2CH4A

Complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
320
structure length
320
Chain Sequence
b'GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLTLAIIQALLVKVNNLVYAIPIANIDTILSISKEDIQRVQDRDVIVIRGEVIPVYRLWEVLQIEHKEELEEMEAVIVRVGNRKYGIVVDDLLGQDDIVIKSLGKVFSEVKEFSGAAILGDGSIALIINVSGIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Reconstruction of the Chemotaxis Receptor-Kinase Assembly
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/chemotaxis
total genus 72
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01584 CheW CheW-like domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ch4A02
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2ch4A03
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2ch4A01
2HKJA 3NPFA 1WI7A 2K3BA 1NHHA 4GQTA 2CSQA 2C0TA 1YETA 3CGZA 3EHJA 4ZKIA 2AZSA 3PE0A 1MUZA 1KFZA 1MU5A 1B3QA 1TC0A 2YE5A 4CE1A 4LWIA 3A0XA 5IHIA 4KRTA 2CT4A 2BTZA 3U67A 3OWBA 3KFVA 4GBQA 4PRVA 2QFOA 5M4EA 4FCPA 1H7UA 1I58A 1RLQC 2EQIA 1H92A 1US7A 3QDDA 1ZSGA 2YKCA 2K6DA 1MX0A 2YECA 3U2KA 2JKIA 1I5BA 2XJJA 2YEFA 4LWGA 3H0FA 2HG1A 1BXDA 1EFNA 4CWTA 4OMPA 2DL3A 4HVUA 2KROA 2CDTA 4XIRA 2DMOA 2WI6A 2KYBA 2ENMA 2KE9A 3HHUA 1WYXA 2YK2A 1IO6A 2LQNA 3EG1A 1AH6A 2Q8HA 4R1FA 3A0WA 2GQIA 2XD6A 4EIKA 4XKAA 2WERA 1Z59A 2LJ0A 1S14A 2FWYA 4NH8A 4J9DA 3TSWA 1KZNA 3T10A 1NYFA 1T0HA 2BZYA 2J06A 1U2OA 3R4PA 2VW5A 3R4MA 4QT7A 2XHXA 4V26A 2YI0A 2QG0A 2YE8A 1AWJA 2J6KA 1R62A 4CWFA 4BQGA 3TZ4A 1FMKA 2DF6A 2WI1A 1UJ0A 2H55A 3ZXQA 2BRCA 2YSQA 2J6FA 5HCKA 4J9BA 3R91A 2LZ6B 2DRMA 1TUDA 1NYGA 1N5ZA 3G7EA 1YC3A 1OOTA 1SEMA 1YNZA 5M4KA 4YKQA 2KR3A 3PVQA 3HZ5A 3WHAA 4RTWA 2YEHA 1GCQA 2MCNA 3EG2A 1NEGA 3EGUA 3ULRB 1PVGA 2RN8A 4XC0A 3FV5A 4QPJA 1AD5A 4H81A 2O2OA 4MP2A 1TC6A 2JTEA 2IWUA 2IWXA 1AM1A 2ESAA 2YE3A 2YKEA 4KTNA 2C0IA 2RQTA 1AZGB 1E6GA 1VYVA 1WA7A 4LNPA 4CWQA 4CWSA 2ROTA 3EKOA 4AS9A 4CE3A 4F17A 1ZUUA 4FCRA 4JAVA 4HYMA 1YT2A 2ED0A 2BZXA 1ZUYA 4AG2C 1JXMA 2HCKA 1YCSB 1YESA 3LPSA 1GJVA 4KP4A 4EGIA 5BODA 3IQLA 3A0RA 4OMLA 3ZKBA 3INXA 1AH8A 2G6FX 1THNA 2WEQA 4JJDA 4BXIA 2SRCA 4WUCA 2RPNA 1J3TA 2JS0A 1PKSA 3IEDA 3O6OA 1SHFA 4ASFA 5CF0A 1TBWA 2EYZA 2YEIA 4URMA 1E7OA 2DM1A 1S16A 1ZXNA 1YC1A 3VS1A 5ECAA 1OPLA 1HJDA 2XHRA 4EFTA 2FRWA 1UUEA 2LCSA 2A36A 1EI1A 4P8OA 2I0NA 1OEBA 1I1JA 2AZVA 2KBTA 4RUGA 1B62A 2ZDYA 5EC7A 3T2SA 1K76A 2HCHA 5FW9A 2F2WA 1OPKA 3GIGB 2XMFA 1QKWA 1BKNA 1U3OA 1H7SA 4DEXA 4KQVA 4AWOA 2FG0A 2RQRA 1UYIA 3M0PA 1PRMC 2LX7A 1BB9A 2FEIA 1SPKA 5CTXA 1U5SA 1WXBA 1WFWA 4IIMA 1UGVA 2B86A 4IIOA 4CWPA 4GLMA 3VS2A 2O9VA 2YGAA 4O04A 5F5RA 1BYQA 1JU5C 2YE2A 2V1RA 3UATA 4OMNA 1SHGA 3VS0A 3CGYA 2ZKJA 4XTJA 1VYUA 2A08A 4HYPA 3H80A 3ZM7A 2FO0A 3EHFA 1PWTA 2JMCA 4FCQA 2CH4A 4OMQA 4Y92A 2UWDA 4RTYA 4KFGA 3VS7A 2YEGA 2EXLA 4CWRA 2F2XA 2IORA 1ARKA 1AZEA 2BYIA 1ZLMA 4CWOA 2A28A 4ESRA 3I5SA 3M0SA 3R6NA 5J6AA 5GJVB 1ZW9A 2YE4A 1TUCA 2CT3A 2E5KA 3NHNA 3ZXOA 1K4US 3G75A 1JXOA 1XOVA 4YKTA 3LNUA 1Z9QA 1GCPA 3OMUA 1QLYA 2K9GA 2KNBB 2VWFA 4J9IA 3D36A 4AFUC 3OWDA 2CSIA 2NWMA 2IOPA 3RKZA 2F2VA 3VRYA 2FPEA 3O5ZA 2K5BA 2BYHA 1NHJA 3C11A 3K99A 2D8HA 2FRYA 2Q2EB 4X1VA 5FWKA 2PZ1A 3UA7A 2DE0X 2M0YA 2EBPA 4YKXA 3T1KA 3B25A 2ABLA 4QPKA 4W7TA 4E02A 5FWBA 3H4LA 3FT8A 3HZ1A 1G2BA 1WX6A 3FJ5A 4BIUA 4DZYA 3UA6A 3BMYA 1FYNA 3PEJA 3CQTA 1JM6A 1JO8A 1Y4UA 2XDKA 2XDUA 2CH4W 4XDMA 2BU6A 1WXTA 2KRMA 5BOCA 4B6CA 1UY8A 2GTJA 3Q5KA 2YEEA 2AKKA 1AWWA 2JM9A 1UHFA 4LPBA 1UYKA 1YSZA 1GCQC 1YP5A 2E0AA 1UYMA 1X27A 4RTXA 1ZUKA 2BZ8A 2KT1A 1UYFA 3ZKDA 2WI7A 1K1ZA 4CC4B 1Y8PA 4MPEA 2KYMA 4FSSA 2JM8A 2YGEA 2PTKA 3H0IA 4K4OA 4EMVA 1GBQA 1GRIA 4RTZA 3Q5LA 4X9LA 2L3QA 2QG2A 4ZVIA 3H0HA 4RTTA 5D7DA 2Q8GA 1NHIA 5L23A 2XX5A 3NMQA 2CREA 4KSHA 3RBBB 1B07A 2XJXA 2XDXA 4F16A 1HD3A 3QWYA 4NH9A 4YKZA 1KJWA 3VHCA 4LN2A 3UF4A 1RLPC 1YWPA 1AMWA 4XKKA 1I59A 4Q20A 1QY8A 4L90A 1W1FA 4BAEA 3ZL7C 3B24A 1TH8A 2FXSA 3R92A 2DX1A 4OMMA 4HXJA 4XD8A 1S1NA 3SHWA 3GIGA 3OPDA 1AOJA 2BTTA 1K9AA 4HXWA 4DUHA 4WUDA 1Y8NA 3R4NA 1X6BA 2YI5A 2OI3A 4UROA 2AKLA 1ABQA 2CCUA 2O1WA 2O9SA 2RF0A 4J9EA 1X69A 2YE9A 5CTWA 5FNCA 1UE9A 2C0OA 4NH7A 2YUQA 2K2MA 2XDSA 5D7RA 1SRMA 1TIDA 3SL2A 1AJ6A 2YK9A 4R0KA 1TG0A 2EYWA 4HY1A 3M0RA 3K97A 4CC7A 2M51A 4BQJA 5J71A 4LUDA 2JW4A 2D1XA 1OV3A 1ZX6A 3EHQA 2BSMA 2PNRA 5I22A 1V1CA 1B63A 2KXCA 2CG9A 2YEBA 4J9HA 3A0YA 3Q5JA 1EA6A 2HDAA 1ZBJA 1W6XA 3I9QA 2CGFA 2PNIA 2EPDA 4EM7A 1UJYA 4GFNA 4XIPA 1GFDA 4V25A 5GGZA 1YN8A 2DLPA 1YT0A 2IWSA 2AKPA 1MV0B 3TSZA 2YEJA 1T0JA 5IXBA 3TUHA 3M0QA 4Z8AA 2YKIA 2EVRA 1AWXA 2KT8A 1L0OA 5D7CA 4JZ3A 5FWCA 2D8JA 4L8ZA 4PU9A 1QKXA 2X3WD 4JJCA 2MIOA 2LNHB 2MOXA 4E6RA 1I5DA 2WI4A 2H8MA 4XKOA 4RTVA 1GFCA 3K60A 4E00A 4LWHA 3TTZA 2DBKA 1PNJA 2KXDA 4L93A 2GNCA 1ZXMA 4BIZA 2K79A 2RQVA 3VHAA 4H7QA 2GGRA 2O1UA 3CRKA 3SEMA 2YJXA 3EHGA 2L2PA 3U23A 1ZWHA 1QYEA 2LJ3A 2BZ5A 2WI5A 3CWVA 4JAUA 4AWQA 1AVZC 2FPDA 3WQ9A 4AWPA 4GT8A 2XHTA 3JZ3A 3QTFA 4HY6A 2YE6A 1QWEA 2ECZA 1X6GA 2OAWA 4XCLA 1Y0MA 2J05A 2X3XD 4AFSC 1Y4SA 2XX2A 3GIFA 4I3HA 2J7IA 1M27C 2L3SA 1U0ZA 2VWCA 4LE9A 4OMOA 2L0AA 4WCIA 1WIEA 4AFQC 2JS2A 2EYYA 1I5CA 2Q8IA 1YT1A 4I5SA 1Z5BA 2VVKA 1UHCA 1QCFA 4MP7A 3VS6A 1QWFA 4MPCA 3O2FA 4EFUA 5M4PA 2QDLA 2XJGA 2O31A 2BU7A 3MNRP 2BU2A 2LQWA 4CC3A 2VCIA 2WI2A 4YKWA 2DBMA 4MBCA 1QZRA 2XX4A 4YKYA 2DILA 4M4ZA 4D8DA 1PKTA 2H8HA 2HSPA 1BU1A 1UFFA 2ED1A 2YEAA 2RQUA 2HBWA 4J9CA 2OJ2A 3QWXX 2AK5A 2YE7A 1YWOA 4XE2A 3O0IA 2YGFA 2ZBKB 4JASA 1UYEA 2ROLA 4XIQA 2YT6A 4JZ4A 2GFDA 1GBRA 2QF6A 2EYXA 3INWA 1M3BA 2ZDXA 4O05A 3EHRA 4EEHA 4XITA 3VS3A 2EKHA 3VRZA 4ORZA 3REBB 4AFZC 2GQPA 2ESWA 1KIJA 3C0CA 5FNDA 4ASGA 4J9FA 5I11A 2KRSA 4EGHA 4HZ0A 1BK2A 1JQQA 4ZNXA 4CE2A 1NEBA 4E01A 1M3CA 1T3SA 2KGTA 2C2AA 3NGPA 2XK2A 3A0ZA 3EG0A 4Z89A 3G7BA 4URLA 2V1QA 1OSFA 2BT0A 2YJWA 4O07A 2CUDA 2JJCA 2DL5A 1NLOC 2W0ZA 2P4RA 3KE6A 3DGEA 3T0ZA 5IN9A 3RNJA 3VHDA 2RNAA 3THKA 4YKUA 4L94A 4U7OA 2GBQA 3H41A 1SRLA 2O1VA 3I35A 4GEEA 2XDLA 4WUBA 4J9GA 1X43A 3EKRA 2DL8A 1UTIA 4GGLA 1Z5CA 5CPHA 5M4HA 2WI3A 4U7NA 3D2RA 5M4NA 2YDLA 3U2DA 3M0TA 3CRLA 3FT5A 4R3MA 1GKZA 1I07A 1UECA 2JT4A 3RLRA 1LCKA 4CC2A 3D0BA 5IHNA 1Z9ZA 1YC4A 2HEQA 2KRNA 2FWZA 1KIKA 5GJWB 5CTYA 5IDMA 2YUOA 1Y57A 3TZ5A 2J6OA 3PVLA 3PEHA 4O09A 4HXZA 4LWFA 5M4MA 3HYYA 5CTUA 1YS3A 4MB9A 5D6QA 3BM9A 2D0NA 4LP0A 1UG1A 4PRXA 2FYPA 1M8MA 4A63B 1NM7A 2JXBA 2LP5A 1M30A 1X2KA 4RTUA 1I5AA 1UY9A 2XABA 2DA9A 4P7AA 2Q8FA 4ASBA 4JPBW 2DRKA 1K0SA 2EGCA 3OW6A 4H85A 4FPPA 4JQLA 2K7AA 2JMAA 2NUZA 1UY7A 1UY6A 2DJQA 3LH5A 1BGQA 2CCTA 4PL9A 4HCKA 4B7PA 5L3JA 2YI6A 2SEMA 4Z88A 2DL4A 3A0TA 2DYBA 1JEGA 1CKAA 4F14A 4HVWA 3B28A 1WXUA 1GL5A 2EGAA 3T0HA 5D6PA 2LMJA 1CSKA 1BBZA 3I5RA 4AG1C 4EGKA 1YERA 1ABOA 4ASAA 1RI9A 5C93A 3B27A 2RMOA 2RQWA 5IH2A 1AEYA 1VA7A 2BU8A 4CWNA 1H8KA 1NG2A 4D8KA 3B26A 1ID0A 3EG3A 2DNUA 1K0XA 1WLPB 1UYLA 3C0EA 2IOQA 4HVVA 1PHTA 3R4OA 2CCSA 5IDJA 3VS5A 3NMZC 1YSRA 5F3KA 4URNA 2YKJA 4JJBA 1VYTA 2LJ1A 1TILA 4K11A 4MOTA 4U93A 3REAB 1E6HA 2DVJA 2W10A 3GBQA 4GCZA 1UYHA 1M3AA 4R3AA 2BREA 2YI7A 2YUPA 2YUNA 1I0CA 3JV3A 4LUEA 3VADA 1Y8OA 1PRLC 3TZ0A 2DL7A 1HSQA 4DEYA 5IHKA 1RUWA 2EGEA 3K98A 2FPFA 3VS4A 4LWEA 1CKBA 5FNFA 2EW3A 4FMTA 2WEPA 1UYGA 3M0UA 1W70A 2BU5A 2A37A 2YKBA 1UDLA 4L91A 4KSGA 1KSWA 1SSHA 4MPNA 1H3HA 1A0NB 1G83A 1Z5AA 1A4HA 2CUBA 3GIEA 1X2QA 1AWOA 3EHHA 1WDXA 3RLPA 1UYCA 3A98A 2KEAA 2IIMA 1T3LA 1NLPC 1GKXA 1UYDA 3TZ2A 5IXFA 2L3PA 4O0BA 1U06A 2XCMA 2VKNA 4YKRA 2GTOA 4HZ5A 4XCJA 3TVTA 1MV3A 2O88A 3RLQA 3HEKA 3HYZA 2VCJA 2YEDA
chains in the Genus database with same CATH superfamily
2LT1A 2X6GA 4G4KA 2RM4A 2VL6A 4DXGA 1WI7A 3HL8A 1LTGD 3NSWA 4OWXB 2K3BA 3CCRQ 4BWGB 1STNA 2CSQA 2C0TA 3HOZH 2UXDL 1NHHA 3S1NH 1MU5A 1KHIA 5CC4A 1TWFH 4NB3A 2H3JA 5LMNQ 4LWIA 3IFDA 4NXMQ 3MP8A 2A5HA 1D1CA 2CT4A 3U67A 4A76A 2E2HB 5EAYA 2DXTA 5M4EA 2K33A 1RLQC 1H92A 4ZGEB 2AWNA 4X3TA 3RERA 2PQAA 4A3KB 1A3UA 2YRCA 1G3SA 3CRLC 2I46A 2YEFA 2HG1A 1EFNA 3G1JA 3I70A 4CWTA 4XU0A 5IP7G 2X4JA 5I6WA 4Y7NH 1WYXA 2QQSA 3G7LA 3HHUA 1I4GA 1X9NA 2ES2A 3CCMT 3EG1A 5IP9H 2IX3A 1SNQA 2M9VA 2MJ8A 4YY3L 1M90U 3GTOH 5C4XG 1AH6A 3CCRA 2QEXT 4EIKA 4XKAA 1NZ9A 6AT1B 4LUVA 5CV9A 4APVA 4NH8A 2SDFA 3RR6A 2R61A 5M5YH 1IYJB 2H4OA 1ASYA 2VW5A 4E7ZA 4DN4M 4HT9A 4V26A 3OYMA 4FYWB 1XNRQ 2YE8A 4BA1I 1CA5A 2QQAA 3CMEQ 2OXPA 3W1GA 5IT9c 1N32Q 4BQGA 5A0LA 4A3IH 1FMKA 2DF6A 2PUOB 2EXZA 1A3VA 2ZTDA 3X28B 3ZXQA 1CHQD 1OO9B 4KKSA 1SYGA 5CV8A 4ELYC 1FJGL 2BRCA 5IYDH 3R91A 1WNLA 2DXCA 4DK6C 2DRMA 1TUDA 2DVEA 4OGCA 4EMKC 4M7DA 1OOTA 1SEMA 1ZYRC 2EY2A 2L1BA 4BI3A 5KEEA 5T1GA 2VUMH 4RTWA 1D0ZA 2RF4A 5GROA 2MCNA 2OF1A 4WF2A 3JB9F 2A73B 1AD5A 5KGUA 4A3MH 1TH7A 4POFA 2JTEA 2IWUA 1AM1A 1M1KC 1AZGB 1E6GA 2G9DA 1VQLQ 3H94A 5KNCA 4II1A 2R93B 4J15A 4CWSA 1EX4A 4AS9A 4CE3A 3EN2A 3UT1A 1ZUUA 5FU7C 3JB9G 1KQSP 3CMEA 1AE3A 1YT2A 1KABA 2AKWB 2DERA 4C92C 2UU9Q 2P84A 4N4IA 1X56A 2ZTCA 2A68D 4DFAA 4EGIA 3T13A 2L55A 1RDPD 4R1JA 4E7HA 2WEQA 2SRCA 1Y14B 5M5WH 2RPNA 2DJZA 3J7AV 1MMAA 1JCKB 4JG2A 2Z8LA 4ASFA 5CF0A 3NQIA 2YEIA 2PQEA 3RMHA 4EMHA 1BQQT 4TRDA 2E3IA 4J1MA 2FZGB 5DY9A 3O13A 2FRWA 4HMJA 1UUEA 4GN5A 3OY9A 3JAMi 4A3KG 1HNZQ 3VYTA 4X6AH 2I0NA 1KC8R 2KBTA 2EQKA 2OCEA 1VQLA 1PVOA 5HY6A 5FW9A 1D8LA 4DR2L 2XIWA 2MWPA 4KY7A 4BBSB 2F2WA 1OPKA 1ZSZC 2DXBA 2XMFA 1DOKA 4LF8L 1NPPA 2H1EA 2AHOB 1BKNA 2XI9A 3ND8A 4F88A 4KQVA 4KKTA 3OYDA 1BCPC 4CKEA 3EFRA 3M0PA 2EQMA 2EYQA 1O75A 1BB9A 3ASKA 1IHZA 2L9HA 3D4RA 4K6LA 5JAVA 3TZDA 2ZPGB 1A8VA 5DM73 4IIMA 5M5XB 2B86A 4IIOA 5EKLA 3C46A 4GLMA 3VS2A 2K32A 4M77D 3MXNB 2KA7A 4UP9A 4DV1Q 5EPJA 4DV2L 4C5EA 1W6JA 1WVLA 2V1RA 3UATA 1GUNA 1ICWA 1SHGA 2X35A 1D1AA 2P4TA 1K9MU 1VQKQ 5E7NA 5GAOr 3M9BA 2KCTA 1N27A 2CP3A 3WVDB 3NBHA 2ZJPA 5LJ5g 4PG3A 3K58A 3ZYYX 3HRSA 4MDWA 4FCQA 1PM3A 4Y92A 4RG2A 2E74C 2EXLA 5C4JH 2F2XA 1WHLA 1ARKA 1AZEA 4HCCA 5IY0A 1ZLMA 5ELBA 3OSSC 4CWOA 2A28A 3QKJA 4HMIA 3J80L 1Y1WG 5J6AA 1AN8A 1Q1BA 1TUCA 2K5HA 2Z4HA 3NHNA 3JC66 1WTVA 1X75C 1Y7XA 3GLXA 4JRPA 1K4US 3M4PA 2HT1A 3H3VC 1KDCA 1UAPA 5I4DA 4ME5A 1QLYA 2K9GA 2KNBB 2VWFA 4C5HA 2E2IH 1LTTD 4OGQC 3D36A 2AQ1B 3QDFA 2R93G 2K1BA 4E2FB 3HOUG 4IFDI 2KCCA 5GMKe 1VQKA 3O5ZA 2F4VQ 3A1PA 2BYHA 5KYWB 1SAPA 5FWKA 3CXCS 4DOWA 1BDOA 1LABA 2PZ1A 1B70B 1DYQA 2R7ZH 1X6OA 2EBPA 2M0YA 1B4OA 1R4PB 4OX9L 2FZCB 4PNYA 4YKXA 4E7IA 1HZ9A 3B25A 4LJZC 3S6WA 4KGZB 3VKIA 4QJFA 4RWSC 3FT8A 5JVH3 3HZ1A 4FM4B 3A8HB 4BIUA 4DZYA 3UA6A 3PEJA 1JM6A 1I5FA 3A74A 2HKNA 3DEOA 3OSVA 5JJKA 4L59A 4M75B 2AKKA 1R4QB 2VQFQ 4B3TL 5CYUA 2JM9A 1XQHA 1UHFA 3FKIH 3SWNB 4BBSG 1UYKA 1LTRD 1UYMA 4XT3B 1I4K1 1X27A 1ZUKA 2KT1A 2JEBI 1UYFA 4FXGC 1PH6A 1K1ZA 1I6VC 4K0KQ 5G3LD 4FSSA 1IXDA 3R93A 4OELB 5I9PA 4O04A 3MPUB 2B3GA 2NUTB 1RKNA 1VCIA 3Q5LA 4X9LA 3QOJA 4ZVIA 1G291 3HRUA 2RCNA 3X20B 3OS2A 2A19A 3CQZB 3P1HA 4PMBA 1N8RR 2Q8GA 1NHIA 3UDIA 2XHCA 2RD1A 4C3HB 3QJ6A 2CREA 4L5GA 4XTVA 2PQWA 2DNEA 3BVZA 3IRBA 2VW9A 1B07A 3CCUQ 2MO0A 2XDXA 2XJXA 4A3JG 4NH9A 1G8ZD 4L5TA 3C1FA 4XYOA 4HIOA 3A7LA 3AFQA 1VQ5T 5CV6A 4DQ2A 3URGA 2KQWA 1YWPA 1PYWD 1N33L 4N9PA 4TVRA 2B2WA 2RHIA 1YJ9Q 5LJ5f 1QY8A 4BAEA 3G6EQ 3ZL7C 2CFMA 3EQLC 2FXQA 3B24A 5HK0A 3D7SB 1VQMQ 3D4WA 1EIYB 2DX1A 1YVCA 1BKBA 1E2VA 2K5QA 1S1NA 1K8GA 2FZKB 2KEDA 1AOJA 2BTTA 4DAMA 1K9AA 3HKSA 5C4HA 1LJOA 2EXDA 3DM1A 3OYHA 1LT5D 2HKQB 4RMFA 4YY3Q 5DM63 1Y8NA 1UGPB 3R4NA 1X6BA 3Q23A 2YI5A 1ZYRD 2MPXC 2AKLA 4JV5L 2CCUA 2O9SA 5CTWA 3CCJQ 1QP3A 4JDSA 2NZHA 1L0YB 2F0TA 3E9IA 3W2DA 3GTMB 5D7RA 3CCUA 1EY7A 4A93B 1NJIU 3PMIA 2JA5H 2YK9A 4PZ6A 1UE5A 2IL8A 1FJGQ 2QEJC 1YJ9A 1XPRA 4XDXA 2NVQB 3G6EA 1V1OA 4M75F 1EQQA 4X9CA 1QUQA 1B9NA 5CKHA 1RACB 2YEBA 1QZGA 3A0YA 3I56Q 2HDAA 1ZBJA 3I9QA 4C92D 1HA6A 2EPDA 3M5AA 2F0NA 1GXDC 4JI1L 1XMOQ 4V25A 2ICEC 4GLXA 5IXBA 3GTLB 3M0QA 4M75G 2YKIA 5CKFA 4Q5VA 4RCCA 1ONLA 4JZ3A 2SNSA 5D7CA 4PNOA 2DETA 4A4HA 3Q6SA 4DR3L 4LFBL 1QKXA 2BOSA 3CCJA 1S5FD 2MOXA 3G71Q 2JN0A 3MCAB 4BI8B 2H8MA 4RTVA 1GD7A 3K60A 4KMUC 2K5VA 1RL2A 5FROA 1C4QA 1KNAA 1TWAB 3SK6A 4LWHA 5HGQA 1Q7YR 2NN6I 3T1HQ 4EDUA 3H09A 4IJLA 3WXMB 4F7XA 3RZDB 4H7QA 4H7BA 4IKFA 2O1UA 1WZOA 3SEMA 2YJXA 4DR7Q 3U23A 1ZWHA 2BZ5A 4GT8A 2EYHA 4RG8A 1BCPD 3QTFA 1FNVA 1KC8C 4UDUC 4BY1B 2OAWA 1I3QB 5DLOA 5C4ZA 2X3XD 4M77A 4C3JH 3M85A 4XCLA 4I3HA 4GNXA 1M27C 4V0BA 1MNDA 2L3SA 1QB5D 2Z4IA 4FYVB 3VYGA 3PNWC 4PL6A 2F0LA 3QWNA 3HOZB 4LE9A 5D3IB 2DEUA 3QXEB 1LT3D 4E00A 4IJHA 1JE5A 1MSGA 1TWFB 2QW7A 4DR2Q 1I5CA 3KF8B 3G4ST 1YT1A 3G71A 4LF8Q 4I5SA 2CCZA 3FDRA 5GANg 3I72A 3S16H 3J81E 1E3PA 1XWEA 1F77A 2F0EA 3RR5A 3VS6A 1F9QA 5C6AA 4IUNA 1VUBA 1DGSA 1HTPA 2RK1A 1PFBA 3SVMA 3O2FA 1VIFA 5M4PA 1LOJA 2O31A 4P5NA 2VCIA 3GP8A 4RCNA 4AH6A 1YNNC 3P8BB 4JRIA 3TREA 2YRDA 1EYAA 2M2LA 4DV2Q 1XMQL 2JA6G 2E6NA 4YKYA 1PKTA 2BUDA 4F04B 2HSPA 1BU1A 3CPWP 1S72T 4UAIA 2RQUA 2K4KA 3A8IE 5EJWA 4Y7NB 2F0WA 3RN5A 4IFDG 4A93G 1YWOA 1WTXA 1UGRB 4A3LG 2M1HA 1ZXTA 1I4HA 1UYEA 3GTOB 2YT6A 1SNOA 4JZ4A 4LMQD 1QOHA 3O8VA 1SLJA 3UI2A 4N9TA 4DV6L 3A5UA 4OVAA 3JCMb 2O5JC 1F2YA 5IODA 3EHRA 5M5YB 4EEHA 1IZ6A 1HUMA 3S5TA 5LJ3d 3PF5A 3REBB 4DR5L 2IVWA 2MWOA 4BY7H 2C1GA 1QVGS 3FIFA 3I4NH 4EGHA 3M4YA 3PT9A 1BK2A 1B53A 1NEBA 3LWUA 4K2KA 4P74A 2PCFB 4X3KA 3TSSA 4A3IB 2K5LA 3NGPA 3EH1A 3H0GH 2QK0A 3U4ZA 1IBLQ 2D0PA 3FEWX 1ZBXA 3CMAQ 5CV4A 1OSFA 2CUDA 2YJWA 4QGUA 2DL5A 2JJCA 2W0ZA 1BO0A 4DAVA 4DV5L 5LJ3h 3DGEA 2E4HA 3KE6A 4GS3A 2RDGA 3RNJA 5IN9A 5GAMd 2JA7H 2VUMB 3CCEQ 4L94A 4N4HA 3GTGB 1RD9D 3A8OB 4DBHA 3H41A 3BDLA 3SE0A 1I81A 1SRLA 3I35A 1PD0A 1CK1A 3ULLA 4A3MB 4X66L 2EIFA 3TS0A 2DL8A 3OW2A 1UTIA 1OULA 4A4FA 2A69D 4XYQA 2R6GA 1WYDA 5GAEC 4B3SL 2WI3A 2VXEA 2BE9B 4U7NA 4GN3B 2E5LL 5KRUA 5NUCA 3M0TA 3HKZE 4ZYSA 4KGVB 3CRLA 1GKZA 3FT5A 2JT4A 4R3MA 1V1QA 4CC2A 5GAMh 5GADC 1VQIA 2B63H 2BE7D 4BY1G 1BI0A 2HEQA 3TP7A 4BXXG 2E70A 2DD5A 3S3MA 2FWZA 1F2MA 5CTYA 2PNRC 2J6OA 3HOZG 1WJRA 3JCMP 3CMAA 3NK9A 3HYYA 1YS3A 2QQRA 2RH2A 4MB9A 5M5WB 5GAOl 1RIPA 2GN5A 2IJ0A 2XGTA 1AHJB 1PTOH 2O4XB 4I7AA 4JCVE 1WHKA 2R92H 1JOQA 3C12A 3B26A 4ZLTF 2LP5A 4PRXA 2XABA 3CCEA 1R8OB 4Y52H 4ASBA 2Z6KC 3EG9B 4N0AC 2DRKA 4LDWA 2EGCA 4M78A 5GANf 1N8RC 1MMDA 1JJ2P 1WJJA 2HIXA 1QCBD 3M58A 2I5HA 1CA6A 5JJIA 4JQLA 4ALPA 2DJQA 3CC2T 2XDBA 4LUZA 4YTLA 5A2QL 5KYNA 4HCKA 4B7PA 5L3JA 4PJOB 5CQXA 4YHHQ 1SXTA 1IBKL 3A0TA 5C0XJ 2Q2UA 3E9HA 2QAZA 4ANJA 2DGYA 2KQ3A 1BBZA 1D3BA 3OTOL 3CRKC 1XNQQ 4GKJL 1RI9A 1H9MA 1QE6A 3B27A 4WFN3 5IH2A 1SJED 4FDBA 1FWZA 1KRSA 5C93A 2QQBA 1AEYA 2M00A 1N33Q 2JUFA 3I8ZA 2E3HA 1NG2A 3VJPA 1O9SA 1UYLA 4DNTB 1O7IA 1QVGA 1WTPA 3C0EA 4RMOA 1PHTA 5CR2A 1IKLA 1GHKA 1OXXK 2CCSA 5K36G 5IDJA 2HL3A 3NWSA 1YSRA 2BIVA 3CBOA 4OONA 2E2DC 3C1EA 4A3IG 5J26A 4IOCA 1QWYA 4M75C 3KYHC 3LLRA 3M4QA 1GUGA 4FL6A 4C92A 4ZUJA 3BYTB 4CWPA 1KXLA 1OZ2A 3RUXA 3SWNC 2ZTEA 3CEYA 4BY6B 3H0GG 5E3FA 3VYSA 2HNIA 1FNWA 4CDFC 2MO1A 2ASBA 1UYHA 1KDBA 2BREA 3OW7A 4OO1H 4RKBA 4LUEA 3CYGA 1Y8OA 1PRLC 3TZ0A 3H3VI 2CWAA 4DEYA 5FRNA 4BI4A 4F87A 1BCOA 4JLGA 3PGZA 1MKHA 3I91A 4BE2A 2VC8A 3VS4A 5CAIA 3CBPA 2EPBA 4A3MG 4FF2A 5FNFA 4FMTA 4QUFA 1T9HA 5M5XH 3EFOA 5EKKA 1NE3A 5KNBA 1UYGA 1R0CB 2WEPA 1W70A 2EYJA 2A37A 2DY7A 4E6IA 3M7NA 4KSGA 1K8MA 5C44H 4MPNA 1G83A 1Z5AA 1VQOQ 3GIEA 2P0PA 4JI1Q 1X2QA 1WTWA 1SE3A 1UYCA 2VV5A 2R7ZB 5IYBH 1EEID 4UHVA 2MI6A 1STGA 3A98A 1TQOA 3QZ5B 1V29B 1Q7YC 1UYDA 3I55T 4DR3Q 4LFBQ 2FTKA 4DXFA 4E7SA 3ZBDA 1UNSA 1U06A 4PJOF 5G3LF 5KYXA 2XCMA 1XJVA 3RUZA 1NBEB 3SDZA 4XCJA 1MV3A 4JI0L 3OS1A 1XNRL 2VCJA 1D6EC 1F2ZA 2YEDA 2RI2A 1LM0A 1VQGA 3DEPA 3NPFA 1BXTA 3QOLA 1YETA 1DZ1A 1RAFB 3EHJA 1C7YA 2AZSA 3PE0A 4PJOG 1KFZA 2A8VA 1HZBA 1I4PA 4DBRA 3FKIB 3S3OA 5IHIA 2RKSA 1EWIA 4IPGA 3TQYA 3LMMA 4FCPA 1VQOA 2NYZD 1ESFA 5FJ8H 1ZSGA 3CCLT 1E2WA 3PUYA 3ZFJA 4P73A 3F2UA 5J3BA 4A3EG 3J81j 1I5BA 3T2SA 1OX9A 3H0FA 2JQOA 2IPKD 1C6VX 1NY4A 4FXDA 2DL3A 1O7ZA 1ZA1B 2KROA 2F5KA 2WI6A 2TSSA 2KE9A 5M3MG 2DK3A 2UXBL 2YK2A 1EY8A 2CWPA 2LQNA 2GFAA 2CZ0B 4NL3A 2EJFC 4R1FA 3CHBD 2Q8HA 2HHHL 2UU9L 5FLMG 4PKCC 2XD6A 2EJ9A 4JI8L 2FWYA 1X3EA 1RI0A 3KLSA 3WOFA 4J9DA 3TSWA 2OEOA 4R4OA 1T0HA 2J06A 1WTRA 1SSOA 3U9SA 1HYOA 1C9OA 5L8RE 3R4MA 2EY1A 3KJPA 3LGLA 1XMQQ 2XHXA 3CC7T 3L9AX 1TXQA 1R62A 2IHEA 4CWFA 1CHPD 2WFWA 2WI1A 1X3GA 4JI2L 2QA4Q 2UUBL 4KHZA 3GV3A 2YSQA 2F0KA 1YCYA 4C0DB 4DGZA 1N5ZA 1G6ZA 4L5QA 3G7EA 1YJNT 1YNZA 5CR3A 5IT9E 3D8GA 2KR3A 3BDUA 2VGNA 2RO0A 3JB9I 3QO2A 3WHAA 2YEHA 4DR5Q 1BI1A 3EG2A 1RCVD 2CZ1B 3ULRB 2EZVA 1HRJA 4QPJA 2Z0SA 3BDOA 2JA5B 3S24A 5FO8B 2E12A 2JVVA 1TC6A 1N9RA 2YE3A 3ULJA 2DIQA 3KK7A 4KTNA 1YHBA 1G8XA 3OYNA 1A6XA 1VYVA 3EBEA 2A74C 4LDYA 4OL7A 1SYEA 5COYA 1HA5A 1Y8PB 1Q82R 5C5LA 4JAVA 5GAOp 4RGMA 1JJGA 4HYMA 1NAPA 1VOMA 3EH2A 3LPSA 2DO3A 1GJVA 2QA4A 3A0RA 2LRQA 4X3UA 4CKBA 2G6FX 4X66Q 4FF1A 4JJDA 1VQPT 4B3SQ 1HNXL 2JXMB 4P71A 3EJIA 3FB9A 5JPNC 5C0XI 4IOAA 4WUCA 1PKSA 2E5LQ 4BB7A 1SHFA 1Q81U 1KQSA 2PNHA 1TBWA 2EYZA 2F0OA 3SK5A 3GNGA 3VUZA 4URMA 1E7OA 3NP8A 1EEFD 4J6HA 2AT1B 1S16A 2V8JA 2DUDA 3VS1A 1VIEA 2XHRA 2KJXA 2HUGA 2VQEL 4O0AA 2XRSD 1IL2A 1P8LA 2N55A 1HZCA 5DNFA 3TRZA 1B62A 2F0QA 2AZVA 1WCMH 4A4GA 5EC7A 4KLKA 1PC0A 1LTLA 1YHAA 2Y0SE 1IYUA 3KLRA 3EGXA 3JCMg 3GIGB 3CCMQ 5C4JB 3K80C 2DTHA 1U3OA 1H7SA 4DEXA 3HP3A 5EG2A 2V8KA 1KQ2A 5BR8Q 4CKCA 3JCMW 1H9SB 4OWTB 3VDYA 3GTKH 1JORA 4C3JB 2FEIA 4A4KA 3CCST 4KY5A 4L5SA 2NBFA 2LDMA 3K7AH 1WXBA 3DM3A 4LFAL 1EY5A 3J7ZC 2B8FA 1U1SA 3NQTA 1IBKQ 4DAYA 1K8OA 4OMFB 1UE6A 4X3SA 4P72A 3HZXA 3CGYA 1VYUA 4J6WA 4MZTA 4QQ6A 2A08A 3UDCA 4JRQA 1M4VA 1M2VA 4M75D 4C0FA 4E7KA 1HJPA 2GA4B 2KEEA 3OTOQ 3S16B 5LJ5d 4GKJQ 4DK0A 3ZM7A 2K03A 3TS2A 1PWTA 4L6TB 2FINB 2CH4A 4OMQA 4C1NK 2OT2A 3RMQA 3I4LA 4CDEC 1KD1U 2B2TC 2JE6I 3A8MB 3FHWA 3MC0B 3T1YQ 3S1MH 2X69A 3VYUA 2YEEA 5CGKA 4ZUIA 3I4MH 4OB0B 1O7LA 3K0YA 1PH8A 4X65L 4DF7A 3CCMA 3I5SA 4FIBA 2KSSA 5GJVB 2EVBA 1ZHIA 2CT3A 3L3OC 4L5RC 2UXCL 2IHFA 3QBYA 2D9TA 4JI7L 1SE4A 1B34A 1Z9QA 2K05A 1GCPA 5KE2A 4IPDA 4MZ9A 3OMUA 2B2VC 2WINB 2LNVA 4BBRG 5IYCG 2CSIA 4X34A 4ZN1A 3NXWA 2F2VA 1L1OA 2NZ1D 1H9RA 4QF4A 2FL7A 2FPEA 3HOXH 2A6EC 2WV6D 1Y69U 1NHJA 3TEHB 1ILPA 4BY7B 3K99A 2KHIA 1IHWA 3I4NB 1GJXA 3TN2A 2DE0X 4RFBA 2I5MX 4PJLA 4PJOC 2ABLA 2HDLA 4QPKA 4O2DA 1HR0W 1I5OB 5KE3A 2XSCA 3U58A 3FJ5A 3H4LA 4BS9A 2BH8A 1WHGA 2K2VA 1NCVA 3V2TA 3IAYA 3MKDA 1B9MA 4XDMA 1VQ7Q 3HOVG 3L2ZA 3CCVQ 4KJNA 2JA7B 3JCMJ 2P0QA 1MJCA 4DR6L 5ELEA 2ZZDA 4J5YA 1RTOA 5M3FG 3Q5KA 2JN4A 4DK1A 1WQWA 2Q8IB 4JBWA 1ENAA 1AWWA 1IL8A 1BR9A 3VYHB 4PV1C 4LPBA 4HT8A 1GCQC 2HAXA 1A3TA 1QJOA 4JI0Q 3JCMf 2B63B 2WI7A 1EQVA 4MPEA 8AT1B 3SFMA 2RJDA 1II3A 4ELZC 4C3JG 2PTKA 3H0IA 1H3ZA 3BZDB 4KTAA 1GRIA 3L2VA 5D14A 1NBWA 1ET9A 4FYYB 3PUVA 4IALA 1FVIA 4K5VA 5J22A 3J80c 3EGDB 4G7HC 1VQBA 4IQZA 3M59A 1N36L 2MF2A 4BY6C 3BDCA 2M16A 2JP1A 3BJUA 3I3CA 3ND9A 3NMQA 4BACA 2KECA 4KSHA 2K50A 1PTOB 4XQQA 4C8QA 2R92B 1OX8A 3RDVA 3OSOA 1HD3A 2DXUA 3QWYA 3CCVA 1VQ7A 4O1NA 5FO9B 4JLIA 3KUFA 3RKXA 2Z1CA 1VQNT 1XMOL 2P0KA 3GTGH 1EQTA 2RJFA 3UF4A 1HXYD 2HCIA 4PJJA 1I59A 4QVZA 4IUTA 2CP7A 4Q20A 1SG5A 1W1FA 1YNJC 2QXFA 4IURA 1E2ZA 3PO3H 3KLWA 1TH8A 3E0EA 4GLKA 4KT0E 3LH0A 4OMMA 2PQAB 1KLUD 1LTSD 2XDKA 1RF2D 2UXBQ 3SHWA 2FMMA 2D0OA 1K8AR 2PW5A 4HXWA 3T1HL 2LSSA 5C6SA 3G48A 2HHHQ 1UWVA 1OYXA 4JI8Q 1L2FA 4A75A 1TIID 1ABQA 1PA6A 1X69A 3CC4T 2LVMA 2F4IA 2LXKA 2C0OA 4DR7L 2YE9A 5FNCA 4M7AE 2ZJQA 1G3YA 1PH5A 3MVVA 2Q8TA 1TIDA 5JPMC 4BY7G 1AJ6A 4R0KA 1F9PA 5GAN3 1VQ8T 3EROA 3I4NG 3K97A 4IO9A 3CCRT 4JI2Q 2ZM6L 1B3AA 3A56A 3DUZA 4LUDA 5E4XA 2UUBQ 2LS01 5J71A 2JW4A 3M57A 3PMTA 4QB4A 4DPGA 2BSMA 5I22A 4ZGDB 1S5ED 2PNRA 5DM7R 1DJRD 5I2YA 1OZ3A 5C0XG 3OBWA 1W6XA 3TMEA 4XIPA 1GFDA 2JA7G 1YN8A 1ZQ1A 2DLPA 4HCZA 4J6XA 2AKPA 1MV0B 2YEJA 1T0JA 1Q82C 2Z6KA 4N0AA 2KT8A 1PH7A 2ZPIB 5K36H 2DFUA 4L8ZA 2WSCE 5CBAE 4DV4Q 4KHPL 1CKNA 3X26B 2MIOA 3JAME 2CW0C 3INZA 2LNHB 4HEDA 3S2HH 2WI4A 2XVSA 4ZGJB 4OIKA 1QVFS 2NVYH 4X64L 5C44B 3KBGA 2OTLT 2B63G 3OYGA 4H44C 1PNJA 3VV0A 3WOEA 1W4SA 4L93A 2YTXA 1ZXMA 2K79A 2RQVA 1SEBD 3P8DA 3R2IA 5KYWA 3VHAA 2OAUA 2LX9A 3CRKA 3CP0A 3U4VA 1ZA2B 4ULLA 1HNXQ 4JAUA 4FF4A 2LJ3A 4HAEA 3CWVA 3S1QH 4X62Q 3MP6A 1LTAD 4V2SA 2C9OA 4HY6A 3JZ3A 2YE6A 4NOYA 1WOCA 1VQ5Q 5GMKm 3QYHB 5CKDA 1NUCA 1XNIA 2CQOA 2V4DA 4KGXB 1BUVT 2J7IA 5EKIA 1BYMA 2RHXA 1SE8A 2QDBA 2WP8J 3I7FA 1CT1D 3L7ZC 2VQEQ 2VXFA 1I6HH 2VWCA 1BIBA 3ONAB 4OMOA 4C0DC 1K73U 1Y1VH 1IBLL 4WCIA 1WIEA 4M75A 4AFQC 5KYUB 3I90A 1ZEQX 2PYKA 1AFPA 3WVEB 1JB3A 1FX7A 5GANd 5EPKA 3HFNA 1Z5BA 1VQ9T 1QCFA 2M0OA 1X01A 1VQAA 2E8GA 5IIFA 1QWFA 2C35B 1SF9A 4MPCA 3OYYA 1FGUA 2QDLA 2CZ7B 4OP0A 3FLGA 4CC3A 3NUCA 3HOYH 3FRPB 4A3BH 5T1IA 2WKDA 3KUPA 4LFAQ 3FPUB 2BA1A 4MBCA 2XX4A 2NUTA 4D8DA 1V1PA 4HSVA 4LUOA 4J8OA 1EWHA 5GANh 1KRTA 3U50C 1YIJT 1UFFA 3KLSX 5ELOA 2X4XA 1FMWA 2AK5A 4XE2A 1CSQA 3NBIA 3KDFB 2YGFA 1YITQ 3A0JA 2AUJD 3K6OA 4XIQA 1EY6A 2GFDA 2WIIB 4XTCS 1TU0B 1CTMA 2QF6A 3NTHA 2GFUA 4TQUS 1M3BA 2YRVA 1Y96B 3L1AA 2ZDXA 5EBCA 2EYLA 3OHXC 4FP5D 2F0FA 2A6ED 3VS3A 3NBHB 2EKHA 3VRZA 2GF7A 3IKJA 4ORZA 1VMPA 1Y07A 4AFZC 2A69C 1Q8IA 2A6HC 4X65Q 1KIJA 5FNDA 2AMCB 4OO1G 2KRSA 2B2UC 4HZ0A 2E64A 2UXCQ 3SD4A 1JRIA 4E01A 3BW1A 4PJOD 2QYZA 3TQ7P 1VQHA 4OXPA 4DUZL 4WRDA 4FCYA 4JI7Q 3JCMe 2NLUA 1JOOA 2C5CA 2BT0A 4O07A 1QVFA 4YHHL 2WAQE 1VQ6T 4IPHA 1YZ6A 1J9OA 1SMYC 2YXYA 2KHSA 4C1NI 1DJ7B 4YKUA 4C3IH 1RAIB 1STYA 1E0BA 1E1TA 2EJMA 2GBQA 5CPHA 5A0GA 1YITA 1XNQL 3L2PA 1Q86R 4F8MA 4OF1A 4DK3C 1X43A 3CBMA 2K5WA 5IYBG 4MMKA 1YI2Q 2ALYB 2DJFC 1IKMA 3NELA 1U5KA 3U2DA 2YV5A 1YHQT 1DONA 2E75C 1Z9ZA 3AFPA 1YC4A 4M7DE 1SMXA 2KRNA 4C8QE 5LL6X 1ASZA 5HKCA 3OYAA 1KIKA 5GJWB 2XWJB 3CKIB 1IBML 1W2BP 3RZOH 4DR6Q 3K59A 1Y57A 4MZMA 1NE8A 4HJAA 1PYSB 5FO7B 4JI4L 4WJ3M 4LWFA 3G4SQ 4RHSA 3BM9A 2D0NA 2J0TD 1QNUA 5CKEA 5KYYA 3S2DH 4LP0A 5C3EH 1UG1A 4A63B 2D62A 1NM7A 1UY9A 4RTUA 3ZKDA 1V9PA 2ZAEA 2YTVA 2Q8FA 2DA9A 4FNFA 3AMUA 4JPBW 4WUDA 3LX7A 2NUZA 1YNJD 4TKOB 2FYKA 1EQRA 1UGSB 1YI2A 1BGQA 1IW7C 2PI2A 2YI6A 1PYBA 2SEMA 3RESA 3OYBA 1WCMB 2B2YC 5JEAH 1S72Q 1JEGA 1N36Q 4KULA 4CJ0B 2KOLA 5GAOq 4DV7L 1VQMA 3V7SA 5D6PA 2LMJA 2B39A 3I5RA 2KUMA 3HKZB 5KIXA 5KCOA 1YERA 1ABOA 4RKUE 3EFSA 1K83H 3GTKB 2COZA 2RMOA 2IX0A 4RCBA 3NPPA 1VA7A 2BU8A 4CWNA 1I94Q 1H8KA 3K7AB 1K8AC 2RJEA 2DNUA 3G4SA 1K0XA 4CI0C 4R4IA 1H641 5FU6B 2E41A 4DNRB 3E1SA 4E47A 2QQ9A 3MWYW 3MO8A 3VS5A 4EVOA 1HUNA 1MHWC 4URNA 2EYFA 3L0OA 4MIUA 5DEHA 1M90R 4JBMA 4LNQA 1D2BA 1GXIE 3S1RH 5C3XA 4HJ8A 3M4OH 2DJGC 1TU2B 3ER0A 3AHUA 2QTVA 4MOTA 1E6HA 3L2WA 2W10A 1WTHA 1S72A 2L11A 3S1MB 3QJYA 3PGGA 1Y8NB 3I4MB 4GCZA 3GTQH 1W6KA 1M3AA 1M1KU 2R58A 4ZTFA 3OW2S 2YUPA 3I56A 1MMGA 4C3HG 3JV3A 3A5ZB 4UC4A 2YI7A 3VADA 1HZAA 3OOCA 5JOBA 2EGEA 2IPOB 3AYHB 1SYBA 3G7ZA 2ZM6Q 1B2TA 4O6JA 1PH9A 2CW0D 2XRQD 3RLOA 1T5XD 1CKOA 3LGFA 2WB1B 4K8JA 3U9OA 4DAPA 1UDLA 3GV6A 3QSUA 3H9NA 3H15A 3VR5A 1H3HA 1A0NB 1PTOC 2DKGA 2QG9B 1U9RA 3CCUT 2XNAC 3E5SA 5C4XH 5KCHA 4XU2A 2L5TA 3HOXB 2CUBA 1SNCA 1A4HA 1QUQB 3DXJC 3EHHA 4FF3A 3FRNA 3L2RA 3RLPA 1RJTA 3EVQA 1QILA 4R56A 4JOIA 2QCPX 1GKXA 2AWOA 5IXFA 3L2UA 4JI3L 1G2TA 4KHPQ 1OQKA 2VKNA 4PZ8A 2IW3A 3TVTA 1CSPA 2O88A 2QGGA 5L37A 4X64Q 5M4MA 2LC4A 4F7UA 1JWUD 1SBBB 3KF6A 5JENA 3C95A 3CC2Q 2ZPBB 4HIKA 3CGZA 1N34L 1ET6A 3MEUA 1TC0A 3K5LA 2I0QA 2YE5A 4CE1A 1LV9A 4WORA 3OYLA 2O2LD 1MSHA 3EIVA 1WTOA 2BTZA 2EY6A 3OWBA 2XKOC 3KFVA 2D6FA 2QFOA 2Q2IA 4PRVA 4K2LA 4DUYL 2EQIA 3HKZG 4WJ4A 1US7A 2YKCA 1MX0A 2JEAI 2K5FA 4B9XA 3U2KA 1I4XA 2XJJA 1SNDA 1BF4A 4LWGA 2CGHA 2KI7A 1IRXA 4HA8A 4HVUA 4L8JA 5FLXE 2E10A 2CDTA 3NTKA 5GMKi 2DMOA 4GNXB 1QZHA 4LF6Q 2ENMA 1D5MC 2RDFA 2ID0A 3OA6A 3M55A 3BZKA 4NXNL 3SEBA 2LQ8A 1KLGD 4Y28E 3DLLA 3BYYB 2RJCA 2L89A 3QR8A 3A0WA 1YFNA 4JJNK 1IXRA 1PMRA 3HRZC 1Z59A 2LJ0A 2VB3X 3CD6T 1S14A 2WERA 2HIVA 2VYTA 5I2XA 3T10A 1JMCA 5D6XA 2BZYA 1E24A 1I50H 3M56A 3N5BB 5CV5A 5BN5A 1U2OA 2A6HD 2KBNA 4PLLA 5I21A 3PO3B 3I4MG 5GAGC 3MXGA 4H02A 2YI0A 1G2SA 4DKAC 2J6KA 1K9MR 1I5LA 2F3IA 3OYFA 4C2MH 3TZ4A 1ENCA 2QGQA 2VNUD 1UJ0A 2WSFE 5CV7A 2HBPA 2H55A 1A2UA 2TMPA 1A62A 3NEMA 2LZ6B 5AJ3Q 3LW5E 1SMYD 4ZN3A 4WJWA 2M9UA 4RG1A 4IZ8A 1C8CA 4YKQA 3BG3A 3PVQA 3Q1JA 2DNCA 1YBYA 2MK5A 1GCQA 3C3LA 3HOXG 1NEGA 3EGUA 1BBXC 5BR8L 4XC0A 2ZXPA 3FV5A 1GVPA 4H81A 2O2OA 3A7AB 3C94A 2JJQA 2K28A 4YIJA 3OIQA 5HK3A 3VYRA 2F1MA 4DUZQ 4E7JA 2IWXA 1EZZB 2C0IA 4MZPA 2RQTA 5C0MA 1BBWA 2PMZE 3V7RA 1WA7A 4LNPA 4CWQA 5ELNA 2ROTA 3MEVA 1Q86C 4M7AD 2QILA 4CDCC 3EKOA 2JA9A 3CXCP 1VQ4T 4R4TA 4FCRA 2XTIA 3T53B 1G3TA 4EMKA 1GUOA 1JXMA 2HCKA 1YCSB 1YESA 5BODA 1TR5A 4G57A 5LMNW 5GMKh 5LHY1 1TS9A 4OMLA 1LYLA 2LTOA 1EYDA 2WB1E 5IP9G 1PH3A 5DLQE 4R8NA 5AT1B 4XQ3A 3FPPA 4PQXA 3T1YL 2RSOA 2JS0A 1QP2A 1Y1WH 4XK8E 2RA2A 4XXEA 1DCZA 5I2SA 3BVGA 4AIMA 4IUQA 4X9DA 4OHJA 2PUKB 4EQ5A 3S2HB 2DM1A 1KNEA 2F0MA 3GO5A 2NVYB 1F1BB 2DEQA 4N8X1 3VR2A 1IYVA 1STHA 4YCWA 3PTAA 4ME7A 4NP5A 1GUWA 4EFTA 3ERQA 3VR4A 5CORA 1IBMQ 1IW7D 2LCSA 1D7QA 4CBVA 1EI1A 2QGFB 2Q2HA 1OEBA 4RUGA 5D3DA 2K3YA 5BN4A 1MJEA 4JI4Q 5JJZA 4LF4L 3HOUH 1K76A 3CCQQ 2EYPA 5IYDG 2F0UA 3JCMd 2MMPA 4DV3L 3FJPA 3S1QB 1QKWA 4U673 1D0YA 1JWSD 3I2ZA 1B8AA 4AWOA 4GOPB 2RQRA 1M8VA 2DIGA 2F03A 2VUMG 4MMLA 2UUAL 3HOWH 1EOVA 4LF5Q 2OTJT 4FYDA 5CTXA 3NFCA 4JI5Q 2LMCB 2D2CC 2K7VA 4Q0FA 1I6HB 3VA7A 1RAGB 2O9VA 2YGAA 1Y1VB 1PD1A 2ICIA 4M78B 2JSOA 1JU5C 2HDMA 2YE2A 5F5RA 3FDTA 5AYFA 2XN9C 5D65A 4IUPA 3VS0A 1IHVA 2K57A 3EA6A 1OXVA 3E3XA 3D6CA 4I7ZC 4DV7Q 5KH6A 2ZKJA 4XTJA 3F2DA 4HYPA 3H80A 2BCOA 2HD0A 2RHUA 3DWAA 1ZSZA 1M2OA 3EHFA 2JMCA 2F0DA 3A8KE 4M77E 1YJNQ 3HOYB 4A3BB 4Q5WA 2O5IC 2IORA 3ERSX 1D3BB 3CCQA 1M9SA 4YWMA 5CBEE 1M90C 3VA5A 1TOVA 4KUDK 2Q2TA 1MI2A 2YWWA 1PH1A 2JOYA 5I9OA 3R6NA 4L6V5 1K28A 3K5MA 1JE4A 1WQ7A 2Y0SB 4A53A 1STEA 1D5XC 2E5KA 1PZJD 3C2PA 1A63A 1UB4A 3ZXOA 1PZKD 1JXOA 2RA4A 4AYBE 2FFKB 1XPUA 4KK7A 1C0AA 3LX0A 3QDRB 1PTOD 2NWMA 2JYOA 2IOPA 2X9HA 1RTNA 4A3JH 3RKZA 2RHYA 2CQAA 3VRYA 2N78A 4J83A 3SR1A 2G3RA 2QASA 1NJIR 1PFSA 4KD4A 5IOCA 2FRYA 4LDUA 4F7UE 1Q3LA 1SNPA 3RIRA 4DOVA 4XTZA 1KQSS 4ZAIA 5CMDA 2RHQB 3GOXA 1TXYA 3T1KA 1YJNA 4W7TA 1EWCA 4QVCA 4ZTJA 1SN8A 2NUPA 1Y8OB 2F0VA 5M9OA 1KG1A 3HS0C 3K0XA 4CDDC 1WX6A 1YJWT 3N6RA 1FYNA 2R7FA 1JO8A 4K14A 3QO3A 4JS5A 1X54A 1V76A 2VASA 1WXTA 4C3IB 5LJ3j 3F2CA 4FVMA 4MNOA 2XDDA 1UY8A 3STBC 5IN1A 3PUZA 4G7ZC 3J7A5 1KC8U 4HIMA 7AT1B 3ITPA 2H3EB 3QYGB 1FL0A 4JI3Q 1YSZA 5FU6C 2E0AA 4RTXA 3M53A 2MGSA 2JJ9A 2DAQA 1EY0A 2B2WC 3J80i 3KFUA 4CC4B 2V26A 3CCSQ 1Y8PA 2KYMA 3QPHA 5GAMj 4EMVA 4K4OA 3RZOB 2ZXOA 3HGBA 4OEMB 4LW1A 3PIOA 2B29A 4RGOS 2L3QA 4EGVA 1U4MA 1PHJA 1N34Q 2QG2A 3H0HA 1VF5C 2EJGC 4M1UB 4A4EA 9ATCB 2BDNA 4LD9K 4Y91A 5L23A 4R4QA 4LDVA 3JCMX 4ZQ3A 5EBDA 1AEXA 3TBIB 3S2DB 2XX5A 1DD2A 3RBBB 5C3EB 4M7DD 2PW7A 4YKZA 4MDXA 1KJWA 4S3SA 4DUYQ 5IGEA 1G91A 1UEAB 3RNUA 1RLPC 3J80E 2PZWA 1AMWA 4XKKA 2K5IA 2B2UA 2FJ2A 2R7ZG 4L90A 3HOYG 3I4OA 4A3BG 1TVXA 1QW1A 2HD3A 2FXSA 3DB3A 4DV4L 5D6WA 3FVQA 1VQCA 4HXJA 2CP2A 3JCMc 3M7GA 4A3DH 4XD8A 4NXNQ 2YU9H 3GIGA 1VQOT 1GO3E 2Y0SG 4XQNA 1HXDA 3KJOA 3OPDA 2HMAA 4AQYQ 3QZ9B 2PPBC 4LFCQ 1IB8A 1K83B 2VXWA 3N52A 1K9MC 4UROA 4M78E 4NDXA 1PH4A 5LMUL 3J81L 2RF0A 4J9EA 1UE9A 4NH7A 3QG1A 1HFGA 3GD7A 4X62L 2XDSA 2DTIA 1IXMA 3FKIG 4GN4B 5EQ0A 2MHVA 4A3CH 3SL2A 2FHTA 1EYCA 5IGDA 3T4AC 5ISRA 1LVKA 2EYWA 3JCMV 3CW2C 3PUWA 4ME3A 1H9KA 1PLFA 4CC7A 2M51A 1ZKOA 2QKIC 1B50A 4BQJA 1NR4A 1W3SA 4CJ2C 1U4LA 1AH9A 1B44D 2MAMA 1OV3A 1ZX6A 1DOMA 3S1RB 3M4OB 3M3YH 1V1CA 3OB9A 1B63A 1R9TB 1QVGP 2CG9A 4PFPA 4J9HA 3Q5JA 1J5EL 2E2JH 4FYXB 1JB0E 4E7LA 4EM7A 3GTQB 5EGTA 3TDQA 4C3IG 5GGZA 4TVAB 3SB2A 3TSZA 1I4QA 3TP6A 2QEXQ 1OXUA 4Z8AA 2EVRA 1AWXA 3NHHA 1L0OA 2JA6H 1M4ZA 2D8JA 4PU9A 2KAFA 4ATOA 5CVIA 1L0XB 2X3WD 1RHPA 2G9HD 4A3GH 4IFDH 4GNXC 4C92E 4A3LH 2B2YA 3L2QA 4XKOA 1GFCA 3MA2B 1JJCB 1WD1A 5C4XB 1EUJA 3TTZA 3A8JE 1PFMA 4KKUA 2K4YA 4M7AB 2DBKA 2KXDA 3AB9A 1G3WA 1X65A 4NKLA 4L63B 2GNCA 4CRIA 1KK7A 1VMCA 5CQYA 2IG0A 4BDZA 4JUVA 2HQLA 3HSBA 3EHGA 1N8RU 2L2PA 4JBJA 3HHTB 4AWQA 3HEJA 1AVZC 3T56B 4AWPA 2G5DA 4J6YA 1IGQA 3OYCA 3BE3A 3D6WA 3W5OA 2XHTA 1QWEA 2PVGB 1F51A 1VQNQ 2L12A 1X6GA 4AFSC 3ZEHA 1PZID 1TWGH 2LXJA 1Y4SA 2WACA 2XX2A 3GIFA 4QW2A 1VS0A 2CP6A 2QEXA 1U0ZA 4KUIA 5LJ5h 2JA5G 1BI2A 1ILQA 4KN7C 3DWPA 1ENFA 2L0AA 1E22A 5IGGA 4IUUA 1PV4A 2JS2A 1HPCA 4LF4Q 1I8FA 4HKEA 2L4NA 1PSFA 4ID6A 2Q8IA 1HQRD 4DV3Q 4J8QA 1LUZA 5KNDA 1DOLA 4HTHA 4HCBA 3S17H 2I2LA 4B6MA 2MPMA 2UUAQ 2KHJA 2EE1A 2N3SA 3CC4Q 3OBYA 2K14A 1IREB 4YKWA 2DBMA 3P8HA 1CKMA 4GLVB 3F2BA 4AT1B 2EQUA 3GTJH 3VR3A 1B1ZA 2YYZA 2V1CC 2ED1A 4O5VA 1MGSA 2YEAA 2HBWA 1VQ8Q 2OJ2A 1VQNA 2XWBB 4KD3A 1PG5B 4OO1I 2YE7A 1DM0B 1EY9A 4LDXA 3PIO3 4JW0A 3D4DA 4DAYB 2ZBKB 4HJ7A 2ROLA 2OQKA 1X3PA 3PCOB 1FMVA 2JTMA 4N4GA 3INWA 2E65A 1OTCA 1LO5D 3H6ZA 1JOKA 3BVMA 1M2VB 4O05A 1S4ZA 1I50B 4XITA 5D6YA 3GTPH 2N49A 2GQPA 1RAAB 4ODGA 1KIXA 2I5LX 1EFWA 3C0CA 4GY5A 1OXTA 4J9FA 5I11A 2L0CA 4ZK9B 1E7ZA 3HRTA 1JQQA 3MJXA 1B7TA 1Z47A 2F0JA 2JK8A 4C2MB 3Q0AA 1T3SA 4M7AF 5HURA 2C2AA 2XK2A 3A0ZA 2GVAA 3CC4A 1D0XA 4P75A 1CZGA 4FO2A 5KYLA 4URLA 1NJIC 4G7OC 2L15A 1NLOC 5CO7A 3HFZB 3T0ZA 5DAUA 1OU9A 4B3ML 4UP8A 2OTLQ 3X25B 2EKOA 2RNAA 3VHDA 3R6OA 1B34B 4LXCA 3THKA 5GAOm 1VQ8A 1Q7YU 4U7OA 3STBD 4GOPC 4M7AG 2EQSA 4QQDA 4EX5A 1YNXA 4DR4L 4GEEA 1QQJA 1L1OB 3EKRA 4GGLA 1Z5CA 4EMGA 2NZOA 2CYZB 1I94L 3PF4A 1R77A 3D2RA 2YDLA 4M78C 1UECA 4OWWB 3RLRA 3D0BA 3B6YA 5IHNA 1HR0L 2RQXA 1AT1B 3FC3A 1BOSA 5EPLA 4DA4A 4HCEA 3PIPA 1SKUB 5IDMA 3TZ5A 2Z6BA 4PZ7A 3PVLA 4TSSA 3PO2H 2E6ZA 3OQ5A 5J1ZA 3RMSA 2BE5C 4DNIA 1WPYA 1H95A 2KY9A 1Y1WB 1VQ9Q 1OXSC 5GAN5 4H0LC 2OTLA 1M8MA 3V05A 3LYIA 2JXBA 3M54A 1M30A 1RAHB 1X2KA 4LD6A 4K5XA 4P2CB 3MXNA 4P7AA 1W2BA 1X55A 1K0SA 1MD2D 2NN6H 2WAQB 2JA8H 3OW6A 2K01A 2ATWA 4FPPA 4QVDA 2K7AA 2JMAA 1UY7A 3I73A 3SHLA 1THNA 2CCTA 4O42A 4KHVA 1MBYA 3CPFA 4BE0A 3JRZA 4Z88A 3HOUB 1TWHH 5I2MA 2DD4A 2DYBA 2YLCA 1YIJQ 2XD0A 1KAWA 4NW2A 1CKAA 2O01E 1G6PA 4KFGA 2KK4A 1GL5A 1TY2A 4PMWA 2Z9HA 3TP8A 3LWIA 3CPWS 1LNXA 2D5DA 1QMCA 3HOWB 1M1GA 4M7DB 4C8QB 2PVOB 1MGQA 4KI0A 1ID0A 1WLPB 4XTUA 1S5CD 4YCVA 4C56C 1Z9FA 2IOQA 5E1FA 1VQ9A 1PRTB 1HNWL 5A0DA 1CUKA 3S14H 5KYUA 3R4OA 3ZJYC 5FKAC 5GAN6 1VQ7T 3CCVT 2RBMA 3DWQA 3K5OA 2BA0A 3PQIA 1BNZA 1FR3A 1VDZA 5GAN2 4QIWB 2ZPFB 1PTOF 4A3FH 4OB1B 2EOTA 5IGBA 5LJ3e 4VUBA 2NB0A 4JJBA 1SFOH 3AEVA 1SR3A 3T51B 1EIHA 3PFSA 1TILA 1VQ6Q 4HSPA 2GQVA 3REAB 5LMUQ 2LCCA 1LTBD 4U93A 1YIJA 2AUKA 4XTYA 3RKYA 3GBQA 2BKDN 4R3AA 1UEBA 1I4RA 4RGNA 2YUNA 2R92G 1SYDA 5C5MA 4A3EH 5IHKA 3TP5A 3CMET 4I65A 2EWNA 3MHXA 1ESRA 2FPFA 2FHDA 3GNFB 1CKBA 1TS3A 5GAMe 3KDFA 2EW3A 5FOBB 5LJ5j 1CI3M 5M3MH 3M0UA 1YHQQ 2D0QB 2BU5A 2YKBA 2LFNA 2C1IA 2L8DA 4E72A 2F0GA 1SSHA 1Y96A 4LK1C 4PK4A 4A3JB 3MEFA 4LF6L 1J5EQ 4MHEA 5FLMH 2FB7A 3SWNA 4H13C 4EQOA 1AWOA 2OWOA 4JI6L 5F2DA 5IT9L 2OQ0A 3DLMA 2IIMA 1LLRD 4HJ5A 1NLPC 1VQ6A 2ZCFB 3TZ2A 3K57A 2L3PA 4O0BA 1BBUA 1VQLT 2GTOA 4DBQA 5A2QE 1BVSA 1CQFA 4HZ5A 3F1ZA 3OYKA 3RLQA 1F2LA 3OWFA 1GKHA 2WAQG 2HKJA 2XDPA 1VQ5A 2R57A 4FU6A 3D3RA 1CKNB 2RI5A 1TT2A 2AQ3B 4GQTA 5J39A 4RHRA 4ZKIA 1JJ2S 3D31A 1MUZA 2RSNA 3TEEA 1B3QA 2ZT9C 3JSCA 4M7DF 2H5XA 1YHQA 5AJ3L 4C8QF 4JC0A 3A0XA 4KRTA 3BZCA 3CPWA 4XU1A 1Q81R 4CHTB 4C0GA 1MHNA 4GBQA 1PRTF 2F0HA 1H7UA 1I58A 1BI3A 1GM5A 4UP7A 3QDDA 1RABB 2K6DA 2F1LA 2NVXH 3S15H 2YECA 3HOWG 4ZCKA 4M7DG 2RVLA 2GCXA 2JKIA 1V43A 4C8QG 1WHJA 1BXDA 3TZUA 2K5DA 4OMPA 3HPWA 4XIRA 1FGBD 2KYBA 4HIDA 3CU7A 3HG9A 2LY7A 3PIP3 1IO6A 2LCLA 5C44G 1C0MA 2A7YA 3MEAA 3V8JA 4N8FA 2GQIA 1PFNA 1QG7A 5CKBA 3META 4DR1L 2HQXA 1M1FA 3JCMQ 2MYSA 4PFZA 4HN7A 3ICEA 1KZNA 1NYFA 3R4PA 1SYFA 1OU8A 1M5Q1 4QT7A 3MFYA 2NVTH 4UY8C 4MTKA 1EZ8A 3SK8A 2QG0A 1AWJA 3GIBA 4CJ1B 4A3DB 1J8IA 1VQKT 4AMCA 4M7AC 4DU9A 2YU9B 2UXDQ 1EU3A 4HR7B 1WHHA 1CM9A 5GQOA 1V1PB 1X32A 1PCXA 2J6FA 4NS5A 4XU3A 5HCKA 4J9BA 4BE1A 4B3RL 1MNEA 2EJFA 1KD1R 1JQYD 2A1AA 1NYGA 1HFNA 5M4KA 1JB7A 1YC3A 3F8TA 2X4YA 3OIPA 3HZ5A 5E4WC 2NWGA 4QIWE 3V96A 5IWAL 1PVGA 2KENA 2RN8A 2EYOA 4LF7L 3OYJA 4B9WA 2K52A 2XK0A 4RA8A 4LF5L 4MP2A 3E2UA 2ESAA 1WI5A 2YKEA 5FJ8G 4M78D 1EIFA 1D1IA 4QMGA 4JI5L 3QB3A 1CQVA 3M3YB 2LKVA 1SNMA 3T9NA 2EJGA 4F17A 3GDEA 5A35A 1SRUA 4B3MQ 2E2JB 2MP1A 2HZYA 1HQMC 2VGMA 3H3VH 2ED0A 2BZXA 1ZUYA 3VU3C 4AG2C 1JJ2A 1ICFB 2PZTA 1PSEA 4KV6A 4ILWA 5K5PA 4KP4A 4DR4Q 3IQLA 2BE5D 1N9SA 2M02A 5IGFA 3INXA 1AH8A 3ZKBA 4BXIA 4Z02A 1D5ZC 1VQJA 2JA6B 1YEZA 4XIGS 1J3TA 1K0RA 5IGCA 3CXCA 3GPLA 3O6OA 3IEDA 5IAYA 4BUGA 4A3GB 1UUPA 3PV0A 1X3QA 4XT1B 1N6AA 2RCFA 2PU9B 3LGJA 1HR0Q 1YC1A 1ZXNA 2VUBA 1H9JA 5ECAA 4XTWA 1OPLA 2E5QA 1HJDA 1Q12A 2N8NA 3G6JB 3KF8A 2DYIA 1YITT 3LNNA 4FT2A 3MZ5A 4R4CA 3S1NB 4KBMB 4BBRH 5IYCH 2A36A 2KVQG 3RKWA 3TU4K 4P8OA 1NNXA 2WKCA 4BDYA 1I1JA 2ZDYA 3OS0A 3UDGA 2NTTA 1C48A 2F69A 1Q95G 1E1OA 1X3FA 3H91A 2HCHA 2VB6A 1VF7A 3JAMc 4K8IA 3Q24A 2PMZB 3DMUA 3VR6A 2FG0A 2SNMA 1UYIA 2IY5B 5BN3A 1PRMC 2LX7A 3CD6Q 4U68A 1SPKA 2YHTA 5KYYB 1TWGB 2FVUA 2MQHA 3UE1A 1U5SA 1NTGA 1WFWA 1UGVA 1AW7A 1WJSA 5FRMA 5IP7H 4GZYC 1BYQA 5GAHC 2EYMA 3HOVH 4DV0L 4OMNA 5JEAJ 2KMTA 1WJQA 1SSFA 1OI1A 1A0IA 4LAAA 4A3DG 1GOZA 2K6AA 2N88A 1B7YB 5M3FH 1EL0A 1TWCH 3W1BA 2DZCA 5GAN7 3J7YW 2FO0A 3NWTA 4RGTA 2HQEA 3S17B 4Z9CB 1L1OC 2JZ2A 2UWDA 4RTYA 4CWRA 3VS7A 1YI2T 3J81i 1K3RA 2YEGA 1V8QA 4H85A 1YJ9T 1UE7A 1RAEB 2WSEE 3G6ET 1GHJA 2F0PA 1A15A 1EYGA 2BYIA 2IWHA 2JTFA 3GTJB 1HNWQ 4ESRA 2FMCA 3M0SA 4M75E 1XJWB 1VQMT 4PMCA 1TS5A 3UDFA 4A3CG 1ZW9A 2YE4A 2XG8D 3M9QA 1LT6D 4GKKL 5GANj 3CD6A 3G75A 2HL5C 3AU7A 1XOVA 4KN4C 1Z7TA 1RADB 3NE5B 5C3WA 3LNUA 4YKTA 4J9IA 4QQGA 1XXGA 4AFUC 4OGEA 1STBA 5ELFA 3OWDA 3MTSA 1VQ4Q 1WCMG 1Q82U 2KDSA 3CCJT 2B2TA 3GTPB 2K5BA 3MXPA 2B8GA 3GQBA 3W3AA 1KTKA 1HK9A 2D8HA 3GF5A 2Q2EB 4X1VA 3URYA 1SDFA 3UA7A 2MUYA 3HYZA 2RDHA 4QKUA 3SGIA 2ZJRA 2Y4YA 1S3OA 4FW1A 2AIRB 1TTHB 2R7DA 4KY6A 4E02A 1XTCD 2RB6A 2OX7A 3H6MA 5FWBA 5ELDA 1PXUA 1HH2P 3Q22A 1G2BA 3E6ZX 3K8AA 3JB9H 3BMYA 4M77B 3FP9A 3CQTA 4A3GG 2PVDB 2MNAA 2B2VA 1Y4UA 4PFOA 3R2TA 1LPLA 2CH4W 3E9GA 3I56T 3MFGA 4J7IA 2BU6A 2XDUA 2KRMA 2RK2A 4OB3B 5BOCA 2K04A 2HQHA 4B6CA 2O4XA 2PO4A 3KOJA 3MHBA 2GTJA 1QNKA 2EFIA 2F3WA 3CC2A 4KJOA 3AQQA 4M7DC 4LFCL 4AQYL 4JI6Q 2XU8A 4NPSA 4C8QC 3EG9A 1EOTA 4A4IA 1QVFP 3UWNA 2RI3A 4AYBB 3E9FA 1VQ4A 2K5NA 1YP5A 2YTYA 3MEHA 1PRTC 2E2HH 1CZWA 2BZ8A 1EZ6A 4YCUA 4PJOA 3HP9A 3G71T 1NMFA 2OTJQ 2PZUA 4RH6A 1KAAA 1QVCA 2QF7A 3P20A 4HCSA 4A3KH 2JM8A 1UGQB 3LWHA 2HCCA 2YGEA 1Q81C 3JAML 1GBQA 4RTZA 2C06A 1FYCA 3PO2B 3AT1B 5D7UA 4RTTA 3H0GB 5C0XH 1R0BG 4F7UB 3KF6B 5D7DA 1HCZA 3OMCA 2WB1G 1TS4A 4C5GA 2CVRA 4FW2A 1JBMA 1VQDA 4WTOB 1N9WA 3QIIA 4F16A 1XX8A 1TWBA 3VHCA 2DTOA 3PUXA 1GUTA 4JS4A 4LN2A 2ZXRA 5H1SE 4OX9Q 2JA8B 4JRKA 2BDOA 4LF9L 2QDYB 2K75A 1K3BC 2IX1A 3I55Q 1K73R 3R92A 3V8LA 5LJ5e 1TWHB 3JB9J 1HHVA 5GAOn 2VY3A 1SE2A 4NMZA 2HHIA 2OTJA 3F70A 4B3TQ 3NENA 4GOPA 3BS1A 2OI3A 4MTNA 4DR1Q 2O1WA 1JR0D 1T5EA 2YUQA 4EQNA 2K2MA 3MP1A 4C0ZA 2PI2E 2F52A 1SRMA 2AHJB 2F0IA 3A55A 3ULPA 1KD1C 2NUCA 3S14B 2QI2A 4M77F 4DBFA 1O7YA 3PSIA 1TG0A 4HY1A 1Q1EA 3M0RA 3CCLQ 4RAUC 1RODA 3A8GB 4A3FB 3H8ZA 1D09B 1MMNA 2D1XA 3EHQA 1WD0A 1YJWQ 1SFOB 3I55A 2CKZB 2ENBA 4B3RQ 2R93H 1VQFA 3BU2A 2XICA 2KXCA 1PDQA 4JYAL 2SEBD 3UPUA 4M77G 1FNUA 1EA6A 2CGFA 1VQEA 2CKKA 2PNIA 2E76C 2MFIA 1UJYA 2UUCL 1XTDA 2RHZA 4EQPA 1D1BA 5IWAQ 4GFNA 1YT0A 2IWSA 3A54A 4A3EB 1G5VA 2ZPHB 4LF7Q 2DPPB 3TUHA 4QUCA 2F3VA 3WWVA 2DZ9A 1SROA 3IL8A 5FWCA 5AFWA 2A3LA 1S5BD 3JB9D 3MAQA 5TSSA 2I07B 2Q8RE 1M8AA 3CMAT 4AYBG 4JJCA 4KH0B 2D9UA 3CC7Q 5FK9C 5M3MB 5CIUA 3A8LB 4E6RA 1NPRA 4F7UF 1I5DA 3JCMh 3PO3G 4D6WA 2HSEB 3EFXD 4M8AA 2CP5A 3KXTA 4POGA 4V190 3MEWA 3K7UC 3QHSA 3CCET 3CCLA 1WTQA 5JJLA 4BIZA 1IGUA 2CS7A 3QUIA 4OB2B 3E19A 3DHQA 4JV5Q 2GGRA 2LQKA 4PLIA 2IT1A 3P75A 3PO2G 1YJWA 5LMNL 4BBSH 4F7UG 2F0SA 4XAXB 4EMKB 3HTRA 4NXML 1QYEA 2WI5A 3OS5A 2V8IA 2FPDA 2Z0WA 2J4XA 4OIJA 3WQ9A 2COWA 1TY0A 2ATCB 3BFMA 2ECZA 1Y0MA 2J05A 2NN6G 3J81c 4NL2A 4IUVA 3X3MA 2JA8G 4ZKCB 4GLAC 1AZQA 1QCOA 2E2IB 4JK1C 3R8BA 4QY7A 2EYYA 3CC7A 1LACA 2KCMA 1PH2A 2VVKA 5FU7B 4A54A 1EFID 1UHCA 1DXMA 4QL5A 1BCMA 4MP7A 1K8AU 4ZRZA 2VB2X 4C92B 4PJMA 4EFUA 2XJGA 5LL6S 3BY7A 5CCAA 2NVXB 3S15B 2BU7A 2LQWA 4QQBX 2BU2A 3MNRP 3P7JA 1VQPQ 2WI2A 1KQ1A 1AE2A 1O80A 3UE0A 1QZRA 2YLBA 2DILA 4M4ZA 5GMKl 2R3ZA 2H8HA 4DV0Q 3RLFA 4CGYB 3K5NA 1N32L 4J9CA 3QWXX 5KYIA 3O0IA 2DN8A 1NSNS 2JNGA 2SOBA 4JASA 3EFOB 2L5QA 1GBRA 4A3FG 4XQJA 1U4PA 3SXHA 2EYXA 4HJ9A 1Q46A 1WFQA 1Z6HA 4EPCA 1ZSZB 2F5TX 3J7AF 2QTXA 5LJ3g 5FLXc 1S40A 2NVTB 2ESWA 1P16A 3D0FA 4ASGA 1U4RA 4M78F 1JT8A 1BCPB 1YNND 4ZKBB 1U0LA 4ZNXA 4DA2A 4GKKQ 4CE2A 1M3CA 3X3NA 4FSXA 2KGTA 3EG0A 4Z89A 3G7BA 1VQPA 2V1QA 2K3XA 5KYXB 5JVG3 3DKMA 4R55A 4QCLA 1XPOA 3OW2P 3CCQT 3RN2A 2P4RA 1G51A 1LTID 1Y1VG 2AQ2B 2CP0A 4M78G 3FMCA 4FXKC 5GAMg 1M1KR 1TS2A 2NTSA 1AP0A 2XIDA 1ML0D 1U1TA 4J7FA 4PJOE 4C8QD 3SK4A 2O1VA 1TSFA 4RKLA 4J9GA 1KL9A 3WDNA 2XDLA 4WUBA 3OYIA 2GVBA 1EU4A 1J6QA 2EY5A 5M4HA 1A2TA 2B8AA 1PRTD 5M4NA 2E1HA 2KVMA 4YWLA 4ABNA 3K81C 1I07A 1KHCA 2CZ6B 8ATCB 1LCKA 1NMGA 3OMGA 4UPAA 1CFMA 3IFTA 3S9WA 2RHSB 3MXUA 2NUPB 1HNZL 5GAN8 3CCSA 2EDGA 2BH2A 2YUOA 3EAEA 4C92F 4DV6Q 3PEHA 5I6YA 4HXZA 4O09A 2A68C 3CQZH 1H9SA 4JVZA 5CTUA 5D6QA 5GMKj 4C3HH 3TCJA 4BA2I 1R9TH 1Q8KA 1FXXA 2FYPA 3C11A 1D1KA 4DUHA 1I5AA 4B08A 4C92G 3V8KA 3C4SA 1UY6A 3KBXA 1WHMA 2R5AA 3LH5A 5GANe 3FEOA 3HFOA 4M7AA 4FT4A 4BBRB 4PL9A 5HGTA 3GP7A 4DV1L 2DL4A 4DV5Q 3R3OA 2A0FB 4F14A 1Y71A 4HVWA 1EIGA 1WXUA 1GUSA 1Q90A 3B28A 3OWEB 2EGAA 3T0HA 1CSKA 1TUGB 1K73C 4AG1C 4EGKA 4ASAA 4IPCA 3X24B 1JC7A 2RQWA 1BCPF 4R8IA 2Y90A 1LT4D 4LF9Q 2CHBD 2L3RA 1TKWB 4D8KA 1O78A 3EG3A 4PJNA 1ACMB 2COYA 3E0JA 1S5DD 3GTMH 1C1AA 4HVVA 1EY4A 4M77C 4K6DA 3HOVB 4A93H 3RLNA 3S3NA 1KDAA 2ZGWA 3QIAA 3NMZC 5LJ3f 5F3KA 5M3FB 1U8RA 1HTLD 1TWCB 3V7CA 2NYSA 5FLXL 2YKJA 1F9SA 2NVQH 3Q8DA 1L0WA 3T16A 1VYTA 1QCNA 2LJ1A 2R5MA 2X51A 4K11A 1JICA 1STAA 3OPOA 2VS1A 2DVJA 3DB4A 4BD3A 3ME9A 2P5ZX 3CF5A 2F4VL 2KCNA 2X4WA 3VUBA 1I0CA 4JOIC 4K5WA 2EAYA 3OYEA 5C3EG 2DL7A 1HSQA 3LWEA 2J7ZA 1BIAA 1RUWA 5GAMf 5CK9A 4RCOA 1Q86U 3GTLH 4JBKA 3K98A 2DY8A 2X6LA 4LWEA 1WGSA 2Y4XA 1JWMD 1NR2A 2QA4T 4R9WA 2EQJA 1SJHD 5GAN4 4L91A 1AZPA 4JYAQ 4IN3A 3PMFA 1XYIA 1KSWA 5JEAG 1TWAH 2UUCQ 2VZAA 4LWCA 1SYCA 2ZPEB 1P92A 1WDXA 4YWKA 3L42A 3RD4A 3RZDH 4MN3A 2VQFL 1FD7D 2LT4A 2KEAA 1F9RA 1T3LA 5IE8A 3EGXB 3UDXA 3M4GA 1W2BS 4C5IA 5ELCA 4KH1B 4XTXA 3CAMA 3NTIA 4YKRA 1UE1A 1MIUA 4BY1H 4IFDJ 1I3QH 4BXXH 3HEKA 4K0KL 3EGDA 1QVPA
chains in the Genus database with same CATH topology
2HKJA 3NPFA 1WI7A 2K3BA 1NHHA 4GQTA 2CSQA 2C0TA 1YETA 3CGZA 3EHJA 4ZKIA 2AZSA 3PE0A 1MUZA 1KFZA 1MU5A 1B3QA 1TC0A 2YE5A 4CE1A 4LWIA 3A0XA 5IHIA 4KRTA 2CT4A 2BTZA 3U67A 3OWBA 3KFVA 4GBQA 4PRVA 2QFOA 5M4EA 4FCPA 1H7UA 1I58A 1RLQC 2EQIA 1H92A 1US7A 3QDDA 1ZSGA 2YKCA 2K6DA 1MX0A 2YECA 3U2KA 2JKIA 1I5BA 2XJJA 2YEFA 4LWGA 3H0FA 2HG1A 1BXDA 1EFNA 4CWTA 4OMPA 2DL3A 4HVUA 2KROA 2CDTA 4XIRA 2DMOA 2WI6A 2KYBA 2ENMA 2KE9A 3HHUA 1WYXA 2YK2A 1IO6A 2LQNA 3EG1A 1AH6A 2Q8HA 4R1FA 3A0WA 2GQIA 2XD6A 4EIKA 4XKAA 2WERA 1Z59A 2LJ0A 1S14A 2FWYA 4NH8A 4J9DA 3TSWA 1KZNA 3T10A 1NYFA 1T0HA 2BZYA 2J06A 1U2OA 3R4PA 2VW5A 3R4MA 4QT7A 2XHXA 4V26A 2YI0A 2QG0A 2YE8A 1AWJA 2J6KA 1R62A 4CWFA 4BQGA 3TZ4A 1FMKA 2DF6A 2WI1A 1UJ0A 2H55A 3ZXQA 2BRCA 2YSQA 2J6FA 5HCKA 4J9BA 3R91A 2LZ6B 2DRMA 1TUDA 1NYGA 1N5ZA 3G7EA 1YC3A 1OOTA 1SEMA 1YNZA 5M4KA 4YKQA 2KR3A 3PVQA 3HZ5A 3WHAA 4RTWA 2YEHA 1GCQA 2MCNA 3EG2A 1NEGA 3EGUA 3ULRB 1PVGA 2RN8A 4XC0A 3FV5A 4QPJA 1AD5A 4H81A 2O2OA 4MP2A 1TC6A 2JTEA 2IWUA 2IWXA 1AM1A 2ESAA 2YE3A 2YKEA 4KTNA 2C0IA 2RQTA 1AZGB 1E6GA 1VYVA 1WA7A 4LNPA 4CWQA 4CWSA 2ROTA 3EKOA 4AS9A 4CE3A 4F17A 1ZUUA 4FCRA 4JAVA 4HYMA 1YT2A 2ED0A 2BZXA 1ZUYA 4AG2C 1JXMA 2HCKA 1YCSB 1YESA 3LPSA 1GJVA 4KP4A 4EGIA 5BODA 3IQLA 3A0RA 4OMLA 3ZKBA 3INXA 1AH8A 2G6FX 1THNA 2WEQA 4JJDA 4BXIA 2SRCA 4WUCA 2RPNA 1J3TA 2JS0A 1PKSA 3IEDA 3O6OA 1SHFA 4ASFA 5CF0A 1TBWA 2EYZA 2YEIA 4URMA 1E7OA 2DM1A 1S16A 1ZXNA 1YC1A 3VS1A 5ECAA 1OPLA 1HJDA 2XHRA 4EFTA 2FRWA 1UUEA 2LCSA 2A36A 1EI1A 4P8OA 2I0NA 1OEBA 1I1JA 2AZVA 2KBTA 4RUGA 1B62A 2ZDYA 5EC7A 3T2SA 1K76A 2HCHA 5FW9A 2F2WA 1OPKA 3GIGB 2XMFA 1QKWA 1BKNA 1U3OA 1H7SA 4DEXA 4KQVA 4AWOA 2FG0A 2RQRA 1UYIA 3M0PA 1PRMC 2LX7A 1BB9A 2FEIA 1SPKA 5CTXA 1U5SA 1WXBA 1WFWA 4IIMA 1UGVA 2B86A 4IIOA 4CWPA 4GLMA 3VS2A 2O9VA 2YGAA 4O04A 5F5RA 1BYQA 1JU5C 2YE2A 2V1RA 3UATA 4OMNA 1SHGA 3VS0A 3CGYA 2ZKJA 4XTJA 1VYUA 2A08A 4HYPA 3H80A 3ZM7A 2FO0A 3EHFA 1PWTA 2JMCA 4FCQA 2CH4A 4OMQA 4Y92A 2UWDA 4RTYA 4KFGA 3VS7A 2YEGA 2EXLA 4CWRA 2F2XA 2IORA 1ARKA 1AZEA 2BYIA 1ZLMA 4CWOA 2A28A 4ESRA 3I5SA 3M0SA 3R6NA 5J6AA 5GJVB 1ZW9A 2YE4A 1TUCA 2CT3A 2E5KA 3NHNA 3ZXOA 1K4US 3G75A 1JXOA 1XOVA 4YKTA 3LNUA 1Z9QA 1GCPA 3OMUA 1QLYA 2K9GA 2KNBB 2VWFA 4J9IA 3D36A 4AFUC 3OWDA 2CSIA 2NWMA 2IOPA 3RKZA 2F2VA 3VRYA 2FPEA 3O5ZA 2K5BA 2BYHA 1NHJA 3C11A 3K99A 2D8HA 2FRYA 2Q2EB 4X1VA 5FWKA 2PZ1A 3UA7A 2DE0X 2M0YA 2EBPA 4YKXA 3T1KA 3B25A 2ABLA 4QPKA 4W7TA 4E02A 5FWBA 3H4LA 3FT8A 3HZ1A 1G2BA 1WX6A 3FJ5A 4BIUA 4DZYA 3UA6A 3BMYA 1FYNA 3PEJA 3CQTA 1JM6A