2CH4A

Complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
320
structure length
320
Chain Sequence
GSHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLTLAIIQALLVKVNNLVYAIPIANIDTILSISKEDIQRVQDRDVIVIRGEVIPVYRLWEVLQIEHKEELEEMEAVIVRVGNRKYGIVVDDLLGQDDIVIKSLGKVFSEVKEFSGAAILGDGSIALIINVSGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reconstruction of the Chemotaxis Receptor-Kinase Assembly
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/chemotaxis
molecule keywords CHEMOTAXIS PROTEIN CHEA
total genus 72
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01584 CheW CheW-like domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ch4A02
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2ch4A03
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2ch4A01
3NMZC 2L3PA 2WI7A 1YT1A 2CGFA 2ECZA 3A98A 3EHJA 4HY1A 4U93A 1T3LA 2OAWA 4HZ5A 4R0KA 2VW5A 1KFZA 2VWCA 3WQ9A 2DL8A 1T0HA 1AM1A 2ZDYA 4MOTA 1OV3A 2LMJA 2KNBB 2XX5A 2EVRA 4ASAA 1SHGA 2WEQA 3H0HA 1H8KA 4OMQA 1UUEA 1SHFA 4EGHA 1TH8A 4GCZA 1KZNA 2JXBA 1VA7A 5I22A 1NHIA 2JT4A 4F17A 4W7TA 2WI6A 2BZ5A 2VCJA 3KE6A 3NMQA 1BGQA 2YUNA 1H7SA 5D6QA 3WHAA 1GCQC 4ZNXA 5D7RA 2LNHB 1YC1A 2YGFA 4URLA 2VVKA 5FWKA 5IN9A 1VYUA 2AKLA 5IXBA 1Y8NA 2FWZA 2IORA 1YP5A 5GJVB 4JASA 4L90A 4MP7A 2HG1A 4BQJA 5ECAA 4J9EA 3A0YA 4GGLA 5M4NA 2BZ8A 2JS0A 2WI5A 5M4PA 3QWYA 4I5SA 4YKUA 3CWVA 4ZKIA 1SEMA 1SRMA 2LQWA 2E0AA 4HXJA 4RTVA 1B07A 4JAUA 3HEKA 3R92A 2M51A 1PKSA 2FEIA 1AH8A 4AFQC 1YC3A 4LWFA 2L2PA 1HJDA 4R1FA 2KEAA 1TC0A 2XABA 3RLRA 2HCHA 3H41A 5GJWB 2CCSA 4YKTA 1CSKA 4OMNA 1ZUYA 3VS5A 1I5BA 2YI0A 4JAVA 1GKXA 1YWOA 2GBQA 3I5SA 2FXSA 4YKZA 4HVUA 1GRIA 4LUDA 2YI6A 2DM1A 4O0BA 2HDAA 3R91A 3SL2A 2F2VA 2A28A 3TZ0A 2JJCA 3QDDA 4EFUA 3A0RA 4BAEA 4ORZA 1SRLA 3VS6A 1GBQA 3G7BA 2KRSA 4GFNA 2YJXA 3B25A 2JM9A 2YE4A 1WYXA 1RUWA 2D0NA 4J9HA 4AS9A 4CWPA 1BYQA 1EA6A 1TC6A 5HCKA 2FYPA 4ASFA 3OMUA 4EFTA 4PL9A 2YK2A 4E01A 3QWXX 3RBBB 1M3CA 2CH4W 3U2DA 1QKXA 2LP5A 1BB9A 4CWTA 2BRCA 1JXOA 2BSMA 4HXZA 4F16A 4CWNA 1YS3A 5M4MA 1YT0A 1YERA 2NUZA 1R62A 3H0IA 2ESAA 1WLPB 1I58A 4GQTA 4NH9A 3UF4A 3BMYA 4PRVA 2K9GA 2CCTA 4E00A 2KBTA 1NHJA 2HEQA 4FPPA 2PNIA 4LNPA 3EG2A 2YE8A 4XC0A 1MV3A 2J6KA 3NPFA 1NLOC 4AWOA 1GFCA 1MX0A 4HYMA 2ESWA 2QFOA 2YE5A 1OPLA 3IQLA 1LCKA 2CDTA 2FRWA 2AKKA 2KE9A 4YKWA 2ED1A 2RQTA 4A63B 2O1UA 1BXDA 1W6XA 4HY6A 1QY8A 3CRKA 2XDUA 4EMVA 2Q8GA 1U06A 1KSWA 4Y92A 2LJ3A 2W10A 2J6OA 4OMOA 4YKYA 4FSSA 3ZKBA 1HSQA 1W1FA 5I11A 1M30A 5CTYA 4H81A 4BQGA 3K98A 3U2KA 1RLPC 2KGTA 4QT7A 4RTXA 1NLPC 2B86A 2H55A 2H8HA 4MPCA 3ULRB 1UYMA 3T1KA 4R3AA 3O6OA 3M0UA 1Y4UA 3VS3A 2BU6A 1ZUUA 3LPSA 1G83A 3FJ5A 1UTIA 3U67A 1I59A 2HKJA 4O07A 4HVVA 2YE6A 2FPFA 1BBZA 2CT4A 1JEGA 2YEEA 4J9DA 4XIRA 3ZXOA 2IIMA 4H7QA 3O5ZA 2CG9A 4IIMA 1UE9A 1B3QA 1MUZA 3M0QA 2YE3A 3TSWA 1Z9QA 1KIKA 1JM6A 4CC4B 2GTJA 2YEIA 1X6BA 1ZWHA 2CSQA 2L0AA 2LX7A 3VS7A 4K11A 1G2BA 4GLMA 1AZEA 3G7EA 4V26A 4BXIA 2DRMA 1I07A 4JZ4A 3MNRP 3U23A 1TILA 1ZLMA 1THNA 2YJWA 1AWXA 2C0IA 2CCUA 2JKIA 4CE2A 2BYHA 2RQWA 4JZ3A 2DX1A 2XDXA 4XKOA 4RTTA 1GKZA 2E5KA 1X6GA 4E6RA 4MB9A 1I0CA 2KYMA 1FYNA 1UY7A 2X3WD 4LN2A 2ENMA 4NH7A 4MBCA 4XKAA 4MPEA 1ABQA 3VHAA 1Y8OA 1UG1A 1XOVA 2FPDA 4MPNA 2EGAA 3A0XA 3A0ZA 3PEJA 2VKNA 4O09A 1UHCA 2DNUA 1K0SA 2F2WA 3GIGB 2ZDXA 2DVJA 3TUHA 2HCKA 3JV3A 1E6GA 2ROTA 2IWXA 1YCSB 2GGRA 2ED0A 3IEDA 3VHCA 5FWCA 1UFFA 1GL5A 1EFNA 2YEJA 5D6PA 2LJ1A 2YE9A 1AD5A 3EHRA 4AWPA 4O04A 1UECA 1NEBA 1A4HA 1QYEA 5IHNA 4L94A 4XDMA 2WI4A 1UYLA 1S16A 5FNDA 3TTZA 4ASBA 2CT3A 4KTNA 4CC2A 2BU8A 1M27C 4D8KA 2D8JA 2GFDA 3OWBA 5BODA 4XE2A 2K7AA 3GIEA 3UA7A 1ZW9A 3C0EA 1TBWA 4CWFA 1OSFA 3RLQA 1YSZA 4BIUA 2BZXA 2J7IA 1WI7A 4AFZC 4L8ZA 1H7UA 1US7A 3Q5LA 1PRLC 4RTWA 3C0CA 3THKA 4OMPA 1L0OA 3EKRA 2JS2A 1M3AA 2NWMA 4GEEA 5M4HA 3A0TA 3UA6A 3K60A 2AZVA 4XIQA 3B24A 2EGEA 3EHHA 1UJ0A 4ASGA 1U0ZA 4CC3A 2QDLA 2XDSA 4AFUC 3HYYA 2O2OA 2DL7A 4KSHA 2YUQA 3B28A 2K5BA 4ESRA 5F3KA 4B7PA 1X27A 1NYFA 2YUOA 3VS1A 2L3SA 2EKHA 2WEPA 1I5DA 4CWSA 3TZ4A 3R4MA 1ZSGA 3Q5JA 2XJGA 1UYEA 1W70A 1E6HA 2KYBA 4Z8AA 2BT0A 2YE2A 2YKBA 4CE3A 1UYIA 2XHXA 3D0BA 1WA7A 5CTWA 4EEHA 3TVTA 4JJBA 3EG3A 2KXCA 4NH8A 1UJYA 3M0SA 1UYHA 5L3JA 4LE9A 4YKXA 2K3BA 4XITA 2KR3A 2WERA 2YGAA 2KRNA 3OWDA 4U7NA 3PE0A 4E02A 3T0HA 4AG1C 1PVGA 4HXWA 4XTJA 4DEYA 1PHTA 2HSPA 4FMTA 3DGEA 4LWIA 1WX6A 2JTEA 2SRCA 4X9LA 3ZXQA 2DLPA 3KFVA 4OMMA 2BU5A 1OOTA 3CRLA 4V25A 2GQIA 4YKRA 2BZYA 2EYWA 2BREA 1WIEA 4FCRA 1ZUKA 2YK9A 4D8DA 3VS4A 4J9BA 1OEBA 2JMAA 5D7DA 1QLYA 1TG0A 4KP4A 4CWRA 2AZSA 1GJVA 2BU2A 4AG2C 1YT2A 1Z5CA 2YGEA 1QKWA 1RI9A 4MP2A 4XKKA 2AK5A 2EGCA 1NEGA 2DE0X 1KIJA 1YN8A 2OJ2A 2EYXA 1UHFA 2L3QA 3VS0A 2A36A 2RF0A 1J3TA 4JQLA 2Q8IA 1AVZC 1X43A 4WUDA 2YEFA 1TUCA 2PZ1A 2RQRA 4JPBW 2RNAA 4GT8A 1UYKA 1X2KA 1WXTA 2JMCA 1PRMC 1QCFA 1K4US 3HYZA 5IDJA 4XD8A 3OW6A 3INXA 2EYYA 4IIOA 2O9SA 2K2MA 4RTZA 3JZ3A 1JU5C 1AZGB 3EKOA 1E7OA 4CWQA 1BK2A 5FWBA 4RUGA 4XCLA 1Y0MA 2YKIA 1KJWA 2O9VA 4B6CA 2DA9A 1I5CA 2H8MA 2DYBA 4J9FA 3O0IA 1GCPA 2BU7A 4URMA 5J6AA 3T10A 3EHFA 4U7OA 1VYTA 2O1VA 3D2RA 2XDKA 2XK2A 3B26A 1GBRA 3G75A 2YKCA 3VS2A 1YWPA 4DEXA 2YEAA 3T0ZA 2EYZA 4ZVIA 1B63A 1NG2A 1UDLA 2RPNA 1ZXMA 4RTUA 4HCKA 5CF0A 4X1VA 2I0NA 2J6FA 2RQUA 2HBWA 2YEDA 1H92A 5IHKA 1Y8PA 4EM7A 2C2AA 4HVWA 1AWWA 5D7CA 2DBMA 4AWQA 1YC4A 1Z59A 1K1ZA 1I1JA 2XX2A 4UROA 1Y57A 4LWEA 2PTKA 1OPKA 2XHTA 1ZX6A 2CH4A 2CUBA 4F14A 4YKQA 3ZL7C 1PNJA 4I3HA 4EGKA 1YETA 3VRZA 5IHIA 3REAB 2FWYA 3R4OA 1PKTA 2RN8A 5IDMA 2O31A 3FT5A 3PVQA 1U3OA 5FNCA 3C11A 4KRTA 2D8HA 1EI1A 3GIGA 3K97A 1U2OA 4LPBA 2M0YA 2YEGA 2IOPA 3R4NA 2KROA 3R6NA 5C93A 2YT6A 3B27A 1JQQA 1NYGA 2Q2EB 4KQVA 1WXBA 3FT8A 3I35A 2IOQA 1UYDA 1UYGA 2W0ZA 2CUDA 3TZ5A 1NM7A 2EQIA 4DUHA 4GBQA 2V1RA 4WCIA 2V1QA 2K79A 3HHUA 2YI5A 3K99A 3NHNA 3INWA 2JW4A 2BTZA 4R3MA 2XDLA 4PRXA 2DL3A 3GBQA 4O05A 4QPKA 2ZKJA 3M0PA 1SPKA 2DILA 1N5ZA 2ABLA 4PU9A 3OPDA 2DBKA 1Z5BA 1PWTA 1RLQC 2MCNA 1GFDA 1CKAA 1HD3A 1WFWA 1WDXA 1WXUA 1CKBA 2EW3A 3PVLA 3CQTA 4H85A 1I5AA 1UY9A 1MV0B 1JO8A 3O2FA 2QG2A 1ID0A 4M4ZA 1IO6A 1BU1A 1V1CA 1TUDA 2X3XD 2IWUA 2JM8A 2XHRA 3Q5KA 3QTFA 4J9IA 4BIZA 4CE1A 2XX4A 2O1WA 1U5SA 2D1XA 1SSHA 3CGYA 3ZM7A 1UY6A 4P8OA 3EGUA 1NHHA 2YKEA 1QZRA 1K76A 3EHGA 2EBPA 2MOXA 3SHWA 2ROLA 2WI2A 2YEBA 4L93A 5BOCA 1B62A 4Z89A 5M4EA 2PNRA 2Q8FA 1AWOA 1MU5A 2YECA 2QG0A 2J06A 1JXMA 3R4PA 4XIPA 2DL4A 2LCSA 1Y4SA 2BYIA 3M0RA 2AKPA 3BM9A 3I9QA 1YSRA 2YEHA 4FCQA 2MIOA 4QPJA 1BKNA 4OMLA 4JJCA 3PEHA 4RTYA 2C0TA 5IXFA 4K4OA 5GGZA 1UYCA 4L91A 2KXDA 2YE7A 3HZ1A 2DF6A 2G6FX 4FCPA 1UGVA 1YESA 4HYPA 3ZKDA 2FRYA 1YNZA 3SEMA 2IWSA 4WUCA 1ARKA 1FMKA 2YUPA 3GIFA 2P4RA 2QF6A 5CPHA 3RNJA 3H0FA 5L23A 2VCIA 1M8MA 3CGZA 2DJQA 2GNCA 1AH6A 1X2QA 1AOJA 4J9GA 3NGPA 3FV5A 2EXLA 4EIKA 1T3SA 2UWDA 2K6DA 1AWJA 1TIDA 4LWGA 2XD6A 2YKJA 5CTXA 5F5RA 2LJ0A 4KSGA 3EG0A 1S1NA 2A37A 2LQNA 4J9CA 3RKZA 2Q8HA 3TSZA 2XMFA 2GQPA 2A08A 3LH5A 2VWFA 1S14A 2J05A 1UY8A 1AEYA 2KT1A 4JJDA 1UYFA 2XCMA 2O88A 1Z9ZA 1X69A 4XCJA 2YSQA 4LP0A 2RMOA 5M4KA 1K9AA 3M0TA 3EHQA 1AJ6A 4LWHA 2WI3A 2ZBKB 1A0NB 3T2SA 2EPDA 3REBB 3VADA 3I5RA 1ZBJA 4WUBA 4EGIA 2CREA 3A0WA 1ZXNA 4Q20A 2F2XA 2OI3A 5FNFA 3UATA 4HZ0A 4LUEA 4DZYA 4URNA 3VRYA 2FG0A 5J71A 1T0JA 2FO0A 3EG1A 1QWFA 4Z88A 2YI7A 4AFSC 2GTOA 2XJJA 5FW9A 2XJXA 1ABOA 3LNUA 1QWEA 1H3HA 3H4LA 2C0OA 3RLPA 1VYVA 5EC7A 4CC7A 3HZ5A 2DRKA 3VHDA 2LZ6B 1GCQA 4KFGA 4CWOA 2CSIA 1AMWA 2WI1A 2RQVA 1K0XA 2YDLA 3D36A 2SEMA 2KT8A 2DMOA 5IH2A 3H80A 4P7AA 3TZ2A 2KRMA 1Z5AA 2BTTA 5CTUA 2FPEA 2DL5A 1M3BA
chains in the Genus database with same CATH superfamily
2YRDA 3NMZC 3HOVG 2E74C 1D7QA 2F0HA 2ZT9C 1AH9A 3LWEA 2NVYH 3A98A 4QKUA 4NS5A 5CR2A 1R4PB 2OAWA 2LMCB 4R0KA 3KOJA 5JEAJ 1PC0A 5IGDA 5JJLA 2VW5A 2DL8A 5GAMh 3CQZH 4DBHA 5LJ5j 3D3RA 1PSFA 4HEDA 4R1JA 2KNBB 1C8CA 4YCWA 2AHOB 3JRZA 1LTRD 4GLKA 5GAOn 1H8KA 4E7KA 4KKUA 5M3MB 4DR5Q 2ATWA 1E3PA 1KZNA 2WACA 4F17A 5FROA 1WCMG 1EOTA 2BZ5A 1PTOB 3KE6A 5A0GA 3NMQA 4F04B 2QA4A 2YUNA 3S24A 4ALPA 3Q6SA 3KFUA 1H7SA 5D6QA 3JCMd 1OXSC 2F0KA 2UUCL 1VQDA 2LNHB 2LXJA 2Z6BA 4LF8Q 3HHTB 3HOUH 3MWYW 2XDBA 2K05A 1Q7YC 2JA7H 2EJGA 2YHTA 4MP7A 2E8GA 1I4PA 3WOFA 2VXWA 5ECAA 5LJ3h 3G4ST 2BZ8A 2I07B 2WI5A 3QWYA 2HMAA 1VQLA 1WJSA 2RK1A 2HQHA 5KE3A 3NSWA 2LQWA 3R92A 1VQFA 1O7ZA 5DY9A 3HEKA 2MO0A 4OGEA 2FEIA 3VU3C 4LWFA 4R1FA 3K7AH 4DV2Q 3MHXA 2K5QA 4JI7L 3L2RA 2JA8B 4FYXB 2B3GA 5GJWB 4B9WA 1VQ7Q 3L2VA 2KA7A 2XVSA 3VS5A 2Z6KC 3A8MB 5DLQE 3K81C 5D7UA 1SROA 3S1MB 1YWOA 4GZYC 1KDCA 3I5SA 3CP0A 2R7ZH 1ICWA 4YKZA 5M3FG 1VQEA 2HDAA 3TZ0A 5CKFA 2A28A 1IKLA 4XTUA 1G2SA 1WFQA 4OVAA 2B39A 3LNNA 3HOXH 1GBQA 4MIUA 2KRSA 1NCVA 1FGUA 3P75A 2YJXA 4AIMA 2AQ3B 1PTOC 4XXEA 2QEXT 1WYXA 4K2LA 1JORA 4IOCA 1ZHIA 3L2PA 4XTXA 3HFNA 2E75C 1HQMC 3B6YA 4FVMA 4ME7A 1MI2A 2KENA 5D3DA 3RBBB 2JA7B 1M3CA 2CH4W 2LP5A 4H7BA 4NL2A 3K5MA 1STHA 1JXOA 2BSMA 3CCQT 4LF6Q 4GN4B 1A15A 1UUPA 4CWNA 3PCOB 2EYMA 1KRTA 1Z9FA 4MMKA 4JV5Q 2UXDQ 1YT0A 2R3ZA 3H0IA 2ESAA 1N33L 4P73A 4BACA 1GUNA 5KH6A 2XN9C 3EN2A 2BU7A 3OMGA 3OWEB 4CJ0B 4PRVA 1TS9A 2EAYA 1LABA 1VQ5A 2KBTA 2VZAA 2HEQA 1PZKD 4LNPA 3DHQA 4C8QG 5IYBH 1NHJA 1EWCA 1FWZA 2YE8A 1MV3A 3EFXD 1GUTA 2L0CA 4JYAQ 1NLOC 1M90U 3EQLC 1GFCA 3JAML 5A0LA 1EZ6A 1QCOA 2E65A 3TBIB 1OPLA 3IQLA 1G2TA 4N0AC 2Q2UA 4C2MB 4LK1C 4A63B 4KUDK 4CDFC 3CRKA 4XQ3A 2XDUA 1FNUA 4IZ8A 2RI3A 1NJIC 3BE3A 1QCNA 4RGTA 2A69C 1EY6A 4OXPA 3DEPA 3I91A 1XMOL 2DETA 4RG1A 2Z8LA 5JAVA 1VQ6Q 2B8GA 4GLAC 3GPLA 4DU9A 4B3TL 3MZ5A 4OMOA 5J39A 1EY9A 2HKNA 1VQKT 3MJXA 3TSSA 4A3EG 2COZA 3S3MA 2RDGA 2WB1G 3TP5A 2R7ZG 1AEXA 1W1FA 5CTYA 1VQ7T 3U2KA 2JNGA 2D6FA 2KGTA 3PT9A 1ML0D 1TS4A 1Z6HA 1B3AA 2FJ2A 3EFOB 2H8HA 1U4LA 4JK1C 4M77C 2A0FB 1CA6A 1UYMA 2ZJQA 1EZZB 2Y90A 2QTVA 1Q82R 3FRNA 5C3EG 2UUAQ 2NN6I 1Y4UA 1LYLA 4Z9CB 1HH2P 1FJGL 4O07A 1HFNA 1NJIR 1UE7A 2YE6A 1BBZA 1CZWA 5I2MA 3K7AB 5CKHA 5FK9C 4J9DA 4O6JA 3O5ZA 2CG9A 4C3IG 2CZ1B 1UE9A 3HFOA 1Q82U 3MXUA 1KDAA 1C0MA 1QP2A 1Z9QA 1M1GA 5GAHC 1EQQA 4B3SL 4BB7A 3CCEQ 1YNXA 2K28A 3FJPA 3VS7A 1JWMD 4GLMA 2DD5A 3M3YB 4V26A 4KI0A 2DRMA 2JEBI 2LT1A 4F7UB 4BA2I 2PQAA 4MN3A 5EGTA 1HZ9A 5DM73 4N4HA 1XWEA 4QCLA 2D5DA 1TILA 1AWXA 1STAA 2F0PA 3LLRA 1GJXA 4X3UA 2RQWA 1CQVA 3BDOA 5C5LA 4XKOA 4JV5L 5FLMH 5EQ0A 1IB8A 3FMCA 1X6GA 4A76A 3MXNA 4NH7A 2K5NA 4LN2A 2ENMA 4XKAA 2VXEA 2VB6A 2BKDN 2YLBA 4BDZA 2EGAA 3A0ZA 4X66Q 1UHCA 1S3OA 2JA8G 2RHYA 4A3JB 4PL6A 2DNUA 3OYKA 3TZUA 4FM4B 2F2WA 2EQJA 2RJEA 1OXTA 3FKIB 2KCTA 2HCKA 3KF6B 1XNQQ 4PJLA 1LOJA 3W5OA 2ROTA 1F2LA 2CW0C 4OB3B 5C3EH 3HKZB 4OHJA 3VHCA 1UFFA 2K14A 4LF8L 1VQKQ 2LJ1A 3O2FA 1AD5A 3EHRA 4PFPA 1HR0W 4AWPA 4KH1B 3V8KA 2DYIA 5IHNA 3J81L 3M4QA 2NTSA 4DR3Q 1NZ9A 3S2HB 4HT9A 1DCZA 1TXQA 1WTXA 2OT2A 1KXLA 1S16A 2WI4A 1X3FA 1RABB 4JI5Q 3TTZA 3E0EA 5E1FA 1M27C 1WGSA 2D8JA 4D8KA 1JB7A 4A3LH 2EVBA 3IRBA 3AEVA 3GIEA 4ELZC 1CUKA 1ZW9A 2JA7G 3IL8A 1OX8A 4L8JA 1MJEA 3C0EA 3RLQA 1JWUD 4DBRA 2WIIB 1TWAH 1H7UA 3THKA 1L0OA 2KOLA 4IJLA 1BCMA 1M3AA 3S6WA 2JS2A 3M3YH 3L9AX 5IP7G 3A0TA 4JDSA 3P1HA 2E5QA 1UJ0A 1RKNA 5CV4A 1IZ6A 4OO1G 4C8QC 2JA9A 2XDSA 2KAFA 4H44C 3D7SB 2DEUA 3GV6A 4JOIA 3EH1A 4K6DA 2DL7A 2RJFA 4PJOB 4KSHA 5F3KA 2DK3A 2YUOA 4ZTFA 5GAGC 4QQDA 2VASA 3ZEHA 3ZFJA 4CWSA 1FR3A 3TZ4A 1BQQT 3HOUB 3R4MA 2FINB 4B3RL 3EVQA 2NVYB 4WORA 1V43A 3I8ZA 2M16A 4M75D 1KTKA 2F0UA 3H6MA 1IW7D 4J15A 3LYIA 1X9NA 1RAIB 5IP9H 3CC2Q 5CTWA 4EEHA 4IFDH 5LJ3j 5AJ3L 4HCZA 3MEWA 2BA1A 2Z1CA 3PV0A 3HZXA 1PCXA 2HT1A 2R92H 3GOXA 4JI1L 4M7AF 1N9WA 1TWHH 2PU9B 2K3BA 3GF5A 4DR4Q 5DAUA 2WERA 2KRNA 5DLOA 4U7NA 4HSVA 1D8LA 3PNWC 2TMPA 4C3HB 3SWNB 1VQPA 1EY8A 4CBVA 3A74A 3PF4A 2EYQA 2HSPA 4HCBA 4NMZA 4G57A 4F8MA 1WX6A 5KYXA 2J0TD 1HTLD 1TY2A 4X6AH 3MP6A 2BU5A 1I6HH 5JJIA 5L8RE 1Q7YR 4ILWA 4J6WA 1BCOA 4C5EA 3EAEA 1NBEB 1CKNA 2B2WC 4RMFA 5FRMA 1ZUKA 1LTSD 2FXQA 2JA5G 1CM9A 4Q5VA 4D8DA 1D3BB 3OSSC 2YK9A 5D7DA 4YY3Q 5E4WC 4JBMA 2PMZB 3VA5A 4KP4A 2AQ1B 3VR2A 4RCBA 2K5VA 2KVQG 3V2TA 3DWQA 2QW7A 1Z5CA 2GVBA 4QUCA 2OQ0A 5I9PA 4JS4A 2E2HH 1P92A 2OJ2A 1H9KA 2FTKA 1UHFA 3EGXA 3OMCA 3G7ZA 1WI5A 5C6AA 1GOZA 3VS0A 2X4XA 2VL6A 2RF0A 3JB9G 4C0DC 3U50C 4QUFA 2Q8IA 1VMCA 1X43A 2OTLA 4RGNA 3QZ5B 1UE6A 2A73B 5A0DA 4A4FA 3F8TA 4GT8A 4RGOS 3UI2A 3I55A 1UYKA 1HA6A 2QI2A 1K4US 3A8OB 2UXCL 2LTOA 4PJOG 3OYGA 1F1BB 3URGA 5CQXA 3KLSX 2R61A 3SK4A 2YV5A 4IIOA 1H9RA 4L5GA 4RTZA 4IALA 4HIDA 1JU5C 3EKOA 1OXVA 1LJOA 3OIPA 2B63G 1SNOA 3D4RA 3UE1A 4M77B 2ZZDA 3JB9D 1TH7A 2V1CC 4O0AA 5I2XA 1PH2A 1H9JA 4FXKC 4J5YA 1Y1VG 2DA9A 2SNSA 1I5CA 1LT4D 3QYGB 2CP7A 5J6AA 1IHZA 3EHFA 4U7OA 3KBGA 1Q81R 1EQTA 4LF9Q 3OS1A 2KEDA 4K8IA 3D2RA 3H9NA 2K7VA 3TN2A 2GCXA 4A3DG 3E9FA 3VS2A 1YWPA 1SYBA 3CRLC 1NAPA 3HG9A 4ZLTF 4DV6Q 1M90C 2Z9HA 1Q1EA 5IYDG 2EYZA 3ULPA 3T0ZA 1UGPB 2RA4A 2B2UA 5KYLA 5M5YH 2NYSA 2LRQA 1NG2A 2RPNA 2Q8IB 1ZXMA 4HCKA 4JW0A 4X1VA 2I0NA 1P16A 3V7CA 4XU2A 2HBWA 5KYUB 1D6EC 1B7YB 2C2AA 2TSSA 2WSFE 2NLUA 3PUVA 1GD7A 2B29A 2L5QA 3H3VC 3S1NH 1BXTA 1YC4A 4BY6B 1FD7D 1VQOT 1K1ZA 1I1JA 4M78B 1V8QA 3KDFA 1Z59A 2XX2A 5CCAA 2FZGB 4LWEA 1OPKA 3RMQA 1D1KA 1LUZA 2E3IA 2ZPGB 2YU9B 5KYYB 1VF5C 1F9RA 2CH4A 3G4SQ 3EH2A 4F14A 3ZL7C 1CKNB 4EGKA 4M7DA 4ANJA 1MJCA 3R4OA 4JRQA 2YYZA 5IDMA 3FT5A 4KHPL 5FNCA 3L2UA 3NK9A 3C11A 2ZXPA 3A7LA 4QW2A 2MFIA 1YITA 4BY7H 3VR4A 4RKBA 1EI1A 2L9HA 4JUVA 4H0LC 4UDUC 2YEGA 2K3YA 1WD1A 1JQQA 1YJ9Q 1L0XB 3J80c 3KXTA 3I35A 2IOQA 4OELB 1QE6A 1F9SA 1NM7A 2Y0SB 3I55Q 1B9MA 1PTOF 1YIJQ 2V1QA 3HHUA 5GAOq 4UP7A 5LMNQ 3GTQH 2SOBA 1CZGA 4IKFA 3INWA 1KQ1A 1BCPF 2ID0A 4PKCC 1SKUB 3DB4A 1U1TA 1LM0A 3Q0AA 2WSEE 4B3RQ 3OBWA 4I65A 3HRUA 3ZBDA 3GBQA 4FT4A 2RJCA 2PO4A 1HA5A 4HR7B 5EKIA 1MGQA 3VYRA 3CQZB 2L55A 2Z0SA 4DR6Q 2ZKJA 2EYHA 2SDFA 1Q86R 2IG0A 5E4XA 2YRVA 2EY5A 4JI5L 5GAN6 1Z5BA 1G3YA 1PWTA 2MCNA 1KL9A 3PVLA 4EX5A 4HJAA 1WDXA 4A4GA 2N55A 4H85A 1L0WA 1YJWQ 1D5MC 4M4ZA 3HPWA 1ZYRD 3SK6A 1IBML 2X3XD 1A6XA 3K5OA 3ICEA 3QDFA 1TQOA 4A3CH 2XX4A 2MAMA 2QQSA 3ME9A 1Y14B 1YHQA 1GHJA 5NUCA 5K36G 2KVMA 3LWHA 2ICIA 3FKIH 3UDIA 3X26B 4OONA 2YKEA 1QZRA 4UAIA 2EBPA 3EG9A 1FNVA 4UC4A 4JRKA 2ZTCA 1NUCA 1JR0D 4P5NA 3SB2A 4E6IA 1X6OA 4R4QA 1A3UA 3MEVA 2YECA 3LWIA 2X9HA 2XIDA 3VKIA 1N36Q 1J6QA 5C5MA 2QQAA 3M0RA 2OAUA 2HL3A 3E9IA 3ZJYC 4B3ML 2YEHA 4DPGA 2EOTA 4FCQA 2EQMA 3EIVA 5KYNA 3SXHA 4OMLA 3CCET 2VUBA 1HFGA 2F52A 4F87A 5GGZA 2X35A 1Y71A 1YJ9A 2DNEA 3NBHB 3A56A 2KXDA 3J80L 2X4WA 2DF6A 2E4HA 4A3KB 4DAVA 3HOWH 2CYZB 3G71T 4NKLA 5CR3A 3SEMA 3PUXA 4WUCA 2JN0A 4XU0A 2YUPA 2P4TA 2VXFA 1AHJB 2P4RA 1FX7A 2VGNA 1EUJA 3H0FA 3NTIA 2E5LQ 1M8MA 2DJQA 2GNCA 3BY7A 1XJVA 3MKDA 2K5IA 2B2VC 5J22A 2VYTA 3I4NH 1K9MR 2AUKA 1YJWT 1ZKOA 5EPLA 2K6DA 4M78G 1AWJA 1BIBA 1RAHB 4A4KA 1EYAA 3J81j 3JCMh 5GAMg 5A2QE 3K59A 2Q2IA 4U68A 2XD6A 4LWGA 1E0BA 3RD4A 4NXNQ 1S1NA 2JEAI 2ATCB 3RKZA 5JVG3 2P0KA 1N9RA 2XMFA 4J83A 3TSZA 4EMKA 3UDFA 3Q24A 4AYBG 1H3ZA 4LAAA 1UYFA 2HAXA 4FL6A 2V26A 1VQ8T 2AMCB 1NR2A 4ZGJB 1Q46A 2XNAC 4YIJA 1XPUA 4LP0A 3CHBD 4RHSA 2PZWA 4LWHA 2ZBKB 1KNAA 4DR1Q 2PVGB 3A8KE 4QB4A 4HAEA 3T2SA 1KC8C 1NY4A 2L15A 2BUDA 1IHWA 4J8QA 2F0EA 4WUBA 1PFBA 2K01A 3A0WA 1GXDC 3KJPA 4Q20A 3CAMA 4ZRZA 4LF4Q 3CCVQ 3CC4Q 4LUEA 3ULJA 4C0FA 3OYDA 5CMDA 5J71A 3PGGA 4DK1A 4JI2L 2PUKB 2HKQB 3LX7A 4AFSC 2GTOA 5LJ3g 1VQBA 3AMUA 4A3LG 1ABOA 3ASKA 2XJXA 1QWEA 1WTWA 2WFWA 3HOWB 4HN7A 1B7TA 2PNRC 1C7YA 3D4DA 4PJMA 3EG9B 2DRKA 3VHDA 1Q81C 1M1FA 5GMKl 3V05A 5GAOl 1RHPA 3SGIA 2OEOA 2SEMA 2P0QA 1JQYD 3M9BA 4PG3A 3RDVA 4KY7A 1PFNA 3E3XA 4C1NI 4B3TQ 2DL5A 1M3BA 3MVVA 3UWNA 2D2CC 2WI7A 2WAQG 1WHHA 3N52A 2Q2TA 1VQCA 1KQ2A 4HY1A 3WQ9A 4PJOF 4PZ6A 3OPOA 1G6ZA 1KFZA 2VWCA 1HZAA 3HYZA 3L42A 5IYCG 4R4OA 1I4GA 2ZDYA 1Y8NB 4MOTA 1OV3A 2DZCA 5FU7C 3CMAA 2EVRA 2XI9A 3H6ZA 3KLWA 2M9UA 3P20A 1XYIA 1M2VA 1WTQA 3FLGA 2Z6KA 4DV7Q 1TWGH 3I4MB 4GCZA 2ICEC 2AT1B 2JT4A 1PXUA 4IQZA 5GAN8 1WD0A 3K58A 4W7TA 5GADC 2VCJA 3CU7A 3ITPA 1ICFB 1QUQB 4KY5A 3DLMA 1Q8IA 8AT1B 4P75A 3C3LA 2DXUA 1K73C 1LTTD 2E2IB 1GCQC 3JB9H 3EROA 2YGFA 1YI2T 2VVKA 2WSCE 1I4K1 2A68D 5FWKA 1QG7A 2K5WA 2FWZA 2IORA 2H55A 1YP5A 5GJVB 1DONA 4L90A 1BO0A 3HOYH 3A0YA 5M4NA 4X65L 1STBA 4MZ9A 5DEHA 2E2HB 2EJFA 5ISRA 1KC8R 2LNVA 4A4HA 3GLXA 4OMFB 3CWVA 4I5SA 1MHWC 1CKMA 1EYCA 1SRMA 4WRDA 3CCVT 4CRIA 2E0AA 1B07A 3CCMA 2A6EC 3FHWA 3M4PA 2GFAA 2M51A 1BIAA 1PA6A 1VQ5T 3X28B 1RODA 1TY0A 2LDMA 1HUMA 2EE1A 2F3VA 3A8GB 2VB3X 3BU2A 4IUPA 3PF5A 4DR6L 2EYFA 1EOVA 5FO9B 2HCHA 3H41A 1R0BG 4V190 4YKTA 5GQOA 3R6OA 1CSKA 4OMNA 3HGBA 1Y8PB 2G9HD 4PZ8A 4HMJA 4E7JA 4A3BG 1BDOA 2MUYA 2GBQA 5CQYA 1RAEB 1HQRD 2E2DC 5IYCH 1GRIA 4LUDA 1K9MC 2YI6A 1RAFB 3SE0A 3R91A 3I3CA 1RD9D 3ULLA 4A3EB 5JJKA 1W6KA 2JJCA 2DJZA 5GMKm 4ORZA 1BCPC 1ILPA 2KHSA 1SRLA 1IXDA 4IUUA 1EYDA 3QXEB 2PVDB 3B25A 2JM9A 2FYKA 1U8RA 3S1MH 2D0NA 4J9HA 2K5FA 2E2IH 2BE5C 4FXDA 1BYQA 3W1BA 1D0YA 1TWHB 3CMAQ 3OMUA 1VQPQ 2EYLA 3ONAB 2UXCQ 1HJPA 3W1GA 2QXFA 4M77A 2RJDA 1BB9A 2BRCA 2XK0A 1BI3A 4HXZA 3CEYA 4HA8A 3R2TA 2A3LA 4HJ9A 1QCBD 4A3JH 1VQ9A 4IPDA 1YS3A 1DM0B 1RAGB 1W4SA 1C4QA 5A35A 1LT3D 3PO2B 1R62A 3M56A 2DERA 4ME5A 2GF7A 4RKLA 3RLOA 1NTGA 1JCKB 3FB9A 3UF4A 4DV5Q 2K9GA 1HNXQ 1YI2Q 4LF7L 2RH2A 3V8JA 2PNIA 2FVUA 1BVSA 3A8IE 4NDXA 1OTCA 1KK7A 2C1GA 3NPFA 2IHEA 3JCMf 1ONLA 2XKOC 1ASZA 4AWOA 1Y96B 3OYAA 2ESWA 2YE5A 4BI3A 1S72A 4KGZB 3A5UA 1YITQ 1LCKA 2CP0A 2FRWA 1IL2A 4YKWA 8ATCB 3AYHB 4LJZC 4IUQA 1MMDA 1W6XA 4RGMA 2FHTA 1D5XC 1IBMQ 1B53A 4JI6L 3FIFA 2FHDA 1KSWA 1P8LA 1H9MA 4XQNA 1ACMB 2JZ2A 4KLKA 4B3SQ 4JI8L 1LT6D 2J6OA 1YIJA 3QIAA 3S2DH 2E2JB 3P8DA 2R93H 4YKYA 4R4TA 4DN4M 3MXPA 4BY1H 2PW5A 3HFZB 3SWNA 2B8FA 1QNUA 1HSQA 1BBXC 2LQKA 2O4XB 3V7RA 3OYFA 4M7AA 2EPBA 2O2LD 3K98A 1RLPC 4QT7A 4RTXA 1BI1A 2O01E 2IT1A 4DR4L 2PZUA 3ND9A 2EJMA 4ZCKA 3ULRB 4A4IA 2O4XA 3TU4K 3ND8A 3O6OA 2V8JA 3M0UA 3GNGA 2DIQA 3QWNA 4J6YA 1A63A 4OGCA 3GTGH 3VA7A 3GTPH 1G83A 3FJ5A 4XTVA 2XRSD 5C4XG 2HKJA 4HVVA 1EIHA 1KNEA 2CT4A 1LV9A 1SR3A 1M8AA 1U4PA 2JSOA 3CXCP 3A1PA 4F7UG 2KHJA 3UDXA 4XIRA 1NNXA 3ZXOA 4KJNA 4IIMA 4RAUC 5JOBA 2Y4YA 5LMUL 1B3QA 3NEMA 1HXDA 3Q8DA 4HIMA 3TSWA 1JT8A 5T1GA 4JI3L 1X6BA 1EWHA 2IHFA 2L0AA 1VIEA 4J6HA 3G7EA 2FL7A 4MZMA 1N8RU 1I5LA 3QJ6A 5C4HA 1LPLA 3CBPA 2JUFA 3M7GA 3S14B 3D31A 2QGGA 3U23A 1THNA 3R2IA 2HCIA 3J81E 1A2UA 3ERQA 2C0IA 2WB1E 2NVTH 4M75G 2PI2A 3V96A 2JKIA 2LCCA 4CE2A 1ZA1B 4C3IH 1KG1A 1X01A 4EMHA 2HQLA 2XDXA 2MO1A 5HK3A 5KNCA 4ZUIA 4MB9A 2ZJPA 4K0KL 4K5VA 1KABA 1UY7A 2X3WD 1EQVA 3VHAA 4MPEA 4OO1I 2C35B 4DUZQ 1Y8OA 1PVOA 3QSUA 2RHXA 4O42A 3A8JE 3KUPA 2VKNA 2BE9B 5ELBA 3FDTA 3T53B 3T1HL 3RZOB 1DYQA 4RCNA 4MTNA 4C1NK 5DM63 3HOVH 2E10A 2D0OA 3GIBA 1Y1WG 5LJ5g 1TWGB 2BIVA 1AN8A 4A3JG 1JMCA 1G51A 1YCSB 4A3EH 2KECA 1WNLA 1DD2A 1CFMA 1HHVA 2YEJA 3OS2A 3GQBA 1BF4A 2Q8RE 3CYGA 1PM3A 2YE9A 4JC0A 4HJ7A 1A4HA 4E7IA 1QYEA 3J80i 4L94A 1LTID 1ENFA 3PO3G 1UYLA 3H91A 1UEBA 3A7AB 3MFGA 4CC2A 4C2MH 2VGMA 1M1KC 3F2CA 1B44D 1QVFP 2UUBL 4XE2A 2UXDL 2K5LA 2NBFA 1YHQQ 4OB0B 4E7LA 1TBWA 3NTHA 1T5EA 3RUZA 1RL2A 1OSFA 1YSZA 5EAYA 5KGUA 4NP5A 1STGA 2RHQB 3OYNA 5J1ZA 1VQLQ 4JLGA 5FO8B 1US7A 1XJWB 1SYFA 5M5XB 3EKRA 4OMPA 4HIKA 5FO7B 2M1HA 4PMWA 1JJGA 3HOUG 3UA6A 4KJOA 3BYYB 4ZQ3A 4P2CB 1PH6A 4AFUC 1D1CA 3HYYA 1TS2A 4ZYSA 1YHBA 2F69A 3L2WA 2WAQB 5IGCA 4JI3Q 3QBYA 1ENAA 4ZKCB 2JA6G 3QKJA 5CAIA 3VS1A 1S4ZA 1GUWA 2L3SA 2D62A 3UDCA 2WEPA 2DN8A 1D0ZA 1WJJA 2Q8TA 1H95A 1ZSGA 3EFRA 3Q5JA 5JEAH 2KBNA 1E6HA 2KYBA 4Z8AA 3CC4T 4CE3A 3BJUA 1WA7A 3TVTA 2KK4A 3TREA 3EG3A 5GANh 2KXCA 5KNDA 5C44H 2PQWA 5L3JA 2RI2A 1Q82C 4YKXA 1UE5A 1SE3A 4M7AB 1Q86U 2YGAA 3C46A 5E3FA 3HTRA 1RADB 3TS0A 4E02A 3U4ZA 3T0HA 3G6EA 2F0GA 3H0GH 2XWBB 4RCOA 5BR8Q 4FMTA 1U5KA 1PFMA 2JTEA 1ASYA 3S16B 4X65Q 4TRDA 3KFVA 4FCYA 1HPCA 3BG3A 3AT1B 4V25A 1U4RA 4KHVA 4AMCA 1J5EL 2KQ3A 2M00A 3GV3A 1PRTB 4FCRA 3VS4A 2JMAA 2M0OA 2L89A 1QLYA 2COYA 4PNOA 1TG0A 1ZSZB 1PYBA 4XYQA 5JPMC 2JA6B 5GMKh 4C3JG 4LFCQ 2V4DA 2F1LA 1YT2A 2YGEA 1QKWA 2X4JA 2Y0SG 4A93H 2AK5A 4MP2A 4XKKA 1YN8A 1S72T 1K3RA 4KD4A 1ZA2B 4ZGDB 2F0SA 3HOVB 2D9TA 3CBMA 3CCSA 2HIVA 2JA5H 1NMGA 2OX7A 4G4KA 2WINB 4LUZA 4IUVA 2UUBQ 3GTMB 3CC4A 4ME3A 1C6VX 3M4YA 1O9SA 4R55A 3LH0A 1VQ4T 1F77A 1SJED 2B2TA 3L7ZC 2HHHL 2ZTDA 4LDWA 2CP5A 1VQ7A 2VC8A 4BDYA 4LFCL 3OW6A 2VNUD 1STYA 2K2MA 1AZGB 4MHEA 2ES2A 3MC0B 4YHHQ 3KJOA 1STNA 5FWBA 1EWIA 1ESRA 2NZOA 3JB9I 3D6CA 3M85A 3HOYG 3MPUB 1Y0MA 1TU0B 1S5DD 2O9VA 4FF4A 3HEJA 4A3DH 2BCOA 3O0IA 4J9FA 1JJ2A 3GTJH 1PTOH 2WB1B 1OU9A 4N9TA 3F70A 4FYYB 5IAYA 1CSQA 4OEMB 5G3LD 1R4QB 2Y0SE 2O1VA 3I4NB 2ZXRA 2XDKA 4DGZA 1Y1VH 2HDMA 1TTHB 5CIUA 4B6MA 1PH1A 2YEAA 5IT9E 2QQRA 3RKXA 3DKMA 4EPCA 3U58A 3NTKA 2LQ8A 2KCCA 1B63A 3VYUA 5C3EB 4A3DB 1ZSZC 2PYKA 4RTUA 3NXWA 3PO2G 4MZTA 1PYSB 4IPCA 5CF0A 3DM1A 3T4AC 4JI0Q 2IPOB 1Y8PA 4OWWB 2ZGWA 5L37A 5LMNL 4IFDI 2DBMA 5D7CA 2N88A 2EWNA 3IFTA 1Y1WH 3NBHA 5GANe 1HTPA 3JAMi 2YWWA 1TUGB 3DB3A 2ZPEB 3FC3A 2RHIA 1Q3LA 3O13A 4GN5A 3X3NA 4CKEA 4YKQA 1PNJA 1ET9A 3NPPA 3INZA 3VRZA 2N49A 1VQAA 1YETA 4I3HA 5D6WA 3RKYA 2RN8A 1QVGA 2NVQB 3PVQA 1PDQA 3X3MA 3NQTA 3E9GA 1O7IA 4N4IA 3GTGB 3GTPB 4M75C 3CPWA 4EGVA 4KGVB 3GTKH 3BZDB 4EDUA 4XU1A 5IGBA 3T1HQ 4LPBA 1N8RR 2OXPA 1YI2A 5KE2A 2LX9A 3CCUA 2ZM6L 3R6NA 3R4NA 3B27A 4KQVA 1Y07A 2A7YA 1WXBA 3J7A5 2OQKA 2DZ9A 4M7DD 2HSEB 3A8HB 1CTMA 2NUPA 1LTBD 1QJOA 2VQFL 4M75F 2K79A 4M7AG 3G48A 2EFIA 2YI5A 2R57A 4M8AA 3K99A 1U1SA 2OTJT 4POFA 1TWBA 2CZ7B 2BTZA 4R3MA 3LW5E 2EYPA 2LXKA 2LT4A 4C92F 3CCJQ 4MDXA 4XU3A 2RCNA 4PRXA 4O05A 1M2VB 4ULLA 3DUZA 4YCUA 4JI7Q 1SNDA 4I7ZC 2RA2A 5D14A 1KDBA 3CBOA 3MTSA 4HT8A 4JG2A 3OPDA 4M7DG 2JOYA 1I4QA 1RLQC 1WXUA 4GKJL 2DO3A 4M7DC 1QVGP 2RI5A 4XT1B 1MV0B 1VOMA 1PFSA 3OYJA 2DFUA 1E1OA 4BXXG 1UY9A 1BU1A 3IFDA 3KYHC 2XHRA 5FLXE 2JM8A 1RDPD 4BIZA 5FLXc 4J9IA 2GA4B 2O1WA 3NELA 2D1XA 2JN4A 5FLXL 4ZK9B 5IOCA 4M1UB 1UY6A 4PJNA 1AE2A 2C06A 1NHHA 4DNTB 1YNND 2WI2A 2PQEA 4L93A 5BOCA 2HNIA 2BE5D 4IJHA 3HRSA 2IX3A 2PPBC 1YCYA 5M4EA 3KUFA 5ELNA 2DTHA 3PIO3 5J26A 2Z4HA 3KLSA 1MU5A 4FDBA 1WCMH 1YHQT 3K5LA 2QG0A 4C0ZA 4R4CA 4A3KH 1D09B 2EDGA 2DL4A 2VW9A 4G7OC 4XIPA 2BYIA 2M9VA 1EY5A 4DBFA 5CKEA 2AKPA 3I9QA 4LDUA 1JJCB 4C3HH 5IGEA 5CBAE 4BD3A 4BBRB 1BKNA 3H8ZA 5IY0A 5GAEC 1WJRA 3JB9F 5BN4A 4M78D 4OB2B 5C44B 4JRPA 4DV1Q 1SFOB 1HR0L 4FYDA 1UYCA 5BR8L 2YE7A 4IN3A 1HUNA 4EMKB 3HZ1A 2G6FX 4FNFA 3TQ7P 2B63B 2FRYA 1QWYA 2IWSA 1I5FA 1FMKA 1NMFA 3GIFA 5ELOA 2QF6A 3E0JA 2VCIA 4OWXB 4BBRH 1AH6A 1X2QA 5I4DA 4J9GA 1VQ9T 5EBDA 1KLGD 1A3VA 1VCIA 1N32L 4LXCA 5C0XI 2YKJA 2NUTB 1J9OA 3D0FA 5CTXA 4KSGA 1SYCA 2A68C 3L0OA 2H1EA 2H4OA 4POGA 2OWOA 3V7SA 1S14A 2E70A 2KT1A 4JJDA 1ILQA 1NSNS 2O88A 1Z9ZA 3TDQA 4A75A 1IBKL 4FXGC 2YSQA 2NTTA 1YZ6A 4A3GH 5M3MH 3D36A 4MDWA 1AJ6A 4HCCA 4VUBA 2K1BA 2DD4A 1I8FA 2CQAA 3BZCA 2VS1A 4V2SA 1X75C 3J7ZC 1XMQL 1KAWA 3GP7A 3TS2A 4GKJQ 4BS9A 2O5JC 3I5RA 1ZBJA 3HOYB 4GOPC 3J81c 1VQHA 4GY5A 4WFN3 4HZ0A 4URNA 1DOKA 4PMBA 2FG0A 2FO0A 2HD0A 4Z88A 1NBWA 4GS3A 5HY6A 4DV5L 1HNXL 4LF7Q 1KAAA 2YI7A 2CHBD 4TQUS 4C92G 3LNUA 4FO2A 1UGSB 2IPKD 1VYVA 4CC7A 2E3HA 1ZXTA 2EJFC 2LZ6B 1QILA 3Q22A 2MWOA 1PTOD 2LKVA 1IYUA 3HP3A 2DUDA 2WI1A 3H80A 3OSOA 4P7AA 4YWMA 2E6NA 1KLUD 3L2ZA 1ZSZA 4DR5L 2KRMA 1NJIU 2HUGA 1CK1A 1Z7TA 2FPEA 1CQFA 3RN2A 1CT1D 1DOLA 1AZQA 2QQBA 1CKOA 1JICA 5GMKe 3HS0C 3S17B 2A1AA 1YT1A 3TQYA 2CGFA 1SNQA 1KHIA 2XICA 2ECZA 2CQOA 3CCRT 3EHJA 4CKCA 5KYXB 1WTPA 2EYJA 1L1OA 3M4OB 3X25B 4QY7A 4TKOB 1E1TA 4KN7C 3FVQA 4X66L 3T1YQ 4A3IB 2HD3A 2XX5A 4ASAA 3BVZA 1SHGA 1WCMB 4A53A 4JI2Q 4OMQA 1UUEA 1SHFA 2XWJB 2NVXH 5GANd 4DUYQ 5I22A 1VA7A 1EEFD 3D4WA 4RHRA 1N32Q 1DZ1A 2ZAEA 1NHIA 1HK9A 2WI6A 5GAMd 4BXXH 2CKKA 4FYWB 1N33Q 1TWFH 1WJQA 1S5ED 2UU9L 3WHAA 3RMSA 2KI7A 3PIOA 1GVPA 3QO3A 4JRIA 1BCPD 2WKCA 1YC1A 4GLXA 1RACB 2PUOB 4A54A 1IXMA 2AKLA 5IXBA 1M90R 4C0DB 2F0LA 3S15B 3MEFA 4JASA 5BODA 4ELYC 1VDZA 3T56B 3CCMQ 2F0NA 2FZCB 3L1AA 4N0AA 5FU6B 5I21A 3PUYA 4L5QA 4FF2A 4LWCA 4QF4A 1A2TA 4PK4A 2C9OA 1IBLQ 1SF9A 1IBKQ 4HXJA 4RTVA 2R7ZB 4JAUA 4IO9A 5M5WH 1XMOQ 1AH8A 1PZID 4QIWB 2L2PA 4M78A 1HJDA 1QW1A 2KEAA 4DBQA 1SNMA 4A3KG 1TC0A 5LJ3d 3RLRA 2XTIA 3K8AA 3M59A 2K50A 2MF2A 1S40A 3QJYA 1YHAA 3A5ZB 3OYMA 5HURA 2CCSA 2F4VQ 1ZUYA 2YI0A 3FEWX 5KYUA 2F0FA 4JI0L 1MKHA 1GKXA 3OWFA 2BE7D 2MP1A 4HVUA 4GN3B 4JLIA 3NHHA 1EFID 1L2FA 3F2BA 4LW1A 4O0BA 4EFUA 3S9WA 1V29B 4KY6A 4PJOD 1GO3E 1MMGA 1WTOA 3VS6A 1M9SA 3RMHA 1LTLA 1IREB 1JRIA 3QDRB 1YIJT 4EQOA 3QOLA 1CA5A 3S2DB 3HOZG 2YE4A 2LFNA 1YEZA 3KK7A 4RH6A 4AYBB 9ATCB 4A3FB 1TC6A 5K36H 2FZKB 3A8LB 3T9NA 3CPWP 5HCKA 7AT1B 1O78A 1UAPA 5JJZA 3GTQB 3AFQA 3G71Q 2FYPA 2YK2A 4PL9A 3QWXX 5GAMj 2YTYA 4KH0B 1QKXA 4CHTB 4JI6Q 3U2DA 4CWTA 1LTGD 3G4SA 3QYHB 1PSEA 1PRTD 2K04A 3RR5A 3H15A 4F16A 3J80E 3I90A 1PH4A 2PVOB 2LCLA 1VQ4A 4GLVB 3WDNA 5IWAL 5M4MA 2NUZA 2OTLT 2J7ZA 4ODGA 4G7HC 5C0XG 3MCAB 4A3GB 1WLPB 1I58A 4MNOA 4BY7B 3OS5A 4GQTA 4NH9A 3BFMA 3BMYA 4PV1C 2CCTA 2KMTA 1CI3M 4FPPA 1LT5D 5I2SA 1MIUA 2IX0A 1FMVA 1E22A 3QPHA 1UGRB 2J6KA 3EGXB 5KCHA 2R7FA 3VDYA 1MX0A 1D5ZC 4QGUA 1VQ8A 4LD6A 4GKKQ 4GOPB 2CDTA 1KD1C 2AKKA 1I4XA 4CDCC 2ED1A 1K28A 2RQTA 4LFBL 1XQHA 2NN6H 1IBLL 1G91A 4C8QF 2F5KA 1SE2A 3SR1A 4EMVA 1UWVA 2ALYB 5F2DA 2AIRB 4A3IG 3M7NA 2F0IA 4P74A 5LL6S 1SE8A 2F0TA 4S3SA 4Y92A 1I94L 2DJFC 2LJ3A 5LJ5f 1FJGQ 1LTAD 1SLJA 2CCZA 5KYWB 1T5XD 1TS3A 2BH2A 4Y52H 3PQIA 4KD3A 2DTOA 4WTOB 5I11A 3H94A 4OP0A 2F03A 1QVFS 4OIKA 1B70B 2DY8A 1UEAB 2BDOA 3SD4A 3CD6Q 1RJTA 5EG2A 2AUJD 1SBBB 4NOYA 5LJ5h 2K52A 3HKZG 2EYOA 4N8FA 4PQXA 3CF5A 2NZ1D 4HCSA 3T1KA 2QDBA 1EY7A 2VUMB 3CMEA 4LF9L 4DNIA 4DKAC 2BU6A 1N9SA 1ZUUA 2XDDA 2QDYB 4K2KA 1UTIA 3CCJT 2CFMA 1LO5D 3I4OA 3OA6A 1YJNA 1OYXA 3WXMB 1M1KR 3HKZE 2B8AA 4OGQC 4UPAA 4F88A 4Y7NB 2F0OA 4TVAB 1OXXK 3D8GA 2FMCA 4KK7A 4APVA 1MUZA 2C5CA 2XGTA 2YE3A 4WJWA 1VQ6T 1KIKA 4NPSA 4CC4B 5IYBG 1JM6A 4C92D 1HXYD 1K8GA 2ZPBB 1B50A 4K11A 1Y96A 4MZPA 4DA4A 4O1NA 1OQKA 4BXIA 4C5GA 3H0GB 3HKSA 1LNXA 1EEID 2VB2X 1ZLMA 4L6TB 5E7NA 2E1HA 2NN6G 2H3EB 3BS1A 2HHHQ 2K33A 2N78A 1F9QA 3NWSA 1G3SA 3BW1A 3PGZA 2DX1A 1X3GA 5JEAG 3HOXG 1Q1BA 5C4JB 1GKZA 2WV6D 4L5RC 4E6RA 2EIFA 1FYNA 4FIBA 4DV4L 1HNWQ 5HGQA 1YBYA 5M3FH 4MBCA 5IDJA 1ABQA 4MPNA 1UG1A 2FPDA 4EQNA 2HHIA 4RCCA 3OYIA 1I50B 1QNKA 4PJOE 2WAQE 1Q12A 3PEJA 4O09A 3C95A 1K0SA 1PH8A 4FYVB 3E5SA 3GIGB 2ZDXA 2DVJA 1IRXA 3QG1A 3TUHA 3RZDB 3JV3A 1E6GA 1V1OA 4QIWE 1EX4A 3I56A 3N5BB 1I94Q 4LUOA 3IEDA 2KDSA 3KF6A 1GL5A 1EFNA 3DMUA 4YWKA 3CKIB 1HZBA 2DGYA 1HNWL 4O04A 1UECA 2QA4T 3QIIA 5CO7A 1BI0A 3UE0A 2R5AA 4WF2A 1MSHA 1FVIA 1LLRD 4R9WA 5CORA 5FNDA 5IYDH 3CC7A 4ASBA 3AU7A 2GFDA 4XDXA 4M75B 1VQJA 3QO2A 1HNZL 3S15H 3MXNB 4ZTJA 2E5LL 3K0XA 1VQIA 2UUAL 5GAN2 3NBIA 3UA7A 4F7UE 3DEOA 5CV5A 3CCST 2K03A 4BIUA 2IL8A 1AZPA 4KHPQ 1WI7A 3E19A 1G3WA 3Q5LA 1PRLC 4M78F 4RTWA 4E7ZA 4IOAA 3CC2T 4X9DA 4GEEA 2NWMA 4OX9L 4F7UA 1CHQD 5M4HA 1PD0A 2PMZE 3CCEA 1VMPA 2DIGA 3JAME 2EGEA 3EHHA 3R3OA 5C0XH 3K60A 3NWTA 1U0ZA 1H641 3EJIA 5EPJA 4IURA 2BDNA 1VQOA 3S1QH 2YUQA 3B28A 1J5EQ 4ESRA 1X27A 4HKEA 1K8MA 4BY7G 2D0PA 2QF7A 4JBWA 2EKHA 1N34Q 4LFAL 3M9QA 3JCMP 3VR6A 5IT9c 1JJ2P 2ZXOA 1KD1R 2BT0A 1QUQA 4M7DE 1PHJA 2M2LA 2XHXA 3E9HA 3D0BA 3OW2S 2DXBA 5IN1A 1I6VC 1XPRA 1Q7YU 4JJBA 4OB1B 2GN5A 1TR5A 4GNXA 4H02A 5EKKA 4NH8A 2UU9Q 1UJYA 1S5CD 5K5PA 5AYFA 1UYHA 3K0YA 4RKUE 4LE9A 3CC7T 2KR3A 4OIJA 4P71A 5JENA 2QCPX 3OWDA 1R9TB 5LL6X 1PVGA 4JBKA 2DKGA 1PHTA 1SMXA 2QKIC 3MHBA 3ZXQA 2SRCA 3RESA 1U4MA 3NUCA 4X9LA 2DLPA 4OMMA 1DXMA 4KN4C 1OOTA 4JI4L 1VQNT 3MEUA 3MAQA 4J6XA 2RK2A 4YKRA 3RIRA 2EYWA 2Y4XA 2V8IA 1WIEA 3OY9A 1W2BP 1I3QH 5C4JH 4BBSG 1XNQL 1IXRA 4XQQA 4X9CA 4BI4A 1OO9B 1PRTF 3QOJA 1RF2D 4ZUJA 4LNQA 1GJVA 3BDUA 2BU2A 4ZGEB 1TWFB 2VUMG 4LFBQ 2AKWB 2EGCA 1NEGA 2DE0X 3PFSA 2RSOA 1KIJA 1E2VA 4KBMB 2L3QA 4L59A 2A36A 5M9OA 5COYA 1J3TA 4D6WA 1S72Q 4YCVA 2A6HD 5GROA 4GNXB 4EMKC 1RTOA 1K83B 1TUCA 2PZ1A 1HYOA 2RQRA 4JPBW 4KGXB 3WVEB 2F3IA 3H09A 2JA6H 2RNAA 4Y91A 3MP1A 1WQWA 3KBXA 2YRCA 1QCFA 4XD8A 2FFKB 3ERSX 2EYYA 3OYBA 3OW2A 3C1EA 4FT2A 1E7OA 1VQOQ 1QB5D 4QVZA 3PMFA 4JOIC 5I6WA 4CWQA 2D9UA 1XXGA 4RUGA 2QQ9A 1F9PA 5AFWA 4XCLA 2YKIA 1KJWA 2AWNA 1IYJB 2R92G 2H8MA 1SJHD 5FU7B 3T10A 4K5WA 1VYTA 1QVCA 3BYTB 5CYUA 5CC4A 5IP9G 2ZCFB 3B26A 1H9SB 1WTVA 3VUBA 2YKCA 1JE5A 2JJQA 2QILA 4DEXA 2XD0A 1G5VA 4PFOA 3W3AA 1A0IA 1F2MA 4ZVIA 2YU9H 4J8OA 3I4MG 2RQUA 1GUGA 2MHVA 2YEDA 4C5HA 1H92A 3JCMV 4HVWA 1VQ9Q 1JBMA 1AWWA 2RB6A 1FGBD 5D3IB 4AWQA 3LGLA 1Q90A 2F5TX 1M2OA 1C48A 3CCUT 4JVZA 3VYTA 3PO2H 3STBC 5IODA 2A74C 1Y57A 4X62Q 3I7FA 1BUVT 4UHVA 4PJOC 2LC4A 1K83H 4KHZA 2EZVA 4LF4L 4A3FG 1JOQA 1ZX6A 3CCMT 4AH6A 2FWYA 5IHIA 3REAB 3SDZA 4C92E 1SMYD 1YNNC 5D65A 1MHNA 2O31A 4M7AD 3G6JB 1XMQQ 4JI4Q 5LJ3e 3CCUQ 2R93G 4M75E 4QQ6A 4IFDG 3AFPA 2DEQA 3RLFA 3GIGA 5LJ5e 2M0YA 4OX9Q 3M55A 3SK8A 4A3MH 2PW7A 2IOPA 4HIOA 4DUZL 3RR6A 5EJWA 1GHKA 2Q2EB 3ER0A 2E12A 4A4EA 1G6PA 2GQVA 2RF4A 1UYDA 1SYGA 2VQEL 2W0ZA 2CUDA 3VUZA 2K4YA 2HCCA 2NVQH 4GBQA 4WCIA 2V1RA 4IUNA 3GTOH 3TZ5A 4XTWA 1WPYA 3NHNA 2F0VA 5LJ5d 4E7SA 2JW4A 2BREA 2DL3A 5IE8A 5FJ8H 5IWAQ 4LUVA 4X3KA 3I2ZA 2DILA 4BI8B 1MBYA 3NP8A 1W3SA 1HNZQ 2ZTEA 1VQMT 4L5TA 4AQYQ 4PU9A 4E72A 4EQPA 2MK5A 2DBKA 4DV3L 1WVLA 4DR7Q 1PD1A 1CKBA 4HSPA 3CQTA 1A62A 1I5AA 3K80C 3T16A 4M78E 2QG2A 1OXUA 2JTMA 3QTFA 4H81A 1V1CA 1TUDA 1BNZA 3Q5KA 4CE1A 1PMRA 1U5SA 4GKKL 4E47A 1PH5A 5FU6C 3LGFA 4FSXA 4R56A 1K8AC 3M54A 4NXML 3RZOH 1IGUA 3PO3H 3CGYA 4J7FA 3RKWA 4C92A 3ZM7A 5KCOA 2IJ0A 2SEBD 2KSSA 3CW2C 1QZGA 2WKDA 3VR3A 4DV4Q 2MOXA 1YJNQ 3D6WA 2ROLA 4XQJA 2MI6A 4M75A 4F7XA 5HGTA 4Z89A 1KRSA 2PNRA 3J7AV 3OYHA 4C3HG 4LFAQ 5FLMG 1AP0A 1ZQ1A 5CGKA 1JXMA 2HQEA 3R4PA 2G3RA 2LCSA 1BYMA 2B63H 3EBEA 2QK0A 3T13A 3JB9J 1FMWA 5M3FB 2LY7A 3R93A 4CJ2C 5LMUQ 4YHHL 3T51B 4DR2Q 4M7DF 4RTYA 1VQ8Q 3F1ZA 1XTCD 2RO0A 3V8LA 4HCEA 3G6ET 4GOPA 1WHKA 4BBRG 1TSFA 4FCPA 1UE1A 1Y1WB 1UGVA 4HYPA 3QUIA 4KULA 1TKWB 3JCMJ 4E7HA 3U9OA 4JJNK 3RNJA 2CZ6B 1KHCA 2E64A 4II1A 4FW2A 2CW0D 5TSSA 2DNCA 3FV5A 4J1MA 1I4HA 2OTJA 1KQSA 4RG2A 3P8BB 3S17H 1TIDA 4B9XA 4R8NA 4A3CG 3CD6T 4DFAA 1TU2B 2LJ0A 2L1BA 2K5DA 2IY5B 1R8OB 1N27A 2A37A 2LQNA 4J9CA 4ZKBB 2Q8HA 2CP6A 4QQBX 1VQKA 2JYOA 2A08A 1NPPA 3LH5A 1E2WA 2J05A 2JJ9A 1PLFA 1K8AR 5BN3A 4DV3Q 1UY8A 2DTIA 1OI1A 2F0DA 3SWNC 2KHIA 4U93A 2VUMH 2RMOA 4N8X1 1HR0Q 1K9AA 2LS01 4XT3B 3EHQA 3W2DA 1AW7A 4K14A 1A0NB 3G7LA 1MD2D 2I46A 4FW1A 1ET6A 2EPDA 1QVPA 1CSPA 4C3JH 3NE5B 4EGIA 2CREA 5CV8A 3MEHA 5M3MG 1STEA 3TEHB 3UATA 2DXTA 4DZYA 3M5AA 1TWAB 1WOCA 1UB4A 1T0JA 3CCLT 1YJNT 1JJ2S 4QVCA 1IYVA 1MMAA 5CVIA 1YNJD 2XJJA 5FW9A 1B9NA 2MYSA 3Q1JA 1H3HA 3SVMA 3P7JA 3IAYA 1C0AA 4WJ4A 4BY1G 2C0OA 5EC7A 2RCFA 4KFGA 1BCPB 1OULA 3J7AF 4QL5A 2EQSA 1AMWA 1F51A 4H13C 2RQVA 2B2UC 5KYWA 5IH2A 2DMOA 1RAAB 4IPGA 2R93B 1XNIA 1EY0A 3TZ2A 3I70A 1Z5AA 2BTTA 3PTAA 1D3BA 1YVCA 5CTUA 5IP7H 3CCQQ 2L3PA 2QEXA 2EQKA 4BE0A 1KQSS 4ABNA 3QR8A 5FOBB 5GAN3 1V1QA 4UP8A 3U4VA 3FKIG 1T3LA 3M58A 1W2BS 2H5XA 4HZ5A 3G6EQ 3JCMg 2P84A 1T0HA 1VQGA 5CV6A 3J81i 1AM1A 4DOVA 1X55A 2LMJA 1JOKA 4N4GA 2MGSA 4AQYL 2I0QA 2WEQA 3H0HA 4FP5D 2Q2HA 2G5DA 4EGHA 3C1FA 1TH8A 4XC0A 3VYGA 2JXBA 1WHMA 2QA4Q 2KEEA 2RQXA 4C56C 1QQJA 4C3JB 2QG9B 4KUIA 1JOOA 2F4VL 4A93B 5I9OA 4YY3L 1BGQA 4XYOA 2DVEA 3MEAA 4ATOA 1SRUA 1Z47A 3TZDA 3CCLA 4DV2L 4DR3L 5C4XB 4ZNXA 5D7RA 1V9PA 4DA2A 1YITT 5IN9A 3OYYA 4YWLA 3GTKB 4URLA 4A3GG 1VYUA 1Y8NA 4BQJA 4LDYA 3S14H 2ZM6Q 2HG1A 4BE1A 4J9EA 4GGLA 5GAOm 3OYEA 2JS0A 2KCMA 1TWCB 2F0JA 3LX0A 4YKUA 5M4PA 4ZKIA 1SEMA 1FL0A 5HK0A 4C3IB 2CWPA 3C94A 4BBSH 3WVDB 1B62A 3PMIA 4ID6A 4IUTA 4UY8C 1PKSA 1F2ZA 3DWPA 1PH3A 3MFYA 3NQIA 4CKBA 4AFQC 3HSBA 2RHUA 1YC3A 1OZ3A 1QOHA 3PUWA 2A6ED 2XABA 4WJ3M 3QHSA 4XTYA 2BA0A 1I4RA 1M8VA 3JAMc 4JAVA 4DAYB 1I5BA 1U0LA 1C1AA 4M7AC 1N8RC 1L1OC 2HDLA 2D0QB 3HL8A 1AFPA 2EQUA 1I3QB 2FXSA 3OS0A 4YTLA 5GAOr 2DM1A 4HJ5A 4LF5L 3SL2A 4L63B 2F2VA 4L6V5 3QDDA 3CCQA 1A3TA 3A0RA 4BAEA 3GTLB 2MPXC 1UNSA 3KF8A 1SXTA 1E2ZA 3G7BA 4GFNA 1TVXA 4B08A 1YFNA 1SDFA 2FB7A 2X69A 5ELDA 2E2JH 1RUWA 5CKDA 4CI0C 2EJGC 4RA8A 4AS9A 3JCMX 4CWPA 5C4XH 1NPRA 1VQMA 3R8BA 1EL0A 2HBPA 1EA6A 2R7DA 5LJ3f 4ASFA 1YNJC 4EFTA 3BDCA 4DNRB 4DXGA 4C5IA 3A0JA 4E01A 3O8VA 4Y7NH 2L8DA 2R6GA 1VQ4Q 3S3OA 2DY7A 4V0BA 1N36L 1ZBXA 2DAQA 4X34A 1IKMA 1VIFA 5J3BA 3S16H 2RHSB 3K7UC 3EGDA 3KLRA 1TOVA 1BOSA 1IGQA 4M78C 4XIGS 2VQEQ 3S1NB 3OYLA 1YERA 1ZYRC 5CV9A 1X3QA 5DNFA 2F3WA 3JSCA 1FNWA 3CCLQ 1TIID 5GAMf 2RDFA 2OCEA 1GKHA 4E00A 2AWOA 2P5ZX 4PFZA 2EY2A 3QB3A 1D2BA 3EG2A 2KY9A 2MJ8A 3GTJB 2E6ZA 5GMKj 2NVTB 3SFMA 2RDHA 1MNDA 4BBSB 2DPPB 2AHJB 2QFOA 4HYMA 2N8NA 1SNCA 1R0CB 1L1OB 3I4LA 3A54A 2KE9A 2O1UA 2YXYA 1VQLT 3AB9A 4HY6A 1QY8A 5I2YA 5C0XJ 1BXDA 2XDPA 3Q23A 3M57A 4KTAA 4C8QB 5KNBA 1V1PB 2A6HC 1EIGA 1U06A 3L2QA 2Q8GA 3OIQA 2K75A 1J8IA 1X56A 3TP8A 2W10A 4OL7A 1CHPD 1VF7A 3TP7A 4NB3A 3GNFB 2B2YC 4OWTB 3PIP3 4FSSA 4DQ2A 3CD6A 1TS5A 3ZKBA 2X6LA 5CK9A 2HL5C 5BN5A 1M30A 2GVAA 4BQGA 1B34B 1K73U 5AJ3Q 2I5MX 2A69D 1WZOA 1NLPC 4KKTA 3WOEA 1S5BD 2B86A 4JI1Q 4MPCA 4DUYL 2VQFQ 5T1IA 1B34A 4A3IH 1QZHA 3JC66 3M4GA 4LF5Q 4R3AA 5D6YA 3VS3A 4JS5A 2NB0A 4FF3A 3LPSA 2JVVA 3U67A 1I59A 3OOCA 2JTFA 2FPFA 3X20B 1JEGA 3HRZC 2YEEA 4Z02A 3CCRA 2NUCA 2IIMA 4H7QA 3OB9A 4Q0FA 1MNEA 2JA8H 2RBMA 2L5TA 2XSCA 1XPOA 1E7ZA 4DR2L 3M0QA 2L12A 5IIFA 2JXMB 3GTOB 2Z4IA 4RFBA 2GTJA 3VJPA 4PMCA 2YEIA 1ZWHA 5KRUA 2CSQA 1WHJA 2LX7A 2YLCA 1IL8A 1NE3A 1G2BA 4F7UF 1AZEA 2G9DA 2PCFB 4X3SA 1PRTC 1I07A 4JZ4A 3MNRP 2NUTA 2XU8A 1ENCA 4X64L 2MPMA 3ZYYX 3K5NA 4DV0L 3CRKC 2AQ2B 2YJWA 1B1ZA 1RCVD 3X24B 2UXBL 2CCUA 2QAZA 4DOWA 2BYHA 4PNYA 3LMMA 4JZ3A 1SFOH 4RTTA 4A3BB 2E5KA 1O80A 5FKAC 1EIYB 3FPUB 1I0CA 2KYMA 4C8QD 2LVMA 2HIXA 2JE6I 4PJJA 3EGDB 2K57A 1B4OA 3FP9A 5KYIA 1K8AU 3P8HA 1XOVA 5LMNW 1PH7A 1FXXA 2I2LA 1TXYA 1SYEA 1XNRQ 3S1QB 2CWAA 3A0XA 3OSVA 4HTHA 1D1IA 4FF1A 2RD1A 1WYDA 3CMAT 1E24A 4PLLA 4UP9A 4A3BH 3MP8A 4Q5WA 1IHVA 2NYZD 2M02A 5GAN5 1RIPA 5FJ8G 2IWXA 2GGRA 3VYHB 5GANg 2ED0A 4L5SA 4M7DB 1X32A 5FWCA 1OZ2A 3KF8B 2QGQA 3I56Q 1NEBA 2OTJQ 3I4MH 4XDMA 5ELCA 3KDFB 5GAOp 1Y69U 3HOZB 3VYSA 4BA1I 3H0GG 4DR7L 3GDEA 2CT3A 4KTNA 2LSSA 2BU8A 3OWBA 2K2VA 1WHGA 2BH8A 4DAYA 4HMIA 1XTDA 2K7AA 1BKBA 1SMYC 2NZHA 3CC7Q 1RTNA 2HZYA 3M53A 3A55A 2IWHA 2XG8D 4IPHA 4CWFA 5EPKA 4DXFA 3DLLA 2BZXA 4AYBE 2CZ0B 2J7IA 4AFZC 5G3LF 3I72A 4L8ZA 3CCSQ 3PO3B 1PYWD 3C0CA 3PMTA 1Q8KA 4CDEC 2J4XA 3DXJC 1YJ9T 3FEOA 4TVRA 4LDVA 2BOSA 1JB0E 2AZVA 3JCMc 3B24A 4XIQA 3MO8A 3CXCS 4ASGA 2F0MA 2OF1A 2IVWA 3OYCA 2V8KA 4CC3A 2QDLA 2B2WA 2ZJRA 2O2OA 1KQSP 3N6RA 1I5OB 1BBWA 1M4VA 3S1RB 2K5BA 1B8AA 4B7PA 1NYFA 3C12A 1Y7XA 1I5DA 3RZDH 1PV4A 2MQHA 2XJGA 3K57A 1UYEA 3H3VI 1W70A 2QASA 2PZTA 2YKBA 2YE2A 1UYIA 3E6ZX 5GAN7 1FYCA 2NUPB 5CKBA 3OHXC 5IGGA 4JCVE 4K0KQ 1KC8U 3URYA 1JB3A 5C3WA 3M0SA 2RM4A 1DGSA 4XITA 2H3JA 4R8IA 1BI2A 4O2DA 2CVRA 2N3SA 4DF7A 1SEBD 4KKSA 3PE0A 1T9HA 5M5YB 4C8QE 5GANj 4DV1L 3G71A 4AG1C 3VV0A 4HXWA 3JCMe 4DEYA 1BR9A 3DGEA 4LWIA 2EXZA 3PSIA 4LF6L 3UPUA 4XTJA 4OF1A 2ZPFB 3CRLA 2GQIA 1Y1VB 4NXMQ 2BZYA 3CPFA 3I56T 1PZJD 1PG5B 1V1PA 2PI2E 2SNMA 4C8QA 1X54A 5KIXA 3H3VH 2IX1A 2NVXB 5KYYA 4J9BA 1OEBA 1D1AA 3I55T 4RG8A 3L3OC 4CGYB 1SSFA 4CWRA 2AZSA 4AG2C 3I73A 5ELFA 1I50H 1RI9A 3CXCA 4K6LA 3PUZA 3FDRA 4ZAIA 3S3NA 2EYXA 2CKZB 4PLIA 2NWGA 2MNAA 3OQ5A 4K8JA 3BDLA 3E2UA 2CP2A 5GAMe 4JQLA 5M5WB 1AVZC 3EA6A 2B2YA 4HJ8A 4WUDA 1AE3A 3TP6A 3OTOL 2YEFA 1SNPA 4GNXC 4A3MB 5D6XA 5DM7R 5GANf 4QVDA 2WP8J 5CV7A 1SYDA 1X2KA 1L0YB 1NE8A 1WXTA 1M4ZA 1PRMC 2JMCA 3UT1A 2OTLQ 4LD9K 1QVFA 4DV0Q 3STBD 1K8OA 3INXA 4EMGA 4DV7L 2O9SA 3JZ3A 1VQ6A 4M77F 3HOZH 4J7IA 5CBEE 1BK2A 2R5MA 3NFCA 4CJ1B 2QEJC 1QVGS 4DK3C 4M7AE 1JWSD 2F4IA 3NENA 5C4ZA 3GTMH 2DYBA 3QZ9B 4LDXA 1GCPA 3CPWS 4URMA 4LMQD 1IW7C 1G291 2XK2A 1JE4A 2QEXQ 1HZCA 3HRTA 1K3BC 1GBRA 1X3PA 2EJ9A 3RNUA 2R92B 1I6HB 3G75A 4G7ZC 3S5TA 1K0RA 2A5HA 3TMEA 3G1JA 2RHZA 4P72A 1B2TA 4IFDJ 2YTXA 5FRNA 1WTHA 1UDLA 4U673 5EKLA 2E76C 4C0GA 2J6FA 2ENBA 2MMPA 1MSGA 5IHKA 2HQXA 4EM7A 3T1YL 3JCMb 1RI0A 3SEBA 2UXBQ 4UROA 2I5HA 2PTKA 2XRQD 4X64Q 2XHTA 4KMUC 1GXIE 3LGJA 1VQ5Q 2CUBA 1DJ7B 2K6AA 3UDGA 2A8VA 1K9MU 2EKOA 2COWA 1PKTA 4M77D 3RUXA 4DR1L 1WTRA 1VQNA 2O5IC 1ESFA 1U3OA 4RWSC 2YTVA 3PEHA 2P0PA 5M5XH 4KRTA 3JCMW 3FRPB 2UUCQ 2D8HA 2RKSA 1GUOA 3K97A 2JA5B 4M77E 1U2OA 1C9OA 5HKCA 2DJGC 2K4KA 1R9TH 2KROA 3OW7A 1XNRL 2YT6A 2EXDA 3F2UA 3HOXB 5C93A 1NYGA 1Y8OB 1JC7A 1EU3A 3FT8A 3TEEA 1NR4A 3F2DA 1UYGA 4X62L 1SAPA 4DUHA 3RN5A 2EQIA 2JK8A 2L4NA 1ZEQX 4M77G 4KV6A 3META 2B2TC 2VV5A 1II3A 4CDDC 2KJXA 1VS0A 5C0MA 4DAMA 3BZKA 4PZ7A 2CGHA 3OTOQ 4JBJA 2XDLA 4QPKA 3I4NG 4XTCS 3M0PA 1OU8A 1SPKA 2PQAB 2KUMA 2VY3A 1N5ZA 1PH9A 2ABLA 1EU4A 4XTZA 4PJOA 1Q95G 3CMEQ 3MA2B 2EY1A 1GFDA 1CKAA 1HD3A 1WFWA 4QMGA 4B6CA 1TT2A 2EW3A 5KEEA 2Z0WA 1G3TA 1JO8A 1K73R 1LACA 1ID0A 4E2FB 1OX9A 4BUGA 1IO6A 3FPPA 1QP3A 1SE4A 2IWUA 2K32A 4FU6A 2JQOA 2QYZA 1KD1U 4EQ5A 1SSHA 5C6SA 1YJWA 5GMKi 4MTKA 1O7LA 2RSNA 3MXGA 3C2PA 1GM5A 1VQMQ 2A19A 2F1MA 4P8OA 3EGUA 2IW3A 4A3FH 3EFSA 1K76A 4AT1B 1SSOA 1XX8A 3EHGA 2ZPIB 2K5HA 3SHWA 2B2VA 2YEBA 1MMNA 4BWGB 1WHLA 1O75A 2XHCA 4ZN3A 3AQQA 3VR5A 4R4IA 2F0WA 5LHY1 1TWCH 3J7YW 2EY6A 1D1BA 1S5FD 2Q8FA 1D0XA 1AWOA 1EY4A 2DXCA 5A2QL 1U9RA 5IGFA 4NW2A 2J06A 4BY1B 2GFUA 3BVMA 4Y28E 1UGQB 4K5XA 4N9PA 1VQNQ 1Y4SA 2X6GA 1BBUA 1KIXA 4QJFA 3BM9A 5C44G 3DWAA 1YSRA 2MIOA 5JVH3 4DK6C 3AHUA 4QPJA 5ELEA 5IT9L 4A3MG 2ZPHB 2CP3A 2L3RA 3BVGA 4JJCA 5IXFA 2C0TA 2X4YA 3CC2A 3DM3A 4K4OA 4L91A 1W2BA 5H1SE 1SN8A 1WQ7A 4DAPA 5EBCA 2MWPA 1YESA 3PIPA 1VQPT 3ZKDA 4MMLA 1YNZA 1I81A 3HP9A 1ARKA 4TSSA 4C92C 5CPHA 3U9SA 4KT0E 5L23A 3E1SA 3CMET 3CGZA 5AT1B 3HOWG 3CCJA 4DV6L 1AOJA 3NGPA 2EXLA 4EIKA 1T3SA 2UWDA 1G8ZD 3K6OA 3JCMQ 4XK8E 1X65A 3GP8A 5F5RA 1H9SA 3EG0A 1O7YA 2FMMA 3RLNA 2E41A 4O5VA 1N34L 3GO5A 1HRJA 1HCZA 3M4OH 4B3MQ 2C1IA 2QGFB 2GQPA 2XCMA 2VWFA 4I7AA 5D6PA 1SG5A 1LVKA 1AEYA 4OO1H 3SK5A 1X69A 1EQRA 4XCJA 2JP1A 1F2YA 5I6YA 1AT1B 3IKJA 1EYGA 4A93G 5M4KA 3M0TA 1N6AA 1M5Q1 4QQGA 5C3XA 2WI3A 2L11A 3GD7A 3CCVA 3TRZA 3SHLA 3CCRQ 3REBB 4BE2A 4RMOA 1EFWA 3VADA 4X3TA 4NL3A 1EIFA 3TCJA 1DOMA 3GTLH 2X51A 2ASBA 1ZXNA 2F2XA 2OI3A 4JYAL 6AT1B 5FNFA 1R77A 1Q86C 2QTXA 3VRYA 5JPNC 4NXNL 1Q81U 1GUSA 3EG1A 2F0QA 1QWFA 1DJRD 5GAN4 1W6JA 2K3XA 2R58A 4BY6C 2I5LX 4DK0A 4EVOA 3EFOA 3OW2P 2KCNA 3RERA 2KQWA 3H4LA 2XIWA 3RLPA 1VUBA 4XAXB 3HZ5A 1GCQA 3OBYA 4CWOA 2CSIA 2RVLA 4C92B 1K0XA 3LWUA 1G8XA 2YDLA 1V76A 2KT8A 2PNHA 3WWVA 1M1KU 3S1RH 1EZ8A 4JI8Q 3S2HH 1MGSA 2CS7A 1A8VA 1QMCA 3C4SA 1X3EA 4ZN1A
chains in the Genus database with same CATH topology
3NMZC 2L3PA 2WI7A 1YT1A 2CGFA 2ECZA 3A98A 3EHJA 4HY1A 4U93A 1T3LA 2OAWA 4HZ5A 4R0KA 2VW5A 1KFZA 2VWCA 3WQ9A 2DL8A 1T0HA 1AM1A 2ZDYA 4MOTA 1OV3A 2LMJA 2KNBB 2XX5A 2EVRA 4ASAA 1SHGA 2WEQA 3H0HA 1H8KA 4OMQA 1UUEA 1SHFA 4EGHA 1TH8A 4GCZA 1KZNA 2JXBA 1VA7A 5I22A 1NHIA 2JT4A 4F17A 4W7TA 2WI6A 2BZ5A 2VCJA 3KE6A 3NMQA 1BGQA 2YUNA 1H7SA 5D6QA 3WHAA 1GCQC 4ZNXA 5D7RA 2LNHB 1YC1A 2YGFA 4URLA 2VVKA 5FWKA 5IN9A 1VYUA 2AKLA 5IXBA 1Y8NA 2FWZA 2IORA 1YP5A 5GJVB 4JASA 4L90A 4MP7A 2HG1A 4BQJA 5ECAA 4J9EA 3A0YA 4GGLA 5M4NA 2BZ8A 2JS0A 2WI5A 5M4PA 3QWYA 4I5SA 4YKUA 3CWVA 4ZKIA 1SEMA 1SRMA 2LQWA 2E0AA 4HXJA 4RTVA 1B07A 4JAUA 3HEKA 3R92A 2M51A 1PKSA 2FEIA 1AH8A 4AFQC 1YC3A 4LWFA 2L2PA 1HJDA 4R1FA 2KEAA 1TC0A 2XABA 3RLRA 2HCHA 3H41A 5GJWB 2CCSA 4YKTA 1CSKA 4OMNA 1ZUYA 3VS5A 1I5BA 2YI0A 4JAVA 1GKXA 1YWOA 2GBQA 3I5SA 2FXSA 4YKZA 4HVUA 1GRIA 4LUDA 2YI6A 2DM1A 4O0BA 2HDAA 3R91A 3SL2A 2F2VA 2A28A 3TZ0A 2JJCA 3QDDA 4EFUA 3A0RA 4BAEA 4ORZA 1SRLA 3VS6A 1GBQA 3G7BA 2KRSA 4GFNA 2YJXA 3B25A 2JM9A 2YE4A 1WYXA 1RUWA 2D0NA 4J9HA 4AS9A 4CWPA 1BYQA 1EA6A 1TC6A 5HCKA 2FYPA 4ASFA 3OMUA 4EFTA 4PL9A 2YK2A 4E01A 3QWXX 3RBBB 1M3CA 2CH4W 3U2DA 1QKXA 2LP5A 1BB9A 4CWTA 2BRCA 1JXOA 2BSMA 4HXZA 4F16A 4CWNA 1YS3A 5M4MA 1YT0A 1YERA 2NUZA 1R62A 3H0IA 2ESAA 1WLPB 1I58A 4GQTA 4NH9A 3UF4A 3BMYA 4PRVA 2K9GA 2CCTA 4E00A 2KBTA 1NHJA 2HEQA 4FPPA 2PNIA 4LNPA 3EG2A 2YE8A 4XC0A 1MV3A 2J6KA 3NPFA 1NLOC 4AWOA 1GFCA 1MX0A 4HYMA 2ESWA 2QFOA 2YE5A 1OPLA 3IQLA 1LCKA 2CDTA 2FRWA 2AKKA 2KE9A 4YKWA 2ED1A 2RQTA 4A63B 2O1UA 1BXDA 1W6XA 4HY6A 1QY8A 3CRKA 2XDUA 4EMVA 2Q8GA 1U06A 1KSWA 4Y92A 2LJ3A 2W10A 2J6OA 4OMOA 4YKYA 4FSSA 3ZKBA 1HSQA 1W1FA 5I11A 1M30A 5CTYA 4H81A 4BQGA 3K98A 3U2KA 1RLPC 2KGTA 4QT7A 4RTXA 1NLPC 2B86A 2H55A 2H8HA 4MPCA 3ULRB 1UYMA 3T1KA 4R3AA 3O6OA 3M0UA 1Y4UA 3VS3A 2BU6A 1ZUUA 3LPSA 1G83A 3FJ5A 1UTIA 3U67A 1I59A 2HKJA 4O07A 4HVVA 2YE6A 2FPFA 1BBZA 2CT4A 1JEGA 2YEEA 4J9DA 4XIRA 3ZXOA 2IIMA 4H7QA 3O5ZA 2CG9A 4IIMA 1UE9A 1B3QA 1MUZA 3M0QA 2YE3A 3TSWA 1Z9QA 1KIKA 1JM6A 4CC4B 2GTJA 2YEIA 1X6BA 1ZWHA 2CSQA 2L0AA 2LX7A 3VS7A 4K11A 1G2BA 4GLMA 1AZEA 3G7EA 4V26A 4BXIA 2DRMA 1I07A 4JZ4A 3MNRP 3U23A 1TILA 1ZLMA 1THNA 2YJWA 1AWXA 2C0IA 2CCUA 2JKIA 4CE2A 2BYHA 2RQWA 4JZ3A 2DX1A 2XDXA 4XKOA 4RTTA 1GKZA 2E5KA 1X6GA 4E6RA 4MB9A 1I0CA 2KYMA 1FYNA 1UY7A 2X3WD 4LN2A 2ENMA 4NH7A 4MBCA 4XKAA 4MPEA 1ABQA 3VHAA 1Y8OA 1UG1A 1XOVA 2FPDA 4MPNA 2EGAA 3A0XA 3A0ZA 3PEJA 2VKNA 4O09A 1UHCA 2DNUA 1K0SA 2F2WA 3GIGB 2ZDXA 2DVJA 3TUHA 2HCKA 3JV3A 1E6GA 2ROTA 2IWXA 1YCSB 2G