1I5BA

Structure of chea domain p4 in complex with adpnp and manganese
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
180
Chain Sequence
GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein, transferase
molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Nucleotide binding by the histidine kinase CheA.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 56
structure length 180
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1i5bA00
5D7DA 4BIUA 3WQ9A 2WI3A 2O1VA 1EI1A 2BU8A 4DUHA 2YKBA 4MPEA 4YKWA 2FWYA 4WUBA 3R91A 2YJXA 4MB9A 2ZDYA 4NH8A 1R62A 1PVGA 3PEHA 3OPDA 2YE2A 1TC6A 4LWHA 4LWEA 4ZKIA 5IDMA 4AWPA 1B3QA 2CCUA 1B62A 3G7EA 5CTWA 2YEIA 4EMVA 2YI5A 1UY6A 4HY1A 4URLA 2BYIA 1AM1A 3A0WA 4EFUA 1UY8A 3R4PA 1I59A 4H7QA 3TZ4A 4BIZA 4YKXA 1THNA 4GT8A 4MOTA 3HYZA 2YKIA 4R3MA 3RLQA 4CWSA 1S14A 1YERA 4XD8A 3EHFA 4B6CA 2ZKJA 4EGHA 4CWTA 4XTJA 4KP4A 1AH6A 3OWDA 3ZKBA 1UYKA 2XDKA 3EKOA 2QG0A 4NH9A 5J71A 2GFDA 1NHIA 1I5DA 5IDJA 2XHXA 3K99A 1Z59A 4XITA 1Y4UA 1ZXMA 1UYEA 3A0RA 3ZXOA 4JQLA 2YE4A 1UYFA 1A4HA 3NMQA 4U7NA 5BOCA 1QZRA 3T0HA 2XABA 4EFTA 4GEEA 2UWDA 5M4EA 1I5BA 4CWFA 4CWRA 2YEHA 4E00A 3R4OA 4L93A 2Q8IA 3DGEA 2JJCA 4YKUA 4AWOA 3R4NA 3T0ZA 5J6AA 4HY6A 3VHDA 1QYEA 1B63A 4I3HA 3CRLA 3A0YA 1UY7A 2ESAA 1US7A 4PU9A 4ASAA 2YECA 2IWXA 4K4OA 2YK9A 4YKRA 5M4MA 3O2FA 2Q2EB 4XC0A 2FXSA 5D6PA 3K60A 2IOQA 5M4PA 1KIJA 2BT0A 1YT2A 4ASFA 4LWIA 1I58A 5M4HA 2YEGA 4PL9A 1YC3A 4LWGA 2WEPA 2BU5A 3ZXQA 1YS3A 3QDDA 4V26A 5BODA 2YE6A 4GQTA 5IN9A 2WERA 3T10A 3IEDA 4P7AA 1TC0A 2ZDXA 4XE2A 3O0IA 2YJWA 4BXIA 3Q5JA 3FT8A 2H55A 3EHJA 4LPBA 1I5AA 3EHHA 2YE9A 1Z5BA 2CGFA 2C2AA 4HZ0A 3D2RA 1YC4A 4JAUA 1GKXA 4LP0A 3CGZA 3RLPA 3FT5A 2IWUA 4FCPA 2XX5A 4O0BA 2BU7A 1BXDA 2O1UA 2O1WA 4GFNA 5F5RA 2YKCA 1YESA 1GJVA 3HZ5A 1YC1A 3EKRA 2WI2A 3R4MA 3A0TA 4CWQA 1U2OA 5D7RA 1TH8A 2XDSA 3U2DA 4E02A 3EHGA 1MU5A 1Y8PA 2YGAA 3CRKA 4R1FA 1Z5CA 5CF0A 2YGFA 4MP2A 4L91A 4L90A 5FWKA 1BGQA 2BSMA 2YEFA 2XD6A 5L3JA 4EGIA 1YT0A 4HXWA 4R3AA 4PRVA 4FCQA 4YKYA 5F3KA 4B7PA 2VCIA 1ZXNA 3K98A 2CG9A 4L8ZA 2XK2A 4AWQA 2YEJA 3B24A 4CE3A 2XDLA 4EM7A 3INXA 5CTXA 1AH8A 4U93A 2YKJA 3T1KA 5M4KA 2Q8FA 3WHAA 4URNA 3G75A 1Y4SA 4KTNA 3RLRA 1ZWHA 2AKPA 2CH4A 2YE3A 3ZM7A 1H7UA 3GIGA 3HEKA 3LPSA 4FPPA 2IOPA 3TZ0A 5M4NA 2FYPA 4O09A 2QFOA 3B27A 4EGKA 2YEDA 1BYQA 3MNRP 4EEHA 3QTFA 1L0OA 2YE5A 4QPJA 3R92A 4V25A 2YEAA 3ZKDA 2XJJA 5CTUA 4XCJA 4YKQA 4HYPA 4PRXA 3C11A 1UY9A 2K5BA 4U7OA 3HYYA 2XHRA 2WEQA 4O05A 4ASGA 4XIQA 4XIRA 5CTYA 1QY8A 3B25A 5GGZA 4CE2A 5FNFA 4URMA 4WUCA 3B26A 3FV5A 1TIDA 4H81A 1YSRA 3U67A 2IORA 2GQPA 1YETA 2XX2A 2XDXA 1NHJA 3RKZA 1UYHA 1AMWA 2PNRA 4XKOA 1TILA 3CGYA 2XJXA 3A0XA 3D36A 2JKIA 1Z5AA 3LNUA 2BU2A 4MBCA 2YKEA 2YE7A 2BYHA 2BREA 4AS9A 1GKZA 4FCRA 4KQVA 2XJGA 3JZ3A 1UYLA 4GCZA 2YI6A 4CWOA 2YI7A 4Q20A 1NHHA 1EA6A 1BKNA 1KZNA 3HZ1A 4LWFA 2BTZA 2WI7A 4O07A 4XKKA 2YGEA 3CWVA 2FWZA 2YK2A 2VW5A 3OWBA 3BM9A 4KFGA 4P8OA 3OW6A 1UYIA 1I5CA 2XX4A 3KE6A 4MPNA 1JM6A 4JASA 4ZVIA 4XCLA 2WI1A 3G7BA 1ZW9A 1Y8NA 3OMUA 3H4LA 1UYDA 2BRCA 3Q5KA 2ZBKB 4O04A 3Q5LA 3T2SA 2Q8GA 3U2KA 2IWSA 2H8MA 2VCJA 2YE8A 3INWA 3TZ2A 4KSHA 3TUHA 1U0ZA 2WI5A 4HZ5A 3D0BA 4XDMA 2CCSA 3C0EA 4HXZA 2E0AA 1UYMA 4BAEA 1YT1A 4WUDA 4UROA 4CWNA 1H7SA 1TBWA 4QPKA 3SL2A 5CPHA 3VHAA 2XDUA 4XKAA 2XHTA 4L94A 4CWPA 4BQJA 2CCTA 3HHUA 2HG1A 4CE1A 2WI4A 4YKZA 3GIEA 4KSGA 4NH7A 1MX0A 2EXLA 3A0ZA 3GIFA 1AJ6A 2HKJA 3GIGB 3O6OA 2YEBA 3TZ5A 4ASBA 1S16A 5C93A 3PEJA 1UYCA 2XCMA 1Y8OA 3TTZA 2VWCA 5D6QA 4DZYA 3BMYA 3B28A 1UYGA 3H80A 4W7TA 4H85A 4BQGA 4E01A 1YSZA 2QF6A 4GGLA 2BU6A 4FMTA 5FNCA 4I5SA 4JAVA 4MP7A 3K97A 4X9LA 1OSFA 2HCHA 2YI0A 2BZ5A 1ID0A 2WI6A 4YKTA 5D7CA 2Q8HA 4HYMA 5FNDA 3VADA 3VHCA 2QG2A 4XIPA 2YEEA 4MPCA
chains in the Genus database with same CATH superfamily
5D7DA 4BIUA 3WQ9A 2WI3A 2O1VA 1EI1A 2BU8A 3LMMA 4DUHA 2YKBA 4MPEA 4YKWA 2FWYA 4WUBA 3R91A 2YJXA 4MB9A 2ZDYA 4NH8A 1R62A 1PVGA 3PEHA 3OPDA 2YE2A 1TC6A 4LWHA 4LWEA 4ZKIA 5IDMA 4AWPA 1B3QA 2CCUA 1B62A 3G7EA 5CTWA 2YEIA 4EMVA 2YI5A 1UY6A 4HY1A 4URLA 2BYIA 1AM1A 3A0WA 4EFUA 1UY8A 3R4PA 1I59A 4H7QA 3TZ4A 4BIZA 3S5TA 4YKXA 1THNA 4GT8A 4MOTA 3HYZA 2YKIA 4R3MA 3RLQA 4CWSA 1S14A 1YERA 4XD8A 3EHFA 4B6CA 2ZKJA 4EGHA 4CWTA 4XTJA 4KP4A 2FTKA 1AH6A 3OWDA 3ZKBA 1UYKA 2XDKA 3EKOA 2QG0A 4NH9A 5J71A 2GFDA 1NHIA 1I5DA 5IDJA 2XHXA 3K99A 1Z59A 4XITA 1Y4UA 1ZXMA 1UYEA 3A0RA 3ZXOA 4JQLA 2YE4A 1UYFA 1A4HA 3NMQA 4U7NA 5BOCA 1QZRA 3T0HA 2XABA 2C1IA 4GEEA 4EFTA 2UWDA 5M4EA 1I5BA 4CWFA 4CWRA 2YEHA 4E00A 3R4OA 4L93A 2Q8IA 3DGEA 2JJCA 4YKUA 4AWOA 3R4NA 3T0ZA 5J6AA 4HY6A 3VHDA 1QYEA 1B63A 4I3HA 3CRLA 3A0YA 1UY7A 2ESAA 1US7A 4PU9A 4ASAA 2YECA 2IWXA 4K4OA 2YK9A 4YKRA 5M4MA 3O2FA 2Q2EB 4XC0A 2FXSA 5D6PA 3K60A 2IOQA 5M4PA 1KIJA 2BT0A 1YT2A 4ASFA 4LWIA 1I58A 5M4HA 2YEGA 4PL9A 1YC3A 4LWGA 2WEPA 2BU5A 3ZXQA 1YS3A 3QDDA 4V26A 5BODA 2YE6A 4GQTA 5IN9A 2WERA 3T10A 3IEDA 4P7AA 1TC0A 2ZDXA 4XE2A 3O0IA 2YJWA 4BXIA 3Q5JA 3FT8A 2H55A 3EHJA 4LPBA 1I5AA 3EHHA 2YE9A 1Z5BA 2CGFA 2C2AA 4HZ0A 3D2RA 1YC4A 4JAUA 1GKXA 4LP0A 3CGZA 3RLPA 3FT5A 2IWUA 4FCPA 2XX5A 4O0BA 2BU7A 1BXDA 2O1UA 2O1WA 4GFNA 5F5RA 2YKCA 1YESA 1GJVA 3HZ5A 1YC1A 3EKRA 2WI2A 3R4MA 3A0TA 4CWQA 1U2OA 5D7RA 1TH8A 2XDSA 3U2DA 4E02A 3EHGA 1MU5A 1Y8PA 2YGAA 3CRKA 4R1FA 1Z5CA 5CF0A 2YGFA 4MP2A 4L91A 4L90A 5FWKA 1BGQA 2BSMA 2YEFA 2XD6A 5L3JA 4EGIA 1YT0A 4HXWA 4R3AA 4PRVA 4FCQA 4YKYA 5F3KA 4B7PA 2VCIA 1ZXNA 3K98A 2CG9A 4L8ZA 2XK2A 4AWQA 2YEJA 3B24A 4CE3A 2XDLA 4EM7A 3INXA 5CTXA 1AH8A 4U93A 2YKJA 3T1KA 5M4KA 2Q8FA 3WHAA 4URNA 3G75A 1Y4SA 4KTNA 3RLRA 1ZWHA 2AKPA 2CH4A 2YE3A 3ZM7A 1H7UA 3GIGA 3HEKA 3LPSA 4FPPA 2IOPA 3TZ0A 5M4NA 2FYPA 4O09A 2QFOA 3B27A 4EGKA 2YEDA 1BYQA 3MNRP 4EEHA 3QTFA 1L0OA 2YE5A 4QPJA 3R92A 4V25A 2YEAA 3ZKDA 2XJJA 5CTUA 4XCJA 4E72A 4YKQA 4HYPA 4PRXA 3C11A 1UY9A 2K5BA 4U7OA 3HYYA 2XHRA 2WEQA 4O05A 4ASGA 4XIQA 4XIRA 5CTYA 1QY8A 3B25A 5GGZA 4CE2A 5FNFA 4URMA 4WUCA 3B26A 3FV5A 1TIDA 4H81A 1YSRA 3U67A 2IORA 2GQPA 1YETA 2XX2A 2XDXA 1NHJA 3RKZA 1UYHA 1AMWA 2PNRA 4XKOA 1TILA 3CGYA 2XJXA 3A0XA 3D36A 2JKIA 1Z5AA 3LNUA 2HHIA 2BU2A 4MBCA 2YKEA 2YE7A 2BYHA 2BREA 4AS9A 1GKZA 4FCRA 4KQVA 2XJGA 3JZ3A 1IXMA 1UYLA 4GCZA 2YI6A 4CWOA 2YI7A 4Q20A 1NHHA 1EA6A 1BKNA 1KZNA 3HZ1A 4LWFA 2BTZA 2WI7A 4O07A 4XKKA 2YGEA 3CWVA 2FWZA 2YK2A 2VW5A 3OWBA 3BM9A 4KFGA 4P8OA 3OW6A 1UYIA 1I5CA 2XX4A 3KE6A 4MPNA 1JM6A 4JASA 4ZVIA 4XCLA 2WI1A 3G7BA 1ZW9A 1Y8NA 3OMUA 1F51A 1UYDA 3H4LA 2BRCA 3Q5KA 2ZBKB 4O04A 3Q5LA 3T2SA 2Q8GA 3U2KA 2IWSA 2H8MA 2VCJA 2YE8A 3INWA 3TZ2A 4KSHA 3TUHA 1U0ZA 2WI5A 4HZ5A 3D0BA 4XDMA 2CCSA 3C0EA 4HXZA 2E0AA 1UYMA 4BAEA 1YT1A 4WUDA 4UROA 4CWNA 1H7SA 1TBWA 4QPKA 3SL2A 5CPHA 3VHAA 2XDUA 4XKAA 2XHTA 4L94A 4CWPA 4BQJA 2CCTA 3HHUA 2HG1A 4CE1A 2WI4A 4YKZA 3GIEA 4KSGA 4NH7A 1MX0A 2EXLA 3A0ZA 3GIFA 1AJ6A 2HKJA 3GIGB 3O6OA 2YEBA 3TZ5A 4ASBA 1S16A 5C93A 3PEJA 1UYCA 2XCMA 1Y8OA 3TTZA 2VWCA 5D6QA 4DZYA 3BMYA 3B28A 1UYGA 3H80A 4W7TA 4H85A 4BQGA 5JENA 4E01A 1YSZA 2QF6A 4GGLA 2BU6A 4FMTA 5FNCA 4I5SA 4JAVA 4MP7A 3K97A 4X9LA 1OSFA 2HCHA 2YI0A 2BZ5A 2C1GA 3CYGA 1ID0A 2WI6A 4YKTA 5D7CA 2Q8HA 4HYMA 5FNDA 3VADA 3VHCA 2QG2A 4XIPA 2YEEA 4MPCA
chains in the Genus database with same CATH topology
5D7DA 4BIUA 3WQ9A 2WI3A 2O1VA 1EI1A 2BU8A 4DUHA 2YKBA 4MPEA 4YKWA 2FWYA 4WUBA 3R91A 2YJXA 4MB9A 2ZDYA 4NH8A 1R62A 1PVGA 3PEHA 3OPDA 2YE2A 1TC6A 4LWHA 4LWEA 4ZKIA 5IDMA 4AWPA 1B3QA 2CCUA 1B62A 3G7EA 5CTWA 2YEIA 4EMVA 2YI5A 1UY6A 4HY1A 4URLA 2BYIA 1AM1A 3A0WA 4EFUA 1UY8A 3R4PA 1I59A 4H7QA 3TZ4A 4BIZA 4YKXA 1THNA 4GT8A 4MOTA 3HYZA 2YKIA 4R3MA 3RLQA 4CWSA 1S14A 1YERA 4XD8A 3EHFA 4B6CA 2ZKJA 4EGHA 4CWTA 4XTJA 4KP4A 1AH6A 3OWDA 3ZKBA 1UYKA 2XDKA 3EKOA 2QG0A 4NH9A 5J71A 2GFDA 1NHIA 1I5DA 5IDJA 2XHXA 3K99A 1Z59A 4XITA 1Y4UA 1ZXMA 1UYEA 3A0RA 3ZXOA 4JQLA 2YE4A 1UYFA 1A4HA 3NMQA 4U7NA 5BOCA 1QZRA 3T0HA 2XABA 4EFTA 4GEEA 2UWDA 5M4EA 1I5BA 4CWFA 4CWRA 2YEHA 4E00A 3R4OA 4L93A 2Q8IA 3DGEA 2JJCA 4YKUA 4AWOA 3R4NA 3T0ZA 5J6AA 4HY6A 3VHDA 1QYEA 1B63A 4I3HA 3CRLA 3A0YA 1UY7A 2ESAA 1US7A 4PU9A 4ASAA 2YECA 2IWXA 4K4OA 2YK9A 4YKRA 5M4MA 3O2FA 2Q2EB 4XC0A 2FXSA 5D6PA 3K60A 2IOQA 5M4PA 1KIJA 2BT0A 1YT2A 4ASFA 4LWIA 1I58A 5M4HA 2YEGA 4PL9A 1YC3A 4LWGA 2WEPA 2BU5A 3ZXQA 1YS3A 3QDDA 4V26A 5BODA 2YE6A 4GQTA 5IN9A 2WERA 3T10A 3IEDA 4P7AA 1TC0A 2ZDXA 4XE2A 3O0IA 2YJWA 4BXIA 3Q5JA 3FT8A 2H55A 3EHJA 4LPBA 1I5AA 3EHHA 2YE9A 1Z5BA 2CGFA 2C2AA 4HZ0A 3D2RA 1YC4A 4JAUA 1GKXA 4LP0A 3CGZA 3RLPA 3FT5A 2IWUA 4FCPA 2XX5A 4O0BA 2BU7A 1BXDA 2O1UA 2O1WA 4GFNA 5F5RA 2YKCA 1YESA 1GJVA 3HZ5A 1YC1A 3EKRA 2WI2A 3R4MA 3A0TA 4CWQA 1U2OA 5D7RA 1TH8A 2XDSA 3U2DA 4E02A 3EHGA 1MU5A 1Y8PA 2YGAA 3CRKA 4R1FA 1Z5CA 5CF0A 2YGFA 4MP2A 4L91A 4L90A 5FWKA 1BGQA 2BSMA 2YEFA 2XD6A 5L3JA 4EGIA 1YT0A 4HXWA 4R3AA 4PRVA 4FCQA 4YKYA 5F3KA 4B7PA 2VCIA 1ZXNA 3K98A 2CG9A 4L8ZA 2XK2A 4AWQA 2YEJA 3B24A 4CE3A 2XDLA 4EM7A 3INXA 5CTXA 1AH8A 4U93A 2YKJA 3T1KA 5M4KA 2Q8FA 3WHAA 4URNA 3G75A 1Y4SA 4KTNA 3RLRA 1ZWHA 2AKPA 2CH4A 2YE3A 3ZM7A 1H7UA 3GIGA 3HEKA 3LPSA 4FPPA 2IOPA 3TZ0A 5M4NA 2FYPA 4O09A 2QFOA 3B27A 4EGKA 2YEDA 1BYQA 3MNRP 4EEHA 3QTFA 1L0OA 2YE5A 4QPJA 3R92A 4V25A 2YEAA 3ZKDA 2XJJA 5CTUA 4XCJA 4YKQA 4HYPA 4PRXA 3C11A 1UY9A 2K5BA 4U7OA 3HYYA 2XHRA 2WEQA 4O05A 4ASGA 4XIQA 4XIRA 5CTYA 1QY8A 3B25A 5GGZA 4CE2A 5FNFA 4URMA 4WUCA 3B26A 3FV5A 1TIDA 4H81A 1YSRA 3U67A 2IORA 2GQPA 1YETA 2XX2A 2XDXA 1NHJA 3RKZA 1UYHA 1AMWA 2PNRA 4XKOA 1TILA 3CGYA 2XJXA 3A0XA 3D36A 2JKIA 1Z5AA 3LNUA 2BU2A 4MBCA 2YKEA 2YE7A 2BYHA 2BREA 4AS9A 1GKZA 4FCRA 4KQVA 2XJGA 3JZ3A 1UYLA 4GCZA 2YI6A 4CWOA 2YI7A 4Q20A 1NHHA 1EA6A 1BKNA 1KZNA 3HZ1A 4LWFA 2BTZA 2WI7A 4O07A 4XKKA 2YGEA 3CWVA 2FWZA 2YK2A 2VW5A 3OWBA 3BM9A 4KFGA 4P8OA 3OW6A 1UYIA 1I5CA 2XX4A 3KE6A 4MPNA 1JM6A 4JASA 4ZVIA 4XCLA 2WI1A 3G7BA 1ZW9A 1Y8NA 3OMUA 3H4LA 1UYDA 2BRCA 3Q5KA 2ZBKB 4O04A 3Q5LA 3T2SA 2Q8GA 3U2KA 2IWSA 2H8MA 2VCJA 2YE8A 3INWA 3TZ2A 4KSHA 3TUHA 1U0ZA 2WI5A 4HZ5A 3D0BA 4XDMA 2CCSA 3C0EA 4HXZA 2E0AA 1UYMA 4BAEA 1YT1A 4WUDA 4UROA 4CWNA 1H7SA 1TBWA 4QPKA 3SL2A 5CPHA 3VHAA 2XDUA 4XKAA 2XHTA 4L94A 4CWPA 4BQJA 2CCTA 3HHUA 2HG1A 4CE1A 2WI4A 4YKZA 3GIEA 4KSGA 4NH7A 1MX0A 2EXLA 3A0ZA 3GIFA 1AJ6A 2HKJA 3GIGB 3O6OA 2YEBA 3TZ5A 4ASBA 1S16A 5C93A 3PEJA 1UYCA 2XCMA 1Y8OA 3TTZA 2VWCA 5D6QA 4DZYA 3BMYA 3B28A 1UYGA 3H80A 4W7TA 4H85A 4BQGA 4E01A 1YSZA 2QF6A 4GGLA 2BU6A 4FMTA 5FNCA 4I5SA 4JAVA 4MP7A 3K97A 4X9LA 1OSFA 2HCHA 2YI0A 2BZ5A 1ID0A 2WI6A 4YKTA 5D7CA 2Q8HA 4HYMA 5FNDA 3VADA 3VHCA 2QG2A 4XIPA 2YEEA 4MPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D7D A;  4BIU A;  3WQ9 A;  2WI3 A;  2O1V A;  1EI1 A;  2BU8 A;  4DUH A;  2YKB A;  4MPE A;  4YKW A;  2FWY A;  4WUB A;  3R91 A;  2YJX A;  4MB9 A;  2ZDY A;  4NH8 A;  1R62 A;  1PVG A;  3PEH A;  3OPD A;  2YE2 A;  1TC6 A;  4LWH A;  4LWE A;  4ZKI A;  5IDM A;  4AWP A;  1B3Q A;  2CCU A;  1B62 A;  3G7E A;  5CTW A;  2YEI A;  4EMV A;  2YI5 A;  1UY6 A;  4HY1 A;  4URL A;  2BYI A;  1AM1 A;  3A0W A;  4EFU A;  1UY8 A;  3R4P A;  1I59 A;  4H7Q A;  3TZ4 A;  4BIZ A;  4YKX A;  1THN A;  4GT8 A;  4MOT A;  3HYZ A;  2YKI A;  4R3M A;  3RLQ A;  4CWS A;  1S14 A;  1YER A;  4XD8 A;  3EHF A;  4B6C A;  2ZKJ A;  4EGH A;  4CWT A;  4XTJ A;  4KP4 A;  1AH6 A;  3OWD A;  3ZKB A;  1UYK A;  2XDK A;  3EKO A;  2QG0 A;  4NH9 A;  5J71 A;  2GFD A;  1NHI A;  1I5D A;  5IDJ A;  2XHX A;  3K99 A;  1Z59 A;  4XIT A;  1Y4U A;  1ZXM A;  1UYE A;  3A0R A;  3ZXO A;  4JQL A;  2YE4 A;  1UYF A;  1A4H A;  3NMQ A;  4U7N A;  5BOC A;  1QZR A;  3T0H A;  2XAB A;  4EFT A;  4GEE A;  2UWD A;  5M4E A;  1I5B A;  4CWF A;  4CWR A;  2YEH A;  4E00 A;  3R4O A;  4L93 A;  2Q8I A;  3DGE A;  2JJC A;  4YKU A;  4AWO A;  3R4N A;  3T0Z A;  5J6A A;  4HY6 A;  3VHD A;  1QYE A;  1B63 A;  4I3H A;  3CRL A;  3A0Y A;  1UY7 A;  2ESA A;  1US7 A;  4PU9 A;  4ASA A;  2YEC A;  2IWX A;  4K4O A;  2YK9 A;  4YKR A;  5M4M A;  3O2F A;  2Q2E B;  4XC0 A;  2FXS A;  5D6P A;  3K60 A;  2IOQ A;  5M4P A;  1KIJ A;  2BT0 A;  1YT2 A;  4ASF A;  4LWI A;  1I58 A;  5M4H A;  2YEG A;  4PL9 A;  1YC3 A;  4LWG A;  2WEP A;  2BU5 A;  3ZXQ A;  1YS3 A;  3QDD A;  4V26 A;  5BOD A;  2YE6 A;  4GQT A;  5IN9 A;  2WER A;  3T10 A;  3IED A;  4P7A A;  1TC0 A;  2ZDX A;  4XE2 A;  3O0I A;  2YJW A;  4BXI A;  3Q5J A;  3FT8 A;  2H55 A;  3EHJ A;  4LPB A;  1I5A A;  3EHH A;  2YE9 A;  1Z5B A;  2CGF A;  2C2A A;  4HZ0 A;  3D2R A;  1YC4 A;  4JAU A;  1GKX A;  4LP0 A;  3CGZ A;  3RLP A;  3FT5 A;  2IWU A;  4FCP A;  2XX5 A;  4O0B A;  2BU7 A;  1BXD A;  2O1U A;  2O1W A;  4GFN A;  5F5R A;  2YKC A;  1YES A;  1GJV A;  3HZ5 A;  1YC1 A;  3EKR A;  2WI2 A;  3R4M A;  3A0T A;  4CWQ A;  1U2O A;  5D7R A;  1TH8 A;  2XDS A;  3U2D A;  4E02 A;  3EHG A;  1MU5 A;  1Y8P A;  2YGA A;  3CRK A;  4R1F A;  1Z5C A;  5CF0 A;  2YGF A;  4MP2 A;  4L91 A;  4L90 A;  5FWK A;  1BGQ A;  2BSM A;  2YEF A;  2XD6 A;  5L3J A;  4EGI A;  1YT0 A;  4HXW A;  4R3A A;  4PRV A;  4FCQ A;  4YKY A;  5F3K A;  4B7P A;  2VCI A;  1ZXN A;  3K98 A;  2CG9 A;  4L8Z A;  2XK2 A;  4AWQ A;  2YEJ A;  3B24 A;  4CE3 A;  2XDL A;  4EM7 A;  3INX A;  5CTX A;  1AH8 A;  4U93 A;  2YKJ A;  3T1K A;  5M4K A;  2Q8F A;  3WHA A;  4URN A;  3G75 A;  1Y4S A;  4KTN A;  3RLR A;  1ZWH A;  2AKP A;  2CH4 A;  2YE3 A;  3ZM7 A;  1H7U A;  3GIG A;  3HEK A;  3LPS A;  4FPP A;  2IOP A;  3TZ0 A;  5M4N A;  2FYP A;  4O09 A;  2QFO A;  3B27 A;  4EGK A;  2YED A;  1BYQ A;  3MNR P;  4EEH A;  3QTF A;  1L0O A;  2YE5 A;  4QPJ A;  3R92 A;  4V25 A;  2YEA A;  3ZKD A;  2XJJ A;  5CTU A;  4XCJ A;  4YKQ A;  4HYP A;  4PRX A;  3C11 A;  1UY9 A;  2K5B A;  4U7O A;  3HYY A;  2XHR A;  2WEQ A;  4O05 A;  4ASG A;  4XIQ A;  4XIR A;  5CTY A;  1QY8 A;  3B25 A;  5GGZ A;  4CE2 A;  5FNF A;  4URM A;  4WUC A;  3B26 A;  3FV5 A;  1TID A;  4H81 A;  1YSR A;  3U67 A;  2IOR A;  2GQP A;  1YET A;  2XX2 A;  2XDX A;  1NHJ A;  3RKZ A;  1UYH A;  1AMW A;  2PNR A;  4XKO A;  1TIL A;  3CGY A;  2XJX A;  3A0X A;  3D36 A;  2JKI A;  1Z5A A;  3LNU A;  2BU2 A;  4MBC A;  2YKE A;  2YE7 A;  2BYH A;  2BRE A;  4AS9 A;  1GKZ A;  4FCR A;  4KQV A;  2XJG A;  3JZ3 A;  1UYL A;  4GCZ A;  2YI6 A;  4CWO A;  2YI7 A;  4Q20 A;  1NHH A;  1EA6 A;  1BKN A;  1KZN A;  3HZ1 A;  4LWF A;  2BTZ A;  2WI7 A;  4O07 A;  4XKK A;  2YGE A;  3CWV A;  2FWZ A;  2YK2 A;  2VW5 A;  3OWB A;  3BM9 A;  4KFG A;  4P8O A;  3OW6 A;  1UYI A;  1I5C A;  2XX4 A;  3KE6 A;  4MPN A;  1JM6 A;  4JAS A;  4ZVI A;  4XCL A;  2WI1 A;  3G7B A;  1ZW9 A;  1Y8N A;  3OMU A;  3H4L A;  1UYD A;  2BRC A;  3Q5K A;  2ZBK B;  4O04 A;  3Q5L A;  3T2S A;  2Q8G A;  3U2K A;  2IWS A;  2H8M A;  2VCJ A;  2YE8 A;  3INW A;  3TZ2 A;  4KSH A;  3TUH A;  1U0Z A;  2WI5 A;  4HZ5 A;  3D0B A;  4XDM A;  2CCS A;  3C0E A;  4HXZ A;  2E0A A;  1UYM A;  4BAE A;  1YT1 A;  4WUD A;  4URO A;  4CWN A;  1H7S A;  1TBW A;  4QPK A;  3SL2 A;  5CPH A;  3VHA A;  2XDU A;  4XKA A;  2XHT A;  4L94 A;  4CWP A;  4BQJ A;  2CCT A;  3HHU A;  2HG1 A;  4CE1 A;  2WI4 A;  4YKZ A;  3GIE A;  4KSG A;  4NH7 A;  1MX0 A;  2EXL A;  3A0Z A;  3GIF A;  1AJ6 A;  2HKJ A;  3GIG B;  3O6O A;  2YEB A;  3TZ5 A;  4ASB A;  1S16 A;  5C93 A;  3PEJ A;  1UYC A;  2XCM A;  1Y8O A;  3TTZ A;  2VWC A;  5D6Q A;  4DZY A;  3BMY A;  3B28 A;  1UYG A;  3H80 A;  4W7T A;  4H85 A;  4BQG A;  4E01 A;  1YSZ A;  2QF6 A;  4GGL A;  2BU6 A;  4FMT A;  5FNC A;  4I5S A;  4JAV A;  4MP7 A;  3K97 A;  4X9L A;  1OSF A;  2HCH A;  2YI0 A;  2BZ5 A;  1ID0 A;  2WI6 A;  4YKT A;  5D7C A;  2Q8H A;  4HYM A;  5FND A;  3VAD A;  3VHC A;  2QG2 A;  4XIP A;  2YEE A;  4MPC A; 
#chains in the Genus database with same CATH topology
 5D7D A;  4BIU A;  3WQ9 A;  2WI3 A;  2O1V A;  1EI1 A;  2BU8 A;  3LMM A;  4DUH A;  2YKB A;  4MPE A;  4YKW A;  2FWY A;  4WUB A;  3R91 A;  2YJX A;  4MB9 A;  2ZDY A;  4NH8 A;  1R62 A;  1PVG A;  3PEH A;  3OPD A;  2YE2 A;  1TC6 A;  4LWH A;  4LWE A;  4ZKI A;  5IDM A;  4AWP A;  1B3Q A;  2CCU A;  1B62 A;  3G7E A;  5CTW A;  2YEI A;  4EMV A;  2YI5 A;  1UY6 A;  4HY1 A;  4URL A;  2BYI A;  1AM1 A;  3A0W A;  4EFU A;  1UY8 A;  3R4P A;  1I59 A;  4H7Q A;  3TZ4 A;  4BIZ A;  3S5T A;  4YKX A;  1THN A;  4GT8 A;  4MOT A;  3HYZ A;  2YKI A;  4R3M A;  3RLQ A;  4CWS A;  1S14 A;  1YER A;  4XD8 A;  3EHF A;  4B6C A;  2ZKJ A;  4EGH A;  4CWT A;  4XTJ A;  4KP4 A;  2FTK A;  1AH6 A;  3OWD A;  3ZKB A;  1UYK A;  2XDK A;  3EKO A;  2QG0 A;  4NH9 A;  5J71 A;  2GFD A;  1NHI A;  1I5D A;  5IDJ A;  2XHX A;  3K99 A;  1Z59 A;  4XIT A;  1Y4U A;  1ZXM A;  1UYE A;  3A0R A;  3ZXO A;  4JQL A;  2YE4 A;  1UYF A;  1A4H A;  3NMQ A;  4U7N A;  5BOC A;  1QZR A;  3T0H A;  2XAB A;  2C1I A;  4GEE A;  4EFT A;  2UWD A;  5M4E A;  1I5B A;  4CWF A;  4CWR A;  2YEH A;  4E00 A;  3R4O A;  4L93 A;  2Q8I A;  3DGE A;  2JJC A;  4YKU A;  4AWO A;  3R4N A;  3T0Z A;  5J6A A;  4HY6 A;  3VHD A;  1QYE A;  1B63 A;  4I3H A;  3CRL A;  3A0Y A;  1UY7 A;  2ESA A;  1US7 A;  4PU9 A;  4ASA A;  2YEC A;  2IWX A;  4K4O A;  2YK9 A;  4YKR A;  5M4M A;  3O2F A;  2Q2E B;  4XC0 A;  2FXS A;  5D6P A;  3K60 A;  2IOQ A;  5M4P A;  1KIJ A;  2BT0 A;  1YT2 A;  4ASF A;  4LWI A;  1I58 A;  5M4H A;  2YEG A;  4PL9 A;  1YC3 A;  4LWG A;  2WEP A;  2BU5 A;  3ZXQ A;  1YS3 A;  3QDD A;  4V26 A;  5BOD A;  2YE6 A;  4GQT A;  5IN9 A;  2WER A;  3T10 A;  3IED A;  4P7A A;  1TC0 A;  2ZDX A;  4XE2 A;  3O0I A;  2YJW A;  4BXI A;  3Q5J A;  3FT8 A;  2H55 A;  3EHJ A;  4LPB A;  1I5A A;  3EHH A;  2YE9 A;  1Z5B A;  2CGF A;  2C2A A;  4HZ0 A;  3D2R A;  1YC4 A;  4JAU A;  1GKX A;  4LP0 A;  3CGZ A;  3RLP A;  3FT5 A;  2IWU A;  4FCP A;  2XX5 A;  4O0B A;  2BU7 A;  1BXD A;  2O1U A;  2O1W A;  4GFN A;  5F5R A;  2YKC A;  1YES A;  1GJV A;  3HZ5 A;  1YC1 A;  3EKR A;  2WI2 A;  3R4M A;  3A0T A;  4CWQ A;  1U2O A;  5D7R A;  1TH8 A;  2XDS A;  3U2D A;  4E02 A;  3EHG A;  1MU5 A;  1Y8P A;  2YGA A;  3CRK A;  4R1F A;  1Z5C A;  5CF0 A;  2YGF A;  4MP2 A;  4L91 A;  4L90 A;  5FWK A;  1BGQ A;  2BSM A;  2YEF A;  2XD6 A;  5L3J A;  4EGI A;  1YT0 A;  4HXW A;  4R3A A;  4PRV A;  4FCQ A;  4YKY A;  5F3K A;  4B7P A;  2VCI A;  1ZXN A;  3K98 A;  2CG9 A;  4L8Z A;  2XK2 A;  4AWQ A;  2YEJ A;  3B24 A;  4CE3 A;  2XDL A;  4EM7 A;  3INX A;  5CTX A;  1AH8 A;  4U93 A;  2YKJ A;  3T1K A;  5M4K A;  2Q8F A;  3WHA A;  4URN A;  3G75 A;  1Y4S A;  4KTN A;  3RLR A;  1ZWH A;  2AKP A;  2CH4 A;  2YE3 A;  3ZM7 A;  1H7U A;  3GIG A;  3HEK A;  3LPS A;  4FPP A;  2IOP A;  3TZ0 A;  5M4N A;  2FYP A;  4O09 A;  2QFO A;  3B27 A;  4EGK A;  2YED A;  1BYQ A;  3MNR P;  4EEH A;  3QTF A;  1L0O A;  2YE5 A;  4QPJ A;  3R92 A;  4V25 A;  2YEA A;  3ZKD A;  2XJJ A;  5CTU A;  4XCJ A;  4E72 A;  4YKQ A;  4HYP A;  4PRX A;  3C11 A;  1UY9 A;  2K5B A;  4U7O A;  3HYY A;  2XHR A;  2WEQ A;  4O05 A;  4ASG A;  4XIQ A;  4XIR A;  5CTY A;  1QY8 A;  3B25 A;  5GGZ A;  4CE2 A;  5FNF A;  4URM A;  4WUC A;  3B26 A;  3FV5 A;  1TID A;  4H81 A;  1YSR A;  3U67 A;  2IOR A;  2GQP A;  1YET A;  2XX2 A;  2XDX A;  1NHJ A;  3RKZ A;  1UYH A;  1AMW A;  2PNR A;  4XKO A;  1TIL A;  3CGY A;  2XJX A;  3A0X A;  3D36 A;  2JKI A;  1Z5A A;  3LNU A;  2HHI A;  2BU2 A;  4MBC A;  2YKE A;  2YE7 A;  2BYH A;  2BRE A;  4AS9 A;  1GKZ A;  4FCR A;  4KQV A;  2XJG A;  3JZ3 A;  1IXM A;  1UYL A;  4GCZ A;  2YI6 A;  4CWO A;  2YI7 A;  4Q20 A;  1NHH A;  1EA6 A;  1BKN A;  1KZN A;  3HZ1 A;  4LWF A;  2BTZ A;  2WI7 A;  4O07 A;  4XKK A;  2YGE A;  3CWV A;  2FWZ A;  2YK2 A;  2VW5 A;  3OWB A;  3BM9 A;  4KFG A;  4P8O A;  3OW6 A;  1UYI A;  1I5C A;  2XX4 A;  3KE6 A;  4MPN A;  1JM6 A;  4JAS A;  4ZVI A;  4XCL A;  2WI1 A;  3G7B A;  1ZW9 A;  1Y8N A;  3OMU A;  1F51 A;  1UYD A;  3H4L A;  2BRC A;  3Q5K A;  2ZBK B;  4O04 A;  3Q5L A;  3T2S A;  2Q8G A;  3U2K A;  2IWS A;  2H8M A;  2VCJ A;  2YE8 A;  3INW A;  3TZ2 A;  4KSH A;  3TUH A;  1U0Z A;  2WI5 A;  4HZ5 A;  3D0B A;  4XDM A;  2CCS A;  3C0E A;  4HXZ A;  2E0A A;  1UYM A;  4BAE A;  1YT1 A;  4WUD A;  4URO A;  4CWN A;  1H7S A;  1TBW A;  4QPK A;  3SL2 A;  5CPH A;  3VHA A;  2XDU A;  4XKA A;  2XHT A;  4L94 A;  4CWP A;  4BQJ A;  2CCT A;  3HHU A;  2HG1 A;  4CE1 A;  2WI4 A;  4YKZ A;  3GIE A;  4KSG A;  4NH7 A;  1MX0 A;  2EXL A;  3A0Z A;  3GIF A;  1AJ6 A;  2HKJ A;  3GIG B;  3O6O A;  2YEB A;  3TZ5 A;  4ASB A;  1S16 A;  5C93 A;  3PEJ A;  1UYC A;  2XCM A;  1Y8O A;  3TTZ A;  2VWC A;  5D6Q A;  4DZY A;  3BMY A;  3B28 A;  1UYG A;  3H80 A;  4W7T A;  4H85 A;  4BQG A;  5JEN A;  4E01 A;  1YSZ A;  2QF6 A;  4GGL A;  2BU6 A;  4FMT A;  5FNC A;  4I5S A;  4JAV A;  4MP7 A;  3K97 A;  4X9L A;  1OSF A;  2HCH A;  2YI0 A;  2BZ5 A;  2C1G A;  3CYG A;  1ID0 A;  2WI6 A;  4YKT A;  5D7C A;  2Q8H A;  4HYM A;  5FND A;  3VAD A;  3VHC A;  2QG2 A;  4XIP A;  2YEE A;  4MPC A; 
#chains in the Genus database with same CATH homology
 5D7D A;  4BIU A;  3WQ9 A;  2WI3 A;  2O1V A;  1EI1 A;  2BU8 A;  4DUH A;  2YKB A;  4MPE A;  4YKW A;  2FWY A;  4WUB A;  3R91 A;  2YJX A;  4MB9 A;  2ZDY A;  4NH8 A;  1R62 A;  1PVG A;  3PEH A;  3OPD A;  2YE2 A;  1TC6 A;  4LWH A;  4LWE A;  4ZKI A;  5IDM A;  4AWP A;  1B3Q A;  2CCU A;  1B62 A;  3G7E A;  5CTW A;  2YEI A;  4EMV A;  2YI5 A;  1UY6 A;  4HY1 A;  4URL A;  2BYI A;  1AM1 A;  3A0W A;  4EFU A;  1UY8 A;  3R4P A;  1I59 A;  4H7Q A;  3TZ4 A;  4BIZ A;  4YKX A;  1THN A;  4GT8 A;  4MOT A;  3HYZ A;  2YKI A;  4R3M A;  3RLQ A;  4CWS A;  1S14 A;  1YER A;  4XD8 A;  3EHF A;  4B6C A;  2ZKJ A;  4EGH A;  4CWT A;  4XTJ A;  4KP4 A;  1AH6 A;  3OWD A;  3ZKB A;  1UYK A;  2XDK A;  3EKO A;  2QG0 A;  4NH9 A;  5J71 A;  2GFD A;  1NHI A;  1I5D A;  5IDJ A;  2XHX A;  3K99 A;  1Z59 A;  4XIT A;  1Y4U A;  1ZXM A;  1UYE A;  3A0R A;  3ZXO A;  4JQL A;  2YE4 A;  1UYF A;  1A4H A;  3NMQ A;  4U7N A;  5BOC A;  1QZR A;  3T0H A;  2XAB A;  4EFT A;  4GEE A;  2UWD A;  5M4E A;  1I5B A;  4CWF A;  4CWR A;  2YEH A;  4E00 A;  3R4O A;  4L93 A;  2Q8I A;  3DGE A;  2JJC A;  4YKU A;  4AWO A;  3R4N A;  3T0Z A;  5J6A A;  4HY6 A;  3VHD A;  1QYE A;  1B63 A;  4I3H A;  3CRL A;  3A0Y A;  1UY7 A;  2ESA A;  1US7 A;  4PU9 A;  4ASA A;  2YEC A;  2IWX A;  4K4O A;  2YK9 A;  4YKR A;  5M4M A;  3O2F A;  2Q2E B;  4XC0 A;  2FXS A;  5D6P A;  3K60 A;  2IOQ A;  5M4P A;  1KIJ A;  2BT0 A;  1YT2 A;  4ASF A;  4LWI A;  1I58 A;  5M4H A;  2YEG A;  4PL9 A;  1YC3 A;  4LWG A;  2WEP A;  2BU5 A;  3ZXQ A;  1YS3 A;  3QDD A;  4V26 A;  5BOD A;  2YE6 A;  4GQT A;  5IN9 A;  2WER A;  3T10 A;  3IED A;  4P7A A;  1TC0 A;  2ZDX A;  4XE2 A;  3O0I A;  2YJW A;  4BXI A;  3Q5J A;  3FT8 A;  2H55 A;  3EHJ A;  4LPB A;  1I5A A;  3EHH A;  2YE9 A;  1Z5B A;  2CGF A;  2C2A A;  4HZ0 A;  3D2R A;  1YC4 A;  4JAU A;  1GKX A;  4LP0 A;  3CGZ A;  3RLP A;  3FT5 A;  2IWU A;  4FCP A;  2XX5 A;  4O0B A;  2BU7 A;  1BXD A;  2O1U A;  2O1W A;  4GFN A;  5F5R A;  2YKC A;  1YES A;  1GJV A;  3HZ5 A;  1YC1 A;  3EKR A;  2WI2 A;  3R4M A;  3A0T A;  4CWQ A;  1U2O A;  5D7R A;  1TH8 A;  2XDS A;  3U2D A;  4E02 A;  3EHG A;  1MU5 A;  1Y8P A;  2YGA A;  3CRK A;  4R1F A;  1Z5C A;  5CF0 A;  2YGF A;  4MP2 A;  4L91 A;  4L90 A;  5FWK A;  1BGQ A;  2BSM A;  2YEF A;  2XD6 A;  5L3J A;  4EGI A;  1YT0 A;  4HXW A;  4R3A A;  4PRV A;  4FCQ A;  4YKY A;  5F3K A;  4B7P A;  2VCI A;  1ZXN A;  3K98 A;  2CG9 A;  4L8Z A;  2XK2 A;  4AWQ A;  2YEJ A;  3B24 A;  4CE3 A;  2XDL A;  4EM7 A;  3INX A;  5CTX A;  1AH8 A;  4U93 A;  2YKJ A;  3T1K A;  5M4K A;  2Q8F A;  3WHA A;  4URN A;  3G75 A;  1Y4S A;  4KTN A;  3RLR A;  1ZWH A;  2AKP A;  2CH4 A;  2YE3 A;  3ZM7 A;  1H7U A;  3GIG A;  3HEK A;  3LPS A;  4FPP A;  2IOP A;  3TZ0 A;  5M4N A;  2FYP A;  4O09 A;  2QFO A;  3B27 A;  4EGK A;  2YED A;  1BYQ A;  3MNR P;  4EEH A;  3QTF A;  1L0O A;  2YE5 A;  4QPJ A;  3R92 A;  4V25 A;  2YEA A;  3ZKD A;  2XJJ A;  5CTU A;  4XCJ A;  4YKQ A;  4HYP A;  4PRX A;  3C11 A;  1UY9 A;  2K5B A;  4U7O A;  3HYY A;  2XHR A;  2WEQ A;  4O05 A;  4ASG A;  4XIQ A;  4XIR A;  5CTY A;  1QY8 A;  3B25 A;  5GGZ A;  4CE2 A;  5FNF A;  4URM A;  4WUC A;  3B26 A;  3FV5 A;  1TID A;  4H81 A;  1YSR A;  3U67 A;  2IOR A;  2GQP A;  1YET A;  2XX2 A;  2XDX A;  1NHJ A;  3RKZ A;  1UYH A;  1AMW A;  2PNR A;  4XKO A;  1TIL A;  3CGY A;  2XJX A;  3A0X A;  3D36 A;  2JKI A;  1Z5A A;  3LNU A;  2BU2 A;  4MBC A;  2YKE A;  2YE7 A;  2BYH A;  2BRE A;  4AS9 A;  1GKZ A;  4FCR A;  4KQV A;  2XJG A;  3JZ3 A;  1UYL A;  4GCZ A;  2YI6 A;  4CWO A;  2YI7 A;  4Q20 A;  1NHH A;  1EA6 A;  1BKN A;  1KZN A;  3HZ1 A;  4LWF A;  2BTZ A;  2WI7 A;  4O07 A;  4XKK A;  2YGE A;  3CWV A;  2FWZ A;  2YK2 A;  2VW5 A;  3OWB A;  3BM9 A;  4KFG A;  4P8O A;  3OW6 A;  1UYI A;  1I5C A;  2XX4 A;  3KE6 A;  4MPN A;  1JM6 A;  4JAS A;  4ZVI A;  4XCL A;  2WI1 A;  3G7B A;  1ZW9 A;  1Y8N A;  3OMU A;  3H4L A;  1UYD A;  2BRC A;  3Q5K A;  2ZBK B;  4O04 A;  3Q5L A;  3T2S A;  2Q8G A;  3U2K A;  2IWS A;  2H8M A;  2VCJ A;  2YE8 A;  3INW A;  3TZ2 A;  4KSH A;  3TUH A;  1U0Z A;  2WI5 A;  4HZ5 A;  3D0B A;  4XDM A;  2CCS A;  3C0E A;  4HXZ A;  2E0A A;  1UYM A;  4BAE A;  1YT1 A;  4WUD A;  4URO A;  4CWN A;  1H7S A;  1TBW A;  4QPK A;  3SL2 A;  5CPH A;  3VHA A;  2XDU A;  4XKA A;  2XHT A;  4L94 A;  4CWP A;  4BQJ A;  2CCT A;  3HHU A;  2HG1 A;  4CE1 A;  2WI4 A;  4YKZ A;  3GIE A;  4KSG A;  4NH7 A;  1MX0 A;  2EXL A;  3A0Z A;  3GIF A;  1AJ6 A;  2HKJ A;  3GIG B;  3O6O A;  2YEB A;  3TZ5 A;  4ASB A;  1S16 A;  5C93 A;  3PEJ A;  1UYC A;  2XCM A;  1Y8O A;  3TTZ A;  2VWC A;  5D6Q A;  4DZY A;  3BMY A;  3B28 A;  1UYG A;  3H80 A;  4W7T A;  4H85 A;  4BQG A;  4E01 A;  1YSZ A;  2QF6 A;  4GGL A;  2BU6 A;  4FMT A;  5FNC A;  4I5S A;  4JAV A;  4MP7 A;  3K97 A;  4X9L A;  1OSF A;  2HCH A;  2YI0 A;  2BZ5 A;  1ID0 A;  2WI6 A;  4YKT A;  5D7C A;  2Q8H A;  4HYM A;  5FND A;  3VAD A;  3VHC A;  2QG2 A;  4XIP A;  2YEE A;  4MPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...