4U7NA

Inactive structure of histidine kinase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
225
structure length
211
Chain Sequence
VSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Transferase
molecule keywords Histidine protein kinase sensor protein
total genus 69
structure length 211
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4u7nA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4u7nA02
1UY8A 2WWWA 4H81A 4YKRA 4LC1A 1KIJA 2IORA 4XIPA 4GQTA 3SL2A 4CWRA 1YC3A 4KSGA 4YKXA 4CWOA 2JJCA 4HYMA 4XDMA 4URMA 2IWUA 4URLA 4BIZA 3ZRXA 4KFGA 1YT2A 4H7QA 1YS3A 4BQJA 1F51A 2JKIA 5M4EA 3H4LA 4GGLA 4KTNA 4L90A 2YE5A 1YT0A 4JAVA 1AH8A 4FCQA 5FNCA 4EGIA 1THNA 3INXA 1UYHA 4U7OA 4GCZA 2P67A 1B3QA 2YE9A 3ZRVA 4NH9A 3EHGA 5CTXA 4QPJA 3OPDA 1GJVA 3EHFA 1YC4A 4KQVA 1NHHA 3EKRA 4XKAA 3NXSA 4CE2A 3U67A 3MNRP 2YI7A 2XHRA 2BU6A 4PL9A 4LWIA 4K4OA 4CWFA 2HKJA 4R3MA 3A0TA 1Y8NA 3RLPA 2FXSA 1I5BA 2IWSA 2BSMA 2XCMA 4X9LA 4NH7A 3A0ZA 3HYYA 4CWPA 1S14A 1YSZA 2XJJA 3R4NA 2BREA 3HYZA 4BQGA 4EFUA 4YKTA 4R3AA 2YK2A 3K97A 2WI6A 2Q8GA 4MBCA 1BKNA 4XCJA 1IXMA 2ZDXA 2QG2A 2HCHA 2QFOA 2ESAA 2XK2A 4H85A 2YEAA 3HZ5A 4V26A 3O0IA 5FWKA 4P7AA 4MT8A 3ZKDA 4ASAA 4HYPA 3CWVA 3R91A 3NMQA 3EHJA 1I59A 5B1NA 3OMUA 4XKKA 4JYCA 2O1WA 1ZWHA 1BYQA 2BU2A 2YE3A 3H80A 2WI3A 4XC0A 2YEBA 1UYCA 3RKZA 5M4MA 1TC6A 4O05A 4BAEA 4HZ5A 1UY9A 2YEHA 4DZYA 4WUBA 4MP2A 4YKWA 4YKUA 5M4NA 1UY7A 3A0WA 2CH4A 2YI5A 3O6OA 2Q8HA 3ZM7A 2FWZA 3D0BA 5CTWA 2ZBKB 3FT5A 4YKYA 3PEHA 3A0YA 5F3KA 4L91A 5M4KA 4FPPA 3Q5JA 4MPCA 2O1VA 3D2RA 1Z59A 2XX5A 1YERA 2LFRA 2XJGA 4BXIA 3CRLA 2XDKA 4I3HA 3G7BA 4LWFA 4URNA 2WI7A 2XX2A 5CPHA 2VWCA 3R4OA 5GGZA 2ZKJA 4XKOA 4CE3A 1PVGA 2BT0A 3K98A 2CGFA 4W7TA 5L3JA 3ZXOA 3CGYA 4HXZA 4E01A 4EGKA 5FNDA 2FWYA 4B7PA 2XD6A 4CWSA 1UYKA 4EGHA 1UYGA 5B1OA 4U93A 1TC0A 4GFNA 3MD0A 2XHXA 5D7RA 4MOTA 1TIDA 3INWA 2WI2A 1H7SA 3TZ2A 4XIQA 2QG0A 2WERA 1GKXA 3FV5A 3G75A 3OWBA 3TZ0A 5D6PA 3B25A 1YSRA 4O09A 5BODA 2AKPA 3ZRWA 3R92A 4JASA 2YKIA 1AH6A 1A4HA 1ZXMA 3VHAA 4GT1A 1L0OA 2CCSA 4HY6A 2CCUA 2WI4A 2YKBA 4MP7A 2IOQA 4P8OA 2YJXA 4XIRA 3DGEA 4JYBA 2YEIA 2H8MA 1QZRA 3VHDA 3VHCA 2XHTA 3BMYA 4JAUA 3JZ3A 2YE2A 3T1KA 2K5BA 4EM7A 2YE8A 2BYIA 2YEEA 3HZ1A 3R4MA 1Z5BA 4LWGA 2UWDA 2VCJA 2YKCA 1U0ZA 4AS9A 3P32A 2YEDA 2YKJA 1TH8A 4E00A 4GT8A 1JOYA 1AJ6A 1BXDA 1Y8PA 1I5AA 3C0EA 2FTKA 1AM1A 1I58A 3GIEA 4YKQA 2YKEA 1I5CA 2YJWA 3CRKA 2EXLA 3O2FA 4XD8A 4ASBA 4HY1A 3OWDA 4L8ZA 4ASFA 3Q5LA 3OW6A 2H55A 3T0HA 4LP0A 5IN9A 5C93A 1U2OA 4CWNA 4DUHA 3A0XA 4LWHA 5D6QA 1ZW9A 5CTYA 3B28A 2Q2EB 4XITA 2BU7A 2C2AA 2VW5A 4I5SA 4LWEA 2FYPA 2YE6A 1QYEA 1QY8A 4WUDA 3CGZA 3U2KA 3KE6A 4HZ0A 5FNFA 4B6CA 3RLRA 2XX4A 2WI1A 2YI0A 2YK9A 4R1FA 5M4HA 2ZDYA 4ZKIA 4O0BA 2CG9A 4E02A 4GEEA 2IWXA 4QPKA 4L94A 2XDSA 3K60A 2XABA 2PNRA 3HHUA 4Q20A 3EKOA 2YECA 1Y4SA 3ZKBA 3VADA 1UYMA 2QF6A 2LFSA 1UYIA 2XDLA 2BU5A 5CF0A 3GIGB 3TK1A 4KP4A 5M4PA 4CE1A 4UROA 3BM9A 1ID0A 1YETA 5IDJA 5F5RA 1TBWA 2WEQA 3EHHA 4EMVA 5D7CA 3G7EA 3QTFA 1NHJA 3HEKA 4AWQA 1YC1A 1Z5AA 4O07A 4EEHA 2CCTA 4XE2A 5J6AA 4FCRA 5BOCA 3IEDA 1UYFA 4EFTA 1ZXNA 4ZVIA 1UY6A 3ZXQA 4FCPA 1NHIA 3TZ5A 2Q8IA 4LPBA 2YE4A 4YKZA 3ZRWB 3FT8A 1MX0A 2BZ5A 1UYEA 1MU5A 5CTUA 4O04A 4L93A 3TTZA 4CWQA 1B62A 2GFDA 1Z5CA 2YEGA 1Y8OA 4MPEA 1BGQA 2GQPA 2XDXA 4FMTA 3Q5KA 4CWTA 4NH8A 4MB9A 3LNUA 3RLQA 2BRCA 4MTXA 2BTZA 5D7DA 1R62A 4BIUA 2XDUA 4PU9A 1YT1A 4PRVA 2YEJA 4AWOA 1TILA 3TZ4A 1JM6A 4U7NA 1H7UA 5J71A 4HXWA 3WQ9A 1S16A 1I5DA 1KZNA 1OSFA 2WI5A 3B27A 3T10A 4PRXA 2YI6A 2BYHA 4MPNA 3WHAA 4ASGA 2QM8A 4JQLA 3U2DA 2Q8FA 3K99A 3TUHA 2YGEA 3GIGA 1EI1A 1UYLA 3GIFA 1YESA 2HG1A 3T0ZA 3ZCCA 1US7A 2YGFA 2XJXA 3B26A 1EA6A 1UYDA 2E0AA 4V25A 5IDMA 3C11A 4XTJA 3T2SA 4KSHA 4AWPA 3D36A 3QDDA 3R4PA 3PEJA 2VCIA 3A0RA 4XCLA 2QM7A 2O1UA 4WUCA 3B24A 1GKZA 1B63A 2IOPA 3LPSA 2YGAA 1AMWA 2WEPA 2YE7A 1Y4UA 2YEFA 2BU8A
chains in the Genus database with same CATH superfamily
5IT9N 3CX5F 1Y6XA 3JSLA 2JEUA 4UVBA 4UUJC 4GQTA 4RWUA 4DR7B 1WP8A 1K4CC 4DV2O 2D2CB 4BIZA 4NTYA 1WB8A 1WNSA 3RBZA 4PA6A 2Y0PA 3JAKA 3TETA 3E2EA 4GGLA 4ZHQB 4LFCB 2QKCA 1WAZA 4L90A 2YE5A 1S76D 5C8YB 1AI6A 1THNA 3TGUH 3CJHB 3SJQC 1UYHA 5KAFZ 1I94B 1WLEA 5CB4A 3CRAA 4J10A 3ZRVA 5BR8B 4LFBO 3ZMZA 1NU1H 4H44B 4TSFG 1GJVA 2IJHA 1FFTB 2PYLA 1YC4A 3EHFA 4KQVA 4XKAA 5KA5A 3MNRP 4LFAO 3RFRA 3STLC 2Y4TA 3OMNB 4X1IA 1US6A 4JI2O 2QSAA 4CWFA 3A0TA 1Y8NA 3RLPA 1NR7A 2PZSA 1VQ5V 2FXSA 1QQCA 3KCXA 3CPWU 4LNUA 4CWPA 2E76B 3R4NA 3QO7A 1HR0B 4EFUA 1M4UA 4LF7B 5L3FA 4X65O 1BT8A 4LH6A 2Y4UA 1R6TA 4GX0A 2YSUB 4Z1VA 4Q6GA 5K1PA 2UXDO 1OCRC 2IBZH 4DR5B 2ARHA 1OCOB 1XMQB 1V55B 1AR5A 2PI5A 3CC4V 2HCHA 2ZE7A 4X9QA 1Q6UA 4V26A 4JGSA 3RYCB 3X2QB 4O4JA 1RPRA 1W59A 2QWPB 1PL4A 2ITDC 4UV8A 3ETDA 4J41A 2VQEB 1L0NH 3R65A 4FM1A 1TUBA 4DW0A 1NS1A 2YXYA 3CRCA 1EN5A 2O1WA 2ZDIA 1EZVH 1BHBA 5DM6V 2UXDB 1M56C 1X4TA 4F6EA 4XC0A 4X65B 2YEBA 3D36C 2MW2B 2DN9A 1AILA 4IHJB 2YEHA 4DZYA 1XHXA 2CH7B 1I7FA 4I7ZB 4YKWA 5M4NA 4I0XA 1VQKV 1GH6A 3UM7A 1RFYA 3ZM7A 2WLNA 2FWZA 3VBBA 5CTWA 2XAGA 5H6RA 1WB7A 3W7SA 5LP6C 4WFGA 1FXKB 4KHPB 3SJBC 3JATB 3A0YA 2CUGA 2JS5A 4UB6Z 5IWAO 2M6YA 4ICGA 1XREA 2PUSA 3D2RA 4LBEC 5BR8O 4LFBB 3CRLA 4NKGB 3G7BA 2EJRA 3B77A 4URNA 1O9GA 2P4VA 3R4OA 3MAQA 2B1GA 2F95B 1WN7A 4CE3A 1PVGA 5KUMA 4LF6O 5L3JA 2UUCO 1YXBA 5EBLC 3ZXOA 4I4TA 3W7UA 3KG2A 1NTKH 2O57A 4E01A 3AG1B 3OR7C 1VF7A 4O4LA 1M93A 1COWG 4B7PA 2XD6A 2DOSA 1VQMV 5B1OA 1V9PA 1YSCA 5JCOC 3INWA 3LSQA 2AGAA 4NXNO 1B6QA 4YIOA 2WERA 5DEDA 4DV1B 1GKXA 2CK3G 2F66C 4DR1O 2Q0OC 3T1CA 4BW5A 4DYLA 1AR4A 3ZRWA 1QU7A 4P2ZA 1Q82W 4JASA 2P6JA 4DR1B 3VHAA 1NT2B 1JX9A 4J11A 2CCSA 4DV1O 3G6EV 4L87A 4P8OA 3JALB 3BY6A 1L0LH 4JYBA 2H8MA 1BE3H 1PM9A 2UXBO 3L70H 2QWOB 3VHCA 1ENVA 3U10A 4QE9A 4OPHA 5GONA 2YUAA 3SPCA 1JJOA 4QE7A 2H3OA 4JAUA 5JVDB 3JZ3A 2YE2A 1DF4A 2NN4A 4NYKA 3WB1A 3R4MA 1W0JG 4K8XA 4J7ZA 3P32A 2YEDA 4ABMA 3M8AA 2YKJA 2B9ZA 1GN6A 1H2LA 2WAMA 3L72H 4HNAA 3ZS8C 2MK3A 3UCSC 1AI4A 1Q81W 1VQ4V 1BXDA 2DQ3A 1K9MW 2F1MA 2FTKA 4LF9O 2EIJB 1I58A 2CTRA 4G28B 4O4JB 1SESA 4LF8B 4ASBA 4NXMO 5DECA 1L1FA 1PL0A 2H55A 1CPYA 2EIKB 3SJAC 2ZE5A 2HJFC 4KHPO 1N32O 4DV7O 2JK5C 3OTOB 1OCRB 4CH5A 1ZW9A 5TISZ 1UFIA 2Q2EB 4XITA 4F6RA 1URFA 3F7VC 1R6KA 2BTQB 4LWEA 4UFZA 2ADPA 2Z0AA 4DR4B 3ZRSA 4I0XB 4U3JA 1VQLV 3STZC 3RLRA 2XX4A 1JFFA 3CRMA 5KHHA 5ITZA 2DMXA 3ZX6A 5JWPA 4OXSA 4ZKIA 3KCYA 3O65A 1LR1A 4GEEA 2IWXA 2HKOA 2OTLV 2XDSA 3CMEV 4J80A 4GLXA 3CSXA 4FLVA 4N23A 1S77D 3ABMB 3CJHA 5GTIZ 1NQTA 1HNXB 2P5OA 4IL6Z 1UYIA 2BU5A 3GIGB 3H1HH 2IH3C 2ZE6A 4ZOLA 4WFBV 3GB7C 1XMQO 4FIPC 1ID0A 5F5RA 4DV5B 2Y0IA 1GTOA 3SPGA 4MVMA 3CCJV 3QTFA 4LF7O 3HEKA 1Z5AA 4X64B 2CCTA 1KYOF 4XE2A 5J6AA 3OGCC 1FYJA 3QTCA 5B66Z 3AG4C 1XDCA 4MTGA 4LPBA 1NH2B 3ZRWB 1XBLA 1XHZA 2BZ5A 1VQOV 4X20B 1MU5A 1RM1B 5CTUA 4JI2B 4O04A 3E8HA 4I50B 4JI7B 1YITV 2QA4V 2YEGA 1BGQA 2ITCC 2PTMA 2E5LB 3UT5A 1GM7A 1ZUQA 2ZXWB 3FD9A 4FMTA 4UVAA 1ZL8A 4WFFA 4Z2WA 2FMLA 3AG2C 5D7DA 1R62A 1DTOA 2YEJA 4GX1A 4OX9B 1TILA 3AG3C 1VQ9V 4HZ3A 3CYOA 5H5NA 4WFAV 5BXZA 4L8JA 1Y74A 4UCVA 1S16A 2WI5A 3B27A 2CGOA 2Q5ZA 2BYHA 2W6IG 2QM8A 4DV2B 1NJIW 3PJSK 3ZHTA 3TUHA 1EI1A 2XAFA 3JAKB 3LUTB 3FAVB 3ETQA 3ZCCA 2JS3A 4B08A 3P3PA 2EIMC 3B26A 4DR3B 2B1IA 4V25A 1K34A 2YDEA 1KD1W 2IJKA 1AP5A 3C11A 5LOVA 2AW9A 4XTJA 2V1DA 5CBGA 2JDIG 3ASNB 2KKWA 4DK1A 4DRXB 1PKXA 3RYFA 3R4PA 3PEJA 1S3JA 2H8PC 4IT5A 4LCUC 4H13B 1KKDA 2QM7A 2O1UA 1LUWA 3VQVA 4TT3G 1JA8A 1KBHA 1DK1A 4KXRA 3AK2A 3RN4A 4WF9V 1IBLB 2IOPA 4JI0O 3LPSA 3DSQA 3E8FA 2YE7A 2HR3A 4NTWA 2YEFA 2BU8A 3CC2V 3AG1C 2V7QG 3ZHQA 1Z5WA 3CCQV 4IIJB 4YKRA 4XIPA 4JPRA 3MHSC 1MABG 4YKXA 1KU9A 1H38A 3FB7C 1MA1A 4GX5A 1HP8A 2L35A 3CWBH 3E35A 2X6AA 4DUYO 3JASA 4TOIA 1YT2A 4JTCB 1YS3A 3E8BA 1NZ6A 4TQDA 2Q7EA 5M4EA 1BZKA 2BSKB 3F7YC 3CC7V 4JAVA 2IU3A 1GO3F 3B40A 3K5NA 2YI8A 2BCCH 3INXA 1AJPA 2CTPA 4NH9A 5HFMA 2W0FC 1SQVH 3EHGA 2XASA 5LXTA 1ZLZA 5LMUB 3AG2B 3EKRA 3U67A 3FFQA 3FB6C 1XEQA 1ZWIC 2QTSA 2EIKC 3JD2A 4LNUB 4PL9A 2CGNA 4JI7O 3OMIB 2QM4A 2N04A 4K4OA 2JEXA 4TV8A 2WSSG 4FFKA 3H1JH 1KKCA 2HP8A 1AI7A 2EIJC 2IWSA 3EHBB 2BSMA 3A0ZA 2E75B 1EBOA 5LXTB 2BREA 1HNWO 2RN9A 4YKTA 4R3AA 4DV6B 1FXKA 2CE4A 2A79B 1YJWV 2OCCC 2Y69B 2YK2A 1P7GA 2WI6A 2N74A 3L9DA 3B8MA 1BKNA 4XCJA 5L3DA 2YIDA 2ZDXA 1IX9A 2OIEA 1XMOB 2QFOA 2XK2A 2QKSA 3O0IA 4U3JB 1VF5B 1B04A 1YJNV 4ASAA 3HKCB 1M90W 3K5OA 4O2BB 1VF6A 4X8AA 3R91A 3QO5A 2RJZA 2YC0A 1R3LC 5B1NA 3OMUA 2HLDG 4JI4O 1WPXA 1YVWA 1BYQA 2BU2A 3G71V 4PHZA 2YE3A 2WI3A 2ZINA 1S5LZ 3LNMB 5IYZB 3ZN0A 1ZL8B 2ODMA 4DR4O 1TC6A 4O4HB 4O05A 1UY9A 4YKUA 3HB3B 2D3OW 3A0WA 1ZTEA 2CH4A 3UO2A 2IJJA 2KB1A 3O6OA 3B8NA 2Q8HA 4DV0O 4X1YA 4CS4A 3DXRB 3M99B 5CMUA 4DV7B 3CS5A 2ATKC 2Q9LA 3N2GA 5J2UB 5M4KA 5LHHA 4FPPA 4NXMB 5B3SB 2EIMB 5KX5B 4FLYA 4MPCA 2O1VA 1Z59A 1J5EB 2LFRA 1TAEA 1BGYH 2QKAA 3K57A 3GVMA 2ETNA 4QNHB 3ZMSA 5CPHA 5GGZA 1GN2A 1JR9A 5GW7A 2F4VB 1NKDA 1IBMO 3BEHA 1XL6A 4AQYO 2IH1C 1H2GA 3SPHA 4FJCC 1VQ7V 2DW4A 5JQGB 5CA3A 5FNDA 4GUNA 4CWSA 1K5QA 4FFBA 3AK1A 3LSSA 4H37A 3JAWA 3HPLC 5D7RA 5KA6A 2WI2A 1VQ6V 2XOKG 3TZ2A 4XIQA 1N0NA 1YZBA 1V55C 3G75A 2W0XA 4X1KA 4DUZB 2AZ2A 3N2KB 3JALA 3K5LA 1QLEB 5D6PA 5BODA 2P4KA 3GWKC 1E1QG 2Y48A 3CD6V 5KHIA 2YKIA 1AH6A 3JCZA 4F4LA 1QNMA 1YTFD 5LOVB 4LF5O 1A4HA 2XTAA 3SYOA 2Q0AA 3K58A 1L0OA 4HY6A 1FS0G 3ZHVA 1N33O 5EC1C 2YJXA 2LO1A 1QZRA 2IM9A 3HR0A 1UPGA 3CCRV 3VHDA 5C8YA 2XHTA 3X2QC 5KMGB 3WG7B 3BMYA 2GV9A 2K5BA 3G6BA 3QG5A 2WLKA 1AI5A 1Z5BA 4Z1MG 2VCJA 2UUCB 2OT5A 1RSOA 2YKCA 2CAZC 1LNQA 1ORQC 2RMKB 3OGIB 4N21A 2UU9O 1IBKB 1HWYA 1GM9A 4E00A 4GT8A 3FX7A 4QIWF 4J9YB 4KUMA 1Y8PA 4PELA 3DXRA 1I5AA 5B1AC 4PA3A 4B3TO 4LP8A 5CA0B 3SR2C 5H2FZ 2BE3A 4X62O 1FPOA 4MSWC 3CRKA 2DQ0A 2EXLA 4P30A 5FNVA 1EN4A 4UV9A 4ZOLB 1F7YA 2BTOA 3K9SA 3Q5LA 3FB5C 2F43G 4LP0A 5IN9A 5IE9A 3CE2A 2LJ2A 1A32A 1FD9A 5B5EZ 1FAFA 1TVKB 3SYPA 3A0XA 4LWHA 2OCCB 3BABA 5EIBD 5CTYA 2Q68A 2BU7A 1G8MA 4B3SO 2WA4A 3C3TA 4BW9A 2VQFO 4I5SA 2NR5A 2EJ7A 3FYIB 1QY8A 4WUDA 3K04A 3L71H 2RCVA 4FK5C 4J42A 5FNFA 4B6CA 3MHHC 4B3MO 5H9CA 2YK9A 1TUEB 5M4HA 1NVPD 4E02A 2XNDG 1FXVA 4NB5A 5IYZA 3AG3B 2B5UA 4DXWA 5FPRA 4Q20A 5JJNB 4YJ3A 5A9GA 1KQSU 3EKOA 3TXQA 1IXBA 1VMGA 2ZIMA 2XUMA 4R7CA 3BRCA 4XDLA 2QF6A 3U11A 2LFSA 3K03A 3RYHB 1XL4A 4KP4A 4LWSA 5M4PA 2JGDB 4UROA 3OEHG 1YETA 4MTOA 3BM9A 4FLWA 4X66B 5FLXN 4B3MB 1TA8A 3EHHA 5D7CA 2EINC 3G7EA 1FXHA 2JJ2G 4HBNA 1NHJA 2BOBC 3T1YO 4FCRA 3IEDA 1UYFA 4EFTA 2A9HA 1ZXNA 1KP3A 4ZVIA 1UY6A 4FCPA 3TZ5A 2YE4A 2LQTA 4B3SB 4QGPA 3E86A 2GDSA 4CC6A 5IYDO 3CEIA 2KSDA 4DV3O 1N34O 4MW8A 4ZI7B 3TTZA 3BVOA 4CWQA 1YI2V 3BA8A 4ZHQA 4B7EA 4I55B 4E72A 3U0ZA 2XDXA 4AHCA 4FLTA 3Q5KA 3APQA 4MB9A 4JZGA 3RYHA 4A5UB 3RLQA 5EBWC 4X62B 1I08A 1GN3A 2HG5C 2Q69A 3ABKC 5LGTA 1I94O 1Q5OA 2KG7B 3L73H 5A2QN 4PRVA 4B3TB 4MVOA 3KZIZ 3ZBHA 4IIJA 2K1EA 4U7NA 4JTAB 4LFCO 5J71A 1N4CA 4HXWA 2CDYA 1WPBA 4BIOA 1IBKO 5KMGA 1S5JA 4K35A 4ASGA 2ZCEA 4KL1A 3ETEA 2Q4PA 3GIGA 3A2FA 3H9VA 3JD1A 4DR7O 1YESA 2PGGA 3T0ZA 5KX5A 4DRXA 5EZYB 5KAIZ 2YGFA 4YJ3B 2BTQA 1NI8A 2Y69C 5IDMA 2ZDIC 3IC7A 2UUBB 1GN4A 1K7DA 3ZMVA 3W7TA 3IAYA 4K0KO 2EINB 3RW0A 3D36A 3QDDA 3T1HB 1M1KW 4JI8O 5BY1A 4JI6O 4DUZO 4CZZA 4MVZA 3B24A 5IY5B 3JARB 2JVDA 3SGIA 1JQ0A 2LW7A 2UXCO 5LP6A 2WEPA 4FZ1A 3CCSV 4MS2A 4D6TH 1XNRO 1UY8A 2WWWA 4JI3O 4H81A 2QWNB 3K3WA 2IORA 3MDSA 2V4DA 1YC3A 4KSGA 2EILC 4O2AA 4HYMA 2ZE8A 3WB0A 1RP3B 4URLA 3ZRXA 4WFHA 2JGUA 4H7QA 4FM0A 5D5PA 1IBMB 4BQJA 2JIZG 1F51A 2R9AA 2WLJA 1YHQV 3H4LA 1D5AA 4H0LB 1QLNA 3J80N 2LP7A 4W4LA 5FNCA 4B3RO 4EGIA 3ZEDA 4R6ZA 5B1AB 3CCMV 2HJDA 4U3FH 2YE9A 2C1IA 3A8TA 4FLUA 4MVSA 3T2MA 2EBOA 4GYCB 1OJHA 4QPJA 1J5EO 3OM3B 1PNMA 2E74B 2Q73A 4UCOA 2AHZA 1QR9A 3N27A 4TV9B 1NHHA 3NXSA 2P22C 2VWJA 2YI7A 1VIBA 1NTMH 3LDDA 1H2SB 4PI2A 2ZM6O 2FL4A 3RYCA 2HKJA 4OPAA 4ZI7A 1KUQA 2K9PA 1I5BA 3OEEG 4NH7A 2FYUH 3JD4A 1AJNA 3ASNC 1S14A 1YSZA 3HYZA 3AK3A 5EC2C 4DR6B 4BAYA 4TV9A 2QWQB 4QJFB 1T5EA 4RQFA 3EVKA 2X6BA 4RUFA 2DWDC 4I9WA 3UQ8A 3WB2A 4MBCA 4YXWG 1QBZA 5EYPB 4YJ2B 2QG2A 4AILC 4CS2A 2ESAA 3FAVA 2WLHA 4H85A 2YEAA 1MG1A 2CH7A 2YIBD 4P7AA 5JJJB 4MT8A 3ZKDA 4HYPA 1R3KC 4PA7A 2HFEC 1BCCH 2A0LA 1SQGA 1QVFU 1E79G 4PA4A 4LF4B 1D2DA 1BSMA 3NMQA 1Z5VA 3EHJA 1XMOO 4XKKA 4GKKO 3LDCA 1OZ0A 2AZ0A 1ZWHA 3RYIB 3JATA 3K0DA 3A0BZ 3E22B 4P9PA 5LHGA 1Q6IA 1KB9F 3H80A 3K0GA 5BMVB 1QVGU 5CA1A 1Y66A 4DV6O 2OWOA 1N0JA 1N8RW 3RKZA 2PYJA 5M4MA 3QNEA 3D3QA 1NTZH 5ITZB 2RDCA 2WLIB 4MP2A 4RO2A 2WA3A 2VRZA 1I0HA 3SPJA 4FZ0A 4I50A 3FT5A 2QEXV 2DWEC 1RPOA 4YKYA 3PEHA 1OCCB 2GTSA 2M7WA 4XDKA 1VQNV 4UCRA 4L91A 4JI1B 5IJ0B 2HHHO 1KECA 2XX5A 1VQPV 1P84F 1N36O 3W7WA 4BXIA 3JSNA 4O2BA 4DV4B 2IW5A 1BHAA 2G38A 5KHJA 2XDKA 3F5WC 4I3HA 2GUZB 4TWKA 5KLVH 2WI7A 2XX2A 3ICXA 4IHJA 4TUYB 3IJ4A 5L3BA 3IGAC 4PI0A 5L3GA 1FKAO 5B3SC 3ABMC 3K98A 2EZPA 1WP7A 4JV5B 4W7TA 3EFFK 3CGYA 4XDJA 4F6RB 3D3IA 2PY5A 3T4ZA 5IJ9A 2FWYA 2Q8VA 1AROP 5IYBO 1UYKA 3JAMN 2NLJC 1UYGA 3SYQA 1ROPA 2N05A 4GKJB 4X1KB 4MVQA 1NR1A 1XNRB 1TC0A 4GFNA 1PNLA 2YS8A 3MD0A 5GONB 2Q7GA 4MOTA 4UVCA 2ZD9A 1FFXA 1H7SA 3ZMUA 3AG7A 1UJWB 2QG0A 5EIBC 4H33A 3EXAA 5EYPA 4YY3O 4JYAB 2A7WA 3OWBA 1AR1B 1GM8A 5JJEB 1HW7A 1IDSA 3B25A 4O09A 3JD0A 1IZ3A 4JYAO 5AG2A 1ZXMA 4GT1A 1FXKC 2DE0X 3CRRA 4BWAA 1QLEC 2ZNIA 2YKBA 4RQEA 2F23A 3DGEA 1ZX3A 2YEIA 3HKCA 5K1XA 2P7TC 2Q7HA 5LGUA 1SQFA 1I5YA 2YIBA 4EM7A 2YEEA 1VEWA 4LWGA 1Y74B 5E1AC 1VF6C 3VQXA 4DR2B 4JV5O 3TJTA 1H2MA 2A3QA 3T4DA 1U0ZA 3B2EE 1QR8A 1Q7YW 4LH7A 1AJ6A 3ZHUA 1SQQH 4IYHA 3QVNA 1WA8A 3IC9A 3BHPA 3OUSA 3C3SA 2YKEA 1I5CA 1L8DA 1MZEA 3OE7G 3RWRD 4XD8A 4B7KA 2ADQB 4KFMA 3GWOA 3OWDA 4L8ZA 3HKEB 2E5LO 4JI1O 4ASFA 3LDEA 3T0HA 3AEIA 5FPOA 2Z3YA 4O2AB 5C93A 2W6JG 1Q6HA 4JI5O 4CWNA 2QE7G 5LBQA 5BZBA 4DV3B 3FKSG 3AG4B 1SQBH 1Q3EA 1G4YB 2UXNA 2C2AA 2DYSB 3OFNG 2HHIA 2P90A 4YIPA 1X59A 1QYEA 3CGZA 3U2KA 4X64O 1CEZA 3KE6A 1KMIZ 4R8CA 4HZ0A 4X66O 1R3JC 4MW3A 3OR6C 2YI0A 4R1FA 3Q4HA 4O0BA 2CG9A 4L94A 3SYCA 3BAAA 3CB2A 3ZHRA 5IJ0A 4CC5A 3HHUA 3L74H 4UCTA 3CHXA 2YECA 5IYCO 1RSOB 4JZ2A 2ZR2A 3WU2Z 3OW2U 5CF0A 2OTJV 3TK1A 5LHIA 1MSWD 5DN6G 1SERA 4CE1A 3J7AU 4PDRA 5IDJA 2UUAB 1F23A 1GKFA 1SKVA 5CN0A 2R70A 5CA0A 1TBWA 3G4SV 4EMVA 1OCZB 4EEQA 4AWQA 1Q90D 4EEHA 5BOCA 5J2TA 3CCUV 2QR4A 1M57C 1NHIA 2Q8IA 2VQFB 3M7MX 4YKZA 1THZA 1TUBB 1MX0A 5CB4B 1TVKA 3C90A 4O4IA 1FJGO 1JFFB 2ZNJA 3CXHF 1CP9A 5IY5C 4L93A 1JVMA 1B62A 2WLIA 2GFDA 1Z5CA 1Y8OA 2BSKA 2YI9A 2GQPA 1NVPB 1R6NA 3ABTA 4NH8A 2UXXA 3OT7A 3ZJZA 5BMVA 2BRCA 5CA1B 2Q67A 1M56B 3CYGA 4D7SA 4LF9B 2HEPA 2X0LA 3OTFA 4PA9A 4AWOA 3ZN1A 4DO2A 4RUEA 4B3RB 1F4NA 2A06H 1H7UA 2YEVB 4NR1A 3BCCH 1SETA 3E83A 2ZXWC 1I5DA 1KZNA 1Z2GA 5LMNO 4PRXA 1MMMA 2ZR3A 3H01A 4K3AA 5KHGA 2YI6A 1H2KA 4TV8B 4JQLA 2OIGA 1YF2A 4K8ZA 3ASOC 4MVUA 4PDLA 1UYLA 3I56V 1K4DC 1SQXH 3JASB 2YXHA 2E3CA 3TCUA 1J95A 1SZTA 1US7A 4NVPA 4YHHB 1M57B 3VQWA 1UYDA 2OCHA 5KHKA 4KSHA 5CBHA 1HNZB 1R73A 4FVMA 4AWPA 4LF5B 2ZQMA 3CP1A 4JI6B 5D5QA 1JPXA 2C1GA 3A0RA 2VCIA 2QGNA 1E1RG 4K0KB 1HNZO 1PV0A 3G80A 3SJCC 1Y76B 3QO8A 2F93B 4X20A 1GKZA 2QTOA 1B63A 2WLLA 3CXCU 3IFXA 2YGAA 1YIJV 4YHHO 5JQGA 1Y4UA 3K5MA 1M5IA 2EZOA 2FB5A 5B1BB 2WPDG 4LC1A 1KIJA 2X7RB 4EB6B 5L3CA 3CMAV 3SL2A 4CWRA 4J9ZB 4RAIA 4UXNA 3PN1A 3I55V 4CWOA 2JJCA 2DYRC 4XDMA 4URMA 1K92A 2IWUA 4KFGA 3ASOB 1Y76A 5LMNB 5CBFA 1PP9H 4LF6B 4P9OA 1S72V 3B09A 2F4VO 1MNGA 3JD3A 2JKIA 4KTNA 1SQPH 1S0VA 1JMKC 1V54C 1YT0A 4GZRB 1SC5B 2CTQA 1AH8A 4FCQA 5JH7B 1AVMA 4U7OA 4GCZA 2P67A 3KKYA 4O4LB 3P3NA 1B3QA 2L6LA 3N2GB 1P7BA 4BR6A 1PPJH 5CTXA 5LA6A 3OPDA 2R9IA 5IWAB 4CE2A 3ZMTA 3WFVA 2QWRB 4HAMA 2XHRA 1YJ9V 2BU6A 3LNNA 4LWIA 1AJQA 1K5SA 5JCOA 1N34B 2GBOA 1FJGB 4R3MA 1FFXB 4GX2A 4DV0B 1ZAUA 2NNUA 3H1LH 2XAJA 2XCMA 4X9LA 3HKBB 2RNBA 3HYYA 3D8CA 1ZSPA 3CCEV 2P06A 4MVRA 3E22A 2XJJA 1BQZA 4BQGA 1WJZA 3T1YB 3O9OA 3DC6A 1R1BA 3S3WA 3K97A 3F5TA 2Q8GA 2UUAO 1I5XA 1IXMA 1K73W 1PNKA 3K79A 1D5NA 4I9QA 3HZ5A 1U97A 5FWKA 2VQEO 2AHYA 4X1IB 1YCIA 3RT3C 4ASUG 1EFRG 3CWVA 3K06A 4FFBB 4O4IB 2DYRB 3S3XA 1M9NA 1GMGA 4EB6A 1I59A 4JYCA 5B1BC 5J2UA 1BS3A 5LL6Y 1JJ2U 3DC5A 4DR5O 3ABKB 5F2VO 3ABLB 3P30A 2EX3A 5E79Z 1UYCA 1H8HG 1HR0O 4BAEA 4JF3A 3K08A 4HZ5A 1XI1A 4WUBA 3RVYA 1UY7A 2YI5A 2AXTZ 1DGSA 1PD3A 3JAWB 3D0BA 4IGGA 1DLBA 5L3EA 2ZBKB 1SS3A 1Y67A 1NH2D 2DYSC 4JI5B 2DJVA 2R72A 3OAAG 2JJ1G 4LFAB 5F3KA 1F4MA 2RQ6A 1P49A 3N2KA 5LP6B 5LMUO 3Q5JA 3OMAB 1XOUA 1YERA 2XJGA 2IJIA 5HFLA 4X89A 4C7UA 2PF4E 3OUFA 4ZBMA 3BA9A 4LWFA 4FLZA 2VWCA 1H2NA 2GUZA 5EBMC 1SA0A 4E2LA 1MOFA 2ZKJA 1P4RA 4JYYA 1YTFB 4XKOA 2UU9B 2BT0A 1K33A 2CGFA 4HNAB 4DR2O 1OHHG 1OCCC 4UCUA 4HXZA 4W4KA 3JCUZ 4EGKA 3K59A 5EZYA 4EGHA 2GSMB 1SF9A 2WLLB 3G67A 4U93A 4TQFA 3JARA 2XHXA 4R50A 1TIDA 1IBLO 4DW1A 1N33B 3QF7A 3FV5A 4PV1B 2QDOA 2FKXA 3ABUA 3BFRA 1OCOC 3TZ0A 3CRQA 4MTFA 2IU0A 2PI4A 1R3IC 1YSRA 4J7JA 4EKWA 2AKPA 4JAAA 3R92A 5EK0A 4AI8A 3CCVV 4YY3B 1Q86W 1XILA 2CCUA 5KUKA 2WI4A 4MP7A 3L75H 2IOQA 4XIRA 2HVJC 5FL7G 3UT5B 3ETGA 3LSUA 1V54B 1IURA 3ZIAG 5J9PC 5JVDA 1BQ0A 4GKJO 5LYJA 2JRIA 3T1KA 5GTHZ 2YE8A 2YXLA 3HKDB 2BYIA 3HZ1A 1B06A 3TXSA 2UWDA 3ABLC 4AS9A 1G6UA 2X6CA 2ZT9B 4I4TB 4AQYB 1Q8IA 3OD4A 1XNQB 1TH8A 1JOYA 1OV9A 3SYAA 1YEWA 3DTUB 4OX9O 3C0EA 1BMFG 4FLXA 2ILMA 1AM1A 4CH4A 3GIEA 3I5DA 4YKQA 4CBCA 1JCHA 4DV4O 3WG7C 1SA0B 2YJWA 2ZIOA 4I55A 1N36B 3O2FA 4EFBA 2VS0A 2HHHB 2Z5UA 4D7TA 1NBMG 4HY1A 4UCSA 3BPZA 2VWKA 4EFEA 5LGNA 3OW6A 4CS3A 3ML0A 4DK0A 5JENA 4CH6A 2YIAA 1U2OA 4DUHA 5D6QA 1VP7A 1EZJA 3R66A 3B28A 4WBNA 2VW5A 2WLMA 2FYPA 2YE6A 5JH7A 2ZKOA 2JGDA 4LWSB 1MSDA 4O4HA 1O9HA 2XHBA 4UB8Z 4DV5O 2WI1A 1Q43A 3J81N 2ZDYA 4JI4B 4QPKA 4PD4F 3H1KH 4GKKB 4PJ0Z 3K60A 2XABA 3FB8C 4WBNB 1MZFA 3K9AA 2PNRA 3S5TA 4LF4O 1HNXO 2YICA 1YDXA 1G1XB 1Y4SA 1LUVA 3FYEB 3E8GA 3ZKBA 3VADA 2R9RB 1UYMA 1EN6A 1K97A 3HKBA 2XDLA 3VQYA 2LGWA 2KQXA 1KP2A 4E4EA 3RVZA 1KC8W 4WFEA 3W7XA 1BL8A 1S5HC 2WEQA 1RM1C 2Q6AA 1W0KG 1SZXA 3SDLA 1YC1A 4O07A 4DR6O 3CCLV 1HNWB 2GTAA 2H94A 3SPIA 1SRYA 2KG7A 5LA6B 3ZXQA 1DF5A 3B4SA 1H8EG 3VOUA 3E89A 5J2TB 3FT8A 1OCZC 1UYEA 3Q4HB 2EULA 2ZM6B 1GRJA 2XT9A 3OTOO 4MPEA 1GAXA 1N32B 3JYCA 1K3EA 4HYOA 5FNVB 2LW1A 3RGBA 4CWTA 1TGOA 4G27B 3LNUA 4YJ2A 4LF8O 2OYQA 4MTXA 5IJ9B 2BTZA 3RYIA 2XDUA 4BIUA 4PU9A 4JTDB 1YT1A 2HVKC 4X88A 3UO3A 4ZIBA 3TZ4A 1JM6A 2CTWA 3APOA 2XAQA 4IYIA 4WCEV 1XNQO 2QJ1A 3WQ9A 4OGQB 1OSFA 3HKEA 3T10A 4DUYB 4MPNA 3WHAA 4G2KA 3U2DA 5LYJB 2Q8FA 3K99A 2GHYA 3ZHSA 2LGQA 2YGEA 1GK9A 1WA8B 3UKMA 3GIFA 4CH3A 4PDMA 2HG1A 4JI3B 3H1IH 1CXZB 1VARA 2EILB 4FM2A 2XJXA 2UXBB 1EA6A 1Y4MA 2E0AA 5H6QA 4JI0B 2UXCB 1IVSA 1EM1A 4XBFA 1W2BU 1VQ8V 3T2SA 3LMMA 2BOCC 4LR3A 3HKDA 4J7KA 1XQ8A 2XAHA 4JI8B 4X1YB 4TUYA 3T1HO 1XUQA 1QHTA 4PDVA 4XCLA 1U96A 3NR7A 4WUCA 2UUBO 1HDJA 1K8AW 4NXNB 1QCEA 3THOA 3RYFB 2YEVA 1AMWA 4DR3O 4NTXA 3A0HZ 1AB3A 1AP6A
chains in the Genus database with same CATH topology
3CC2V 4MS2A 3AG1C 2V7QG 1UY8A 2EZOA 2WWWA 4H81A 5B1BB 3CCQV 4YKRA 2WPDG 3K3WA 4LC1A 1KIJA 2IORA 2X7RB 4XIPA 2JEUA 5L3CA 4JPRA 4UUJC 4UVBA 3CMAV 4GQTA 1YC3A 3SL2A 4KSGA 4J9ZB 2EILC 4RAIA 3MHSC 4UXNA 1K4CC 1MABG 3I55V 4YKXA 1H38A 2JJCA 2DYRC 4CWOA 4HYMA 3FB7C 4XDMA 4URMA 1K92A 2IWUA 4GX5A 4URLA 3E35A 4BIZA 5M4EA 2X6AA 3ZRXA 4WFHA 4KFGA 3ASOB 3RBZA 1YT2A 5CBFA 4H7QA 4JTCB 4PA6A 1YS3A 3E8BA 4P9OA 3TETA 1S72V 4BQJA 2JIZG 3E2EA 1F51A 2WLJA 3JD3A 1YHQV 2JKIA 1S0VA 3H4LA 4GGLA 4KTNA 4L90A 2YE5A 3F7YC 1V54C 1QLNA 3CC7V 1S76D 4JAVA 1YT0A 1AH8A 1AI6A 2LP7A 4FCQA 5FNCA 4EGIA 1THNA 2IU3A 1GO3F 4R6ZA 3INXA 1UYHA 5B1AB 4U7OA 4GCZA 2P67A 3SJQC 1AJPA 3CCMV 1WLEA 1B3QA 2YE9A 1P7BA 3ZRVA 4NH9A 4MVSA 2W0FC 5HFMA 3ZMZA 3T2MA 3EHGA 2EBOA 5CTXA 2XASA 4QPJA 3OM3B 1PNMA 2R9IA 4TSFG 1GJVA 3OPDA 3AG2B 2AHZA 1FFTB 2IJHA 1YC4A 1QR9A 3EHFA 1NHHA 3EKRA 4KQVA 3NXSA 4XKAA 3ZMTA 4CE2A 5KA5A 3U67A 3FB6C 3WFVA 3JD2A 1ZWIC 4HAMA 2EIKC 3MNRP 2YI7A 2XHRA 3STLC 1YJ9V 2BU6A 4PL9A 3OMNB 4LWIA 3OMIB 1AJQA 3LDDA 1K5SA 4K4OA 2JEXA 4CWFA 2HKJA 4R3MA 4GX2A 3A0TA 1Y8NA 3RLPA 1NR7A 2WSSG 1VQ5V 1AI7A 2NNUA 2FXSA 2EIJC 1I5BA 2IWSA 2XAJA 3EHBB 2BSMA 3OEEG 3CPWU 2XCMA 4NH7A 4X9LA 3A0ZA 3HYYA 3JD4A 1AJNA 4CWPA 3ASNC 3CCEV 1S14A 4MVRA 1YSZA 2XJJA 3R4NA 2BREA 1EBOA 3QO7A 3HYZA 4BQGA 5EC2C 4EFUA 4BAYA 4YKTA 4QJFB 4R3AA 5L3FA 1FXKA 2A79B 1YJWV 4RQFA 2OCCC 2X6BA 2Y69B 4GX0A 2DWDC 2YSUB 4I9WA 4RUFA 2YK2A 3K97A 2WI6A 1OCRC 3B8MA 2Q8GA 4MBCA 1I5XA 1BKNA 4XCJA 4YXWG 1IXMA 5L3DA 1OCOB 1QBZA 1K73W 1PNKA 2ZDXA 3K79A 1V55B 2QG2A 2PI5A 3CC4V 2HCHA 2QFOA 2ESAA 2XK2A 2WLHA 4H85A 2YEAA 3HZ5A 1MG1A 4V26A 4JGSA 2QKSA 3O0IA 3X2QB 5FWKA 1RPRA 4P7AA 2AHYA 4MT8A 1YJNV 3ZKDA 4ASAA 4HYPA 1R3KC 4PA7A 4ASUG 2HFEC 2ITDC 1EFRG 1M90W 3CWVA 4UV8A 3ETDA 3K06A 2A0LA 4X8AA 1QVFU 3R91A 2DYRB 1E79G 4PA4A 3QO5A 3NMQA 1M9NA 3R65A 1GMGA 3EHJA 1R3LC 1I59A 5B1NA 3OMUA 4XKKA 2HLDG 3LDCA 4JYCA 1OZ0A 1WPXA 2O1WA 5B1BC 1ZWHA 1BYQA 2BU2A 3K0DA 1JJ2U 2ZDIA 4P9PA 3G71V 5LHGA 3ABKB 5DM6V 2YE3A 3H80A 3K0GA 3ABLB 3P30A 1M56C 2WI3A 1QVGU 4XC0A 1Y66A 3LNMB 2YEBA 3ZN0A 1UYCA 1N8RW 1H8HG 3RKZA 5M4MA 1TC6A 4O05A 4JF3A 3QNEA 4BAEA 3K08A 4HZ5A 1UY9A 2YEHA 4DZYA 2WLIB 4WUBA 4MP2A 3RVYA 4YKUA 3HB3B 4RO2A 4YKWA 5M4NA 2D3OW 1UY7A 3A0WA 1VQKV 2CH4A 2IJJA 2KB1A 2YI5A 3UM7A 3B8NA 3O6OA 2Q8HA 1PD3A 3SPJA 3ZM7A 2WLNA 2FWZA 3VBBA 3D0BA 5CTWA 1DLBA 2XAGA 5L3EA 2ZBKB 3FT5A 5H6RA 2QEXV 2DWEC 1NH2D 2DYSC 3W7SA 1RPOA 3M99B 5CMUA 4WFGA 4YKYA 3PEHA 1OCCB 1FXKB 2JJ1G 3OAAG 2M7WA 2ATKC 4XDKA 3A0YA 1VQNV 5F3KA 1F4MA 4L91A 5M4KA 5LHHA 4FPPA 5B3SB 2EIMB 3Q5JA 4MPCA 2O1VA 3D2RA 1KECA 3OMAB 4LBEC 1VQPV 1YERA 1Z59A 2LFRA 2XJGA 3W7WA 2XX5A 4BXIA 2IJIA 2IW5A 3CRLA 5HFLA 1BHAA 2XDKA 4X89A 3F5WC 4I3HA 4ZBMA 2EJRA 3OUFA 4TWKA 3B77A 2WI7A 2XX2A 3G7BA 4LWFA 4URNA 4QNHB 3ZMSA 5CPHA 2VWCA 5EBMC 3R4OA 5GGZA 5L3BA 4E2LA 1MOFA 2ZKJA 3IGAC 5GW7A 5L3GA 1P4RA 2B1GA 1YTFB 1NKDA 4XKOA 4CE3A 1PVGA 3BEHA 1XL6A 5KUMA 2BT0A 5B3SC 1K33A 3ABMC 2CGFA 2EZPA 3K98A 2IH1C 4W7TA 5L3JA 3EFFK 5EBLC 3ZXOA 3CGYA 4XDJA 1H2GA 3W7UA 3KG2A 1OHHG 3D3IA 3SPHA 1OCCC 4FJCC 3T4ZA 3AG1B 2DW4A 1VQ7V 3OR7C 5CA3A 4HXZA 4E01A 5FNDA 4EGKA 2FWYA 1COWG 4B7PA 2XD6A 1AROP 5IYBO 1UYKA 1K5QA 4CWSA 2NLJC 1VQMV 2GSMB 1UYGA 3SYQA 1ROPA 4EGHA 5B1OA 3LSSA 2WLLB 4H37A 1NR1A 4MVQA 1TC0A 4U93A 4GFNA 1PNLA 3MD0A 4CWRA 2XHXA 3HPLC 1YSCA 4R50A 5D7RA 4MOTA 4UVCA 2ZD9A 5KA6A 3LSQA 1TIDA 2WI2A 3INWA 1VQ6V 1H7SA 3ZMUA 2XOKG 3TZ2A 1UJWB 4XIQA 2QG0A 1B6QA 2WERA 4H33A 1GKXA 3FV5A 1V55C 2CK3G 3G75A 3ABUA 1OCOC 3OWBA 3TZ0A 1AR1B 1GM8A 4MTFA 2IU0A 1QLEB 1R3IC 2PI4A 3B25A 5D6PA 1YSRA 3T1CA 4O09A 3JD0A 4EKWA 4BW5A 2AKPA 5BODA 1E1QG 4P2ZA 3ZRWA 1Q82W 2Y48A 4JASA 5EK0A 3CD6V 2P6JA 3JCZA 4F4LA 3CCVV 1YTFD 1A4HA 1AH6A 1ZXMA 1Q86W 4GT1A 3VHAA 1FXKC 3SYOA 1JX9A 1L0OA 2CCSA 4HY6A 3G6EV 1FS0G 2CCUA 4L87A 1QLEC 5KUKA 2WI4A 2YKBA 5EC1C 4RQEA 2IOQA 2YJXA 4MP7A 4P8OA 4XIRA 2HVJC 3DGEA 3BY6A 4JYBA 5FL7G 2YEIA 2H8MA 1QZRA 3ETGA 1V54B 3CCRV 3ZIAG 3VHDA 3VHCA 5J9PC 1ENVA 2XHTA 4QE9A 3X2QC 3SPCA 2P7TC 5LGUA 4QE7A 3WG7B 3BMYA 4JAUA 3JZ3A 2YE2A 1DF4A 1I5YA 3T1KA 2K5BA 4EM7A 2YE8A 2WLKA 2BYIA 1AI5A 2YEEA 3HZ1A 3R4MA 1Z5BA 4LWGA 1W0JG 4Z1MG 5E1AC 2UWDA 2VCJA 2OT5A 3ABLC 2YKCA 1U0ZA 3T4DA 1LNQA 4AS9A 1ORQC 2X6CA 3P32A 4N21A 2YEDA 1QR8A 1Q7YW 1HWYA 2YKJA 1TH8A 1GM9A 2WAMA 4GT8A 1JOYA 1AJ6A 2MK3A 4E00A 1AI4A 1Q81W 1VQ4V 4QIWF 3SYAA 1BXDA 3DTUB 4J9YB 4KUMA 2DQ3A 1Y8PA 4PELA 1K9MW 1I5AA 5B1AC 3C0EA 4PA3A 1BMFG 2FTKA 4LP8A 2EIJB 1AM1A 1I58A 3GIEA 4YKQA 3OUSA 4CBCA 1JCHA 2YKEA 4G28B 3WG7C 1I5CA 2YJWA 4MSWC 3CRKA 3OE7G 2DQ0A 2EXLA 1SESA 4P30A 3O2FA 4UV9A 4XD8A 2Z5UA 4KFMA 4ASBA 1NBMG 4HY1A 3GWOA 3OWDA 4L8ZA 1L1FA 5LGNA 4ASFA 1PL0A 3FB5C 3LDEA 1CPYA 2H55A 2EIKB 2F43G 3AEIA 3ML0A 3OW6A 4LP0A 2Z3YA 2HJFC 3T0HA 5IN9A 2JK5C 5C93A 2W6JG 1U2OA 4CWNA 1OCRB 2QE7G 4DUHA 3SYPA 5LBQA 5BZBA 3A0XA 4LWHA 5D6QA 3FKSG 2OCCB 1ZW9A 3AG4B 5CTYA 1EZJA 3B28A 2Q68A 2Q2EB 1G4YB 4XITA 2BU7A 2UXNA 1G8MA 2C2AA 1R6KA 2DYSB 3F7VC 2VW5A 4I5SA 2WLMA 3OFNG 4LWEA 2FYPA 2P90A 2YE6A 3FYIB 1QYEA 1QY8A 4WUDA 3CGZA 3K04A 3U2KA 4FK5C 1CEZA 3KE6A 3ZRSA 4R8CA 4HZ0A 5FNFA 4B6CA 1VQLV 3STZC 3MHHC 3RLRA 2XX4A 2WI1A 1R3JC 4MW3A 3OR6C 5H9CA 1TUEB 2YI0A 2YK9A 4R1FA 3R92A 4OXSA 4ZKIA 1NVPD 2CG9A 2ZDYA 4O0BA 4E02A 5M4HA 4GEEA 2IWXA 2XNDG 4QPKA 1FXVA 2HKOA 2OTLV 2XDSA 3K60A 3CMEV 4L94A 2XABA 3FB8C 3SYCA 3K9AA 3AG3B 2B5UA 2PNRA 3HHUA 4DXWA 4Q20A 1KQSU 3EKOA 2YECA 4N23A 1Y4SA 1S77D 3FYEB 3E8GA 3ABMB 4R7CA 5IYCO 1NQTA 3ZKBA 3VADA 2R9RB 4XDLA 1UYMA 2QF6A 2LFSA 1UYIA 3K03A 1K97A 2XDLA 2ZR2A 2BU5A 3OW2U 5CF0A 3GIGB 1XL4A 2OTJV 3TK1A 2IH3C 5LHIA 4WFBV 1MSWD 4KP4A 5DN6G 3GB7C 1SERA 1KP2A 5M4PA 3RVZA 4FIPC 1KC8W 4UROA 4CE1A 3OEHG 4PDRA 4MTOA 5IDJA 1ID0A 1YETA 4WFEA 3BM9A 1F23A 1GKFA 5CN0A 5F5RA 3W7XA 1TBWA 1BL8A 2YKIA 1S5HC 2WEQA 3G4SV 3EHHA 1GTOA 1RM1C 5D7CA 2Q6AA 4EMVA 3SPGA 1W0KG 2EINC 1FXHA 1OCZB 4MVMA 2JJ2G 3CCJV 1NHJA 2BOBC 3G7EA 3HEKA 3QTFA 4AWQA 1YC1A 1Z5AA 4O07A 4EEHA 2CCTA 4XE2A 3CCLV 4FCRA 5J6AA 2H94A 5BOCA 3OGCC 3IEDA 1UYFA 3SPIA 1SRYA 2A9HA 1KP3A 3AG4C 1ZXNA 1UY6A 4ZVIA 3CCUV 3ZXQA 1DF5A 4FCPA 1M57C 1NHIA 3TZ5A 1H8EG 3VOUA 4MTGA 2Q8IA 4LPBA 3E89A 2YE4A 4YKZA 1THZA 1NH2B 3E86A 3ZRWB 3FT8A 5IYDO 1MX0A 2BZ5A 3Q5LA 1VQOV 1OCZC 1UYEA 1MU5A 1RM1B 5CTUA 4O04A 3E8HA 4MW8A 5IY5C 1CP9A 4L93A 3TTZA 4CWQA 1JVMA 1YI2V 1YITV 1B62A 2WLIA 2GFDA 2QA4V 1Z5CA 1Y8OA 2YEGA 4MPEA 3JYCA 1BGQA 2GQPA 2ITCC 1K3EA 4HYOA 1NVPB 2XDXA 1R6NA 1GM7A 2ZXWB 4FMTA 3Q5KA 4UVAA 4CWTA 3ABTA 4NH8A 4G27B 2UXXA 4MB9A 3ZJZA 3LNUA 3RLQA 2BRCA 4WFFA 5EBWC 4MTXA 2Q67A 1M56B 2BTZA 2HG5C 2Q69A 3ABKC 5LGTA 3AG2C 5D7DA 1R62A 4BIUA 2XDUA 4JTDB 1DTOA 1YT1A 4PRVA 4PU9A 4MVOA 2HVKC 2X0LA 4PA9A 2YEJA 4AWOA 4GX1A 3ZN1A 4X88A 4RUEA 3AG3C 2K1EA 4HZ3A 1F4NA 4DO2A 1VQ9V 1TILA 3TZ4A 3CYOA 1JM6A 4U7NA 4JTAB 1H7UA 5J71A 4HXWA 2XAQA 2YEVB 4WFAV 4WCEV 3WQ9A 1SETA 3E83A 2ZXWC 1I5DA 1KZNA 1OSFA 1S16A 2WI5A 3B27A 4PRXA 3T10A 2ZR3A 3H01A 2YI6A 2BYHA 2W6IG 4MPNA 3WHAA 4G2KA 4ASGA 2QM8A 4JQLA 3U2DA 1NJIW 2Q8FA 3ETEA 3PJSK 3K99A 2GHYA 2BU8A 2YGEA 3GIGA 1EI1A 3TUHA 2XAFA 3LUTB 1GK9A 3ASOC 4MVUA 3JD1A 4PDLA 3UKMA 1UYLA 3GIFA 3I56V 1K4DC 1YESA 4PDMA 2HG1A 3T0ZA 3ZCCA 3TCUA 1J95A 1SZTA 1US7A 2EIMC 2YGFA 2EILB 2XJXA 3B26A 4EFTA 1EA6A 1Y4MA 1M57B 2B1IA 2Y69C 1UYDA 2E0AA 1K34A 4V25A 5H6QA 5IDMA 1KD1W 2IJKA 2ZDIC 3C11A 4XBFA 1W2BU 1VQ8V 4XTJA 3IC7A 3T2SA 2V1DA 5CBGA 1K7DA 4KSHA 3ZMVA 2BOCC 1R73A 2JDIG 5CBHA 3ASNB 3W7TA 4AWPA 2EINB 2ZQMA 3CP1A 3D36A 3RW0A 3QDDA 1PKXA 3R4PA 1JPXA 1S3JA 2XAHA 1M1KW 3PEJA 2H8PC 2VCIA 3A0RA 4LCUC 1KKDA 4PDVA 4XCLA 2QM7A 2O1UA 1E1RG 4TT3G 4CZZA 4WUCA 4MVZA 3B24A 5IY5B 3QO8A 1K8AW 1JQ0A 2QTOA 1GKZA 1QCEA 4WF9V 1B63A 2IOPA 2WLLA 3LPSA 3CXCU 3IFXA 2YGAA 1YIJV 2YEVA 1AMWA 3E8FA 2WEPA 2HR3A 2YE7A 1Y4UA 2YEFA 3CCSV 1BHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UY8 A;  2WWW A;  4H81 A;  4YKR A;  4LC1 A;  1KIJ A;  2IOR A;  4XIP A;  4GQT A;  3SL2 A;  4CWR A;  1YC3 A;  4KSG A;  4YKX A;  4CWO A;  2JJC A;  4HYM A;  4XDM A;  4URM A;  2IWU A;  4URL A;  4BIZ A;  3ZRX A;  4KFG A;  1YT2 A;  4H7Q A;  1YS3 A;  4BQJ A;  1F51 A;  2JKI A;  5M4E A;  3H4L A;  4GGL A;  4KTN A;  4L90 A;  2YE5 A;  1YT0 A;  4JAV A;  1AH8 A;  4FCQ A;  5FNC A;  4EGI A;  1THN A;  3INX A;  1UYH A;  4U7O A;  4GCZ A;  2P67 A;  1B3Q A;  2YE9 A;  3ZRV A;  4NH9 A;  3EHG A;  5CTX A;  4QPJ A;  3OPD A;  1GJV A;  3EHF A;  1YC4 A;  4KQV A;  1NHH A;  3EKR A;  4XKA A;  3NXS A;  4CE2 A;  3U67 A;  3MNR P;  2YI7 A;  2XHR A;  2BU6 A;  4PL9 A;  4LWI A;  4K4O A;  4CWF A;  2HKJ A;  4R3M A;  3A0T A;  1Y8N A;  3RLP A;  2FXS A;  1I5B A;  2IWS A;  2BSM A;  2XCM A;  4X9L A;  4NH7 A;  3A0Z A;  3HYY A;  4CWP A;  1S14 A;  1YSZ A;  2XJJ A;  3R4N A;  2BRE A;  3HYZ A;  4BQG A;  4EFU A;  4YKT A;  4R3A A;  2YK2 A;  3K97 A;  2WI6 A;  2Q8G A;  4MBC A;  1BKN A;  4XCJ A;  1IXM A;  2ZDX A;  2QG2 A;  2HCH A;  2QFO A;  2ESA A;  2XK2 A;  4H85 A;  2YEA A;  3HZ5 A;  4V26 A;  3O0I A;  5FWK A;  4P7A A;  4MT8 A;  3ZKD A;  4ASA A;  4HYP A;  3CWV A;  3R91 A;  3NMQ A;  3EHJ A;  1I59 A;  5B1N A;  3OMU A;  4XKK A;  4JYC A;  2O1W A;  1ZWH A;  1BYQ A;  2BU2 A;  2YE3 A;  3H80 A;  2WI3 A;  4XC0 A;  2YEB A;  1UYC A;  3RKZ A;  5M4M A;  1TC6 A;  4O05 A;  4BAE A;  4HZ5 A;  1UY9 A;  2YEH A;  4DZY A;  4WUB A;  4MP2 A;  4YKW A;  4YKU A;  5M4N A;  1UY7 A;  3A0W A;  2CH4 A;  2YI5 A;  3O6O A;  2Q8H A;  3ZM7 A;  2FWZ A;  3D0B A;  5CTW A;  2ZBK B;  3FT5 A;  4YKY A;  3PEH A;  3A0Y A;  5F3K A;  4L91 A;  5M4K A;  4FPP A;  3Q5J A;  4MPC A;  2O1V A;  3D2R A;  1Z59 A;  2XX5 A;  1YER A;  2LFR A;  2XJG A;  4BXI A;  3CRL A;  2XDK A;  4I3H A;  3G7B A;  4LWF A;  4URN A;  2WI7 A;  2XX2 A;  5CPH A;  2VWC A;  3R4O A;  5GGZ A;  2ZKJ A;  4XKO A;  4CE3 A;  1PVG A;  2BT0 A;  3K98 A;  2CGF A;  4W7T A;  5L3J A;  3ZXO A;  3CGY A;  4HXZ A;  4E01 A;  4EGK A;  5FND A;  2FWY A;  4B7P A;  2XD6 A;  4CWS A;  1UYK A;  4EGH A;  1UYG A;  5B1O A;  4U93 A;  1TC0 A;  4GFN A;  3MD0 A;  2XHX A;  5D7R A;  4MOT A;  1TID A;  3INW A;  2WI2 A;  1H7S A;  3TZ2 A;  4XIQ A;  2QG0 A;  2WER A;  1GKX A;  3FV5 A;  3G75 A;  3OWB A;  3TZ0 A;  5D6P A;  3B25 A;  1YSR A;  4O09 A;  5BOD A;  2AKP A;  3ZRW A;  3R92 A;  4JAS A;  2YKI A;  1AH6 A;  1A4H A;  1ZXM A;  3VHA A;  4GT1 A;  1L0O A;  2CCS A;  4HY6 A;  2CCU A;  2WI4 A;  2YKB A;  4MP7 A;  2IOQ A;  4P8O A;  2YJX A;  4XIR A;  3DGE A;  4JYB A;  2YEI A;  2H8M A;  1QZR A;  3VHD A;  3VHC A;  2XHT A;  3BMY A;  4JAU A;  3JZ3 A;  2YE2 A;  3T1K A;  2K5B A;  4EM7 A;  2YE8 A;  2BYI A;  2YEE A;  3HZ1 A;  3R4M A;  1Z5B A;  4LWG A;  2UWD A;  2VCJ A;  2YKC A;  1U0Z A;  4AS9 A;  3P32 A;  2YED A;  2YKJ A;  1TH8 A;  4E00 A;  4GT8 A;  1JOY A;  1AJ6 A;  1BXD A;  1Y8P A;  1I5A A;  3C0E A;  2FTK A;  1AM1 A;  1I58 A;  3GIE A;  4YKQ A;  2YKE A;  1I5C A;  2YJW A;  3CRK A;  2EXL A;  3O2F A;  4XD8 A;  4ASB A;  4HY1 A;  3OWD A;  4L8Z A;  4ASF A;  3Q5L A;  3OW6 A;  2H55 A;  3T0H A;  4LP0 A;  5IN9 A;  5C93 A;  1U2O A;  4CWN A;  4DUH A;  3A0X A;  4LWH A;  5D6Q A;  1ZW9 A;  5CTY A;  3B28 A;  2Q2E B;  4XIT A;  2BU7 A;  2C2A A;  2VW5 A;  4I5S A;  4LWE A;  2FYP A;  2YE6 A;  1QYE A;  1QY8 A;  4WUD A;  3CGZ A;  3U2K A;  3KE6 A;  4HZ0 A;  5FNF A;  4B6C A;  3RLR A;  2XX4 A;  2WI1 A;  2YI0 A;  2YK9 A;  4R1F A;  5M4H A;  2ZDY A;  4ZKI A;  4O0B A;  2CG9 A;  4E02 A;  4GEE A;  2IWX A;  4QPK A;  4L94 A;  2XDS A;  3K60 A;  2XAB A;  2PNR A;  3HHU A;  4Q20 A;  3EKO A;  2YEC A;  1Y4S A;  3ZKB A;  3VAD A;  1UYM A;  2QF6 A;  2LFS A;  1UYI A;  2XDL A;  2BU5 A;  5CF0 A;  3GIG B;  3TK1 A;  4KP4 A;  5M4P A;  4CE1 A;  4URO A;  3BM9 A;  1ID0 A;  1YET A;  5IDJ A;  5F5R A;  1TBW A;  2WEQ A;  3EHH A;  4EMV A;  5D7C A;  3G7E A;  3QTF A;  1NHJ A;  3HEK A;  4AWQ A;  1YC1 A;  1Z5A A;  4O07 A;  4EEH A;  2CCT A;  4XE2 A;  5J6A A;  4FCR A;  5BOC A;  3IED A;  1UYF A;  4EFT A;  1ZXN A;  4ZVI A;  1UY6 A;  3ZXQ A;  4FCP A;  1NHI A;  3TZ5 A;  2Q8I A;  4LPB A;  2YE4 A;  4YKZ A;  3ZRW B;  3FT8 A;  1MX0 A;  2BZ5 A;  1UYE A;  1MU5 A;  5CTU A;  4O04 A;  4L93 A;  3TTZ A;  4CWQ A;  1B62 A;  2GFD A;  1Z5C A;  2YEG A;  1Y8O A;  4MPE A;  1BGQ A;  2GQP A;  2XDX A;  4FMT A;  3Q5K A;  4CWT A;  4NH8 A;  4MB9 A;  3LNU A;  3RLQ A;  2BRC A;  4MTX A;  2BTZ A;  5D7D A;  1R62 A;  4BIU A;  2XDU A;  4PU9 A;  1YT1 A;  4PRV A;  2YEJ A;  4AWO A;  1TIL A;  3TZ4 A;  1JM6 A;  4U7N A;  1H7U A;  5J71 A;  4HXW A;  3WQ9 A;  1S16 A;  1I5D A;  1KZN A;  1OSF A;  2WI5 A;  3B27 A;  3T10 A;  4PRX A;  2YI6 A;  2BYH A;  4MPN A;  3WHA A;  4ASG A;  2QM8 A;  4JQL A;  3U2D A;  2Q8F A;  3K99 A;  3TUH A;  2YGE A;  3GIG A;  1EI1 A;  1UYL A;  3GIF A;  1YES A;  2HG1 A;  3T0Z A;  3ZCC A;  1US7 A;  2YGF A;  2XJX A;  3B26 A;  1EA6 A;  1UYD A;  2E0A A;  4V25 A;  5IDM A;  3C11 A;  4XTJ A;  3T2S A;  4KSH A;  4AWP A;  3D36 A;  3QDD A;  3R4P A;  3PEJ A;  2VCI A;  3A0R A;  4XCL A;  2QM7 A;  2O1U A;  4WUC A;  3B24 A;  1GKZ A;  1B63 A;  2IOP A;  3LPS A;  2YGA A;  1AMW A;  2WEP A;  2YE7 A;  1Y4U A;  2YEF A;  2BU8 A; 
#chains in the Genus database with same CATH topology
 5IT9 N;  3CX5 F;  1Y6X A;  3JSL A;  2JEU A;  4UVB A;  4UUJ C;  4GQT A;  4RWU A;  4DR7 B;  1WP8 A;  1K4C C;  4DV2 O;  2D2C B;  4BIZ A;  4NTY A;  1WB8 A;  1WNS A;  3RBZ A;  4PA6 A;  2Y0P A;  3JAK A;  3TET A;  3E2E A;  4GGL A;  4ZHQ B;  4LFC B;  2QKC A;  1WAZ A;  4L90 A;  2YE5 A;  1S76 D;  5C8Y B;  1AI6 A;  1THN A;  3TGU H;  3CJH B;  3SJQ C;  1UYH A;  5KAF Z;  1I94 B;  1WLE A;  5CB4 A;  3CRA A;  4J10 A;  3ZRV A;  5BR8 B;  4LFB O;  3ZMZ A;  1NU1 H;  4H44 B;  4TSF G;  1GJV A;  2IJH A;  1FFT B;  2PYL A;  1YC4 A;  3EHF A;  4KQV A;  4XKA A;  5KA5 A;  3MNR P;  4LFA O;  3RFR A;  3STL C;  2Y4T A;  3OMN B;  4X1I A;  1US6 A;  4JI2 O;  2QSA A;  4CWF A;  3A0T A;  1Y8N A;  3RLP A;  1NR7 A;  2PZS A;  1VQ5 V;  2FXS A;  1QQC A;  3KCX A;  3CPW U;  4LNU A;  4CWP A;  2E76 B;  3R4N A;  3QO7 A;  1HR0 B;  4EFU A;  1M4U A;  4LF7 B;  5L3F A;  4X65 O;  1BT8 A;  4LH6 A;  2Y4U A;  1R6T A;  4GX0 A;  2YSU B;  4Z1V A;  4Q6G A;  5K1P A;  2UXD O;  1OCR C;  2IBZ H;  4DR5 B;  2ARH A;  1OCO B;  1XMQ B;  1V55 B;  1AR5 A;  2PI5 A;  3CC4 V;  2HCH A;  2ZE7 A;  4X9Q A;  1Q6U A;  4V26 A;  4JGS A;  3RYC B;  3X2Q B;  4O4J A;  1RPR A;  1W59 A;  2QWP B;  1PL4 A;  2ITD C;  4UV8 A;  3ETD A;  4J41 A;  2VQE B;  1L0N H;  3R65 A;  4FM1 A;  1TUB A;  4DW0 A;  1NS1 A;  2YXY A;  3CRC A;  1EN5 A;  2O1W A;  2ZDI A;  1EZV H;  1BHB A;  5DM6 V;  2UXD B;  1M56 C;  1X4T A;  4F6E A;  4XC0 A;  4X65 B;  2YEB A;  3D36 C;  2MW2 B;  2DN9 A;  1AIL A;  4IHJ B;  2YEH A;  4DZY A;  1XHX A;  2CH7 B;  1I7F A;  4I7Z B;  4YKW A;  5M4N A;  4I0X A;  1VQK V;  1GH6 A;  3UM7 A;  1RFY A;  3ZM7 A;  2WLN A;  2FWZ A;  3VBB A;  5CTW A;  2XAG A;  5H6R A;  1WB7 A;  3W7S A;  5LP6 C;  4WFG A;  1FXK B;  4KHP B;  3SJB C;  3JAT B;  3A0Y A;  2CUG A;  2JS5 A;  4UB6 Z;  5IWA O;  2M6Y A;  4ICG A;  1XRE A;  2PUS A;  3D2R A;  4LBE C;  5BR8 O;  4LFB B;  3CRL A;  4NKG B;  3G7B A;  2EJR A;  3B77 A;  4URN A;  1O9G A;  2P4V A;  3R4O A;  3MAQ A;  2B1G A;  2F95 B;  1WN7 A;  4CE3 A;  1PVG A;  5KUM A;  4LF6 O;  5L3J A;  2UUC O;  1YXB A;  5EBL C;  3ZXO A;  4I4T A;  3W7U A;  3KG2 A;  1NTK H;  2O57 A;  4E01 A;  3AG1 B;  3OR7 C;  1VF7 A;  4O4L A;  1M93 A;  1COW G;  4B7P A;  2XD6 A;  2DOS A;  1VQM V;  5B1O A;  1V9P A;  1YSC A;  5JCO C;  3INW A;  3LSQ A;  2AGA A;  4NXN O;  1B6Q A;  4YIO A;  2WER A;  5DED A;  4DV1 B;  1GKX A;  2CK3 G;  2F66 C;  4DR1 O;  2Q0O C;  3T1C A;  4BW5 A;  4DYL A;  1AR4 A;  3ZRW A;  1QU7 A;  4P2Z A;  1Q82 W;  4JAS A;  2P6J A;  4DR1 B;  3VHA A;  1NT2 B;  1JX9 A;  4J11 A;  2CCS A;  4DV1 O;  3G6E V;  4L87 A;  4P8O A;  3JAL B;  3BY6 A;  1L0L H;  4JYB A;  2H8M A;  1BE3 H;  1PM9 A;  2UXB O;  3L70 H;  2QWO B;  3VHC A;  1ENV A;  3U10 A;  4QE9 A;  4OPH A;  5GON A;  2YUA A;  3SPC A;  1JJO A;  4QE7 A;  2H3O A;  4JAU A;  5JVD B;  3JZ3 A;  2YE2 A;  1DF4 A;  2NN4 A;  4NYK A;  3WB1 A;  3R4M A;  1W0J G;  4K8X A;  4J7Z A;  3P32 A;  2YED A;  4ABM A;  3M8A A;  2YKJ A;  2B9Z A;  1GN6 A;  1H2L A;  2WAM A;  3L72 H;  4HNA A;  3ZS8 C;  2MK3 A;  3UCS C;  1AI4 A;  1Q81 W;  1VQ4 V;  1BXD A;  2DQ3 A;  1K9M W;  2F1M A;  2FTK A;  4LF9 O;  2EIJ B;  1I58 A;  2CTR A;  4G28 B;  4O4J B;  1SES A;  4LF8 B;  4ASB A;  4NXM O;  5DEC A;  1L1F A;  1PL0 A;  2H55 A;  1CPY A;  2EIK B;  3SJA C;  2ZE5 A;  2HJF C;  4KHP O;  1N32 O;  4DV7 O;  2JK5 C;  3OTO B;  1OCR B;  4CH5 A;  1ZW9 A;  5TIS Z;  1UFI A;  2Q2E B;  4XIT A;  4F6R A;  1URF A;  3F7V C;  1R6K A;  2BTQ B;  4LWE A;  4UFZ A;  2ADP A;  2Z0A A;  4DR4 B;  3ZRS A;  4I0X B;  4U3J A;  1VQL V;  3STZ C;  3RLR A;  2XX4 A;  1JFF A;  3CRM A;  5KHH A;  5ITZ A;  2DMX A;  3ZX6 A;  5JWP A;  4OXS A;  4ZKI A;  3KCY A;  3O65 A;  1LR1 A;  4GEE A;  2IWX A;  2HKO A;  2OTL V;  2XDS A;  3CME V;  4J80 A;  4GLX A;  3CSX A;  4FLV A;  4N23 A;  1S77 D;  3ABM B;  3CJH A;  5GTI Z;  1NQT A;  1HNX B;  2P5O A;  4IL6 Z;  1UYI A;  2BU5 A;  3GIG B;  3H1H H;  2IH3 C;  2ZE6 A;  4ZOL A;  4WFB V;  3GB7 C;  1XMQ O;  4FIP C;  1ID0 A;  5F5R A;  4DV5 B;  2Y0I A;  1GTO A;  3SPG A;  4MVM A;  3CCJ V;  3QTF A;  4LF7 O;  3HEK A;  1Z5A A;  4X64 B;  2CCT A;  1KYO F;  4XE2 A;  5J6A A;  3OGC C;  1FYJ A;  3QTC A;  5B66 Z;  3AG4 C;  1XDC A;  4MTG A;  4LPB A;  1NH2 B;  3ZRW B;  1XBL A;  1XHZ A;  2BZ5 A;  1VQO V;  4X20 B;  1MU5 A;  1RM1 B;  5CTU A;  4JI2 B;  4O04 A;  3E8H A;  4I50 B;  4JI7 B;  1YIT V;  2QA4 V;  2YEG A;  1BGQ A;  2ITC C;  2PTM A;  2E5L B;  3UT5 A;  1GM7 A;  1ZUQ A;  2ZXW B;  3FD9 A;  4FMT A;  4UVA A;  1ZL8 A;  4WFF A;  4Z2W A;  2FML A;  3AG2 C;  5D7D A;  1R62 A;  1DTO A;  2YEJ A;  4GX1 A;  4OX9 B;  1TIL A;  3AG3 C;  1VQ9 V;  4HZ3 A;  3CYO A;  5H5N A;  4WFA V;  5BXZ A;  4L8J A;  1Y74 A;  4UCV A;  1S16 A;  2WI5 A;  3B27 A;  2CGO A;  2Q5Z A;  2BYH A;  2W6I G;  2QM8 A;  4DV2 B;  1NJI W;  3PJS K;  3ZHT A;  3TUH A;  1EI1 A;  2XAF A;  3JAK B;  3LUT B;  3FAV B;  3ETQ A;  3ZCC A;  2JS3 A;  4B08 A;  3P3P A;  2EIM C;  3B26 A;  4DR3 B;  2B1I A;  4V25 A;  1K34 A;  2YDE A;  1KD1 W;  2IJK A;  1AP5 A;  3C11 A;  5LOV A;  2AW9 A;  4XTJ A;  2V1D A;  5CBG A;  2JDI G;  3ASN B;  2KKW A;  4DK1 A;  4DRX B;  1PKX A;  3RYF A;  3R4P A;  3PEJ A;  1S3J A;  2H8P C;  4IT5 A;  4LCU C;  4H13 B;  1KKD A;  2QM7 A;  2O1U A;  1LUW A;  3VQV A;  4TT3 G;  1JA8 A;  1KBH A;  1DK1 A;  4KXR A;  3AK2 A;  3RN4 A;  4WF9 V;  1IBL B;  2IOP A;  4JI0 O;  3LPS A;  3DSQ A;  3E8F A;  2YE7 A;  2HR3 A;  4NTW A;  2YEF A;  2BU8 A;  3CC2 V;  3AG1 C;  2V7Q G;  3ZHQ A;  1Z5W A;  3CCQ V;  4IIJ B;  4YKR A;  4XIP A;  4JPR A;  3MHS C;  1MAB G;  4YKX A;  1KU9 A;  1H38 A;  3FB7 C;  1MA1 A;  4GX5 A;  1HP8 A;  2L35 A;  3CWB H;  3E35 A;  2X6A A;  4DUY O;  3JAS A;  4TOI A;  1YT2 A;  4JTC B;  1YS3 A;  3E8B A;  1NZ6 A;  4TQD A;  2Q7E A;  5M4E A;  1BZK A;  2BSK B;  3F7Y C;  3CC7 V;  4JAV A;  2IU3 A;  1GO3 F;  3B40 A;  3K5N A;  2YI8 A;  2BCC H;  3INX A;  1AJP A;  2CTP A;  4NH9 A;  5HFM A;  2W0F C;  1SQV H;  3EHG A;  2XAS A;  5LXT A;  1ZLZ A;  5LMU B;  3AG2 B;  3EKR A;  3U67 A;  3FFQ A;  3FB6 C;  1XEQ A;  1ZWI C;  2QTS A;  2EIK C;  3JD2 A;  4LNU B;  4PL9 A;  2CGN A;  4JI7 O;  3OMI B;  2QM4 A;  2N04 A;  4K4O A;  2JEX A;  4TV8 A;  2WSS G;  4FFK A;  3H1J H;  1KKC A;  2HP8 A;  1AI7 A;  2EIJ C;  2IWS A;  3EHB B;  2BSM A;  3A0Z A;  2E75 B;  1EBO A;  5LXT B;  2BRE A;  1HNW O;  2RN9 A;  4YKT A;  4R3A A;  4DV6 B;  1FXK A;  2CE4 A;  2A79 B;  1YJW V;  2OCC C;  2Y69 B;  2YK2 A;  1P7G A;  2WI6 A;  2N74 A;  3L9D A;  3B8M A;  1BKN A;  4XCJ A;  5L3D A;  2YID A;  2ZDX A;  1IX9 A;  2OIE A;  1XMO B;  2QFO A;  2XK2 A;  2QKS A;  3O0I A;  4U3J B;  1VF5 B;  1B04 A;  1YJN V;  4ASA A;  3HKC B;  1M90 W;  3K5O A;  4O2B B;  1VF6 A;  4X8A A;  3R91 A;  3QO5 A;  2RJZ A;  2YC0 A;  1R3L C;  5B1N A;  3OMU A;  2HLD G;  4JI4 O;  1WPX A;  1YVW A;  1BYQ A;  2BU2 A;  3G71 V;  4PHZ A;  2YE3 A;  2WI3 A;  2ZIN A;  1S5L Z;  3LNM B;  5IYZ B;  3ZN0 A;  1ZL8 B;  2ODM A;  4DR4 O;  1TC6 A;  4O4H B;  4O05 A;  1UY9 A;  4YKU A;  3HB3 B;  2D3O W;  3A0W A;  1ZTE A;  2CH4 A;  3UO2 A;  2IJJ A;  2KB1 A;  3O6O A;  3B8N A;  2Q8H A;  4DV0 O;  4X1Y A;  4CS4 A;  3DXR B;  3M99 B;  5CMU A;  4DV7 B;  3CS5 A;  2ATK C;  2Q9L A;  3N2G A;  5J2U B;  5M4K A;  5LHH A;  4FPP A;  4NXM B;  5B3S B;  2EIM B;  5KX5 B;  4FLY A;  4MPC A;  2O1V A;  1Z59 A;  1J5E B;  2LFR A;  1TAE A;  1BGY H;  2QKA A;  3K57 A;  3GVM A;  2ETN A;  4QNH B;  3ZMS A;  5CPH A;  5GGZ A;  1GN2 A;  1JR9 A;  5GW7 A;  2F4V B;  1NKD A;  1IBM O;  3BEH A;  1XL6 A;  4AQY O;  2IH1 C;  1H2G A;  3SPH A;  4FJC C;  1VQ7 V;  2DW4 A;  5JQG B;  5CA3 A;  5FND A;  4GUN A;  4CWS A;  1K5Q A;  4FFB A;  3AK1 A;  3LSS A;  4H37 A;  3JAW A;  3HPL C;  5D7R A;  5KA6 A;  2WI2 A;  1VQ6 V;  2XOK G;  3TZ2 A;  4XIQ A;  1N0N A;  1YZB A;  1V55 C;  3G75 A;  2W0X A;  4X1K A;  4DUZ B;  2AZ2 A;  3N2K B;  3JAL A;  3K5L A;  1QLE B;  5D6P A;  5BOD A;  2P4K A;  3GWK C;  1E1Q G;  2Y48 A;  3CD6 V;  5KHI A;  2YKI A;  1AH6 A;  3JCZ A;  4F4L A;  1QNM A;  1YTF D;  5LOV B;  4LF5 O;  1A4H A;  2XTA A;  3SYO A;  2Q0A A;  3K58 A;  1L0O A;  4HY6 A;  1FS0 G;  3ZHV A;  1N33 O;  5EC1 C;  2YJX A;  2LO1 A;  1QZR A;  2IM9 A;  3HR0 A;  1UPG A;  3CCR V;  3VHD A;  5C8Y A;  2XHT A;  3X2Q C;  5KMG B;  3WG7 B;  3BMY A;  2GV9 A;  2K5B A;  3G6B A;  3QG5 A;  2WLK A;  1AI5 A;  1Z5B A;  4Z1M G;  2VCJ A;  2UUC B;  2OT5 A;  1RSO A;  2YKC A;  2CAZ C;  1LNQ A;  1ORQ C;  2RMK B;  3OGI B;  4N21 A;  2UU9 O;  1IBK B;  1HWY A;  1GM9 A;  4E00 A;  4GT8 A;  3FX7 A;  4QIW F;  4J9Y B;  4KUM A;  1Y8P A;  4PEL A;  3DXR A;  1I5A A;  5B1A C;  4PA3 A;  4B3T O;  4LP8 A;  5CA0 B;  3SR2 C;  5H2F Z;  2BE3 A;  4X62 O;  1FPO A;  4MSW C;  3CRK A;  2DQ0 A;  2EXL A;  4P30 A;  5FNV A;  1EN4 A;  4UV9 A;  4ZOL B;  1F7Y A;  2BTO A;  3K9S A;  3Q5L A;  3FB5 C;  2F43 G;  4LP0 A;  5IN9 A;  5IE9 A;  3CE2 A;  2LJ2 A;  1A32 A;  1FD9 A;  5B5E Z;  1FAF A;  1TVK B;  3SYP A;  3A0X A;  4LWH A;  2OCC B;  3BAB A;  5EIB D;  5CTY A;  2Q68 A;  2BU7 A;  1G8M A;  4B3S O;  2WA4 A;  3C3T A;  4BW9 A;  2VQF O;  4I5S A;  2NR5 A;  2EJ7 A;  3FYI B;  1QY8 A;  4WUD A;  3K04 A;  3L71 H;  2RCV A;  4FK5 C;  4J42 A;  5FNF A;  4B6C A;  3MHH C;  4B3M O;  5H9C A;  2YK9 A;  1TUE B;  5M4H A;  1NVP D;  4E02 A;  2XND G;  1FXV A;  4NB5 A;  5IYZ A;  3AG3 B;  2B5U A;  4DXW A;  5FPR A;  4Q20 A;  5JJN B;  4YJ3 A;  5A9G A;  1KQS U;  3EKO A;  3TXQ A;  1IXB A;  1VMG A;  2ZIM A;  2XUM A;  4R7C A;  3BRC A;  4XDL A;  2QF6 A;  3U11 A;  2LFS A;  3K03 A;  3RYH B;  1XL4 A;  4KP4 A;  4LWS A;  5M4P A;  2JGD B;  4URO A;  3OEH G;  1YET A;  4MTO A;  3BM9 A;  4FLW A;  4X66 B;  5FLX N;  4B3M B;  1TA8 A;  3EHH A;  5D7C A;  2EIN C;  3G7E A;  1FXH A;  2JJ2 G;  4HBN A;  1NHJ A;  2BOB C;  3T1Y O;  4FCR A;  3IED A;  1UYF A;  4EFT A;  2A9H A;  1ZXN A;  1KP3 A;  4ZVI A;  1UY6 A;  4FCP A;  3TZ5 A;  2YE4 A;  2LQT A;  4B3S B;  4QGP A;  3E86 A;  2GDS A;  4CC6 A;  5IYD O;  3CEI A;  2KSD A;  4DV3 O;  1N34 O;  4MW8 A;  4ZI7 B;  3TTZ A;  3BVO A;  4CWQ A;  1YI2 V;  3BA8 A;  4ZHQ A;  4B7E A;  4I55 B;  4E72 A;  3U0Z A;  2XDX A;  4AHC A;  4FLT A;  3Q5K A;  3APQ A;  4MB9 A;  4JZG A;  3RYH A;  4A5U B;  3RLQ A;  5EBW C;  4X62 B;  1I08 A;  1GN3 A;  2HG5 C;  2Q69 A;  3ABK C;  5LGT A;  1I94 O;  1Q5O A;  2KG7 B;  3L73 H;  5A2Q N;  4PRV A;  4B3T B;  4MVO A;  3KZI Z;  3ZBH A;  4IIJ A;  2K1E A;  4U7N A;  4JTA B;  4LFC O;  5J71 A;  1N4C A;  4HXW A;  2CDY A;  1WPB A;  4BIO A;  1IBK O;  5KMG A;  1S5J A;  4K35 A;  4ASG A;  2ZCE A;  4KL1 A;  3ETE A;  2Q4P A;  3GIG A;  3A2F A;  3H9V A;  3JD1 A;  4DR7 O;  1YES A;  2PGG A;  3T0Z A;  5KX5 A;  4DRX A;  5EZY B;  5KAI Z;  2YGF A;  4YJ3 B;  2BTQ A;  1NI8 A;  2Y69 C;  5IDM A;  2ZDI C;  3IC7 A;  2UUB B;  1GN4 A;  1K7D A;  3ZMV A;  3W7T A;  3IAY A;  4K0K O;  2EIN B;  3RW0 A;  3D36 A;  3QDD A;  3T1H B;  1M1K W;  4JI8 O;  5BY1 A;  4JI6 O;  4DUZ O;  4CZZ A;  4MVZ A;  3B24 A;  5IY5 B;  3JAR B;  2JVD A;  3SGI A;  1JQ0 A;  2LW7 A;  2UXC O;  5LP6 A;  2WEP A;  4FZ1 A;  3CCS V;  4MS2 A;  4D6T H;  1XNR O;  1UY8 A;  2WWW A;  4JI3 O;  4H81 A;  2QWN B;  3K3W A;  2IOR A;  3MDS A;  2V4D A;  1YC3 A;  4KSG A;  2EIL C;  4O2A A;  4HYM A;  2ZE8 A;  3WB0 A;  1RP3 B;  4URL A;  3ZRX A;  4WFH A;  2JGU A;  4H7Q A;  4FM0 A;  5D5P A;  1IBM B;  4BQJ A;  2JIZ G;  1F51 A;  2R9A A;  2WLJ A;  1YHQ V;  3H4L A;  1D5A A;  4H0L B;  1QLN A;  3J80 N;  2LP7 A;  4W4L A;  5FNC A;  4B3R O;  4EGI A;  3ZED A;  4R6Z A;  5B1A B;  3CCM V;  2HJD A;  4U3F H;  2YE9 A;  2C1I A;  3A8T A;  4FLU A;  4MVS A;  3T2M A;  2EBO A;  4GYC B;  1OJH A;  4QPJ A;  1J5E O;  3OM3 B;  1PNM A;  2E74 B;  2Q73 A;  4UCO A;  2AHZ A;  1QR9 A;  3N27 A;  4TV9 B;  1NHH A;  3NXS A;  2P22 C;  2VWJ A;  2YI7 A;  1VIB A;  1NTM H;  3LDD A;  1H2S B;  4PI2 A;  2ZM6 O;  2FL4 A;  3RYC A;  2HKJ A;  4OPA A;  4ZI7 A;  1KUQ A;  2K9P A;  1I5B A;  3OEE G;  4NH7 A;  2FYU H;  3JD4 A;  1AJN A;  3ASN C;  1S14 A;  1YSZ A;  3HYZ A;  3AK3 A;  5EC2 C;  4DR6 B;  4BAY A;  4TV9 A;  2QWQ B;  4QJF B;  1T5E A;  4RQF A;  3EVK A;  2X6B A;  4RUF A;  2DWD C;  4I9W A;  3UQ8 A;  3WB2 A;  4MBC A;  4YXW G;  1QBZ A;  5EYP B;  4YJ2 B;  2QG2 A;  4AIL C;  4CS2 A;  2ESA A;  3FAV A;  2WLH A;  4H85 A;  2YEA A;  1MG1 A;  2CH7 A;  2YIB D;  4P7A A;  5JJJ B;  4MT8 A;  3ZKD A;  4HYP A;  1R3K C;  4PA7 A;  2HFE C;  1BCC H;  2A0L A;  1SQG A;  1QVF U;  1E79 G;  4PA4 A;  4LF4 B;  1D2D A;  1BSM A;  3NMQ A;  1Z5V A;  3EHJ A;  1XMO O;  4XKK A;  4GKK O;  3LDC A;  1OZ0 A;  2AZ0 A;  1ZWH A;  3RYI B;  3JAT A;  3K0D A;  3A0B Z;  3E22 B;  4P9P A;  5LHG A;  1Q6I A;  1KB9 F;  3H80 A;  3K0G A;  5BMV B;  1QVG U;  5CA1 A;  1Y66 A;  4DV6 O;  2OWO A;  1N0J A;  1N8R W;  3RKZ A;  2PYJ A;  5M4M A;  3QNE A;  3D3Q A;  1NTZ H;  5ITZ B;  2RDC A;  2WLI B;  4MP2 A;  4RO2 A;  2WA3 A;  2VRZ A;  1I0H A;  3SPJ A;  4FZ0 A;  4I50 A;  3FT5 A;  2QEX V;  2DWE C;  1RPO A;  4YKY A;  3PEH A;  1OCC B;  2GTS A;  2M7W A;  4XDK A;  1VQN V;  4UCR A;  4L91 A;  4JI1 B;  5IJ0 B;  2HHH O;  1KEC A;  2XX5 A;  1VQP V;  1P84 F;  1N36 O;  3W7W A;  4BXI A;  3JSN A;  4O2B A;  4DV4 B;  2IW5 A;  1BHA A;  2G38 A;  5KHJ A;  2XDK A;  3F5W C;  4I3H A;  2GUZ B;  4TWK A;  5KLV H;  2WI7 A;  2XX2 A;  3ICX A;  4IHJ A;  4TUY B;  3IJ4 A;  5L3B A;  3IGA C;  4PI0 A;  5L3G A;  1FKA O;  5B3S C;  3ABM C;  3K98 A;  2EZP A;  1WP7 A;  4JV5 B;  4W7T A;  3EFF K;  3CGY A;  4XDJ A;  4F6R B;  3D3I A;  2PY5 A;  3T4Z A;  5IJ9 A;  2FWY A;  2Q8V A;  1ARO P;  5IYB O;  1UYK A;  3JAM N;  2NLJ C;  1UYG A;  3SYQ A;  1ROP A;  2N05 A;  4GKJ B;  4X1K B;  4MVQ A;  1NR1 A;  1XNR B;  1TC0 A;  4GFN A;  1PNL A;  2YS8 A;  3MD0 A;  5GON B;  2Q7G A;  4MOT A;  4UVC A;  2ZD9 A;  1FFX A;  1H7S A;  3ZMU A;  3AG7 A;  1UJW B;  2QG0 A;  5EIB C;  4H33 A;  3EXA A;  5EYP A;  4YY3 O;  4JYA B;  2A7W A;  3OWB A;  1AR1 B;  1GM8 A;  5JJE B;  1HW7 A;  1IDS A;  3B25 A;  4O09 A;  3JD0 A;  1IZ3 A;  4JYA O;  5AG2 A;  1ZXM A;  4GT1 A;  1FXK C;  2DE0 X;  3CRR A;  4BWA A;  1QLE C;  2ZNI A;  2YKB A;  4RQE A;  2F23 A;  3DGE A;  1ZX3 A;  2YEI A;  3HKC A;  5K1X A;  2P7T C;  2Q7H A;  5LGU A;  1SQF A;  1I5Y A;  2YIB A;  4EM7 A;  2YEE A;  1VEW A;  4LWG A;  1Y74 B;  5E1A C;  1VF6 C;  3VQX A;  4DR2 B;  4JV5 O;  3TJT A;  1H2M A;  2A3Q A;  3T4D A;  1U0Z A;  3B2E E;  1QR8 A;  1Q7Y W;  4LH7 A;  1AJ6 A;  3ZHU A;  1SQQ H;  4IYH A;  3QVN A;  1WA8 A;  3IC9 A;  3BHP A;  3OUS A;  3C3S A;  2YKE A;  1I5C A;  1L8D A;  1MZE A;  3OE7 G;  3RWR D;  4XD8 A;  4B7K A;  2ADQ B;  4KFM A;  3GWO A;  3OWD A;  4L8Z A;  3HKE B;  2E5L O;  4JI1 O;  4ASF A;  3LDE A;  3T0H A;  3AEI A;  5FPO A;  2Z3Y A;  4O2A B;  5C93 A;  2W6J G;  1Q6H A;  4JI5 O;  4CWN A;  2QE7 G;  5LBQ A;  5BZB A;  4DV3 B;  3FKS G;  3AG4 B;  1SQB H;  1Q3E A;  1G4Y B;  2UXN A;  2C2A A;  2DYS B;  3OFN G;  2HHI A;  2P90 A;  4YIP A;  1X59 A;  1QYE A;  3CGZ A;  3U2K A;  4X64 O;  1CEZ A;  3KE6 A;  1KMI Z;  4R8C A;  4HZ0 A;  4X66 O;  1R3J C;  4MW3 A;  3OR6 C;  2YI0 A;  4R1F A;  3Q4H A;  4O0B A;  2CG9 A;  4L94 A;  3SYC A;  3BAA A;  3CB2 A;  3ZHR A;  5IJ0 A;  4CC5 A;  3HHU A;  3L74 H;  4UCT A;  3CHX A;  2YEC A;  5IYC O;  1RSO B;  4JZ2 A;  2ZR2 A;  3WU2 Z;  3OW2 U;  5CF0 A;  2OTJ V;  3TK1 A;  5LHI A;  1MSW D;  5DN6 G;  1SER A;  4CE1 A;  3J7A U;  4PDR A;  5IDJ A;  2UUA B;  1F23 A;  1GKF A;  1SKV A;  5CN0 A;  2R70 A;  5CA0 A;  1TBW A;  3G4S V;  4EMV A;  1OCZ B;  4EEQ A;  4AWQ A;  1Q90 D;  4EEH A;  5BOC A;  5J2T A;  3CCU V;  2QR4 A;  1M57 C;  1NHI A;  2Q8I A;  2VQF B;  3M7M X;  4YKZ A;  1THZ A;  1TUB B;  1MX0 A;  5CB4 B;  1TVK A;  3C90 A;  4O4I A;  1FJG O;  1JFF B;  2ZNJ A;  3CXH F;  1CP9 A;  5IY5 C;  4L93 A;  1JVM A;  1B62 A;  2WLI A;  2GFD A;  1Z5C A;  1Y8O A;  2BSK A;  2YI9 A;  2GQP A;  1NVP B;  1R6N A;  3ABT A;  4NH8 A;  2UXX A;  3OT7 A;  3ZJZ A;  5BMV A;  2BRC A;  5CA1 B;  2Q67 A;  1M56 B;  3CYG A;  4D7S A;  4LF9 B;  2HEP A;  2X0L A;  3OTF A;  4PA9 A;  4AWO A;  3ZN1 A;  4DO2 A;  4RUE A;  4B3R B;  1F4N A;  2A06 H;  1H7U A;  2YEV B;  4NR1 A;  3BCC H;  1SET A;  3E83 A;  2ZXW C;  1I5D A;  1KZN A;  1Z2G A;  5LMN O;  4PRX A;  1MMM A;  2ZR3 A;  3H01 A;  4K3A A;  5KHG A;  2YI6 A;  1H2K A;  4TV8 B;  4JQL A;  2OIG A;  1YF2 A;  4K8Z A;  3ASO C;  4MVU A;  4PDL A;  1UYL A;  3I56 V;  1K4D C;  1SQX H;  3JAS B;  2YXH A;  2E3C A;  3TCU A;  1J95 A;  1SZT A;  1US7 A;  4NVP A;  4YHH B;  1M57 B;  3VQW A;  1UYD A;  2OCH A;  5KHK A;  4KSH A;  5CBH A;  1HNZ B;  1R73 A;  4FVM A;  4AWP A;  4LF5 B;  2ZQM A;  3CP1 A;  4JI6 B;  5D5Q A;  1JPX A;  2C1G A;  3A0R A;  2VCI A;  2QGN A;  1E1R G;  4K0K B;  1HNZ O;  1PV0 A;  3G80 A;  3SJC C;  1Y76 B;  3QO8 A;  2F93 B;  4X20 A;  1GKZ A;  2QTO A;  1B63 A;  2WLL A;  3CXC U;  3IFX A;  2YGA A;  1YIJ V;  4YHH O;  5JQG A;  1Y4U A;  3K5M A;  1M5I A;  2EZO A;  2FB5 A;  5B1B B;  2WPD G;  4LC1 A;  1KIJ A;  2X7R B;  4EB6 B;  5L3C A;  3CMA V;  3SL2 A;  4CWR A;  4J9Z B;  4RAI A;  4UXN A;  3PN1 A;  3I55 V;  4CWO A;  2JJC A;  2DYR C;  4XDM A;  4URM A;  1K92 A;  2IWU A;  4KFG A;  3ASO B;  1Y76 A;  5LMN B;  5CBF A;  1PP9 H;  4LF6 B;  4P9O A;  1S72 V;  3B09 A;  2F4V O;  1MNG A;  3JD3 A;  2JKI A;  4KTN A;  1SQP H;  1S0V A;  1JMK C;  1V54 C;  1YT0 A;  4GZR B;  1SC5 B;  2CTQ A;  1AH8 A;  4FCQ A;  5JH7 B;  1AVM A;  4U7O A;  4GCZ A;  2P67 A;  3KKY A;  4O4L B;  3P3N A;  1B3Q A;  2L6L A;  3N2G B;  1P7B A;  4BR6 A;  1PPJ H;  5CTX A;  5LA6 A;  3OPD A;  2R9I A;  5IWA B;  4CE2 A;  3ZMT A;  3WFV A;  2QWR B;  4HAM A;  2XHR A;  1YJ9 V;  2BU6 A;  3LNN A;  4LWI A;  1AJQ A;  1K5S A;  5JCO A;  1N34 B;  2GBO A;  1FJG B;  4R3M A;  1FFX B;  4GX2 A;  4DV0 B;  1ZAU A;  2NNU A;  3H1L H;  2XAJ A;  2XCM A;  4X9L A;  3HKB B;  2RNB A;  3HYY A;  3D8C A;  1ZSP A;  3CCE V;  2P06 A;  4MVR A;  3E22 A;  2XJJ A;  1BQZ A;  4BQG A;  1WJZ A;  3T1Y B;  3O9O A;  3DC6 A;  1R1B A;  3S3W A;  3K97 A;  3F5T A;  2Q8G A;  2UUA O;  1I5X A;  1IXM A;  1K73 W;  1PNK A;  3K79 A;  1D5N A;  4I9Q A;  3HZ5 A;  1U97 A;  5FWK A;  2VQE O;  2AHY A;  4X1I B;  1YCI A;  3RT3 C;  4ASU G;  1EFR G;  3CWV A;  3K06 A;  4FFB B;  4O4I B;  2DYR B;  3S3X A;  1M9N A;  1GMG A;  4EB6 A;  1I59 A;  4JYC A;  5B1B C;  5J2U A;  1BS3 A;  5LL6 Y;  1JJ2 U;  3DC5 A;  4DR5 O;  3ABK B;  5F2V O;  3ABL B;  3P30 A;  2EX3 A;  5E79 Z;  1UYC A;  1H8H G;  1HR0 O;  4BAE A;  4JF3 A;  3K08 A;  4HZ5 A;  1XI1 A;  4WUB A;  3RVY A;  1UY7 A;  2YI5 A;  2AXT Z;  1DGS A;  1PD3 A;  3JAW B;  3D0B A;  4IGG A;  1DLB A;  5L3E A;  2ZBK B;  1SS3 A;  1Y67 A;  1NH2 D;  2DYS C;  4JI5 B;  2DJV A;  2R72 A;  3OAA G;  2JJ1 G;  4LFA B;  5F3K A;  1F4M A;  2RQ6 A;  1P49 A;  3N2K A;  5LP6 B;  5LMU O;  3Q5J A;  3OMA B;  1XOU A;  1YER A;  2XJG A;  2IJI A;  5HFL A;  4X89 A;  4C7U A;  2PF4 E;  3OUF A;  4ZBM A;  3BA9 A;  4LWF A;  4FLZ A;  2VWC A;  1H2N A;  2GUZ A;  5EBM C;  1SA0 A;  4E2L A;  1MOF A;  2ZKJ A;  1P4R A;  4JYY A;  1YTF B;  4XKO A;  2UU9 B;  2BT0 A;  1K33 A;  2CGF A;  4HNA B;  4DR2 O;  1OHH G;  1OCC C;  4UCU A;  4HXZ A;  4W4K A;  3JCU Z;  4EGK A;  3K59 A;  5EZY A;  4EGH A;  2GSM B;  1SF9 A;  2WLL B;  3G67 A;  4U93 A;  4TQF A;  3JAR A;  2XHX A;  4R50 A;  1TID A;  1IBL O;  4DW1 A;  1N33 B;  3QF7 A;  3FV5 A;  4PV1 B;  2QDO A;  2FKX A;  3ABU A;  3BFR A;  1OCO C;  3TZ0 A;  3CRQ A;  4MTF A;  2IU0 A;  2PI4 A;  1R3I C;  1YSR A;  4J7J A;  4EKW A;  2AKP A;  4JAA A;  3R92 A;  5EK0 A;  4AI8 A;  3CCV V;  4YY3 B;  1Q86 W;  1XIL A;  2CCU A;  5KUK A;  2WI4 A;  4MP7 A;  3L75 H;  2IOQ A;  4XIR A;  2HVJ C;  5FL7 G;  3UT5 B;  3ETG A;  3LSU A;  1V54 B;  1IUR A;  3ZIA G;  5J9P C;  5JVD A;  1BQ0 A;  4GKJ O;  5LYJ A;  2JRI A;  3T1K A;  5GTH Z;  2YE8 A;  2YXL A;  3HKD B;  2BYI A;  3HZ1 A;  1B06 A;  3TXS A;  2UWD A;  3ABL C;  4AS9 A;  1G6U A;  2X6C A;  2ZT9 B;  4I4T B;  4AQY B;  1Q8I A;  3OD4 A;  1XNQ B;  1TH8 A;  1JOY A;  1OV9 A;  3SYA A;  1YEW A;  3DTU B;  4OX9 O;  3C0E A;  1BMF G;  4FLX A;  2ILM A;  1AM1 A;  4CH4 A;  3GIE A;  3I5D A;  4YKQ A;  4CBC A;  1JCH A;  4DV4 O;  3WG7 C;  1SA0 B;  2YJW A;  2ZIO A;  4I55 A;  1N36 B;  3O2F A;  4EFB A;  2VS0 A;  2HHH B;  2Z5U A;  4D7T A;  1NBM G;  4HY1 A;  4UCS A;  3BPZ A;  2VWK A;  4EFE A;  5LGN A;  3OW6 A;  4CS3 A;  3ML0 A;  4DK0 A;  5JEN A;  4CH6 A;  2YIA A;  1U2O A;  4DUH A;  5D6Q A;  1VP7 A;  1EZJ A;  3R66 A;  3B28 A;  4WBN A;  2VW5 A;  2WLM A;  2FYP A;  2YE6 A;  5JH7 A;  2ZKO A;  2JGD A;  4LWS B;  1MSD A;  4O4H A;  1O9H A;  2XHB A;  4UB8 Z;  4DV5 O;  2WI1 A;  1Q43 A;  3J81 N;  2ZDY A;  4JI4 B;  4QPK A;  4PD4 F;  3H1K H;  4GKK B;  4PJ0 Z;  3K60 A;  2XAB A;  3FB8 C;  4WBN B;  1MZF A;  3K9A A;  2PNR A;  3S5T A;  4LF4 O;  1HNX O;  2YIC A;  1YDX A;  1G1X B;  1Y4S A;  1LUV A;  3FYE B;  3E8G A;  3ZKB A;  3VAD A;  2R9R B;  1UYM A;  1EN6 A;  1K97 A;  3HKB A;  2XDL A;  3VQY A;  2LGW A;  2KQX A;  1KP2 A;  4E4E A;  3RVZ A;  1KC8 W;  4WFE A;  3W7X A;  1BL8 A;  1S5H C;  2WEQ A;  1RM1 C;  2Q6A A;  1W0K G;  1SZX A;  3SDL A;  1YC1 A;  4O07 A;  4DR6 O;  3CCL V;  1HNW B;  2GTA A;  2H94 A;  3SPI A;  1SRY A;  2KG7 A;  5LA6 B;  3ZXQ A;  1DF5 A;  3B4S A;  1H8E G;  3VOU A;  3E89 A;  5J2T B;  3FT8 A;  1OCZ C;  1UYE A;  3Q4H B;  2EUL A;  2ZM6 B;  1GRJ A;  2XT9 A;  3OTO O;  4MPE A;  1GAX A;  1N32 B;  3JYC A;  1K3E A;  4HYO A;  5FNV B;  2LW1 A;  3RGB A;  4CWT A;  1TGO A;  4G27 B;  3LNU A;  4YJ2 A;  4LF8 O;  2OYQ A;  4MTX A;  5IJ9 B;  2BTZ A;  3RYI A;  2XDU A;  4BIU A;  4PU9 A;  4JTD B;  1YT1 A;  2HVK C;  4X88 A;  3UO3 A;  4ZIB A;  3TZ4 A;  1JM6 A;  2CTW A;  3APO A;  2XAQ A;  4IYI A;  4WCE V;  1XNQ O;  2QJ1 A;  3WQ9 A;  4OGQ B;  1OSF A;  3HKE A;  3T10 A;  4DUY B;  4MPN A;  3WHA A;  4G2K A;  3U2D A;  5LYJ B;  2Q8F A;  3K99 A;  2GHY A;  3ZHS A;  2LGQ A;  2YGE A;  1GK9 A;  1WA8 B;  3UKM A;  3GIF A;  4CH3 A;  4PDM A;  2HG1 A;  4JI3 B;  3H1I H;  1CXZ B;  1VAR A;  2EIL B;  4FM2 A;  2XJX A;  2UXB B;  1EA6 A;  1Y4M A;  2E0A A;  5H6Q A;  4JI0 B;  2UXC B;  1IVS A;  1EM1 A;  4XBF A;  1W2B U;  1VQ8 V;  3T2S A;  3LMM A;  2BOC C;  4LR3 A;  3HKD A;  4J7K A;  1XQ8 A;  2XAH A;  4JI8 B;  4X1Y B;  4TUY A;  3T1H O;  1XUQ A;  1QHT A;  4PDV A;  4XCL A;  1U96 A;  3NR7 A;  4WUC A;  2UUB O;  1HDJ A;  1K8A W;  4NXN B;  1QCE A;  3THO A;  3RYF B;  2YEV A;  1AMW A;  4DR3 O;  4NTX A;  3A0H Z;  1AB3 A;  1AP6 A; 
#chains in the Genus database with same CATH homology
 3CC2 V;  4MS2 A;  3AG1 C;  2V7Q G;  1UY8 A;  2EZO A;  2WWW A;  4H81 A;  5B1B B;  3CCQ V;  4YKR A;  2WPD G;  3K3W A;  4LC1 A;  1KIJ A;  2IOR A;  2X7R B;  4XIP A;  2JEU A;  5L3C A;  4JPR A;  4UUJ C;  4UVB A;  3CMA V;  4GQT A;  1YC3 A;  3SL2 A;  4KSG A;  4J9Z B;  2EIL C;  4RAI A;  3MHS C;  4UXN A;  1K4C C;  1MAB G;  3I55 V;  4YKX A;  1H38 A;  2JJC A;  2DYR C;  4CWO A;  4HYM A;  3FB7 C;  4XDM A;  4URM A;  1K92 A;  2IWU A;  4GX5 A;  4URL A;  3E35 A;  4BIZ A;  5M4E A;  2X6A A;  3ZRX A;  4WFH A;  4KFG A;  3ASO B;  3RBZ A;  1YT2 A;  5CBF A;  4H7Q A;  4JTC B;  4PA6 A;  1YS3 A;  3E8B A;  4P9O A;  3TET A;  1S72 V;  4BQJ A;  2JIZ G;  3E2E A;  1F51 A;  2WLJ A;  3JD3 A;  1YHQ V;  2JKI A;  1S0V A;  3H4L A;  4GGL A;  4KTN A;  4L90 A;  2YE5 A;  3F7Y C;  1V54 C;  1QLN A;  3CC7 V;  1S76 D;  4JAV A;  1YT0 A;  1AH8 A;  1AI6 A;  2LP7 A;  4FCQ A;  5FNC A;  4EGI A;  1THN A;  2IU3 A;  1GO3 F;  4R6Z A;  3INX A;  1UYH A;  5B1A B;  4U7O A;  4GCZ A;  2P67 A;  3SJQ C;  1AJP A;  3CCM V;  1WLE A;  1B3Q A;  2YE9 A;  1P7B A;  3ZRV A;  4NH9 A;  4MVS A;  2W0F C;  5HFM A;  3ZMZ A;  3T2M A;  3EHG A;  2EBO A;  5CTX A;  2XAS A;  4QPJ A;  3OM3 B;  1PNM A;  2R9I A;  4TSF G;  1GJV A;  3OPD A;  3AG2 B;  2AHZ A;  1FFT B;  2IJH A;  1YC4 A;  1QR9 A;  3EHF A;  1NHH A;  3EKR A;  4KQV A;  3NXS A;  4XKA A;  3ZMT A;  4CE2 A;  5KA5 A;  3U67 A;  3FB6 C;  3WFV A;  3JD2 A;  1ZWI C;  4HAM A;  2EIK C;  3MNR P;  2YI7 A;  2XHR A;  3STL C;  1YJ9 V;  2BU6 A;  4PL9 A;  3OMN B;  4LWI A;  3OMI B;  1AJQ A;  3LDD A;  1K5S A;  4K4O A;  2JEX A;  4CWF A;  2HKJ A;  4R3M A;  4GX2 A;  3A0T A;  1Y8N A;  3RLP A;  1NR7 A;  2WSS G;  1VQ5 V;  1AI7 A;  2NNU A;  2FXS A;  2EIJ C;  1I5B A;  2IWS A;  2XAJ A;  3EHB B;  2BSM A;  3OEE G;  3CPW U;  2XCM A;  4NH7 A;  4X9L A;  3A0Z A;  3HYY A;  3JD4 A;  1AJN A;  4CWP A;  3ASN C;  3CCE V;  1S14 A;  4MVR A;  1YSZ A;  2XJJ A;  3R4N A;  2BRE A;  1EBO A;  3QO7 A;  3HYZ A;  4BQG A;  5EC2 C;  4EFU A;  4BAY A;  4YKT A;  4QJF B;  4R3A A;  5L3F A;  1FXK A;  2A79 B;  1YJW V;  4RQF A;  2OCC C;  2X6B A;  2Y69 B;  4GX0 A;  2DWD C;  2YSU B;  4I9W A;  4RUF A;  2YK2 A;  3K97 A;  2WI6 A;  1OCR C;  3B8M A;  2Q8G A;  4MBC A;  1I5X A;  1BKN A;  4XCJ A;  4YXW G;  1IXM A;  5L3D A;  1OCO B;  1QBZ A;  1K73 W;  1PNK A;  2ZDX A;  3K79 A;  1V55 B;  2QG2 A;  2PI5 A;  3CC4 V;  2HCH A;  2QFO A;  2ESA A;  2XK2 A;  2WLH A;  4H85 A;  2YEA A;  3HZ5 A;  1MG1 A;  4V26 A;  4JGS A;  2QKS A;  3O0I A;  3X2Q B;  5FWK A;  1RPR A;  4P7A A;  2AHY A;  4MT8 A;  1YJN V;  3ZKD A;  4ASA A;  4HYP A;  1R3K C;  4PA7 A;  4ASU G;  2HFE C;  2ITD C;  1EFR G;  1M90 W;  3CWV A;  4UV8 A;  3ETD A;  3K06 A;  2A0L A;  4X8A A;  1QVF U;  3R91 A;  2DYR B;  1E79 G;  4PA4 A;  3QO5 A;  3NMQ A;  1M9N A;  3R65 A;  1GMG A;  3EHJ A;  1R3L C;  1I59 A;  5B1N A;  3OMU A;  4XKK A;  2HLD G;  3LDC A;  4JYC A;  1OZ0 A;  1WPX A;  2O1W A;  5B1B C;  1ZWH A;  1BYQ A;  2BU2 A;  3K0D A;  1JJ2 U;  2ZDI A;  4P9P A;  3G71 V;  5LHG A;  3ABK B;  5DM6 V;  2YE3 A;  3H80 A;  3K0G A;  3ABL B;  3P30 A;  1M56 C;  2WI3 A;  1QVG U;  4XC0 A;  1Y66 A;  3LNM B;  2YEB A;  3ZN0 A;  1UYC A;  1N8R W;  1H8H G;  3RKZ A;  5M4M A;  1TC6 A;  4O05 A;  4JF3 A;  3QNE A;  4BAE A;  3K08 A;  4HZ5 A;  1UY9 A;  2YEH A;  4DZY A;  2WLI B;  4WUB A;  4MP2 A;  3RVY A;  4YKU A;  3HB3 B;  4RO2 A;  4YKW A;  5M4N A;  2D3O W;  1UY7 A;  3A0W A;  1VQK V;  2CH4 A;  2IJJ A;  2KB1 A;  2YI5 A;  3UM7 A;  3B8N A;  3O6O A;  2Q8H A;  1PD3 A;  3SPJ A;  3ZM7 A;  2WLN A;  2FWZ A;  3VBB A;  3D0B A;  5CTW A;  1DLB A;  2XAG A;  5L3E A;  2ZBK B;  3FT5 A;  5H6R A;  2QEX V;  2DWE C;  1NH2 D;  2DYS C;  3W7S A;  1RPO A;  3M99 B;  5CMU A;  4WFG A;  4YKY A;  3PEH A;  1OCC B;  1FXK B;  2JJ1 G;  3OAA G;  2M7W A;  2ATK C;  4XDK A;  3A0Y A;  1VQN V;  5F3K A;  1F4M A;  4L91 A;  5M4K A;  5LHH A;  4FPP A;  5B3S B;  2EIM B;  3Q5J A;  4MPC A;  2O1V A;  3D2R A;  1KEC A;  3OMA B;  4LBE C;  1VQP V;  1YER A;  1Z59 A;  2LFR A;  2XJG A;  3W7W A;  2XX5 A;  4BXI A;  2IJI A;  2IW5 A;  3CRL A;  5HFL A;  1BHA A;  2XDK A;  4X89 A;  3F5W C;  4I3H A;  4ZBM A;  2EJR A;  3OUF A;  4TWK A;  3B77 A;  2WI7 A;  2XX2 A;  3G7B A;  4LWF A;  4URN A;  4QNH B;  3ZMS A;  5CPH A;  2VWC A;  5EBM C;  3R4O A;  5GGZ A;  5L3B A;  4E2L A;  1MOF A;  2ZKJ A;  3IGA C;  5GW7 A;  5L3G A;  1P4R A;  2B1G A;  1YTF B;  1NKD A;  4XKO A;  4CE3 A;  1PVG A;  3BEH A;  1XL6 A;  5KUM A;  2BT0 A;  5B3S C;  1K33 A;  3ABM C;  2CGF A;  2EZP A;  3K98 A;  2IH1 C;  4W7T A;  5L3J A;  3EFF K;  5EBL C;  3ZXO A;  3CGY A;  4XDJ A;  1H2G A;  3W7U A;  3KG2 A;  1OHH G;  3D3I A;  3SPH A;  1OCC C;  4FJC C;  3T4Z A;  3AG1 B;  2DW4 A;  1VQ7 V;  3OR7 C;  5CA3 A;  4HXZ A;  4E01 A;  5FND A;  4EGK A;  2FWY A;  1COW G;  4B7P A;  2XD6 A;  1ARO P;  5IYB O;  1UYK A;  1K5Q A;  4CWS A;  2NLJ C;  1VQM V;  2GSM B;  1UYG A;  3SYQ A;  1ROP A;  4EGH A;  5B1O A;  3LSS A;  2WLL B;  4H37 A;  1NR1 A;  4MVQ A;  1TC0 A;  4U93 A;  4GFN A;  1PNL A;  3MD0 A;  4CWR A;  2XHX A;  3HPL C;  1YSC A;  4R50 A;  5D7R A;  4MOT A;  4UVC A;  2ZD9 A;  5KA6 A;  3LSQ A;  1TID A;  2WI2 A;  3INW A;  1VQ6 V;  1H7S A;  3ZMU A;  2XOK G;  3TZ2 A;  1UJW B;  4XIQ A;  2QG0 A;  1B6Q A;  2WER A;  4H33 A;  1GKX A;  3FV5 A;  1V55 C;  2CK3 G;  3G75 A;  3ABU A;  1OCO C;  3OWB A;  3TZ0 A;  1AR1 B;  1GM8 A;  4MTF A;  2IU0 A;  1QLE B;  1R3I C;  2PI4 A;  3B25 A;  5D6P A;  1YSR A;  3T1C A;  4O09 A;  3JD0 A;  4EKW A;  4BW5 A;  2AKP A;  5BOD A;  1E1Q G;  4P2Z A;  3ZRW A;  1Q82 W;  2Y48 A;  4JAS A;  5EK0 A;  3CD6 V;  2P6J A;  3JCZ A;  4F4L A;  3CCV V;  1YTF D;  1A4H A;  1AH6 A;  1ZXM A;  1Q86 W;  4GT1 A;  3VHA A;  1FXK C;  3SYO A;  1JX9 A;  1L0O A;  2CCS A;  4HY6 A;  3G6E V;  1FS0 G;  2CCU A;  4L87 A;  1QLE C;  5KUK A;  2WI4 A;  2YKB A;  5EC1 C;  4RQE A;  2IOQ A;  2YJX A;  4MP7 A;  4P8O A;  4XIR A;  2HVJ C;  3DGE A;  3BY6 A;  4JYB A;  5FL7 G;  2YEI A;  2H8M A;  1QZR A;  3ETG A;  1V54 B;  3CCR V;  3ZIA G;  3VHD A;  3VHC A;  5J9P C;  1ENV A;  2XHT A;  4QE9 A;  3X2Q C;  3SPC A;  2P7T C;  5LGU A;  4QE7 A;  3WG7 B;  3BMY A;  4JAU A;  3JZ3 A;  2YE2 A;  1DF4 A;  1I5Y A;  3T1K A;  2K5B A;  4EM7 A;  2YE8 A;  2WLK A;  2BYI A;  1AI5 A;  2YEE A;  3HZ1 A;  3R4M A;  1Z5B A;  4LWG A;  1W0J G;  4Z1M G;  5E1A C;  2UWD A;  2VCJ A;  2OT5 A;  3ABL C;  2YKC A;  1U0Z A;  3T4D A;  1LNQ A;  4AS9 A;  1ORQ C;  2X6C A;  3P32 A;  4N21 A;  2YED A;  1QR8 A;  1Q7Y W;  1HWY A;  2YKJ A;  1TH8 A;  1GM9 A;  2WAM A;  4GT8 A;  1JOY A;  1AJ6 A;  2MK3 A;  4E00 A;  1AI4 A;  1Q81 W;  1VQ4 V;  4QIW F;  3SYA A;  1BXD A;  3DTU B;  4J9Y B;  4KUM A;  2DQ3 A;  1Y8P A;  4PEL A;  1K9M W;  1I5A A;  5B1A C;  3C0E A;  4PA3 A;  1BMF G;  2FTK A;  4LP8 A;  2EIJ B;  1AM1 A;  1I58 A;  3GIE A;  4YKQ A;  3OUS A;  4CBC A;  1JCH A;  2YKE A;  4G28 B;  3WG7 C;  1I5C A;  2YJW A;  4MSW C;  3CRK A;  3OE7 G;  2DQ0 A;  2EXL A;  1SES A;  4P30 A;  3O2F A;  4UV9 A;  4XD8 A;  2Z5U A;  4KFM A;  4ASB A;  1NBM G;  4HY1 A;  3GWO A;  3OWD A;  4L8Z A;  1L1F A;  5LGN A;  4ASF A;  1PL0 A;  3FB5 C;  3LDE A;  1CPY A;  2H55 A;  2EIK B;  2F43 G;  3AEI A;  3ML0 A;  3OW6 A;  4LP0 A;  2Z3Y A;  2HJF C;  3T0H A;  5IN9 A;  2JK5 C;  5C93 A;  2W6J G;  1U2O A;  4CWN A;  1OCR B;  2QE7 G;  4DUH A;  3SYP A;  5LBQ A;  5BZB A;  3A0X A;  4LWH A;  5D6Q A;  3FKS G;  2OCC B;  1ZW9 A;  3AG4 B;  5CTY A;  1EZJ A;  3B28 A;  2Q68 A;  2Q2E B;  1G4Y B;  4XIT A;  2BU7 A;  2UXN A;  1G8M A;  2C2A A;  1R6K A;  2DYS B;  3F7V C;  2VW5 A;  4I5S A;  2WLM A;  3OFN G;  4LWE A;  2FYP A;  2P90 A;  2YE6 A;  3FYI B;  1QYE A;  1QY8 A;  4WUD A;  3CGZ A;  3K04 A;  3U2K A;  4FK5 C;  1CEZ A;  3KE6 A;  3ZRS A;  4R8C A;  4HZ0 A;  5FNF A;  4B6C A;  1VQL V;  3STZ C;  3MHH C;  3RLR A;  2XX4 A;  2WI1 A;  1R3J C;  4MW3 A;  3OR6 C;  5H9C A;  1TUE B;  2YI0 A;  2YK9 A;  4R1F A;  3R92 A;  4OXS A;  4ZKI A;  1NVP D;  2CG9 A;  2ZDY A;  4O0B A;  4E02 A;  5M4H A;  4GEE A;  2IWX A;  2XND G;  4QPK A;  1FXV A;  2HKO A;  2OTL V;  2XDS A;  3K60 A;  3CME V;  4L94 A;  2XAB A;  3FB8 C;  3SYC A;  3K9A A;  3AG3 B;  2B5U A;  2PNR A;  3HHU A;  4DXW A;  4Q20 A;  1KQS U;  3EKO A;  2YEC A;  4N23 A;  1Y4S A;  1S77 D;  3FYE B;  3E8G A;  3ABM B;  4R7C A;  5IYC O;  1NQT A;  3ZKB A;  3VAD A;  2R9R B;  4XDL A;  1UYM A;  2QF6 A;  2LFS A;  1UYI A;  3K03 A;  1K97 A;  2XDL A;  2ZR2 A;  2BU5 A;  3OW2 U;  5CF0 A;  3GIG B;  1XL4 A;  2OTJ V;  3TK1 A;  2IH3 C;  5LHI A;  4WFB V;  1MSW D;  4KP4 A;  5DN6 G;  3GB7 C;  1SER A;  1KP2 A;  5M4P A;  3RVZ A;  4FIP C;  1KC8 W;  4URO A;  4CE1 A;  3OEH G;  4PDR A;  4MTO A;  5IDJ A;  1ID0 A;  1YET A;  4WFE A;  3BM9 A;  1F23 A;  1GKF A;  5CN0 A;  5F5R A;  3W7X A;  1TBW A;  1BL8 A;  2YKI A;  1S5H C;  2WEQ A;  3G4S V;  3EHH A;  1GTO A;  1RM1 C;  5D7C A;  2Q6A A;  4EMV A;  3SPG A;  1W0K G;  2EIN C;  1FXH A;  1OCZ B;  4MVM A;  2JJ2 G;  3CCJ V;  1NHJ A;  2BOB C;  3G7E A;  3HEK A;  3QTF A;  4AWQ A;  1YC1 A;  1Z5A A;  4O07 A;  4EEH A;  2CCT A;  4XE2 A;  3CCL V;  4FCR A;  5J6A A;  2H94 A;  5BOC A;  3OGC C;  3IED A;  1UYF A;  3SPI A;  1SRY A;  2A9H A;  1KP3 A;  3AG4 C;  1ZXN A;  1UY6 A;  4ZVI A;  3CCU V;  3ZXQ A;  1DF5 A;  4FCP A;  1M57 C;  1NHI A;  3TZ5 A;  1H8E G;  3VOU A;  4MTG A;  2Q8I A;  4LPB A;  3E89 A;  2YE4 A;  4YKZ A;  1THZ A;  1NH2 B;  3E86 A;  3ZRW B;  3FT8 A;  5IYD O;  1MX0 A;  2BZ5 A;  3Q5L A;  1VQO V;  1OCZ C;  1UYE A;  1MU5 A;  1RM1 B;  5CTU A;  4O04 A;  3E8H A;  4MW8 A;  5IY5 C;  1CP9 A;  4L93 A;  3TTZ A;  4CWQ A;  1JVM A;  1YI2 V;  1YIT V;  1B62 A;  2WLI A;  2GFD A;  2QA4 V;  1Z5C A;  1Y8O A;  2YEG A;  4MPE A;  3JYC A;  1BGQ A;  2GQP A;  2ITC C;  1K3E A;  4HYO A;  1NVP B;  2XDX A;  1R6N A;  1GM7 A;  2ZXW B;  4FMT A;  3Q5K A;  4UVA A;  4CWT A;  3ABT A;  4NH8 A;  4G27 B;  2UXX A;  4MB9 A;  3ZJZ A;  3LNU A;  3RLQ A;  2BRC A;  4WFF A;  5EBW C;  4MTX A;  2Q67 A;  1M56 B;  2BTZ A;  2HG5 C;  2Q69 A;  3ABK C;  5LGT A;  3AG2 C;  5D7D A;  1R62 A;  4BIU A;  2XDU A;  4JTD B;  1DTO A;  1YT1 A;  4PRV A;  4PU9 A;  4MVO A;  2HVK C;  2X0L A;  4PA9 A;  2YEJ A;  4AWO A;  4GX1 A;  3ZN1 A;  4X88 A;  4RUE A;  3AG3 C;  2K1E A;  4HZ3 A;  1F4N A;  4DO2 A;  1VQ9 V;  1TIL A;  3TZ4 A;  3CYO A;  1JM6 A;  4U7N A;  4JTA B;  1H7U A;  5J71 A;  4HXW A;  2XAQ A;  2YEV B;  4WFA V;  4WCE V;  3WQ9 A;  1SET A;  3E83 A;  2ZXW C;  1I5D A;  1KZN A;  1OSF A;  1S16 A;  2WI5 A;  3B27 A;  4PRX A;  3T10 A;  2ZR3 A;  3H01 A;  2YI6 A;  2BYH A;  2W6I G;  4MPN A;  3WHA A;  4G2K A;  4ASG A;  2QM8 A;  4JQL A;  3U2D A;  1NJI W;  2Q8F A;  3ETE A;  3PJS K;  3K99 A;  2GHY A;  2BU8 A;  2YGE A;  3GIG A;  1EI1 A;  3TUH A;  2XAF A;  3LUT B;  1GK9 A;  3ASO C;  4MVU A;  3JD1 A;  4PDL A;  3UKM A;  1UYL A;  3GIF A;  3I56 V;  1K4D C;  1YES A;  4PDM A;  2HG1 A;  3T0Z A;  3ZCC A;  3TCU A;  1J95 A;  1SZT A;  1US7 A;  2EIM C;  2YGF A;  2EIL B;  2XJX A;  3B26 A;  4EFT A;  1EA6 A;  1Y4M A;  1M57 B;  2B1I A;  2Y69 C;  1UYD A;  2E0A A;  1K34 A;  4V25 A;  5H6Q A;  5IDM A;  1KD1 W;  2IJK A;  2ZDI C;  3C11 A;  4XBF A;  1W2B U;  1VQ8 V;  4XTJ A;  3IC7 A;  3T2S A;  2V1D A;  5CBG A;  1K7D A;  4KSH A;  3ZMV A;  2BOC C;  1R73 A;  2JDI G;  5CBH A;  3ASN B;  3W7T A;  4AWP A;  2EIN B;  2ZQM A;  3CP1 A;  3D36 A;  3RW0 A;  3QDD A;  1PKX A;  3R4P A;  1JPX A;  1S3J A;  2XAH A;  1M1K W;  3PEJ A;  2H8P C;  2VCI A;  3A0R A;  4LCU C;  1KKD A;  4PDV A;  4XCL A;  2QM7 A;  2O1U A;  1E1R G;  4TT3 G;  4CZZ A;  4WUC A;  4MVZ A;  3B24 A;  5IY5 B;  3QO8 A;  1K8A W;  1JQ0 A;  2QTO A;  1GKZ A;  1QCE A;  4WF9 V;  1B63 A;  2IOP A;  2WLL A;  3LPS A;  3CXC U;  3IFX A;  2YGA A;  1YIJ V;  2YEV A;  1AMW A;  3E8F A;  2WEP A;  2HR3 A;  2YE7 A;  1Y4U A;  2YEF A;  3CCS V;  1BHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...