2CH4A

Complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
320
structure length
320
Chain Sequence
GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLTLAIIQALLVKVNNLVYAIPIANIDTILSISKEDIQRVQDRDVIVIRGEVIPVYRLWEVLQIEHKEELEEMEAVIVRVGNRKYGIVVDDLLGQDDIVIKSLGKVFSEVKEFSGAAILGDGSIALIINVSGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Reconstruction of the Chemotaxis Receptor-Kinase Assembly
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/chemotaxis
total genus 72
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01584 CheW CheW-like domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ch4A02
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2ch4A03
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2ch4A01
1UYFA 1RI9A 2J6OA 2JM9A 2OAWA 3C0EA 4FMTA 4H81A 3VRZA 1QLYA 1JM6A 1H7SA 4YKRA 2DL8A 2LJ0A 2RPNA 1J3TA 3ZM7A 4EGIA 3KFVA 1WFWA 2WERA 4BQGA 3ZL7C 2DE0X 3R4PA 5BODA 1M8MA 3A0YA 1WYXA 1PRMC 1WDXA 1WA7A 2NWMA 1KIJA 2WI5A 2RQRA 4HVWA 1X27A 4U93A 4RTZA 2LCSA 1MUZA 1OPLA 2SEMA 1UYLA 1BXDA 3R4MA 4I5SA 4H7QA 2K7AA 2DLPA 5L23A 4IIOA 1I5DA 1TILA 1HJDA 1I5CA 4CC7A 1BKNA 5M4NA 2L3SA 1UUEA 2JW4A 4H85A 2KR3A 1PRLC 1M27C 2LMJA 2RN8A 1AWOA 1YESA 1SSHA 2BU5A 4CWRA 3HEKA 3CGYA 1JEGA 2XHTA 2PNRA 1YWOA 4YKTA 1BK2A 1OOTA 5C93A 3JZ3A 2JXBA 5EC7A 2YUPA 1SPKA 2DNUA 5CTXA 1UHFA 2KXDA 1E6GA 4J9BA 4GBQA 4AFUC 3ZKDA 1RLQC 2K3BA 3JV3A 2PTKA 1AWJA 1Z5CA 2YE8A 5FNDA 1K0SA 4L8ZA 1CKAA 3REAB 1THNA 1UYHA 1YSRA 2BT0A 2YKCA 4MOTA 2BTZA 3O6OA 2JMCA 4AS9A 1B3QA 2A28A 2CDTA 2IOPA 3VS1A 4FCRA 1AH6A 2YKBA 1AZGB 1UFFA 4Z88A 2YE9A 2YEEA 2CT3A 2LNHB 2V1RA 3UF4A 4URLA 2YJWA 1GKZA 2JT4A 4AWOA 3I9QA 3NMQA 2Q8GA 3Q5JA 4V26A 4BAEA 5IHIA 4XIRA 1PWTA 1ZX6A 4MB9A 1AD5A 1KFZA 4K11A 2AKPA 3CRLA 3EHGA 2XMFA 2ZBKB 3K97A 1YSZA 2KROA 2NUZA 3RNJA 1S14A 2CT4A 4LUDA 2CG9A 4O09A 3H41A 2ECZA 1I5AA 1PKSA 2LX7A 1MV0B 2EGEA 4F17A 1UG1A 2QG2A 2VW5A 3R4NA 1QZRA 4RTUA 1HSQA 4KSHA 2D0NA 2DYBA 4DEYA 1Z9ZA 2DBKA 4RTYA 4ASGA 4ESRA 1KSWA 2CCTA 1X43A 4JAUA 4DUHA 5IDMA 3LH5A 3T0HA 4MPEA 1WIEA 1BGQA 5ECAA 1W70A 2YSQA 1ABOA 4MPNA 3O2FA 2ENMA 4EIKA 1H92A 2FEIA 4AWQA 2RQTA 3O5ZA 4WUDA 2F2XA 5BOCA 3VS5A 2DJQA 2YE4A 2YI6A 3WQ9A 2YUOA 2FWYA 3Q5KA 1BYQA 1NHIA 1Z59A 3TZ0A 2ROTA 1GL5A 4EGKA 2KXCA 4CE1A 3EG2A 2AK5A 1B63A 2JM8A 2K5BA 1M3CA 3TVTA 2P4RA 4AFQC 1W6XA 4KFGA 5FW9A 2KGTA 2YE5A 4JASA 1AVZC 3BM9A 2JMAA 3U2KA 1NYGA 1PKTA 2JKIA 2YE3A 1X6BA 4A63B 4LWIA 1K4US 3A0TA 2DMOA 2DRMA 3EKOA 3WHAA 1GBQA 3M0QA 2HBWA 2XX4A 4B7PA 4O07A 4XCJA 4AFSC 3PEJA 5D7DA 1B07A 1OSFA 3RKZA 3SL2A 1PNJA 2SRCA 4XKKA 1VA7A 5GJWB 2XDLA 1OV3A 4NH8A 2XJJA 2F2VA 1Z9QA 4AG2C 2YEAA 3HZ1A 4CE3A 4CWOA 1S16A 2BZXA 3INWA 2W10A 2ESWA 1GBRA 1UJ0A 5CF0A 1YS3A 4EM7A 3EKRA 1WXBA 3OMUA 2XJGA 4FSSA 2KT8A 4KQVA 3UATA 1WXUA 3HZ5A 4ZKIA 4OMOA 1AM1A 1JU5C 2YKIA 2WEPA 4P7AA 2DM1A 1QY8A 1NLOC 2CCUA 3QTFA 1VYVA 1PVGA 1UE9A 1Y4SA 4J9CA 2RNAA 5F5RA 2GQIA 3U23A 3CQTA 5FNFA 4CWPA 1G83A 2YK2A 4J9FA 3M0SA 3CRKA 4YKZA 1TC0A 5M4KA 5D6QA 2DL3A 2FPDA 2I0NA 1X69A 2E0AA 2O1UA 2W0ZA 2YI0A 2IIMA 3D2RA 4CWSA 2CSIA 2EYWA 3RLRA 2DVJA 1UY7A 1AWXA 1GJVA 1Z5AA 3K60A 1TH8A 2XCMA 4LWGA 4JJBA 3GIGA 2KT1A 1US7A 4OMQA 4HXWA 4R0KA 2KE9A 1AH8A 4FPPA 2K9GA 1UY9A 2XHXA 2FG0A 2O31A 4ORZA 2VWFA 3U2DA 4CWQA 3RBBB 1ZXMA 4RTWA 3GBQA 2GQPA 1EI1A 2WI3A 1BU1A 4YKWA 1L0OA 1X2QA 2K6DA 2CH4W 2YEGA 2HEQA 2O88A 3T0ZA 1YERA 1RLPC 1Y57A 4NH9A 1TBWA 1H3HA 3C11A 4KSGA 5M4EA 3EG3A 2DF6A 2O9VA 3T10A 5I11A 5IN9A 5GGZA 2BYHA 3VS7A 1H8KA 2BZYA 4R1FA 2XK2A 4K4OA 2KRSA 3TUHA 1KJWA 2EBPA 1WI7A 2FO0A 2GNCA 1R62A 2L3PA 4JPBW 5CTUA 2D8JA 1GFCA 2CGFA 4OMPA 2C0TA 4YKYA 2EYXA 4EFTA 4CC3A 1AMWA 2KBTA 4FCPA 5D6PA 1GCQA 5FNCA 2MOXA 4XIQA 3NPFA 2EW3A 1YCSB 1M3AA 1TUCA 3NMZC 5CTWA 2AKLA 2HCKA 3H0IA 4LNPA 1EA6A 4LE9A 2A37A 4LN2A 2YECA 4LPBA 3R6NA 2L0AA 1QKXA 1I07A 1W1FA 1UTIA 2M51A 4IIMA 3VRYA 1AEYA 1SHGA 3PE0A 2BZ5A 4BXIA 2YE6A 4GT8A 4KP4A 1ZXNA 1TC6A 1OPKA 1VYUA 2G6FX 2GFDA 2YEBA 1UECA 3HYYA 2VCJA 1SRLA 2YK9A 4CWFA 2Q8IA 2HKJA 4OMMA 1K1ZA 1T3SA 3SHWA 2OJ2A 2RQVA 3RLQA 2J7IA 2DA9A 3C0CA 2MIOA 4CC2A 1NEBA 3VS4A 3OWDA 3FV5A 2QDLA 5FWBA 3TZ5A 2YUQA 4XIPA 2H55A 4JZ3A 2WI7A 4EMVA 4ASBA 1YC4A 4XKOA 2ZDYA 2L3QA 2VKNA 4LWEA 2EPDA 4GEEA 1YC1A 3M0UA 3NHNA 2FWZA 1H7UA 3IEDA 1I5BA 4PU9A 4WUBA 5CTYA 3U67A 1GKXA 2AKKA 4HVUA 4PRVA 2K2MA 3VS6A 2ZKJA 4HVVA 2YGAA 4QPJA 1NM7A 1E6HA 2YKEA 2D1XA 3A0XA 3Q5LA 1QCFA 2K79A 3M0RA 3UA7A 1ZSGA 2ED0A 1QYEA 3TSZA 2YI5A 4Q20A 1I0CA 3DGEA 4XD8A 1Y0MA 3VHCA 3EHQA 3H0HA 1ZLMA 1UDLA 1UHCA 3ZKBA 4Z89A 2C2AA 2M0YA 2EXLA 2LQWA 4GLMA 1NYFA 1YNZA 1OEBA 4HXJA 2H8MA 4D8DA 1RUWA 5IHNA 2GTOA 3I5RA 1X6GA 2PZ1A 2ZDXA 4V25A 1UY6A 4DEXA 3VS2A 2EKHA 3OWBA 1CKBA 1K76A 3G7BA 4HYMA 1ARKA 4X1VA 1LCKA 1UYIA 3B24A 3EGUA 1X2KA 4W7TA 2C0OA 4HZ0A 2XX2A 1GRIA 2ROLA 1V1CA 1U0ZA 2DRKA 4JZ4A 1UYGA 2HSPA 2BYIA 2HCHA 3ULRB 5IHKA 2WI4A 4HZ5A 2O1VA 1KZNA 2ED1A 2E5KA 3G75A 4L93A 4X9LA 2YGFA 3A98A 1SHFA 4J9IA 4PRXA 1Y8PA 2BZ8A 5M4MA 1PHTA 2FPFA 2AZVA 5IH2A 4J9DA 2YJXA 3TTZA 4GQTA 4J9GA 1TIDA 2LP5A 2YEFA 3UA6A 3BMYA 4HXZA 4MPCA 4UROA 1HD3A 4XTJA 3VADA 2HDAA 2LZ6B 3HHUA 3H80A 1CSKA 1QWEA 4JAVA 5M4HA 4ASFA 2OI3A 2X3WD 1T0JA 2WI2A 2EQIA 1UYMA 1ZW9A 2BU6A 2DX1A 3D36A 1JQQA 5L3JA 3CWVA 2L2PA 2XDKA 1BB9A 2DL4A 1I1JA 2XDSA 1UYKA 4RUGA 2Q2EB 4Z8AA 3GIGB 2YE7A 4O05A 5J71A 2KYMA 4E00A 2YDLA 2JJCA 3H4LA 1NHJA 4URMA 4XITA 1I59A 4FCQA 2WEQA 2O9SA 4RTXA 1QWFA 3OW6A 3EG1A 2DILA 2EYYA 2RMOA 3QWXX 3TSWA 3RLPA 1AJ6A 4AFZC 1WX6A 2B86A 1WXTA 3HYZA 1A0NB 3EHHA 4J9EA 4AG1C 5D7RA 3R4OA 2DL7A 2BSMA 1YN8A 4HCKA 4XDMA 2EGAA 2YEDA 4E02A 2XD6A 2F2WA 2XDUA 1QKWA 2Q8FA 3K98A 2BU8A 2CREA 1Y8OA 2KYBA 2BRCA 2CH4A 1YT2A 2FPEA 4F14A 4L90A 2JS2A 3REBB 4GCZA 4L91A 4ZNXA 1ZUKA 2FRYA 5HCKA 3GIEA 4CC4B 2AZSA 3R91A 1IO6A 2JS0A 1ABQA 4Y92A 4D8KA 4RTTA 2WI6A 2YE2A 2O2OA 2XDXA 3EHJA 1B62A 4MBCA 4XC0A 2MCNA 1YP5A 1UY8A 2XABA 3NGPA 3D0BA 4CE2A 3EHFA 2YT6A 1U2OA 5D7CA 1U5SA 4OMLA 3ZXQA 4B6CA 1E7OA 2C0IA 1FMKA 3G7EA 4EFUA 3MNRP 1UYEA 2CSQA 2EYZA 3EHRA 3O0IA 3VHDA 4LP0A 1ZBJA 4I3HA 1K9AA 1YWPA 2YKJA 1GCQC 1NG2A 2EVRA 3VS3A 3K99A 3T1KA 4NH7A 3A0ZA 2H8HA 3T2SA 2KEAA 2IWSA 4WCIA 2VCIA 1A4HA 5GJVB 2HG1A 3B25A 4L94A 4R3AA 4U7NA 1MX0A 2FYPA 4XE2A 4BIZA 1UGVA 2IOQA 1U06A 1TUDA 1U3OA 2DBMA 2V1QA 4U7OA 1N5ZA 2D8HA 3PVQA 3LPSA 4JQLA 3QWYA 1NLPC 2QF6A 4F16A 4HYPA 1JXMA 4EEHA 4PL9A 3KE6A 4E6RA 3M0TA 2BU2A 4EGHA 2A08A 1XOVA 1JXOA 2PNIA 2YGEA 4LWHA 4O04A 2Q8HA 4ASAA 4CWNA 3VS0A 1Y4UA 2YEJA 1NEGA 3CGZA 3EG0A 4GFNA 4MP2A 4P8OA 2YUNA 2X3XD 1Y8NA 2IWUA 2DL5A 4BQJA 2CUDA 4XCLA 3R92A 1UYCA 5IDJA 1UJYA 1YT1A 2WI1A 1ID0A 4DZYA 4KTNA 2LQNA 3THKA 4QPKA 3FT8A 2GBQA 4BIUA 2RQUA 2J6KA 3INXA 1WLPB 1YETA 2RQWA 2QFOA 3TZ4A 3FT5A 4JJDA 4HY6A 2IORA 2FRWA 1UYDA 1AOJA 2XX5A 4R3MA 2ABLA 2KRMA 2BTTA 3PEHA 1ZUUA 4J9HA 5I22A 1NHHA 1GCPA 2VVKA 3PVLA 2XJXA 4HY1A 1AZEA 1ZWHA 3B28A 3B27A 3VHAA 2O1WA 4QT7A 2YEHA 4JJCA 4LWFA 2LJ3A 4YKQA 1G2BA 5J6AA 3I35A 1AWWA 2ESAA 2BU7A 2BREA 2VWCA 2CCSA 2GTJA 2FXSA 3ZXOA 2J6FA 5M4PA 1K0XA 2J06A 3FJ5A 2CUBA 2KNBB 1S1NA 4MP7A 1MV3A 4KRTA 2EGCA 3B26A 2A36A 2YEIA 4LUEA 5FWCA 2QG0A 3GIFA 5FWKA 5F3KA 3OPDA 2J05A 5IXFA 5IXBA 4AWPA 1ZUYA 2GGRA 2IWXA 3IQLA 1KIKA 4E01A 1VYTA 1M3BA 1SEMA 1T3LA 3I5SA 3SEMA 4WUCA 5CPHA 1GFDA 3A0WA 3TZ2A 3M0PA 4CWTA 4URNA 2JTEA 3H0FA 1I58A 1Z5BA 2LJ1A 1T0HA 4OMNA 1BBZA 2RF0A 4ZVIA 4YKUA 4O0BA 1M30A 3LNUA 1EFNA 2YI7A 2KRNA 1YT0A 3QDDA 2UWDA 4YKXA 3A0RA 4M4ZA 1TG0A 1SRMA 1MU5A 4GGLA 1FYNA 4XKAA 2XHRA 1JO8A 1YC3A 4RTVA
chains in the Genus database with same CATH superfamily
1UYFA 2J6OA 1WTXA 2VQFQ 3BVMA 3J7AF 1QQJA 3PTAA 2ZJPA 3C46A 1EZZB 1ZSZB 5EKKA 2MYSA 1U0LA 1HK9A 4P71A 4YWMA 3PO3H 2LJ0A 1JM6A 1H7SA 2K01A 1BDOA 3HP9A 4BDYA 4BBSG 3KFVA 5KEEA 5GAMd 4M77C 3S14B 2WERA 2RQXA 4EGIA 3PMTA 1D1CA 3R4PA 4C92E 5BODA 3A0YA 1WYXA 2XI9A 3OW2P 2QDYB 2ICEC 2VB3X 1X3PA 1BUVT 1UYLA 2SEMA 3S24A 4TRDA 1QWYA 3R2TA 2JOYA 4BBRB 2JEAI 4H7QA 2OTJQ 4I5SA 1Q7YC 4MNOA 5L23A 3SXHA 4JI5Q 3HKZB 1I5DA 2D5DA 4O6JA 4CJ0B 1BKNA 1WHJA 1F2LA 2HIVA 3KBXA 5IYBH 3S15H 1STGA 2KR3A 3LLRA 3FRPB 1PRLC 2LMJA 2RN8A 3SB2A 4X62Q 1S5DD 1I81A 3FHWA 2FXQA 2D0PA 3S2HB 1WHHA 1OZ3A 4PJOF 3CGYA 5DM7R 2LVMA 4B3MQ 3LWEA 5KYYA 1YWOA 2OX7A 3CPWA 1KD1R 1Y1VH 3O13A 5IT9c 2UUAQ 4YKTA 1CZGA 1I94L 1TH7A 1VQ5T 1MSGA 3M4QA 2JXBA 3JZ3A 2YUPA 3HOXH 3CCQT 1UHFA 1E6GA 4MMKA 4GBQA 4A3EG 3BZCA 2K52A 2MP1A 2K3BA 3JV3A 4GS3A 1I4K1 4A4HA 4A3FG 3JCMc 3JRZA 1MJEA 1Z5CA 1JQYD 1MMAA 5FNDA 1DJ7B 1K0SA 4J6XA 4VUBA 1QZHA 3REAB 1UYHA 1V76A 3RN5A 3GTMB 2E2JB 2QQ9A 1AW7A 1MMDA 2SOBA 3FC3A 1N34L 1B3QA 4IPGA 5EBCA 5BR8Q 3O6OA 1R0CB 2E64A 3RLFA 1X65A 1C8CA 1AZGB 2L3RA 1M1KC 4OF1A 2VV5A 8ATCB 2B39A 3CPWP 5ELCA 4ZK9B 2YJWA 4F7UB 3K5NA 3MCAB 4MIUA 4NKLA 1GKZA 1WCMH 4Y7NH 3I9QA 3T1YL 2Y4XA 2V4DA 2E2HH 2NVTH 4AWOA 3NQTA 4BAEA 4L5QA 4X3UA 1PWTA 1ZX6A 3JCMV 3BE3A 2OQ0A 2HNIA 2X35A 2AKPA 3RMQA 2XMFA 2NZHA 2DIQA 1SBBB 2K5NA 1X3FA 2J0TD 5HGQA 1GJXA 2N3SA 1PKSA 2LX7A 2NYZD 4LF7L 1WZOA 2SNMA 2OTJT 1VQMQ 1UG1A 4C3HB 3R4NA 1R0BG 3OYDA 2H4OA 1OYXA 1VQOA 4C5HA 3GTMH 1VQ4Q 1FJGQ 4ESRA 1HZCA 2YWWA 3MKDA 1K83B 3JCMW 5ISRA 3F2BA 4M78D 4PJOD 5ECAA 1W70A 2KOLA 1YJ9Q 4OONA 4MPNA 3DLMA 2ENMA 4EIKA 1Y1WG 2FEIA 4EX5A 2F5TX 4JS5A 2RQTA 4A3KG 3HOVG 1LTBD 5C3EB 5FU6C 5L8RE 2PZWA 5LJ5f 1D5XC 2YI6A 3J81L 2FWYA 3URGA 4BY1B 5CV5A 5K5PA 1NHIA 3TZ0A 3C1EA 2HAXA 1GL5A 4EGKA 5C5MA 3T1HL 2KXCA 5LJ3f 4PFZA 1NJIU 3D6WA 3FDTA 4JI4L 5IY0A 1IYVA 2I2LA 5HKCA 3TVTA 4AFQC 4XT3B 4E72A 2PQEA 3EG9B 1YNND 2L89A 3K7AH 2KGTA 3GOXA 4KFGA 4R8NA 4JASA 1D1IA 4C3IH 1J5EQ 1KAWA 3T4AC 4P72A 2JKIA 5J26A 1B53A 2RA4A 3W1GA 3A0TA 4RH6A 4B9XA 1QJOA 3ULJA 3M0QA 4UHVA 3A8HB 4C0DB 1JJ2S 3TP8A 4O07A 2MI6A 1B07A 4IPHA 2JK8A 4A93B 4UP8A 1PNJA 2VZAA 2HHIA 3TCJA 2EXDA 1VS0A 2SRCA 3KLRA 2B2YC 4ID6A 3E19A 3P75A 2F2VA 2NUTB 1YJWA 4N0AC 2A6ED 2K04A 4DR5L 3GTKH 4XAXB 2BZXA 3D4RA 2W10A 2ESWA 1SFOH 1S16A 1G3YA 1GBRA 1VQMT 1N27A 3EAEA 5CF0A 4RA8A 1CT1D 1WXBA 1D5MC 1SNMA 4ZUIA 1IGUA 2RK1A 3TEHB 2R58A 1PRTC 4GLAC 3Q8DA 1VQ4T 1WVLA 1RADB 5IT9E 5GAN4 1CKMA 4KHVA 1XNRL 1CKOA 2R57A 2HCIA 4X65L 2XIWA 2E6ZA 1I4GA 3HZ5A 2YKIA 4DV4L 2WEPA 2DM1A 1QY8A 3QHSA 2KBNA 2OXPA 3CBOA 1YJ9T 4DR6Q 1I6HB 1ILQA 1STHA 5M3FB 2P84A 3TBIB 1UE9A 3CCEA 1I50B 1JOQA 2B2WA 4EQOA 1G3SA 1QVPA 3E1SA 5FNFA 4M75D 1KIXA 2F0LA 5I6YA 4DUYQ 3CCLQ 1KC8R 3CRKA 3KJPA 4YKZA 1TC0A 1EU3A 5M4KA 4CHTB 2DL3A 2PI2A 2WAQE 3GP7A 1X69A 2E0AA 2YI0A 2IIMA 2DXCA 3CCMA 2F0PA 3BZKA 1DM0B 2Q2IA 1QVFA 2AT1B 5C4XG 3A56A 2IW3A 2L8DA 1Z5AA 1SE3A 1D8LA 3PGGA 1QP3A 1TH8A 1HXYD 5C4JB 1RCVD 1RTNA 4R0KA 3F8TA 1AH6A 1W6JA 1AH8A 1O9SA 3EFOB 2UU9Q 3I55Q 2DZ9A 2KVQG 2R7ZH 1SEBD 3HFZB 1WHGA 4O5VA 2WACA 3OYAA 1NJIC 2HUGA 1E24A 3BDOA 4DR7Q 3MXNB 4M7AC 4JI6Q 2O88A 2K6AA 3I56A 3SHLA 3DKMA 5IAYA 5D3IB 3C11A 4PZ8A 1ZA2B 4JI8Q 4DN4M 1IL2A 1VOMA 2O9VA 5LMUQ 5I11A 1F77A 1PZKD 3EBEA 1ZSZA 4XTXA 1QVFP 3VS7A 4XQ3A 2BDOA 3DWQA 3GV3A 3I2ZA 3DB4A 2O4XB 3JAML 2KRSA 1LTID 4HJ7A 1WJJA 5GAOn 1WI7A 4DV7Q 3A8JE 4ZAIA 1R62A 2L3PA 1KHIA 4JPBW 5AT1B 1GHJA 1ZYRC 2QK0A 4HZ0A 4DNRB 4LUVA 4FF2A 4POFA 3OYMA 4CC3A 2KBTA 2X4JA 4IUTA 5C0XH 3J81c 1HJPA 1CA6A 2AWNA 1EWIA 3NPFA 3VYGA 2EW3A 5JJIA 4XIQA 5FNCA 1YCSB 1M3AA 2A7YA 2LC4A 4C92G 1H9KA 1C48A 1I4PA 2KEEA 3H0IA 4LNPA 4MDWA 1CKNB 1EY0A 1TVXA 4GNXB 4A3JG 4LF5Q 4JRKA 2SEBD 4LPBA 5L37A 3R6NA 3A8KE 2M51A 5CBEE 1UTIA 4YWLA 4DV5Q 4PZ6A 1YIJT 4GT8A 4AT1B 4KP4A 4IUQA 2B3GA 5GMKm 2G6FX 3KDFB 1WTWA 4CWFA 3CC2A 2VCJA 5DM73 2YK9A 3S16B 3KF8A 4XTYA 3STBC 2OJ2A 2RQVA 3CCSQ 3RLQA 2YYZA 4MMLA 2Z6KC 2Q2TA 2JA8H 1JBMA 3VS4A 4E7ZA 5ELNA 2WB1E 3G4ST 2F1LA 4XIPA 2H55A 2K3XA 1RL2A 3SGIA 1YC4A 4UY8C 4XKOA 4L5TA 3V7SA 1W2BA 3JB9H 5EQ0A 3I55T 4GEEA 1YC1A 3NHNA 1NE8A 4WUBA 2WSFE 1KQSP 4C5IA 1E1OA 3HL8A 4KY6A 1PH6A 2EQJA 4JYAL 5AYFA 4QVCA 1PH4A 1VQBA 4OWTB 2YGAA 3A0XA 3M0RA 1EQTA 1PYWD 2ED0A 1QYEA 3H0GB 3LNNA 1QCNA 2RHSB 1M1GA 3HOZG 2ZAEA 4RMOA 3OYHA 3TS2A 4EQPA 3FDRA 2IPOB 2X51A 1VF7A 3TQYA 4NW2A 3ZKBA 2DXUA 3M4YA 1YNZA 5GANf 1OEBA 3OYGA 4RWSC 1W2BP 4HJ8A 2EPBA 1C0MA 4XU3A 1PH3A 4V25A 4U68A 4WRDA 5GAEC 1SNPA 4RCBA 4RMFA 3G7BA 4M77D 1ARKA 1LCKA 3HRZC 4B3RQ 4GKJL 2ATWA 2LKVA 1KLUD 4W7TA 3LGJA 3MEFA 4CRIA 1J5EL 4LF9L 4PJOB 4TQUS 4C3JB 1UYGA 5FLMH 2BYIA 2HCHA 4JZ4A 2WI4A 3ULRB 4WTOB 5IHKA 1P92A 3S1QH 4XTCS 3MVVA 3GTQH 4X9LA 2HD0A 1KL9A 2LMCB 4F87A 1SHFA 4FYVB 4J9IA 2RI3A 2DKGA 4DV1L 1JE4A 4PLIA 1JB7A 3P8BB 2DGYA 1MI2A 2KA7A 2FPFA 2AZVA 5IH2A 2B8GA 3PO3G 2IY5B 3TTZA 1JC7A 1L2FA 2LQ8A 3T53B 1D7QA 1VQLT 2PVOB 4LNQA 3CCVA 2YEFA 3BMYA 4ZN1A 1YJNT 4C5GA 2HDAA 5CKBA 5GAN8 4XTJA 1QUQA 5HGTA 3SWNC 5CGKA 3VUZA 2KCMA 2DO3A 3I4MB 2QA4Q 3HHUA 1QWEA 1GUGA 4JAVA 3CCUQ 4ASFA 2A69C 2OI3A 2AIRB 1T0JA 2X3WD 1Y7XA 5EPJA 1BCMA 4CGYB 5IGEA 1UYMA 1ZW9A 3BZDB 3D36A 2FZCB 2C9OA 1EQRA 1D3BB 3EG9A 3HOXB 2L2PA 1LPLA 1S5ED 1M90R 2XDKA 3CWVA 2QCPX 1EWCA 2XU8A 3JAMc 5IYBG 2QEJC 3HG9A 3GIGB 1MMNA 5J71A 4DAYB 2ASBA 4DNIA 2Z4HA 3LWIA 4DR6L 4QGUA 3OMGA 2R93B 4URMA 2WEQA 1M8VA 2QYZA 4RTXA 2DILA 2EYYA 2V26A 1Q82U 4X64L 3RLPA 5IYCH 4DFAA 3A8GB 1Y1VG 2WINB 2E10A 4AFZC 1S5FD 4DV0L 2A8VA 1XX8A 3H9NA 3HYZA 4AYBB 5GAMf 2QTXA 1STEA 3HOXG 1YN8A 2UXDL 2F0NA 1OZ2A 2F1MA 2NUTA 1E7ZA 1VQGA 1E2ZA 2LXJA 3RZDB 4LFBL 1G2TA 2F2WA 2XDUA 3SD4A 4A3DH 3S1RB 4DXGA 2Q8FA 3CC7A 3K0XA 2E1HA 1R4PB 1KABA 4C8QC 1RIPA 1OI1A 3OBYA 1YT2A 2FPEA 5GADC 1N32L 4JOIA 3CF5A 1MGSA 4OIJA 4M75B 3REBB 4GCZA 4L91A 4A3BH 3GIEA 2RCFA 1SNOA 2AZSA 2R6GA 3ND9A 2OQKA 2WKCA 2XVSA 4M8AA 4RTTA 1PRTF 4XC0A 1TY0A 4MBCA 1B62A 4JI8L 4FT2A 2XABA 3NGPA 3D0BA 4CE2A 1AH9A 1X6OA 4BACA 4IFDJ 2B8FA 2QA4T 4OMLA 5ELOA 5D7CA 3BS1A 3CCUT 1FMKA 4BY6C 3EFSA 2H3EB 4EFUA 4C92D 2CSQA 5BN5A 4A4EA 4Z9CB 4WJ3M 3VHDA 1HXDA 3MXGA 4OGQC 2DUDA 1WTVA 1ZBJA 4M7DE 1Z47A 2JJ9A 1YWPA 2YHTA 4E47A 1GCQC 3KXTA 2K03A 2K5IA 2MQHA 1EYDA 3CQZH 2WAQG 1CZWA 3T1KA 5IODA 4NH7A 2KEAA 2F0DA 2ZJRA 3OW2S 1YHQQ 1WJRA 3OTOQ 5GJVB 5LJ5e 3WDNA 4CDFC 4BIZA 3LGLA 5C44B 2IOQA 4CJ2C 1CTMA 2PUOB 3NBIA 3V7RA 3C2PA 1N5ZA 2PVDB 4N4IA 4KKSA 3W5OA 1I5OB 2VUMH 4GKKQ 4YCWA 3LPSA 3RDVA 1RKNA 2YTYA 3NP8A 5I2XA 3K57A 5C0MA 5M5WH 1BBXC 4HYPA 4IUPA 4QQ6A 2O4XA 1HQRD 3DWAA 1IBKQ 3KE6A 1VCIA 2WP8J 5DLOA 3L2PA 4FU6A 1T5XD 4CDEC 5AJ3L 4BI3A 3OYNA 4CWNA 1DOKA 2XJJA 3JB9J 2NVQH 1ML0D 4C3IG 5K36H 4PJLA 1ASYA 4P8OA 2HMAA 2X3XD 2BCOA 3GD7A 2DL5A 3S2DB 2IWUA 5FRNA 4FVMA 4GNXA 2HDLA 5IDJA 1PRTD 5LJ5j 4ULLA 1WTRA 4DUHA 1KDCA 4KTNA 3NUCA 1SNQA 4QCLA 1PA6A 3FT8A 2RQUA 3MHXA 3VR5A 1EYGA 1WLPB 1OXVA 5LJ3j 1RI0A 2RQWA 4OB0B 1CQFA 4FXDA 3H6MA 1YT1A 3MP8A 4XQQA 3PIPA 5FRMA 3JAME 3I73A 1AOJA 1SLJA 1RF2D 1I4RA 2EQMA 2A1AA 4YY3L 2KRMA 5EG2A 3CPWS 4PFPA 4A3LH 3TEEA 5I22A 4DR2L 1NHHA 4HY1A 1JR0D 1ZWHA 2BE5C 2RHIA 1WQ7A 1J9OA 4LDVA 3I35A 2JXMB 1PHJA 1YBYA 1NCVA 3ONAB 4QUFA 2BREA 1V9PA 1KAAA 2FXSA 2GTJA 4AYBE 3ZXOA 3M4PA 2J6FA 4NOYA 2AQ2B 1VQ5A 2DERA 2WB1G 2KNBB 1RABB 1L1OB 1BR9A 3CCQA 2B2TC 4QJFA 3R93A 2E2IH 1ICWA 4C2MH 4F7UF 2EYOA 2IX0A 4GLKA 4LF6Q 4A93G 3B26A 2F3VA 3H6ZA 5FWKA 2CKKA 1I3QB 1FMWA 2KQWA 3E5SA 1V8QA 4KT0E 4M7DA 2J05A 4YTLA 4YHHL 5F3KA 4AWPA 4M7AD 4DV6L 4DNTB 3IQLA 5GAN2 1KIKA 4M78C 1KDAA 2IG0A 4XTVA 1HNXQ 1VYTA 1T3LA 1SEMA 1TY2A 4M77B 3TZ2A 1Q1EA 2OTLQ 4URNA 3KUFA 2AKWB 3NQIA 3P7JA 1N9SA 2LJ1A 1T0HA 3V2TA 2ES2A 2RF0A 1T5EA 4HCBA 2CCTA 3CPFA 2RKSA 4DK0A 1SRMA 2DNCA 2EOTA 4K2LA 4GGLA 4G4KA 2MO1A 5ELEA 4A4KA 5LMNQ 2F0EA 4RG8A 5KE3A 1Q81R 5M3FG 2KY9A 4RTVA 1YC3A 1K0RA 1OULA 1RI9A 4DAPA 3KLSA 2B63B 2F03A 2JM9A 2OAWA 4A76A 4RCCA 4H81A 3OY9A 1TS2A 3K5OA 2OTJA 1VQ8Q 3PGZA 4KD3A 1J3TA 1CUKA 1DOMA 2F0FA 2OT2A 3I8ZA 1TS3A 5C4HA 3N52A 3ZM7A 3AHUA 5A0GA 8AT1B 3CC4Q 2NVXB 1PRMC 5EKIA 1WDXA 2EJ9A 2NWMA 2ZPGB 1VQPQ 2KCTA 2Q2HA 4BXXH 2KCCA 1KIJA 2WI5A 4U93A 4KMUC 1TTHB 3M4OH 2FZKB 1MUZA 2NYSA 1EEID 3STBD 5C0XG 4L6TB 2P0QA 2K05A 1TILA 1U4LA 2QEXQ 1D3BA 1SJED 1HQMC 4HR7B 3QDDA 5L3JA 1HJDA 5GAOm 4CC7A 5M4NA 1UUEA 2KHIA 4XU2A 4DAYA 1AWOA 1X3QA 4QL5A 2K3YA 3QYHB 3KF6A 3OSVA 4CWRA 4ZYSA 1HRJA 2QAZA 1TWHB 1MNEA 2QI2A 2D62A 3H3VI 2R7DA 1JEGA 2KQ3A 2XHTA 3TP6A 5IGDA 1IXRA 4B3SL 3G71Q 1BK2A 1OOTA 1YITQ 3EIVA 3D4DA 1E1TA 4K8JA 1AEXA 1N8RU 2VW9A 4QIWE 2OTLT 2DNUA 4E7HA 3JCMh 1VQNT 3R3OA 4CBVA 1EIYB 5CAIA 4IQZA 4EPCA 3PO2B 1BBUA 3JB9G 1NNXA 1R9TH 3R6OA 1MJCA 1TXYA 4XQNA 2JA5B 4L8ZA 2MO0A 1XTDA 3GIBA 2NWGA 4L8JA 2Y0SE 4H0LC 5CKFA 3RKYA 4K6DA 5DM63 3VS1A 4MN3A 4URLA 4Z88A 1N33Q 2CFMA 2LNHB 2V1RA 3UF4A 1RHPA 1KRTA 2XIDA 2MF2A 4DV2L 2RH2A 2JT4A 3T56B 2XX5A 1G2SA 1VQMA 3NMQA 1VQ8T 3OOCA 4QUCA 2E70A 5IHIA 5FU7C 5GANe 4C8QF 4TVRA 2L4NA 3GDEA 4K11A 3BVGA 3MXUA 1VQ4A 5FU6B 1FGUA 2MK5A 3K97A 1UE1A 2ZPBB 1VQPT 4K0KL 2L9HA 2GA4B 2NTSA 3H41A 1YJ9A 3JCMX 5IT9L 2E5LQ 4R55A 3P8HA 4F17A 1CHPD 5IIFA 4KSHA 2D0NA 4DEYA 1QVFS 1SE8A 1Z9ZA 4RTYA 3PCOB 5FLMG 3HOWH 1SMYD 1D0XA 1KSWA 1K8AU 2A69D 2F0UA 1X43A 1KDBA 4X66L 3GTLB 4JV5Q 1JT8A 4JAUA 1IKLA 1Q7YU 3T0HA 1WIEA 2LXKA 2M2LA 4LAAA 5FROA 4JS4A 4DAVA 2YSQA 3RN2A 1ABOA 3MFGA 1BGQA 5EPLA 2YU9B 3O5ZA 2ZPHB 4M7DG 5GANj 2F2XA 1SYDA 1F2MA 3G71T 5M5YB 2KAFA 1YITT 1WTHA 1JOKA 4H7BA 2ICIA 2YUOA 4DR3Q 2I0QA 2AWOA 4JI0L 3Q5KA 1Z59A 5LL6X 4OWWB 4ME7A 4H44C 4HAEA 3LX7A 5GQOA 1ONLA 2K5BA 2P4RA 1LTLA 1JOOA 3M56A 3BM9A 4KBMB 1PRTB 1NYGA 1PKTA 4P2CB 2G9DA 3ASKA 1X6BA 4A63B 2PZUA 1OX8A 4DV3L 3VKIA 1K4US 4HMJA 2DMOA 1QVGA 1EQVA 3WHAA 1GBQA 1FR3A 4XK8E 2HBWA 4JK1C 5IYCG 3PEJA 1NY4A 1M1KU 1PFBA 1U8RA 3I72A 4P73A 3H3VC 4HCCA 4BI8B 4PJJA 3MPUB 2VY3A 1BYQA 5GJWB 2XDLA 1HNXL 3QO2A 2F3WA 2YEAA 1Z9QA 3I4MG 5CO7A 1C9OA 1ASZA 5CV9A 2NZOA 5FOBB 1UJ0A 1LT4D 2D9UA 4EM7A 3EKRA 3GV6A 4JI2Q 4ZGEB 1PVOA 1VQEA 3Q24A 1Q1BA 3EH1A 3VDYA 2KT8A 2FHDA 4ATOA 1YIJA 1E0BA 1SNCA 4FP5D 3CCLA 5IP7G 1QVGP 3T51B 2DETA 4A3MB 1ESRA 2CP0A 2AMCB 3EJIA 3CD6Q 1KQ1A 4A3GB 2XSCA 2Q8TA 2R93G 1HYOA 1W2BS 3GTJB 3L2UA 1JE5A 2BA0A 2B2VA 4KY5A 4A3BG 1PVGA 1DGSA 3M3YB 2M16A 5FO9B 4J9CA 2RNAA 4KV6A 3G4SA 4MZ9A 2WFWA 3U23A 3OB9A 2I46A 4J83A 4M7AB 5GAMj 3E3XA 3M9BA 4KI0A 2UUCL 3PMIA 1LACA 2D2CC 2UXCL 4AYBG 1B34A 3I55A 4ZCKA 5CKHA 1A63A 1JCKB 1NZ9A 1K8AC 2FPDA 2HQLA 3NE5B 4E7IA 2J7ZA 2W0ZA 3UDFA 1Q12A 4AMCA 2CSIA 1EY4A 1AWXA 1SE2A 1N9WA 2M9UA 3CAMA 3J7YW 1SRUA 1Y14B 2AHOB 5CIUA 2KT1A 4XTWA 1US7A 2EJFC 4HXWA 1Y96A 2PW5A 3OWEB 4RCOA 5LL6S 3D6CA 4FPPA 4FW1A 1S72T 2NBFA 1D1BA 2UXBQ 4M78F 2FG0A 2O31A 4ORZA 2VWFA 3RBBB 3DUZA 1ZXMA 4RTWA 4E2FB 2F4VL 1EI1A 2GQPA 2ALYB 4GLXA 1BU1A 1NR4A 2RSNA 1QILA 1IBMQ 1IXMA 3G48A 1L0OA 2CH4W 3S14H 2YEGA 4N4GA 4YKWA 1YERA 3PUYA 1PSFA 5KNDA 3G1JA 1Y57A 3VYHB 1H3HA 1B44D 4YWKA 4KSGA 3EG3A 1UGQB 2DF6A 1X56A 3T10A 3OQ5A 2VUMG 3GTPB 2B2UA 1H8KA 2BZYA 4R1FA 3VA5A 1SG5A 4BBRH 2JA6B 3S1NB 2JVVA 2K7VA 3JB9D 4R4TA 4OX9Q 2EBPA 4LMQD 2FO0A 3J7A5 3HFOA 3UE0A 3VR3A 5CTUA 1BIAA 1GFCA 2D8JA 1EIGA 4YKYA 2IT1A 4FIBA 3RR5A 3S9WA 4FXKC 2V8JA 3VV0A 1S5CD 4CJ1B 2HSEB 4N9PA 3M7GA 3S2HH 4YKRA 5K36G 4OB3B 4ELZC 1TUCA 4DBFA 2L12A 2EYFA 4ME5A 5CTWA 5DNFA 2G5DA 2HCKA 2JA7B 1VQLA 1Z7TA 2G3RA 1EA6A 2BE5D 5KGUA 1YJNA 4LE9A 2CP2A 3ME9A 1KD1C 2DY8A 1QCBD 4FT4A 5C44G 1PC0A 3U4VA 1B7YB 1B9NA 3TUHA 4BE0A 3HYYA 3A8OB 4R1JA 4O0AA 1UECA 2Y90A 1LTSD 1SRLA 2VGMA 4MTNA 3FB9A 4APVA 4DQ2A 4H02A 1T3SA 3SHWA 2C5CA 2BH8A 3OYCA 1XPRA 2LCLA 1PZJD 1Y69U 3C0CA 1P16A 1UAPA 4A3LG 3FV5A 2E2JH 1XNIA 4PLLA 2YUQA 3A54A 1HUNA 3TZ5A 2PI2E 4J6HA 4EMVA 2SDFA 4NMZA 2VKNA 1GKHA 3PUWA 2EPDA 2XHCA 3LYIA 4L5GA 1CFMA 3V05A 3M0UA 1XYIA 2XDDA 1EOTA 5CTYA 1LVKA 4JBWA 2GVAA 3M58A 1GKXA 2AKKA 3CCJQ 2K2MA 3RERA 2XG8D 1PTOC 1NAPA 1HTLD 5GMKh 4XYOA 4IFDH 3NENA 5JJLA 4M75F 4C92C 3RKXA 2YKEA 1SR3A 4XYQA 3HOUB 1OXUA 2YI5A 4FYWB 1PZID 3I4NB 4GKKL 3DGEA 2EY6A 4OWXB 3EHQA 3S3MA 2R7ZG 1ZLMA 3L2WA 2Y0SG 4BY7B 3MTSA 3J81i 4JI7L 2C2AA 2M0YA 2VXFA 1AZPA 4C3HH 4HXJA 2EKOA 5IHNA 2GTOA 3I5RA 4OIKA 2PZ1A 3META 4JDSA 2ZDXA 5KE2A 3SWNB 2L55A 1B1ZA 3V96A 2KSSA 4DUZQ 3D7SB 4FYYB 2M00A 1D6EC 1K83H 1PDQA 2D9TA 1EOVA 1NMFA 1ZA1B 3S1MB 1X2KA 2AUKA 3C1FA 2ID0A 5CKDA 2NUCA 1U0ZA 2DRKA 2KECA 4ZTJA 2HSPA 2K14A 3ULPA 4JVZA 4PMCA 2KUMA 1PFMA 4A4GA 3K7UC 2E5KA 5CYUA 5GROA 1TWFB 3TSSA 4C5EA 5C3EH 2QA4A 4L93A 2ZXOA 4BY1H 3S17B 3EGXB 3CCUA 3HKZE 3NPPA 1FD7D 5M4MA 3HS0C 1HZAA 1IW7C 2CHBD 1V1QA 1H9MA 4J9DA 4IOAA 2YJXA 4FSXA 4XIGS 3DLLA 5GAN5 1TIDA 2LP5A 4UAIA 3UA6A 3P8DA 1XMOL 3X20B 4K5WA 2XKOC 5IWAQ 1G3TA 1HA6A 3URYA 4WJWA 1CSKA 3G6EQ 4YCVA 4JI3Q 4BXXG 3U50C 3RMSA 1ENAA 2CKZB 3X3NA 1IBLQ 4DR4L 1HR0L 1JQQA 1WYDA 2CGHA 5GMKi 1BBWA 3E0EA 3OYEA 1TWAB 3G6JB 4N9TA 4HJ9A 2PNHA 2VGNA 2VQFL 2YLCA 2DNEA 1BI0A 4A93H 1VQFA 2QTVA 4C8QB 1NR2A 3KLSX 2YE7A 4IPCA 4M1UB 3EVQA 1NHJA 2L5QA 4FCQA 1KNEA 2MWPA 2B63G 2XTIA 2LQKA 1S3OA 4JRPA 1TR5A 3SR1A 2RMOA 4A4IA 1RAHB 3QWXX 3TSWA 2IX1A 1ILPA 1B7TA 3AQQA 3SE0A 1CI3M 2JUFA 2B86A 2ZT9C 1WXTA 1R77A 2XWJB 3RNUA 4F7UE 3CRKC 4J7IA 4NB3A 4AG1C 3EROA 3LWUA 4GN4B 1A2TA 2AQ1B 4ZQ3A 1PH1A 4HCKA 1NJIR 5ELFA 1IYUA 3X25B 4JI5L 1AHJB 3RIRA 1GVPA 3VYTA 2YEDA 3NBHA 3QJ6A 1LJOA 1SYGA 3A5UA 3LMMA 1QKWA 3GP8A 3M53A 3GQBA 3TP5A 4BY6B 1I6HH 1XXGA 2NN6H 4P5NA 5M3FH 2CREA 1YNXA 4X62L 2KYBA 1I50H 4HEDA 5JVG3 2CH4A 4B3ML 1XQHA 2MMPA 3BDUA 2UUAL 3LH0A 2FRYA 1H641 1KC8C 2E6NA 5CV7A 5EJWA 1RTOA 3R91A 4Y92A 2MJ8A 5BN3A 4MPCA 2KCNA 2CQAA 1BCPC 2YRVA 4FYDA 2MCNA 1UY8A 4X3SA 4KGVB 4JI1Q 3H94A 4ZN3A 1SSFA 2KENA 2KI7A 1G6PA 3JAMi 2LDMA 5C4JH 2IHFA 2E4HA 1E7OA 1EIHA 3QDRB 2C0IA 1G91A 2PVGB 4R4QA 4M77F 3G7EA 1VQCA 2VQEQ 5BR8L 2EYZA 3EHRA 4K5VA 4J8OA 2HHHQ 4LP0A 3BDLA 5GMKl 4P74A 3RZOB 4I3HA 4HT8A 4DOWA 3A7AB 1S40A 3HOWG 1HFNA 2EVRA 3VS3A 3OSOA 1I5LA 2MGSA 3CCLT 3A0ZA 1FNWA 1R8OB 5KYXB 1V1PB 4WCIA 4L94A 1TUGB 1C4QA 1A4HA 4R3AA 1CM9A 2QGFB 2FYPA 3MAQA 1M9SA 4G7HC 1K9MU 2I07B 3UE1A 3D31A 3WXMB 4FL6A 2K1BA 1HFGA 4Q0FA 1GUOA 1ZXTA 3SK4A 2QF6A 3JCMJ 1LYLA 4F16A 2M02A 5GAMh 1TWGB 2O5JC 3ICEA 3FIFA 4ANJA 4E6RA 1PXUA 1VQDA 1UB4A 2RHUA 4KJOA 4DKAC 1OQKA 3MZ5A 3V8KA 1EQQA 1FJGL 2BU2A 4EGHA 2Z6KA 4DBRA 4A53A 3E0JA 5EAYA 4LF4Q 4KGZB 3CGZA 3EG0A 3OYIA 5IGBA 1H95A 4ZUJA 1HNWQ 3X3MA 4F7UA 3KFUA 2F3IA 4BQJA 2CCZA 5M3MB 4XTZA 4LXCA 3R92A 1UYCA 4EMKB 4EMHA 1M90U 1XTCD 3E6ZX 2XK0A 1MHWC 2QILA 4OXPA 1EY6A 1JWMD 5EBDA 1HH2P 3S16H 2JQOA 2WI1A 3Q23A 3J7AV 4AQYQ 1MSHA 2LCCA 4QPKA 2GBQA 1M4VA 4OGCA 3JCMP 2K2VA 2IHEA 4E7LA 3A8IE 3NEMA 4QVDA 1GOZA 1B8AA 2K5WA 3CMAQ 1K8MA 4RG2A 1DOLA 2ABLA 4BDZA 4C8QE 3TREA 1ET9A 1XMQQ 2XWBB 4HJAA 2EAYA 1EFWA 3A5ZB 2R92B 1NPRA 1GCPA 2VVKA 4M78B 1C1AA 3CBPA 3QSUA 1F9PA 2CWAA 2R61A 2TMPA 3B27A 1LT3D 4IN3A 1G8XA 2LJ3A 1SJHD 1TWCB 2JN4A 4IUNA 5C0XI 2BU7A 3F70A 2NLUA 1BI3A 4R8IA 3SVMA 2NB0A 3H0GH 3QXEB 2VL6A 2CCSA 4LUOA 1K0XA 2J06A 1S1NA 2KDSA 3CCST 3W1BA 2OTLA 4MP7A 1MV3A 1VQNA 3PIO3 2YEIA 1K3BC 1VQ6Q 4OP0A 5GAN7 1RAGB 2EY5A 5GAOq 4OO1H 3HEJA 4C0FA 1SMYC 3QKJA 5ELDA 2UUBQ 3OPDA 1IXDA 3SDZA 1IL8A 2FFKB 2K33A 3QYGB 1HR0W 4OMFB 4C92F 3BW1A 4C3JH 2JTEA 3C4SA 2PUKB 1LTGD 2K5QA 1WNLA 1XJWB 3H0FA 2VB2X 5NUCA 4HIKA 1K9MC 1I58A 5IP9H 1WJQA 1OXXK 1ENCA 2MWOA 1NBWA 4DPGA 1VQ8A 1EFNA 3MEVA 3JB9I 2N88A 4S3SA 2KRNA 4B3TQ 3IAYA 4YKXA 4FCPA 4M4ZA 3FKIB 1TG0A 3TN2A 2CP6A 2DY7A 4FDBA 4A3IB 3FLGA 3QR8A 4UROA 4XKAA 1D09B 2N55A 2QXFA 1UGPB 1VIEA 2K50A 4DUYL 4XU1A 2FZGB 1VQPA 3HOYB 2J4XA 2NUPB 3RESA 1GXIE 3C0EA 3HSBA 2VYTA 1YJWQ 1EY8A 3I4MH 4R9WA 1QLYA 4KUDK 2RPNA 1SYBA 3PF5A 2ATCB 3CMAT 1Z9FA 2RHQB 3CW2C 3SK5A 1WFWA 4BBRG 2F0VA 3FMCA 3W2DA 3ZL7C 4BQGA 3T13A 1BXTA 1CQVA 2HKNA 1JICA 1G8ZD 3KYHC 3HKZG 3RLNA 2ZXRA 1WA7A 1M90C 3A8MB 4N4HA 1F9SA 2RQRA 5D6XA 2E76C 3PMFA 3RUZA 4RTZA 4BBSB 5D14A 1OPLA 1B2TA 2HKQB 1BXDA 5D7UA 2R93H 5A2QL 4DR7L 4IIOA 1V43A 2QW7A 4JI6L 2LT4A 3G71A 1A3TA 2RO0A 1YITA 2L5TA 5DY9A 2KHSA 2L3SA 2QG9B 3IKJA 4H85A 4JOIC 5LMUL 4C8QA 1M27C 3OYKA 5CORA 1SSHA 2EJGA 2A19A 4HIMA 4LDWA 2F52A 1PH7A 1HNZQ 1QW1A 4L5RC 2RJCA 5HY6A 1VQ7Q 4GN5A 2PNRA 1EUJA 4DV7L 3HRTA 1PTOD 4HCEA 2N8NA 3A8LB 1QVGS 2A74C 3RZDH 3GTOB 4KKUA 1G5VA 5C93A 4HA8A 5FU7B 4RKBA 3S1RH 3AT1B 4MZMA 3RD4A 4PNOA 4E7JA 5C0XJ 1SPKA 3LX0A 1CA5A 3M54A 4J9BA 1O75A 2HBPA 2R3ZA 3ZKDA 2COWA 2HL3A 3EFOA 1RAFB 2F5KA 1Q90A 2WIIB 4LF5L 2PTKA 4ZGDB 1AWJA 4HSVA 2HQEA 3M5AA 2HHHL 2YE8A 4F7UG 2YKCA 1YSRA 3QOJA 4UP7A 5IDMA 1GHKA 2X4WA 2JMCA 3L2RA 3MXNA 4DV5L 2A28A 2CDTA 4A3EB 2JA7G 2IOPA 4A3FB 4FCRA 1F2YA 3EFXD 2Z0WA 2CT3A 1Q86U 4IFDG 3HRSA 3NTHA 2DJZA 1EFID 4M78E 2DIGA 1FX7A 4PJOE 2QQAA 2DN8A 1Q82R 5KIXA 3H8ZA 4EQNA 3DM1A 3Q5JA 4V26A 2R5MA 2Q8GA 4XIRA 4M7AF 4MB9A 4HT9A 1AD5A 3U9OA 5IYDH 3CRLA 2LFNA 1BVSA 4C3HG 4A75A 2C06A 3UDCA 1LM0A 1YSZA 2NUZA 1IW7D 1QZGA 4DGZA 2CT4A 3AMUA 2CS7A 4O09A 3HFNA 2ECZA 1UEAB 1I5AA 1MV0B 1BCPF 3P20A 2EGEA 4XXEA 2LT1A 1GUSA 2PYKA 2E5QA 2O5IC 2GFUA 2QG2A 2VW5A 4RTUA 1RAEB 1HSQA 4Q5WA 1CKNA 4K6LA 2DYBA 4DF7A 5C44H 4ODGA 4IJHA 4HIOA 1D0ZA 5HURA 3KUPA 5C3EG 3NTIA 4QB4A 3LH5A 1F51A 4MPEA 4BY1G 5KYXA 1V1PA 1ZBXA 3KDFA 4GNXC 2DEQA 1VQ7T 2DYIA 4CKBA 4WUDA 3BVZA 3PSIA 2VC8A 4NXNQ 5BOCA 1EWHA 3VS5A 2DJQA 1EIFA 2MUYA 2XN9C 2RCNA 2RJEA 2FL7A 3A1PA 3DB3A 3JCMg 2DFUA 3MJXA 1LO5D 2AQ3B 2ROTA 3MC0B 4LWCA 3PFSA 1Y1WB 4YIJA 1S72A 4RAUC 1G291 1BKBA 1Q8IA 3PF4A 4A3KB 4B3RL 3HOVB 4KHPQ 4CE1A 1M2VB 1A6XA 2AK5A 3OYLA 1WJSA 3NK9A 2YLBA 1KLGD 1V29B 1I4HA 1YHQT 2Z8LA 4KN7C 5G3LF 5M5XB 3S2DH 2RSOA 2YE5A 1SSOA 1AVZC 5GAN6 3K81C 4NXMQ 2YRCA 2EDGA 1D2BA 4HIDA 1O78A 5D65A 3TU4K 4NDXA 2YE3A 2CZ0B 3NHHA 2TSSA 1RODA 4H13C 2ZM6Q 1JB3A 4RFBA 4EMKA 2XX4A 5D7DA 4XCJA 4AFSC 1OSFA 3RKZA 3G7ZA 1DJRD 1A2UA 1TS5A 1H9SB 5H1SE 4M75E 2E2DC 4XKKA 3I90A 4ZKBB 4ZGJB 4LJZC 3VYSA 4M7DC 4IUUA 3CD6A 2VS1A 4NH8A 4CWOA 4OHJA 1BCPD 1Q86C 2VB6A 2M9VA 1QB5D 1VQKQ 3J80L 1VF5C 5ELBA 1YS3A 4U673 4M78A 4EDUA 4PJOA 2RBMA 3OMUA 1MD2D 4Z02A 1Y8OB 5D6YA 2NN6G 2ZGWA 4IOCA 2NVYB 2RDHA 4OMOA 1AM1A 4C8QG 3TMEA 4P7AA 4X6AH 3QTFA 2H5XA 1I3QH 4F04B 2MAMA 1KRSA 1Y4SA 3QO3A 3CCVQ 1STAA 1E3PA 5F5RA 2GQIA 3CQTA 3DWPA 4CWPA 5EKLA 3TP7A 5HK0A 1AE2A 1PD0A 4J9FA 1QNKA 2EYJA 3C12A 1DCZA 4GOPC 4A3CH 3DEOA 5TSSA 5GAOl 2OCEA 5D6QA 5KYYB 2I0NA 1A8VA 3EHHA 3D2RA 3VR2A 3QWNA 2A68C 2EYWA 1Q95G 2DVJA 5G3LD 2PQAB 3WOFA 1GXDC 1GJVA 4K14A 2BIVA 1UY7A 4FYXB 5JOBA 2QDBA 3NSWA 3K60A 2KMTA 2XCMA 4LWGA 2Z1CA 1FGBD 3CCRQ 3QZ9B 3GIGA 4OMQA 3VYRA 4LDUA 1Q81C 5C3XA 4X34A 2V1CC 2DD4A 2K9GA 3PT9A 1VQ9Q 4IALA 2F4IA 4JBKA 2B63H 1HPCA 5C4XB 1EL0A 1UY9A 2XHXA 4ME3A 3U2DA 3X26B 3MXPA 2WI3A 5IN1A 1X2QA 2HD3A 2FMCA 3T0ZA 2HEQA 1X01A 1RLPC 2RD1A 1Z6HA 4KK7A 3CYGA 2K32A 4NH9A 4UC4A 4FXGC 5M4EA 2NVXH 2IJ0A 1QNUA 4J6YA 2BYHA 1NUCA 2XK2A 1XPOA 1PM3A 2DPPB 4K4OA 3N5BB 3E9IA 3K0YA 2VASA 3CC7Q 1IYJB 3CBMA 1O7YA 2DJFC 3FPUB 1EYAA 5KYUB 1I94Q 5JPNC 1SYEA 3CP0A 5C5LA 2EYXA 2C1GA 4EFTA 1AMWA 3OTOL 5D6PA 2A0FB 1C6VX 2LNVA 1EY7A 4M75A 4FO2A 1TWHH 3L7ZC 3QOLA 2AKLA 3E9FA 2D0OA 2EY2A 1PLFA 3VJPA 1WTPA 1LUZA 3HKSA 1PTOB 2L0AA 3VRYA 1I07A 1W1FA 1T9HA 5LJ5g 3CC4T 1U4RA 4IO9A 1SHGA 3M7NA 2BZ5A 4XTUA 4BXIA 4C92B 2QQSA 1ZXNA 1OPKA 1VYUA 2F69A 4A3JB 1IBKL 4Y52H 5LJ3g 5DAUA 1X9NA 1KTKA 3PO2H 3T1YQ 3CCJA 2JA5H 2QEXT 5DEHA 4JW0A 1JJGA 4E00A 4JZ3A 3CCRT 2WI7A 1AE3A 1I4QA 3I4LA 4WORA 1B50A 1EY5A 3F2DA 5A2QE 1VQ9T 3A7LA 3M59A 2ZDYA 4LWEA 2IL8A 4M77E 2FWZA 1H7UA 1I5BA 4PU9A 3M9QA 3A55A 3H0GG 4LF7Q 5JAVA 3BY7A 3ZBDA 4HVUA 4V0BA 3VYUA 4II1A 1TT2A 4QPJA 2RB6A 2JE6I 1H3ZA 5KYLA 3J80c 2X6GA 3GTGB 4G7OC 3Q5LA 2K79A 1ZSGA 3NTKA 1UE6A 3CXCA 1YI2Q 1I0CA 4XD8A 3VHCA 3UWNA 2X4XA 3H0HA 5FJ8G 4OO1G 1UNSA 1UDLA 1X75C 1DXMA 2B29A 3E9HA 1UHCA 4Z89A 1VDZA 3I7FA 1STYA 1NYFA 1K73R 2L15A 1N8RR 4HSPA 4RGMA 1VUBA 3QZ5B 3HOZB 4KHPL 2R92G 3VU3C 4M78G 4K8IA 4PJOG 1RAIB 4QKUA 3HP3A 4C3JG 5FO8B 1HHVA 1BNZA 3E2UA 4Y28E 4ZLTF 2EKHA 1CKBA 3GTLH 5IP9G 5FKAC 2VUBA 4HYMA 3ER0A 1UYIA 3B24A 3T1HQ 2LS01 3D8GA 2H3JA 4JI4Q 2C0OA 6AT1B 1IHVA 4DU9A 1GRIA 2ROLA 1V1CA 4LF6L 2ZPFB 2YU9H 3CXCP 1JORA 3IEDA 3AEVA 4HZ5A 3VA7A 5E3FA 1KZNA 2ED1A 5M5YH 2O1VA 3G75A 1GO3E 3A98A 3AU7A 4EMGA 2E3HA 2EE1A 4P75A 1PHTA 2CQOA 2X69A 4L63B 1KD1U 4C1NK 4IURA 4GQTA 1TOVA 3KLWA 5CMDA 3JB9F 4HXZA 1BF4A 2IPKD 2EY1A 3MWYW 3Q0AA 2LZ6B 3C95A 4LFCQ 3IFTA 3RR6A 5I6WA 1UEBA 5I4DA 3PO3B 1V1OA 3K8AA 3MP6A 1BI1A 2BU6A 4KGXB 4X9DA 5LMNL 4DR5Q 1H9JA 1VQ5Q 3FP9A 1SDFA 2F0HA 2DL4A 2PQWA 1I1JA 4HKEA 4MZTA 1LT5D 3CCQQ 2F0QA 1UYKA 1MMGA 4Z8AA 1L1OA 2K4YA 1K8AR 1PYSB 2E74C 2EYHA 3E9GA 3V7CA 2KYMA 2PO4A 1YCYA 2YDLA 4J5YA 1BO0A 3BU2A 1TSFA 1Q7YR 4TSSA 3WVDB 1G3WA 1QMCA 3OW2A 1YI2T 5LJ5h 4CDDC 2K5LA 5C6AA 5KNBA 4FF1A 3OW6A 4V190 4DV4Q 1A62A 3S15B 1AJ6A 4R56A 3W3AA 2CZ6B 4KUIA 5LJ3h 1HCZA 1BCPB 3D4WA 4M77A 2RHYA 1H9SA 4IZ8A 4ELYC 4ILWA 5I9OA 2JYOA 5D7RA 3R4OA 2BSMA 3AFQA 3ND8A 2QKIC 1Y1VB 4BD3A 4A3MH 2I5LX 4XDMA 4E02A 2P0PA 1D5ZC 5C3WA 2XD6A 5A35A 4N8X1 1BIBA 4A3GH 1BYMA 2JTMA 1B9MA 4M75G 1TS4A 1BI2A 3GTJH 1RJTA 2CYZB 4FCYA 3GNGA 2NZ1D 4MZPA 2AUJD 2OEOA 3T9NA 1TQOA 4M7DF 1VMPA 4KD4A 4PZ7A 3M3YH 3TRZA 1Y8OA 1GD7A 2EJFA 2JS2A 3CMEQ 4X3TA 4ZNXA 5KNCA 2CP3A 2HL5C 3HGBA 1UGSB 5HCKA 1LLRD 4CC4B 3MEAA 1SAPA 3S6WA 2EFIA 2O2OA 3L2VA 1A3VA 1M1KR 4OEMB 3UDIA 4X9CA 3FEOA 1U4MA 3INWA 5DLQE 5J22A 2RM4A 3OYYA 5IYDG 3MHBA 2DXTA 1DZ1A 2XX2A 1HUMA 5CKEA 2B2UC 2HIXA 2A3LA 1WCMB 3NXWA 3VR4A 4Y7NB 2VNUD 2NVTB 3CKIB 2E2HB 3H15A 1U2OA 4QW2A 4QQDA 3H09A 3KF8B 2CZ7B 3J80E 3CD6T 1CHQD 1WPYA 4IPDA 4ZRZA 5JEAH 3KJOA 4E7SA 3CCSA 1FNVA 1ESFA 2PQAA 3O0IA 1IB8A 4CKEA 5A0LA 3OS2A 1N33L 1IHWA 1LTRD 2BH2A 1K9AA 5GAN3 1NG2A 1N6AA 2WSCE 3DHQA 4FF3A 1OU9A 4QQGA 4JBJA 2PMZB 1FWZA 1PFSA 1W4SA 3T2SA 1IZ6A 2YXYA 4HCSA 3X24B 4JC0A 2HG1A 3GTPH 2VCIA 4IKFA 2XDPA 2L0CA 1MX0A 4XE2A 5HK3A 2K5HA 1A0IA 1UGVA 4DK3C 1KK7A 1N9RA 1PYBA 2WAQB 2JA6H 3S1NH 2XNAC 5I9PA 2E41A 4I65A 5GANg 1TUDA 1U3OA 1Y07A 2DBMA 3TZDA 4WFN3 2D8HA 1X54A 3PVQA 4JQLA 3QIIA 2E5LL 1EX4A 1JXMA 4B6MA 1D1KA 4DK1A 4EEHA 5COYA 2FYKA 4PL9A 1IREB 3M0TA 1AP0A 4JV5L 5GAHC 2A08A 2JA7H 2PNIA 1JXOA 5KYUA 4M7DD 4NL3A 2Q8HA 2XICA 4RKUE 4JUVA 3VS0A 1HTPA 1Y4UA 1NEGA 2EYQA 4GFNA 3DXJC 2UU9L 2YTVA 3CMET 1UE5A 1YNJD 1WOCA 3CMAA 3DM3A 2CUDA 3HZXA 3K7AB 4XCLA 1Q46A 3KBGA 1TXQA 1UJYA 4OB1B 2F0MA 3A0JA 3LW5E 2PW7A 4C3IB 4DR3L 4DZYA 3M4GA 1N36Q 2LQNA 4JYAQ 3M85A 4RKLA 2DD5A 1LABA 1O7IA 4YCUA 1K3RA 1WTOA 5FO7B 2J6KA 5KRUA 4C92A 3INXA 1KC8U 3QJYA 3TZ4A 3FT5A 2KEDA 2M1HA 2FRWA 4AH6A 1UYDA 1TWBA 3HTRA 4R3MA 4M7AE 4J8QA 3PIOA 2ZTEA 3B6YA 1O80A 5KYWB 2JA9A 4K5XA 1Q8KA 1QUQB 1S4ZA 2DVEA 1XJVA 2O1WA 2E3IA 2OF1A 2LY7A 4RG1A 2YEHA 3Q22A 4LWFA 5J6AA 1G2BA 1VQ6A 3GTKB 1AWWA 3TDQA 2F0KA 4PV1C 1SFOB 1ICFB 1OXSC 4JG2A 2A68D 4X3KA 4ABNA 2VXEA 3HOUH 3I4NH 2JJQA 2VWCA 1F1BB 2CW0C 4L6V5 5M4PA 3TZUA 4GKJQ 2BE7D 2CUBA 3BYTB 4BY7H 1WHLA 2RI2A 2F0GA 2F0JA 4LF9Q 2EGCA 3INZA 2E8GA 2ZJQA 2A36A 2M0OA 1LOJA 4C0GA 4M77G 4LUEA 2QG0A 2X4YA 5GAMg 2C1IA 2WB1B 4KLKA 2B2YA 4L5SA 4A3CG 2VXWA 4DV1Q 2DJGC 4HJ5A 4DOVA 2LTOA 1ZUYA 4JI2L 1E2VA 2IWXA 4N0AA 5LMNW 4LFCL 2BE9B 2E12A 3S1MH 5CPHA 4C56C 4CWTA 1GFDA 4ZKCB 3A0WA 3CCJT 3GPLA 3IL8A 4BA1I 2EYPA 5JVH3 1BBZA 2GQVA 1VQAA 2FVUA 2PU9B 1TWFH 3D0FA 4YKUA 3ITPA 3LNUA 4BE2A 2IWHA 4ZVIA 2JEBI 3S17H 2UWDA 4PG3A 5E4XA 1VIFA 2B2WC 5F2DA 1YHBA 2ZTCA 1SXTA 1U1TA 1Q3LA 5EGTA 5CV8A 4TVAB 3HHTB 2YTXA 4IFDI 4PMWA 5CQYA 3OS5A 4FMTA 2EJMA 4PMBA 5GANh 3H91A 3K58A 3VRZA 1LTAD 1WTQA 2DL8A 1EZ6A 2FHTA 3F2UA 3QUIA 2AHJB 4XQJA 4X64Q 2DE0X 4FW2A 4A4FA 2PMZE 1M8MA 1TWAH 1YIJQ 1M5Q1 2YV5A 2WKDA 1FMVA 2K5FA 4PK4A 2XGTA 4DV0Q 4HVWA 3MA2B 1X27A 1P8LA 2UXBL 2LCSA 1S5BD 2COZA 3R8BA 1VQ7A 4F8MA 2Q2UA 3R4MA 2K7AA 1IBML 2DLPA 1SROA 2UXDQ 2Z0SA 3QIAA 2JNGA 2HQHA 1B3AA 4LFBQ 5JENA 2Z9HA 1I5CA 3D3RA 3G4SQ 2EQUA 2X6LA 1BOSA 2JW4A 3HPWA 4M7AA 2BU5A 1PV4A 1YESA 2GN5A 3HEKA 3I3CA 5A0DA 1ZSZC 4RGTA 4ZTFA 3L2QA 1ZKOA 3LWHA 1FVIA 1N32Q 3G6ET 2Q8IB 1I5FA 1STBA 3HRUA 1YHQA 4LW1A 4OX9L 2BUDA 3C94A 2K75A 3PO2G 4IJLA 1LNXA 3NELA 3MP1A 1SMXA 1XWEA 2JA5G 4QVZA 5EC7A 5CCAA 4LD9K 5CTXA 5IP7H 2KXDA 1JJCB 3SFMA 5JEAJ 4AFUC 3UI2A 1LT6D 1RLQC 1IRXA 1XNQQ 1SNDA 1X3EA 1EEFD 2JA8B 1A3UA 1CKAA 1SF9A 4RCNA 1THNA 4HTHA 3ZJYC 2BT0A 4MOTA 2BTZA 3QG1A 1MGQA 3LGFA 3EQLC 4QQBX 4NPSA 4AS9A 2YKBA 1UFFA 1J8IA 4PQXA 2YEEA 3MEWA 2YE9A 1TU2B 1NMGA 1PH5A 2P5ZX 4Q5VA 3TS0A 3OW7A 2JTFA 2ZXPA 5BN4A 3M57A 1D1AA 2OAUA 4BI4A 1KFZA 3K5LA 1KQSA 1EZ8A 1GUTA 5D3DA 1OX9A 3ERQA 3OYJA 2NTTA 2ZBKB 3EHGA 5JJZA 3RZOH 3QPHA 1SYFA 2KROA 3M55A 3RNJA 1S14A 4LUDA 5IGCA 2CG9A 2DAQA 2EYLA 3EFRA 4L59A 1E2WA 2YRDA 2CCUA 1VQLQ 1QZRA 1YJNQ 2GFAA 2A6HD 2NN6I 4BWGB 2RJDA 5I2YA 2DBKA 3OMCA 4ASGA 2EZVA 1U1SA 3PV0A 5AJ3Q 4JRIA 1EY9A 4KTAA 3RUXA 5CQXA 4N8FA 1Y8PB 3L0OA 2WSEE 3L9AX 3JC66 4PJNA 1K28A 1N36L 3O2FA 1H92A 5E7NA 2C35B 4AWQA 1TWGH 3S1QB 3Q6SA 5IE8A 2EQSA 1TU0B 3GTQB 1VQOQ 2YE4A 3WQ9A 2RI5A 4DUZL 4PL6A 4KULA 2QQBA 1RACB 1JRIA 4M7DB 3EG2A 4O1NA 2CWPA 2JM8A 3JCMe 1B63A 1M3CA 1ENFA 1IHZA 4J7FA 1M1FA 2CP5A 4MTKA 1W6XA 5M3MH 5FW9A 2DK3A 4YY3Q 2H1EA 3I4OA 2DZCA 2JMAA 1JWUD 4MDXA 5KCOA 4DR2Q 7AT1B 5LHY1 3U2KA 4IUVA 4OVAA 2E75C 5EPKA 4LWIA 4R4OA 3OYFA 5FJ8H 2DRMA 1I6VC 2N78A 2CVRA 3U4ZA 3EKOA 2CP7A 1VQKA 1B4OA 4B7PA 1PTOF 2QF7A 1GUWA 1K9MR 3OWFA 3SL2A 5IWAL 1ZEQX 2BA1A 2R92H 2LSSA 1KXLA 4JI3L 2O01E 1VA7A 4Y91A 1VQIA 1IBLL 3SWNA 4KY7A 1OV3A 4GOPB 2LRQA 4AG2C 3JCMd 1TWCH 5J1ZA 4CE3A 1IGQA 4A3MG 1AN8A 5CK9A 3KK7A 4YHHQ 2V8IA 1PH8A 5M9OA 4A3GG 1OU8A 4DV6Q 2F0OA 2XJGA 2HZYA 2B8AA 2BKDN 5KYWA 3CC4A 4KH1B 4FSSA 4RHSA 1PH9A 1K8OA 4KQVA 1KNAA 3BFMA 3UATA 1WXUA 4V2SA 3QB3A 5T1GA 2BOSA 4O42A 4ZKIA 1JU5C 3EGXA 4M7AG 1OO9B 4DXFA 1KQ2A 4A3DB 1NLOC 2K4KA 1VYVA 4C0DC 3QBYA 4HMIA 1WFQA 1SN8A 2QEXA 1MHNA 2QGGA 1DYQA 1L0YB 2OWOA 5I2MA 1YHAA 3L2ZA 1VMCA 1VQOT 2WV6D 3CCRA 1G83A 3KF6B 3MFYA 2YK2A 3M0SA 4GZYC 4A3BB 1VQ9A 1BCOA 2XD0A 1G51A 1Y71A 3CXCS 4CWSA 1C7YA 2O1UA 1PCXA 2EIFA 5JEAG 3RLRA 4JLIA 3J81E 2F0SA 2RF4A 3FVQA 2P4TA 3CCEQ 3FKIH 5AFWA 2A73B 1QOHA 4A3IH 5KYNA 3AFPA 4JJBA 2DEUA 2N49A 5I21A 3RMHA 3HOYH 4FF4A 3U9SA 1OTCA 2CZ1B 2KE9A 1VQJA 1X3GA 5JPMC 1VQ6T 4JRQA 4CWQA 4LK1C 1YVCA 3UPUA 3GBQA 5FLXL 3CCMQ 4JI1L 4PKCC 2K6DA 1RD9D 3CQZB 2JA6G 1UGRB 2SNSA 1WD1A 2EJGC 1TBWA 3BJUA 3C3LA 3OA6A 3N6RA 4WJ4A 2PNRC 4DBHA 5IN9A 3T16A 1LV9A 5GGZA 4OO1I 3X28B 1WCMG 2VQEL 4BBSH 1UUPA 5T1IA 3PQIA 1WI5A 4JBMA 1KJWA 2GNCA 4B3SQ 1ZQ1A 2VUMB 1E22A 1PFNA 4OMPA 2CGFA 2C0TA 3UT1A 3I56Q 1XNQL 1PG5B 4GLVB 2IX3A 1X55A 1AFPA 5M5WB 2RVLA 1GCQA 2MOXA 1SYCA 2FINB 1YFNA 1Y8NB 4AIMA 3DEPA 3NMZC 1YJWT 1JJ2A 3NWTA 3ZEHA 1RAAB 2E65A 1PD1A 1NSNS 2L1BA 2A37A 4LN2A 3GTOH 2YECA 1ACMB 2Z6BA 1U4PA 2FB7A 2NVQB 1QKXA 4ALPA 5I2SA 4IIMA 1AEYA 1PH2A 3F2CA 3PE0A 3HZ1A 2YE6A 2D0QB 5GAOr 2XDBA 1TC6A 5C6SA 2GFDA 2CW0D 2YEBA 1FL0A 2Q8IA 3K80C 4OMMA 2HKJA 1K1ZA 4DV2Q 1ET6A 4XT1B 1II3A 1O7ZA 3CRLC 2J7IA 2DA9A 2MIOA 4CC2A 3OBWA 3CCET 1NEBA 2COYA 3JCMb 1NE3A 4OL7A 4LF4L 2QDLA 3OIPA 5FWBA 5LJ3e 3OS0A 4CDCC 4A3EH 1HNWL 3OS1A 1W3SA 1YI2A 1JJ2P 4FM4B 4A3FH 4ASBA 5J39A 1M2OA 2L3QA 2JN0A 3V8LA 4K0KQ 1DD2A 3CC2Q 3U67A 4HN7A 3EGDB 3HOUG 1M8AA 2MFIA 1MIUA 3I4NG 2JSOA 3S3OA 4AQYL 3CCMT 1Q82C 4PRVA 3VS6A 2ZKJA 4HVVA 1NM7A 1E6HA 1Q81U 2D1XA 2HCCA 2MPMA 4BY7G 1QCFA 4BB7A 3UA7A 1TIID 3MEHA 4PNYA 1M4ZA 3TSZA 3SK8A 2HDMA 4R4IA 4F7XA 4Q20A 1XMQL 4QIWB 4B9WA 1Y0MA 4X66Q 3AB9A 5LJ5d 4DK6C 3JCMQ 1PMRA 3CHBD 2K5VA 2KHJA 2Z4IA 3FPPA 3I70A 4LF8L 1FNUA 2E2IB 2EXLA 2LQWA 4GLMA 4C2MB 4OGEA 3L3OC 2H8MA 5LJ3d 4LFAQ 2O2LD 3WOEA 4D8DA 1RUWA 2DTIA 1X6GA 2R7ZB 3I56T 5CV6A 2Y0SB 4JI0Q 3L1AA 1UY6A 4DEXA 3VS2A 2Q8RE 3PUVA 5CC4A 1K76A 3OWBA 3FEWX 4X1VA 1NBEB 3EGUA 2I5MX 2G9HD 1EU4A 1PSEA 1WQWA 3OIQA 1CK1A 4MHEA 5IGGA 4DR1Q 2KJXA 1O7LA 4LDXA 1XPUA 3OPOA 4G7ZC 4RGOS 3IFDA 4UP9A 3RKWA 2GCXA 1Q86R 1OXTA 2B2TA 2YGFA 3PUZA 4BE1A 2FJ2A 2UUBL 1MKHA 3H3VH 2BZ8A 1UWVA 1Y8PA 4PRXA 2QQRA 4R4CA 1Y1WH 4EMKC 2K28A 4A3KH 3HOVH 3Q1JA 4DV3Q 4J15A 1F9RA 4J9GA 2RJFA 3UDXA 1YNJC 2RDGA 2K5DA 3K6OA 4NS5A 1QE6A 3VADA 3VR6A 1HD3A 2ZPIB 5M5XH 3I91A 5FLXc 4A54A 4B08A 1D0YA 1LTTD 3EA6A 4DAMA 1B34B 4C0ZA 4B3TL 4E6IA 3VUBA 2DTOA 3L42A 3H80A 5M4HA 3J81j 2WI2A 3J80i 1QG7A 2EQIA 1QCOA 2DX1A 3CC2T 2R7FA 4PJOC 1CSPA 2ZTDA 2JP1A 3KOJA 3P1HA 1BB9A 2HT1A 2XDSA 4RUGA 2Q2EB 4QMGA 1L0WA 4UDUC 4EVOA 1VQNQ 5IOCA 3M4OB 4O05A 3S3NA 1Y96B 2JJCA 3QDFA 3H4LA 5GMKe 4XITA 2DTHA 1JB0E 5CVIA 1I59A 2XRSD 1H9RA 4TKOB 2O9SA 2FMMA 3ULLA 4KJNA 1QWFA 3UDGA 3EG1A 1U9RA 1ZYRD 1F9QA 3RLOA 1WX6A 4O2DA 2RDFA 3K5MA 4JCVE 3A0RA 1A0NB 1YNNC 2ZPEB 4J9EA 4DA2A 4BUGA 4CI0C 1TKWB 2UUCQ 2DL7A 1HA5A 3CMEA 4GOPA 1KHCA 2EGAA 2NVYH 2ENBA 2UXCQ 4PJMA 3TQ7P 1WHMA 5CBAE 5GAGC 2V8KA 2MHVA 3K98A 2L11A 5FK9C 2BU8A 4KHZA 2ZZDA 2BRCA 1QVCA 5E1FA 1HNZL 4F14A 3MO8A 2NUPA 4L90A 4J6WA 5GMKj 1R9TB 3DMUA 1ZUKA 2EQKA 4NL2A 2JZ2A 3IRBA 4K2KA 1IO6A 2JS0A 1ABQA 4D6WA 4D8KA 1MBYA 2A6EC 2WI6A 2ZCFB 2XDXA 2KVMA 2YE2A 3EHJA 1VQKT 1YP5A 3F1ZA 2F4VQ 3EH2A 2RA2A 1I8FA 2KK4A 2FTKA 4J1MA 3EHFA 1SKUB 1GUNA 2YT6A 2HQXA 5IGFA 2GF7A 1NPPA 1U5SA 1J6QA 4KH0B 3J7ZC 3ZXQA 3FJPA 4HCZA 4B6CA 1HZ9A 1C0AA 1JWSD 2F0WA 5C4XH 3O8VA 1JMCA 1VQHA 4C1NI 1UYEA 3MNRP 1K73U 3S5TA 2JA8G 1BQQT 4NP5A 3PNWC 3CCVT 2YKJA 4GN3B 3K99A 4M75C 1U5KA 1N34Q 3U58A 1FYCA 5D6WA 4FNFA 4JLGA 2H8HA 1HZBA 4LUZA 1R4QB 2IWSA 2QGQA 4U7NA 3B25A 1WGSA 9ATCB 3HOWB 4E7KA 2EXZA 1AT1B 1U06A 2A5HA 3WWVA 4WF2A 2PCFB 4U7OA 2V1QA 1NTGA 3ERSX 1WD0A 2MPXC 3QWYA 4EQ5A 1NLPC 4UPAA 2F0IA 1B70B 1F2ZA 2PZTA 2IVWA 5GAOp 3EN2A 1QP2A 4KKTA 3SK6A 3BDCA 5M3MG 2QASA 1XOVA 1KG1A 1DONA 2YGEA 3OWDA 4EGVA 4LWHA 2I5HA 1YEZA 4O04A 3FRNA 4ASAA 2EWNA 2YEJA 3G7LA 1WHKA 2LX9A 1PTOH 3SEBA 3CEYA 2EYMA 4F88A 4MP2A 2YUNA 5J3BA 5KCHA 4I7AA 1Y8NA 5FLXE 3GLXA 5CR3A 4NXNL 4A3JH 1CSQA 1L0XB 5CV4A 2PPBC 1FXXA 5JJKA 1ID0A 4LDYA 3THKA 1TS9A 3CC7T 2Y4YA 2D6FA 1YZ6A 2EVBA 2F0TA 4BIUA 2DXBA 1YETA 3OHXC 2RK2A 2QFOA 3WVEB 4JJDA 4BA2I 2IORA 4HY6A 4LD6A 3ZYYX 5GANd 3R2IA 4LFAL 2BTTA 3PEHA 1RDPD 3V8JA 1ZUUA 4NXML 4J9HA 2P0KA 1STNA 3PUXA 3NWSA 3PVLA 5C4ZA 2XJXA 1AZEA 4QF4A 4JI7Q 3B28A 3VHAA 5KYIA 4QT7A 2MNAA 4JJCA 4YKQA 3GTGH 1MNDA 1A15A 3GNFB 2ZM6L 2K57A 2ESAA 2RHZA 3GF5A 3G6EA 2GVBA 1GM5A 4DR1L 3EGDA 3JSCA 3GO5A 4DA4A 4KN4C 1G6ZA 3MEUA 3FJ5A 3OSSC 3CU7A 3PIP3 4POGA 1AZQA 4OELB 4LF8Q 4KRTA 2XRQD 3NFCA 4QY7A 1SE4A 1K73C 1S72Q 2A6HC 1N8RC 3HOZH 4JJNK 5FWCA 1UE7A 3GIFA 4PFOA 2X9HA 1M2VA 1ZHIA 5IXBA 5IXFA 5E4WC 2GGRA 4C8QD 4DBQA 3K59A 4E01A 4XU0A 5GAMe 1M3BA 3I5SA 3SEMA 3JCMf 1IKMA 4WUCA 2BDNA 3OYBA 3M0PA 1KQSS 5KH6A 3FKIG 4G57A 4RGNA 4A3IG 4XDXA 1Z5BA 4OMNA 3ZFJA 3AYHB 1X32A 1XMOQ 3HOYG 4O0BA 1M30A 2R5AA 3BG3A 2YI7A 3NBHB 2B2VC 5CR2A 4RHRA 1XNRQ 1YT0A 4OB2B 4X65Q 1EYCA 4GY5A 1I4XA 4BS9A 3BYYB 4A3DG 4I7ZC 1MU5A 1K8GA 1L1OC 1FYNA 4DR4Q 1HR0Q 2RHXA 2XHRA 1JO8A 4CKCA 3A74A 1W6KA
chains in the Genus database with same CATH topology
1UYFA 1RI9A 2J6OA 2JM9A 2OAWA 3C0EA 4FMTA 4H81A 3VRZA 1QLYA 1JM6A 1H7SA 4YKRA 2DL8A 2LJ0A 2RPNA 1J3TA 3ZM7A 4EGIA 3KFVA 1WFWA 2WERA 4BQGA 3ZL7C 2DE0X 3R4PA 5BODA 1M8MA 3A0YA 1WYXA 1PRMC 1WDXA 1WA7A 2NWMA 1KIJA 2WI5A 2RQRA 4HVWA 1X27A 4U93A 4RTZA 2LCSA 1MUZA 1OPLA 2SEMA 1UYLA 1BXDA 3R4MA 4I5SA 4H7QA 2K7AA 2DLPA 5L23A 4IIOA 1I5DA 1TILA 1HJDA 1I5CA 4CC7A 1BKNA 5M4NA 2L3SA 1UUEA 2JW4A 4H85A 2KR3A 1PRLC 1M27C 2LMJA 2RN8A 1AWOA 1YESA 1SSHA 2BU5A 4CWRA 3HEKA 3CGYA 1JEGA 2XHTA 2PNRA 1YWOA 4YKTA 1BK2A 1OOTA 5C93A 3JZ3A 2JXBA 5EC7A 2YUPA 1SPKA 2DNUA 5CTXA 1UHFA 2KXDA 1E6GA 4J9BA 4GBQA 4AFUC 3ZKDA 1RLQC 2K3BA 3JV3A 2PTKA 1AWJA 1Z5CA 2YE8A 5FNDA 1K0SA 4L8ZA 1CKAA 3REAB 1THNA 1UYHA 1YSRA 2BT0A 2YKCA 4MOTA 2BTZA 3O6OA 2JMCA 4AS9A 1B3QA 2A28A 2CDTA 2IOPA 3VS1A 4FCRA 1AH6A 2YKBA 1AZGB 1UFFA 4Z88A 2YE9A 2YEEA 2CT3A 2LNHB 2V1RA 3UF4A 4URLA 2YJWA 1GKZA 2JT4A 4AWOA 3I9QA 3NMQA 2Q8GA 3Q5JA 4V26A 4BAEA 5IHIA 4XIRA 1PWTA 1ZX6A 4MB9A 1AD5A 1KFZA 4K11A 2AKPA 3CRLA 3EHGA 2XMFA 2ZBKB 3K97A 1YSZA 2KROA 2NUZA 3RNJA 1S14A 2CT4A 4LUDA 2CG9A 4O09A 3H41A 2ECZA 1I5AA 1PKSA 2LX7A 1MV0B 2EGEA 4F17A 1UG1A 2QG2A 2VW5A 3R4NA 1QZRA 4RTUA 1HSQA 4KSHA 2D0NA 2DYBA 4DEYA 1Z9ZA 2DBKA 4RTYA 4ASGA 4ESRA 1KSWA 2CCTA 1X43A 4JAUA 4DUHA 5IDMA 3LH5A 3T0HA 4MPEA 1WIEA 1BGQA 5ECAA 1W70A 2YSQA 1ABOA 4MPNA 3O2FA 2ENMA 4EIKA 1H92A 2FEIA 4AWQA 2RQTA 3O5ZA 4WUDA 2F2XA 5BOCA 3VS5A 2DJQA 2YE4A 2YI6A 3WQ9A 2YUOA 2FWYA 3Q5KA 1BYQA 1NHIA 1Z59A 3TZ0A 2ROTA 1GL5A 4EGKA 2KXCA 4CE1A 3EG2A 2AK5A 1B63A 2JM8A 2K5BA 1M3CA 3TVTA 2P4RA 4AFQC 1W6XA 4KFGA 5FW9A 2KGTA 2YE5A 4JASA 1AVZC 3BM9A 2JMAA 3U2KA 1NYGA 1PKTA 2JKIA 2YE3A 1X6BA 4A63B 4LWIA 1K4US 3A0TA 2DMOA 2DRMA 3EKOA 3WHAA 1GBQA 3M0QA 2HBWA 2XX4A 4B7PA 4O07A 4XCJA 4AFSC 3PEJA 5D7DA 1B07A 1OSFA 3RKZA 3SL2A 1PNJA 2SRCA 4XKKA 1VA7A 5GJWB 2XDLA 1OV3A 4NH8A 2XJJA 2F2VA 1Z9QA 4AG2C 2YEAA 3HZ1A 4CE3A 4CWOA 1S16A 2BZXA 3INWA 2W10A 2ESWA 1GBRA 1UJ0A 5CF0A 1YS3A 4EM7A 3EKRA 1WXBA 3OMUA 2XJGA 4FSSA 2KT8A 4KQVA 3UATA 1WXUA 3HZ5A 4ZKIA 4OMOA 1AM1A 1JU5C 2YKIA 2WEPA 4P7AA 2DM1A 1QY8A 1NLOC 2CCUA 3QTFA 1VYVA 1PVGA 1UE9A 1Y4SA 4J9CA 2RNAA 5F5RA 2GQIA 3U23A 3CQTA 5FNFA 4CWPA 1G83A 2YK2A 4J9FA 3M0SA 3CRKA 4YKZA 1TC0A 5M4KA 5D6QA 2DL3A 2FPDA 2I0NA 1X69A 2E0AA 2O1UA 2W0ZA 2YI0A 2IIMA 3D2RA 4CWSA 2CSIA 2EYWA 3RLRA 2DVJA 1UY7A 1AWXA 1GJVA 1Z5AA 3K60A 1TH8A 2XCMA 4LWGA 4JJBA 3GIGA 2KT1A 1US7A 4OMQA 4HXWA 4R0KA 2KE9A 1AH8A 4FPPA 2K9GA 1UY9A 2XHXA 2FG0A 2O31A 4ORZA 2VWFA 3U2DA 4CWQA 3RBBB 1ZXMA 4RTWA 3GBQA 2GQPA 1EI1A 2WI3A