4U7NA

Inactive structure of histidine kinase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
225
structure length
211
Chain Sequence
VSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histidine protein kinase sensor protein
publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum
total genus 69
structure length 211
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4u7nA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4u7nA02
3ZRXA 4MPEA 2FYPA 5J6AA 2Q2EB 1AH8A 4LC1A 1UYCA 5GGZA 4ZKIA 2HKJA 1I5AA 4URLA 1JOYA 4R3MA 5L3JA 2H55A 1YT0A 4QPKA 3ZXQA 3RLQA 3HYZA 4XKKA 4FPPA 1Z59A 1UYGA 2C2AA 5F5RA 3Q5JA 1UYIA 4FCQA 2YK9A 2JJCA 2FWZA 2YE9A 2BT0A 2YE3A 1TILA 2YEBA 4O09A 3T10A 1L0OA 4YKZA 3KE6A 3R4MA 4Q20A 1UYDA 4JAVA 4BIZA 1PVGA 1UYHA 2YGFA 3ZXOA 4CE1A 2YI7A 2BU2A 1YT1A 1OSFA 4LPBA 5CF0A 5M4EA 3A0ZA 1GJVA 2YE6A 4B6CA 4GFNA 4LWFA 5M4HA 2XK2A 1YSZA 5CTXA 2YEAA 4KP4A 4LWIA 1A4HA 2QF6A 3R4PA 4FCPA 4GGLA 3K98A 3GIGA 3ZRWB 2IWSA 1MU5A 4O05A 4XD8A 2XD6A 1Z5CA 2YE7A 2CCUA 4XKOA 2YEIA 4L90A 4AWQA 1TC0A 2CH4A 4MTXA 2QFOA 4CWNA 4CWQA 2XHXA 4GQTA 1Y4UA 4L91A 4KQVA 3RLPA 4EGIA 3B25A 5IN9A 4XITA 4DUHA 2YKBA 2BU8A 2GQPA 2VW5A 3EHFA 3EHGA 3ZRVA 4HY6A 4BIUA 4U7NA 4LWHA 3TZ0A 3NXSA 4AWPA 2BZ5A 4JYBA 1TC6A 4MPNA 1UY7A 3CWVA 3A0XA 2YK2A 5D6QA 4HXWA 1YSRA 4B7PA 4URMA 1QZRA 3OW6A 3VHAA 2WI3A 1UYEA 3VADA 3TK1A 1I5BA 2LFRA 1ZXNA 4E02A 1R62A 5IDMA 3TZ2A 3U2DA 4NH7A 4PL9A 2XDXA 3C11A 2WI4A 1B62A 3H4LA 4CE3A 1IXMA 2E0AA 3Q5LA 1MX0A 4MPCA 3ZKBA 2YI5A 3ZRWA 1AJ6A 4LP0A 2YJWA 3PEJA 2H8MA 3INWA 4DZYA 4YKYA 4CE2A 1ZW9A 2BU5A 1YT2A 4BQGA 2GFDA 3EKOA 2FWYA 2O1UA 3BMYA 4JYCA 4EM7A 3PEHA 3FT8A 1Y8OA 3D36A 3CRKA 3O6OA 2XDUA 4PRXA 4HXZA 4WUCA 3HHUA 5BOCA 2HG1A 1UYFA 2WEQA 4MOTA 5CTYA 4QPJA 2ZDXA 4P8OA 1QY8A 1UYLA 3D0BA 1NHJA 3C0EA 5FNCA 2QM8A 1UY6A 2YKEA 3ZM7A 3IEDA 5B1OA 4YKRA 5FNDA 1THNA 4URNA 4CWFA 4MT8A 2YE4A 4P7AA 3RKZA 1B63A 4V26A 2YGEA 2YEFA 2WI5A 1YESA 2YEDA 3T2SA 5FNFA 3OWBA 1BXDA 3D2RA 2IORA 4MBCA 2CCSA 1NHIA 2BU7A 5M4MA 4U93A 2ZKJA 5D7RA 3DGEA 4JASA 4L94A 2K5BA 2WEPA 1YC3A 3MD0A 2BSMA 3HEKA 4KSHA 2UWDA 4KFGA 1Z5AA 3G7BA 4MP7A 2Q8FA 3P32A 1S14A 3TTZA 3VHDA 3K60A 3TZ5A 4AS9A 4O04A 3A0YA 3SL2A 4CWOA 1I58A 4I3HA 1ZXMA 3CGZA 4I5SA 4JAUA 1YS3A 3QTFA 2YECA 4FCRA 3B26A 3LNUA 4CWPA 1TIDA 2YKJA 3T1KA 4BAEA 5CTUA 2XX2A 4XCJA 2XDSA 2LFSA 3R4NA 2JKIA 4L93A 5CPHA 4EEHA 4ASGA 3O0IA 2WERA 3QDDA 4PRVA 2CGFA 3T0HA 4HZ5A 2Q8IA 1GKZA 3TZ4A 3OMUA 3ZCCA 3G7EA 5CTWA 2ZBKB 4MB9A 1Z5BA 4YKWA 3EKRA 3EHHA 1JM6A 1U0ZA 2EXLA 1YETA 3HYYA 2IOQA 4XC0A 4AWOA 3K97A 3INXA 2IOPA 4W7TA 4K4OA 2WI7A 1I5DA 3GIEA 2VCJA 2ESAA 5D7CA 4O0BA 3ZKDA 1AH6A 2YE5A 4KTNA 2WI1A 4GT8A 4EFUA 3HZ5A 1Y8PA 4YKTA 3A0WA 3GIGB 1U2OA 1YC1A 2IWXA 3CRLA 2WWWA 5D7DA 4ASBA 1I5CA 4H85A 3FV5A 4U7OA 5BODA 3BM9A 2BREA 4HY1A 4ASAA 2XABA 2XJGA 3OWDA 2XJJA 1QYEA 4LWEA 4GT1A 4LWGA 1UYKA 1YC4A 5M4PA 3U67A 3H80A 1I59A 2XDKA 3B27A 5M4KA 2YE8A 3EHJA 2XHRA 3A0TA 3G75A 3VHCA 4E01A 4ZVIA 4YKQA 4XDMA 4XIPA 2ZDYA 4H7QA 2YEJA 1EI1A 3R92A 4BXIA 2Q8HA 2XHTA 5IDJA 4EGHA 4X9LA 4XCLA 2HCHA 4V25A 3R4OA 1UY8A 2YE2A 1KZNA 4YKUA 4CWRA 2WI2A 3JZ3A 2BU6A 4UROA 5C93A 5F3KA 4XTJA 4ASFA 2BTZA 5D6PA 1TBWA 4GEEA 1Y4SA 4HZ0A 2YJXA 4NH8A 4H81A 2FXSA 2XDLA 4HYPA 1TH8A 1AM1A 1YERA 2QG0A 1B3QA 4MP2A 2BYIA 2XX5A 2PNRA 4YKXA 1S16A 4PU9A 2BRCA 2CG9A 2XX4A 3Q5KA 4WUBA 1KIJA 3CGYA 4CWTA 2YI0A 2YI6A 1UY9A 3B24A 1BGQA 3T0ZA 4XE2A 4GCZA 4EMVA 2IWUA 1ID0A 4FMTA 2O1WA 2XCMA 3LPSA 4XIQA 4JQLA 4R1FA 2YEGA 3OPDA 1NHHA 4KSGA 3A0RA 2WI6A 3O2FA 1GKXA 2CCTA 4L8ZA 2QM7A 3WHAA 4E00A 1ZWHA 4HYMA 5FWKA 2XJXA 3HZ1A 4WUDA 4R3AA 4BQJA 2Q8GA 5B1NA 2VWCA 1AMWA 5M4NA 1F51A 2BYHA 3K99A 3TUHA 2FTKA 2P67A 2O1VA 4O07A 4XIRA 3R91A 2YEHA 1US7A 4XKAA 2YEEA 2YKCA 1UYMA 3MNRP 3FT5A 2YGAA 4EGKA 3U2KA 1H7UA 1H7SA 2AKPA 3B28A 5J71A 3NMQA 2VCIA 1BKNA 3WQ9A 3RLRA 4EFTA 1EA6A 2QG2A 1Y8NA 4CWSA 3GIFA 1BYQA 4NH9A 2YKIA
chains in the Genus database with same CATH superfamily
3ZRXA 2CTQA 4PDVA 1SF9A 5GONA 2Y0IA 5GGZA 5JH7B 2UUCB 4RQFA 1NKDA 4J7JA 1SETA 1R1BA 4GX1A 5KA5A 3H1LH 4QPKA 3ML0A 1JCHA 3WU2Z 2CH7B 3RLQA 4FLZA 3HYZA 2ILMA 4EKWA 2C2AA 3OEEG 2IJIA 3ZHTA 4FCQA 1S5JA 4LF6O 2YE9A 2YE3A 4TT3G 1B04A 2UUAB 1Y74A 2AHYA 1GK9A 4BIZA 4JI8O 1D5NA 2YI7A 4PA6A 2BU2A 1MZEA 5IY5B 4JI5B 2DOSA 3JATA 5M4EA 2BSKB 4UCUA 1F4MA 3JD1A 4ZOLA 4X8AA 4G28B 4XDKA 4WBNA 5LA6A 1YI2V 4GFNA 5M4HA 4HZ3A 2EIMC 1AILA 3ZHUA 5B1AC 3QF7A 4LNUA 3CCLV 1A4HA 1K4CC 2AW9A 4K8XA 3WG7C 3HKEA 3R4PA 2LW7A 4FCPA 4AI8A 1G6UA 1JJOA 3B8MA 2ZDIA 2DMXA 3GIGA 2ZIMA 4O05A 1NZ6A 1H2NA 4PA4A 1PPJH 3SYQA 2F23A 3E2EA 2IJHA 2YEIA 1Q81W 3K3WA 4KXRA 4J7KA 1EZVH 4E2LA 2IH3C 2Q0OC 4MTXA 1LUVA 2XHXA 3G80A 4XDJA 4L91A 4KQVA 3B25A 3CMEV 1K8AW 4DR1B 4DUHA 1FFXA 2CH7A 4R7CA 2GQPA 5D5QA 2VW5A 1RSOA 2IM9A 3EHGA 3ZRVA 3FYIB 3ETDA 4HY6A 4BIUA 4I9WA 3H9VA 4LWHA 3TZ0A 4W4LA 2BZ5A 3J81N 1AR1B 4MPNA 2QGNA 5EYPB 2ZXWC 1XMOB 3A0XA 5FPRA 3K5NA 4FZ1A 4JI4B 2HVKC 1YF2A 1F4NA 2VQEB 4B7PA 3SYCA 1M9NA 1GKFA 2BSKA 4HYOA 2WI3A 3HKBA 3TK1A 1PNMA 3SR2C 1IXBA 4B3TB 5CB4B 1FD9A 1GMGA 4NH7A 3DTUB 4ZHQB 4YHHB 3ZKBA 4JI3O 1KYOF 1XL4A 4B3SB 2YJWA 3PEJA 2BTOA 3B2EE 1WPXA 4HNAB 4KUMA 4PELA 4YKYA 1N0NA 1XNRO 4TWKA 3ZMVA 5IYBO 4CH3A 1Z5WA 4OX9O 2BU5A 2GBOA 3ZRSA 1YT2A 1HDJA 4X66B 2O1UA 3BMYA 4TQDA 3DC6A 4EM7A 3FT8A 2JRIA 1Z5VA 3CWBH 2WAMA 3KCYA 3O6OA 3STLC 1DGSA 3AK1A 2EIKC 2H94A 4K0KB 2LJ2A 2HKOA 2WA3A 4TV8A 1UYFA 4G27B 3VBBA 4NTYA 2ZDXA 1QY8A 1ZSPA 4ASUG 4JZGA 5FNCA 4MTOA 2R70A 1UY6A 2RN9A 2XASA 4DV4B 4FM0A 3ZM7A 4PDRA 5HFMA 2FL4A 3JYCA 1THNA 4URNA 1Q86W 2LGWA 2R9RB 1W2BU 3DC5A 4B7EA 3JSNA 1H38A 4CWFA 4X20B 4X89A 3THOA 4PJ0Z 1FFTB 2HEPA 2DWEC 2YEFA 2QR4A 5CB4A 5JWPA 2YEDA 1YSCA 1NU1H 4IIJB 4NVPA 3UT5B 4ZHQA 3D2RA 1OCCC 2WLNA 4WFAV 1H2SB 5JJJB 4MBCA 4O4HB 4DR6B 2CCSA 2ODMA 1NHIA 2BU7A 1QR8A 2XAFA 4HNAA 5L3EA 3DGEA 2UUBB 2ZT9B 4JI2B 1XREA 1F7YA 1ZX3A 2NN4A 1Z5AA 4MS2A 4MP7A 2Q8FA 2CE4A 3CJHA 3TTZA 1AVMA 1AR5A 1N33B 4BW9A 1E79G 3A2FA 2NR5A 3OAAG 4O04A 3A0YA 3SL2A 3QTCA 3VOUA 2EIMB 4I3HA 3RW0A 3CGZA 4X65O 1M56C 5B1AB 3ZEDA 1G4YB 3WG7B 1HR0B 5BR8O 2P4VA 3B26A 4UB8Z 1ZWIC 3T4DA 3FX7A 4JTCB 4XCJA 4FFKA 4DR4O 2Q8VA 2XUMA 3JD2A 3R4NA 4X20A 2ARHA 2VRZA 4EEHA 4TQFA 2N74A 3T0HA 3TZ4A 3GWKC 4U3JB 4Z2WA 3TJTA 2ZBKB 5LHGA 1Z5BA 1TAEA 1U0ZA 3UT5A 2ZE6A 4CH6A 1S5HC 2D3OW 3HYYA 4LFAB 2IOQA 3N2GB 3JD3A 5LL6Y 2KG7A 4K4OA 2GSMB 1BE3H 3FAVA 4NXMB 1YIJV 2ESAA 1L0LH 2ADPA 4JV5O 4J80A 4KTNA 4JPRA 1W0JG 4JI1O 3SJBC 5EZYB 3CCVV 4WFHA 2HHHO 3ZS8C 1Y8PA 4YKTA 3QVNA 1W59A 2IWXA 3AK2A 3NR7A 4O2BB 3SYAA 4BR6A 5LP6C 4ASBA 2JK5C 3OT7A 3FV5A 4LF9B 4U7OA 2QTSA 4HY1A 3ZHQA 2XABA 3LUTB 2HHIA 3OWDA 3C90A 1IZ3A 2Z5UA 2ZIOA 5JVDA 1UYKA 1YC4A 1IVSA 4O2AB 5CA3A 3ZN0A 3H80A 1I59A 3OMAB 3EHBB 2KQXA 2XDKA 5BMVB 3B27A 4PDMA 2R72A 4LF8O 5BXZA 4YKQA 4RAIA 2PZSA 2P22C 3ASOC 4GKKB 5AG2A 3B8NA 2ZDYA 4BXIA 1EI1A 3R92A 2UUCO 3CCQV 2Q8HA 2XHTA 4R8CA 1RPRA 3LNMB 3BPZA 3HKCB 2YE2A 4IT5A 2WSSG 1BL8A 3N2GA 4UCOA 2YEVB 3TETA 3JZ3A 2EIKB 1EN5A 2UXCB 5CBGA 2NLJC 4EFEA 4F6RB 3AG4C 2DN9A 3CXCU 4R6ZA 2RDCA 4H81A 1Q6IA 2UUAO 1GN4A 2F4VB 3H1KH 1RM1C 3TXQA 5CA1B 1AM1A 2QG0A 4LWSB 3JASB 2BYIA 4P30A 2WLHA 4JI5O 1EFRG 1R6TA 1D2DA 5IT9N 4Z1MG 2IBZH 2ZE5A 3C3TA 2CDYA 5LHIA 2UXBB 1MSWD 3L71H 3WFVA 4FFBB 3CP1A 2JDIG 4GCZA 3G6EV 4R50A 2IWUA 1ID0A 2O1WA 1XL6A 2XCMA 3OUSA 2YEGA 4O2AA 1OCCB 2GDSA 1NHHA 3K58A 5E79Z 3O65A 1GKXA 1E1QG 2CCTA 4L8ZA 4ICGA 1MABG 4W4KA 1ZWHA 1SC5B 2KKWA 4I4TA 2QTOA 5C8YB 3HZ1A 3IJ4A 5B1BC 1AROP 4UVAA 2P4KA 2VWCA 2HR3A 5LOVB 3F7VC 2QA4V 2P5OA 1J95A 2IJKA 1I94B 1ZLZA 4O07A 3C3SA 5FNVB 3R91A 4XKAA 1UYMA 4ZI7B 1PNLA 2NNUA 4F6RA 3MNRP 5B66Z 1KB9F 2YGAA 4EGKA 2E5LB 1M56B 3H01A 4TUYA 3B28A 3K0GA 5J71A 1V54C 1AP5A 4YIPA 5CA1A 5GTIZ 2VCIA 3S5TA 4LWSA 3JASA 2QG2A 2VQEO 4FLXA 2Q5ZA 3GIFA 2UXXA 1VQ7V 4NH9A 1SQBH 4PI0A 1SZXA 4UXNA 2YSUB 1BS3A 1SZTA 2PGGA 1UYCA 4FFBA 3UM7A 5KHGA 4LF4B 2GTSA 4URLA 1NI8A 1JOYA 3F5WC 4B3TO 4B3RB 2H55A 4FLTA 1WLEA 1LUWA 5KHKA 1GH6A 1H2KA 3UCSC 3GWOA 4CC5A 4XKKA 4YHHO 4D6TH 2DYRC 3H1JH 1Z59A 1IBMO 1JFFB 3Q5JA 2E3CA 4UUJC 4DR3B 4Z1VA 4J9ZB 2PI5A 1Y6XA 4O09A 2YEBA 3T10A 2XAQA 1L0OA 3PJSK 3KE6A 5C8YA 2A7WA 1PVGA 4CE1A 3LSUA 3RT3C 1RFYA 2DQ3A 1YT1A 1OV9A 2QKCA 5K1PA 5CF0A 1VQPV 4H33A 1T5EA 2HP8A 2YE6A 1GM8A 4KFMA 2ZKOA 2L6LA 1AI7A 4K0KO 4B6CA 1HP8A 5EBWC 2XK2A 5LP6B 4I55B 1YSZA 2DYSC 5CTXA 3U11A 3S3XA 4ZI7A 3MAQA 4FZ0A 4KP4A 1VQKV 3Q4HB 3E89A 1HNWB 1TUBB 3OFNG 4MSWC 4PD4F 3W7TA 1K73W 1NJIW 3EFFK 1IBLO 4DV4O 3ZRWB 2IWSA 2PUSA 4LF7B 2YE7A 5K1XA 1Q82W 2CCUA 4X88A 4L90A 3CRRA 3K9AA 3RWRD 3ASOB 2Y4TA 2UU9O 2V1DA 2JS5A 2QEXV 1XNQO 4OPAA 1TC0A 4CWNA 4CWQA 4I0XB 3BHPA 1QR9A 4EEQA 4XITA 1BCCH 2WLJA 1QHTA 4GX5A 2YKBA 1Q3EA 1Q8IA 2Q7HA 4YY3B 1MSDA 4DR6O 1RPOA 1H8EG 2BTQB 4FLYA 4DR5O 4LBEC 4DK0A 3AG4B 1X59A 3N2KB 2UUBO 4B3MB 4AQYB 3O9OA 1UY7A 3CPWU 1QU7A 4JI2O 5D6QA 5H6RA 1RM1B 4X64B 5LXTB 4ZIBA 1PNKA 1SESA 4URMA 1QZRA 3OW6A 2JJ1G 1M57C 5L3FA 4PA3A 4P2ZA 3LDDA 4DUYB 3OE7G 1UYEA 4E4EA 4LH7A 4WFEA 1QQCA 1I5BA 2JVDA 2ZINA 5LP6A 4I55A 4LFBO 3E8BA 1MZFA 3Q4HA 5IDMA 3CE2A 4CBCA 1KQSU 1TUBA 3JAWB 3U2DA 3H4LA 4CE3A 2W6JG 1IXMA 3Q5LA 1KMIZ 1MX0A 3ZRWA 4JTDB 4P9PA 3RYIB 2WLMA 1WP7A 3L9DA 4DZYA 2GV9A 1HNXB 5B3SC 2JEXA 1EZJA 5B1BB 4NTXA 1N4CA 4DRXB 1OCZC 1Y8OA 3RYCA 3E8FA 3SPCA 3CC4V 3I5DA 4LFAO 1COWG 1WPBA 3ETQA 2YXHA 3M7MX 3HHUA 4O4IB 2HG1A 2BTQA 1QCEA 4NXMO 5CTYA 1URFA 4QPJA 4NTWA 4P8OA 1NTMH 3N2KA 1UYLA 1CP9A 3TXSA 2B9ZA 2IU0A 3D0BA 1NHJA 2HFEC 3CC7V 4X1YB 1V54B 3VQVA 5LMUB 2YKEA 1US6A 2CK3G 3IEDA 5B1OA 1UJWB 4YKRA 5FNDA 1VP7A 5LYJB 4MT8A 4OPHA 2ZNIA 3BY6A 3R65A 3W7XA 4LF9O 4LFCB 1GAXA 1DK1A 4DV2B 3D8CA 3JAWA 3CD6V 3OWBA 1I08A 3U0ZA 3CX5F 3D36C 5IWAB 1NTKH 2OT5A 2OWOA 3CRCA 4O4JB 1KU9A 3AEIA 5FLXN 3W7SA 3L72H 5JH7A 4GKKO 2BSMA 1SQFA 2PY5A 4G2KA 1FXVA 2IU3A 3G7BA 5EK0A 5L3BA 3P32A 2LP7A 3JAKB 3K60A 4X1KB 1ROPA 2YIBA 3QNEA 3EXAA 2ITDC 5L3DA 1QVFU 2E75B 2Q73A 4O4IA 4CWOA 2DYSB 1I58A 1X4TA 2L35A 2P06A 3K04A 4JAUA 4RWUA 1YS3A 3ABMC 2YECA 2QWQB 3ZBHA 4FCRA 3E8HA 1V9PA 3AK3A 2F4VO 4CWPA 3JCUZ 1TIDA 2PYLA 2EINB 1SQPH 5CTUA 2XX2A 4WFFA 2LFSA 5KMGB 1P7BA 2C1GA 4L93A 2HLDG 5CPHA 4ASGA 3QDDA 4BW5A 2UXBO 2CGFA 1THZA 3OMUA 5CTWA 3ABKC 4UVCA 4JYAB 3BABA 4YKWA 3EHHA 3BA9A 4B08A 1IBKB 1UFIA 1ZTEA 1Q6HA 2Q7GA 5KX5B 4AWOA 3FFQA 3INXA 3B09A 2IOPA 2XOKG 2F43G 1I5DA 1YHQV 3ZKDA 4O0BA 1DLBA 3RFRA 3BFRA 1CXZB 3KZIZ 1Y76B 4TOIA 1GN2A 2MK3A 1BHAA 3SDLA 3K5MA 1KC8W 2YI9A 1JVMA 1NS1A 1U2OA 1M57B 3KCXA 4PI2A 3CB2A 1XMQB 2WWWA 4MTFA 1I94O 2YUAA 4I50B 4LH6A 3ABLC 4ASAA 5H5NA 3T2MA 4DYLA 5EYPA 1Q7YW 3J7AU 2E5LO 2XJJA 3RVYA 1QYEA 5EC1C 4GT1A 4J42A 4LWGA 3OUFA 5M4PA 3VQWA 2XT9A 3LDEA 3E22B 2XHRA 3A0TA 2A79B 3G75A 2JS3A 2JEUA 2QM4A 5KMGA 2R9IA 4CH5A 4DV5B 1N36B 3DSQA 4JI6B 4H7QA 2W6IG 1JQ0A 2YDEA 4LF4O 2W0FC 5JJEB 5B3SB 3H1IH 5JQGB 2EBOA 4LF5O 4X9LA 4WFBV 2QKAA 3I55V 2HCHA 1OCZB 4V25A 1R6NA 4LR3A 1UY8A 2AZ2A 4AHCA 1AJPA 5KX5A 4CWRA 3RN4A 2WLIB 5CBFA 1VF6C 3K06A 4GKJB 4XTJA 4ASFA 4DR3O 3FB7C 1TBWA 1U96A 4NH8A 3SPJA 2ZM6B 1QNMA 1AI5A 5LGTA 1B3QA 1VMGA 3LSQA 3J80N 2XX5A 1J5EB 4YKXA 2WLKA 2BRCA 2XX4A 3Q5KA 1XDCA 1YZBA 2B1IA 4I7ZB 1KBHA 4I50A 3SPGA 1UY9A 3T0ZA 4UV8A 4FMTA 3ZJZA 3ZMZA 5TISZ 1R6KA 1S3JA 4PA7A 4CS3A 3RVZA 1O9GA 3ZN1A 4KSGA 3A0RA 2OCCC 3ZHSA 2QM7A 1FJGB 5H2FZ 3CCEV 1K9MW 4WUDA 4BQJA 5JCOC 5JQGA 2JGDB 1KECA 2EZOA 2M7WA 2WA4A 3T1CA 4IIJA 1F51A 4JI0B 4OGQB 4O4HA 4LP8A 2FTKA 3LNNA 3T4ZA 4YY3O 2P67A 2WLIA 2CTRA 2P90A 2Q4PA 3WB1A 1H2GA 3K5OA 2ADQB 3L74H 1H8HG 1PM9A 3CCUV 2E76B 4KHPB 2ZXWB 1YJ9V 4B3MO 1H7UA 3ABMB 2RMKB 3IGAC 3SJAC 4QE7A 1BYQA 3EVKA 4UROA 4MPEA 2KSDA 1AH8A 4LC1A 1FAFA 1I5AA 1SQGA 5IYZB 4JI8B 4D7SA 1LR1A 5L3JA 3ABKB 5JENA 2FYUH 3IC9A 1K7DA 3ZXQA 4MW3A 4C7UA 4FPPA 1GO3F 3MHSC 5F5RA 2IW5A 1M93A 2Q69A 4WCEV 2YK9A 3IFXA 2FWZA 2MW2B 3E8GA 1DF5A 1TILA 4GX2A 1HNXO 3OTFA 2N05A 2OYQA 2YXLA 3R4MA 4DUZB 4U3JA 4JAVA 2YGFA 1AR4A 1I7FA 2JGDA 3ZXOA 3P3PA 4DO2A 5BZBA 1A32A 2OIEA 1OSFA 1MA1A 2Y48A 4LPBA 3RBZA 1GJVA 3A0ZA 3OD4A 1OZ0A 1M90W 4QIWF 4LWFA 4J9YB 2YEAA 2A3QA 3P3NA 3ABLB 4LWIA 4HBNA 3CRQA 3CRAA 5EZYA 4GGLA 3OR7C 2RCVA 3APQA 3K98A 5KAIZ 1VQNV 3B77A 2F93B 4XD8A 1G1XB 4O2BA 3AG1C 2YXYA 4XKOA 4E72A 3B4SA 4QJFB 2QJ1A 5IYZA 4GQTA 1Y4UA 3HB3B 4LFCO 2RNBA 5IN9A 3VQYA 4H13B 4RUFA 4O4LB 1L8DA 5IWAO 4IGGA 5BMVA 1WP8A 3EHFA 1FKAO 3ETEA 2F95B 2Q67A 2EX3A 4DV7B 2Q0AA 1QLNA 4AWPA 4JYBA 3STZC 1B06A 2BE3A 5H6QA 1GN6A 1WA8B 1SS3A 1OCOC 4EB6B 1ZL8B 1TA8A 3ASNC 4FLVA 3ZMTA 1N0JA 3HKCA 4J41A 4DR1O 3L70H 4H0LB 5BY1A 2X7RB 2YEVA 5LHHA 2PYJA 2BCCH 2DW4A 1XNRB 3UQ8A 4P9OA 2XAHA 3LDCA 5LMNB 1ZXNA 1P4RA 2EULA 1R62A 5CBHA 1R73A 1SERA 4PHZA 3TZ2A 1XMOO 4PL9A 4CS4A 1B62A 2E0AA 3UO3A 4N23A 3SJQC 1ORQC 4MPCA 4JI4O 2YI5A 1F23A 1WN7A 2H8MA 4X1IB 5FPOA 2ZCEA 3INWA 3I56V 1SQQH 1VIBA 1ZW9A 5IYDO 2Q68A 4BQGA 2CGOA 3CSXA 3EKOA 2FWYA 2V7QG 3QO8A 1EM1A 1I0HA 1KKCA 3PEHA 4JYAO 3S3WA 3GB7C 1IBKO 3CRKA 4JI7B 4NXNB 1EN6A 4PRXA 4NYKA 4B3SO 4WUCA 3ZX6A 3KG2A 2RJZA 1VF6A 1NTZH 3SGIA 3ZMSA 4YJ2B 1WA8A 1QBZA 4X66O 4FVMA 4EB6A 5L3CA 1ZL8A 1N34B 1Y4MA 1YJNV 1SKVA 4IYIA 4QNHB 5LOVA 2P6JA 2QWNB 1XMQO 2YE4A 4P7AA 3FYEB 5FNVA 1PP9H 4MW8A 3OMNB 4V26A 2EILC 1BT8A 2F1MA 1YESA 5FNFA 1XI1A 2GUZB 1Y66A 3W7UA 3CMAV 3HKDB 4WFGA 3X2QC 5A9GA 1GTOA 1TVKB 2IORA 3A8TA 3ETGA 4A5UB 2ZKJA 5D7RA 4JASA 4L94A 2K5BA 2WEPA 3OR6C 1WB8A 1PD3A 2DJVA 4DV5O 1N36O 2G38A 1XHXA 3MD0A 4JI6O 1K5QA 3A0HZ 3HEKA 4KSHA 3ZIAG 3FB5C 2VS0A 1BGYH 1Q90D 2UXNA 3VHDA 2XNDG 3A0BZ 3VQXA 1N32B 3TZ5A 4AS9A 1JFFA 5KLVH 2WPDG 3CHXA 1EBOA 4X62B 1H2LA 3OTOB 4I5SA 4GKJO 4BAYA 4CZZA 4EFBA 3QTFA 3CCJV 4UFZA 1PKXA 3BRCA 3LNUA 2YC0A 3P30A 3T1KA 1RP3B 2ZQMA 1W0KG 1J5EO 1N33O 2BOCC 3AG1B 3N27A 2WERA 3JSLA 4JV5B 4PRVA 2ZD9A 1CEZA 2Q8IA 1Y74B 2AGAA 2A9HA 3ZCCA 3G7EA 1YITV 4MB9A 2AZ0A 2EXLA 1HR0O 3T1YB 3KKYA 1AJQA 1YETA 3JATB 1TVKA 4X9QA 1VQ4V 3K03A 4BWAA 4W7TA 2WI7A 5EIBD 2VCJA 2XAGA 5D7CA 1Q5OA 1VQ5V 1K97A 2XHBA 1AH6A 2YE5A 1GN3A 4I0XA 1OCOB 4GT8A 5LGNA 4MVRA 4DV6B 3IAYA 4QGPA 3ASNB 3A0WA 3GIGB 2LW1A 4JI0O 1O9HA 4RUEA 1FXKC 3CRLA 4K8ZA 4DR7B 1M4UA 1P49A 3K0DA 5D7DA 5EIBC 1I5CA 1VQ8V 4JF3A 3MDSA 5HFLA 4UCTA 5GTHZ 1XHZA 2BREA 3BM9A 2HJFC 4B7KA 4HAMA 4DV3B 1VF7A 4KHPO 1KP2A 4L8JA 5LXTA 2Y0PA 1FFXB 4UCRA 4NR1A 5M4KA 2YE8A 1YTFD 2Y69C 1RSOB 2VWJA 4GLXA 4XBFA 3VHCA 4E01A 4J11A 3BVOA 1KUQA 1FS0G 1WAZA 1IX9A 4XIPA 2QWOB 4QE9A 2YEJA 3SPHA 4GYCB 3ZMUA 2OTJV 3F7YC 4XCLA 4DR2B 4NB5A 3GVMA 4F4LA 1KZNA 1U97A 4YKUA 3RYIA 4DV1B 2DYRB 3HKBB 2BU6A 1NT2B 2BTZA 3CRMA 5EBMC 4MVMA 3APOA 4GX0A 2FXSA 1OHHG 4RQEA 2XDLA 4DUZO 4UV9A 4DRXA 3QO7A 3CEIA 2PNRA 2K1EA 5KHJA 3DXRB 1S16A 1JJ2U 1EN4A 4WUBA 3CGYA 2BOBC 2YI6A 2UXCO 3B24A 2HJDA 4XE2A 2Z3YA 2E74B 2EILB 1K5SA 3ZHVA 4J7ZA 4JQLA 3JD0A 5KHIA 3B40A 4X1YA 4K35A 1Z2GA 3AG2C 1XQ8A 1S0VA 1VQOV 3X2QB 3OPDA 5LBQA 2WI6A 3O2FA 2OIGA 2M6YA 5LYJA 1BZKA 4TV8B 4E00A 4HYMA 2AHZA 1KP3A 2ZE7A 2LQTA 2XJXA 3PN1A 5B1NA 5M4NA 5A2QN 1XEQA 1M1KW 3TUHA 4O4JA 1FXHA 3FKSG 2O1VA 5CMUA 5LGUA 1XUQA 5DM6V 4XIRA 4JGSA 1K4DC 2YEEA 2YKCA 4DV7O 3WB0A 3FT5A 1ZAUA 1DF4A 5KA6A 3U2KA 4PA9A 4FM1A 1H7SA 3JARB 4DW1A 4DW0A 1BKNA 3WQ9A 3JAKA 5EC2C 4N21A 4X1KA 4IYHA 1Q43A 2EJRA 2YICA 3DXRA 1IBMB 4CWSA 1UPGA 3U10A 1NVPD 2DWDC 1YVWA 2FYPA 1R3IC 3G6BA 5J6AA 2Q2EB 4U3FH 4AILC 2HG5C 3WB2A 5LMNO 5KAFZ 2ZR3A 4ZKIA 4TV9B 2HKJA 1VQ6V 4JZ2A 4R3MA 3RGBA 4H37A 1YT0A 4L87A 2CAZC 1DTOA 2LO1A 3ABUA 3CJHB 4UCVA 3CCRV 5JJNB 1B6QA 1HNZB 4MTGA 5F2VO 5KUMA 1UYGA 4MVSA 1UYIA 1VEWA 2JJCA 2ITCC 1LNQA 2QDOA 2JGUA 3QG5A 5H9CA 2BT0A 4YJ3B 2VQFB 1NQTA 4YKZA 2X0LA 4Q20A 1NBMG 1UYDA 1UYHA 3L73H 4B3RO 1G8MA 4FK5C 1YEWA 1K34A 1IBLB 1Y67A 4TSFG 4JI7O 1FXKB 4NXNO 5J2UB 2OTLV 5EBLC 2UU9B 4JAAA 1XNQB 5B5EZ 1P7GA 1Y76A 2QF6A 4DV0B 3JARA 2IJJA 1N34O 1I5YA 1BQZA 1MU5A 3JD4A 2KG7B 1AJNA 2Y69B 5GW7A 2XD6A 1Z5CA 4YXWG 3FAVB 4ABMA 2DE0X 4DR5B 1QLEC 4AWQA 2CH4A 4TV9A 2RQ6A 5J2TB 2QFOA 2FMLA 1P84F 2CTWA 3RLPA 1HNWO 3BEHA 4EGIA 1HW7A 1WNSA 3W7WA 1NR7A 2BU8A 4KL1A 1YTFB 2HVJC 3ABTA 3E22A 3T1HB 2X6BA 1JA8A 4BIOA 5FL7G 4U7NA 4LFBB 4LF7O 3NXSA 3G71V 3K59A 4YJ3A 1TC6A 3AG7A 3BA8A 3SYOA 3K5LA 3AG3C 1AI4A 2X6CA 3CWVA 5IJ0B 4GUNA 2GHYA 2UXDB 2YK2A 4HXWA 2EIJC 5JVDB 1YSRA 2FB5A 5IYCO 1N32O 3OGIB 3VHAA 5DN6G 3VADA 1KD1W 1FXKA 1BQ0A 4FM2A 1YXBA 4H44B 5J2UA 2F66C 2LFRA 4E02A 1NH2D 1GRJA 4X62O 2YS8A 3OTOO 4AQYO 3CXHF 2XDXA 3C11A 2WI4A 4F6EA 1SQXH 2KB1A 4X64O 1HWYA 3AG2B 1AJ6A 4LP0A 3D3QA 3CCMV 4DUYO 4UB6Z 4LF6B 2ATKC 5J9PC 1V55C 3E35A 4CE2A 1ZUQA 3ICXA 2Q7EA 2GFDA 5J2TA 2R9AA 5KHHA 4JYCA 3F5TA 3SPIA 1GM9A 4JYYA 1OJHA 3D36A 1S77D 3T1YO 2O57A 3OEHG 4I9QA 4FIPC 2XDUA 2JJ2G 4HXZA 3L75H 5BOCA 4RO2A 4NKGB 2WEQA 4MOTA 4FLWA 1ENVA 5IJ0A 3CCSV 3C0EA 5E1AC 2QM8A 2VWKA 3OMIB 4DV6O 2YIAA 1E1RG 4FLUA 3RKZA 4DR7O 3MHHC 1BSMA 1B63A 5CA0B 2YGEA 1MG1A 4I4TB 2WI5A 3OW2U 3T2SA 4DV3O 1H2MA 3BCCH 1BXDA 3JCZA 1NR1A 3LSSA 2QWRB 3K57A 5LMUO 2Q6AA 2PI4A 3R66A 4MVQA 1PL0A 5M4MA 2ETNA 4CS2A 4U93A 2QE7G 1CPYA 1NVPB 3FD9A 1YJWV 3K9SA 1VQLV 1YC3A 1VQMV 1FPOA 4TUYB 2UWDA 5KUKA 4J10A 4KFGA 1SA0B 5DECA 4DV2O 1S14A 1XOUA 2Y4UA 4DR2O 5CN0A 2AXTZ 3M99B 1IURA 3CC2V 4PDLA 4DV1O 1VARA 4IHJB 1S72V 1D5AA 4YIOA 1L0NH 1K92A 1ZXMA 3G67A 3JAMN 1JX9A 3BAAA 4K3AA 3K79A 2ZDIC 4JI3B 2YKJA 2YIBD 4BAEA 1OCRC 1MOFA 4PV1B 1PV0A 2XDSA 3RYFB 1AI6A 2JKIA 1R3KC 5ITZB 4OX9B 3O0IA 1QLEB 4MVZA 5CA0A 4HZ5A 2V4DA 1GKZA 1VF5B 2P7TC 4JTAB 1VQ9V 2H3OA 3EKRA 1JM6A 1R3LC 2DQ0A 2B1GA 2ZR2A 1BHBA 4XC0A 3K97A 3UKMA 3E83A 3M8AA 3CYGA 2C1IA 3GIEA 2OCCB 4WF9V 2QKSA 2FKXA 1R3JC 2H8PC 3HR0A 1MNGA 4IL6Z 1MMMA 3AG3B 1M5IA 2WI1A 3OGCC 4EFUA 1SA0A 3HZ5A 2EIJB 5IY5C 3SJCC 4XDLA 4O4LA 1XILA 1YC1A 2K9PA 4DXWA 3JALB 2B5UA 5D5PA 2Q9LA 4IHJA 3HPLC 1BMFG 1YCIA 4UCSA 4H85A 4DK1A 5BODA 3D3IA 1SQVH 3RYHB 2EJ7A 2XJGA 1WB7A 4LF5B 4MVUA 4LWEA 2JIZG 2N04A 1TUEB 2XAJA 3U67A 1PL4A 3EHJA 2QSAA 2XTAA 3UO2A 3RYFA 3IC7A 3FB8C 4ZVIA 1TGOA 1V55B 5ITZA 4XDMA 4FJCC 1SRYA 2QWPB 3H1HH 1NH2B 4Q6GA 2YI8A 5IDJA 4EGHA 4OXSA 4ZBMA 5IJ9B 3K08A 3R4OA 4LCUC 1IDSA 3LMMA 3TGUH 2IH1C 2LGQA 1HNZO 2WI2A 5IE9A 4X1IA 2OCHA 2ZNJA 5C93A 1K3EA 2GTAA 5F3KA 4X65B 1K33A 5D6PA 2PF4E 2X6AA 1S76D 4GEEA 2VQFO 1Y4SA 2YJXA 4HZ0A 2A06H 5BR8B 4HYPA 1TH8A 3G4SV 1JR9A 5JCOA 1YERA 4MP2A 1JMKC 2WLLB 2EINC 1AP6A 4PU9A 2W0XA 4DR4B 2CG9A 3JALA 1KIJA 3QO5A 2CTPA 4CWTA 5GONB 2YI0A 2CUGA 1Q6UA 5DEDA 1BGQA 4CC6A 4CH4A 3RYHA 4EMVA 4YJ2A 2A0LA 1XBLA 1GM7A 3LPSA 4XIQA 2ZM6O 4R1FA 3CYOA 4DV0O 3RYCB 1FYJA 4GZRB 2PTMA 4MVOA 2ZE8A 3ZHRA 1N8RW 2D2CB 3WHAA 2EZPA 5FWKA 3FB6C 3SYPA 1S5LZ 4JI1B 2HHHB 4R3AA 2GUZA 2Q8GA 1AMWA 1QVGU 1JPXA 5IJ9A 3E86A 2BYHA 3HKDA 3K99A 5L3GA 2CGNA 1I5XA 4ZOLB 3OM3B 2Z0AA 2YIDA 4WBNB 5LA6B 3T1HO 4UVBA 2YEHA 1US7A 1KKDA 4D7TA 4LNUB 1L1FA 1FJGO 1YDXA 3HKEB 3TCUA 2AKPA 1AB3A 3NMQA 2UXDO 3RLRA 4EFTA 2WLLA 1EA6A 4LF8B 1Y8NA 1OCRB 1WJZA 2YKIA 3CS5A
chains in the Genus database with same CATH topology
3ZRXA 4PDVA 5GGZA 4RQFA 1NKDA 1SETA 4GX1A 5KA5A 4QPKA 3ML0A 1JCHA 3RLQA 3HYZA 4EKWA 2C2AA 3OEEG 2IJIA 4FCQA 2YE9A 2YE3A 4TT3G 2AHYA 1GK9A 4BIZA 2YI7A 4PA6A 2BU2A 5IY5B 5M4EA 1F4MA 3JD1A 4X8AA 4G28B 4XDKA 1YI2V 4GFNA 5M4HA 4HZ3A 2EIMC 5B1AC 3CCLV 1A4HA 1K4CC 3WG7C 3R4PA 4FCPA 3B8MA 2ZDIA 3GIGA 4O05A 3E2EA 4PA4A 3SYQA 2IJHA 2YEIA 1Q81W 3K3WA 4E2LA 2IH3C 4MTXA 2XHXA 4XDJA 4L91A 4KQVA 3B25A 3CMEV 1K8AW 4DUHA 4R7CA 2GQPA 2VW5A 3EHGA 3ZRVA 3FYIB 3ETDA 4HY6A 4BIUA 4I9WA 4LWHA 3TZ0A 2BZ5A 1AR1B 4MPNA 2ZXWC 3A0XA 2HVKC 1F4NA 4B7PA 3SYCA 1M9NA 1GKFA 4HYOA 2WI3A 3TK1A 1PNMA 1GMGA 4NH7A 3DTUB 3ZKBA 1XL4A 2YJWA 3PEJA 1WPXA 4KUMA 4PELA 4YKYA 4TWKA 3ZMVA 5IYBO 2BU5A 1YT2A 3ZRSA 2O1UA 3BMYA 4EM7A 3FT8A 2WAMA 3O6OA 3STLC 2EIKC 2H94A 2HKOA 1UYFA 4G27B 3VBBA 2ZDXA 1QY8A 4ASUG 5FNCA 4MTOA 1UY6A 2XASA 3ZM7A 4PDRA 5HFMA 3JYCA 1THNA 4URNA 1Q86W 2R9RB 1W2BU 1H38A 4CWFA 4X89A 1FFTB 2DWEC 2YEFA 2YEDA 1YSCA 3D2RA 1OCCC 2WLNA 4WFAV 4MBCA 2CCSA 1NHIA 2BU7A 1QR8A 2XAFA 5L3EA 3DGEA 1Z5AA 4MS2A 4MP7A 2Q8FA 3TTZA 1E79G 3OAAG 4O04A 3A0YA 3SL2A 3VOUA 2EIMB 4I3HA 3RW0A 3CGZA 1M56C 5B1AB 1G4YB 3WG7B 3B26A 1ZWIC 3T4DA 4JTCB 4XCJA 3JD2A 3R4NA 4EEHA 3T0HA 3TZ4A 2ZBKB 5LHGA 1Z5BA 1U0ZA 1S5HC 2D3OW 3HYYA 2IOQA 3JD3A 4K4OA 2GSMB 1YIJV 2ESAA 4KTNA 4JPRA 1W0JG 3CCVV 4WFHA 1Y8PA 4YKTA 2IWXA 3SYAA 4ASBA 2JK5C 3FV5A 4U7OA 4HY1A 2XABA 3LUTB 3OWDA 2Z5UA 1UYKA 1YC4A 5CA3A 3ZN0A 3H80A 1I59A 3OMAB 3EHBB 2XDKA 3B27A 4PDMA 4YKQA 4RAIA 3ASOC 3B8NA 2ZDYA 4BXIA 1EI1A 3R92A 3CCQV 2Q8HA 2XHTA 4R8CA 1RPRA 3LNMB 2YE2A 2WSSG 1BL8A 2YEVB 3TETA 3JZ3A 2EIKB 5CBGA 2NLJC 3AG4C 3CXCU 4R6ZA 4H81A 1RM1C 1AM1A 2QG0A 2BYIA 4P30A 2WLHA 1EFRG 4Z1MG 5LHIA 1MSWD 3WFVA 3CP1A 2JDIG 4GCZA 3G6EV 4R50A 2IWUA 1ID0A 2O1WA 1XL6A 2XCMA 3OUSA 2YEGA 1OCCB 1NHHA 1GKXA 1E1QG 2CCTA 4L8ZA 1MABG 1ZWHA 2QTOA 3HZ1A 5B1BC 1AROP 4UVAA 2VWCA 2HR3A 3F7VC 2QA4V 1J95A 2IJKA 4O07A 3R91A 4XKAA 1UYMA 1PNLA 2NNUA 3MNRP 2YGAA 4EGKA 1M56B 3H01A 3B28A 3K0GA 5J71A 1V54C 2VCIA 2QG2A 3GIFA 1VQ7V 4NH9A 2UXXA 4UXNA 2YSUB 1SZTA 1UYCA 3UM7A 4URLA 1JOYA 3F5WC 2H55A 1WLEA 3GWOA 4XKKA 2DYRC 1Z59A 3Q5JA 4UUJC 4J9ZB 2PI5A 4O09A 2YEBA 3T10A 2XAQA 1L0OA 3PJSK 3KE6A 1PVGA 4CE1A 2DQ3A 1YT1A 5CF0A 1VQPV 4H33A 2YE6A 1GM8A 4KFMA 4B6CA 1AI7A 5EBWC 2XK2A 1YSZA 2DYSC 5CTXA 4KP4A 1VQKV 3E89A 3OFNG 4MSWC 3W7TA 1K73W 1NJIW 3EFFK 3ZRWB 2IWSA 2YE7A 2CCUA 1Q82W 4X88A 4L90A 3K9AA 3ASOB 2QEXV 2V1DA 1TC0A 4CWNA 4CWQA 1QR9A 4XITA 2WLJA 4GX5A 2YKBA 1RPOA 1H8EG 4LBEC 3AG4B 1UY7A 3CPWU 5D6QA 5H6RA 1RM1B 1PNKA 1SESA 4URMA 1QZRA 3OW6A 2JJ1G 1M57C 5L3FA 4PA3A 4P2ZA 3LDDA 3OE7G 1UYEA 4WFEA 1I5BA 3E8BA 5IDMA 4CBCA 1KQSU 3U2DA 3H4LA 4CE3A 2W6JG 1IXMA 3Q5LA 1MX0A 3ZRWA 4JTDB 4P9PA 2WLMA 4DZYA 5B3SC 2JEXA 1EZJA 5B1BB 1OCZC 1Y8OA 3E8FA 3SPCA 3CC4V 1COWG 3HHUA 2HG1A 1QCEA 5CTYA 4QPJA 4P8OA 1UYLA 1CP9A 2IU0A 3D0BA 1NHJA 2HFEC 3CC7V 1V54B 2YKEA 2CK3G 3IEDA 5B1OA 1UJWB 4YKRA 5FNDA 4MT8A 3BY6A 3R65A 3W7XA 3CD6V 3OWBA 2OT5A 3AEIA 3W7SA 2BSMA 4G2KA 1FXVA 2IU3A 3G7BA 5EK0A 5L3BA 3P32A 2LP7A 3K60A 1ROPA 3QNEA 2ITDC 5L3DA 1QVFU 4CWOA 2DYSB 1I58A 3K04A 4JAUA 1YS3A 3ABMC 2YECA 4FCRA 3E8HA 4CWPA 1TIDA 2EINB 5CTUA 2XX2A 4WFFA 2LFSA 1P7BA 4L93A 2HLDG 5CPHA 4ASGA 3QDDA 4BW5A 2CGFA 1THZA 3OMUA 5CTWA 3ABKC 4UVCA 4YKWA 3EHHA 4AWOA 3INXA 2IOPA 2XOKG 2F43G 1I5DA 1YHQV 3ZKDA 4O0BA 1DLBA 2MK3A 1BHAA 1KC8W 1JVMA 1U2OA 1M57B 2WWWA 4MTFA 3ABLC 4ASAA 3T2MA 1Q7YW 2XJJA 3RVYA 1QYEA 5EC1C 4GT1A 4LWGA 3OUFA 5M4PA 3LDEA 2XHRA 3A0TA 2A79B 3G75A 2JEUA 2R9IA 4H7QA 2W6IG 1JQ0A 2W0FC 5B3SB 2EBOA 4X9LA 4WFBV 2HCHA 3I55V 1OCZB 4V25A 1R6NA 1UY8A 1AJPA 4CWRA 2WLIB 5CBFA 3K06A 4XTJA 4ASFA 3FB7C 1TBWA 4NH8A 3SPJA 1AI5A 5LGTA 1B3QA 3LSQA 2XX5A 4YKXA 2WLKA 2BRCA 2XX4A 3Q5KA 2B1IA 3SPGA 1UY9A 3T0ZA 4UV8A 4FMTA 3ZJZA 3ZMZA 1R6KA 1S3JA 4PA7A 3RVZA 3ZN1A 4KSGA 3A0RA 2OCCC 2QM7A 3CCEV 1K9MW 4WUDA 4BQJA 1KECA 2EZOA 2M7WA 3T1CA 1F51A 4LP8A 2FTKA 3T4ZA 2P67A 2WLIA 2P90A 1H2GA 1H8HG 3CCUV 2ZXWB 1YJ9V 1H7UA 3ABMB 3IGAC 4QE7A 1BYQA 4UROA 4MPEA 1AH8A 4LC1A 1I5AA 5L3JA 3ABKB 1K7DA 3ZXQA 4MW3A 4FPPA 1GO3F 3MHSC 5F5RA 2IW5A 2Q69A 4WCEV 2YK9A 3IFXA 2FWZA 3E8GA 1DF5A 1TILA 4GX2A 3R4MA 4JAVA 2YGFA 3ZXOA 5BZBA 4DO2A 1OSFA 2Y48A 4LPBA 3RBZA 1GJVA 3A0ZA 1OZ0A 1M90W 4QIWF 4LWFA 4J9YB 2YEAA 3ABLB 4LWIA 4GGLA 3OR7C 3K98A 1VQNV 3B77A 4XD8A 3AG1C 4XKOA 4QJFB 4GQTA 1Y4UA 3HB3B 5IN9A 4RUFA 3EHFA 3ETEA 2Q67A 1QLNA 4AWPA 4JYBA 3STZC 5H6QA 1OCOC 3ASNC 3ZMTA 2X7RB 2YEVA 5LHHA 2DW4A 4P9OA 2XAHA 3LDCA 1ZXNA 1P4RA 1R62A 5CBHA 1R73A 1SERA 3TZ2A 4PL9A 1B62A 2E0AA 4N23A 3SJQC 1ORQC 4MPCA 2YI5A 1F23A 2H8MA 3INWA 3I56V 1ZW9A 5IYDO 2Q68A 4BQGA 3EKOA 2FWYA 2V7QG 3QO8A 3PEHA 3GB7C 3CRKA 4PRXA 4WUCA 3KG2A 3ZMSA 1QBZA 5L3CA 1Y4MA 1YJNV 4QNHB 2P6JA 2YE4A 4P7AA 3FYEB 4MW8A 3OMNB 4V26A 2EILC 1YESA 5FNFA 1Y66A 3W7UA 3CMAV 4WFGA 3X2QC 1GTOA 2IORA 3ETGA 2ZKJA 5D7RA 4JASA 4L94A 2K5BA 2WEPA 3OR6C 1PD3A 3MD0A 1K5QA 3HEKA 4KSHA 3ZIAG 3FB5C 2UXNA 3VHDA 2XNDG 3TZ5A 4AS9A 2WPDG 1EBOA 4I5SA 4BAYA 4CZZA 3QTFA 3CCJV 1PKXA 3LNUA 3P30A 3T1KA 2ZQMA 1W0KG 2BOCC 3AG1B 2WERA 4PRVA 2ZD9A 1CEZA 2Q8IA 2A9HA 3ZCCA 3G7EA 1YITV 4MB9A 2EXLA 1YETA 1AJQA 1VQ4V 3K03A 4W7TA 2WI7A 2VCJA 2XAGA 5D7CA 1VQ5V 1K97A 1AH6A 2YE5A 4GT8A 1OCOB 5LGNA 4MVRA 3ASNB 3A0WA 3GIGB 4RUEA 1FXKC 3CRLA 3K0DA 5D7DA 1I5CA 1VQ8V 4JF3A 5HFLA 3BM9A 2BREA 2HJFC 4HAMA 1KP2A 5M4KA 2YE8A 1YTFD 2Y69C 4XBFA 3VHCA 4E01A 1FS0G 4XIPA 4QE9A 2YEJA 3SPHA 3ZMUA 2OTJV 3F7YC 4XCLA 4F4LA 1KZNA 4YKUA 2DYRB 2BU6A 2BTZA 5EBMC 4MVMA 4GX0A 2FXSA 1OHHG 4RQEA 2XDLA 4UV9A 3QO7A 2PNRA 2K1EA 1S16A 1JJ2U 4WUBA 3CGYA 2BOBC 2YI6A 3B24A 4XE2A 2Z3YA 2EILB 1K5SA 4JQLA 3JD0A 3AG2C 1S0VA 1VQOV 3X2QB 3OPDA 5LBQA 2WI6A 3O2FA 4E00A 4HYMA 2AHZA 1KP3A 2XJXA 5B1NA 5M4NA 1M1KW 3TUHA 1FXHA 3FKSG 2O1VA 5CMUA 5LGUA 4XIRA 5DM6V 4JGSA 1K4DC 2YEEA 2YKCA 3FT5A 1DF4A 5KA6A 3U2KA 4PA9A 1H7SA 1BKNA 3WQ9A 5EC2C 4N21A 2EJRA 4CWSA 1NVPD 2DWDC 2FYPA 1R3IC 5J6AA 2Q2EB 2HG5C 2ZR3A 4ZKIA 2HKJA 1VQ6V 4R3MA 1YT0A 4H37A 4L87A 1DTOA 3ABUA 3CCRV 1B6QA 4MTGA 1UYGA 5KUMA 4MVSA 1UYIA 2JJCA 2ITCC 1LNQA 5H9CA 2BT0A 1NQTA 4YKZA 2X0LA 4Q20A 1NBMG 1UYDA 1UYHA 1G8MA 4FK5C 1K34A 4TSFG 1FXKB 2OTLV 5EBLC 2QF6A 2IJJA 1I5YA 1MU5A 3JD4A 1AJNA 2Y69B 5GW7A 2XD6A 1Z5CA 4YXWG 1QLEC 4AWQA 2CH4A 2QFOA 3RLPA 3BEHA 4EGIA 3W7WA 1NR7A 2BU8A 1YTFB 2HVJC 3ABTA 2X6BA 5FL7G 4U7NA 3NXSA 3G71V 1TC6A 3SYOA 3AG3C 1AI4A 2X6CA 3CWVA 2GHYA 2YK2A 4HXWA 2EIJC 1YSRA 5IYCO 3VHAA 5DN6G 3VADA 1KD1W 1FXKA 2LFRA 4E02A 1NH2D 2XDXA 3C11A 2WI4A 2KB1A 1HWYA 3AG2B 1AJ6A 4LP0A 3CCMV 2ATKC 5J9PC 1V55C 3E35A 4CE2A 2GFDA 4JYCA 3SPIA 1GM9A 3D36A 1S77D 3OEHG 4FIPC 2XDUA 2JJ2G 4HXZA 5BOCA 4RO2A 2WEQA 4MOTA 1ENVA 3CCSV 3C0EA 5E1AC 2QM8A 3OMIB 1E1RG 3RKZA 3MHHC 1B63A 2YGEA 1MG1A 2WI5A 3OW2U 3T2SA 1BXDA 3JCZA 1NR1A 3LSSA 2Q6AA 2PI4A 4MVQA 1PL0A 5M4MA 4U93A 2QE7G 1CPYA 1NVPB 1YJWV 1VQLV 1YC3A 1VQMV 2UWDA 5KUKA 4KFGA 1S14A 5CN0A 3M99B 3CC2V 4PDLA 1S72V 1K92A 1ZXMA 1JX9A 3K79A 2ZDIC 2YKJA 4BAEA 1OCRC 1MOFA 2XDSA 1AI6A 2JKIA 1R3KC 3O0IA 1QLEB 4MVZA 4HZ5A 1GKZA 2P7TC 4JTAB 1VQ9V 3EKRA 1JM6A 1R3LC 2DQ0A 2B1GA 2ZR2A 1BHBA 4XC0A 3K97A 3UKMA 3E83A 3GIEA 2OCCB 4WF9V 2QKSA 1R3JC 2H8PC 3AG3B 2WI1A 3OGCC 4EFUA 3HZ5A 2EIJB 5IY5C 4XDLA 1YC1A 4DXWA 2B5UA 3HPLC 1BMFG 4H85A 5BODA 3D3IA 2XJGA 4MVUA 4LWEA 2JIZG 1TUEB 2XAJA 3U67A 3EHJA 3IC7A 3FB8C 4ZVIA 1V55B 4XDMA 4FJCC 1SRYA 1NH2B 5IDJA 4EGHA 4OXSA 4ZBMA 3K08A 3R4OA 4LCUC 2IH1C 2WI2A 5C93A 1K3EA 5F3KA 1K33A 5D6PA 2X6AA 1S76D 4GEEA 1Y4SA 4HZ0A 2YJXA 4HYPA 1TH8A 3G4SV 1YERA 4MP2A 2WLLB 2EINC 4PU9A 2CG9A 1KIJA 3QO5A 4CWTA 2YI0A 1BGQA 4EMVA 2A0LA 1GM7A 3LPSA 4XIQA 4R1FA 3CYOA 4MVOA 1N8RW 3WHAA 2EZPA 5FWKA 3FB6C 3SYPA 4R3AA 2Q8GA 1AMWA 1QVGU 1JPXA 3E86A 2BYHA 3K99A 5L3GA 1I5XA 3OM3B 4UVBA 2YEHA 1US7A 1KKDA 1L1FA 3TCUA 2AKPA 3NMQA 3RLRA 4EFTA 2WLLA 1EA6A 1Y8NA 1OCRB 2YKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRX A;  4MPE A;  2FYP A;  5J6A A;  2Q2E B;  1AH8 A;  4LC1 A;  1UYC A;  5GGZ A;  4ZKI A;  2HKJ A;  1I5A A;  4URL A;  1JOY A;  4R3M A;  5L3J A;  2H55 A;  1YT0 A;  4QPK A;  3ZXQ A;  3RLQ A;  3HYZ A;  4XKK A;  4FPP A;  1Z59 A;  1UYG A;  2C2A A;  5F5R A;  3Q5J A;  1UYI A;  4FCQ A;  2YK9 A;  2JJC A;  2FWZ A;  2YE9 A;  2BT0 A;  2YE3 A;  1TIL A;  2YEB A;  4O09 A;  3T10 A;  1L0O A;  4YKZ A;  3KE6 A;  3R4M A;  4Q20 A;  1UYD A;  4JAV A;  4BIZ A;  1PVG A;  1UYH A;  2YGF A;  3ZXO A;  4CE1 A;  2YI7 A;  2BU2 A;  1YT1 A;  1OSF A;  4LPB A;  5CF0 A;  5M4E A;  3A0Z A;  1GJV A;  2YE6 A;  4B6C A;  4GFN A;  4LWF A;  5M4H A;  2XK2 A;  1YSZ A;  5CTX A;  2YEA A;  4KP4 A;  4LWI A;  1A4H A;  2QF6 A;  3R4P A;  4FCP A;  4GGL A;  3K98 A;  3GIG A;  3ZRW B;  2IWS A;  1MU5 A;  4O05 A;  4XD8 A;  2XD6 A;  1Z5C A;  2YE7 A;  2CCU A;  4XKO A;  2YEI A;  4L90 A;  4AWQ A;  1TC0 A;  2CH4 A;  4MTX A;  2QFO A;  4CWN A;  4CWQ A;  2XHX A;  4GQT A;  1Y4U A;  4L91 A;  4KQV A;  3RLP A;  4EGI A;  3B25 A;  5IN9 A;  4XIT A;  4DUH A;  2YKB A;  2BU8 A;  2GQP A;  2VW5 A;  3EHF A;  3EHG A;  3ZRV A;  4HY6 A;  4BIU A;  4U7N A;  4LWH A;  3TZ0 A;  3NXS A;  4AWP A;  2BZ5 A;  4JYB A;  1TC6 A;  4MPN A;  1UY7 A;  3CWV A;  3A0X A;  2YK2 A;  5D6Q A;  4HXW A;  1YSR A;  4B7P A;  4URM A;  1QZR A;  3OW6 A;  3VHA A;  2WI3 A;  1UYE A;  3VAD A;  3TK1 A;  1I5B A;  2LFR A;  1ZXN A;  4E02 A;  1R62 A;  5IDM A;  3TZ2 A;  3U2D A;  4NH7 A;  4PL9 A;  2XDX A;  3C11 A;  2WI4 A;  1B62 A;  3H4L A;  4CE3 A;  1IXM A;  2E0A A;  3Q5L A;  1MX0 A;  4MPC A;  3ZKB A;  2YI5 A;  3ZRW A;  1AJ6 A;  4LP0 A;  2YJW A;  3PEJ A;  2H8M A;  3INW A;  4DZY A;  4YKY A;  4CE2 A;  1ZW9 A;  2BU5 A;  1YT2 A;  4BQG A;  2GFD A;  3EKO A;  2FWY A;  2O1U A;  3BMY A;  4JYC A;  4EM7 A;  3PEH A;  3FT8 A;  1Y8O A;  3D36 A;  3CRK A;  3O6O A;  2XDU A;  4PRX A;  4HXZ A;  4WUC A;  3HHU A;  5BOC A;  2HG1 A;  1UYF A;  2WEQ A;  4MOT A;  5CTY A;  4QPJ A;  2ZDX A;  4P8O A;  1QY8 A;  1UYL A;  3D0B A;  1NHJ A;  3C0E A;  5FNC A;  2QM8 A;  1UY6 A;  2YKE A;  3ZM7 A;  3IED A;  5B1O A;  4YKR A;  5FND A;  1THN A;  4URN A;  4CWF A;  4MT8 A;  2YE4 A;  4P7A A;  3RKZ A;  1B63 A;  4V26 A;  2YGE A;  2YEF A;  2WI5 A;  1YES A;  2YED A;  3T2S A;  5FNF A;  3OWB A;  1BXD A;  3D2R A;  2IOR A;  4MBC A;  2CCS A;  1NHI A;  2BU7 A;  5M4M A;  4U93 A;  2ZKJ A;  5D7R A;  3DGE A;  4JAS A;  4L94 A;  2K5B A;  2WEP A;  1YC3 A;  3MD0 A;  2BSM A;  3HEK A;  4KSH A;  2UWD A;  4KFG A;  1Z5A A;  3G7B A;  4MP7 A;  2Q8F A;  3P32 A;  1S14 A;  3TTZ A;  3VHD A;  3K60 A;  3TZ5 A;  4AS9 A;  4O04 A;  3A0Y A;  3SL2 A;  4CWO A;  1I58 A;  4I3H A;  1ZXM A;  3CGZ A;  4I5S A;  4JAU A;  1YS3 A;  3QTF A;  2YEC A;  4FCR A;  3B26 A;  3LNU A;  4CWP A;  1TID A;  2YKJ A;  3T1K A;  4BAE A;  5CTU A;  2XX2 A;  4XCJ A;  2XDS A;  2LFS A;  3R4N A;  2JKI A;  4L93 A;  5CPH A;  4EEH A;  4ASG A;  3O0I A;  2WER A;  3QDD A;  4PRV A;  2CGF A;  3T0H A;  4HZ5 A;  2Q8I A;  1GKZ A;  3TZ4 A;  3OMU A;  3ZCC A;  3G7E A;  5CTW A;  2ZBK B;  4MB9 A;  1Z5B A;  4YKW A;  3EKR A;  3EHH A;  1JM6 A;  1U0Z A;  2EXL A;  1YET A;  3HYY A;  2IOQ A;  4XC0 A;  4AWO A;  3K97 A;  3INX A;  2IOP A;  4W7T A;  4K4O A;  2WI7 A;  1I5D A;  3GIE A;  2VCJ A;  2ESA A;  5D7C A;  4O0B A;  3ZKD A;  1AH6 A;  2YE5 A;  4KTN A;  2WI1 A;  4GT8 A;  4EFU A;  3HZ5 A;  1Y8P A;  4YKT A;  3A0W A;  3GIG B;  1U2O A;  1YC1 A;  2IWX A;  3CRL A;  2WWW A;  5D7D A;  4ASB A;  1I5C A;  4H85 A;  3FV5 A;  4U7O A;  5BOD A;  3BM9 A;  2BRE A;  4HY1 A;  4ASA A;  2XAB A;  2XJG A;  3OWD A;  2XJJ A;  1QYE A;  4LWE A;  4GT1 A;  4LWG A;  1UYK A;  1YC4 A;  5M4P A;  3U67 A;  3H80 A;  1I59 A;  2XDK A;  3B27 A;  5M4K A;  2YE8 A;  3EHJ A;  2XHR A;  3A0T A;  3G75 A;  3VHC A;  4E01 A;  4ZVI A;  4YKQ A;  4XDM A;  4XIP A;  2ZDY A;  4H7Q A;  2YEJ A;  1EI1 A;  3R92 A;  4BXI A;  2Q8H A;  2XHT A;  5IDJ A;  4EGH A;  4X9L A;  4XCL A;  2HCH A;  4V25 A;  3R4O A;  1UY8 A;  2YE2 A;  1KZN A;  4YKU A;  4CWR A;  2WI2 A;  3JZ3 A;  2BU6 A;  4URO A;  5C93 A;  5F3K A;  4XTJ A;  4ASF A;  2BTZ A;  5D6P A;  1TBW A;  4GEE A;  1Y4S A;  4HZ0 A;  2YJX A;  4NH8 A;  4H81 A;  2FXS A;  2XDL A;  4HYP A;  1TH8 A;  1AM1 A;  1YER A;  2QG0 A;  1B3Q A;  4MP2 A;  2BYI A;  2XX5 A;  2PNR A;  4YKX A;  1S16 A;  4PU9 A;  2BRC A;  2CG9 A;  2XX4 A;  3Q5K A;  4WUB A;  1KIJ A;  3CGY A;  4CWT A;  2YI0 A;  2YI6 A;  1UY9 A;  3B24 A;  1BGQ A;  3T0Z A;  4XE2 A;  4GCZ A;  4EMV A;  2IWU A;  1ID0 A;  4FMT A;  2O1W A;  2XCM A;  3LPS A;  4XIQ A;  4JQL A;  4R1F A;  2YEG A;  3OPD A;  1NHH A;  4KSG A;  3A0R A;  2WI6 A;  3O2F A;  1GKX A;  2CCT A;  4L8Z A;  2QM7 A;  3WHA A;  4E00 A;  1ZWH A;  4HYM A;  5FWK A;  2XJX A;  3HZ1 A;  4WUD A;  4R3A A;  4BQJ A;  2Q8G A;  5B1N A;  2VWC A;  1AMW A;  5M4N A;  1F51 A;  2BYH A;  3K99 A;  3TUH A;  2FTK A;  2P67 A;  2O1V A;  4O07 A;  4XIR A;  3R91 A;  2YEH A;  1US7 A;  4XKA A;  2YEE A;  2YKC A;  1UYM A;  3MNR P;  3FT5 A;  2YGA A;  4EGK A;  3U2K A;  1H7U A;  1H7S A;  2AKP A;  3B28 A;  5J71 A;  3NMQ A;  2VCI A;  1BKN A;  3WQ9 A;  3RLR A;  4EFT A;  1EA6 A;  2QG2 A;  1Y8N A;  4CWS A;  3GIF A;  1BYQ A;  4NH9 A;  2YKI A; 
#chains in the Genus database with same CATH topology
 3ZRX A;  2CTQ A;  4PDV A;  1SF9 A;  5GON A;  2Y0I A;  5GGZ A;  5JH7 B;  2UUC B;  4RQF A;  1NKD A;  4J7J A;  1SET A;  1R1B A;  4GX1 A;  5KA5 A;  3H1L H;  4QPK A;  3ML0 A;  1JCH A;  3WU2 Z;  2CH7 B;  3RLQ A;  4FLZ A;  3HYZ A;  2ILM A;  4EKW A;  2C2A A;  3OEE G;  2IJI A;  3ZHT A;  4FCQ A;  1S5J A;  4LF6 O;  2YE9 A;  2YE3 A;  4TT3 G;  1B04 A;  2UUA B;  1Y74 A;  2AHY A;  1GK9 A;  4BIZ A;  4JI8 O;  1D5N A;  2YI7 A;  4PA6 A;  2BU2 A;  1MZE A;  5IY5 B;  4JI5 B;  2DOS A;  3JAT A;  5M4E A;  2BSK B;  4UCU A;  1F4M A;  3JD1 A;  4ZOL A;  4X8A A;  4G28 B;  4XDK A;  4WBN A;  5LA6 A;  1YI2 V;  4GFN A;  5M4H A;  4HZ3 A;  2EIM C;  1AIL A;  3ZHU A;  5B1A C;  3QF7 A;  4LNU A;  3CCL V;  1A4H A;  1K4C C;  2AW9 A;  4K8X A;  3WG7 C;  3HKE A;  3R4P A;  2LW7 A;  4FCP A;  4AI8 A;  1G6U A;  1JJO A;  3B8M A;  2ZDI A;  2DMX A;  3GIG A;  2ZIM A;  4O05 A;  1NZ6 A;  1H2N A;  4PA4 A;  1PPJ H;  3SYQ A;  2F23 A;  3E2E A;  2IJH A;  2YEI A;  1Q81 W;  3K3W A;  4KXR A;  4J7K A;  1EZV H;  4E2L A;  2IH3 C;  2Q0O C;  4MTX A;  1LUV A;  2XHX A;  3G80 A;  4XDJ A;  4L91 A;  4KQV A;  3B25 A;  3CME V;  1K8A W;  4DR1 B;  4DUH A;  1FFX A;  2CH7 A;  4R7C A;  2GQP A;  5D5Q A;  2VW5 A;  1RSO A;  2IM9 A;  3EHG A;  3ZRV A;  3FYI B;  3ETD A;  4HY6 A;  4BIU A;  4I9W A;  3H9V A;  4LWH A;  3TZ0 A;  4W4L A;  2BZ5 A;  3J81 N;  1AR1 B;  4MPN A;  2QGN A;  5EYP B;  2ZXW C;  1XMO B;  3A0X A;  5FPR A;  3K5N A;  4FZ1 A;  4JI4 B;  2HVK C;  1YF2 A;  1F4N A;  2VQE B;  4B7P A;  3SYC A;  1M9N A;  1GKF A;  2BSK A;  4HYO A;  2WI3 A;  3HKB A;  3TK1 A;  1PNM A;  3SR2 C;  1IXB A;  4B3T B;  5CB4 B;  1FD9 A;  1GMG A;  4NH7 A;  3DTU B;  4ZHQ B;  4YHH B;  3ZKB A;  4JI3 O;  1KYO F;  1XL4 A;  4B3S B;  2YJW A;  3PEJ A;  2BTO A;  3B2E E;  1WPX A;  4HNA B;  4KUM A;  4PEL A;  4YKY A;  1N0N A;  1XNR O;  4TWK A;  3ZMV A;  5IYB O;  4CH3 A;  1Z5W A;  4OX9 O;  2BU5 A;  2GBO A;  3ZRS A;  1YT2 A;  1HDJ A;  4X66 B;  2O1U A;  3BMY A;  4TQD A;  3DC6 A;  4EM7 A;  3FT8 A;  2JRI A;  1Z5V A;  3CWB H;  2WAM A;  3KCY A;  3O6O A;  3STL C;  1DGS A;  3AK1 A;  2EIK C;  2H94 A;  4K0K B;  2LJ2 A;  2HKO A;  2WA3 A;  4TV8 A;  1UYF A;  4G27 B;  3VBB A;  4NTY A;  2ZDX A;  1QY8 A;  1ZSP A;  4ASU G;  4JZG A;  5FNC A;  4MTO A;  2R70 A;  1UY6 A;  2RN9 A;  2XAS A;  4DV4 B;  4FM0 A;  3ZM7 A;  4PDR A;  5HFM A;  2FL4 A;  3JYC A;  1THN A;  4URN A;  1Q86 W;  2LGW A;  2R9R B;  1W2B U;  3DC5 A;  4B7E A;  3JSN A;  1H38 A;  4CWF A;  4X20 B;  4X89 A;  3THO A;  4PJ0 Z;  1FFT B;  2HEP A;  2DWE C;  2YEF A;  2QR4 A;  5CB4 A;  5JWP A;  2YED A;  1YSC A;  1NU1 H;  4IIJ B;  4NVP A;  3UT5 B;  4ZHQ A;  3D2R A;  1OCC C;  2WLN A;  4WFA V;  1H2S B;  5JJJ B;  4MBC A;  4O4H B;  4DR6 B;  2CCS A;  2ODM A;  1NHI A;  2BU7 A;  1QR8 A;  2XAF A;  4HNA A;  5L3E A;  3DGE A;  2UUB B;  2ZT9 B;  4JI2 B;  1XRE A;  1F7Y A;  1ZX3 A;  2NN4 A;  1Z5A A;  4MS2 A;  4MP7 A;  2Q8F A;  2CE4 A;  3CJH A;  3TTZ A;  1AVM A;  1AR5 A;  1N33 B;  4BW9 A;  1E79 G;  3A2F A;  2NR5 A;  3OAA G;  4O04 A;  3A0Y A;  3SL2 A;  3QTC A;  3VOU A;  2EIM B;  4I3H A;  3RW0 A;  3CGZ A;  4X65 O;  1M56 C;  5B1A B;  3ZED A;  1G4Y B;  3WG7 B;  1HR0 B;  5BR8 O;  2P4V A;  3B26 A;  4UB8 Z;  1ZWI C;  3T4D A;  3FX7 A;  4JTC B;  4XCJ A;  4FFK A;  4DR4 O;  2Q8V A;  2XUM A;  3JD2 A;  3R4N A;  4X20 A;  2ARH A;  2VRZ A;  4EEH A;  4TQF A;  2N74 A;  3T0H A;  3TZ4 A;  3GWK C;  4U3J B;  4Z2W A;  3TJT A;  2ZBK B;  5LHG A;  1Z5B A;  1TAE A;  1U0Z A;  3UT5 A;  2ZE6 A;  4CH6 A;  1S5H C;  2D3O W;  3HYY A;  4LFA B;  2IOQ A;  3N2G B;  3JD3 A;  5LL6 Y;  2KG7 A;  4K4O A;  2GSM B;  1BE3 H;  3FAV A;  4NXM B;  1YIJ V;  2ESA A;  1L0L H;  2ADP A;  4JV5 O;  4J80 A;  4KTN A;  4JPR A;  1W0J G;  4JI1 O;  3SJB C;  5EZY B;  3CCV V;  4WFH A;  2HHH O;  3ZS8 C;  1Y8P A;  4YKT A;  3QVN A;  1W59 A;  2IWX A;  3AK2 A;  3NR7 A;  4O2B B;  3SYA A;  4BR6 A;  5LP6 C;  4ASB A;  2JK5 C;  3OT7 A;  3FV5 A;  4LF9 B;  4U7O A;  2QTS A;  4HY1 A;  3ZHQ A;  2XAB A;  3LUT B;  2HHI A;  3OWD A;  3C90 A;  1IZ3 A;  2Z5U A;  2ZIO A;  5JVD A;  1UYK A;  1YC4 A;  1IVS A;  4O2A B;  5CA3 A;  3ZN0 A;  3H80 A;  1I59 A;  3OMA B;  3EHB B;  2KQX A;  2XDK A;  5BMV B;  3B27 A;  4PDM A;  2R72 A;  4LF8 O;  5BXZ A;  4YKQ A;  4RAI A;  2PZS A;  2P22 C;  3ASO C;  4GKK B;  5AG2 A;  3B8N A;  2ZDY A;  4BXI A;  1EI1 A;  3R92 A;  2UUC O;  3CCQ V;  2Q8H A;  2XHT A;  4R8C A;  1RPR A;  3LNM B;  3BPZ A;  3HKC B;  2YE2 A;  4IT5 A;  2WSS G;  1BL8 A;  3N2G A;  4UCO A;  2YEV B;  3TET A;  3JZ3 A;  2EIK B;  1EN5 A;  2UXC B;  5CBG A;  2NLJ C;  4EFE A;  4F6R B;  3AG4 C;  2DN9 A;  3CXC U;  4R6Z A;  2RDC A;  4H81 A;  1Q6I A;  2UUA O;  1GN4 A;  2F4V B;  3H1K H;  1RM1 C;  3TXQ A;  5CA1 B;  1AM1 A;  2QG0 A;  4LWS B;  3JAS B;  2BYI A;  4P30 A;  2WLH A;  4JI5 O;  1EFR G;  1R6T A;  1D2D A;  5IT9 N;  4Z1M G;  2IBZ H;  2ZE5 A;  3C3T A;  2CDY A;  5LHI A;  2UXB B;  1MSW D;  3L71 H;  3WFV A;  4FFB B;  3CP1 A;  2JDI G;  4GCZ A;  3G6E V;  4R50 A;  2IWU A;  1ID0 A;  2O1W A;  1XL6 A;  2XCM A;  3OUS A;  2YEG A;  4O2A A;  1OCC B;  2GDS A;  1NHH A;  3K58 A;  5E79 Z;  3O65 A;  1GKX A;  1E1Q G;  2CCT A;  4L8Z A;  4ICG A;  1MAB G;  4W4K A;  1ZWH A;  1SC5 B;  2KKW A;  4I4T A;  2QTO A;  5C8Y B;  3HZ1 A;  3IJ4 A;  5B1B C;  1ARO P;  4UVA A;  2P4K A;  2VWC A;  2HR3 A;  5LOV B;  3F7V C;  2QA4 V;  2P5O A;  1J95 A;  2IJK A;  1I94 B;  1ZLZ A;  4O07 A;  3C3S A;  5FNV B;  3R91 A;  4XKA A;  1UYM A;  4ZI7 B;  1PNL A;  2NNU A;  4F6R A;  3MNR P;  5B66 Z;  1KB9 F;  2YGA A;  4EGK A;  2E5L B;  1M56 B;  3H01 A;  4TUY A;  3B28 A;  3K0G A;  5J71 A;  1V54 C;  1AP5 A;  4YIP A;  5CA1 A;  5GTI Z;  2VCI A;  3S5T A;  4LWS A;  3JAS A;  2QG2 A;  2VQE O;  4FLX A;  2Q5Z A;  3GIF A;  2UXX A;  1VQ7 V;  4NH9 A;  1SQB H;  4PI0 A;  1SZX A;  4UXN A;  2YSU B;  1BS3 A;  1SZT A;  2PGG A;  1UYC A;  4FFB A;  3UM7 A;  5KHG A;  4LF4 B;  2GTS A;  4URL A;  1NI8 A;  1JOY A;  3F5W C;  4B3T O;  4B3R B;  2H55 A;  4FLT A;  1WLE A;  1LUW A;  5KHK A;  1GH6 A;  1H2K A;  3UCS C;  3GWO A;  4CC5 A;  4XKK A;  4YHH O;  4D6T H;  2DYR C;  3H1J H;  1Z59 A;  1IBM O;  1JFF B;  3Q5J A;  2E3C A;  4UUJ C;  4DR3 B;  4Z1V A;  4J9Z B;  2PI5 A;  1Y6X A;  4O09 A;  2YEB A;  3T10 A;  2XAQ A;  1L0O A;  3PJS K;  3KE6 A;  5C8Y A;  2A7W A;  1PVG A;  4CE1 A;  3LSU A;  3RT3 C;  1RFY A;  2DQ3 A;  1YT1 A;  1OV9 A;  2QKC A;  5K1P A;  5CF0 A;  1VQP V;  4H33 A;  1T5E A;  2HP8 A;  2YE6 A;  1GM8 A;  4KFM A;  2ZKO A;  2L6L A;  1AI7 A;  4K0K O;  4B6C A;  1HP8 A;  5EBW C;  2XK2 A;  5LP6 B;  4I55 B;  1YSZ A;  2DYS C;  5CTX A;  3U11 A;  3S3X A;  4ZI7 A;  3MAQ A;  4FZ0 A;  4KP4 A;  1VQK V;  3Q4H B;  3E89 A;  1HNW B;  1TUB B;  3OFN G;  4MSW C;  4PD4 F;  3W7T A;  1K73 W;  1NJI W;  3EFF K;  1IBL O;  4DV4 O;  3ZRW B;  2IWS A;  2PUS A;  4LF7 B;  2YE7 A;  5K1X A;  1Q82 W;  2CCU A;  4X88 A;  4L90 A;  3CRR A;  3K9A A;  3RWR D;  3ASO B;  2Y4T A;  2UU9 O;  2V1D A;  2JS5 A;  2QEX V;  1XNQ O;  4OPA A;  1TC0 A;  4CWN A;  4CWQ A;  4I0X B;  3BHP A;  1QR9 A;  4EEQ A;  4XIT A;  1BCC H;  2WLJ A;  1QHT A;  4GX5 A;  2YKB A;  1Q3E A;  1Q8I A;  2Q7H A;  4YY3 B;  1MSD A;  4DR6 O;  1RPO A;  1H8E G;  2BTQ B;  4FLY A;  4DR5 O;  4LBE C;  4DK0 A;  3AG4 B;  1X59 A;  3N2K B;  2UUB O;  4B3M B;  4AQY B;  3O9O A;  1UY7 A;  3CPW U;  1QU7 A;  4JI2 O;  5D6Q A;  5H6R A;  1RM1 B;  4X64 B;  5LXT B;  4ZIB A;  1PNK A;  1SES A;  4URM A;  1QZR A;  3OW6 A;  2JJ1 G;  1M57 C;  5L3F A;  4PA3 A;  4P2Z A;  3LDD A;  4DUY B;  3OE7 G;  1UYE A;  4E4E A;  4LH7 A;  4WFE A;  1QQC A;  1I5B A;  2JVD A;  2ZIN A;  5LP6 A;  4I55 A;  4LFB O;  3E8B A;  1MZF A;  3Q4H A;  5IDM A;  3CE2 A;  4CBC A;  1KQS U;  1TUB A;  3JAW B;  3U2D A;  3H4L A;  4CE3 A;  2W6J G;  1IXM A;  3Q5L A;  1KMI Z;  1MX0 A;  3ZRW A;  4JTD B;  4P9P A;  3RYI B;  2WLM A;  1WP7 A;  3L9D A;  4DZY A;  2GV9 A;  1HNX B;  5B3S C;  2JEX A;  1EZJ A;  5B1B B;  4NTX A;  1N4C A;  4DRX B;  1OCZ C;  1Y8O A;  3RYC A;  3E8F A;  3SPC A;  3CC4 V;  3I5D A;  4LFA O;  1COW G;  1WPB A;  3ETQ A;  2YXH A;  3M7M X;  3HHU A;  4O4I B;  2HG1 A;  2BTQ A;  1QCE A;  4NXM O;  5CTY A;  1URF A;  4QPJ A;  4NTW A;  4P8O A;  1NTM H;  3N2K A;  1UYL A;  1CP9 A;  3TXS A;  2B9Z A;  2IU0 A;  3D0B A;  1NHJ A;  2HFE C;  3CC7 V;  4X1Y B;  1V54 B;  3VQV A;  5LMU B;  2YKE A;  1US6 A;  2CK3 G;  3IED A;  5B1O A;  1UJW B;  4YKR A;  5FND A;  1VP7 A;  5LYJ B;  4MT8 A;  4OPH A;  2ZNI A;  3BY6 A;  3R65 A;  3W7X A;  4LF9 O;  4LFC B;  1GAX A;  1DK1 A;  4DV2 B;  3D8C A;  3JAW A;  3CD6 V;  3OWB A;  1I08 A;  3U0Z A;  3CX5 F;  3D36 C;  5IWA B;  1NTK H;  2OT5 A;  2OWO A;  3CRC A;  4O4J B;  1KU9 A;  3AEI A;  5FLX N;  3W7S A;  3L72 H;  5JH7 A;  4GKK O;  2BSM A;  1SQF A;  2PY5 A;  4G2K A;  1FXV A;  2IU3 A;  3G7B A;  5EK0 A;  5L3B A;  3P32 A;  2LP7 A;  3JAK B;  3K60 A;  4X1K B;  1ROP A;  2YIB A;  3QNE A;  3EXA A;  2ITD C;  5L3D A;  1QVF U;  2E75 B;  2Q73 A;  4O4I A;  4CWO A;  2DYS B;  1I58 A;  1X4T A;  2L35 A;  2P06 A;  3K04 A;  4JAU A;  4RWU A;  1YS3 A;  3ABM C;  2YEC A;  2QWQ B;  3ZBH A;  4FCR A;  3E8H A;  1V9P A;  3AK3 A;  2F4V O;  4CWP A;  3JCU Z;  1TID A;  2PYL A;  2EIN B;  1SQP H;  5CTU A;  2XX2 A;  4WFF A;  2LFS A;  5KMG B;  1P7B A;  2C1G A;  4L93 A;  2HLD G;  5CPH A;  4ASG A;  3QDD A;  4BW5 A;  2UXB O;  2CGF A;  1THZ A;  3OMU A;  5CTW A;  3ABK C;  4UVC A;  4JYA B;  3BAB A;  4YKW A;  3EHH A;  3BA9 A;  4B08 A;  1IBK B;  1UFI A;  1ZTE A;  1Q6H A;  2Q7G A;  5KX5 B;  4AWO A;  3FFQ A;  3INX A;  3B09 A;  2IOP A;  2XOK G;  2F43 G;  1I5D A;  1YHQ V;  3ZKD A;  4O0B A;  1DLB A;  3RFR A;  3BFR A;  1CXZ B;  3KZI Z;  1Y76 B;  4TOI A;  1GN2 A;  2MK3 A;  1BHA A;  3SDL A;  3K5M A;  1KC8 W;  2YI9 A;  1JVM A;  1NS1 A;  1U2O A;  1M57 B;  3KCX A;  4PI2 A;  3CB2 A;  1XMQ B;  2WWW A;  4MTF A;  1I94 O;  2YUA A;  4I50 B;  4LH6 A;  3ABL C;  4ASA A;  5H5N A;  3T2M A;  4DYL A;  5EYP A;  1Q7Y W;  3J7A U;  2E5L O;  2XJJ A;  3RVY A;  1QYE A;  5EC1 C;  4GT1 A;  4J42 A;  4LWG A;  3OUF A;  5M4P A;  3VQW A;  2XT9 A;  3LDE A;  3E22 B;  2XHR A;  3A0T A;  2A79 B;  3G75 A;  2JS3 A;  2JEU A;  2QM4 A;  5KMG A;  2R9I A;  4CH5 A;  4DV5 B;  1N36 B;  3DSQ A;  4JI6 B;  4H7Q A;  2W6I G;  1JQ0 A;  2YDE A;  4LF4 O;  2W0F C;  5JJE B;  5B3S B;  3H1I H;  5JQG B;  2EBO A;  4LF5 O;  4X9L A;  4WFB V;  2QKA A;  3I55 V;  2HCH A;  1OCZ B;  4V25 A;  1R6N A;  4LR3 A;  1UY8 A;  2AZ2 A;  4AHC A;  1AJP A;  5KX5 A;  4CWR A;  3RN4 A;  2WLI B;  5CBF A;  1VF6 C;  3K06 A;  4GKJ B;  4XTJ A;  4ASF A;  4DR3 O;  3FB7 C;  1TBW A;  1U96 A;  4NH8 A;  3SPJ A;  2ZM6 B;  1QNM A;  1AI5 A;  5LGT A;  1B3Q A;  1VMG A;  3LSQ A;  3J80 N;  2XX5 A;  1J5E B;  4YKX A;  2WLK A;  2BRC A;  2XX4 A;  3Q5K A;  1XDC A;  1YZB A;  2B1I A;  4I7Z B;  1KBH A;  4I50 A;  3SPG A;  1UY9 A;  3T0Z A;  4UV8 A;  4FMT A;  3ZJZ A;  3ZMZ A;  5TIS Z;  1R6K A;  1S3J A;  4PA7 A;  4CS3 A;  3RVZ A;  1O9G A;  3ZN1 A;  4KSG A;  3A0R A;  2OCC C;  3ZHS A;  2QM7 A;  1FJG B;  5H2F Z;  3CCE V;  1K9M W;  4WUD A;  4BQJ A;  5JCO C;  5JQG A;  2JGD B;  1KEC A;  2EZO A;  2M7W A;  2WA4 A;  3T1C A;  4IIJ A;  1F51 A;  4JI0 B;  4OGQ B;  4O4H A;  4LP8 A;  2FTK A;  3LNN A;  3T4Z A;  4YY3 O;  2P67 A;  2WLI A;  2CTR A;  2P90 A;  2Q4P A;  3WB1 A;  1H2G A;  3K5O A;  2ADQ B;  3L74 H;  1H8H G;  1PM9 A;  3CCU V;  2E76 B;  4KHP B;  2ZXW B;  1YJ9 V;  4B3M O;  1H7U A;  3ABM B;  2RMK B;  3IGA C;  3SJA C;  4QE7 A;  1BYQ A;  3EVK A;  4URO A;  4MPE A;  2KSD A;  1AH8 A;  4LC1 A;  1FAF A;  1I5A A;  1SQG A;  5IYZ B;  4JI8 B;  4D7S A;  1LR1 A;  5L3J A;  3ABK B;  5JEN A;  2FYU H;  3IC9 A;  1K7D A;  3ZXQ A;  4MW3 A;  4C7U A;  4FPP A;  1GO3 F;  3MHS C;  5F5R A;  2IW5 A;  1M93 A;  2Q69 A;  4WCE V;  2YK9 A;  3IFX A;  2FWZ A;  2MW2 B;  3E8G A;  1DF5 A;  1TIL A;  4GX2 A;  1HNX O;  3OTF A;  2N05 A;  2OYQ A;  2YXL A;  3R4M A;  4DUZ B;  4U3J A;  4JAV A;  2YGF A;  1AR4 A;  1I7F A;  2JGD A;  3ZXO A;  3P3P A;  4DO2 A;  5BZB A;  1A32 A;  2OIE A;  1OSF A;  1MA1 A;  2Y48 A;  4LPB A;  3RBZ A;  1GJV A;  3A0Z A;  3OD4 A;  1OZ0 A;  1M90 W;  4QIW F;  4LWF A;  4J9Y B;  2YEA A;  2A3Q A;  3P3N A;  3ABL B;  4LWI A;  4HBN A;  3CRQ A;  3CRA A;  5EZY A;  4GGL A;  3OR7 C;  2RCV A;  3APQ A;  3K98 A;  5KAI Z;  1VQN V;  3B77 A;  2F93 B;  4XD8 A;  1G1X B;  4O2B A;  3AG1 C;  2YXY A;  4XKO A;  4E72 A;  3B4S A;  4QJF B;  2QJ1 A;  5IYZ A;  4GQT A;  1Y4U A;  3HB3 B;  4LFC O;  2RNB A;  5IN9 A;  3VQY A;  4H13 B;  4RUF A;  4O4L B;  1L8D A;  5IWA O;  4IGG A;  5BMV A;  1WP8 A;  3EHF A;  1FKA O;  3ETE A;  2F95 B;  2Q67 A;  2EX3 A;  4DV7 B;  2Q0A A;  1QLN A;  4AWP A;  4JYB A;  3STZ C;  1B06 A;  2BE3 A;  5H6Q A;  1GN6 A;  1WA8 B;  1SS3 A;  1OCO C;  4EB6 B;  1ZL8 B;  1TA8 A;  3ASN C;  4FLV A;  3ZMT A;  1N0J A;  3HKC A;  4J41 A;  4DR1 O;  3L70 H;  4H0L B;  5BY1 A;  2X7R B;  2YEV A;  5LHH A;  2PYJ A;  2BCC H;  2DW4 A;  1XNR B;  3UQ8 A;  4P9O A;  2XAH A;  3LDC A;  5LMN B;  1ZXN A;  1P4R A;  2EUL A;  1R62 A;  5CBH A;  1R73 A;  1SER A;  4PHZ A;  3TZ2 A;  1XMO O;  4PL9 A;  4CS4 A;  1B62 A;  2E0A A;  3UO3 A;  4N23 A;  3SJQ C;  1ORQ C;  4MPC A;  4JI4 O;  2YI5 A;  1F23 A;  1WN7 A;  2H8M A;  4X1I B;  5FPO A;  2ZCE A;  3INW A;  3I56 V;  1SQQ H;  1VIB A;  1ZW9 A;  5IYD O;  2Q68 A;  4BQG A;  2CGO A;  3CSX A;  3EKO A;  2FWY A;  2V7Q G;  3QO8 A;  1EM1 A;  1I0H A;  1KKC A;  3PEH A;  4JYA O;  3S3W A;  3GB7 C;  1IBK O;  3CRK A;  4JI7 B;  4NXN B;  1EN6 A;  4PRX A;  4NYK A;  4B3S O;  4WUC A;  3ZX6 A;  3KG2 A;  2RJZ A;  1VF6 A;  1NTZ H;  3SGI A;  3ZMS A;  4YJ2 B;  1WA8 A;  1QBZ A;  4X66 O;  4FVM A;  4EB6 A;  5L3C A;  1ZL8 A;  1N34 B;  1Y4M A;  1YJN V;  1SKV A;  4IYI A;  4QNH B;  5LOV A;  2P6J A;  2QWN B;  1XMQ O;  2YE4 A;  4P7A A;  3FYE B;  5FNV A;  1PP9 H;  4MW8 A;  3OMN B;  4V26 A;  2EIL C;  1BT8 A;  2F1M A;  1YES A;  5FNF A;  1XI1 A;  2GUZ B;  1Y66 A;  3W7U A;  3CMA V;  3HKD B;  4WFG A;  3X2Q C;  5A9G A;  1GTO A;  1TVK B;  2IOR A;  3A8T A;  3ETG A;  4A5U B;  2ZKJ A;  5D7R A;  4JAS A;  4L94 A;  2K5B A;  2WEP A;  3OR6 C;  1WB8 A;  1PD3 A;  2DJV A;  4DV5 O;  1N36 O;  2G38 A;  1XHX A;  3MD0 A;  4JI6 O;  1K5Q A;  3A0H Z;  3HEK A;  4KSH A;  3ZIA G;  3FB5 C;  2VS0 A;  1BGY H;  1Q90 D;  2UXN A;  3VHD A;  2XND G;  3A0B Z;  3VQX A;  1N32 B;  3TZ5 A;  4AS9 A;  1JFF A;  5KLV H;  2WPD G;  3CHX A;  1EBO A;  4X62 B;  1H2L A;  3OTO B;  4I5S A;  4GKJ O;  4BAY A;  4CZZ A;  4EFB A;  3QTF A;  3CCJ V;  4UFZ A;  1PKX A;  3BRC A;  3LNU A;  2YC0 A;  3P30 A;  3T1K A;  1RP3 B;  2ZQM A;  1W0K G;  1J5E O;  1N33 O;  2BOC C;  3AG1 B;  3N27 A;  2WER A;  3JSL A;  4JV5 B;  4PRV A;  2ZD9 A;  1CEZ A;  2Q8I A;  1Y74 B;  2AGA A;  2A9H A;  3ZCC A;  3G7E A;  1YIT V;  4MB9 A;  2AZ0 A;  2EXL A;  1HR0 O;  3T1Y B;  3KKY A;  1AJQ A;  1YET A;  3JAT B;  1TVK A;  4X9Q A;  1VQ4 V;  3K03 A;  4BWA A;  4W7T A;  2WI7 A;  5EIB D;  2VCJ A;  2XAG A;  5D7C A;  1Q5O A;  1VQ5 V;  1K97 A;  2XHB A;  1AH6 A;  2YE5 A;  1GN3 A;  4I0X A;  1OCO B;  4GT8 A;  5LGN A;  4MVR A;  4DV6 B;  3IAY A;  4QGP A;  3ASN B;  3A0W A;  3GIG B;  2LW1 A;  4JI0 O;  1O9H A;  4RUE A;  1FXK C;  3CRL A;  4K8Z A;  4DR7 B;  1M4U A;  1P49 A;  3K0D A;  5D7D A;  5EIB C;  1I5C A;  1VQ8 V;  4JF3 A;  3MDS A;  5HFL A;  4UCT A;  5GTH Z;  1XHZ A;  2BRE A;  3BM9 A;  2HJF C;  4B7K A;  4HAM A;  4DV3 B;  1VF7 A;  4KHP O;  1KP2 A;  4L8J A;  5LXT A;  2Y0P A;  1FFX B;  4UCR A;  4NR1 A;  5M4K A;  2YE8 A;  1YTF D;  2Y69 C;  1RSO B;  2VWJ A;  4GLX A;  4XBF A;  3VHC A;  4E01 A;  4J11 A;  3BVO A;  1KUQ A;  1FS0 G;  1WAZ A;  1IX9 A;  4XIP A;  2QWO B;  4QE9 A;  2YEJ A;  3SPH A;  4GYC B;  3ZMU A;  2OTJ V;  3F7Y C;  4XCL A;  4DR2 B;  4NB5 A;  3GVM A;  4F4L A;  1KZN A;  1U97 A;  4YKU A;  3RYI A;  4DV1 B;  2DYR B;  3HKB B;  2BU6 A;  1NT2 B;  2BTZ A;  3CRM A;  5EBM C;  4MVM A;  3APO A;  4GX0 A;  2FXS A;  1OHH G;  4RQE A;  2XDL A;  4DUZ O;  4UV9 A;  4DRX A;  3QO7 A;  3CEI A;  2PNR A;  2K1E A;  5KHJ A;  3DXR B;  1S16 A;  1JJ2 U;  1EN4 A;  4WUB A;  3CGY A;  2BOB C;  2YI6 A;  2UXC O;  3B24 A;  2HJD A;  4XE2 A;  2Z3Y A;  2E74 B;  2EIL B;  1K5S A;  3ZHV A;  4J7Z A;  4JQL A;  3JD0 A;  5KHI A;  3B40 A;  4X1Y A;  4K35 A;  1Z2G A;  3AG2 C;  1XQ8 A;  1S0V A;  1VQO V;  3X2Q B;  3OPD A;  5LBQ A;  2WI6 A;  3O2F A;  2OIG A;  2M6Y A;  5LYJ A;  1BZK A;  4TV8 B;  4E00 A;  4HYM A;  2AHZ A;  1KP3 A;  2ZE7 A;  2LQT A;  2XJX A;  3PN1 A;  5B1N A;  5M4N A;  5A2Q N;  1XEQ A;  1M1K W;  3TUH A;  4O4J A;  1FXH A;  3FKS G;  2O1V A;  5CMU A;  5LGU A;  1XUQ A;  5DM6 V;  4XIR A;  4JGS A;  1K4D C;  2YEE A;  2YKC A;  4DV7 O;  3WB0 A;  3FT5 A;  1ZAU A;  1DF4 A;  5KA6 A;  3U2K A;  4PA9 A;  4FM1 A;  1H7S A;  3JAR B;  4DW1 A;  4DW0 A;  1BKN A;  3WQ9 A;  3JAK A;  5EC2 C;  4N21 A;  4X1K A;  4IYH A;  1Q43 A;  2EJR A;  2YIC A;  3DXR A;  1IBM B;  4CWS A;  1UPG A;  3U10 A;  1NVP D;  2DWD C;  1YVW A;  2FYP A;  1R3I C;  3G6B A;  5J6A A;  2Q2E B;  4U3F H;  4AIL C;  2HG5 C;  3WB2 A;  5LMN O;  5KAF Z;  2ZR3 A;  4ZKI A;  4TV9 B;  2HKJ A;  1VQ6 V;  4JZ2 A;  4R3M A;  3RGB A;  4H37 A;  1YT0 A;  4L87 A;  2CAZ C;  1DTO A;  2LO1 A;  3ABU A;  3CJH B;  4UCV A;  3CCR V;  5JJN B;  1B6Q A;  1HNZ B;  4MTG A;  5F2V O;  5KUM A;  1UYG A;  4MVS A;  1UYI A;  1VEW A;  2JJC A;  2ITC C;  1LNQ A;  2QDO A;  2JGU A;  3QG5 A;  5H9C A;  2BT0 A;  4YJ3 B;  2VQF B;  1NQT A;  4YKZ A;  2X0L A;  4Q20 A;  1NBM G;  1UYD A;  1UYH A;  3L73 H;  4B3R O;  1G8M A;  4FK5 C;  1YEW A;  1K34 A;  1IBL B;  1Y67 A;  4TSF G;  4JI7 O;  1FXK B;  4NXN O;  5J2U B;  2OTL V;  5EBL C;  2UU9 B;  4JAA A;  1XNQ B;  5B5E Z;  1P7G A;  1Y76 A;  2QF6 A;  4DV0 B;  3JAR A;  2IJJ A;  1N34 O;  1I5Y A;  1BQZ A;  1MU5 A;  3JD4 A;  2KG7 B;  1AJN A;  2Y69 B;  5GW7 A;  2XD6 A;  1Z5C A;  4YXW G;  3FAV B;  4ABM A;  2DE0 X;  4DR5 B;  1QLE C;  4AWQ A;  2CH4 A;  4TV9 A;  2RQ6 A;  5J2T B;  2QFO A;  2FML A;  1P84 F;  2CTW A;  3RLP A;  1HNW O;  3BEH A;  4EGI A;  1HW7 A;  1WNS A;  3W7W A;  1NR7 A;  2BU8 A;  4KL1 A;  1YTF B;  2HVJ C;  3ABT A;  3E22 A;  3T1H B;  2X6B A;  1JA8 A;  4BIO A;  5FL7 G;  4U7N A;  4LFB B;  4LF7 O;  3NXS A;  3G71 V;  3K59 A;  4YJ3 A;  1TC6 A;  3AG7 A;  3BA8 A;  3SYO A;  3K5L A;  3AG3 C;  1AI4 A;  2X6C A;  3CWV A;  5IJ0 B;  4GUN A;  2GHY A;  2UXD B;  2YK2 A;  4HXW A;  2EIJ C;  5JVD B;  1YSR A;  2FB5 A;  5IYC O;  1N32 O;  3OGI B;  3VHA A;  5DN6 G;  3VAD A;  1KD1 W;  1FXK A;  1BQ0 A;  4FM2 A;  1YXB A;  4H44 B;  5J2U A;  2F66 C;  2LFR A;  4E02 A;  1NH2 D;  1GRJ A;  4X62 O;  2YS8 A;  3OTO O;  4AQY O;  3CXH F;  2XDX A;  3C11 A;  2WI4 A;  4F6E A;  1SQX H;  2KB1 A;  4X64 O;  1HWY A;  3AG2 B;  1AJ6 A;  4LP0 A;  3D3Q A;  3CCM V;  4DUY O;  4UB6 Z;  4LF6 B;  2ATK C;  5J9P C;  1V55 C;  3E35 A;  4CE2 A;  1ZUQ A;  3ICX A;  2Q7E A;  2GFD A;  5J2T A;  2R9A A;  5KHH A;  4JYC A;  3F5T A;  3SPI A;  1GM9 A;  4JYY A;  1OJH A;  3D36 A;  1S77 D;  3T1Y O;  2O57 A;  3OEH G;  4I9Q A;  4FIP C;  2XDU A;  2JJ2 G;  4HXZ A;  3L75 H;  5BOC A;  4RO2 A;  4NKG B;  2WEQ A;  4MOT A;  4FLW A;  1ENV A;  5IJ0 A;  3CCS V;  3C0E A;  5E1A C;  2QM8 A;  2VWK A;  3OMI B;  4DV6 O;  2YIA A;  1E1R G;  4FLU A;  3RKZ A;  4DR7 O;  3MHH C;  1BSM A;  1B63 A;  5CA0 B;  2YGE A;  1MG1 A;  4I4T B;  2WI5 A;  3OW2 U;  3T2S A;  4DV3 O;  1H2M A;  3BCC H;  1BXD A;  3JCZ A;  1NR1 A;  3LSS A;  2QWR B;  3K57 A;  5LMU O;  2Q6A A;  2PI4 A;  3R66 A;  4MVQ A;  1PL0 A;  5M4M A;  2ETN A;  4CS2 A;  4U93 A;  2QE7 G;  1CPY A;  1NVP B;  3FD9 A;  1YJW V;  3K9S A;  1VQL V;  1YC3 A;  1VQM V;  1FPO A;  4TUY B;  2UWD A;  5KUK A;  4J10 A;  4KFG A;  1SA0 B;  5DEC A;  4DV2 O;  1S14 A;  1XOU A;  2Y4U A;  4DR2 O;  5CN0 A;  2AXT Z;  3M99 B;  1IUR A;  3CC2 V;  4PDL A;  4DV1 O;  1VAR A;  4IHJ B;  1S72 V;  1D5A A;  4YIO A;  1L0N H;  1K92 A;  1ZXM A;  3G67 A;  3JAM N;  1JX9 A;  3BAA A;  4K3A A;  3K79 A;  2ZDI C;  4JI3 B;  2YKJ A;  2YIB D;  4BAE A;  1OCR C;  1MOF A;  4PV1 B;  1PV0 A;  2XDS A;  3RYF B;  1AI6 A;  2JKI A;  1R3K C;  5ITZ B;  4OX9 B;  3O0I A;  1QLE B;  4MVZ A;  5CA0 A;  4HZ5 A;  2V4D A;  1GKZ A;  1VF5 B;  2P7T C;  4JTA B;  1VQ9 V;  2H3O A;  3EKR A;  1JM6 A;  1R3L C;  2DQ0 A;  2B1G A;  2ZR2 A;  1BHB A;  4XC0 A;  3K97 A;  3UKM A;  3E83 A;  3M8A A;  3CYG A;  2C1I A;  3GIE A;  2OCC B;  4WF9 V;  2QKS A;  2FKX A;  1R3J C;  2H8P C;  3HR0 A;  1MNG A;  4IL6 Z;  1MMM A;  3AG3 B;  1M5I A;  2WI1 A;  3OGC C;  4EFU A;  1SA0 A;  3HZ5 A;  2EIJ B;  5IY5 C;  3SJC C;  4XDL A;  4O4L A;  1XIL A;  1YC1 A;  2K9P A;  4DXW A;  3JAL B;  2B5U A;  5D5P A;  2Q9L A;  4IHJ A;  3HPL C;  1BMF G;  1YCI A;  4UCS A;  4H85 A;  4DK1 A;  5BOD A;  3D3I A;  1SQV H;  3RYH B;  2EJ7 A;  2XJG A;  1WB7 A;  4LF5 B;  4MVU A;  4LWE A;  2JIZ G;  2N04 A;  1TUE B;  2XAJ A;  3U67 A;  1PL4 A;  3EHJ A;  2QSA A;  2XTA A;  3UO2 A;  3RYF A;  3IC7 A;  3FB8 C;  4ZVI A;  1TGO A;  1V55 B;  5ITZ A;  4XDM A;  4FJC C;  1SRY A;  2QWP B;  3H1H H;  1NH2 B;  4Q6G A;  2YI8 A;  5IDJ A;  4EGH A;  4OXS A;  4ZBM A;  5IJ9 B;  3K08 A;  3R4O A;  4LCU C;  1IDS A;  3LMM A;  3TGU H;  2IH1 C;  2LGQ A;  1HNZ O;  2WI2 A;  5IE9 A;  4X1I A;  2OCH A;  2ZNJ A;  5C93 A;  1K3E A;  2GTA A;  5F3K A;  4X65 B;  1K33 A;  5D6P A;  2PF4 E;  2X6A A;  1S76 D;  4GEE A;  2VQF O;  1Y4S A;  2YJX A;  4HZ0 A;  2A06 H;  5BR8 B;  4HYP A;  1TH8 A;  3G4S V;  1JR9 A;  5JCO A;  1YER A;  4MP2 A;  1JMK C;  2WLL B;  2EIN C;  1AP6 A;  4PU9 A;  2W0X A;  4DR4 B;  2CG9 A;  3JAL A;  1KIJ A;  3QO5 A;  2CTP A;  4CWT A;  5GON B;  2YI0 A;  2CUG A;  1Q6U A;  5DED A;  1BGQ A;  4CC6 A;  4CH4 A;  3RYH A;  4EMV A;  4YJ2 A;  2A0L A;  1XBL A;  1GM7 A;  3LPS A;  4XIQ A;  2ZM6 O;  4R1F A;  3CYO A;  4DV0 O;  3RYC B;  1FYJ A;  4GZR B;  2PTM A;  4MVO A;  2ZE8 A;  3ZHR A;  1N8R W;  2D2C B;  3WHA A;  2EZP A;  5FWK A;  3FB6 C;  3SYP A;  1S5L Z;  4JI1 B;  2HHH B;  4R3A A;  2GUZ A;  2Q8G A;  1AMW A;  1QVG U;  1JPX A;  5IJ9 A;  3E86 A;  2BYH A;  3HKD A;  3K99 A;  5L3G A;  2CGN A;  1I5X A;  4ZOL B;  3OM3 B;  2Z0A A;  2YID A;  4WBN B;  5LA6 B;  3T1H O;  4UVB A;  2YEH A;  1US7 A;  1KKD A;  4D7T A;  4LNU B;  1L1F A;  1FJG O;  1YDX A;  3HKE B;  3TCU A;  2AKP A;  1AB3 A;  3NMQ A;  2UXD O;  3RLR A;  4EFT A;  2WLL A;  1EA6 A;  4LF8 B;  1Y8N A;  1OCR B;  1WJZ A;  2YKI A;  3CS5 A; 
#chains in the Genus database with same CATH homology
 3ZRX A;  4PDV A;  5GGZ A;  4RQF A;  1NKD A;  1SET A;  4GX1 A;  5KA5 A;  4QPK A;  3ML0 A;  1JCH A;  3RLQ A;  3HYZ A;  4EKW A;  2C2A A;  3OEE G;  2IJI A;  4FCQ A;  2YE9 A;  2YE3 A;  4TT3 G;  2AHY A;  1GK9 A;  4BIZ A;  2YI7 A;  4PA6 A;  2BU2 A;  5IY5 B;  5M4E A;  1F4M A;  3JD1 A;  4X8A A;  4G28 B;  4XDK A;  1YI2 V;  4GFN A;  5M4H A;  4HZ3 A;  2EIM C;  5B1A C;  3CCL V;  1A4H A;  1K4C C;  3WG7 C;  3R4P A;  4FCP A;  3B8M A;  2ZDI A;  3GIG A;  4O05 A;  3E2E A;  4PA4 A;  3SYQ A;  2IJH A;  2YEI A;  1Q81 W;  3K3W A;  4E2L A;  2IH3 C;  4MTX A;  2XHX A;  4XDJ A;  4L91 A;  4KQV A;  3B25 A;  3CME V;  1K8A W;  4DUH A;  4R7C A;  2GQP A;  2VW5 A;  3EHG A;  3ZRV A;  3FYI B;  3ETD A;  4HY6 A;  4BIU A;  4I9W A;  4LWH A;  3TZ0 A;  2BZ5 A;  1AR1 B;  4MPN A;  2ZXW C;  3A0X A;  2HVK C;  1F4N A;  4B7P A;  3SYC A;  1M9N A;  1GKF A;  4HYO A;  2WI3 A;  3TK1 A;  1PNM A;  1GMG A;  4NH7 A;  3DTU B;  3ZKB A;  1XL4 A;  2YJW A;  3PEJ A;  1WPX A;  4KUM A;  4PEL A;  4YKY A;  4TWK A;  3ZMV A;  5IYB O;  2BU5 A;  1YT2 A;  3ZRS A;  2O1U A;  3BMY A;  4EM7 A;  3FT8 A;  2WAM A;  3O6O A;  3STL C;  2EIK C;  2H94 A;  2HKO A;  1UYF A;  4G27 B;  3VBB A;  2ZDX A;  1QY8 A;  4ASU G;  5FNC A;  4MTO A;  1UY6 A;  2XAS A;  3ZM7 A;  4PDR A;  5HFM A;  3JYC A;  1THN A;  4URN A;  1Q86 W;  2R9R B;  1W2B U;  1H38 A;  4CWF A;  4X89 A;  1FFT B;  2DWE C;  2YEF A;  2YED A;  1YSC A;  3D2R A;  1OCC C;  2WLN A;  4WFA V;  4MBC A;  2CCS A;  1NHI A;  2BU7 A;  1QR8 A;  2XAF A;  5L3E A;  3DGE A;  1Z5A A;  4MS2 A;  4MP7 A;  2Q8F A;  3TTZ A;  1E79 G;  3OAA G;  4O04 A;  3A0Y A;  3SL2 A;  3VOU A;  2EIM B;  4I3H A;  3RW0 A;  3CGZ A;  1M56 C;  5B1A B;  1G4Y B;  3WG7 B;  3B26 A;  1ZWI C;  3T4D A;  4JTC B;  4XCJ A;  3JD2 A;  3R4N A;  4EEH A;  3T0H A;  3TZ4 A;  2ZBK B;  5LHG A;  1Z5B A;  1U0Z A;  1S5H C;  2D3O W;  3HYY A;  2IOQ A;  3JD3 A;  4K4O A;  2GSM B;  1YIJ V;  2ESA A;  4KTN A;  4JPR A;  1W0J G;  3CCV V;  4WFH A;  1Y8P A;  4YKT A;  2IWX A;  3SYA A;  4ASB A;  2JK5 C;  3FV5 A;  4U7O A;  4HY1 A;  2XAB A;  3LUT B;  3OWD A;  2Z5U A;  1UYK A;  1YC4 A;  5CA3 A;  3ZN0 A;  3H80 A;  1I59 A;  3OMA B;  3EHB B;  2XDK A;  3B27 A;  4PDM A;  4YKQ A;  4RAI A;  3ASO C;  3B8N A;  2ZDY A;  4BXI A;  1EI1 A;  3R92 A;  3CCQ V;  2Q8H A;  2XHT A;  4R8C A;  1RPR A;  3LNM B;  2YE2 A;  2WSS G;  1BL8 A;  2YEV B;  3TET A;  3JZ3 A;  2EIK B;  5CBG A;  2NLJ C;  3AG4 C;  3CXC U;  4R6Z A;  4H81 A;  1RM1 C;  1AM1 A;  2QG0 A;  2BYI A;  4P30 A;  2WLH A;  1EFR G;  4Z1M G;  5LHI A;  1MSW D;  3WFV A;  3CP1 A;  2JDI G;  4GCZ A;  3G6E V;  4R50 A;  2IWU A;  1ID0 A;  2O1W A;  1XL6 A;  2XCM A;  3OUS A;  2YEG A;  1OCC B;  1NHH A;  1GKX A;  1E1Q G;  2CCT A;  4L8Z A;  1MAB G;  1ZWH A;  2QTO A;  3HZ1 A;  5B1B C;  1ARO P;  4UVA A;  2VWC A;  2HR3 A;  3F7V C;  2QA4 V;  1J95 A;  2IJK A;  4O07 A;  3R91 A;  4XKA A;  1UYM A;  1PNL A;  2NNU A;  3MNR P;  2YGA A;  4EGK A;  1M56 B;  3H01 A;  3B28 A;  3K0G A;  5J71 A;  1V54 C;  2VCI A;  2QG2 A;  3GIF A;  1VQ7 V;  4NH9 A;  2UXX A;  4UXN A;  2YSU B;  1SZT A;  1UYC A;  3UM7 A;  4URL A;  1JOY A;  3F5W C;  2H55 A;  1WLE A;  3GWO A;  4XKK A;  2DYR C;  1Z59 A;  3Q5J A;  4UUJ C;  4J9Z B;  2PI5 A;  4O09 A;  2YEB A;  3T10 A;  2XAQ A;  1L0O A;  3PJS K;  3KE6 A;  1PVG A;  4CE1 A;  2DQ3 A;  1YT1 A;  5CF0 A;  1VQP V;  4H33 A;  2YE6 A;  1GM8 A;  4KFM A;  4B6C A;  1AI7 A;  5EBW C;  2XK2 A;  1YSZ A;  2DYS C;  5CTX A;  4KP4 A;  1VQK V;  3E89 A;  3OFN G;  4MSW C;  3W7T A;  1K73 W;  1NJI W;  3EFF K;  3ZRW B;  2IWS A;  2YE7 A;  2CCU A;  1Q82 W;  4X88 A;  4L90 A;  3K9A A;  3ASO B;  2QEX V;  2V1D A;  1TC0 A;  4CWN A;  4CWQ A;  1QR9 A;  4XIT A;  2WLJ A;  4GX5 A;  2YKB A;  1RPO A;  1H8E G;  4LBE C;  3AG4 B;  1UY7 A;  3CPW U;  5D6Q A;  5H6R A;  1RM1 B;  1PNK A;  1SES A;  4URM A;  1QZR A;  3OW6 A;  2JJ1 G;  1M57 C;  5L3F A;  4PA3 A;  4P2Z A;  3LDD A;  3OE7 G;  1UYE A;  4WFE A;  1I5B A;  3E8B A;  5IDM A;  4CBC A;  1KQS U;  3U2D A;  3H4L A;  4CE3 A;  2W6J G;  1IXM A;  3Q5L A;  1MX0 A;  3ZRW A;  4JTD B;  4P9P A;  2WLM A;  4DZY A;  5B3S C;  2JEX A;  1EZJ A;  5B1B B;  1OCZ C;  1Y8O A;  3E8F A;  3SPC A;  3CC4 V;  1COW G;  3HHU A;  2HG1 A;  1QCE A;  5CTY A;  4QPJ A;  4P8O A;  1UYL A;  1CP9 A;  2IU0 A;  3D0B A;  1NHJ A;  2HFE C;  3CC7 V;  1V54 B;  2YKE A;  2CK3 G;  3IED A;  5B1O A;  1UJW B;  4YKR A;  5FND A;  4MT8 A;  3BY6 A;  3R65 A;  3W7X A;  3CD6 V;  3OWB A;  2OT5 A;  3AEI A;  3W7S A;  2BSM A;  4G2K A;  1FXV A;  2IU3 A;  3G7B A;  5EK0 A;  5L3B A;  3P32 A;  2LP7 A;  3K60 A;  1ROP A;  3QNE A;  2ITD C;  5L3D A;  1QVF U;  4CWO A;  2DYS B;  1I58 A;  3K04 A;  4JAU A;  1YS3 A;  3ABM C;  2YEC A;  4FCR A;  3E8H A;  4CWP A;  1TID A;  2EIN B;  5CTU A;  2XX2 A;  4WFF A;  2LFS A;  1P7B A;  4L93 A;  2HLD G;  5CPH A;  4ASG A;  3QDD A;  4BW5 A;  2CGF A;  1THZ A;  3OMU A;  5CTW A;  3ABK C;  4UVC A;  4YKW A;  3EHH A;  4AWO A;  3INX A;  2IOP A;  2XOK G;  2F43 G;  1I5D A;  1YHQ V;  3ZKD A;  4O0B A;  1DLB A;  2MK3 A;  1BHA A;  1KC8 W;  1JVM A;  1U2O A;  1M57 B;  2WWW A;  4MTF A;  3ABL C;  4ASA A;  3T2M A;  1Q7Y W;  2XJJ A;  3RVY A;  1QYE A;  5EC1 C;  4GT1 A;  4LWG A;  3OUF A;  5M4P A;  3LDE A;  2XHR A;  3A0T A;  2A79 B;  3G75 A;  2JEU A;  2R9I A;  4H7Q A;  2W6I G;  1JQ0 A;  2W0F C;  5B3S B;  2EBO A;  4X9L A;  4WFB V;  2HCH A;  3I55 V;  1OCZ B;  4V25 A;  1R6N A;  1UY8 A;  1AJP A;  4CWR A;  2WLI B;  5CBF A;  3K06 A;  4XTJ A;  4ASF A;  3FB7 C;  1TBW A;  4NH8 A;  3SPJ A;  1AI5 A;  5LGT A;  1B3Q A;  3LSQ A;  2XX5 A;  4YKX A;  2WLK A;  2BRC A;  2XX4 A;  3Q5K A;  2B1I A;  3SPG A;  1UY9 A;  3T0Z A;  4UV8 A;  4FMT A;  3ZJZ A;  3ZMZ A;  1R6K A;  1S3J A;  4PA7 A;  3RVZ A;  3ZN1 A;  4KSG A;  3A0R A;  2OCC C;  2QM7 A;  3CCE V;  1K9M W;  4WUD A;  4BQJ A;  1KEC A;  2EZO A;  2M7W A;  3T1C A;  1F51 A;  4LP8 A;  2FTK A;  3T4Z A;  2P67 A;  2WLI A;  2P90 A;  1H2G A;  1H8H G;  3CCU V;  2ZXW B;  1YJ9 V;  1H7U A;  3ABM B;  3IGA C;  4QE7 A;  1BYQ A;  4URO A;  4MPE A;  1AH8 A;  4LC1 A;  1I5A A;  5L3J A;  3ABK B;  1K7D A;  3ZXQ A;  4MW3 A;  4FPP A;  1GO3 F;  3MHS C;  5F5R A;  2IW5 A;  2Q69 A;  4WCE V;  2YK9 A;  3IFX A;  2FWZ A;  3E8G A;  1DF5 A;  1TIL A;  4GX2 A;  3R4M A;  4JAV A;  2YGF A;  3ZXO A;  5BZB A;  4DO2 A;  1OSF A;  2Y48 A;  4LPB A;  3RBZ A;  1GJV A;  3A0Z A;  1OZ0 A;  1M90 W;  4QIW F;  4LWF A;  4J9Y B;  2YEA A;  3ABL B;  4LWI A;  4GGL A;  3OR7 C;  3K98 A;  1VQN V;  3B77 A;  4XD8 A;  3AG1 C;  4XKO A;  4QJF B;  4GQT A;  1Y4U A;  3HB3 B;  5IN9 A;  4RUF A;  3EHF A;  3ETE A;  2Q67 A;  1QLN A;  4AWP A;  4JYB A;  3STZ C;  5H6Q A;  1OCO C;  3ASN C;  3ZMT A;  2X7R B;  2YEV A;  5LHH A;  2DW4 A;  4P9O A;  2XAH A;  3LDC A;  1ZXN A;  1P4R A;  1R62 A;  5CBH A;  1R73 A;  1SER A;  3TZ2 A;  4PL9 A;  1B62 A;  2E0A A;  4N23 A;  3SJQ C;  1ORQ C;  4MPC A;  2YI5 A;  1F23 A;  2H8M A;  3INW A;  3I56 V;  1ZW9 A;  5IYD O;  2Q68 A;  4BQG A;  3EKO A;  2FWY A;  2V7Q G;  3QO8 A;  3PEH A;  3GB7 C;  3CRK A;  4PRX A;  4WUC A;  3KG2 A;  3ZMS A;  1QBZ A;  5L3C A;  1Y4M A;  1YJN V;  4QNH B;  2P6J A;  2YE4 A;  4P7A A;  3FYE B;  4MW8 A;  3OMN B;  4V26 A;  2EIL C;  1YES A;  5FNF A;  1Y66 A;  3W7U A;  3CMA V;  4WFG A;  3X2Q C;  1GTO A;  2IOR A;  3ETG A;  2ZKJ A;  5D7R A;  4JAS A;  4L94 A;  2K5B A;  2WEP A;  3OR6 C;  1PD3 A;  3MD0 A;  1K5Q A;  3HEK A;  4KSH A;  3ZIA G;  3FB5 C;  2UXN A;  3VHD A;  2XND G;  3TZ5 A;  4AS9 A;  2WPD G;  1EBO A;  4I5S A;  4BAY A;  4CZZ A;  3QTF A;  3CCJ V;  1PKX A;  3LNU A;  3P30 A;  3T1K A;  2ZQM A;  1W0K G;  2BOC C;  3AG1 B;  2WER A;  4PRV A;  2ZD9 A;  1CEZ A;  2Q8I A;  2A9H A;  3ZCC A;  3G7E A;  1YIT V;  4MB9 A;  2EXL A;  1YET A;  1AJQ A;  1VQ4 V;  3K03 A;  4W7T A;  2WI7 A;  2VCJ A;  2XAG A;  5D7C A;  1VQ5 V;  1K97 A;  1AH6 A;  2YE5 A;  4GT8 A;  1OCO B;  5LGN A;  4MVR A;  3ASN B;  3A0W A;  3GIG B;  4RUE A;  1FXK C;  3CRL A;  3K0D A;  5D7D A;  1I5C A;  1VQ8 V;  4JF3 A;  5HFL A;  3BM9 A;  2BRE A;  2HJF C;  4HAM A;  1KP2 A;  5M4K A;  2YE8 A;  1YTF D;  2Y69 C;  4XBF A;  3VHC A;  4E01 A;  1FS0 G;  4XIP A;  4QE9 A;  2YEJ A;  3SPH A;  3ZMU A;  2OTJ V;  3F7Y C;  4XCL A;  4F4L A;  1KZN A;  4YKU A;  2DYR B;  2BU6 A;  2BTZ A;  5EBM C;  4MVM A;  4GX0 A;  2FXS A;  1OHH G;  4RQE A;  2XDL A;  4UV9 A;  3QO7 A;  2PNR A;  2K1E A;  1S16 A;  1JJ2 U;  4WUB A;  3CGY A;  2BOB C;  2YI6 A;  3B24 A;  4XE2 A;  2Z3Y A;  2EIL B;  1K5S A;  4JQL A;  3JD0 A;  3AG2 C;  1S0V A;  1VQO V;  3X2Q B;  3OPD A;  5LBQ A;  2WI6 A;  3O2F A;  4E00 A;  4HYM A;  2AHZ A;  1KP3 A;  2XJX A;  5B1N A;  5M4N A;  1M1K W;  3TUH A;  1FXH A;  3FKS G;  2O1V A;  5CMU A;  5LGU A;  4XIR A;  5DM6 V;  4JGS A;  1K4D C;  2YEE A;  2YKC A;  3FT5 A;  1DF4 A;  5KA6 A;  3U2K A;  4PA9 A;  1H7S A;  1BKN A;  3WQ9 A;  5EC2 C;  4N21 A;  2EJR A;  4CWS A;  1NVP D;  2DWD C;  2FYP A;  1R3I C;  5J6A A;  2Q2E B;  2HG5 C;  2ZR3 A;  4ZKI A;  2HKJ A;  1VQ6 V;  4R3M A;  1YT0 A;  4H37 A;  4L87 A;  1DTO A;  3ABU A;  3CCR V;  1B6Q A;  4MTG A;  1UYG A;  5KUM A;  4MVS A;  1UYI A;  2JJC A;  2ITC C;  1LNQ A;  5H9C A;  2BT0 A;  1NQT A;  4YKZ A;  2X0L A;  4Q20 A;  1NBM G;  1UYD A;  1UYH A;  1G8M A;  4FK5 C;  1K34 A;  4TSF G;  1FXK B;  2OTL V;  5EBL C;  2QF6 A;  2IJJ A;  1I5Y A;  1MU5 A;  3JD4 A;  1AJN A;  2Y69 B;  5GW7 A;  2XD6 A;  1Z5C A;  4YXW G;  1QLE C;  4AWQ A;  2CH4 A;  2QFO A;  3RLP A;  3BEH A;  4EGI A;  3W7W A;  1NR7 A;  2BU8 A;  1YTF B;  2HVJ C;  3ABT A;  2X6B A;  5FL7 G;  4U7N A;  3NXS A;  3G71 V;  1TC6 A;  3SYO A;  3AG3 C;  1AI4 A;  2X6C A;  3CWV A;  2GHY A;  2YK2 A;  4HXW A;  2EIJ C;  1YSR A;  5IYC O;  3VHA A;  5DN6 G;  3VAD A;  1KD1 W;  1FXK A;  2LFR A;  4E02 A;  1NH2 D;  2XDX A;  3C11 A;  2WI4 A;  2KB1 A;  1HWY A;  3AG2 B;  1AJ6 A;  4LP0 A;  3CCM V;  2ATK C;  5J9P C;  1V55 C;  3E35 A;  4CE2 A;  2GFD A;  4JYC A;  3SPI A;  1GM9 A;  3D36 A;  1S77 D;  3OEH G;  4FIP C;  2XDU A;  2JJ2 G;  4HXZ A;  5BOC A;  4RO2 A;  2WEQ A;  4MOT A;  1ENV A;  3CCS V;  3C0E A;  5E1A C;  2QM8 A;  3OMI B;  1E1R G;  3RKZ A;  3MHH C;  1B63 A;  2YGE A;  1MG1 A;  2WI5 A;  3OW2 U;  3T2S A;  1BXD A;  3JCZ A;  1NR1 A;  3LSS A;  2Q6A A;  2PI4 A;  4MVQ A;  1PL0 A;  5M4M A;  4U93 A;  2QE7 G;  1CPY A;  1NVP B;  1YJW V;  1VQL V;  1YC3 A;  1VQM V;  2UWD A;  5KUK A;  4KFG A;  1S14 A;  5CN0 A;  3M99 B;  3CC2 V;  4PDL A;  1S72 V;  1K92 A;  1ZXM A;  1JX9 A;  3K79 A;  2ZDI C;  2YKJ A;  4BAE A;  1OCR C;  1MOF A;  2XDS A;  1AI6 A;  2JKI A;  1R3K C;  3O0I A;  1QLE B;  4MVZ A;  4HZ5 A;  1GKZ A;  2P7T C;  4JTA B;  1VQ9 V;  3EKR A;  1JM6 A;  1R3L C;  2DQ0 A;  2B1G A;  2ZR2 A;  1BHB A;  4XC0 A;  3K97 A;  3UKM A;  3E83 A;  3GIE A;  2OCC B;  4WF9 V;  2QKS A;  1R3J C;  2H8P C;  3AG3 B;  2WI1 A;  3OGC C;  4EFU A;  3HZ5 A;  2EIJ B;  5IY5 C;  4XDL A;  1YC1 A;  4DXW A;  2B5U A;  3HPL C;  1BMF G;  4H85 A;  5BOD A;  3D3I A;  2XJG A;  4MVU A;  4LWE A;  2JIZ G;  1TUE B;  2XAJ A;  3U67 A;  3EHJ A;  3IC7 A;  3FB8 C;  4ZVI A;  1V55 B;  4XDM A;  4FJC C;  1SRY A;  1NH2 B;  5IDJ A;  4EGH A;  4OXS A;  4ZBM A;  3K08 A;  3R4O A;  4LCU C;  2IH1 C;  2WI2 A;  5C93 A;  1K3E A;  5F3K A;  1K33 A;  5D6P A;  2X6A A;  1S76 D;  4GEE A;  1Y4S A;  4HZ0 A;  2YJX A;  4HYP A;  1TH8 A;  3G4S V;  1YER A;  4MP2 A;  2WLL B;  2EIN C;  4PU9 A;  2CG9 A;  1KIJ A;  3QO5 A;  4CWT A;  2YI0 A;  1BGQ A;  4EMV A;  2A0L A;  1GM7 A;  3LPS A;  4XIQ A;  4R1F A;  3CYO A;  4MVO A;  1N8R W;  3WHA A;  2EZP A;  5FWK A;  3FB6 C;  3SYP A;  4R3A A;  2Q8G A;  1AMW A;  1QVG U;  1JPX A;  3E86 A;  2BYH A;  3K99 A;  5L3G A;  1I5X A;  3OM3 B;  4UVB A;  2YEH A;  1US7 A;  1KKD A;  1L1F A;  3TCU A;  2AKP A;  3NMQ A;  3RLR A;  4EFT A;  2WLL A;  1EA6 A;  1Y8N A;  1OCR B;  2YKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...