2CH4A

Complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
320
structure length
320
Chain Sequence
GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLTLAIIQALLVKVNNLVYAIPIANIDTILSISKEDIQRVQDRDVIVIRGEVIPVYRLWEVLQIEHKEELEEMEAVIVRVGNRKYGIVVDDLLGQDDIVIKSLGKVFSEVKEFSGAAILGDGSIALIINVSGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Reconstruction of the Chemotaxis Receptor-Kinase Assembly
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/chemotaxis
total genus 72
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01584 CheW CheW-like domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ch4A02
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2ch4A03
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2ch4A01
2ENMA 2BU7A 3B25A 1H7UA 3B26A 1ABOA 3M0UA 3NMZC 2WEQA 2D0NA 1QZRA 4LWGA 4KP4A 2YK2A 1AVZC 1ZUYA 3REAB 2EYXA 1EI1A 4CC3A 2YEJA 2J06A 4XDMA 2FO0A 1NYFA 1I5DA 1UTIA 5IH2A 2C0TA 3G75A 2C0IA 2CUDA 3LPSA 4E01A 4EGKA 4HY6A 1HJDA 2HKJA 3C11A 4HY1A 4RUGA 5CTWA 1YC1A 1I5BA 1HD3A 2ZKJA 2IWSA 2YE5A 1AMWA 4K4OA 3D2RA 4GT8A 4O04A 2DNUA 4LN2A 3TSWA 1UYLA 3R4OA 5M4NA 2CGFA 3A0WA 5L3JA 3M0SA 2YE4A 4FPPA 1BK2A 3NMQA 1KIKA 4GBQA 3A98A 3EKOA 1U3OA 4CWSA 1M3AA 3INXA 2J6KA 2DMOA 3QWYA 2YGFA 3PEHA 4Q20A 3TUHA 1ARKA 5GGZA 1SEMA 2YEAA 1UUEA 3RNJA 2YJWA 4QPJA 2WI7A 2RMOA 3EGUA 2C2AA 2J6OA 4L93A 1OOTA 3RLPA 2XMFA 2YE3A 4EFUA 1G83A 2EGCA 1TIDA 2LCSA 2DLPA 4HXWA 4AFZC 2O88A 1Y8PA 2ABLA 5CTUA 1WLPB 2QG0A 1WXBA 4JJBA 2O2OA 4LUEA 1THNA 3CGYA 1JXOA 3HZ1A 4X9LA 3R92A 1E7OA 3I35A 3U2KA 1J3TA 1OEBA 2YEGA 1YETA 4ASAA 3OPDA 2KYBA 1H3HA 1GCPA 1YNZA 2M51A 5D7CA 2DBKA 4EGIA 3I9QA 5F5RA 2BZXA 4QPKA 3TTZA 3SL2A 3VS3A 4U93A 2IORA 2HCHA 1UY8A 2L3QA 4AFSC 1UYIA 1N5ZA 1G2BA 2DF6A 3GBQA 4YKYA 2L0AA 4Z88A 2BT0A 1TUDA 2LX7A 1AZEA 4HZ5A 1S14A 1NLPC 4XC0A 1U5SA 5D7RA 2NWMA 4JAVA 4JZ4A 2YEIA 1LCKA 1UYCA 1UYDA 2BU6A 1VYVA 3EHFA 2FWZA 2XK2A 1I1JA 3H0IA 3HEKA 3B28A 4LPBA 4MPCA 2Q8HA 2DRMA 3EG0A 2YUQA 2FRWA 1TH8A 2CH4A 3VS1A 3U23A 5ECAA 2XX4A 4YKWA 4KRTA 4L91A 2EGAA 3T0ZA 2G6FX 3T10A 2GTJA 4L8ZA 4WCIA 4IIMA 4Z89A 2XCMA 1AD5A 2BZYA 5HCKA 4MOTA 3H41A 1QKXA 3ZM7A 2PZ1A 4IIOA 4BAEA 1CSKA 1SRMA 4OMNA 5C93A 2Q8IA 2KGTA 2GTOA 3ULRB 4KQVA 3O6OA 1PVGA 3EHHA 1PKTA 1UFFA 2YI7A 4V26A 2JMAA 2YKCA 4WUBA 1Y57A 4XKKA 2XHRA 3B27A 1GCQA 2RQVA 2KE9A 4J9CA 3CWVA 4RTVA 1T3LA 2O9VA 2K6DA 1EFNA 1ZX6A 3PVLA 3CRKA 4KSHA 4WUCA 2YE7A 4HYMA 1UYHA 4XIRA 2MIOA 2J7IA 4JJCA 4CWTA 1B62A 4EIKA 2HG1A 2YKIA 5FWKA 2QF6A 3DGEA 4QT7A 2EYZA 4MPEA 4NH8A 2KRNA 4Z8AA 4XKOA 1ID0A 4GCZA 3C0CA 4ESRA 1HSQA 3PVQA 2DL5A 2XDKA 4CE2A 4JAUA 4AG2C 1WYXA 4AS9A 3WQ9A 2CSIA 3RBBB 2CH4W 1UJ0A 5D6QA 1PRMC 2O31A 4DUHA 2YUNA 1K9AA 1I5AA 3VHCA 4E02A 4O0BA 1BB9A 3UA7A 1AWOA 1GFDA 2D1XA 1YERA 2BYHA 3HYYA 3Q5LA 4JASA 2ECZA 4CE1A 4A63B 5J71A 2DBMA 3A0RA 1W1FA 4FCPA 1AOJA 2FPFA 4J9DA 4RTUA 4PRVA 2O9SA 2JMCA 1YC3A 2LMJA 2KYMA 4XIQA 2V1RA 4D8KA 2YE8A 2AK5A 2O1UA 3GIEA 5BOCA 1WX6A 2XD6A 2XDLA 2A37A 4GEEA 2YUOA 3VRZA 3A0YA 4XCLA 3CQTA 3KE6A 1X6GA 1UY7A 1WXTA 2JXBA 2H8MA 4XD8A 3IEDA 1AEYA 2YT6A 2KXDA 3PEJA 3H0FA 3C0EA 1ZSGA 1PWTA 2KRSA 3VRYA 4RTWA 2Q8FA 3R91A 3O2FA 4FCQA 3TZ0A 4RTXA 2E5KA 3VS0A 4CWRA 2WI3A 4MB9A 2QDLA 1YESA 3EHJA 2M0YA 1CKAA 1JU5C 1ZBJA 3VS2A 1Y4UA 1OPLA 2XHXA 2YGEA 2DL7A 3VHAA 4EGHA 5BODA 1UYMA 2XX5A 3HZ5A 3EG1A 2FWYA 2YECA 2LNHB 2YE2A 3JV3A 1W70A 2XDUA 1SSHA 2L3PA 2FPEA 2LZ6B 1AJ6A 2ESAA 2K3BA 2IOPA 1B07A 1BKNA 2WI5A 1Y8OA 2CUBA 3UF4A 2YKBA 2KXCA 5FWBA 2H8HA 4PU9A 4R3MA 3U67A 3U2DA 3SHWA 3ZKBA 1BYQA 1AWWA 4B6CA 2LJ1A 1AH8A 1QWFA 4ZNXA 3ZL7C 1SRLA 4BIZA 2L2PA 1ZUUA 2BREA 1W6XA 3JZ3A 5J6AA 1UG1A 2YEEA 1GCQC 3EHGA 1E6GA 1YWOA 2JW4A 3O5ZA 1A4HA 2VCJA 2YEFA 4OMMA 1UHCA 2B86A 1NYGA 3VS4A 4PL9A 2XABA 2JS2A 3K99A 2AZSA 2CCTA 2HCKA 5M4HA 3EHQA 3R4PA 1SPKA 2DM1A 3T1KA 1X6BA 4URNA 4RTZA 3WHAA 4CWOA 1YC4A 2YI6A 3VS5A 1JXMA 1ABQA 2CCSA 2BU2A 1KFZA 2WI2A 4NH7A 1RLPC 5IXFA 2PNRA 2RQWA 1AWXA 3NHNA 2L3SA 3TSZA 1QYEA 1X69A 2WEPA 2LQWA 2MOXA 5FWCA 2AZVA 1UY9A 1YSZA 4CE3A 2KNBB 4LWIA 5IHNA 3UA6A 2DL3A 1PHTA 2DJQA 1GL5A 2FYPA 1U2OA 2OJ2A 2RQTA 1I0CA 2EGEA 2D8HA 2J05A 1FMKA 2AKLA 2RNAA 2VWFA 1B63A 1EA6A 4MP7A 3K60A 3OW6A 1S16A 2PNIA 2EBPA 5L23A 2BU8A 1TC6A 1QCFA 1I5CA 1GJVA 1JM6A 2DYBA 4LWEA 4R1FA 3VADA 5CF0A 1AH6A 1M27C 1PRLC 4LWFA 5M4KA 3UATA 3G7BA 1JEGA 1YSRA 2EXLA 3A0ZA 4XITA 4EFTA 4P7AA 4MPNA 1Z9QA 1Z5AA 3THKA 5M4MA 2F2XA 2P4RA 4MP2A 1WIEA 4CWPA 3QDDA 1A0NB 4CC4B 4YKTA 4NH9A 2BRCA 1UJYA 2ED0A 2NUZA 1NG2A 2BZ8A 1VA7A 2ROTA 2IWUA 2DL8A 3A0XA 3Q5JA 1T3SA 1SHGA 2XJGA 5CPHA 2XHTA 3FT8A 3A0TA 1K1ZA 4J9HA 1H7SA 4KFGA 1U0ZA 4GQTA 2KR3A 1Y0MA 2XJXA 4MBCA 4CWNA 1VYUA 1QWEA 4E6RA 4J9EA 1UYKA 2FRYA 4HVVA 2J6FA 2AKKA 2A08A 2W0ZA 4RTTA 5I11A 4O07A 4LP0A 4KTNA 2LJ3A 1M3BA 4HVUA 4ASFA 2CT4A 3M0RA 1ZLMA 2EVRA 1KSWA 3BMYA 1KIJA 2KT1A 3EG2A 1X43A 2BZ5A 4LNPA 5GJVB 1KJWA 4XE2A 5FNFA 4YKZA 2IWXA 1M3CA 2GQPA 1T0HA 1PKSA 1ZXMA 3INWA 2RQRA 2WERA 4KSGA 4XKAA 2YGAA 4BQGA 2C0OA 1B3QA 4J9GA 2YEHA 5FNCA 2BTZA 2CT3A 4HYPA 3OWDA 4FSSA 2MCNA 2YUPA 2YEBA 2DVJA 3H80A 1RUWA 2DE0X 2EQIA 4Y92A 1M8MA 3CGZA 2YSQA 2CG9A 2O1VA 3H4LA 2X3XD 4JQLA 1M30A 4LUDA 1ZW9A 4I3HA 2XX2A 2K5BA 1TC0A 2YE9A 2KEAA 3EKRA 3TZ4A 1VYTA 4ORZA 2OAWA 4BIUA 1QKWA 2ZDYA 2WI1A 2DRKA 2JJCA 3NPFA 2GBQA 1NHIA 3MNRP 4FCRA 1YT2A 4J9IA 1YWPA 5CTXA 3D36A 2SRCA 3VS6A 1ZUKA 3R4MA 2UWDA 4AWPA 4BQJA 3VS7A 4DEXA 2YK9A 4EM7A 1RLQC 1Y4SA 4O05A 2HEQA 1WXUA 2IOQA 1K0XA 2PTKA 2VWCA 3EG3A 2GNCA 3IQLA 3TVTA 4ZKIA 4L90A 1UYGA 2YKJA 1AM1A 2BTTA 4U7NA 1JQQA 4K11A 1S1NA 2I0NA 2JT4A 3NGPA 4GLMA 3K97A 2V1QA 4JPBW 1BBZA 4WUDA 4YKXA 1OSFA 4URMA 3Q5KA 4LE9A 2ED1A 1BGQA 1E6HA 4JJDA 2Q8GA 2WI4A 2HDAA 3I5RA 5IDJA 1NLOC 3OWBA 1I59A 1NEGA 1MU5A 1OV3A 4F17A 2DILA 1RI9A 2FXSA 2GQIA 4O09A 3M0QA 1KZNA 2BU5A 2VW5A 5IXBA 1GKZA 3FT5A 1K76A 5D6PA 3HHUA 4CWFA 3OMUA 2XJJA 4E00A 3H0HA 1I58A 2KROA 2WI6A 2SEMA 4H85A 3EHRA 2D8JA 1UHFA 3I5SA 1NHJA 2CREA 3R6NA 2YE6A 4DEYA 4AG1C 2O1WA 3TZ5A 4URLA 4H7QA 2VKNA 2AKPA 1TILA 1UYEA 4PRXA 1WDXA 1YS3A 4EMVA 1YCSB 2HSPA 4CWQA 3R4NA 4H81A 4BXIA 2RF0A 2XDSA 3K98A 2ZBKB 1X2QA 1AZGB 1K4US 2YI0A 3LNUA 4GFNA 1BXDA 2FEIA 2EPDA 2RQUA 2QG2A 1YN8A 4R0KA 2K9GA 1UY6A 1Z5CA 4YKQA 3QWXX 4YKUA 2ESWA 4OMLA 2BSMA 2YEDA 1NEBA 2DX1A 2EW3A 2JM9A 2DA9A 1WFWA 3QTFA 1X2KA 2XDXA 2K79A 1U06A 2KT8A 3HYZA 5F3KA 3RLRA 1YT1A 3CRLA 2W10A 4OMQA 1MV0B 1BU1A 1NM7A 1PNJA 1FYNA 2KRMA 1WA7A 4F16A 5IHKA 1H92A 1TBWA 4J9FA 1ZXNA 2QFOA 2YKEA 4B7PA 2K2MA 2F2WA 2IIMA 1L0OA 3T2SA 2EKHA 4HXJA 4AWQA 4JZ3A 1GFCA 1IO6A 1XOVA 5FW9A 4CC2A 1MX0A 1NHHA 1YT0A 2E0AA 4OMOA 5IHIA 4GGLA 4W7TA 3RKZA 1TG0A 4ASGA 2ROLA 2YJXA 4HVWA 5IDMA 5M4PA 4UROA 4LWHA 5CTYA 4CC7A 2VVKA 4RTYA 1MV3A 4EEHA 4AFUC 2K7AA 4XCJA 1TUCA 3B24A 3O0IA 2YDLA 4U7OA 5FNDA 2KBTA 1AWJA 2OI3A 2DL4A 4HZ0A 1T0JA 4OMPA 4X1VA 1X27A 2Q2EB 3ZXOA 4AWOA 2BYIA 2YI5A 4HCKA 5I22A 1US7A 2F2VA 2CDTA 3ZXQA 5M4EA 1K0SA 4FMTA 2A28A 2A36A 3REBB 4I5SA 2JS0A 1MUZA 3FV5A 1YP5A 1ZWHA 2VCIA 2X3WD 3GIGA 1JO8A 5IN9A 2LQNA 1OPKA 2FG0A 1QY8A 2FPDA 3SEMA 1I07A 5EC7A 1V1CA 4AFQC 3VHDA 1SHFA 4ZVIA 1GBQA 2GFDA 3M0TA 5D7DA 3ZKDA 4P8OA 1CKBA 1R62A 4DZYA 1UECA 2LJ0A 4M4ZA 2ZDXA 1UGVA 3PE0A 3G7EA 4XTJA 4ASBA 1WI7A 1Y8NA 2JM8A 1H8KA 4R3AA 3TZ2A 3GIGB 3LH5A 2CSQA 2EYYA 2CCUA 1UDLA 2H55A 1UE9A 4D8DA 2RPNA 3T0HA 1UYFA 4XIPA 5GJWB 3BM9A 4J9BA 4F14A 3GIFA 2LP5A 1Z59A 3KFVA 3D0BA 1QLYA 2GGRA 4V25A 3FJ5A 1Z5BA 2HBWA 3M0PA 1GBRA 1GKXA 4YKRA 4L94A 4HXZA 2RN8A 1Z9ZA 3RLQA 2EYWA 1GRIA 2JKIA 2JTEA
chains in the Genus database with same CATH superfamily
3B25A 2HSEB 4DA2A 1X3PA 1QG7A 1JB3A 4M7AE 2JZ2A 2EYPA 4RKUE 4ELZC 1YHBA 3HZXA 4L5RC 4XDMA 1LLRD 1N27A 2EJGC 1SE4A 1UTIA 4E7HA 2C0TA 4C8QE 5CO7A 1JICA 3VR5A 3G75A 3LPSA 4XU2A 1MGSA 2EJMA 3C11A 2NVXB 5CTWA 1PD1A 2MPXC 4M75G 3VDYA 4X62L 1JJGA 4B9XA 2IWSA 3CCLT 1BCPB 1EIHA 2F3IA 4GT8A 3IRBA 4C0DC 1EY7A 2XICA 2D9UA 3T1HL 4A3BB 1JWMD 5M4NA 2CGFA 1TWBA 2MWPA 2ZPHB 5GAMe 3JCMX 1H9KA 1XPOA 2UUAQ 4QCLA 1BI0A 2MPMA 5IE8A 3INXA 2J6KA 3P8DA 3AB9A 1M4VA 2L9HA 2DZCA 3TREA 4IJLA 3TUHA 1ARKA 4XU3A 1RAAB 1SEMA 4BE2A 4M78A 4DBHA 1YJ9T 5A0GA 5GMKi 1KABA 1CKNA 1VIEA 4TKOB 2RMOA 2YJWA 2C2AA 4YY3Q 4M77C 1OOTA 4IN3A 1G83A 1ZSZC 4NL2A 4C5EA 2FHTA 3CCRA 4AFZC 1XTDA 5LJ3h 1IZ6A 2O88A 5CTUA 3K5MA 3KFUA 2QG0A 4LDVA 4G4KA 4CI0C 3KDFA 1NMGA 1THNA 3HZ1A 3K60A 4L6V5 1TU0B 5E4WC 2YEGA 3L7ZC 2JA6G 1ZYRD 1D5MC 1TWCH 5K5PA 1V1PA 3MHXA 1YNZA 2M51A 1H3HA 2HCCA 5IGEA 1LT4D 4J8OA 2DBKA 5KCOA 4M7DB 1NTGA 2VUMH 2HDLA 1GO3E 5CKEA 1DOLA 2BZXA 3TTZA 1WZOA 5CV5A 2HCHA 1UY8A 4RCCA 4JLIA 1Q82U 2QQAA 2XIWA 1R0BG 2FMMA 5EQ0A 5GAN8 3GBQA 1CSQA 4DPGA 3LLRA 2L0AA 2F0SA 1EYDA 4Z88A 3J81c 4MZMA 1LTRD 3CMAQ 1MKHA 3EVQA 2V8JA 1NNXA 2XG8D 3TU4K 1NLPC 1QP3A 4MZPA 2EYMA 1EEFD 3W2DA 2JA5G 1HNXL 3CF5A 2NWMA 4JAVA 4O1NA 4JZ4A 4QKUA 4A3KB 1PV4A 2YEIA 1UYCA 3EHFA 3CCEQ 1X65A 3J7YW 2UUBQ 1I1JA 1YJNT 2VY3A 3GTQH 5IGDA 4EGKA 3FEOA 2Q8HA 4A4EA 4YWLA 3EG0A 2LY7A 3T16A 1I3QB 1EFID 3F2BA 2BH2A 4M77F 1TH8A 3KBXA 2FL7A 5F2DA 2R57A 4KRTA 2EGAA 2X51A 2G6FX 4CHTB 5EKKA 3T10A 2F5TX 2Q2UA 4L8ZA 1FVIA 1XYIA 1YHQQ 1MGQA 1G8ZD 3D4WA 3H41A 3ZM7A 1DONA 1CSKA 1NCVA 2QTXA 1SRMA 1DGSA 3BDOA 5C93A 4C3HG 5FJ8G 2XWJB 3D0FA 4R9WA 2BUDA 3S1NH 4E47A 3KF6B 2E2JH 1MNEA 4NXNL 3B27A 3HPWA 2MAMA 1CK1A 1L2FA 4QQGA 1QCBD 4B3TQ 4Y91A 1RD9D 2KE9A 3T1YQ 2RA4A 4RTVA 4ASGA 3CPFA 2K6DA 3RUXA 4KSHA 5FOBB 5LL6S 5KYYA 2GVBA 1XX8A 2YE7A 1I50B 4M77G 3OYDA 3X28B 1RAIB 4XIRA 1KG1A 3I4MH 1VQ5A 1K9MR 3SK5A 4Y28E 2EYLA 1Y1WH 3PIO3 3OMGA 2Q2TA 2HHHL 1B62A 3QSUA 2EWNA 2EYZA 4QT7A 3JCMe 4NH8A 2LQKA 3C0CA 2F0GA 3QOJA 5CKBA 3UE1A 4DV6L 1HZBA 2KJXA 2XDKA 1SYEA 4JAUA 3RZOB 1WYXA 5KE2A 3LGLA 1HCZA 4HSPA 1VQAA 1UJ0A 5D6QA 3W5OA 4DUHA 3KUPA 2XGTA 1E1OA 1SFOH 4JI0Q 1JC7A 4HJ5A 4EMKA 1K9AA 4PJNA 1HZ9A 4RH6A 3VHCA 2DK3A 3UA7A 3E0EA 4OP0A 1YERA 5CC4A 3GTJB 4L6TB 2ZGWA 4PL6A 4JASA 2DBMA 5KRUA 3A0RA 1M8AA 2F0FA 3FKIB 4FCPA 1SYGA 1SNQA 2TSSA 4A3JB 3MFGA 4PRVA 1D1CA 2O9SA 4HIDA 1YC3A 2LMJA 2EQMA 3CCLQ 1LV9A 2NYSA 3SFMA 2KYMA 2PW5A 1I4GA 1B8AA 3CQZH 4AYBB 2CP6A 1EWHA 3TEHB 2F4VQ 1KNEA 3NSWA 4DV4L 1WHMA 2VQFQ 4PJLA 3M4QA 1Q46A 2YUOA 2F0DA 3E1SA 3SK4A 4IZ8A 2GA4B 1UY7A 3VR6A 4E6IA 4KBMB 3IEDA 1AEYA 2YT6A 5J22A 2KXDA 4DR6Q 5IP7H 2NVTH 1ZSGA 4EQOA 1PWTA 4LDYA 3VRYA 1YJ9Q 4RTWA 4VUBA 2UXBL 1SR3A 2Q8FA 5JJIA 2V1CC 1G51A 1L0YB 2WI3A 2FINB 1ENCA 2OEOA 4MB9A 3LWUA 1PFNA 4E7KA 1YESA 3H3VI 3HOVH 3VYTA 1ZBJA 3X26B 2MMPA 4PK4A 2DL7A 1DOMA 4DKAC 5BODA 2XX5A 2LS01 4WUBA 2EY2A 4JK1C 2ZTEA 2LNHB 4XDXA 3JV3A 2F03A 1YNJC 1OZ2A 4IOAA 1GUWA 5BR8L 1K3BC 3MFYA 2AT1B 3GTQB 1RHPA 2FJ2A 1OI1A 1BI1A 5DM73 3KBGA 2L11A 5HGQA 5CQXA 3UPUA 2F3VA 3MZ5A 1BYQA 1AWWA 2LJ1A 2MK5A 1CUKA 1SNCA 3F2CA 1AH8A 1SRLA 1UWVA 2EQKA 3LWEA 3JZ3A 4KUDK 3I91A 1SSFA 3OS0A 1VQLA 5C3EG 1E6GA 2JW4A 4BI8B 3O5ZA 5IGBA 2IX3A 1PH2A 1PM3A 3NELA 4OMMA 1XPRA 3BS1A 3VS4A 2XABA 3G71T 3C94A 3K7UC 1H3ZA 3MXPA 4LDXA 3W3AA 4FO2A 5GQOA 3OS1A 4JRQA 2HCKA 1OXVA 3SK8A 1VQKA 5IP9H 2E1HA 5LMNQ 4A75A 5I6YA 3R4PA 3QUIA 4J6YA 1E2WA 1D09B 3T1KA 1R4PB 1I5OB 1ZA1B 2DFUA 2RI2A 1KLGD 4EDUA 8AT1B 4M8AA 3VS5A 1RTNA 1JXMA 4WJ3M 1Z7TA 5FJ8H 4C3HH 2BU2A 4V2SA 2JEBI 2WI2A 2PNRA 2VV5A 1IREB 2RQWA 5IXFA 2Z4HA 3BW1A 2HL5C 1QYEA 2WEPA 4IFDG 1PA6A 4EMKC 2RA2A 1UY9A 1HA6A 5D7DA 3G6EA 3KLSA 3O8VA 3JCMJ 3SE0A 1YSZA 2KNBB 4F7UB 3W1BA 5IYBG 2OCEA 3RN5A 2OWOA 1GL5A 4LWIA 1U2OA 1G2TA 2RNAA 2J05A 1K73U 4Z9CB 1MMAA 3R3OA 1A15A 2EBPA 4X3SA 3PT9A 1TC6A 4KHZA 1PZJD 3E19A 5KNBA 2DYBA 4R1FA 1W2BP 3RD4A 2R6GA 1XJVA 5CF0A 1PH5A 2VC8A 1JEGA 1GUSA 4EFTA 5KYXA 3GOXA 1D0ZA 1Z9QA 3U4VA 5LMNW 3I72A 2F0IA 3ULJA 2JN4A 3ZFJA 1BF4A 4MP2A 3TZUA 4DFAA 4B3RL 1YHAA 4YCVA 3QDDA 1AE3A 4CC4B 2DUDA 2CW0D 1GXDC 1HYOA 4YHHQ 1B34A 2EQJA 4C1NK 2RJFA 2QKIC 2DNEA 2DL8A 1T3SA 1HPCA 2ZAEA 1VQNA 1SHGA 4FVMA 1STBA 4JI5Q 1M90R 4JV5Q 2MP1A 2VS1A 1PCXA 4LF6L 3FT8A 4PFPA 3J81E 2BA1A 5M9OA 3OYIA 5LJ3f 1WCMG 2AQ3B 2EJFA 1D8LA 1Y0MA 2B2TC 2XJXA 4C92A 2F52A 4E6RA 4MBCA 1QVGS 3OYNA 1VOMA 2I5MX 2K5WA 1PH8A 2RSNA 3HSBA 2A08A 2W0ZA 4RTTA 1MMGA 3RIRA 5I11A 4KTNA 3ERSX 3H0GH 4R8IA 3VYHB 3UI2A 3VU3C 5A2QL 1VQ9T 1M2VA 1H9SB 1KSWA 2K4YA 3HRSA 3CPWA 2YV5A 4LUOA 4PJOD 1CA6A 1N33Q 1X6OA 2BIVA 1PTOD 2A3LA 4DV5Q 4DV1L 4BXXG 1M3CA 1LT3D 1F77A 4KY6A 3S2HH 2CQOA 1KIXA 3INWA 3LX0A 3MEUA 3SEBA 4J9GA 5FLMG 2YEHA 4OF1A 1I4PA 3OWDA 1R77A 2COYA 3PO3H 2AHJB 4OB1B 1AW7A 4JI6Q 1Y1VG 2DE0X 1K0RA 1E2ZA 1M8MA 3BU2A 2YSQA 1N8RU 3P1HA 4LUVA 3CGZA 3H4LA 4UP9A 5COYA 1ZW9A 4I3HA 2Q8RE 2E2JB 3NE5B 2F0PA 1R9TH 1UNSA 2K57A 2GFAA 4HJ9A 4NS5A 4OWXB 1Z47A 3EKRA 3TZ4A 3DLLA 2PNRC 3OYBA 2ZT9C 3E3XA 3RN2A 5C0XH 3RKXA 4HAEA 2JE6I 1O7LA 3NBHB 1NHIA 2SDFA 1CHQD 4FXGC 4CKEA 3BVGA 2ZPFB 1BUVT 3I4MB 4DF7A 1J8IA 4XTCS 1ICWA 4R4IA 1JWUD 4QUCA 2VNUD 3RLOA 4LFBQ 4XTUA 1RAGB 3HOUH 4AWPA 1BIAA 4CGYB 4UAIA 4EM7A 1GUNA 2LMCB 4KKSA 3ME9A 5GGZA 3DHQA 1WXUA 2IOQA 2XHCA 2WP8J 4P2CB 3TVTA 2RB6A 1EYGA 4L90A 3GTOH 2V26A 1UEBA 1Q8KA 3D4DA 1PH4A 1SFOB 5LJ3d 4K11A 5JVH3 2B63G 4U7NA 2RKSA 5HKCA 4A3IG 2V1QA 1VDZA 1BBZA 2RHYA 4HIKA 3JCMP 2PW7A 4WUDA 4JLGA 4BA1I 2OTJT 4IFDH 1J9OA 2Q8GA 3NTIA 3G71Q 5D6XA 2MQHA 4OO1G 3OWBA 4DV0L 4XQNA 2E5LL 4DAYB 1RI0A 3EG9B 4BDZA 1BCOA 4HT9A 4IQZA 3M0QA 4P75A 1KZNA 1M1KC 1FR3A 2OF1A 1JOQA 4LD6A 3LYIA 3I8ZA 2XDBA 3L2WA 1K76A 1YI2A 2LRQA 3JB9D 4DR3Q 2YU9B 3M57A 3TCJA 4IPCA 3VA5A 3ZYYX 4E00A 4OIJA 4OIKA 1XNRL 2KROA 2VZAA 3I4OA 4KK7A 4Q5VA 4B3MQ 2EJFC 3OYYA 1L0WA 3GTKB 4WORA 4C92C 2L89A 3BY7A 1MHNA 1F2ZA 1RIPA 1T5XD 4XYOA 2JA6B 5JOBA 3GLXA 5C6SA 1HNWQ 2NVTB 5KYWB 1CKMA 2UXCL 2DXUA 2K52A 4FXDA 2DZ9A 1PXUA 4H7QA 1TILA 1UYEA 1W3SA 1WDXA 2WAQG 4ZKCB 4EMVA 2HSPA 1C7YA 1PSFA 4G7ZC 4E72A 4H81A 2LKVA 1IBKL 1NAPA 4NP5A 1X2QA 2Z0SA 2YI0A 1UE7A 3G7LA 3G6EQ 1Q1EA 5C4XG 3CC4T 1JJCB 2RQUA 3PSIA 1BQQT 1SMYC 1ILQA 2K9GA 4E7ZA 3JCMg 3RERA 3PUZA 3L2QA 4LMQD 4M7AD 1S5DD 1UY6A 1Z5CA 1I5LA 2ESWA 3R6OA 4GLAC 4B08A 4BDYA 4KUIA 3HP9A 2DX1A 2EW3A 2JM9A 2UUCL 2JA8H 4IUVA 5CVIA 1X2KA 2L5QA 5C44G 1TWHH 4C8QD 2R61A 1U06A 1K28A 2QW7A 4EGVA 2V4DA 1NSNS 3V2TA 3S2DB 3CRLA 4X64Q 5IHKA 1NM7A 2KRMA 1FYNA 2CG9A 5C0MA 1DXMA 2HD3A 1H92A 3S14H 1ZXNA 1IXMA 1LM0A 2NUTB 1Q7YU 1EFWA 4BBSH 2K2MA 4JI4L 2K6AA 2WB1G 2D0OA 1EIGA 1SYDA 2XI9A 4IJHA 5ELFA 3C3LA 4HXJA 1BXTA 2A69C 4JZ3A 1IO6A 2Y4YA 2VB6A 3MPUB 4GN3B 4DR4L 4OMOA 4HIMA 2RVLA 1TG0A 4ZGEB 3E9GA 1S5FD 2VVKA 1B9NA 1XNIA 1VUBA 5CBAE 4C0DB 5L3JA 1N6AA 4C92F 5IODA 3QR8A 3O0IA 1AT1B 5GMKl 4C3HB 4XIGS 4HZ0A 3A5ZB 4OMPA 1VQ9Q 3MCAB 2QG9B 4Q5WA 5BN4A 1FXXA 1LJOA 2YLCA 1IXRA 3I4NH 5I22A 1US7A 2F2VA 2QCPX 4RGMA 5M4EA 4FMTA 3SD4A 2F0VA 2A28A 3PMFA 1NY4A 4X3TA 5LJ3j 4P5NA 3L0OA 4X65Q 3CCJA 3QKJA 2VCIA 3RNUA 1JO8A 3NP8A 1JB0E 4M77B 3LWIA 2NVXH 2FG0A 4A4GA 3DKMA 1I07A 1ZSZB 4DUZQ 4GKKQ 3S17B 4BQJA 1MMNA 1B2TA 4AFQC 2CFMA 5CKHA 3JCMc 1TS5A 1Q3LA 3M0TA 3STBD 4ALPA 4QVZA 3JB9I 2E76C 1E7ZA 4A3BH 2PQAA 4JI1L 1ZEQX 4A3EG 1HZCA 4M4ZA 2EXDA 2XWBB 4YY3L 4LF9Q 1OXUA 1Y8NA 1LNXA 4N0AC 4Y7NH 4A3GG 1RAHB 4C92G 3EQLC 4DNIA 2CQAA 3BZDB 3V96A 2TMPA 3EA6A 4JG2A 1KQSA 3TZ2A 4ZRZA 2YRVA 2ICIA 2IW3A 4O6JA 1B50A 3S3NA 2H55A 1UE9A 2QK0A 2Y90A 2RPNA 4D8DA 3LWHA 3E0JA 3NK9A 5C3XA 3F70A 2M00A 4A3IH 3HOWH 3CC2T 1VQMT 3MJXA 3QDFA 3QIIA 4F14A 3CD6T 3ZJYC 1JB7A 1OX8A 3GIFA 2AQ2B 1QLYA 3FJ5A 4OO1H 4GKJQ 3CCMT 1IW7C 3TQYA 2PQEA 4F04B 4C5HA 2JTEA 1I8FA 3G4ST 5IT9L 4A3FH 2A8VA 5CQYA 3OYCA 4ZUIA 3NMZC 4LFCQ 1QZRA 1XMQQ 5C4HA 1I6VC 1ZUYA 3REAB 2Y4XA 4C0FA 1PLFA 1RABB 2F0HA 2A68D 4K6LA 1G3YA 5L8RE 3NPPA 4JCVE 1GM5A 1FNVA 2CHBD 2CZ6B 3RZDH 4PKCC 4JYAQ 3TQ7P 1I5DA 1U4PA 3D3RA 2CUDA 3H0GB 2OTJQ 2BKDN 1G291 3FEWX 1TS4A 1YC1A 1JOKA 3CXCA 2K4KA 4L5QA 2ZKJA 3BJUA 3CRLC 2R93G 2X6GA 5GAEC 2DXBA 4ZCKA 3CEYA 4LN2A 3S2HB 1M90C 3SVMA 4MMKA 3F1ZA 2LX9A 1VQOA 4WRDA 2GVAA 2KK4A 4FPPA 4LF5L 3PO2G 3A98A 1B7TA 1HXYD 1YNND 3OYJA 1U3OA 3PO3B 1IXDA 1SN8A 3M85A 2YGFA 4DA4A 2QGQA 2RDHA 4N8FA 2R7FA 2Y0SG 5ELCA 2YEAA 4MDXA 1U0LA 4QPJA 1BKBA 1EY8A 3EGUA 3NQTA 5D65A 1Q86C 1V76A 2K5HA 3J80i 1J6QA 1SE2A 1A3UA 3RLPA 2XMFA 4JUVA 1ENAA 1I3QH 3A54A 3PIPA 2D2CC 1VQBA 2LCSA 1TIDA 4HXWA 5E4XA 1XMOQ 1D6EC 3L1AA 1Y8PA 2ABLA 1S40A 1WXBA 4GY5A 3GDEA 5C3EB 4JJBA 1VQ4T 5DAUA 4A76A 1WD1A 4FU6A 4A93G 1E7OA 3I35A 3OW6A 1D7QA 4M78B 3CC4Q 3WDNA 1M1GA 1J3TA 1CKNB 2ZZDA 3HOUB 3H94A 4B3TL 4CDEC 4A3CG 4ASAA 3T1YL 3GNGA 2RJDA 3OW2P 5D7CA 2NUPA 4BUGA 1S72T 4DQ2A 3A8GB 3I9QA 4M7DE 5F5RA 1YJWA 4QPKA 1RKNA 2E4HA 3KDFB 2IORA 2YEJA 4QVDA 2OTLT 5GAHC 1V1QA 1B70B 4BY1G 1B4OA 2RM4A 4C0GA 1I50H 1V1PB 3CMAA 2BT0A 1Q82R 2COWA 5C4JH 4DAVA 1PMRA 4X6AH 3H09A 1W6JA 4ZK9B 1U5SA 1SSOA 5D7RA 4JI0L 4KGVB 3CCEA 2LXJA 3I4LA 1U8RA 2B2VC 1VYVA 3SR1A 3RZOH 2FWZA 4EMHA 3HEKA 3H0IA 1Q1BA 3B28A 4MPCA 4OXPA 3TEEA 2R7ZG 3M3YH 3I90A 3MTSA 4J15A 3D6CA 4C3JG 3LH0A 4YCWA 1I94L 3K6OA 4A3EH 1NZ9A 2ZTCA 2LFNA 1VQCA 1VQ7T 1BOSA 1L1OA 1O7YA 2ZTDA 1SYFA 3FRPB 2MHVA 4A3LG 2F4VL 2XCMA 2B8FA 2J7ZA 2C35B 4DV7Q 4MOTA 1QKXA 2PZ1A 5LJ3e 1CA5A 4BAEA 1SRUA 1AEXA 4JRIA 3S3OA 2ALYB 4A3JH 3KLSX 4B6MA 4GOPC 2Q8IA 5ELBA 4K0KL 4NB3A 4KQVA 1RDPD 1C6VX 1XTCD 2YTVA 4BI4A 4FT4A 5GAN2 3L2VA 1A2UA 5I2SA 4OHJA 4C0ZA 4FT2A 1N32Q 1HQMC 4J6HA 3CRKA 1ZX6A 3CCUT 4ATOA 1WCMB 4WUCA 2A1AA 1NMFA 3RKWA 2JA8B 2F0UA 1WNLA 2MIOA 4XTZA 3QHSA 3PV0A 3RUZA 2YKIA 3DGEA 2PUOB 1LTAD 3LNNA 4MPEA 3CC2Q 1VQMQ 3CD6Q 3S14B 1AP0A 1ID0A 4BS9A 5KH6A 4ESRA 3M4YA 3PVQA 5J26A 2EXZA 4CE2A 1QQJA 4R55A 4AG2C 3OY9A 4AS9A 3CBOA 1HUMA 2N55A 2DTHA 3RBBB 3CCMQ 2CH4W 1OU8A 3AFPA 3ERQA 2M9VA 5KYYB 4H02A 3G4SQ 4IFDJ 1EL0A 2YUNA 1A8VA 4GN5A 2F0WA 1M4ZA 2NLUA 2O4XA 1YEZA 3CKIB 2RD1A 1BB9A 2N3SA 1GFDA 4MDWA 4O0BA 1VQEA 3Q5LA 1J5EQ 2ZDXA 1A0IA 1WTXA 2O2LD 1N34L 4PFZA 2ECZA 3MP8A 1KD1C 4CE1A 1IYVA 3NUCA 2YXYA 1W1FA 1EIFA 4X3UA 3HOYG 2DIGA 3V7CA 3TS2A 5J39A 2FPFA 4RTUA 1GD7A 3CCLA 3FIFA 3I4NB 3D4RA 1IL2A 4BXIA 4QUFA 2WACA 4EMKB 2EZVA 4XIQA 3CAMA 4KJNA 2AK5A 3GIEA 4DOWA 5BOCA 2B29A 2NZ1D 1X56A 5G3LD 2E41A 3EH1A 2B2WA 4AYBE 1VQHA 4F88A 5I9PA 2HT1A 1JJ2P 4RMFA 3VR2A 5I4DA 3CQTA 2LT4A 4XT1B 1WXTA 4G7HC 1FL0A 4BBRG 3RKYA 3J81i 2H8MA 4XD8A 4DBQA 4BE1A 4L5TA 1YJ9A 2K5DA 1Z9FA 1ASZA 2KRSA 1VQOQ 1RODA 2AWOA 4Y7NB 2E5KA 3PCOB 2VXWA 3HRUA 4CWRA 4O5VA 4CDFC 3HFOA 3Q0AA 3EHJA 2K03A 3M4PA 1CKAA 2B63B 4EGHA 4A3IB 2I46A 3VHAA 4IPHA 1L1OC 3HZ5A 3HOWB 4IOCA 1EOTA 4RKLA 2FWYA 4RGTA 2R92H 3OS5A 1KC8U 2EJ9A 3HKSA 2L3PA 2LZ6B 3G1JA 1QZHA 2E2IB 4KN4C 2CP2A 2ESAA 2PPBC 2K3BA 1NJIR 3OSVA 3TS0A 4JI2L 5ELEA 1B07A 3X3NA 1Y8OA 1G6PA 5JJKA 2KXCA 5FWBA 2H8HA 2RI3A 4DAPA 4A3FB 2O5IC 5D3DA 1WHLA 5AT1B 4B6CA 1XQHA 3ZL7C 5IT9c 4BIZA 2DYIA 1QUQA 5J6AA 3RR5A 4BY6C 4GZYC 1O78A 3EHGA 2OTLQ 3S1RB 1A4HA 3RZDB 1G8XA 2B86A 1CFMA 3CRKC 4JI5L 4DK1A 4JV5L 1KXLA 3K99A 2AZSA 1ZYRC 1YJWQ 4A3MG 1PFSA 5M4HA 1CZGA 1N36L 4CKBA 1PYBA 2YTYA 2DM1A 4N4HA 5CV7A 2NYZD 4IUNA 2COZA 4QQ6A 2WAQB 4URNA 1VS0A 1FNUA 4OMFB 2YI6A 1YJNA 2VUBA 4EMGA 1UEAB 1QW1A 1ESRA 3KJPA 5C4XB 1FD7D 5LMUQ 1N33L 3HKZG 2JOYA 3CW2C 3GTPH 4LJZC 2PO4A 4LWCA 5JPMC 2QQBA 4DV5L 1D0YA 1KL9A 1VQ7Q 1PRTB 3EHHA 1HXDA 1GHJA 4CE3A 1PHTA 1WQWA 3EGXA 4UP7A 2OJ2A 1DM0B 4F7UE 2EGEA 2ZXOA 5C44B 1FMKA 1NE8A 4DV2Q 1XWEA 1WHJA 2KCNA 2B2UA 3KOJA 3A5UA 1G3WA 2PNIA 3A1PA 5L23A 3BZKA 3FHWA 2N49A 1E3PA 2LNVA 1JM6A 1YBYA 1DCZA 1K73R 1E2VA 4F87A 4FL6A 2WB1B 5M4KA 2RHIA 4ID6A 2Q2HA 4XITA 1OQKA 2B2WC 3H3VC 3F8TA 4P7AA 4K14A 4H13C 3THKA 4PJMA 5M4MA 4LF5Q 2F2XA 2J4XA 5HURA 2P4RA 2CVRA 3CCUQ 2EPBA 4KKTA 1TY0A 1AH9A 3NENA 5CK9A 4CWPA 1KRSA 4X66Q 2BRCA 2Z6KA 3JAME 3H9NA 2WKDA 3E9HA 1VA7A 2ROTA 4X9CA 2DNCA 2RHQB 2IWUA 2NB0A 2FYKA 2F1MA 2YTXA 3HOYH 5GANh 3V8JA 2QQRA 1VQIA 1BNZA 4NXMQ 2VB3X 5KYXB 2IL8A 1F9RA 3OTOQ 1Z6HA 3SK6A 3R93A 4J9HA 2KBNA 5C4JB 4KFGA 2KR3A 2DD4A 2ZJRA 4CWNA 1UYKA 1R4QB 2FRYA 1JORA 2J6FA 3VKIA 2ICEC 2J0TD 3DB4A 2B2YA 3RDVA 1LT5D 3ONAB 3M3YB 1X3GA 3M0RA 3BVZA 5GAMh 1KIJA 1JRIA 3PF5A 3BFMA 1X43A 4A3EB 4M78D 1KTKA 1ZXTA 3I70A 5GJVB 4XE2A 3VUZA 5JJLA 5FNFA 2CP7A 1L0XB 1MJCA 2GQPA 4YTLA 5JJZA 2QQ9A 2C0OA 1B3QA 4CRIA 3AYHB 4DR3L 4HYPA 2CT3A 5FNCA 5JENA 4JBMA 1BI3A 1C8CA 4L5GA 2QASA 1ML0D 4H0LC 1F51A 2YEBA 1M2VB 3S5TA 3H80A 1RUWA 2EQIA 5EKIA 4B3ML 2Z4IA 2LXKA 1SYBA 2X3XD 4IUUA 4O2DA 2PQWA 3M56A 2YU9H 4RHSA 1HNWL 1AHJB 1UB4A 2DJFC 2KEAA 1N8RR 5I21A 4LUZA 3T4AC 3TRZA 3GTKH 2F0MA 3S6WA 1JCKB 4BIUA 1VQ6T 3P8HA 1MSGA 2XD0A 2WSEE 2F4IA 1HR0Q 2JA6H 1QVGA 3E5SA 4XQJA 1YWPA 2V8IA 5CTXA 2SRCA 3HL8A 2CP5A 3VS6A 4OWWB 2KHIA 1WTOA 1XJWB 1PH1A 3DLMA 1NPPA 4A3MH 2EY5A 3WVDB 1Y4SA 1ENFA 2B2UC 4LF7Q 2PCFB 4NMZA 1YCYA 2R93B 1D1BA 4M75E 2D62A 4ZYSA 5M5WB 1IBLL 2PTKA 2VWCA 3IQLA 2GNCA 3MP1A 2B2TA 1UYGA 3EJIA 5D14A 2BTTA 3K59A 2I0NA 3NGPA 3L2ZA 4GLMA 3T9NA 4AH6A 4X64L 4YKXA 1CZWA 4URMA 3M4GA 4LE9A 1KRTA 2JA5H 1BGQA 1E6HA 1X9NA 4JJDA 1GUGA 1EY5A 2HDAA 3G71A 3K7AH 3OOCA 5EPJA 4FP5D 2Y0SB 4TVRA 3G6JB 2A5HA 2M2LA 2RQXA 5LJ5h 1HFGA 3R2TA 5CAIA 4GLVB 2I5HA 4EVOA 4KH0B 1MU5A 5KYLA 1Y96A 2DILA 1RI9A 1V9PA 2Z6KC 2X69A 4PJOA 3SB2A 2BU5A 4A53A 4LDUA 1GKZA 1N9RA 1B44D 1QCNA 5IN1A 1TSFA 4XTVA 4HR7B 1HR0W 5LJ3g 4XKKA 3V8KA 3SHLA 1PZKD 1I58A 2WI6A 2SEMA 4PG3A 4PZ7A 5IWAQ 2V8KA 4TRDA 4LAAA 3RLNA 3CCQT 2VYTA 4DEYA 1SXTA 1YJNQ 4X65L 4ME3A 2B2YC 3WVEB 3TZ5A 2AKPA 5ISRA 3JCMb 3PIP3 1IHWA 3R4NA 1QVFA 2H3EB 4DUZL 3UDGA 2RF0A 2XDSA 3K98A 1PC0A 3E9FA 1DJ7B 1STEA 2FEIA 1CQFA 2EPDA 3NWSA 5IGFA 4BY1B 5M5YH 1M2OA 5CMDA 1HJPA 2R92B 3V7RA 2DJGC 3ITPA 4JI3L 4H44C 4LF9L 1KQ2A 1DD2A 1HK9A 3S17H 1FWZA 2FB7A 1QE6A 2ES2A 1RADB 1JT8A 3FLGA 1VQPT 1IGUA 2KI7A 4XAXB 3G48A 2CP3A 2MFIA 1B3AA 3H6MA 1H641 4X62Q 2WSFE 1YT1A 5F3KA 1MV0B 1PNJA 4RWSC 1MNDA 4IUPA 2HCIA 2R7ZB 2YKEA 2QFOA 3EGDA 2VXEA 3C1EA 4P72A 1BCPD 1YVCA 2JYOA 4JBJA 1L0OA 3PMTA 2EKHA 3Q1JA 3MXNA 4OGEA 1GFCA 2F0OA 3D6WA 4U673 1MX0A 2IJ0A 4C56C 2E0AA 2HQEA 1Q7YR 5CV8A 4GGLA 2ROLA 2PI2E 2DPPB 2D9TA 2HBPA 4LFCL 5CTYA 4CC7A 3R8BA 3S16B 1CTMA 1NJIC 4B3SL 1MV3A 4L8JA 4EEHA 4AFUC 2CZ7B 2Z8LA 2CW0C 3D31A 1TUCA 4L59A 1IBMQ 1OTCA 4EQPA 4JYAL 3X3MA 1A6XA 4U7OA 1STAA 5FNDA 1FMVA 2F0TA 1LOJA 1TY2A 1VQ9A 5GMKj 1T5EA 3WOFA 5DM63 2BYIA 2CZ0B 3BDLA 4HKEA 5GAOr 3L9AX 1VF5C 3GTPB 2K1BA 1NPRA 3REBB 2SOBA 3RLFA 1M1FA 2R7DA 3K5OA 1MUZA 1YFNA 3FV5A 4HMJA 5L37A 2X3WD 3Q22A 4HN7A 1OPKA 1IKMA 2PMZB 4M77E 5IYCG 4R4CA 1WTRA 2UU9Q 4FW1A 3HP3A 2AMCB 5GAN5 4YWKA 1GBQA 1Q81U 2NTSA 3AT1B 1OZ3A 4PJOC 1M1KU 5EKLA 4DR7L 1UECA 2LJ0A 4M7DD 2A7YA 1UGVA 2DAQA 3PE0A 4FYYB 1Q95G 5KE3A 1PTOC 2RH2A 1D5XC 4POGA 4IUTA 2LCLA 1D2BA 2BE9B 2JM8A 1I5FA 3JC66 4S3SA 4R3AA 2B39A 3OHXC 2K14A 2CCUA 2PZTA 4M7AA 1BI2A 1XMOL 3QZ9B 1VQ6Q 1TWFH 4GN4B 1EY9A 2DEUA 5GJWB 4LF4Q 4DBFA 1K8AR 1QILA 3C4SA 4C8QA 1NBWA 2PQAB 4QQBX 3KFVA 4DOVA 2GGRA 6AT1B 1Z5BA 1Y8NB 4XU0A 1GBRA 1TIID 1UE5A 2JTMA 4P71A 3HOYB 4WJ4A 1A63A 4UPAA 2RN8A 1Z9ZA 2YYZA 2EYWA 1GRIA 1TU2B 5C3EH 4HXZA 1WHGA 3ULPA 2BU7A 1PRTD 1VQGA 4ZTJA 3B26A 1ABOA 1RACB 2WEQA 2D0NA 2K5NA 2PNHA 2YK2A 4IALA 4MMLA 5IYDG 4V26A 3CPWP 2J06A 1D3BA 1QMCA 1S5BD 3KLWA 4M75B 4I7ZC 4J1MA 4OEMB 2CWPA 1NYFA 4E7LA 2OTJA 3T13A 2C0IA 1EUJA 2K3XA 1EWCA 3A8KE 3FJPA 4NW2A 4APVA 2X4WA 1HJDA 4BBRB 1O75A 3GTMH 2HKJA 1W2BS 1QVFS 2A6ED 4KHVA 2NN6I 3Q23A 2A6HD 1C0MA 2VW9A 4BY7G 1I5BA 3A8OB 3OWEB 1LTLA 4P74A 1VQ8T 2YE5A 3D2RA 2IX0A 4IPDA 8ATCB 2DNUA 2YHTA 3HOZG 2EYFA 4PZ8A 5JPNC 1Y07A 2HD0A 1K9MC 3M0SA 2YE4A 3V05A 3NMQA 1FX7A 4PJOF 4GBQA 1KIKA 2WKCA 5IGGA 4KMUC 5GANf 1PTOF 1SG5A 5IYBH 1M3AA 2NZOA 4A3DB 2DMOA 2X4JA 3QWYA 3PUVA 5FK9C 4Q20A 2K5IA 2PYKA 5T1IA 4CBVA 5D3IB 5M3MG 2WI7A 5LL6X 1NUCA 4N0AA 3CCQQ 4L93A 2QEXT 4EFUA 4MIUA 2EGCA 3MC0B 3FMCA 2JTFA 2E6NA 2C06A 3QJ6A 2KHJA 2OXPA 1WLPB 2EAYA 4PLIA 5GAMf 2O2OA 4LUEA 1JXOA 4FF2A 2O5JC 5DM7R 3CC4A 1WTQA 2FXQA 5AFWA 4DGZA 5FU6B 2EE1A 2ID0A 2QF7A 4M78E 1OEBA 3IKJA 4OELB 1CQVA 4LK1C 4A3MB 4PJOG 4DU9A 4IUQA 3MEWA 2XN9C 4BWGB 1EZZB 1Y8PB 3J80L 1WTWA 1MJEA 5CGKA 2KDSA 4OB2B 1IL8A 4U93A 3DB3A 1K8MA 1G2SA 5ELOA 1N8RC 1W4SA 4A4KA 2HQLA 1G6ZA 1IRXA 1UYIA 1N5ZA 2RK2A 1WCMH 2DF6A 4LF8Q 2JA5B 4XU1A 4KT0E 4YKYA 3BYYB 4FYVB 3J7ZC 2MYSA 4M7AC 4J8QA 3K7AB 2HQXA 1AZEA 2NUPB 2JXMB 1GJXA 4HZ5A 3PNWC 2Z0WA 5D7UA 1I4QA 4JVZA 5KYIA 3PTAA 4DV3Q 4C8QC 1UYDA 2PVGB 2BU6A 1KDBA 1R62A 3Q8DA 2XK2A 1ZBXA 1U5KA 2KAFA 1J5EL 4LPBA 1O7ZA 4L63B 4JI8Q 4A3KG 4BXXH 2SNSA 2FRWA 4OVAA 2CH4A 3U23A 5GANd 5FLMH 1XNQQ 2XX4A 4GLKA 4YKWA 5FO9B 2LCCA 1D1KA 4X34A 5GMKe 1QWYA 3D8GA 3MEHA 4FDBA 4A3DG 4L91A 3T0ZA 2AUKA 3JB9F 1Y1VH 1WD0A 1BCMA 1B7YB 3M7NA 4WCIA 1R0CB 4IIMA 5GROA 4Z89A 3PGGA 3N5BB 5I2XA 1UAPA 4IIOA 1X3EA 3CCVT 3DEOA 4OMNA 4KJOA 3KLRA 5IAYA 2KGTA 3HOXG 3ULRB 4RG2A 1TXQA 5LJ5f 2ZPGB 5GAMd 5AJ3Q 1PVGA 2YI7A 5M5YB 3TP8A 2JMAA 1L1OB 1G3SA 1Y57A 2QYZA 3P8BB 1M90U 2IG0A 2UUAL 2YKCA 1GCQA 2XKOC 4K5VA 4A54A 1EEID 5KGUA 2RQVA 3A55A 1T3LA 2O9VA 1F2MA 1PDQA 1HRJA 4AQYQ 2IWHA 2RSOA 2P5ZX 2JN0A 1UYHA 3CC7T 2NZHA 2JA7G 2L5TA 4CWTA 3V7SA 2Q8IB 4EIKA 4FCYA 2QF6A 2RHXA 4M7AF 5GAGC 3CC2A 4JJNK 1VQMA 3CD6A 1Q86U 3ER0A 4Z8AA 3C46A 3JB9G 3STBC 4GCZA 1HSQA 4HCCA 2DL5A 2ENBA 3FPPA 4C8QF 2B63H 1LPLA 2A0FB 3CCMA 3WQ9A 2KCTA 2FZCB 1B53A 2KCCA 3G4SA 1EY4A 3MA2B 1PRMC 3OMCA 2O31A 2K5VA 3MXUA 2M1HA 2VGNA 2L12A 4K2KA 3AFQA 3MKDA 1WHKA 1BO0A 2B2VA 3DEPA 2E2IH 4E02A 1AWOA 3MXGA 2E6ZA 3GNFB 2H4OA 1K3RA 2QA4T 3QYHB 1KDCA 3EFXD 4C2MH 3EFRA 3JCMQ 3I56T 3CHBD 1JR0D 1FNWA 3S1RH 1VQ8Q 4M7AG 4RGNA 4XT3B 1ZQ1A 4C3IG 2O4XB 3FKIG 3JAMi 1F9QA 3NEMA 2O1UA 5CORA 3A0JA 2XD6A 2A68C 2A37A 4C8QG 1YITT 1MI2A 3RMHA 3VRZA 4K5WA 1YIJT 4GOPA 3A0YA 3F2UA 3E9IA 3DXJC 1X6GA 2L1BA 2GN5A 2JXBA 4KD4A 5KNDA 4QF4A 5LMUL 1SNDA 3PEJA 1TWGB 3H0FA 2L55A 3QPHA 3EIVA 3HGBA 1Y69U 4UC4A 2D0QB 1KQSP 1PZID 1HNZQ 2UUBL 5LJ5d 1WHHA 5I9OA 4K6DA 3O2FA 3R91A 3TZ0A 5M5XH 2QEXQ 5FKAC 5C4XH 1G91A 3M58A 4KH1B 1F1BB 4OWTB 4C5GA 2QDLA 4DV2L 2M0YA 2XHXA 3VS2A 1SMXA 1TWFB 5KCHA 1I81A 4PNYA 5CBEE 4GNXA 1SAPA 1JMCA 3OYGA 1YNNC 1UYMA 5GANj 4QW2A 1TVXA 3CU7A 1W70A 5C44H 2ZJQA 5EPKA 5KEEA 1LTGD 2G5DA 2MNAA 2JVVA 1AJ6A 2IOPA 1TWAB 2FFKB 3FDRA 4JS4A 1EZ6A 2EYHA 3J81L 2E2HH 2WI5A 2CUBA 2E64A 3UF4A 3JCMW 1KC8R 4DXGA 2YKBA 3MO8A 4ZNXA 2K04A 4KHPQ 3NTHA 2L2PA 1ZUUA 3WWVA 1W6XA 4JC0A 4X66L 4IPGA 5D6WA 1KHCA 4I65A 2OTLA 2DKGA 3KJOA 1GCQC 2UWDA 1YWOA 2LTOA 3ND9A 2YEFA 2I5LX 3CXCP 2VL6A 4PL9A 2DEQA 4QIWB 4NXML 3VYRA 3GTMB 3OTOL 4F7UF 1U9RA 1IBLQ 4AMCA 1Y8OB 3M4OB 2ZM6Q 4P73A 1K8AC 4WF2A 2EDGA 1D1AA 3EHQA 2M9UA 5GAN3 1SPKA 1Y14B 4IKFA 3ND8A 1QUQB 3CBPA 1U4RA 1GOZA 4CWOA 1YC4A 1QOHA 2WAQE 1ABQA 4NH7A 1KFZA 3WOEA 4IURA 1RLPC 2HL3A 5A0DA 1AZPA 1K83H 3C2PA 2L3SA 4KGXB 2PZWA 5AYFA 1LO5D 2MOXA 1CT1D 2AZVA 1VQ7A 1EY0A 3H6ZA 2C1GA 2NVYB 2PZUA 5IHNA 3UA6A 2DL3A 3UT1A 1WJQA 1IYUA 4JW0A 2FYPA 3P7JA 1ILPA 1EQVA 2AKLA 1KD1U 2VWFA 3FPUB 1EX4A 4KTAA 4F8MA 1EA6A 4MP7A 2DY7A 2H3JA 4OGQC 1X75C 5FU7C 4AT1B 4F7UG 3CCST 1A3TA 2JA9A 3X25B 2WIIB 3M9BA 3CCVQ 4A3GH 2BU8A 1GJVA 4LWEA 4M75D 2VXFA 5EG2A 4LWFA 3UATA 3BVMA 1YSRA 3G7BA 2EXLA 4RCBA 2MWOA 2WB1E 3EGXB 2VQFL 2E2DC 4N8X1 4MPNA 1IHZA 1Z5AA 4A4IA 3CCUA 3IFTA 3O13A 3DWPA 1F2LA 3A7LA 4DR6L 4NDXA 3CC7Q 3QG1A 2HIXA 4HIOA 4NH9A 3J80c 2ED0A 1AN8A 1NG2A 2FTKA 5CKFA 4QQDA 2VUMG 4BB7A 5LJ5j 3A0XA 1BBUA 5CR2A 2MO0A 3Q5JA 1LABA 2PVOB 5CPHA 1QZGA 2RF4A 3SXHA 4LF7L 2IHEA 3MAQA 3A0TA 3TDQA 3JRZA 1CM9A 4GNXC 3SGIA 3GQBA 5A0LA 4FYXB 1GUOA 3N52A 1M9SA 4HA8A 1OU9A 3GD7A 3OSOA 1QP2A 1QWEA 2RDGA 3NFCA 4J9EA 2RHSB 1KAWA 4HVVA 5HK0A 4QY7A 2AKKA 2KA7A 4O07A 3OYHA 5C5LA 4LP0A 2LJ3A 1M3BA 1YHQT 1ASYA 2R93H 5M5WH 2OAUA 3CYGA 1OX9A 2CT4A 4WJWA 4ASFA 1ZLMA 3BMYA 2KT1A 2K28A 3TP7A 2BZ5A 1WGSA 1QVPA 2X35A 1V8QA 2CCZA 3PO2H 1WJRA 2Z1CA 1RCVD 1SJHD 4YKZA 5I2MA 2VQEQ 4X9DA 3OW2S 1PKSA 2WV6D 3BDCA 1WI5A 1Y1VB 4C92E 2WERA 3RR6A 4XKAA 4DUYQ 2K3YA 2BTZA 2HKQB 4RCOA 5LMNL 2A74C 4OONA 4FSSA 2MCNA 4ZN3A 4C5IA 2F5KA 1ONLA 2DVJA 1YITQ 1Q12A 4KV6A 1IB8A 1NR4A 4Y92A 5KYUA 1YIJQ 1CSPA 3VV0A 5GAOn 1KNAA 2I2LA 4CJ2C 3ULLA 4LUDA 3CMET 4JQLA 3D7SB 3BZCA 2XU8A 3I55T 2ZJPA 1BBXC 1S3OA 1PH3A 2IPOB 4TVAB 2EOTA 4U68A 2EIFA 4A93H 2RK1A 1VYTA 2KQ3A 4AIMA 2DIQA 2L3RA 1QKWA 1KDAA 1SDFA 2WI1A 2ZDYA 2GFUA 2JJCA 3NPFA 2GBQA 3DM3A 4A3CH 1SE3A 3MNRP 4NKLA 1YT2A 4OL7A 4FCRA 1C48A 4DR4Q 3D36A 4Z02A 1SNOA 3N6RA 1ZUKA 3AMUA 3FB9A 4G57A 4J7FA 1GHKA 1MSHA 2K05A 1WJJA 4DR1Q 2PUKB 1FYCA 2BE5D 2XRSD 1NBEB 3VS7A 5GANe 2XTIA 5JVG3 4B9WA 1Y1WG 3I4MG 1RLQC 4BY7B 4J6WA 2HEQA 4BY1H 4RCNA 1VQ4Q 1BR9A 1II3A 1SBBB 3OBWA 2BE5C 1UUPA 2K75A 3HOZB 4ZKIA 2L15A 5BN5A 1S1NA 2JT4A 3CP0A 3K97A 4JPBW 5C4ZA 4TSSA 1WFQA 1OSFA 2X4XA 3Q5KA 1STHA 3SWNA 1X32A 4LDWA 2WI4A 1S72Q 3I5RA 1O9SA 5IDJA 5E1FA 5M3MB 2CKZB 3MP6A 9ATCB 2KENA 3UDFA 4C2MB 2BH8A 1NEGA 4K5XA 2Y0SE 4YHHL 5EPLA 1OV3A 4F17A 3OS2A 2R7ZH 4M77D 4KGZB 4OX9Q 3HS0C 2FXSA 3KF8A 3HTRA 3A8JE 4O09A 1TOVA 4C3JH 2VW5A 4JI1Q 2IX1A 1IBML 3FT5A 3OYAA 2X9HA 4KD3A 2G9DA 5D6PA 3PUYA 5FRNA 4CWFA 1P92A 3OMUA 1U1SA 4KY7A 2RHUA 3H0HA 4FSXA 5A2QE 3EBEA 4Q0FA 4JI7Q 4A3LH 2AIRB 3S16H 1W6KA 2Z6BA 3EHRA 4H85A 2D8JA 2M02A 1E1TA 4MNOA 5M3FG 1Y96B 3I5SA 1FJGQ 1NHJA 2YE6A 3CBMA 3L3OC 1YZ6A 4AG1C 4PJOB 1HH2P 5G3LF 4Y52H 2O1WA 3UWNA 4URLA 2QDYB 5M5XB 1PTOB 4R4QA 5J1ZA 1PYWD 2C5CA 4PMWA 1YS3A 3CCRT 1YCSB 4J5YA 1TT2A 2LDMA 2X4YA 3PQIA 5IP7G 1Q8IA 2AWNA 2EQUA 3EFOA 4TQUS 4YIJA 5JEAG 5DLOA 1ET9A 3CCSQ 2UU9L 1VMPA 2WFWA 1K4US 2P4TA 1EY6A 2KECA 2ATCB 2KY9A 4R56A 2ZXRA 3K80C 4ZKBB 1YNXA 1BXDA 2QG2A 1YN8A 5CV9A 3AEVA 2VASA 4PMBA 3QWXX 3HOVG 4YKUA 5GAN6 1VQFA 2YEDA 2K7VA 2BSMA 4JI6L 3VA7A 1NEBA 4POFA 1K8GA 2DA9A 1WFWA 2E2HB 1WJSA 1I6HB 3QTFA 3L42A 5IGCA 2K79A 2XDXA 1HHVA 2KT8A 1GXIE 3OIPA 3RLRA 1U4LA 4LF4L 1BU1A 4N9PA 2YE3A 4YWMA 4JOIA 4LW1A 2K32A 4J9FA 1JJ2S 3MVVA 1VIFA 2F2WA 3HFNA 4LFAQ 3BDUA 3S15B 3NXWA 1E22A 1PH6A 2DETA 3T2SA 1RAEB 1X3QA 4AWQA 1NHHA 5FW9A 1XOVA 5LJ5e 4CC2A 1N9SA 1QVCA 1SLJA 2IHFA 3MEAA 5IHIA 4MHEA 4W7TA 1P16A 3RKZA 5M4PA 3E6ZX 4HVWA 2YJXA 4LFBL 2K5FA 1H9JA 2F69A 4MTNA 5EBCA 1T9HA 5IP9G 2N8NA 1KC8C 3EGDB 1NE3A 3OYFA 1TS2A 1MMDA 2CS7A 1LVKA 4DXFA 2E3HA 2CGHA 1OXXK 1T0JA 4OB3B 4X1VA 1X27A 2DN8A 1K83B 1QNKA 3I73A 3MXNB 4X3KA 4AWOA 4II1A 3I7FA 1DOKA 5FRMA 1BBWA 2FZKB 2N78A 3NWTA 1B34B 2E70A 2CYZB 4EQ5A 1IYJB 2YI5A 3ZXQA 2HHIA 2A36A 4I5SA 1PYSB 5HK3A 5FO8B 3SWNC 1JE4A 1YP5A 4BBRH 2UXDQ 1ZWHA 3GIGA 2LQNA 2JNGA 4XQ3A 3OBYA 1FGBD 3NBIA 4CKCA 2FPDA 3SEMA 2HUGA 2JA7B 1QY8A 4QB4A 2PMZE 1V1CA 3VUBA 4ABNA 5FLXL 3VHDA 1SHFA 4A3GB 3TBIB 4ZVIA 4C92B 2D5DA 2RDFA 4DK0A 5IIFA 3R2IA 1CKBA 5ELDA 4P8OA 4M78C 3CMEQ 1Q82C 3VYSA 4R8NA 3G7EA 4DZYA 1LYLA 1WI7A 1WQ7A 3I55Q 1TUGB 2CWAA 1Q81R 1PHJA 3LH5A 2CSQA 2EYYA 1VQ6A 1M1KR 1B9MA 1P8LA 2YWWA 2LSSA 4QMGA 2ATWA 1EI1A 1VQ5T 1G5VA 1S4ZA 1STNA 1X3FA 1XXGA 3T0HA 2XDPA 1UYFA 1JBMA 4XIPA 4J9BA 3J80E 1Z59A 3GTLH 2BOSA 3GP7A 3L2UA 4V25A 1BIBA 3M0PA 1Y7XA 3G7ZA 4XTXA 1TKWB 2EY6A 1C0AA 1STYA 4J9DA 3RLQA 3URYA 5C3WA 2P0PA 2YRDA 2ENMA 4M7AB 1H7UA 4NPSA 4C3IB 1I94Q 3M0UA 2GQVA 3JSCA 2F0KA 2MJ8A 4KP4A 4LWGA 1AVZC 2EYXA 4CC3A 3OYEA 2D6FA 4C8QB 2FO0A 3FC3A 3PF4A 4LF8L 3OW7A 5IH2A 4HSVA 3S9WA 4QGUA 2JEAI 4HY6A 4E01A 2JSOA 2R3ZA 2F0JA 5CYUA 4RUGA 1LTSD 5M3FH 3LMMA 4HY1A 3M9QA 1HD3A 2XVSA 1H9RA 3VR4A 1AMWA 3H0GG 3PO2B 4K0KQ 1D0XA 1OO9B 4JOIC 4QL5A 5GMKm 4DV3L 1EIYB 4K4OA 3TSWA 4O04A 5E3FA 1UYLA 3R4OA 3HG9A 1D3BB 3A0WA 3K0YA 3M7GA 4OB0B 5JEAH 1BK2A 3TP6A 3QB3A 3QJYA 3S1QH 3EKOA 4M78F 4JI8L 4FIBA 4DR2Q 3K5LA 4CWSA 1NR2A 3OYKA 1ZKOA 3ZEHA 3K8AA 1CKOA 3PEHA 2R5AA 1XNQL 4JRPA 1YNJD 3HFZB 4CJ0B 1WPYA 2LC4A 1UUEA 3RNJA 1PG5B 3OSSC 3K0XA 3X24B 1NJIU 2K01A 1C4QA 3CCQA 5CIUA 1AE2A 3C95A 2J6OA 3KK7A 4CDCC 3PO3G 3JB9J 2Q8TA 4HTHA 1EU4A 3M5AA 1QVGP 3EH2A 4KLKA 4A93B 2DLPA 4M7DA 2BE7D 4ZUJA 2QDBA 3CCRQ 2N88A 4C1NI 2MGSA 5C0XI 2ZCFB 4BI3A 3LX7A 1EU3A 3CGYA 1EQTA 1ESFA 4X9LA 4JBKA 5AJ3L 2IT1A 3U2KA 2BA0A 4CDDC 5C0XG 4HJ7A 3T56B 2NWGA 3OYMA 4DR5Q 1YETA 4E2FB 1VMCA 2BDOA 1PH7A 2KYBA 1W2BA 3OPDA 1GCPA 4GKKL 4CJ1B 2P0QA 1N34Q 4M78G 2FZGB 4AQYL 3SDZA 3GTGH 1VQPA 4DK6C 1K8OA 4EGIA 3HOUG 2K5LA 5D6YA 1PD0A 4FF3A 3SL2A 1ACMB 3VS3A 4BD3A 3RMQA 4PNOA 2L3QA 1EQRA 4EPCA 5CV4A 4AFSC 2CP0A 1VQLT 2KVMA 3JCMh 1LTBD 4M1UB 4XQQA 1G2BA 2B8GA 4E7SA 1S16A 1UE6A 1D1IA 1N9WA 2KOLA 5BN3A 4IFDI 4WTOB 1TUDA 2LX7A 5FROA 1VQKT 3HKZE 1S14A 4N4IA 4XC0A 5IT9E 1O80A 2MF2A 5IY0A 3A8HB 2RJCA 2MI6A 1OULA 3T1HQ 1SE8A 1LCKA 4J7IA 1LT6D 4C3JB 4GKJL 2GCXA 1TR5A 1ICFB 3J81j 2DRMA 4DNRB 2YUQA 4N4GA 1BCPC 3VS1A 2F0QA 5ECAA 1F2YA 1XMQL 2NVQH 2Q2IA 3G6ET 2DVEA 3KF6A 3QOLA 4KN7C 2GTJA 2WSCE 2AUJD 1QVFP 3FP9A 1EYAA 5IOCA 1UGPB 1AD5A 2BZYA 5HCKA 3M53A 1TS9A 4HCEA 4MZTA 1TWCB 4K8IA 4JI2Q 2SEBD 5EAYA 5CKDA 2DGYA 1SNPA 2GTOA 2EQSA 2VUMB 3O6OA 1PKTA 1UFFA 1HNZL 4ANJA 2FMCA 3Q6SA 3QWNA 4EX5A 2XHRA 3BE3A 3QO3A 1K9MU 1AFPA 2LT1A 2KHSA 3TZDA 5GANg 4J9CA 3MEFA 5EGTA 2EVBA 2PVDB 3A56A 3DWQA 1EFNA 3H15A 3PVLA 3CWVA 1JE5A 3OQ5A 3BG3A 4MZ9A 4HYMA 1TWGH 3QO2A 2E3IA 2CZ1B 2J7IA 4JJCA 4ZLTF 2FHDA 1VQ5Q 2HG1A 5FWKA 1BVSA 3M54A 1C1AA 1N36Q 1WTHA 3K81C 2JA8G 2KRNA 4XKOA 1DJRD 4DBRA 1VQNT 3H3VH 4G7OC 4M7DC 2K2VA 4YCUA 1WTPA 5GAOm 4HEDA 2CSIA 5GAMg 5GAN4 1RF2D 2X6LA 3PGZA 1WTVA 1Q86R 2M16A 4HCZA 3ZBDA 3GO5A 1HNXQ 4BBSG 4KHPL 2OX7A 4DK3C 2JK8A 1I5AA 1BCPF 5DEHA 2BYHA 1TWAH 3ASKA 2D1XA 3HYYA 2ZPEB 3K57A 4R4TA 2F1LA 2XK0A 2HKNA 1K73C 4DN4M 2DD5A 4A63B 2KSSA 2E8GA 5J71A 4E7IA 2HIVA 2IVWA 1QB5D 4KKUA 4RA8A 1AOJA 3MEVA 4DNTB 2ZM6L 4HJ8A 2CKKA 3E2UA 2KMTA 1VQ8A 2JMCA 4K2LA 1PRTC 1MIUA 2V1RA 4D8KA 2YE8A 2F0NA 3S1NB 4I7AA 4O0AA 4PQXA 3OWFA 3M4OH 1WX6A 3I4NG 1QCOA 2HAXA 2QAZA 2QXFA 2XDLA 4GEEA 3P20A 3PUWA 4XCLA 3DWAA 3KE6A 2I07B 5FU7B 1LTID 2DY8A 2XSCA 1LUZA 2A6EC 2NN6G 3C0EA 3S3MA 2EY1A 4ZAIA 5FLXc 2A6HC 1Y1WB 3IAYA 4XK8E 1PFBA 3V8LA 4NXNQ 3B6YA 4FCQA 1EYCA 2QEXA 4RTXA 4V0BA 3VS0A 2XRQD 3KYHC 5E7NA 4XXEA 4LNQA 1UGQB 2JP1A 4A3BG 4JBWA 1PSEA 3GF5A 3UDIA 3META 1JU5C 2YGEA 2BDNA 4GOPB 1Y4UA 1OPLA 3I3CA 2NVYH 3JAML 4M7DF 2HHHQ 2FVUA 3EG1A 2YECA 4UP8A 3KUFA 2AHOB 3AQQA 2YE2A 4HJAA 2QEJC 3ICEA 2DJZA 1SSHA 2XDUA 4OGCA 2FPEA 5I2YA 2PU9B 4DV6Q 4DV7L 3GTLB 4E7JA 5GAOp 1FGUA 4OO1I 3HOWG 4DAMA 1C9OA 1BKNA 1SKUB 1U4MA 4PU9A 4KI0A 5LJ5g 5J3BA 3NHHA 3SHWA 4R3MA 4BE0A 3VYUA 3U2DA 3ZKBA 2MO1A 3OB9A 1QWFA 2P84A 1Q90A 4GNXB 2RCFA 2BREA 1Q81C 1UG1A 4ILWA 2YEEA 1JWSD 4A3FG 1VQLQ 1N32L 5GAN7 2VCJA 1UHCA 2YRCA 1NYGA 4PV1C 4ULLA 4HMIA 5C5MA 2EFIA 3BYTB 1VQPQ 1PRTF 1V43A 2JS2A 4C92D 3DMUA 3CQZB 5M3FB 4LXCA 4FXKC 4QIWE 3MWYW 4HT8A 5GAOq 2CCTA 2EYJA 2RI5A 1VQKQ 2K5QA 3URGA 1B1ZA 4M7DG 4MTKA 4RG8A 2D0PA 3T51B 4F7UA 2H5XA 3GV3A 1X6BA 1STGA 4ELYC 4RTZA 2KUMA 5T1GA 3C1FA 1YI2T 3HKZB 2R5MA 4DV4Q 2CCSA 1E0BA 3K58A 1A2TA 1GVPA 3S1QB 1SF9A 1UGRB 2E12A 1EOVA 1AWXA 3NHNA 1M5Q1 3TSZA 1HFNA 1X69A 1HZAA 1SROA 1SMYD 1F9SA 3X20B 2LQWA 1RTOA 2OT2A 2C9OA 5FWCA 1JOOA 3HOVB 4JS5A 3FRNA 2RHZA 3QDRB 4R4OA 2AQ1B 5IYCH 2VQEL 2UXBQ 5DY9A 2DJQA 3VJPA 2RQTA 2A19A 1I0CA 2DTIA 1HTPA 2NBFA 2D8HA 4DUYL 1KQ1A 1UGSB 1B63A 1HA5A 4RGOS 2YLBA 3S1MH 3P75A 2B3GA 3S24A 3LGFA 3QBYA 3CCVA 4D6WA 1TS3A 1QCFA 3CPWS 1I5CA 1EWIA 5NUCA 2RO0A 3KXTA 2AKWB 4HCSA 3TMEA 3VADA 3OA6A 1KD1R 1I4HA 1AH6A 1M27C 1PRLC 4FM4B 4RAUC 1XPUA 5BR8Q 2A69D 2G9HD 5KNCA 3A0ZA 3PMIA 2XDDA 3F2DA 2O01E 4IO9A 3GIBA 1TTHB 2JJ9A 2WINB 3GTGB 3HHTB 3VYGA 3CC7A 1WIEA 5FO7B 3PIOA 1A0NB 2KEEA 4YKTA 5HGTA 1UJYA 1E24A 2NUZA 2BZ8A 1CI3M 1SEBD 4DR1L 2F3WA 2QGFB 2XJGA 1H9SA 1VQNQ 3TSSA 5IYDH 2XHTA 1K1ZA 1H7SA 1LACA 4XYQA 1U0ZA 3HOXB 1A3VA 4GQTA 2L8DA 1VQJA 3A8LB 4NL3A 1VYUA 2L4NA 2ZPIB 4BA2I 3RESA 4BY6B 1JQYD 4FW2A 1SYCA 4BY7H 3R92A 4PMCA 1KHIA 4L5SA 4HVUA 3J7A5 2QA4A 2GF7A 2KEDA 3HOZH 2EVRA 2HZYA 2A73B 2NN6H 1G3TA 5JEAJ 3EG2A 1BYMA 4UHVA 4LNPA 3I56A 4RKBA 2NVQB 1KJWA 4OX9L 3NTKA 3NQIA 1MD2D 3TP5A 5K36G 2IWXA 4NOYA 1T0HA 4XTWA 3CCJT 3IFDA 1GUTA 1OYXA 2RQRA 4QJFA 1ZXMA 3FDTA 3A7AB 2YGAA 4KSGA 3GPLA 5M3MH 4BQGA 5DLQE 3JCMf 2NUCA 3UDXA 3L2PA 4JI3Q 1GKXA 3QXEB 4RMOA 1EQQA 3NBHA 1YITA 2YUPA 2Z9HA 1YIJA 4JI7L 1K8AU 2LQ8A 3HRZC 2I0QA 2O1VA 1RL2A 1M30A 3A8IE 2QILA 2B8AA 1FJGL 3QIAA 1IKLA 2XX2A 5EBDA 1IW7D 4A3JG 1ET6A 1Q7YC 2ZXPA 3L2RA 4M75A 3A74A 1TC0A 2K5BA 4V190 2YE9A 3LW5E 4ORZA 3IL8A 3WXMB 3RMSA 2OAWA 4ZTFA 4AYBG 1IGQA 5LHY1 3H91A 2DRKA 4PJJA 4B3RQ 2DO3A 5ELNA 1WOCA 4FYWB 5KYUB 4J9IA 2IPKD 1Y71A 1UE1A 1X55A 2JUFA 1PTOH 4ASBA 3R4MA 4DEXA 4B3SQ 4XTYA 2YK9A 3HHUA 1SJED 2OQ0A 2IY5B 2KQWA 1A62A 1V1OA 4LF6Q 2K50A 4A4FA 4O05A 1I4RA 4F7XA 3HEJA 1K0XA 1VQ4A 4DAYA 2DXTA 3EG3A 3EG9A 3J7AF 4FF4A 4MN3A 2YKJA 3OW2A 1AM1A 1JQQA 2KCMA 3OIQA 1KLUD 4ZQ3A 3C12A 2ED1A 1I6HH 1QNUA 1HUNA 4LFAL 1S72A 1F9PA 2E74C 2M0OA 3EFSA 3JCMV 1NLOC 3OYLA 2MUYA 1I59A 5GADC 3U9SA 2JQOA 5KYNA 3EAEA 2QGGA 1R8OB 1LTTD 5GAMj 2GQIA 2BCOA 1OXSC 5KYWA 4H7BA 4DV1Q 3A8MB 4ZGJB 2SNMA 4A3KH 2C1IA 3S15H 1I4XA 1VQOT 2E75C 5IXBA 5GMKh 4RFBA 4DR7Q 2F0LA 2KVQG 2QQSA 2QTVA 4J83A 3SWNB 3PFSA 1YI2Q 1KAAA 5EJWA 5A35A 1R9TB 3JCMd 2XJJA 4ME7A 4PZ6A 2LVMA 4ME5A 2OQKA 1BDOA 1UHFA 3GP8A 2CREA 3R6NA 3AU7A 3KF8B 2K33A 5FLXE 3INZA 4O42A 1HQRD 4A4HA 3HOXH 2UXDL 2DTOA 2VKNA 4PRXA 4PJOE 3Q24A 2NTTA 4CWQA 3H8ZA 3MHBA 3CCSA 1ZHIA 4FF1A 1MBYA 2ZBKB 4GFNA 1AZGB 3LNUA 1X54A 1PVOA 5GAOl 3EN2A 4R0KA 2ASBA 2NUTA 3JAMc 4WFN3 3HRTA 3GTOB 4YKQA 2EYOA 2JA7H 2EJGA 4GLXA 4OMLA 3U4ZA 3J7AV 3GV6A 1H9MA 3DUZA 2R92G 2PI2A 2R58A 3JB9H 1GKHA 3EFOB 1YJWT 2L0CA 2EYQA 1VCIA 1AZQA 2HQHA 1SNMA 3HYZA 4RHRA 1DZ1A 2W10A 4OMQA 4F16A 1TXYA 1I4K1 1TBWA 1WA7A 1DYQA 1V29B 2F0EA 2DXCA 2RCNA 5DNFA 4ZN1A 3QYGB 4M75C 4LD9K 1HTLD 3TN2A 1FMWA 4EQNA 2IIMA 4B7PA 2H1EA 2E65A 5KIXA 3AHUA 2E5QA 1HR0L 3CMAT 2XNAC 3WHAA 1KK7A 4DV0Q 4QVCA 1KQSS 3QZ5B 2P0KA 1M8VA 5TSSA 2E5LQ 5K36H 1YT0A 3I2ZA 5IDMA 1PH9A 4K8JA 4UROA 3UE0A 4LWHA 3CCET 1TH7A 4RTYA 5HY6A 3U58A 1S5CD 1TQOA 5CCAA 1QJOA 4R1JA 3GTJH 2RBMA 2K7AA 3UDCA 1WYDA 3S2DH 3B24A 4M77A 3LGJA 2YDLA 4XCJA 4J6XA 2DERA 1IHVA 1YHQA 2KBTA 5CR3A 1AWJA 2G3RA 1ZSZA 2DL4A 2OI3A 4C3IH 3FKIH 3PUXA 2HDMA 4ZGDB 4UY8C 1XNRQ 2Q2EB 3ZXOA 4ODGA 1RAFB 4HCKA 4FNFA 1WVLA 2CDTA 2EKOA 4PLLA 1ZA2B 3M59A 1K0SA 1CHPD 1RJTA 4RG1A 2UXCQ 5C0XJ 3K5NA 2JS0A 1OXTA 1S5ED 2QA4Q 3CCJQ 1U1TA 2HNIA 3VR3A 5IN9A 2HMAA 3S1MB 1H95A 5EC7A 3I56Q 1VF7A 1VQDA 4DR2L 1IBKQ 2E10A 5C6AA 5H1SE 3FVQA 2GFDA 1PFMA 1TWHB 3U9OA 2ZPBB 4A3DH 3CXCS 3CMEA 3U50C 1JJ2A 2XIDA 3ZKDA 5I6WA 4XTJA 3EROA 5FU6C 4PFOA 3I55A 5JAVA 4FYDA 2VB2X 1O7IA 1H8KA 3DM1A 5CV6A 3GIGB 1X01A 1EZ8A 2UUCQ 4BBSB 1UDLA 4JRKA 4M75F 3M55A 5IWAL 4GS3A 3T53B 3U67A 3W1GA 2QI2A 4HCBA 4UDUC 3BM9A 4KULA 1MHWC 2LP5A 4KY5A 4BACA 3D0BA 2VGMA 2HBWA 4DR5L 7AT1B 4JI4Q 2JJQA 4JDSA 4N9TA 4L94A 4YKRA 3OPOA 2RJEA 2JKIA 1D5ZC
chains in the Genus database with same CATH topology
2ENMA 2BU7A 3B25A 1H7UA 3B26A 1ABOA 3M0UA 3NMZC 2WEQA 2D0NA 1QZRA 4LWGA 4KP4A 2YK2A 1AVZC 1ZUYA 3REAB 2EYXA 1EI1A 4CC3A 2YEJA 2J06A 4XDMA 2FO0A 1NYFA 1I5DA 1UTIA 5IH2A 2C0TA 3G75A 2C0IA 2CUDA 3LPSA 4E01A 4EGKA 4HY6A 1HJDA 2HKJA 3C11A 4HY1A 4RUGA 5CTWA 1YC1A 1I5BA 1HD3A 2ZKJA 2IWSA 2YE5A 1AMWA 4K4OA 3D2RA 4GT8A 4O04A 2DNUA 4LN2A 3TSWA 1UYLA 3R4OA 5M4NA 2CGFA 3A0WA 5L3JA 3M0SA 2YE4A 4FPPA 1BK2A 3NMQA 1KIKA 4GBQA 3A98A 3EKOA 1U3OA 4CWSA 1M3AA 3INXA 2J6KA 2DMOA 3QWYA 2YGFA 3PEHA 4Q20A 3TUHA 1ARKA 5GGZA 1SEMA 2YEAA 1UUEA 3RNJA 2YJWA 4QPJA 2WI7A 2RMOA 3EGUA 2C2AA 2J6OA 4L93A 1OOTA 3RLPA 2XMFA 2YE3A 4EFUA 1G83A 2EGCA 1TIDA 2LCSA 2DLPA 4HXWA 4AFZC 2O88A 1Y8PA 2ABLA 5CTUA 1WLPB 2QG0A 1WXBA 4JJBA 2O2OA 4LUEA 1THNA 3CGYA 1JXOA 3HZ1A 4X9LA 3R92A 1E7OA 3I35A 3U2KA 1J3TA 1OEBA 2YEGA 1YETA 4ASAA 3OPDA 2KYBA 1H3HA 1GCPA 1YNZA 2M51A 5D7CA 2DBKA 4EGIA 3I9QA 5F5RA 2BZXA 4QPKA 3TTZA 3SL2A 3VS3A 4U93A 2IORA 2HCHA 1UY8A 2L3QA 4AFSC 1UYIA 1N5ZA 1G2BA 2DF6A 3GBQA 4YKYA 2L0AA 4Z88A 2BT0A 1TUDA 2LX7A 1AZEA 4HZ5A 1S14A 1NLPC 4XC0A 1U5SA 5D7RA 2NWMA 4JAVA 4JZ4A 2YEIA 1LCKA 1UYCA 1UYDA 2BU6A 1VYVA 3EHFA 2FWZA 2XK2A 1I1JA 3H0IA 3HEKA 3B28A 4LPBA 4MPCA 2Q8HA 2DRMA 3EG0A 2YUQA 2FRWA 1TH8A 2CH4A 3VS1A 3U23A 5ECAA 2XX4A 4YKWA 4KRTA 4L91A 2EGAA 3T0ZA 2G6FX 3T10A 2GTJA 4L8ZA 4WCIA 4IIMA 4Z89A 2XCMA 1AD5A 2BZYA 5HCKA 4MOTA 3H41A 1QKXA 3ZM7A 2PZ1A 4IIOA 4BAEA 1CSKA 1SRMA 4OMNA 5C93A 2Q8IA 2KGTA 2GTOA 3ULRB 4KQVA 3O6OA 1PVGA 3EHHA 1PKTA 1UFFA 2YI7A 4V26A 2JMAA 2YKCA 4WUBA 1Y57A 4XKKA 2XHRA 3B27A 1GCQA 2RQVA 2KE9A 4J9CA 3CWVA 4RTVA 1T3LA 2O9VA 2K6DA 1EFNA 1ZX6A 3PVLA 3CRKA 4KSHA 4WUCA 2YE7A 4HYMA 1UYHA 4XIRA 2MIOA 2J7IA 4JJCA 4CWTA 1B62A 4EIKA 2HG1A 2YKIA 5FWKA 2QF6A 3DGEA 4QT7A 2EYZA 4MPEA 4NH8A 2KRNA 4Z8AA 4XKOA 1ID0A 4GCZA 3C0CA 4ESRA 1HSQA 3PVQA 2DL5A 2XDKA 4CE2A 4JAUA 4AG2C 1WYXA 4AS9A 3WQ9A 2CSIA 3RBBB 2CH4W 1UJ0A 5D6QA 1PRMC 2O31A 4DUHA 2YUNA 1K9AA 1I5AA 3VHCA 4E02A 4O0BA 1BB9A 3UA7A 1AWOA 1GFDA 2D1XA 1YERA 2BYHA 3HYYA 3Q5LA 4JASA 2ECZA 4CE1A 4A63B 5J71A 2DBMA 3A0RA 1W1FA 4FCPA 1AOJA 2FPFA 4J9DA 4RTUA 4PRVA 2O9SA 2JMCA 1YC3A 2LMJA 2KYMA 4XIQA 2V1RA 4D8KA 2YE8A 2AK5A 2O1UA 3GIEA 5BOCA 1WX6A 2XD6A 2XDLA 2A37A 4GEEA 2YUOA 3VRZA 3A0YA 4XCLA 3CQTA 3KE6A 1X6GA 1UY7A 1WXTA 2JXBA 2H8MA 4XD8A 3IEDA 1AEYA 2YT6A 2KXDA 3PEJA 3H0FA 3C0EA 1ZSGA 1PWTA 2KRSA 3VRYA 4RTWA 2Q8FA 3R91A 3O2FA 4FCQA 3TZ0A 4RTXA 2E5KA 3VS0A 4CWRA 2WI3A 4MB9A 2QDLA 1YESA 3EHJA 2M0YA 1CKAA 1JU5C 1ZBJA 3VS2A 1Y4UA 1OPLA 2XHXA 2YGEA 2DL7A 3VHAA 4EGHA 5BODA