4U7NA

Inactive structure of histidine kinase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
225
structure length
211
Chain Sequence
b'VSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine protein kinase sensor protein
publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Transferase
total genus 69
structure length 211
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4u7nA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4u7nA02
4MOTA 2WI4A 4MPNA 1EA6A 4ZKIA 3Q5KA 2CCUA 4NH7A 1H7UA 1TC0A 3EKOA 4CWFA 4H81A 3EHGA 5M4MA 5CTXA 2XJXA 4ASAA 4ASFA 3Q5LA 1UYDA 2YKIA 1KIJA 3VHCA 3R92A 3C0EA 2XDXA 2YE9A 4O09A 1YT2A 3D2RA 2IWUA 1Z5AA 1AJ6A 1QY8A 4PRXA 4YKQA 3CRLA 2XD6A 1UYFA 2IORA 3INXA 4O07A 4BQJA 4BAEA 4KFGA 4URNA 5M4KA 4KP4A 3LNUA 1UY9A 2IWSA 2QFOA 2VW5A 1THNA 2EXLA 2BU8A 2WI5A 2YI7A 2XJGA 2WERA 4LWHA 1AMWA 3VHAA 2YK2A 1TILA 3PEJA 4KSGA 4XKKA 4URLA 1UYKA 3GIEA 3P32A 2YGEA 2P67A 1MX0A 2XHTA 2YKCA 2ZKJA 3HYZA 1MU5A 4Q20A 3B27A 3GIFA 4MPEA 4EFTA 1R62A 4QPKA 3O2FA 3T2SA 2ZDYA 4JYCA 4URMA 4I5SA 2WI1A 4HY1A 3WHAA 1AH6A 4KSHA 2FYPA 2BRCA 2LFSA 4GFNA 4BQGA 4WUDA 5J6AA 4U93A 5IDMA 3DGEA 4CE3A 2BU2A 2YE3A 4ZVIA 2QF6A 3K98A 1JM6A 2XK2A 3A0XA 4P8OA 3NMQA 1UYHA 2YJXA 1NHHA 2ESAA 5CF0A 5M4NA 5FWKA 2O1VA 3G7EA 5CTUA 3TK1A 3SL2A 2CG9A 1IXMA 3G75A 5C93A 2XHRA 1UY6A 2WI2A 3FT5A 2YE6A 1S14A 4V25A 4CE1A 2FXSA 4CWRA 3OPDA 3HHUA 3JZ3A 4E00A 3OW6A 4H7QA 5CPHA 2YEFA 1YESA 2CH4A 3MD0A 3RLQA 2ZBKB 3TZ2A 5CTYA 1B63A 4HZ5A 3D36A 2HCHA 4K4OA 4XE2A 4V26A 2BZ5A 2XCMA 4BXIA 2Q8HA 1GJVA 4CWTA 5FNCA 4HY6A 1I5DA 1Y4UA 4WUCA 1I5BA 3B25A 4GQTA 3ZXQA 4U7OA 4LP0A 2YKBA 2YKEA 5D7DA 1BGQA 4EGKA 2VCIA 3HZ5A 1YERA 3ZM7A 3EHHA 4EM7A 4GT1A 4YKXA 4XC0A 2XDSA 4XITA 1AM1A 4U7NA 3HEKA 4PRVA 1YETA 2HG1A 1H7SA 3EHJA 3B24A 2YGAA 2VWCA 3VADA 2BYHA 2FTKA 4JASA 1BKNA 1JOYA 2CCSA 1UY8A 1TC6A 2XX4A 2CGFA 4XCJA 2YEIA 4L91A 2K5BA 2YGFA 1ZWHA 4HZ0A 4LC1A 1UYGA 4CWNA 4XKAA 2LFRA 2O1WA 4ASGA 3C11A 3K97A 5GGZA 3H80A 1GKZA 4R3MA 4YKRA 3D0BA 2YE2A 3LPSA 4XIRA 1NHIA 2BU5A 5D7CA 4YKZA 2FWYA 5M4EA 1GKXA 2YI6A 4ASBA 3BM9A 3Q5JA 4FCQA 3IEDA 3O0IA 1Y4SA 3R4MA 4E02A 3ZCCA 3A0RA 1UY7A 4AWQA 2XABA 3A0YA 5IN9A 4LWEA 3T1KA 3RLRA 4BIUA 4MBCA 1I5AA 1I58A 2YEGA 5F5RA 4EEHA 2UWDA 3ZXOA 1TIDA 2GQPA 1YSZA 3HYYA 4LWFA 4H85A 2BYIA 1L0OA 1AH8A 4GEEA 4L94A 4X9LA 2XX5A 1ZW9A 4MT8A 2WI6A 1YC1A 3BMYA 4CWQA 2BU6A 5IDJA 1OSFA 4KTNA 4AS9A 2YEHA 3QDDA 4L93A 1UYIA 2JJCA 4P7AA 2XHXA 2H8MA 1YT1A 3ZRVA 3QTFA 4XKOA 1BXDA 4EGIA 2XDKA 3U2DA 4DZYA 4GCZA 4JYBA 1ZXMA 4YKWA 3ZKBA 2GFDA 5FNDA 4YKUA 4EFUA 3TUHA 4B6CA 4JAUA 1I5CA 2YE4A 4DUHA 3CWVA 3R4OA 2WWWA 2BSMA 1Y8NA 5BODA 1ZXNA 3ZRWA 3PEHA 1F51A 2IOQA 4R3AA 4HYPA 4QPJA 4B7PA 4L90A 3KE6A 3U2KA 1PVGA 1YSRA 2PNRA 5L3JA 5B1NA 2IOPA 1B3QA 1QZRA 2Q8FA 4L8ZA 2Q8GA 3RLPA 5J71A 1B62A 1Z5BA 1UYCA 5F3KA 3WQ9A 2WI7A 4CE2A 3OWBA 2FWZA 1YT0A 4PU9A 5D7RA 3CGZA 1BYQA 3HZ1A 4MP2A 2BU7A 3MNRP 1A4HA 5M4HA 3B28A 2O1UA 1Y8PA 4MTXA 1YC4A 2YE7A 5D6QA 3G7BA 4EGHA 2YEEA 4W7TA 3TTZA 4EMVA 3R4NA 4HXWA 3T0HA 3CGYA 4LWGA 4MB9A 4NH8A 4XD8A 5M4PA 3VHDA 4JQLA 2JKIA 4I3HA 4JAVA 2YI5A 3O6OA 4XIPA 2HKJA 4O0BA 3TZ4A 5B1OA 3FT8A 2ZDXA 2BREA 3K99A 4CWSA 2C2AA 4LWIA 2QM8A 4AWOA 2XJJA 2YK9A 4FCRA 2IWXA 2AKPA 2QG0A 3T10A 1I59A 1YC3A 1TBWA 2WEQA 2XDLA 3NXSA 1U0ZA 1Y8OA 3OMUA 2XDUA 4HYMA 3EHFA 4PL9A 4FPPA 2BT0A 2BTZA 4GGLA 2Q8IA 3CRKA 2WEPA 3K60A 3INWA 1Z5CA 3U67A 2YEBA 1UYEA 2WI3A 3FV5A 4XDMA 3A0TA 3EKRA 2XX2A 4GT8A 3RKZA 3TZ0A 3ZKDA 3R91A 2E0AA 1YS3A 4LPBA 3GIGB 2YE5A 4O04A 1QYEA 3TZ5A 4FCPA 2QM7A 2YKJA 4YKYA 4AWPA 1US7A 4HXZA 5FNFA 3GIGA 1ID0A 4UROA 4BIZA 2YJWA 2CCTA 1TH8A 1EI1A 3A0WA 4WUBA 5CTWA 4R1FA 3B26A 2YEAA 2YE8A 4CWPA 1KZNA 1Z59A 4YKTA 3H4LA 4XIQA 4CWOA 3ZRXA 1S16A 3A0ZA 2H55A 1UYMA 2VCJA 2YEDA 3OWDA 4XTJA 4XCLA 1U2OA 2YEJA 3ZRWB 4FMTA 1UYLA 2YI0A 4NH9A 4O05A 2Q2EB 1NHJA 3R4PA 4MPCA 2QG2A 2YECA 4KQVA 5D6PA 4E01A 4MP7A 5BOCA 3T0ZA
chains in the Genus database with same CATH superfamily
4MOTA 2UXBO 3WB1A 3OTOO 5EC2C 3APQA 1JFFA 2UXNA 2CCUA 4NH7A 1NKDA 2QWOB 4H81A 4JV5O 4HZ3A 1ROPA 3C3SA 1UYDA 3RYCB 3R92A 2FL4A 4IYIA 3FYEB 5A9GA 3JCZA 4UCTA 3OW2U 1NI8A 4LNUA 4JI6B 1JR9A 4K0KB 4H37A 3G71V 4LBEC 3HKCB 5JQGA 1UYFA 4KXRA 4MTOA 2EILC 1W0KG 2XASA 4KFMA 2KKWA 3DC5A 4BAEA 4KFGA 3RT3C 5BMVB 3LNUA 3H1HH 5GONA 1AI5A 2EXLA 1DF5A 1V55B 1JPXA 4LWHA 1AMWA 2P5OA 4FFKA 3CJHA 4PDLA 3OE7G 3PEJA 1RP3B 3LUTB 3RN4A 3RBZA 1UYKA 2W6IG 1D2DA 1D5AA 2E76B 2YGEA 3N2GB 3ZMZA 3TETA 3PN1A 2XHTA 3ASNB 2ZKJA 2Y0PA 4X20B 2PGGA 1KBHA 2XUMA 3DTUB 1QLEC 3JARB 5HFLA 5JVDB 4WFBV 4YY3B 3OGIB 1AVMA 2RJZA 1N32O 1R62A 4DR5O 4JI3B 1TVKB 2ZDYA 2VQEB 1O9GA 4BW5A 1IX9A 4I0XA 3CD6V 1FXKB 3ETGA 4JF3A 2LFSA 4MVSA 2UUBB 4GFNA 4O4HB 5J6AA 5IDMA 1HNWO 4UV8A 1JM6A 3UQ8A 3AG7A 4BWAA 4P8OA 4LF9B 5J2TA 5KMGA 3L71H 4FVMA 3CEIA 2ESAA 1K4DC 5M4NA 1Q8IA 5FWKA 2IBZH 1M4UA 3VQWA 4DV7O 5ITZB 2E5LB 1SA0B 4PELA 4TUYB 3JAMN 4V25A 1I08A 1EN6A 1WLEA 5LA6B 1GN3A 2QWPB 2XHBA 3JSNA 2UU9B 1M57C 4J41A 3JZ3A 5CPHA 5J2UA 3RGBA 4B3SO 4UXNA 4RO2A 4TV9A 2HFEC 3RLQA 2ZCEA 1TA8A 2F23A 3TZ2A 5EBWC 4LF5B 2JGUA 1ZAUA 3ICXA 4XE2A 3JCUZ 5KX5A 2GDSA 4PD4F 1PL0A 2PY5A 5FNCA 1Y4UA 3FB6C 1XMQB 3BHPA 4WUCA 4WBNA 4JI1O 5GTIZ 4DR2B 3W7WA 3A8TA 1BGQA 4W4LA 2HP8A 3ZM7A 4GT1A 5JQGB 4YKXA 1XNRO 1AJPA 2CGOA 4O4IB 4WFAV 1VEWA 1YETA 4O2BA 3RWRD 4UCRA 2PZSA 3K9AA 1P84F 2ADQB 1PM9A 5GONB 1OV9A 1AILA 2Q68A 1TC6A 2CGFA 2E3CA 4X62B 3QF7A 3JALA 2HG5C 3PJSK 3CJHB 4X66B 1O9HA 1PNLA 1PV0A 3B4SA 3SYAA 4HZ0A 4MVRA 1VQLV 3OGCC 4CWNA 2ITDC 3AK2A 1OCZC 1W2BU 1SESA 1KMIZ 3C11A 4E4EA 4YHHO 5KUMA 3K08A 5CB4B 4X1YA 3U0ZA 4MVQA 1NHIA 4YKZA 1S72V 4I55B 5M4EA 4JI8B 4FCQA 1SZTA 3IFXA 4GKKO 2FKXA 4E02A 3CB2A 1UY7A 1F4NA 4K8XA 4CC5A 5FL7G 3CYOA 2Q0AA 1OCOB 3K9SA 3AG4C 3F7YC 4LP8A 3SPCA 1Z5WA 4MS2A 3RLRA 4BIUA 5J2TB 1U97A 1XNQB 4TQDA 4XDLA 2Y4TA 1K5SA 3H1KH 2GQPA 3EFFK 4RQFA 1Q90D 3BAAA 2QKAA 3A0BZ 2BYIA 2C1GA 4CBCA 4X9QA 1AH8A 3SJQC 4L94A 2XX5A 1WB8A 1KC8W 1XHXA 1ZW9A 1I5YA 3S5TA 3BMYA 1I0HA 4Q6GA 5LMUO 3CSXA 2YEHA 4Z1MG 3QDDA 2F93B 5LOVA 5LXTB 1UYIA 4L93A 4P7AA 3CC7V 2JVDA 5BZBA 2ZE7A 4H13B 5IYCO 1JVMA 2WLHA 4JYBA 2GTAA 1NTMH 2A0LA 5KX5B 3JD0A 4F6RA 1KKDA 3ABTA 3VQYA 4X8AA 1H2KA 3UKMA 4EFUA 4HYOA 2KG7A 1BL8A 4B6CA 3G6BA 4BIOA 3K0DA 3ZBHA 1I5CA 4DUHA 2CTRA 1W0JG 3OTFA 2OYQA 1XOUA 1NBMG 1BT8A 1F51A 5B5EZ 1SQXH 3APOA 5IE9A 5JCOC 4B7PA 2PNRA 1YSRA 1Z5VA 3DC6A 2IW5A 4O2BB 3H1JH 4CZZA 4KHPO 4L8ZA 3E35A 4DV6B 3CCEV 3RLPA 2WLLA 3ASOB 5J71A 1YXBA 3TJTA 3WQ9A 3CPWU 2WI7A 3HPLC 3OWBA 3AG3C 3FB7C 3TXQA 1V54B 2N74A 3CXCU 2JS5A 1B06A 4PU9A 3HR0A 3AG2B 4MVUA 3ZHQA 1Q43A 3HZ1A 1HNXB 4B08A 3QG5A 1YDXA 1Y8PA 1YC4A 2YE7A 2XOKG 4NTXA 2YEEA 4X1YB 4EMVA 2CH7A 4TOIA 4MB9A 3K04A 4XD8A 3E89A 5IJ0B 1FXVA 3T1CA 3CX5F 1ZLZA 3WG7B 4AI8A 3HKEA 1IBKB 1MSDA 1A32A 3D36C 1XMOB 2ZDXA 3K99A 3FB8C 2C2AA 4OPHA 2XJJA 4GX5A 3ZHSA 2IWXA 2AKPA 3GVMA 3ZMUA 2RN9A 2W0XA 4TQFA 3CS5A 1I59A 4DW0A 3OMNB 4O4JA 4GUNA 3WU2Z 1KKCA 4X65B 1QVGU 1IBLB 3GB7C 2XDLA 1URFA 3RYIA 1Q7YW 1Y8OA 4LF6O 2X7RB 4CS3A 3EHFA 2BTZA 3ML0A 1NJIW 2R72A 3CRAA 4BW9A 1BGYH 3W7TA 1THZA 3ABMB 3K60A 3K5OA 1WJZA 2X6CA 3J7AU 4O2AA 2GHYA 2Q7GA 2OIEA 2AZ2A 1F7YA 4GKJO 4UV9A 1AR1B 4XDMA 5BXZA 5EIBD 3ZKDA 3R66A 5CBGA 4DV4O 5LOVB 2ZIOA 3B8NA 4I50B 2BE3A 2DWEC 1QYEA 4FCPA 3TZ5A 4DV1B 1FS0G 1US7A 2IJHA 3GIGA 4LWSB 1HR0O 4BIZA 2A7WA 3LDDA 4PA6A 3BFRA 3OAAG 3ZHUA 5CTWA 2R9IA 2P22C 3BRCA 1Z59A 1FD9A 1Q5OA 4XDJA 4XIQA 5B3SC 2GUZB 2Q7HA 4H44B 4NXNB 2KG7B 2IJJA 1VP7A 2DQ0A 2WLIB 4XTJA 1H2MA 5LHHA 1R3JC 4O05A 2Q2EB 2OCCC 1P7GA 4X88A 2OTLV 3R4PA 3OEEG 1OCRB 2WPDG 4E01A 3UO3A 4DR7B 1NH2D 1I94O 5LGUA 3SPHA 1K33A 4JI7B 1Y4MA 1S5JA 4B3TB 1EN4A 4MPNA 5H2FZ 3FD9A 5DN6G 1SQGA 2EZOA 1T5EA 3SPIA 1I5XA 1JMKC 3CRQA 5M4MA 4PDRA 5CN0A 4FZ0A 2XJXA 4LF7B 4ASFA 2DJVA 3Q5LA 4J80A 5LMNO 2YS8A 2VQFO 3VHCA 2XTAA 2YIDA 3C0EA 3B2EE 4NYKA 2WLMA 5LYJB 5B1BB 3RYCA 2V1DA 2B1GA 3D2RA 2IWUA 3KCXA 1M1KW 1AJ6A 1QY8A 2XD6A 1EZVH 3E83A 2CH7B 5DEDA 5BR8B 2YEVB 1CEZA 3L72H 1BSMA 1HP8A 4R6ZA 1CP9A 4BQJA 4AILC 2JDIG 4P9OA 2A3QA 5E1AC 1R6NA 4J10A 4N23A 3SJBC 4DR4B 2WI5A 3A2FA 3H01A 3T4DA 3W7SA 2CTQA 2HJDA 2LQTA 2YK2A 2DW4A 2ITCC 3P3PA 3STZC 4KSGA 2ARHA 2YXYA 4O4JB 1MMMA 2AXTZ 2ZXWB 3GIEA 3P32A 1QNMA 1MX0A 3K58A 1N36B 2GBOA 4K0KO 1S5LZ 2UUAB 2LW7A 3N2GA 4ZIBA 1YTFD 1MOFA 2ZDIC 4X20A 2R9AA 1AI7A 3ZIAG 1IURA 1DK1A 4EFTA 3ZRSA 3CRRA 4AHCA 1AP6A 1TVKA 3STLC 3J80N 1AH6A 4KSHA 2FYPA 4JTCB 1E1RG 4MTGA 1ENVA 1KUQA 1COWG 1FXKA 1SQVH 1ZSPA 1FKAO 3AK3A 2CTPA 5LGTA 3OR6C 4ASUG 1XEQA 4OGQB 3QNEA 5CTUA 3TK1A 4EEQA 1PPJH 2KB1A 4FLTA 2XHRA 1NH2B 1OJHA 2K1EA 3ETDA 4YY3O 5ITZA 2V4DA 2WI2A 1NQTA 3OFNG 5B1AC 1SA0A 4JI3O 1S14A 5C8YA 1Y66A 5FPOA 2VQEO 1V55C 4CE1A 4TUYA 5L3EA 1TGOA 4E00A 2UUBO 2EIJB 2CH4A 2AGAA 3MD0A 2QWQB 3FYIB 1AR5A 5CTYA 3ASNC 3U10A 4LF9O 2HCHA 2QGNA 3JD3A 4KUMA 4BXIA 2JJ2G 4I9QA 4JI5B 4CWTA 1I5DA 1PD3A 4IYHA 2CGNA 2RMKB 1QHTA 3B25A 2Q9LA 3ZXQA 2E5LO 5DM6V 4LFAB 4LP0A 1VQ9V 3ZEDA 5D7DA 1H2SB 1YZBA 2WLKA 2VCIA 3AEIA 1YERA 3HZ5A 2QJ1A 4EM7A 2DYRB 4XITA 4YJ3B 5FLXN 2D2CB 3I5DA 1VQMV 3HEKA 5L3GA 5L3FA 2FB5A 4UFZA 2UU9O 5CA3A 2X6BA 3O65A 3P30A 3EHJA 3DSQA 3HB3B 1XUQA 4CH3A 4O4IA 2YGAA 2VWCA 3VADA 3CRCA 2FTKA 4J9YB 2QSAA 1BKNA 3VBBA 3Q4HA 2CCSA 4LF5O 5KHHA 2YEIA 1WN7A 1S0VA 1L0LH 2PUSA 3EXAA 1YTFB 4LC1A 1RPOA 1XMQO 4CS4A 2LFRA 3X2QB 1IDSA 4DR2O 2F4VB 3H80A 4YKRA 1QU7A 4CH6A 4R3MA 3C90A 3D0BA 2ZM6O 5K1XA 3IJ4A 5CB4A 4MW8A 4XIRA 2WA4A 5D7CA 2G38A 1Q82W 3SJAC 3AK1A 3BM9A 3Q5JA 4JI4O 3K59A 4YXWG 4I55A 4EKWA 3R4MA 1RPRA 1K5QA 3A0RA 2PYLA 3OD4A 2Q4PA 4PA9A 4RUEA 2XABA 1F4MA 4X62O 3A0YA 4X66O 4X89A 3BA8A 4FJCC 4PA3A 3CCQV 2UUCB 3VOUA 1I5AA 1I58A 1E79G 2YEGA 4IIJB 4JTAB 4X64O 1YI2V 3HYYA 4DRXA 4CH5A 4LWFA 5EZYA 3ABKB 4MT8A 2WI6A 5C8YB 3SYPA 2BU6A 4JYYA 4JI8O 4KTNA 4LFCB 2EILB 1M56B 1L1FA 4ZHQB 1XBLA 2Q69A 3JSLA 3JYCA 4TWKA 1XILA 3QTFA 1CXZB 4G2KA 5LXTA 3C3TA 2N05A 4EGIA 4B3MB 2QWRB 3K03A 4UB8Z 4UVCA 2DYSC 5EK0A 1ZXMA 3M99B 1XNQO 2RNBA 2A79B 3P3NA 1SQBH 1XQ8A 4YKUA 1D5NA 3TUHA 5GW7A 3B77A 3CWVA 1R73A 2WWWA 1Y8NA 3BY6A 3ZRWA 1S76D 2Z5UA 1WAZA 4R3AA 5LHGA 3B40A 4HYPA 3VQXA 3TCUA 3KE6A 1OCOC 1QLEB 1SQQH 1VQ5V 3E8BA 1PVGA 3I55V 3J81N 4D7SA 1QZRA 5JJEB 3ZHTA 3CMAV 1XDCA 5IYBO 1P49A 3KZIZ 2LGQA 2WSSG 3Q4HB 4H0LB 5K1PA 1FXHA 4CE2A 1Z2GA 2FWZA 2XT9A 2ETNA 3SPJA 1NZ6A 5D7RA 1WPBA 1RSOB 1K34A 5IY5C 2O1UA 3FFQA 4DR5B 4PA7A 5LP6A 3G7BA 2EIKC 4EGHA 4W7TA 3RVZA 4HXWA 5H9CA 1VF6A 4OXSA 3R65A 4QJFB 3CWBH 2OCHA 3SGIA 2YI5A 1VQ4V 1Q3EA 5IJ0A 3TZ4A 2AW9A 5B1OA 3FT8A 3N27A 3CRMA 4DK0A 1HNWB 1GN2A 4LWIA 1S3JA 2QM8A 4X1IA 3MHHC 3I56V 4DV6O 1M57B 2YK9A 2PTMA 1KD1W 3UT5A 1MSWD 1FPOA 2W0FC 3T2MA 4PJ0Z 3T10A 5LBQA 4LF4B 2ZKOA 2NN4A 2XAHA 5KHGA 1QCEA 4UVAA 4XDKA 2WEQA 5DECA 3NXSA 4DYLA 1U0ZA 5L3CA 4EFBA 2PI5A 1AJQA 4GGLA 1MA1A 1WPXA 1YJNV 4DRXB 5EZYB 2UXCB 4DK1A 5CA0A 3UM7A 2K9PA 1Z5CA 3U67A 3ASOC 1OZ0A 4FLYA 2OT5A 3EKRA 1K3EA 1TAEA 1XMOO 3RKZA 3TZ0A 3B8MA 3R91A 4ABMA 2E0AA 3T1HB 3ZJZA 2YE5A 3LMMA 1IBMB 3MAQA 3ZX6A 4YKYA 1ZL8A 4UUJC 5FNFA 4QE7A 1ID0A 4I50A 4LF8O 4UROA 3RYHA 5L3BA 2QDOA 2CCTA 1TH8A 2Y4UA 1R6KA 4LWSA 3E8GA 4R1FA 1IBLO 4PHZA 4CWPA 1GN4A 1KZNA 2HLDG 2HHHB 2EZPA 2CAZC 5E79Z 4CWOA 3ZRXA 1S16A 3WG7C 2YIBD 2H55A 2ZD9A 2BSKB 2GUZA 3G6EV 1NT2B 3FX7A 2HJFC 1U2OA 2YEJA 3ZRWB 4FMTA 2WLIA 4DR6B 2Q0OC 1U96A 1VMGA 3DXRB 4MPCA 3OEHG 1N33O 3QO7A 1YJ9V 2YECA 4MP7A 4GZRB 5BOCA 3UCSC 3KG2A 4DV1O 3D3QA 2WI4A 1DGSA 1JCHA 4OX9B 1YITV 2Y48A 1Q6HA 1H7UA 1TC0A 3AG1C 4CWFA 2LP7A 4DW1A 3WB2A 5CTXA 1L0NH 3ABMC 1JA8A 2DQ3A 4CC6A 4JYAB 2XDXA 2PYJA 2YE9A 1QVFU 5B66Z 1YT2A 2QE7G 2GV9A 1BMFG 5LYJA 3T1YB 1N8RW 4PRXA 4YKQA 5LP6B 1N34B 1JJOA 2QM4A 2HKOA 4IHJA 2R70A 4J11A 3INXA 4FM2A 4DR7O 4WFEA 4K8ZA 4JI7O 4URNA 2YEVA 4B3TO 1FFXB 1TUEB 3LNNA 1UY9A 2IWSA 2QFOA 1Y6XA 2VW5A 4X1IB 2BU8A 1Y74A 1K7DA 4B3RB 2WERA 3UT5B 1EM1A 2ZR3A 3VHAA 1MG1A 4I7ZB 4URLA 1YIJV 3BVOA 3JASA 3LSUA 1OCRC 3HYZA 1SC5B 2WLNA 4E2LA 1ZWIC 3FB5C 2BTQB 1R3LC 4Q20A 1DLBA 1LUWA 3GIFA 4MPEA 5CA0B 4DV0B 3O2FA 1SERA 4PV1B 1KECA 2AHYA 4URMA 3JAKA 4HY1A 3WHAA 2M7WA 2BRCA 4DV3O 4DR4O 4U93A 1XL4A 1EFRG 3JAWB 4U3FH 3IC9A 1ORQC 2BU2A 2PI4A 2YICA 1ZL8B 2QF6A 5B1BC 1Y76B 2N04A 3RVYA 3K5NA 2XK2A 3A0XA 2RDCA 1QBZA 2DE0X 3LNMB 1M90W 2ATKC 3RYHB 3NMQA 4JZ2A 1UYHA 4DV5B 3AG3B 3G7EA 1SS3A 3SYQA 2UUAO 3SL2A 5KAFZ 1IXMA 3G75A 5C93A 1ZTEA 3FT5A 2ZQMA 4D7TA 2NLJC 4GX1A 3W7XA 3G67A 2FXSA 3H1IH 2H3OA 3RFRA 3CHXA 3HHUA 4KHPB 4DR1B 2B9ZA 3GWKC 2YEFA 4NTWA 1YESA 2ZXWC 2Q8VA 2ZNJA 1OCCB 2JK5C 1E1QG 3TXSA 4NR1A 3MHSC 4HZ5A 3L73H 2HVKC 4DR3B 4JI2B 4V26A 2BZ5A 2XCMA 1BHAA 4IT5A 2Q8HA 5IT9N 3ZN0A 4MVZA 5D5QA 4DV2B 2EX3A 1GM9A 3QVNA 4GQTA 2EIMB 2Y69C 4U7OA 5GTHZ 2Q5ZA 2Y0IA 1QLNA 5FPRA 2F43G 4EGKA 5IYZB 3EHHA 1VF7A 2YC0A 2XAFA 4U7NA 4BR6A 1NTZH 1H8EG 4IHJB 2UXDB 2HG1A 4YJ3A 3BCCH 4K35A 1H7SA 4B7KA 5LHIA 5H5NA 2DN9A 1FYJA 3EHBB 4Z1VA 2Z0AA 2BYHA 4JASA 3N2KA 1Y74B 1JOYA 2XX4A 4NXMB 4XCJA 1HNZB 4L91A 2EINC 3D3IA 4IL6Z 3ABLC 1AI6A 4JI5O 1N0NA 1AR4A 4P30A 2O1WA 5KA6A 4J7JA 2AHZA 3JASB 4ASGA 3K97A 5GGZA 4LFAO 5IWAB 4PDVA 2Q67A 1GKZA 2KSDA 2LJ2A 4WCEV 4WFGA 2YE2A 4JI6O 2EIJC 2JEXA 1Q6IA 2Z3YA 5FNVA 4LFBB 2QKSA 2YI8A 1VQ8V 2BU5A 3CMEV 4DV4B 4MVOA 4ZOLA 2YI6A 1GK9A 3IEDA 3O0IA 3JAKB 1G8MA 1YJWV 2DWDC 3CYGA 1SF9A 4DUYB 4AWQA 4QE9A 2XAQA 1YCIA 3O9OA 1XL6A 4PA4A 1TUBB 2B1IA 5IN9A 2GSMB 3T1KA 1GH6A 2CE4A 4K3AA 3SPGA 5AG2A 1S77D 1J5EB 5F5RA 1AP5A 3ZXOA 1NTKH 1OHHG 2F4VO 2FMLA 1YSZA 2NNUA 3CCVV 2EJ7A 4IIJA 1EN5A 1L0OA 1GN6A 4J7ZA 4CWQA 5IDJA 1PP9H 2OIGA 4JI0B 1OSFA 5KHJA 4FLWA 4R8CA 3WFVA 2JJCA 1GTOA 2XHXA 2H8MA 3ZRVA 4ZHQA 2VWJA 4AQYB 4XKOA 1KP3A 1NR1A 2VRZA 3X2QC 1BQZA 2XDKA 3U2DA 1LNQA 3E22A 4XBFA 1KB9F 4DZYA 1FJGB 4GCZA 1P7BA 2ZINA 3ZKBA 1US6A 3FAVB 4FIPC 5FNDA 4MW3A 1K92A 4JAUA 3R4OA 2BSMA 4GLXA 3PEHA 2HVJC 1FAFA 4FM1A 4L87A 4QPJA 1R3KC 4RAIA 4UB6Z 1FXKC 5H6QA 5B1NA 2IOPA 1YVWA 4LFCO 4UCOA 1B3QA 2D3OW 2IJIA 3OM3B 2Q8FA 3OUSA 4WFFA 1JQ0A 2CTWA 1Q81W 4B3MO 1B62A 1Z5BA 3N2KB 3RW0A 3IGAC 1QR8A 4X1KA 1PNKA 1YT0A 3OR7C 1RM1B 1WP7A 3ABKC 4TV8A 3CGZA 4MP2A 3MNRP 5KHIA 5M4HA 1R3IC 4R50A 3B28A 5CA1A 5D5PA 4MTXA 1M56C 1RSOA 4DUZB 3MDSA 3CCRV 3TTZA 5FNVB 1SQFA 3CGYA 4LWGA 2KQXA 5M4PA 4CS2A 4LH7A 1B04A 4JAVA 4XIPA 4ZOLB 5B1AB 1H2GA 3OT7A 2BREA 2BCCH 1AJNA 3CCSV 2IM9A 3K79A 3HKBA 4A5UB 3SYCA 3CCMV 1IXBA 1PNMA 4HAMA 3B09A 1JX9A 4ZI7B 3H1LH 1G6UA 4E72A 2XNDG 1TBWA 2HEPA 1VARA 2QKCA 2RQ6A 2QR4A 3OMUA 4QNHB 2O57A 3WB0A 5HFMA 4OPAA 4PL9A 4FPPA 5KLVH 4HBNA 1K4CC 1F23A 3SDLA 2Q8IA 3CRKA 2A06H 1KU9A 4G28B 1AROP 2UXXA 2YEBA 1UYEA 2WI3A 3FV5A 4GT8A 5H6RA 3LSSA 1H2LA 1PKXA 4LPBA 1ZX3A 1K73W 3D8CA 4O04A 2UXBB 1HW7A 1CPYA 3E8HA 2QM7A 4AWPA 3OTOB 4I9WA 4YIPA 2JEUA 4LF4O 2YJWA 3E22B 3A0WA 4JV5B 1BCCH 4NTYA 1H8HG 1PL4A 1LR1A 4U3JA 4N21A 3H4LA 2IU0A 4PDMA 5KAIZ 4EB6A 1M93A 5L3DA 4RQEA 3CCJV 1VQ7V 2VCJA 4RWUA 3OWDA 1DF4A 1P4RA 4DO2A 2UXCO 3CP1A 4CH4A 1XHZA 2BSKA 4GYCB 4KQVA 5D6PA 2JS3A 3DXRA 3T1HO 4I4TA 3JD4A 1HDJA 3T0ZA 3RYFA 1WNSA 1IBMO 3UO2A 1JFFB 2F66C 3K0GA 3L9DA 1WP8A 1EA6A 2JRIA 1NU1H 4ZKIA 3Q5KA 1MABG 4GX0A 3EKOA 1EZJA 3BPZA 4EFEA 3EHGA 2JGDA 4X1KB 4ASAA 2H94A 4FM0A 2HHHO 2YKIA 1KIJA 3CE2A 4LNUB 4TV8B 3E8FA 4O09A 2ZM6B 3A0HZ 2E74B 2F1MA 2LO1A 3G80A 1KP2A 1Z5AA 3JATA 5CA1B 4P9PA 3CRLA 2V7QG 5JWPA 2YDEA 4DR6O 2ZNIA 2IORA 1N32B 4JI4B 4O07A 2X6AA 1IVSA 1NS1A 4ICGA 4KP4A 5M4KA 2Q6AA 1THNA 3T4ZA 2YI7A 1FFXA 4OX9O 2OWOA 3HKBB 2XJGA 2P4VA 1B6QA 1SQPH 1TILA 4XKKA 4B7EA 1X4TA 4JYAO 4X64B 5CBHA 2DYSB 2P67A 1N0JA 2YKCA 2WA3A 1MU5A 4DV7B 2BTOA 2CUGA 3T1YO 3QO8A 1R6TA 1HNXO 3IAYA 3SJCC 1G1XB 3B27A 3L70H 1N34O 3IC7A 2DOSA 1BQ0A 2BTQA 1XREA 4QPKA 3T2SA 3CXHF 4I0XB 3KKYA 2A9HA 4JYCA 2P4KA 4I5SA 2WI1A 1M5IA 1G4YB 3F5WC 5EC1C 2P6JA 4BQGA 4B3SB 2JIZG 1IBKO 4WUDA 1YF2A 5JCOA 1SKVA 2LW1A 2Q73A 3DGEA 4P2ZA 3K3WA 4B3RO 4CE3A 2YE3A 4ZVIA 1KYOF 1V54C 3K98A 3JAWA 5KMGB 2EBOA 3AG2C 3OUFA 1VQPV 1Y76A 2YJXA 1NVPD 4H33A 4F4LA 2F95B 5LP6C 2YIBA 2BOCC 1NHHA 5CF0A 4FLZA 2JJ1G 4U3JB 5TISZ 4YJ2A 2O1VA 4BAYA 1VF6C 3FKSG 4X65O 2ADPA 4EB6B 1K97A 4DXWA 2CG9A 4J42A 4JI1B 3SR2C 1UY6A 1GO3F 1H2NA 4DV0O 4JPRA 2YE6A 5IY5B 3GWOA 1XNRB 1OCZB 4IGGA 5J2UB 1UFIA 2EIKB 2ZE8A 4CWRA 2DMXA 3OPDA 3ZN1A 4TV9B 5JJNB 5F2VO 3OW6A 4H7QA 4LR3A 4I4TB 3RYFB 3JD1A 2ZBKB 1B63A 3ETQA 3D36A 4K4OA 4WBNB 1GJVA 1SRYA 2JGDB 4FFBA 4DV5O 4HY6A 4J9ZB 1QR9A 2BOBC 3W7UA 1I5BA 1GM7A 1MZFA 3AG4B 3LSQA 4YHHB 2YKBA 2ZR2A 2YKEA 2YXLA 2GTSA 4NXNO 3JATB 2X0LA 3CCLV 4XC0A 2XDSA 5JH7A 2IJKA 1AM1A 4UCVA 5IYZA 4PRVA 1FFTB 4DR1O 2YSUB 1GMGA 3B24A 4GKKB 2WAMA 4WF9V 1V9PA 2E75B 3JALB 1UY8A 4DR3O 1BE3H 4JI2O 2K5BA 3HKDA 4MTFA 2ZE5A 2YGFA 3S3XA 4KL1A 1ZWHA 4MSWC 1UYGA 5KHKA 4DV2O 4XKAA 2L6LA 1QQCA 4LF7O 2RCVA 1M9NA 2FYUH 1GRJA 2ZIMA 5JJJB 3LPSA 4FLXA 2PF4E 1OCCC 1BZKA 2XAGA 5LGNA 1EBOA 1GKFA 1R1BA 2FWYA 2AZ0A 2UXDO 1GKXA 4ASBA 5LMUB 1Y4SA 4J7KA 5BR8O 2WLJA 3ZCCA 1NVPB 4MVMA 5IJ9A 4LF8B 4PI0A 1S5HC 4L8JA 4NXMO 1HNZO 5KA5A 2EIMC 3K06A 4LWEA 2NR5A 4MBCA 2H8PC 1YEWA 1TUBA 3QTCA 3CC4V 4EEHA 3AG1B 4LH6A 2UWDA 1TIDA 5EYPA 3LDCA 2MK3A 1K9MW 5IWAO 4YJ2B 2ZT9B 1N4CA 1VQOV 4ZBMA 2QTOA 3L74H 2P06A 1N36O 4H85A 2ZE6A 4GEEA 1GAXA 4LFBO 4X9LA 1N33B 1UPGA 4JGSA 2C1IA 1YC1A 3BEHA 4UCSA 1Q86W 1HWYA 4G27B 4AS9A 4C7UA 2IH3C 2YI9A 3K5MA 1VF5B 4DUYO 4FLUA 1YT1A 1BS3A 1MZEA 1BXDA 3THOA 1I7FA 3ZMTA 4TT3G 1ZUQA 4UCUA 4F6RB 2W6JG 3ABUA 4R7CA 4HNAA 4YKWA 2P7TC 1J5EO 4W4KA 5J9PC 2GFDA 4FFBB 5EIBC 4O4LA 2HR3A 1IZ3A 3FAVA 2YE4A 1J95A 3KCYA 2QA4V 5BODA 1ZXNA 2CK3G 2IOQA 3QO5A 5CBFA 2MW2B 1SETA 4F6EA 4JI0O 4L90A 5JH7B 3U2KA 5L3JA 2QEXV 1WA8A 3H9VA 1XI1A 3S3WA 2ZDIA 4PI2A 2WLLB 3SYOA 1LUVA 2EULA 2VWKA 4AQYO 2VS0A 4JZGA 2Q8GA 5EBMC 1VQ6V 5LL6Y 1K8AW 2IU3A 1KQSU 1UYCA 5F3KA 2R9RB 3OMIB 1FJGO 2QWNB 4YIOA 3HKDB 1VQKV 1YSCA 3ZMVA 4FLVA 5EBLC 3U11A 1BYQA 1NR7A 2BU7A 3ZHVA 1A4HA 4NB5A 1X59A 4LF6B 3LDEA 2LGWA 4QGPA 3VQVA 2CDYA 5D6QA 3HKCA 3CC2V 4JTDB 3R4NA 1VQNV 3T0HA 2YXHA 2ILMA 1AB3A 4NH8A 3HKEB 4QIWF 2L35A 2Q7EA 5B3SB 3NR7A 3VHDA 4JQLA 2JKIA 2XAJA 4I3HA 4GKJB 3O6OA 3ZS8C 2HKJA 4DV3B 4O0BA 4CWSA 5BMVA 3ZHRA 3L75H 4AWOA 1DTOA 5IJ9B 3K5LA 1BHBA 2OCCB 4FCRA 3M7MX 1SZXA 1JJ2U 1HR0B 2QG0A 5JENA 3RYIB 1YC3A 4ZI7A 5A2QN 5CMUA 5EYPB 4FZ1A 3K57A 3E86A 2QTSA 2YUAA 1RFYA 2XDUA 4HYMA 1W59A 2BT0A 2DYRC 4GX2A 4DUZO 4O2AB 3JARA 5JVDA 4Z2WA 2WEPA 3M8AA 2Y69B 2HHIA 3INWA 3BA9A 4LCUC 5IYDO 3A0TA 2XX2A 1YS3A 4O4HA 1I94B 1Y67A 2OTJV 1RM1C 3GIGB 5BY1A 2YKJA 4WFHA 4HXZA 1MNGA 5KUKA 2M6YA 4TSFG 1EI1A 1L8DA 2ODMA 4WUBA 3TGUH 2EJRA 3OMAB 4HNAB 3EVKA 2YEAA 2YE8A 3B26A 2IH1C 3ZMSA 3F5TA 2UUCO 2EINB 5LMNB 4YKTA 2VQFB 3ABLB 3ETEA 4O4LB 3BABA 3CCUV 1H38A 3G4SV 1GM8A 3E2EA 1UJWB 3A0ZA 3JD2A 1UYMA 2YEDA 3F7VC 4NKGB 4D6TH 4XCLA 1Q6UA 2B5UA 1UYLA 2YI0A 4NH9A 4JAAA 4RUFA 1WB7A 1NHJA 2QG2A 5LA6A 4UVBA 1YHQV 4FK5C 1WA8B 2P90A 2YIAA 1AI4A 1VIBA 4NVPA
chains in the Genus database with same CATH topology
4MOTA 5EC2C 2UXNA 2CCUA 4NH7A 1NKDA 4H81A 4HZ3A 1ROPA 1UYDA 3R92A 3FYEB 3JCZA 3OW2U 4H37A 3G71V 4LBEC 1UYFA 4MTOA 2EILC 1W0KG 2XASA 4KFMA 4BAEA 4KFGA 3LNUA 1AI5A 2EXLA 1DF5A 1V55B 1JPXA 4LWHA 1AMWA 4PDLA 3OE7G 3PEJA 3LUTB 3RBZA 1UYKA 2W6IG 2YGEA 3ZMZA 3TETA 2XHTA 3ASNB 2ZKJA 3DTUB 1QLEC 5HFLA 4WFBV 1R62A 2ZDYA 4BW5A 3CD6V 1FXKB 3ETGA 4JF3A 2LFSA 4MVSA 4GFNA 5J6AA 5IDMA 4UV8A 1JM6A 4P8OA 2ESAA 1K4DC 5M4NA 5FWKA 4PELA 4V25A 1WLEA 1M57C 3JZ3A 5CPHA 4UXNA 4RO2A 2HFEC 3RLQA 3TZ2A 5EBWC 4XE2A 1PL0A 5FNCA 1Y4UA 3FB6C 4WUCA 3W7WA 1BGQA 3ZM7A 4GT1A 4YKXA 1AJPA 4WFAV 1YETA 3K9AA 2Q68A 1TC6A 2CGFA 2HG5C 3PJSK 1PNLA 4HZ0A 3SYAA 4MVRA 1VQLV 3OGCC 4CWNA 2ITDC 1OCZC 1W2BU 1SESA 3C11A 5KUMA 3K08A 4MVQA 1NHIA 4YKZA 1S72V 5M4EA 4FCQA 1SZTA 3IFXA 4E02A 1UY7A 1F4NA 5FL7G 3CYOA 1OCOB 3AG4C 3F7YC 4LP8A 3SPCA 4MS2A 3RLRA 4BIUA 4XDLA 1K5SA 2GQPA 3EFFK 4RQFA 2BYIA 4CBCA 1AH8A 3SJQC 4L94A 2XX5A 1KC8W 1ZW9A 1I5YA 3BMYA 2YEHA 4Z1MG 3QDDA 4L93A 1UYIA 4P7AA 3CC7V 5BZBA 5IYCO 1JVMA 2WLHA 4JYBA 2A0LA 3JD0A 1KKDA 3ABTA 4X8AA 3UKMA 4EFUA 4HYOA 1BL8A 4B6CA 3K0DA 1I5CA 4DUHA 1W0JG 1NBMG 1F51A 4B7PA 2PNRA 1YSRA 2IW5A 4CZZA 4L8ZA 3RLPA 3E35A 3CCEV 2WLLA 3ASOB 5J71A 3WQ9A 3CPWU 2WI7A 3HPLC 3OWBA 3AG3C 3FB7C 1V54B 3CXCU 4PU9A 3AG2B 4MVUA 3HZ1A 1Y8PA 1YC4A 2YE7A 2XOKG 2YEEA 4EMVA 4MB9A 3K04A 4XD8A 3E89A 1FXVA 3T1CA 3WG7B 2ZDXA 3K99A 3FB8C 2C2AA 2XJJA 4GX5A 2IWXA 2AKPA 3ZMUA 1I59A 3OMNB 1QVGU 3GB7C 2XDLA 1Q7YW 1Y8OA 2X7RB 3EHFA 2BTZA 1NJIW 3W7TA 1THZA 3ABMB 3K60A 2X6CA 2GHYA 4UV9A 1AR1B 4XDMA 3ZKDA 5CBGA 3B8NA 3TZ5A 1QYEA 2DWEC 4FCPA 1FS0G 1US7A 2IJHA 3GIGA 4BIZA 3LDDA 3OAAG 5CTWA 4PA6A 2R9IA 1Z59A 4XDJA 4XIQA 5B3SC 2IJJA 2WLIB 2DQ0A 4XTJA 5LHHA 1R3JC 4O05A 2Q2EB 2OCCC 4X88A 2OTLV 3R4PA 3OEEG 1OCRB 2WPDG 4E01A 1NH2D 5LGUA 3SPHA 1K33A 1Y4MA 4MPNA 5DN6G 2EZOA 3SPIA 1I5XA 5M4MA 4PDRA 5CN0A 2XJXA 4ASFA 3Q5LA 3VHCA 3C0EA 2WLMA 5B1BB 2V1DA 2B1GA 3D2RA 2IWUA 1M1KW 1AJ6A 1QY8A 2XD6A 3E83A 2YEVB 1CEZA 4R6ZA 1CP9A 4BQJA 2JDIG 4P9OA 5E1AC 1R6NA 2WI5A 4N23A 3H01A 3T4DA 3W7SA 2YK2A 2DW4A 2ITCC 3STZC 4KSGA 2ZXWB 3GIEA 3P32A 1MX0A 1YTFD 1MOFA 2ZDIC 1AI7A 3ZIAG 4EFTA 3ZRSA 3STLC 1AH6A 4KSHA 2FYPA 4JTCB 1E1RG 4MTGA 1ENVA 1COWG 1FXKA 5LGTA 3OR6C 4ASUG 3QNEA 5CTUA 3TK1A 2KB1A 2XHRA 1NH2B 2K1EA 3ETDA 2WI2A 1NQTA 3OFNG 5B1AC 1S14A 1Y66A 1V55C 4CE1A 5L3EA 4E00A 2EIJB 2CH4A 3MD0A 3FYIB 5CTYA 3ASNC 2HCHA 3JD3A 4KUMA 4BXIA 2JJ2G 4CWTA 1I5DA 1PD3A 3B25A 3ZXQA 5DM6V 4LP0A 1VQ9V 5D7DA 2WLKA 2VCIA 3AEIA 1YERA 3HZ5A 4EM7A 2DYRB 4XITA 1VQMV 3HEKA 5L3GA 5L3FA 5CA3A 2X6BA 3P30A 3EHJA 3HB3B 2YGAA 2VWCA 3VADA 2FTKA 4J9YB 1BKNA 3VBBA 2CCSA 2YEIA 1S0VA 1YTFB 4LC1A 1RPOA 2LFRA 3X2QB 3H80A 4YKRA 4R3MA 3D0BA 4MW8A 4XIRA 5D7CA 1Q82W 3BM9A 3Q5JA 4YXWG 3R4MA 4EKWA 1RPRA 1K5QA 3A0RA 4PA9A 4RUEA 2XABA 1F4MA 3A0YA 4X89A 4FJCC 4PA3A 3CCQV 1I5AA 3VOUA 1I58A 1E79G 2YEGA 4JTAB 1YI2V 3HYYA 4LWFA 3ABKB 4MT8A 2WI6A 2BU6A 3SYPA 4KTNA 2EILB 1M56B 1L1FA 2Q69A 3JYCA 4TWKA 3QTFA 4G2KA 4EGIA 3K03A 4UVCA 2DYSC 5EK0A 1ZXMA 3M99B 2A79B 4YKUA 3TUHA 5GW7A 3B77A 3CWVA 1R73A 2WWWA 1Y8NA 3BY6A 3ZRWA 1S76D 2Z5UA 4R3AA 5LHGA 4HYPA 3TCUA 3KE6A 1OCOC 1QLEB 1VQ5V 1PVGA 3E8BA 3I55V 1QZRA 3CMAV 5IYBO 2WSSG 1FXHA 4CE2A 2FWZA 3SPJA 5D7RA 1K34A 5IY5C 2O1UA 4PA7A 3G7BA 2EIKC 4EGHA 4W7TA 3RVZA 4HXWA 5H9CA 4OXSA 3R65A 4QJFB 2YI5A 1VQ4V 3TZ4A 5B1OA 3FT8A 4LWIA 1S3JA 2QM8A 3I56V 3MHHC 1M57B 2YK9A 1KD1W 1MSWD 2W0FC 3T2MA 3T10A 5LBQA 2XAHA 1QCEA 4UVAA 4XDKA 2WEQA 3NXSA 1U0ZA 5L3CA 2PI5A 1AJQA 4GGLA 1WPXA 1YJNV 3UM7A 1Z5CA 3U67A 3ASOC 1OZ0A 2OT5A 3EKRA 1K3EA 3TZ0A 3RKZA 3B8MA 3R91A 2E0AA 3ZJZA 2YE5A 4YKYA 4UUJC 5FNFA 4QE7A 1ID0A 4UROA 5L3BA 2CCTA 1TH8A 1R6KA 4R1FA 3E8GA 4CWPA 1KZNA 2HLDG 2EZPA 4CWOA 3ZRXA 1S16A 3WG7C 2H55A 2ZD9A 3G6EV 2HJFC 1U2OA 2YEJA 3ZRWB 4FMTA 2WLIA 4MPCA 3OEHG 3QO7A 1YJ9V 2YECA 4MP7A 5BOCA 3KG2A 2WI4A 1JCHA 1YITV 2Y48A 1H7UA 1TC0A 3AG1C 4CWFA 2LP7A 5CTXA 3ABMC 2DQ3A 2XDXA 2YE9A 1QVFU 1YT2A 2QE7G 1BMFG 1N8RW 4PRXA 4YKQA 2HKOA 3INXA 4WFEA 4URNA 2YEVA 1TUEB 1UY9A 2IWSA 2QFOA 2VW5A 2BU8A 1K7DA 2WERA 2ZR3A 3VHAA 1MG1A 4URLA 1YIJV 1OCRC 3HYZA 2WLNA 4E2LA 1ZWIC 3FB5C 1R3LC 4Q20A 1DLBA 3GIFA 4MPEA 3O2FA 1SERA 1KECA 2AHYA 4URMA 4HY1A 3WHAA 2M7WA 2BRCA 4U93A 1XL4A 1EFRG 2BU2A 1ORQC 2PI4A 2QF6A 5B1BC 3RVYA 2XK2A 3A0XA 1QBZA 3LNMB 1M90W 2ATKC 3NMQA 1UYHA 3AG3B 3G7EA 3SYQA 3SL2A 1IXMA 3G75A 5C93A 3FT5A 2ZQMA 2NLJC 4GX1A 3W7XA 2FXSA 3HHUA 2YEFA 1YESA 2ZXWC 1OCCB 2JK5C 1E1QG 3MHSC 4HZ5A 2HVKC 4V26A 2BZ5A 2XCMA 1BHAA 2Q8HA 3ZN0A 4MVZA 1GM9A 4GQTA 2EIMB 2Y69C 4U7OA 1QLNA 2F43G 4EGKA 3EHHA 2XAFA 4U7NA 1H8EG 2HG1A 1H7SA 5LHIA 3EHBB 2BYHA 4JASA 1JOYA 2XX4A 4XCJA 4L91A 2EINC 3D3IA 3ABLC 1AI6A 4P30A 2O1WA 5KA6A 2AHZA 4ASGA 3K97A 5GGZA 4PDVA 2Q67A 1GKZA 4WCEV 4WFGA 2YE2A 2EIJC 2JEXA 2Z3YA 2QKSA 1VQ8V 2BU5A 3CMEV 4MVOA 2YI6A 1GK9A 3IEDA 3O0IA 1G8MA 1YJWV 2DWDC 4AWQA 4QE9A 2XAQA 1XL6A 4PA4A 2B1IA 5IN9A 2GSMB 3T1KA 3SPGA 1S77D 5F5RA 3ZXOA 1OHHG 1YSZA 2NNUA 3CCVV 1L0OA 4CWQA 5IDJA 1OSFA 4R8CA 3WFVA 2JJCA 1GTOA 2XHXA 2H8MA 3ZRVA 4XKOA 1KP3A 1NR1A 3X2QC 2XDKA 3U2DA 1LNQA 4XBFA 4DZYA 4GCZA 1P7BA 3ZKBA 4FIPC 5FNDA 4MW3A 1K92A 4JAUA 3R4OA 2BSMA 3PEHA 2HVJC 4L87A 4QPJA 1R3KC 4RAIA 1FXKC 5H6QA 5B1NA 2IOPA 1B3QA 2D3OW 2IJIA 3OM3B 2Q8FA 3OUSA 4WFFA 1JQ0A 1Q81W 1B62A 1Z5BA 3RW0A 3IGAC 1QR8A 1PNKA 1YT0A 3OR7C 1RM1B 3ABKC 3CGZA 4MP2A 3MNRP 5M4HA 1R3IC 4R50A 3B28A 4MTXA 1M56C 3CCRV 3TTZA 3CGYA 4LWGA 5M4PA 4JAVA 4XIPA 5B1AB 1H2GA 2BREA 1AJNA 3CCSV 3K79A 3SYCA 3CCMV 1PNMA 4HAMA 1JX9A 2XNDG 1TBWA 3OMUA 4QNHB 5HFMA 4PL9A 4FPPA 1K4CC 1F23A 2Q8IA 3CRKA 4G28B 1AROP 2UXXA 2YEBA 1UYEA 2WI3A 3FV5A 4GT8A 5H6RA 3LSSA 1PKXA 4LPBA 1K73W 4O04A 1CPYA 3E8HA 2QM7A 4AWPA 4I9WA 2JEUA 2YJWA 3A0WA 1H8HG 4N21A 3H4LA 2IU0A 4PDMA 5L3DA 4RQEA 3CCJV 1VQ7V 2VCJA 3OWDA 1DF4A 1P4RA 4DO2A 3CP1A 4KQVA 5D6PA 3JD4A 3T0ZA 3K0GA 1EA6A 4ZKIA 3Q5KA 1MABG 4GX0A 3EKOA 1EZJA 3EHGA 4ASAA 2H94A 2YKIA 1KIJA 3E8FA 4O09A 1KP2A 1Z5AA 4P9PA 3CRLA 2V7QG 2IORA 4O07A 2X6AA 5M4KA 4KP4A 2Q6AA 1THNA 3T4ZA 2YI7A 2XJGA 1B6QA 1TILA 4XKKA 5CBHA 2DYSB 2P67A 2YKCA 1MU5A 3QO8A 3B27A 3IC7A 4QPKA 3T2SA 4JYCA 2A9HA 4I5SA 2WI1A 1G4YB 3F5WC 5EC1C 2P6JA 4BQGA 2JIZG 4WUDA 4P2ZA 3DGEA 4CE3A 3K3WA 2YE3A 4ZVIA 1V54C 3K98A 2EBOA 3AG2C 3OUFA 1VQPV 2YJXA 1NVPD 4H33A 4F4LA 2BOCC 1NHHA 5CF0A 2JJ1G 2O1VA 4BAYA 3FKSG 2CG9A 1K97A 4DXWA 1UY6A 1GO3F 4JPRA 2YE6A 5IY5B 3GWOA 1OCZB 2EIKB 4CWRA 3OPDA 3ZN1A 3OW6A 4H7QA 3JD1A 2ZBKB 1B63A 3D36A 4K4OA 1GJVA 1SRYA 4HY6A 4J9ZB 1QR9A 2BOBC 3W7UA 1I5BA 1GM7A 3AG4B 3LSQA 2YKBA 2ZR2A 2YKEA 3CCLV 2X0LA 4XC0A 2XDSA 2IJKA 1AM1A 4PRVA 1FFTB 2YSUB 1GMGA 3B24A 2WAMA 4WF9V 1UY8A 2K5BA 4MTFA 2YGFA 1ZWHA 4MSWC 1UYGA 4XKAA 1M9NA 3LPSA 1OCCC 2XAGA 5LGNA 1EBOA 1GKFA 2FWYA 1GKXA 4ASBA 1Y4SA 2WLJA 3ZCCA 1NVPB 4MVMA 1S5HC 5KA5A 2EIMC 3K06A 4LWEA 4MBCA 2H8PC 3CC4V 4EEHA 3AG1B 2UWDA 1TIDA 3LDCA 2MK3A 1K9MW 1VQOV 4ZBMA 2QTOA 4H85A 4GEEA 4X9LA 4JGSA 1YC1A 3BEHA 1Q86W 1HWYA 4G27B 4AS9A 2IH3C 1YT1A 1BXDA 3ZMTA 4TT3G 2W6JG 4YKWA 3ABUA 4R7CA 2P7TC 5J9PC 2GFDA 2HR3A 2YE4A 1J95A 2QA4V 5BODA 1ZXNA 2CK3G 2IOQA 3QO5A 5CBFA 1SETA 4L90A 3U2KA 5L3JA 2QEXV 2ZDIA 2WLLB 3SYOA 2Q8GA 5EBMC 1VQ6V 1K8AW 2IU3A 1KQSU 1UYCA 5F3KA 2R9RB 3OMIB 1VQKV 1YSCA 3ZMVA 5EBLC 1BYQA 1NR7A 2BU7A 1A4HA 3LDEA 5D6QA 3CC2V 4JTDB 3R4NA 1VQNV 3T0HA 4NH8A 4QIWF 5B3SB 3VHDA 4JQLA 2JKIA 2XAJA 4I3HA 3O6OA 2HKJA 4O0BA 4CWSA 4AWOA 1DTOA 1BHBA 2OCCB 4FCRA 1JJ2U 2QG0A 1YC3A 5CMUA 3E86A 2XDUA 4HYMA 2BT0A 2DYRC 4GX2A 2WEPA 2Y69B 3INWA 4LCUC 5IYDO 3A0TA 2XX2A 1YS3A 2OTJV 1RM1C 3GIGB 2YKJA 4WFHA 4HXZA 5KUKA 4TSFG 1EI1A 4WUBA 2EJRA 3OMAB 3B26A 2YEAA 2YE8A 2IH1C 3ZMSA 2EINB 4YKTA 3ABLB 3ETEA 3CCUV 1H38A 3G4SV 1GM8A 3E2EA 1UJWB 3A0ZA 3JD2A 1UYMA 2YEDA 3F7VC 4XCLA 2B5UA 1UYLA 2YI0A 4NH9A 4RUFA 1NHJA 2QG2A 4UVBA 1YHQV 4FK5C 2P90A 1AI4A 3ML0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MOT A;  2WI4 A;  4MPN A;  1EA6 A;  4ZKI A;  3Q5K A;  2CCU A;  4NH7 A;  1H7U A;  1TC0 A;  3EKO A;  4CWF A;  4H81 A;  3EHG A;  5M4M A;  5CTX A;  2XJX A;  4ASA A;  4ASF A;  3Q5L A;  1UYD A;  2YKI A;  1KIJ A;  3VHC A;  3R92 A;  3C0E A;  2XDX A;  2YE9 A;  4O09 A;  1YT2 A;  3D2R A;  2IWU A;  1Z5A A;  1AJ6 A;  1QY8 A;  4PRX A;  4YKQ A;  3CRL A;  2XD6 A;  1UYF A;  2IOR A;  3INX A;  4O07 A;  4BQJ A;  4BAE A;  4KFG A;  4URN A;  5M4K A;  4KP4 A;  3LNU A;  1UY9 A;  2IWS A;  2QFO A;  2VW5 A;  1THN A;  2EXL A;  2BU8 A;  2WI5 A;  2YI7 A;  2XJG A;  2WER A;  4LWH A;  1AMW A;  3VHA A;  2YK2 A;  1TIL A;  3PEJ A;  4KSG A;  4XKK A;  4URL A;  1UYK A;  3GIE A;  3P32 A;  2YGE A;  2P67 A;  1MX0 A;  2XHT A;  2YKC A;  2ZKJ A;  3HYZ A;  1MU5 A;  4Q20 A;  3B27 A;  3GIF A;  4MPE A;  4EFT A;  1R62 A;  4QPK A;  3O2F A;  3T2S A;  2ZDY A;  4JYC A;  4URM A;  4I5S A;  2WI1 A;  4HY1 A;  3WHA A;  1AH6 A;  4KSH A;  2FYP A;  2BRC A;  2LFS A;  4GFN A;  4BQG A;  4WUD A;  5J6A A;  4U93 A;  5IDM A;  3DGE A;  4CE3 A;  2BU2 A;  2YE3 A;  4ZVI A;  2QF6 A;  3K98 A;  1JM6 A;  2XK2 A;  3A0X A;  4P8O A;  3NMQ A;  1UYH A;  2YJX A;  1NHH A;  2ESA A;  5CF0 A;  5M4N A;  5FWK A;  2O1V A;  3G7E A;  5CTU A;  3TK1 A;  3SL2 A;  2CG9 A;  1IXM A;  3G75 A;  5C93 A;  2XHR A;  1UY6 A;  2WI2 A;  3FT5 A;  2YE6 A;  1S14 A;  4V25 A;  4CE1 A;  2FXS A;  4CWR A;  3OPD A;  3HHU A;  3JZ3 A;  4E00 A;  3OW6 A;  4H7Q A;  5CPH A;  2YEF A;  1YES A;  2CH4 A;  3MD0 A;  3RLQ A;  2ZBK B;  3TZ2 A;  5CTY A;  1B63 A;  4HZ5 A;  3D36 A;  2HCH A;  4K4O A;  4XE2 A;  4V26 A;  2BZ5 A;  2XCM A;  4BXI A;  2Q8H A;  1GJV A;  4CWT A;  5FNC A;  4HY6 A;  1I5D A;  1Y4U A;  4WUC A;  1I5B A;  3B25 A;  4GQT A;  3ZXQ A;  4U7O A;  4LP0 A;  2YKB A;  2YKE A;  5D7D A;  1BGQ A;  4EGK A;  2VCI A;  3HZ5 A;  1YER A;  3ZM7 A;  3EHH A;  4EM7 A;  4GT1 A;  4YKX A;  4XC0 A;  2XDS A;  4XIT A;  1AM1 A;  4U7N A;  3HEK A;  4PRV A;  1YET A;  2HG1 A;  1H7S A;  3EHJ A;  3B24 A;  2YGA A;  2VWC A;  3VAD A;  2BYH A;  2FTK A;  4JAS A;  1BKN A;  1JOY A;  2CCS A;  1UY8 A;  1TC6 A;  2XX4 A;  2CGF A;  4XCJ A;  2YEI A;  4L91 A;  2K5B A;  2YGF A;  1ZWH A;  4HZ0 A;  4LC1 A;  1UYG A;  4CWN A;  4XKA A;  2LFR A;  2O1W A;  4ASG A;  3C11 A;  3K97 A;  5GGZ A;  3H80 A;  1GKZ A;  4R3M A;  4YKR A;  3D0B A;  2YE2 A;  3LPS A;  4XIR A;  1NHI A;  2BU5 A;  5D7C A;  4YKZ A;  2FWY A;  5M4E A;  1GKX A;  2YI6 A;  4ASB A;  3BM9 A;  3Q5J A;  4FCQ A;  3IED A;  3O0I A;  1Y4S A;  3R4M A;  4E02 A;  3ZCC A;  3A0R A;  1UY7 A;  4AWQ A;  2XAB A;  3A0Y A;  5IN9 A;  4LWE A;  3T1K A;  3RLR A;  4BIU A;  4MBC A;  1I5A A;  1I58 A;  2YEG A;  5F5R A;  4EEH A;  2UWD A;  3ZXO A;  1TID A;  2GQP A;  1YSZ A;  3HYY A;  4LWF A;  4H85 A;  2BYI A;  1L0O A;  1AH8 A;  4GEE A;  4L94 A;  4X9L A;  2XX5 A;  1ZW9 A;  4MT8 A;  2WI6 A;  1YC1 A;  3BMY A;  4CWQ A;  2BU6 A;  5IDJ A;  1OSF A;  4KTN A;  4AS9 A;  2YEH A;  3QDD A;  4L93 A;  1UYI A;  2JJC A;  4P7A A;  2XHX A;  2H8M A;  1YT1 A;  3ZRV A;  3QTF A;  4XKO A;  1BXD A;  4EGI A;  2XDK A;  3U2D A;  4DZY A;  4GCZ A;  4JYB A;  1ZXM A;  4YKW A;  3ZKB A;  2GFD A;  5FND A;  4YKU A;  4EFU A;  3TUH A;  4B6C A;  4JAU A;  1I5C A;  2YE4 A;  4DUH A;  3CWV A;  3R4O A;  2WWW A;  2BSM A;  1Y8N A;  5BOD A;  1ZXN A;  3ZRW A;  3PEH A;  1F51 A;  2IOQ A;  4R3A A;  4HYP A;  4QPJ A;  4B7P A;  4L90 A;  3KE6 A;  3U2K A;  1PVG A;  1YSR A;  2PNR A;  5L3J A;  5B1N A;  2IOP A;  1B3Q A;  1QZR A;  2Q8F A;  4L8Z A;  2Q8G A;  3RLP A;  5J71 A;  1B62 A;  1Z5B A;  1UYC A;  5F3K A;  3WQ9 A;  2WI7 A;  4CE2 A;  3OWB A;  2FWZ A;  1YT0 A;  4PU9 A;  5D7R A;  3CGZ A;  1BYQ A;  3HZ1 A;  4MP2 A;  2BU7 A;  3MNR P;  1A4H A;  5M4H A;  3B28 A;  2O1U A;  1Y8P A;  4MTX A;  1YC4 A;  2YE7 A;  5D6Q A;  3G7B A;  4EGH A;  2YEE A;  4W7T A;  3TTZ A;  4EMV A;  3R4N A;  4HXW A;  3T0H A;  3CGY A;  4LWG A;  4MB9 A;  4NH8 A;  4XD8 A;  5M4P A;  3VHD A;  4JQL A;  2JKI A;  4I3H A;  4JAV A;  2YI5 A;  3O6O A;  4XIP A;  2HKJ A;  4O0B A;  3TZ4 A;  5B1O A;  3FT8 A;  2ZDX A;  2BRE A;  3K99 A;  4CWS A;  2C2A A;  4LWI A;  2QM8 A;  4AWO A;  2XJJ A;  2YK9 A;  4FCR A;  2IWX A;  2AKP A;  2QG0 A;  3T10 A;  1I59 A;  1YC3 A;  1TBW A;  2WEQ A;  2XDL A;  3NXS A;  1U0Z A;  1Y8O A;  3OMU A;  2XDU A;  4HYM A;  3EHF A;  4PL9 A;  4FPP A;  2BT0 A;  2BTZ A;  4GGL A;  2Q8I A;  3CRK A;  2WEP A;  3K60 A;  3INW A;  1Z5C A;  3U67 A;  2YEB A;  1UYE A;  2WI3 A;  3FV5 A;  4XDM A;  3A0T A;  3EKR A;  2XX2 A;  4GT8 A;  3RKZ A;  3TZ0 A;  3ZKD A;  3R91 A;  2E0A A;  1YS3 A;  4LPB A;  3GIG B;  2YE5 A;  4O04 A;  1QYE A;  3TZ5 A;  4FCP A;  2QM7 A;  2YKJ A;  4YKY A;  4AWP A;  1US7 A;  4HXZ A;  5FNF A;  3GIG A;  1ID0 A;  4URO A;  4BIZ A;  2YJW A;  2CCT A;  1TH8 A;  1EI1 A;  3A0W A;  4WUB A;  5CTW A;  4R1F A;  3B26 A;  2YEA A;  2YE8 A;  4CWP A;  1KZN A;  1Z59 A;  4YKT A;  3H4L A;  4XIQ A;  4CWO A;  3ZRX A;  1S16 A;  3A0Z A;  2H55 A;  1UYM A;  2VCJ A;  2YED A;  3OWD A;  4XTJ A;  4XCL A;  1U2O A;  2YEJ A;  3ZRW B;  4FMT A;  1UYL A;  2YI0 A;  4NH9 A;  4O05 A;  2Q2E B;  1NHJ A;  3R4P A;  4MPC A;  2QG2 A;  2YEC A;  4KQV A;  5D6P A;  4E01 A;  4MP7 A;  5BOC A;  3T0Z A; 
#chains in the Genus database with same CATH topology
 4MOT A;  2UXB O;  3WB1 A;  3OTO O;  5EC2 C;  3APQ A;  1JFF A;  2UXN A;  2CCU A;  4NH7 A;  1NKD A;  2QWO B;  4H81 A;  4JV5 O;  4HZ3 A;  1ROP A;  3C3S A;  1UYD A;  3RYC B;  3R92 A;  2FL4 A;  4IYI A;  3FYE B;  5A9G A;  3JCZ A;  4UCT A;  3OW2 U;  1NI8 A;  4LNU A;  4JI6 B;  1JR9 A;  4K0K B;  4H37 A;  3G71 V;  4LBE C;  3HKC B;  5JQG A;  1UYF A;  4KXR A;  4MTO A;  2EIL C;  1W0K G;  2XAS A;  4KFM A;  2KKW A;  3DC5 A;  4BAE A;  4KFG A;  3RT3 C;  5BMV B;  3LNU A;  3H1H H;  5GON A;  1AI5 A;  2EXL A;  1DF5 A;  1V55 B;  1JPX A;  4LWH A;  1AMW A;  2P5O A;  4FFK A;  3CJH A;  4PDL A;  3OE7 G;  3PEJ A;  1RP3 B;  3LUT B;  3RN4 A;  3RBZ A;  1UYK A;  2W6I G;  1D2D A;  1D5A A;  2E76 B;  2YGE A;  3N2G B;  3ZMZ A;  3TET A;  3PN1 A;  2XHT A;  3ASN B;  2ZKJ A;  2Y0P A;  4X20 B;  2PGG A;  1KBH A;  2XUM A;  3DTU B;  1QLE C;  3JAR B;  5HFL A;  5JVD B;  4WFB V;  4YY3 B;  3OGI B;  1AVM A;  2RJZ A;  1N32 O;  1R62 A;  4DR5 O;  4JI3 B;  1TVK B;  2ZDY A;  2VQE B;  1O9G A;  4BW5 A;  1IX9 A;  4I0X A;  3CD6 V;  1FXK B;  3ETG A;  4JF3 A;  2LFS A;  4MVS A;  2UUB B;  4GFN A;  4O4H B;  5J6A A;  5IDM A;  1HNW O;  4UV8 A;  1JM6 A;  3UQ8 A;  3AG7 A;  4BWA A;  4P8O A;  4LF9 B;  5J2T A;  5KMG A;  3L71 H;  4FVM A;  3CEI A;  2ESA A;  1K4D C;  5M4N A;  1Q8I A;  5FWK A;  2IBZ H;  1M4U A;  3VQW A;  4DV7 O;  5ITZ B;  2E5L B;  1SA0 B;  4PEL A;  4TUY B;  3JAM N;  4V25 A;  1I08 A;  1EN6 A;  1WLE A;  5LA6 B;  1GN3 A;  2QWP B;  2XHB A;  3JSN A;  2UU9 B;  1M57 C;  4J41 A;  3JZ3 A;  5CPH A;  5J2U A;  3RGB A;  4B3S O;  4UXN A;  4RO2 A;  4TV9 A;  2HFE C;  3RLQ A;  2ZCE A;  1TA8 A;  2F23 A;  3TZ2 A;  5EBW C;  4LF5 B;  2JGU A;  1ZAU A;  3ICX A;  4XE2 A;  3JCU Z;  5KX5 A;  2GDS A;  4PD4 F;  1PL0 A;  2PY5 A;  5FNC A;  1Y4U A;  3FB6 C;  1XMQ B;  3BHP A;  4WUC A;  4WBN A;  4JI1 O;  5GTI Z;  4DR2 B;  3W7W A;  3A8T A;  1BGQ A;  4W4L A;  2HP8 A;  3ZM7 A;  4GT1 A;  5JQG B;  4YKX A;  1XNR O;  1AJP A;  2CGO A;  4O4I B;  4WFA V;  1VEW A;  1YET A;  4O2B A;  3RWR D;  4UCR A;  2PZS A;  3K9A A;  1P84 F;  2ADQ B;  1PM9 A;  5GON B;  1OV9 A;  1AIL A;  2Q68 A;  1TC6 A;  2CGF A;  2E3C A;  4X62 B;  3QF7 A;  3JAL A;  2HG5 C;  3PJS K;  3CJH B;  4X66 B;  1O9H A;  1PNL A;  1PV0 A;  3B4S A;  3SYA A;  4HZ0 A;  4MVR A;  1VQL V;  3OGC C;  4CWN A;  2ITD C;  3AK2 A;  1OCZ C;  1W2B U;  1SES A;  1KMI Z;  3C11 A;  4E4E A;  4YHH O;  5KUM A;  3K08 A;  5CB4 B;  4X1Y A;  3U0Z A;  4MVQ A;  1NHI A;  4YKZ A;  1S72 V;  4I55 B;  5M4E A;  4JI8 B;  4FCQ A;  1SZT A;  3IFX A;  4GKK O;  2FKX A;  4E02 A;  3CB2 A;  1UY7 A;  1F4N A;  4K8X A;  4CC5 A;  5FL7 G;  3CYO A;  2Q0A A;  1OCO B;  3K9S A;  3AG4 C;  3F7Y C;  4LP8 A;  3SPC A;  1Z5W A;  4MS2 A;  3RLR A;  4BIU A;  5J2T B;  1U97 A;  1XNQ B;  4TQD A;  4XDL A;  2Y4T A;  1K5S A;  3H1K H;  2GQP A;  3EFF K;  4RQF A;  1Q90 D;  3BAA A;  2QKA A;  3A0B Z;  2BYI A;  2C1G A;  4CBC A;  4X9Q A;  1AH8 A;  3SJQ C;  4L94 A;  2XX5 A;  1WB8 A;  1KC8 W;  1XHX A;  1ZW9 A;  1I5Y A;  3S5T A;  3BMY A;  1I0H A;  4Q6G A;  5LMU O;  3CSX A;  2YEH A;  4Z1M G;  3QDD A;  2F93 B;  5LOV A;  5LXT B;  1UYI A;  4L93 A;  4P7A A;  3CC7 V;  2JVD A;  5BZB A;  2ZE7 A;  4H13 B;  5IYC O;  1JVM A;  2WLH A;  4JYB A;  2GTA A;  1NTM H;  2A0L A;  5KX5 B;  3JD0 A;  4F6R A;  1KKD A;  3ABT A;  3VQY A;  4X8A A;  1H2K A;  3UKM A;  4EFU A;  4HYO A;  2KG7 A;  1BL8 A;  4B6C A;  3G6B A;  4BIO A;  3K0D A;  3ZBH A;  1I5C A;  4DUH A;  2CTR A;  1W0J G;  3OTF A;  2OYQ A;  1XOU A;  1NBM G;  1BT8 A;  1F51 A;  5B5E Z;  1SQX H;  3APO A;  5IE9 A;  5JCO C;  4B7P A;  2PNR A;  1YSR A;  1Z5V A;  3DC6 A;  2IW5 A;  4O2B B;  3H1J H;  4CZZ A;  4KHP O;  4L8Z A;  3E35 A;  4DV6 B;  3CCE V;  3RLP A;  2WLL A;  3ASO B;  5J71 A;  1YXB A;  3TJT A;  3WQ9 A;  3CPW U;  2WI7 A;  3HPL C;  3OWB A;  3AG3 C;  3FB7 C;  3TXQ A;  1V54 B;  2N74 A;  3CXC U;  2JS5 A;  1B06 A;  4PU9 A;  3HR0 A;  3AG2 B;  4MVU A;  3ZHQ A;  1Q43 A;  3HZ1 A;  1HNX B;  4B08 A;  3QG5 A;  1YDX A;  1Y8P A;  1YC4 A;  2YE7 A;  2XOK G;  4NTX A;  2YEE A;  4X1Y B;  4EMV A;  2CH7 A;  4TOI A;  4MB9 A;  3K04 A;  4XD8 A;  3E89 A;  5IJ0 B;  1FXV A;  3T1C A;  3CX5 F;  1ZLZ A;  3WG7 B;  4AI8 A;  3HKE A;  1IBK B;  1MSD A;  1A32 A;  3D36 C;  1XMO B;  2ZDX A;  3K99 A;  3FB8 C;  2C2A A;  4OPH A;  2XJJ A;  4GX5 A;  3ZHS A;  2IWX A;  2AKP A;  3GVM A;  3ZMU A;  2RN9 A;  2W0X A;  4TQF A;  3CS5 A;  1I59 A;  4DW0 A;  3OMN B;  4O4J A;  4GUN A;  3WU2 Z;  1KKC A;  4X65 B;  1QVG U;  1IBL B;  3GB7 C;  2XDL A;  1URF A;  3RYI A;  1Q7Y W;  1Y8O A;  4LF6 O;  2X7R B;  4CS3 A;  3EHF A;  2BTZ A;  3ML0 A;  1NJI W;  2R72 A;  3CRA A;  4BW9 A;  1BGY H;  3W7T A;  1THZ A;  3ABM B;  3K60 A;  3K5O A;  1WJZ A;  2X6C A;  3J7A U;  4O2A A;  2GHY A;  2Q7G A;  2OIE A;  2AZ2 A;  1F7Y A;  4GKJ O;  4UV9 A;  1AR1 B;  4XDM A;  5BXZ A;  5EIB D;  3ZKD A;  3R66 A;  5CBG A;  4DV4 O;  5LOV B;  2ZIO A;  3B8N A;  4I50 B;  2BE3 A;  2DWE C;  1QYE A;  4FCP A;  3TZ5 A;  4DV1 B;  1FS0 G;  1US7 A;  2IJH A;  3GIG A;  4LWS B;  1HR0 O;  4BIZ A;  2A7W A;  3LDD A;  4PA6 A;  3BFR A;  3OAA G;  3ZHU A;  5CTW A;  2R9I A;  2P22 C;  3BRC A;  1Z59 A;  1FD9 A;  1Q5O A;  4XDJ A;  4XIQ A;  5B3S C;  2GUZ B;  2Q7H A;  4H44 B;  4NXN B;  2KG7 B;  2IJJ A;  1VP7 A;  2DQ0 A;  2WLI B;  4XTJ A;  1H2M A;  5LHH A;  1R3J C;  4O05 A;  2Q2E B;  2OCC C;  1P7G A;  4X88 A;  2OTL V;  3R4P A;  3OEE G;  1OCR B;  2WPD G;  4E01 A;  3UO3 A;  4DR7 B;  1NH2 D;  1I94 O;  5LGU A;  3SPH A;  1K33 A;  4JI7 B;  1Y4M A;  1S5J A;  4B3T B;  1EN4 A;  4MPN A;  5H2F Z;  3FD9 A;  5DN6 G;  1SQG A;  2EZO A;  1T5E A;  3SPI A;  1I5X A;  1JMK C;  3CRQ A;  5M4M A;  4PDR A;  5CN0 A;  4FZ0 A;  2XJX A;  4LF7 B;  4ASF A;  2DJV A;  3Q5L A;  4J80 A;  5LMN O;  2YS8 A;  2VQF O;  3VHC A;  2XTA A;  2YID A;  3C0E A;  3B2E E;  4NYK A;  2WLM A;  5LYJ B;  5B1B B;  3RYC A;  2V1D A;  2B1G A;  3D2R A;  2IWU A;  3KCX A;  1M1K W;  1AJ6 A;  1QY8 A;  2XD6 A;  1EZV H;  3E83 A;  2CH7 B;  5DED A;  5BR8 B;  2YEV B;  1CEZ A;  3L72 H;  1BSM A;  1HP8 A;  4R6Z A;  1CP9 A;  4BQJ A;  4AIL C;  2JDI G;  4P9O A;  2A3Q A;  5E1A C;  1R6N A;  4J10 A;  4N23 A;  3SJB C;  4DR4 B;  2WI5 A;  3A2F A;  3H01 A;  3T4D A;  3W7S A;  2CTQ A;  2HJD A;  2LQT A;  2YK2 A;  2DW4 A;  2ITC C;  3P3P A;  3STZ C;  4KSG A;  2ARH A;  2YXY A;  4O4J B;  1MMM A;  2AXT Z;  2ZXW B;  3GIE A;  3P32 A;  1QNM A;  1MX0 A;  3K58 A;  1N36 B;  2GBO A;  4K0K O;  1S5L Z;  2UUA B;  2LW7 A;  3N2G A;  4ZIB A;  1YTF D;  1MOF A;  2ZDI C;  4X20 A;  2R9A A;  1AI7 A;  3ZIA G;  1IUR A;  1DK1 A;  4EFT A;  3ZRS A;  3CRR A;  4AHC A;  1AP6 A;  1TVK A;  3STL C;  3J80 N;  1AH6 A;  4KSH A;  2FYP A;  4JTC B;  1E1R G;  4MTG A;  1ENV A;  1KUQ A;  1COW G;  1FXK A;  1SQV H;  1ZSP A;  1FKA O;  3AK3 A;  2CTP A;  5LGT A;  3OR6 C;  4ASU G;  1XEQ A;  4OGQ B;  3QNE A;  5CTU A;  3TK1 A;  4EEQ A;  1PPJ H;  2KB1 A;  4FLT A;  2XHR A;  1NH2 B;  1OJH A;  2K1E A;  3ETD A;  4YY3 O;  5ITZ A;  2V4D A;  2WI2 A;  1NQT A;  3OFN G;  5B1A C;  1SA0 A;  4JI3 O;  1S14 A;  5C8Y A;  1Y66 A;  5FPO A;  2VQE O;  1V55 C;  4CE1 A;  4TUY A;  5L3E A;  1TGO A;  4E00 A;  2UUB O;  2EIJ B;  2CH4 A;  2AGA A;  3MD0 A;  2QWQ B;  3FYI B;  1AR5 A;  5CTY A;  3ASN C;  3U10 A;  4LF9 O;  2HCH A;  2QGN A;  3JD3 A;  4KUM A;  4BXI A;  2JJ2 G;  4I9Q A;  4JI5 B;  4CWT A;  1I5D A;  1PD3 A;  4IYH A;  2CGN A;  2RMK B;  1QHT A;  3B25 A;  2Q9L A;  3ZXQ A;  2E5L O;  5DM6 V;  4LFA B;  4LP0 A;  1VQ9 V;  3ZED A;  5D7D A;  1H2S B;  1YZB A;  2WLK A;  2VCI A;  3AEI A;  1YER A;  3HZ5 A;  2QJ1 A;  4EM7 A;  2DYR B;  4XIT A;  4YJ3 B;  5FLX N;  2D2C B;  3I5D A;  1VQM V;  3HEK A;  5L3G A;  5L3F A;  2FB5 A;  4UFZ A;  2UU9 O;  5CA3 A;  2X6B A;  3O65 A;  3P30 A;  3EHJ A;  3DSQ A;  3HB3 B;  1XUQ A;  4CH3 A;  4O4I A;  2YGA A;  2VWC A;  3VAD A;  3CRC A;  2FTK A;  4J9Y B;  2QSA A;  1BKN A;  3VBB A;  3Q4H A;  2CCS A;  4LF5 O;  5KHH A;  2YEI A;  1WN7 A;  1S0V A;  1L0L H;  2PUS A;  3EXA A;  1YTF B;  4LC1 A;  1RPO A;  1XMQ O;  4CS4 A;  2LFR A;  3X2Q B;  1IDS A;  4DR2 O;  2F4V B;  3H80 A;  4YKR A;  1QU7 A;  4CH6 A;  4R3M A;  3C90 A;  3D0B A;  2ZM6 O;  5K1X A;  3IJ4 A;  5CB4 A;  4MW8 A;  4XIR A;  2WA4 A;  5D7C A;  2G38 A;  1Q82 W;  3SJA C;  3AK1 A;  3BM9 A;  3Q5J A;  4JI4 O;  3K59 A;  4YXW G;  4I55 A;  4EKW A;  3R4M A;  1RPR A;  1K5Q A;  3A0R A;  2PYL A;  3OD4 A;  2Q4P A;  4PA9 A;  4RUE A;  2XAB A;  1F4M A;  4X62 O;  3A0Y A;  4X66 O;  4X89 A;  3BA8 A;  4FJC C;  4PA3 A;  3CCQ V;  2UUC B;  3VOU A;  1I5A A;  1I58 A;  1E79 G;  2YEG A;  4IIJ B;  4JTA B;  4X64 O;  1YI2 V;  3HYY A;  4DRX A;  4CH5 A;  4LWF A;  5EZY A;  3ABK B;  4MT8 A;  2WI6 A;  5C8Y B;  3SYP A;  2BU6 A;  4JYY A;  4JI8 O;  4KTN A;  4LFC B;  2EIL B;  1M56 B;  1L1F A;  4ZHQ B;  1XBL A;  2Q69 A;  3JSL A;  3JYC A;  4TWK A;  1XIL A;  3QTF A;  1CXZ B;  4G2K A;  5LXT A;  3C3T A;  2N05 A;  4EGI A;  4B3M B;  2QWR B;  3K03 A;  4UB8 Z;  4UVC A;  2DYS C;  5EK0 A;  1ZXM A;  3M99 B;  1XNQ O;  2RNB A;  2A79 B;  3P3N A;  1SQB H;  1XQ8 A;  4YKU A;  1D5N A;  3TUH A;  5GW7 A;  3B77 A;  3CWV A;  1R73 A;  2WWW A;  1Y8N A;  3BY6 A;  3ZRW A;  1S76 D;  2Z5U A;  1WAZ A;  4R3A A;  5LHG A;  3B40 A;  4HYP A;  3VQX A;  3TCU A;  3KE6 A;  1OCO C;  1QLE B;  1SQQ H;  1VQ5 V;  3E8B A;  1PVG A;  3I55 V;  3J81 N;  4D7S A;  1QZR A;  5JJE B;  3ZHT A;  3CMA V;  1XDC A;  5IYB O;  1P49 A;  3KZI Z;  2LGQ A;  2WSS G;  3Q4H B;  4H0L B;  5K1P A;  1FXH A;  4CE2 A;  1Z2G A;  2FWZ A;  2XT9 A;  2ETN A;  3SPJ A;  1NZ6 A;  5D7R A;  1WPB A;  1RSO B;  1K34 A;  5IY5 C;  2O1U A;  3FFQ A;  4DR5 B;  4PA7 A;  5LP6 A;  3G7B A;  2EIK C;  4EGH A;  4W7T A;  3RVZ A;  4HXW A;  5H9C A;  1VF6 A;  4OXS A;  3R65 A;  4QJF B;  3CWB H;  2OCH A;  3SGI A;  2YI5 A;  1VQ4 V;  1Q3E A;  5IJ0 A;  3TZ4 A;  2AW9 A;  5B1O A;  3FT8 A;  3N27 A;  3CRM A;  4DK0 A;  1HNW B;  1GN2 A;  4LWI A;  1S3J A;  2QM8 A;  4X1I A;  3MHH C;  3I56 V;  4DV6 O;  1M57 B;  2YK9 A;  2PTM A;  1KD1 W;  3UT5 A;  1MSW D;  1FPO A;  2W0F C;  3T2M A;  4PJ0 Z;  3T10 A;  5LBQ A;  4LF4 B;  2ZKO A;  2NN4 A;  2XAH A;  5KHG A;  1QCE A;  4UVA A;  4XDK A;  2WEQ A;  5DEC A;  3NXS A;  4DYL A;  1U0Z A;  5L3C A;  4EFB A;  2PI5 A;  1AJQ A;  4GGL A;  1MA1 A;  1WPX A;  1YJN V;  4DRX B;  5EZY B;  2UXC B;  4DK1 A;  5CA0 A;  3UM7 A;  2K9P A;  1Z5C A;  3U67 A;  3ASO C;  1OZ0 A;  4FLY A;  2OT5 A;  3EKR A;  1K3E A;  1TAE A;  1XMO O;  3RKZ A;  3TZ0 A;  3B8M A;  3R91 A;  4ABM A;  2E0A A;  3T1H B;  3ZJZ A;  2YE5 A;  3LMM A;  1IBM B;  3MAQ A;  3ZX6 A;  4YKY A;  1ZL8 A;  4UUJ C;  5FNF A;  4QE7 A;  1ID0 A;  4I50 A;  4LF8 O;  4URO A;  3RYH A;  5L3B A;  2QDO A;  2CCT A;  1TH8 A;  2Y4U A;  1R6K A;  4LWS A;  3E8G A;  4R1F A;  1IBL O;  4PHZ A;  4CWP A;  1GN4 A;  1KZN A;  2HLD G;  2HHH B;  2EZP A;  2CAZ C;  5E79 Z;  4CWO A;  3ZRX A;  1S16 A;  3WG7 C;  2YIB D;  2H55 A;  2ZD9 A;  2BSK B;  2GUZ A;  3G6E V;  1NT2 B;  3FX7 A;  2HJF C;  1U2O A;  2YEJ A;  3ZRW B;  4FMT A;  2WLI A;  4DR6 B;  2Q0O C;  1U96 A;  1VMG A;  3DXR B;  4MPC A;  3OEH G;  1N33 O;  3QO7 A;  1YJ9 V;  2YEC A;  4MP7 A;  4GZR B;  5BOC A;  3UCS C;  3KG2 A;  4DV1 O;  3D3Q A;  2WI4 A;  1DGS A;  1JCH A;  4OX9 B;  1YIT V;  2Y48 A;  1Q6H A;  1H7U A;  1TC0 A;  3AG1 C;  4CWF A;  2LP7 A;  4DW1 A;  3WB2 A;  5CTX A;  1L0N H;  3ABM C;  1JA8 A;  2DQ3 A;  4CC6 A;  4JYA B;  2XDX A;  2PYJ A;  2YE9 A;  1QVF U;  5B66 Z;  1YT2 A;  2QE7 G;  2GV9 A;  1BMF G;  5LYJ A;  3T1Y B;  1N8R W;  4PRX A;  4YKQ A;  5LP6 B;  1N34 B;  1JJO A;  2QM4 A;  2HKO A;  4IHJ A;  2R70 A;  4J11 A;  3INX A;  4FM2 A;  4DR7 O;  4WFE A;  4K8Z A;  4JI7 O;  4URN A;  2YEV A;  4B3T O;  1FFX B;  1TUE B;  3LNN A;  1UY9 A;  2IWS A;  2QFO A;  1Y6X A;  2VW5 A;  4X1I B;  2BU8 A;  1Y74 A;  1K7D A;  4B3R B;  2WER A;  3UT5 B;  1EM1 A;  2ZR3 A;  3VHA A;  1MG1 A;  4I7Z B;  4URL A;  1YIJ V;  3BVO A;  3JAS A;  3LSU A;  1OCR C;  3HYZ A;  1SC5 B;  2WLN A;  4E2L A;  1ZWI C;  3FB5 C;  2BTQ B;  1R3L C;  4Q20 A;  1DLB A;  1LUW A;  3GIF A;  4MPE A;  5CA0 B;  4DV0 B;  3O2F A;  1SER A;  4PV1 B;  1KEC A;  2AHY A;  4URM A;  3JAK A;  4HY1 A;  3WHA A;  2M7W A;  2BRC A;  4DV3 O;  4DR4 O;  4U93 A;  1XL4 A;  1EFR G;  3JAW B;  4U3F H;  3IC9 A;  1ORQ C;  2BU2 A;  2PI4 A;  2YIC A;  1ZL8 B;  2QF6 A;  5B1B C;  1Y76 B;  2N04 A;  3RVY A;  3K5N A;  2XK2 A;  3A0X A;  2RDC A;  1QBZ A;  2DE0 X;  3LNM B;  1M90 W;  2ATK C;  3RYH B;  3NMQ A;  4JZ2 A;  1UYH A;  4DV5 B;  3AG3 B;  3G7E A;  1SS3 A;  3SYQ A;  2UUA O;  3SL2 A;  5KAF Z;  1IXM A;  3G75 A;  5C93 A;  1ZTE A;  3FT5 A;  2ZQM A;  4D7T A;  2NLJ C;  4GX1 A;  3W7X A;  3G67 A;  2FXS A;  3H1I H;  2H3O A;  3RFR A;  3CHX A;  3HHU A;  4KHP B;  4DR1 B;  2B9Z A;  3GWK C;  2YEF A;  4NTW A;  1YES A;  2ZXW C;  2Q8V A;  2ZNJ A;  1OCC B;  2JK5 C;  1E1Q G;  3TXS A;  4NR1 A;  3MHS C;  4HZ5 A;  3L73 H;  2HVK C;  4DR3 B;  4JI2 B;  4V26 A;  2BZ5 A;  2XCM A;  1BHA A;  4IT5 A;  2Q8H A;  5IT9 N;  3ZN0 A;  4MVZ A;  5D5Q A;  4DV2 B;  2EX3 A;  1GM9 A;  3QVN A;  4GQT A;  2EIM B;  2Y69 C;  4U7O A;  5GTH Z;  2Q5Z A;  2Y0I A;  1QLN A;  5FPR A;  2F43 G;  4EGK A;  5IYZ B;  3EHH A;  1VF7 A;  2YC0 A;  2XAF A;  4U7N A;  4BR6 A;  1NTZ H;  1H8E G;  4IHJ B;  2UXD B;  2HG1 A;  4YJ3 A;  3BCC H;  4K35 A;  1H7S A;  4B7K A;  5LHI A;  5H5N A;  2DN9 A;  1FYJ A;  3EHB B;  4Z1V A;  2Z0A A;  2BYH A;  4JAS A;  3N2K A;  1Y74 B;  1JOY A;  2XX4 A;  4NXM B;  4XCJ A;  1HNZ B;  4L91 A;  2EIN C;  3D3I A;  4IL6 Z;  3ABL C;  1AI6 A;  4JI5 O;  1N0N A;  1AR4 A;  4P30 A;  2O1W A;  5KA6 A;  4J7J A;  2AHZ A;  3JAS B;  4ASG A;  3K97 A;  5GGZ A;  4LFA O;  5IWA B;  4PDV A;  2Q67 A;  1GKZ A;  2KSD A;  2LJ2 A;  4WCE V;  4WFG A;  2YE2 A;  4JI6 O;  2EIJ C;  2JEX A;  1Q6I A;  2Z3Y A;  5FNV A;  4LFB B;  2QKS A;  2YI8 A;  1VQ8 V;  2BU5 A;  3CME V;  4DV4 B;  4MVO A;  4ZOL A;  2YI6 A;  1GK9 A;  3IED A;  3O0I A;  3JAK B;  1G8M A;  1YJW V;  2DWD C;  3CYG A;  1SF9 A;  4DUY B;  4AWQ A;  4QE9 A;  2XAQ A;  1YCI A;  3O9O A;  1XL6 A;  4PA4 A;  1TUB B;  2B1I A;  5IN9 A;  2GSM B;  3T1K A;  1GH6 A;  2CE4 A;  4K3A A;  3SPG A;  5AG2 A;  1S77 D;  1J5E B;  5F5R A;  1AP5 A;  3ZXO A;  1NTK H;  1OHH G;  2F4V O;  2FML A;  1YSZ A;  2NNU A;  3CCV V;  2EJ7 A;  4IIJ A;  1EN5 A;  1L0O A;  1GN6 A;  4J7Z A;  4CWQ A;  5IDJ A;  1PP9 H;  2OIG A;  4JI0 B;  1OSF A;  5KHJ A;  4FLW A;  4R8C A;  3WFV A;  2JJC A;  1GTO A;  2XHX A;  2H8M A;  3ZRV A;  4ZHQ A;  2VWJ A;  4AQY B;  4XKO A;  1KP3 A;  1NR1 A;  2VRZ A;  3X2Q C;  1BQZ A;  2XDK A;  3U2D A;  1LNQ A;  3E22 A;  4XBF A;  1KB9 F;  4DZY A;  1FJG B;  4GCZ A;  1P7B A;  2ZIN A;  3ZKB A;  1US6 A;  3FAV B;  4FIP C;  5FND A;  4MW3 A;  1K92 A;  4JAU A;  3R4O A;  2BSM A;  4GLX A;  3PEH A;  2HVJ C;  1FAF A;  4FM1 A;  4L87 A;  4QPJ A;  1R3K C;  4RAI A;  4UB6 Z;  1FXK C;  5H6Q A;  5B1N A;  2IOP A;  1YVW A;  4LFC O;  4UCO A;  1B3Q A;  2D3O W;  2IJI A;  3OM3 B;  2Q8F A;  3OUS A;  4WFF A;  1JQ0 A;  2CTW A;  1Q81 W;  4B3M O;  1B62 A;  1Z5B A;  3N2K B;  3RW0 A;  3IGA C;  1QR8 A;  4X1K A;  1PNK A;  1YT0 A;  3OR7 C;  1RM1 B;  1WP7 A;  3ABK C;  4TV8 A;  3CGZ A;  4MP2 A;  3MNR P;  5KHI A;  5M4H A;  1R3I C;  4R50 A;  3B28 A;  5CA1 A;  5D5P A;  4MTX A;  1M56 C;  1RSO A;  4DUZ B;  3MDS A;  3CCR V;  3TTZ A;  5FNV B;  1SQF A;  3CGY A;  4LWG A;  2KQX A;  5M4P A;  4CS2 A;  4LH7 A;  1B04 A;  4JAV A;  4XIP A;  4ZOL B;  5B1A B;  1H2G A;  3OT7 A;  2BRE A;  2BCC H;  1AJN A;  3CCS V;  2IM9 A;  3K79 A;  3HKB A;  4A5U B;  3SYC A;  3CCM V;  1IXB A;  1PNM A;  4HAM A;  3B09 A;  1JX9 A;  4ZI7 B;  3H1L H;  1G6U A;  4E72 A;  2XND G;  1TBW A;  2HEP A;  1VAR A;  2QKC A;  2RQ6 A;  2QR4 A;  3OMU A;  4QNH B;  2O57 A;  3WB0 A;  5HFM A;  4OPA A;  4PL9 A;  4FPP A;  5KLV H;  4HBN A;  1K4C C;  1F23 A;  3SDL A;  2Q8I A;  3CRK A;  2A06 H;  1KU9 A;  4G28 B;  1ARO P;  2UXX A;  2YEB A;  1UYE A;  2WI3 A;  3FV5 A;  4GT8 A;  5H6R A;  3LSS A;  1H2L A;  1PKX A;  4LPB A;  1ZX3 A;  1K73 W;  3D8C A;  4O04 A;  2UXB B;  1HW7 A;  1CPY A;  3E8H A;  2QM7 A;  4AWP A;  3OTO B;  4I9W A;  4YIP A;  2JEU A;  4LF4 O;  2YJW A;  3E22 B;  3A0W A;  4JV5 B;  1BCC H;  4NTY A;  1H8H G;  1PL4 A;  1LR1 A;  4U3J A;  4N21 A;  3H4L A;  2IU0 A;  4PDM A;  5KAI Z;  4EB6 A;  1M93 A;  5L3D A;  4RQE A;  3CCJ V;  1VQ7 V;  2VCJ A;  4RWU A;  3OWD A;  1DF4 A;  1P4R A;  4DO2 A;  2UXC O;  3CP1 A;  4CH4 A;  1XHZ A;  2BSK A;  4GYC B;  4KQV A;  5D6P A;  2JS3 A;  3DXR A;  3T1H O;  4I4T A;  3JD4 A;  1HDJ A;  3T0Z A;  3RYF A;  1WNS A;  1IBM O;  3UO2 A;  1JFF B;  2F66 C;  3K0G A;  3L9D A;  1WP8 A;  1EA6 A;  2JRI A;  1NU1 H;  4ZKI A;  3Q5K A;  1MAB G;  4GX0 A;  3EKO A;  1EZJ A;  3BPZ A;  4EFE A;  3EHG A;  2JGD A;  4X1K B;  4ASA A;  2H94 A;  4FM0 A;  2HHH O;  2YKI A;  1KIJ A;  3CE2 A;  4LNU B;  4TV8 B;  3E8F A;  4O09 A;  2ZM6 B;  3A0H Z;  2E74 B;  2F1M A;  2LO1 A;  3G80 A;  1KP2 A;  1Z5A A;  3JAT A;  5CA1 B;  4P9P A;  3CRL A;  2V7Q G;  5JWP A;  2YDE A;  4DR6 O;  2ZNI A;  2IOR A;  1N32 B;  4JI4 B;  4O07 A;  2X6A A;  1IVS A;  1NS1 A;  4ICG A;  4KP4 A;  5M4K A;  2Q6A A;  1THN A;  3T4Z A;  2YI7 A;  1FFX A;  4OX9 O;  2OWO A;  3HKB B;  2XJG A;  2P4V A;  1B6Q A;  1SQP H;  1TIL A;  4XKK A;  4B7E A;  1X4T A;  4JYA O;  4X64 B;  5CBH A;  2DYS B;  2P67 A;  1N0J A;  2YKC A;  2WA3 A;  1MU5 A;  4DV7 B;  2BTO A;  2CUG A;  3T1Y O;  3QO8 A;  1R6T A;  1HNX O;  3IAY A;  3SJC C;  1G1X B;  3B27 A;  3L70 H;  1N34 O;  3IC7 A;  2DOS A;  1BQ0 A;  2BTQ A;  1XRE A;  4QPK A;  3T2S A;  3CXH F;  4I0X B;  3KKY A;  2A9H A;  4JYC A;  2P4K A;  4I5S A;  2WI1 A;  1M5I A;  1G4Y B;  3F5W C;  5EC1 C;  2P6J A;  4BQG A;  4B3S B;  2JIZ G;  1IBK O;  4WUD A;  1YF2 A;  5JCO A;  1SKV A;  2LW1 A;  2Q73 A;  3DGE A;  4P2Z A;  3K3W A;  4B3R O;  4CE3 A;  2YE3 A;  4ZVI A;  1KYO F;  1V54 C;  3K98 A;  3JAW A;  5KMG B;  2EBO A;  3AG2 C;  3OUF A;  1VQP V;  1Y76 A;  2YJX A;  1NVP D;  4H33 A;  4F4L A;  2F95 B;  5LP6 C;  2YIB A;  2BOC C;  1NHH A;  5CF0 A;  4FLZ A;  2JJ1 G;  4U3J B;  5TIS Z;  4YJ2 A;  2O1V A;  4BAY A;  1VF6 C;  3FKS G;  4X65 O;  2ADP A;  4EB6 B;  1K97 A;  4DXW A;  2CG9 A;  4J42 A;  4JI1 B;  3SR2 C;  1UY6 A;  1GO3 F;  1H2N A;  4DV0 O;  4JPR A;  2YE6 A;  5IY5 B;  3GWO A;  1XNR B;  1OCZ B;  4IGG A;  5J2U B;  1UFI A;  2EIK B;  2ZE8 A;  4CWR A;  2DMX A;  3OPD A;  3ZN1 A;  4TV9 B;  5JJN B;  5F2V O;  3OW6 A;  4H7Q A;  4LR3 A;  4I4T B;  3RYF B;  3JD1 A;  2ZBK B;  1B63 A;  3ETQ A;  3D36 A;  4K4O A;  4WBN B;  1GJV A;  1SRY A;  2JGD B;  4FFB A;  4DV5 O;  4HY6 A;  4J9Z B;  1QR9 A;  2BOB C;  3W7U A;  1I5B A;  1GM7 A;  1MZF A;  3AG4 B;  3LSQ A;  4YHH B;  2YKB A;  2ZR2 A;  2YKE A;  2YXL A;  2GTS A;  4NXN O;  3JAT B;  2X0L A;  3CCL V;  4XC0 A;  2XDS A;  5JH7 A;  2IJK A;  1AM1 A;  4UCV A;  5IYZ A;  4PRV A;  1FFT B;  4DR1 O;  2YSU B;  1GMG A;  3B24 A;  4GKK B;  2WAM A;  4WF9 V;  1V9P A;  2E75 B;  3JAL B;  1UY8 A;  4DR3 O;  1BE3 H;  4JI2 O;  2K5B A;  3HKD A;  4MTF A;  2ZE5 A;  2YGF A;  3S3X A;  4KL1 A;  1ZWH A;  4MSW C;  1UYG A;  5KHK A;  4DV2 O;  4XKA A;  2L6L A;  1QQC A;  4LF7 O;  2RCV A;  1M9N A;  2FYU H;  1GRJ A;  2ZIM A;  5JJJ B;  3LPS A;  4FLX A;  2PF4 E;  1OCC C;  1BZK A;  2XAG A;  5LGN A;  1EBO A;  1GKF A;  1R1B A;  2FWY A;  2AZ0 A;  2UXD O;  1GKX A;  4ASB A;  5LMU B;  1Y4S A;  4J7K A;  5BR8 O;  2WLJ A;  3ZCC A;  1NVP B;  4MVM A;  5IJ9 A;  4LF8 B;  4PI0 A;  1S5H C;  4L8J A;  4NXM O;  1HNZ O;  5KA5 A;  2EIM C;  3K06 A;  4LWE A;  2NR5 A;  4MBC A;  2H8P C;  1YEW A;  1TUB A;  3QTC A;  3CC4 V;  4EEH A;  3AG1 B;  4LH6 A;  2UWD A;  1TID A;  5EYP A;  3LDC A;  2MK3 A;  1K9M W;  5IWA O;  4YJ2 B;  2ZT9 B;  1N4C A;  1VQO V;  4ZBM A;  2QTO A;  3L74 H;  2P06 A;  1N36 O;  4H85 A;  2ZE6 A;  4GEE A;  1GAX A;  4LFB O;  4X9L A;  1N33 B;  1UPG A;  4JGS A;  2C1I A;  1YC1 A;  3BEH A;  4UCS A;  1Q86 W;  1HWY A;  4G27 B;  4AS9 A;  4C7U A;  2IH3 C;  2YI9 A;  3K5M A;  1VF5 B;  4DUY O;  4FLU A;  1YT1 A;  1BS3 A;  1MZE A;  1BXD A;  3THO A;  1I7F A;  3ZMT A;  4TT3 G;  1ZUQ A;  4UCU A;  4F6R B;  2W6J G;  3ABU A;  4R7C A;  4HNA A;  4YKW A;  2P7T C;  1J5E O;  4W4K A;  5J9P C;  2GFD A;  4FFB B;  5EIB C;  4O4L A;  2HR3 A;  1IZ3 A;  3FAV A;  2YE4 A;  1J95 A;  3KCY A;  2QA4 V;  5BOD A;  1ZXN A;  2CK3 G;  2IOQ A;  3QO5 A;  5CBF A;  2MW2 B;  1SET A;  4F6E A;  4JI0 O;  4L90 A;  5JH7 B;  3U2K A;  5L3J A;  2QEX V;  1WA8 A;  3H9V A;  1XI1 A;  3S3W A;  2ZDI A;  4PI2 A;  2WLL B;  3SYO A;  1LUV A;  2EUL A;  2VWK A;  4AQY O;  2VS0 A;  4JZG A;  2Q8G A;  5EBM C;  1VQ6 V;  5LL6 Y;  1K8A W;  2IU3 A;  1KQS U;  1UYC A;  5F3K A;  2R9R B;  3OMI B;  1FJG O;  2QWN B;  4YIO A;  3HKD B;  1VQK V;  1YSC A;  3ZMV A;  4FLV A;  5EBL C;  3U11 A;  1BYQ A;  1NR7 A;  2BU7 A;  3ZHV A;  1A4H A;  4NB5 A;  1X59 A;  4LF6 B;  3LDE A;  2LGW A;  4QGP A;  3VQV A;  2CDY A;  5D6Q A;  3HKC A;  3CC2 V;  4JTD B;  3R4N A;  1VQN V;  3T0H A;  2YXH A;  2ILM A;  1AB3 A;  4NH8 A;  3HKE B;  4QIW F;  2L35 A;  2Q7E A;  5B3S B;  3NR7 A;  3VHD A;  4JQL A;  2JKI A;  2XAJ A;  4I3H A;  4GKJ B;  3O6O A;  3ZS8 C;  2HKJ A;  4DV3 B;  4O0B A;  4CWS A;  5BMV A;  3ZHR A;  3L75 H;  4AWO A;  1DTO A;  5IJ9 B;  3K5L A;  1BHB A;  2OCC B;  4FCR A;  3M7M X;  1SZX A;  1JJ2 U;  1HR0 B;  2QG0 A;  5JEN A;  3RYI B;  1YC3 A;  4ZI7 A;  5A2Q N;  5CMU A;  5EYP B;  4FZ1 A;  3K57 A;  3E86 A;  2QTS A;  2YUA A;  1RFY A;  2XDU A;  4HYM A;  1W59 A;  2BT0 A;  2DYR C;  4GX2 A;  4DUZ O;  4O2A B;  3JAR A;  5JVD A;  4Z2W A;  2WEP A;  3M8A A;  2Y69 B;  2HHI A;  3INW A;  3BA9 A;  4LCU C;  5IYD O;  3A0T A;  2XX2 A;  1YS3 A;  4O4H A;  1I94 B;  1Y67 A;  2OTJ V;  1RM1 C;  3GIG B;  5BY1 A;  2YKJ A;  4WFH A;  4HXZ A;  1MNG A;  5KUK A;  2M6Y A;  4TSF G;  1EI1 A;  1L8D A;  2ODM A;  4WUB A;  3TGU H;  2EJR A;  3OMA B;  4HNA B;  3EVK A;  2YEA A;  2YE8 A;  3B26 A;  2IH1 C;  3ZMS A;  3F5T A;  2UUC O;  2EIN B;  5LMN B;  4YKT A;  2VQF B;  3ABL B;  3ETE A;  4O4L B;  3BAB A;  3CCU V;  1H38 A;  3G4S V;  1GM8 A;  3E2E A;  1UJW B;  3A0Z A;  3JD2 A;  1UYM A;  2YED A;  3F7V C;  4NKG B;  4D6T H;  4XCL A;  1Q6U A;  2B5U A;  1UYL A;  2YI0 A;  4NH9 A;  4JAA A;  4RUF A;  1WB7 A;  1NHJ A;  2QG2 A;  5LA6 A;  4UVB A;  1YHQ V;  4FK5 C;  1WA8 B;  2P90 A;  2YIA A;  1AI4 A;  1VIB A;  4NVP A; 
#chains in the Genus database with same CATH homology
 4MOT A;  5EC2 C;  2UXN A;  2CCU A;  4NH7 A;  1NKD A;  4H81 A;  4HZ3 A;  1ROP A;  1UYD A;  3R92 A;  3FYE B;  3JCZ A;  3OW2 U;  4H37 A;  3G71 V;  4LBE C;  1UYF A;  4MTO A;  2EIL C;  1W0K G;  2XAS A;  4KFM A;  4BAE A;  4KFG A;  3LNU A;  1AI5 A;  2EXL A;  1DF5 A;  1V55 B;  1JPX A;  4LWH A;  1AMW A;  4PDL A;  3OE7 G;  3PEJ A;  3LUT B;  3RBZ A;  1UYK A;  2W6I G;  2YGE A;  3ZMZ A;  3TET A;  2XHT A;  3ASN B;  2ZKJ A;  3DTU B;  1QLE C;  5HFL A;  4WFB V;  1R62 A;  2ZDY A;  4BW5 A;  3CD6 V;  1FXK B;  3ETG A;  4JF3 A;  2LFS A;  4MVS A;  4GFN A;  5J6A A;  5IDM A;  4UV8 A;  1JM6 A;  4P8O A;  2ESA A;  1K4D C;  5M4N A;  5FWK A;  4PEL A;  4V25 A;  1WLE A;  1M57 C;  3JZ3 A;  5CPH A;  4UXN A;  4RO2 A;  2HFE C;  3RLQ A;  3TZ2 A;  5EBW C;  4XE2 A;  1PL0 A;  5FNC A;  1Y4U A;  3FB6 C;  4WUC A;  3W7W A;  1BGQ A;  3ZM7 A;  4GT1 A;  4YKX A;  1AJP A;  4WFA V;  1YET A;  3K9A A;  2Q68 A;  1TC6 A;  2CGF A;  2HG5 C;  3PJS K;  1PNL A;  4HZ0 A;  3SYA A;  4MVR A;  1VQL V;  3OGC C;  4CWN A;  2ITD C;  1OCZ C;  1W2B U;  1SES A;  3C11 A;  5KUM A;  3K08 A;  4MVQ A;  1NHI A;  4YKZ A;  1S72 V;  5M4E A;  4FCQ A;  1SZT A;  3IFX A;  4E02 A;  1UY7 A;  1F4N A;  5FL7 G;  3CYO A;  1OCO B;  3AG4 C;  3F7Y C;  4LP8 A;  3SPC A;  4MS2 A;  3RLR A;  4BIU A;  4XDL A;  1K5S A;  2GQP A;  3EFF K;  4RQF A;  2BYI A;  4CBC A;  1AH8 A;  3SJQ C;  4L94 A;  2XX5 A;  1KC8 W;  1ZW9 A;  1I5Y A;  3BMY A;  2YEH A;  4Z1M G;  3QDD A;  4L93 A;  1UYI A;  4P7A A;  3CC7 V;  5BZB A;  5IYC O;  1JVM A;  2WLH A;  4JYB A;  2A0L A;  3JD0 A;  1KKD A;  3ABT A;  4X8A A;  3UKM A;  4EFU A;  4HYO A;  1BL8 A;  4B6C A;  3K0D A;  1I5C A;  4DUH A;  1W0J G;  1NBM G;  1F51 A;  4B7P A;  2PNR A;  1YSR A;  2IW5 A;  4CZZ A;  4L8Z A;  3RLP A;  3E35 A;  3CCE V;  2WLL A;  3ASO B;  5J71 A;  3WQ9 A;  3CPW U;  2WI7 A;  3HPL C;  3OWB A;  3AG3 C;  3FB7 C;  1V54 B;  3CXC U;  4PU9 A;  3AG2 B;  4MVU A;  3HZ1 A;  1Y8P A;  1YC4 A;  2YE7 A;  2XOK G;  2YEE A;  4EMV A;  4MB9 A;  3K04 A;  4XD8 A;  3E89 A;  1FXV A;  3T1C A;  3WG7 B;  2ZDX A;  3K99 A;  3FB8 C;  2C2A A;  2XJJ A;  4GX5 A;  2IWX A;  2AKP A;  3ZMU A;  1I59 A;  3OMN B;  1QVG U;  3GB7 C;  2XDL A;  1Q7Y W;  1Y8O A;  2X7R B;  3EHF A;  2BTZ A;  1NJI W;  3W7T A;  1THZ A;  3ABM B;  3K60 A;  2X6C A;  2GHY A;  4UV9 A;  1AR1 B;  4XDM A;  3ZKD A;  5CBG A;  3B8N A;  3TZ5 A;  1QYE A;  2DWE C;  4FCP A;  1FS0 G;  1US7 A;  2IJH A;  3GIG A;  4BIZ A;  3LDD A;  3OAA G;  5CTW A;  4PA6 A;  2R9I A;  1Z59 A;  4XDJ A;  4XIQ A;  5B3S C;  2IJJ A;  2WLI B;  2DQ0 A;  4XTJ A;  5LHH A;  1R3J C;  4O05 A;  2Q2E B;  2OCC C;  4X88 A;  2OTL V;  3R4P A;  3OEE G;  1OCR B;  2WPD G;  4E01 A;  1NH2 D;  5LGU A;  3SPH A;  1K33 A;  1Y4M A;  4MPN A;  5DN6 G;  2EZO A;  3SPI A;  1I5X A;  5M4M A;  4PDR A;  5CN0 A;  2XJX A;  4ASF A;  3Q5L A;  3VHC A;  3C0E A;  2WLM A;  5B1B B;  2V1D A;  2B1G A;  3D2R A;  2IWU A;  1M1K W;  1AJ6 A;  1QY8 A;  2XD6 A;  3E83 A;  2YEV B;  1CEZ A;  4R6Z A;  1CP9 A;  4BQJ A;  2JDI G;  4P9O A;  5E1A C;  1R6N A;  2WI5 A;  4N23 A;  3H01 A;  3T4D A;  3W7S A;  2YK2 A;  2DW4 A;  2ITC C;  3STZ C;  4KSG A;  2ZXW B;  3GIE A;  3P32 A;  1MX0 A;  1YTF D;  1MOF A;  2ZDI C;  1AI7 A;  3ZIA G;  4EFT A;  3ZRS A;  3STL C;  1AH6 A;  4KSH A;  2FYP A;  4JTC B;  1E1R G;  4MTG A;  1ENV A;  1COW G;  1FXK A;  5LGT A;  3OR6 C;  4ASU G;  3QNE A;  5CTU A;  3TK1 A;  2KB1 A;  2XHR A;  1NH2 B;  2K1E A;  3ETD A;  2WI2 A;  1NQT A;  3OFN G;  5B1A C;  1S14 A;  1Y66 A;  1V55 C;  4CE1 A;  5L3E A;  4E00 A;  2EIJ B;  2CH4 A;  3MD0 A;  3FYI B;  5CTY A;  3ASN C;  2HCH A;  3JD3 A;  4KUM A;  4BXI A;  2JJ2 G;  4CWT A;  1I5D A;  1PD3 A;  3B25 A;  3ZXQ A;  5DM6 V;  4LP0 A;  1VQ9 V;  5D7D A;  2WLK A;  2VCI A;  3AEI A;  1YER A;  3HZ5 A;  4EM7 A;  2DYR B;  4XIT A;  1VQM V;  3HEK A;  5L3G A;  5L3F A;  5CA3 A;  2X6B A;  3P30 A;  3EHJ A;  3HB3 B;  2YGA A;  2VWC A;  3VAD A;  2FTK A;  4J9Y B;  1BKN A;  3VBB A;  2CCS A;  2YEI A;  1S0V A;  1YTF B;  4LC1 A;  1RPO A;  2LFR A;  3X2Q B;  3H80 A;  4YKR A;  4R3M A;  3D0B A;  4MW8 A;  4XIR A;  5D7C A;  1Q82 W;  3BM9 A;  3Q5J A;  4YXW G;  3R4M A;  4EKW A;  1RPR A;  1K5Q A;  3A0R A;  4PA9 A;  4RUE A;  2XAB A;  1F4M A;  3A0Y A;  4X89 A;  4FJC C;  4PA3 A;  3CCQ V;  1I5A A;  3VOU A;  1I58 A;  1E79 G;  2YEG A;  4JTA B;  1YI2 V;  3HYY A;  4LWF A;  3ABK B;  4MT8 A;  2WI6 A;  2BU6 A;  3SYP A;  4KTN A;  2EIL B;  1M56 B;  1L1F A;  2Q69 A;  3JYC A;  4TWK A;  3QTF A;  4G2K A;  4EGI A;  3K03 A;  4UVC A;  2DYS C;  5EK0 A;  1ZXM A;  3M99 B;  2A79 B;  4YKU A;  3TUH A;  5GW7 A;  3B77 A;  3CWV A;  1R73 A;  2WWW A;  1Y8N A;  3BY6 A;  3ZRW A;  1S76 D;  2Z5U A;  4R3A A;  5LHG A;  4HYP A;  3TCU A;  3KE6 A;  1OCO C;  1QLE B;  1VQ5 V;  1PVG A;  3E8B A;  3I55 V;  1QZR A;  3CMA V;  5IYB O;  2WSS G;  1FXH A;  4CE2 A;  2FWZ A;  3SPJ A;  5D7R A;  1K34 A;  5IY5 C;  2O1U A;  4PA7 A;  3G7B A;  2EIK C;  4EGH A;  4W7T A;  3RVZ A;  4HXW A;  5H9C A;  4OXS A;  3R65 A;  4QJF B;  2YI5 A;  1VQ4 V;  3TZ4 A;  5B1O A;  3FT8 A;  4LWI A;  1S3J A;  2QM8 A;  3I56 V;  3MHH C;  1M57 B;  2YK9 A;  1KD1 W;  1MSW D;  2W0F C;  3T2M A;  3T10 A;  5LBQ A;  2XAH A;  1QCE A;  4UVA A;  4XDK A;  2WEQ A;  3NXS A;  1U0Z A;  5L3C A;  2PI5 A;  1AJQ A;  4GGL A;  1WPX A;  1YJN V;  3UM7 A;  1Z5C A;  3U67 A;  3ASO C;  1OZ0 A;  2OT5 A;  3EKR A;  1K3E A;  3TZ0 A;  3RKZ A;  3B8M A;  3R91 A;  2E0A A;  3ZJZ A;  2YE5 A;  4YKY A;  4UUJ C;  5FNF A;  4QE7 A;  1ID0 A;  4URO A;  5L3B A;  2CCT A;  1TH8 A;  1R6K A;  4R1F A;  3E8G A;  4CWP A;  1KZN A;  2HLD G;  2EZP A;  4CWO A;  3ZRX A;  1S16 A;  3WG7 C;  2H55 A;  2ZD9 A;  3G6E V;  2HJF C;  1U2O A;  2YEJ A;  3ZRW B;  4FMT A;  2WLI A;  4MPC A;  3OEH G;  3QO7 A;  1YJ9 V;  2YEC A;  4MP7 A;  5BOC A;  3KG2 A;  2WI4 A;  1JCH A;  1YIT V;  2Y48 A;  1H7U A;  1TC0 A;  3AG1 C;  4CWF A;  2LP7 A;  5CTX A;  3ABM C;  2DQ3 A;  2XDX A;  2YE9 A;  1QVF U;  1YT2 A;  2QE7 G;  1BMF G;  1N8R W;  4PRX A;  4YKQ A;  2HKO A;  3INX A;  4WFE A;  4URN A;  2YEV A;  1TUE B;  1UY9 A;  2IWS A;  2QFO A;  2VW5 A;  2BU8 A;  1K7D A;  2WER A;  2ZR3 A;  3VHA A;  1MG1 A;  4URL A;  1YIJ V;  1OCR C;  3HYZ A;  2WLN A;  4E2L A;  1ZWI C;  3FB5 C;  1R3L C;  4Q20 A;  1DLB A;  3GIF A;  4MPE A;  3O2F A;  1SER A;  1KEC A;  2AHY A;  4URM A;  4HY1 A;  3WHA A;  2M7W A;  2BRC A;  4U93 A;  1XL4 A;  1EFR G;  2BU2 A;  1ORQ C;  2PI4 A;  2QF6 A;  5B1B C;  3RVY A;  2XK2 A;  3A0X A;  1QBZ A;  3LNM B;  1M90 W;  2ATK C;  3NMQ A;  1UYH A;  3AG3 B;  3G7E A;  3SYQ A;  3SL2 A;  1IXM A;  3G75 A;  5C93 A;  3FT5 A;  2ZQM A;  2NLJ C;  4GX1 A;  3W7X A;  2FXS A;  3HHU A;  2YEF A;  1YES A;  2ZXW C;  1OCC B;  2JK5 C;  1E1Q G;  3MHS C;  4HZ5 A;  2HVK C;  4V26 A;  2BZ5 A;  2XCM A;  1BHA A;  2Q8H A;  3ZN0 A;  4MVZ A;  1GM9 A;  4GQT A;  2EIM B;  2Y69 C;  4U7O A;  1QLN A;  2F43 G;  4EGK A;  3EHH A;  2XAF A;  4U7N A;  1H8E G;  2HG1 A;  1H7S A;  5LHI A;  3EHB B;  2BYH A;  4JAS A;  1JOY A;  2XX4 A;  4XCJ A;  4L91 A;  2EIN C;  3D3I A;  3ABL C;  1AI6 A;  4P30 A;  2O1W A;  5KA6 A;  2AHZ A;  4ASG A;  3K97 A;  5GGZ A;  4PDV A;  2Q67 A;  1GKZ A;  4WCE V;  4WFG A;  2YE2 A;  2EIJ C;  2JEX A;  2Z3Y A;  2QKS A;  1VQ8 V;  2BU5 A;  3CME V;  4MVO A;  2YI6 A;  1GK9 A;  3IED A;  3O0I A;  1G8M A;  1YJW V;  2DWD C;  4AWQ A;  4QE9 A;  2XAQ A;  1XL6 A;  4PA4 A;  2B1I A;  5IN9 A;  2GSM B;  3T1K A;  3SPG A;  1S77 D;  5F5R A;  3ZXO A;  1OHH G;  1YSZ A;  2NNU A;  3CCV V;  1L0O A;  4CWQ A;  5IDJ A;  1OSF A;  4R8C A;  3WFV A;  2JJC A;  1GTO A;  2XHX A;  2H8M A;  3ZRV A;  4XKO A;  1KP3 A;  1NR1 A;  3X2Q C;  2XDK A;  3U2D A;  1LNQ A;  4XBF A;  4DZY A;  4GCZ A;  1P7B A;  3ZKB A;  4FIP C;  5FND A;  4MW3 A;  1K92 A;  4JAU A;  3R4O A;  2BSM A;  3PEH A;  2HVJ C;  4L87 A;  4QPJ A;  1R3K C;  4RAI A;  1FXK C;  5H6Q A;  5B1N A;  2IOP A;  1B3Q A;  2D3O W;  2IJI A;  3OM3 B;  2Q8F A;  3OUS A;  4WFF A;  1JQ0 A;  1Q81 W;  1B62 A;  1Z5B A;  3RW0 A;  3IGA C;  1QR8 A;  1PNK A;  1YT0 A;  3OR7 C;  1RM1 B;  3ABK C;  3CGZ A;  4MP2 A;  3MNR P;  5M4H A;  1R3I C;  4R50 A;  3B28 A;  4MTX A;  1M56 C;  3CCR V;  3TTZ A;  3CGY A;  4LWG A;  5M4P A;  4JAV A;  4XIP A;  5B1A B;  1H2G A;  2BRE A;  1AJN A;  3CCS V;  3K79 A;  3SYC A;  3CCM V;  1PNM A;  4HAM A;  1JX9 A;  2XND G;  1TBW A;  3OMU A;  4QNH B;  5HFM A;  4PL9 A;  4FPP A;  1K4C C;  1F23 A;  2Q8I A;  3CRK A;  4G28 B;  1ARO P;  2UXX A;  2YEB A;  1UYE A;  2WI3 A;  3FV5 A;  4GT8 A;  5H6R A;  3LSS A;  1PKX A;  4LPB A;  1K73 W;  4O04 A;  1CPY A;  3E8H A;  2QM7 A;  4AWP A;  4I9W A;  2JEU A;  2YJW A;  3A0W A;  1H8H G;  4N21 A;  3H4L A;  2IU0 A;  4PDM A;  5L3D A;  4RQE A;  3CCJ V;  1VQ7 V;  2VCJ A;  3OWD A;  1DF4 A;  1P4R A;  4DO2 A;  3CP1 A;  4KQV A;  5D6P A;  3JD4 A;  3T0Z A;  3K0G A;  1EA6 A;  4ZKI A;  3Q5K A;  1MAB G;  4GX0 A;  3EKO A;  1EZJ A;  3EHG A;  4ASA A;  2H94 A;  2YKI A;  1KIJ A;  3E8F A;  4O09 A;  1KP2 A;  1Z5A A;  4P9P A;  3CRL A;  2V7Q G;  2IOR A;  4O07 A;  2X6A A;  5M4K A;  4KP4 A;  2Q6A A;  1THN A;  3T4Z A;  2YI7 A;  2XJG A;  1B6Q A;  1TIL A;  4XKK A;  5CBH A;  2DYS B;  2P67 A;  2YKC A;  1MU5 A;  3QO8 A;  3B27 A;  3IC7 A;  4QPK A;  3T2S A;  4JYC A;  2A9H A;  4I5S A;  2WI1 A;  1G4Y B;  3F5W C;  5EC1 C;  2P6J A;  4BQG A;  2JIZ G;  4WUD A;  4P2Z A;  3DGE A;  4CE3 A;  3K3W A;  2YE3 A;  4ZVI A;  1V54 C;  3K98 A;  2EBO A;  3AG2 C;  3OUF A;  1VQP V;  2YJX A;  1NVP D;  4H33 A;  4F4L A;  2BOC C;  1NHH A;  5CF0 A;  2JJ1 G;  2O1V A;  4BAY A;  3FKS G;  2CG9 A;  1K97 A;  4DXW A;  1UY6 A;  1GO3 F;  4JPR A;  2YE6 A;  5IY5 B;  3GWO A;  1OCZ B;  2EIK B;  4CWR A;  3OPD A;  3ZN1 A;  3OW6 A;  4H7Q A;  3JD1 A;  2ZBK B;  1B63 A;  3D36 A;  4K4O A;  1GJV A;  1SRY A;  4HY6 A;  4J9Z B;  1QR9 A;  2BOB C;  3W7U A;  1I5B A;  1GM7 A;  3AG4 B;  3LSQ A;  2YKB A;  2ZR2 A;  2YKE A;  3CCL V;  2X0L A;  4XC0 A;  2XDS A;  2IJK A;  1AM1 A;  4PRV A;  1FFT B;  2YSU B;  1GMG A;  3B24 A;  2WAM A;  4WF9 V;  1UY8 A;  2K5B A;  4MTF A;  2YGF A;  1ZWH A;  4MSW C;  1UYG A;  4XKA A;  1M9N A;  3LPS A;  1OCC C;  2XAG A;  5LGN A;  1EBO A;  1GKF A;  2FWY A;  1GKX A;  4ASB A;  1Y4S A;  2WLJ A;  3ZCC A;  1NVP B;  4MVM A;  1S5H C;  5KA5 A;  2EIM C;  3K06 A;  4LWE A;  4MBC A;  2H8P C;  3CC4 V;  4EEH A;  3AG1 B;  2UWD A;  1TID A;  3LDC A;  2MK3 A;  1K9M W;  1VQO V;  4ZBM A;  2QTO A;  4H85 A;  4GEE A;  4X9L A;  4JGS A;  1YC1 A;  3BEH A;  1Q86 W;  1HWY A;  4G27 B;  4AS9 A;  2IH3 C;  1YT1 A;  1BXD A;  3ZMT A;  4TT3 G;  2W6J G;  4YKW A;  3ABU A;  4R7C A;  2P7T C;  5J9P C;  2GFD A;  2HR3 A;  2YE4 A;  1J95 A;  2QA4 V;  5BOD A;  1ZXN A;  2CK3 G;  2IOQ A;  3QO5 A;  5CBF A;  1SET A;  4L90 A;  3U2K A;  5L3J A;  2QEX V;  2ZDI A;  2WLL B;  3SYO A;  2Q8G A;  5EBM C;  1VQ6 V;  1K8A W;  2IU3 A;  1KQS U;  1UYC A;  5F3K A;  2R9R B;  3OMI B;  1VQK V;  1YSC A;  3ZMV A;  5EBL C;  1BYQ A;  1NR7 A;  2BU7 A;  1A4H A;  3LDE A;  5D6Q A;  3CC2 V;  4JTD B;  3R4N A;  1VQN V;  3T0H A;  4NH8 A;  4QIW F;  5B3S B;  3VHD A;  4JQL A;  2JKI A;  2XAJ A;  4I3H A;  3O6O A;  2HKJ A;  4O0B A;  4CWS A;  4AWO A;  1DTO A;  1BHB A;  2OCC B;  4FCR A;  1JJ2 U;  2QG0 A;  1YC3 A;  5CMU A;  3E86 A;  2XDU A;  4HYM A;  2BT0 A;  2DYR C;  4GX2 A;  2WEP A;  2Y69 B;  3INW A;  4LCU C;  5IYD O;  3A0T A;  2XX2 A;  1YS3 A;  2OTJ V;  1RM1 C;  3GIG B;  2YKJ A;  4WFH A;  4HXZ A;  5KUK A;  4TSF G;  1EI1 A;  4WUB A;  2EJR A;  3OMA B;  3B26 A;  2YEA A;  2YE8 A;  2IH1 C;  3ZMS A;  2EIN B;  4YKT A;  3ABL B;  3ETE A;  3CCU V;  1H38 A;  3G4S V;  1GM8 A;  3E2E A;  1UJW B;  3A0Z A;  3JD2 A;  1UYM A;  2YED A;  3F7V C;  4XCL A;  2B5U A;  1UYL A;  2YI0 A;  4NH9 A;  4RUF A;  1NHJ A;  2QG2 A;  4UVB A;  1YHQ V;  4FK5 C;  2P90 A;  1AI4 A;  3ML0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...