2CH4A

Complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
320
structure length
320
Chain Sequence
GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLTLAIIQALLVKVNNLVYAIPIANIDTILSISKEDIQRVQDRDVIVIRGEVIPVYRLWEVLQIEHKEELEEMEAVIVRVGNRKYGIVVDDLLGQDDIVIKSLGKVFSEVKEFSGAAILGDGSIALIINVSGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reconstruction of the Chemotaxis Receptor-Kinase Assembly
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/chemotaxis
molecule keywords CHEMOTAXIS PROTEIN CHEA
total genus 72
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01584 CheW CheW-like domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ch4A02
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2ch4A03
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2ch4A01
3CGZA 3ZL7C 4EGIA 3REAB 3VS7A 3HZ5A 2NUZA 4OMMA 2XDKA 1WI7A 3U2KA 2CCTA 1THNA 2L2PA 2MCNA 1Z5AA 1WIEA 3M0TA 1YWPA 4O04A 2ECZA 4PL9A 1GCPA 4OMNA 4JASA 1PWTA 1X2QA 1UUEA 2KXCA 3GBQA 3PVLA 3BMYA 4XKAA 2HKJA 5BODA 4Z88A 2XDSA 4X9LA 2E0AA 4L8ZA 1AWOA 2JS2A 1HD3A 2YEJA 1NG2A 2OI3A 3B28A 4GLMA 2YT6A 2AZSA 2DBKA 3M0QA 2BU6A 2DL5A 1Z9ZA 2EYXA 1UTIA 2ZBKB 4CWRA 2DVJA 2EBPA 3O5ZA 4LWIA 1PKTA 2P4RA 2WI6A 4QPJA 5HCKA 2JTEA 4KSHA 4EM7A 4LE9A 4FCPA 4LWFA 2XJXA 4CE1A 2GGRA 1GKXA 3A0XA 3A0ZA 3TSWA 4E01A 4PRVA 2ESAA 1I5DA 4DEXA 1RUWA 5GJVB 3RKZA 2GQIA 2KRSA 4E02A 1T0HA 1QYEA 2JMAA 2EXLA 1ARKA 2KXDA 2GTOA 2CSQA 2J05A 1UYEA 4KP4A 1ZW9A 3K97A 2DA9A 1TBWA 4XDMA 1QZRA 3R6NA 1GFDA 1AMWA 1YC3A 2D8HA 2HSPA 1YESA 4GFNA 3VHDA 5FNDA 2CUDA 2O1UA 3CRLA 1UY7A 2YE8A 2EYZA 2K2MA 1XOVA 3A0RA 4BAEA 1QCFA 2VWFA 2AKPA 2BYIA 4J9FA 4AS9A 4GBQA 2K3BA 4O0BA 5D7CA 2YEGA 2YGFA 1MV0B 3REBB 2IOPA 2XDLA 2IWSA 1VYUA 1UJYA 4HY1A 2WERA 3B24A 3FV5A 4J9CA 5CF0A 1GBQA 2EW3A 2H8HA 4AFQC 3BM9A 4GEEA 4GGLA 4O07A 2KE9A 3QDDA 2YECA 1Y8OA 3EG2A 4AFUC 1Z5CA 1A4HA 1ZXMA 2LNHB 4Y92A 2M51A 3C0CA 2BZ8A 3I5RA 4YKTA 2Q8GA 4MP2A 1U06A 5BOCA 4HYPA 4AWPA 1MUZA 1T3SA 4F14A 1YNZA 2DRKA 1Y4UA 2RQWA 3EGUA 1Z9QA 1I07A 1AM1A 1ZLMA 2D0NA 2DL8A 4H7QA 2YE6A 3R91A 2W10A 1NM7A 1UECA 1W70A 2ROLA 1U2OA 2IOQA 3O6OA 4HXZA 4WUDA 3RLRA 2LJ0A 5IN9A 4EEHA 4ASBA 1TG0A 4LUDA 1UY6A 3C11A 3Q5KA 1SHFA 2K9GA 2FPEA 3U2DA 2A28A 2XD6A 1M27C 2ABLA 2BZXA 1UYLA 1GRIA 2L3QA 3NMZC 2DL3A 1BK2A 4B6CA 1K76A 4CE3A 1ZWHA 2KYMA 4R3MA 2G6FX 1JXMA 1Y57A 3JZ3A 4RTXA 2DILA 4WCIA 4FCQA 4YKZA 3A98A 5D6PA 3VS5A 5C93A 2SEMA 1AH8A 4O05A 2CCUA 2IIMA 2DRMA 1OPKA 2M0YA 4FSSA 2YE2A 3DGEA 2YKBA 1E6GA 1E6HA 1WXUA 3T10A 2K5BA 1YCSB 4IIMA 4LWHA 4CC7A 1TUCA 2O1WA 2FRYA 2CUBA 2RN8A 4EFUA 4DZYA 4Q20A 4R0KA 1ZUUA 3NMQA 4RTZA 2FO0A 5I22A 2HCHA 2HDAA 4EIKA 2C0OA 3H0HA 1FYNA 1GCQA 1TC0A 1CSKA 4MPNA 2EKHA 1PHTA 2ESWA 4Z8AA 5IDJA 1I59A 2X3XD 4MPEA 4GT8A 3IQLA 2BT0A 4KFGA 4ESRA 2DF6A 3A0TA 1OPLA 1YERA 4BIUA 4CWNA 1RI9A 2FRWA 3OWDA 2KR3A 4HXWA 1K1ZA 1M3AA 2KBTA 4LPBA 3T0ZA 3VHCA 2BTZA 4CE2A 1KFZA 2RPNA 1AWWA 4XD8A 1PRMC 3PEJA 4EGHA 4L94A 2YEFA 4URMA 1AWJA 4HVVA 4BIZA 4AG2C 1GFCA 2JW4A 1GL5A 3OWBA 2KYBA 3K98A 4XCLA 1NEGA 4J9BA 3U23A 4EGKA 2LX7A 2YEIA 1U0ZA 2CCSA 2QFOA 4H81A 4U93A 1ID0A 4K11A 4XTJA 2BTTA 2I0NA 1YP5A 3HYZA 2O31A 3SL2A 4KRTA 2EGCA 2JS0A 2DYBA 1JM6A 3I5SA 3JV3A 4F17A 1YSRA 4RUGA 4YKYA 5D7RA 2XDXA 4Z89A 5J6AA 2XHTA 3K60A 1T3LA 3VRZA 2GFDA 2FWZA 3WQ9A 2AKKA 5IHNA 4URNA 5M4KA 4JZ4A 2YEEA 3T2SA 1UYKA 1PNJA 3TTZA 3R4OA 2LJ1A 2HG1A 3SEMA 1U3OA 2XHRA 1B63A 1NYFA 5GGZA 1PRLC 1KSWA 2J6OA 4UROA 1G83A 2VVKA 2L3PA 3NGPA 3PEHA 4LNPA 2XX2A 2YK2A 2EQIA 4HY6A 2IWUA 4MPCA 3D36A 1OSFA 3VS0A 3VS6A 2C2AA 1HJDA 2A36A 1UY8A 1NYGA 2QG0A 1PKSA 3RLPA 1BYQA 4XIQA 3TZ2A 1ZXNA 3ZXQA 1AOJA 2O9SA 1J3TA 2XJGA 4K4OA 4HZ5A 4YKQA 5D7DA 2YUNA 2EYWA 2YE5A 2ZDXA 4ASFA 2A37A 2YI6A 4LP0A 2RF0A 1MU5A 4NH7A 4BXIA 1EFNA 5I11A 1A0NB 1Y4SA 4XKOA 5M4HA 2Q8IA 2VW5A 4GQTA 2YKCA 1YSZA 2BZYA 3TUHA 1QLYA 2WI2A 4HYMA 4LWGA 4U7OA 1BBZA 4YKXA 2WEPA 2RQVA 1W6XA 1EI1A 1M8MA 3VS1A 1N5ZA 1B62A 2RQTA 2QF6A 1OEBA 2XX4A 1NLOC 2ED0A 2WI5A 4GCZA 1UHFA 1W1FA 1GKZA 4EMVA 3WHAA 1UYDA 1ZBJA 3FJ5A 1B07A 1K9AA 1M3BA 2YI0A 3SHWA 5FWCA 1TC6A 3QTFA 2J7IA 4AWQA 1SSHA 2BSMA 1WXBA 1UYHA 2YEAA 1T0JA 1AD5A 4R3AA 3TSZA 3R4PA 2ROTA 2CT3A 2Q2EB 1UFFA 2YEHA 3EHFA 2JM8A 3ULRB 2J6KA 3H0FA 1Y8PA 4CC2A 1KZNA 4ORZA 3HHUA 1BKNA 1H92A 2L3SA 1R62A 2EGEA 3FT8A 3Q5JA 1NLPC 2Q8HA 3M0UA 4FCRA 2RNAA 4XE2A 1K0XA 4CWSA 2OJ2A 1VYVA 1YC4A 5FWBA 2BRCA 2VKNA 4LWEA 2CG9A 2DBMA 4WUBA 4HCKA 2XX5A 4HZ0A 1VYTA 4JJDA 1QWEA 1YT0A 1ZX6A 4JZ3A 4LN2A 2WEQA 1WLPB 1AZGB 2FPFA 2XABA 1KJWA 2GBQA 3TVTA 1Y8NA 3U67A 2DLPA 3Q5LA 2IWXA 4R1FA 1WFWA 1X69A 3EG1A 2EYYA 1KIKA 2XCMA 2XMFA 5FNCA 3LH5A 1ZUKA 2PZ1A 2YI7A 3RBBB 3H4LA 2PNRA 1ZSGA 4J9IA 5IH2A 3EG3A 1UDLA 3D0BA 5FNFA 2RMOA 4NH8A 1BXDA 5IDMA 2BZ5A 2C0TA 2YK9A 1QKXA 2HEQA 3UA7A 2FEIA 1MX0A 2BREA 2YSQA 1CKBA 2RQUA 3EHHA 2DJQA 2YEBA 2AKLA 2ENMA 4L93A 4J9HA 3A0YA 4KSGA 1WYXA 1X43A 2WI3A 1SRMA 2YKIA 4XIPA 2VWCA 4JPBW 5IXFA 4P8OA 3RLQA 1BGQA 2YUOA 2WI7A 1I5AA 1UJ0A 2DM1A 2YI5A 2MIOA 2D8JA 2CSIA 4CWFA 4QT7A 5FWKA 3THKA 4XKKA 1UYCA 2CH4A 1WXTA 5FW9A 2V1RA 2CT4A 4D8DA 1YT1A 2LP5A 4FPPA 2FXSA 4PU9A 1FMKA 2JKIA 1KIJA 4QPKA 2CREA 3OW6A 4AG1C 3RNJA 3T0HA 3H80A 1NEBA 1H7UA 3T1KA 4ZKIA 1H3HA 1I5BA 2IORA 1ABOA 2J06A 1SPKA 2YGAA 4B7PA 3HZ1A 1VA7A 2KRNA 1OV3A 1YT2A 1JU5C 2F2VA 2BU7A 2YKJA 3LPSA 3GIEA 4H85A 4KTNA 4M4ZA 3QWXX 2HCKA 3TZ0A 3I35A 2DX1A 1X6BA 2GTJA 1BB9A 3GIFA 2WI4A 2KEAA 3G75A 4MOTA 4RTWA 2LQNA 3VS3A 1EA6A 2XHXA 2DE0X 2KT8A 3ZKBA 3R4MA 4MB9A 2B86A 3G7EA 4CWPA 5L3JA 2SRCA 1QWFA 1Y0MA 1HSQA 2YGEA 2FPDA 3O2FA 2AZVA 2E5KA 2KROA 2W0ZA 1AJ6A 4PRXA 2PNIA 1JO8A 3D2RA 5CTWA 4CWTA 4OMLA 4RTYA 3EKRA 5CPHA 1TH8A 1V1CA 2FWYA 4YKRA 3CQTA 3OMUA 1H8KA 2O1VA 2JXBA 1NHHA 1JEGA 3G7BA 4ASGA 2RQRA 1QY8A 1M30A 1UY9A 3CWVA 1NHJA 4V26A 3ZM7A 3PVQA 5IXBA 1US7A 4MBCA 5CTXA 3INXA 1M3CA 3CGYA 2KNBB 1B3QA 3OPDA 3R4NA 4AFSC 1K0SA 2F2XA 5EC7A 1I5CA 2YJXA 4JQLA 1JQQA 2CGFA 2HBWA 4CWOA 2EVRA 2F2WA 1SRLA 1AZEA 4P7AA 4U7NA 3VADA 3UA6A 1RLQC 3NHNA 2GNCA 4DUHA 3C0EA 4XIRA 4JJBA 2LQWA 1I58A 3A0WA 4RTTA 2XJJA 1X27A 1TIDA 2YUPA 1E7OA 3EHRA 2EGAA 3NPFA 1UG1A 5CTYA 1IO6A 1QKWA 1SEMA 2H55A 1I1JA 4E6RA 2ZKJA 4L90A 1TILA 3MNRP 2YE4A 3M0SA 3EHQA 3GIGB 4HVUA 4BQJA 2O2OA 2YE9A 4E00A 1UGVA 1PVGA 2ZDYA 4EFTA 4JAUA 1YN8A 1AVZC 3TZ4A 1WX6A 2YE7A 2D1XA 3K99A 1X6GA 1UYMA 1YC1A 2LJ3A 4XITA 2DL7A 2C0IA 2KGTA 1L0OA 2JM9A 2O88A 3KFVA 2CDTA 4XC0A 4ZVIA 2QDLA 3UF4A 1GJVA 4O09A 2BU2A 5M4EA 2YEDA 4OMPA 4I3HA 3O0IA 5M4PA 3ZKDA 4ASAA 4HXJA 1ZUYA 4OMOA 5ECAA 2EPDA 5F3KA 4FMTA 3VHAA 4J9DA 1S16A 4JJCA 1WA7A 4I5SA 4MP7A 1H7SA 3HYYA 1AEYA 4L91A 4YKWA 2UWDA 1GBRA 3HEKA 2KT1A 2FG0A 3B25A 2K79A 1NHIA 1UYGA 1Z5BA 3UATA 3GIGA 1G2BA 1K4US 2BU5A 2O9VA 3B27A 1MV3A 3FT5A 3R92A 4AWOA 2JJCA 2DNUA 1U5SA 2X3WD 3INWA 2OAWA 2NWMA 2CH4W 1ABQA 1S14A 1GCQC 2VCIA 3M0PA 5GJWB 4W7TA 2YJWA 5M4MA 2DL4A 1OOTA 3PE0A 1RLPC 3VS2A 2A08A 3EHGA 5IHKA 5F5RA 2Q8FA 1CKAA 2YDLA 2WI1A 2J6FA 2DMOA 2MOXA 1X2KA 4HVWA 1I0CA 1JXOA 2AK5A 1LCKA 3M0RA 1UYFA 5D6QA 1S1NA 4RTUA 4URLA 2BYHA 3B26A 2XK2A 4NH9A 4J9GA 1TUDA 2JT4A 1UHCA 2LZ6B 4LUEA 2PTKA 1WDXA 3KE6A 4D8KA 2YUQA 4BQGA 4F16A 5IHIA 5M4NA 3H0IA 4YKUA 3I9QA 2YE3A 2L0AA 2V1QA 4WUCA 4CC4B 5CTUA 2K7AA 3VRYA 4J9EA 4A63B 1UE9A 4DEYA 2LMJA 1YETA 3TZ5A 1YWOA 2ED1A 4JAVA 1SHGA 2QG2A 2H8MA 4XCJA 2GQPA 3QWYA 2JMCA 2K6DA 2FYPA 4AFZC 3CRKA 3EHJA 1Z59A 4RTVA 5J71A 4ZNXA 2VCJA 3ZXOA 5L23A 2YKEA 3LNUA 2BU8A 1AWXA 1YS3A 4CWQA 3EG0A 3H41A 4X1VA 2LCSA 4IIOA 1AH6A 4CC3A 3EKOA 1UYIA 2XDUA 4V25A 1BU1A 4OMQA 3VS4A 3IEDA 4KQVA 2KRMA
chains in the Genus database with same CATH superfamily
4M8AA 5DM73 4C5EA 3REAB 2R5AA 3VS7A 2HIVA 1ONLA 4OMMA 2SDFA 3X28B 2MCNA 2DFUA 1DOKA 4PZ8A 5C4XG 1VQOQ 2ECZA 5BN5A 4JI4Q 2KXCA 3CMAQ 4LF4L 3QIIA 4JOIC 3KUFA 2HKJA 1I81A 4Z88A 5JJLA 4GLKA 1YITA 2NWGA 4ID6A 4L8ZA 2CZ6B 2JS2A 3H0GB 3FC3A 2OTJA 2K28A 3SR1A 1PH4A 4OF1A 1FVIA 2YT6A 1BBUA 3FLGA 4A76A 2EYXA 1Z9ZA 4N0AA 2ZBKB 2E5LL 1EOTA 2NUPB 3META 3OYYA 3P8HA 1ML0D 1TWAH 4ZUIA 5M3FB 4A3CH 1GJXA 1HHVA 4LWIA 4QPJA 1Q7YC 1D1KA 2JUFA 3VKIA 1DYQA 1RADB 2Z6KC 3H0GH 4OHJA 4X3SA 4QF4A 5H1SE 3CCLA 2ZAEA 1S5BD 2OQ0A 4FYYB 3A74A 2K1BA 2NN6I 1GKXA 3A0XA 3IKJA 4E01A 2HAXA 1WCMH 4LAAA 2JK8A 1I5DA 1TKWB 3A7LA 2GQIA 3OMGA 4WTOB 1QYEA 3M9BA 1CKNA 3S1NB 1S3OA 2H3JA 1A0IA 4A3BB 2LSSA 1BO0A 1M90R 4KKUA 2GTOA 2F0JA 2J05A 5GAMd 2XWBB 3T1HL 1UYEA 3K97A 1H9RA 2DA9A 1TBWA 1AW7A 2Y0SE 5GAN3 1TXYA 2IY5B 2HSPA 4JRKA 3SK8A 3HOYG 1YC3A 2RF4A 3ZYYX 1XNRQ 5I6YA 1UY7A 3R3OA 4DA2A 1XOVA 2RH2A 2ZTEA 4PJNA 2E2HH 1I50B 5GAOm 5JEAJ 1YJWQ 4A3JH 3MXPA 5IP7H 1GVPA 4KLKA 4MDWA 2XHCA 1WOCA 3IFDA 3SDZA 2AUKA 4MZ9A 2YGFA 1NE3A 5GAHC 2IOPA 1N8RU 1PH7A 1G2TA 1VYUA 2IWSA 1UJYA 1QVGS 4BE2A 1STEA 4J7FA 4J9CA 1X75C 4V0BA 2H8HA 5EKKA 4AFQC 5IGEA 1V1OA 3SVMA 4BY1G 2KE9A 1RAHB 4E7LA 2F0TA 3K6OA 3AFPA 2ZJRA 3CCMA 3G7LA 3GF5A 4HSPA 4MZMA 4Y92A 4JI0L 4K6LA 1QWYA 2M51A 3C0CA 2BZ8A 2RSOA 1K8GA 4RKBA 4GLAC 4C2MH 5M5WB 3HOXH 4HYPA 1CA6A 4OGCA 2E76C 3HRTA 2MGSA 4F14A 3NXWA 4KKSA 3K57A 4DUZL 1G3WA 4LUOA 1A62A 1MGSA 4FL6A 1UECA 1U2OA 5LL6S 4YWKA 3O6OA 3FIFA 4CDDC 1YFNA 3GTJB 4LUDA 3HS0C 5G3LD 1B7TA 1VQNQ 1E1OA 3C3LA 3CC4Q 1M27C 1V76A 2B8AA 4RCCA 3D3RA 4CHTB 4PJOB 1EU4A 2XIDA 2M16A 1V43A 2A6HC 3GTKH 4CE3A 2JEAI 4LNQA 2KQ3A 1PTOB 5KGUA 2G6FX 3M4GA 1Y57A 5D6PA 1HQMC 2SOBA 5C93A 2SEMA 4O05A 2DRMA 1WZOA 4A3CG 3LH0A 1LTSD 1TIID 2A8VA 5LMNW 2VXFA 3GIEA 2YE2A 3WWVA 4OEMB 1E6GA 1WXUA 4A4FA 1XYIA 2NZHA 4PL6A 1PD1A 4C3HB 4OX9Q 3PTAA 4IUNA 2WB1B 3JCMb 2RN8A 1X3QA 3HOUH 1HJPA 2PI2A 3SFMA 4R0KA 2K5LA 3MEAA 5C44H 4DV6L 4F7UB 4LFBQ 4JI0Q 3EFSA 3HOUG 1WHKA 2HCHA 2BE5D 4NW2A 4M7DD 5GMKi 2BOSA 1BI2A 1FYNA 2PNHA 4MPNA 2C9OA 1YJ9A 2F4VL 5JPNC 2JSOA 2X3XD 1PMRA 2FZCB 3LLRA 4XTXA 3CC4A 2VY3A 4HJ8A 4ZRZA 5LL6X 4LF8Q 2PQAA 2BCOA 4EX5A 2DF6A 3OYBA 2FRWA 3OWDA 2P0QA 3CPWA 1NMGA 4OO1G 3W1BA 1VQLQ 4LPBA 1M3AA 3DM3A 3J81c 4LF7L 2V8IA 3VHCA 5AYFA 3PV0A 1B34A 4M77G 2VL6A 2RPNA 1CSPA 2DEQA 4L94A 3RLNA 3ITPA 4DFAA 1HNWL 4AG2C 1GL5A 2R7ZG 3OWBA 1N33L 4E7SA 2B63G 2E2HB 4J9BA 3U23A 1FNVA 2LX7A 2L3RA 1SR3A 4A3JB 4K11A 3HSBA 2EQSA 2Z1CA 1YP5A 3HYZA 1B9NA 3OW7A 5JPMC 2EGCA 1SYGA 1TWFB 5CYUA 1KRTA 2E2IB 2PZWA 4CDCC 1JM6A 2PUKB 3CPFA 3I5SA 3PMFA 4H0LC 3HOXG 1U1SA 1YSRA 1KQSS 5J6AA 3VR5A 3CC7T 5JENA 4MMLA 5A2QE 3UDGA 2XHTA 3UDXA 2FB7A 2JA9A 5KNDA 5C5MA 3W2DA 2AKKA 3VV0A 5GADC 4R8IA 1ENFA 3WQ9A 4URNA 3HRSA 4FT2A 4C5IA 3MFYA 3OYGA 3RERA 4HEDA 1HA6A 3R4OA 2LJ1A 3SEMA 2JP1A 1NYFA 4ZN1A 1PRLC 1KRSA 3QYGB 2J0TD 3HOXB 4UROA 4A3EH 1JJ2S 4O6JA 4WFN3 3M4PA 1FMWA 2AQ2B 2EQIA 1D6EC 1SYFA 3L2UA 3CCJQ 4E7JA 4DR3Q 2NVXH 4JDSA 4OWXB 3LYIA 3VS6A 1HJDA 1AE2A 4OB3B 1XNIA 1K8MA 2QG0A 2YTXA 5EBCA 2MWPA 1EIGA 1SMYD 4XQQA 3ZXQA 1QCNA 2PUOB 4DAPA 1L1OC 4DR6L 5D7DA 1LTLA 4HJ9A 4M7AE 1OXXK 2HQXA 1PG5B 3M4YA 3BZDB 1J5EL 1HNWQ 2YI6A 3A8GB 4AYBB 5CV4A 4NH7A 1EY8A 1VQDA 3L2VA 4C92E 2EJGA 5FO9B 5M3FG 2C1IA 3D4WA 3V7CA 5IT9c 3SGIA 4XKOA 5M4HA 1EU3A 3M3YH 2QW7A 4GQTA 1B4OA 3MWYW 3J7A5 1F2MA 5IYDG 1YIJQ 4A3IH 5CKDA 3QIAA 2LQKA 3GTMH 1CI3M 2BH8A 3A0JA 4G7HC 5DM7R 3I56T 1NCVA 1BBZA 2CKKA 2AUJD 4AQYL 4HYMA 3A56A 2OX7A 2B2WA 4GOPB 1M8MA 3CC2T 3H3VC 2E6ZA 3MVVA 1N5ZA 2F3VA 4JI7Q 1OEBA 4GCZA 2RK2A 4DR7Q 1D0XA 4OELB 4AH6A 1LNXA 1L0XB 1ZBJA 3FJ5A 3CC7A 2OTJT 1K9AA 1M3BA 4KBMB 2EJ9A 3SHWA 3X24B 1D1IA 2DJGC 3MCAB 2K52A 1UGPB 2NZOA 4AWQA 2AHJB 4OB1B 4ZGDB 3D4RA 1TU0B 1OZ3A 3M5AA 1GHJA 4QVCA 3JB9J 2MF2A 1S4ZA 4JI4L 4BXXH 5IP9G 3I4MB 4RG8A 2ROTA 1HTLD 1L0YB 2HCCA 2Z6KA 1Q7YR 4CDEC 4E6IA 1UFFA 3U9SA 4DR5L 1BXTA 5KYWB 3H0FA 3G71T 2ENBA 2A7YA 2FYKA 3ZBDA 4CC2A 1SE2A 4ZYSA 3MP1A 1C7YA 1Y1WB 3CMAT 1H92A 2R57A 1E7ZA 2WKDA 4RGMA 2FINB 4DXGA 3G7ZA 5IIFA 1IW7D 2JA7G 2JA8G 3PO3H 1SG5A 4FCRA 2RNAA 2BDNA 1EIFA 2QAZA 1K0XA 4XYQA 5JAVA 4XE2A 4CDFC 4XTYA 2YHTA 1IXMA 5FWBA 2BRCA 4LWEA 5BN3A 1PRTB 2F3IA 2CG9A 3OSVA 2XX5A 1PD0A 4M75E 3HRZC 4Q20A 4JJDA 1QWEA 2DTOA 3J7ZC 1Y1WH 2WEQA 1WLPB 1KD1C 2JJ9A 3JCMg 1QNKA 1MD2D 4M7DE 2DLPA 3Q5LA 2IWXA 5CKBA 1IBML 1ZA2B 1K73R 2M1HA 2QA4T 2PZ1A 1IB8A 3RBBB 3ZFJA 1PTOC 2JA6H 1U4MA 1BCPD 4M78A 1PH3A 3EG3A 3D0BA 4C8QF 2F0QA 4K14A 4NH8A 5IDMA 2BZ5A 2YK9A 1QKXA 4HCBA 1EFWA 3UA7A 1O7LA 3PMTA 4XT3B 3HOYH 5FJ8G 1ZSZA 3WDNA 3HRUA 4ZTJA 3EHHA 1KAWA 2YEBA 3NBIA 5CV8A 1Y96A 4J9HA 4KD4A 1VMCA 3A0YA 2EJFC 1IHZA 1ET9A 2L89A 4LWCA 1XXGA 4R4QA 4DXFA 4P8OA 1JB3A 4RMFA 1YJ9T 2IT1A 1LT5D 3EVQA 3A55A 1RTNA 2YI5A 3AFQA 1PYWD 3GQBA 5CK9A 3PUVA 6AT1B 3T51B 4BBSH 3OYMA 3MZ5A 4XKKA 3OS0A 1SFOH 4IOAA 4JI3L 4B3SQ 2V1RA 2CT4A 1DD2A 3T4AC 1TS3A 3MHXA 1WTXA 1FMKA 4JI1Q 2CCZA 1H7UA 5LJ5d 4C3JG 4XK8E 3RKYA 2DXCA 2UXBQ 1TH7A 1UEAB 4GN5A 4M7DA 5IT9L 4C3HH 4KHZA 3ME9A 1WGSA 1NE8A 1SPKA 4YCUA 1QVFP 2MO0A 3L2WA 3CCET 1YT2A 5J22A 2F2VA 4B3ML 3TZ2A 3D4DA 3S17H 5DEHA 3S9WA 2DX1A 2ZM6L 1X6BA 1HNZQ 3LX0A 3HOVB 4JI8L 2GQPA 1SYBA 4DV6Q 4LFBL 1P92A 2WI4A 4MOTA 3VS3A 2OTJQ 2WACA 4B9XA 2KT8A 4EPCA 3CPWP 1UE1A 2PMZE 2SNMA 4CGYB 3V8LA 3S1MH 3R4MA 5LJ3f 2E8GA 2SRCA 1QWFA 1SE8A 3FVQA 4AIMA 1D7QA 3CCQT 4HJ7A 1DM0B 1XPOA 3CF5A 3O2FA 4JRQA 2KROA 4V190 1AJ6A 1BCPF 4K0KL 2XICA 5GMKl 4MIUA 4IO9A 2HL5C 4RTYA 3G4SA 3V05A 3H6ZA 4LF8L 2R93B 5CPHA 5GAN8 2IW3A 1TH8A 1V1CA 2FWYA 1TY0A 2F5TX 2KENA 2JE6I 1D3BB 1CSQA 1CT1D 3NP8A 4M78F 5GMKj 2HKNA 1K9MC 4ABNA 3I4MH 1WHJA 4J1MA 3N6RA 2YTYA 1QY8A 2YXYA 2LMCB 2VYTA 3S1NH 3IAYA 2L8DA 3I72A 3EA6A 5CTXA 2B2YC 5GMKm 4TKOB 3CW2C 3OS1A 4XU2A 4AFSC 1JE4A 2JA7B 1LPLA 1KLGD 2EJGC 5FLMG 3JCMJ 2YJXA 4JQLA 1KDCA 4FW2A 2UXBL 2F0OA 2CGFA 4CWOA 1BKBA 1DCZA 4J6XA 2E2IH 2EVRA 4DOVA 1H3ZA 4P7AA 2B63H 4U7NA 1Q12A 1LTGD 4E7ZA 2BDOA 2M9UA 1IL8A 2F4IA 3R93A 3L1AA 1TT2A 2F0LA 3P20A 2JTMA 5GANe 4KTAA 3WOFA 5IWAQ 4QQBX 5COYA 3CEYA 2XRSD 3A54A 3JCMV 2B2VC 4XIRA 4DUHA 4JJBA 4YIJA 3L2QA 2F0DA 4C1NI 3S2HH 4F7UG 1O7ZA 2QTVA 4RTTA 4MMKA 2K32A 3A0WA 2LT1A 1VF5C 4C0GA 2RJFA 3PUXA 4A3MB 1QKWA 1SEMA 4XU3A 5GANj 4M7DF 3SK6A 2E41A 1D2BA 4LWGA 1SSOA 1M90U 4K2KA 3KYHC 3MNRP 4PFZA 4HVUA 1VQ5A 1BVSA 4E00A 1F9SA 1GUSA 5M3MG 1S40A 3KF6B 2NVXB 3LWHA 3FB9A 1U9RA 1PVGA 4JS5A 2KECA 5C44G 4EFTA 1YN8A 1AVZC 4A4EA 2P84A 1M1KU 5K5PA 5KNBA 1KC8C 2YE7A 1HR0W 1Q8IA 2F0GA 3I70A 2C0IA 2MPXC 3BVMA 2DNCA 2R7DA 2ZXOA 4K8IA 4ZVIA 1ILPA 3QYHB 1IGQA 1BKNA 4N4IA 4O09A 4G7OC 5ELCA 2BU2A 4BBSB 4OMPA 4OMFB 3S2DB 4FF1A 4HJ5A 1EX4A 1Z9FA 4CKCA 4ZGEB 1ZUYA 3L2RA 3PUYA 1OX8A 3U4VA 4NS5A 1AN8A 2VC8A 4PJOG 4XQ3A 3OYCA 1F51A 4NB3A 3VHAA 3QOJA 4HAEA 1S16A 1VQ7T 1HFNA 4AYBE 4PK4A 4KY7A 1X3GA 2MJ8A 4K5WA 2UWDA 2N78A 2KT1A 3S1RH 3GV3A 2NBFA 1HNXQ 2K79A 5FU6B 4JK1C 3K80C 1Z5BA 2DVEA 4A54A 1K4US 2O9VA 3V96A 3E1SA 4DV4L 3HKSA 2DTIA 2JJCA 2CZ1B 1U5SA 4DR1L 3QG1A 3AT1B 1IHVA 1LO5D 2UUAL 4HCZA 5IAYA 4DR2L 2IPKD 1CZWA 4C92F 2YJWA 5KE3A 1Y1VH 3GLXA 1OOTA 1RLPC 2A08A 3MXNA 1QQJA 5IHKA 4HMJA 2Q8FA 1CKAA 4M7AF 1SF9A 2MOXA 2MUYA 1CKMA 1PH1A 4JI6L 3GTGB 5CVIA 4M77A 5FROA 4LD6A 4QUCA 3OOCA 1I0CA 3NE5B 3VYUA 3NHHA 4FYDA 1LCKA 3M0RA 3FHWA 1VQ4A 1X3EA 5D6QA 3UWNA 1S1NA 1MKHA 3QR8A 5M3MB 1N36L 3PO3G 1N32L 3GNGA 4NH9A 2LZ6B 4LUEA 2PTKA 2RO0A 1FGBD 1KDAA 4NXNL 1M1FA 2YUQA 4F16A 3H0IA 4XDXA 2F0MA 2EXDA 2N49A 1SNQA 5CTUA 2K7AA 2F0EA 2EQMA 4OONA 3DUZA 1KK7A 1X32A 3L7ZC 3RUZA 1IYVA 1PYSB 1MIUA 5J3BA 4XCJA 1EZ8A 4PFPA 2H8MA 1PYBA 3QWYA 2EKOA 3M59A 3MAQA 2O4XA 1Q95G 4J6YA 5J71A 4PLLA 2DKGA 4RHRA 3GOXA 3S2HB 3OBWA 1S5ED 4QGUA 5CO7A 5KYYA 2DUDA 1STBA 2YKEA 2NVQH 3MP6A 1ICWA 3EKOA 2PVGB 2H4OA 1FNUA 1YVCA 3EFOB 3SK5A 1WD1A 3IEDA 1QVFS 2PVDB 1Q7YU 1Q1EA 3QPHA 1OV3A 1G51A 4A4IA 2OTLT 3ZL7C 4YY3Q 1G8ZD 3N52A 2E0AA 3M4QA 2NUZA 2A5HA 1M2VA 4KHVA 3U2KA 2YWWA 1GD7A 4OMNA 3CCVQ 1FD7D 5IGCA 3BMYA 4RG2A 4HKEA 1I3QH 4IUUA 2XSCA 3U9OA 2X6LA 5D3DA 4X9LA 5BODA 1IKMA 3ER0A 5EPJA 3F2BA 4BBRG 4BACA 2OI3A 5C4XB 1VQLT 4GLMA 4PJLA 2FMCA 2DBKA 1F1BB 3M0QA 1JC7A 4A3FB 2DL5A 1AH8A 1UTIA 1B9MA 2VASA 3HL8A 3O5ZA 3K0XA 1PKTA 1WHLA 1RABB 2FVUA 1NJIR 4M7AA 1AEXA 1UUPA 2F0NA 4LE9A 3KBXA 4C3JH 4OXPA 4AMCA 3CMEQ 3E0EA 2XJXA 5C4XH 4ZKBB 4CE1A 2LT4A 2GGRA 1D09B 4A3EG 2V8KA 3MXUA 4IPCA 4IPDA 4DEXA 5GROA 4OB2B 3RKZA 2KRSA 3R6OA 1R4PB 1T0HA 4C0DB 2Y0SG 1BF4A 1G6PA 4X3KA 2B2WC 9ATCB 1ARKA 1KL9A 2F0KA 2WB1E 2EYQA 5KYUA 1CKNB 1LTRD 3TP6A 4KP4A 4FSXA 1JB7A 1XPUA 5HURA 1I4PA 2D8HA 4LDWA 3K8AA 1QUQB 1TU2B 1C9OA 1RTOA 4JW0A 4YTLA 2YE8A 2EYZA 5BN4A 4OO1I 1D0ZA 2K2MA 3KJPA 4LDVA 2L4NA 4BAEA 1QCFA 1QZHA 1PSFA 2VWFA 3G6JB 4A53A 4PJOE 4AS9A 3KLSX 4GBQA 2K3BA 3VYGA 1R4QB 1U4RA 2RHSB 5D7CA 1KC8R 3HKZB 2K5WA 4KSGA 1MV0B 2QXFA 3S1QB 2OCEA 2EW3A 4J7IA 4PZ6A 4TRDA 4ZAIA 2YV5A 3V7RA 2C06A 3X26B 5FNCA 1VDZA 3EG2A 4AFUC 2Q2HA 1A4HA 2LNHB 1M8VA 5I6WA 2YU9B 4YKTA 3I5RA 5LJ5j 2JOYA 3P1HA 4KJNA 1WHMA 1Q81R 1LTTD 3BVGA 3JC66 3CCEQ 5BOCA 4EGHA 4BY1B 4M75F 1XMOQ 5KRUA 3J80c 2E65A 1YNZA 2EAYA 2DNEA 2R92B 4POFA 2RQWA 3EGUA 3JAME 2PCFB 1Z9QA 1SNDA 1TWCH 3NUCA 5EBDA 1AM1A 2P0PA 4H7QA 2YE6A 3R91A 2W10A 1NM7A 2RHZA 2ROLA 4WUDA 2HQEA 1QW1A 2X51A 1A2TA 1ZXTA 4GLVB 2LJ0A 2Q2TA 4HXZA 2GQVA 4ASBA 1TG0A 3KF6A 3C11A 4FYVB 1SHFA 5KYXB 1G291 2D2CC 1JJ2A 2FPEA 5E4WC 5KYLA 1R0BG 2RHIA 1VQFA 5JEAG 1K3RA 1PH9A 2BZXA 1J5EQ 1UYLA 2L3QA 4B6CA 4R4OA 1K76A 2YRCA 4XXEA 4R3MA 3ULLA 2J7ZA 1I6HB 3JZ3A 4WCIA 4FCQA 2C5CA 4Y7NH 4GOPC 4KH1B 1OU8A 2IIMA 2WSCE 1OPKA 4EVOA 4LF5L 4FSSA 4YHHQ 4A3BH 4R56A 1ZHIA 3BU2A 3TU4K 1E6HA 2Y0SB 4KULA 5HGQA 3HP3A 1KABA 4LWHA 1Q90A 2RA2A 1TUCA 5GMKh 2ZT9C 1PC0A 4KN4C 2FRYA 3I4OA 4UP9A 1SJHD 2L1BA 2CUBA 4FXKC 4JI2Q 4J5YA 3GTLH 4Y52H 4ZKCB 4EFUA 3CBPA 3H09A 2KHIA 4HIOA 5G3LF 3BFMA 2E5LQ 3JCMQ 4FDBA 1TWGH 5I22A 1S72T 1Y8PB 5K36G 2AKWB 3H8ZA 4B3TL 1JRIA 2CZ0B 2LY7A 1CSKA 5C0XI 4XQJA 1VQBA 3OYLA 4EMKB 1F2ZA 4DR4Q 4XQNA 2PVOB 1K8OA 1VQIA 1OPLA 2K5DA 3GTPH 2KBNA 3HG9A 1TXQA 2RI2A 1Y1VB 2KBTA 2M0OA 4XTZA 4DR3L 2BTZA 4FT4A 3WVEB 2RDHA 1M90C 1GUWA 2K6AA 5FO8B 2YEFA 1SNPA 2XDPA 4C8QB 2TMPA 4DBRA 1KNAA 1M8AA 4KKTA 4DR6Q 5CORA 3VR2A 2KYBA 3QJYA 4DAYA 1ZQ1A 1E3PA 1O7YA 3OIPA 4EGKA 2XDDA 3E9HA 2YEIA 2NUTB 1B8AA 4YWMA 3W1GA 2QFOA 4U93A 1BBXC 1XPRA 4XTJA 4M75C 3GTOB 4DUYL 3FEOA 1U4LA 4P71A 2VW9A 1FX7A 2JS0A 2OWOA 4HA8A 4C0FA 5CV5A 2L9HA 5CGKA 2QCPX 1EWCA 1BOSA 3MFGA 2RJCA 4TVAB 3KF8B 2MK5A 4EQOA 4GNXC 3DMUA 2ATWA 3M7NA 4YKQA 1RAEB 1NBEB 1EQRA 1HUMA 2KI7A 4LDYA 5KE2A 2Z0SA 5TSSA 3GTQH 5M4KA 1UYKA 1PNJA 1TUGB 3HZXA 1PLFA 1SLJA 2L55A 4PKCC 1STAA 4UPAA 3K7AB 1WYDA 4II1A 2VVKA 5C4JH 3PEHA 4I65A 1D5XC 1IGUA 2YK2A 3ERQA 4DOWA 1GHKA 4FU6A 2VUMG 4MPCA 4X62L 4H02A 2C2AA 1N9RA 2E5QA 4X3UA 3K7AH 1VQCA 4F87A 4GY5A 4LJZC 4Q5VA 1LACA 3WVDB 5C4JB 4KGXB 4BI8B 1AOJA 1Y07A 2O9SA 3DB4A 3E9GA 4MDXA 3CBOA 1U8RA 1J3TA 2EYWA 4OGQC 2ZDXA 2A37A 3OY9A 4LK1C 1MU5A 5CR2A 4BXIA 2Q8IB 5I11A 1A0NB 1YBYA 3I4LA 4DV7L 1AHJB 1B7YB 3QWNA 1YNNC 3RLOA 3PIOA 5LHY1 2YKCA 4IUTA 4M7AG 2M9VA 2QG9B 4PMBA 4PQXA 3DLLA 3S16B 1YSZA 4RFBA 1S5CD 2EXZA 2KHJA 3LMMA 3JAML 2WI2A 3MXNB 4FF3A 4JLGA 4YKXA 2XD0A 1W6XA 1LYLA 1X01A 1YHBA 4IJLA 3PO2H 3CHBD 2QF6A 1B62A 2XX4A 2ED0A 2HNIA 1UHFA 5I4DA 4R55A 3K0YA 2HHHL 1X65A 1UYDA 4FMTA 1L0WA 3WHAA 4PJOC 1G5VA 3K5OA 2KOLA 4C8QG 1GXIE 1I50H 1MMAA 2F52A 4FP5D 4F8MA 3TS0A 1TC6A 3QTFA 3GO5A 1SSHA 2LNVA 3SXHA 1WXBA 1UYHA 1I94L 2CP6A 1MBYA 1TS4A 5J39A 2YEAA 2HL3A 2PZTA 4X64L 1PV4A 1AD5A 2RHXA 1EYCA 1HR0L 4QQDA 2GVAA 2Q2EB 2R7FA 2COZA 4RAUC 3EHFA 2JM8A 2Z4HA 2J6KA 3EQLC 1KAAA 3S5TA 4A3LH 1I6VC 1ZEQX 3FEWX 1YJWT 1YJNA 1KZNA 4R4TA 3BY7A 3VR6A 1KDBA 2C1GA 3F2UA 2JVVA 1NLPC 3PNWC 3LGLA 1Q82U 2Q8HA 1Q86C 1VMPA 1OXTA 4CWSA 3O8VA 1VYVA 2RDGA 4A3LG 3BS1A 2VKNA 1QJOA 2RBMA 2QDBA 3W5OA 2E70A 2UUAQ 3HOWH 4HZ0A 1M4VA 5T1IA 4PZ7A 1YT0A 1ZX6A 4LN2A 5FO7B 3PIP3 2KJXA 4M1UB 5ELDA 3VR4A 1KJWA 1JOOA 3TVTA 1NJIU 1RODA 4DV2Q 3QDDA 2R93G 4R1FA 4JRIA 2R92G 3NTIA 1KIKA 4JI7L 2QKIC 4C3HG 4DV1Q 4QCLA 3LH5A 3MEUA 1IXRA 1P8LA 3EGDA 1ZSGA 2B2VA 4J9IA 4A75A 1D1AA 2QQAA 4QW2A 2VZAA 1UDLA 1WJSA 1BYMA 4MTNA 1II3A 4PNYA 3ERSX 1BXDA 4UY8C 3I3CA 3RMHA 2C0TA 3QXEB 7AT1B 1CKBA 2RQUA 2L11A 1SYCA 2RDFA 4YCVA 2ENMA 1VQ4T 3MO8A 2MI6A 4RCBA 5HY6A 2EYHA 1WYXA 4OIJA 2YKIA 3NK9A 4L93A 1Y8OB 4H13C 4ZQ3A 4DV4Q 2VWCA 3RLQA 5GAOl 3GTJH 4A3MH 1HYOA 1QB5D 1ZA1B 2K01A 1UJ0A 4QUFA 2CS7A 2CKZB 4FIBA 4PMCA 4Q0FA 1R9TB 4LFCQ 4A3DB 2D8JA 3CCMT 3D7SB 2CSIA 5GAN4 3KLRA 3OS2A 1UYCA 5FW9A 1K3BC 4GS3A 3A7AB 2D9UA 4PU9A 1PTOH 2FXSA 3STBC 4QPKA 3OW6A 4AG1C 3RNJA 1PM3A 3RN5A 1EQQA 1N34Q 5GAGC 1BI3A 1H9JA 2K33A 2R3ZA 3BG3A 2XN9C 2J06A 4KK7A 2IORA 1TWAB 4B7PA 3GTMB 3GTLB 5EKIA 3JB9H 1F77A 2DTHA 4PRXA 4HT8A 4KTNA 3QUIA 1Z7TA 3UE1A 3TZ0A 1FL0A 3A8OB 4A3KB 1EIHA 5IWAL 2UXCQ 1LOJA 4Q5WA 2PW5A 2KEAA 4UDUC 4I7AA 4RTWA 3PT9A 4M77E 2BUDA 2LQNA 1GUGA 4AQYQ 1EA6A 4KY5A 2XHXA 2CP2A 3G7EA 2CP0A 1EWIA 1M5Q1 1IYJB 5KYIA 4CWPA 2KMTA 1LJOA 3UPUA 1SMYC 2IJ0A 3J7AV 3UT1A 2R61A 4B08A 1PRTF 3SD4A 3CMAA 3CCVA 2PNIA 1K28A 3D2RA 3GTPB 2QF7A 3A1PA 4X65Q 2FTKA 4YKRA 1Z6HA 3OMUA 5GAMj 3L0OA 5C0XG 1LT4D 4C8QA 3EFXD 4C56C 1VQ7A 4V26A 3PVQA 4MBCA 5KEEA 1VQLA 1VQKQ 2MO1A 1M3CA 1IW7C 1X3PA 1I4QA 3E6ZX 3OPDA 2WAQG 3R4NA 4HCEA 3MKDA 1I5CA 3C2PA 1VQ9Q 3T1YQ 5CCAA 1STNA 1SRLA 5M9OA 2YYZA 2JA5G 4ANJA 1RLQC 2A3LA 2WV6D 1H95A 1O7IA 2GNCA 3FP9A 3KOJA 1U4PA 4PV1C 3HOYB 2LQWA 1A15A 2X69A 2L5QA 2QDYB 2LXKA 3OYJA 1X27A 4EDUA 5KH6A 2YUPA 5GAN2 2X4XA 3NTKA 2PU9B 1PTOF 1UG1A 3OW2A 4TQUS 1I1JA 1VQ5T 2Y4XA 1C6VX 5CKEA 2B29A 4R8NA 5IGGA 1TILA 5GGZA 3CXCP 4RA8A 5GAN6 3F70A 2DERA 3GIGB 3BVZA 3HFOA 4B9WA 1DJRD 4RGTA 3HOZB 3RIRA 5I2MA 1VQMA 3DWPA 3G6EQ 3BDCA 4JI5L 3S6WA 4LXCA 3EJIA 4DV5Q 4KHPQ 4JAUA 4EQ5A 3B6YA 5I21A 2KUMA 2B2TA 2LJ3A 4HCSA 1U1TA 3I2ZA 3JAMi 1UYMA 1L0OA 1YC1A 2CYZB 2ZPIB 1W6JA 4RGNA 1C48A 4A93G 2CDTA 4XC0A 1FMVA 1BUVT 2QDLA 3UF4A 1GJVA 2IHFA 1NSNS 5M4EA 3EIVA 3GD7A 2ZPHB 2BKDN 3F2CA 1N36Q 4QQ6A 2HIXA 2HUGA 2ZPFB 1HK9A 1M2OA 3OWFA 5CV7A 2NYZD 2MAMA 4O0AA 1V9PA 1B2TA 3QHSA 5ECAA 1OZ2A 4PJJA 2DGYA 3CXCS 3VJPA 3H94A 1YZ6A 2EPDA 1SSFA 1TWBA 1BQQT 3PGZA 1LTAD 2ZPBB 4NOYA 4H44C 4JVZA 2VGMA 3UDIA 1TTHB 3S15H 3DEPA 3F2DA 1TS9A 1IBKQ 2X9HA 4L8JA 1G6ZA 3SB2A 3HYYA 2KEEA 2F0VA 1BIAA 2F4VQ 2E6NA 3T13A 1GBRA 4DGZA 2IWHA 1KXLA 3K5NA 1T9HA 3S1MB 4IFDH 1FR3A 2MQHA 3CAMA 1Q86R 2N3SA 2K50A 2NUTA 3D8GA 1NHIA 4L5TA 2HHHQ 2VUMH 2BU5A 5J26A 1MV3A 4KN7C 1JE5A 3FT5A 3R92A 2AMCB 4DR4L 4AWOA 1N9SA 2RK1A 1W6KA 1RAFB 5JOBA 2NWMA 4R4IA 4R9WA 1S14A 1GCQC 1K8AU 1ZKOA 5GJWB 4N0AC 5BR8Q 2JYOA 4W7TA 4N9TA 5M4MA 1VQMT 1E0BA 1G2SA 2RVLA 3EHGA 5M5YH 5A0DA 4RMOA 3KF8A 4A3BG 2J6FA 2DMOA 4NXNQ 1X2KA 2B2YA 5CBEE 1NMFA 1LABA 1UYFA 2XDBA 4G4KA 1ILQA 2DN8A 3GTGH 4URLA 2BYHA 3BZCA 4O1NA 4J9GA 5FLXc 4JYAL 1UHCA 3WXMB 3KE6A 3M4OB 4JI6Q 2IG0A 3MEVA 3QO3A 4IKFA 4M7DB 2DPPB 2WAQE 4J15A 1TR5A 5IP7G 3FKIB 5M4NA 5NUCA 2OT2A 3J7YW 2ZM6Q 1IL2A 4O5VA 2V1QA 4C3IH 4WUCA 2A74C 4J6WA 3VRYA 3RNUA 3MEWA 3CBMA 4DEYA 1R8OB 1HA5A 1W3SA 3HPWA 3QOLA 4NDXA 3QJ6A 2VQEL 1YETA 4JAVA 1SHGA 2QG2A 3LWUA 4JBMA 4M77F 1LTID 3P8BB 3OYEA 4U673 1IBKL 2R93H 4AFZC 4M7AC 4QQGA 4CJ0B 2R92H 4RTVA 2XKOC 1Z59A 1ENCA 4BY6C 3ZXOA 1I4XA 1AWXA 2ZPEB 2B2TC 3K5MA 3EG0A 3GDEA 1HZ9A 3MXGA 3GNFB 3SWNB 1A2UA 2LCSA 3V8KA 1AH6A 4X9DA 1Q3LA 2RHYA 2LS01 1IZ6A 4ELZC 4A3DG 4Z02A 2PQWA 3PGGA 4PJOD 1VQEA 2X35A 1Q1BA 1STHA 1BBWA 1L2FA 2DIGA 4WORA 1PFMA 1WI7A 1E2WA 1YNXA 2L12A 2CCTA 1SDFA 2L2PA 2K57A 3JSCA 3I4NB 1Z5AA 4YHHL 4O04A 4PL9A 1RL2A 3CPWS 1X2QA 4QJFA 1UUEA 2QA4A 3PVLA 2KCCA 3VYTA 4M77C 4LF9Q 4XKAA 1RACB 4LFCL 1OTCA 1XNQL 2B2UC 2YEJA 3AEVA 2A6HD 1NG2A 1ET6A 3B28A 3IL8A 2FZKB 3ICEA 3AQQA 2AZSA 2KEDA 5AFWA 2BU6A 3RD4A 2GFAA 2E3IA 1VQPQ 4CWRA 1EZZB 2EBPA 2HQHA 5DY9A 1PH5A 4DBQA 3VDYA 5HCKA 2IX0A 3H15A 3OHXC 5GAEC 1E1TA 3S14B 1YHQA 4A3FH 1TOVA 4LWFA 2BA1A 3NEMA 2UUBQ 2NVTH 2UXDQ 3VR3A 4DK1A 4DR7L 4O2DA 3A0ZA 3PO2G 3BYTB 3INZA 3G6EA 2EY2A 3D6CA 5C3EH 1RUWA 5GJVB 3VUZA 3F1ZA 4LUVA 1B50A 2JMAA 4OIKA 5GAMh 2OQKA 2XNAC 1EL0A 5IYDH 5HGTA 2CSQA 4ME3A 3QDFA 3FPUB 2FXQA 4XDMA 1QZRA 3R6NA 4ALPA 3JCMc 4Y91A 1GFDA 4GFNA 3S3MA 2EQJA 3TEEA 1QVFA 2CUDA 2O1UA 3QB3A 3CRLA 3CCRT 2EYPA 3K5LA 2O4XB 5D6XA 3A0RA 3PO3B 2RHUA 4BDYA 4L5SA 1GXDC 1K9MU 3I8ZA 3I56A 2EZVA 2Q8RE 1Q46A 4C3IG 1Z47A 3SWNA 4XTCS 4HY1A 3FV5A 3UE0A 1JOKA 3RZOH 2VQFQ 1GBQA 3BM9A 4GEEA 4LFAQ 4FCPA 4O07A 4VUBA 1GO3E 3M85A 3KFUA 2AIRB 4A3GB 1CFMA 2LXJA 1Y8OA 2YECA 4CBVA 2ZJQA 2G9DA 1TWHB 1XX8A 3FKIH 2K5FA 2EQKA 2AQ1B 3BYYB 2NVQB 2Q8GA 2H5XA 1XNQQ 1FYCA 2AWNA 4ILWA 2QI2A 4MP2A 4HTHA 3UDCA 2L0CA 3I91A 2DYIA 3CP0A 1QILA 4AWPA 1T3SA 2DRKA 2F0PA 1ESRA 3PQIA 1BIBA 1C1AA 2R7ZB 5FLXL 1I07A 5CC4A 5JVH3 2D0NA 2DL8A 4IJHA 3GTKB 3P75A 5I2XA 3J80L 1LV9A 1VQ6A 5CBAE 1YJ9Q 4M7AD 2CP5A 2K9GA 1QMCA 4OGEA 4HR7B 4C5HA 2XD6A 5GQOA 2ABLA 3OYKA 1A3VA 1GRIA 3A5ZB 1Y14B 2DL3A 2XIWA 5HK0A 1Q81U 2V8JA 1VQ8Q 2ZTDA 2KYMA 1AZQA 1JXMA 2VGNA 1VQ5Q 3PSIA 3T1YL 4KD3A 4JV5Q 5IGBA 3A98A 5GAOr 3LGFA 4POGA 4A93B 2M0YA 1K73C 3TQ7P 2MPMA 3T10A 2CWAA 4IIMA 4X66Q 3JCMe 5E3FA 1KD1R 5LMUL 2DD5A 1M4ZA 2DXBA 4KI0A 1DGSA 3LX7A 4A4GA 1HPCA 1WD0A 4X6AH 1AFPA 2EYMA 1BCPB 1PFNA 3S3OA 2H3EB 3SK4A 4RTZA 3X20B 1JJ2P 3HKZE 5KYWA 4LW1A 2HKQB 2HDAA 1WVLA 2RHQB 1ASZA 2EJFA 2QTXA 3ONAB 1TC0A 4IUQA 2A73B 2EKHA 1I5OB 1PHTA 2ESWA 1TWGB 3NSWA 1B1ZA 2YRVA 2GN5A 4QL5A 1V8QA 4X64Q 3Q1JA 5C44B 5CMDA 3IQLA 2BT0A 1I4HA 1JQYD 3A0TA 4BIUA 4CWNA 1KD1U 1RI9A 1C0AA 5CV6A 5LJ3d 4GZYC 3KLWA 5T1GA 4CE2A 1W2BA 3T0ZA 1G8XA 2NLUA 5KYNA 1CZGA 4WJWA 3TQYA 3RDVA 1AWWA 2JXMB 1PRMC 1LUZA 3PEJA 3FRPB 2YTVA 1YNJC 4XD8A 3DLMA 1AWJA 4HVVA 1VQ6T 3CCJA 2EOTA 3RZDH 4MHEA 3EAEA 2LDMA 3K98A 1IREB 3CCJT 1D0YA 3L2PA 4XCLA 4X65L 4H81A 1I5LA 1WTRA 2YU9H 2CCSA 3VU3C 1ID0A 3QBYA 2I0NA 3QKJA 1VQNT 2O31A 5LJ5f 3X25B 4KGZB 3LWEA 3N5BB 3KJOA 4NMZA 1F9RA 5D7RA 3BDUA 3OB9A 1B70B 4YKYA 2IVWA 3LGJA 2XI9A 4PFOA 3TCJA 1SE4A 3CC2A 3PUZA 4P74A 1T3LA 2MNAA 2GFDA 4KQVA 4F7UF 1UAPA 3QO2A 4J83A 2L15A 2Z9HA 1AP0A 2NVYH 2I0QA 5E1FA 3T2SA 2YEEA 4PJOA 1MMNA 2PNRC 2HG1A 3RN2A 5LJ5e 1JJCB 1QVPA 4RCNA 1B63A 1W4SA 4GN4B 2J6OA 3GTQB 1D1CA 1RDPD 1Y8NB 2L3PA 4FYWB 5EKLA 3HOVG 2EQUA 3M54A 4KGVB 2B3GA 5ELOA 2IWUA 5GAOn 4HY6A 4CI0C 3CCUA 4ME7A 1B34B 2F1MA 4QVDA 2E12A 2VNUD 1JORA 1HZAA 2A36A 1EIYB 4A3KG 1PKSA 1D5ZC 4M78B 5GANh 1JOQA 2HD3A 4BXXG 4JYAQ 2KA7A 5FK9C 5M5XH 2TSSA 4GN3B 4ODGA 5C4ZA 4D6WA 2RF0A 4DK0A 1EFNA 3IRBA 2DY7A 1N8RR 3M7GA 2Q8IA 1MGQA 1Y96B 1LT3D 3HFZB 4WRDA 2EJMA 3G6ET 1S72A 3NELA 3VA7A 4CKEA 2D62A 5C0MA 1HZCA 2YLCA 5ISRA 2JQOA 1QLYA 3C1EA 4L6TB 3NWSA 4QIWB 4U7OA 2LRQA 1A3UA 4L5GA 3A8MB 2WEPA 4RKUE 3VS1A 3M3YB 2I46A 2RQXA 2JN4A 1C8CA 1NLOC 1HR0Q 1W1FA 3H0GG 4IPGA 3R2TA 1WQ7A 3S1RB 4EMVA 2MMPA 1EY9A 1VF7A 1RAGB 3CCUQ 2E75C 3EBEA 2GFUA 1WTOA 4OWWB 2EY5A 3K81C 2J7IA 2KAFA 1SAPA 4BBRH 4A3KH 5E4XA 3BE3A 4OVAA 5I9PA 1KG1A 4B3TQ 3VYHB 4BE1A 2B8FA 5A35A 1QNUA 1T0JA 3BJUA 3TSZA 2PW7A 1BCMA 1B44D 2V26A 2A0FB 3DXJC 4F7UA 4NKLA 5F2DA 3M57A 3RR6A 3ULRB 5CV9A 3CQZB 1BI1A 2O5JC 2AQ3B 2D0OA 4BBRB 2A6ED 4PJOF 4ORZA 3RMSA 3DWAA 2CW0C 3DM1A 1IYUA 4E7HA 2EGEA 1R62A 3FT8A 3Q5JA 4YKWA 4JJNK 4N8X1 1DOLA 3TRZA 4P75A 1YC4A 1J6QA 1KHCA 2EIFA 1BI0A 1NTGA 5CR3A 2VXEA 4HCKA 3QZ5B 2YKBA 5IYBG 1VYTA 4MZTA 4JZ3A 2FHDA 2FPFA 5FU7C 1WTQA 2XABA 2RM4A 1OQKA 1KIXA 2GBQA 2ICEC 4GKJL 1RD9D 4DPGA 4A3GH 4P5NA 4M78E 1LM0A 1WFWA 2K04A 1I4K1 2WKCA 2EYYA 1QVGP 2PMZB 4NXMQ 3UI2A 1ZUKA 2KY9A 2I5LX 2YI7A 3C4SA 3CCSQ 1N27A 1I4RA 1SRUA 3I73A 3I4MG 5IH2A 1CHQD 2NN6H 3D31A 3SWNC 5FNFA 2RMOA 4FNFA 4TSSA 4C0DC 5CAIA 2NVYB 2WINB 2COWA 5ELEA 2A6EC 2HEQA 3DHQA 3H6MA 4QIWE 3A8IE 1MX0A 2YSQA 5GANd 1VQKA 2QK0A 2WB1G 1YHQT 4C92C 4BI4A 1AT1B 2AKLA 4F7UE 5KCOA 2WFWA 2EYOA 4DV0Q 1J9OA 2JEBI 2WI3A 4J6HA 4QY7A 5IXFA 4APVA 1BGQA 3A8HB 3RESA 4JRPA 3C46A 1I5AA 2PO4A 2WI7A 2DM1A 3EH1A 1SJED 2ZPGB 2MIOA 4ZN3A 2PI2E 2F0WA 4R3AA 3NQIA 1VOMA 2M02A 2RD1A 1X56A 5C6AA 4QT7A 2BH2A 2WP8J 3THKA 4DUYQ 5FWKA 4D8DA 1WXTA 4A93H 5ELBA 4NL3A 5M5XB 2XTIA 2LP5A 5LJ5h 2P4TA 4HT9A 1PSEA 1MJCA 4BB7A 1KIJA 2JKIA 5EQ0A 3EH2A 1UE6A 5IYCH 2K5HA 1IBLL 3H80A 4JC0A 1H3HA 3WOEA 3S14H 1I5BA 3BW1A 1T5EA 3S16H 1EYDA 2AWOA 1CA5A 4KT0E 2X4YA 4UC4A 4Y28E 1YIJT 5L8RE 4FO2A 3JB9D 1U0LA 3ZEHA 2BU7A 1UB4A 2R58A 2HCKA 3QWXX 4KUIA 3I35A 4DF7A 1IBMQ 1EY5A 2WSEE 1HXYD 5DM63 5AJ3L 1BB9A 1EOVA 3F8TA 3SHLA 4FF4A 2WIIB 3GIFA 3OQ5A 1OULA 2KQWA 3CCUT 3EGXA 2DE0X 5DLQE 4A4KA 2VB2X 2E3HA 1LVKA 4MNOA 4MB9A 2B86A 3Q22A 1PTOD 5L3JA 3ULJA 4L5QA 2R5MA 1Y0MA 3EGXB 1BCPC 3RR5A 5IT9E 1BDOA 1WJQA 1JWMD 2K14A 4C8QE 1K9MR 3HOVH 4C0ZA 5IODA 4ASGA 2AZVA 2E5KA 2W0ZA 4PJMA 5DAUA 5ELFA 3J81i 1JO8A 3OYFA 1FJGQ 3CCRQ 5CTWA 4JV5L 2A68C 2QQ9A 3MC0B 1X54A 3CQTA 3RKXA 2X6GA 2O1VA 1NHHA 2OTLQ 1JEGA 1KTKA 1PHJA 4JI5Q 3G7BA 2O01E 3NFCA 4N4HA 3T16A 3ASKA 3ZM7A 5M3MH 1UY9A 2EDGA 1RAIB 1NHJA 2LX9A 5IXBA 2V4DA 4GLXA 3T9NA 1O9SA 2VUBA 2KCTA 4KY6A 1YNND 4IOCA 2KNBB 2ZJPA 3U58A 4RCOA 4JLIA 4TVRA 4RG1A 2F2XA 1JQQA 2D0QB 2Y90A 2EY1A 1D5MC 2HBWA 1W2BS 5LJ3g 1FNWA 4XYOA 2F2WA 1AZEA 1QCBD 2NTSA 2A69C 3GTOH 3NHNA 5FRMA 1DONA 4GKKQ 2UXCL 1KNEA 4M77B 2L5TA 2JA7H 2J4XA 2RCFA 3I55Q 1I58A 3PUWA 4LUZA 1UGQB 2RJDA 5FU7B 1TIDA 3P8DA 3NPFA 2EGAA 3OYDA 3CCRA 1VQAA 2RCNA 2JZ2A 4B3RL 4CRIA 3Q6SA 2Z0WA 3I90A 4UAIA 4LDXA 5GAN5 1YITT 2YE4A 2QILA 4ELYC 4X62Q 4BQJA 2F69A 2YE9A 3JB9G 1CK1A 1HRJA 2XWJB 1N33Q 5HK3A 2OAUA 3NPPA 3NQTA 3URGA 3J7AF 1CKOA 4M7AB 1HZBA 3TZ4A 5I9OA 2D1XA 5IYCG 3HOZG 1EY6A 2R7ZH 4XITA 3TZUA 2A69D 2JM9A 1XNRL 2O88A 1OX9A 1FXXA 3KFVA 4M75G 3CYGA 3QZ9B 4QB4A 2N55A 1VQ6Q 3JAMc 2IX1A 1E2ZA 1WCMG 3KBGA 2BE5C 1G3YA 3O0IA 3ZKDA 1KQSP 4LP0A 4HXJA 5CQYA 5KYUB 4ULLA 2QQSA 4OMOA 4PNOA 3P7JA 5M3FH 2UUCL 4NL2A 4WF2A 3M53A 1YNJD 4DU9A 5F3KA 1VIEA 4JJCA 5C0XJ 4I5SA 4MP7A 3S2DH 1EEID 1AEYA 4F88A 2RB6A 5C3EB 3HEKA 3M9QA 4N9PA 2PZUA 3T1HQ 2LTOA 1NAPA 1YCYA 2O2LD 5JJKA 1G2BA 3B27A 4RHSA 2RJEA 2QGQA 2NVTB 4NP5A 3OW2S 5GAMf 2DNUA 1PH6A 2DETA 1C4QA 1ABQA 2VCIA 2QGFB 1V1PA 2GF7A 2XK0A 2LCCA 1GUNA 1H9SB 1P16A 2B2UA 2CW0D 2HT1A 2NUPA 4JUVA 4M78C 2K5QA 2DO3A 4CJ1B 2DL4A 3PE0A 5KIXA 2O5IC 4A3GG 3U4ZA 4LF7Q 1PFSA 5C3WA 2YDLA 5LMNL 3PIPA 1LTBD 1SNOA 4HVWA 4FYXB 2GA4B 4K8JA 1MSHA 1PZJD 3STBD 5GAMe 1QVCA 4R4CA 2X4JA 3ND8A 4K2LA 3DWQA 4EQPA 2DD4A 2K05A 2XK2A 4C92G 1VQ8T 4MZPA 1WDXA 2MYSA 4E2FB 4D8KA 1KQ2A 4BQGA 1X3FA 4JG2A 4K5VA 3CCQQ 1M1KR 2BIVA 2L0AA 3CMET 4C92A 1SKUB 4CC4B 2NTTA 4IFDG 4BY7B 1UE9A 2QGGA 1YI2A 4B6MA 3M56A 2CVRA 3J81E 2ED1A 3V8JA 4F7XA 1XTDA 3A8LB 2MWOA 3CXCA 2FMMA 4K5XA 4BE0A 1N8RC 1SYDA 1RI0A 2FZGB 2JMCA 2K6DA 1TWCB 4YCWA 5A2QL 2HDMA 1JMCA 4FXDA 4I7ZC 2FYPA 3CRKA 2KVMA 3EHJA 1EQVA 4BUGA 1PRTD 5L23A 3S3NA 5C0XH 2C35B 4S3SA 4OO1H 5FKAC 1QP2A 4EMKA 1I8FA 1YS3A 1VQ9T 2K2VA 1XMQL 2E2JB 2BU8A 2JA8B 3H41A 1A8VA 4CWQA 2DY8A 2KK4A 3GV6A 1UYIA 2A1AA 1EY0A 2IL8A 3KDFB 2XDUA 1F9QA 4OMQA 1RKNA 1MMDA 3HOZH 1EFID 3U2DA 3A8JE 2KRMA 3CGZA 3KDFA 1M1GA 4EGIA 1Y7XA 3HZ5A 2CQOA 1KQSA 2ZXPA 3G4ST 1DJ7B 1K8AR 2E2JH 2K5NA 2XDKA 2JA8H 1VQGA 1HUNA 1THNA 1Y69U 1OI1A 3OYNA 1WIEA 3M0TA 1YWPA 1QUQA 1GCPA 3OYIA 1Q82R 4JASA 1PWTA 3GBQA 2MFIA 1HCZA 3E5SA 4ZUJA 2IHEA 4L59A 2XDSA 4XTVA 3I4NH 1AWOA 3A8KE 1HD3A 1N32Q 2AHOB 1NPPA 4C5GA 3TMEA 3I4NG 1N34L 1YHQQ 2Z8LA 5JJIA 5IY0A 1H9SA 3HEJA 1HTPA 1D8LA 2DVJA 4OP0A 5D6YA 1QG7A 2P4RA 2LCLA 2HCIA 2H1EA 2LKVA 2JTEA 2WI6A 3FPPA 4KSHA 4EM7A 3TN2A 4O42A 1YI2T 3J81L 4E7KA 1VQNA 4B3MQ 2DAQA 2HMAA 4V2SA 4IUVA 3ND9A 3TSWA 2EWNA 4BA1I 4PRVA 1WFQA 3AMUA 2F0FA 2ESAA 3TP8A 1EY7A 2K03A 1G3SA 3OSOA 5AJ3Q 2HDLA 4JBWA 1SE3A 1WHGA 2K4YA 4E02A 2XG8D 4DV3Q 4JOIA 4LF6L 2EXLA 4C8QC 2A68D 5IOCA 2KXDA 3W3AA 4XTWA 5GMKe 1ZW9A 4C92B 4Z9CB 2COYA 3I55A 4CJ2C 3PF5A 1AMWA 2Q2IA 1YESA 1E24A 3EN2A 3VHDA 1ASYA 5FNDA 2GVBA 1MHNA 2VB6A 2DIQA 5KYXA 2RSNA 4OB0B 5JVG3 2JA5B 3LW5E 1GOZA 4ZK9B 2VQFL 2DXUA 1TS2A 2CHBD 5IGFA 1MI2A 4J9FA 1TS5A 2AKPA 4EMKC 4M7DG 2BYIA 3KLSA 3D6WA 3Q24A 4O0BA 2BA0A 2YEGA 4HN7A 1VCIA 3K60A 3REBB 3TP5A 3DEOA 2E1HA 4DNIA 2XDLA 1PZID 1YJWA 3I7FA 3B24A 3CCSA 1VQHA 3E19A 5CF0A 1VQ7Q 2PQAB 2N88A 4H7BA 4GGLA 5HKCA 4C3IB 1DZ1A 3KK7A 5JJZA 3ULPA 1Z5CA 1ZXMA 3X3MA 1PH2A 3FDTA 3S1QH 2ZZDA 1U06A 5CQXA 5FLMH 1F2LA 2HQLA 1MUZA 1GUOA 1Y4UA 1UWVA 3TZDA 5LJ5g 1ZLMA 4KJOA 5BR8L 1VQKT 4IPHA 3J80i 5K36H 4BS9A 1W70A 2IOQA 2CZ7B 3RLRA 2I2LA 4IN3A 5IN9A 4GNXA 4EEHA 5KCHA 2LVMA 1EEFD 1UY6A 3Q5KA 3ZJYC 3FMCA 4HIKA 4GNXB 2F03A 2A28A 3CD6Q 1FGUA 2MHVA 3NMZC 1BK2A 5AT1B 4A3EB 3CRLC 2QYZA 4DK3C 2K3XA 1VIFA 4M75A 1ZWHA 3LNNA 1JCKB 4RTXA 2DILA 3DKMA 3JCMf 4YKZA 5KYYB 4M75B 3VS5A 3S15B 5D14A 2CCUA 3MTSA 2DEUA 4MN3A 4JI3Q 5D65A 2LQ8A 4GKKL 4LFAL 1PZKD 3DGEA 1HQRD 1U5KA 3NENA 4F04B 3KUPA 4LF9L 1SEBD 4CKBA 1KHIA 1YCSB 3HOUB 2SNSA 2K5BA 4CC7A 4BDZA 2O1WA 3CCEA 3SE0A 3O13A 3H3VH 2NN6G 4FCYA 4DZYA 2QEXA 3JRZA 1ZUUA 2EFIA 2NB0A 4IALA 3NMQA 1E22A 2P5ZX 2ALYB 1SFOB 2FO0A 4GKJQ 1HNZL 4EIKA 2QEXT 1ICFB 5IGDA 4OX9L 2C0OA 3H0HA 4DUZQ 1K0RA 3URYA 1S72Q 1GCQA 1WHHA 4NXML 4XU0A 1AE3A 4Z8AA 5IDJA 1I59A 2K7VA 1IXDA 4MPEA 4GT8A 2XGTA 2HHIA 2UU9L 2BE9B 4KFGA 4ESRA 1YERA 4KV6A 5L37A 3BDOA 3MEHA 4CWTA 2YLBA 2E10A 4IUPA 3D0FA 4N4GA 2KR3A 3GPLA 1K1ZA 1GUTA 2M2LA 4HXWA 4AYBG 2YRDA 1M2VB 1N6AA 3OW2P 1CUKA 3G1JA 4DBFA 1KFZA 1EUJA 2K4KA 3G71Q 1KLUD 2Z4IA 4EGVA 1FWZA 4C8QD 1VQ4Q 5FJ8H 1WQWA 1HFGA 3FDRA 3NBHB 3RZOB 4URMA 3M55A 4BIZA 1JWSD 1GFCA 2JW4A 1JICA 1PH8A 4ME5A 3VUBA 8ATCB 2EE1A 4JCVE 4FXGC 2JA5H 3JB9F 1NEGA 2JA6G 1V1QA 2BE7D 1U0ZA 5CIUA 5I2SA 3C1FA 2BTTA 5LMUQ 4C2MB 4PLIA 1GM5A 3HTRA 1RF2D 2ID0A 1O80A 4KRTA 2LC4A 1EYGA 2UUBL 3HFNA 2DYBA 2UXDL 3SL2A 2FHTA 3X3NA 3JV3A 4F17A 4H85A 4RUGA 4DNRB 3RLFA 2XDXA 1JB0E 4Z89A 4EQNA 2QQBA 4JI2L 2DK3A 1ACMB 1XJWB 2K3YA 5D6WA 1NR4A 1O78A 2F0IA 4XIGS 1MNDA 1G3TA 3VRZA 3EROA 1SMXA 2FWZA 5IHNA 4L5RC 2A19A 4JZ4A 1F2YA 1SYEA 1VQPA 3TTZA 4LDUA 4DBHA 1YI2Q 2OF1A 2KSSA 3TREA 2ICIA 1U3OA 2XHRA 3JCMX 1T5XD 4BY1H 1KSWA 4U68A 1DOMA 1G83A 4B3RQ 3MPUB 3NGPA 3H9NA 3H3VI 4LNPA 2XX2A 1XMQQ 1HH2P 2B39A 4A3JG 1STGA 1VUBA 3D36A 3L3OC 1OSFA 3VS0A 1WI5A 3Q0AA 2EYFA 4P73A 3E9FA 2Q2UA 1EYAA 1UY8A 1NYGA 1KQ1A 3NWTA 1QVGA 3RLPA 1BYQA 4DR2Q 4L63B 5KNCA 1D3BA 4B3SL 4XIQA 1ZXNA 1CHPD 4DA4A 3K59A 4K4OA 4HZ5A 3NTHA 2YUNA 3H91A 1IBLQ 1X6OA 2YE5A 4ASFA 1I3QB 4EMGA 4M78D 4X9CA 1LLRD 4JBKA 2CGHA 5A0GA 4XU1A 3I55T 3TSSA 1A6XA 4L6V5 1UGRB 2IPOB 4M78G 1MSGA 4KMUC 1HXDA 1Y4SA 2ES2A 4BD3A 3MJXA 3CD6A 3OTOQ 3PO2B 2VW5A 5GAN7 3AYHB 1CM9A 1MHWC 5EJWA 2KHSA 2QA4Q 2BZYA 1I4GA 1AH9A 2WERA 3RKWA 3TUHA 1TSFA 4M77D 4C3JB 1YITQ 3K58A 1YT1A 3AB9A 4X66L 4A3IG 2RQVA 1EI1A 5I2YA 3FRNA 2RQTA 2F3WA 2WI5A 1TQOA 1GKZA 1CQVA 3CU7A 3JCMP 1B07A 1HNXL 5FWCA 3CCMQ 1WCMB 4JS4A 2JTFA 1PFBA 1WJRA 5C5LA 3S24A 4DQ2A 2BSMA 2CFMA 3VA5A 4KUDK 3CQZH 3R4PA 2CT3A 1PRTC 1V1PB 1X9NA 1S5FD 2YEHA 1NJIC 3QDRB 1Y8PA 1N9WA 2RI3A 3M58A 1VQOT 1I5FA 3HOWB 4XT1B 1MNEA 4FM4B 3UDFA 5IE8A 3HHUA 5E7NA 2L3SA 4DAVA 2VXWA 4WJ4A 3CD6T 3M0UA 2EYJA 4A4HA 2VS1A 2NZ1D 2OJ2A 1WTVA 1OU9A 1XQHA 2JNGA 3Q23A 4BY7G 1IHWA 1ESFA 1V29B 2LFNA 3E9IA 1E2VA 2DBMA 4WUBA 3TDQA 1CTMA 2RKSA 1SBBB 4RWSC 1QZGA 5IN1A 4JI1L 1AZGB 3HOWG 4AT1B 1UGSB 4C1NK 1K8AC 1H641 2ZCFB 5D3IB 5DNFA 1Y8NA 3U67A 3MP8A 2VQEQ 1UE5A 1X69A 3EG1A 1JT8A 1SNMA 2XCMA 1YJNT 2XMFA 4DV3L 4LF6Q 1NPRA 2HBPA 1NY4A 2XRQD 3MA2B 3H4LA 3PFSA 4EMHA 1Q86U 2UUCQ 1NZ9A 5D7UA 1RAAB 4DAYB 2PNRA 3C95A 3LWIA 4FW1A 1LT6D 2I07B 5LJ3j 2HD0A 1SNCA 3CMEA 5M5WH 1Y71A 1EZ6A 1VQPT 2FEIA 2BREA 1TVXA 4QMGA 1R9TH 1YJNQ 2OEOA 1I94Q 2DJQA 2DJZA 2D6FA 2E64A 2B8GA 3CRKC 1OXUA 3HKZG 1M9SA 1X43A 2D0PA 1SRMA 2E2DC 1YHAA 2F0SA 4JPBW 4LD9K 1S5DD 2I5MX 4YY3L 1K73U 3CKIB 3RUXA 3OYHA 2YUOA 4QKUA 3QSUA 1J8IA 2ASBA 3CC4T 3TEHB 1I6HH 4XTUA 1WTPA 4CWFA 1C0MA 5JEAH 2CP3A 3OSSC 1Q81C 1B53A 2CH4A 1JWUD 2R6GA 2XVSA 1WPYA 5FRNA 4NPSA 4FPPA 4E72A 1XWEA 4RH6A 2FJ2A 2Q8TA 2CREA 3T0HA 5C4HA 3T1KA 4ZKIA 1NEBA 1JR0D 1QP3A 4MTKA 4LF5Q 3CCLQ 4N8FA 4HIDA 3S17B 1ABOA 2M00A 2YGAA 2KDSA 1VA7A 3HZ1A 1STYA 2KRNA 2F0HA 5J1ZA 1JU5C 2YI0A 1PDQA 2YKJA 3LPSA 4M4ZA 2RI5A 3J81j 2ZTCA 2FL7A 2G5DA 4DV1L 2GTJA 1XJVA 3FKIG 2VUMB 4DAMA 1ZBXA 1ZSZC 3HHTB 1ZYRD 4G57A 5EPLA 2CQAA 3G75A 3ZKBA 3CCST 1SXTA 2JJQA 3DB3A 2RA4A 3G48A 3RZDB 1NBWA 4OL7A 5FU6C 4JBJA 2ATCB 3V7SA 1HSQA 1VQOA 1BR9A 1NUCA 2FPDA 2IX3A 3EFRA 4DV0L 4J8OA 2YGEA 4UHVA 1O75A 2DZCA 2OTLA 1NR2A 4HCCA 1SROA 2D5DA 3PIO3 3TS2A 2KCMA 4OMLA 5CKHA 3EKRA 4XAXB 1MJEA 1PCXA 2ZXRA 3FJPA 3CCVT 4DV5L 1AZPA 4KHPL 2QQRA 1H8KA 2JXBA 4BY6B 2E4HA 3NBHA 4P72A 2P0KA 1UEBA 3TBIB 1WJJA 2RQRA 4DKAC 3G4SQ 3CWVA 1M30A 2K5VA 3K7UC 3TP7A 4IQZA 1US7A 2EPBA 3V2TA 2X4WA 5GAMg 1CQFA 3INXA 3T53B 3CGYA 1B3QA 4WJ3M 2GCXA 2KVQG 1K0SA 3I56Q 5EC7A 3PMIA 4P2CB 2JA6B 1Y1WG 3OA6A 1R0CB 3C94A 3KXTA 2NUCA 1RJTA 5C6SA 1ZYRC 5C3XA 4FF2A 2Y4YA 1XTCD 4M7DC 4UP7A 3RMQA 4K6DA 3VADA 4RKLA 1BNZA 3UA6A 4X34A 1BCOA 1IKLA 4UP8A 4BY7H 2EVBA 4JI8Q 3JCMd 1TWFH 4BWGB 2ZGWA 1ENAA 4J8QA 4A3FG 3C0EA 5EG2A 4IFDI 4E7IA 2QASA 1RHPA 2XJJA 4RGOS 3CCQA 1Q82C 5IP9H 1XMOL 1E7OA 2VV5A 5GANf 2DZ9A 3EHRA 1RCVD 5CTYA 3E0JA 5EGTA 1IO6A 3SEBA 2H55A 3OPOA 4E6RA 2ZKJA 4R1JA 4L90A 1B3AA 2F5KA 1OXSC 1Q8KA 3PF4A 3VYSA 3EG9A 3M0SA 3U50C 3EHQA 3OIQA 2QEJC 4DK6C 1PVOA 2K5IA 3BDLA 2O2OA 3PCOB 3JCMW 3EG9B 1UGVA 4DNTB 4C92D 1TY2A 2OXPA 2ZDYA 5GAOp 3GIBA 2F1LA 4PMWA 1D1BA 1EWHA 1WX6A 5LJ3h 3E2UA 4HSVA 4Y7NB 1X6GA 3K99A 1EQTA 2DL7A 2KGTA 4BI3A 1DXMA 1VQJA 4ZTFA 1SN8A 3HGBA 3Q8DA 4LMQD 5LMNQ 3J80E 1H9KA 1YEZA 3OWEB 4A3DH 2HSEB 2VB3X 1UNSA 2QEXQ 1JBMA 4A3MG 2YEDA 4I3HA 3A5UA 5FLXE 3CC7Q 2DXTA 2EY6A 2EYLA 2G9HD 5EPKA 4YWLA 4ASAA 1M1KC 3MHBA 1PA6A 5M4PA 3OTOL 3T56B 1MMGA 2XU8A 2MP1A 1EY4A 3EFOA 5CKFA 2PPBC 1PXUA 4GOPA 4A3IB 4XIPA 3E3XA 1K83B 4FVMA 3L42A 4J9DA 4X3TA 4HIMA 1WA7A 2E74C 2JN0A 1H7SA 3EGDB 4ZGJB 5GAOq 3HP9A 4IFDJ 2XJGA 4L91A 4KH0B 1H9MA 1YIJA 3R2IA 2FG0A 3B25A 1A3TA 1UYGA 2WAQB 2Z6BA 3UATA 3GIGA 3CCLT 2FFKB 1K83H 1VQ8A 2N8NA 1GKHA 3BZKA 3L2ZA 2X3WD 4ZCKA 3INWA 2OAWA 4DN4M 2CH4W 1IRXA 3M0PA 4BBSG 3OMCA 2NYSA 1OO9B 2CWPA 4PG3A 4DR5Q 1OYXA 1VS0A 5EAYA 3OYAA 2AT1B 1F9PA 1NNXA 1OXVA 2CP7A 3VS2A 1G91A 5F5RA 2K75A 4M75D 4OWTB 4K0KQ 1FJGL 4DV7Q 3M4OH 1VQMQ 2WI1A 4ZLTF 3MEFA 1QOHA 1WTWA 3OBYA 1A63A 2SEBD 2F0UA 4LF4Q 2AK5A 1JXOA 2HZYA 3OS5A 4IZ8A 4RTUA 1R77A 3B26A 3IFTA 5M5YB 1TUDA 3JCMh 2JT4A 3R8BA 4ATOA 1RIPA 2PQEA 4HJAA 1TWHH 5IHIA 1WNLA 4YKUA 3I9QA 1X55A 2YE3A 2B63B 3G71A 1W2BP 4J9EA 3GP7A 4A63B 5GANg 2KCNA 2LMJA 3TZ5A 5FOBB 2D9TA 1YWOA 4DV2L 4G7ZC 5ELNA 5LJ3e 5A0LA 4HMIA 5DLOA 3CC2Q 3GP8A 1VQ9A 3VYRA 4BA2I 4ZNXA 2VCJA 4QVZA 3LNUA 4DR1Q 4IURA 1UE7A 2I5HA 2DJFC 2V1CC 3AU7A 1ZSZB 3L9AX 3JB9I 2PYKA 4X1VA 1Y1VG 4IIOA 2WSFE 4CC3A 2G3RA 4E47A 1L1OB 1KC8U 1QE6A 8AT1B 1WTHA 5IYBH 5C3EG 1JJGA 1BU1A 3VS4A 1QCOA 3AHUA 1L1OA 3C12A 4V25A 2UU9Q
chains in the Genus database with same CATH topology
3CGZA 3ZL7C 4EGIA 3REAB 3VS7A 3HZ5A 2NUZA 4OMMA 2XDKA 1WI7A 3U2KA 2CCTA 1THNA 2L2PA 2MCNA 1Z5AA 1WIEA 3M0TA 1YWPA 4O04A 2ECZA 4PL9A 1GCPA 4OMNA 4JASA 1PWTA 1X2QA 1UUEA 2KXCA 3GBQA 3PVLA 3BMYA 4XKAA 2HKJA 5BODA 4Z88A 2XDSA 4X9LA 2E0AA 4L8ZA 1AWOA 2JS2A 1HD3A 2YEJA 1NG2A 2OI3A 3B28A 4GLMA 2YT6A 2AZSA 2DBKA 3M0QA 2BU6A 2DL5A 1Z9ZA 2EYXA 1UTIA 2ZBKB 4CWRA 2DVJA 2EBPA 3O5ZA 4LWIA 1PKTA 2P4RA 2WI6A 4QPJA 5HCKA 2JTEA 4KSHA 4EM7A 4LE9A 4FCPA 4LWFA 2XJXA 4CE1A 2GGRA 1GKXA 3A0XA 3A0ZA 3TSWA 4E01A 4PRVA 2ESAA 1I5DA 4DEXA 1RUWA 5GJVB 3RKZA 2GQIA 2KRSA 4E02A 1T0HA 1QYEA 2JMAA 2EXLA 1ARKA 2KXDA 2GTOA 2CSQA 2J05A 1UYEA 4KP4A 1ZW9A 3K97A 2DA9A 1TBWA 4XDMA 1QZRA 3R6NA 1GFDA 1AMWA 1YC3A 2D8HA 2HSPA 1YESA 4GFNA 3VHDA 5FNDA 2CUDA 2O1UA 3CRLA 1UY7A 2YE8A 2EYZA 2K2MA 1XOVA 3A0RA 4BAEA 1QCFA 2VWFA 2AKPA 2BYIA 4J9FA 4AS9A 4GBQA 2K3BA 4O0BA 5D7CA 2YEGA 2YGFA 1MV0B 3REBB 2IOPA 2XDLA 2IWSA 1VYUA 1UJYA 4HY1A 2WERA 3B24A 3FV5A 4J9CA 5CF0A 1GBQA 2EW3A 2H8HA 4AFQC 3BM9A 4GEEA 4GGLA 4O07A 2KE9A 3QDDA 2YECA 1Y8OA 3EG2A 4AFUC 1Z5CA 1A4HA 1ZXMA 2LNHB 4Y92A 2M51A 3C0CA 2BZ8A 3I5RA 4YKTA 2Q8GA 4MP2A 1U06A 5BOCA 4HYPA 4AWPA 1MUZA 1T3SA 4F14A 1YNZA 2DRKA 1Y4UA 2RQWA 3EGUA 1Z9QA 1I07A 1AM1A 1ZLMA 2D0NA 2DL8A 4H7QA 2YE6A 3R91A 2W10A 1NM7A 1UECA 1W70A 2ROLA 1U2OA 2IOQA 3O6OA 4HXZA 4WUDA 3RLRA 2LJ0A 5IN9A 4EEHA 4ASBA 1TG0A 4LUDA 1UY6A 3C11A 3Q5KA 1SHFA 2K9GA 2FPEA 3U2DA 2A28A 2XD6A 1M27C 2ABLA 2BZXA 1UYLA 1GRIA 2L3QA 3NMZC 2DL3A 1BK2A 4B6CA 1K76A 4CE3A 1ZWHA 2KYMA 4R3MA 2G6FX 1JXMA 1Y57A 3JZ3A 4RTXA 2DILA 4WCIA 4FCQA 4YKZA 3A98A 5D6PA 3VS5A 5C93A 2SEMA 1AH8A 4O05A 2CCUA 2IIMA 2DRMA 1OPKA 2M0YA 4FSSA 2YE2A 3DGEA 2YKBA 1E6GA 1E6HA 1WXUA 3T10A 2K5BA 1YCSB 4IIMA 4LWHA 4CC7A 1TUCA 2O1WA 2FRYA 2CUBA 2RN8A 4EFUA 4DZYA 4Q20A 4R0KA 1ZUUA 3NMQA 4RTZA 2FO0A 5I22A 2HCHA 2HDAA 4EIKA 2C0OA 3H0HA 1FYNA 1GCQA 1TC0A 1CSKA 4MPNA 2EKHA 1PHTA 2ESWA 4Z8AA 5IDJA 1I59A 2X3XD 4MPEA 4GT8A 3IQLA 2BT0A 4KFGA 4ESRA 2DF6A 3A0TA 1OPLA 1YERA 4BIUA 4CWNA 1RI9A 2FRWA 3OWDA 2KR3A 4HXWA 1K1ZA 1M3AA 2KBTA 4LPBA 3T0ZA 3VHCA 2BTZA 4CE2A 1KFZA 2RPNA 1AWWA 4XD8A 1PRMC 3PEJA 4EGHA 4L94A 2YEFA 4URMA 1AWJA 4HVVA 4BIZA 4AG2C 1GFCA 2JW4A 1GL5A 3OWBA 2KYBA 3K98A 4XCLA 1NEGA 4J9BA 3U23A 4EGKA 2LX7A 2YEIA 1U0ZA 2CCSA 2QFOA 4H81A 4U93A 1ID0A 4K11A 4XTJA 2BTTA 2I0NA 1YP5A 3HYZA 2O31A 3SL2A 4KRTA 2EGCA 2JS0A 2DYBA 1JM6A 3I5SA 3JV3A 4F17A 1YSRA 4RUGA 4YKYA 5D7RA 2XDXA 4Z89A 5J6AA 2XHTA 3K60A 1T3LA 3VRZA 2GFDA 2FWZA 3WQ9A 2AKKA 5IHNA 4URNA 5M4KA 4JZ4A 2YEEA 3T2SA 1UYKA 1PNJA 3T