1I58A

Structure of the histidine kinase chea atp-binding domain in complex with atp analog adpcp and magnesium
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
189
structure length
189
Chain Sequence
b'GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein, transferase
total genus 61
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i58A00
5CTXA 4EGHA 4ASGA 4CWFA 5FNDA 1Y4SA 4FCQA 1YERA 4UROA 4YKZA 3HZ1A 2IOQA 2YK2A 3Q5JA 4MBCA 4URNA 2YEJA 2QF6A 4MPNA 5BOCA 5CTUA 4BQGA 1AMWA 3LPSA 3Q5LA 1EA6A 1ID0A 2YE3A 1Z59A 5CPHA 4U7NA 4EMVA 3BMYA 3WHAA 4ASAA 1PVGA 1TH8A 3VHCA 1YT2A 3HHUA 2QG2A 3CRLA 4H7QA 4ZVIA 4YKWA 2GQPA 2XX4A 1UYGA 4E00A 4LPBA 4V25A 4R3AA 3R4PA 2YE4A 4CWQA 4URLA 2CCTA 5M4PA 1YC3A 3B28A 1I5DA 4XIRA 3RKZA 4CE3A 4HYPA 1H7UA 5CTYA 2HG1A 2YE6A 1NHIA 4HXWA 3TZ4A 1YT0A 4WUDA 1Z5AA 3R92A 1KZNA 4EGKA 3Q5KA 1TIDA 3FT5A 2WI7A 4L91A 3ZM7A 5IDJA 2XJGA 1Z5CA 1THNA 2BU7A 3TZ2A 3VHDA 4EFTA 4O04A 4AWPA 5M4EA 3LNUA 4L94A 2BSMA 4FCRA 3T0HA 4WUBA 4EGIA 2ESAA 2ZDYA 2YGFA 1I58A 2IOPA 2YEAA 2WEPA 2CGFA 1Y4UA 4E02A 3T2SA 3VADA 4U7OA 3G7BA 1YETA 4B7PA 4W7TA 4PRVA 1UYHA 3EHFA 4XC0A 2YEDA 2UWDA 3OWDA 2IWSA 1YC1A 4NH7A 4AWQA 2XHTA 3KE6A 2YK9A 2XDSA 1AH6A 2E0AA 3RLRA 4MPCA 3B26A 1S14A 2BU2A 4MPEA 1OSFA 2XHXA 2CCSA 3HZ5A 3O0IA 4B6CA 2ZBKB 3HEKA 2IORA 2C2AA 1YSZA 3T1KA 1KIJA 3MNRP 1AM1A 2QG0A 2YJWA 4XIPA 3A0TA 2WI4A 1Y8NA 1JM6A 1TILA 4LWGA 2Q8HA 2BU8A 2YI6A 2YE9A 2WEQA 4CWPA 2JKIA 5M4NA 2WERA 3GIEA 4AWOA 3B24A 4U93A 1MU5A 4MP2A 1YC4A 2BREA 4XCJA 2YI5A 1BXDA 4LP0A 2XX5A 2YJXA 1U0ZA 1NHHA 4HYMA 4HZ0A 4EM7A 2XDKA 4XD8A 3CWVA 3D2RA 3TTZA 4JAUA 1H7SA 4HY6A 3EHGA 1A4HA 2BT0A 1I5BA 3A0ZA 1UYEA 3B25A 5BODA 3R4NA 1S16A 5C93A 3EKOA 5D7RA 3HYZA 1QY8A 3ZKDA 4ASBA 3U2KA 2YKEA 5CTWA 1GKXA 4O07A 4I3HA 5J6AA 1UYFA 4GEEA 4V26A 2XJXA 2HCHA 1TC6A 1I59A 1UY7A 3FV5A 2BU5A 4DUHA 3OMUA 4YKRA 3ZKBA 1US7A 4YKYA 4KSHA 4I5SA 2XX2A 5L3JA 4NH8A 1AJ6A 1U2OA 1Z5BA 4HZ5A 5F3KA 1AH8A 1YESA 5FNCA 2XJJA 4Q20A 4GT8A 2YKJA 4HXZA 1UYKA 3EHJA 2YI0A 4YKTA 3H80A 1ZWHA 4PU9A 2Q8IA 4FMTA 5M4MA 4KQVA 4P8OA 5CF0A 5FWKA 1QZRA 1B63A 4JQLA 2YGAA 2YKCA 4YKXA 3A0WA 5D6PA 3H4LA 2Q8FA 3ZXOA 2JJCA 3HYYA 3VHAA 1TC0A 2WI1A 4URMA 2GFDA 2BTZA 2Q8GA 3GIFA 4R1FA 3D0BA 1BYQA 1I5AA 3U67A 2YGEA 3ZXQA 2O1WA 1BKNA 4ASFA 5IN9A 2WI3A 3R4MA 2YKBA 5M4KA 2YEGA 2XDUA 4H81A 2YE2A 2PNRA 4KP4A 5D7CA 1UY6A 3A0XA 5D6QA 4H85A 2VWCA 4XKAA 2IWUA 3K99A 4FCPA 2AKPA 2WI2A 2YKIA 3IEDA 1B62A 2YEEA 4LWEA 3RLQA 4EFUA 3BM9A 3GIGA 3T0ZA 1MX0A 1Y8PA 4BIUA 3CRKA 3T10A 4X9LA 2YE5A 5IDMA 4O0BA 4P7AA 4LWHA 3OWBA 3TZ5A 3R4OA 3SL2A 4KFGA 2VCIA 3A0RA 4XKKA 3RLPA 3NMQA 3G75A 2WI5A 3U2DA 1UYCA 1L0OA 4XDMA 1NHJA 1ZXMA 2WI6A 4DZYA 4JASA 2K5BA 2EXLA 2CG9A 4BAEA 2O1UA 2CH4A 4MP7A 4L90A 4CWTA 4CWNA 3D36A 5J71A 3INXA 2XDXA 2HKJA 1R62A 3K97A 2H8MA 2XCMA 4FPPA 3FT8A 1TBWA 1EI1A 2BYHA 2FWZA 3JZ3A 2XHRA 3O2FA 4BIZA 4XCLA 2O1VA 4O09A 3CGYA 3C0EA 3K60A 4GCZA 4CE2A 1YSRA 4L8ZA 4PRXA 2ZDXA 4KTNA 4XIQA 4ZKIA 4BQJA 1UYDA 3O6OA 2YI7A 3OW6A 3R91A 2YECA 3TUHA 2ZKJA 3GIGB 4HY1A 3EKRA 4GGLA 4YKUA 4BXIA 1YS3A 1Y8OA 2YE7A 4CWSA 3K98A 2QFOA 3TZ0A 4R3MA 3PEHA 3INWA 2XK2A 3WQ9A 1UYIA 2FYPA 1UYMA 3PEJA 4PL9A 2Q2EB 4XKOA 4LWFA 3C11A 2YEFA 2BZ5A 4QPKA 4EEHA 3G7EA 2XABA 5M4HA 3A0YA 3EHHA 2IWXA 1ZXNA 1UY9A 1I5CA 5D7DA 4CWRA 2BYIA 3OPDA 2BRCA 1QYEA 2VCJA 3CGZA 4QPJA 4XITA 4MB9A 3QDDA 4L93A 4AS9A 4XTJA 2BU6A 4YKQA 5FNFA 2YEBA 4CE1A 2XD6A 4GFNA 1ZW9A 4GQTA 1UYLA 3DGEA 4JAVA 2CCUA 2VW5A 2YEHA 4K4OA 1GJVA 3B27A 4E01A 1UY8A 1B3QA 2H55A 4CWOA 2FWYA 4NH9A 4XE2A 4WUCA 4MOTA 1YT1A 1BGQA 4KSGA 2YEIA 4LWIA 1GKZA 2YE8A 5F5RA 4O05A 2XDLA 5GGZA 2FXSA 3QTFA
chains in the Genus database with same CATH superfamily
5CTXA 4EGHA 4ASGA 4CWFA 5FNDA 1Y4SA 4FCQA 1YERA 4UROA 4YKZA 3HZ1A 2IOQA 2YK2A 2C1IA 3Q5JA 4MBCA 4URNA 2YEJA 2QF6A 4MPNA 5BOCA 5CTUA 4BQGA 1AMWA 3LPSA 3Q5LA 1EA6A 1ID0A 2YE3A 1Z59A 5CPHA 4U7NA 4EMVA 3BMYA 3WHAA 4ASAA 1PVGA 1TH8A 3VHCA 1YT2A 3HHUA 2QG2A 3CRLA 4H7QA 4ZVIA 4YKWA 2GQPA 2XX4A 1UYGA 4E00A 4LPBA 4V25A 4R3AA 3R4PA 2YE4A 4CWQA 4URLA 2CCTA 5M4PA 1YC3A 3B28A 1I5DA 4XIRA 3RKZA 4CE3A 4HYPA 1H7UA 5CTYA 2HG1A 2YE6A 1NHIA 4HXWA 1IXMA 3TZ4A 1YT0A 4WUDA 1Z5AA 3R92A 1KZNA 4EGKA 3Q5KA 1TIDA 3FT5A 2WI7A 4L91A 3ZM7A 5IDJA 2XJGA 1Z5CA 1THNA 2BU7A 3TZ2A 3VHDA 4EFTA 4O04A 4AWPA 5M4EA 2HHIA 3LNUA 4L94A 2BSMA 4FCRA 3T0HA 4WUBA 4EGIA 2ESAA 2ZDYA 2YGFA 1I58A 2IOPA 2YEAA 2WEPA 2CGFA 1Y4UA 4E02A 3T2SA 3VADA 4U7OA 3G7BA 1YETA 4B7PA 4W7TA 4PRVA 1UYHA 3EHFA 4XC0A 2YEDA 2UWDA 3OWDA 2IWSA 1YC1A 4NH7A 4AWQA 2XHTA 3KE6A 2YK9A 2XDSA 1AH6A 2E0AA 3RLRA 4MPCA 3B26A 1S14A 2BU2A 4MPEA 1OSFA 2XHXA 2CCSA 3HZ5A 3O0IA 4B6CA 2ZBKB 3HEKA 2IORA 2C2AA 1YSZA 3T1KA 1KIJA 3MNRP 1AM1A 2QG0A 2YJWA 4XIPA 3A0TA 2WI4A 1Y8NA 1JM6A 1TILA 4LWGA 2Q8HA 2BU8A 2YI6A 2YE9A 2WEQA 4CWPA 2JKIA 5M4NA 2WERA 3GIEA 4AWOA 3B24A 4U93A 1MU5A 4MP2A 1YC4A 2BREA 4XCJA 2YI5A 1BXDA 4LP0A 2XX5A 2YJXA 1U0ZA 1NHHA 4HYMA 4HZ0A 4EM7A 2XDKA 4XD8A 3CWVA 3D2RA 3TTZA 4JAUA 1H7SA 4HY6A 3EHGA 1A4HA 2BT0A 1I5BA 3A0ZA 1UYEA 3B25A 5BODA 3R4NA 1S16A 5C93A 3EKOA 5D7RA 3HYZA 1QY8A 3ZKDA 4ASBA 3U2KA 2YKEA 5CTWA 1GKXA 4O07A 4I3HA 5J6AA 1UYFA 4GEEA 4V26A 2XJXA 1F51A 2HCHA 1TC6A 1I59A 1UY7A 3FV5A 2BU5A 4DUHA 3OMUA 4YKRA 3ZKBA 1US7A 4YKYA 4KSHA 4I5SA 2XX2A 5L3JA 4NH8A 1AJ6A 1U2OA 1Z5BA 4E72A 4HZ5A 5F3KA 1AH8A 1YESA 2C1GA 5FNCA 2XJJA 4Q20A 4GT8A 2YKJA 4HXZA 1UYKA 3EHJA 2YI0A 4YKTA 3H80A 1ZWHA 4PU9A 2Q8IA 4FMTA 5M4MA 4KQVA 4P8OA 5CF0A 5FWKA 1QZRA 1B63A 4JQLA 2YGAA 2YKCA 4YKXA 3A0WA 5D6PA 3H4LA 2Q8FA 3S5TA 3ZXOA 2JJCA 3HYYA 3VHAA 1TC0A 2WI1A 4URMA 2GFDA 2BTZA 2Q8GA 3GIFA 4R1FA 3D0BA 1BYQA 1I5AA 3U67A 2YGEA 3ZXQA 2O1WA 1BKNA 4ASFA 5IN9A 2WI3A 3R4MA 2YKBA 5M4KA 2YEGA 2XDUA 4H81A 2YE2A 2PNRA 4KP4A 5D7CA 1UY6A 3A0XA 5D6QA 4H85A 2VWCA 4XKAA 2IWUA 3K99A 4FCPA 2AKPA 2WI2A 2YKIA 3IEDA 1B62A 2YEEA 4LWEA 3RLQA 4EFUA 3BM9A 3GIGA 3T0ZA 1MX0A 1Y8PA 4BIUA 3CRKA 3T10A 4X9LA 2YE5A 5IDMA 4O0BA 4P7AA 4LWHA 3OWBA 3TZ5A 3R4OA 3SL2A 4KFGA 2VCIA 3A0RA 4XKKA 3RLPA 3NMQA 3G75A 2WI5A 3U2DA 1UYCA 1L0OA 4XDMA 1NHJA 1ZXMA 2WI6A 4DZYA 4JASA 2K5BA 2EXLA 2CG9A 4BAEA 2O1UA 2CH4A 4MP7A 4L90A 4CWTA 4CWNA 3D36A 5J71A 3INXA 2XDXA 2HKJA 1R62A 3K97A 2H8MA 2XCMA 4FPPA 3FT8A 1TBWA 1EI1A 2BYHA 2FWZA 3JZ3A 2XHRA 3O2FA 4BIZA 4XCLA 2O1VA 4O09A 3CGYA 3C0EA 3K60A 2FTKA 4GCZA 4CE2A 1YSRA 4L8ZA 4PRXA 3CYGA 2ZDXA 4KTNA 4XIQA 4ZKIA 4BQJA 1UYDA 3O6OA 2YI7A 3OW6A 3R91A 2YECA 3TUHA 2ZKJA 3GIGB 4HY1A 3EKRA 4GGLA 4YKUA 4BXIA 1YS3A 1Y8OA 2YE7A 4CWSA 3K98A 2QFOA 3TZ0A 4R3MA 3PEHA 3INWA 2XK2A 3WQ9A 1UYIA 2FYPA 1UYMA 3PEJA 4PL9A 2Q2EB 4XKOA 4LWFA 3C11A 2YEFA 2BZ5A 4QPKA 4EEHA 3G7EA 2XABA 5M4HA 3A0YA 3EHHA 2IWXA 1ZXNA 1UY9A 1I5CA 5D7DA 4CWRA 2BYIA 3OPDA 2BRCA 1QYEA 2VCJA 3CGZA 4QPJA 4XITA 4MB9A 3QDDA 4L93A 4AS9A 4XTJA 2BU6A 4YKQA 5FNFA 2YEBA 4CE1A 2XD6A 4GFNA 1ZW9A 4GQTA 1UYLA 3DGEA 4JAVA 2CCUA 2VW5A 2YEHA 4K4OA 1GJVA 3B27A 4E01A 1UY8A 1B3QA 2H55A 5JENA 4CWOA 2FWYA 4NH9A 4XE2A 4WUCA 4MOTA 1YT1A 3LMMA 1BGQA 4KSGA 2YEIA 4LWIA 1GKZA 2YE8A 5F5RA 4O05A 2XDLA 5GGZA 2FXSA 3QTFA
chains in the Genus database with same CATH topology
5CTXA 4EGHA 4ASGA 4CWFA 5FNDA 1Y4SA 4FCQA 1YERA 4UROA 4YKZA 3HZ1A 2IOQA 2YK2A 3Q5JA 4MBCA 4URNA 2YEJA 2QF6A 4MPNA 5BOCA 5CTUA 4BQGA 1AMWA 3LPSA 3Q5LA 1EA6A 1ID0A 2YE3A 1Z59A 5CPHA 4U7NA 4EMVA 3BMYA 3WHAA 4ASAA 1PVGA 1TH8A 3VHCA 1YT2A 3HHUA 2QG2A 3CRLA 4H7QA 4ZVIA 4YKWA 2GQPA 2XX4A 1UYGA 4E00A 4LPBA 4V25A 4R3AA 3R4PA 2YE4A 4CWQA 4URLA 2CCTA 5M4PA 1YC3A 3B28A 1I5DA 4XIRA 3RKZA 4CE3A 4HYPA 1H7UA 5CTYA 2HG1A 2YE6A 1NHIA 4HXWA 3TZ4A 1YT0A 4WUDA 1Z5AA 3R92A 1KZNA 4EGKA 3Q5KA 1TIDA 3FT5A 2WI7A 4L91A 3ZM7A 5IDJA 2XJGA 1Z5CA 1THNA 2BU7A 3TZ2A 3VHDA 4EFTA 4O04A 4AWPA 5M4EA 3LNUA 4L94A 2BSMA 4FCRA 3T0HA 4WUBA 4EGIA 2ESAA 2ZDYA 2YGFA 1I58A 2IOPA 2YEAA 2WEPA 2CGFA 1Y4UA 4E02A 3T2SA 3VADA 4U7OA 3G7BA 1YETA 4B7PA 4W7TA 4PRVA 1UYHA 3EHFA 4XC0A 2YEDA 2UWDA 3OWDA 2IWSA 1YC1A 4NH7A 4AWQA 2XHTA 3KE6A 2YK9A 2XDSA 1AH6A 2E0AA 3RLRA 4MPCA 3B26A 1S14A 2BU2A 4MPEA 1OSFA 2XHXA 2CCSA 3HZ5A 3O0IA 4B6CA 2ZBKB 3HEKA 2IORA 2C2AA 1YSZA 3T1KA 1KIJA 3MNRP 1AM1A 2QG0A 2YJWA 4XIPA 3A0TA 2WI4A 1Y8NA 1JM6A 1TILA 4LWGA 2Q8HA 2BU8A 2YI6A 2YE9A 2WEQA 4CWPA 2JKIA 5M4NA 2WERA 3GIEA 4AWOA 3B24A 4U93A 1MU5A 4MP2A 1YC4A 2BREA 4XCJA 2YI5A 1BXDA 4LP0A 2XX5A 2YJXA 1U0ZA 1NHHA 4HYMA 4HZ0A 4EM7A 2XDKA 4XD8A 3CWVA 3D2RA 3TTZA 4JAUA 1H7SA 4HY6A 3EHGA 1A4HA 2BT0A 1I5BA 3A0ZA 1UYEA 3B25A 5BODA 3R4NA 1S16A 5C93A 3EKOA 5D7RA 3HYZA 1QY8A 3ZKDA 4ASBA 3U2KA 2YKEA 5CTWA 1GKXA 4O07A 4I3HA 5J6AA 1UYFA 4GEEA 4V26A 2XJXA 2HCHA 1TC6A 1I59A 1UY7A 3FV5A 2BU5A 4DUHA 3OMUA 4YKRA 3ZKBA 1US7A 4YKYA 4KSHA 4I5SA 2XX2A 5L3JA 4NH8A 1AJ6A 1U2OA 1Z5BA 4HZ5A 5F3KA 1AH8A 1YESA 5FNCA 2XJJA 4Q20A 4GT8A 2YKJA 4HXZA 1UYKA 3EHJA 2YI0A 4YKTA 3H80A 1ZWHA 4PU9A 2Q8IA 4FMTA 5M4MA 4KQVA 4P8OA 5CF0A 5FWKA 1QZRA 1B63A 4JQLA 2YGAA 2YKCA 4YKXA 3A0WA 5D6PA 3H4LA 2Q8FA 3ZXOA 2JJCA 3HYYA 3VHAA 1TC0A 2WI1A 4URMA 2GFDA 2BTZA 2Q8GA 3GIFA 4R1FA 3D0BA 1BYQA 1I5AA 3U67A 2YGEA 3ZXQA 2O1WA 1BKNA 4ASFA 5IN9A 2WI3A 3R4MA 2YKBA 5M4KA 2YEGA 2XDUA 4H81A 2YE2A 2PNRA 4KP4A 5D7CA 1UY6A 3A0XA 5D6QA 4H85A 2VWCA 4XKAA 2IWUA 3K99A 4FCPA 2AKPA 2WI2A 2YKIA 3IEDA 1B62A 2YEEA 4LWEA 3RLQA 4EFUA 3BM9A 3GIGA 3T0ZA 1MX0A 1Y8PA 4BIUA 3CRKA 3T10A 4X9LA 2YE5A 5IDMA 4O0BA 4P7AA 4LWHA 3OWBA 3TZ5A 3R4OA 3SL2A 4KFGA 2VCIA 3A0RA 4XKKA 3RLPA 3NMQA 3G75A 2WI5A 3U2DA 1UYCA 1L0OA 4XDMA 1NHJA 1ZXMA 2WI6A 4DZYA 4JASA 2K5BA 2EXLA 2CG9A 4BAEA 2O1UA 2CH4A 4MP7A 4L90A 4CWTA 4CWNA 3D36A 5J71A 3INXA 2XDXA 2HKJA 1R62A 3K97A 2H8MA 2XCMA 4FPPA 3FT8A 1TBWA 1EI1A 2BYHA 2FWZA 3JZ3A 2XHRA 3O2FA 4BIZA 4XCLA 2O1VA 4O09A 3CGYA 3C0EA 3K60A 4GCZA 4CE2A 1YSRA 4L8ZA 4PRXA 2ZDXA 4KTNA 4XIQA 4ZKIA 4BQJA 1UYDA 3O6OA 2YI7A 3OW6A 3R91A 2YECA 3TUHA 2ZKJA 3GIGB 4HY1A 3EKRA 4GGLA 4YKUA 4BXIA 1YS3A 1Y8OA 2YE7A 4CWSA 3K98A 2QFOA 3TZ0A 4R3MA 3PEHA 3INWA 2XK2A 3WQ9A 1UYIA 2FYPA 1UYMA 3PEJA 4PL9A 2Q2EB 4XKOA 4LWFA 3C11A 2YEFA 2BZ5A 4QPKA 4EEHA 3G7EA 2XABA 5M4HA 3A0YA 3EHHA 2IWXA 1ZXNA 1UY9A 1I5CA 5D7DA 4CWRA 2BYIA 3OPDA 2BRCA 1QYEA 2VCJA 3CGZA 4QPJA 4XITA 4MB9A 3QDDA 4L93A 4AS9A 4XTJA 2BU6A 4YKQA 5FNFA 2YEBA 4CE1A 2XD6A 4GFNA 1ZW9A 4GQTA 1UYLA 3DGEA 4JAVA 2CCUA 2VW5A 2YEHA 4K4OA 1GJVA 3B27A 4E01A 1UY8A 1B3QA 2H55A 4CWOA 2FWYA 4NH9A 4XE2A 4WUCA 4MOTA 1YT1A 1BGQA 4KSGA 2YEIA 4LWIA 1GKZA 2YE8A 5F5RA 4O05A 2XDLA 5GGZA 2FXSA 3QTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CTX A;  4EGH A;  4ASG A;  4CWF A;  5FND A;  1Y4S A;  4FCQ A;  1YER A;  4URO A;  4YKZ A;  3HZ1 A;  2IOQ A;  2YK2 A;  3Q5J A;  4MBC A;  4URN A;  2YEJ A;  2QF6 A;  4MPN A;  5BOC A;  5CTU A;  4BQG A;  1AMW A;  3LPS A;  3Q5L A;  1EA6 A;  1ID0 A;  2YE3 A;  1Z59 A;  5CPH A;  4U7N A;  4EMV A;  3BMY A;  3WHA A;  4ASA A;  1PVG A;  1TH8 A;  3VHC A;  1YT2 A;  3HHU A;  2QG2 A;  3CRL A;  4H7Q A;  4ZVI A;  4YKW A;  2GQP A;  2XX4 A;  1UYG A;  4E00 A;  4LPB A;  4V25 A;  4R3A A;  3R4P A;  2YE4 A;  4CWQ A;  4URL A;  2CCT A;  5M4P A;  1YC3 A;  3B28 A;  1I5D A;  4XIR A;  3RKZ A;  4CE3 A;  4HYP A;  1H7U A;  5CTY A;  2HG1 A;  2YE6 A;  1NHI A;  4HXW A;  3TZ4 A;  1YT0 A;  4WUD A;  1Z5A A;  3R92 A;  1KZN A;  4EGK A;  3Q5K A;  1TID A;  3FT5 A;  2WI7 A;  4L91 A;  3ZM7 A;  5IDJ A;  2XJG A;  1Z5C A;  1THN A;  2BU7 A;  3TZ2 A;  3VHD A;  4EFT A;  4O04 A;  4AWP A;  5M4E A;  3LNU A;  4L94 A;  2BSM A;  4FCR A;  3T0H A;  4WUB A;  4EGI A;  2ESA A;  2ZDY A;  2YGF A;  1I58 A;  2IOP A;  2YEA A;  2WEP A;  2CGF A;  1Y4U A;  4E02 A;  3T2S A;  3VAD A;  4U7O A;  3G7B A;  1YET A;  4B7P A;  4W7T A;  4PRV A;  1UYH A;  3EHF A;  4XC0 A;  2YED A;  2UWD A;  3OWD A;  2IWS A;  1YC1 A;  4NH7 A;  4AWQ A;  2XHT A;  3KE6 A;  2YK9 A;  2XDS A;  1AH6 A;  2E0A A;  3RLR A;  4MPC A;  3B26 A;  1S14 A;  2BU2 A;  4MPE A;  1OSF A;  2XHX A;  2CCS A;  3HZ5 A;  3O0I A;  4B6C A;  2ZBK B;  3HEK A;  2IOR A;  2C2A A;  1YSZ A;  3T1K A;  1KIJ A;  3MNR P;  1AM1 A;  2QG0 A;  2YJW A;  4XIP A;  3A0T A;  2WI4 A;  1Y8N A;  1JM6 A;  1TIL A;  4LWG A;  2Q8H A;  2BU8 A;  2YI6 A;  2YE9 A;  2WEQ A;  4CWP A;  2JKI A;  5M4N A;  2WER A;  3GIE A;  4AWO A;  3B24 A;  4U93 A;  1MU5 A;  4MP2 A;  1YC4 A;  2BRE A;  4XCJ A;  2YI5 A;  1BXD A;  4LP0 A;  2XX5 A;  2YJX A;  1U0Z A;  1NHH A;  4HYM A;  4HZ0 A;  4EM7 A;  2XDK A;  4XD8 A;  3CWV A;  3D2R A;  3TTZ A;  4JAU A;  1H7S A;  4HY6 A;  3EHG A;  1A4H A;  2BT0 A;  1I5B A;  3A0Z A;  1UYE A;  3B25 A;  5BOD A;  3R4N A;  1S16 A;  5C93 A;  3EKO A;  5D7R A;  3HYZ A;  1QY8 A;  3ZKD A;  4ASB A;  3U2K A;  2YKE A;  5CTW A;  1GKX A;  4O07 A;  4I3H A;  5J6A A;  1UYF A;  4GEE A;  4V26 A;  2XJX A;  2HCH A;  1TC6 A;  1I59 A;  1UY7 A;  3FV5 A;  2BU5 A;  4DUH A;  3OMU A;  4YKR A;  3ZKB A;  1US7 A;  4YKY A;  4KSH A;  4I5S A;  2XX2 A;  5L3J A;  4NH8 A;  1AJ6 A;  1U2O A;  1Z5B A;  4HZ5 A;  5F3K A;  1AH8 A;  1YES A;  5FNC A;  2XJJ A;  4Q20 A;  4GT8 A;  2YKJ A;  4HXZ A;  1UYK A;  3EHJ A;  2YI0 A;  4YKT A;  3H80 A;  1ZWH A;  4PU9 A;  2Q8I A;  4FMT A;  5M4M A;  4KQV A;  4P8O A;  5CF0 A;  5FWK A;  1QZR A;  1B63 A;  4JQL A;  2YGA A;  2YKC A;  4YKX A;  3A0W A;  5D6P A;  3H4L A;  2Q8F A;  3ZXO A;  2JJC A;  3HYY A;  3VHA A;  1TC0 A;  2WI1 A;  4URM A;  2GFD A;  2BTZ A;  2Q8G A;  3GIF A;  4R1F A;  3D0B A;  1BYQ A;  1I5A A;  3U67 A;  2YGE A;  3ZXQ A;  2O1W A;  1BKN A;  4ASF A;  5IN9 A;  2WI3 A;  3R4M A;  2YKB A;  5M4K A;  2YEG A;  2XDU A;  4H81 A;  2YE2 A;  2PNR A;  4KP4 A;  5D7C A;  1UY6 A;  3A0X A;  5D6Q A;  4H85 A;  2VWC A;  4XKA A;  2IWU A;  3K99 A;  4FCP A;  2AKP A;  2WI2 A;  2YKI A;  3IED A;  1B62 A;  2YEE A;  4LWE A;  3RLQ A;  4EFU A;  3BM9 A;  3GIG A;  3T0Z A;  1MX0 A;  1Y8P A;  4BIU A;  3CRK A;  3T10 A;  4X9L A;  2YE5 A;  5IDM A;  4O0B A;  4P7A A;  4LWH A;  3OWB A;  3TZ5 A;  3R4O A;  3SL2 A;  4KFG A;  2VCI A;  3A0R A;  4XKK A;  3RLP A;  3NMQ A;  3G75 A;  2WI5 A;  3U2D A;  1UYC A;  1L0O A;  4XDM A;  1NHJ A;  1ZXM A;  2WI6 A;  4DZY A;  4JAS A;  2K5B A;  2EXL A;  2CG9 A;  4BAE A;  2O1U A;  2CH4 A;  4MP7 A;  4L90 A;  4CWT A;  4CWN A;  3D36 A;  5J71 A;  3INX A;  2XDX A;  2HKJ A;  1R62 A;  3K97 A;  2H8M A;  2XCM A;  4FPP A;  3FT8 A;  1TBW A;  1EI1 A;  2BYH A;  2FWZ A;  3JZ3 A;  2XHR A;  3O2F A;  4BIZ A;  4XCL A;  2O1V A;  4O09 A;  3CGY A;  3C0E A;  3K60 A;  4GCZ A;  4CE2 A;  1YSR A;  4L8Z A;  4PRX A;  2ZDX A;  4KTN A;  4XIQ A;  4ZKI A;  4BQJ A;  1UYD A;  3O6O A;  2YI7 A;  3OW6 A;  3R91 A;  2YEC A;  3TUH A;  2ZKJ A;  3GIG B;  4HY1 A;  3EKR A;  4GGL A;  4YKU A;  4BXI A;  1YS3 A;  1Y8O A;  2YE7 A;  4CWS A;  3K98 A;  2QFO A;  3TZ0 A;  4R3M A;  3PEH A;  3INW A;  2XK2 A;  3WQ9 A;  1UYI A;  2FYP A;  1UYM A;  3PEJ A;  4PL9 A;  2Q2E B;  4XKO A;  4LWF A;  3C11 A;  2YEF A;  2BZ5 A;  4QPK A;  4EEH A;  3G7E A;  2XAB A;  5M4H A;  3A0Y A;  3EHH A;  2IWX A;  1ZXN A;  1UY9 A;  1I5C A;  5D7D A;  4CWR A;  2BYI A;  3OPD A;  2BRC A;  1QYE A;  2VCJ A;  3CGZ A;  4QPJ A;  4XIT A;  4MB9 A;  3QDD A;  4L93 A;  4AS9 A;  4XTJ A;  2BU6 A;  4YKQ A;  5FNF A;  2YEB A;  4CE1 A;  2XD6 A;  4GFN A;  1ZW9 A;  4GQT A;  1UYL A;  3DGE A;  4JAV A;  2CCU A;  2VW5 A;  2YEH A;  4K4O A;  1GJV A;  3B27 A;  4E01 A;  1UY8 A;  1B3Q A;  2H55 A;  4CWO A;  2FWY A;  4NH9 A;  4XE2 A;  4WUC A;  4MOT A;  1YT1 A;  1BGQ A;  4KSG A;  2YEI A;  4LWI A;  1GKZ A;  2YE8 A;  5F5R A;  4O05 A;  2XDL A;  5GGZ A;  2FXS A;  3QTF A; 
#chains in the Genus database with same CATH topology
 5CTX A;  4EGH A;  4ASG A;  4CWF A;  5FND A;  1Y4S A;  4FCQ A;  1YER A;  4URO A;  4YKZ A;  3HZ1 A;  2IOQ A;  2YK2 A;  2C1I A;  3Q5J A;  4MBC A;  4URN A;  2YEJ A;  2QF6 A;  4MPN A;  5BOC A;  5CTU A;  4BQG A;  1AMW A;  3LPS A;  3Q5L A;  1EA6 A;  1ID0 A;  2YE3 A;  1Z59 A;  5CPH A;  4U7N A;  4EMV A;  3BMY A;  3WHA A;  4ASA A;  1PVG A;  1TH8 A;  3VHC A;  1YT2 A;  3HHU A;  2QG2 A;  3CRL A;  4H7Q A;  4ZVI A;  4YKW A;  2GQP A;  2XX4 A;  1UYG A;  4E00 A;  4LPB A;  4V25 A;  4R3A A;  3R4P A;  2YE4 A;  4CWQ A;  4URL A;  2CCT A;  5M4P A;  1YC3 A;  3B28 A;  1I5D A;  4XIR A;  3RKZ A;  4CE3 A;  4HYP A;  1H7U A;  5CTY A;  2HG1 A;  2YE6 A;  1NHI A;  4HXW A;  1IXM A;  3TZ4 A;  1YT0 A;  4WUD A;  1Z5A A;  3R92 A;  1KZN A;  4EGK A;  3Q5K A;  1TID A;  3FT5 A;  2WI7 A;  4L91 A;  3ZM7 A;  5IDJ A;  2XJG A;  1Z5C A;  1THN A;  2BU7 A;  3TZ2 A;  3VHD A;  4EFT A;  4O04 A;  4AWP A;  5M4E A;  2HHI A;  3LNU A;  4L94 A;  2BSM A;  4FCR A;  3T0H A;  4WUB A;  4EGI A;  2ESA A;  2ZDY A;  2YGF A;  1I58 A;  2IOP A;  2YEA A;  2WEP A;  2CGF A;  1Y4U A;  4E02 A;  3T2S A;  3VAD A;  4U7O A;  3G7B A;  1YET A;  4B7P A;  4W7T A;  4PRV A;  1UYH A;  3EHF A;  4XC0 A;  2YED A;  2UWD A;  3OWD A;  2IWS A;  1YC1 A;  4NH7 A;  4AWQ A;  2XHT A;  3KE6 A;  2YK9 A;  2XDS A;  1AH6 A;  2E0A A;  3RLR A;  4MPC A;  3B26 A;  1S14 A;  2BU2 A;  4MPE A;  1OSF A;  2XHX A;  2CCS A;  3HZ5 A;  3O0I A;  4B6C A;  2ZBK B;  3HEK A;  2IOR A;  2C2A A;  1YSZ A;  3T1K A;  1KIJ A;  3MNR P;  1AM1 A;  2QG0 A;  2YJW A;  4XIP A;  3A0T A;  2WI4 A;  1Y8N A;  1JM6 A;  1TIL A;  4LWG A;  2Q8H A;  2BU8 A;  2YI6 A;  2YE9 A;  2WEQ A;  4CWP A;  2JKI A;  5M4N A;  2WER A;  3GIE A;  4AWO A;  3B24 A;  4U93 A;  1MU5 A;  4MP2 A;  1YC4 A;  2BRE A;  4XCJ A;  2YI5 A;  1BXD A;  4LP0 A;  2XX5 A;  2YJX A;  1U0Z A;  1NHH A;  4HYM A;  4HZ0 A;  4EM7 A;  2XDK A;  4XD8 A;  3CWV A;  3D2R A;  3TTZ A;  4JAU A;  1H7S A;  4HY6 A;  3EHG A;  1A4H A;  2BT0 A;  1I5B A;  3A0Z A;  1UYE A;  3B25 A;  5BOD A;  3R4N A;  1S16 A;  5C93 A;  3EKO A;  5D7R A;  3HYZ A;  1QY8 A;  3ZKD A;  4ASB A;  3U2K A;  2YKE A;  5CTW A;  1GKX A;  4O07 A;  4I3H A;  5J6A A;  1UYF A;  4GEE A;  4V26 A;  2XJX A;  1F51 A;  2HCH A;  1TC6 A;  1I59 A;  1UY7 A;  3FV5 A;  2BU5 A;  4DUH A;  3OMU A;  4YKR A;  3ZKB A;  1US7 A;  4YKY A;  4KSH A;  4I5S A;  2XX2 A;  5L3J A;  4NH8 A;  1AJ6 A;  1U2O A;  1Z5B A;  4E72 A;  4HZ5 A;  5F3K A;  1AH8 A;  1YES A;  2C1G A;  5FNC A;  2XJJ A;  4Q20 A;  4GT8 A;  2YKJ A;  4HXZ A;  1UYK A;  3EHJ A;  2YI0 A;  4YKT A;  3H80 A;  1ZWH A;  4PU9 A;  2Q8I A;  4FMT A;  5M4M A;  4KQV A;  4P8O A;  5CF0 A;  5FWK A;  1QZR A;  1B63 A;  4JQL A;  2YGA A;  2YKC A;  4YKX A;  3A0W A;  5D6P A;  3H4L A;  2Q8F A;  3S5T A;  3ZXO A;  2JJC A;  3HYY A;  3VHA A;  1TC0 A;  2WI1 A;  4URM A;  2GFD A;  2BTZ A;  2Q8G A;  3GIF A;  4R1F A;  3D0B A;  1BYQ A;  1I5A A;  3U67 A;  2YGE A;  3ZXQ A;  2O1W A;  1BKN A;  4ASF A;  5IN9 A;  2WI3 A;  3R4M A;  2YKB A;  5M4K A;  2YEG A;  2XDU A;  4H81 A;  2YE2 A;  2PNR A;  4KP4 A;  5D7C A;  1UY6 A;  3A0X A;  5D6Q A;  4H85 A;  2VWC A;  4XKA A;  2IWU A;  3K99 A;  4FCP A;  2AKP A;  2WI2 A;  2YKI A;  3IED A;  1B62 A;  2YEE A;  4LWE A;  3RLQ A;  4EFU A;  3BM9 A;  3GIG A;  3T0Z A;  1MX0 A;  1Y8P A;  4BIU A;  3CRK A;  3T10 A;  4X9L A;  2YE5 A;  5IDM A;  4O0B A;  4P7A A;  4LWH A;  3OWB A;  3TZ5 A;  3R4O A;  3SL2 A;  4KFG A;  2VCI A;  3A0R A;  4XKK A;  3RLP A;  3NMQ A;  3G75 A;  2WI5 A;  3U2D A;  1UYC A;  1L0O A;  4XDM A;  1NHJ A;  1ZXM A;  2WI6 A;  4DZY A;  4JAS A;  2K5B A;  2EXL A;  2CG9 A;  4BAE A;  2O1U A;  2CH4 A;  4MP7 A;  4L90 A;  4CWT A;  4CWN A;  3D36 A;  5J71 A;  3INX A;  2XDX A;  2HKJ A;  1R62 A;  3K97 A;  2H8M A;  2XCM A;  4FPP A;  3FT8 A;  1TBW A;  1EI1 A;  2BYH A;  2FWZ A;  3JZ3 A;  2XHR A;  3O2F A;  4BIZ A;  4XCL A;  2O1V A;  4O09 A;  3CGY A;  3C0E A;  3K60 A;  2FTK A;  4GCZ A;  4CE2 A;  1YSR A;  4L8Z A;  4PRX A;  3CYG A;  2ZDX A;  4KTN A;  4XIQ A;  4ZKI A;  4BQJ A;  1UYD A;  3O6O A;  2YI7 A;  3OW6 A;  3R91 A;  2YEC A;  3TUH A;  2ZKJ A;  3GIG B;  4HY1 A;  3EKR A;  4GGL A;  4YKU A;  4BXI A;  1YS3 A;  1Y8O A;  2YE7 A;  4CWS A;  3K98 A;  2QFO A;  3TZ0 A;  4R3M A;  3PEH A;  3INW A;  2XK2 A;  3WQ9 A;  1UYI A;  2FYP A;  1UYM A;  3PEJ A;  4PL9 A;  2Q2E B;  4XKO A;  4LWF A;  3C11 A;  2YEF A;  2BZ5 A;  4QPK A;  4EEH A;  3G7E A;  2XAB A;  5M4H A;  3A0Y A;  3EHH A;  2IWX A;  1ZXN A;  1UY9 A;  1I5C A;  5D7D A;  4CWR A;  2BYI A;  3OPD A;  2BRC A;  1QYE A;  2VCJ A;  3CGZ A;  4QPJ A;  4XIT A;  4MB9 A;  3QDD A;  4L93 A;  4AS9 A;  4XTJ A;  2BU6 A;  4YKQ A;  5FNF A;  2YEB A;  4CE1 A;  2XD6 A;  4GFN A;  1ZW9 A;  4GQT A;  1UYL A;  3DGE A;  4JAV A;  2CCU A;  2VW5 A;  2YEH A;  4K4O A;  1GJV A;  3B27 A;  4E01 A;  1UY8 A;  1B3Q A;  2H55 A;  5JEN A;  4CWO A;  2FWY A;  4NH9 A;  4XE2 A;  4WUC A;  4MOT A;  1YT1 A;  3LMM A;  1BGQ A;  4KSG A;  2YEI A;  4LWI A;  1GKZ A;  2YE8 A;  5F5R A;  4O05 A;  2XDL A;  5GGZ A;  2FXS A;  3QTF A; 
#chains in the Genus database with same CATH homology
 5CTX A;  4EGH A;  4ASG A;  4CWF A;  5FND A;  1Y4S A;  4FCQ A;  1YER A;  4URO A;  4YKZ A;  3HZ1 A;  2IOQ A;  2YK2 A;  3Q5J A;  4MBC A;  4URN A;  2YEJ A;  2QF6 A;  4MPN A;  5BOC A;  5CTU A;  4BQG A;  1AMW A;  3LPS A;  3Q5L A;  1EA6 A;  1ID0 A;  2YE3 A;  1Z59 A;  5CPH A;  4U7N A;  4EMV A;  3BMY A;  3WHA A;  4ASA A;  1PVG A;  1TH8 A;  3VHC A;  1YT2 A;  3HHU A;  2QG2 A;  3CRL A;  4H7Q A;  4ZVI A;  4YKW A;  2GQP A;  2XX4 A;  1UYG A;  4E00 A;  4LPB A;  4V25 A;  4R3A A;  3R4P A;  2YE4 A;  4CWQ A;  4URL A;  2CCT A;  5M4P A;  1YC3 A;  3B28 A;  1I5D A;  4XIR A;  3RKZ A;  4CE3 A;  4HYP A;  1H7U A;  5CTY A;  2HG1 A;  2YE6 A;  1NHI A;  4HXW A;  3TZ4 A;  1YT0 A;  4WUD A;  1Z5A A;  3R92 A;  1KZN A;  4EGK A;  3Q5K A;  1TID A;  3FT5 A;  2WI7 A;  4L91 A;  3ZM7 A;  5IDJ A;  2XJG A;  1Z5C A;  1THN A;  2BU7 A;  3TZ2 A;  3VHD A;  4EFT A;  4O04 A;  4AWP A;  5M4E A;  3LNU A;  4L94 A;  2BSM A;  4FCR A;  3T0H A;  4WUB A;  4EGI A;  2ESA A;  2ZDY A;  2YGF A;  1I58 A;  2IOP A;  2YEA A;  2WEP A;  2CGF A;  1Y4U A;  4E02 A;  3T2S A;  3VAD A;  4U7O A;  3G7B A;  1YET A;  4B7P A;  4W7T A;  4PRV A;  1UYH A;  3EHF A;  4XC0 A;  2YED A;  2UWD A;  3OWD A;  2IWS A;  1YC1 A;  4NH7 A;  4AWQ A;  2XHT A;  3KE6 A;  2YK9 A;  2XDS A;  1AH6 A;  2E0A A;  3RLR A;  4MPC A;  3B26 A;  1S14 A;  2BU2 A;  4MPE A;  1OSF A;  2XHX A;  2CCS A;  3HZ5 A;  3O0I A;  4B6C A;  2ZBK B;  3HEK A;  2IOR A;  2C2A A;  1YSZ A;  3T1K A;  1KIJ A;  3MNR P;  1AM1 A;  2QG0 A;  2YJW A;  4XIP A;  3A0T A;  2WI4 A;  1Y8N A;  1JM6 A;  1TIL A;  4LWG A;  2Q8H A;  2BU8 A;  2YI6 A;  2YE9 A;  2WEQ A;  4CWP A;  2JKI A;  5M4N A;  2WER A;  3GIE A;  4AWO A;  3B24 A;  4U93 A;  1MU5 A;  4MP2 A;  1YC4 A;  2BRE A;  4XCJ A;  2YI5 A;  1BXD A;  4LP0 A;  2XX5 A;  2YJX A;  1U0Z A;  1NHH A;  4HYM A;  4HZ0 A;  4EM7 A;  2XDK A;  4XD8 A;  3CWV A;  3D2R A;  3TTZ A;  4JAU A;  1H7S A;  4HY6 A;  3EHG A;  1A4H A;  2BT0 A;  1I5B A;  3A0Z A;  1UYE A;  3B25 A;  5BOD A;  3R4N A;  1S16 A;  5C93 A;  3EKO A;  5D7R A;  3HYZ A;  1QY8 A;  3ZKD A;  4ASB A;  3U2K A;  2YKE A;  5CTW A;  1GKX A;  4O07 A;  4I3H A;  5J6A A;  1UYF A;  4GEE A;  4V26 A;  2XJX A;  2HCH A;  1TC6 A;  1I59 A;  1UY7 A;  3FV5 A;  2BU5 A;  4DUH A;  3OMU A;  4YKR A;  3ZKB A;  1US7 A;  4YKY A;  4KSH A;  4I5S A;  2XX2 A;  5L3J A;  4NH8 A;  1AJ6 A;  1U2O A;  1Z5B A;  4HZ5 A;  5F3K A;  1AH8 A;  1YES A;  5FNC A;  2XJJ A;  4Q20 A;  4GT8 A;  2YKJ A;  4HXZ A;  1UYK A;  3EHJ A;  2YI0 A;  4YKT A;  3H80 A;  1ZWH A;  4PU9 A;  2Q8I A;  4FMT A;  5M4M A;  4KQV A;  4P8O A;  5CF0 A;  5FWK A;  1QZR A;  1B63 A;  4JQL A;  2YGA A;  2YKC A;  4YKX A;  3A0W A;  5D6P A;  3H4L A;  2Q8F A;  3ZXO A;  2JJC A;  3HYY A;  3VHA A;  1TC0 A;  2WI1 A;  4URM A;  2GFD A;  2BTZ A;  2Q8G A;  3GIF A;  4R1F A;  3D0B A;  1BYQ A;  1I5A A;  3U67 A;  2YGE A;  3ZXQ A;  2O1W A;  1BKN A;  4ASF A;  5IN9 A;  2WI3 A;  3R4M A;  2YKB A;  5M4K A;  2YEG A;  2XDU A;  4H81 A;  2YE2 A;  2PNR A;  4KP4 A;  5D7C A;  1UY6 A;  3A0X A;  5D6Q A;  4H85 A;  2VWC A;  4XKA A;  2IWU A;  3K99 A;  4FCP A;  2AKP A;  2WI2 A;  2YKI A;  3IED A;  1B62 A;  2YEE A;  4LWE A;  3RLQ A;  4EFU A;  3BM9 A;  3GIG A;  3T0Z A;  1MX0 A;  1Y8P A;  4BIU A;  3CRK A;  3T10 A;  4X9L A;  2YE5 A;  5IDM A;  4O0B A;  4P7A A;  4LWH A;  3OWB A;  3TZ5 A;  3R4O A;  3SL2 A;  4KFG A;  2VCI A;  3A0R A;  4XKK A;  3RLP A;  3NMQ A;  3G75 A;  2WI5 A;  3U2D A;  1UYC A;  1L0O A;  4XDM A;  1NHJ A;  1ZXM A;  2WI6 A;  4DZY A;  4JAS A;  2K5B A;  2EXL A;  2CG9 A;  4BAE A;  2O1U A;  2CH4 A;  4MP7 A;  4L90 A;  4CWT A;  4CWN A;  3D36 A;  5J71 A;  3INX A;  2XDX A;  2HKJ A;  1R62 A;  3K97 A;  2H8M A;  2XCM A;  4FPP A;  3FT8 A;  1TBW A;  1EI1 A;  2BYH A;  2FWZ A;  3JZ3 A;  2XHR A;  3O2F A;  4BIZ A;  4XCL A;  2O1V A;  4O09 A;  3CGY A;  3C0E A;  3K60 A;  4GCZ A;  4CE2 A;  1YSR A;  4L8Z A;  4PRX A;  2ZDX A;  4KTN A;  4XIQ A;  4ZKI A;  4BQJ A;  1UYD A;  3O6O A;  2YI7 A;  3OW6 A;  3R91 A;  2YEC A;  3TUH A;  2ZKJ A;  3GIG B;  4HY1 A;  3EKR A;  4GGL A;  4YKU A;  4BXI A;  1YS3 A;  1Y8O A;  2YE7 A;  4CWS A;  3K98 A;  2QFO A;  3TZ0 A;  4R3M A;  3PEH A;  3INW A;  2XK2 A;  3WQ9 A;  1UYI A;  2FYP A;  1UYM A;  3PEJ A;  4PL9 A;  2Q2E B;  4XKO A;  4LWF A;  3C11 A;  2YEF A;  2BZ5 A;  4QPK A;  4EEH A;  3G7E A;  2XAB A;  5M4H A;  3A0Y A;  3EHH A;  2IWX A;  1ZXN A;  1UY9 A;  1I5C A;  5D7D A;  4CWR A;  2BYI A;  3OPD A;  2BRC A;  1QYE A;  2VCJ A;  3CGZ A;  4QPJ A;  4XIT A;  4MB9 A;  3QDD A;  4L93 A;  4AS9 A;  4XTJ A;  2BU6 A;  4YKQ A;  5FNF A;  2YEB A;  4CE1 A;  2XD6 A;  4GFN A;  1ZW9 A;  4GQT A;  1UYL A;  3DGE A;  4JAV A;  2CCU A;  2VW5 A;  2YEH A;  4K4O A;  1GJV A;  3B27 A;  4E01 A;  1UY8 A;  1B3Q A;  2H55 A;  4CWO A;  2FWY A;  4NH9 A;  4XE2 A;  4WUC A;  4MOT A;  1YT1 A;  1BGQ A;  4KSG A;  2YEI A;  4LWI A;  1GKZ A;  2YE8 A;  5F5R A;  4O05 A;  2XDL A;  5GGZ A;  2FXS A;  3QTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...