1I5BA

Structure of chea domain p4 in complex with adpnp and manganese
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
180
Chain Sequence
GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein, transferase
molecule keywords CHEMOTAXIS PROTEIN CHEA
total genus 56
structure length 180
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i5bA00
4XCJA 3Q5LA 1UY7A 1I5AA 1YC3A 4UROA 3R4PA 2VWCA 5FNFA 4BIZA 4GFNA 2EXLA 2WI1A 4WUDA 3SL2A 1EI1A 2IWSA 1Z5CA 3VHCA 2YKBA 1BKNA 2CCTA 2XCMA 3LNUA 1B62A 3QDDA 3R4MA 3D36A 1THNA 1YERA 2H55A 1NHJA 4HZ0A 5IDJA 2BYIA 4BXIA 4E00A 4CE1A 5BODA 1BGQA 1I5DA 4YKRA 2YI5A 1JM6A 3EHHA 1ID0A 4FCRA 2FYPA 2Q8FA 3TTZA 1S14A 4L93A 2BU8A 1UY6A 1Y8PA 3JZ3A 3D0BA 4FMTA 4MPEA 5IN9A 4HXWA 2CH4A 4FCPA 2YEGA 1MX0A 5J6AA 3EKOA 3T10A 4EGIA 2O1VA 4WUBA 1S16A 2XHRA 3LPSA 3TZ4A 2YEAA 2BYHA 3Q5KA 1Y4SA 3RKZA 2HKJA 4XKKA 2Q8GA 4CE3A 4XE2A 3T0ZA 3RLPA 4JAVA 1TH8A 4XIRA 5CTWA 3GIFA 4EFUA 4CWOA 2GFDA 4MP7A 2BREA 1L0OA 3IEDA 1OSFA 1YC4A 4P7AA 1AM1A 2H8MA 3O6OA 3ZKBA 4YKXA 4R3AA 3T1KA 3QTFA 3A0WA 2FWZA 3C0EA 4HXZA 4LPBA 3RLQA 4YKUA 1A4HA 4GEEA 4I5SA 1Y4UA 3OWDA 4LWGA 5M4HA 5J71A 5F5RA 1Z5AA 4XIPA 4E01A 3R4NA 2YKCA 4W7TA 4KFGA 4LP0A 2BU6A 2GQPA 3K60A 1TBWA 3HYZA 1YT1A 3FV5A 4LWHA 2FXSA 4XKAA 5D7DA 2FWYA 3HEKA 3INXA 4EGKA 3R91A 2BSMA 4MOTA 2YE9A 2BU2A 3DGEA 4QPKA 1YT2A 5FWKA 2BU5A 2AKPA 1US7A 4YKWA 2YKJA 1I58A 2YGFA 4CE2A 3ZM7A 4KSGA 1H7UA 2YGAA 5FNDA 1U0ZA 5CTXA 1H7SA 2XDKA 2BZ5A 4AWQA 3TZ5A 4Q20A 1YT0A 4L91A 3NMQA 4PRVA 4V25A 4HY1A 4CWTA 4L8ZA 3TZ0A 1AMWA 1UYKA 1Y8NA 1YSRA 4B7PA 4KQVA 4URMA 3T2SA 4P8OA 3KE6A 4XTJA 2XX4A 3FT5A 1TC0A 5CTYA 5M4KA 1UY9A 2XJGA 4E02A 2QF6A 1ZWHA 4HYPA 4JAUA 2WEPA 2C2AA 2YEIA 4DUHA 4O05A 3ZKDA 4CWRA 2O1WA 1U2OA 3CRLA 4KTNA 5D6QA 1YS3A 2ZKJA 4FPPA 3H80A 2VW5A 3B24A 4XD8A 4MBCA 1QY8A 5GGZA 2ESAA 3RLRA 3U67A 1KIJA 4L90A 4YKYA 4XDMA 1UYGA 4NH7A 1UYEA 3PEHA 3Q5JA 2XX5A 4JQLA 2XDUA 5CPHA 4ASFA 4B6CA 1UY8A 4MPCA 2YKIA 2ZDYA 3VADA 3A0XA 5F3KA 2CG9A 5D6PA 1B3QA 3B26A 4CWSA 2YEHA 3BMYA 3CRKA 2XHTA 3WQ9A 2YI0A 2IORA 4V26A 1YC1A 3U2DA 3ZXQA 2WI5A 2WI3A 1UYCA 2YE3A 4AWPA 4XC0A 1YESA 4EEHA 4O04A 4U7NA 5D7RA 2ZBKB 3A0ZA 4NH8A 1QZRA 3R4OA 2E0AA 2YGEA 3BM9A 3EHGA 4PL9A 5M4NA 2YEFA 1PVGA 2JJCA 4O0BA 4GCZA 4CWPA 1ZXNA 2JKIA 4O09A 4XCLA 2Q8IA 1Z5BA 1I5CA 2CCSA 2Q2EB 5CTUA 3INWA 1ZXMA 3A0RA 2YJXA 2YE6A 4CWNA 3EKRA 2WI4A 2YE8A 4EFTA 2PNRA 3GIGB 2WI6A 4HZ5A 2K5BA 4MP2A 1BYQA 4QPJA 2YE7A 4ASAA 3O2FA 2YECA 1KZNA 3C11A 4PRXA 2YEEA 4BIUA 3HZ1A 3B25A 3G7EA 4PU9A 2XX2A 3GIEA 1Z59A 2QG2A 5L3JA 2BRCA 1GJVA 3K97A 3OWBA 3VHAA 2XHXA 1BXDA 3EHJA 4NH9A 2XDLA 4ASGA 4BQJA 4R1FA 2XDSA 2XJXA 2YJWA 2CGFA 3CGZA 3R92A 1QYEA 4K4OA 4KSHA 4X9LA 2Q8HA 2O1UA 4BAEA 2YEBA 4YKTA 2IWUA 4LWFA 1GKXA 4U93A 1AJ6A 4XIQA 2BTZA 4LWEA 4MPNA 5M4PA 4HYMA 2YEJA 1UYMA 2IWXA 1NHHA 3T0HA 3H4LA 3A0TA 3EHFA 4HY6A 2HCHA 3U2KA 1TC6A 3B27A 4R3MA 3PEJA 3TZ2A 1R62A 3O0IA 2YK2A 2WI7A 4YKQA 2QG0A 1UYIA 2YE4A 3OW6A 4U7OA 4MB9A 3OPDA 4EMVA 5FNCA 1ZW9A 3WHAA 3G75A 3VHDA 5M4EA 2XD6A 2YK9A 4BQGA 1EA6A 5D7CA 2YE2A 3TUHA 3G7BA 2XABA 3ZXOA 4JASA 1Y8OA 2WI2A 2XDXA 2WEQA 4GQTA 4XKOA 4AS9A 4GGLA 2YKEA 1AH8A 1UYHA 2YI6A 3CGYA 3GIGA 2XJJA 2BT0A 2VCIA 4URLA 3K99A 3CWVA 4DZYA 5IDMA 4EM7A 2XK2A 4L94A 1UYDA 5M4MA 2CCUA 2BU7A 2UWDA 4YKZA 2VCJA 2YI7A 1YSZA 2QFOA 3A0YA 1UYLA 4CWQA 5C93A 3MNRP 1MU5A 1TILA 4CWFA 1I59A 3D2RA 4H7QA 3HZ5A 3B28A 4WUCA 4FCQA 2HG1A 4ASBA 5BOCA 1NHIA 4H81A 1B63A 1YETA 3FT8A 3OMUA 5CF0A 4AWOA 3HHUA 2IOPA 2IOQA 2ZDXA 4GT8A 1GKZA 4LWIA 4ZKIA 3K98A 4KP4A 1AH6A 4ZVIA 2YEDA 4I3HA 3HYYA 2WERA 4H85A 1TIDA 4O07A 1I5BA 4EGHA 2YE5A 4URNA 4XITA 1UYFA
chains in the Genus database with same CATH superfamily
4XCJA 3Q5LA 1UY7A 2C1GA 1I5AA 1YC3A 4UROA 3R4PA 2VWCA 5FNFA 4BIZA 4GFNA 2EXLA 2WI1A 4WUDA 3SL2A 1EI1A 2IWSA 1Z5CA 3VHCA 2YKBA 1BKNA 2CCTA 2XCMA 3LNUA 1B62A 3QDDA 3R4MA 3D36A 1THNA 1YERA 2H55A 1NHJA 4HZ0A 5IDJA 2BYIA 4BXIA 4E00A 4CE1A 5BODA 1BGQA 1I5DA 4YKRA 2YI5A 1JM6A 3EHHA 1ID0A 4FCRA 2FYPA 2Q8FA 3TTZA 1S14A 4L93A 2BU8A 1UY6A 1Y8PA 3JZ3A 3D0BA 4FMTA 4MPEA 5IN9A 4HXWA 2CH4A 4FCPA 2YEGA 1MX0A 5J6AA 3EKOA 3T10A 4EGIA 2O1VA 4WUBA 1S16A 2XHRA 3LPSA 3TZ4A 2YEAA 2BYHA 3Q5KA 1Y4SA 3RKZA 2HKJA 4XKKA 2Q8GA 4CE3A 4XE2A 3T0ZA 3RLPA 4JAVA 1TH8A 4XIRA 5CTWA 3GIFA 4EFUA 4CWOA 2GFDA 4MP7A 2BREA 1L0OA 3IEDA 1OSFA 1YC4A 4P7AA 1AM1A 2H8MA 3LMMA 3O6OA 3ZKBA 4YKXA 4R3AA 3T1KA 3QTFA 3A0WA 2FWZA 3C0EA 4HXZA 4LPBA 3RLQA 4YKUA 1A4HA 4GEEA 4I5SA 1Y4UA 3CYGA 3OWDA 4LWGA 5M4HA 5J71A 5F5RA 1Z5AA 4XIPA 4E01A 3R4NA 2YKCA 4W7TA 4KFGA 4LP0A 2BU6A 2GQPA 1IXMA 3K60A 1TBWA 3HYZA 1YT1A 3FV5A 4LWHA 2FXSA 4XKAA 5D7DA 2FWYA 3HEKA 3INXA 4EGKA 3R91A 2BSMA 4MOTA 2YE9A 2BU2A 3DGEA 4QPKA 1YT2A 5FWKA 2BU5A 2AKPA 1US7A 4YKWA 2YKJA 1I58A 2YGFA 4CE2A 3ZM7A 4KSGA 1H7UA 2YGAA 5FNDA 1U0ZA 2C1IA 5CTXA 1H7SA 2XDKA 2BZ5A 4AWQA 3TZ5A 4Q20A 1YT0A 4L91A 3NMQA 4PRVA 4V25A 4HY1A 4CWTA 4L8ZA 3TZ0A 1AMWA 1UYKA 1Y8NA 1YSRA 4B7PA 4KQVA 4URMA 3T2SA 4P8OA 3KE6A 2HHIA 4XTJA 2XX4A 3FT5A 1TC0A 5CTYA 5M4KA 1UY9A 2XJGA 4E02A 2QF6A 1ZWHA 4HYPA 4JAUA 2WEPA 2C2AA 2YEIA 4DUHA 4O05A 3ZKDA 4CWRA 2O1WA 1U2OA 3CRLA 4KTNA 5D6QA 1YS3A 2ZKJA 4FPPA 3H80A 2VW5A 3B24A 4XD8A 4MBCA 1QY8A 5GGZA 2ESAA 3RLRA 3U67A 1KIJA 4L90A 4YKYA 4XDMA 1UYGA 4NH7A 1UYEA 3PEHA 3Q5JA 2XX5A 4JQLA 2XDUA 5CPHA 4ASFA 4B6CA 1UY8A 4MPCA 2YKIA 2ZDYA 3VADA 3A0XA 5F3KA 2CG9A 5D6PA 1B3QA 3B26A 4CWSA 2YEHA 3BMYA 3CRKA 2XHTA 3WQ9A 4E72A 2YI0A 2IORA 4V26A 1YC1A 3U2DA 3ZXQA 2WI5A 2WI3A 1UYCA 2YE3A 4AWPA 4XC0A 1YESA 4EEHA 4O04A 4U7NA 5D7RA 2ZBKB 3A0ZA 4NH8A 1QZRA 3R4OA 2E0AA 2YGEA 3BM9A 3EHGA 4PL9A 5M4NA 2YEFA 1PVGA 2JJCA 4O0BA 4GCZA 4CWPA 1ZXNA 2JKIA 4O09A 4XCLA 2Q8IA 1Z5BA 1I5CA 2CCSA 2Q2EB 5CTUA 3INWA 1ZXMA 3A0RA 2YJXA 2YE6A 4CWNA 3EKRA 2WI4A 2YE8A 4EFTA 2PNRA 3GIGB 2WI6A 4HZ5A 2K5BA 4MP2A 1BYQA 4QPJA 2YE7A 4ASAA 3O2FA 2YECA 1KZNA 3C11A 4PRXA 2YEEA 4BIUA 3HZ1A 3B25A 3G7EA 4PU9A 2XX2A 3GIEA 1Z59A 2QG2A 5L3JA 2BRCA 1GJVA 3K97A 3OWBA 3VHAA 2XHXA 1BXDA 3EHJA 4NH9A 2XDLA 4ASGA 4BQJA 4R1FA 2XDSA 2XJXA 2YJWA 2CGFA 3CGZA 3R92A 1QYEA 4K4OA 4KSHA 4X9LA 2Q8HA 2O1UA 4BAEA 2YEBA 4YKTA 2IWUA 4LWFA 1GKXA 4U93A 1AJ6A 4XIQA 2BTZA 4LWEA 4MPNA 5M4PA 4HYMA 2YEJA 1UYMA 2IWXA 1NHHA 3T0HA 3H4LA 3A0TA 3EHFA 1F51A 4HY6A 2HCHA 3U2KA 1TC6A 3B27A 4R3MA 3PEJA 3TZ2A 1R62A 3O0IA 2YK2A 2WI7A 4YKQA 2QG0A 1UYIA 2YE4A 3OW6A 4U7OA 4MB9A 3OPDA 4EMVA 5FNCA 1ZW9A 3WHAA 3G75A 3VHDA 5JENA 5M4EA 2XD6A 2YK9A 4BQGA 1EA6A 5D7CA 2YE2A 3TUHA 3G7BA 2XABA 3ZXOA 4JASA 1Y8OA 2WI2A 2XDXA 2WEQA 4GQTA 4XKOA 4AS9A 4GGLA 2YKEA 1AH8A 1UYHA 2YI6A 3CGYA 3GIGA 2XJJA 2BT0A 2VCIA 4URLA 3K99A 3CWVA 4DZYA 5IDMA 4EM7A 2XK2A 4L94A 1UYDA 5M4MA 2CCUA 2BU7A 2UWDA 4YKZA 2VCJA 2YI7A 1YSZA 2QFOA 3A0YA 1UYLA 4CWQA 5C93A 2FTKA 3MNRP 1MU5A 1TILA 4CWFA 1I59A 3D2RA 4H7QA 3HZ5A 3B28A 4WUCA 4FCQA 2HG1A 4ASBA 5BOCA 1NHIA 4H81A 1B63A 1YETA 3FT8A 3OMUA 5CF0A 4AWOA 3HHUA 2IOPA 2IOQA 2ZDXA 4GT8A 1GKZA 4LWIA 3S5TA 4ZKIA 3K98A 4KP4A 1AH6A 4ZVIA 2YEDA 4I3HA 3HYYA 2WERA 4H85A 1TIDA 4O07A 1I5BA 4EGHA 2YE5A 4URNA 4XITA 1UYFA
chains in the Genus database with same CATH topology
4XCJA 3Q5LA 1UY7A 1I5AA 1YC3A 4UROA 3R4PA 2VWCA 5FNFA 4BIZA 4GFNA 2EXLA 2WI1A 4WUDA 3SL2A 1EI1A 2IWSA 1Z5CA 3VHCA 2YKBA 1BKNA 2CCTA 2XCMA 3LNUA 1B62A 3QDDA 3R4MA 3D36A 1THNA 1YERA 2H55A 1NHJA 4HZ0A 5IDJA 2BYIA 4BXIA 4E00A 4CE1A 5BODA 1BGQA 1I5DA 4YKRA 2YI5A 1JM6A 3EHHA 1ID0A 4FCRA 2FYPA 2Q8FA 3TTZA 1S14A 4L93A 2BU8A 1UY6A 1Y8PA 3JZ3A 3D0BA 4FMTA 4MPEA 5IN9A 4HXWA 2CH4A 4FCPA 2YEGA 1MX0A 5J6AA 3EKOA 3T10A 4EGIA 2O1VA 4WUBA 1S16A 2XHRA 3LPSA 3TZ4A 2YEAA 2BYHA 3Q5KA 1Y4SA 3RKZA 2HKJA 4XKKA 2Q8GA 4CE3A 4XE2A 3T0ZA 3RLPA 4JAVA 1TH8A 4XIRA 5CTWA 3GIFA 4EFUA 4CWOA 2GFDA 4MP7A 2BREA 1L0OA 3IEDA 1OSFA 1YC4A 4P7AA 1AM1A 2H8MA 3O6OA 3ZKBA 4YKXA 4R3AA 3T1KA 3QTFA 3A0WA 2FWZA 3C0EA 4HXZA 4LPBA 3RLQA 4YKUA 1A4HA 4GEEA 4I5SA 1Y4UA 3OWDA 4LWGA 5M4HA 5J71A 5F5RA 1Z5AA 4XIPA 4E01A 3R4NA 2YKCA 4W7TA 4KFGA 4LP0A 2BU6A 2GQPA 3K60A 1TBWA 3HYZA 1YT1A 3FV5A 4LWHA 2FXSA 4XKAA 5D7DA 2FWYA 3HEKA 3INXA 4EGKA 3R91A 2BSMA 4MOTA 2YE9A 2BU2A 3DGEA 4QPKA 1YT2A 5FWKA 2BU5A 2AKPA 1US7A 4YKWA 2YKJA 1I58A 2YGFA 4CE2A 3ZM7A 4KSGA 1H7UA 2YGAA 5FNDA 1U0ZA 5CTXA 1H7SA 2XDKA 2BZ5A 4AWQA 3TZ5A 4Q20A 1YT0A 4L91A 3NMQA 4PRVA 4V25A 4HY1A 4CWTA 4L8ZA 3TZ0A 1AMWA 1UYKA 1Y8NA 1YSRA 4B7PA 4KQVA 4URMA 3T2SA 4P8OA 3KE6A 4XTJA 2XX4A 3FT5A 1TC0A 5CTYA 5M4KA 1UY9A 2XJGA 4E02A 2QF6A 1ZWHA 4HYPA 4JAUA 2WEPA 2C2AA 2YEIA 4DUHA 4O05A 3ZKDA 4CWRA 2O1WA 1U2OA 3CRLA 4KTNA 5D6QA 1YS3A 2ZKJA 4FPPA 3H80A 2VW5A 3B24A 4XD8A 4MBCA 1QY8A 5GGZA 2ESAA 3RLRA 3U67A 1KIJA 4L90A 4YKYA 4XDMA 1UYGA 4NH7A 1UYEA 3PEHA 3Q5JA 2XX5A 4JQLA 2XDUA 5CPHA 4ASFA 4B6CA 1UY8A 4MPCA 2YKIA 2ZDYA 3VADA 3A0XA 5F3KA 2CG9A 5D6PA 1B3QA 3B26A 4CWSA 2YEHA 3BMYA 3CRKA 2XHTA 3WQ9A 2YI0A 2IORA 4V26A 1YC1A 3U2DA 3ZXQA 2WI5A 2WI3A 1UYCA 2YE3A 4AWPA 4XC0A 1YESA 4EEHA 4O04A 4U7NA 5D7RA 2ZBKB 3A0ZA 4NH8A 1QZRA 3R4OA 2E0AA 2YGEA 3BM9A 3EHGA 4PL9A 5M4NA 2YEFA 1PVGA 2JJCA 4O0BA 4GCZA 4CWPA 1ZXNA 2JKIA 4O09A 4XCLA 2Q8IA 1Z5BA 1I5CA 2CCSA 2Q2EB 5CTUA 3INWA 1ZXMA 3A0RA 2YJXA 2YE6A 4CWNA 3EKRA 2WI4A 2YE8A 4EFTA 2PNRA 3GIGB 2WI6A 4HZ5A 2K5BA 4MP2A 1BYQA 4QPJA 2YE7A 4ASAA 3O2FA 2YECA 1KZNA 3C11A 4PRXA 2YEEA 4BIUA 3HZ1A 3B25A 3G7EA 4PU9A 2XX2A 3GIEA 1Z59A 2QG2A 5L3JA 2BRCA 1GJVA 3K97A 3OWBA 3VHAA 2XHXA 1BXDA 3EHJA 4NH9A 2XDLA 4ASGA 4BQJA 4R1FA 2XDSA 2XJXA 2YJWA 2CGFA 3CGZA 3R92A 1QYEA 4K4OA 4KSHA 4X9LA 2Q8HA 2O1UA 4BAEA 2YEBA 4YKTA 2IWUA 4LWFA 1GKXA 4U93A 1AJ6A 4XIQA 2BTZA 4LWEA 4MPNA 5M4PA 4HYMA 2YEJA 1UYMA 2IWXA 1NHHA 3T0HA 3H4LA 3A0TA 3EHFA 4HY6A 2HCHA 3U2KA 1TC6A 3B27A 4R3MA 3PEJA 3TZ2A 1R62A 3O0IA 2YK2A 2WI7A 4YKQA 2QG0A 1UYIA 2YE4A 3OW6A 4U7OA 4MB9A 3OPDA 4EMVA 5FNCA 1ZW9A 3WHAA 3G75A 3VHDA 5M4EA 2XD6A 2YK9A 4BQGA 1EA6A 5D7CA 2YE2A 3TUHA 3G7BA 2XABA 3ZXOA 4JASA 1Y8OA 2WI2A 2XDXA 2WEQA 4GQTA 4XKOA 4AS9A 4GGLA 2YKEA 1AH8A 1UYHA 2YI6A 3CGYA 3GIGA 2XJJA 2BT0A 2VCIA 4URLA 3K99A 3CWVA 4DZYA 5IDMA 4EM7A 2XK2A 4L94A 1UYDA 5M4MA 2CCUA 2BU7A 2UWDA 4YKZA 2VCJA 2YI7A 1YSZA 2QFOA 3A0YA 1UYLA 4CWQA 5C93A 3MNRP 1MU5A 1TILA 4CWFA 1I59A 3D2RA 4H7QA 3HZ5A 3B28A 4WUCA 4FCQA 2HG1A 4ASBA 5BOCA 1NHIA 4H81A 1B63A 1YETA 3FT8A 3OMUA 5CF0A 4AWOA 3HHUA 2IOPA 2IOQA 2ZDXA 4GT8A 1GKZA 4LWIA 4ZKIA 3K98A 4KP4A 1AH6A 4ZVIA 2YEDA 4I3HA 3HYYA 2WERA 4H85A 1TIDA 4O07A 1I5BA 4EGHA 2YE5A 4URNA 4XITA 1UYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XCJ A;  3Q5L A;  1UY7 A;  1I5A A;  1YC3 A;  4URO A;  3R4P A;  2VWC A;  5FNF A;  4BIZ A;  4GFN A;  2EXL A;  2WI1 A;  4WUD A;  3SL2 A;  1EI1 A;  2IWS A;  1Z5C A;  3VHC A;  2YKB A;  1BKN A;  2CCT A;  2XCM A;  3LNU A;  1B62 A;  3QDD A;  3R4M A;  3D36 A;  1THN A;  1YER A;  2H55 A;  1NHJ A;  4HZ0 A;  5IDJ A;  2BYI A;  4BXI A;  4E00 A;  4CE1 A;  5BOD A;  1BGQ A;  1I5D A;  4YKR A;  2YI5 A;  1JM6 A;  3EHH A;  1ID0 A;  4FCR A;  2FYP A;  2Q8F A;  3TTZ A;  1S14 A;  4L93 A;  2BU8 A;  1UY6 A;  1Y8P A;  3JZ3 A;  3D0B A;  4FMT A;  4MPE A;  5IN9 A;  4HXW A;  2CH4 A;  4FCP A;  2YEG A;  1MX0 A;  5J6A A;  3EKO A;  3T10 A;  4EGI A;  2O1V A;  4WUB A;  1S16 A;  2XHR A;  3LPS A;  3TZ4 A;  2YEA A;  2BYH A;  3Q5K A;  1Y4S A;  3RKZ A;  2HKJ A;  4XKK A;  2Q8G A;  4CE3 A;  4XE2 A;  3T0Z A;  3RLP A;  4JAV A;  1TH8 A;  4XIR A;  5CTW A;  3GIF A;  4EFU A;  4CWO A;  2GFD A;  4MP7 A;  2BRE A;  1L0O A;  3IED A;  1OSF A;  1YC4 A;  4P7A A;  1AM1 A;  2H8M A;  3O6O A;  3ZKB A;  4YKX A;  4R3A A;  3T1K A;  3QTF A;  3A0W A;  2FWZ A;  3C0E A;  4HXZ A;  4LPB A;  3RLQ A;  4YKU A;  1A4H A;  4GEE A;  4I5S A;  1Y4U A;  3OWD A;  4LWG A;  5M4H A;  5J71 A;  5F5R A;  1Z5A A;  4XIP A;  4E01 A;  3R4N A;  2YKC A;  4W7T A;  4KFG A;  4LP0 A;  2BU6 A;  2GQP A;  3K60 A;  1TBW A;  3HYZ A;  1YT1 A;  3FV5 A;  4LWH A;  2FXS A;  4XKA A;  5D7D A;  2FWY A;  3HEK A;  3INX A;  4EGK A;  3R91 A;  2BSM A;  4MOT A;  2YE9 A;  2BU2 A;  3DGE A;  4QPK A;  1YT2 A;  5FWK A;  2BU5 A;  2AKP A;  1US7 A;  4YKW A;  2YKJ A;  1I58 A;  2YGF A;  4CE2 A;  3ZM7 A;  4KSG A;  1H7U A;  2YGA A;  5FND A;  1U0Z A;  5CTX A;  1H7S A;  2XDK A;  2BZ5 A;  4AWQ A;  3TZ5 A;  4Q20 A;  1YT0 A;  4L91 A;  3NMQ A;  4PRV A;  4V25 A;  4HY1 A;  4CWT A;  4L8Z A;  3TZ0 A;  1AMW A;  1UYK A;  1Y8N A;  1YSR A;  4B7P A;  4KQV A;  4URM A;  3T2S A;  4P8O A;  3KE6 A;  4XTJ A;  2XX4 A;  3FT5 A;  1TC0 A;  5CTY A;  5M4K A;  1UY9 A;  2XJG A;  4E02 A;  2QF6 A;  1ZWH A;  4HYP A;  4JAU A;  2WEP A;  2C2A A;  2YEI A;  4DUH A;  4O05 A;  3ZKD A;  4CWR A;  2O1W A;  1U2O A;  3CRL A;  4KTN A;  5D6Q A;  1YS3 A;  2ZKJ A;  4FPP A;  3H80 A;  2VW5 A;  3B24 A;  4XD8 A;  4MBC A;  1QY8 A;  5GGZ A;  2ESA A;  3RLR A;  3U67 A;  1KIJ A;  4L90 A;  4YKY A;  4XDM A;  1UYG A;  4NH7 A;  1UYE A;  3PEH A;  3Q5J A;  2XX5 A;  4JQL A;  2XDU A;  5CPH A;  4ASF A;  4B6C A;  1UY8 A;  4MPC A;  2YKI A;  2ZDY A;  3VAD A;  3A0X A;  5F3K A;  2CG9 A;  5D6P A;  1B3Q A;  3B26 A;  4CWS A;  2YEH A;  3BMY A;  3CRK A;  2XHT A;  3WQ9 A;  2YI0 A;  2IOR A;  4V26 A;  1YC1 A;  3U2D A;  3ZXQ A;  2WI5 A;  2WI3 A;  1UYC A;  2YE3 A;  4AWP A;  4XC0 A;  1YES A;  4EEH A;  4O04 A;  4U7N A;  5D7R A;  2ZBK B;  3A0Z A;  4NH8 A;  1QZR A;  3R4O A;  2E0A A;  2YGE A;  3BM9 A;  3EHG A;  4PL9 A;  5M4N A;  2YEF A;  1PVG A;  2JJC A;  4O0B A;  4GCZ A;  4CWP A;  1ZXN A;  2JKI A;  4O09 A;  4XCL A;  2Q8I A;  1Z5B A;  1I5C A;  2CCS A;  2Q2E B;  5CTU A;  3INW A;  1ZXM A;  3A0R A;  2YJX A;  2YE6 A;  4CWN A;  3EKR A;  2WI4 A;  2YE8 A;  4EFT A;  2PNR A;  3GIG B;  2WI6 A;  4HZ5 A;  2K5B A;  4MP2 A;  1BYQ A;  4QPJ A;  2YE7 A;  4ASA A;  3O2F A;  2YEC A;  1KZN A;  3C11 A;  4PRX A;  2YEE A;  4BIU A;  3HZ1 A;  3B25 A;  3G7E A;  4PU9 A;  2XX2 A;  3GIE A;  1Z59 A;  2QG2 A;  5L3J A;  2BRC A;  1GJV A;  3K97 A;  3OWB A;  3VHA A;  2XHX A;  1BXD A;  3EHJ A;  4NH9 A;  2XDL A;  4ASG A;  4BQJ A;  4R1F A;  2XDS A;  2XJX A;  2YJW A;  2CGF A;  3CGZ A;  3R92 A;  1QYE A;  4K4O A;  4KSH A;  4X9L A;  2Q8H A;  2O1U A;  4BAE A;  2YEB A;  4YKT A;  2IWU A;  4LWF A;  1GKX A;  4U93 A;  1AJ6 A;  4XIQ A;  2BTZ A;  4LWE A;  4MPN A;  5M4P A;  4HYM A;  2YEJ A;  1UYM A;  2IWX A;  1NHH A;  3T0H A;  3H4L A;  3A0T A;  3EHF A;  4HY6 A;  2HCH A;  3U2K A;  1TC6 A;  3B27 A;  4R3M A;  3PEJ A;  3TZ2 A;  1R62 A;  3O0I A;  2YK2 A;  2WI7 A;  4YKQ A;  2QG0 A;  1UYI A;  2YE4 A;  3OW6 A;  4U7O A;  4MB9 A;  3OPD A;  4EMV A;  5FNC A;  1ZW9 A;  3WHA A;  3G75 A;  3VHD A;  5M4E A;  2XD6 A;  2YK9 A;  4BQG A;  1EA6 A;  5D7C A;  2YE2 A;  3TUH A;  3G7B A;  2XAB A;  3ZXO A;  4JAS A;  1Y8O A;  2WI2 A;  2XDX A;  2WEQ A;  4GQT A;  4XKO A;  4AS9 A;  4GGL A;  2YKE A;  1AH8 A;  1UYH A;  2YI6 A;  3CGY A;  3GIG A;  2XJJ A;  2BT0 A;  2VCI A;  4URL A;  3K99 A;  3CWV A;  4DZY A;  5IDM A;  4EM7 A;  2XK2 A;  4L94 A;  1UYD A;  5M4M A;  2CCU A;  2BU7 A;  2UWD A;  4YKZ A;  2VCJ A;  2YI7 A;  1YSZ A;  2QFO A;  3A0Y A;  1UYL A;  4CWQ A;  5C93 A;  3MNR P;  1MU5 A;  1TIL A;  4CWF A;  1I59 A;  3D2R A;  4H7Q A;  3HZ5 A;  3B28 A;  4WUC A;  4FCQ A;  2HG1 A;  4ASB A;  5BOC A;  1NHI A;  4H81 A;  1B63 A;  1YET A;  3FT8 A;  3OMU A;  5CF0 A;  4AWO A;  3HHU A;  2IOP A;  2IOQ A;  2ZDX A;  4GT8 A;  1GKZ A;  4LWI A;  4ZKI A;  3K98 A;  4KP4 A;  1AH6 A;  4ZVI A;  2YED A;  4I3H A;  3HYY A;  2WER A;  4H85 A;  1TID A;  4O07 A;  1I5B A;  4EGH A;  2YE5 A;  4URN A;  4XIT A;  1UYF A; 
#chains in the Genus database with same CATH topology
 4XCJ A;  3Q5L A;  1UY7 A;  2C1G A;  1I5A A;  1YC3 A;  4URO A;  3R4P A;  2VWC A;  5FNF A;  4BIZ A;  4GFN A;  2EXL A;  2WI1 A;  4WUD A;  3SL2 A;  1EI1 A;  2IWS A;  1Z5C A;  3VHC A;  2YKB A;  1BKN A;  2CCT A;  2XCM A;  3LNU A;  1B62 A;  3QDD A;  3R4M A;  3D36 A;  1THN A;  1YER A;  2H55 A;  1NHJ A;  4HZ0 A;  5IDJ A;  2BYI A;  4BXI A;  4E00 A;  4CE1 A;  5BOD A;  1BGQ A;  1I5D A;  4YKR A;  2YI5 A;  1JM6 A;  3EHH A;  1ID0 A;  4FCR A;  2FYP A;  2Q8F A;  3TTZ A;  1S14 A;  4L93 A;  2BU8 A;  1UY6 A;  1Y8P A;  3JZ3 A;  3D0B A;  4FMT A;  4MPE A;  5IN9 A;  4HXW A;  2CH4 A;  4FCP A;  2YEG A;  1MX0 A;  5J6A A;  3EKO A;  3T10 A;  4EGI A;  2O1V A;  4WUB A;  1S16 A;  2XHR A;  3LPS A;  3TZ4 A;  2YEA A;  2BYH A;  3Q5K A;  1Y4S A;  3RKZ A;  2HKJ A;  4XKK A;  2Q8G A;  4CE3 A;  4XE2 A;  3T0Z A;  3RLP A;  4JAV A;  1TH8 A;  4XIR A;  5CTW A;  3GIF A;  4EFU A;  4CWO A;  2GFD A;  4MP7 A;  2BRE A;  1L0O A;  3IED A;  1OSF A;  1YC4 A;  4P7A A;  1AM1 A;  2H8M A;  3LMM A;  3O6O A;  3ZKB A;  4YKX A;  4R3A A;  3T1K A;  3QTF A;  3A0W A;  2FWZ A;  3C0E A;  4HXZ A;  4LPB A;  3RLQ A;  4YKU A;  1A4H A;  4GEE A;  4I5S A;  1Y4U A;  3CYG A;  3OWD A;  4LWG A;  5M4H A;  5J71 A;  5F5R A;  1Z5A A;  4XIP A;  4E01 A;  3R4N A;  2YKC A;  4W7T A;  4KFG A;  4LP0 A;  2BU6 A;  2GQP A;  1IXM A;  3K60 A;  1TBW A;  3HYZ A;  1YT1 A;  3FV5 A;  4LWH A;  2FXS A;  4XKA A;  5D7D A;  2FWY A;  3HEK A;  3INX A;  4EGK A;  3R91 A;  2BSM A;  4MOT A;  2YE9 A;  2BU2 A;  3DGE A;  4QPK A;  1YT2 A;  5FWK A;  2BU5 A;  2AKP A;  1US7 A;  4YKW A;  2YKJ A;  1I58 A;  2YGF A;  4CE2 A;  3ZM7 A;  4KSG A;  1H7U A;  2YGA A;  5FND A;  1U0Z A;  2C1I A;  5CTX A;  1H7S A;  2XDK A;  2BZ5 A;  4AWQ A;  3TZ5 A;  4Q20 A;  1YT0 A;  4L91 A;  3NMQ A;  4PRV A;  4V25 A;  4HY1 A;  4CWT A;  4L8Z A;  3TZ0 A;  1AMW A;  1UYK A;  1Y8N A;  1YSR A;  4B7P A;  4KQV A;  4URM A;  3T2S A;  4P8O A;  3KE6 A;  2HHI A;  4XTJ A;  2XX4 A;  3FT5 A;  1TC0 A;  5CTY A;  5M4K A;  1UY9 A;  2XJG A;  4E02 A;  2QF6 A;  1ZWH A;  4HYP A;  4JAU A;  2WEP A;  2C2A A;  2YEI A;  4DUH A;  4O05 A;  3ZKD A;  4CWR A;  2O1W A;  1U2O A;  3CRL A;  4KTN A;  5D6Q A;  1YS3 A;  2ZKJ A;  4FPP A;  3H80 A;  2VW5 A;  3B24 A;  4XD8 A;  4MBC A;  1QY8 A;  5GGZ A;  2ESA A;  3RLR A;  3U67 A;  1KIJ A;  4L90 A;  4YKY A;  4XDM A;  1UYG A;  4NH7 A;  1UYE A;  3PEH A;  3Q5J A;  2XX5 A;  4JQL A;  2XDU A;  5CPH A;  4ASF A;  4B6C A;  1UY8 A;  4MPC A;  2YKI A;  2ZDY A;  3VAD A;  3A0X A;  5F3K A;  2CG9 A;  5D6P A;  1B3Q A;  3B26 A;  4CWS A;  2YEH A;  3BMY A;  3CRK A;  2XHT A;  3WQ9 A;  4E72 A;  2YI0 A;  2IOR A;  4V26 A;  1YC1 A;  3U2D A;  3ZXQ A;  2WI5 A;  2WI3 A;  1UYC A;  2YE3 A;  4AWP A;  4XC0 A;  1YES A;  4EEH A;  4O04 A;  4U7N A;  5D7R A;  2ZBK B;  3A0Z A;  4NH8 A;  1QZR A;  3R4O A;  2E0A A;  2YGE A;  3BM9 A;  3EHG A;  4PL9 A;  5M4N A;  2YEF A;  1PVG A;  2JJC A;  4O0B A;  4GCZ A;  4CWP A;  1ZXN A;  2JKI A;  4O09 A;  4XCL A;  2Q8I A;  1Z5B A;  1I5C A;  2CCS A;  2Q2E B;  5CTU A;  3INW A;  1ZXM A;  3A0R A;  2YJX A;  2YE6 A;  4CWN A;  3EKR A;  2WI4 A;  2YE8 A;  4EFT A;  2PNR A;  3GIG B;  2WI6 A;  4HZ5 A;  2K5B A;  4MP2 A;  1BYQ A;  4QPJ A;  2YE7 A;  4ASA A;  3O2F A;  2YEC A;  1KZN A;  3C11 A;  4PRX A;  2YEE A;  4BIU A;  3HZ1 A;  3B25 A;  3G7E A;  4PU9 A;  2XX2 A;  3GIE A;  1Z59 A;  2QG2 A;  5L3J A;  2BRC A;  1GJV A;  3K97 A;  3OWB A;  3VHA A;  2XHX A;  1BXD A;  3EHJ A;  4NH9 A;  2XDL A;  4ASG A;  4BQJ A;  4R1F A;  2XDS A;  2XJX A;  2YJW A;  2CGF A;  3CGZ A;  3R92 A;  1QYE A;  4K4O A;  4KSH A;  4X9L A;  2Q8H A;  2O1U A;  4BAE A;  2YEB A;  4YKT A;  2IWU A;  4LWF A;  1GKX A;  4U93 A;  1AJ6 A;  4XIQ A;  2BTZ A;  4LWE A;  4MPN A;  5M4P A;  4HYM A;  2YEJ A;  1UYM A;  2IWX A;  1NHH A;  3T0H A;  3H4L A;  3A0T A;  3EHF A;  1F51 A;  4HY6 A;  2HCH A;  3U2K A;  1TC6 A;  3B27 A;  4R3M A;  3PEJ A;  3TZ2 A;  1R62 A;  3O0I A;  2YK2 A;  2WI7 A;  4YKQ A;  2QG0 A;  1UYI A;  2YE4 A;  3OW6 A;  4U7O A;  4MB9 A;  3OPD A;  4EMV A;  5FNC A;  1ZW9 A;  3WHA A;  3G75 A;  3VHD A;  5JEN A;  5M4E A;  2XD6 A;  2YK9 A;  4BQG A;  1EA6 A;  5D7C A;  2YE2 A;  3TUH A;  3G7B A;  2XAB A;  3ZXO A;  4JAS A;  1Y8O A;  2WI2 A;  2XDX A;  2WEQ A;  4GQT A;  4XKO A;  4AS9 A;  4GGL A;  2YKE A;  1AH8 A;  1UYH A;  2YI6 A;  3CGY A;  3GIG A;  2XJJ A;  2BT0 A;  2VCI A;  4URL A;  3K99 A;  3CWV A;  4DZY A;  5IDM A;  4EM7 A;  2XK2 A;  4L94 A;  1UYD A;  5M4M A;  2CCU A;  2BU7 A;  2UWD A;  4YKZ A;  2VCJ A;  2YI7 A;  1YSZ A;  2QFO A;  3A0Y A;  1UYL A;  4CWQ A;  5C93 A;  2FTK A;  3MNR P;  1MU5 A;  1TIL A;  4CWF A;  1I59 A;  3D2R A;  4H7Q A;  3HZ5 A;  3B28 A;  4WUC A;  4FCQ A;  2HG1 A;  4ASB A;  5BOC A;  1NHI A;  4H81 A;  1B63 A;  1YET A;  3FT8 A;  3OMU A;  5CF0 A;  4AWO A;  3HHU A;  2IOP A;  2IOQ A;  2ZDX A;  4GT8 A;  1GKZ A;  4LWI A;  3S5T A;  4ZKI A;  3K98 A;  4KP4 A;  1AH6 A;  4ZVI A;  2YED A;  4I3H A;  3HYY A;  2WER A;  4H85 A;  1TID A;  4O07 A;  1I5B A;  4EGH A;  2YE5 A;  4URN A;  4XIT A;  1UYF A; 
#chains in the Genus database with same CATH homology
 4XCJ A;  3Q5L A;  1UY7 A;  1I5A A;  1YC3 A;  4URO A;  3R4P A;  2VWC A;  5FNF A;  4BIZ A;  4GFN A;  2EXL A;  2WI1 A;  4WUD A;  3SL2 A;  1EI1 A;  2IWS A;  1Z5C A;  3VHC A;  2YKB A;  1BKN A;  2CCT A;  2XCM A;  3LNU A;  1B62 A;  3QDD A;  3R4M A;  3D36 A;  1THN A;  1YER A;  2H55 A;  1NHJ A;  4HZ0 A;  5IDJ A;  2BYI A;  4BXI A;  4E00 A;  4CE1 A;  5BOD A;  1BGQ A;  1I5D A;  4YKR A;  2YI5 A;  1JM6 A;  3EHH A;  1ID0 A;  4FCR A;  2FYP A;  2Q8F A;  3TTZ A;  1S14 A;  4L93 A;  2BU8 A;  1UY6 A;  1Y8P A;  3JZ3 A;  3D0B A;  4FMT A;  4MPE A;  5IN9 A;  4HXW A;  2CH4 A;  4FCP A;  2YEG A;  1MX0 A;  5J6A A;  3EKO A;  3T10 A;  4EGI A;  2O1V A;  4WUB A;  1S16 A;  2XHR A;  3LPS A;  3TZ4 A;  2YEA A;  2BYH A;  3Q5K A;  1Y4S A;  3RKZ A;  2HKJ A;  4XKK A;  2Q8G A;  4CE3 A;  4XE2 A;  3T0Z A;  3RLP A;  4JAV A;  1TH8 A;  4XIR A;  5CTW A;  3GIF A;  4EFU A;  4CWO A;  2GFD A;  4MP7 A;  2BRE A;  1L0O A;  3IED A;  1OSF A;  1YC4 A;  4P7A A;  1AM1 A;  2H8M A;  3O6O A;  3ZKB A;  4YKX A;  4R3A A;  3T1K A;  3QTF A;  3A0W A;  2FWZ A;  3C0E A;  4HXZ A;  4LPB A;  3RLQ A;  4YKU A;  1A4H A;  4GEE A;  4I5S A;  1Y4U A;  3OWD A;  4LWG A;  5M4H A;  5J71 A;  5F5R A;  1Z5A A;  4XIP A;  4E01 A;  3R4N A;  2YKC A;  4W7T A;  4KFG A;  4LP0 A;  2BU6 A;  2GQP A;  3K60 A;  1TBW A;  3HYZ A;  1YT1 A;  3FV5 A;  4LWH A;  2FXS A;  4XKA A;  5D7D A;  2FWY A;  3HEK A;  3INX A;  4EGK A;  3R91 A;  2BSM A;  4MOT A;  2YE9 A;  2BU2 A;  3DGE A;  4QPK A;  1YT2 A;  5FWK A;  2BU5 A;  2AKP A;  1US7 A;  4YKW A;  2YKJ A;  1I58 A;  2YGF A;  4CE2 A;  3ZM7 A;  4KSG A;  1H7U A;  2YGA A;  5FND A;  1U0Z A;  5CTX A;  1H7S A;  2XDK A;  2BZ5 A;  4AWQ A;  3TZ5 A;  4Q20 A;  1YT0 A;  4L91 A;  3NMQ A;  4PRV A;  4V25 A;  4HY1 A;  4CWT A;  4L8Z A;  3TZ0 A;  1AMW A;  1UYK A;  1Y8N A;  1YSR A;  4B7P A;  4KQV A;  4URM A;  3T2S A;  4P8O A;  3KE6 A;  4XTJ A;  2XX4 A;  3FT5 A;  1TC0 A;  5CTY A;  5M4K A;  1UY9 A;  2XJG A;  4E02 A;  2QF6 A;  1ZWH A;  4HYP A;  4JAU A;  2WEP A;  2C2A A;  2YEI A;  4DUH A;  4O05 A;  3ZKD A;  4CWR A;  2O1W A;  1U2O A;  3CRL A;  4KTN A;  5D6Q A;  1YS3 A;  2ZKJ A;  4FPP A;  3H80 A;  2VW5 A;  3B24 A;  4XD8 A;  4MBC A;  1QY8 A;  5GGZ A;  2ESA A;  3RLR A;  3U67 A;  1KIJ A;  4L90 A;  4YKY A;  4XDM A;  1UYG A;  4NH7 A;  1UYE A;  3PEH A;  3Q5J A;  2XX5 A;  4JQL A;  2XDU A;  5CPH A;  4ASF A;  4B6C A;  1UY8 A;  4MPC A;  2YKI A;  2ZDY A;  3VAD A;  3A0X A;  5F3K A;  2CG9 A;  5D6P A;  1B3Q A;  3B26 A;  4CWS A;  2YEH A;  3BMY A;  3CRK A;  2XHT A;  3WQ9 A;  2YI0 A;  2IOR A;  4V26 A;  1YC1 A;  3U2D A;  3ZXQ A;  2WI5 A;  2WI3 A;  1UYC A;  2YE3 A;  4AWP A;  4XC0 A;  1YES A;  4EEH A;  4O04 A;  4U7N A;  5D7R A;  2ZBK B;  3A0Z A;  4NH8 A;  1QZR A;  3R4O A;  2E0A A;  2YGE A;  3BM9 A;  3EHG A;  4PL9 A;  5M4N A;  2YEF A;  1PVG A;  2JJC A;  4O0B A;  4GCZ A;  4CWP A;  1ZXN A;  2JKI A;  4O09 A;  4XCL A;  2Q8I A;  1Z5B A;  1I5C A;  2CCS A;  2Q2E B;  5CTU A;  3INW A;  1ZXM A;  3A0R A;  2YJX A;  2YE6 A;  4CWN A;  3EKR A;  2WI4 A;  2YE8 A;  4EFT A;  2PNR A;  3GIG B;  2WI6 A;  4HZ5 A;  2K5B A;  4MP2 A;  1BYQ A;  4QPJ A;  2YE7 A;  4ASA A;  3O2F A;  2YEC A;  1KZN A;  3C11 A;  4PRX A;  2YEE A;  4BIU A;  3HZ1 A;  3B25 A;  3G7E A;  4PU9 A;  2XX2 A;  3GIE A;  1Z59 A;  2QG2 A;  5L3J A;  2BRC A;  1GJV A;  3K97 A;  3OWB A;  3VHA A;  2XHX A;  1BXD A;  3EHJ A;  4NH9 A;  2XDL A;  4ASG A;  4BQJ A;  4R1F A;  2XDS A;  2XJX A;  2YJW A;  2CGF A;  3CGZ A;  3R92 A;  1QYE A;  4K4O A;  4KSH A;  4X9L A;  2Q8H A;  2O1U A;  4BAE A;  2YEB A;  4YKT A;  2IWU A;  4LWF A;  1GKX A;  4U93 A;  1AJ6 A;  4XIQ A;  2BTZ A;  4LWE A;  4MPN A;  5M4P A;  4HYM A;  2YEJ A;  1UYM A;  2IWX A;  1NHH A;  3T0H A;  3H4L A;  3A0T A;  3EHF A;  4HY6 A;  2HCH A;  3U2K A;  1TC6 A;  3B27 A;  4R3M A;  3PEJ A;  3TZ2 A;  1R62 A;  3O0I A;  2YK2 A;  2WI7 A;  4YKQ A;  2QG0 A;  1UYI A;  2YE4 A;  3OW6 A;  4U7O A;  4MB9 A;  3OPD A;  4EMV A;  5FNC A;  1ZW9 A;  3WHA A;  3G75 A;  3VHD A;  5M4E A;  2XD6 A;  2YK9 A;  4BQG A;  1EA6 A;  5D7C A;  2YE2 A;  3TUH A;  3G7B A;  2XAB A;  3ZXO A;  4JAS A;  1Y8O A;  2WI2 A;  2XDX A;  2WEQ A;  4GQT A;  4XKO A;  4AS9 A;  4GGL A;  2YKE A;  1AH8 A;  1UYH A;  2YI6 A;  3CGY A;  3GIG A;  2XJJ A;  2BT0 A;  2VCI A;  4URL A;  3K99 A;  3CWV A;  4DZY A;  5IDM A;  4EM7 A;  2XK2 A;  4L94 A;  1UYD A;  5M4M A;  2CCU A;  2BU7 A;  2UWD A;  4YKZ A;  2VCJ A;  2YI7 A;  1YSZ A;  2QFO A;  3A0Y A;  1UYL A;  4CWQ A;  5C93 A;  3MNR P;  1MU5 A;  1TIL A;  4CWF A;  1I59 A;  3D2R A;  4H7Q A;  3HZ5 A;  3B28 A;  4WUC A;  4FCQ A;  2HG1 A;  4ASB A;  5BOC A;  1NHI A;  4H81 A;  1B63 A;  1YET A;  3FT8 A;  3OMU A;  5CF0 A;  4AWO A;  3HHU A;  2IOP A;  2IOQ A;  2ZDX A;  4GT8 A;  1GKZ A;  4LWI A;  4ZKI A;  3K98 A;  4KP4 A;  1AH6 A;  4ZVI A;  2YED A;  4I3H A;  3HYY A;  2WER A;  4H85 A;  1TID A;  4O07 A;  1I5B A;  4EGH A;  2YE5 A;  4URN A;  4XIT A;  1UYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...