1I58A

Structure of the histidine kinase chea atp-binding domain in complex with atp analog adpcp and magnesium
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
189
structure length
189
Chain Sequence
GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein, transferase
molecule keywords CHEMOTAXIS PROTEIN CHEA
total genus 61
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i58A00
1I5DA 4ASBA 2XK2A 3A0TA 1TC6A 1Y4SA 4O0BA 4KFGA 2Q8HA 4I3HA 1UY8A 1I58A 3K98A 3B24A 4HY6A 4EEHA 3EHGA 1I59A 1YC1A 2IORA 4XE2A 2IOQA 1NHJA 1EA6A 1MU5A 4GEEA 4CWTA 3ZKBA 2IOPA 2CCTA 4BQGA 4U7OA 3IEDA 3TTZA 1YS3A 4XC0A 2QG0A 5FWKA 2XJJA 3U67A 2ZDYA 3KE6A 2YE7A 5M4MA 1U0ZA 4K4OA 2HCHA 4U7NA 5CTXA 3G7BA 2YGFA 2XX4A 2WI6A 3JZ3A 3QTFA 1R62A 2BREA 2PNRA 1NHHA 4MPNA 5CTWA 2YI0A 4FPPA 4EFUA 3Q5LA 2K5BA 4YKYA 4LWIA 2WERA 2ZBKB 5GGZA 2YE3A 4EMVA 1BYQA 4HYMA 4JASA 2EXLA 4FMTA 1UYDA 4XITA 4URNA 2YEAA 2XDLA 3FV5A 4I5SA 3PEHA 3OMUA 4LWEA 4CWSA 1TC0A 2AKPA 4FCRA 4XDMA 5F5RA 4NH9A 3EKOA 4AS9A 4L93A 4KP4A 4KSHA 1BKNA 4JAUA 2UWDA 3T10A 5IN9A 3VHCA 2WI2A 3C0EA 2YEIA 2CH4A 3OWDA 3RLQA 4HY1A 1Y4UA 3U2DA 1Y8OA 3A0YA 4R1FA 2GQPA 4ASAA 5F3KA 1ZXNA 3A0XA 3RKZA 1H7UA 5BOCA 1TBWA 3TZ5A 5IDMA 4P8OA 3H80A 4KSGA 1UYLA 2C2AA 3D0BA 3PEJA 4CE2A 3TZ4A 3GIGA 4ASFA 3VADA 2XDXA 4MPEA 3EHHA 1YESA 4UROA 4PRVA 3D2RA 1UYMA 3FT8A 5D6PA 3SL2A 1YETA 4H85A 5C93A 3R4OA 1UYEA 2BYHA 4DZYA 5M4EA 2YKIA 2BU8A 2Q8GA 5BODA 3B27A 2VCIA 4CE3A 1B63A 2JKIA 2YGEA 1TILA 3EHFA 1QY8A 1UY6A 3RLRA 4FCQA 4U93A 4YKUA 3DGEA 5CTUA 5J71A 4MB9A 1YSRA 1UYGA 2CGFA 3R92A 3EHJA 4CWQA 3HYZA 4Q20A 4HYPA 2XABA 3GIGB 3INWA 3ZM7A 3CRLA 4GQTA 3CWVA 2ZKJA 1B62A 4XD8A 4GCZA 5M4NA 1QYEA 4JQLA 1YERA 3QDDA 3G7EA 1UYHA 4B7PA 5D7RA 1ZXMA 1PVGA 1S16A 1UY9A 1AH6A 1I5BA 2XD6A 2YEDA 4XKOA 2XX5A 2WEPA 2WI5A 3EKRA 3G75A 3R4NA 1GKXA 3R4MA 1BXDA 4XIQA 3HZ5A 5FNDA 3B28A 4CWNA 1GJVA 3WHAA 3Q5KA 4E01A 1BGQA 5M4HA 2YEFA 4AWQA 1KIJA 3K99A 3GIFA 3GIEA 4H81A 4W7TA 4GT8A 3K60A 1QZRA 2YK9A 3CGYA 4BXIA 2BYIA 1Z5BA 2XDUA 2YE2A 4O05A 5D7DA 4DUHA 3HEKA 3LNUA 1I5AA 2HG1A 2BTZA 4NH8A 1ZWHA 2WI4A 2E0AA 3K97A 3T0HA 1UYKA 4XIRA 4V26A 2FYPA 1AJ6A 1Y8NA 4L8ZA 4MP2A 4XCJA 2BRCA 1US7A 2QG2A 4AWOA 2YEGA 2O1WA 4EGHA 3A0RA 2YE5A 2BU6A 1Z59A 2YI5A 4CE1A 4FCPA 1ID0A 4WUBA 1YT0A 2YE8A 2YEHA 1Z5AA 2YE4A 3ZXOA 3R91A 2BSMA 2YEBA 1TH8A 4LWGA 4EFTA 4PU9A 4MBCA 1YSZA 1S14A 1YC4A 1UYIA 4GGLA 4XIPA 4EM7A 1GKZA 4WUCA 4YKTA 3O6OA 3INXA 3TUHA 1L0OA 2XCMA 4P7AA 4H7QA 1A4HA 3BM9A 4LP0A 4AWPA 4YKQA 4L90A 4HXWA 2BU5A 4CWFA 4E00A 2FXSA 3OPDA 2YKJA 2Q2EB 2XHTA 2BU7A 2YI7A 3TZ0A 5M4PA 4XKKA 5D6QA 4EGKA 3OW6A 2YKBA 3LPSA 4KQVA 2O1UA 1UY7A 3O2FA 1MX0A 4LWHA 1OSFA 4MOTA 1THNA 2IWUA 4O04A 4URMA 1NHIA 1I5CA 2ESAA 4LWFA 2XJXA 3T1KA 2YEJA 2XJGA 4EGIA 4GFNA 5CTYA 4L91A 4BAEA 2XDKA 3HHUA 4HXZA 3WQ9A 1YC3A 2YGAA 2HKJA 2O1VA 4WUDA 4ASGA 4KTNA 3O0IA 2YKEA 4URLA 2ZDXA 2YJWA 2BT0A 1B3QA 4YKZA 2FWZA 4MPCA 3ZKDA 2WI7A 4R3AA 3FT5A 4CWPA 3H4LA 5FNFA 2FWYA 5M4KA 2CG9A 4PL9A 2IWSA 5IDJA 1YT2A 4XKAA 2CCSA 1AM1A 4MP7A 1KZNA 1AMWA 1UYFA 4L94A 4E02A 4ZKIA 5CF0A 3T2SA 4CWRA 4O09A 4NH7A 3C11A 1Z5CA 2YK2A 2YE9A 4X9LA 1ZW9A 2Q8FA 2WI3A 2GFDA 2WEQA 2YE6A 2WI1A 4BIUA 1TIDA 3BMYA 3OWBA 5J6AA 2BU2A 2VCJA 2VW5A 2XX2A 3HZ1A 3TZ2A 2YI6A 3HYYA 4XTJA 1JM6A 4O07A 2CCUA 2JJCA 2QF6A 2H8MA 4PRXA 4YKWA 3MNRP 2H55A 4B6CA 3D36A 4YKXA 5L3JA 5D7CA 4CWOA 1UYCA 4HZ0A 5CPHA 2YJXA 1Y8PA 3VHAA 3NMQA 4JAVA 2YECA 2YKCA 3A0WA 1H7SA 1EI1A 4ZVIA 3B26A 4HZ5A 4QPJA 2VWCA 2IWXA 2XHRA 3CRKA 4BIZA 3A0ZA 4LPBA 2XHXA 1U2OA 1YT1A 4YKRA 3R4PA 4V25A 3CGZA 3U2KA 3B25A 3ZXQA 4QPKA 4XCLA 1AH8A 4BQJA 2BZ5A 2Q8IA 3T0ZA 5FNCA 2QFOA 3Q5JA 3RLPA 2XDSA 4R3MA 3VHDA 2YEEA
chains in the Genus database with same CATH superfamily
1I5DA 4ASBA 2XK2A 3A0TA 1TC6A 1Y4SA 4O0BA 4KFGA 2Q8HA 4I3HA 1UY8A 1I58A 3K98A 3B24A 4HY6A 4EEHA 3EHGA 1I59A 1YC1A 2IORA 4XE2A 2IOQA 1NHJA 1EA6A 1MU5A 4GEEA 4CWTA 3ZKBA 2IOPA 2CCTA 4BQGA 4U7OA 3IEDA 3TTZA 1YS3A 4XC0A 2QG0A 5FWKA 2XJJA 3U67A 2ZDYA 3KE6A 2YE7A 5M4MA 1U0ZA 4K4OA 2HCHA 4U7NA 5CTXA 3G7BA 2YGFA 2XX4A 2WI6A 3JZ3A 3QTFA 1R62A 2BREA 2PNRA 1NHHA 4MPNA 5CTWA 2YI0A 4FPPA 4EFUA 3Q5LA 2K5BA 4YKYA 4LWIA 2WERA 2ZBKB 5GGZA 2YE3A 4EMVA 1BYQA 4HYMA 4JASA 2EXLA 4FMTA 2C1IA 1UYDA 4XITA 4URNA 2YEAA 2XDLA 3FV5A 4I5SA 3PEHA 3OMUA 4LWEA 4CWSA 1TC0A 2AKPA 4FCRA 4E72A 4XDMA 5F5RA 4NH9A 3EKOA 4AS9A 4L93A 4KP4A 4KSHA 1BKNA 4JAUA 2UWDA 3T10A 5IN9A 3VHCA 2WI2A 3C0EA 3CYGA 2YEIA 2CH4A 3OWDA 3RLQA 4HY1A 1Y4UA 3U2DA 1Y8OA 3A0YA 4R1FA 2GQPA 4ASAA 5F3KA 1ZXNA 3A0XA 3RKZA 1H7UA 5BOCA 1TBWA 3TZ5A 5IDMA 4P8OA 3H80A 4KSGA 1UYLA 2C2AA 3D0BA 3PEJA 4CE2A 3TZ4A 3GIGA 4ASFA 3VADA 2XDXA 4MPEA 3EHHA 1YESA 4UROA 4PRVA 3D2RA 1UYMA 3FT8A 5D6PA 3SL2A 1YETA 2HHIA 4H85A 5C93A 3R4OA 1UYEA 2BYHA 4DZYA 5M4EA 2YKIA 2BU8A 2Q8GA 5BODA 3B27A 2VCIA 4CE3A 1B63A 2JKIA 2YGEA 3S5TA 1TILA 3EHFA 1QY8A 1UY6A 3RLRA 4FCQA 4U93A 4YKUA 3DGEA 5CTUA 5J71A 4MB9A 1YSRA 1UYGA 2CGFA 3R92A 3EHJA 4CWQA 3HYZA 4Q20A 4HYPA 2XABA 3GIGB 3INWA 3ZM7A 3CRLA 4GQTA 3CWVA 2ZKJA 1B62A 4XD8A 4GCZA 5M4NA 1QYEA 4JQLA 1YERA 3QDDA 3G7EA 1UYHA 4B7PA 5D7RA 1ZXMA 1PVGA 1S16A 1UY9A 1AH6A 1I5BA 2XD6A 2YEDA 4XKOA 2XX5A 2WEPA 2WI5A 3EKRA 3G75A 3R4NA 1GKXA 3R4MA 1BXDA 4XIQA 3HZ5A 3LMMA 5FNDA 3B28A 4CWNA 1GJVA 3WHAA 3Q5KA 4E01A 1BGQA 5M4HA 2YEFA 4AWQA 1KIJA 3K99A 3GIFA 3GIEA 4H81A 4W7TA 4GT8A 3K60A 1QZRA 2YK9A 3CGYA 4BXIA 2BYIA 1Z5BA 2XDUA 2YE2A 4O05A 5D7DA 4DUHA 3HEKA 3LNUA 1I5AA 2HG1A 2BTZA 4NH8A 1ZWHA 2WI4A 2E0AA 3K97A 3T0HA 1UYKA 4XIRA 4V26A 2FYPA 1AJ6A 1Y8NA 4L8ZA 4MP2A 4XCJA 2BRCA 1US7A 2QG2A 4AWOA 2YEGA 2O1WA 4EGHA 3A0RA 2YE5A 2BU6A 1Z59A 2YI5A 4CE1A 4FCPA 1ID0A 4WUBA 1YT0A 2YE8A 2YEHA 1Z5AA 2YE4A 3ZXOA 3R91A 2BSMA 2YEBA 1TH8A 4LWGA 4EFTA 4PU9A 4MBCA 1YSZA 1S14A 1YC4A 1UYIA 4GGLA 4XIPA 4EM7A 1GKZA 4WUCA 4YKTA 3O6OA 3INXA 3TUHA 1L0OA 2XCMA 4P7AA 4H7QA 1A4HA 2FTKA 3BM9A 4LP0A 4AWPA 4YKQA 2C1GA 4L90A 4HXWA 2BU5A 4CWFA 4E00A 2FXSA 3OPDA 2YKJA 2Q2EB 2XHTA 2BU7A 2YI7A 3TZ0A 5M4PA 4XKKA 5D6QA 4EGKA 3OW6A 2YKBA 3LPSA 4KQVA 2O1UA 1UY7A 3O2FA 1MX0A 4LWHA 1OSFA 4MOTA 1THNA 2IWUA 4O04A 4URMA 1NHIA 1I5CA 2ESAA 4LWFA 2XJXA 3T1KA 2YEJA 2XJGA 4EGIA 4GFNA 5CTYA 4L91A 4BAEA 2XDKA 3HHUA 4HXZA 3WQ9A 1YC3A 2YGAA 2HKJA 2O1VA 4WUDA 4ASGA 4KTNA 3O0IA 2YKEA 4URLA 2ZDXA 2YJWA 2BT0A 1B3QA 4YKZA 2FWZA 4MPCA 3ZKDA 2WI7A 4R3AA 3FT5A 4CWPA 3H4LA 5FNFA 2FWYA 5M4KA 2CG9A 4PL9A 2IWSA 5IDJA 1YT2A 4XKAA 2CCSA 1AM1A 4MP7A 1KZNA 1AMWA 1UYFA 4L94A 4E02A 4ZKIA 5CF0A 3T2SA 4CWRA 4O09A 4NH7A 3C11A 1Z5CA 2YK2A 2YE9A 4X9LA 1ZW9A 2Q8FA 2WI3A 2GFDA 5JENA 2WEQA 2YE6A 1F51A 2WI1A 4BIUA 1TIDA 3BMYA 1IXMA 3OWBA 5J6AA 2BU2A 2VCJA 2VW5A 2XX2A 3HZ1A 3TZ2A 2YI6A 3HYYA 4XTJA 1JM6A 4O07A 2CCUA 2JJCA 2QF6A 2H8MA 4PRXA 4YKWA 3MNRP 2H55A 4B6CA 3D36A 4YKXA 5L3JA 5D7CA 4CWOA 1UYCA 4HZ0A 5CPHA 2YJXA 1Y8PA 3VHAA 3NMQA 4JAVA 2YECA 2YKCA 3A0WA 1H7SA 1EI1A 4ZVIA 3B26A 4HZ5A 4QPJA 2VWCA 2IWXA 2XHRA 3CRKA 4BIZA 3A0ZA 4LPBA 2XHXA 1U2OA 1YT1A 4YKRA 3R4PA 4V25A 3CGZA 3U2KA 3B25A 3ZXQA 4QPKA 4XCLA 1AH8A 4BQJA 2BZ5A 2Q8IA 3T0ZA 5FNCA 2QFOA 3Q5JA 3RLPA 2XDSA 4R3MA 3VHDA 2YEEA
chains in the Genus database with same CATH topology
1I5DA 4ASBA 2XK2A 3A0TA 1TC6A 1Y4SA 4O0BA 4KFGA 2Q8HA 4I3HA 1UY8A 1I58A 3K98A 3B24A 4HY6A 4EEHA 3EHGA 1I59A 1YC1A 2IORA 4XE2A 2IOQA 1NHJA 1EA6A 1MU5A 4GEEA 4CWTA 3ZKBA 2IOPA 2CCTA 4BQGA 4U7OA 3IEDA 3TTZA 1YS3A 4XC0A 2QG0A 5FWKA 2XJJA 3U67A 2ZDYA 3KE6A 2YE7A 5M4MA 1U0ZA 4K4OA 2HCHA 4U7NA 5CTXA 3G7BA 2YGFA 2XX4A 2WI6A 3JZ3A 3QTFA 1R62A 2BREA 2PNRA 1NHHA 4MPNA 5CTWA 2YI0A 4FPPA 4EFUA 3Q5LA 2K5BA 4YKYA 4LWIA 2WERA 2ZBKB 5GGZA 2YE3A 4EMVA 1BYQA 4HYMA 4JASA 2EXLA 4FMTA 1UYDA 4XITA 4URNA 2YEAA 2XDLA 3FV5A 4I5SA 3PEHA 3OMUA 4LWEA 4CWSA 1TC0A 2AKPA 4FCRA 4XDMA 5F5RA 4NH9A 3EKOA 4AS9A 4L93A 4KP4A 4KSHA 1BKNA 4JAUA 2UWDA 3T10A 5IN9A 3VHCA 2WI2A 3C0EA 2YEIA 2CH4A 3OWDA 3RLQA 4HY1A 1Y4UA 3U2DA 1Y8OA 3A0YA 4R1FA 2GQPA 4ASAA 5F3KA 1ZXNA 3A0XA 3RKZA 1H7UA 5BOCA 1TBWA 3TZ5A 5IDMA 4P8OA 3H80A 4KSGA 1UYLA 2C2AA 3D0BA 3PEJA 4CE2A 3TZ4A 3GIGA 4ASFA 3VADA 2XDXA 4MPEA 3EHHA 1YESA 4UROA 4PRVA 3D2RA 1UYMA 3FT8A 5D6PA 3SL2A 1YETA 4H85A 5C93A 3R4OA 1UYEA 2BYHA 4DZYA 5M4EA 2YKIA 2BU8A 2Q8GA 5BODA 3B27A 2VCIA 4CE3A 1B63A 2JKIA 2YGEA 1TILA 3EHFA 1QY8A 1UY6A 3RLRA 4FCQA 4U93A 4YKUA 3DGEA 5CTUA 5J71A 4MB9A 1YSRA 1UYGA 2CGFA 3R92A 3EHJA 4CWQA 3HYZA 4Q20A 4HYPA 2XABA 3GIGB 3INWA 3ZM7A 3CRLA 4GQTA 3CWVA 2ZKJA 1B62A 4XD8A 4GCZA 5M4NA 1QYEA 4JQLA 1YERA 3QDDA 3G7EA 1UYHA 4B7PA 5D7RA 1ZXMA 1PVGA 1S16A 1UY9A 1AH6A 1I5BA 2XD6A 2YEDA 4XKOA 2XX5A 2WEPA 2WI5A 3EKRA 3G75A 3R4NA 1GKXA 3R4MA 1BXDA 4XIQA 3HZ5A 5FNDA 3B28A 4CWNA 1GJVA 3WHAA 3Q5KA 4E01A 1BGQA 5M4HA 2YEFA 4AWQA 1KIJA 3K99A 3GIFA 3GIEA 4H81A 4W7TA 4GT8A 3K60A 1QZRA 2YK9A 3CGYA 4BXIA 2BYIA 1Z5BA 2XDUA 2YE2A 4O05A 5D7DA 4DUHA 3HEKA 3LNUA 1I5AA 2HG1A 2BTZA 4NH8A 1ZWHA 2WI4A 2E0AA 3K97A 3T0HA 1UYKA 4XIRA 4V26A 2FYPA 1AJ6A 1Y8NA 4L8ZA 4MP2A 4XCJA 2BRCA 1US7A 2QG2A 4AWOA 2YEGA 2O1WA 4EGHA 3A0RA 2YE5A 2BU6A 1Z59A 2YI5A 4CE1A 4FCPA 1ID0A 4WUBA 1YT0A 2YE8A 2YEHA 1Z5AA 2YE4A 3ZXOA 3R91A 2BSMA 2YEBA 1TH8A 4LWGA 4EFTA 4PU9A 4MBCA 1YSZA 1S14A 1YC4A 1UYIA 4GGLA 4XIPA 4EM7A 1GKZA 4WUCA 4YKTA 3O6OA 3INXA 3TUHA 1L0OA 2XCMA 4P7AA 4H7QA 1A4HA 3BM9A 4LP0A 4AWPA 4YKQA 4L90A 4HXWA 2BU5A 4CWFA 4E00A 2FXSA 3OPDA 2YKJA 2Q2EB 2XHTA 2BU7A 2YI7A 3TZ0A 5M4PA 4XKKA 5D6QA 4EGKA 3OW6A 2YKBA 3LPSA 4KQVA 2O1UA 1UY7A 3O2FA 1MX0A 4LWHA 1OSFA 4MOTA 1THNA 2IWUA 4O04A 4URMA 1NHIA 1I5CA 2ESAA 4LWFA 2XJXA 3T1KA 2YEJA 2XJGA 4EGIA 4GFNA 5CTYA 4L91A 4BAEA 2XDKA 3HHUA 4HXZA 3WQ9A 1YC3A 2YGAA 2HKJA 2O1VA 4WUDA 4ASGA 4KTNA 3O0IA 2YKEA 4URLA 2ZDXA 2YJWA 2BT0A 1B3QA 4YKZA 2FWZA 4MPCA 3ZKDA 2WI7A 4R3AA 3FT5A 4CWPA 3H4LA 5FNFA 2FWYA 5M4KA 2CG9A 4PL9A 2IWSA 5IDJA 1YT2A 4XKAA 2CCSA 1AM1A 4MP7A 1KZNA 1AMWA 1UYFA 4L94A 4E02A 4ZKIA 5CF0A 3T2SA 4CWRA 4O09A 4NH7A 3C11A 1Z5CA 2YK2A 2YE9A 4X9LA 1ZW9A 2Q8FA 2WI3A 2GFDA 2WEQA 2YE6A 2WI1A 4BIUA 1TIDA 3BMYA 3OWBA 5J6AA 2BU2A 2VCJA 2VW5A 2XX2A 3HZ1A 3TZ2A 2YI6A 3HYYA 4XTJA 1JM6A 4O07A 2CCUA 2JJCA 2QF6A 2H8MA 4PRXA 4YKWA 3MNRP 2H55A 4B6CA 3D36A 4YKXA 5L3JA 5D7CA 4CWOA 1UYCA 4HZ0A 5CPHA 2YJXA 1Y8PA 3VHAA 3NMQA 4JAVA 2YECA 2YKCA 3A0WA 1H7SA 1EI1A 4ZVIA 3B26A 4HZ5A 4QPJA 2VWCA 2IWXA 2XHRA 3CRKA 4BIZA 3A0ZA 4LPBA 2XHXA 1U2OA 1YT1A 4YKRA 3R4PA 4V25A 3CGZA 3U2KA 3B25A 3ZXQA 4QPKA 4XCLA 1AH8A 4BQJA 2BZ5A 2Q8IA 3T0ZA 5FNCA 2QFOA 3Q5JA 3RLPA 2XDSA 4R3MA 3VHDA 2YEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5D A;  4ASB A;  2XK2 A;  3A0T A;  1TC6 A;  1Y4S A;  4O0B A;  4KFG A;  2Q8H A;  4I3H A;  1UY8 A;  1I58 A;  3K98 A;  3B24 A;  4HY6 A;  4EEH A;  3EHG A;  1I59 A;  1YC1 A;  2IOR A;  4XE2 A;  2IOQ A;  1NHJ A;  1EA6 A;  1MU5 A;  4GEE A;  4CWT A;  3ZKB A;  2IOP A;  2CCT A;  4BQG A;  4U7O A;  3IED A;  3TTZ A;  1YS3 A;  4XC0 A;  2QG0 A;  5FWK A;  2XJJ A;  3U67 A;  2ZDY A;  3KE6 A;  2YE7 A;  5M4M A;  1U0Z A;  4K4O A;  2HCH A;  4U7N A;  5CTX A;  3G7B A;  2YGF A;  2XX4 A;  2WI6 A;  3JZ3 A;  3QTF A;  1R62 A;  2BRE A;  2PNR A;  1NHH A;  4MPN A;  5CTW A;  2YI0 A;  4FPP A;  4EFU A;  3Q5L A;  2K5B A;  4YKY A;  4LWI A;  2WER A;  2ZBK B;  5GGZ A;  2YE3 A;  4EMV A;  1BYQ A;  4HYM A;  4JAS A;  2EXL A;  4FMT A;  1UYD A;  4XIT A;  4URN A;  2YEA A;  2XDL A;  3FV5 A;  4I5S A;  3PEH A;  3OMU A;  4LWE A;  4CWS A;  1TC0 A;  2AKP A;  4FCR A;  4XDM A;  5F5R A;  4NH9 A;  3EKO A;  4AS9 A;  4L93 A;  4KP4 A;  4KSH A;  1BKN A;  4JAU A;  2UWD A;  3T10 A;  5IN9 A;  3VHC A;  2WI2 A;  3C0E A;  2YEI A;  2CH4 A;  3OWD A;  3RLQ A;  4HY1 A;  1Y4U A;  3U2D A;  1Y8O A;  3A0Y A;  4R1F A;  2GQP A;  4ASA A;  5F3K A;  1ZXN A;  3A0X A;  3RKZ A;  1H7U A;  5BOC A;  1TBW A;  3TZ5 A;  5IDM A;  4P8O A;  3H80 A;  4KSG A;  1UYL A;  2C2A A;  3D0B A;  3PEJ A;  4CE2 A;  3TZ4 A;  3GIG A;  4ASF A;  3VAD A;  2XDX A;  4MPE A;  3EHH A;  1YES A;  4URO A;  4PRV A;  3D2R A;  1UYM A;  3FT8 A;  5D6P A;  3SL2 A;  1YET A;  4H85 A;  5C93 A;  3R4O A;  1UYE A;  2BYH A;  4DZY A;  5M4E A;  2YKI A;  2BU8 A;  2Q8G A;  5BOD A;  3B27 A;  2VCI A;  4CE3 A;  1B63 A;  2JKI A;  2YGE A;  1TIL A;  3EHF A;  1QY8 A;  1UY6 A;  3RLR A;  4FCQ A;  4U93 A;  4YKU A;  3DGE A;  5CTU A;  5J71 A;  4MB9 A;  1YSR A;  1UYG A;  2CGF A;  3R92 A;  3EHJ A;  4CWQ A;  3HYZ A;  4Q20 A;  4HYP A;  2XAB A;  3GIG B;  3INW A;  3ZM7 A;  3CRL A;  4GQT A;  3CWV A;  2ZKJ A;  1B62 A;  4XD8 A;  4GCZ A;  5M4N A;  1QYE A;  4JQL A;  1YER A;  3QDD A;  3G7E A;  1UYH A;  4B7P A;  5D7R A;  1ZXM A;  1PVG A;  1S16 A;  1UY9 A;  1AH6 A;  1I5B A;  2XD6 A;  2YED A;  4XKO A;  2XX5 A;  2WEP A;  2WI5 A;  3EKR A;  3G75 A;  3R4N A;  1GKX A;  3R4M A;  1BXD A;  4XIQ A;  3HZ5 A;  5FND A;  3B28 A;  4CWN A;  1GJV A;  3WHA A;  3Q5K A;  4E01 A;  1BGQ A;  5M4H A;  2YEF A;  4AWQ A;  1KIJ A;  3K99 A;  3GIF A;  3GIE A;  4H81 A;  4W7T A;  4GT8 A;  3K60 A;  1QZR A;  2YK9 A;  3CGY A;  4BXI A;  2BYI A;  1Z5B A;  2XDU A;  2YE2 A;  4O05 A;  5D7D A;  4DUH A;  3HEK A;  3LNU A;  1I5A A;  2HG1 A;  2BTZ A;  4NH8 A;  1ZWH A;  2WI4 A;  2E0A A;  3K97 A;  3T0H A;  1UYK A;  4XIR A;  4V26 A;  2FYP A;  1AJ6 A;  1Y8N A;  4L8Z A;  4MP2 A;  4XCJ A;  2BRC A;  1US7 A;  2QG2 A;  4AWO A;  2YEG A;  2O1W A;  4EGH A;  3A0R A;  2YE5 A;  2BU6 A;  1Z59 A;  2YI5 A;  4CE1 A;  4FCP A;  1ID0 A;  4WUB A;  1YT0 A;  2YE8 A;  2YEH A;  1Z5A A;  2YE4 A;  3ZXO A;  3R91 A;  2BSM A;  2YEB A;  1TH8 A;  4LWG A;  4EFT A;  4PU9 A;  4MBC A;  1YSZ A;  1S14 A;  1YC4 A;  1UYI A;  4GGL A;  4XIP A;  4EM7 A;  1GKZ A;  4WUC A;  4YKT A;  3O6O A;  3INX A;  3TUH A;  1L0O A;  2XCM A;  4P7A A;  4H7Q A;  1A4H A;  3BM9 A;  4LP0 A;  4AWP A;  4YKQ A;  4L90 A;  4HXW A;  2BU5 A;  4CWF A;  4E00 A;  2FXS A;  3OPD A;  2YKJ A;  2Q2E B;  2XHT A;  2BU7 A;  2YI7 A;  3TZ0 A;  5M4P A;  4XKK A;  5D6Q A;  4EGK A;  3OW6 A;  2YKB A;  3LPS A;  4KQV A;  2O1U A;  1UY7 A;  3O2F A;  1MX0 A;  4LWH A;  1OSF A;  4MOT A;  1THN A;  2IWU A;  4O04 A;  4URM A;  1NHI A;  1I5C A;  2ESA A;  4LWF A;  2XJX A;  3T1K A;  2YEJ A;  2XJG A;  4EGI A;  4GFN A;  5CTY A;  4L91 A;  4BAE A;  2XDK A;  3HHU A;  4HXZ A;  3WQ9 A;  1YC3 A;  2YGA A;  2HKJ A;  2O1V A;  4WUD A;  4ASG A;  4KTN A;  3O0I A;  2YKE A;  4URL A;  2ZDX A;  2YJW A;  2BT0 A;  1B3Q A;  4YKZ A;  2FWZ A;  4MPC A;  3ZKD A;  2WI7 A;  4R3A A;  3FT5 A;  4CWP A;  3H4L A;  5FNF A;  2FWY A;  5M4K A;  2CG9 A;  4PL9 A;  2IWS A;  5IDJ A;  1YT2 A;  4XKA A;  2CCS A;  1AM1 A;  4MP7 A;  1KZN A;  1AMW A;  1UYF A;  4L94 A;  4E02 A;  4ZKI A;  5CF0 A;  3T2S A;  4CWR A;  4O09 A;  4NH7 A;  3C11 A;  1Z5C A;  2YK2 A;  2YE9 A;  4X9L A;  1ZW9 A;  2Q8F A;  2WI3 A;  2GFD A;  2WEQ A;  2YE6 A;  2WI1 A;  4BIU A;  1TID A;  3BMY A;  3OWB A;  5J6A A;  2BU2 A;  2VCJ A;  2VW5 A;  2XX2 A;  3HZ1 A;  3TZ2 A;  2YI6 A;  3HYY A;  4XTJ A;  1JM6 A;  4O07 A;  2CCU A;  2JJC A;  2QF6 A;  2H8M A;  4PRX A;  4YKW A;  3MNR P;  2H55 A;  4B6C A;  3D36 A;  4YKX A;  5L3J A;  5D7C A;  4CWO A;  1UYC A;  4HZ0 A;  5CPH A;  2YJX A;  1Y8P A;  3VHA A;  3NMQ A;  4JAV A;  2YEC A;  2YKC A;  3A0W A;  1H7S A;  1EI1 A;  4ZVI A;  3B26 A;  4HZ5 A;  4QPJ A;  2VWC A;  2IWX A;  2XHR A;  3CRK A;  4BIZ A;  3A0Z A;  4LPB A;  2XHX A;  1U2O A;  1YT1 A;  4YKR A;  3R4P A;  4V25 A;  3CGZ A;  3U2K A;  3B25 A;  3ZXQ A;  4QPK A;  4XCL A;  1AH8 A;  4BQJ A;  2BZ5 A;  2Q8I A;  3T0Z A;  5FNC A;  2QFO A;  3Q5J A;  3RLP A;  2XDS A;  4R3M A;  3VHD A;  2YEE A; 
#chains in the Genus database with same CATH topology
 1I5D A;  4ASB A;  2XK2 A;  3A0T A;  1TC6 A;  1Y4S A;  4O0B A;  4KFG A;  2Q8H A;  4I3H A;  1UY8 A;  1I58 A;  3K98 A;  3B24 A;  4HY6 A;  4EEH A;  3EHG A;  1I59 A;  1YC1 A;  2IOR A;  4XE2 A;  2IOQ A;  1NHJ A;  1EA6 A;  1MU5 A;  4GEE A;  4CWT A;  3ZKB A;  2IOP A;  2CCT A;  4BQG A;  4U7O A;  3IED A;  3TTZ A;  1YS3 A;  4XC0 A;  2QG0 A;  5FWK A;  2XJJ A;  3U67 A;  2ZDY A;  3KE6 A;  2YE7 A;  5M4M A;  1U0Z A;  4K4O A;  2HCH A;  4U7N A;  5CTX A;  3G7B A;  2YGF A;  2XX4 A;  2WI6 A;  3JZ3 A;  3QTF A;  1R62 A;  2BRE A;  2PNR A;  1NHH A;  4MPN A;  5CTW A;  2YI0 A;  4FPP A;  4EFU A;  3Q5L A;  2K5B A;  4YKY A;  4LWI A;  2WER A;  2ZBK B;  5GGZ A;  2YE3 A;  4EMV A;  1BYQ A;  4HYM A;  4JAS A;  2EXL A;  4FMT A;  2C1I A;  1UYD A;  4XIT A;  4URN A;  2YEA A;  2XDL A;  3FV5 A;  4I5S A;  3PEH A;  3OMU A;  4LWE A;  4CWS A;  1TC0 A;  2AKP A;  4FCR A;  4E72 A;  4XDM A;  5F5R A;  4NH9 A;  3EKO A;  4AS9 A;  4L93 A;  4KP4 A;  4KSH A;  1BKN A;  4JAU A;  2UWD A;  3T10 A;  5IN9 A;  3VHC A;  2WI2 A;  3C0E A;  3CYG A;  2YEI A;  2CH4 A;  3OWD A;  3RLQ A;  4HY1 A;  1Y4U A;  3U2D A;  1Y8O A;  3A0Y A;  4R1F A;  2GQP A;  4ASA A;  5F3K A;  1ZXN A;  3A0X A;  3RKZ A;  1H7U A;  5BOC A;  1TBW A;  3TZ5 A;  5IDM A;  4P8O A;  3H80 A;  4KSG A;  1UYL A;  2C2A A;  3D0B A;  3PEJ A;  4CE2 A;  3TZ4 A;  3GIG A;  4ASF A;  3VAD A;  2XDX A;  4MPE A;  3EHH A;  1YES A;  4URO A;  4PRV A;  3D2R A;  1UYM A;  3FT8 A;  5D6P A;  3SL2 A;  1YET A;  2HHI A;  4H85 A;  5C93 A;  3R4O A;  1UYE A;  2BYH A;  4DZY A;  5M4E A;  2YKI A;  2BU8 A;  2Q8G A;  5BOD A;  3B27 A;  2VCI A;  4CE3 A;  1B63 A;  2JKI A;  2YGE A;  3S5T A;  1TIL A;  3EHF A;  1QY8 A;  1UY6 A;  3RLR A;  4FCQ A;  4U93 A;  4YKU A;  3DGE A;  5CTU A;  5J71 A;  4MB9 A;  1YSR A;  1UYG A;  2CGF A;  3R92 A;  3EHJ A;  4CWQ A;  3HYZ A;  4Q20 A;  4HYP A;  2XAB A;  3GIG B;  3INW A;  3ZM7 A;  3CRL A;  4GQT A;  3CWV A;  2ZKJ A;  1B62 A;  4XD8 A;  4GCZ A;  5M4N A;  1QYE A;  4JQL A;  1YER A;  3QDD A;  3G7E A;  1UYH A;  4B7P A;  5D7R A;  1ZXM A;  1PVG A;  1S16 A;  1UY9 A;  1AH6 A;  1I5B A;  2XD6 A;  2YED A;  4XKO A;  2XX5 A;  2WEP A;  2WI5 A;  3EKR A;  3G75 A;  3R4N A;  1GKX A;  3R4M A;  1BXD A;  4XIQ A;  3HZ5 A;  3LMM A;  5FND A;  3B28 A;  4CWN A;  1GJV A;  3WHA A;  3Q5K A;  4E01 A;  1BGQ A;  5M4H A;  2YEF A;  4AWQ A;  1KIJ A;  3K99 A;  3GIF A;  3GIE A;  4H81 A;  4W7T A;  4GT8 A;  3K60 A;  1QZR A;  2YK9 A;  3CGY A;  4BXI A;  2BYI A;  1Z5B A;  2XDU A;  2YE2 A;  4O05 A;  5D7D A;  4DUH A;  3HEK A;  3LNU A;  1I5A A;  2HG1 A;  2BTZ A;  4NH8 A;  1ZWH A;  2WI4 A;  2E0A A;  3K97 A;  3T0H A;  1UYK A;  4XIR A;  4V26 A;  2FYP A;  1AJ6 A;  1Y8N A;  4L8Z A;  4MP2 A;  4XCJ A;  2BRC A;  1US7 A;  2QG2 A;  4AWO A;  2YEG A;  2O1W A;  4EGH A;  3A0R A;  2YE5 A;  2BU6 A;  1Z59 A;  2YI5 A;  4CE1 A;  4FCP A;  1ID0 A;  4WUB A;  1YT0 A;  2YE8 A;  2YEH A;  1Z5A A;  2YE4 A;  3ZXO A;  3R91 A;  2BSM A;  2YEB A;  1TH8 A;  4LWG A;  4EFT A;  4PU9 A;  4MBC A;  1YSZ A;  1S14 A;  1YC4 A;  1UYI A;  4GGL A;  4XIP A;  4EM7 A;  1GKZ A;  4WUC A;  4YKT A;  3O6O A;  3INX A;  3TUH A;  1L0O A;  2XCM A;  4P7A A;  4H7Q A;  1A4H A;  2FTK A;  3BM9 A;  4LP0 A;  4AWP A;  4YKQ A;  2C1G A;  4L90 A;  4HXW A;  2BU5 A;  4CWF A;  4E00 A;  2FXS A;  3OPD A;  2YKJ A;  2Q2E B;  2XHT A;  2BU7 A;  2YI7 A;  3TZ0 A;  5M4P A;  4XKK A;  5D6Q A;  4EGK A;  3OW6 A;  2YKB A;  3LPS A;  4KQV A;  2O1U A;  1UY7 A;  3O2F A;  1MX0 A;  4LWH A;  1OSF A;  4MOT A;  1THN A;  2IWU A;  4O04 A;  4URM A;  1NHI A;  1I5C A;  2ESA A;  4LWF A;  2XJX A;  3T1K A;  2YEJ A;  2XJG A;  4EGI A;  4GFN A;  5CTY A;  4L91 A;  4BAE A;  2XDK A;  3HHU A;  4HXZ A;  3WQ9 A;  1YC3 A;  2YGA A;  2HKJ A;  2O1V A;  4WUD A;  4ASG A;  4KTN A;  3O0I A;  2YKE A;  4URL A;  2ZDX A;  2YJW A;  2BT0 A;  1B3Q A;  4YKZ A;  2FWZ A;  4MPC A;  3ZKD A;  2WI7 A;  4R3A A;  3FT5 A;  4CWP A;  3H4L A;  5FNF A;  2FWY A;  5M4K A;  2CG9 A;  4PL9 A;  2IWS A;  5IDJ A;  1YT2 A;  4XKA A;  2CCS A;  1AM1 A;  4MP7 A;  1KZN A;  1AMW A;  1UYF A;  4L94 A;  4E02 A;  4ZKI A;  5CF0 A;  3T2S A;  4CWR A;  4O09 A;  4NH7 A;  3C11 A;  1Z5C A;  2YK2 A;  2YE9 A;  4X9L A;  1ZW9 A;  2Q8F A;  2WI3 A;  2GFD A;  5JEN A;  2WEQ A;  2YE6 A;  1F51 A;  2WI1 A;  4BIU A;  1TID A;  3BMY A;  1IXM A;  3OWB A;  5J6A A;  2BU2 A;  2VCJ A;  2VW5 A;  2XX2 A;  3HZ1 A;  3TZ2 A;  2YI6 A;  3HYY A;  4XTJ A;  1JM6 A;  4O07 A;  2CCU A;  2JJC A;  2QF6 A;  2H8M A;  4PRX A;  4YKW A;  3MNR P;  2H55 A;  4B6C A;  3D36 A;  4YKX A;  5L3J A;  5D7C A;  4CWO A;  1UYC A;  4HZ0 A;  5CPH A;  2YJX A;  1Y8P A;  3VHA A;  3NMQ A;  4JAV A;  2YEC A;  2YKC A;  3A0W A;  1H7S A;  1EI1 A;  4ZVI A;  3B26 A;  4HZ5 A;  4QPJ A;  2VWC A;  2IWX A;  2XHR A;  3CRK A;  4BIZ A;  3A0Z A;  4LPB A;  2XHX A;  1U2O A;  1YT1 A;  4YKR A;  3R4P A;  4V25 A;  3CGZ A;  3U2K A;  3B25 A;  3ZXQ A;  4QPK A;  4XCL A;  1AH8 A;  4BQJ A;  2BZ5 A;  2Q8I A;  3T0Z A;  5FNC A;  2QFO A;  3Q5J A;  3RLP A;  2XDS A;  4R3M A;  3VHD A;  2YEE A; 
#chains in the Genus database with same CATH homology
 1I5D A;  4ASB A;  2XK2 A;  3A0T A;  1TC6 A;  1Y4S A;  4O0B A;  4KFG A;  2Q8H A;  4I3H A;  1UY8 A;  1I58 A;  3K98 A;  3B24 A;  4HY6 A;  4EEH A;  3EHG A;  1I59 A;  1YC1 A;  2IOR A;  4XE2 A;  2IOQ A;  1NHJ A;  1EA6 A;  1MU5 A;  4GEE A;  4CWT A;  3ZKB A;  2IOP A;  2CCT A;  4BQG A;  4U7O A;  3IED A;  3TTZ A;  1YS3 A;  4XC0 A;  2QG0 A;  5FWK A;  2XJJ A;  3U67 A;  2ZDY A;  3KE6 A;  2YE7 A;  5M4M A;  1U0Z A;  4K4O A;  2HCH A;  4U7N A;  5CTX A;  3G7B A;  2YGF A;  2XX4 A;  2WI6 A;  3JZ3 A;  3QTF A;  1R62 A;  2BRE A;  2PNR A;  1NHH A;  4MPN A;  5CTW A;  2YI0 A;  4FPP A;  4EFU A;  3Q5L A;  2K5B A;  4YKY A;  4LWI A;  2WER A;  2ZBK B;  5GGZ A;  2YE3 A;  4EMV A;  1BYQ A;  4HYM A;  4JAS A;  2EXL A;  4FMT A;  1UYD A;  4XIT A;  4URN A;  2YEA A;  2XDL A;  3FV5 A;  4I5S A;  3PEH A;  3OMU A;  4LWE A;  4CWS A;  1TC0 A;  2AKP A;  4FCR A;  4XDM A;  5F5R A;  4NH9 A;  3EKO A;  4AS9 A;  4L93 A;  4KP4 A;  4KSH A;  1BKN A;  4JAU A;  2UWD A;  3T10 A;  5IN9 A;  3VHC A;  2WI2 A;  3C0E A;  2YEI A;  2CH4 A;  3OWD A;  3RLQ A;  4HY1 A;  1Y4U A;  3U2D A;  1Y8O A;  3A0Y A;  4R1F A;  2GQP A;  4ASA A;  5F3K A;  1ZXN A;  3A0X A;  3RKZ A;  1H7U A;  5BOC A;  1TBW A;  3TZ5 A;  5IDM A;  4P8O A;  3H80 A;  4KSG A;  1UYL A;  2C2A A;  3D0B A;  3PEJ A;  4CE2 A;  3TZ4 A;  3GIG A;  4ASF A;  3VAD A;  2XDX A;  4MPE A;  3EHH A;  1YES A;  4URO A;  4PRV A;  3D2R A;  1UYM A;  3FT8 A;  5D6P A;  3SL2 A;  1YET A;  4H85 A;  5C93 A;  3R4O A;  1UYE A;  2BYH A;  4DZY A;  5M4E A;  2YKI A;  2BU8 A;  2Q8G A;  5BOD A;  3B27 A;  2VCI A;  4CE3 A;  1B63 A;  2JKI A;  2YGE A;  1TIL A;  3EHF A;  1QY8 A;  1UY6 A;  3RLR A;  4FCQ A;  4U93 A;  4YKU A;  3DGE A;  5CTU A;  5J71 A;  4MB9 A;  1YSR A;  1UYG A;  2CGF A;  3R92 A;  3EHJ A;  4CWQ A;  3HYZ A;  4Q20 A;  4HYP A;  2XAB A;  3GIG B;  3INW A;  3ZM7 A;  3CRL A;  4GQT A;  3CWV A;  2ZKJ A;  1B62 A;  4XD8 A;  4GCZ A;  5M4N A;  1QYE A;  4JQL A;  1YER A;  3QDD A;  3G7E A;  1UYH A;  4B7P A;  5D7R A;  1ZXM A;  1PVG A;  1S16 A;  1UY9 A;  1AH6 A;  1I5B A;  2XD6 A;  2YED A;  4XKO A;  2XX5 A;  2WEP A;  2WI5 A;  3EKR A;  3G75 A;  3R4N A;  1GKX A;  3R4M A;  1BXD A;  4XIQ A;  3HZ5 A;  5FND A;  3B28 A;  4CWN A;  1GJV A;  3WHA A;  3Q5K A;  4E01 A;  1BGQ A;  5M4H A;  2YEF A;  4AWQ A;  1KIJ A;  3K99 A;  3GIF A;  3GIE A;  4H81 A;  4W7T A;  4GT8 A;  3K60 A;  1QZR A;  2YK9 A;  3CGY A;  4BXI A;  2BYI A;  1Z5B A;  2XDU A;  2YE2 A;  4O05 A;  5D7D A;  4DUH A;  3HEK A;  3LNU A;  1I5A A;  2HG1 A;  2BTZ A;  4NH8 A;  1ZWH A;  2WI4 A;  2E0A A;  3K97 A;  3T0H A;  1UYK A;  4XIR A;  4V26 A;  2FYP A;  1AJ6 A;  1Y8N A;  4L8Z A;  4MP2 A;  4XCJ A;  2BRC A;  1US7 A;  2QG2 A;  4AWO A;  2YEG A;  2O1W A;  4EGH A;  3A0R A;  2YE5 A;  2BU6 A;  1Z59 A;  2YI5 A;  4CE1 A;  4FCP A;  1ID0 A;  4WUB A;  1YT0 A;  2YE8 A;  2YEH A;  1Z5A A;  2YE4 A;  3ZXO A;  3R91 A;  2BSM A;  2YEB A;  1TH8 A;  4LWG A;  4EFT A;  4PU9 A;  4MBC A;  1YSZ A;  1S14 A;  1YC4 A;  1UYI A;  4GGL A;  4XIP A;  4EM7 A;  1GKZ A;  4WUC A;  4YKT A;  3O6O A;  3INX A;  3TUH A;  1L0O A;  2XCM A;  4P7A A;  4H7Q A;  1A4H A;  3BM9 A;  4LP0 A;  4AWP A;  4YKQ A;  4L90 A;  4HXW A;  2BU5 A;  4CWF A;  4E00 A;  2FXS A;  3OPD A;  2YKJ A;  2Q2E B;  2XHT A;  2BU7 A;  2YI7 A;  3TZ0 A;  5M4P A;  4XKK A;  5D6Q A;  4EGK A;  3OW6 A;  2YKB A;  3LPS A;  4KQV A;  2O1U A;  1UY7 A;  3O2F A;  1MX0 A;  4LWH A;  1OSF A;  4MOT A;  1THN A;  2IWU A;  4O04 A;  4URM A;  1NHI A;  1I5C A;  2ESA A;  4LWF A;  2XJX A;  3T1K A;  2YEJ A;  2XJG A;  4EGI A;  4GFN A;  5CTY A;  4L91 A;  4BAE A;  2XDK A;  3HHU A;  4HXZ A;  3WQ9 A;  1YC3 A;  2YGA A;  2HKJ A;  2O1V A;  4WUD A;  4ASG A;  4KTN A;  3O0I A;  2YKE A;  4URL A;  2ZDX A;  2YJW A;  2BT0 A;  1B3Q A;  4YKZ A;  2FWZ A;  4MPC A;  3ZKD A;  2WI7 A;  4R3A A;  3FT5 A;  4CWP A;  3H4L A;  5FNF A;  2FWY A;  5M4K A;  2CG9 A;  4PL9 A;  2IWS A;  5IDJ A;  1YT2 A;  4XKA A;  2CCS A;  1AM1 A;  4MP7 A;  1KZN A;  1AMW A;  1UYF A;  4L94 A;  4E02 A;  4ZKI A;  5CF0 A;  3T2S A;  4CWR A;  4O09 A;  4NH7 A;  3C11 A;  1Z5C A;  2YK2 A;  2YE9 A;  4X9L A;  1ZW9 A;  2Q8F A;  2WI3 A;  2GFD A;  2WEQ A;  2YE6 A;  2WI1 A;  4BIU A;  1TID A;  3BMY A;  3OWB A;  5J6A A;  2BU2 A;  2VCJ A;  2VW5 A;  2XX2 A;  3HZ1 A;  3TZ2 A;  2YI6 A;  3HYY A;  4XTJ A;  1JM6 A;  4O07 A;  2CCU A;  2JJC A;  2QF6 A;  2H8M A;  4PRX A;  4YKW A;  3MNR P;  2H55 A;  4B6C A;  3D36 A;  4YKX A;  5L3J A;  5D7C A;  4CWO A;  1UYC A;  4HZ0 A;  5CPH A;  2YJX A;  1Y8P A;  3VHA A;  3NMQ A;  4JAV A;  2YEC A;  2YKC A;  3A0W A;  1H7S A;  1EI1 A;  4ZVI A;  3B26 A;  4HZ5 A;  4QPJ A;  2VWC A;  2IWX A;  2XHR A;  3CRK A;  4BIZ A;  3A0Z A;  4LPB A;  2XHX A;  1U2O A;  1YT1 A;  4YKR A;  3R4P A;  4V25 A;  3CGZ A;  3U2K A;  3B25 A;  3ZXQ A;  4QPK A;  4XCL A;  1AH8 A;  4BQJ A;  2BZ5 A;  2Q8I A;  3T0Z A;  5FNC A;  2QFO A;  3Q5J A;  3RLP A;  2XDS A;  4R3M A;  3VHD A;  2YEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...