2CH4A

Complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
320
structure length
320
Chain Sequence
GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLTLAIIQALLVKVNNLVYAIPIANIDTILSISKEDIQRVQDRDVIVIRGEVIPVYRLWEVLQIEHKEELEEMEAVIVRVGNRKYGIVVDDLLGQDDIVIKSLGKVFSEVKEFSGAAILGDGSIALIINVSGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/chemotaxis
molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Reconstruction of the Chemotaxis Receptor-Kinase Assembly
pubmed doi rcsb
source organism Thermotoga maritima
total genus 72
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01584 CheW CheW-like domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ch4A02
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2ch4A03
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2ch4A01
1UGVA 2GBQA 2ED1A 1UYMA 1K1ZA 4EEHA 4YKZA 1T0JA 4CC7A 1UTIA 2ENMA 1OOTA 1TBWA 3ZXOA 2ABLA 4AFUC 2BZ8A 4OMNA 4BQGA 4YKQA 4HVVA 3EHRA 3T0HA 2BU5A 2JM8A 4IIMA 1AH6A 2HKJA 4KP4A 4CWRA 3CWVA 1YT0A 2WI6A 4AG1C 2DF6A 1BYQA 4KQVA 2J6FA 4P7AA 2PZ1A 4LUDA 2AKPA 4MPEA 2HBWA 5IN9A 2GQPA 4MOTA 2O9VA 2O1UA 4AWOA 2M51A 1YT1A 1NYFA 4E6RA 4F17A 3R4MA 4W7TA 2L2PA 1T3LA 2FYPA 4URMA 2LJ3A 2K9GA 2HG1A 2C0TA 2F2XA 2XX4A 5HCKA 2EW3A 3M0RA 4X1VA 1KFZA 4I3HA 2RF0A 1BU1A 4OMOA 1NHHA 2K5BA 2K7AA 1ZUUA 3RLPA 5M4PA 2KRSA 4OMPA 2XJJA 3GIFA 4PU9A 4GLMA 1K0XA 2HCKA 3UA7A 2H8MA 2LNHB 2IORA 4OMMA 1K0SA 4HZ5A 1Z9QA 3M0SA 1M3CA 4FCPA 4CE1A 3PVLA 2KGTA 4XKAA 2KYMA 4RTZA 3EKRA 3IEDA 1JXOA 2LX7A 2YEFA 3ULRB 3LNUA 4X9LA 3G75A 2VCIA 1M3AA 4LWFA 4JAUA 5IDJA 1PRLC 1TUDA 4CE2A 3O6OA 4O05A 2FPFA 3GIGA 4WUCA 2KXCA 1WI7A 2JW4A 3QWYA 4O09A 2MOXA 2YEBA 1MUZA 1M30A 2CCSA 3ZKDA 2YKBA 4AS9A 2V1QA 4XTJA 1W70A 3R91A 2FXSA 3C0CA 1ZX6A 4E02A 2EGEA 2LP5A 2W10A 2YT6A 3REAB 1W1FA 4EMVA 4L93A 4YKXA 2X3WD 1UYHA 2K79A 2AZSA 4JPBW 1YERA 2Q8FA 1I1JA 2J05A 2L3PA 4LUEA 1US7A 2YI7A 1QYEA 1Y8PA 1M3BA 4HVUA 1B07A 4Z88A 4H81A 2BYIA 2EYZA 4HCKA 1NEBA 2ESWA 1OPLA 3PEJA 4B6CA 2JMCA 1UYFA 3EHJA 2CUBA 2K3BA 2EXLA 3A0TA 4ASAA 1WA7A 2A36A 3VHAA 2H55A 2CT4A 4J9IA 3O0IA 4J9EA 1PKSA 3WHAA 4XKOA 1S16A 3VS4A 3M0QA 2WI3A 3OPDA 2KBTA 1B3QA 4LNPA 1YSZA 2RQUA 1YESA 4RTVA 1CKBA 2HEQA 2H8HA 1YETA 1AZEA 2I0NA 3VADA 2EGCA 1UHFA 4J9BA 4Q20A 1ARKA 2WI4A 1QKXA 4RTYA 1AVZC 2IOQA 1OEBA 1Y4UA 4LWGA 2UWDA 2YEDA 4XIRA 4U7OA 1UYLA 1AEYA 3PVQA 4CC2A 4ESRA 2YK9A 4BQJA 2YUQA 3A0XA 1VYVA 1AJ6A 2VCJA 1ZWHA 2SRCA 4OMLA 2CSIA 1I5BA 2YI6A 1ZBJA 1R62A 2CREA 2DL8A 2ED0A 2XHXA 1PVGA 1PRMC 5FNFA 4CWSA 4LWHA 1Z5AA 4L8ZA 2WEPA 1G83A 2GTJA 3TSWA 1X43A 4ASGA 4PRXA 2WI5A 2LQWA 5IH2A 2BZ5A 4QPJA 3INXA 1HJDA 1H7SA 3C11A 1YCSB 1U5SA 2EQIA 2CG9A 3G7BA 4HYPA 2RNAA 4KSGA 2JKIA 4XITA 4NH8A 2FPDA 2YKJA 1A4HA 2QG2A 3R4NA 3RLRA 1QLYA 1RLQC 2BTZA 5CTWA 3VRYA 3O5ZA 2YI5A 1WXUA 2BSMA 3VRZA 2XDSA 3FT8A 2YUOA 2KNBB 2V1RA 4GBQA 2ZDXA 2YEEA 1YNZA 4GT8A 3NHNA 1GFCA 3EG0A 2O1WA 2RN8A 2CDTA 1FMKA 3CGYA 3VHDA 4U7NA 1NHIA 4GGLA 1Y8OA 3VS7A 1OPKA 3OWDA 2XCMA 5GGZA 4BXIA 1BXDA 1Z5BA 1SHGA 2YECA 1YN8A 3JV3A 4EIKA 3NMQA 4KSHA 3R4OA 1BBZA 1KJWA 2WI2A 3EG3A 5L3JA 3H0IA 5F3KA 3K97A 1U2OA 3I5RA 4ZVIA 2KRNA 4AFZC 2YE4A 1BKNA 2W0ZA 4EM7A 3T1KA 3ZKBA 2K6DA 4CWTA 2DX1A 2FRWA 2ESAA 1I58A 3A98A 2YKIA 4GCZA 3R92A 5J71A 3Q5KA 3OW6A 2YSQA 3VS3A 4DEXA 2YGEA 4CC4B 1RLPC 4MB9A 1MV0B 3GIEA 2C0IA 2VWFA 3H0FA 2XK2A 2M0YA 3CGZA 3HZ1A 4YKTA 2YE7A 1LCKA 1YWPA 2WI7A 2ZDYA 4PL9A 1GRIA 3EHQA 3VS1A 1YWOA 2HDAA 4ZNXA 2BU2A 2GTOA 1PWTA 5M4KA 1TILA 2XJXA 2DL3A 4R0KA 5IXFA 2XDUA 1U3OA 4FPPA 2EBPA 2GNCA 1B63A 2YGFA 4V25A 1AWOA 1CSKA 2LMJA 1AMWA 1YT2A 2YEAA 3IQLA 2KT8A 4F14A 2YJWA 3TZ0A 3THKA 4GQTA 1BK2A 4WUBA 2G6FX 3NGPA 2YEHA 5I11A 5I22A 4LPBA 2VW5A 3ZL7C 2NWMA 4YKRA 3PEHA 5D7RA 1PNJA 2CUDA 4F16A 4XC0A 2AK5A 1AM1A 2SEMA 2BRCA 3A0YA 1T0HA 5IXBA 1UYKA 2AZVA 3G7EA 2WERA 1X2KA 3R6NA 1WDXA 2O2OA 3CRLA 4KRTA 5C93A 3OMUA 3FV5A 1ABQA 3TSZA 2MIOA 3I35A 3I9QA 2YKCA 1U0ZA 2MCNA 2C2AA 1MU5A 5CF0A 1X6BA 1G2BA 2DRMA 1UJYA 3ZXQA 3A0WA 5EC7A 2EPDA 2ZKJA 4URNA 5IDMA 3VS0A 1UFFA 4MPCA 4XD8A 5M4EA 2YEIA 4JZ3A 2YJXA 4AWQA 4CWPA 3M0TA 1NEGA 1ZUKA 2K2MA 2GGRA 4QT7A 4HYMA 2D8JA 3PE0A 5GJWB 4JJDA 1BGQA 2QFOA 3B26A 4J9GA 3UATA 4D8KA 4GFNA 1WIEA 1GBRA 2XD6A 2F2WA 4JJBA 4RTWA 2EYYA 3BM9A 1UY7A 1RUWA 4RTUA 3RNJA 4R1FA 4XCJA 2Q2EB 2RQWA 2J6KA 4IIOA 1JM6A 1AWWA 2CCUA 3C0EA 4EFUA 2DJQA 2NUZA 1NLOC 2YDLA 4Y92A 2JMAA 4FMTA 1TG0A 5FWCA 4EGKA 2YE5A 1TC0A 4CWQA 4A63B 4KFGA 3K98A 1ZSGA 3RKZA 1UDLA 1AWXA 2EGAA 3VS2A 1UY6A 2QF6A 2OAWA 3VS6A 3R4PA 3HYYA 2CH4W 2BU7A 3H0HA 2PNRA 4JJCA 3KE6A 3FT5A 1AH8A 2D1XA 1KIKA 2O1VA 2YE3A 2RPNA 4DUHA 1ZXNA 2JS2A 2J7IA 1K76A 1OV3A 4J9FA 3H4LA 5ECAA 4MP2A 2DLPA 2DILA 1EI1A 3LPSA 1WLPB 2DBMA 2CGFA 4MP7A 1ZUYA 3VHCA 1TUCA 2F2VA 1Z9ZA 2FEIA 4YKUA 5FW9A 2LJ0A 2YUNA 2JJCA 3INWA 2GQIA 4AG2C 1GCQA 3O2FA 1UYEA 2DVJA 1MV3A 1YSRA 4LP0A 3MNRP 3Q5LA 4NH9A 1NLPC 4M4ZA 4I5SA 4AWPA 5FWKA 1GCQC 1XOVA 3UF4A 1EA6A 1SHFA 1JEGA 1FYNA 2YE6A 2AKLA 1W6XA 1KIJA 3TZ5A 1Y4SA 2XDLA 5L23A 1B62A 2VKNA 2L3QA 3U23A 5FNDA 2CH4A 2OI3A 2YEJA 1THNA 1T3SA 4BIZA 2J06A 2IWXA 4B7PA 4HZ0A 4Z89A 2XHRA 2QG0A 2XX2A 1H8KA 2RQVA 3ZM7A 1UYGA 2JM9A 1PKTA 1WXTA 3FJ5A 1KZNA 3QDDA 4DZYA 4GEEA 2JS0A 5CTXA 1WXBA 4HXJA 4P8OA 1PHTA 2D0NA 2Q8HA 2LZ6B 4HVWA 1UYDA 2YE2A 4CE3A 1SRLA 2RQTA 3D2RA 2J6OA 2KEAA 3U67A 1WX6A 2A08A 2OJ2A 2GFDA 2KT1A 4J9DA 3SEMA 1M27C 4AFQC 3HHUA 3TZ2A 4AFSC 4QPKA 1S14A 4ZKIA 5M4MA 2EYXA 4NH7A 5CPHA 2DBKA 2ZBKB 1JXMA 2E0AA 1Z59A 1I59A 5CTYA 1SEMA 2DL4A 2EYWA 3TUHA 5IHIA 1UECA 4HXWA 3T2SA 4PRVA 4L94A 5M4HA 1AD5A 3I5SA 4L90A 1I07A 2B86A 1OSFA 1K9AA 1YS3A 5BODA 3SHWA 2AKKA 1GJVA 2YUPA 5D6QA 3B25A 3T10A 1Y0MA 3LH5A 1CKAA 5M4NA 2E5KA 2ECZA 2FO0A 1VYTA 1YC1A 1ZLMA 3EHGA 4MPNA 1QY8A 2JXBA 4V26A 1E6HA 2DL7A 4YKYA 4BIUA 4E01A 4EFTA 2KRMA 4YKWA 2Q8GA 2YI0A 3U2DA 1UG1A 2IWSA 3NPFA 1ZW9A 4XDMA 5IHKA 3M0PA 2DM1A 2YE8A 2BZXA 1QZRA 2YGAA 4JASA 2BTTA 1GCPA 1TH8A 4CWNA 1HD3A 1VYUA 5F5RA 4FCQA 2LJ1A 2CSQA 2DE0X 4ASBA 3DGEA 2XHTA 1UJ0A 4E00A 4KTNA 3GIGB 1QWFA 3K60A 2KXDA 3KFVA 3EHFA 3T0ZA 1X69A 1I0CA 2RQRA 2DMOA 2XABA 2D8HA 2L0AA 5D7CA 4EGIA 4FCRA 2FG0A 2FWYA 1SPKA 2FRYA 2BREA 5FNCA 4CWFA 4H7QA 1YC4A 5J6AA 1KSWA 1WYXA 1UHCA 1WFWA 2CT3A 5D6PA 1N5ZA 1AOJA 2VVKA 1H7UA 2JTEA 4Z8AA 2BYHA 2KE9A 4HY1A 4LWEA 1X6GA 3H80A 3HYZA 4WUDA 4EGHA 2Q8IA 4ORZA 1E6GA 3RBBB 3TTZA 2FPEA 1HSQA 5IHNA 1JU5C 4HY6A 1UYCA 1X27A 4JQLA 2PNIA 3NMZC 3M0UA 4O04A 1JQQA 2YK2A 5D7DA 4XCLA 2KROA 1H3HA 3BMYA 2LQNA 3U2KA 1RI9A 4CWOA 4D8DA 3EHHA 1UY9A 2O31A 2XX5A 4UROA 2IOPA 1NM7A 1AWJA 3EKOA 3OWBA 3EGUA 3QWXX 1QKWA 1QWEA 4BAEA 1NG2A 4RTTA 4XKKA 3A0RA 2DNUA 5FWBA 2EVRA 3K99A 2HCHA 1TC6A 4LE9A 2DYBA 4L91A 5CTUA 4U93A 4XIQA 1J3TA 1BB9A 3D36A 3JZ3A 1YP5A 4URLA 2PTKA 1AZGB 2XMFA 4WCIA 2BU8A 3QTFA 4OMQA 1I5DA 4FSSA 1UYIA 1EFNA 2WEQA 4O0BA 4XIPA 1MX0A 3A0ZA 4HXZA 3GBQA 2A28A 1I5AA 2BU6A 2ROTA 1A0NB 3CRKA 5GJVB 1Z5CA 1SRMA 2XDXA 4MBCA 3UA6A 2WI1A 2KYBA 1GFDA 1GBQA 1UE9A 2IIMA 4JZ4A 5BOCA 4RTXA 3TVTA 2DA9A 2XJGA 2L3SA 1E7OA 2IWUA 4ASFA 3CQTA 2X3XD 1H92A 4J9HA 4O07A 2A37A 3EG2A 2RMOA 3D0BA 3B28A 4CC3A 1GKXA 1X2QA 1ABOA 4RUGA 2DL5A 2KR3A 4K4OA 3TZ4A 2P4RA 2YEGA 1L0OA 2BZYA 1TIDA 4DEYA 1ID0A 3Q5JA 2ROLA 4K11A 1UY8A 2O88A 2HSPA 2JT4A 4XE2A 2C0OA 2DRKA 1YC3A 1K4US 2EKHA 3HZ5A 1UUEA 3WQ9A 4J9CA 3RLQA 2YKEA 1U06A 1Y8NA 1SSHA 3B24A 1Y57A 3B27A 3REBB 1S1NA 1NHJA 2BT0A 2O9SA 1QCFA 2XDKA 1I5CA 4JAVA 4R3MA 1GL5A 4H85A 3HEKA 1IO6A 3SL2A 4R3AA 2YE9A 4LN2A 2VWCA 1M8MA 1VA7A 2QDLA 3VS5A 3H41A 1NYGA 1GKZA 4LWIA 1ZXMA 3EG1A 1JO8A 2LCSA 2FWZA 1V1CA 2CCTA
chains in the Genus database with same CATH superfamily
2GBQA 1UUPA 1U4LA 2E74C 4N0AA 1UYMA 3M5AA 3F2BA 4B3TL 1T0JA 1VQ7A 2HNIA 1HTLD 5JAVA 4PK4A 2ENMA 1R4PB 3E5SA 5COYA 1HTPA 2FHTA 2NN6H 1G3TA 4OB2B 1HZ9A 1SNMA 1Y1WB 3OWFA 1IGUA 1AP0A 4QKUA 5KRUA 4IIMA 4HN7A 1I94L 1PXUA 2N88A 1A3UA 3CC4Q 3SK8A 1IW7D 2F0EA 1DXMA 4GLKA 1YT0A 4ZRZA 2DF6A 1LOJA 1D09B 1TTHB 2MPMA 4PZ6A 2J6FA 2PZ1A 2EXDA 2AKPA 3LH0A 1NJIR 1P16A 4LDWA 4XIGS 3S24A 3K7AH 4OVAA 1Q82R 3KOJA 3M9BA 1TVXA 3BDUA 4MMKA 1PTOB 2M51A 2JA7G 4JYAQ 3S14H 1G6PA 1DOKA 4F17A 4OELB 4FP5D 8AT1B 2I5LX 2IX1A 2EW3A 3M0RA 3V2TA 1KFZA 2RF0A 2ZCFB 3HTRA 1VQAA 2JN0A 1B9NA 1NMFA 3RLPA 3CXCS 3J7ZC 4RCBA 2KRSA 4EMKB 4M7DF 2IPKD 5M4PA 4PU9A 2UUAQ 2DJGC 3L3OC 1K0SA 1QNKA 1Z9QA 1M3CA 3TS2A 2LDMA 2R7ZG 1VQDA 2KYMA 4X9LA 5CV9A 1JXOA 2LX7A 2YEFA 2R93B 3SK4A 3KLSA 4CE2A 2JYOA 4KN7C 2HBPA 2F0KA 1Y8PB 1KNEA 3ZKDA 1M30A 2PW5A 2YKBA 2V1QA 4ID6A 1W70A 3W1GA 2FXSA 3J81i 3BJUA 4E02A 3J80c 2QG9B 3VUBA 2LP5A 4EMVA 1W1FA 2LNVA 2HIVA 4HSVA 3CU7A 1HNWL 2X3WD 5CMDA 2K79A 4LF5L 1RAHB 2Q8FA 5GAMd 4OWTB 1US7A 2YI7A 2VNUD 1WNLA 2PPBC 4A3JB 1RABB 4HVUA 2O2LD 1B07A 4Z88A 4BI3A 5A2QE 2F69A 3R2TA 3S16B 2BYIA 3CRLA 3B6YA 1NSNS 1NEBA 3UWNA 4QL5A 4M75D 4R4TA 1OXSC 1FJGQ 3DM1A 1UYFA 3CCRA 2K3BA 2K28A 3A0TA 1VDZA 1D1CA 2A36A 3VHAA 2NUTA 2CT4A 3GTQH 1F9PA 3D31A 1TS4A 1SE4A 3KF8A 5M5YH 2KAFA 4M78A 2CP7A 4OB0B 4C8QA 4JVZA 2KBTA 1B3QA 4DK6C 2B8AA 3PQIA 3JB9D 4C0ZA 2ATWA 3GTLB 1V8QA 4KV6A 5C44H 1VS0A 2M0OA 3VADA 2EGCA 1UHFA 4J9BA 1LNXA 2MUYA 1MMNA 2O01E 5LJ5d 4KD3A 5DLOA 4R8NA 3PIOA 1LT6D 3EG9A 2Q8RE 2DEUA 2WAQB 3NQIA 3JCMc 3EFOA 1UYLA 5KYXA 1ZA2B 2B2WC 1SYCA 4A3DB 4CC2A 1EYAA 1I3QB 3OOCA 1PH6A 1VQ8A 2YK9A 3TCJA 4E72A 1VYVA 3X25B 5DM73 1ZWHA 2SRCA 4OMLA 3NWTA 4HY1A 2XHXA 1OZ3A 1OX8A 4C3HB 4CWSA 3FEOA 4LWHA 3HOXB 2WKDA 4A3BG 1R77A 2P0KA 2BA1A 2VUMG 2HQXA 2UUCQ 1G83A 1TS3A 5D6WA 4ASGA 2RI3A 4PRXA 2LQWA 3NENA 4Q5VA 2BZ5A 1H7SA 1PYSB 1S5FD 1OQKA 4GN4B 1YCSB 1EFWA 3CD6A 3G7BA 4JBKA 3HEJA 4EQ5A 4F7UE 2YKJA 1TR5A 3RLNA 2LRQA 2E75C 4M75E 5KE2A 5GAMg 1A4HA 5GAN8 2QG2A 3R4NA 5LJ3h 4A3KB 3H3VH 4A4GA 5BN5A 4X62L 4FXKC 3BW1A 1I6HH 2ZPFB 2YI5A 2EYMA 1H9RA 1XNRQ 1AZQA 4LF7Q 4Y52H 2PUKB 2SOBA 1QJOA 5IYDH 1XMQQ 3FT8A 2B63G 2V1RA 5FU7B 4JRPA 1Q86U 2OTJA 1EY9A 1M8AA 2YEEA 3S15B 1GFCA 3BZCA 4AIMA 2O1WA 3CCJQ 1SNQA 2RN8A 1QCNA 3HP9A 3M58A 1PDQA 3VHDA 2UXDL 1VQBA 4BXIA 3OYFA 2D62A 4BBRG 3K0YA 4YCVA 1Z5BA 5BR8L 3T10A 2DPPB 3RKXA 2OQKA 2FVUA 1VQPT 3EROA 5LJ5g 1WQ7A 3LWUA 4OXPA 3ULPA 4BY7G 2HHIA 3NMQA 3R4OA 4KSHA 2WI2A 2R5AA 4A3EG 5FU6B 3QOLA 2FZCB 3ASKA 4PJOA 3TMEA 1JB7A 2YU9B 1J5EL 1FMVA 3RZDH 1SNPA 3K97A 3NBIA 4UC4A 4F04B 1SYBA 5JJKA 2KRNA 2MPXC 2KCMA 3R8BA 2PYKA 4HJ7A 4CWTA 2M2LA 4C5EA 1T9HA 2R92B 3A98A 1QUQA 2ESAA 4JI6L 3JRZA 2BA0A 1CHPD 3FVQA 3VS3A 4DEXA 3LLRA 4C0FA 4CC4B 1NZ9A 2YGEA 1JB3A 1MV0B 3GIEA 1NE8A 4GY5A 5IN1A 1O7YA 4A75A 4DR2L 2A1AA 1EIFA 4GKJQ 4C92E 2YE7A 3CMET 3PIO3 3BDCA 4Y91A 3FDTA 3AB9A 4UHVA 1XMOL 2WI7A 2CP6A 3BYTB 2RB6A 2HDAA 1KD1C 4U68A 2KENA 3EN2A 1C0AA 5FO7B 5M4KA 2KVQG 3FLGA 3CMAQ 2UU9Q 3HOWG 1KD1U 4UDUC 2YGFA 4CGYB 1LYLA 2KQ3A 5FO9B 1AMWA 2Y90A 1PTOC 2KT8A 1GUTA 3X20B 5D6XA 3THKA 3DLLA 2BUDA 2QA4T 1AE2A 2Z1CA 4OF1A 4C3IH 1VQ5Q 4JG2A 4S3SA 4DK3C 1IW7C 1YI2T 4JK1C 5I22A 1ILPA 5D7RA 1JWUD 4DV7Q 2E2HH 2AK5A 3SVMA 5I9OA 1SAPA 5E7NA 4DAPA 3I70A 4CJ1B 3DEOA 3HGBA 5EPJA 3VV0A 2HUGA 4EMKC 2XWJB 1C1AA 1VQKQ 4E7ZA 3OMUA 1MJCA 4DUZL 1YHQQ 2AKWB 4KTAA 4C3JG 1ABQA 3FV5A 3CRLC 3DHQA 2EJFC 1QVGS 2K50A 2NTSA 3AYHB 3K5LA 3GTGH 1Y69U 1X3FA 3UE1A 2JA6H 4NL3A 3G71T 4HTHA 2K7VA 1KK7A 1QE6A 3PO3G 1DM0B 2LXJA 2GCXA 3MEWA 4LF8Q 4XD8A 1HFGA 1K83B 5CV4A 1V1QA 3F2CA 1VQ9Q 2AIRB 1GHKA 3AT1B 2D8JA 4M78D 1TWFH 2YLBA 1VMCA 4PZ8A 4BI4A 3B26A 4J9GA 5EKLA 3HP3A 2V1CC 4I65A 3CC7T 4QB4A 2E2JH 1M90U 1GBRA 1PFMA 3EJIA 3TRZA 2XD6A 2F2WA 2X4YA 2DN8A 2EYYA 5GAMj 5LMNL 4B3MQ 1FMWA 1ILQA 1TT2A 4JI5L 1X32A 2FYKA 1CKNA 1SROA 3E9HA 3MXUA 3URYA 2FTKA 2J6KA 3MEAA 2Q2EB 1AWWA 4OWWB 4EGVA 1I4PA 4XU3A 4YCWA 5GAMf 2YDLA 1NLOC 3EGDB 3JCMb 3FKIH 5FKAC 2A6EC 3QG1A 1F1BB 2E8GA 4DR5Q 3GP8A 2EYOA 4JRQA 2CKKA 3CCVT 1FNUA 1I6VC 1WOCA 2N55A 5IYBH 1W3SA 2L89A 3TZUA 3T1YQ 3OTOL 1BI3A 2QTVA 1Q7YU 1CM9A 3CBMA 1D0ZA 3SEBA 2F03A 1PYBA 2EGAA 3DUZA 1UY6A 3MJXA 3VS6A 4KKUA 4IUVA 5ELNA 3M4GA 2YV5A 4MHEA 2K6AA 2YE3A 4DV3L 5LJ5j 1G3YA 1AN8A 2F0PA 4J9FA 1OV3A 4JI2L 2EY6A 3S2DH 3HKSA 2IHEA 5D14A 2VB6A 5KYYB 4OIJA 4EPCA 2QQ9A 2CGFA 5LJ5f 2DERA 3DWPA 1X75C 2Y0SB 5C6AA 3CC4T 1QVFS 3PIPA 1IB8A 4IUPA 2LJ0A 1B8AA 1D6EC 5M3MH 4XTUA 4MTNA 3OA6A 2VQFQ 1ACMB 4M78E 1KC8C 5M5WB 2GQIA 3GIBA 1MV3A 3CQZH 4UPAA 2KI7A 1LTRD 4I5SA 4EQNA 1KC8U 1GCQC 2KCNA 2Z4HA 1OI1A 1JEGA 5GMKj 5C5MA 3T51B 1BUVT 1Y4SA 2VASA 5C3XA 4A3IH 3GTPH 3HG9A 2L3QA 5IGBA 5FNDA 4I7AA 4ZGDB 4ABNA 2R58A 5JPMC 3QXEB 3GTOH 4A3MH 3K57A 1RF2D 1V9PA 1QCOA 1FWZA 1M4VA 2DY8A 1AH9A 2XX2A 4HMIA 2P0PA 2QGGA 4FM4B 4EGIA 3FJ5A 5FU7C 3QDDA 4JLIA 5FLXL 2E64A 1PCXA 2DKGA 1PHTA 4HSPA 2K03A 2NVYB 2VUMB 4WJWA 4HVWA 1X54A 1SRLA 1HA6A 2AQ1B 3JB9J 1O9SA 1SE3A 3U67A 2G3RA 3I4MH 4JLGA 5D3IB 4A4IA 2L55A 3H8ZA 2KT1A 3HZXA 1SF9A 4AFQC 3HOVG 5C4HA 1CKOA 3TZ2A 3J7AV 4P5NA 1JWSD 1VQOT 5L37A 2MAMA 2EYXA 1MKHA 2EAYA 2CGHA 5FU6C 4M77F 1A62A 3U4ZA 2DBKA 5CPHA 2QXFA 1JXMA 4ME7A 2A6HD 5CTYA 3TUHA 3GTMH 1VQPA 2B63B 1PZKD 3T2SA 2E4HA 4L94A 3CPWS 2IX0A 3UDFA 2MP1A 3SHLA 1K9AA 1YS3A 3JCMX 3OHXC 1E1OA 5M5XH 2MNAA 3J81c 2BE7D 3SHWA 5BODA 3V05A 2K5HA 5D6QA 3Q22A 2E5KA 2FO0A 2ZT9C 4DGZA 4BBRB 1YNND 4X64Q 3TU4K 4JI7L 1B44D 4AYBG 1JE4A 1E6HA 2DL7A 5GAMe 1H9SB 1EOVA 1MBYA 3U2DA 1LV9A 5C4XH 4H02A 5IP9G 4KUDK 2F4IA 5IHKA 5J3BA 2FMCA 3CMEA 1G51A 1QZRA 1RJTA 3QZ5B 1I8FA 4CWNA 3PIP3 1W2BA 2E3HA 5KH6A 3PGGA 2I07B 1C6VX 2X4XA 4E00A 1LTSD 1PSEA 5JEAJ 3STBC 4CDCC 2XABA 2RKSA 2FZGB 2XICA 2D8HA 2LMCB 4X65L 1SPKA 1YI2A 2E10A 1W2BP 4OWXB 3K58A 5K36G 1YC4A 2PO4A 1N36L 4X66L 5LJ5e 4M7DD 1MMGA 1Q8KA 1TWGB 2RK2A 5D6PA 1V76A 2JTEA 1BVSA 4LWEA 2KE9A 1QVPA 1X6GA 2K01A 2UXCQ 5FLXc 2RHUA 1V1PB 4XDXA 3V7SA 4BBSG 1RAEB 2H5XA 4JV5Q 3FPUB 3FDRA 3RBBB 2WIIB 2FPEA 4OL7A 1YJWT 4K6LA 2XIWA 4HY6A 1UYCA 3S17B 2VUBA 1EL0A 5C0XH 2KROA 1H3HA 4LWCA 1L1OA 4JI3L 1K8GA 3KBGA 3URGA 3Q23A 4GQTA 3EHHA 3G71A 5IP7G 1RHPA 4DN4M 1T5XD 1NM7A 3R3OA 4J6XA 3VYUA 4LFCQ 3QWXX 2EJGC 5FLMH 1V29B 4BAEA 3AFPA 1IL8A 2KHIA 3KJPA 1QZGA 2JSOA 1N9RA 1IHWA 3DXJC 3CYGA 1LTTD 1QP3A 5GANd 1Y1VG 1N8RC 1M1KC 2AWOA 5CVIA 3GQBA 5I2YA 4YHHQ 3K99A 2HCHA 2QGFB 5LJ3d 4LE9A 2DYBA 3OSSC 2MO1A 1Y96A 8ATCB 2WB1E 4XIQA 3CC7A 1M1KU 5A0DA 5GAMh 1TWHB 3A56A 4IPHA 3V8KA 2BIVA 4BXXH 4DV2Q 2XMFA 1RCVD 2PNRC 2RHIA 4YY3L 1TKWB 3I8ZA 4TVAB 2WEQA 4O0BA 1MX0A 2LS01 3DWQA 4HXZA 2I46A 1A0NB 3A74A 4LF9Q 1CTMA 1Z5CA 1PSFA 4A4EA 2DJFC 3UA6A 1JR0D 2XDXA 4MBCA 4QQ6A 4M7DE 2KCCA 2DXBA 1VQIA 4NXML 3NBHB 2DA9A 4KH0B 1HNZQ 1E7OA 4FW2A 1KNAA 4AH6A 2IHFA 1N32Q 3F2DA 2X3XD 1F9SA 4O07A 1Y1WG 2A37A 4B6MA 2RMOA 4XYQA 5KCHA 2QW7A 3FJPA 2XWBB 1VQ6T 1GKXA 1G2TA 2K5VA 3CBOA 1X2QA 4RUGA 3BE3A 1Y8NB 2B2UA 4ZYSA 5KNBA 2KHJA 5BN3A 4RGMA 4G7ZC 4K4OA 3OW2A 3F8TA 1L0OA 4XYOA 1GUNA 3PO2H 1KAWA 1ID0A 1TIDA 1VQ7T 1NR4A 5C0XI 2QK0A 3TEEA 2D0QB 2HSPA 5KYWA 1GJXA 4XE2A 2C0OA 1YC3A 1FD7D 2BE5D 3CMAT 1GD7A 2JJ9A 2ENBA 3CC4A 2YKEA 1U06A 1FNVA 1SSHA 2PMZE 1Y57A 2RCNA 3REBB 1IREB 4JUVA 5KIXA 3B27A 3TP6A 4H13C 1I5CA 2JTFA 3OW2P 4JW0A 1UWVA 1QNUA 5I4DA 3ZBDA 5C3EG 4XTVA 1STAA 2Q8TA 1VQ5T 1TS2A 3EA6A 4GKKL 2QDLA 1MI2A 3VS5A 3CCQQ 3DWAA 4KY5A 1LUZA 4ZKCB 1GKZA 3QJYA 4IPGA 1ZXMA 3G6JB 5GANg 5IAYA 5CV8A 1IL2A 2HL3A 3INXA 4FU6A 2A68D 5LJ3g 2IW3A 3OYHA 4XTWA 4H7QA 2B2VC 5I2SA 1CI3M 2BYHA 3HRSA 1YHQT 2PVGB 2R93G 4FYYB 3RR6A 4OX9Q 1UTIA 2CYZB 3F2UA 2ABLA 1SYEA 3HKZE 2AQ2B 4K5WA 4AMCA 4YKQA 3EHRA 1DONA 1SMYC 5E4WC 4KP4A 2Y4YA 5IWAQ 3C1FA 1RL2A 1OX9A 2WI6A 4AG1C 1EY4A 2MK5A 1I50H 1PRTF 4QUCA 1BYQA 4P7AA 1XTCD 4CDEC 1S3OA 2HBWA 1BBXC 3M54A 3KDFA 4MOTA 1LM0A 4ZGJB 1VQ9T 4UP7A 1JORA 3VKIA 1SYFA 4Q0FA 2QQRA 4AWOA 2PW7A 4FYVB 1CZWA 4R1JA 1JJ2P 4A93H 4E6RA 4RGTA 2CVRA 4OO1H 1ICWA 1YT1A 3A8GB 1VQOA 3HFNA 1K8AU 2RCFA 1HNXQ 4URMA 4DV0L 2F2XA 2K2VA 1OO9B 4RCOA 4QIWB 1N34Q 2HG1A 3ZXOA 1YIJQ 1DOMA 1BU1A 2K5BA 1PD1A 1ZUUA 4IUQA 4DK1A 4OMPA 1Q81R 3NP8A 2IORA 3UA7A 1U8RA 2A6HC 2HQLA 3H91A 4HEDA 3RESA 4B08A 2KA7A 4FCPA 3PVLA 3HOVB 1FYCA 1KDAA 2BDNA 1G3SA 1PFBA 3F1ZA 3UDIA 2B2TC 4A3JH 4M75G 3EKRA 3G1JA 3IEDA 4M77A 1YITQ 1BQQT 2SDFA 2F1LA 1ENFA 1PRLC 1TUDA 3CCRT 3O6OA 5LL6X 1O7IA 5A35A 1WI7A 4XQNA 4L5SA 4O09A 2MOXA 2YEBA 3QYHB 2LT4A 1SR3A 2EJFA 1YNNC 2PQAB 3H0GG 3U9OA 3QIAA 3C0CA 1ZX6A 3RR5A 2E2DC 1HR0Q 1N8RR 1K9MU 5AJ3L 1JMCA 4J6WA 2KQWA 2EFIA 3IFTA 1O80A 4K2KA 4NP5A 4YKXA 3S3OA 4CKCA 4X3SA 3S1RB 4ZN3A 2AZSA 4JPBW 5IYCH 2LCLA 3BDLA 2PI2A 3TP7A 4G7OC 4B3TQ 3BS1A 1Y8PA 1KL9A 3LGFA 4JS4A 4N8FA 2LX9A 3VYGA 3LNNA 2EYZA 4HCKA 1QOHA 4PL6A 3PEJA 3P7JA 4B6CA 2JMCA 4HKEA 5C6SA 1I94Q 2CUBA 2N3SA 4KLKA 3OMGA 5HK0A 2H1EA 2MQHA 3A54A 3M4OB 2VV5A 2UUBL 4DR4Q 3HOUH 1JJGA 4OO1I 3QBYA 2VB2X 2RD1A 3O0IA 4ZTFA 1PKSA 1YNJC 4KHZA 3VS4A 4A3KG 3M0QA 1DYQA 2WI3A 2LXKA 2A8VA 4LNPA 1YSZA 3MA2B 1TWAB 1LO5D 2HEQA 1SEBD 4B3SL 1YETA 2NWGA 2I0NA 1EZ8A 2BKDN 3UI2A 4Q20A 1ARKA 4RTYA 1AVZC 2GN5A 3D6CA 3JCMQ 1VOMA 5E1FA 3CD6T 3TZDA 2AT1B 3UE0A 1KLUD 1Y4UA 2UWDA 2YEDA 2FINB 2JQOA 2NVTH 4HA8A 3IFDA 4G4KA 5DNFA 4U7OA 1AEYA 1HZCA 4PJMA 3OBYA 5GANj 3PUZA 2XSCA 1NPRA 4ESRA 1LTLA 1EFID 1MSGA 2XI9A 2DXCA 2YUQA 2LY7A 2Z0SA 5LJ3j 2AHJB 3CW2C 3DM3A 1AJ6A 4FXDA 2RA4A 5JEAG 2K5NA 4DV5L 1ZBJA 1R62A 2CREA 1VQHA 2ED0A 1WJQA 4PV1C 3S1MB 5LHY1 1PRMC 5GANf 3CCJA 4KJNA 1Z5AA 2LC4A 3FC3A 1Q90A 3E3XA 5LJ3f 2WEPA 2GTJA 1X43A 5BN4A 2WI5A 1WZOA 2OAUA 4MZTA 4BE2A 4RA8A 2DO3A 3BFMA 3HOYG 3C11A 3S1NB 1V1OA 1IZ6A 4POFA 5JJIA 4HYPA 3QZ9B 3Q8DA 3GTJB 2F52A 4NH8A 2FPDA 2YTXA 1Y1VB 4WJ4A 1D1IA 3P20A 2DNCA 3MEVA 1QLYA 1RLQC 1UGQB 3EAEA 4ODGA 4ZKBB 1S5DD 3VRYA 5CTWA 1HNWQ 5D7UA 1HYOA 2ZJQA 2FMMA 4LF5Q 5FJ8H 2XDSA 4CI0C 2K4KA 3CC2Q 1SJHD 2KNBB 2EZVA 1VQGA 4J6YA 3MHBA 1G91A 4GT8A 3EGXB 3NHNA 2RO0A 4HCBA 2FXQA 2BH2A 2CDTA 4XK8E 1FMKA 2R92H 1MSHA 1R9TB 4GNXA 4O6JA 1MGQA 2Z6KC 3EIVA 3MXNA 1HHVA 3MVVA 3P1HA 3VR4A 2XCMA 5GGZA 2EQMA 3HHTB 1IHZA 1ML0D 4LF4L 1S5CD 1SHGA 5G3LD 2CS7A 4HJAA 2KY9A 2YECA 4K6DA 1W4SA 1YJNQ 2B2YC 3CMAA 2VY3A 3KF6A 3MXGA 5F2DA 1VUBA 4NXNL 3RUZA 3EG3A 1BCPD 2NN6G 2RSOA 2D2CC 4IFDG 3OIQA 3M7GA 3H0IA 3TSSA 2F3VA 1U0LA 4LFBL 5GAEC 1U2OA 5L3JA 2BE5C 4KGXB 1VQ5A 1HRJA 2ZM6L 3GO5A 1ENAA 1JT8A 3S1QH 4F7XA 2NUPA 1KHIA 2NVXB 3R92A 1I58A 3OS2A 4EMGA 3VA7A 1TU0B 3OW6A 3RMQA 5GAN7 4J6HA 2R6GA 2C0IA 2VWFA 3H0FA 5CK9A 1VQKA 4XU1A 4V190 1YHQA 3NWSA 2QEXQ 1HA5A 5C4JB 1P92A 1A3VA 5FRNA 2O4XB 5C3EB 3VS1A 3S2HH 5C4XB 1YWOA 2CHBD 1F77A 3KYHC 2GTOA 1SBBB 4DUYL 5IT9E 1TILA 3EFSA 1MMAA 4L8JA 3ZJYC 5C5LA 3K7UC 3HL8A 2GNCA 1A8VA 1IBKL 1AWOA 4JC0A 1CSKA 3UT1A 3MFGA 4BY1H 1B7YB 2K5QA 2YEAA 1K8MA 1BBUA 4HIOA 3NGPA 2YEHA 1XJWB 3E9FA 5I11A 3OYLA 3QKJA 1CUKA 3V8JA 1LT3D 2JA7H 2F0DA 2VW5A 3ZL7C 2NWMA 1VQ9A 1RD9D 3PFSA 3PEHA 1F9QA 4YKRA 2CUDA 4XC0A 2LQKA 2SEMA 1AM1A 2BRCA 3A0YA 1QW1A 4X62Q 5IXBA 2IWHA 2C5CA 3G7EA 4R9WA 1U4RA 1X2KA 2E76C 2EPBA 4IUTA 4KRTA 3TEHB 1VIEA 3FMCA 5C93A 1IYUA 5JVH3 3O13A 2KUMA 3EBEA 4ELYC 1U0ZA 5GANe 2R7ZH 1YJ9Q 2RHYA 4Q5WA 2UXDQ 1X6BA 5LJ3e 2AUKA 1LT4D 4NDXA 2DRMA 4DOVA 1VQMT 4L5QA 2EPDA 1E24A 2QCPX 1B2TA 5C3WA 2EVBA 4FO2A 2QAZA 3LW5E 1UFFA 2K5FA 5IDMA 2EOTA 3MZ5A 3ME9A 1LLRD 2K5LA 3E1SA 3M0TA 2K2MA 4BACA 1UGSB 4KH1B 2V4DA 4PQXA 4QT7A 1RI0A 3GV6A 1J5EQ 1DGSA 2Y0SG 3A5UA 2Z0WA 4JJDA 1PFNA 3QB3A 2KEEA 3PUVA 4D8KA 2PZUA 1X01A 3TDQA 2DVEA 3U50C 5IIFA 4IFDI 4JOIC 2XK0A 1TUGB 4RTWA 4JI6Q 4F7UB 1S5ED 3A55A 3RNJA 3PMTA 4M75B 1V43A 2RQWA 4M77E 3DEPA 4XT3B 4DR2Q 3JCMd 2CCUA 3C0EA 2HL5C 3J7A5 5HY6A 2EE1A 2MFIA 3D0FA 2Q2HA 1XMOQ 4K0KL 2F0IA 2YE5A 1TC0A 2A3LA 3H0GB 4R4CA 4TQUS 1ZSGA 3A8HB 1HH2P 4KUIA 1N33L 4DAYA 4IO9A 2ZJPA 1G6ZA 5NUCA 3R4PA 4NS5A 4GZYC 1B50A 1IRXA 2CH4W 4QVDA 2RJEA 2PNRA 4JJCA 4YCUA 4WJ3M 1AH8A 2PI2E 3CCSQ 3IAYA 3QYGB 1ZXNA 2DTHA 1TWCH 4MZMA 1NNXA 3D8GA 2J7IA 1M2VB 5J1ZA 4X3KA 1K76A 1HK9A 3H6MA 1YHBA 5ECAA 4P72A 1PH5A 4MP2A 2DILA 1EI1A 3LPSA 2A19A 4M7AD 2GFAA 3SWNC 3S3NA 1CQVA 4KJOA 4C92D 2HD3A 1ZUYA 5GANh 4DUZQ 1Z9ZA 4YKUA 4IJLA 2XHCA 5FW9A 1BXTA 4RAUC 2NB0A 2JJCA 2VS1A 2HKNA 3HPWA 2DVJA 1Q86C 4FNFA 4KD4A 4A3BH 5IGCA 3Q5LA 4NH9A 1Y14B 3M55A 2A0FB 3HFZB 4AWPA 5I9PA 3RKWA 3UF4A 1SHFA 4BI8B 1D1AA 2D0OA 1FYNA 1IXMA 3OYYA 5L8RE 2XDLA 2I0QA 3P8DA 1EIHA 2HQHA 4DR7L 2CH4A 3OYIA 3QR8A 2YEJA 5I2MA 1STBA 2OCEA 3R2IA 2L15A 2OWOA 2BH8A 1THNA 2IWXA 2HMAA 2X9HA 1JBMA 1YIJT 3D4WA 1H8KA 1O7LA 1PYWD 2E41A 2DD5A 2JM9A 4FF3A 3A8IE 3CPFA 2LFNA 5GAN3 4KGVB 3JCMg 3OW2S 5LMNQ 2CW0D 1XYIA 2DZCA 5CTXA 1WXBA 5M9OA 4QUFA 2HDMA 1FGUA 3ONAB 4JI5Q 2K5DA 5A2QL 1IYVA 3RZOH 4CE3A 3W5OA 2RQTA 3AHUA 2KEAA 1EY0A 3GTKH 3D2RA 1ZSZC 2A08A 3HOYB 1R0CB 2YYZA 2R61A 4FW1A 3OB9A 2IT1A 1EOTA 4J9DA 3SEMA 3R6OA 4PJLA 1X3QA 3OTOQ 5IGGA 2H3JA 4AFSC 1KDCA 4M7AE 1X6OA 1JWMD 2ICEC 5CORA 3WOEA 4BY7H 4OMFB 3L2VA 5C0XJ 2E2IB 4DNRB 5AYFA 4A3EH 1VF7A 3KFUA 4HXWA 2DK3A 4CKBA 3V8LA 4PRVA 4BB7A 3W3AA 4DV3Q 5M4HA 1AD5A 4LD9K 4QJFA 1WD1A 2B86A 4JI2Q 2DY7A 1Y07A 1XX8A 4JRIA 2EY1A 1SXTA 3M4PA 2F3WA 1X3GA 2YUPA 2WACA 3B25A 3MPUB 3LH5A 1Y0MA 2ZAEA 4KHVA 5DAUA 2ECZA 4PJNA 3D4RA 3VYSA 2Q2IA 4R4OA 2QI2A 4M7DG 3QJ6A 2JXBA 3V96A 1PVOA 4C3IG 1JJ2S 3EH2A 4V26A 4EFTA 2D9UA 2VQEL 1ASYA 2YI0A 4FL6A 3M0PA 2DM1A 5HKCA 1ET9A 2YE8A 3K5OA 1X65A 2VXEA 5ELDA 1STEA 4CJ2C 1LTGD 3HOWH 1VYUA 5F5RA 2NZ1D 3CCUQ 3DGEA 2XHTA 1UJ0A 1H9SA 4KTNA 5KE3A 1QWFA 1J8IA 2KXDA 3KFVA 3EHFA 3T0ZA 1BIBA 2DMOA 4LDUA 1F2MA 1CA5A 5KNDA 1AW7A 1Q46A 2QF7A 2E1HA 1JOOA 3OSOA 1RAFB 3M9QA 2AUJD 4FCRA 2JA6G 4CHTB 5J6AA 4KY6A 1SKUB 4GOPA 3S14B 2M16A 1WYXA 1UHCA 3KXTA 3IRBA 1EU3A 3DB3A 2RHZA 1LPLA 3G4SQ 4C3JH 1H7UA 2DXUA 1M90C 4C8QD 4N4HA 3HRTA 4JI1L 1U1TA 4EGHA 3L42A 2Q8IA 4N4GA 5CV7A 5E4XA 1JQYD 4WF2A 1JRIA 4G7HC 3NMZC 3RD4A 1EEFD 1M4ZA 1Q1EA 4RFBA 5D7DA 2P4TA 4Z02A 1WFQA 4DA2A 3PO3H 4QVZA 4XCLA 1QMCA 2E6ZA 1MGSA 3VR2A 2LQNA 1AEXA 1RI9A 4IOAA 4CWOA 2FB7A 4M78B 1VQMA 2O31A 1V1PA 1VQCA 5IE8A 4BQGA 2IOPA 2KEDA 4OB1B 4LDYA 1Q7YC 2PCFB 3EKOA 3E9GA 5GAOp 1QWEA 4X6AH 1GUGA 5CKHA 1J6QA 4RTTA 3CC2T 2RH2A 1O7ZA 4XKKA 1EWHA 4L5TA 1UAPA 1A63A 5FWBA 1Y71A 7AT1B 3P8HA 3EG9B 2ZXOA 3HRZC 1TC6A 4B9WA 4M75C 5CBEE 5CTUA 4U93A 5EKIA 1BB9A 1Q86R 3NTHA 5KYXB 2XTIA 4C2MH 3MKDA 3FRNA 4JI7Q 3K8AA 1AZGB 4WCIA 1LTID 4OEMB 4FSSA 1YJNT 3BZKA 2L8DA 4XIPA 5JJZA 2IVWA 4UAIA 1KQSA 1L0WA 2DTOA 2XG8D 4P75A 3JCMf 5ELCA 2IPOB 1GBQA 2IIMA 3L1AA 3CRKC 4JZ4A 4RTXA 2XJGA 1A3TA 1IXRA 2EYHA 3GTQB 3CCQA 5M3MG 5M5YB 4C8QE 4DR3Q 1VF5C 5I6YA 3PMIA 2VZAA 4OONA 1VIFA 1IKMA 1KQSP 4X65Q 5C44B 2DIGA 4R55A 4QMGA 3LX0A 4LJZC 1NR2A 1ENCA 1F2YA 3CP0A 4K5VA 2KR3A 1WHLA 1N36Q 4X66Q 2P4RA 2N8NA 4PMCA 2A69D 1B34B 5FO8B 3Q5JA 2ROLA 5EAYA 3PSIA 3W1BA 2JT4A 3MHXA 3WDNA 2PZWA 1K4US 2QYZA 2F0FA 2IL8A 2X4WA 1BIAA 1C8CA 4PJOD 4ZTJA 1RAAB 1Y8NA 2CZ0B 1S1NA 1HZBA 1UEAB 4N8X1 4RCNA 2E5QA 2VL6A 3AMUA 3VR5A 3SL2A 4C92C 2EIFA 1KD1R 2A73B 1EY7A 5T1GA 4JI3Q 1M8MA 1UE7A 3PNWC 1UE6A 2M02A 2MMPA 4E7HA 3RN2A 4LWIA 1XJVA 3Q24A 1PTOF 2LCSA 5KYUA 1HR0W 3UPUA 1G8ZD 5HGQA 4R4IA 2VC8A 1A0IA 2EQKA 1RTNA 3T9NA 4YKZA 4EEHA 1IXDA 1PH2A 1YIJA 3HOZH 4N0AC 2FJ2A 1OOTA 2BZ8A 3A8LB 4X34A 2EXZA 3BZDB 4HVVA 1YJ9T 4ME3A 4XT1B 4ZUIA 5KGUA 1I6HB 2JM8A 1AH6A 2BU5A 4M1UB 2EYQA 2G5DA 2EYLA 1WHHA 4YY3Q 3I2ZA 4KQVA 4LUDA 5A0GA 1BCMA 3G6EQ 3OYAA 1YITA 1AFPA 2GQVA 2CW0C 5IN9A 2GQPA 3HOVH 3BY7A 3CCLQ 1TY0A 4A3LG 2O9VA 2O1UA 5M3FG 1EX4A 2F4VL 4RH6A 5AT1B 3E6ZX 4NXMQ 1LJOA 3NUCA 1I5OB 1NYFA 3R4MA 4W7TA 2L2PA 3K5NA 1T3LA 2FYPA 2LJ3A 2OTLQ 2K9GA 3JCMW 2C0TA 4V2SA 1ZHIA 4PJOE 1Y7XA 5HCKA 4X1VA 1QG7A 4XAXB 4I3HA 1M90R 5GMKl 3K80C 1NHHA 1AE3A 2JOYA 2VXFA 4K5XA 2MWPA 2ATCB 5KYIA 2XJJA 4GLMA 4NL2A 1K0XA 4FT2A 2SNMA 4JI8L 1HFNA 4HZ5A 3M0SA 2HQEA 4CE1A 2NZOA 2JA8H 2P5ZX 2QQBA 1F51A 2NVQH 3LNUA 2JE6I 3G75A 1VQNQ 2VCIA 4A3FH 1M3AA 1JE5A 5IP9H 5IDJA 1TWBA 2WB1B 3GNGA 3QSUA 4DV1L 4O05A 2FPFA 2EQJA 3JCMe 4KHPL 5ELOA 3GIGA 1XQHA 2CZ7B 1Q7YR 2KXCA 4J15A 2JW4A 4RGOS 1KIXA 5CCAA 1O78A 4GKKQ 4AS9A 1M1FA 2K57A 3CCST 1LVKA 4XTJA 3R91A 2EGEA 2YT6A 4M75F 3KK7A 1H9KA 4BE1A 1UYHA 1YERA 2CKZB 2K05A 1DD2A 1I1JA 2L3PA 4LUEA 4M7DB 3M3YH 3A1PA 2JP1A 3I4NG 5KNCA 4WTOB 1B7TA 2D0PA 3K81C 2DXTA 1I5LA 4LW1A 3A8MB 4C3IB 5K36H 1Q3LA 2E2HB 2RA2A 2A74C 1C48A 2ESWA 1EY8A 3EFRA 2WV6D 1IBML 2K75A 4PZ7A 2K04A 4E7JA 2DETA 3I73A 2V26A 2QDYB 3JCMP 1WA7A 1CKNB 3G48A 4BBSH 3I72A 2J0TD 4JOIA 1WYDA 1KRTA 5CC4A 4J9IA 3OYNA 4KK7A 3CCJT 4KKTA 1KC8R 2Q2UA 1S16A 3WHAA 3OPDA 2JN4A 4M78C 3KBXA 1YESA 3MEUA 1UE1A 5KYLA 2H8HA 4C8QC 3NE5B 5IP7H 2JA6B 4UP8A 4FYXB 2CP2A 1QKXA 1K28A 5IGEA 2IOQA 4HT8A 1OEBA 1MMDA 3T1HL 4ZN1A 2B2WA 1AZPA 4LWGA 1SYDA 3X24B 4DV0Q 4XIRA 4GN3B 4KKSA 1D3BA 2ZZDA 1Z6HA 5DEHA 1HZAA 1I81A 3PVQA 2L11A 2ZTDA 3TN2A 3A0XA 2EKOA 3CC2A 1I4HA 4A3CG 4QQGA 2TMPA 1FX7A 2VCJA 4L91A 2Q8GA 3GDEA 2CSIA 3SD4A 1XPRA 2YI6A 2DL8A 1VCIA 2L3RA 3L2WA 2E2JB 4C1NK 1G3WA 4ZAIA 4HR7B 2Z4IA 5D6YA 2UXBL 1TSFA 2ZXPA 3META 2PZTA 3RNUA 4L8ZA 3JCMh 4X9DA 4J8QA 4Y7NB 2L9HA 4FYWB 3HKZB 2VGMA 1H9MA 4QY7A 4QPJA 1HJDA 2YRCA 1I4QA 5JPNC 1PZJD 1U5SA 1C9OA 3VR6A 4RMOA 4K8JA 1YJNA 3FKIB 4RHSA 1CA6A 3MXPA 1MNEA 2HHHL 2JKIA 4KSGA 3PO2G 4PLIA 5AJ3Q 2EDGA 1NAPA 1Y1WH 3JAME 1Y8OB 4A4FA 3O5ZA 2BSMA 4XQQA 4FF4A 3L2QA 3AQQA 3CKIB 4DV6L 4NKLA 2ZDXA 2CP0A 4G57A 1YNZA 1HQMC 1OXTA 2CP3A 1CSPA 2G9HD 5IY0A 2DEQA 2MYSA 3VU3C 2VB3X 2OF1A 1YFNA 2HCIA 1M9SA 1BYMA 3CGYA 4GGLA 4U7NA 1OPKA 3OWDA 3OQ5A 2QEXA 1JC7A 1PTOH 4DK0A 2EQUA 1VQKT 2UUBQ 4LFAL 1AHJB 4L59A 5ELEA 1YN8A 1YZ6A 5C4JH 3CCUT 5M3MB 4EIKA 3OYGA 2KCTA 2F0UA 3I4OA 2A69C 4DR1L 4R56A 1BOSA 3CQZB 4B3SQ 1Z7TA 4IPCA 1JOQA 4PJOC 2YE4A 2ICIA 1BKNA 2W0ZA 2YWWA 4L5GA 5CKBA 4EM7A 4A3IB 5GMKi 2K6DA 3GTPB 2DX1A 2YKIA 4GCZA 5J71A 6AT1B 3GTOB 1IBLL 2YSQA 3Q5KA 1UGRB 2R93H 1RLPC 1BNZA 4A3MB 5GAOn 3ULLA 2F5KA 1K8AC 1SN8A 5TSSA 3U4VA 2XK2A 3H3VC 1ONLA 3S5TA 5CYUA 3HZ1A 1PC0A 4APVA 1KG1A 3MAQA 4DV5Q 4X9CA 2QQSA 4YKTA 1LCKA 1XNQQ 4PL9A 4A93G 1RADB 2GFUA 1L0XB 3EHQA 4ZK9B 3J81j 4ZNXA 2BU2A 2EY5A 2YRDA 1YJ9A 3SB2A 2DL3A 5IXFA 3S3MA 2F0LA 4DAVA 2K1BA 2XDUA 2XJXA 2AQ3B 4DBQA 2EBPA 1BI1A 4BUGA 1D1BA 3U58A 3M53A 4ANJA 2CWPA 2J7ZA 3IQLA 4DBFA 4F14A 2DGYA 3J7YW 2YJWA 1I4GA 1BK2A 3I4MB 4F7UG 3RKYA 5C4ZA 1Q1BA 1TOVA 3MEHA 3S16H 1NBWA 1PNJA 4QF4A 3T56B 4EMKA 1QVGA 2RHSB 2B29A 3C1EA 3PF5A 2XVSA 3L2RA 1WJJA 2AZVA 2EJMA 2QKIC 1K9MC 1JICA 1WCMG 3R6NA 3CHBD 2O2OA 4CKEA 1CFMA 5ELFA 3OPOA 4DQ2A 2JA5G 2PU9B 2DFUA 3H6ZA 3GTMB 3LMMA 1YCYA 3A0JA 3PUXA 5AFWA 3JB9G 2MIOA 3I35A 1M1KR 2E5LL 4E7KA 1TS5A 4B3RL 2YKCA 2C2AA 1PM3A 1NJIC 2JZ2A 3GTLH 5M5XB 5CF0A 2QEJC 1G2BA 2JVVA 2G9DA 4WUBA 2WP8J 5M3FB 3ZXQA 1NJIU 2MGSA 2MHVA 4LF4Q 2I5HA 1VQJA 2JA9A 1Q82U 2ZKJA 3A0WA 1CT1D 3JAML 3J80E 4MPCA 4URNA 4TVRA 5M4EA 4IN3A 2YEIA 4JZ3A 2YJXA 5EPLA 4CWPA 1SLJA 3PMFA 1ZUKA 4NXNQ 2A5HA 2R3ZA 4LD6A 2GGRA 1QQJA 1UE5A 2XDPA 3LGJA 5CR3A 1SYGA 1I3QH 4A3DH 4LFBQ 4IJHA 1K3RA 4URLA 3C95A 3PE0A 1N9WA 2QFOA 2XN9C 3WWVA 3WVEB 3UATA 4DF7A 2RM4A 4PFPA 4XQ3A 4HIDA 4GFNA 2ZM6Q 3CCSA 1XPOA 1D7QA 3L2ZA 4M7DC 3MWYW 4C3HH 3HOUG 4JJBA 5K5PA 3BG3A 1Z47A 4MTKA 3HOXH 1UY7A 1C7YA 1GVPA 1PFSA 3RDVA 2M00A 2TSSA 4QIWE 1MIUA 1FNWA 4XCJA 4M7AG 4OGEA 4IIOA 3PGZA 1U4PA 4C92G 1I5FA 2P84A 4EFUA 4JI4L 2DJQA 2NUZA 1KQ2A 4PMBA 4Y92A 4UY8C 4AQYL 1TG0A 5FWCA 4OP0A 4DV4L 2QA4Q 1LACA 2MWOA 1TS9A 4KGZB 4HT9A 4DUYQ 3CCMQ 1F2ZA 4KFGA 3SWNB 1F9RA 4A3GG 1GUSA 3NFCA 4M75A 2OX7A 2HAXA 3K59A 4A3KH 1SFOB 3RKZA 1AWXA 3TQ7P 3VS2A 3K0XA 1IBKQ 2LQ8A 2OAWA 2QF6A 3S6WA 4ZCKA 4PG3A 3VYHB 4GLAC 1N27A 3OS5A 3H0HA 1PZID 3L2PA 1KXLA 2BU7A 3KE6A 3D6WA 4J1MA 3I4NB 1QVFA 1KIKA 2O1VA 3S15H 4DUHA 4N9TA 3TS0A 2FL7A 2JS2A 4XTXA 3TREA 3ND8A 4PLLA 3ULJA 2RDHA 2M9UA 1SNDA 4C5HA 2O5IC 2FFKB 1WTPA 4MNOA 2ZPIB 1NCVA 4GS3A 2F2VA 2COZA 2FEIA 5DY9A 4MZ9A 4AYBE 1PH7A 1QVFP 4DR6L 4PNOA 4PJJA 3RMSA 2NTTA 3INWA 2E6NA 5GMKm 4AG2C 3O2FA 1GCQA 1YSRA 4LMQD 2YU9H 5KYWB 1NLPC 3A8OB 3OSVA 4M4ZA 3CCLT 1B3AA 3JB9I 1KQSS 1GKHA 1U4MA 4ZUJA 1XOVA 3JCMV 4DU9A 1EA6A 3C4SA 3OYKA 3TZ5A 1W6XA 3RIRA 1KIJA 4L5RC 5EGTA 3E2UA 2V8IA 1YEZA 2XGTA 2L5QA 3U23A 3T16A 1PD0A 4RHRA 2LKVA 1XXGA 3MTSA 1ZSZB 2J06A 1IHVA 4N9PA 2L0CA 2XHRA 2DJZA 1K8AR 2RSNA 2RQVA 5CV5A 1H95A 3V7CA 1UYGA 4X3UA 3QDRB 3ZM7A 5JENA 1ZBXA 3PF4A 1KZNA 5ELBA 4MDXA 2JS0A 3RLOA 4P8OA 4BY6C 3I3CA 1N9SA 3CCVQ 1U5KA 3FRPB 3QWNA 4E6IA 4NW2A 3J80L 2JEAI 2Q8HA 1UYDA 2VW9A 4E2FB 2J6OA 2VGNA 1RDPD 1XWEA 1B9MA 1HR0L 4LNQA 4BS9A 2OJ2A 3E19A 3G7LA 4K0KQ 1F2LA 3ER0A 3RLFA 3P75A 3PO2B 1N33Q 3LWIA 3CPWA 3HHUA 1CK1A 3K5MA 3KLSX 2HKQB 1BCPB 1DZ1A 4ZKIA 1C4QA 3HSBA 1EQQA 1R8OB 1BO0A 4IFDH 1X56A 2A68C 3KDFB 3CF5A 1MHNA 3CCUA 4JDSA 1PTOD 1NE3A 1Z59A 4C5GA 1NMGA 1TIID 1K9MR 4ZQ3A 2DAQA 1PG5B 5D3DA 2EYPA 4DR4L 5J39A 3CPWP 1VQLQ 2KECA 3QO2A 2ZPHB 3OY9A 1EWCA 1PA6A 2AKKA 4M77D 1WJSA 4F88A 2RDGA 3FPPA 3A5ZB 3H9NA 3GNFB 4BY1G 1VYTA 1ZLMA 5C0MA 1RIPA 1PH9A 4MPNA 3M4YA 4N4IA 5GAN4 3G4SA 2GA4B 1OXXK 5D65A 1K83H 4M78G 1QILA 4YKWA 4R4QA 1UG1A 4C8QG 4PFOA 3LYIA 4RCCA 1WHJA 1HXYD 2B3GA 2WKCA 4YWKA 4H7BA 1QWYA 2CCZA 2BZXA 1PH4A 4JASA 2YLCA 1GCPA 3QO3A 4M77B 4XQJA 4FCQA 2LJ1A 2CSQA 2RDFA 4IKFA 1I50B 4DR7Q 2KMTA 3KLWA 2K33A 1X69A 1I0CA 1BBWA 3SFMA 2JNGA 4JI0L 1EQTA 2L0AA 3GP7A 1E7ZA 5BR8Q 1W2BS 3VYTA 2FWYA 5GAN5 3F70A 5LMUL 4CWFA 4LF6L 4QW2A 1KSWA 1H9JA 1WFWA 4A93B 1HXDA 3I4LA 2CT3A 2KDSA 3DMUA 1GUWA 1N5ZA 1AOJA 1DOLA 4FIBA 3ICEA 2A7YA 4Z8AA 1CHQD 3MCAB 1TQOA 1WTHA 4DOWA 1LTAD 4K14A 3SK6A 3C2PA 2EY2A 1CKMA 2IG0A 3QUIA 4HCEA 1VQOQ 3PUWA 3PT9A 1Q12A 2NN6I 2ZTCA 3IL8A 5IHNA 4J7IA 4C1NI 1JU5C 4FXGC 1X27A 2ZPBB 3I56Q 2A6ED 1JQQA 2YK2A 2SEBD 2K5WA 3KUFA 4O42A 5C44G 1DJRD 2EJGA 4UROA 3X28B 2XD0A 3NELA 1L1OC 3QDFA 4E7SA 1AWJA 1W6JA 3IKJA 3E0JA 3EGUA 4DBRA 1QKWA 2LCCA 1WCMB 2JA5B 3HFOA 2RI2A 4ATOA 3RN5A 3CCQT 2DNUA 3SGIA 3HS0C 4IALA 5M5WH 2E65A 4OIKA 1J3TA 3EGDA 3D36A 3JZ3A 4OGQC 4DFAA 1SE2A 1EIGA 1D5XC 4C5IA 1EYDA 2ZTEA 4L6V5 3NK9A 4WORA 2PTKA 1SRUA 1A15A 2I2LA 3QTFA 4OMQA 1E0BA 1I5DA 1VQ4Q 1EFNA 4NB3A 1G8XA 2VQEQ 1Q8IA 1UYIA 1EYCA 3A0ZA 2L5TA 4B9XA 2QTXA 2BU6A 2ROTA 5IT9L 1X55A 3C94A 4PJOG 4WRDA 2K52A 1LTBD 4QGUA 2COYA 1UE9A 4JBJA 5IGFA 4L63B 1XPUA 4JYAL 4GN5A 3TVTA 5BOCA 2F3IA 2L3SA 3HOUB 2D6FA 4IOCA 3CQTA 1H92A 5A0LA 4J9HA 2NVYH 2CZ6B 3EG2A 3QHSA 3JCMJ 3UDXA 2VUMH 5KYYA 3B28A 3C3LA 1MD2D 4ME5A 4CC3A 4M7AB 3I55Q 2RHQB 3OYEA 5JVG3 5IYDG 2PQEA 4C92B 3X3MA 3M56A 2DL5A 1IKLA 3RERA 5GAOm 2OQ0A 3TP5A 3TZ4A 4MDWA 2UUAL 2B2UC 4YTLA 1YJWQ 2BZYA 1I4K1 4HCZA 5KYNA 3N5BB 3ITPA 4QQBX 4K11A 2N49A 3NTKA 2NVTB 2O88A 4A3GB 1FL0A 3WVDB 2DRKA 4I7ZC 2EKHA 1J9OA 2R57A 4JI1Q 4A53A 2B8GA 2KHSA 3RLQA 4YWLA 2R7DA 1UNSA 4GNXB 1NHJA 2BT0A 1KLGD 3MXNB 4JAVA 4R3MA 2RJDA 1HCZA 2J4XA 2WAQE 3L7ZC 5EPKA 1HUMA 2B63H 3G6EA 3HEKA 4H85A 2YE9A 2HSEB 4LN2A 1B34A 5J26A 4R3AA 5CV6A 3W2DA 1VA7A 4TKOB 1PHJA 3CCLA 4OGCA 1YITT 3KF6B 2JJQA 1FXXA 1OZ2A 3EG1A 1B1ZA 4F87A 2B2VA 2FWZA 2CCTA 3LX7A 1STYA 4BBRH 1UGVA 4BD3A 1QCBD 2ED1A 1EZ6A 2OTLA 1K1ZA 2RHXA 1GXIE 4XTYA 3CCEQ 4RKUE 4CC7A 2NUPB 1TBWA 1NPPA 1E2WA 4PKCC 4AFUC 2WB1G 4OMNA 3S9WA 1D8LA 2NYZD 1H641 1FJGL 1NY4A 4IUUA 3L2UA 3T0HA 2X35A 2Y4XA 4HIKA 2HKJA 4CWRA 3SE0A 5GAGC 1ASZA 3CWVA 4P71A 1VMPA 2D5DA 1BI0A 3FIFA 4MPEA 1VQNA 4POGA 4XU0A 1G5VA 1BCPC 5KCOA 1D0XA 9ATCB 1S72Q 2EYJA 3SK5A 4ZLTF 1VQ6Q 2OXPA 1KHCA 2V8KA 1XTDA 5CO7A 5IT9c 2RK1A 3I91A 4GLXA 3OYCA 3J81E 1T5EA 1PRTD 5EKKA 1TWGH 2Q2TA 2ZJRA 3JC66 4IQZA 2MF2A 3STBD 1VQ7Q 2XX4A 1IYJB 4JJNK 4OMOA 1W6KA 4C0GA 2K7AA 2FHDA 2XIDA 4QQDA 3LWEA 3H3VI 3GIFA 2H8MA 1M1GA 2HCKA 4ALPA 2LNHB 2B2TA 1RACB 4OMMA 3H94A 2Z6BA 1BF4A 3BDOA 3S17H 3K7AB 4C0DB 3S1QB 2YTVA 1PRTB 2KGTA 4XKAA 5FOBB 2D9TA 4RTZA 4BE0A 3CCMT 3OS1A 1VQEA 3ULRB 3N6RA 4EQPA 3FEWX 1MJEA 2UUCL 3OBWA 3ERQA 4LWFA 4JAUA 1S4ZA 4VUBA 4M77C 5EG2A 3PUYA 4WUCA 3QWYA 2KVMA 1TH7A 4EVOA 1MUZA 3S2HB 4F8MA 3RMHA 2CCSA 4RG8A 2JUFA 4C56C 2W10A 4H44C 3REAB 3OW7A 4BWGB 4L93A 1TWHH 1U9RA 1XNRL 4KT0E 4BY1B 2HD0A 2F0MA 4LF7L 2J05A 2NUTB 3SDZA 2K4YA 1MNDA 1XMQL 2HZYA 1ZYRD 5FLXE 5J22A 3KF8B 2JA7B 1M3BA 1E2VA 3BVMA 2COWA 4BA2I 3HKZG 4C8QB 4K8IA 3SXHA 3DB4A 5CBAE 2CP5A 2C1IA 2QGQA 1O75A 1OPLA 5FROA 3C46A 2C9OA 4FF2A 2F0HA 1NBEB 1L2FA 3EHJA 5GAN2 3FKIG 2EXLA 4IPDA 4ASAA 1ICFB 5EBDA 2F0QA 2H55A 4M7DA 3V7RA 3MP6A 5IYBG 1UGPB 4MZPA 4J9EA 4DNTB 4FSXA 3SR1A 1EY5A 3UDGA 4XKOA 2FZKB 3EFOB 5GAOr 2R7ZB 4KULA 4LXCA 3VR3A 2RQUA 1D5ZC 4RTVA 1CKBA 4DAYB 1TXQA 3D3RA 1AZEA 3WQ9A 3WXMB 1SNOA 1SNCA 1E3PA 4Y7NH 1S40A 2F4VQ 1WQWA 1ESRA 2HT1A 2WI4A 1JB0E 4JCVE 3Q1JA 2ZGWA 2ID0A 3L0OA 4FT4A 4HCSA 5CGKA 2RVLA 1A2UA 2CQAA 1SE8A 4RKBA 1WTXA 4O1NA 4BQJA 2CQOA 2XRQD 2EQSA 3KLRA 3HRUA 4E7IA 2R7FA 3CCRQ 3M4QA 1LT5D 4JI8Q 4GKJL 1I5BA 4GEEA 1PVGA 1GOZA 5FNFA 3U9SA 4NMZA 3VDYA 4U673 1UEBA 5LL6S 1G291 3J81L 3TSWA 1OXUA 2UU9L 1E1TA 5IH2A 3MC0B 4J5YA 3CAMA 1D5MC 3NBHA 2QEXT 2GVBA 2I5MX 5FK9C 3TBIB 4DV1Q 3WOFA 5ISRA 4Y28E 4A3IG 4KHPQ 3VYRA 2EQIA 3MEFA 2CG9A 2H4OA 2RNAA 3PV0A 4XITA 2F0OA 4DNIA 3QOJA 4A3MG 5H1SE 4DV7L 1X9NA 1C0MA 3RLRA 3D7SB 3FHWA 2L1BA 1VQLT 1OTCA 2BTZA 2ZPGB 1KQ1A 4M7AC 1WXUA 1WVLA 1WTVA 2DTIA 1VQ8Q 3VRZA 4KY7A 3BVGA 3A8JE 4GLVB 2YUOA 3LWHA 1FR3A 4GBQA 5G3LF 4CJ0B 4NPSA 1A2TA 2Z6KA 1UB4A 4XU2A 1WHMA 3EG0A 1TWCB 1GO3E 2MJ8A 1BCPF 1IBMQ 1NHIA 3FB9A 4PJOB 1ESFA 1Y8OA 3VS7A 2LVMA 1SMYD 1STNA 3OIPA 3LGLA 3I4MG 1RODA 1BXDA 2B2YA 4NOYA 2R5MA 5CQYA 4GNXC 2KK4A 5EBCA 1OU8A 4J8OA 1JJCB 2JK8A 2VYTA 3ZYYX 4LF8L 3JV3A 3H09A 3CD6Q 1QUQB 4MMLA 3A7LA 1WI5A 2QILA 3HOZG 1D0YA 1BBZA 1KJWA 5CIUA 4HJ8A 2DIQA 2IWSA 1STGA 4A3BB 4EMHA 1SSOA 1X3PA 2XRSD 2ASBA 5F3KA 1B53A 2IX3A 3I5RA 2Y0SE 2NYSA 4XXEA 1HQRD 2XDDA 4EQOA 1EIYB 4AFZC 2E0AA 3JAMi 4ZVIA 2F5TX 1M5Q1 4L6TB 3T1HQ 3NQTA 2NZHA 5GAOq 2V8JA 3T1KA 1EYGA 2FRWA 4LUOA 3ZKBA 3P8BB 4R8IA 4B3ML 2OTJQ 5KEEA 4MB9A 1KAAA 3CXCA 2YRVA 3RUXA 1QVCA 3AU7A 1PH1A 2M0YA 3CGZA 3ZFJA 4YWMA 2DD4A 4DXGA 1YWPA 2ZDYA 3VUZA 1GRIA 3OYDA 1TU2B 3I56T 4DR5L 5C4XG 2UXBQ 1BDOA 1PWTA 3D4DA 2E12A 1YVCA 3I90A 4R0KA 4CBVA 3T1YL 3RZDB 1PV4A 1U3OA 3RZOB 4FPPA 3CXCP 4V25A 1CSQA 3EH1A 4RG2A 2F0JA 1B63A 3S1RH 1WHKA 3GTKB 2LMJA 1EY6A 4A3LH 1D2BA 1YT2A 1OXVA 5M3FH 3TZ0A 2HHHQ 2G6FX 2BDOA 2F0GA 4CRIA 4DBHA 1GUOA 4PNYA 4LPBA 4A76A 2JA8G 2DZ9A 4F16A 1RAGB 2LSSA 4KMUC 3NEMA 3QPHA 4H81A 1T0HA 2NBFA 4BY7B 2LTOA 3UDCA 3TP8A 4A3FG 1UYKA 4A3EB 4JBMA 3M4OH 2WERA 2K32A 4DV6Q 1WDXA 4JRKA 1KDBA 2PVDB 3TSZA 4F7UF 4BDYA 1B4OA 3I9QA 1LABA 4GOPB 4C0DC 2MCNA 1VQ4T 1PRTC 4K2LA 2VQFL 1MU5A 2L4NA 1PMRA 1TWAH 4HMJA 4DR3L 2AWNA 1UJYA 5EJWA 3GTGB 1E22A 4HJ5A 3C12A 5EC7A 2BCOA 4UP9A 4LFAQ 2QA4A 2WFWA 2PQAA 2RBMA 2Q8IB 3VS0A 5C0XG 1CQFA 2F0VA 4LDVA 1WJRA 3CCMA 4AWQA 1YNJD 1NEGA 2HCCA 3JB9F 2LT1A 1KABA 1KRSA 3PCOB 4FDBA 3E0EA 1WHGA 4HYMA 4DR1Q 2KBNA 4ZGEB 5FLMG 5GJWB 1BGQA 3I55T 1SFOH 2K3XA 4KN4C 2GVAA 3HOWB 1SSFA 4DA4A 1Q81C 2JEBI 1WIEA 1BR9A 5FRMA 5GAN6 2X6GA 3N52A 3S1MH 4PFZA 1II3A 2NUCA 3ND9A 3AEVA 3BM9A 3FP9A 1Q95G 2X69A 1WD0A 1IBLQ 2F0WA 3I4NH 1Q81U 3NXWA 4BDZA 1RUWA 4RTUA 2DUDA 4R1FA 3QIIA 3X26B 3CEYA 1FVIA 2PMZB 1RKNA 2PNHA 4RKLA 4BXXG 4QCLA 1JM6A 2X6LA 2DYIA 5HK3A 3K6OA 5E3FA 3S1NH 4FMTA 2JMAA 5GMKe 3GTJH 1GXDC 5JJLA 1EZZB 5CAIA 4EGKA 1Y1VH 3MP8A 2DNEA 4CWQA 3M85A 4A63B 3K98A 2EWNA 1ZYRC 3J80i 4C3JB 1TWFB 2C35B 2XNAC 1XNIA 4KBMB 1HJPA 3M57A 1BCOA 1UDLA 2MO0A 3GOXA 1YC1A 3T4AC 4M7AF 4PMWA 3HYYA 1ET6A 4EDUA 4C92F 4AT1B 2PVOB 1N8RU 1OULA 3FT5A 2RI5A 2D1XA 4E7LA 1HUNA 4IFDJ 3OS0A 2RPNA 3PO3B 4Z9CB 2H3EB 3SWNA 3CCET 1EQRA 1YBYA 1S5BD 4YIJA 1R9TH 2DLPA 1QYEA 3H4LA 1WLPB 2DBMA 2X51A 3CBPA 4MP7A 3VHCA 1VQMQ 4X64L 1TUCA 4A3CH 5EQ0A 3OYBA 2E5LQ 4B3RQ 2YUNA 3CCVA 1EWIA 1KTKA 1AT1B 1EUJA 3X3NA 4CDFC 1UYEA 4LP0A 3MNRP 2JTMA 2L12A 1ZA1B 1FGBD 4RMFA 5CKDA 4DAMA 4A54A 4C2MB 1S72T 5FWKA 2HIXA 1YNXA 1S14A 5LJ5h 3JSCA 2AKLA 4BY6B 2YE6A 3EFXD 5L23A 5HGTA 2NVXH 2VKNA 1B62A 1QZHA 1K73C 2OI3A 1VQFA 4WFN3 3S2DB 1T3SA 4BIZA 3A8KE 4B7PA 4HZ0A 2QASA 1OYXA 4Z89A 2QDBA 3BU2A 1K73U 1NUCA 2QG0A 3NSWA 1PKTA 2K5IA 2E3IA 3EGXA 4J7FA 5KYUB 2K14A 1WXTA 5C3EH 2SNSA 4DZYA 3G7ZA 3ZEHA 1VQLA 2PQWA 4HXJA 1PH3A 4DXFA 2QQAA 2D0NA 5DM7R 2LZ6B 4HCCA 1OU9A 1ZSZA 2GF7A 4M77G 3BVZA 2PUOB 5DM63 2UXCL 3OYMA 2YE2A 5GMKh 3KUPA 1BI2A 4JV5L 4JI4Q 1WX6A 3OWEB 1MHWC 3T53B 3Q0AA 4AQYQ 1JOKA 3NHHA 1STHA 2CZ1B 2WSEE 1L0YB 4DV4Q 2GFDA 3G4ST 4MN3A 3DKMA 1M27C 3O8VA 4IURA 2F0NA 4LUVA 4QPKA 5M4MA 3I7FA 4RG1A 4NH7A 2RF4A 3EVQA 2ZBKB 4ULLA 2BE9B 3MO8A 2AMCB 4LFCL 4OO1G 4ILWA 1I59A 1SEMA 2DL4A 2EYWA 4P73A 5IHIA 1UECA 3T13A 4M8AA 4JBWA 2YXYA 1RAIB 4H0LC 1H3ZA 3I5SA 1JJ2A 3A7AB 1I07A 4YHHL 3INZA 1OSFA 4IZ8A 5CR2A 4L90A 2XU8A 1P8LA 1A6XA 5T1IA 4P2CB 1GJVA 1N6AA 2XKOC 5M4NA 1WGSA 2RJFA 1CKAA 1NTGA 2O4XA 4ELZC 4JS5A 1HPCA 2YHTA 5GAOl 4BA1I 3L9AX 4DPGA 1X3EA 4DV2L 4DR6Q 3GF5A 1TY2A 1YHAA 4V0BA 1QY8A 3EHGA 4YKYA 4BIUA 4A3JG 4E01A 4OB3B 2KRMA 2MI6A 1WTWA 4FCYA 3HOZB 4O5VA 4J83A 2VXWA 3NPFA 1EEID 1E2ZA 4O0AA 1ZW9A 4LDXA 2YGAA 1DJ7B 4LF9L 2BTTA 1TH8A 1HD3A 4D6WA 3I56A 1SJED 2Z8LA 1WTQA 2WINB 3GLXA 2F1MA 3OYJA 1WTRA 1CZGA 2DE0X 3GV3A 1K8OA 4ASBA 1VQPQ 1HNZL 1N32L 2ES2A 3GIGB 1Q82C 3K60A 2E70A 2EJ9A 1ZQ1A 4M78F 1QVGP 2RQRA 4A4HA 1EU4A 4C8QF 5D7CA 5IYCG 2M9VA 2IY5B 2FG0A 5JOBA 3VA5A 2FRYA 2BREA 5FNCA 5I6WA 3M59A 2N78A 5GROA 4RGNA 1EQVA 2ZXRA 1WCMH 2WAQG 5IGDA 5CKEA 2JA5H 3H0GH 1RTOA 2VVKA 1L1OB 4EX5A 4GOPC 2M1HA 3JB9H 3J7AF 3NTIA 3H80A 4O2DA 4A3DG 3MP1A 3HYZA 2K3YA 4WUDA 3KJOA 4ORZA 1E6GA 1SG5A 4E47A 3CMEQ 4OHJA 3TTZA 2JXMB 1HSQA 3E9IA 4XDMA 3TQYA 2CWAA 1VQ4A 2PNIA 4JQLA 3M0UA 2F0SA 4O04A 4C3HG 1DCZA 2KSSA 5LMNW 4AYBB 1K0RA 1ZXTA 3HOXG 2P0QA 2JA8B 4KI0A 2RJCA 1TXYA 4LUZA 3H15A 2O5JC 3BMYA 4D8DA 3U2KA 3R93A 2NVQB 1UY9A 2KJXA 2XX5A 1Y96B 4A3FB 1M2OA 4LAAA 3AFQA 5CQXA 3OMCA 1BKBA 4A4KA 1QP2A 3OWBA 4DKAC 1VQ8T 2B8FA 1NG2A 4MIUA 4F7UA 1YI2Q 2B39A 4TSSA 3A0RA 2EVRA 4OX9L 3I55A 2RQXA 1QB5D 2C1GA 2F0TA 1ZEQX 2OT2A 2WSFE 1D3BB 5CKFA 1YP5A 1U1SA 5GQOA 5IWAL 1YJWA 2Z9HA 5IODA 3M3YB 1IGQA 2BU8A 2KOLA 4II1A 1GM5A 3GBQA 2A28A 1I4XA 3MFYA 4QVCA 4FF1A 1K73R 4XTZA 1ZKOA 1I5AA 5GJVB 4A3GH 3CRKA 1SRMA 1D1KA 3G71Q 1JCKB 3GD7A 2KYBA 2WI1A 1GFDA 1WPYA 1I4RA 2CFMA 5JEAH 1WTOA 1K3BC 4FVMA 4BBSB 3VJPA 4IUNA 4CDDC 5I21A 3Q6SA 2IWUA 1M2VA 3G6ET 4ASFA 4HAEA 1Z9FA 2WSCE 3GPLA 1PH8A 1HNXL 1XNQL 1N34L 2OTJT 4FYDA 3D0BA 4JI0Q 4X3TA 4XTCS 4PJOF 1ABOA 1GHJA 2OEOA 5FJ8G 3ERSX 5LMUQ 2YTYA 3M7NA 3CC7Q 4LF6Q 4HJ9A 3HOYH 1R4QB 4HIMA 2YEGA 3JAMc 2BOSA 3CCEA 2EYFA 5DLQE 2OTLT 1B70B 4TRDA 4DEYA 5I2XA 2R92G 1UY8A 5HURA 2C06A 2XDBA 2AHOB 1UUEA 2NLUA 5GAHC 4M7AA 1SDFA 2E2IH 4J9CA 3HZ5A 3B24A 2ZPEB 5GADC 4C92A 1PLFA 3PTAA 2O9SA 1QCFA 4RWSC 2IJ0A 2XDKA 1GL5A 2ALYB 1IO6A 2VWCA 3BYYB 1M8VA 3H41A 1NYGA 1VQNT 1S72A 3EQLC 1SMXA 2X4JA 3DLMA 1JO8A 1VQ6A 5IOCA 2HDLA 1G2SA 3NPPA 4LK1C 4P74A 1V1CA 1R0BG
chains in the Genus database with same CATH topology
1UGVA 2GBQA 2ED1A 1UYMA 1K1ZA 4EEHA 4YKZA 1T0JA 4CC7A 1UTIA 2ENMA 1OOTA 1TBWA 3ZXOA 2ABLA 4AFUC 2BZ8A 4OMNA 4BQGA 4YKQA 4HVVA 3EHRA 3T0HA 2BU5A 2JM8A 4IIMA 1AH6A 2HKJA 4KP4A 4CWRA 3CWVA 1YT0A 2WI6A 4AG1C 2DF6A 1BYQA 4KQVA 2J6FA 4P7AA 2PZ1A 4LUDA 2AKPA 4MPEA 2HBWA 5IN9A 2GQPA 4MOTA 2O9VA 2O1UA 4AWOA 2M51A 1YT1A 1NYFA 4E6RA 4F17A 3R4MA 4W7TA 2L2PA 1T3LA 2FYPA 4URMA 2LJ3A 2K9GA 2HG1A 2C0TA 2F2XA 2XX4A 5HCKA 2EW3A 3M0RA 4X1VA 1KFZA 4I3HA 2RF0A 1BU1A 4OMOA 1NHHA 2K5BA 2K7AA 1ZUUA 3RLPA 5M4PA 2KRSA 4OMPA 2XJJA 3GIFA 4PU9A 4GLMA 1K0XA 2HCKA 3UA7A 2H8MA 2LNHB 2IORA 4OMMA 1K0SA 4HZ5A 1Z9QA 3M0SA 1M3CA 4FCPA 4CE1A 3PVLA 2KGTA 4XKAA 2KYMA 4RTZA 3EKRA 3IEDA 1JXOA 2LX7A 2YEFA 3ULRB 3LNUA 4X9LA 3G75A 2VCIA 1M3AA 4LWFA 4JAUA 5IDJA 1PRLC 1TUDA 4CE2A 3O6OA 4O05A 2FPFA 3GIGA 4WUCA 2KXCA 1WI7A 2JW4A 3QWYA 4O09A 2MOXA 2YEBA 1MUZA 1M30A 2CCSA 3ZKDA 2YKBA 4AS9A 2V1QA 4XTJA 1W70A 3R91A 2FXSA 3C0CA 1ZX6A 4E02A 2EGEA 2LP5A 2W10A 2YT6A 3REAB 1W1FA 4EMVA 4L93A 4YKXA 2X3WD 1UYHA 2K79A 2AZSA 4JPBW 1YERA 2Q8FA 1I1JA 2J05A 2L3PA 4LUEA 1US7A 2YI7A 1QYEA 1Y8PA 1M3BA 4HVUA 1B07A 4Z88A 4H81A 2BYIA 2EYZA 4HCKA 1NEBA 2ESWA 1OPLA 3PEJA 4B6CA 2JMCA 1UYFA 3EHJA 2CUBA 2K3BA 2EXLA 3A0TA 4ASAA 1WA7A 2A36A 3VHAA 2H55A 2CT4A 4J9IA 3O0IA 4J9EA 1PKSA 3WHAA 4XKOA 1S16A 3VS4A 3M0QA 2WI3A 3OPDA 2KBTA 1B3QA 4LNPA 1YSZA 2RQUA 1YESA 4RTVA 1CKBA 2HEQA 2H8HA 1YETA 1AZEA 2I0NA 3VADA 2EGCA 1UHFA 4J9BA 4Q20A 1ARKA 2WI4A 1QKXA 4RTYA 1AVZC 2IOQA 1OEBA 1Y4UA 4LWGA 2UWDA 2YEDA 4XIRA 4U7OA 1UYLA 1AEYA 3PVQA 4CC2A 4ESRA 2YK9A 4BQJA 2YUQA 3A0XA 1VYVA 1AJ6A 2VCJA 1ZWHA 2SRCA 4OMLA 2CSIA 1I5BA 2YI6A 1ZBJA 1R62A 2CREA 2DL8A 2ED0A 2XHXA 1PVGA 1PRMC 5FNFA 4CWSA 4LWHA 1Z5AA 4L8ZA 2WEPA 1G83A 2GTJA 3TSWA 1X43A 4ASGA 4PRXA 2WI5A 2LQWA 5IH2A 2BZ5A 4QPJA 3INXA 1HJDA 1H7SA 3C11A 1YCSB 1U5SA 2EQIA 2CG9A 3G7BA 4HYPA 2RNAA 4KSGA 2JKIA 4XITA 4NH8A 2FPDA 2YKJA 1A4HA 2QG2A 3R4NA 3RLRA 1QLYA 1RLQC 2BTZA 5CTWA 3VRYA 3O5ZA 2YI5A 1WXUA 2BSMA 3VRZA 2XDSA 3FT8A 2YUOA 2KNBB 2V1RA 4GBQA 2ZDXA 2YEEA 1YNZA 4GT8A 3NHNA 1GFCA 3EG0A 2O1WA 2RN8A 2CDTA 1FMKA 3CGYA 3VHDA 4U7NA 1NHIA 4GGLA 1Y8OA 3VS7A 1OPKA 3OWDA 2XCMA 5GGZA 4BXIA 1BXDA 1Z5BA 1SHGA 2YECA 1YN8A 3JV3A 4EIKA 3NMQA 4KSHA 3R4OA 1BBZA 1KJWA 2WI2A 3EG3A 5L3JA 3H0IA 5F3KA 3K97A 1U2OA 3I5RA 4ZVIA 2KRNA 4AFZC 2YE4A 1BKNA 2W0ZA 4EM7A 3T1KA 3ZKBA 2K6DA 4CWTA 2DX1A 2FRWA 2ESAA 1I58A 3A98A 2YKIA 4GCZA 3R92A 5J71A 3Q5KA 3OW6A 2YSQA 3VS3A 4DEXA 2YGEA 4CC4B 1RLPC 4MB9A 1MV0B 3GIEA 2C0IA 2VWFA 3H0FA 2XK2A 2M0YA 3CGZA 3HZ1A 4YKTA