1I5BA

Structure of chea domain p4 in complex with adpnp and manganese
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
180
Chain Sequence
GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein, transferase
total genus 56
structure length 180
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i5bA00
3O0IA 5IN9A 3HZ5A 4MB9A 4JQLA 3K60A 4HY1A 5CTUA 4AS9A 3C11A 1TC0A 1AJ6A 1TH8A 3CGZA 4XKAA 2YEGA 2E0AA 2YE7A 3K98A 3FV5A 4LWGA 3TZ2A 1AH8A 5J71A 2YJWA 4MPNA 4LWEA 2FWYA 3EHFA 4EGHA 1BYQA 4URLA 1EI1A 2YEDA 2XABA 4XD8A 1B63A 1MU5A 1UYEA 1I5BA 2IWUA 1TBWA 5CTXA 1I5CA 4QPJA 1BKNA 1Y8PA 4U7NA 3A0ZA 1U2OA 1NHJA 4XKKA 3TZ5A 2BYHA 4MOTA 4W7TA 3CWVA 2FXSA 1Z5AA 1QZRA 2WERA 3ZXOA 2YI7A 3EHHA 4P8OA 4YKUA 3HEKA 3Q5LA 2XX4A 3GIEA 4MP7A 2XDLA 1YC4A 1PVGA 1YERA 4L90A 4XIQA 4NH8A 4E02A 2HG1A 2YEJA 1UYIA 4HYPA 4HZ5A 2YE2A 1UYFA 2XJGA 3EKOA 4KTNA 4BQGA 3CRLA 3U2DA 4YKZA 1AM1A 2VW5A 4B6CA 4XKOA 3LPSA 1YC1A 3QDDA 4XTJA 4NH9A 4CE1A 1H7SA 5M4HA 3U2KA 4XE2A 4XCJA 2Q8IA 4K4OA 3OWDA 1S16A 3VHCA 4UROA 2XX5A 3O6OA 2CCSA 4MPEA 4WUBA 4XIRA 1H7UA 3ZKBA 3D2RA 1QY8A 4YKWA 2GFDA 4EEHA 4FCPA 2IWSA 2IORA 4GT8A 1BXDA 2ESAA 4EMVA 1UYDA 3A0TA 3RLQA 3T0ZA 3HZ1A 1UY7A 3H4LA 3INWA 4FCRA 1AH6A 2YGAA 2BU8A 3OW6A 5BOCA 5FNDA 2WI5A 2YGEA 4WUDA 4PRXA 5CF0A 4PU9A 3QTFA 2CCUA 2XK2A 3IEDA 4GCZA 4R1FA 2WEPA 3TUHA 4ASFA 3T2SA 4CWNA 2Q8HA 2Q8GA 1UYCA 4YKQA 4MPCA 2YKCA 2WI2A 2Q8FA 4BXIA 1A4HA 1KZNA 4BIZA 5IDMA 5IDJA 2ZDXA 3A0XA 2WI7A 3R91A 4EGKA 3EHGA 2EXLA 4E01A 3EHJA 4GFNA 3VADA 3R4NA 2YE8A 2YKIA 2ZBKB 2YI6A 3NMQA 2BU6A 2QF6A 2YI0A 2BT0A 3BMYA 2XJXA 2BTZA 5CTYA 4CWFA 4KP4A 3R4MA 4EM7A 2WI4A 4O04A 2YK9A 1MX0A 3Q5JA 2WI3A 4DZYA 2FYPA 5C93A 4AWOA 1TILA 3U67A 4R3AA 4URMA 3PEJA 1Z5CA 1Z5BA 2BU2A 2JJCA 2XHTA 4YKXA 4ASAA 1L0OA 5M4KA 2AKPA 3GIGB 3DGEA 4O0BA 3B27A 4HXWA 1AMWA 3A0YA 3ZKDA 5M4NA 3HHUA 1TIDA 4O09A 4YKTA 2CCTA 4X9LA 1BGQA 4MP2A 2VCIA 5FNFA 1ZW9A 4JAVA 3FT8A 3T10A 2WI6A 1I5AA 2YJXA 3CRKA 4L93A 2YE4A 5FWKA 1S14A 3B28A 5FNCA 1NHHA 5M4EA 1ZWHA 5D7CA 5F3KA 2CGFA 1Y4SA 2YKEA 1Z59A 1U0ZA 3INXA 4R3MA 4BIUA 3G7BA 1YC3A 4HYMA 4JASA 2GQPA 4LWFA 3OWBA 2XDKA 3B25A 5M4PA 1YESA 5D7DA 2K5BA 3D36A 3VHDA 4YKRA 2CH4A 2O1UA 3WQ9A 1GKZA 3GIFA 2VWCA 4O05A 4HZ0A 2IWXA 4EFTA 4V25A 2IOPA 4EFUA 2YE5A 2XDSA 3EKRA 4KQVA 3Q5KA 1NHIA 4QPKA 4HXZA 3R92A 4Q20A 4CWQA 4V26A 4I5SA 1JM6A 3D0BA 5D6PA 1ZXNA 2YK2A 2XD6A 4CWOA 1R62A 2BREA 3G75A 1YT2A 4ZVIA 4U93A 2YKJA 4ASGA 3PEHA 4FCQA 4B7PA 3FT5A 5D6QA 2QG2A 3B26A 2YEFA 1Y4UA 1ZXMA 5GGZA 3T0HA 3JZ3A 1UY6A 2Q2EB 4AWQA 2YE3A 4CWSA 3TZ0A 4LP0A 1YETA 3RLPA 2YI5A 1OSFA 1UYLA 4ZKIA 1B3QA 2FWZA 1I59A 4ASBA 4AWPA 4KSHA 3G7EA 2XHRA 3TTZA 4LPBA 2JKIA 4L91A 1QYEA 4LWHA 1GKXA 1ID0A 4DUHA 3HYZA 4XC0A 1YSRA 3A0RA 2BU7A 3R4PA 1I58A 4P7AA 4FPPA 2VCJA 3LNUA 1UY8A 3OMUA 4MBCA 2YE9A 2WEQA 3O2FA 1I5DA 2YEAA 3K99A 2BSMA 3KE6A 3CGYA 4H7QA 4PL9A 1UYGA 3T1KA 3OPDA 1Y8NA 3MNRP 4CWPA 2IOQA 4H81A 4EGIA 5J6AA 1TC6A 3WHAA 5CTWA 1YSZA 2CG9A 2XCMA 4LWIA 1EA6A 4O07A 4URNA 1B62A 2YEIA 1GJVA 1UYMA 2BYIA 2QG0A 4XITA 1UYHA 2UWDA 5CPHA 1THNA 2XJJA 1KIJA 2YE6A 2ZKJA 4GEEA 4I3HA 3GIGA 4KFGA 3VHAA 3H80A 3R4OA 2XX2A 2YECA 4CWRA 2H55A 2YGFA 1UY9A 1YT1A 4NH7A 5L3JA 3RKZA 4U7OA 2XDXA 4CWTA 5F5RA 2BRCA 2ZDYA 3ZXQA 2PNRA 3SL2A 5D7RA 4BAEA 4L8ZA 2C2AA 2QFOA 4YKYA 3ZM7A 2YEBA 2O1VA 5M4MA 4KSGA 4L94A 3C0EA 4WUCA 3BM9A 4XIPA 2YEHA 1YT0A 1YS3A 4CE3A 4XCLA 3RLRA 3HYYA 2XHXA 2HCHA 2O1WA 2BZ5A 3A0WA 1UYKA 4CE2A 2YEEA 3B24A 2XDUA 4JAUA 4HY6A 4PRVA 1US7A 3K97A 3TZ4A 4BQJA 4FMTA 4XDMA 2HKJA 2BU5A 2WI1A 5BODA 4H85A 2H8MA 4GGLA 1Y8OA 4E00A 4GQTA 2YKBA
chains in the Genus database with same CATH superfamily
3O0IA 5IN9A 3HZ5A 4MB9A 4JQLA 3K60A 4HY1A 2HHIA 5CTUA 4AS9A 3C11A 1TC0A 1AJ6A 1TH8A 3CGZA 4XKAA 2YEGA 2E0AA 2YE7A 3K98A 3FV5A 4LWGA 3TZ2A 1AH8A 5J71A 2YJWA 4MPNA 4LWEA 2FWYA 2YKBA 3EHFA 4EGHA 1BYQA 4URLA 1EI1A 2YEDA 2XABA 3S5TA 4XD8A 1B63A 1MU5A 1UYEA 1I5BA 2IWUA 1TBWA 5CTXA 1I5CA 4QPJA 1BKNA 1Y8PA 4U7NA 3A0ZA 1U2OA 1NHJA 4XKKA 3TZ5A 2BYHA 4MOTA 4W7TA 3CWVA 2FXSA 1Z5AA 1QZRA 2WERA 3ZXOA 2YI7A 3EHHA 4P8OA 4YKUA 3HEKA 3Q5LA 2XX4A 3GIEA 4MP7A 2XDLA 1YC4A 1PVGA 1YERA 4L90A 4XIQA 4NH8A 4E02A 2HG1A 2YEJA 1UYIA 4HYPA 4HZ5A 2YE2A 1UYFA 2XJGA 3EKOA 4KTNA 4BQGA 3CRLA 3U2DA 4YKZA 1AM1A 2VW5A 4B6CA 4XKOA 3LPSA 1YC1A 3QDDA 4XTJA 4NH9A 4CE1A 1H7SA 5M4HA 3U2KA 4XE2A 4XCJA 2Q8IA 4K4OA 3OWDA 1S16A 3VHCA 4UROA 2XX5A 3O6OA 2CCSA 4MPEA 4WUBA 4XIRA 1H7UA 3ZKBA 3D2RA 1QY8A 4YKWA 2GFDA 4EEHA 4FCPA 2IWSA 5JENA 2IORA 4GT8A 1BXDA 1F51A 2ESAA 4EMVA 1UYDA 3A0TA 3RLQA 3T0ZA 3HZ1A 1UY7A 3H4LA 3INWA 4FCRA 1AH6A 2YGAA 2BU8A 3OW6A 5BOCA 5FNDA 2WI5A 2YGEA 4WUDA 4PRXA 5CF0A 4PU9A 3QTFA 2CCUA 2XK2A 3IEDA 4GCZA 4R1FA 2WEPA 3TUHA 4ASFA 3T2SA 4CWNA 2Q8HA 2Q8GA 1UYCA 4YKQA 4MPCA 2YKCA 2WI2A 2Q8FA 4BXIA 1A4HA 1KZNA 4BIZA 5IDMA 5IDJA 1IXMA 2ZDXA 3A0XA 2WI7A 3R91A 4EGKA 3EHGA 2EXLA 4E01A 3EHJA 4GFNA 3VADA 3R4NA 2YE8A 2YKIA 2ZBKB 2YI6A 3NMQA 2BU6A 2QF6A 2YI0A 2BT0A 3BMYA 2XJXA 2BTZA 5CTYA 4CWFA 4KP4A 3R4MA 4EM7A 2WI4A 4O04A 2C1IA 2YK9A 1MX0A 3Q5JA 2FTKA 2WI3A 3CYGA 4DZYA 2FYPA 5C93A 4AWOA 1TILA 3U67A 4R3AA 4URMA 3PEJA 1Z5CA 1Z5BA 2BU2A 2JJCA 2XHTA 4YKXA 4ASAA 1L0OA 5M4KA 2AKPA 3GIGB 3DGEA 4O0BA 3B27A 4HXWA 1AMWA 3A0YA 3ZKDA 5M4NA 3HHUA 1TIDA 4O09A 4YKTA 2CCTA 4X9LA 1BGQA 4MP2A 2VCIA 5FNFA 1ZW9A 4JAVA 3FT8A 3T10A 2WI6A 1I5AA 2YJXA 3CRKA 4L93A 2YE4A 5FWKA 1S14A 3B28A 5FNCA 1NHHA 5M4EA 1ZWHA 5D7CA 5F3KA 2CGFA 1Y4SA 2YKEA 1Z59A 1U0ZA 3INXA 4R3MA 4BIUA 3G7BA 1YC3A 4HYMA 4JASA 2GQPA 4LWFA 3OWBA 2XDKA 3B25A 5M4PA 1YESA 5D7DA 2K5BA 3D36A 3VHDA 4YKRA 2CH4A 2O1UA 3WQ9A 1GKZA 3GIFA 2VWCA 4O05A 4HZ0A 2IWXA 4EFTA 4V25A 2IOPA 4EFUA 2YE5A 2XDSA 3EKRA 4KQVA 3Q5KA 1NHIA 4QPKA 4HXZA 3R92A 4Q20A 4CWQA 4V26A 4I5SA 1JM6A 3D0BA 5D6PA 1ZXNA 2YK2A 2XD6A 4CWOA 1R62A 2BREA 3G75A 1YT2A 4ZVIA 4U93A 2YKJA 4ASGA 3PEHA 4FCQA 4B7PA 3FT5A 5D6QA 2QG2A 3B26A 2YEFA 1Y4UA 1ZXMA 5GGZA 3T0HA 3JZ3A 1UY6A 2Q2EB 4AWQA 2YE3A 4CWSA 3TZ0A 4LP0A 1YETA 3RLPA 2YI5A 1OSFA 1UYLA 4ZKIA 1B3QA 2FWZA 1I59A 4ASBA 4AWPA 4KSHA 3G7EA 2XHRA 3TTZA 4LPBA 2JKIA 4L91A 1QYEA 4LWHA 1GKXA 1ID0A 4DUHA 3HYZA 4XC0A 1YSRA 3A0RA 2BU7A 3R4PA 1I58A 4P7AA 4FPPA 2VCJA 3LNUA 1UY8A 3OMUA 4MBCA 2YE9A 2WEQA 3O2FA 1I5DA 2YEAA 3K99A 3LMMA 2BSMA 3KE6A 3CGYA 4H7QA 4PL9A 1UYGA 3T1KA 3OPDA 1Y8NA 3MNRP 4CWPA 2IOQA 4H81A 4EGIA 5J6AA 1TC6A 3WHAA 5CTWA 1YSZA 2CG9A 2XCMA 4LWIA 1EA6A 4O07A 4URNA 1B62A 2YEIA 1GJVA 1UYMA 2BYIA 2QG0A 4XITA 1UYHA 2UWDA 5CPHA 1THNA 2XJJA 1KIJA 2YE6A 2ZKJA 4GEEA 4I3HA 3GIGA 4KFGA 3VHAA 3H80A 3R4OA 2XX2A 4E72A 2YECA 4CWRA 2H55A 2YGFA 1UY9A 1YT1A 4NH7A 5L3JA 3RKZA 4U7OA 2XDXA 4CWTA 5F5RA 2BRCA 2ZDYA 3ZXQA 2PNRA 3SL2A 5D7RA 4BAEA 4L8ZA 2C2AA 2QFOA 4YKYA 3ZM7A 2YEBA 2O1VA 5M4MA 4KSGA 4L94A 3C0EA 4WUCA 3BM9A 4XIPA 2YEHA 1YT0A 1YS3A 4CE3A 4XCLA 3RLRA 3HYYA 2XHXA 2HCHA 2O1WA 2BZ5A 3A0WA 1UYKA 4CE2A 2YEEA 3B24A 2XDUA 4JAUA 4HY6A 4PRVA 1US7A 3K97A 3TZ4A 4BQJA 4FMTA 4XDMA 2HKJA 2BU5A 2WI1A 5BODA 4H85A 2H8MA 4GGLA 1Y8OA 4E00A 4GQTA 2C1GA
chains in the Genus database with same CATH topology
3O0IA 5IN9A 3HZ5A 4MB9A 4JQLA 3K60A 4HY1A 5CTUA 4AS9A 3C11A 1TC0A 1AJ6A 1TH8A 3CGZA 4XKAA 2YEGA 2E0AA 2YE7A 3K98A 3FV5A 4LWGA 3TZ2A 1AH8A 5J71A 2YJWA 4MPNA 4LWEA 2FWYA 3EHFA 4EGHA 1BYQA 4URLA 1EI1A 2YEDA 2XABA 4XD8A 1B63A 1MU5A 1UYEA 1I5BA 2IWUA 1TBWA 5CTXA 1I5CA 4QPJA 1BKNA 1Y8PA 4U7NA 3A0ZA 1U2OA 1NHJA 4XKKA 3TZ5A 2BYHA 4MOTA 4W7TA 3CWVA 2FXSA 1Z5AA 1QZRA 2WERA 3ZXOA 2YI7A 3EHHA 4P8OA 4YKUA 3HEKA 3Q5LA 2XX4A 3GIEA 4MP7A 2XDLA 1YC4A 1PVGA 1YERA 4L90A 4XIQA 4NH8A 4E02A 2HG1A 2YEJA 1UYIA 4HYPA 4HZ5A 2YE2A 1UYFA 2XJGA 3EKOA 4KTNA 4BQGA 3CRLA 3U2DA 4YKZA 1AM1A 2VW5A 4B6CA 4XKOA 3LPSA 1YC1A 3QDDA 4XTJA 4NH9A 4CE1A 1H7SA 5M4HA 3U2KA 4XE2A 4XCJA 2Q8IA 4K4OA 3OWDA 1S16A 3VHCA 4UROA 2XX5A 3O6OA 2CCSA 4MPEA 4WUBA 4XIRA 1H7UA 3ZKBA 3D2RA 1QY8A 4YKWA 2GFDA 4EEHA 4FCPA 2IWSA 2IORA 4GT8A 1BXDA 2ESAA 4EMVA 1UYDA 3A0TA 3RLQA 3T0ZA 3HZ1A 1UY7A 3H4LA 3INWA 4FCRA 1AH6A 2YGAA 2BU8A 3OW6A 5BOCA 5FNDA 2WI5A 2YGEA 4WUDA 4PRXA 5CF0A 4PU9A 3QTFA 2CCUA 2XK2A 3IEDA 4GCZA 4R1FA 2WEPA 3TUHA 4ASFA 3T2SA 4CWNA 2Q8HA 2Q8GA 1UYCA 4YKQA 4MPCA 2YKCA 2WI2A 2Q8FA 4BXIA 1A4HA 1KZNA 4BIZA 5IDMA 5IDJA 2ZDXA 3A0XA 2WI7A 3R91A 4EGKA 3EHGA 2EXLA 4E01A 3EHJA 4GFNA 3VADA 3R4NA 2YE8A 2YKIA 2ZBKB 2YI6A 3NMQA 2BU6A 2QF6A 2YI0A 2BT0A 3BMYA 2XJXA 2BTZA 5CTYA 4CWFA 4KP4A 3R4MA 4EM7A 2WI4A 4O04A 2YK9A 1MX0A 3Q5JA 2WI3A 4DZYA 2FYPA 5C93A 4AWOA 1TILA 3U67A 4R3AA 4URMA 3PEJA 1Z5CA 1Z5BA 2BU2A 2JJCA 2XHTA 4YKXA 4ASAA 1L0OA 5M4KA 2AKPA 3GIGB 3DGEA 4O0BA 3B27A 4HXWA 1AMWA 3A0YA 3ZKDA 5M4NA 3HHUA 1TIDA 4O09A 4YKTA 2CCTA 4X9LA 1BGQA 4MP2A 2VCIA 5FNFA 1ZW9A 4JAVA 3FT8A 3T10A 2WI6A 1I5AA 2YJXA 3CRKA 4L93A 2YE4A 5FWKA 1S14A 3B28A 5FNCA 1NHHA 5M4EA 1ZWHA 5D7CA 5F3KA 2CGFA 1Y4SA 2YKEA 1Z59A 1U0ZA 3INXA 4R3MA 4BIUA 3G7BA 1YC3A 4HYMA 4JASA 2GQPA 4LWFA 3OWBA 2XDKA 3B25A 5M4PA 1YESA 5D7DA 2K5BA 3D36A 3VHDA 4YKRA 2CH4A 2O1UA 3WQ9A 1GKZA 3GIFA 2VWCA 4O05A 4HZ0A 2IWXA 4EFTA 4V25A 2IOPA 4EFUA 2YE5A 2XDSA 3EKRA 4KQVA 3Q5KA 1NHIA 4QPKA 4HXZA 3R92A 4Q20A 4CWQA 4V26A 4I5SA 1JM6A 3D0BA 5D6PA 1ZXNA 2YK2A 2XD6A 4CWOA 1R62A 2BREA 3G75A 1YT2A 4ZVIA 4U93A 2YKJA 4ASGA 3PEHA 4FCQA 4B7PA 3FT5A 5D6QA 2QG2A 3B26A 2YEFA 1Y4UA 1ZXMA 5GGZA 3T0HA 3JZ3A 1UY6A 2Q2EB 4AWQA 2YE3A 4CWSA 3TZ0A 4LP0A 1YETA 3RLPA 2YI5A 1OSFA 1UYLA 4ZKIA 1B3QA 2FWZA 1I59A 4ASBA 4AWPA 4KSHA 3G7EA 2XHRA 3TTZA 4LPBA 2JKIA 4L91A 1QYEA 4LWHA 1GKXA 1ID0A 4DUHA 3HYZA 4XC0A 1YSRA 3A0RA 2BU7A 3R4PA 1I58A 4P7AA 4FPPA 2VCJA 3LNUA 1UY8A 3OMUA 4MBCA 2YE9A 2WEQA 3O2FA 1I5DA 2YEAA 3K99A 2BSMA 3KE6A 3CGYA 4H7QA 4PL9A 1UYGA 3T1KA 3OPDA 1Y8NA 3MNRP 4CWPA 2IOQA 4H81A 4EGIA 5J6AA 1TC6A 3WHAA 5CTWA 1YSZA 2CG9A 2XCMA 4LWIA 1EA6A 4O07A 4URNA 1B62A 2YEIA 1GJVA 1UYMA 2BYIA 2QG0A 4XITA 1UYHA 2UWDA 5CPHA 1THNA 2XJJA 1KIJA 2YE6A 2ZKJA 4GEEA 4I3HA 3GIGA 4KFGA 3VHAA 3H80A 3R4OA 2XX2A 2YECA 4CWRA 2H55A 2YGFA 1UY9A 1YT1A 4NH7A 5L3JA 3RKZA 4U7OA 2XDXA 4CWTA 5F5RA 2BRCA 2ZDYA 3ZXQA 2PNRA 3SL2A 5D7RA 4BAEA 4L8ZA 2C2AA 2QFOA 4YKYA 3ZM7A 2YEBA 2O1VA 5M4MA 4KSGA 4L94A 3C0EA 4WUCA 3BM9A 4XIPA 2YEHA 1YT0A 1YS3A 4CE3A 4XCLA 3RLRA 3HYYA 2XHXA 2HCHA 2O1WA 2BZ5A 3A0WA 1UYKA 4CE2A 2YEEA 3B24A 2XDUA 4JAUA 4HY6A 4PRVA 1US7A 3K97A 3TZ4A 4BQJA 4FMTA 4XDMA 2HKJA 2BU5A 2WI1A 5BODA 4H85A 2H8MA 4GGLA 1Y8OA 4E00A 4GQTA 2YKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O0I A;  5IN9 A;  3HZ5 A;  4MB9 A;  4JQL A;  3K60 A;  4HY1 A;  5CTU A;  4AS9 A;  3C11 A;  1TC0 A;  1AJ6 A;  1TH8 A;  3CGZ A;  4XKA A;  2YEG A;  2E0A A;  2YE7 A;  3K98 A;  3FV5 A;  4LWG A;  3TZ2 A;  1AH8 A;  5J71 A;  2YJW A;  4MPN A;  4LWE A;  2FWY A;  3EHF A;  4EGH A;  1BYQ A;  4URL A;  1EI1 A;  2YED A;  2XAB A;  4XD8 A;  1B63 A;  1MU5 A;  1UYE A;  1I5B A;  2IWU A;  1TBW A;  5CTX A;  1I5C A;  4QPJ A;  1BKN A;  1Y8P A;  4U7N A;  3A0Z A;  1U2O A;  1NHJ A;  4XKK A;  3TZ5 A;  2BYH A;  4MOT A;  4W7T A;  3CWV A;  2FXS A;  1Z5A A;  1QZR A;  2WER A;  3ZXO A;  2YI7 A;  3EHH A;  4P8O A;  4YKU A;  3HEK A;  3Q5L A;  2XX4 A;  3GIE A;  4MP7 A;  2XDL A;  1YC4 A;  1PVG A;  1YER A;  4L90 A;  4XIQ A;  4NH8 A;  4E02 A;  2HG1 A;  2YEJ A;  1UYI A;  4HYP A;  4HZ5 A;  2YE2 A;  1UYF A;  2XJG A;  3EKO A;  4KTN A;  4BQG A;  3CRL A;  3U2D A;  4YKZ A;  1AM1 A;  2VW5 A;  4B6C A;  4XKO A;  3LPS A;  1YC1 A;  3QDD A;  4XTJ A;  4NH9 A;  4CE1 A;  1H7S A;  5M4H A;  3U2K A;  4XE2 A;  4XCJ A;  2Q8I A;  4K4O A;  3OWD A;  1S16 A;  3VHC A;  4URO A;  2XX5 A;  3O6O A;  2CCS A;  4MPE A;  4WUB A;  4XIR A;  1H7U A;  3ZKB A;  3D2R A;  1QY8 A;  4YKW A;  2GFD A;  4EEH A;  4FCP A;  2IWS A;  2IOR A;  4GT8 A;  1BXD A;  2ESA A;  4EMV A;  1UYD A;  3A0T A;  3RLQ A;  3T0Z A;  3HZ1 A;  1UY7 A;  3H4L A;  3INW A;  4FCR A;  1AH6 A;  2YGA A;  2BU8 A;  3OW6 A;  5BOC A;  5FND A;  2WI5 A;  2YGE A;  4WUD A;  4PRX A;  5CF0 A;  4PU9 A;  3QTF A;  2CCU A;  2XK2 A;  3IED A;  4GCZ A;  4R1F A;  2WEP A;  3TUH A;  4ASF A;  3T2S A;  4CWN A;  2Q8H A;  2Q8G A;  1UYC A;  4YKQ A;  4MPC A;  2YKC A;  2WI2 A;  2Q8F A;  4BXI A;  1A4H A;  1KZN A;  4BIZ A;  5IDM A;  5IDJ A;  2ZDX A;  3A0X A;  2WI7 A;  3R91 A;  4EGK A;  3EHG A;  2EXL A;  4E01 A;  3EHJ A;  4GFN A;  3VAD A;  3R4N A;  2YE8 A;  2YKI A;  2ZBK B;  2YI6 A;  3NMQ A;  2BU6 A;  2QF6 A;  2YI0 A;  2BT0 A;  3BMY A;  2XJX A;  2BTZ A;  5CTY A;  4CWF A;  4KP4 A;  3R4M A;  4EM7 A;  2WI4 A;  4O04 A;  2YK9 A;  1MX0 A;  3Q5J A;  2WI3 A;  4DZY A;  2FYP A;  5C93 A;  4AWO A;  1TIL A;  3U67 A;  4R3A A;  4URM A;  3PEJ A;  1Z5C A;  1Z5B A;  2BU2 A;  2JJC A;  2XHT A;  4YKX A;  4ASA A;  1L0O A;  5M4K A;  2AKP A;  3GIG B;  3DGE A;  4O0B A;  3B27 A;  4HXW A;  1AMW A;  3A0Y A;  3ZKD A;  5M4N A;  3HHU A;  1TID A;  4O09 A;  4YKT A;  2CCT A;  4X9L A;  1BGQ A;  4MP2 A;  2VCI A;  5FNF A;  1ZW9 A;  4JAV A;  3FT8 A;  3T10 A;  2WI6 A;  1I5A A;  2YJX A;  3CRK A;  4L93 A;  2YE4 A;  5FWK A;  1S14 A;  3B28 A;  5FNC A;  1NHH A;  5M4E A;  1ZWH A;  5D7C A;  5F3K A;  2CGF A;  1Y4S A;  2YKE A;  1Z59 A;  1U0Z A;  3INX A;  4R3M A;  4BIU A;  3G7B A;  1YC3 A;  4HYM A;  4JAS A;  2GQP A;  4LWF A;  3OWB A;  2XDK A;  3B25 A;  5M4P A;  1YES A;  5D7D A;  2K5B A;  3D36 A;  3VHD A;  4YKR A;  2CH4 A;  2O1U A;  3WQ9 A;  1GKZ A;  3GIF A;  2VWC A;  4O05 A;  4HZ0 A;  2IWX A;  4EFT A;  4V25 A;  2IOP A;  4EFU A;  2YE5 A;  2XDS A;  3EKR A;  4KQV A;  3Q5K A;  1NHI A;  4QPK A;  4HXZ A;  3R92 A;  4Q20 A;  4CWQ A;  4V26 A;  4I5S A;  1JM6 A;  3D0B A;  5D6P A;  1ZXN A;  2YK2 A;  2XD6 A;  4CWO A;  1R62 A;  2BRE A;  3G75 A;  1YT2 A;  4ZVI A;  4U93 A;  2YKJ A;  4ASG A;  3PEH A;  4FCQ A;  4B7P A;  3FT5 A;  5D6Q A;  2QG2 A;  3B26 A;  2YEF A;  1Y4U A;  1ZXM A;  5GGZ A;  3T0H A;  3JZ3 A;  1UY6 A;  2Q2E B;  4AWQ A;  2YE3 A;  4CWS A;  3TZ0 A;  4LP0 A;  1YET A;  3RLP A;  2YI5 A;  1OSF A;  1UYL A;  4ZKI A;  1B3Q A;  2FWZ A;  1I59 A;  4ASB A;  4AWP A;  4KSH A;  3G7E A;  2XHR A;  3TTZ A;  4LPB A;  2JKI A;  4L91 A;  1QYE A;  4LWH A;  1GKX A;  1ID0 A;  4DUH A;  3HYZ A;  4XC0 A;  1YSR A;  3A0R A;  2BU7 A;  3R4P A;  1I58 A;  4P7A A;  4FPP A;  2VCJ A;  3LNU A;  1UY8 A;  3OMU A;  4MBC A;  2YE9 A;  2WEQ A;  3O2F A;  1I5D A;  2YEA A;  3K99 A;  2BSM A;  3KE6 A;  3CGY A;  4H7Q A;  4PL9 A;  1UYG A;  3T1K A;  3OPD A;  1Y8N A;  3MNR P;  4CWP A;  2IOQ A;  4H81 A;  4EGI A;  5J6A A;  1TC6 A;  3WHA A;  5CTW A;  1YSZ A;  2CG9 A;  2XCM A;  4LWI A;  1EA6 A;  4O07 A;  4URN A;  1B62 A;  2YEI A;  1GJV A;  1UYM A;  2BYI A;  2QG0 A;  4XIT A;  1UYH A;  2UWD A;  5CPH A;  1THN A;  2XJJ A;  1KIJ A;  2YE6 A;  2ZKJ A;  4GEE A;  4I3H A;  3GIG A;  4KFG A;  3VHA A;  3H80 A;  3R4O A;  2XX2 A;  2YEC A;  4CWR A;  2H55 A;  2YGF A;  1UY9 A;  1YT1 A;  4NH7 A;  5L3J A;  3RKZ A;  4U7O A;  2XDX A;  4CWT A;  5F5R A;  2BRC A;  2ZDY A;  3ZXQ A;  2PNR A;  3SL2 A;  5D7R A;  4BAE A;  4L8Z A;  2C2A A;  2QFO A;  4YKY A;  3ZM7 A;  2YEB A;  2O1V A;  5M4M A;  4KSG A;  4L94 A;  3C0E A;  4WUC A;  3BM9 A;  4XIP A;  2YEH A;  1YT0 A;  1YS3 A;  4CE3 A;  4XCL A;  3RLR A;  3HYY A;  2XHX A;  2HCH A;  2O1W A;  2BZ5 A;  3A0W A;  1UYK A;  4CE2 A;  2YEE A;  3B24 A;  2XDU A;  4JAU A;  4HY6 A;  4PRV A;  1US7 A;  3K97 A;  3TZ4 A;  4BQJ A;  4FMT A;  4XDM A;  2HKJ A;  2BU5 A;  2WI1 A;  5BOD A;  4H85 A;  2H8M A;  4GGL A;  1Y8O A;  4E00 A;  4GQT A;  2YKB A; 
#chains in the Genus database with same CATH topology
 3O0I A;  5IN9 A;  3HZ5 A;  4MB9 A;  4JQL A;  3K60 A;  4HY1 A;  2HHI A;  5CTU A;  4AS9 A;  3C11 A;  1TC0 A;  1AJ6 A;  1TH8 A;  3CGZ A;  4XKA A;  2YEG A;  2E0A A;  2YE7 A;  3K98 A;  3FV5 A;  4LWG A;  3TZ2 A;  1AH8 A;  5J71 A;  2YJW A;  4MPN A;  4LWE A;  2FWY A;  2YKB A;  3EHF A;  4EGH A;  1BYQ A;  4URL A;  1EI1 A;  2YED A;  2XAB A;  3S5T A;  4XD8 A;  1B63 A;  1MU5 A;  1UYE A;  1I5B A;  2IWU A;  1TBW A;  5CTX A;  1I5C A;  4QPJ A;  1BKN A;  1Y8P A;  4U7N A;  3A0Z A;  1U2O A;  1NHJ A;  4XKK A;  3TZ5 A;  2BYH A;  4MOT A;  4W7T A;  3CWV A;  2FXS A;  1Z5A A;  1QZR A;  2WER A;  3ZXO A;  2YI7 A;  3EHH A;  4P8O A;  4YKU A;  3HEK A;  3Q5L A;  2XX4 A;  3GIE A;  4MP7 A;  2XDL A;  1YC4 A;  1PVG A;  1YER A;  4L90 A;  4XIQ A;  4NH8 A;  4E02 A;  2HG1 A;  2YEJ A;  1UYI A;  4HYP A;  4HZ5 A;  2YE2 A;  1UYF A;  2XJG A;  3EKO A;  4KTN A;  4BQG A;  3CRL A;  3U2D A;  4YKZ A;  1AM1 A;  2VW5 A;  4B6C A;  4XKO A;  3LPS A;  1YC1 A;  3QDD A;  4XTJ A;  4NH9 A;  4CE1 A;  1H7S A;  5M4H A;  3U2K A;  4XE2 A;  4XCJ A;  2Q8I A;  4K4O A;  3OWD A;  1S16 A;  3VHC A;  4URO A;  2XX5 A;  3O6O A;  2CCS A;  4MPE A;  4WUB A;  4XIR A;  1H7U A;  3ZKB A;  3D2R A;  1QY8 A;  4YKW A;  2GFD A;  4EEH A;  4FCP A;  2IWS A;  5JEN A;  2IOR A;  4GT8 A;  1BXD A;  1F51 A;  2ESA A;  4EMV A;  1UYD A;  3A0T A;  3RLQ A;  3T0Z A;  3HZ1 A;  1UY7 A;  3H4L A;  3INW A;  4FCR A;  1AH6 A;  2YGA A;  2BU8 A;  3OW6 A;  5BOC A;  5FND A;  2WI5 A;  2YGE A;  4WUD A;  4PRX A;  5CF0 A;  4PU9 A;  3QTF A;  2CCU A;  2XK2 A;  3IED A;  4GCZ A;  4R1F A;  2WEP A;  3TUH A;  4ASF A;  3T2S A;  4CWN A;  2Q8H A;  2Q8G A;  1UYC A;  4YKQ A;  4MPC A;  2YKC A;  2WI2 A;  2Q8F A;  4BXI A;  1A4H A;  1KZN A;  4BIZ A;  5IDM A;  5IDJ A;  1IXM A;  2ZDX A;  3A0X A;  2WI7 A;  3R91 A;  4EGK A;  3EHG A;  2EXL A;  4E01 A;  3EHJ A;  4GFN A;  3VAD A;  3R4N A;  2YE8 A;  2YKI A;  2ZBK B;  2YI6 A;  3NMQ A;  2BU6 A;  2QF6 A;  2YI0 A;  2BT0 A;  3BMY A;  2XJX A;  2BTZ A;  5CTY A;  4CWF A;  4KP4 A;  3R4M A;  4EM7 A;  2WI4 A;  4O04 A;  2C1I A;  2YK9 A;  1MX0 A;  3Q5J A;  2FTK A;  2WI3 A;  3CYG A;  4DZY A;  2FYP A;  5C93 A;  4AWO A;  1TIL A;  3U67 A;  4R3A A;  4URM A;  3PEJ A;  1Z5C A;  1Z5B A;  2BU2 A;  2JJC A;  2XHT A;  4YKX A;  4ASA A;  1L0O A;  5M4K A;  2AKP A;  3GIG B;  3DGE A;  4O0B A;  3B27 A;  4HXW A;  1AMW A;  3A0Y A;  3ZKD A;  5M4N A;  3HHU A;  1TID A;  4O09 A;  4YKT A;  2CCT A;  4X9L A;  1BGQ A;  4MP2 A;  2VCI A;  5FNF A;  1ZW9 A;  4JAV A;  3FT8 A;  3T10 A;  2WI6 A;  1I5A A;  2YJX A;  3CRK A;  4L93 A;  2YE4 A;  5FWK A;  1S14 A;  3B28 A;  5FNC A;  1NHH A;  5M4E A;  1ZWH A;  5D7C A;  5F3K A;  2CGF A;  1Y4S A;  2YKE A;  1Z59 A;  1U0Z A;  3INX A;  4R3M A;  4BIU A;  3G7B A;  1YC3 A;  4HYM A;  4JAS A;  2GQP A;  4LWF A;  3OWB A;  2XDK A;  3B25 A;  5M4P A;  1YES A;  5D7D A;  2K5B A;  3D36 A;  3VHD A;  4YKR A;  2CH4 A;  2O1U A;  3WQ9 A;  1GKZ A;  3GIF A;  2VWC A;  4O05 A;  4HZ0 A;  2IWX A;  4EFT A;  4V25 A;  2IOP A;  4EFU A;  2YE5 A;  2XDS A;  3EKR A;  4KQV A;  3Q5K A;  1NHI A;  4QPK A;  4HXZ A;  3R92 A;  4Q20 A;  4CWQ A;  4V26 A;  4I5S A;  1JM6 A;  3D0B A;  5D6P A;  1ZXN A;  2YK2 A;  2XD6 A;  4CWO A;  1R62 A;  2BRE A;  3G75 A;  1YT2 A;  4ZVI A;  4U93 A;  2YKJ A;  4ASG A;  3PEH A;  4FCQ A;  4B7P A;  3FT5 A;  5D6Q A;  2QG2 A;  3B26 A;  2YEF A;  1Y4U A;  1ZXM A;  5GGZ A;  3T0H A;  3JZ3 A;  1UY6 A;  2Q2E B;  4AWQ A;  2YE3 A;  4CWS A;  3TZ0 A;  4LP0 A;  1YET A;  3RLP A;  2YI5 A;  1OSF A;  1UYL A;  4ZKI A;  1B3Q A;  2FWZ A;  1I59 A;  4ASB A;  4AWP A;  4KSH A;  3G7E A;  2XHR A;  3TTZ A;  4LPB A;  2JKI A;  4L91 A;  1QYE A;  4LWH A;  1GKX A;  1ID0 A;  4DUH A;  3HYZ A;  4XC0 A;  1YSR A;  3A0R A;  2BU7 A;  3R4P A;  1I58 A;  4P7A A;  4FPP A;  2VCJ A;  3LNU A;  1UY8 A;  3OMU A;  4MBC A;  2YE9 A;  2WEQ A;  3O2F A;  1I5D A;  2YEA A;  3K99 A;  3LMM A;  2BSM A;  3KE6 A;  3CGY A;  4H7Q A;  4PL9 A;  1UYG A;  3T1K A;  3OPD A;  1Y8N A;  3MNR P;  4CWP A;  2IOQ A;  4H81 A;  4EGI A;  5J6A A;  1TC6 A;  3WHA A;  5CTW A;  1YSZ A;  2CG9 A;  2XCM A;  4LWI A;  1EA6 A;  4O07 A;  4URN A;  1B62 A;  2YEI A;  1GJV A;  1UYM A;  2BYI A;  2QG0 A;  4XIT A;  1UYH A;  2UWD A;  5CPH A;  1THN A;  2XJJ A;  1KIJ A;  2YE6 A;  2ZKJ A;  4GEE A;  4I3H A;  3GIG A;  4KFG A;  3VHA A;  3H80 A;  3R4O A;  2XX2 A;  4E72 A;  2YEC A;  4CWR A;  2H55 A;  2YGF A;  1UY9 A;  1YT1 A;  4NH7 A;  5L3J A;  3RKZ A;  4U7O A;  2XDX A;  4CWT A;  5F5R A;  2BRC A;  2ZDY A;  3ZXQ A;  2PNR A;  3SL2 A;  5D7R A;  4BAE A;  4L8Z A;  2C2A A;  2QFO A;  4YKY A;  3ZM7 A;  2YEB A;  2O1V A;  5M4M A;  4KSG A;  4L94 A;  3C0E A;  4WUC A;  3BM9 A;  4XIP A;  2YEH A;  1YT0 A;  1YS3 A;  4CE3 A;  4XCL A;  3RLR A;  3HYY A;  2XHX A;  2HCH A;  2O1W A;  2BZ5 A;  3A0W A;  1UYK A;  4CE2 A;  2YEE A;  3B24 A;  2XDU A;  4JAU A;  4HY6 A;  4PRV A;  1US7 A;  3K97 A;  3TZ4 A;  4BQJ A;  4FMT A;  4XDM A;  2HKJ A;  2BU5 A;  2WI1 A;  5BOD A;  4H85 A;  2H8M A;  4GGL A;  1Y8O A;  4E00 A;  4GQT A;  2C1G A; 
#chains in the Genus database with same CATH homology
 3O0I A;  5IN9 A;  3HZ5 A;  4MB9 A;  4JQL A;  3K60 A;  4HY1 A;  5CTU A;  4AS9 A;  3C11 A;  1TC0 A;  1AJ6 A;  1TH8 A;  3CGZ A;  4XKA A;  2YEG A;  2E0A A;  2YE7 A;  3K98 A;  3FV5 A;  4LWG A;  3TZ2 A;  1AH8 A;  5J71 A;  2YJW A;  4MPN A;  4LWE A;  2FWY A;  3EHF A;  4EGH A;  1BYQ A;  4URL A;  1EI1 A;  2YED A;  2XAB A;  4XD8 A;  1B63 A;  1MU5 A;  1UYE A;  1I5B A;  2IWU A;  1TBW A;  5CTX A;  1I5C A;  4QPJ A;  1BKN A;  1Y8P A;  4U7N A;  3A0Z A;  1U2O A;  1NHJ A;  4XKK A;  3TZ5 A;  2BYH A;  4MOT A;  4W7T A;  3CWV A;  2FXS A;  1Z5A A;  1QZR A;  2WER A;  3ZXO A;  2YI7 A;  3EHH A;  4P8O A;  4YKU A;  3HEK A;  3Q5L A;  2XX4 A;  3GIE A;  4MP7 A;  2XDL A;  1YC4 A;  1PVG A;  1YER A;  4L90 A;  4XIQ A;  4NH8 A;  4E02 A;  2HG1 A;  2YEJ A;  1UYI A;  4HYP A;  4HZ5 A;  2YE2 A;  1UYF A;  2XJG A;  3EKO A;  4KTN A;  4BQG A;  3CRL A;  3U2D A;  4YKZ A;  1AM1 A;  2VW5 A;  4B6C A;  4XKO A;  3LPS A;  1YC1 A;  3QDD A;  4XTJ A;  4NH9 A;  4CE1 A;  1H7S A;  5M4H A;  3U2K A;  4XE2 A;  4XCJ A;  2Q8I A;  4K4O A;  3OWD A;  1S16 A;  3VHC A;  4URO A;  2XX5 A;  3O6O A;  2CCS A;  4MPE A;  4WUB A;  4XIR A;  1H7U A;  3ZKB A;  3D2R A;  1QY8 A;  4YKW A;  2GFD A;  4EEH A;  4FCP A;  2IWS A;  2IOR A;  4GT8 A;  1BXD A;  2ESA A;  4EMV A;  1UYD A;  3A0T A;  3RLQ A;  3T0Z A;  3HZ1 A;  1UY7 A;  3H4L A;  3INW A;  4FCR A;  1AH6 A;  2YGA A;  2BU8 A;  3OW6 A;  5BOC A;  5FND A;  2WI5 A;  2YGE A;  4WUD A;  4PRX A;  5CF0 A;  4PU9 A;  3QTF A;  2CCU A;  2XK2 A;  3IED A;  4GCZ A;  4R1F A;  2WEP A;  3TUH A;  4ASF A;  3T2S A;  4CWN A;  2Q8H A;  2Q8G A;  1UYC A;  4YKQ A;  4MPC A;  2YKC A;  2WI2 A;  2Q8F A;  4BXI A;  1A4H A;  1KZN A;  4BIZ A;  5IDM A;  5IDJ A;  2ZDX A;  3A0X A;  2WI7 A;  3R91 A;  4EGK A;  3EHG A;  2EXL A;  4E01 A;  3EHJ A;  4GFN A;  3VAD A;  3R4N A;  2YE8 A;  2YKI A;  2ZBK B;  2YI6 A;  3NMQ A;  2BU6 A;  2QF6 A;  2YI0 A;  2BT0 A;  3BMY A;  2XJX A;  2BTZ A;  5CTY A;  4CWF A;  4KP4 A;  3R4M A;  4EM7 A;  2WI4 A;  4O04 A;  2YK9 A;  1MX0 A;  3Q5J A;  2WI3 A;  4DZY A;  2FYP A;  5C93 A;  4AWO A;  1TIL A;  3U67 A;  4R3A A;  4URM A;  3PEJ A;  1Z5C A;  1Z5B A;  2BU2 A;  2JJC A;  2XHT A;  4YKX A;  4ASA A;  1L0O A;  5M4K A;  2AKP A;  3GIG B;  3DGE A;  4O0B A;  3B27 A;  4HXW A;  1AMW A;  3A0Y A;  3ZKD A;  5M4N A;  3HHU A;  1TID A;  4O09 A;  4YKT A;  2CCT A;  4X9L A;  1BGQ A;  4MP2 A;  2VCI A;  5FNF A;  1ZW9 A;  4JAV A;  3FT8 A;  3T10 A;  2WI6 A;  1I5A A;  2YJX A;  3CRK A;  4L93 A;  2YE4 A;  5FWK A;  1S14 A;  3B28 A;  5FNC A;  1NHH A;  5M4E A;  1ZWH A;  5D7C A;  5F3K A;  2CGF A;  1Y4S A;  2YKE A;  1Z59 A;  1U0Z A;  3INX A;  4R3M A;  4BIU A;  3G7B A;  1YC3 A;  4HYM A;  4JAS A;  2GQP A;  4LWF A;  3OWB A;  2XDK A;  3B25 A;  5M4P A;  1YES A;  5D7D A;  2K5B A;  3D36 A;  3VHD A;  4YKR A;  2CH4 A;  2O1U A;  3WQ9 A;  1GKZ A;  3GIF A;  2VWC A;  4O05 A;  4HZ0 A;  2IWX A;  4EFT A;  4V25 A;  2IOP A;  4EFU A;  2YE5 A;  2XDS A;  3EKR A;  4KQV A;  3Q5K A;  1NHI A;  4QPK A;  4HXZ A;  3R92 A;  4Q20 A;  4CWQ A;  4V26 A;  4I5S A;  1JM6 A;  3D0B A;  5D6P A;  1ZXN A;  2YK2 A;  2XD6 A;  4CWO A;  1R62 A;  2BRE A;  3G75 A;  1YT2 A;  4ZVI A;  4U93 A;  2YKJ A;  4ASG A;  3PEH A;  4FCQ A;  4B7P A;  3FT5 A;  5D6Q A;  2QG2 A;  3B26 A;  2YEF A;  1Y4U A;  1ZXM A;  5GGZ A;  3T0H A;  3JZ3 A;  1UY6 A;  2Q2E B;  4AWQ A;  2YE3 A;  4CWS A;  3TZ0 A;  4LP0 A;  1YET A;  3RLP A;  2YI5 A;  1OSF A;  1UYL A;  4ZKI A;  1B3Q A;  2FWZ A;  1I59 A;  4ASB A;  4AWP A;  4KSH A;  3G7E A;  2XHR A;  3TTZ A;  4LPB A;  2JKI A;  4L91 A;  1QYE A;  4LWH A;  1GKX A;  1ID0 A;  4DUH A;  3HYZ A;  4XC0 A;  1YSR A;  3A0R A;  2BU7 A;  3R4P A;  1I58 A;  4P7A A;  4FPP A;  2VCJ A;  3LNU A;  1UY8 A;  3OMU A;  4MBC A;  2YE9 A;  2WEQ A;  3O2F A;  1I5D A;  2YEA A;  3K99 A;  2BSM A;  3KE6 A;  3CGY A;  4H7Q A;  4PL9 A;  1UYG A;  3T1K A;  3OPD A;  1Y8N A;  3MNR P;  4CWP A;  2IOQ A;  4H81 A;  4EGI A;  5J6A A;  1TC6 A;  3WHA A;  5CTW A;  1YSZ A;  2CG9 A;  2XCM A;  4LWI A;  1EA6 A;  4O07 A;  4URN A;  1B62 A;  2YEI A;  1GJV A;  1UYM A;  2BYI A;  2QG0 A;  4XIT A;  1UYH A;  2UWD A;  5CPH A;  1THN A;  2XJJ A;  1KIJ A;  2YE6 A;  2ZKJ A;  4GEE A;  4I3H A;  3GIG A;  4KFG A;  3VHA A;  3H80 A;  3R4O A;  2XX2 A;  2YEC A;  4CWR A;  2H55 A;  2YGF A;  1UY9 A;  1YT1 A;  4NH7 A;  5L3J A;  3RKZ A;  4U7O A;  2XDX A;  4CWT A;  5F5R A;  2BRC A;  2ZDY A;  3ZXQ A;  2PNR A;  3SL2 A;  5D7R A;  4BAE A;  4L8Z A;  2C2A A;  2QFO A;  4YKY A;  3ZM7 A;  2YEB A;  2O1V A;  5M4M A;  4KSG A;  4L94 A;  3C0E A;  4WUC A;  3BM9 A;  4XIP A;  2YEH A;  1YT0 A;  1YS3 A;  4CE3 A;  4XCL A;  3RLR A;  3HYY A;  2XHX A;  2HCH A;  2O1W A;  2BZ5 A;  3A0W A;  1UYK A;  4CE2 A;  2YEE A;  3B24 A;  2XDU A;  4JAU A;  4HY6 A;  4PRV A;  1US7 A;  3K97 A;  3TZ4 A;  4BQJ A;  4FMT A;  4XDM A;  2HKJ A;  2BU5 A;  2WI1 A;  5BOD A;  4H85 A;  2H8M A;  4GGL A;  1Y8O A;  4E00 A;  4GQT A;  2YKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...