  5BOC A;  3KE6 A;  2E0A A;  1Y4S A;  4XCJ A;  2JKI A;  1I5A A;  4R3A A;  3U2K A;  4BXI A;  2XHT A;  3CGZ A;  1YET A;  3B28 A;  3MNR P;  1AH6 A;  4CWS A;  3CGY A;  2YE5 A;  2XJJ A;  2QG2 A;  3WHA A;  2HCH A;  2YE6 A;  2H8M A;  5CF0 A;  4BQG A;  2IOQ A;  3ZM7 A;  1UYE A;  3VAD A;  4LWI A;  5IDM A;  4AWP A;  1AM1 A;  3C11 A;  5BOD A;  2YEB A;  4XC0 A;  1Y8N A;  3RKZ A;  3T1K A;  2XDU A;  2YEA A;  4MT8 A;  4P8O A;  2XX4 A;  2LFR A;  2BTZ A;  4O07 A;  4BIU A;  4CWO A;  2FWZ A;  2K5B A;  4YKW A;  1YS3 A;  2YKJ A;  5B1O A;  2BU7 A;  4LPB A;  2FTK A;  3JZ3 A;  3O2F A;  2WI3 A;  3QTF A;  3K60 A;  1TID A;  2BU5 A;  4YKQ A;  4HZ0 A;  2IOR A;  3T0Z A;  4L91 A;  1EA6 A;  3D36 A;  2XCM A;  2WEP A;  4L94 A;  4JYC A;  5FNC A;  1YC4 A;  4KFG A;  2XHR A;  2IWU A;  2UWD A;  4YKY A;  3G7B A;  4O04 A;  1B3Q A;  4GFN A;  4HYP A;  3NXS A;  5M4E A;  2BU8 A;  1OSF A;  3CWV A;  2GQP A;  3VHD A;  2BU2 A;  2YE4 A;  3ZKD A;  2LFS A;  1BKN A;  3OMU A;  4HY6 A;  2HG1 A;  3TZ2 A;  4NH7 A;  3Q5K A;  5IDJ A;  3Q5J A;  3NMQ A;  4Q20 A;  2PNR A;  4H85 A;  1UYD A;  3CRK A;  3TTZ A;  4XKO A;  2O1V A;  3EHF A;  4ASF A;  2QF6 A;  5D6P A;  4B7P A;  1YSR A;  2CH4 A;  4NH8 A;  1S14 A;  2IWS A;  3ZXO A;  5FND A;  1U2O A;  4ASG A;  1THN A;  4URO A;  4GCZ A;  2YE7 A;  3A0T A;  1UYH A;  1UY7 A;  2XJG A;  4E00 A;  4U7O A;  4KSG A;  4FMT A;  1GJV A;  2WI5 A;  4E01 A;  1Z59 A;  3GIE A;  4CE3 A;  4AWQ A;  3FT8 A;  2WI4 A;  4ZKI A;  2CCT A;  4CE1 A;  5CPH A;  4HXW A;  5D7R A;  3ZRW A;  2YI6 A;  3BM9 A;  1AH8 A;  1A4H A;  1UY6 A;  2JJC A;  3PEH A;  2YE2 A;  2EXL A;  5CTW A;  5CTU A;  4EGI A;  3T2S A;  2Q8I A;  5D6Q A;  1TH8 A;  4EFT A;  4MTX A;  4FPP A;  2C2A A;  2Q8H A;  4EFU A;  3EKR A;  4MPE A;  4GT1 A;  3RLR A;  3ZRW B;  2YI5 A;  3R4N A;  4LWE A;  4U93 A;  4L8Z A;  2ZBK B;  3HZ1 A;  1Z5A A;  1ZW9 A;  3B27 A;  3TZ4 A;  2XDX A;  4PRX A; 
#chains in the Genus database with same CATH topology
 4D6T H;  5LHG A;  2HKJ A;  4JI7 B;  2XDL A;  5JH7 A;  1B06 A;  4DUH A;  4HXZ A;  4BR6 A;  2VS0 A;  1G8M A;  3TJT A;  1KMI Z;  1ZL8 A;  1BSM A;  2WWW A;  5JJN B;  2ZXW C;  1NHI A;  4P9O A;  4PA4 A;  2YI0 A;  1QHT A;  4RUE A;  1EBO A;  3FB8 C;  1SC5 B;  2GFD A;  4LFB O;  4PL9 A;  2A06 H;  2EIN C;  4J9Z B;  2Q0O C;  4DW0 A;  1HNW B;  3CCJ V;  3ETE A;  4PRV A;  3B40 A;  5LMU O;  2A79 B;  5EBW C;  5KHG A;  1ZSP A;  3EFF K;  2DQ0 A;  1IBM O;  4UUJ C;  3JYC A;  3D36 C;  2BTO A;  1K9M W;  4DV6 O;  2M6Y A;  2UXN A;  4XDJ A;  4PI0 A;  4XIP A;  2DQ3 A;  4X9Q A;  3TZ5 A;  2CH7 B;  2QM4 A;  3A0H Z;  1JOY A;  3EKO A;  3ZXQ A;  2EIJ C;  4GGL A;  1TUB A;  3T2M A;  3H1K H;  4IYH A;  3RLQ A;  4H7Q A;  4FZ1 A;  1V54 C;  4O2A B;  3CRL A;  2CTP A;  4CWP A;  1THZ A;  5B5E Z;  5EIB C;  2LJ2 A;  3S3W A;  2P6J A;  1RM1 C;  1WPX A;  3B25 A;  3BFR A;  3THO A;  3MAQ A;  3RVY A;  4YKT A;  2RCV A;  1BGQ A;  4JI6 B;  3ZIA G;  3K9A A;  2ZKJ A;  5IYZ B;  4I3H A;  2YEG A;  1OCO B;  2XD6 A;  4GQT A;  2E75 B;  4KSH A;  1Y76 A;  2CTQ A;  4JAU A;  2Y48 A;  4NXN B;  2PUS A;  4LFA B;  2PZS A;  1QU7 A;  1M5I A;  4GKK O;  1AR5 A;  3G7E A;  1NQT A;  1QNM A;  4DR1 O;  2UUC O;  1MX0 A;  4P9P A;  3JSN A;  4DV0 B;  1LUV A;  4DO2 A;  3ABT A;  2KG7 A;  4DR4 B;  1TC6 A;  1K34 A;  1UJW B;  1Q90 D;  3UT5 A;  3ML0 A;  4F4L A;  1IX9 A;  1M57 B;  1XI1 A;  4DR6 O;  1I7F A;  4JV5 B;  1I5C A;  1VQK V;  3RW0 A;  5KHJ A;  4YKX A;  1SQP H;  1AJ6 A;  3LPS A;  3R4O A;  4BQJ A;  2FYU H;  4U7N A;  4OXS A;  3TXS A;  4ZHQ A;  5LP6 B;  1S5L Z;  4O2B A;  2XHX A;  2W0F C;  1H8H G;  4QPJ A;  4WBN A;  4O05 A;  3FT5 A;  3CHX A;  3L70 H;  1GRJ A;  2K1E A;  2P7T C;  1UYK A;  3BMY A;  1MOF A;  1Z5C A;  4AQY O;  1I5X A;  4OX9 B;  5IN9 A;  4E72 A;  3K98 A;  4LF7 B;  2ZNJ A;  4U3J A;  2BYH A;  2FML A;  2XAG A;  1JQ0 A;  3OD4 A;  1G4Y B;  1GH6 A;  3OM3 B;  2P4V A;  4DR2 O;  1QYE A;  4NXM B;  4WFG A;  3LMM A;  2QA4 V;  4DR5 B;  4R8C A;  4MPN A;  2ITC C;  2YEH A;  5JCO C;  3A0W A;  2ZDX A;  1SQX H;  1UYC A;  2AHZ A;  3JAK B;  4FZ0 A;  4J11 A;  4P7A A;  3BHP A;  3B09 A;  1HDJ A;  4MVR A;  4ZBM A;  2XDS A;  4YKZ A;  3B26 A;  3LSQ A;  1NBM G;  1I94 B;  4ZHQ B;  5FPR A;  2ARH A;  1EN4 A;  4PJ0 Z;  2YEV B;  2YEE A;  4K8X A;  3VBB A;  3G6B A;  2WA4 A;  1VQ7 V;  2AXT Z;  3VHC A;  1Q6U A;  5M4P A;  1SQV H;  4QE9 A;  1DF4 A;  5LHI A;  4HNA B;  1I5B A;  1E79 G;  1PV0 A;  2CK3 G;  3AK3 A;  3GVM A;  4MVO A;  3WQ9 A;  3OUF A;  1BMF G;  1CP9 A;  1Y4M A;  3A2F A;  1XMQ O;  1SA0 B;  3JAR A;  3M7M X;  4WFH A;  1AI5 A;  2YJW A;  2GTS A;  2ZDY A;  2R9A A;  2XT9 A;  4JI4 O;  4O4J A;  1P84 F;  5F5R A;  3LUT B;  4GX1 A;  3WG7 C;  5IY5 B;  1MSD A;  4F6R B;  2NNU A;  1JA8 A;  2YKB A;  3CRR A;  2ESA A;  1YTF B;  2Q67 A;  1JPX A;  2RN9 A;  4E2L A;  5CB4 B;  3SL2 A;  3PN1 A;  4W4K A;  4AI8 A;  2P90 A;  2XJX A;  2YE9 A;  1QZR A;  1RPO A;  3C90 A;  1PD3 A;  4UCT A;  3CXC U;  5LXT B;  2EIN B;  5TIS Z;  2WER A;  3FFQ A;  2EIK B;  1AI6 A;  2GUZ A;  3CWB H;  4Z1V A;  2E76 B;  2B9Z A;  3JD1 A;  1GKF A;  2ZD9 A;  2ODM A;  1H8E G;  3RYH B;  5CBF A;  2BOC C;  4LF9 B;  3HKD A;  1YVW A;  4KP4 A;  1M57 C;  1FFX A;  3G67 A;  1X59 A;  4X66 O;  1NVP D;  4QNH B;  3K99 A;  2YE3 A;  1I5Y A;  3BA8 A;  2LW1 A;  3QO8 A;  1GN6 A;  2Q2E B;  1VF6 A;  3HKB A;  3A0Y A;  1UYF A;  5LGU A;  2XAF A;  5BR8 B;  3CMA V;  1P7B A;  5M4N A;  1UPG A;  1IUR A;  3L74 H;  4TT3 G;  4NH9 A;  1H2L A;  1PM9 A;  4FCR A;  2P4K A;  3AEI A;  3RYF A;  5FWK A;  4JI8 O;  2VCI A;  4AWO A;  3CP1 A;  3BY6 A;  4LF4 B;  1KU9 A;  4LF6 B;  3D0B A;  2CAZ C;  2QM7 A;  4MVU A;  4CWF A;  1GTO A;  1G6U A;  1US6 A;  5BOC A;  1Y4S A;  1SES A;  5L3E A;  4XCJ A;  2W0X A;  3NR7 A;  5B3S B;  1XMO B;  1YET A;  3B28 A;  1AH6 A;  2Q73 A;  3CGY A;  2NR5 A;  1PL4 A;  1CEZ A;  3AG3 B;  1S72 V;  4YJ2 B;  4DV1 B;  2HCH A;  3A0B Z;  5LMN B;  1UYE A;  4LWI A;  3SPH A;  1XIL A;  1OCC C;  2PYJ A;  4K3A A;  4B3M B;  4AWP A;  4O2B B;  5BOD A;  1GN2 A;  4YY3 O;  1F23 A;  4UVC A;  4YJ3 A;  4X1K A;  1F4N A;  2ZM6 B;  1FJG O;  1S0V A;  1Y66 A;  2BTZ A;  4O07 A;  2DOS A;  2Q0A A;  2JDI G;  2KB1 A;  2ZCE A;  1L1F A;  1B6Q A;  3H1L H;  2FTK A;  3L9D A;  4DV5 O;  1JJ2 U;  3QTF A;  1VAR A;  2EJ7 A;  1TID A;  1H2G A;  1W0K G;  2H94 A;  4K35 A;  4YKQ A;  4DV5 B;  4HZ0 A;  3F5W C;  2IOR A;  3ZHS A;  3K9S A;  1SA0 A;  3D36 A;  2DN9 A;  2Y0P A;  3I56 V;  1FS0 G;  4X20 A;  3S3X A;  3X2Q C;  3OTO O;  4KFG A;  1M56 C;  4FM0 A;  1GO3 F;  3LDC A;  4YKY A;  2IJI A;  3ASO B;  1AI7 A;  2HG5 C;  4PI2 A;  1O9G A;  2ZXW B;  4J10 A;  5KX5 B;  5KA6 A;  3JSL A;  4F6E A;  4X1K B;  1FJG B;  1N36 O;  1B04 A;  3VHD A;  3ZKD A;  3KKY A;  1A32 A;  1VQO V;  3U0Z A;  1SQQ H;  5DEC A;  1R3L C;  3N2K A;  4WFE A;  2GV9 A;  3LSU A;  4DV0 O;  4B3M O;  2B1G A;  1KC8 W;  4JI8 B;  3Q5K A;  3Q5J A;  3NMQ A;  2PNR A;  3RYI A;  4H85 A;  3TTZ A;  4QE7 A;  3LSS A;  4B08 A;  5IJ9 B;  2YUA A;  4NH8 A;  4PA7 A;  3D3I A;  2IWS A;  3OMI B;  1NH2 B;  4MS2 A;  2UU9 O;  1U2O A;  3GWO A;  3CCU V;  4ASG A;  4URO A;  4GCZ A;  3A0T A;  1UY7 A;  4E00 A;  4U7O A;  4KSG A;  1GJV A;  3AG4 C;  5D5Q A;  2F93 B;  4X8A A;  2PI4 A;  3T1H O;  1U97 A;  3SPC A;  4CH6 A;  4LF4 O;  1MMM A;  4B3R B;  2X0L A;  2YI6 A;  2LQT A;  5H6R A;  2WPD G;  1PPJ H;  5LP6 A;  2P06 A;  1UY6 A;  5B1A C;  4NVP A;  3SYA A;  1AP5 A;  1FYJ A;  5D6Q A;  4EFT A;  1H2M A;  2C2A A;  4J80 A;  3G4S V;  2Q8H A;  3IAY A;  4X1I B;  2OCC B;  3QG5 A;  3ZRW B;  3AG3 C;  1HR0 O;  1PNL A;  1MZE A;  2QR4 A;  5L3F A;  3CCV V;  3K0G A;  1N32 O;  1COW G;  5EYP B;  4I0X B;  3AK2 A;  2CGO A;  1VQ9 V;  2EIL C;  3ASN C;  4DV6 B;  5J2U B;  2XX5 A;  4H0L B;  1EI1 A;  4CH5 A;  5JWP A;  2IJK A;  4WBN B;  3ZMT A;  2HP8 A;  2UUB B;  1O9H A;  3OR7 C;  1Y8O A;  2CCS A;  3R4P A;  2YI7 A;  2YEC A;  2YI9 A;  3VQX A;  1XRE A;  2P5O A;  4O4H B;  2IOP A;  1Z5B A;  1I58 A;  1WB7 A;  4LFB B;  1S16 A;  2WI7 A;  3BEH A;  2X6B A;  3TCU A;  1QVG U;  4OPA A;  1S5H C;  3I5D A;  4XDM A;  4LF7 O;  3IC7 A;  2CDY A;  2B1I A;  4JI4 B;  4HBN A;  3ZX6 A;  5B1A B;  1I5D A;  4MOT A;  3CRM A;  2UXB B;  3P30 A;  3EHJ A;  4ABM A;  1YXB A;  2FWY A;  5JQG B;  5JEN A;  3MD0 A;  2UUA B;  4I55 B;  2UXC B;  1NTZ H;  3L72 H;  2JJ2 G;  2E74 B;  3CJH B;  4NTW A;  3CRA A;  3FX7 A;  3WG7 B;  1OZ0 A;  2QM8 A;  1WA8 B;  4JV5 O;  2QKA A;  2W6I G;  3A0X A;  1OCZ B;  3SJA C;  3APO A;  1Y74 A;  1IDS A;  1YEW A;  2MK3 A;  4ZI7 B;  3H80 A;  4UVB A;  5JVD A;  3K0D A;  1JR9 A;  2GBO A;  4KTN A;  1E1Q G;  3A0R A;  4YY3 B;  1S3J A;  4EMV A;  2QWO B;  3SR2 C;  3FD9 A;  1SZT A;  1RPR A;  1Q6I A;  5H2F Z;  4BAE A;  3E22 A;  2VRZ A;  2OWO A;  4E02 A;  1IZ3 A;  1WPB A;  2HR3 A;  1YJW V;  4DK0 A;  1K33 A;  3AG2 B;  4NR1 A;  3WFV A;  1Z5V A;  1MA1 A;  4JPR A;  5H9C A;  3OR6 C;  1OV9 A;  2QKS A;  4G27 B;  4JI2 B;  2WSS G;  1JCH A;  2FL4 A;  5KHI A;  1UYI A;  2WAM A;  4DUY B;  4J7Z A;  5L3C A;  2EZP A;  3N2G B;  1N4C A;  2D3O W;  1TBW A;  4XIR A;  3BAA A;  2R70 A;  4K0K B;  3T4Z A;  2LO1 A;  3ZHQ A;  3KG2 A;  1QR8 A;  1VF7 A;  5KHH A;  3G71 V;  2O1W A;  2BT0 A;  1OHH G;  2BOB C;  3FAV A;  4LFA O;  4X1Y B;  1I0H A;  4P30 A;  1R3J C;  2VQE O;  1GK9 A;  4C7U A;  3CCS V;  5FL7 G;  4AIL C;  5D7C A;  2Q68 A;  3DGE A;  5CA1 A;  1OCZ C;  2HVK C;  4J9Y B;  2GHY A;  1VQ5 V;  4MPC A;  4O0B A;  1L8D A;  3WB1 A;  1UFI A;  2F4V O;  1NKD A;  3CPW U;  2HHH B;  1N33 O;  4B6C A;  2CGN A;  2CTR A;  2YXH A;  3HB3 B;  1F7Y A;  2YC0 A;  4F6R A;  1AR4 A;  2CH7 A;  1Q81 W;  4CC5 A;  3E83 A;  4W7T A;  3WU2 Z;  3QNE A;  1K8A W;  3K06 A;  4YJ2 A;  2WLI A;  4GKK B;  1BGY H;  4HZ3 A;  2UXX A;  4G28 B;  4H44 B;  1XMQ B;  1JM6 A;  2KKW A;  5IE9 A;  3JAL B;  3ZJZ A;  4LF8 B;  4XD8 A;  3MDS A;  4ASA A;  4MB9 A;  2HJF C;  4GUN A;  4EKW A;  3ZED A;  1MG1 A;  4XCL A;  3W7W A;  3W7T A;  2F95 B;  3CSX A;  4I9Q A;  1XL4 A;  2DWE C;  2ZIN A;  4BW9 A;  4X9L A;  2EZO A;  2WLL B;  2CUG A;  1YES A;  3K97 A;  2IU3 A;  3O0I A;  2IW5 A;  5LYJ A;  3AG4 B;  2GSM B;  2CGF A;  5JJJ B;  1U0Z A;  3ABK C;  4XKK A;  4UV9 A;  4WFF A;  4JI3 B;  1BQ0 A;  1NU1 H;  3TZ0 A;  1R3I C;  3B8M A;  2LW7 A;  2A7W A;  2N74 A;  2E3C A;  1BHB A;  4ICG A;  2DW4 A;  3C0E A;  5LYJ B;  1YC3 A;  2QJ1 A;  3SDL A;  4EFB A;  1AMW A;  5H6Q A;  3BRC A;  4DR3 B;  4DV7 O;  5LGN A;  4ASB A;  1VF6 C;  2BSK A;  2XHB A;  2JVD A;  1YER A;  2V1D A;  1FFX B;  1N0J A;  4DZY A;  4YKU A;  4UB8 Z;  2BZ5 A;  3O9O A;  3CD6 V;  5KHK A;  3GIG A;  4BIZ A;  3B24 A;  3GIF A;  4JI1 O;  1K5Q A;  3O65 A;  3OGC C;  3ZKB A;  4R1F A;  4RWU A;  3O6O A;  1OCR B;  3CCQ V;  3GIG B;  3ABK B;  3BCC H;  4HZ5 A;  3F7V C;  4IIJ A;  4FFB B;  3TGU H;  4UFZ A;  5C93 A;  2UUC B;  3OPD A;  4NTY A;  2EX3 A;  2RDC A;  4JF3 A;  4FK5 C;  5JVD B;  1SKV A;  4O09 A;  4PEL A;  4IIJ B;  2VCJ A;  3DSQ A;  4PDL A;  4ZIB A;  1Q3E A;  1ZTE A;  1LNQ A;  3B8N A;  1K5S A;  2ILM A;  4X89 A;  4DR5 O;  2H3O A;  1NHJ A;  2QG0 A;  4WUC A;  4DR6 B;  4LWG A;  1UYM A;  4CWT A;  4Z2W A;  3OMA B;  1JFF A;  1HWY A;  3HKC B;  3TXQ A;  3ZRX A;  1HNZ B;  2WI1 A;  4CWQ A;  4LF6 O;  3CE2 A;  2C1I A;  4DR4 O;  2N04 A;  2PY5 A;  1M90 W;  1Z2G A;  2Q8V A;  5B3S C;  4JYA B;  1D2D A;  3JD3 A;  2FKX A;  4DV2 O;  3RVZ A;  3WB2 A;  1SQF A;  1S76 D;  4URM A;  3KE6 A;  2EIL B;  3ASN B;  4RUF A;  1YTF D;  3BVO A;  1XNQ B;  4FLV A;  4X62 O;  2JKI A;  4NB5 A;  2XHT A;  4DR3 O;  3MNR P;  4PD4 F;  1EZV H;  2NN4 A;  5B1B B;  4CWS A;  1M93 A;  2YE6 A;  2H8M A;  5CF0 A;  5CB4 A;  2IOQ A;  1GM7 A;  4UCO A;  5IDM A;  4D7S A;  4UVA A;  3C11 A;  1IBK B;  5AG2 A;  1OCC B;  1JVM A;  1KP2 A;  1NS1 A;  3T1K A;  4MT8 A;  1FXK C;  2F66 C;  1AJQ A;  1VQ8 V;  5BZB A;  4BIU A;  4CWO A;  1IBL B;  4B7E A;  1XNQ O;  5B1O A;  3L75 H;  1QBZ A;  4MTG A;  4LPB A;  3JZ3 A;  2KQX A;  3W7U A;  5A2Q N;  2QGN A;  2JS3 A;  4OGQ B;  2WI3 A;  4TQD A;  5CA3 A;  2BU5 A;  1ZWI C;  4MSW C;  1AB3 A;  4X64 O;  1EA6 A;  3FKS G;  5CBH A;  4L94 A;  4JYC A;  4GZR B;  4DV4 B;  4LBE C;  2LGQ A;  1FAF A;  3G7B A;  3ABL C;  1B3Q A;  3M99 B;  4O04 A;  3NXS A;  4BIO A;  3G6E V;  5J2U A;  1NH2 D;  2N05 A;  2GQP A;  3AG7 A;  3L71 H;  4UB6 Z;  4RO2 A;  3OMU A;  5GTI Z;  1KP3 A;  1Y67 A;  2DYR B;  4X88 A;  2OIE A;  1OJH A;  3CYG A;  4FIP C;  1H2S B;  4LCU C;  4K0K O;  3CRK A;  4P2Z A;  4XKO A;  3ABL B;  4ASF A;  2BTQ A;  4B7P A;  2PGG A;  5K1P A;  1S5J A;  4EFE A;  1S14 A;  3U10 A;  2ZNI A;  4NKG B;  3JAR B;  1FPO A;  3DC6 A;  4FFB A;  5FND A;  5EBM C;  1TVK B;  1Y6X A;  1GN4 A;  4B3S O;  1Q82 W;  2XJG A;  3R65 A;  4JTA B;  2ZT9 B;  3W7X A;  4TQF A;  5DN6 G;  2PYL A;  4JZ2 A;  5IWA B;  3L73 H;  4CBC A;  3OE7 G;  3E8G A;  1SQG A;  4ZKI A;  2CCT A;  4CE1 A;  3CRQ A;  5A9G A;  1W59 A;  4JYA O;  1XUQ A;  2OTL V;  4FM1 A;  2Y0I A;  1L0L H;  4W4L A;  3K58 A;  3PEH A;  3ZN0 A;  5HFM A;  1Q86 W;  1YIJ V;  2YE2 A;  3E35 A;  3JAS A;  3T2S A;  3CCL V;  4UCS A;  2EUL A;  4FPP A;  2QTS A;  4LH6 A;  4CZZ A;  2GUZ B;  1KUQ A;  2GDS A;  4GT1 A;  1H2K A;  3VOU A;  2YI5 A;  4U93 A;  3VQY A;  4L8Z A;  2ZBK B;  4GX5 A;  2OTJ V;  3B27 A;  3TZ4 A;  4MVS A;  2JGD B;  2IJJ A;  2YGF A;  5IYZ A;  1SZX A;  3OEE G;  4GX2 A;  1V55 B;  1Y8P A;  2XAH A;  2ADP A;  3KCY A;  1VP7 A;  2Q5Z A;  2OYQ A;  4QPK A;  5EYP A;  2EIM C;  1NTM H;  1MZF A;  5JH7 B;  2WLL A;  1PP9 H;  1MSW D;  5BY1 A;  1IXM A;  3RYC A;  4TV8 A;  2QEX V;  4JI1 B;  1JMK C;  1Q8I A;  3FYE B;  1NR1 A;  3U11 A;  5LL6 Y;  1KQS U;  1SS3 A;  1BE3 H;  2QWP B;  4X1Y A;  4L90 A;  3EXA A;  2UXD B;  3CS5 A;  3ZHV A;  2JK5 C;  3ZRV A;  5J6A A;  3JAW B;  5GON A;  3EHH A;  3A8T A;  4FLW A;  1H7U A;  5ITZ B;  3A0Z A;  3JAT B;  3R92 A;  4MP7 A;  3INX A;  5M4K A;  4LWH A;  1UY9 A;  1P7G A;  1VQM V;  1YCI A;  3HKE B;  2JRI A;  4G2K A;  1QCE A;  2EIK C;  1VQL V;  4LC1 A;  4X62 B;  1UY8 A;  2YK2 A;  4KL1 A;  1AJN A;  5M4M A;  4CWR A;  3RYH A;  4X64 B;  2VQE B;  5K1X A;  4LWS A;  2AW9 A;  4JI3 O;  4V25 A;  4R7C A;  1IBK O;  2CTW A;  3Q4H B;  5CA0 A;  3SYQ A;  4LFC B;  3IFX A;  1M1K W;  4URN A;  1YT2 A;  2DE0 X;  3ABU A;  2GTA A;  2BU6 A;  3P32 A;  4UXN A;  5IYC O;  4TOI A;  5LGT A;  5FNV A;  4CE2 A;  4DUY O;  1T5E A;  1L0O A;  1K4D C;  1J5E O;  2XTA A;  1DTO A;  1ZL8 B;  4UCV A;  1TUE B;  1UYL A;  1N0N A;  3KCX A;  3HKE A;  4CS4 A;  3AG1 C;  2UU9 B;  3SGI A;  2WLK A;  5IYD O;  1VQP V;  1YSZ A;  2VWC A;  2IBZ H;  4I9W A;  1NZ6 A;  1NR7 A;  1KKC A;  3JAS B;  4L93 A;  2IH3 C;  3F7Y C;  2WEQ A;  2DYS C;  2YDE A;  1DK1 A;  2F4V B;  3EHG A;  3MHS C;  4FLX A;  2KSD A;  4UV8 A;  5JCO A;  3K08 A;  4YHH O;  1F4M A;  4JYB A;  2WLJ A;  4ZVI A;  1ID0 A;  3ETG A;  3ABM B;  1AVM A;  1KIJ A;  3JD2 A;  1H38 A;  4XIT A;  3CXH F;  4XDK A;  4DYL A;  4XKA A;  2YSU B;  3S5T A;  1XOU A;  3VHA A;  3ICX A;  5FNF A;  1CXZ B;  4YKR A;  1VQ4 V;  4JI2 O;  1YDX A;  2ZE8 A;  1BCC H;  1X4T A;  4I4T A;  5J2T A;  4DW1 A;  4LF5 O;  4XIQ A;  5LP6 C;  5LOV B;  3D3Q A;  1BHA A;  4D7T A;  5EK0 A;  4X65 O;  5BMV A;  3RBZ A;  4IHJ B;  4TV9 A;  3HYY A;  2PF4 E;  3HR0 A;  1YT0 A;  2C1G A;  3JAL A;  4JAS A;  4DR7 O;  3HEK A;  1ZUQ A;  2ZE7 A;  5LMN O;  4JAV A;  4FCQ A;  1PVG A;  3UQ8 A;  1YT1 A;  2ZE6 A;  4LP0 A;  4R3M A;  2Q4P A;  3E8F A;  1VF5 B;  3U2D A;  4I0X A;  2FXS A;  1R62 A;  3HHU A;  3H9V A;  3ABM C;  1VQN V;  4DXW A;  4CH3 A;  2LGW A;  1XHZ A;  2UUB O;  2UUA O;  3FYI B;  2XDK A;  1I59 A;  4WUD A;  2YEF A;  2ZIO A;  1R3K C;  3ETD A;  2QFO A;  4Q6G A;  2EIM B;  4JYY A;  4I4T B;  5J2T B;  3SJQ C;  4JTD B;  1BQZ A;  2DMX A;  4NYK A;  4JI0 O;  5B1N A;  4MBC A;  2JS5 A;  2QWN B;  3AG2 C;  2WLH A;  4JI5 O;  5FPO A;  2XOK G;  2HLD G;  3CEI A;  1HR0 B;  4R6Z A;  1IXB A;  5JQG A;  1WN7 A;  4QGP A;  1GMG A;  4AHC A;  2BRE A;  3CB2 A;  2O57 A;  2AHY A;  3T4D A;  4LF8 O;  2XX2 A;  4YJ3 B;  2JJ1 G;  2WI2 A;  3FB7 C;  3MHH C;  3SJB C;  1ZWH A;  3QTC A;  4QIW F;  3HPL C;  4AS9 A;  4LF9 O;  4O4L A;  2FB5 A;  4BW5 A;  2EIJ B;  4FCP A;  4KHP O;  4B3R O;  3EVK A;  2YKE A;  1EFR G;  4B3T O;  5DED A;  4B7K A;  4PU9 A;  2Q8G A;  3BA9 A;  3K79 A;  4L8J A;  4GYC B;  4EGK A;  1GN3 A;  2HEP A;  1K4C C;  1DF5 A;  4MW8 A;  1Y4U A;  3R4M A;  3OWB A;  3APQ A;  3LNN A;  4XTJ A;  5D7D A;  2BE3 A;  2ZE5 A;  2WLI B;  1KBH A;  4CWN A;  3OAA G;  1BL8 A;  2ADQ B;  3M8A A;  2YXY A;  5J71 A;  1FXH A;  2YIC A;  3X2Q B;  1US7 A;  4JI0 B;  5M4H A;  4GEE A;  1YSC A;  3CX5 F;  5EBL C;  2HVJ C;  3GB7 C;  5KMG A;  3HZ5 A;  1JFF B;  2M7W A;  2HHH O;  1N33 B;  5BMV B;  2OT5 A;  2YEJ A;  4PHZ A;  3UO2 A;  1VIB A;  4R3A A;  3U2K A;  1AP6 A;  1K92 A;  4J42 A;  3SYO A;  2YE5 A;  2XJJ A;  4LR3 A;  2QG2 A;  3H1H H;  2ZM6 O;  4MTO A;  4BWA A;  4O4H A;  2Q6A A;  1AR1 B;  2Y4U A;  4GKJ O;  1KYO F;  4DV3 O;  1TUB B;  1TAE A;  5LXT A;  1GAX A;  4PDM A;  2E5L O;  4XC0 A;  2Y4T A;  2XUM A;  3OT7 A;  3RKZ A;  2XDU A;  2K9P A;  1N36 B;  4P8O A;  3DC5 A;  1V55 C;  2R9R B;  3JAK A;  1NI8 A;  2LFR A;  1QVF U;  3JAW A;  5GON B;  2YXL A;  3SPJ A;  5IYB O;  1XMO O;  1FXK B;  2FWZ A;  4ZOL A;  2HHI A;  2V7Q G;  5EZY A;  2YKJ A;  1QLN A;  3HKD B;  3OTO B;  2BU7 A;  1TGO A;  3N27 A;  3ZMZ A;  3K03 A;  3O2F A;  3E8B A;  3K04 A;  2QE7 G;  3T1Y B;  3QO5 A;  5LOV A;  4U3J B;  3OGI B;  2QWQ B;  1MAB G;  4GKJ B;  1S77 D;  4PA6 A;  3T1Y O;  2X6A A;  2BCC H;  4DV1 O;  3ZRS A;  2F1M A;  5FNC A;  3ZMS A;  4DV7 B;  2W6J G;  1QR9 A;  3UKM A;  3QO7 A;  4GFN A;  1N34 B;  1P49 A;  4KFM A;  1ARO P;  3FB6 C;  3OFN G;  5KAI Z;  3CWV A;  1NT2 B;  4H33 A;  4X66 B;  2YE4 A;  1RP3 B;  2LFS A;  1BKN A;  4HY6 A;  2L35 A;  4IGG A;  1YHQ V;  1WP7 A;  3DXR A;  2G38 A;  4DRX A;  2E5L B;  3TZ2 A;  1RSO B;  2VQF B;  1P4R A;  2KG7 B;  3K59 A;  5EZY B;  4DUZ B;  3JCZ A;  4KXR A;  4Q20 A;  2Z3Y A;  2OIG A;  1W0J G;  2O1V A;  4LNU A;  3EHF A;  2QF6 A;  5D6P A;  3ZHR A;  1RM1 B;  1SER A;  3F5T A;  4TWK A;  2YE7 A;  1R6N A;  1XL6 A;  1UYH A;  4GLX A;  4FM2 A;  4FMT A;  4I50 A;  5IT9 N;  1QQC A;  4E01 A;  1Z59 A;  3GIE A;  2Q69 A;  5ITZ A;  2QSA A;  3FT8 A;  2ZQM A;  1YJ9 V;  2ETN A;  5KUM A;  2WI4 A;  3CJH A;  5CPH A;  4PV1 B;  1SET A;  2YIB D;  4HXW A;  3ZRW A;  1ZLZ A;  1Y76 B;  3UO3 A;  1N32 B;  1I08 A;  2XND G;  1M56 B;  1AH8 A;  2ZDI C;  3T1H B;  3DXR B;  4DRX B;  1JJO A;  3SYP A;  2YID A;  4EGI A;  1TH8 A;  1N34 O;  1WLE A;  3H1J H;  4EFU A;  3EKR A;  4J7K A;  4MPE A;  2JEX A;  3LDD A;  3RLR A;  1VMG A;  1KB9 F;  3R4N A;  3Q4H A;  4IL6 Z;  4CS3 A;  5EC2 C;  1MNG A;  1Z5A A;  1ZW9 A;  4HNA A;  2RJZ A;  2DWD C;  2XDX A;  4X20 B;  1J95 A;  4PRX A;  4FLZ A;  1GKZ A;  2IJH A;  4DUZ O;  2Q7H A;  3AG1 B;  4I50 B;  3ZS8 C;  3JAM N;  1YZB A;  2VQF O;  4ASU G;  2JGD A;  1PNM A;  2O1U A;  2D2C B;  5LMU B;  3K3W A;  5GW7 A;  1ENV A;  4CH4 A;  4TV9 B;  1HNW O;  3UCS C;  1IVS A;  2VWK A;  1BZK A;  2HKO A;  1GM9 A;  4H13 B;  3RYI B;  1ZX3 A;  4TUY B;  5EC1 C;  4WFB V;  2IWX A;  3UT5 B;  2YKC A;  1CPY A;  2ZR3 A;  2JEU A;  3PJS K;  4JI5 B;  3SJC C;  1OCR C;  1I94 O;  2YGE A;  3P3P A;  1LUW A;  5KA5 A;  2BRC A;  4EEQ A;  2ZIM A;  1Q5O A;  4O2A A;  1FKA O;  3UM7 A;  4OPH A;  5EIB D;  5KAF Z;  1KZN A;  3RFR A;  1YC1 A;  4Z1M G;  3ETQ A;  3GWK C;  4MW3 A;  4WFA V;  2IH1 C;  1Q43 A;  4V26 A;  2UXC O;  3CC7 V;  2Y69 B;  3FB5 C;  3P3N A;  2Q7G A;  1Z5W A;  2BTQ B;  1PL0 A;  3TET A;  3RLP A;  2UXB O;  4LNU B;  1MU5 A;  1K73 W;  1TIL A;  3LNM B;  2X6C A;  4AQY B;  2XAJ A;  3ZHT A;  3T10 A;  3JCU Z;  1ZXM A;  1H7S A;  4DR7 B;  1N8R W;  2P67 A;  1UYG A;  2YGA A;  4J7J A;  1KEC A;  3FV5 A;  1R73 A;  2YE8 A;  5KUK A;  3OEH G;  4LWS B;  5GTH Z;  4X65 B;  2Q8F A;  1WB8 A;  3CC2 V;  1D5N A;  4K8Z A;  1Y74 B;  5E1A C;  4LF5 B;  3RT3 C;  4EGH A;  4EEH A;  1V9P A;  4MVM A;  4R50 A;  2H55 A;  2RQ6 A;  3J7A U;  5IY5 C;  4O4I A;  3N2K B;  3DTU B;  3I55 V;  3QVN A;  5L3D A;  3OW6 A;  4LWF A;  1J5E B;  1AIL A;  2FYP A;  3J81 N;  3H01 A;  3CC4 V;  2VW5 A;  2XAB A;  5H5N A;  4K4O A;  3U67 A;  2DYS B;  3R66 A;  2YKI A;  3IC9 A;  4KHP B;  1M4U A;  4E4E A;  2YEI A;  4KQV A;  1GKX A;  3RYC B;  3K57 A;  3Q5L A;  3EHB B;  3AK1 A;  4HY1 A;  3STZ C;  3IED A;  5F2V O;  5BR8 O;  5L3B A;  3G75 A;  4URL A;  3H4L A;  4JTC B;  5B66 Z;  5IJ0 B;  1G1X B;  4JI6 O;  3OW2 U;  5KMG B;  1H2N A;  3CYO A;  2LP7 A;  1QLE B;  4MP2 A;  4O4I B;  4YIP A;  3WB0 A;  3E8H A;  4JQL A;  2IU0 A;  5CTX A;  4DR1 B;  1XDC A;  1K7D A;  3HKB B;  3QDD A;  4L87 A;  2BSM A;  1TC0 A;  1ZXN A;  4WUB A;  4NXN O;  2WI6 A;  1YIT V;  2WLN A;  1XEQ A;  4WCE V;  3E22 B;  3HYZ A;  4HYM A;  4PDV A;  2ZR2 A;  2JGU A;  3OUS A;  3E2E A;  3CME V;  2QWR B;  4PA3 A;  2YJX A;  3CCE V;  2ZKO A;  3T1C A;  4HYO A;  2YIA A;  3ZHU A;  4FLY A;  4B3T B;  2BYI A;  1PNK A;  2YK9 A;  3OWD A;  4RQE A;  1SQB H;  3TUH A;  1DLB A;  3HKC A;  3N2G A;  4IHJ A;  5KX5 A;  3STL C;  3ASO C;  1TA8 A;  3B4S A;  3SPI A;  2F43 G;  5HFL A;  4RAI A;  4KUM A;  4PDR A;  2AZ0 A;  4EB6 A;  2AKP A;  5CN0 A;  1AI4 A;  4O4J B;  3FAV B;  3PEJ A;  3CRC A;  5CTY A;  5JJE B;  3ZMU A;  3T0H A;  2Z5U A;  1B62 A;  2QTO A;  5D5P A;  1LR1 A;  4TUY A;  2XK2 A;  3SPG A;  1ZAU A;  2A0L A;  5IJ9 A;  3QF7 A;  3BPZ A;  1BYQ A;  2X7R B;  1EN5 A;  1VEW A;  1OCO C;  5L3J A;  1HW7 A;  2YS8 A;  1EM1 A;  1BT8 A;  4MVZ A;  1PKX A;  1ROP A;  1B63 A;  3LDE A;  4H37 A;  4YHH B;  4FFK A;  3OTF A;  2CCU A;  3K5M A;  5LBQ A;  3E86 A;  4J41 A;  2B5U A;  1NTK H;  4XBF A;  3OMN B;  1NVP B;  3JAT A;  1SF9 A;  1WJZ A;  4DR2 B;  1K97 A;  4DK1 A;  1DGS A;  1RFY A;  3ZCC A;  4BAY A;  2OCH A;  4DV3 B;  1NHH A;  5GGZ A;  4X1I A;  2YED A;  4XE2 A;  4FVM A;  4FJC C;  1QY8 A;  3ZN1 A;  3B77 A;  1L0N H;  1BXD A;  3VQW A;  4EM7 A;  1FXV A;  2L6L A;  2XAS A;  4O4L B;  4WF9 V;  3LNU A;  1E1R G;  2HJD A;  3RWR D;  4UCU A;  3D2R A;  2CG9 A;  3INW A;  2JIZ G;  5CA0 B;  4I5S A;  1XHX A;  4GT8 A;  4NXM O;  1HNX B;  4GX0 A;  4XDL A;  5F3K A;  3K5O A;  5L3G A;  1V54 B;  5FLX N;  1FFT B;  2YEV A;  3TK1 A;  2V4D A;  4LH7 A;  5CBG A;  1VQ6 V;  3ZMV A;  3R91 A;  4MTF A;  2OCC C;  1R6K A;  1Q7Y W;  5LA6 B;  1F51 A;  3CCM V;  2VWJ A;  2P22 C;  2DYR C;  3K5L A;  4H81 A;  2R9I A;  3KZI Z;  4A5U B;  5J9P C;  3B2E E;  1EN6 A;  2E0A A;  1JX9 A;  1I5A A;  4BXI A;  3CGZ A;  3BAB A;  1RSO A;  3WHA A;  4BQG A;  3C3S A;  4TV8 B;  1WA8 A;  3ZM7 A;  3VAD A;  1GM8 A;  2EJR A;  4NTX A;  1R1B A;  2A9H A;  1K3E A;  4I7Z B;  4LP8 A;  4EB6 B;  1EZJ A;  4N23 A;  1AM1 A;  2R72 A;  5CMU A;  2YEB A;  4U3F H;  3CCR V;  2QDO A;  4JZG A;  1Y8N A;  5IJ0 A;  1NJI W;  2YEA A;  3C3T A;  4CC6 A;  2XX4 A;  3IGA C;  1YF2 A;  2ZDI A;  2K5B A;  4YKW A;  1YS3 A;  1QLE C;  5C8Y B;  2YI8 A;  4DV4 O;  4IYI A;  2H8P C;  1FXK A;  4TSF G;  4LFC O;  2CE4 A;  1KD1 W;  4UCR A;  4JI7 O;  4ZOL B;  1W2B U;  3K60 A;  2RNB A;  1IBM B;  3SYC A;  1ORQ C;  4CS2 A;  3T0Z A;  2UXD O;  2QKC A;  4L91 A;  2XAQ A;  3G80 A;  2XCM A;  2WEP A;  4IT5 A;  2Y69 C;  1YC4 A;  2XHR A;  2Q9L A;  4FLU A;  2IWU A;  2UWD A;  1HNZ O;  4HYP A;  4QJF B;  5B1B C;  2IM9 A;  1FD9 A;  3RN4 A;  1IBL O;  3IJ4 A;  5M4E A;  2BU8 A;  1WNS A;  1WP8 A;  4FLT A;  2ITD C;  4HAM A;  5BXZ A;  3VQV A;  1XQ8 A;  4JGS A;  1OSF A;  1URF A;  5FNV B;  2BU2 A;  5CA1 B;  4DV2 B;  1R6T A;  2NLJ C;  2HG1 A;  4NH7 A;  2Q7E A;  2MW2 B;  3E89 A;  1Q6H A;  5KLV H;  2WLM A;  2WA3 A;  5C8Y A;  5IDJ A;  1UYD A;  5LHH A;  1U96 A;  1YSR A;  2CH4 A;  3J80 N;  1YI2 V;  4ZI7 A;  3ZXO A;  2BSK B;  3W7S A;  2AZ2 A;  1WAZ A;  5DM6 V;  4JAA A;  1HNX O;  1THN A;  2RMK B;  2YIB A;  3RYF B;  2EBO A;  4I55 A;  4YXW G;  2WI5 A;  1TVK A;  2PI5 A;  1M9N A;  2A3Q A;  4OX9 O;  3RGB A;  4CE3 A;  4AWQ A;  3K5N A;  1KKD A;  2HFE C;  1YJN V;  5D7R A;  2F23 A;  3BM9 A;  2AGA A;  1XBL A;  3JD0 A;  4N21 A;  1A4H A;  2PTM A;  2JJC A;  5IWA O;  3JD4 A;  5E79 Z;  1D5A A;  1XNR O;  2EXL A;  5CTW A;  1BS3 A;  2Z0A A;  5CTU A;  2Q8I A;  3ZBH A;  4RQF A;  4MTX A;  4PA9 A;  4B3S B;  5LA6 A;  4MVQ A;  1XNR B;  3D8C A;  4LWE A;  1SRY A;  2DJV A;  1AJP A;  3HZ1 A;  1HP8 A;  4YIO A;  2ATK C;  3H1I H; 
#chains in the Genus database with same CATH homology
 1GKZ A;  2IJH A;  2IJJ A;  2YGF A;  3OEE G;  1VQ9 V;  4GX2 A;  2EIL C;  3ASN C;  5LHG A;  3AG1 B;  2HKJ A;  1V55 B;  1Y8P A;  2XDL A;  2XX5 A;  4DUH A;  4HXZ A;  2XAH A;  4ASU G;  1EI1 A;  1PNM A;  2IJK A;  2O1U A;  1G8M A;  3ZMT A;  4QPK A;  2EIM C;  3OR7 C;  2WWW A;  1Y8O A;  2CCS A;  3R4P A;  2YI7 A;  3K3W A;  2WLL A;  2ZXW C;  1ENV A;  5GW7 A;  2YEC A;  1MSW D;  4P9O A;  1NHI A;  1IXM A;  4PA4 A;  4RUE A;  2YI0 A;  1EBO A;  3FB8 C;  2GFD A;  4PL9 A;  2QEX V;  2HKO A;  1Z5B A;  1GM9 A;  1I58 A;  2IOP A;  5EC1 C;  2EIN C;  4WFB V;  1S16 A;  2WI7 A;  3FYE B;  4J9Z B;  1NR1 A;  2IWX A;  3BEH A;  2X6B A;  3CCJ V;  3ETE A;  3TCU A;  1QVG U;  1KQS U;  1CPY A;  2ZR3 A;  2YKC A;  4PRV A;  2JEU A;  3PJS K;  2A79 B;  4L90 A;  5EBW C;  1S5H C;  1OCR C;  4XDM A;  3IC7 A;  2YGE A;  2JK5 C;  3ZRV A;  5J6A A;  3EHH A;  3EFF K;  2DQ0 A;  4UUJ C;  2B1I A;  5KA5 A;  3JYC A;  1H7U A;  5B1A B;  1I5D A;  2BRC A;  1K9M W;  4MOT A;  3A0Z A;  3P30 A;  3EHJ A;  2UXN A;  4XDJ A;  3R92 A;  4MP7 A;  3INX A;  5M4K A;  4LWH A;  3UM7 A;  2FWY A;  1UY9 A;  3MD0 A;  4XIP A;  1VQM V;  2DQ3 A;  4G2K A;  1QCE A;  3TZ5 A;  1KZN A;  2EIK C;  2JJ2 G;  1YC1 A;  4Z1M G;  1VQL V;  4MW3 A;  4WFA V;  3WG7 B;  1OZ0 A;  2EIJ C;  2IH1 C;  2QM8 A;  4LC1 A;  1JOY A;  1UY8 A;  3EKO A;  4GGL A;  2YK2 A;  3CC7 V;  4V26 A;  3T2M A;  2Y69 B;  1AJN A;  3RLQ A;  2W6I G;  3FB5 C;  4CWR A;  5M4M A;  3A0X A;  1OCZ B;  4H7Q A;  1PL0 A;  3TET A;  3RLP A;  3H80 A;  1V54 C;  2MK3 A;  3CRL A;  4UVB A;  1MU5 A;  4CWP A;  3K0D A;  1K73 W;  1THZ A;  3LNM B;  1TIL A;  2X6C A;  4V25 A;  2XAJ A;  3T10 A;  4R7C A;  1E1Q G;  3A0R A;  4KTN A;  1S3J A;  3SYQ A;  4EMV A;  1ZXM A;  1H7S A;  1N8R W;  2P67 A;  1UYG A;  1SZT A;  2P6J A;  1RM1 C;  2YGA A;  3IFX A;  1M1K W;  1KEC A;  1WPX A;  1YT2 A;  3B25 A;  3FV5 A;  3ABU A;  4URN A;  1R73 A;  2YE8 A;  1RPR A;  4E02 A;  5KUK A;  4BAE A;  2BU6 A;  3OEH G;  3P32 A;  3RVY A;  4UXN A;  5IYC O;  4YKQ A;  4YKT A;  5LGT A;  4CE2 A;  2Q8F A;  2HR3 A;  1YJW V;  3CC2 V;  1BGQ A;  5E1A C;  1L0O A;  3ZIA G;  1K33 A;  1K4D C;  3AG2 B;  3K9A A;  3WFV A;  2ZKJ A;  4EEH A;  4MVM A;  4R50 A;  2H55 A;  4I3H A;  2YEG A;  1OCO B;  4JPR A;  5H9C A;  1DTO A;  3OR6 C;  5IY5 C;  2XD6 A;  3DTU B;  4GQT A;  4KSH A;  2QKS A;  3I55 V;  4G27 B;  1TUE B;  1UYL A;  4JAU A;  5L3D A;  2WSS G;  1JCH A;  3OW6 A;  4LWF A;  1UYI A;  3AG1 C;  2Y48 A;  2WAM A;  2FYP A;  2WLK A;  3H01 A;  5L3C A;  2EZP A;  5IYD O;  1VQP V;  3CC4 V;  1YSZ A;  2VW5 A;  1NQT A;  2VWC A;  3G7E A;  2DYS B;  4K4O A;  2YKI A;  3U67 A;  2D3O W;  4I9W A;  1TBW A;  1NR7 A;  4XIR A;  1MX0 A;  4L93 A;  3T4Z A;  2IH3 C;  4P9P A;  3KG2 A;  2YEI A;  1GKX A;  4KQV A;  3F7Y C;  1QR8 A;  3G71 V;  2O1W A;  2WEQ A;  2BT0 A;  3Q5L A;  4DO2 A;  3EHB B;  1OHH G;  3ABT A;  2BOB C;  1TC6 A;  2DYS C;  3STZ C;  3IED A;  4HY1 A;  1K34 A;  4P30 A;  1UJW B;  1R3J C;  1GK9 A;  3CCS V;  5FL7 G;  5D7C A;  3ML0 A;  2Q68 A;  4F4L A;  5L3B A;  3MHS C;  3DGE A;  3EHG A;  1M57 B;  1OCZ C;  2HVK C;  4J9Y B;  2GHY A;  4UV8 A;  1VQ5 V;  3G75 A;  4L94 A;  3H4L A;  4MPC A;  4URL A;  4JTC B;  1I5C A;  4O0B A;  1VQK V;  3RW0 A;  4YKX A;  1NKD A;  3K08 A;  1F4M A;  4JYB A;  3CPW U;  3OW2 U;  2WLJ A;  1AJ6 A;  3LPS A;  3R4O A;  4ZVI A;  4U7N A;  4B6C A;  4BQJ A;  1ID0 A;  3HB3 B;  4OXS A;  3ETG A;  3CYO A;  3ABM B;  2XHX A;  2LP7 A;  1KIJ A;  1QLE B;  1H8H G;  2W0F C;  3JD2 A;  4QPJ A;  4MP2 A;  4O05 A;  3FT5 A;  3E8H A;  1H38 A;  4JQL A;  2IU0 A;  2K1E A;  4XIT A;  2P7T C;  1Q81 W;  4XDK A;  5CTX A;  1K7D A;  2YSU B;  3E83 A;  1UYK A;  3BMY A;  4XKA A;  4W7T A;  1MOF A;  3QDD A;  4L87 A;  3QNE A;  1Z5C A;  2BSM A;  1I5X A;  1K8A W;  3K06 A;  1TC0 A;  2WLI A;  1ZXN A;  5IN9 A;  4HZ3 A;  3K98 A;  2UXX A;  4G28 B;  3VHA A;  4WUB A;  2BYH A;  5FNF A;  2XAG A;  1JQ0 A;  2WI6 A;  1YIT V;  1G4Y B;  2WLN A;  1JM6 A;  3OM3 B;  4YKR A;  1VQ4 V;  1QYE A;  4WCE V;  3ZJZ A;  4WFG A;  4XD8 A;  2QA4 V;  3HYZ A;  4HYM A;  4ASA A;  4MB9 A;  2HJF C;  4PDV A;  4EKW A;  4R8C A;  2ZR2 A;  4MPN A;  2ITC C;  1MG1 A;  3OUS A;  3E2E A;  3CME V;  4PA3 A;  2YEH A;  2YJX A;  3CCE V;  2ZDX A;  3A0W A;  4XIQ A;  4XCL A;  3W7W A;  3W7T A;  3ZXQ A;  1BHA A;  1UYC A;  2AHZ A;  3T1C A;  5EK0 A;  4HYO A;  1XL4 A;  2DWE C;  3RBZ A;  4X9L A;  2EZO A;  2WLL B;  2BYI A;  1YES A;  3K97 A;  4P7A A;  1PNK A;  2IU3 A;  4MVR A;  4ZBM A;  2XDS A;  2YK9 A;  1YT0 A;  3HYY A;  3O0I A;  3OWD A;  4RQE A;  4JAS A;  2IW5 A;  3B26 A;  3AG4 B;  2GSM B;  3LSQ A;  4YKZ A;  3HEK A;  1NBM G;  2CGF A;  1U0Z A;  3ABK C;  3TUH A;  4XKK A;  1DLB A;  4UV9 A;  4WFF A;  3TZ0 A;  1R3I C;  2YEV B;  3B8M A;  4JAV A;  2YEE A;  4FCQ A;  1PVG A;  3VBB A;  3STL C;  3ASO C;  1BHB A;  1YT1 A;  2DW4 A;  1VQ7 V;  3VHC A;  3SPI A;  5M4P A;  3C0E A;  4QE9 A;  4LP0 A;  1YC3 A;  1DF4 A;  3E8F A;  4R3M A;  5LHI A;  2F43 G;  1AMW A;  3U2D A;  5HFL A;  2FXS A;  4RAI A;  4KUM A;  4PDR A;  1E79 G;  5H6Q A;  1I5B A;  1R62 A;  3HHU A;  2AKP A;  4EGH A;  5CN0 A;  5LGN A;  1AI4 A;  2CK3 G;  3ABM C;  4MVO A;  1VQN V;  3WQ9 A;  3PEJ A;  3OUF A;  1BMF G;  1CP9 A;  5CTY A;  4DXW A;  1Y4M A;  4ASB A;  3ZMU A;  3T0H A;  2XDK A;  3FYI B;  2Z5U A;  1B62 A;  2QTO A;  1I59 A;  4WFH A;  1AI5 A;  4WUD A;  2YEF A;  1YER A;  1R3K C;  3ETD A;  2QFO A;  2XK2 A;  3SPG A;  2EIM B;  2YJW A;  2ZDY A;  2A0L A;  2V1D A;  4PRX A;  1BYQ A;  3SJQ C;  4DZY A;  4YKU A;  4JTD B;  2X7R B;  5F5R A;  3LUT B;  4GX1 A;  3WG7 C;  5B1N A;  1OCO C;  5IY5 B;  4MBC A;  5L3J A;  2BZ5 A;  2NNU A;  3AG2 C;  4MVZ A;  2WLH A;  1PKX A;  1ROP A;  3CD6 V;  1B63 A;  2XOK G;  2HLD G;  3GIG A;  4BIZ A;  3LDE A;  4H37 A;  3B24 A;  2YKB A;  4R6Z A;  3GIF A;  2ESA A;  1K5Q A;  1YTF B;  2Q67 A;  2CCU A;  1JPX A;  3OGC C;  4E2L A;  4R1F A;  3ZKB A;  5LBQ A;  3SL2 A;  1GMG A;  3E86 A;  2BRE A;  2B5U A;  3OMN B;  4XBF A;  1NVP B;  2AHY A;  2P90 A;  3T4D A;  2XX2 A;  1K97 A;  2XJX A;  2YE9 A;  3O6O A;  1QZR A;  1OCR B;  3CCQ V;  3ZCC A;  2JJ1 G;  4BAY A;  3GIG B;  1RPO A;  3FB7 C;  3ABK B;  1PD3 A;  3MHH C;  1ZWH A;  2WI2 A;  4HZ5 A;  4QIW F;  3CXC U;  3HPL C;  4AS9 A;  3F7V C;  1NHH A;  4BW5 A;  2EIJ B;  5GGZ A;  4FCP A;  2YED A;  4XE2 A;  2EIN B;  2WER A;  5C93 A;  3OPD A;  2EIK B;  4FJC C;  1QY8 A;  1AI6 A;  2YKE A;  1EFR G;  4FK5 C;  4JF3 A;  3ZN1 A;  3B77 A;  4O09 A;  3JD1 A;  2Q8G A;  1GKF A;  2ZD9 A;  4PU9 A;  1BXD A;  1H8E G;  4PEL A;  4EM7 A;  3K79 A;  1FXV A;  5CBF A;  2XAS A;  4WF9 V;  3LNU A;  4EGK A;  1E1R G;  2BOC C;  2VCJ A;  4PDL A;  3D2R A;  2CG9 A;  3INW A;  1K4C C;  1M57 C;  2JIZ G;  1DF5 A;  4KP4 A;  1LNQ A;  4MW8 A;  1NVP D;  1Y4U A;  4I5S A;  3B8N A;  1K5S A;  4X89 A;  4QNH B;  2QG0 A;  2YE3 A;  1NHJ A;  3K99 A;  4GT8 A;  3R4M A;  1I5Y A;  3OWB A;  4LWG A;  4WUC A;  1UYM A;  4CWT A;  3QO8 A;  4GX0 A;  4XTJ A;  2Q2E B;  5D7D A;  3OMA B;  4XDL A;  3A0Y A;  1UYF A;  5F3K A;  3TTZ A;  1HWY A;  5LGU A;  2XAF A;  1V54 B;  3ZRX A;  2WLI B;  5L3G A;  3CMA V;  2WI1 A;  3OAA G;  1BL8 A;  1FFT B;  4CWN A;  1P7B A;  2YEV A;  4CWQ A;  5M4N A;  3TK1 A;  4NH9 A;  4TT3 G;  5J71 A;  1FXH A;  5CBG A;  1VQ6 V;  4FCR A;  3ZMV A;  3X2Q B;  1M90 W;  1US7 A;  3AEI A;  3R91 A;  5B3S C;  5FWK A;  4MTF A;  2OCC C;  2VCI A;  4AWO A;  1Q7Y W;  5M4H A;  3CP1 A;  3JD3 A;  4GEE A;  3BY6 A;  1YSC A;  5EBL C;  1F51 A;  2HVJ C;  3GB7 C;  3HZ5 A;  3CCM V;  2M7W A;  2QM7 A;  4MVU A;  3D0B A;  4CWF A;  2DYR C;  2OT5 A;  3RVZ A;  4H81 A;  2R9I A;  1S76 D;  4URM A;  2YEJ A;  1GTO A;  5J9P C;  5BOC A;  3KE6 A;  2EIL B;  3ASN B;  4RUF A;  1YTF D;  2E0A A;  1Y4S A;  1JX9 A;  1SES A;  5L3E A;  4XCJ A;  2JKI A;  1I5A A;  4R3A A;  3U2K A;  4BXI A;  5B3S B;  2XHT A;  3CGZ A;  1YET A;  3B28 A;  1K92 A;  3MNR P;  1AH6 A;  3SYO A;  5B1B B;  4CWS A;  3CGY A;  2YE5 A;  2XJJ A;  1CEZ A;  3AG3 B;  1S72 V;  2QG2 A;  3WHA A;  2HCH A;  2YE6 A;  2H8M A;  5CF0 A;  4MTO A;  2Q6A A;  1AR1 B;  4BQG A;  2IOQ A;  3ZM7 A;  1GM7 A;  1UYE A;  1GM8 A;  4LWI A;  2EJR A;  3VAD A;  3SPH A;  1OCC C;  1K3E A;  2A9H A;  5IDM A;  4AWP A;  4LP8 A;  4UVA A;  1EZJ A;  4N23 A;  1AM1 A;  4PDM A;  3C11 A;  5BOD A;  1F23 A;  5CMU A;  2YEB A;  1OCC B;  4UVC A;  1JVM A;  3CCR V;  4XC0 A;  1KP2 A;  1Y8N A;  1F4N A;  3RKZ A;  3T1K A;  1NJI W;  2XDU A;  2YEA A;  4MT8 A;  4P8O A;  1S0V A;  1V55 C;  1FXK C;  2R9R B;  1Y66 A;  2XX4 A;  1AJQ A;  2LFR A;  3IGA C;  5BZB A;  1VQ8 V;  1QVF U;  2BTZ A;  4BIU A;  4O07 A;  4CWO A;  3SPJ A;  5IYB O;  1FXK B;  2JDI G;  2ZDI A;  2FWZ A;  2K5B A;  4YKW A;  2V7Q G;  2KB1 A;  1YS3 A;  1QLE C;  2YKJ A;  1L1F A;  1B6Q A;  5B1O A;  1QLN A;  1QBZ A;  2BU7 A;  4MTG A;  2FTK A;  4LPB A;  2H8P C;  1FXK A;  4TSF G;  3JZ3 A;  3ZMZ A;  3K03 A;  1KD1 W;  3E8B A;  3O2F A;  3W7U A;  3K04 A;  2QE7 G;  3QO5 A;  1JJ2 U;  2WI3 A;  3QTF A;  1W2B U;  3K60 A;  1MAB G;  5CA3 A;  1S77 D;  1TID A;  2BU5 A;  1H2G A;  1W0K G;  2H94 A;  4PA6 A;  1ZWI C;  1ORQ C;  4MSW C;  3SYC A;  4HZ0 A;  3F5W C;  2IOR A;  2X6A A;  3T0Z A;  4L91 A;  2XAQ A;  1EA6 A;  3FKS G;  3D36 A;  5CBH A;  3ZRS A;  2WEP A;  3I56 V;  1FS0 G;  4JYC A;  3X2Q C;  1YC4 A;  2Y69 C;  3ZMS A;  2XCM A;  2XHR A;  4KFG A;  1M56 C;  4LBE C;  2IWU A;  2W6J G;  1QR9 A;  2UWD A;  1GO3 F;  3LDC A;  3UKM A;  3G7B A;  2IJI A;  4YKY A;  3ASO B;  3QO7 A;  1AI7 A;  2HG5 C;  3ABL C;  3M99 B;  1B3Q A;  4QJF B;  3NXS A;  2ZXW B;  5B1B C;  4GFN A;  4HYP A;  4O04 A;  5M4E A;  2BU8 A;  3G6E V;  5KA6 A;  2ITD C;  4HAM A;  4KFM A;  1NH2 D;  1ARO P;  4JGS A;  3FB6 C;  3OFN G;  1OSF A;  2GQP A;  3CWV A;  3VHD A;  4H33 A;  2BU2 A;  4RO2 A;  2YE4 A;  2LFS A;  1BKN A;  3ZKD A;  3OMU A;  1VQO V;  4HY6 A;  1YHQ V;  1KP3 A;  2NLJ C;  1R3L C;  2HG1 A;  3TZ2 A;  4X88 A;  2DYR B;  4NH7 A;  4WFE A;  1P4R A;  3E89 A;  2XAB A;  4FIP C;  2B1G A;  2WLM A;  2ATK C;  1KC8 W;  3JCZ A;  5IDJ A;  3Q5J A;  3Q5K A;  3NMQ A;  4Q20 A;  2Z3Y A;  4LCU C;  2PNR A;  1UYD A;  4H85 A;  3CRK A;  1W0J G;  4P2Z A;  4QE7 A;  5LHH A;  3ABL B;  3LSS A;  2O1V A;  2QF6 A;  3EHF A;  4XKO A;  5D6P A;  4ASF A;  4B7P A;  1YSR A;  2CH4 A;  4PA7 A;  4NH8 A;  1RM1 B;  3D3I A;  1SER A;  1YI2 V;  1S14 A;  2IWS A;  3OMI B;  1NH2 B;  3ZXO A;  4MS2 A;  3W7S A;  5FND A;  5EBM C;  1U2O A;  5DM6 V;  4TWK A;  3GWO A;  3CCU V;  4ASG A;  1THN A;  4URO A;  4GCZ A;  2YE7 A;  1R6N A;  1XL6 A;  1UYH A;  1Q82 W;  3A0T A;  1UY7 A;  2XJG A;  4E00 A;  3R65 A;  4U7O A;  4KSG A;  2EBO A;  4FMT A;  4JTA B;  4YXW G;  1GJV A;  2WI5 A;  2PI5 A;  3W7X A;  4E01 A;  3AG4 C;  1M9N A;  4X8A A;  5DN6 G;  1Z59 A;  2PI4 A;  3GIE A;  4CE3 A;  4AWQ A;  2Q69 A;  4CBC A;  1KKD A;  3SPC A;  3FT8 A;  2HFE C;  2ZQM A;  1YJ9 V;  3OE7 G;  3E8G A;  5KUM A;  1YJN V;  2WI4 A;  4ZKI A;  2CCT A;  5FNC A;  5CPH A;  4CE1 A;  4HXW A;  1SET A;  5D7R A;  3ZRW A;  2X0L A;  2YI6 A;  3BM9 A;  5H6R A;  2OTL V;  2XND G;  2WPD G;  1M56 B;  3JD0 A;  1AH8 A;  4N21 A;  1A4H A;  1UY6 A;  2ZDI C;  5B1A C;  2JJC A;  3PEH A;  3SYA A;  3ZN0 A;  5HFM A;  3JD4 A;  1Q86 W;  1YIJ V;  3SYP A;  2EXL A;  2YE2 A;  3E35 A;  5CTW A;  4EGI A;  5CTU A;  3T2S A;  3CCL V;  2Q8I A;  5D6Q A;  4RQF A;  1TH8 A;  4EFT A;  4MTX A;  1WLE A;  4FPP A;  2C2A A;  2Q8H A;  3G4S V;  4PA9 A;  4CZZ A;  4EFU A;  4MVQ A;  3EKR A;  4MPE A;  2OCC B;  2JEX A;  3LDD A;  4GT1 A;  3RLR A;  3ZRW B;  3AG3 C;  1SRY A;  3VOU A;  2YI5 A;  3R4N A;  4LWE A;  4L8Z A;  4U93 A;  2ZBK B;  1PNL A;  1AJP A;  5EC2 C;  5L3F A;  3CCV V;  3HZ1 A;  4GX5 A;  3K0G A;  1Z5A A;  1COW G;  2OTJ V;  1ZW9 A;  3B27 A;  3TZ4 A;  2DWD C;  2XDX A;  1J95 A;  4MVS A;  1R6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...