1S14A

Crystal structure of escherichia coli topoisomerase iv pare 24kda subunit
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
168
structure length
168
Chain Sequence
TDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCISVVNALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of Escherichia coli topoisomerase IV ParE subunit (24 and 43 kilodaltons): a single residue dictates differences in novobiocin potency against topoisomerase IV and DNA gyrase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Topoisomerase IV subunit B
total genus 51
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature ec 5.99.1.-:
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1s14A00
3A0WA 2ESAA 2YKIA 2FWZA 4EGIA 1YC3A 2YE3A 2BU5A 3FT8A 4GQTA 4CE3A 1PVGA 3CWVA 1BYQA 4CWPA 3G7EA 3O2FA 3QTFA 4MP2A 1GKZA 2YE5A 4MBCA 3T0ZA 4BIZA 4L91A 1YT2A 5F3KA 1Y8OA 3INWA 2BU6A 3GIGB 4X9LA 1U2OA 1UY8A 5M4MA 3OPDA 2XX5A 4CWQA 2YJWA 5M4PA 4AWQA 4PU9A 3OW6A 1QZRA 4CWTA 3LPSA 4CWSA 1I59A 2IWSA 3HYZA 2O1WA 4FCRA 1Z5CA 3R4PA 4HY6A 3RLRA 1YSZA 4LPBA 2XDSA 4O0BA 4W7TA 3U2DA 3CGYA 1Y8PA 2YJXA 4L93A 5CPHA 1AMWA 4L90A 3A0XA 3TTZA 4CWFA 1KIJA 1A4HA 1B3QA 4BQJA 4V25A 2YEJA 4YKTA 2WI1A 4DUHA 4EFTA 1UYMA 3HEKA 4HZ5A 4V26A 2BT0A 4ASAA 2FYPA 4R3MA 3CGZA 2YEBA 4MB9A 1GJVA 4MP7A 2YE8A 1R62A 3A0ZA 2XABA 3GIFA 3K60A 2E0AA 2YE4A 3BMYA 4EGHA 1EI1A 3B28A 2BRCA 1AM1A 2VCJA 2IWXA 4H81A 2YGFA 4H85A 1THNA 2Q8IA 1ZXNA 3ZXQA 2CGFA 3HZ1A 4XIRA 1QY8A 4P7AA 4DZYA 2YKCA 3JZ3A 4BAEA 3OMUA 2AKPA 4XE2A 2XHRA 3INXA 1YESA 5GGZA 4WUCA 1EA6A 2HKJA 5BOCA 1MX0A 1TIDA 4EEHA 4URMA 1TH8A 3B26A 3EHFA 2O1VA 2XJGA 2H8MA 2JJCA 5CTXA 4JAVA 3A0TA 4LWIA 3OWDA 1AH6A 3KE6A 2YGEA 1Y4UA 2YEFA 3R92A 4I5SA 1U0ZA 1ID0A 4H7QA 5M4NA 3BM9A 1Y4SA 2XJJA 4LWEA 4LWFA 2WEQA 2CCUA 2WI2A 2ZDYA 2C2AA 4B6CA 1UYLA 4U7OA 4FCQA 4U93A 4YKZA 2WEPA 2IOPA 2QFOA 3EKRA 4XDMA 5J6AA 4CE2A 4ZVIA 1B63A 4E01A 2XHXA 3H4LA 2XX2A 4NH7A 5M4EA 3K97A 2YE9A 4HZ0A 3K98A 2YK2A 2GQPA 4JAUA 4O07A 3RKZA 3MNRP 3TZ4A 4GCZA 4GFNA 2YE6A 3FT5A 3T2SA 4XTJA 2XJXA 3K99A 3C0EA 2Q8GA 3O6OA 4K4OA 2YEDA 1UYCA 2BYIA 1US7A 4R1FA 4JQLA 1UY7A 5CTYA 3DGEA 2YEHA 3SL2A 4O05A 2YKEA 1TILA 4E00A 3U67A 4FPPA 1YC4A 4XIQA 3TUHA 3Q5JA 4ASBA 4FCPA 4AWPA 3ZKBA 4HY1A 4E02A 5F5RA 1ZW9A 2PNRA 4CWNA 2JKIA 4MPCA 4Q20A 4URLA 1I58A 2ZKJA 1H7UA 2BU8A 5D6PA 1L0OA 5D6QA 1ZXMA 4NH8A 4KTNA 3O0IA 4QPJA 1YERA 2YI7A 3R4NA 1YS3A 2IWUA 4JASA 4YKXA 4MPEA 2EXLA 4I3HA 3C11A 3VHCA 5FNFA 2XHTA 4L8ZA 4BXIA 1UYHA 2IORA 3T10A 1KZNA 2XDXA 4R3AA 1Z5AA 3GIEA 2Q8FA 2VW5A 4KSHA 4WUDA 4CWOA 1I5BA 5IDMA 5J71A 4LWGA 2QG0A 2VCIA 2XDUA 4KSGA 2WERA 3G7BA 3LNUA 4MPNA 3TZ5A 2XDKA 5FNDA 2WI7A 2YEAA 1ZWHA 3WHAA 2YKBA 5IDJA 3B27A 3FV5A 2YECA 1Z59A 2UWDA 1NHJA 1Z5BA 4UROA 4EFUA 2FXSA 2ZDXA 4XC0A 3Q5LA 1UYEA 2YK9A 3EHHA 5BODA 4CWRA 1BGQA 2BTZA 4BQGA 4EMVA 5C93A 1TBWA 4YKUA 2YI5A 4EGKA 5FNCA 4FMTA 4GT8A 4WUBA 3EHGA 1QYEA 2XDLA 1AJ6A 1UYDA 4ASGA 5CF0A 3EKOA 4LWHA 3D2RA 2FWYA 3G75A 3HHUA 4XCJA 3T0HA 2CG9A 4HYMA 2HG1A 4NH9A 1NHHA 4GEEA 2YEGA 5IN9A 1YETA 2WI4A 2XD6A 4PRVA 3PEJA 3VHDA 1MU5A 3D36A 2CCSA 2YE2A 4AS9A 2IOQA 1YT1A 3D0BA 2WI5A 3ZKDA 4PL9A 2BU7A 1UYFA 4XIPA 1UYIA 2VWCA 3B24A 2O1UA 3RLQA 4PRXA 5M4KA 3A0YA 2Q2EB 2CH4A 4HYPA 3A0RA 1BXDA 2QF6A 4MOTA 4XCLA 2K5BA 2YI0A 5D7RA 2ZBKB 5CTUA 4XITA 1S16A 2YKJA 4KP4A 3B25A 4HXWA 3HYYA 2YI6A 3R91A 1I5DA 4URNA 3WQ9A 3R4OA 1UY9A 1UYKA 3H80A 3VHAA 3NMQA 1YT0A 5M4HA 4ZKIA 2BSMA 1UYGA 3IEDA 1TC0A 1BKNA 4B7PA 3OWBA 4XKOA 2YGAA 2QG2A 3VADA 4EM7A 1GKXA 4YKRA 3CRLA 3ZXOA 3T1KA 4HXZA 1YSRA 2BREA 2Q8HA 3TZ2A 1B62A 2BU2A 3R4MA 4CE1A 4AWOA 3Q5KA 3EHJA 4YKQA 1AH8A 1UY6A 2YEEA 3QDDA 4P8OA 4XKAA 3U2KA 2WI6A 3CRKA 4YKYA 3RLPA 2CCTA 4QPKA 1JM6A 5D7CA 2XX4A 2XK2A 4XKKA 2WI3A 1H7SA 3GIGA 4LP0A 2YEIA 1I5CA 4U7NA 2YE7A 4O04A 4L94A 1I5AA 4KQVA 1NHIA 4BIUA 4O09A 2BYHA 2H55A 5CTWA 1Y8NA 4ASFA 3TZ0A 2HCHA 1TC6A 1S14A 4KFGA 4XD8A 2GFDA 2BZ5A 1YC1A 2XCMA 4YKWA 3ZM7A 5L3JA 3HZ5A 5D7DA 3PEHA 1OSFA 5FWKA 4GGLA
chains in the Genus database with same CATH superfamily
3A0WA 2C1IA 2ESAA 2YKIA 2FWZA 4EGIA 1YC3A 2YE3A 2BU5A 3FT8A 4GQTA 4CE3A 1PVGA 3CWVA 1BYQA 4CWPA 3G7EA 3O2FA 3LMMA 3QTFA 4MP2A 1GKZA 2YE5A 4MBCA 3T0ZA 4BIZA 4L91A 1YT2A 5F3KA 1Y8OA 2FTKA 1IXMA 3INWA 2BU6A 3GIGB 4X9LA 1U2OA 1UY8A 5M4MA 3OPDA 2XX5A 4CWQA 2YJWA 5M4PA 4AWQA 4PU9A 3OW6A 1QZRA 4CWTA 3LPSA 4CWSA 1I59A 2IWSA 3HYZA 2O1WA 4FCRA 1Z5CA 3R4PA 4HY6A 3RLRA 1YSZA 4LPBA 2XDSA 4O0BA 4W7TA 3U2DA 3CGYA 1Y8PA 2YJXA 4L93A 5CPHA 1AMWA 4L90A 3A0XA 3TTZA 4CWFA 1KIJA 1A4HA 1B3QA 4BQJA 4V25A 2YEJA 4YKTA 2WI1A 4DUHA 4EFTA 1UYMA 3HEKA 4HZ5A 4V26A 2BT0A 4ASAA 2FYPA 4R3MA 3CGZA 2YEBA 4MB9A 1GJVA 4MP7A 2YE8A 1R62A 3A0ZA 2XABA 3GIFA 3K60A 2E0AA 2YE4A 3BMYA 4EGHA 1EI1A 3B28A 2BRCA 1AM1A 2VCJA 2IWXA 4H81A 2YGFA 4H85A 1THNA 2Q8IA 1ZXNA 3ZXQA 2CGFA 3HZ1A 4XIRA 1QY8A 4P7AA 4DZYA 2YKCA 3JZ3A 4BAEA 3OMUA 2AKPA 4XE2A 2XHRA 3INXA 1YESA 5GGZA 4WUCA 1EA6A 2HKJA 5BOCA 1MX0A 1TIDA 4EEHA 4URMA 1TH8A 3B26A 3EHFA 2O1VA 2XJGA 2H8MA 2JJCA 5CTXA 4JAVA 3A0TA 4LWIA 3OWDA 1AH6A 3KE6A 2YGEA 1Y4UA 2YEFA 3R92A 4I5SA 1U0ZA 1ID0A 4H7QA 5M4NA 3BM9A 1Y4SA 2XJJA 4LWEA 4LWFA 2WEQA 2CCUA 2WI2A 2ZDYA 2C2AA 4B6CA 1UYLA 4U7OA 4FCQA 4U93A 4YKZA 2WEPA 2IOPA 2QFOA 3EKRA 4XDMA 5J6AA 4CE2A 4ZVIA 1B63A 4E01A 2XHXA 3H4LA 2C1GA 2XX2A 4NH7A 5M4EA 3K97A 2YE9A 4HZ0A 3K98A 2YK2A 2GQPA 4JAUA 4O07A 3RKZA 3MNRP 3TZ4A 4GCZA 4GFNA 2YE6A 3FT5A 3T2SA 4XTJA 2XJXA 3K99A 3C0EA 2Q8GA 3O6OA 4K4OA 2YEDA 1UYCA 2BYIA 1US7A 4R1FA 4JQLA 1UY7A 5CTYA 3DGEA 2YEHA 3SL2A 4O05A 2YKEA 1TILA 4E00A 3U67A 4FPPA 1YC4A 4XIQA 3TUHA 3Q5JA 4ASBA 4FCPA 4AWPA 3ZKBA 4HY1A 4E02A 5F5RA 1ZW9A 2PNRA 4CWNA 2JKIA 4MPCA 4Q20A 4URLA 1I58A 2ZKJA 1H7UA 2BU8A 5D6PA 1L0OA 5D6QA 1ZXMA 4NH8A 4KTNA 3O0IA 4QPJA 1YERA 2YI7A 3R4NA 1YS3A 2IWUA 4JASA 4YKXA 4MPEA 2EXLA 4I3HA 3C11A 3VHCA 5FNFA 2XHTA 4L8ZA 4BXIA 1UYHA 2IORA 3T10A 1KZNA 2XDXA 4R3AA 1Z5AA 3GIEA 2Q8FA 2VW5A 4KSHA 4WUDA 4CWOA 1I5BA 5IDMA 5J71A 4LWGA 2QG0A 2VCIA 2XDUA 4KSGA 2WERA 3G7BA 3LNUA 4MPNA 3TZ5A 2XDKA 5FNDA 2WI7A 2YEAA 1ZWHA 3WHAA 2YKBA 5IDJA 3B27A 3FV5A 2YECA 1Z59A 2UWDA 1NHJA 1Z5BA 4UROA 4EFUA 2FXSA 2ZDXA 4XC0A 3Q5LA 1UYEA 2YK9A 3EHHA 5BODA 4CWRA 1BGQA 2BTZA 4BQGA 4EMVA 5C93A 1TBWA 4YKUA 2YI5A 4EGKA 5FNCA 4FMTA 4GT8A 4WUBA 3EHGA 1QYEA 2XDLA 1AJ6A 1UYDA 4ASGA 5CF0A 3EKOA 4LWHA 3D2RA 2FWYA 3G75A 3HHUA 4XCJA 3T0HA 2CG9A 4HYMA 2HG1A 4NH9A 1NHHA 4GEEA 2YEGA 5IN9A 1YETA 2WI4A 2XD6A 4PRVA 3PEJA 3VHDA 1MU5A 3D36A 2CCSA 2YE2A 4AS9A 2IOQA 5JENA 1YT1A 4E72A 3D0BA 2WI5A 1F51A 3ZKDA 4PL9A 2BU7A 1UYFA 4XIPA 1UYIA 2VWCA 3B24A 2O1UA 3RLQA 4PRXA 5M4KA 3A0YA 2Q2EB 2CH4A 4HYPA 3A0RA 1BXDA 2QF6A 4MOTA 4XCLA 2K5BA 2YI0A 5D7RA 2ZBKB 5CTUA 4XITA 1S16A 2YKJA 4KP4A 3B25A 4HXWA 2HHIA 3HYYA 2YI6A 3R91A 1I5DA 4URNA 3WQ9A 3R4OA 1UY9A 1UYKA 3H80A 3VHAA 3NMQA 1YT0A 5M4HA 4ZKIA 2BSMA 1UYGA 3IEDA 1TC0A 1BKNA 4B7PA 3OWBA 4XKOA 2YGAA 2QG2A 3VADA 4EM7A 1GKXA 4YKRA 3CRLA 3ZXOA 3T1KA 4HXZA 1YSRA 2BREA 2Q8HA 3TZ2A 3CYGA 1B62A 2BU2A 3R4MA 4CE1A 4AWOA 3Q5KA 3EHJA 4YKQA 1AH8A 1UY6A 2YEEA 3QDDA 4P8OA 4XKAA 3U2KA 2WI6A 3CRKA 4YKYA 3RLPA 2CCTA 4QPKA 1JM6A 5D7CA 2XX4A 2XK2A 4XKKA 3S5TA 2WI3A 1H7SA 3GIGA 4LP0A 2YEIA 1I5CA 4U7NA 2YE7A 4O04A 4L94A 1I5AA 4KQVA 1NHIA 4BIUA 4O09A 2BYHA 2H55A 5CTWA 1Y8NA 4ASFA 3TZ0A 2HCHA 1TC6A 1S14A 4KFGA 4XD8A 2GFDA 2BZ5A 1YC1A 2XCMA 4YKWA 3ZM7A 5L3JA 3HZ5A 5D7DA 3PEHA 1OSFA 5FWKA 4GGLA
chains in the Genus database with same CATH topology
3A0WA 2ESAA 2YKIA 2FWZA 4EGIA 1YC3A 2YE3A 2BU5A 3FT8A 4GQTA 4CE3A 1PVGA 3CWVA 1BYQA 4CWPA 3G7EA 3O2FA 3QTFA 4MP2A 1GKZA 2YE5A 4MBCA 3T0ZA 4BIZA 4L91A 1YT2A 5F3KA 1Y8OA 3INWA 2BU6A 3GIGB 4X9LA 1U2OA 1UY8A 5M4MA 3OPDA 2XX5A 4CWQA 2YJWA 5M4PA 4AWQA 4PU9A 3OW6A 1QZRA 4CWTA 3LPSA 4CWSA 1I59A 2IWSA 3HYZA 2O1WA 4FCRA 1Z5CA 3R4PA 4HY6A 3RLRA 1YSZA 4LPBA 2XDSA 4O0BA 4W7TA 3U2DA 3CGYA 1Y8PA 2YJXA 4L93A 5CPHA 1AMWA 4L90A 3A0XA 3TTZA 4CWFA 1KIJA 1A4HA 1B3QA 4BQJA 4V25A 2YEJA 4YKTA 2WI1A 4DUHA 4EFTA 1UYMA 3HEKA 4HZ5A 4V26A 2BT0A 4ASAA 2FYPA 4R3MA 3CGZA 2YEBA 4MB9A 1GJVA 4MP7A 2YE8A 1R62A 3A0ZA 2XABA 3GIFA 3K60A 2E0AA 2YE4A 3BMYA 4EGHA 1EI1A 3B28A 2BRCA 1AM1A 2VCJA 2IWXA 4H81A 2YGFA 4H85A 1THNA 2Q8IA 1ZXNA 3ZXQA 2CGFA 3HZ1A 4XIRA 1QY8A 4P7AA 4DZYA 2YKCA 3JZ3A 4BAEA 3OMUA 2AKPA 4XE2A 2XHRA 3INXA 1YESA 5GGZA 4WUCA 1EA6A 2HKJA 5BOCA 1MX0A 1TIDA 4EEHA 4URMA 1TH8A 3B26A 3EHFA 2O1VA 2XJGA 2H8MA 2JJCA 5CTXA 4JAVA 3A0TA 4LWIA 3OWDA 1AH6A 3KE6A 2YGEA 1Y4UA 2YEFA 3R92A 4I5SA 1U0ZA 1ID0A 4H7QA 5M4NA 3BM9A 1Y4SA 2XJJA 4LWEA 4LWFA 2WEQA 2CCUA 2WI2A 2ZDYA 2C2AA 4B6CA 1UYLA 4U7OA 4FCQA 4U93A 4YKZA 2WEPA 2IOPA 2QFOA 3EKRA 4XDMA 5J6AA 4CE2A 4ZVIA 1B63A 4E01A 2XHXA 3H4LA 2XX2A 4NH7A 5M4EA 3K97A 2YE9A 4HZ0A 3K98A 2YK2A 2GQPA 4JAUA 4O07A 3RKZA 3MNRP 3TZ4A 4GCZA 4GFNA 2YE6A 3FT5A 3T2SA 4XTJA 2XJXA 3K99A 3C0EA 2Q8GA 3O6OA 4K4OA 2YEDA 1UYCA 2BYIA 1US7A 4R1FA 4JQLA 1UY7A 5CTYA 3DGEA 2YEHA 3SL2A 4O05A 2YKEA 1TILA 4E00A 3U67A 4FPPA 1YC4A 4XIQA 3TUHA 3Q5JA 4ASBA 4FCPA 4AWPA 3ZKBA 4HY1A 4E02A 5F5RA 1ZW9A 2PNRA 4CWNA 2JKIA 4MPCA 4Q20A 4URLA 1I58A 2ZKJA 1H7UA 2BU8A 5D6PA 1L0OA 5D6QA 1ZXMA 4NH8A 4KTNA 3O0IA 4QPJA 1YERA 2YI7A 3R4NA 1YS3A 2IWUA 4JASA 4YKXA 4MPEA 2EXLA 4I3HA 3C11A 3VHCA 5FNFA 2XHTA 4L8ZA 4BXIA 1UYHA 2IORA 3T10A 1KZNA 2XDXA 4R3AA 1Z5AA 3GIEA 2Q8FA 2VW5A 4KSHA 4WUDA 4CWOA 1I5BA 5IDMA 5J71A 4LWGA 2QG0A 2VCIA 2XDUA 4KSGA 2WERA 3G7BA 3LNUA 4MPNA 3TZ5A 2XDKA 5FNDA 2WI7A 2YEAA 1ZWHA 3WHAA 2YKBA 5IDJA 3B27A 3FV5A 2YECA 1Z59A 2UWDA 1NHJA 1Z5BA 4UROA 4EFUA 2FXSA 2ZDXA 4XC0A 3Q5LA 1UYEA 2YK9A 3EHHA 5BODA 4CWRA 1BGQA 2BTZA 4BQGA 4EMVA 5C93A 1TBWA 4YKUA 2YI5A 4EGKA 5FNCA 4FMTA 4GT8A 4WUBA 3EHGA 1QYEA 2XDLA 1AJ6A 1UYDA 4ASGA 5CF0A 3EKOA 4LWHA 3D2RA 2FWYA 3G75A 3HHUA 4XCJA 3T0HA 2CG9A 4HYMA 2HG1A 4NH9A 1NHHA 4GEEA 2YEGA 5IN9A 1YETA 2WI4A 2XD6A 4PRVA 3PEJA 3VHDA 1MU5A 3D36A 2CCSA 2YE2A 4AS9A 2IOQA 1YT1A 3D0BA 2WI5A 3ZKDA 4PL9A 2BU7A 1UYFA 4XIPA 1UYIA 2VWCA 3B24A 2O1UA 3RLQA 4PRXA 5M4KA 3A0YA 2Q2EB 2CH4A 4HYPA 3A0RA 1BXDA 2QF6A 4MOTA 4XCLA 2K5BA 2YI0A 5D7RA 2ZBKB 5CTUA 4XITA 1S16A 2YKJA 4KP4A 3B25A 4HXWA 3HYYA 2YI6A 3R91A 1I5DA 4URNA 3WQ9A 3R4OA 1UY9A 1UYKA 3H80A 3VHAA 3NMQA 1YT0A 5M4HA 4ZKIA 2BSMA 1UYGA 3IEDA 1TC0A 1BKNA 4B7PA 3OWBA 4XKOA 2YGAA 2QG2A 3VADA 4EM7A 1GKXA 4YKRA 3CRLA 3ZXOA 3T1KA 4HXZA 1YSRA 2BREA 2Q8HA 3TZ2A 1B62A 2BU2A 3R4MA 4CE1A 4AWOA 3Q5KA 3EHJA 4YKQA 1AH8A 1UY6A 2YEEA 3QDDA 4P8OA 4XKAA 3U2KA 2WI6A 3CRKA 4YKYA 3RLPA 2CCTA 4QPKA 1JM6A 5D7CA 2XX4A 2XK2A 4XKKA 2WI3A 1H7SA 3GIGA 4LP0A 2YEIA 1I5CA 4U7NA 2YE7A 4O04A 4L94A 1I5AA 4KQVA 1NHIA 4BIUA 4O09A 2BYHA 2H55A 5CTWA 1Y8NA 4ASFA 3TZ0A 2HCHA 1TC6A 1S14A 4KFGA 4XD8A 2GFDA 2BZ5A 1YC1A 2XCMA 4YKWA 3ZM7A 5L3JA 3HZ5A 5D7DA 3PEHA 1OSFA 5FWKA 4GGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0W A;  2ESA A;  2YKI A;  2FWZ A;  4EGI A;  1YC3 A;  2YE3 A;  2BU5 A;  3FT8 A;  4GQT A;  4CE3 A;  1PVG A;  3CWV A;  1BYQ A;  4CWP A;  3G7E A;  3O2F A;  3QTF A;  4MP2 A;  1GKZ A;  2YE5 A;  4MBC A;  3T0Z A;  4BIZ A;  4L91 A;  1YT2 A;  5F3K A;  1Y8O A;  3INW A;  2BU6 A;  3GIG B;  4X9L A;  1U2O A;  1UY8 A;  5M4M A;  3OPD A;  2XX5 A;  4CWQ A;  2YJW A;  5M4P A;  4AWQ A;  4PU9 A;  3OW6 A;  1QZR A;  4CWT A;  3LPS A;  4CWS A;  1I59 A;  2IWS A;  3HYZ A;  2O1W A;  4FCR A;  1Z5C A;  3R4P A;  4HY6 A;  3RLR A;  1YSZ A;  4LPB A;  2XDS A;  4O0B A;  4W7T A;  3U2D A;  3CGY A;  1Y8P A;  2YJX A;  4L93 A;  5CPH A;  1AMW A;  4L90 A;  3A0X A;  3TTZ A;  4CWF A;  1KIJ A;  1A4H A;  1B3Q A;  4BQJ A;  4V25 A;  2YEJ A;  4YKT A;  2WI1 A;  4DUH A;  4EFT A;  1UYM A;  3HEK A;  4HZ5 A;  4V26 A;  2BT0 A;  4ASA A;  2FYP A;  4R3M A;  3CGZ A;  2YEB A;  4MB9 A;  1GJV A;  4MP7 A;  2YE8 A;  1R62 A;  3A0Z A;  2XAB A;  3GIF A;  3K60 A;  2E0A A;  2YE4 A;  3BMY A;  4EGH A;  1EI1 A;  3B28 A;  2BRC A;  1AM1 A;  2VCJ A;  2IWX A;  4H81 A;  2YGF A;  4H85 A;  1THN A;  2Q8I A;  1ZXN A;  3ZXQ A;  2CGF A;  3HZ1 A;  4XIR A;  1QY8 A;  4P7A A;  4DZY A;  2YKC A;  3JZ3 A;  4BAE A;  3OMU A;  2AKP A;  4XE2 A;  2XHR A;  3INX A;  1YES A;  5GGZ A;  4WUC A;  1EA6 A;  2HKJ A;  5BOC A;  1MX0 A;  1TID A;  4EEH A;  4URM A;  1TH8 A;  3B26 A;  3EHF A;  2O1V A;  2XJG A;  2H8M A;  2JJC A;  5CTX A;  4JAV A;  3A0T A;  4LWI A;  3OWD A;  1AH6 A;  3KE6 A;  2YGE A;  1Y4U A;  2YEF A;  3R92 A;  4I5S A;  1U0Z A;  1ID0 A;  4H7Q A;  5M4N A;  3BM9 A;  1Y4S A;  2XJJ A;  4LWE A;  4LWF A;  2WEQ A;  2CCU A;  2WI2 A;  2ZDY A;  2C2A A;  4B6C A;  1UYL A;  4U7O A;  4FCQ A;  4U93 A;  4YKZ A;  2WEP A;  2IOP A;  2QFO A;  3EKR A;  4XDM A;  5J6A A;  4CE2 A;  4ZVI A;  1B63 A;  4E01 A;  2XHX A;  3H4L A;  2XX2 A;  4NH7 A;  5M4E A;  3K97 A;  2YE9 A;  4HZ0 A;  3K98 A;  2YK2 A;  2GQP A;  4JAU A;  4O07 A;  3RKZ A;  3MNR P;  3TZ4 A;  4GCZ A;  4GFN A;  2YE6 A;  3FT5 A;  3T2S A;  4XTJ A;  2XJX A;  3K99 A;  3C0E A;  2Q8G A;  3O6O A;  4K4O A;  2YED A;  1UYC A;  2BYI A;  1US7 A;  4R1F A;  4JQL A;  1UY7 A;  5CTY A;  3DGE A;  2YEH A;  3SL2 A;  4O05 A;  2YKE A;  1TIL A;  4E00 A;  3U67 A;  4FPP A;  1YC4 A;  4XIQ A;  3TUH A;  3Q5J A;  4ASB A;  4FCP A;  4AWP A;  3ZKB A;  4HY1 A;  4E02 A;  5F5R A;  1ZW9 A;  2PNR A;  4CWN A;  2JKI A;  4MPC A;  4Q20 A;  4URL A;  1I58 A;  2ZKJ A;  1H7U A;  2BU8 A;  5D6P A;  1L0O A;  5D6Q A;  1ZXM A;  4NH8 A;  4KTN A;  3O0I A;  4QPJ A;  1YER A;  2YI7 A;  3R4N A;  1YS3 A;  2IWU A;  4JAS A;  4YKX A;  4MPE A;  2EXL A;  4I3H A;  3C11 A;  3VHC A;  5FNF A;  2XHT A;  4L8Z A;  4BXI A;  1UYH A;  2IOR A;  3T10 A;  1KZN A;  2XDX A;  4R3A A;  1Z5A A;  3GIE A;  2Q8F A;  2VW5 A;  4KSH A;  4WUD A;  4CWO A;  1I5B A;  5IDM A;  5J71 A;  4LWG A;  2QG0 A;  2VCI A;  2XDU A;  4KSG A;  2WER A;  3G7B A;  3LNU A;  4MPN A;  3TZ5 A;  2XDK A;  5FND A;  2WI7 A;  2YEA A;  1ZWH A;  3WHA A;  2YKB A;  5IDJ A;  3B27 A;  3FV5 A;  2YEC A;  1Z59 A;  2UWD A;  1NHJ A;  1Z5B A;  4URO A;  4EFU A;  2FXS A;  2ZDX A;  4XC0 A;  3Q5L A;  1UYE A;  2YK9 A;  3EHH A;  5BOD A;  4CWR A;  1BGQ A;  2BTZ A;  4BQG A;  4EMV A;  5C93 A;  1TBW A;  4YKU A;  2YI5 A;  4EGK A;  5FNC A;  4FMT A;  4GT8 A;  4WUB A;  3EHG A;  1QYE A;  2XDL A;  1AJ6 A;  1UYD A;  4ASG A;  5CF0 A;  3EKO A;  4LWH A;  3D2R A;  2FWY A;  3G75 A;  3HHU A;  4XCJ A;  3T0H A;  2CG9 A;  4HYM A;  2HG1 A;  4NH9 A;  1NHH A;  4GEE A;  2YEG A;  5IN9 A;  1YET A;  2WI4 A;  2XD6 A;  4PRV A;  3PEJ A;  3VHD A;  1MU5 A;  3D36 A;  2CCS A;  2YE2 A;  4AS9 A;  2IOQ A;  1YT1 A;  3D0B A;  2WI5 A;  3ZKD A;  4PL9 A;  2BU7 A;  1UYF A;  4XIP A;  1UYI A;  2VWC A;  3B24 A;  2O1U A;  3RLQ A;  4PRX A;  5M4K A;  3A0Y A;  2Q2E B;  2CH4 A;  4HYP A;  3A0R A;  1BXD A;  2QF6 A;  4MOT A;  4XCL A;  2K5B A;  2YI0 A;  5D7R A;  2ZBK B;  5CTU A;  4XIT A;  1S16 A;  2YKJ A;  4KP4 A;  3B25 A;  4HXW A;  3HYY A;  2YI6 A;  3R91 A;  1I5D A;  4URN A;  3WQ9 A;  3R4O A;  1UY9 A;  1UYK A;  3H80 A;  3VHA A;  3NMQ A;  1YT0 A;  5M4H A;  4ZKI A;  2BSM A;  1UYG A;  3IED A;  1TC0 A;  1BKN A;  4B7P A;  3OWB A;  4XKO A;  2YGA A;  2QG2 A;  3VAD A;  4EM7 A;  1GKX A;  4YKR A;  3CRL A;  3ZXO A;  3T1K A;  4HXZ A;  1YSR A;  2BRE A;  2Q8H A;  3TZ2 A;  1B62 A;  2BU2 A;  3R4M A;  4CE1 A;  4AWO A;  3Q5K A;  3EHJ A;  4YKQ A;  1AH8 A;  1UY6 A;  2YEE A;  3QDD A;  4P8O A;  4XKA A;  3U2K A;  2WI6 A;  3CRK A;  4YKY A;  3RLP A;  2CCT A;  4QPK A;  1JM6 A;  5D7C A;  2XX4 A;  2XK2 A;  4XKK A;  2WI3 A;  1H7S A;  3GIG A;  4LP0 A;  2YEI A;  1I5C A;  4U7N A;  2YE7 A;  4O04 A;  4L94 A;  1I5A A;  4KQV A;  1NHI A;  4BIU A;  4O09 A;  2BYH A;  2H55 A;  5CTW A;  1Y8N A;  4ASF A;  3TZ0 A;  2HCH A;  1TC6 A;  1S14 A;  4KFG A;  4XD8 A;  2GFD A;  2BZ5 A;  1YC1 A;  2XCM A;  4YKW A;  3ZM7 A;  5L3J A;  3HZ5 A;  5D7D A;  3PEH A;  1OSF A;  5FWK A;  4GGL A; 
#chains in the Genus database with same CATH topology
 3A0W A;  2C1I A;  2ESA A;  2YKI A;  2FWZ A;  4EGI A;  1YC3 A;  2YE3 A;  2BU5 A;  3FT8 A;  4GQT A;  4CE3 A;  1PVG A;  3CWV A;  1BYQ A;  4CWP A;  3G7E A;  3O2F A;  3LMM A;  3QTF A;  4MP2 A;  1GKZ A;  2YE5 A;  4MBC A;  3T0Z A;  4BIZ A;  4L91 A;  1YT2 A;  5F3K A;  1Y8O A;  2FTK A;  1IXM A;  3INW A;  2BU6 A;  3GIG B;  4X9L A;  1U2O A;  1UY8 A;  5M4M A;  3OPD A;  2XX5 A;  4CWQ A;  2YJW A;  5M4P A;  4AWQ A;  4PU9 A;  3OW6 A;  1QZR A;  4CWT A;  3LPS A;  4CWS A;  1I59 A;  2IWS A;  3HYZ A;  2O1W A;  4FCR A;  1Z5C A;  3R4P A;  4HY6 A;  3RLR A;  1YSZ A;  4LPB A;  2XDS A;  4O0B A;  4W7T A;  3U2D A;  3CGY A;  1Y8P A;  2YJX A;  4L93 A;  5CPH A;  1AMW A;  4L90 A;  3A0X A;  3TTZ A;  4CWF A;  1KIJ A;  1A4H A;  1B3Q A;  4BQJ A;  4V25 A;  2YEJ A;  4YKT A;  2WI1 A;  4DUH A;  4EFT A;  1UYM A;  3HEK A;  4HZ5 A;  4V26 A;  2BT0 A;  4ASA A;  2FYP A;  4R3M A;  3CGZ A;  2YEB A;  4MB9 A;  1GJV A;  4MP7 A;  2YE8 A;  1R62 A;  3A0Z A;  2XAB A;  3GIF A;  3K60 A;  2E0A A;  2YE4 A;  3BMY A;  4EGH A;  1EI1 A;  3B28 A;  2BRC A;  1AM1 A;  2VCJ A;  2IWX A;  4H81 A;  2YGF A;  4H85 A;  1THN A;  2Q8I A;  1ZXN A;  3ZXQ A;  2CGF A;  3HZ1 A;  4XIR A;  1QY8 A;  4P7A A;  4DZY A;  2YKC A;  3JZ3 A;  4BAE A;  3OMU A;  2AKP A;  4XE2 A;  2XHR A;  3INX A;  1YES A;  5GGZ A;  4WUC A;  1EA6 A;  2HKJ A;  5BOC A;  1MX0 A;  1TID A;  4EEH A;  4URM A;  1TH8 A;  3B26 A;  3EHF A;  2O1V A;  2XJG A;  2H8M A;  2JJC A;  5CTX A;  4JAV A;  3A0T A;  4LWI A;  3OWD A;  1AH6 A;  3KE6 A;  2YGE A;  1Y4U A;  2YEF A;  3R92 A;  4I5S A;  1U0Z A;  1ID0 A;  4H7Q A;  5M4N A;  3BM9 A;  1Y4S A;  2XJJ A;  4LWE A;  4LWF A;  2WEQ A;  2CCU A;  2WI2 A;  2ZDY A;  2C2A A;  4B6C A;  1UYL A;  4U7O A;  4FCQ A;  4U93 A;  4YKZ A;  2WEP A;  2IOP A;  2QFO A;  3EKR A;  4XDM A;  5J6A A;  4CE2 A;  4ZVI A;  1B63 A;  4E01 A;  2XHX A;  3H4L A;  2C1G A;  2XX2 A;  4NH7 A;  5M4E A;  3K97 A;  2YE9 A;  4HZ0 A;  3K98 A;  2YK2 A;  2GQP A;  4JAU A;  4O07 A;  3RKZ A;  3MNR P;  3TZ4 A;  4GCZ A;  4GFN A;  2YE6 A;  3FT5 A;  3T2S A;  4XTJ A;  2XJX A;  3K99 A;  3C0E A;  2Q8G A;  3O6O A;  4K4O A;  2YED A;  1UYC A;  2BYI A;  1US7 A;  4R1F A;  4JQL A;  1UY7 A;  5CTY A;  3DGE A;  2YEH A;  3SL2 A;  4O05 A;  2YKE A;  1TIL A;  4E00 A;  3U67 A;  4FPP A;  1YC4 A;  4XIQ A;  3TUH A;  3Q5J A;  4ASB A;  4FCP A;  4AWP A;  3ZKB A;  4HY1 A;  4E02 A;  5F5R A;  1ZW9 A;  2PNR A;  4CWN A;  2JKI A;  4MPC A;  4Q20 A;  4URL A;  1I58 A;  2ZKJ A;  1H7U A;  2BU8 A;  5D6P A;  1L0O A;  5D6Q A;  1ZXM A;  4NH8 A;  4KTN A;  3O0I A;  4QPJ A;  1YER A;  2YI7 A;  3R4N A;  1YS3 A;  2IWU A;  4JAS A;  4YKX A;  4MPE A;  2EXL A;  4I3H A;  3C11 A;  3VHC A;  5FNF A;  2XHT A;  4L8Z A;  4BXI A;  1UYH A;  2IOR A;  3T10 A;  1KZN A;  2XDX A;  4R3A A;  1Z5A A;  3GIE A;  2Q8F A;  2VW5 A;  4KSH A;  4WUD A;  4CWO A;  1I5B A;  5IDM A;  5J71 A;  4LWG A;  2QG0 A;  2VCI A;  2XDU A;  4KSG A;  2WER A;  3G7B A;  3LNU A;  4MPN A;  3TZ5 A;  2XDK A;  5FND A;  2WI7 A;  2YEA A;  1ZWH A;  3WHA A;  2YKB A;  5IDJ A;  3B27 A;  3FV5 A;  2YEC A;  1Z59 A;  2UWD A;  1NHJ A;  1Z5B A;  4URO A;  4EFU A;  2FXS A;  2ZDX A;  4XC0 A;  3Q5L A;  1UYE A;  2YK9 A;  3EHH A;  5BOD A;  4CWR A;  1BGQ A;  2BTZ A;  4BQG A;  4EMV A;  5C93 A;  1TBW A;  4YKU A;  2YI5 A;  4EGK A;  5FNC A;  4FMT A;  4GT8 A;  4WUB A;  3EHG A;  1QYE A;  2XDL A;  1AJ6 A;  1UYD A;  4ASG A;  5CF0 A;  3EKO A;  4LWH A;  3D2R A;  2FWY A;  3G75 A;  3HHU A;  4XCJ A;  3T0H A;  2CG9 A;  4HYM A;  2HG1 A;  4NH9 A;  1NHH A;  4GEE A;  2YEG A;  5IN9 A;  1YET A;  2WI4 A;  2XD6 A;  4PRV A;  3PEJ A;  3VHD A;  1MU5 A;  3D36 A;  2CCS A;  2YE2 A;  4AS9 A;  2IOQ A;  5JEN A;  1YT1 A;  4E72 A;  3D0B A;  2WI5 A;  1F51 A;  3ZKD A;  4PL9 A;  2BU7 A;  1UYF A;  4XIP A;  1UYI A;  2VWC A;  3B24 A;  2O1U A;  3RLQ A;  4PRX A;  5M4K A;  3A0Y A;  2Q2E B;  2CH4 A;  4HYP A;  3A0R A;  1BXD A;  2QF6 A;  4MOT A;  4XCL A;  2K5B A;  2YI0 A;  5D7R A;  2ZBK B;  5CTU A;  4XIT A;  1S16 A;  2YKJ A;  4KP4 A;  3B25 A;  4HXW A;  2HHI A;  3HYY A;  2YI6 A;  3R91 A;  1I5D A;  4URN A;  3WQ9 A;  3R4O A;  1UY9 A;  1UYK A;  3H80 A;  3VHA A;  3NMQ A;  1YT0 A;  5M4H A;  4ZKI A;  2BSM A;  1UYG A;  3IED A;  1TC0 A;  1BKN A;  4B7P A;  3OWB A;  4XKO A;  2YGA A;  2QG2 A;  3VAD A;  4EM7 A;  1GKX A;  4YKR A;  3CRL A;  3ZXO A;  3T1K A;  4HXZ A;  1YSR A;  2BRE A;  2Q8H A;  3TZ2 A;  3CYG A;  1B62 A;  2BU2 A;  3R4M A;  4CE1 A;  4AWO A;  3Q5K A;  3EHJ A;  4YKQ A;  1AH8 A;  1UY6 A;  2YEE A;  3QDD A;  4P8O A;  4XKA A;  3U2K A;  2WI6 A;  3CRK A;  4YKY A;  3RLP A;  2CCT A;  4QPK A;  1JM6 A;  5D7C A;  2XX4 A;  2XK2 A;  4XKK A;  3S5T A;  2WI3 A;  1H7S A;  3GIG A;  4LP0 A;  2YEI A;  1I5C A;  4U7N A;  2YE7 A;  4O04 A;  4L94 A;  1I5A A;  4KQV A;  1NHI A;  4BIU A;  4O09 A;  2BYH A;  2H55 A;  5CTW A;  1Y8N A;  4ASF A;  3TZ0 A;  2HCH A;  1TC6 A;  1S14 A;  4KFG A;  4XD8 A;  2GFD A;  2BZ5 A;  1YC1 A;  2XCM A;  4YKW A;  3ZM7 A;  5L3J A;  3HZ5 A;  5D7D A;  3PEH A;  1OSF A;  5FWK A;  4GGL A; 
#chains in the Genus database with same CATH homology
 3A0W A;  2ESA A;  2YKI A;  2FWZ A;  4EGI A;  1YC3 A;  2YE3 A;  2BU5 A;  3FT8 A;  4GQT A;  4CE3 A;  1PVG A;  3CWV A;  1BYQ A;  4CWP A;  3G7E A;  3O2F A;  3QTF A;  4MP2 A;  1GKZ A;  2YE5 A;  4MBC A;  3T0Z A;  4BIZ A;  4L91 A;  1YT2 A;  5F3K A;  1Y8O A;  3INW A;  2BU6 A;  3GIG B;  4X9L A;  1U2O A;  1UY8 A;  5M4M A;  3OPD A;  2XX5 A;  4CWQ A;  2YJW A;  5M4P A;  4AWQ A;  4PU9 A;  3OW6 A;  1QZR A;  4CWT A;  3LPS A;  4CWS A;  1I59 A;  2IWS A;  3HYZ A;  2O1W A;  4FCR A;  1Z5C A;  3R4P A;  4HY6 A;  3RLR A;  1YSZ A;  4LPB A;  2XDS A;  4O0B A;  4W7T A;  3U2D A;  3CGY A;  1Y8P A;  2YJX A;  4L93 A;  5CPH A;  1AMW A;  4L90 A;  3A0X A;  3TTZ A;  4CWF A;  1KIJ A;  1A4H A;  1B3Q A;  4BQJ A;  4V25 A;  2YEJ A;  4YKT A;  2WI1 A;  4DUH A;  4EFT A;  1UYM A;  3HEK A;  4HZ5 A;  4V26 A;  2BT0 A;  4ASA A;  2FYP A;  4R3M A;  3CGZ A;  2YEB A;  4MB9 A;  1GJV A;  4MP7 A;  2YE8 A;  1R62 A;  3A0Z A;  2XAB A;  3GIF A;  3K60 A;  2E0A A;  2YE4 A;  3BMY A;  4EGH A;  1EI1 A;  3B28 A;  2BRC A;  1AM1 A;  2VCJ A;  2IWX A;  4H81 A;  2YGF A;  4H85 A;  1THN A;  2Q8I A;  1ZXN A;  3ZXQ A;  2CGF A;  3HZ1 A;  4XIR A;  1QY8 A;  4P7A A;  4DZY A;  2YKC A;  3JZ3 A;  4BAE A;  3OMU A;  2AKP A;  4XE2 A;  2XHR A;  3INX A;  1YES A;  5GGZ A;  4WUC A;  1EA6 A;  2HKJ A;  5BOC A;  1MX0 A;  1TID A;  4EEH A;  4URM A;  1TH8 A;  3B26 A;  3EHF A;  2O1V A;  2XJG A;  2H8M A;  2JJC A;  5CTX A;  4JAV A;  3A0T A;  4LWI A;  3OWD A;  1AH6 A;  3KE6 A;  2YGE A;  1Y4U A;  2YEF A;  3R92 A;  4I5S A;  1U0Z A;  1ID0 A;  4H7Q A;  5M4N A;  3BM9 A;  1Y4S A;  2XJJ A;  4LWE A;  4LWF A;  2WEQ A;  2CCU A;  2WI2 A;  2ZDY A;  2C2A A;  4B6C A;  1UYL A;  4U7O A;  4FCQ A;  4U93 A;  4YKZ A;  2WEP A;  2IOP A;  2QFO A;  3EKR A;  4XDM A;  5J6A A;  4CE2 A;  4ZVI A;  1B63 A;  4E01 A;  2XHX A;  3H4L A;  2XX2 A;  4NH7 A;  5M4E A;  3K97 A;  2YE9 A;  4HZ0 A;  3K98 A;  2YK2 A;  2GQP A;  4JAU A;  4O07 A;  3RKZ A;  3MNR P;  3TZ4 A;  4GCZ A;  4GFN A;  2YE6 A;  3FT5 A;  3T2S A;  4XTJ A;  2XJX A;  3K99 A;  3C0E A;  2Q8G A;  3O6O A;  4K4O A;  2YED A;  1UYC A;  2BYI A;  1US7 A;  4R1F A;  4JQL A;  1UY7 A;  5CTY A;  3DGE A;  2YEH A;  3SL2 A;  4O05 A;  2YKE A;  1TIL A;  4E00 A;  3U67 A;  4FPP A;  1YC4 A;  4XIQ A;  3TUH A;  3Q5J A;  4ASB A;  4FCP A;  4AWP A;  3ZKB A;  4HY1 A;  4E02 A;  5F5R A;  1ZW9 A;  2PNR A;  4CWN A;  2JKI A;  4MPC A;  4Q20 A;  4URL A;  1I58 A;  2ZKJ A;  1H7U A;  2BU8 A;  5D6P A;  1L0O A;  5D6Q A;  1ZXM A;  4NH8 A;  4KTN A;  3O0I A;  4QPJ A;  1YER A;  2YI7 A;  3R4N A;  1YS3 A;  2IWU A;  4JAS A;  4YKX A;  4MPE A;  2EXL A;  4I3H A;  3C11 A;  3VHC A;  5FNF A;  2XHT A;  4L8Z A;  4BXI A;  1UYH A;  2IOR A;  3T10 A;  1KZN A;  2XDX A;  4R3A A;  1Z5A A;  3GIE A;  2Q8F A;  2VW5 A;  4KSH A;  4WUD A;  4CWO A;  1I5B A;  5IDM A;  5J71 A;  4LWG A;  2QG0 A;  2VCI A;  2XDU A;  4KSG A;  2WER A;  3G7B A;  3LNU A;  4MPN A;  3TZ5 A;  2XDK A;  5FND A;  2WI7 A;  2YEA A;  1ZWH A;  3WHA A;  2YKB A;  5IDJ A;  3B27 A;  3FV5 A;  2YEC A;  1Z59 A;  2UWD A;  1NHJ A;  1Z5B A;  4URO A;  4EFU A;  2FXS A;  2ZDX A;  4XC0 A;  3Q5L A;  1UYE A;  2YK9 A;  3EHH A;  5BOD A;  4CWR A;  1BGQ A;  2BTZ A;  4BQG A;  4EMV A;  5C93 A;  1TBW A;  4YKU A;  2YI5 A;  4EGK A;  5FNC A;  4FMT A;  4GT8 A;  4WUB A;  3EHG A;  1QYE A;  2XDL A;  1AJ6 A;  1UYD A;  4ASG A;  5CF0 A;  3EKO A;  4LWH A;  3D2R A;  2FWY A;  3G75 A;  3HHU A;  4XCJ A;  3T0H A;  2CG9 A;  4HYM A;  2HG1 A;  4NH9 A;  1NHH A;  4GEE A;  2YEG A;  5IN9 A;  1YET A;  2WI4 A;  2XD6 A;  4PRV A;  3PEJ A;  3VHD A;  1MU5 A;  3D36 A;  2CCS A;  2YE2 A;  4AS9 A;  2IOQ A;  1YT1 A;  3D0B A;  2WI5 A;  3ZKD A;  4PL9 A;  2BU7 A;  1UYF A;  4XIP A;  1UYI A;  2VWC A;  3B24 A;  2O1U A;  3RLQ A;  4PRX A;  5M4K A;  3A0Y A;  2Q2E B;  2CH4 A;  4HYP A;  3A0R A;  1BXD A;  2QF6 A;  4MOT A;  4XCL A;  2K5B A;  2YI0 A;  5D7R A;  2ZBK B;  5CTU A;  4XIT A;  1S16 A;  2YKJ A;  4KP4 A;  3B25 A;  4HXW A;  3HYY A;  2YI6 A;  3R91 A;  1I5D A;  4URN A;  3WQ9 A;  3R4O A;  1UY9 A;  1UYK A;  3H80 A;  3VHA A;  3NMQ A;  1YT0 A;  5M4H A;  4ZKI A;  2BSM A;  1UYG A;  3IED A;  1TC0 A;  1BKN A;  4B7P A;  3OWB A;  4XKO A;  2YGA A;  2QG2 A;  3VAD A;  4EM7 A;  1GKX A;  4YKR A;  3CRL A;  3ZXO A;  3T1K A;  4HXZ A;  1YSR A;  2BRE A;  2Q8H A;  3TZ2 A;  1B62 A;  2BU2 A;  3R4M A;  4CE1 A;  4AWO A;  3Q5K A;  3EHJ A;  4YKQ A;  1AH8 A;  1UY6 A;  2YEE A;  3QDD A;  4P8O A;  4XKA A;  3U2K A;  2WI6 A;  3CRK A;  4YKY A;  3RLP A;  2CCT A;  4QPK A;  1JM6 A;  5D7C A;  2XX4 A;  2XK2 A;  4XKK A;  2WI3 A;  1H7S A;  3GIG A;  4LP0 A;  2YEI A;  1I5C A;  4U7N A;  2YE7 A;  4O04 A;  4L94 A;  1I5A A;  4KQV A;  1NHI A;  4BIU A;  4O09 A;  2BYH A;  2H55 A;  5CTW A;  1Y8N A;  4ASF A;  3TZ0 A;  2HCH A;  1TC6 A;  1S14 A;  4KFG A;  4XD8 A;  2GFD A;  2BZ5 A;  1YC1 A;  2XCM A;  4YKW A;  3ZM7 A;  5L3J A;  3HZ5 A;  5D7D A;  3PEH A;  1OSF A;  5FWK A;  4GGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...