1I5BA

Structure of chea domain p4 in complex with adpnp and manganese
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
180
Chain Sequence
b'GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein, transferase
total genus 56
structure length 180
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i5bA00
4GQTA 4K4OA 3BMYA 2FWZA 2FYPA 5CPHA 3CRKA 3EKOA 3HEKA 4DZYA 2YGFA 3R91A 3JZ3A 4MOTA 1KZNA 2UWDA 4HZ0A 1GKZA 5BODA 3OPDA 1YC3A 4O05A 3MNRP 2QG2A 4MBCA 4NH7A 3B26A 1BXDA 2WI5A 5FNDA 4JAVA 5FNCA 3GIEA 4L90A 2PNRA 2YE3A 3D2RA 4ZVIA 3K98A 4CE3A 1U0ZA 4YKTA 2YEHA 1Z5BA 2HKJA 4XE2A 4HZ5A 1NHIA 4KQVA 3H80A 4MPEA 1QYEA 3B25A 3ZM7A 4HYMA 2Q2EB 3H4LA 4XCLA 1ZXNA 2XABA 4MB9A 1H7UA 5M4KA 4ASGA 4CWPA 2ZDXA 4O07A 2CGFA 3RLQA 1UYFA 4CE1A 4O0BA 2YECA 5IDMA 2XDUA 5CTUA 2WI4A 4V26A 2WI6A 4YKUA 1Y4SA 4I5SA 3EHJA 2CG9A 3O6OA 4FCRA 4X9LA 2YE2A 4ASBA 3WQ9A 3Q5JA 2CCTA 1YT2A 1Y8PA 4KFGA 1B3QA 4MP2A 5M4EA 3C11A 2CH4A 2XDLA 1MX0A 4XITA 1ZWHA 2YE6A 1I58A 1YETA 2CCSA 3T1KA 3EHGA 4O09A 4GFNA 3OW6A 3O2FA 3TZ4A 2XJXA 4CE2A 4YKZA 3DGEA 3G7BA 3OWDA 1UYCA 4GT8A 4AS9A 4W7TA 2YJXA 2IORA 1PVGA 4EGKA 2YEFA 4XKAA 2AKPA 2YE9A 4CWOA 1BKNA 3B24A 3GIGA 1Z5CA 4LWFA 3HZ5A 4MPCA 4U93A 4XCJA 5D7CA 2YKJA 4B7PA 2Q8HA 1YSZA 2YEAA 3A0ZA 2WI3A 4AWOA 4XIPA 4BQGA 4EEHA 2YEIA 4GCZA 4XDMA 1TBWA 3T2SA 2WI1A 1U2OA 2FXSA 4XIRA 3RKZA 1I5CA 2BU7A 1JM6A 2ZBKB 2XX4A 3FV5A 1YC1A 3U2KA 2BTZA 5M4PA 3R4MA 4HYPA 3VHAA 4EFTA 4B6CA 2YK9A 2QFOA 4ASAA 3D36A 3FT8A 1NHHA 2CCUA 3PEHA 5D7RA 3B27A 4FMTA 1YSRA 3QTFA 3SL2A 3A0RA 4H7QA 5J71A 3K60A 4YKQA 4P7AA 4BIZA 4AWQA 3U2DA 1KIJA 2GFDA 3NMQA 5CF0A 2K5BA 2IOQA 4LWIA 2C2AA 1QZRA 2YEGA 1YESA 3R4NA 1ID0A 3TUHA 4HXZA 4R3MA 5F5RA 2YEEA 4R1FA 5IN9A 4DUHA 4U7NA 3Q5LA 3T10A 3G7EA 5D6PA 3CWVA 1GJVA 4MP7A 4UROA 3FT5A 4KP4A 3ZKDA 2YKCA 1EI1A 4ASFA 2VW5A 1UYLA 4GEEA 2BU8A 4L8ZA 3TZ2A 2IOPA 4FCPA 4H85A 3A0XA 2VCIA 5CTXA 2E0AA 4KSGA 4LWEA 1AH6A 1S14A 1UYDA 3IEDA 1B62A 2YGEA 1H7SA 4E00A 3R4PA 3LNUA 3D0BA 3VHDA 1TIDA 1L0OA 5L3JA 2HCHA 2ZDYA 5D6QA 2YE8A 4HY1A 4EM7A 2BU2A 1Y8NA 4HY6A 1Z59A 3T0ZA 4E02A 1Z5AA 3R92A 4HXWA 1UYGA 1OSFA 3GIGB 2BT0A 4P8OA 2YKIA 3TZ5A 1UY7A 4WUBA 3ZKBA 2FWYA 4FPPA 3EHFA 3T0HA 3VADA 1ZXMA 2WI2A 2ESAA 1UYIA 3INXA 2IWUA 4CWQA 1AMWA 3TTZA 2JKIA 1YT1A 1EA6A 4JAUA 1TC6A 4LPBA 2EXLA 2GQPA 3RLPA 1B63A 3A0WA 1I5AA 2YI0A 3HYZA 3Q5KA 2YE7A 2BYIA 4KSHA 4XTJA 2ZKJA 2H55A 3QDDA 4BIUA 2H8MA 2YEDA 4CWRA 4L91A 2XD6A 3G75A 1TC0A 3EHHA 4EGHA 2BREA 1TH8A 2BRCA 1UYEA 2XK2A 4BQJA 4BAEA 2BU5A 3A0TA 4QPJA 1QY8A 1AM1A 3BM9A 2BU6A 4AWPA 4ZKIA 5M4MA 3HZ1A 2O1WA 3HHUA 2QG0A 2XDKA 3EKRA 4V25A 2Q8FA 1AJ6A 1TILA 4BXIA 2YJWA 2WI7A 1UY8A 3LPSA 4NH8A 2XHXA 4XKOA 4LWHA 5M4NA 1UYHA 1A4HA 4WUDA 5FWKA 2XHTA 3ZXQA 5IDJA 4YKRA 1UYKA 2IWXA 3PEJA 2YE5A 4YKWA 4URNA 4FCQA 4QPKA 4WUCA 2O1UA 3VHCA 4H81A 4E01A 1AH8A 2BYHA 2WERA 4PL9A 5C93A 2QF6A 1GKXA 5J6AA 3O0IA 1YT0A 2YI5A 4JASA 4KTNA 2VWCA 2XHRA 2XDXA 2YK2A 3K99A 3CGZA 1MU5A 1BGQA 1I59A 1UY9A 3GIFA 3OWBA 1YS3A 3ZXOA 1S16A 2XX5A 2Q8IA 2YGAA 1Y4UA 2YI7A 4EGIA 2BZ5A 5F3KA 1I5DA 4O04A 2YEJA 2XCMA 4MPNA 3C0EA 1UYMA 4URLA 4EMVA 2WEQA 3CGYA 1US7A 2XJJA 4XIQA 4NH9A 4I3HA 3R4OA 4LWGA 4GGLA 2HG1A 2YI6A 4U7OA 4EFUA 2JJCA 3K97A 1I5BA 5M4HA 2XX2A 2YE4A 4YKXA 3RLRA 5BOCA 5CTYA 2YKBA 4LP0A 1UY6A 3TZ0A 4L94A 4XD8A 1ZW9A 3HYYA 4PRVA 2YKEA 4YKYA 1R62A 3OMUA 4CWFA 2XJGA 4CWTA 4Q20A 4XKKA 4R3AA 1BYQA 4PU9A 4CWSA 3A0YA 5D7DA 2O1VA 5GGZA 3CRLA 2IWSA 4PRXA 2YEBA 4XC0A 4CWNA 1THNA 4L93A 5FNFA 5CTWA 1YC4A 2WEPA 2BSMA 2Q8GA 3U67A 2VCJA 1Y8OA 3INWA 1YERA 3KE6A 4URMA 3WHAA 2XDSA 1NHJA 3B28A 4JQLA
chains in the Genus database with same CATH superfamily
4GQTA 4K4OA 3BMYA 2FWZA 2FYPA 5CPHA 3CRKA 3EKOA 3HEKA 4DZYA 2YGFA 3R91A 3JZ3A 4MOTA 1KZNA 2UWDA 4HZ0A 1GKZA 5BODA 3OPDA 1YC3A 4O05A 3MNRP 2QG2A 4MBCA 4NH7A 4E72A 3B26A 1BXDA 2WI5A 5FNDA 4JAVA 5FNCA 3GIEA 4L90A 2PNRA 2YE3A 3D2RA 4ZVIA 3K98A 4CE3A 1U0ZA 4YKTA 2YEHA 1Z5BA 2HKJA 4XE2A 4HZ5A 1NHIA 3LMMA 4KQVA 3H80A 4MPEA 1QYEA 3B25A 3ZM7A 4HYMA 2Q2EB 3H4LA 4XCLA 1ZXNA 2XABA 4MB9A 1H7UA 5M4KA 4ASGA 4CWPA 2ZDXA 4O07A 2CGFA 3RLQA 1UYFA 4CE1A 4O0BA 2YECA 5IDMA 2XDUA 5CTUA 2WI4A 4V26A 2WI6A 4YKUA 1Y4SA 4I5SA 3EHJA 2CG9A 3O6OA 4FCRA 4X9LA 2YE2A 4ASBA 3WQ9A 3Q5JA 2CCTA 1YT2A 1Y8PA 4KFGA 1B3QA 4MP2A 5M4EA 3C11A 2CH4A 2XDLA 1MX0A 4XITA 1ZWHA 2YE6A 1I58A 1YETA 2CCSA 3T1KA 3EHGA 4O09A 4GFNA 3OW6A 3O2FA 3TZ4A 2XJXA 4CE2A 4YKZA 3DGEA 3G7BA 3OWDA 1UYCA 4GT8A 4AS9A 4W7TA 2YJXA 2IORA 1PVGA 4EGKA 3S5TA 2YEFA 4XKAA 2AKPA 2YE9A 4CWOA 1BKNA 3B24A 3GIGA 1Z5CA 4LWFA 3HZ5A 4MPCA 4U93A 4XCJA 5D7CA 2YKJA 2FTKA 3CYGA 4B7PA 2Q8HA 1YSZA 2YEAA 3A0ZA 2WI3A 4AWOA 4XIPA 4BQGA 4EEHA 2YEIA 4GCZA 4XDMA 1TBWA 3T2SA 2WI1A 1U2OA 2FXSA 4XIRA 3RKZA 1I5CA 2BU7A 1JM6A 2ZBKB 2XX4A 3FV5A 1YC1A 3U2KA 2BTZA 5M4PA 3R4MA 4HYPA 3VHAA 4EFTA 4B6CA 2YK9A 2QFOA 4ASAA 3D36A 3FT8A 1NHHA 2CCUA 3PEHA 5D7RA 3B27A 4FMTA 1YSRA 3QTFA 3SL2A 3A0RA 4H7QA 5J71A 3K60A 4YKQA 4P7AA 4BIZA 4AWQA 3U2DA 1KIJA 2GFDA 3NMQA 5CF0A 2C1GA 2K5BA 2IOQA 4LWIA 2C2AA 1QZRA 2YEGA 1YESA 3R4NA 1ID0A 3TUHA 4HXZA 4R3MA 5F5RA 2YEEA 4R1FA 1IXMA 5IN9A 4DUHA 4U7NA 3Q5LA 3T10A 3G7EA 5D6PA 3CWVA 1GJVA 4MP7A 4UROA 3FT5A 4KP4A 3ZKDA 2YKCA 1EI1A 4ASFA 2VW5A 1UYLA 4GEEA 2BU8A 4L8ZA 3TZ2A 2IOPA 4FCPA 4H85A 3A0XA 2VCIA 5CTXA 2E0AA 4KSGA 4LWEA 1AH6A 2C1IA 1S14A 1UYDA 3IEDA 1B62A 2YGEA 1H7SA 4E00A 3R4PA 3LNUA 3D0BA 3VHDA 1TIDA 1L0OA 5L3JA 2HCHA 2ZDYA 5D6QA 2YE8A 4HY1A 4EM7A 2BU2A 1Y8NA 4HY6A 1Z59A 3T0ZA 4E02A 1Z5AA 3R92A 4HXWA 1UYGA 1OSFA 3GIGB 2BT0A 4P8OA 2YKIA 3TZ5A 1UY7A 4WUBA 3ZKBA 2FWYA 4FPPA 3EHFA 3T0HA 3VADA 1ZXMA 2WI2A 2ESAA 1UYIA 3INXA 2IWUA 4CWQA 1AMWA 3TTZA 2JKIA 1YT1A 1EA6A 4JAUA 1TC6A 4LPBA 2EXLA 2GQPA 3RLPA 1B63A 3A0WA 1I5AA 2YI0A 3HYZA 3Q5KA 2YE7A 2BYIA 4KSHA 4XTJA 2ZKJA 2H55A 3QDDA 4BIUA 2H8MA 2YEDA 4CWRA 4L91A 2XD6A 3G75A 1TC0A 3EHHA 4EGHA 2BREA 1TH8A 2BRCA 1UYEA 2XK2A 4BQJA 4BAEA 2BU5A 3A0TA 4QPJA 1QY8A 1AM1A 3BM9A 2BU6A 4AWPA 4ZKIA 5M4MA 3HZ1A 2O1WA 3HHUA 2QG0A 2XDKA 3EKRA 4V25A 2Q8FA 1AJ6A 1TILA 4BXIA 2YJWA 2WI7A 1UY8A 3LPSA 4NH8A 2XHXA 4XKOA 4LWHA 5M4NA 1UYHA 1A4HA 4WUDA 5FWKA 2XHTA 3ZXQA 5IDJA 4YKRA 1UYKA 2IWXA 3PEJA 2YE5A 4YKWA 4URNA 4FCQA 4QPKA 4WUCA 2O1UA 5JENA 3VHCA 4H81A 4E01A 1AH8A 2BYHA 2WERA 4PL9A 5C93A 2QF6A 1GKXA 5J6AA 3O0IA 1YT0A 2YI5A 4JASA 4KTNA 2VWCA 2XHRA 2XDXA 2YK2A 3K99A 3CGZA 1MU5A 1BGQA 1I59A 1UY9A 3GIFA 3OWBA 1YS3A 3ZXOA 1S16A 2XX5A 2Q8IA 2YGAA 1Y4UA 2YI7A 4EGIA 2BZ5A 5F3KA 1I5DA 4O04A 2YEJA 2XCMA 4MPNA 3C0EA 1UYMA 4URLA 4EMVA 2WEQA 3CGYA 1US7A 2XJJA 4XIQA 4NH9A 4I3HA 3R4OA 4LWGA 4GGLA 2HG1A 2YI6A 4U7OA 4EFUA 2JJCA 3K97A 1I5BA 5M4HA 2XX2A 2YE4A 4YKXA 3RLRA 5BOCA 5CTYA 2YKBA 4LP0A 1UY6A 3TZ0A 4L94A 4XD8A 1ZW9A 3HYYA 4PRVA 2YKEA 4YKYA 1R62A 3OMUA 4CWFA 2XJGA 4CWTA 4Q20A 4XKKA 4R3AA 1BYQA 4PU9A 4CWSA 3A0YA 1F51A 2O1VA 5D7DA 3CRLA 5GGZA 2IWSA 4PRXA 2YEBA 2HHIA 4XC0A 4CWNA 1THNA 4L93A 5FNFA 5CTWA 1YC4A 2WEPA 2BSMA 2Q8GA 3U67A 2VCJA 1Y8OA 3INWA 1YERA 3KE6A 4URMA 3WHAA 2XDSA 1NHJA 3B28A 4JQLA
chains in the Genus database with same CATH topology
4GQTA 4K4OA 3BMYA 2FWZA 2FYPA 5CPHA 3CRKA 3EKOA 3HEKA 4DZYA 2YGFA 3R91A 3JZ3A 4MOTA 1KZNA 2UWDA 4HZ0A 1GKZA 5BODA 3OPDA 1YC3A 4O05A 3MNRP 2QG2A 4MBCA 4NH7A 3B26A 1BXDA 2WI5A 5FNDA 4JAVA 5FNCA 3GIEA 4L90A 2PNRA 2YE3A 3D2RA 4ZVIA 3K98A 4CE3A 1U0ZA 4YKTA 2YEHA 1Z5BA 2HKJA 4XE2A 4HZ5A 1NHIA 4KQVA 3H80A 4MPEA 1QYEA 3B25A 3ZM7A 4HYMA 2Q2EB 3H4LA 4XCLA 1ZXNA 2XABA 4MB9A 1H7UA 5M4KA 4ASGA 4CWPA 2ZDXA 4O07A 2CGFA 3RLQA 1UYFA 4CE1A 4O0BA 2YECA 5IDMA 2XDUA 5CTUA 2WI4A 4V26A 2WI6A 4YKUA 1Y4SA 4I5SA 3EHJA 2CG9A 3O6OA 4FCRA 4X9LA 2YE2A 4ASBA 3WQ9A 3Q5JA 2CCTA 1YT2A 1Y8PA 4KFGA 1B3QA 4MP2A 5M4EA 3C11A 2CH4A 2XDLA 1MX0A 4XITA 1ZWHA 2YE6A 1I58A 1YETA 2CCSA 3T1KA 3EHGA 4O09A 4GFNA 3OW6A 3O2FA 3TZ4A 2XJXA 4CE2A 4YKZA 3DGEA 3G7BA 3OWDA 1UYCA 4GT8A 4AS9A 4W7TA 2YJXA 2IORA 1PVGA 4EGKA 2YEFA 4XKAA 2AKPA 2YE9A 4CWOA 1BKNA 3B24A 3GIGA 1Z5CA 4LWFA 3HZ5A 4MPCA 4U93A 4XCJA 5D7CA 2YKJA 4B7PA 2Q8HA 1YSZA 2YEAA 3A0ZA 2WI3A 4AWOA 4XIPA 4BQGA 4EEHA 2YEIA 4GCZA 4XDMA 1TBWA 3T2SA 2WI1A 1U2OA 2FXSA 4XIRA 3RKZA 1I5CA 2BU7A 1JM6A 2ZBKB 2XX4A 3FV5A 1YC1A 3U2KA 2BTZA 5M4PA 3R4MA 4HYPA 3VHAA 4EFTA 4B6CA 2YK9A 2QFOA 4ASAA 3D36A 3FT8A 1NHHA 2CCUA 3PEHA 5D7RA 3B27A 4FMTA 1YSRA 3QTFA 3SL2A 3A0RA 4H7QA 5J71A 3K60A 4YKQA 4P7AA 4BIZA 4AWQA 3U2DA 1KIJA 2GFDA 3NMQA 5CF0A 2K5BA 2IOQA 4LWIA 2C2AA 1QZRA 2YEGA 1YESA 3R4NA 1ID0A 3TUHA 4HXZA 4R3MA 5F5RA 2YEEA 4R1FA 5IN9A 4DUHA 4U7NA 3Q5LA 3T10A 3G7EA 5D6PA 3CWVA 1GJVA 4MP7A 4UROA 3FT5A 4KP4A 3ZKDA 2YKCA 1EI1A 4ASFA 2VW5A 1UYLA 4GEEA 2BU8A 4L8ZA 3TZ2A 2IOPA 4FCPA 4H85A 3A0XA 2VCIA 5CTXA 2E0AA 4KSGA 4LWEA 1AH6A 1S14A 1UYDA 3IEDA 1B62A 2YGEA 1H7SA 4E00A 3R4PA 3LNUA 3D0BA 3VHDA 1TIDA 1L0OA 5L3JA 2HCHA 2ZDYA 5D6QA 2YE8A 4HY1A 4EM7A 2BU2A 1Y8NA 4HY6A 1Z59A 3T0ZA 4E02A 1Z5AA 3R92A 4HXWA 1UYGA 1OSFA 3GIGB 2BT0A 4P8OA 2YKIA 3TZ5A 1UY7A 4WUBA 3ZKBA 2FWYA 4FPPA 3EHFA 3T0HA 3VADA 1ZXMA 2WI2A 2ESAA 1UYIA 3INXA 2IWUA 4CWQA 1AMWA 3TTZA 2JKIA 1YT1A 1EA6A 4JAUA 1TC6A 4LPBA 2EXLA 2GQPA 3RLPA 1B63A 3A0WA 1I5AA 2YI0A 3HYZA 3Q5KA 2YE7A 2BYIA 4KSHA 4XTJA 2ZKJA 2H55A 3QDDA 4BIUA 2H8MA 2YEDA 4CWRA 4L91A 2XD6A 3G75A 1TC0A 3EHHA 4EGHA 2BREA 1TH8A 2BRCA 1UYEA 2XK2A 4BQJA 4BAEA 2BU5A 3A0TA 4QPJA 1QY8A 1AM1A 3BM9A 2BU6A 4AWPA 4ZKIA 5M4MA 3HZ1A 2O1WA 3HHUA 2QG0A 2XDKA 3EKRA 4V25A 2Q8FA 1AJ6A 1TILA 4BXIA 2YJWA 2WI7A 1UY8A 3LPSA 4NH8A 2XHXA 4XKOA 4LWHA 5M4NA 1UYHA 1A4HA 4WUDA 5FWKA 2XHTA 3ZXQA 5IDJA 4YKRA 1UYKA 2IWXA 3PEJA 2YE5A 4YKWA 4URNA 4FCQA 4QPKA 4WUCA 2O1UA 3VHCA 4H81A 4E01A 1AH8A 2BYHA 2WERA 4PL9A 5C93A 2QF6A 1GKXA 5J6AA 3O0IA 1YT0A 2YI5A 4JASA 4KTNA 2VWCA 2XHRA 2XDXA 2YK2A 3K99A 3CGZA 1MU5A 1BGQA 1I59A 1UY9A 3GIFA 3OWBA 1YS3A 3ZXOA 1S16A 2XX5A 2Q8IA 2YGAA 1Y4UA 2YI7A 4EGIA 2BZ5A 5F3KA 1I5DA 4O04A 2YEJA 2XCMA 4MPNA 3C0EA 1UYMA 4URLA 4EMVA 2WEQA 3CGYA 1US7A 2XJJA 4XIQA 4NH9A 4I3HA 3R4OA 4LWGA 4GGLA 2HG1A 2YI6A 4U7OA 4EFUA 2JJCA 3K97A 1I5BA 5M4HA 2XX2A 2YE4A 4YKXA 3RLRA 5BOCA 5CTYA 2YKBA 4LP0A 1UY6A 3TZ0A 4L94A 4XD8A 1ZW9A 3HYYA 4PRVA 2YKEA 4YKYA 1R62A 3OMUA 4CWFA 2XJGA 4CWTA 4Q20A 4XKKA 4R3AA 1BYQA 4PU9A 4CWSA 3A0YA 5D7DA 2O1VA 5GGZA 3CRLA 2IWSA 4PRXA 2YEBA 4XC0A 4CWNA 1THNA 4L93A 5FNFA 5CTWA 1YC4A 2WEPA 2BSMA 2Q8GA 3U67A 2VCJA 1Y8OA 3INWA 1YERA 3KE6A 4URMA 3WHAA 2XDSA 1NHJA 3B28A 4JQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GQT A;  4K4O A;  3BMY A;  2FWZ A;  2FYP A;  5CPH A;  3CRK A;  3EKO A;  3HEK A;  4DZY A;  2YGF A;  3R91 A;  3JZ3 A;  4MOT A;  1KZN A;  2UWD A;  4HZ0 A;  1GKZ A;  5BOD A;  3OPD A;  1YC3 A;  4O05 A;  3MNR P;  2QG2 A;  4MBC A;  4NH7 A;  3B26 A;  1BXD A;  2WI5 A;  5FND A;  4JAV A;  5FNC A;  3GIE A;  4L90 A;  2PNR A;  2YE3 A;  3D2R A;  4ZVI A;  3K98 A;  4CE3 A;  1U0Z A;  4YKT A;  2YEH A;  1Z5B A;  2HKJ A;  4XE2 A;  4HZ5 A;  1NHI A;  4KQV A;  3H80 A;  4MPE A;  1QYE A;  3B25 A;  3ZM7 A;  4HYM A;  2Q2E B;  3H4L A;  4XCL A;  1ZXN A;  2XAB A;  4MB9 A;  1H7U A;  5M4K A;  4ASG A;  4CWP A;  2ZDX A;  4O07 A;  2CGF A;  3RLQ A;  1UYF A;  4CE1 A;  4O0B A;  2YEC A;  5IDM A;  2XDU A;  5CTU A;  2WI4 A;  4V26 A;  2WI6 A;  4YKU A;  1Y4S A;  4I5S A;  3EHJ A;  2CG9 A;  3O6O A;  4FCR A;  4X9L A;  2YE2 A;  4ASB A;  3WQ9 A;  3Q5J A;  2CCT A;  1YT2 A;  1Y8P A;  4KFG A;  1B3Q A;  4MP2 A;  5M4E A;  3C11 A;  2CH4 A;  2XDL A;  1MX0 A;  4XIT A;  1ZWH A;  2YE6 A;  1I58 A;  1YET A;  2CCS A;  3T1K A;  3EHG A;  4O09 A;  4GFN A;  3OW6 A;  3O2F A;  3TZ4 A;  2XJX A;  4CE2 A;  4YKZ A;  3DGE A;  3G7B A;  3OWD A;  1UYC A;  4GT8 A;  4AS9 A;  4W7T A;  2YJX A;  2IOR A;  1PVG A;  4EGK A;  2YEF A;  4XKA A;  2AKP A;  2YE9 A;  4CWO A;  1BKN A;  3B24 A;  3GIG A;  1Z5C A;  4LWF A;  3HZ5 A;  4MPC A;  4U93 A;  4XCJ A;  5D7C A;  2YKJ A;  4B7P A;  2Q8H A;  1YSZ A;  2YEA A;  3A0Z A;  2WI3 A;  4AWO A;  4XIP A;  4BQG A;  4EEH A;  2YEI A;  4GCZ A;  4XDM A;  1TBW A;  3T2S A;  2WI1 A;  1U2O A;  2FXS A;  4XIR A;  3RKZ A;  1I5C A;  2BU7 A;  1JM6 A;  2ZBK B;  2XX4 A;  3FV5 A;  1YC1 A;  3U2K A;  2BTZ A;  5M4P A;  3R4M A;  4HYP A;  3VHA A;  4EFT A;  4B6C A;  2YK9 A;  2QFO A;  4ASA A;  3D36 A;  3FT8 A;  1NHH A;  2CCU A;  3PEH A;  5D7R A;  3B27 A;  4FMT A;  1YSR A;  3QTF A;  3SL2 A;  3A0R A;  4H7Q A;  5J71 A;  3K60 A;  4YKQ A;  4P7A A;  4BIZ A;  4AWQ A;  3U2D A;  1KIJ A;  2GFD A;  3NMQ A;  5CF0 A;  2K5B A;  2IOQ A;  4LWI A;  2C2A A;  1QZR A;  2YEG A;  1YES A;  3R4N A;  1ID0 A;  3TUH A;  4HXZ A;  4R3M A;  5F5R A;  2YEE A;  4R1F A;  5IN9 A;  4DUH A;  4U7N A;  3Q5L A;  3T10 A;  3G7E A;  5D6P A;  3CWV A;  1GJV A;  4MP7 A;  4URO A;  3FT5 A;  4KP4 A;  3ZKD A;  2YKC A;  1EI1 A;  4ASF A;  2VW5 A;  1UYL A;  4GEE A;  2BU8 A;  4L8Z A;  3TZ2 A;  2IOP A;  4FCP A;  4H85 A;  3A0X A;  2VCI A;  5CTX A;  2E0A A;  4KSG A;  4LWE A;  1AH6 A;  1S14 A;  1UYD A;  3IED A;  1B62 A;  2YGE A;  1H7S A;  4E00 A;  3R4P A;  3LNU A;  3D0B A;  3VHD A;  1TID A;  1L0O A;  5L3J A;  2HCH A;  2ZDY A;  5D6Q A;  2YE8 A;  4HY1 A;  4EM7 A;  2BU2 A;  1Y8N A;  4HY6 A;  1Z59 A;  3T0Z A;  4E02 A;  1Z5A A;  3R92 A;  4HXW A;  1UYG A;  1OSF A;  3GIG B;  2BT0 A;  4P8O A;  2YKI A;  3TZ5 A;  1UY7 A;  4WUB A;  3ZKB A;  2FWY A;  4FPP A;  3EHF A;  3T0H A;  3VAD A;  1ZXM A;  2WI2 A;  2ESA A;  1UYI A;  3INX A;  2IWU A;  4CWQ A;  1AMW A;  3TTZ A;  2JKI A;  1YT1 A;  1EA6 A;  4JAU A;  1TC6 A;  4LPB A;  2EXL A;  2GQP A;  3RLP A;  1B63 A;  3A0W A;  1I5A A;  2YI0 A;  3HYZ A;  3Q5K A;  2YE7 A;  2BYI A;  4KSH A;  4XTJ A;  2ZKJ A;  2H55 A;  3QDD A;  4BIU A;  2H8M A;  2YED A;  4CWR A;  4L91 A;  2XD6 A;  3G75 A;  1TC0 A;  3EHH A;  4EGH A;  2BRE A;  1TH8 A;  2BRC A;  1UYE A;  2XK2 A;  4BQJ A;  4BAE A;  2BU5 A;  3A0T A;  4QPJ A;  1QY8 A;  1AM1 A;  3BM9 A;  2BU6 A;  4AWP A;  4ZKI A;  5M4M A;  3HZ1 A;  2O1W A;  3HHU A;  2QG0 A;  2XDK A;  3EKR A;  4V25 A;  2Q8F A;  1AJ6 A;  1TIL A;  4BXI A;  2YJW A;  2WI7 A;  1UY8 A;  3LPS A;  4NH8 A;  2XHX A;  4XKO A;  4LWH A;  5M4N A;  1UYH A;  1A4H A;  4WUD A;  5FWK A;  2XHT A;  3ZXQ A;  5IDJ A;  4YKR A;  1UYK A;  2IWX A;  3PEJ A;  2YE5 A;  4YKW A;  4URN A;  4FCQ A;  4QPK A;  4WUC A;  2O1U A;  3VHC A;  4H81 A;  4E01 A;  1AH8 A;  2BYH A;  2WER A;  4PL9 A;  5C93 A;  2QF6 A;  1GKX A;  5J6A A;  3O0I A;  1YT0 A;  2YI5 A;  4JAS A;  4KTN A;  2VWC A;  2XHR A;  2XDX A;  2YK2 A;  3K99 A;  3CGZ A;  1MU5 A;  1BGQ A;  1I59 A;  1UY9 A;  3GIF A;  3OWB A;  1YS3 A;  3ZXO A;  1S16 A;  2XX5 A;  2Q8I A;  2YGA A;  1Y4U A;  2YI7 A;  4EGI A;  2BZ5 A;  5F3K A;  1I5D A;  4O04 A;  2YEJ A;  2XCM A;  4MPN A;  3C0E A;  1UYM A;  4URL A;  4EMV A;  2WEQ A;  3CGY A;  1US7 A;  2XJJ A;  4XIQ A;  4NH9 A;  4I3H A;  3R4O A;  4LWG A;  4GGL A;  2HG1 A;  2YI6 A;  4U7O A;  4EFU A;  2JJC A;  3K97 A;  1I5B A;  5M4H A;  2XX2 A;  2YE4 A;  4YKX A;  3RLR A;  5BOC A;  5CTY A;  2YKB A;  4LP0 A;  1UY6 A;  3TZ0 A;  4L94 A;  4XD8 A;  1ZW9 A;  3HYY A;  4PRV A;  2YKE A;  4YKY A;  1R62 A;  3OMU A;  4CWF A;  2XJG A;  4CWT A;  4Q20 A;  4XKK A;  4R3A A;  1BYQ A;  4PU9 A;  4CWS A;  3A0Y A;  5D7D A;  2O1V A;  5GGZ A;  3CRL A;  2IWS A;  4PRX A;  2YEB A;  4XC0 A;  4CWN A;  1THN A;  4L93 A;  5FNF A;  5CTW A;  1YC4 A;  2WEP A;  2BSM A;  2Q8G A;  3U67 A;  2VCJ A;  1Y8O A;  3INW A;  1YER A;  3KE6 A;  4URM A;  3WHA A;  2XDS A;  1NHJ A;  3B28 A;  4JQL A; 
#chains in the Genus database with same CATH topology
 4GQT A;  4K4O A;  3BMY A;  2FWZ A;  2FYP A;  5CPH A;  3CRK A;  3EKO A;  3HEK A;  4DZY A;  2YGF A;  3R91 A;  3JZ3 A;  4MOT A;  1KZN A;  2UWD A;  4HZ0 A;  1GKZ A;  5BOD A;  3OPD A;  1YC3 A;  4O05 A;  3MNR P;  2QG2 A;  4MBC A;  4NH7 A;  4E72 A;  3B26 A;  1BXD A;  2WI5 A;  5FND A;  4JAV A;  5FNC A;  3GIE A;  4L90 A;  2PNR A;  2YE3 A;  3D2R A;  4ZVI A;  3K98 A;  4CE3 A;  1U0Z A;  4YKT A;  2YEH A;  1Z5B A;  2HKJ A;  4XE2 A;  4HZ5 A;  1NHI A;  3LMM A;  4KQV A;  3H80 A;  4MPE A;  1QYE A;  3B25 A;  3ZM7 A;  4HYM A;  2Q2E B;  3H4L A;  4XCL A;  1ZXN A;  2XAB A;  4MB9 A;  1H7U A;  5M4K A;  4ASG A;  4CWP A;  2ZDX A;  4O07 A;  2CGF A;  3RLQ A;  1UYF A;  4CE1 A;  4O0B A;  2YEC A;  5IDM A;  2XDU A;  5CTU A;  2WI4 A;  4V26 A;  2WI6 A;  4YKU A;  1Y4S A;  4I5S A;  3EHJ A;  2CG9 A;  3O6O A;  4FCR A;  4X9L A;  2YE2 A;  4ASB A;  3WQ9 A;  3Q5J A;  2CCT A;  1YT2 A;  1Y8P A;  4KFG A;  1B3Q A;  4MP2 A;  5M4E A;  3C11 A;  2CH4 A;  2XDL A;  1MX0 A;  4XIT A;  1ZWH A;  2YE6 A;  1I58 A;  1YET A;  2CCS A;  3T1K A;  3EHG A;  4O09 A;  4GFN A;  3OW6 A;  3O2F A;  3TZ4 A;  2XJX A;  4CE2 A;  4YKZ A;  3DGE A;  3G7B A;  3OWD A;  1UYC A;  4GT8 A;  4AS9 A;  4W7T A;  2YJX A;  2IOR A;  1PVG A;  4EGK A;  3S5T A;  2YEF A;  4XKA A;  2AKP A;  2YE9 A;  4CWO A;  1BKN A;  3B24 A;  3GIG A;  1Z5C A;  4LWF A;  3HZ5 A;  4MPC A;  4U93 A;  4XCJ A;  5D7C A;  2YKJ A;  2FTK A;  3CYG A;  4B7P A;  2Q8H A;  1YSZ A;  2YEA A;  3A0Z A;  2WI3 A;  4AWO A;  4XIP A;  4BQG A;  4EEH A;  2YEI A;  4GCZ A;  4XDM A;  1TBW A;  3T2S A;  2WI1 A;  1U2O A;  2FXS A;  4XIR A;  3RKZ A;  1I5C A;  2BU7 A;  1JM6 A;  2ZBK B;  2XX4 A;  3FV5 A;  1YC1 A;  3U2K A;  2BTZ A;  5M4P A;  3R4M A;  4HYP A;  3VHA A;  4EFT A;  4B6C A;  2YK9 A;  2QFO A;  4ASA A;  3D36 A;  3FT8 A;  1NHH A;  2CCU A;  3PEH A;  5D7R A;  3B27 A;  4FMT A;  1YSR A;  3QTF A;  3SL2 A;  3A0R A;  4H7Q A;  5J71 A;  3K60 A;  4YKQ A;  4P7A A;  4BIZ A;  4AWQ A;  3U2D A;  1KIJ A;  2GFD A;  3NMQ A;  5CF0 A;  2C1G A;  2K5B A;  2IOQ A;  4LWI A;  2C2A A;  1QZR A;  2YEG A;  1YES A;  3R4N A;  1ID0 A;  3TUH A;  4HXZ A;  4R3M A;  5F5R A;  2YEE A;  4R1F A;  1IXM A;  5IN9 A;  4DUH A;  4U7N A;  3Q5L A;  3T10 A;  3G7E A;  5D6P A;  3CWV A;  1GJV A;  4MP7 A;  4URO A;  3FT5 A;  4KP4 A;  3ZKD A;  2YKC A;  1EI1 A;  4ASF A;  2VW5 A;  1UYL A;  4GEE A;  2BU8 A;  4L8Z A;  3TZ2 A;  2IOP A;  4FCP A;  4H85 A;  3A0X A;  2VCI A;  5CTX A;  2E0A A;  4KSG A;  4LWE A;  1AH6 A;  2C1I A;  1S14 A;  1UYD A;  3IED A;  1B62 A;  2YGE A;  1H7S A;  4E00 A;  3R4P A;  3LNU A;  3D0B A;  3VHD A;  1TID A;  1L0O A;  5L3J A;  2HCH A;  2ZDY A;  5D6Q A;  2YE8 A;  4HY1 A;  4EM7 A;  2BU2 A;  1Y8N A;  4HY6 A;  1Z59 A;  3T0Z A;  4E02 A;  1Z5A A;  3R92 A;  4HXW A;  1UYG A;  1OSF A;  3GIG B;  2BT0 A;  4P8O A;  2YKI A;  3TZ5 A;  1UY7 A;  4WUB A;  3ZKB A;  2FWY A;  4FPP A;  3EHF A;  3T0H A;  3VAD A;  1ZXM A;  2WI2 A;  2ESA A;  1UYI A;  3INX A;  2IWU A;  4CWQ A;  1AMW A;  3TTZ A;  2JKI A;  1YT1 A;  1EA6 A;  4JAU A;  1TC6 A;  4LPB A;  2EXL A;  2GQP A;  3RLP A;  1B63 A;  3A0W A;  1I5A A;  2YI0 A;  3HYZ A;  3Q5K A;  2YE7 A;  2BYI A;  4KSH A;  4XTJ A;  2ZKJ A;  2H55 A;  3QDD A;  4BIU A;  2H8M A;  2YED A;  4CWR A;  4L91 A;  2XD6 A;  3G75 A;  1TC0 A;  3EHH A;  4EGH A;  2BRE A;  1TH8 A;  2BRC A;  1UYE A;  2XK2 A;  4BQJ A;  4BAE A;  2BU5 A;  3A0T A;  4QPJ A;  1QY8 A;  1AM1 A;  3BM9 A;  2BU6 A;  4AWP A;  4ZKI A;  5M4M A;  3HZ1 A;  2O1W A;  3HHU A;  2QG0 A;  2XDK A;  3EKR A;  4V25 A;  2Q8F A;  1AJ6 A;  1TIL A;  4BXI A;  2YJW A;  2WI7 A;  1UY8 A;  3LPS A;  4NH8 A;  2XHX A;  4XKO A;  4LWH A;  5M4N A;  1UYH A;  1A4H A;  4WUD A;  5FWK A;  2XHT A;  3ZXQ A;  5IDJ A;  4YKR A;  1UYK A;  2IWX A;  3PEJ A;  2YE5 A;  4YKW A;  4URN A;  4FCQ A;  4QPK A;  4WUC A;  2O1U A;  5JEN A;  3VHC A;  4H81 A;  4E01 A;  1AH8 A;  2BYH A;  2WER A;  4PL9 A;  5C93 A;  2QF6 A;  1GKX A;  5J6A A;  3O0I A;  1YT0 A;  2YI5 A;  4JAS A;  4KTN A;  2VWC A;  2XHR A;  2XDX A;  2YK2 A;  3K99 A;  3CGZ A;  1MU5 A;  1BGQ A;  1I59 A;  1UY9 A;  3GIF A;  3OWB A;  1YS3 A;  3ZXO A;  1S16 A;  2XX5 A;  2Q8I A;  2YGA A;  1Y4U A;  2YI7 A;  4EGI A;  2BZ5 A;  5F3K A;  1I5D A;  4O04 A;  2YEJ A;  2XCM A;  4MPN A;  3C0E A;  1UYM A;  4URL A;  4EMV A;  2WEQ A;  3CGY A;  1US7 A;  2XJJ A;  4XIQ A;  4NH9 A;  4I3H A;  3R4O A;  4LWG A;  4GGL A;  2HG1 A;  2YI6 A;  4U7O A;  4EFU A;  2JJC A;  3K97 A;  1I5B A;  5M4H A;  2XX2 A;  2YE4 A;  4YKX A;  3RLR A;  5BOC A;  5CTY A;  2YKB A;  4LP0 A;  1UY6 A;  3TZ0 A;  4L94 A;  4XD8 A;  1ZW9 A;  3HYY A;  4PRV A;  2YKE A;  4YKY A;  1R62 A;  3OMU A;  4CWF A;  2XJG A;  4CWT A;  4Q20 A;  4XKK A;  4R3A A;  1BYQ A;  4PU9 A;  4CWS A;  3A0Y A;  1F51 A;  2O1V A;  5D7D A;  3CRL A;  5GGZ A;  2IWS A;  4PRX A;  2YEB A;  2HHI A;  4XC0 A;  4CWN A;  1THN A;  4L93 A;  5FNF A;  5CTW A;  1YC4 A;  2WEP A;  2BSM A;  2Q8G A;  3U67 A;  2VCJ A;  1Y8O A;  3INW A;  1YER A;  3KE6 A;  4URM A;  3WHA A;  2XDS A;  1NHJ A;  3B28 A;  4JQL A; 
#chains in the Genus database with same CATH homology
 4GQT A;  4K4O A;  3BMY A;  2FWZ A;  2FYP A;  5CPH A;  3CRK A;  3EKO A;  3HEK A;  4DZY A;  2YGF A;  3R91 A;  3JZ3 A;  4MOT A;  1KZN A;  2UWD A;  4HZ0 A;  1GKZ A;  5BOD A;  3OPD A;  1YC3 A;  4O05 A;  3MNR P;  2QG2 A;  4MBC A;  4NH7 A;  3B26 A;  1BXD A;  2WI5 A;  5FND A;  4JAV A;  5FNC A;  3GIE A;  4L90 A;  2PNR A;  2YE3 A;  3D2R A;  4ZVI A;  3K98 A;  4CE3 A;  1U0Z A;  4YKT A;  2YEH A;  1Z5B A;  2HKJ A;  4XE2 A;  4HZ5 A;  1NHI A;  4KQV A;  3H80 A;  4MPE A;  1QYE A;  3B25 A;  3ZM7 A;  4HYM A;  2Q2E B;  3H4L A;  4XCL A;  1ZXN A;  2XAB A;  4MB9 A;  1H7U A;  5M4K A;  4ASG A;  4CWP A;  2ZDX A;  4O07 A;  2CGF A;  3RLQ A;  1UYF A;  4CE1 A;  4O0B A;  2YEC A;  5IDM A;  2XDU A;  5CTU A;  2WI4 A;  4V26 A;  2WI6 A;  4YKU A;  1Y4S A;  4I5S A;  3EHJ A;  2CG9 A;  3O6O A;  4FCR A;  4X9L A;  2YE2 A;  4ASB A;  3WQ9 A;  3Q5J A;  2CCT A;  1YT2 A;  1Y8P A;  4KFG A;  1B3Q A;  4MP2 A;  5M4E A;  3C11 A;  2CH4 A;  2XDL A;  1MX0 A;  4XIT A;  1ZWH A;  2YE6 A;  1I58 A;  1YET A;  2CCS A;  3T1K A;  3EHG A;  4O09 A;  4GFN A;  3OW6 A;  3O2F A;  3TZ4 A;  2XJX A;  4CE2 A;  4YKZ A;  3DGE A;  3G7B A;  3OWD A;  1UYC A;  4GT8 A;  4AS9 A;  4W7T A;  2YJX A;  2IOR A;  1PVG A;  4EGK A;  2YEF A;  4XKA A;  2AKP A;  2YE9 A;  4CWO A;  1BKN A;  3B24 A;  3GIG A;  1Z5C A;  4LWF A;  3HZ5 A;  4MPC A;  4U93 A;  4XCJ A;  5D7C A;  2YKJ A;  4B7P A;  2Q8H A;  1YSZ A;  2YEA A;  3A0Z A;  2WI3 A;  4AWO A;  4XIP A;  4BQG A;  4EEH A;  2YEI A;  4GCZ A;  4XDM A;  1TBW A;  3T2S A;  2WI1 A;  1U2O A;  2FXS A;  4XIR A;  3RKZ A;  1I5C A;  2BU7 A;  1JM6 A;  2ZBK B;  2XX4 A;  3FV5 A;  1YC1 A;  3U2K A;  2BTZ A;  5M4P A;  3R4M A;  4HYP A;  3VHA A;  4EFT A;  4B6C A;  2YK9 A;  2QFO A;  4ASA A;  3D36 A;  3FT8 A;  1NHH A;  2CCU A;  3PEH A;  5D7R A;  3B27 A;  4FMT A;  1YSR A;  3QTF A;  3SL2 A;  3A0R A;  4H7Q A;  5J71 A;  3K60 A;  4YKQ A;  4P7A A;  4BIZ A;  4AWQ A;  3U2D A;  1KIJ A;  2GFD A;  3NMQ A;  5CF0 A;  2K5B A;  2IOQ A;  4LWI A;  2C2A A;  1QZR A;  2YEG A;  1YES A;  3R4N A;  1ID0 A;  3TUH A;  4HXZ A;  4R3M A;  5F5R A;  2YEE A;  4R1F A;  5IN9 A;  4DUH A;  4U7N A;  3Q5L A;  3T10 A;  3G7E A;  5D6P A;  3CWV A;  1GJV A;  4MP7 A;  4URO A;  3FT5 A;  4KP4 A;  3ZKD A;  2YKC A;  1EI1 A;  4ASF A;  2VW5 A;  1UYL A;  4GEE A;  2BU8 A;  4L8Z A;  3TZ2 A;  2IOP A;  4FCP A;  4H85 A;  3A0X A;  2VCI A;  5CTX A;  2E0A A;  4KSG A;  4LWE A;  1AH6 A;  1S14 A;  1UYD A;  3IED A;  1B62 A;  2YGE A;  1H7S A;  4E00 A;  3R4P A;  3LNU A;  3D0B A;  3VHD A;  1TID A;  1L0O A;  5L3J A;  2HCH A;  2ZDY A;  5D6Q A;  2YE8 A;  4HY1 A;  4EM7 A;  2BU2 A;  1Y8N A;  4HY6 A;  1Z59 A;  3T0Z A;  4E02 A;  1Z5A A;  3R92 A;  4HXW A;  1UYG A;  1OSF A;  3GIG B;  2BT0 A;  4P8O A;  2YKI A;  3TZ5 A;  1UY7 A;  4WUB A;  3ZKB A;  2FWY A;  4FPP A;  3EHF A;  3T0H A;  3VAD A;  1ZXM A;  2WI2 A;  2ESA A;  1UYI A;  3INX A;  2IWU A;  4CWQ A;  1AMW A;  3TTZ A;  2JKI A;  1YT1 A;  1EA6 A;  4JAU A;  1TC6 A;  4LPB A;  2EXL A;  2GQP A;  3RLP A;  1B63 A;  3A0W A;  1I5A A;  2YI0 A;  3HYZ A;  3Q5K A;  2YE7 A;  2BYI A;  4KSH A;  4XTJ A;  2ZKJ A;  2H55 A;  3QDD A;  4BIU A;  2H8M A;  2YED A;  4CWR A;  4L91 A;  2XD6 A;  3G75 A;  1TC0 A;  3EHH A;  4EGH A;  2BRE A;  1TH8 A;  2BRC A;  1UYE A;  2XK2 A;  4BQJ A;  4BAE A;  2BU5 A;  3A0T A;  4QPJ A;  1QY8 A;  1AM1 A;  3BM9 A;  2BU6 A;  4AWP A;  4ZKI A;  5M4M A;  3HZ1 A;  2O1W A;  3HHU A;  2QG0 A;  2XDK A;  3EKR A;  4V25 A;  2Q8F A;  1AJ6 A;  1TIL A;  4BXI A;  2YJW A;  2WI7 A;  1UY8 A;  3LPS A;  4NH8 A;  2XHX A;  4XKO A;  4LWH A;  5M4N A;  1UYH A;  1A4H A;  4WUD A;  5FWK A;  2XHT A;  3ZXQ A;  5IDJ A;  4YKR A;  1UYK A;  2IWX A;  3PEJ A;  2YE5 A;  4YKW A;  4URN A;  4FCQ A;  4QPK A;  4WUC A;  2O1U A;  3VHC A;  4H81 A;  4E01 A;  1AH8 A;  2BYH A;  2WER A;  4PL9 A;  5C93 A;  2QF6 A;  1GKX A;  5J6A A;  3O0I A;  1YT0 A;  2YI5 A;  4JAS A;  4KTN A;  2VWC A;  2XHR A;  2XDX A;  2YK2 A;  3K99 A;  3CGZ A;  1MU5 A;  1BGQ A;  1I59 A;  1UY9 A;  3GIF A;  3OWB A;  1YS3 A;  3ZXO A;  1S16 A;  2XX5 A;  2Q8I A;  2YGA A;  1Y4U A;  2YI7 A;  4EGI A;  2BZ5 A;  5F3K A;  1I5D A;  4O04 A;  2YEJ A;  2XCM A;  4MPN A;  3C0E A;  1UYM A;  4URL A;  4EMV A;  2WEQ A;  3CGY A;  1US7 A;  2XJJ A;  4XIQ A;  4NH9 A;  4I3H A;  3R4O A;  4LWG A;  4GGL A;  2HG1 A;  2YI6 A;  4U7O A;  4EFU A;  2JJC A;  3K97 A;  1I5B A;  5M4H A;  2XX2 A;  2YE4 A;  4YKX A;  3RLR A;  5BOC A;  5CTY A;  2YKB A;  4LP0 A;  1UY6 A;  3TZ0 A;  4L94 A;  4XD8 A;  1ZW9 A;  3HYY A;  4PRV A;  2YKE A;  4YKY A;  1R62 A;  3OMU A;  4CWF A;  2XJG A;  4CWT A;  4Q20 A;  4XKK A;  4R3A A;  1BYQ A;  4PU9 A;  4CWS A;  3A0Y A;  5D7D A;  2O1V A;  5GGZ A;  3CRL A;  2IWS A;  4PRX A;  2YEB A;  4XC0 A;  4CWN A;  1THN A;  4L93 A;  5FNF A;  5CTW A;  1YC4 A;  2WEP A;  2BSM A;  2Q8G A;  3U67 A;  2VCJ A;  1Y8O A;  3INW A;  1YER A;  3KE6 A;  4URM A;  3WHA A;  2XDS A;  1NHJ A;  3B28 A;  4JQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...