1I58A

Structure of the histidine kinase chea atp-binding domain in complex with atp analog adpcp and magnesium
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
189
structure length
189
Chain Sequence
GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein, transferase
molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 61
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i58A00
4XDMA 3O0IA 2CGFA 4NH8A 1BYQA 4PRVA 1TC0A 1U2OA 4YKWA 5FWKA 4U7OA 3INWA 4EFUA 4XCJA 5CTWA 4YKXA 1ZWHA 4HZ0A 1UY9A 1BKNA 4LWIA 4E01A 4CE2A 2BU7A 2AKPA 2BREA 4EGIA 1UYFA 4MP2A 1UYGA 5D7CA 4HZ5A 4YKTA 4ASFA 4DUHA 4XCLA 4O0BA 1I59A 4GFNA 4EFTA 4BAEA 3RKZA 1GJVA 1UYKA 4H7QA 2XD6A 3TZ2A 2YE6A 2WI5A 2IWUA 2YI6A 1YC4A 4EGKA 3ZKBA 4FCQA 2XCMA 3CGYA 4XE2A 1H7SA 1A4HA 4XKKA 3EHFA 2O1UA 1US7A 2YKIA 4H81A 2WI4A 4XKAA 4PU9A 3VHAA 5M4PA 4L94A 2WI1A 3ZKDA 2YE9A 5M4MA 5M4NA 4WUBA 3T2SA 3U67A 2YK9A 1Y4UA 3O2FA 2FWYA 2YEDA 5IDJA 3MNRP 1GKXA 2BZ5A 2BRCA 1TH8A 5J6AA 4ASBA 4AWQA 4EM7A 4AS9A 3CWVA 1UY8A 4LWFA 4XITA 4XD8A 2JKIA 1QY8A 3EKRA 3FT8A 1R62A 3B25A 4MPNA 3OMUA 1TILA 4JASA 4MP7A 2YEHA 1Z5AA 4MB9A 2Q2EB 2XDUA 1UYDA 4GQTA 2XJXA 4XIQA 5FNDA 1MU5A 5M4KA 4B7PA 1ZXMA 2ZDYA 4URLA 1BXDA 1Z5BA 4KQVA 4DZYA 1EA6A 4O04A 2BSMA 2XK2A 2BU6A 1AJ6A 3BMYA 3K99A 4NH9A 3A0ZA 4ASGA 3GIGB 2IOQA 3LNUA 4L90A 4YKRA 3U2DA 2QG2A 2BYIA 2ZDXA 2YEEA 4BXIA 2Q8IA 3TZ4A 4XTJA 2YI0A 2YJXA 2YEFA 2XDLA 3G7EA 1THNA 3H4LA 4QPKA 1S16A 3GIFA 2Q8HA 2IWXA 4KP4A 3D36A 1Z59A 4U7NA 4FCRA 3VHCA 2UWDA 2VW5A 3B28A 4XC0A 1I58A 5GGZA 3Q5KA 3ZXQA 3B27A 4K4OA 2IORA 4L91A 4LPBA 4FMTA 4HY6A 2CCTA 4HXZA 4O07A 3PEJA 4KSHA 3R92A 3R4NA 4JQLA 2FWZA 4V25A 4BQJA 4MOTA 3OW6A 5CTXA 2ZKJA 3EHHA 1UY7A 4CWFA 5FNFA 3VHDA 5BODA 2O1WA 4HXWA 5CF0A 4MBCA 2YKCA 4YKUA 1I5AA 5F5RA 3NMQA 4R3MA 2XDKA 3D2RA 4HY1A 3R4PA 1YC1A 1ID0A 2H55A 5D6PA 1OSFA 1QZRA 1Y8PA 4NH7A 4KFGA 3A0YA 2O1VA 2BT0A 2BTZA 3G7BA 2IOPA 3HZ5A 4P8OA 3CRKA 1EI1A 2PNRA 2CCUA 1KIJA 3HZ1A 2GFDA 3JZ3A 1NHJA 1UYEA 4XIPA 2XX4A 2XDSA 5BOCA 3WHAA 2ESAA 3A0TA 3TUHA 2FYPA 1TBWA 1B63A 3ZM7A 5CTUA 5M4HA 1YESA 3RLQA 1UYCA 4JAUA 1MX0A 2BU5A 5J71A 2YI7A 2BU2A 1Y8OA 2YKEA 4E00A 2YGAA 4ZVIA 3SL2A 1TIDA 2QFOA 4PL9A 1ZW9A 3RLPA 4KSGA 5FNCA 2WI6A 3T1KA 2HKJA 3C11A 2CH4A 4CWNA 1Z5CA 1I5DA 1AH6A 4Q20A 2YE4A 3A0RA 5IDMA 2YGFA 4YKQA 2YKJA 1B62A 2YEBA 1B3QA 4HYPA 3T0ZA 2CCSA 3D0BA 3FV5A 4XKOA 1I5BA 4WUCA 2YEGA 4UROA 4O09A 4LWEA 4CE3A 4AWPA 1AM1A 3R4MA 3WQ9A 4CWQA 5IN9A 4LWGA 1UYHA 2YKBA 5D6QA 4WUDA 3OWDA 4P7AA 3EHGA 4YKZA 2IWSA 2WI2A 1Y8NA 2EXLA 4LWHA 4CWTA 3U2KA 4PRXA 1YT0A 4H85A 3VADA 1U0ZA 5F3KA 3QDDA 2YE7A 4LP0A 3T10A 4BIZA 4CE1A 3K98A 3ZXOA 1BGQA 4L8ZA 2WI3A 4URMA 1YS3A 4R3AA 3CRLA 3GIGA 4MPEA 3OPDA 2GQPA 4B6CA 2BU8A 2XHRA 3R4OA 2YEJA 3TTZA 1YSZA 2E0AA 2XX5A 3H80A 3HYZA 1NHHA 3IEDA 1L0OA 3K97A 2YECA 4R1FA 2WEQA 2XJJA 3B26A 2FXSA 3HHUA 4GCZA 3TZ5A 2XX2A 3GIEA 4EMVA 3FT5A 5C93A 3A0XA 3CGZA 4MPCA 4E02A 2VCJA 2YI5A 3B24A 1YT2A 2HG1A 4X9LA 2WERA 1UY6A 1ZXNA 2YEIA 5M4EA 2XHTA 2WEPA 4EGHA 3C0EA 3RLRA 2Q8GA 4HYMA 3Q5JA 3R91A 1NHIA 4BQGA 1UYLA 2VCIA 1YERA 1GKZA 3DGEA 4GEEA 3HEKA 3INXA 4V26A 3Q5LA 1YSRA 3PEHA 2BYHA 2YE8A 4I3HA 2ZBKB 2YK2A 1YC3A 1JM6A 4CWPA 3EHJA 4ASAA 3TZ0A 4FPPA 4JAVA 3LPSA 3HYYA 1YT1A 4I5SA 5D7DA 1I5CA 4KTNA 2C2AA 3O6OA 2WI7A 1H7UA 2K5BA 2QF6A 3EKOA 4YKYA 5CTYA 5L3JA 2YGEA 4ZKIA 2XDXA 4O05A 4FCPA 2YE5A 4W7TA 1KZNA 4GGLA 1Y4SA 3BM9A 2XHXA 5CPHA 1AH8A 1QYEA 2YE2A 4EEHA 4AWOA 3K60A 1UYIA 3A0WA 3QTFA 4U93A 4CWSA 1PVGA 2HCHA 3OWBA 1UYMA 4XIRA 1YETA 4QPJA 3KE6A 3G75A 4GT8A 1S14A 4BIUA 2Q8FA 2XABA 4CWOA 2CG9A 2YJWA 2YEAA 2XJGA 5D7RA 2YE3A 1TC6A 2H8MA 4CWRA 2QG0A 1AMWA 2VWCA 2JJCA 4URNA 4L93A 3T0HA
chains in the Genus database with same CATH superfamily
4XDMA 3O0IA 2CGFA 4NH8A 1BYQA 4PRVA 1TC0A 1U2OA 4YKWA 5FWKA 4U7OA 3INWA 2C1GA 4EFUA 3CYGA 4XCJA 5CTWA 4YKXA 1ZWHA 4HZ0A 1UY9A 1BKNA 4LWIA 4E01A 4CE2A 2BU7A 2AKPA 2BREA 2C1IA 4EGIA 1UYFA 4MP2A 1UYGA 5D7CA 4HZ5A 4YKTA 4ASFA 4DUHA 4XCLA 4O0BA 1I59A 4GFNA 4EFTA 4BAEA 3RKZA 1GJVA 1UYKA 4H7QA 2XD6A 3TZ2A 2YE6A 2WI5A 2IWUA 2YI6A 1YC4A 4EGKA 3ZKBA 4FCQA 2XCMA 3CGYA 4XE2A 1H7SA 1A4HA 4XKKA 3EHFA 2O1UA 1US7A 2YKIA 4H81A 2WI4A 4XKAA 4PU9A 3VHAA 5M4PA 4L94A 2WI1A 3ZKDA 2YE9A 5M4MA 5M4NA 4WUBA 3T2SA 3U67A 2YK9A 1Y4UA 3O2FA 2FWYA 2YEDA 5IDJA 3MNRP 1GKXA 2BZ5A 2BRCA 1TH8A 5J6AA 4ASBA 4AWQA 4EM7A 4AS9A 3CWVA 1UY8A 4LWFA 4XITA 4XD8A 2JKIA 1QY8A 3EKRA 3FT8A 1R62A 3B25A 4MPNA 3OMUA 1TILA 4JASA 4MP7A 2YEHA 1Z5AA 4MB9A 2Q2EB 2XDUA 1UYDA 4GQTA 3LMMA 2XJXA 4XIQA 5FNDA 1MU5A 5M4KA 4B7PA 1ZXMA 2ZDYA 4URLA 3S5TA 1BXDA 1Z5BA 4KQVA 4DZYA 1EA6A 4O04A 2BSMA 2XK2A 2BU6A 1AJ6A 3BMYA 3K99A 4NH9A 3A0ZA 4ASGA 3GIGB 2IOQA 3LNUA 4L90A 4YKRA 3U2DA 2QG2A 2BYIA 2ZDXA 2YEEA 4BXIA 2Q8IA 3TZ4A 4XTJA 2YI0A 2YJXA 2YEFA 2XDLA 3G7EA 1THNA 3H4LA 4QPKA 1S16A 3GIFA 2Q8HA 2IWXA 4KP4A 3D36A 1Z59A 4U7NA 4FCRA 3VHCA 2UWDA 2VW5A 3B28A 4XC0A 1I58A 5GGZA 3Q5KA 3ZXQA 3B27A 4K4OA 2IORA 4L91A 4LPBA 4FMTA 4HY6A 2CCTA 4HXZA 4O07A 3PEJA 4KSHA 3R92A 3R4NA 4JQLA 2FWZA 4V25A 4BQJA 4MOTA 2FTKA 3OW6A 5CTXA 2ZKJA 3EHHA 1UY7A 4CWFA 5FNFA 3VHDA 5BODA 2O1WA 4HXWA 5CF0A 4MBCA 2YKCA 4YKUA 1I5AA 5F5RA 3NMQA 4R3MA 2XDKA 3D2RA 4HY1A 3R4PA 1YC1A 1ID0A 2H55A 5D6PA 1OSFA 1QZRA 1Y8PA 4NH7A 4KFGA 3A0YA 2O1VA 2BT0A 2BTZA 3G7BA 2IOPA 3HZ5A 4P8OA 3CRKA 1EI1A 2PNRA 2CCUA 1KIJA 3HZ1A 2GFDA 3JZ3A 1NHJA 1UYEA 4XIPA 2XX4A 2XDSA 5BOCA 3WHAA 2ESAA 3A0TA 3TUHA 2FYPA 1TBWA 1B63A 3ZM7A 5CTUA 5M4HA 1YESA 3RLQA 1UYCA 4JAUA 1MX0A 2BU5A 5J71A 2YI7A 2BU2A 1Y8OA 2YKEA 4E00A 2YGAA 4ZVIA 3SL2A 1TIDA 2QFOA 4PL9A 1ZW9A 3RLPA 4KSGA 5FNCA 2WI6A 3T1KA 2HKJA 3C11A 2CH4A 4CWNA 1Z5CA 1I5DA 1AH6A 4Q20A 2YE4A 3A0RA 5IDMA 2YGFA 4YKQA 2YKJA 1B62A 2YEBA 1B3QA 4HYPA 3T0ZA 2CCSA 3D0BA 3FV5A 4XKOA 1I5BA 4WUCA 2YEGA 4UROA 4O09A 4LWEA 4CE3A 4AWPA 1AM1A 3R4MA 3WQ9A 4CWQA 5IN9A 4LWGA 1UYHA 2YKBA 5D6QA 4WUDA 3OWDA 4P7AA 3EHGA 4YKZA 2IWSA 2WI2A 1Y8NA 2EXLA 4LWHA 4CWTA 3U2KA 4PRXA 1YT0A 4H85A 3VADA 1U0ZA 5F3KA 3QDDA 2YE7A 4LP0A 3T10A 4BIZA 4CE1A 3K98A 3ZXOA 1BGQA 4L8ZA 2WI3A 4URMA 1YS3A 4R3AA 3CRLA 3GIGA 4MPEA 3OPDA 2GQPA 4B6CA 4E72A 2BU8A 2XHRA 3R4OA 2YEJA 3TTZA 1YSZA 2E0AA 2XX5A 3H80A 3HYZA 1NHHA 3IEDA 1L0OA 3K97A 2YECA 4R1FA 2WEQA 2XJJA 3B26A 2FXSA 3HHUA 4GCZA 3TZ5A 2XX2A 3GIEA 4EMVA 3FT5A 5C93A 3A0XA 3CGZA 4MPCA 4E02A 2VCJA 2YI5A 3B24A 1YT2A 2HG1A 4X9LA 2WERA 1UY6A 1ZXNA 2YEIA 5M4EA 2XHTA 2WEPA 4EGHA 3C0EA 3RLRA 2Q8GA 4HYMA 2HHIA 3Q5JA 3R91A 1NHIA 4BQGA 5JENA 1UYLA 2VCIA 1YERA 1GKZA 3DGEA 4GEEA 3HEKA 3INXA 4V26A 3Q5LA 1YSRA 3PEHA 2BYHA 2YE8A 4I3HA 2ZBKB 2YK2A 1YC3A 1JM6A 4CWPA 3EHJA 4ASAA 3TZ0A 4FPPA 4JAVA 3LPSA 3HYYA 1YT1A 4I5SA 5D7DA 1I5CA 4KTNA 2C2AA 3O6OA 2WI7A 1IXMA 1H7UA 2K5BA 2QF6A 3EKOA 4YKYA 5CTYA 5L3JA 2YGEA 4ZKIA 2XDXA 4O05A 4FCPA 2YE5A 4W7TA 1KZNA 4GGLA 1Y4SA 3BM9A 2XHXA 5CPHA 1AH8A 1QYEA 2YE2A 4EEHA 4AWOA 3K60A 1UYIA 3A0WA 3QTFA 4U93A 4CWSA 1PVGA 2HCHA 3OWBA 1UYMA 4XIRA 1YETA 4QPJA 3KE6A 3G75A 4GT8A 1S14A 1F51A 4BIUA 2Q8FA 2XABA 4CWOA 2CG9A 2YJWA 2YEAA 2XJGA 5D7RA 2YE3A 1TC6A 2H8MA 4CWRA 2QG0A 1AMWA 2VWCA 2JJCA 4URNA 4L93A 3T0HA
chains in the Genus database with same CATH topology
4XDMA 3O0IA 2CGFA 4NH8A 1BYQA 4PRVA 1TC0A 1U2OA 4YKWA 5FWKA 4U7OA 3INWA 4EFUA 4XCJA 5CTWA 4YKXA 1ZWHA 4HZ0A 1UY9A 1BKNA 4LWIA 4E01A 4CE2A 2BU7A 2AKPA 2BREA 4EGIA 1UYFA 4MP2A 1UYGA 5D7CA 4HZ5A 4YKTA 4ASFA 4DUHA 4XCLA 4O0BA 1I59A 4GFNA 4EFTA 4BAEA 3RKZA 1GJVA 1UYKA 4H7QA 2XD6A 3TZ2A 2YE6A 2WI5A 2IWUA 2YI6A 1YC4A 4EGKA 3ZKBA 4FCQA 2XCMA 3CGYA 4XE2A 1H7SA 1A4HA 4XKKA 3EHFA 2O1UA 1US7A 2YKIA 4H81A 2WI4A 4XKAA 4PU9A 3VHAA 5M4PA 4L94A 2WI1A 3ZKDA 2YE9A 5M4MA 5M4NA 4WUBA 3T2SA 3U67A 2YK9A 1Y4UA 3O2FA 2FWYA 2YEDA 5IDJA 3MNRP 1GKXA 2BZ5A 2BRCA 1TH8A 5J6AA 4ASBA 4AWQA 4EM7A 4AS9A 3CWVA 1UY8A 4LWFA 4XITA 4XD8A 2JKIA 1QY8A 3EKRA 3FT8A 1R62A 3B25A 4MPNA 3OMUA 1TILA 4JASA 4MP7A 2YEHA 1Z5AA 4MB9A 2Q2EB 2XDUA 1UYDA 4GQTA 2XJXA 4XIQA 5FNDA 1MU5A 5M4KA 4B7PA 1ZXMA 2ZDYA 4URLA 1BXDA 1Z5BA 4KQVA 4DZYA 1EA6A 4O04A 2BSMA 2XK2A 2BU6A 1AJ6A 3BMYA 3K99A 4NH9A 3A0ZA 4ASGA 3GIGB 2IOQA 3LNUA 4L90A 4YKRA 3U2DA 2QG2A 2BYIA 2ZDXA 2YEEA 4BXIA 2Q8IA 3TZ4A 4XTJA 2YI0A 2YJXA 2YEFA 2XDLA 3G7EA 1THNA 3H4LA 4QPKA 1S16A 3GIFA 2Q8HA 2IWXA 4KP4A 3D36A 1Z59A 4U7NA 4FCRA 3VHCA 2UWDA 2VW5A 3B28A 4XC0A 1I58A 5GGZA 3Q5KA 3ZXQA 3B27A 4K4OA 2IORA 4L91A 4LPBA 4FMTA 4HY6A 2CCTA 4HXZA 4O07A 3PEJA 4KSHA 3R92A 3R4NA 4JQLA 2FWZA 4V25A 4BQJA 4MOTA 3OW6A 5CTXA 2ZKJA 3EHHA 1UY7A 4CWFA 5FNFA 3VHDA 5BODA 2O1WA 4HXWA 5CF0A 4MBCA 2YKCA 4YKUA 1I5AA 5F5RA 3NMQA 4R3MA 2XDKA 3D2RA 4HY1A 3R4PA 1YC1A 1ID0A 2H55A 5D6PA 1OSFA 1QZRA 1Y8PA 4NH7A 4KFGA 3A0YA 2O1VA 2BT0A 2BTZA 3G7BA 2IOPA 3HZ5A 4P8OA 3CRKA 1EI1A 2PNRA 2CCUA 1KIJA 3HZ1A 2GFDA 3JZ3A 1NHJA 1UYEA 4XIPA 2XX4A 2XDSA 5BOCA 3WHAA 2ESAA 3A0TA 3TUHA 2FYPA 1TBWA 1B63A 3ZM7A 5CTUA 5M4HA 1YESA 3RLQA 1UYCA 4JAUA 1MX0A 2BU5A 5J71A 2YI7A 2BU2A 1Y8OA 2YKEA 4E00A 2YGAA 4ZVIA 3SL2A 1TIDA 2QFOA 4PL9A 1ZW9A 3RLPA 4KSGA 5FNCA 2WI6A 3T1KA 2HKJA 3C11A 2CH4A 4CWNA 1Z5CA 1I5DA 1AH6A 4Q20A 2YE4A 3A0RA 5IDMA 2YGFA 4YKQA 2YKJA 1B62A 2YEBA 1B3QA 4HYPA 3T0ZA 2CCSA 3D0BA 3FV5A 4XKOA 1I5BA 4WUCA 2YEGA 4UROA 4O09A 4LWEA 4CE3A 4AWPA 1AM1A 3R4MA 3WQ9A 4CWQA 5IN9A 4LWGA 1UYHA 2YKBA 5D6QA 4WUDA 3OWDA 4P7AA 3EHGA 4YKZA 2IWSA 2WI2A 1Y8NA 2EXLA 4LWHA 4CWTA 3U2KA 4PRXA 1YT0A 4H85A 3VADA 1U0ZA 5F3KA 3QDDA 2YE7A 4LP0A 3T10A 4BIZA 4CE1A 3K98A 3ZXOA 1BGQA 4L8ZA 2WI3A 4URMA 1YS3A 4R3AA 3CRLA 3GIGA 4MPEA 3OPDA 2GQPA 4B6CA 2BU8A 2XHRA 3R4OA 2YEJA 3TTZA 1YSZA 2E0AA 2XX5A 3H80A 3HYZA 1NHHA 3IEDA 1L0OA 3K97A 2YECA 4R1FA 2WEQA 2XJJA 3B26A 2FXSA 3HHUA 4GCZA 3TZ5A 2XX2A 3GIEA 4EMVA 3FT5A 5C93A 3A0XA 3CGZA 4MPCA 4E02A 2VCJA 2YI5A 3B24A 1YT2A 2HG1A 4X9LA 2WERA 1UY6A 1ZXNA 2YEIA 5M4EA 2XHTA 2WEPA 4EGHA 3C0EA 3RLRA 2Q8GA 4HYMA 3Q5JA 3R91A 1NHIA 4BQGA 1UYLA 2VCIA 1YERA 1GKZA 3DGEA 4GEEA 3HEKA 3INXA 4V26A 3Q5LA 1YSRA 3PEHA 2BYHA 2YE8A 4I3HA 2ZBKB 2YK2A 1YC3A 1JM6A 4CWPA 3EHJA 4ASAA 3TZ0A 4FPPA 4JAVA 3LPSA 3HYYA 1YT1A 4I5SA 5D7DA 1I5CA 4KTNA 2C2AA 3O6OA 2WI7A 1H7UA 2K5BA 2QF6A 3EKOA 4YKYA 5CTYA 5L3JA 2YGEA 4ZKIA 2XDXA 4O05A 4FCPA 2YE5A 4W7TA 1KZNA 4GGLA 1Y4SA 3BM9A 2XHXA 5CPHA 1AH8A 1QYEA 2YE2A 4EEHA 4AWOA 3K60A 1UYIA 3A0WA 3QTFA 4U93A 4CWSA 1PVGA 2HCHA 3OWBA 1UYMA 4XIRA 1YETA 4QPJA 3KE6A 3G75A 4GT8A 1S14A 4BIUA 2Q8FA 2XABA 4CWOA 2CG9A 2YJWA 2YEAA 2XJGA 5D7RA 2YE3A 1TC6A 2H8MA 4CWRA 2QG0A 1AMWA 2VWCA 2JJCA 4URNA 4L93A 3T0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XDM A;  3O0I A;  2CGF A;  4NH8 A;  1BYQ A;  4PRV A;  1TC0 A;  1U2O A;  4YKW A;  5FWK A;  4U7O A;  3INW A;  4EFU A;  4XCJ A;  5CTW A;  4YKX A;  1ZWH A;  4HZ0 A;  1UY9 A;  1BKN A;  4LWI A;  4E01 A;  4CE2 A;  2BU7 A;  2AKP A;  2BRE A;  4EGI A;  1UYF A;  4MP2 A;  1UYG A;  5D7C A;  4HZ5 A;  4YKT A;  4ASF A;  4DUH A;  4XCL A;  4O0B A;  1I59 A;  4GFN A;  4EFT A;  4BAE A;  3RKZ A;  1GJV A;  1UYK A;  4H7Q A;  2XD6 A;  3TZ2 A;  2YE6 A;  2WI5 A;  2IWU A;  2YI6 A;  1YC4 A;  4EGK A;  3ZKB A;  4FCQ A;  2XCM A;  3CGY A;  4XE2 A;  1H7S A;  1A4H A;  4XKK A;  3EHF A;  2O1U A;  1US7 A;  2YKI A;  4H81 A;  2WI4 A;  4XKA A;  4PU9 A;  3VHA A;  5M4P A;  4L94 A;  2WI1 A;  3ZKD A;  2YE9 A;  5M4M A;  5M4N A;  4WUB A;  3T2S A;  3U67 A;  2YK9 A;  1Y4U A;  3O2F A;  2FWY A;  2YED A;  5IDJ A;  3MNR P;  1GKX A;  2BZ5 A;  2BRC A;  1TH8 A;  5J6A A;  4ASB A;  4AWQ A;  4EM7 A;  4AS9 A;  3CWV A;  1UY8 A;  4LWF A;  4XIT A;  4XD8 A;  2JKI A;  1QY8 A;  3EKR A;  3FT8 A;  1R62 A;  3B25 A;  4MPN A;  3OMU A;  1TIL A;  4JAS A;  4MP7 A;  2YEH A;  1Z5A A;  4MB9 A;  2Q2E B;  2XDU A;  1UYD A;  4GQT A;  2XJX A;  4XIQ A;  5FND A;  1MU5 A;  5M4K A;  4B7P A;  1ZXM A;  2ZDY A;  4URL A;  1BXD A;  1Z5B A;  4KQV A;  4DZY A;  1EA6 A;  4O04 A;  2BSM A;  2XK2 A;  2BU6 A;  1AJ6 A;  3BMY A;  3K99 A;  4NH9 A;  3A0Z A;  4ASG A;  3GIG B;  2IOQ A;  3LNU A;  4L90 A;  4YKR A;  3U2D A;  2QG2 A;  2BYI A;  2ZDX A;  2YEE A;  4BXI A;  2Q8I A;  3TZ4 A;  4XTJ A;  2YI0 A;  2YJX A;  2YEF A;  2XDL A;  3G7E A;  1THN A;  3H4L A;  4QPK A;  1S16 A;  3GIF A;  2Q8H A;  2IWX A;  4KP4 A;  3D36 A;  1Z59 A;  4U7N A;  4FCR A;  3VHC A;  2UWD A;  2VW5 A;  3B28 A;  4XC0 A;  1I58 A;  5GGZ A;  3Q5K A;  3ZXQ A;  3B27 A;  4K4O A;  2IOR A;  4L91 A;  4LPB A;  4FMT A;  4HY6 A;  2CCT A;  4HXZ A;  4O07 A;  3PEJ A;  4KSH A;  3R92 A;  3R4N A;  4JQL A;  2FWZ A;  4V25 A;  4BQJ A;  4MOT A;  3OW6 A;  5CTX A;  2ZKJ A;  3EHH A;  1UY7 A;  4CWF A;  5FNF A;  3VHD A;  5BOD A;  2O1W A;  4HXW A;  5CF0 A;  4MBC A;  2YKC A;  4YKU A;  1I5A A;  5F5R A;  3NMQ A;  4R3M A;  2XDK A;  3D2R A;  4HY1 A;  3R4P A;  1YC1 A;  1ID0 A;  2H55 A;  5D6P A;  1OSF A;  1QZR A;  1Y8P A;  4NH7 A;  4KFG A;  3A0Y A;  2O1V A;  2BT0 A;  2BTZ A;  3G7B A;  2IOP A;  3HZ5 A;  4P8O A;  3CRK A;  1EI1 A;  2PNR A;  2CCU A;  1KIJ A;  3HZ1 A;  2GFD A;  3JZ3 A;  1NHJ A;  1UYE A;  4XIP A;  2XX4 A;  2XDS A;  5BOC A;  3WHA A;  2ESA A;  3A0T A;  3TUH A;  2FYP A;  1TBW A;  1B63 A;  3ZM7 A;  5CTU A;  5M4H A;  1YES A;  3RLQ A;  1UYC A;  4JAU A;  1MX0 A;  2BU5 A;  5J71 A;  2YI7 A;  2BU2 A;  1Y8O A;  2YKE A;  4E00 A;  2YGA A;  4ZVI A;  3SL2 A;  1TID A;  2QFO A;  4PL9 A;  1ZW9 A;  3RLP A;  4KSG A;  5FNC A;  2WI6 A;  3T1K A;  2HKJ A;  3C11 A;  2CH4 A;  4CWN A;  1Z5C A;  1I5D A;  1AH6 A;  4Q20 A;  2YE4 A;  3A0R A;  5IDM A;  2YGF A;  4YKQ A;  2YKJ A;  1B62 A;  2YEB A;  1B3Q A;  4HYP A;  3T0Z A;  2CCS A;  3D0B A;  3FV5 A;  4XKO A;  1I5B A;  4WUC A;  2YEG A;  4URO A;  4O09 A;  4LWE A;  4CE3 A;  4AWP A;  1AM1 A;  3R4M A;  3WQ9 A;  4CWQ A;  5IN9 A;  4LWG A;  1UYH A;  2YKB A;  5D6Q A;  4WUD A;  3OWD A;  4P7A A;  3EHG A;  4YKZ A;  2IWS A;  2WI2 A;  1Y8N A;  2EXL A;  4LWH A;  4CWT A;  3U2K A;  4PRX A;  1YT0 A;  4H85 A;  3VAD A;  1U0Z A;  5F3K A;  3QDD A;  2YE7 A;  4LP0 A;  3T10 A;  4BIZ A;  4CE1 A;  3K98 A;  3ZXO A;  1BGQ A;  4L8Z A;  2WI3 A;  4URM A;  1YS3 A;  4R3A A;  3CRL A;  3GIG A;  4MPE A;  3OPD A;  2GQP A;  4B6C A;  2BU8 A;  2XHR A;  3R4O A;  2YEJ A;  3TTZ A;  1YSZ A;  2E0A A;  2XX5 A;  3H80 A;  3HYZ A;  1NHH A;  3IED A;  1L0O A;  3K97 A;  2YEC A;  4R1F A;  2WEQ A;  2XJJ A;  3B26 A;  2FXS A;  3HHU A;  4GCZ A;  3TZ5 A;  2XX2 A;  3GIE A;  4EMV A;  3FT5 A;  5C93 A;  3A0X A;  3CGZ A;  4MPC A;  4E02 A;  2VCJ A;  2YI5 A;  3B24 A;  1YT2 A;  2HG1 A;  4X9L A;  2WER A;  1UY6 A;  1ZXN A;  2YEI A;  5M4E A;  2XHT A;  2WEP A;  4EGH A;  3C0E A;  3RLR A;  2Q8G A;  4HYM A;  3Q5J A;  3R91 A;  1NHI A;  4BQG A;  1UYL A;  2VCI A;  1YER A;  1GKZ A;  3DGE A;  4GEE A;  3HEK A;  3INX A;  4V26 A;  3Q5L A;  1YSR A;  3PEH A;  2BYH A;  2YE8 A;  4I3H A;  2ZBK B;  2YK2 A;  1YC3 A;  1JM6 A;  4CWP A;  3EHJ A;  4ASA A;  3TZ0 A;  4FPP A;  4JAV A;  3LPS A;  3HYY A;  1YT1 A;  4I5S A;  5D7D A;  1I5C A;  4KTN A;  2C2A A;  3O6O A;  2WI7 A;  1H7U A;  2K5B A;  2QF6 A;  3EKO A;  4YKY A;  5CTY A;  5L3J A;  2YGE A;  4ZKI A;  2XDX A;  4O05 A;  4FCP A;  2YE5 A;  4W7T A;  1KZN A;  4GGL A;  1Y4S A;  3BM9 A;  2XHX A;  5CPH A;  1AH8 A;  1QYE A;  2YE2 A;  4EEH A;  4AWO A;  3K60 A;  1UYI A;  3A0W A;  3QTF A;  4U93 A;  4CWS A;  1PVG A;  2HCH A;  3OWB A;  1UYM A;  4XIR A;  1YET A;  4QPJ A;  3KE6 A;  3G75 A;  4GT8 A;  1S14 A;  4BIU A;  2Q8F A;  2XAB A;  4CWO A;  2CG9 A;  2YJW A;  2YEA A;  2XJG A;  5D7R A;  2YE3 A;  1TC6 A;  2H8M A;  4CWR A;  2QG0 A;  1AMW A;  2VWC A;  2JJC A;  4URN A;  4L93 A;  3T0H A; 
#chains in the Genus database with same CATH topology
 4XDM A;  3O0I A;  2CGF A;  4NH8 A;  1BYQ A;  4PRV A;  1TC0 A;  1U2O A;  4YKW A;  5FWK A;  4U7O A;  3INW A;  2C1G A;  4EFU A;  3CYG A;  4XCJ A;  5CTW A;  4YKX A;  1ZWH A;  4HZ0 A;  1UY9 A;  1BKN A;  4LWI A;  4E01 A;  4CE2 A;  2BU7 A;  2AKP A;  2BRE A;  2C1I A;  4EGI A;  1UYF A;  4MP2 A;  1UYG A;  5D7C A;  4HZ5 A;  4YKT A;  4ASF A;  4DUH A;  4XCL A;  4O0B A;  1I59 A;  4GFN A;  4EFT A;  4BAE A;  3RKZ A;  1GJV A;  1UYK A;  4H7Q A;  2XD6 A;  3TZ2 A;  2YE6 A;  2WI5 A;  2IWU A;  2YI6 A;  1YC4 A;  4EGK A;  3ZKB A;  4FCQ A;  2XCM A;  3CGY A;  4XE2 A;  1H7S A;  1A4H A;  4XKK A;  3EHF A;  2O1U A;  1US7 A;  2YKI A;  4H81 A;  2WI4 A;  4XKA A;  4PU9 A;  3VHA A;  5M4P A;  4L94 A;  2WI1 A;  3ZKD A;  2YE9 A;  5M4M A;  5M4N A;  4WUB A;  3T2S A;  3U67 A;  2YK9 A;  1Y4U A;  3O2F A;  2FWY A;  2YED A;  5IDJ A;  3MNR P;  1GKX A;  2BZ5 A;  2BRC A;  1TH8 A;  5J6A A;  4ASB A;  4AWQ A;  4EM7 A;  4AS9 A;  3CWV A;  1UY8 A;  4LWF A;  4XIT A;  4XD8 A;  2JKI A;  1QY8 A;  3EKR A;  3FT8 A;  1R62 A;  3B25 A;  4MPN A;  3OMU A;  1TIL A;  4JAS A;  4MP7 A;  2YEH A;  1Z5A A;  4MB9 A;  2Q2E B;  2XDU A;  1UYD A;  4GQT A;  3LMM A;  2XJX A;  4XIQ A;  5FND A;  1MU5 A;  5M4K A;  4B7P A;  1ZXM A;  2ZDY A;  4URL A;  3S5T A;  1BXD A;  1Z5B A;  4KQV A;  4DZY A;  1EA6 A;  4O04 A;  2BSM A;  2XK2 A;  2BU6 A;  1AJ6 A;  3BMY A;  3K99 A;  4NH9 A;  3A0Z A;  4ASG A;  3GIG B;  2IOQ A;  3LNU A;  4L90 A;  4YKR A;  3U2D A;  2QG2 A;  2BYI A;  2ZDX A;  2YEE A;  4BXI A;  2Q8I A;  3TZ4 A;  4XTJ A;  2YI0 A;  2YJX A;  2YEF A;  2XDL A;  3G7E A;  1THN A;  3H4L A;  4QPK A;  1S16 A;  3GIF A;  2Q8H A;  2IWX A;  4KP4 A;  3D36 A;  1Z59 A;  4U7N A;  4FCR A;  3VHC A;  2UWD A;  2VW5 A;  3B28 A;  4XC0 A;  1I58 A;  5GGZ A;  3Q5K A;  3ZXQ A;  3B27 A;  4K4O A;  2IOR A;  4L91 A;  4LPB A;  4FMT A;  4HY6 A;  2CCT A;  4HXZ A;  4O07 A;  3PEJ A;  4KSH A;  3R92 A;  3R4N A;  4JQL A;  2FWZ A;  4V25 A;  4BQJ A;  4MOT A;  2FTK A;  3OW6 A;  5CTX A;  2ZKJ A;  3EHH A;  1UY7 A;  4CWF A;  5FNF A;  3VHD A;  5BOD A;  2O1W A;  4HXW A;  5CF0 A;  4MBC A;  2YKC A;  4YKU A;  1I5A A;  5F5R A;  3NMQ A;  4R3M A;  2XDK A;  3D2R A;  4HY1 A;  3R4P A;  1YC1 A;  1ID0 A;  2H55 A;  5D6P A;  1OSF A;  1QZR A;  1Y8P A;  4NH7 A;  4KFG A;  3A0Y A;  2O1V A;  2BT0 A;  2BTZ A;  3G7B A;  2IOP A;  3HZ5 A;  4P8O A;  3CRK A;  1EI1 A;  2PNR A;  2CCU A;  1KIJ A;  3HZ1 A;  2GFD A;  3JZ3 A;  1NHJ A;  1UYE A;  4XIP A;  2XX4 A;  2XDS A;  5BOC A;  3WHA A;  2ESA A;  3A0T A;  3TUH A;  2FYP A;  1TBW A;  1B63 A;  3ZM7 A;  5CTU A;  5M4H A;  1YES A;  3RLQ A;  1UYC A;  4JAU A;  1MX0 A;  2BU5 A;  5J71 A;  2YI7 A;  2BU2 A;  1Y8O A;  2YKE A;  4E00 A;  2YGA A;  4ZVI A;  3SL2 A;  1TID A;  2QFO A;  4PL9 A;  1ZW9 A;  3RLP A;  4KSG A;  5FNC A;  2WI6 A;  3T1K A;  2HKJ A;  3C11 A;  2CH4 A;  4CWN A;  1Z5C A;  1I5D A;  1AH6 A;  4Q20 A;  2YE4 A;  3A0R A;  5IDM A;  2YGF A;  4YKQ A;  2YKJ A;  1B62 A;  2YEB A;  1B3Q A;  4HYP A;  3T0Z A;  2CCS A;  3D0B A;  3FV5 A;  4XKO A;  1I5B A;  4WUC A;  2YEG A;  4URO A;  4O09 A;  4LWE A;  4CE3 A;  4AWP A;  1AM1 A;  3R4M A;  3WQ9 A;  4CWQ A;  5IN9 A;  4LWG A;  1UYH A;  2YKB A;  5D6Q A;  4WUD A;  3OWD A;  4P7A A;  3EHG A;  4YKZ A;  2IWS A;  2WI2 A;  1Y8N A;  2EXL A;  4LWH A;  4CWT A;  3U2K A;  4PRX A;  1YT0 A;  4H85 A;  3VAD A;  1U0Z A;  5F3K A;  3QDD A;  2YE7 A;  4LP0 A;  3T10 A;  4BIZ A;  4CE1 A;  3K98 A;  3ZXO A;  1BGQ A;  4L8Z A;  2WI3 A;  4URM A;  1YS3 A;  4R3A A;  3CRL A;  3GIG A;  4MPE A;  3OPD A;  2GQP A;  4B6C A;  4E72 A;  2BU8 A;  2XHR A;  3R4O A;  2YEJ A;  3TTZ A;  1YSZ A;  2E0A A;  2XX5 A;  3H80 A;  3HYZ A;  1NHH A;  3IED A;  1L0O A;  3K97 A;  2YEC A;  4R1F A;  2WEQ A;  2XJJ A;  3B26 A;  2FXS A;  3HHU A;  4GCZ A;  3TZ5 A;  2XX2 A;  3GIE A;  4EMV A;  3FT5 A;  5C93 A;  3A0X A;  3CGZ A;  4MPC A;  4E02 A;  2VCJ A;  2YI5 A;  3B24 A;  1YT2 A;  2HG1 A;  4X9L A;  2WER A;  1UY6 A;  1ZXN A;  2YEI A;  5M4E A;  2XHT A;  2WEP A;  4EGH A;  3C0E A;  3RLR A;  2Q8G A;  4HYM A;  2HHI A;  3Q5J A;  3R91 A;  1NHI A;  4BQG A;  5JEN A;  1UYL A;  2VCI A;  1YER A;  1GKZ A;  3DGE A;  4GEE A;  3HEK A;  3INX A;  4V26 A;  3Q5L A;  1YSR A;  3PEH A;  2BYH A;  2YE8 A;  4I3H A;  2ZBK B;  2YK2 A;  1YC3 A;  1JM6 A;  4CWP A;  3EHJ A;  4ASA A;  3TZ0 A;  4FPP A;  4JAV A;  3LPS A;  3HYY A;  1YT1 A;  4I5S A;  5D7D A;  1I5C A;  4KTN A;  2C2A A;  3O6O A;  2WI7 A;  1IXM A;  1H7U A;  2K5B A;  2QF6 A;  3EKO A;  4YKY A;  5CTY A;  5L3J A;  2YGE A;  4ZKI A;  2XDX A;  4O05 A;  4FCP A;  2YE5 A;  4W7T A;  1KZN A;  4GGL A;  1Y4S A;  3BM9 A;  2XHX A;  5CPH A;  1AH8 A;  1QYE A;  2YE2 A;  4EEH A;  4AWO A;  3K60 A;  1UYI A;  3A0W A;  3QTF A;  4U93 A;  4CWS A;  1PVG A;  2HCH A;  3OWB A;  1UYM A;  4XIR A;  1YET A;  4QPJ A;  3KE6 A;  3G75 A;  4GT8 A;  1S14 A;  1F51 A;  4BIU A;  2Q8F A;  2XAB A;  4CWO A;  2CG9 A;  2YJW A;  2YEA A;  2XJG A;  5D7R A;  2YE3 A;  1TC6 A;  2H8M A;  4CWR A;  2QG0 A;  1AMW A;  2VWC A;  2JJC A;  4URN A;  4L93 A;  3T0H A; 
#chains in the Genus database with same CATH homology
 4XDM A;  3O0I A;  2CGF A;  4NH8 A;  1BYQ A;  4PRV A;  1TC0 A;  1U2O A;  4YKW A;  5FWK A;  4U7O A;  3INW A;  4EFU A;  4XCJ A;  5CTW A;  4YKX A;  1ZWH A;  4HZ0 A;  1UY9 A;  1BKN A;  4LWI A;  4E01 A;  4CE2 A;  2BU7 A;  2AKP A;  2BRE A;  4EGI A;  1UYF A;  4MP2 A;  1UYG A;  5D7C A;  4HZ5 A;  4YKT A;  4ASF A;  4DUH A;  4XCL A;  4O0B A;  1I59 A;  4GFN A;  4EFT A;  4BAE A;  3RKZ A;  1GJV A;  1UYK A;  4H7Q A;  2XD6 A;  3TZ2 A;  2YE6 A;  2WI5 A;  2IWU A;  2YI6 A;  1YC4 A;  4EGK A;  3ZKB A;  4FCQ A;  2XCM A;  3CGY A;  4XE2 A;  1H7S A;  1A4H A;  4XKK A;  3EHF A;  2O1U A;  1US7 A;  2YKI A;  4H81 A;  2WI4 A;  4XKA A;  4PU9 A;  3VHA A;  5M4P A;  4L94 A;  2WI1 A;  3ZKD A;  2YE9 A;  5M4M A;  5M4N A;  4WUB A;  3T2S A;  3U67 A;  2YK9 A;  1Y4U A;  3O2F A;  2FWY A;  2YED A;  5IDJ A;  3MNR P;  1GKX A;  2BZ5 A;  2BRC A;  1TH8 A;  5J6A A;  4ASB A;  4AWQ A;  4EM7 A;  4AS9 A;  3CWV A;  1UY8 A;  4LWF A;  4XIT A;  4XD8 A;  2JKI A;  1QY8 A;  3EKR A;  3FT8 A;  1R62 A;  3B25 A;  4MPN A;  3OMU A;  1TIL A;  4JAS A;  4MP7 A;  2YEH A;  1Z5A A;  4MB9 A;  2Q2E B;  2XDU A;  1UYD A;  4GQT A;  2XJX A;  4XIQ A;  5FND A;  1MU5 A;  5M4K A;  4B7P A;  1ZXM A;  2ZDY A;  4URL A;  1BXD A;  1Z5B A;  4KQV A;  4DZY A;  1EA6 A;  4O04 A;  2BSM A;  2XK2 A;  2BU6 A;  1AJ6 A;  3BMY A;  3K99 A;  4NH9 A;  3A0Z A;  4ASG A;  3GIG B;  2IOQ A;  3LNU A;  4L90 A;  4YKR A;  3U2D A;  2QG2 A;  2BYI A;  2ZDX A;  2YEE A;  4BXI A;  2Q8I A;  3TZ4 A;  4XTJ A;  2YI0 A;  2YJX A;  2YEF A;  2XDL A;  3G7E A;  1THN A;  3H4L A;  4QPK A;  1S16 A;  3GIF A;  2Q8H A;  2IWX A;  4KP4 A;  3D36 A;  1Z59 A;  4U7N A;  4FCR A;  3VHC A;  2UWD A;  2VW5 A;  3B28 A;  4XC0 A;  1I58 A;  5GGZ A;  3Q5K A;  3ZXQ A;  3B27 A;  4K4O A;  2IOR A;  4L91 A;  4LPB A;  4FMT A;  4HY6 A;  2CCT A;  4HXZ A;  4O07 A;  3PEJ A;  4KSH A;  3R92 A;  3R4N A;  4JQL A;  2FWZ A;  4V25 A;  4BQJ A;  4MOT A;  3OW6 A;  5CTX A;  2ZKJ A;  3EHH A;  1UY7 A;  4CWF A;  5FNF A;  3VHD A;  5BOD A;  2O1W A;  4HXW A;  5CF0 A;  4MBC A;  2YKC A;  4YKU A;  1I5A A;  5F5R A;  3NMQ A;  4R3M A;  2XDK A;  3D2R A;  4HY1 A;  3R4P A;  1YC1 A;  1ID0 A;  2H55 A;  5D6P A;  1OSF A;  1QZR A;  1Y8P A;  4NH7 A;  4KFG A;  3A0Y A;  2O1V A;  2BT0 A;  2BTZ A;  3G7B A;  2IOP A;  3HZ5 A;  4P8O A;  3CRK A;  1EI1 A;  2PNR A;  2CCU A;  1KIJ A;  3HZ1 A;  2GFD A;  3JZ3 A;  1NHJ A;  1UYE A;  4XIP A;  2XX4 A;  2XDS A;  5BOC A;  3WHA A;  2ESA A;  3A0T A;  3TUH A;  2FYP A;  1TBW A;  1B63 A;  3ZM7 A;  5CTU A;  5M4H A;  1YES A;  3RLQ A;  1UYC A;  4JAU A;  1MX0 A;  2BU5 A;  5J71 A;  2YI7 A;  2BU2 A;  1Y8O A;  2YKE A;  4E00 A;  2YGA A;  4ZVI A;  3SL2 A;  1TID A;  2QFO A;  4PL9 A;  1ZW9 A;  3RLP A;  4KSG A;  5FNC A;  2WI6 A;  3T1K A;  2HKJ A;  3C11 A;  2CH4 A;  4CWN A;  1Z5C A;  1I5D A;  1AH6 A;  4Q20 A;  2YE4 A;  3A0R A;  5IDM A;  2YGF A;  4YKQ A;  2YKJ A;  1B62 A;  2YEB A;  1B3Q A;  4HYP A;  3T0Z A;  2CCS A;  3D0B A;  3FV5 A;  4XKO A;  1I5B A;  4WUC A;  2YEG A;  4URO A;  4O09 A;  4LWE A;  4CE3 A;  4AWP A;  1AM1 A;  3R4M A;  3WQ9 A;  4CWQ A;  5IN9 A;  4LWG A;  1UYH A;  2YKB A;  5D6Q A;  4WUD A;  3OWD A;  4P7A A;  3EHG A;  4YKZ A;  2IWS A;  2WI2 A;  1Y8N A;  2EXL A;  4LWH A;  4CWT A;  3U2K A;  4PRX A;  1YT0 A;  4H85 A;  3VAD A;  1U0Z A;  5F3K A;  3QDD A;  2YE7 A;  4LP0 A;  3T10 A;  4BIZ A;  4CE1 A;  3K98 A;  3ZXO A;  1BGQ A;  4L8Z A;  2WI3 A;  4URM A;  1YS3 A;  4R3A A;  3CRL A;  3GIG A;  4MPE A;  3OPD A;  2GQP A;  4B6C A;  2BU8 A;  2XHR A;  3R4O A;  2YEJ A;  3TTZ A;  1YSZ A;  2E0A A;  2XX5 A;  3H80 A;  3HYZ A;  1NHH A;  3IED A;  1L0O A;  3K97 A;  2YEC A;  4R1F A;  2WEQ A;  2XJJ A;  3B26 A;  2FXS A;  3HHU A;  4GCZ A;  3TZ5 A;  2XX2 A;  3GIE A;  4EMV A;  3FT5 A;  5C93 A;  3A0X A;  3CGZ A;  4MPC A;  4E02 A;  2VCJ A;  2YI5 A;  3B24 A;  1YT2 A;  2HG1 A;  4X9L A;  2WER A;  1UY6 A;  1ZXN A;  2YEI A;  5M4E A;  2XHT A;  2WEP A;  4EGH A;  3C0E A;  3RLR A;  2Q8G A;  4HYM A;  3Q5J A;  3R91 A;  1NHI A;  4BQG A;  1UYL A;  2VCI A;  1YER A;  1GKZ A;  3DGE A;  4GEE A;  3HEK A;  3INX A;  4V26 A;  3Q5L A;  1YSR A;  3PEH A;  2BYH A;  2YE8 A;  4I3H A;  2ZBK B;  2YK2 A;  1YC3 A;  1JM6 A;  4CWP A;  3EHJ A;  4ASA A;  3TZ0 A;  4FPP A;  4JAV A;  3LPS A;  3HYY A;  1YT1 A;  4I5S A;  5D7D A;  1I5C A;  4KTN A;  2C2A A;  3O6O A;  2WI7 A;  1H7U A;  2K5B A;  2QF6 A;  3EKO A;  4YKY A;  5CTY A;  5L3J A;  2YGE A;  4ZKI A;  2XDX A;  4O05 A;  4FCP A;  2YE5 A;  4W7T A;  1KZN A;  4GGL A;  1Y4S A;  3BM9 A;  2XHX A;  5CPH A;  1AH8 A;  1QYE A;  2YE2 A;  4EEH A;  4AWO A;  3K60 A;  1UYI A;  3A0W A;  3QTF A;  4U93 A;  4CWS A;  1PVG A;  2HCH A;  3OWB A;  1UYM A;  4XIR A;  1YET A;  4QPJ A;  3KE6 A;  3G75 A;  4GT8 A;  1S14 A;  4BIU A;  2Q8F A;  2XAB A;  4CWO A;  2CG9 A;  2YJW A;  2YEA A;  2XJG A;  5D7R A;  2YE3 A;  1TC6 A;  2H8M A;  4CWR A;  2QG0 A;  1AMW A;  2VWC A;  2JJC A;  4URN A;  4L93 A;  3T0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...