1S14A

Crystal structure of escherichia coli topoisomerase iv pare 24kda subunit
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
168
structure length
168
Chain Sequence
b'TDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCISVVNALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCYQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Topoisomerase IV subunit B
publication title Crystal structures of Escherichia coli topoisomerase IV ParE subunit (24 and 43 kilodaltons): a single residue dictates differences in novobiocin potency against topoisomerase IV and DNA gyrase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 51
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature ec 5.99.1.-:
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1s14A00
2XD6A 3B26A 4U93A 2YEHA 2WI3A 2VW5A 3CRKA 4HYMA 3H4LA 2CCSA 4BIUA 1UYEA 3ZKDA 1TBWA 2XX5A 2XJGA 1UY9A 3FT8A 3D36A 2O1UA 1TH8A 4K4OA 3B24A 4WUCA 1UY8A 3EHFA 3EHGA 3EKRA 1UYCA 2C2AA 1ZXMA 2BU5A 4URLA 4PRVA 4LWGA 3RLRA 4CWOA 4AWOA 3K60A 2ZDXA 4O07A 5D7RA 3PEHA 4I5SA 1B63A 2YI6A 2WEPA 3INWA 4V26A 1AH8A 2YEFA 2E0AA 3G75A 4XITA 2YE5A 4HZ0A 4DUHA 2YJWA 2HKJA 3OPDA 1TC0A 4DZYA 5CTYA 5CTXA 1BXDA 3U2DA 1THNA 1YERA 1A4HA 3C11A 3U2KA 2YI5A 1EA6A 4LWIA 1GKZA 1ZXNA 3RLPA 2H55A 3HEKA 1UY7A 2WI4A 2YEAA 2YEBA 2Q2EB 4HXZA 3R92A 3EHHA 2XX4A 4LWEA 2XDKA 3GIGA 4EFTA 2YKBA 1QYEA 3MNRP 1YT1A 4KTNA 1ZWHA 4YKXA 2XDLA 4CWTA 2YE9A 4KSHA 2XABA 1UYHA 3O0IA 4CE3A 4W7TA 4XKAA 5J6AA 4R3AA 5FNCA 4EGKA 4WUBA 5CTWA 3C0EA 4BQGA 1ID0A 4EEHA 4MPCA 5L3JA 4LPBA 4EM7A 3CGYA 4H81A 2VCJA 1AMWA 1Y8OA 4KFGA 3CWVA 2XK2A 2UWDA 2YK9A 4YKYA 4ASGA 1PVGA 4CE1A 4JASA 1US7A 3T0HA 4FMTA 3R4MA 3K98A 4GEEA 5D6PA 1I58A 4LWHA 4UROA 3TUHA 5M4KA 1YT0A 4URNA 1AJ6A 3BMYA 2IOPA 3CRLA 3TZ5A 3HHUA 4EFUA 4YKZA 3K99A 4H85A 4P8OA 3WQ9A 3NMQA 3R4NA 4JAVA 3Q5LA 4LWFA 2YEDA 4AS9A 4XKOA 4ASBA 3D2RA 1MX0A 1I5BA 2ESAA 2YE7A 4CWNA 2QF6A 3CGZA 2IOQA 3A0XA 4H7QA 4MP2A 4R3MA 4FPPA 1NHHA 2CH4A 3RKZA 1GKXA 3HYYA 1Y4UA 2YEGA 2PNRA 2BTZA 2FXSA 1YC3A 2YGAA 1H7SA 1TILA 2EXLA 4CWRA 1UYDA 4AWPA 4XDMA 3G7EA 2XDXA 5F5RA 4MB9A 1UY6A 5M4HA 2ZDYA 5D7DA 4X9LA 4EMVA 3O2FA 4XIRA 5IN9A 2IWUA 1B62A 1UYMA 2YE3A 3OWDA 1R62A 2VCIA 2GQPA 1GJVA 1NHJA 4AWQA 2CCTA 4BXIA 3VHDA 1YT2A 4BIZA 5GGZA 2ZKJA 2BYIA 2JKIA 2BU6A 3O6OA 1OSFA 4ZKIA 4CE2A 4V25A 2FYPA 2YKEA 5D7CA 1UYIA 4Q20A 2XJXA 1U2OA 1BGQA 2YGEA 3A0YA 3HZ1A 4BAEA 5CTUA 4XE2A 3HYZA 2YKCA 4HYPA 1YC1A 1Y8NA 2FWYA 4PRXA 3T2SA 2XDUA 4HZ5A 4GQTA 4ASFA 3GIFA 3PEJA 1YS3A 3R91A 3QDDA 2XJJA 3D0BA 1KIJA 3G7BA 4E02A 4KQVA 5BOCA 4HXWA 4R1FA 2YKIA 2QG0A 3TTZA 1KZNA 2YE6A 2IORA 1I59A 2CCUA 4KP4A 1ZW9A 1UYFA 4EGIA 4PU9A 3B27A 2FWZA 2YE8A 2BT0A 2QFOA 5D6QA 1Z5AA 2BSMA 2YEIA 2O1VA 1QZRA 3TZ2A 4XC0A 1I5DA 4E01A 4L93A 4U7OA 1Y4SA 1I5CA 3R4OA 2WI1A 5M4MA 4O04A 3BM9A 2YEEA 5M4NA 3QTFA 4L90A 3U67A 4L91A 4ASAA 3JZ3A 4U7NA 1S16A 2CGFA 4MPEA 4XD8A 2XHXA 3EHJA 2BREA 3HZ5A 3H80A 1I5AA 3LPSA 2WI2A 2YK2A 4JAUA 3TZ0A 1TIDA 1YSRA 4GCZA 2Q8FA 4MP7A 2YJXA 1BYQA 5CPHA 2VWCA 4O05A 1AM1A 4BQJA 4EGHA 5BODA 2YEJA 4CWPA 1YSZA 4B7PA 2YE4A 3FV5A 1UYKA 1BKNA 5CF0A 3LNUA 5FNFA 4P7AA 4XCLA 4XKKA 3K97A 4NH9A 3VADA 2YI7A 3RLQA 1EI1A 4XIPA 4B6CA 3DGEA 3OWBA 2Q8IA 2BU2A 3GIGB 4HY6A 5M4EA 2BZ5A 2XCMA 3B28A 3VHAA 4LP0A 4XCJA 3VHCA 1Y8PA 5IDMA 2XHRA 1MU5A 3T0ZA 1Z59A 2XDSA 2HG1A 3KE6A 4FCPA 4NH7A 3TZ4A 1UYGA 4O09A 3INXA 2BYHA 4YKWA 1UYLA 2BU7A 2QG2A 3Q5KA 4YKRA 1H7UA 4GT8A 4GGLA 4FCQA 2WERA 3WHAA 4E00A 2AKPA 3GIEA 3Q5JA 2JJCA 1AH6A 5FWKA 3A0WA 1Z5CA 4QPJA 4L94A 5F3KA 4MOTA 3A0ZA 4WUDA 1YETA 2ZBKB 2Q8HA 4HY1A 2BRCA 2BU8A 2K5BA 4CWQA 1QY8A 3T1KA 2YGFA 4GFNA 3OMUA 2YECA 2GFDA 2H8MA 4MBCA 5M4PA 4I3HA 4QPKA 2WI5A 3OW6A 2WEQA 4YKUA 3ZXOA 1YC4A 1B3QA 1NHIA 2IWSA 4MPNA 4YKTA 4XIQA 5IDJA 2YE2A 4NH8A 4CWFA 1JM6A 3ZKBA 4JQLA 3FT5A 2CG9A 4YKQA 5J71A 4FCRA 2IWXA 3B25A 1S14A 2O1WA 3R4PA 3IEDA 4CWSA 2HCHA 1TC6A 3A0TA 4PL9A 3SL2A 3T10A 4L8ZA 1Z5BA 2YKJA 2Q8GA 5C93A 3ZXQA 4O0BA 2XHTA 4KSGA 1U0ZA 5FNDA 3EKOA 4URMA 4XTJA 2WI7A 4ZVIA 3ZM7A 3A0RA 2WI6A 2XX2A 1YESA 2YI0A 1L0OA
chains in the Genus database with same CATH superfamily
2XD6A 3B26A 4U93A 2YEHA 2WI3A 2VW5A 3CRKA 4HYMA 3H4LA 2CCSA 4BIUA 1UYEA 3ZKDA 1TBWA 2XX5A 2XJGA 1UY9A 3FT8A 3D36A 2O1UA 1TH8A 4K4OA 3B24A 4WUCA 1UY8A 3EHFA 3EHGA 3EKRA 1UYCA 2C2AA 1ZXMA 2BU5A 4URLA 4PRVA 4LWGA 3RLRA 4CWOA 4AWOA 3K60A 2ZDXA 4O07A 5D7RA 3PEHA 4I5SA 1B63A 2YI6A 2WEPA 3INWA 4V26A 1AH8A 4E72A 2YEFA 2E0AA 3G75A 4XITA 2YE5A 4HZ0A 4DUHA 2YJWA 2HKJA 3OPDA 1TC0A 4DZYA 5CTYA 5CTXA 1BXDA 3U2DA 1THNA 1YERA 1A4HA 3C11A 3U2KA 2YI5A 1EA6A 4LWIA 1GKZA 1ZXNA 3RLPA 2H55A 3HEKA 1UY7A 2WI4A 2YEAA 2YEBA 2Q2EB 4HXZA 3R92A 3EHHA 2XX4A 4LWEA 2XDKA 3GIGA 4EFTA 2YKBA 1QYEA 3MNRP 1YT1A 4KTNA 1ZWHA 4YKXA 2XDLA 4CWTA 2YE9A 4KSHA 2XABA 1UYHA 3O0IA 4CE3A 4W7TA 4XKAA 5J6AA 4R3AA 5FNCA 4EGKA 4WUBA 5CTWA 3C0EA 4BQGA 1ID0A 4EEHA 4MPCA 5L3JA 4LPBA 4EM7A 3CGYA 4H81A 2VCJA 1AMWA 1Y8OA 4KFGA 3CWVA 2XK2A 2UWDA 2YK9A 4YKYA 4ASGA 1PVGA 4CE1A 4JASA 1US7A 3T0HA 4FMTA 3R4MA 3K98A 4GEEA 5D6PA 1I58A 4LWHA 4UROA 3TUHA 5M4KA 1YT0A 4URNA 1AJ6A 3BMYA 2IOPA 3CRLA 3TZ5A 3HHUA 4EFUA 4YKZA 3K99A 4H85A 4P8OA 3WQ9A 3NMQA 3R4NA 4JAVA 3Q5LA 4LWFA 2YEDA 4AS9A 4XKOA 4ASBA 3D2RA 1MX0A 1I5BA 2ESAA 2YE7A 4CWNA 2QF6A 3CGZA 2IOQA 3A0XA 4H7QA 4MP2A 4R3MA 4FPPA 1NHHA 2CH4A 3RKZA 1GKXA 3HYYA 1Y4UA 2YEGA 2PNRA 2BTZA 2FXSA 1YC3A 2YGAA 1H7SA 1TILA 2EXLA 4CWRA 1UYDA 4AWPA 4XDMA 3G7EA 2XDXA 5F5RA 4MB9A 1UY6A 5M4HA 5JENA 2ZDYA 5D7DA 4X9LA 4EMVA 3O2FA 4XIRA 5IN9A 2IWUA 1B62A 1UYMA 2YE3A 3OWDA 1R62A 2VCIA 2GQPA 1GJVA 1NHJA 4AWQA 2CCTA 4BXIA 3VHDA 1YT2A 4BIZA 5GGZA 2ZKJA 2BYIA 2JKIA 2BU6A 3O6OA 1OSFA 4ZKIA 4CE2A 4V25A 2FYPA 2YKEA 5D7CA 1UYIA 4Q20A 2XJXA 1U2OA 1BGQA 2YGEA 3A0YA 3HZ1A 4BAEA 5CTUA 4XE2A 3HYZA 2YKCA 4HYPA 1YC1A 1Y8NA 2FWYA 4PRXA 3T2SA 2XDUA 4HZ5A 4GQTA 4ASFA 3GIFA 3PEJA 1YS3A 3R91A 3QDDA 2XJJA 3D0BA 1KIJA 3G7BA 4E02A 4KQVA 5BOCA 4HXWA 4R1FA 2YKIA 2QG0A 3TTZA 1KZNA 2YE6A 2IORA 1I59A 2CCUA 4KP4A 1ZW9A 1UYFA 4EGIA 4PU9A 3B27A 2FWZA 2YE8A 2BT0A 2QFOA 5D6QA 1Z5AA 2BSMA 2YEIA 2O1VA 1QZRA 3TZ2A 4XC0A 1I5DA 4E01A 4L93A 4U7OA 1Y4SA 1I5CA 3R4OA 2WI1A 5M4MA 4O04A 3BM9A 2YEEA 3S5TA 5M4NA 3QTFA 4L90A 3U67A 4L91A 4ASAA 3JZ3A 2HHIA 4U7NA 1S16A 2CGFA 4MPEA 4XD8A 2XHXA 3EHJA 2BREA 3HZ5A 3H80A 1I5AA 3LPSA 2WI2A 2YK2A 4JAUA 3TZ0A 1TIDA 1YSRA 4GCZA 2Q8FA 4MP7A 2YJXA 1BYQA 5CPHA 1IXMA 2VWCA 4O05A 1AM1A 4BQJA 4EGHA 5BODA 2YEJA 4CWPA 1YSZA 4B7PA 2YE4A 3FV5A 1UYKA 1BKNA 5CF0A 3LNUA 5FNFA 4P7AA 4XCLA 4XKKA 2C1GA 3K97A 4NH9A 3VADA 2YI7A 3RLQA 1EI1A 2C1IA 4XIPA 4B6CA 3DGEA 3OWBA 2Q8IA 2BU2A 3GIGB 4HY6A 5M4EA 2BZ5A 2XCMA 3B28A 3VHAA 4LP0A 4XCJA 3VHCA 1Y8PA 5IDMA 2XHRA 1MU5A 3T0ZA 1Z59A 2XDSA 2HG1A 3KE6A 4FCPA 4NH7A 3TZ4A 1UYGA 4O09A 3INXA 2BYHA 4YKWA 1UYLA 2BU7A 2QG2A 3Q5KA 4YKRA 1H7UA 4GT8A 4GGLA 4FCQA 2WERA 3WHAA 4E00A 2AKPA 3GIEA 3Q5JA 2JJCA 1AH6A 5FWKA 3A0WA 1Z5CA 4QPJA 4L94A 5F3KA 4MOTA 3A0ZA 4WUDA 1YETA 2ZBKB 2Q8HA 4HY1A 2BRCA 2FTKA 2BU8A 2K5BA 4CWQA 1QY8A 3T1KA 2YGFA 4GFNA 3OMUA 2YECA 2GFDA 2H8MA 4MBCA 5M4PA 4I3HA 4QPKA 2WI5A 3OW6A 2WEQA 4YKUA 3ZXOA 1YC4A 1B3QA 1NHIA 1F51A 2IWSA 4MPNA 4YKTA 4XIQA 5IDJA 2YE2A 4NH8A 4CWFA 1JM6A 3ZKBA 4JQLA 3FT5A 2CG9A 4YKQA 5J71A 4FCRA 2IWXA 3B25A 1S14A 2O1WA 3R4PA 3IEDA 4CWSA 2HCHA 1TC6A 3A0TA 4PL9A 3SL2A 3T10A 4L8ZA 3CYGA 1Z5BA 2YKJA 2Q8GA 5C93A 3ZXQA 4O0BA 2XHTA 4KSGA 1U0ZA 3LMMA 3EKOA 4URMA 5FNDA 4XTJA 2WI7A 4ZVIA 3ZM7A 3A0RA 2WI6A 2XX2A 1YESA 2YI0A 1L0OA
chains in the Genus database with same CATH topology
2XD6A 3B26A 4U93A 2YEHA 2WI3A 2VW5A 3CRKA 4HYMA 3H4LA 2CCSA 4BIUA 1UYEA 3ZKDA 1TBWA 2XX5A 2XJGA 1UY9A 3FT8A 3D36A 2O1UA 1TH8A 4K4OA 3B24A 4WUCA 1UY8A 3EHFA 3EHGA 3EKRA 1UYCA 2C2AA 1ZXMA 2BU5A 4URLA 4PRVA 4LWGA 3RLRA 4CWOA 4AWOA 3K60A 2ZDXA 4O07A 5D7RA 3PEHA 4I5SA 1B63A 2YI6A 2WEPA 3INWA 4V26A 1AH8A 2YEFA 2E0AA 3G75A 4XITA 2YE5A 4HZ0A 4DUHA 2YJWA 2HKJA 3OPDA 1TC0A 4DZYA 5CTYA 5CTXA 1BXDA 3U2DA 1THNA 1YERA 1A4HA 3C11A 3U2KA 2YI5A 1EA6A 4LWIA 1GKZA 1ZXNA 3RLPA 2H55A 3HEKA 1UY7A 2WI4A 2YEAA 2YEBA 2Q2EB 4HXZA 3R92A 3EHHA 2XX4A 4LWEA 2XDKA 3GIGA 4EFTA 2YKBA 1QYEA 3MNRP 1YT1A 4KTNA 1ZWHA 4YKXA 2XDLA 4CWTA 2YE9A 4KSHA 2XABA 1UYHA 3O0IA 4CE3A 4W7TA 4XKAA 5J6AA 4R3AA 5FNCA 4EGKA 4WUBA 5CTWA 3C0EA 4BQGA 1ID0A 4EEHA 4MPCA 5L3JA 4LPBA 4EM7A 3CGYA 4H81A 2VCJA 1AMWA 1Y8OA 4KFGA 3CWVA 2XK2A 2UWDA 2YK9A 4YKYA 4ASGA 1PVGA 4CE1A 4JASA 1US7A 3T0HA 4FMTA 3R4MA 3K98A 4GEEA 5D6PA 1I58A 4LWHA 4UROA 3TUHA 5M4KA 1YT0A 4URNA 1AJ6A 3BMYA 2IOPA 3CRLA 3TZ5A 3HHUA 4EFUA 4YKZA 3K99A 4H85A 4P8OA 3WQ9A 3NMQA 3R4NA 4JAVA 3Q5LA 4LWFA 2YEDA 4AS9A 4XKOA 4ASBA 3D2RA 1MX0A 1I5BA 2ESAA 2YE7A 4CWNA 2QF6A 3CGZA 2IOQA 3A0XA 4H7QA 4MP2A 4R3MA 4FPPA 1NHHA 2CH4A 3RKZA 1GKXA 3HYYA 1Y4UA 2YEGA 2PNRA 2BTZA 2FXSA 1YC3A 2YGAA 1H7SA 1TILA 2EXLA 4CWRA 1UYDA 4AWPA 4XDMA 3G7EA 2XDXA 5F5RA 4MB9A 1UY6A 5M4HA 2ZDYA 5D7DA 4X9LA 4EMVA 3O2FA 4XIRA 5IN9A 2IWUA 1B62A 1UYMA 2YE3A 3OWDA 1R62A 2VCIA 2GQPA 1GJVA 1NHJA 4AWQA 2CCTA 4BXIA 3VHDA 1YT2A 4BIZA 5GGZA 2ZKJA 2BYIA 2JKIA 2BU6A 3O6OA 1OSFA 4ZKIA 4CE2A 4V25A 2FYPA 2YKEA 5D7CA 1UYIA 4Q20A 2XJXA 1U2OA 1BGQA 2YGEA 3A0YA 3HZ1A 4BAEA 5CTUA 4XE2A 3HYZA 2YKCA 4HYPA 1YC1A 1Y8NA 2FWYA 4PRXA 3T2SA 2XDUA 4HZ5A 4GQTA 4ASFA 3GIFA 3PEJA 1YS3A 3R91A 3QDDA 2XJJA 3D0BA 1KIJA 3G7BA 4E02A 4KQVA 5BOCA 4HXWA 4R1FA 2YKIA 2QG0A 3TTZA 1KZNA 2YE6A 2IORA 1I59A 2CCUA 4KP4A 1ZW9A 1UYFA 4EGIA 4PU9A 3B27A 2FWZA 2YE8A 2BT0A 2QFOA 5D6QA 1Z5AA 2BSMA 2YEIA 2O1VA 1QZRA 3TZ2A 4XC0A 1I5DA 4E01A 4L93A 4U7OA 1Y4SA 1I5CA 3R4OA 2WI1A 5M4MA 4O04A 3BM9A 2YEEA 5M4NA 3QTFA 4L90A 3U67A 4L91A 4ASAA 3JZ3A 4U7NA 1S16A 2CGFA 4MPEA 4XD8A 2XHXA 3EHJA 2BREA 3HZ5A 3H80A 1I5AA 3LPSA 2WI2A 2YK2A 4JAUA 3TZ0A 1TIDA 1YSRA 4GCZA 2Q8FA 4MP7A 2YJXA 1BYQA 5CPHA 2VWCA 4O05A 1AM1A 4BQJA 4EGHA 5BODA 2YEJA 4CWPA 1YSZA 4B7PA 2YE4A 3FV5A 1UYKA 1BKNA 5CF0A 3LNUA 5FNFA 4P7AA 4XCLA 4XKKA 3K97A 4NH9A 3VADA 2YI7A 3RLQA 1EI1A 4XIPA 4B6CA 3DGEA 3OWBA 2Q8IA 2BU2A 3GIGB 4HY6A 5M4EA 2BZ5A 2XCMA 3B28A 3VHAA 4LP0A 4XCJA 3VHCA 1Y8PA 5IDMA 2XHRA 1MU5A 3T0ZA 1Z59A 2XDSA 2HG1A 3KE6A 4FCPA 4NH7A 3TZ4A 1UYGA 4O09A 3INXA 2BYHA 4YKWA 1UYLA 2BU7A 2QG2A 3Q5KA 4YKRA 1H7UA 4GT8A 4GGLA 4FCQA 2WERA 3WHAA 4E00A 2AKPA 3GIEA 3Q5JA 2JJCA 1AH6A 5FWKA 3A0WA 1Z5CA 4QPJA 4L94A 5F3KA 4MOTA 3A0ZA 4WUDA 1YETA 2ZBKB 2Q8HA 4HY1A 2BRCA 2BU8A 2K5BA 4CWQA 1QY8A 3T1KA 2YGFA 4GFNA 3OMUA 2YECA 2GFDA 2H8MA 4MBCA 5M4PA 4I3HA 4QPKA 2WI5A 3OW6A 2WEQA 4YKUA 3ZXOA 1YC4A 1B3QA 1NHIA 2IWSA 4MPNA 4YKTA 4XIQA 5IDJA 2YE2A 4NH8A 4CWFA 1JM6A 3ZKBA 4JQLA 3FT5A 2CG9A 4YKQA 5J71A 4FCRA 2IWXA 3B25A 1S14A 2O1WA 3R4PA 3IEDA 4CWSA 2HCHA 1TC6A 3A0TA 4PL9A 3SL2A 3T10A 4L8ZA 1Z5BA 2YKJA 2Q8GA 5C93A 3ZXQA 4O0BA 2XHTA 4KSGA 1U0ZA 5FNDA 3EKOA 4URMA 4XTJA 2WI7A 4ZVIA 3ZM7A 3A0RA 2WI6A 2XX2A 1YESA 2YI0A 1L0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XD6 A;  3B26 A;  4U93 A;  2YEH A;  2WI3 A;  2VW5 A;  3CRK A;  4HYM A;  3H4L A;  2CCS A;  4BIU A;  1UYE A;  3ZKD A;  1TBW A;  2XX5 A;  2XJG A;  1UY9 A;  3FT8 A;  3D36 A;  2O1U A;  1TH8 A;  4K4O A;  3B24 A;  4WUC A;  1UY8 A;  3EHF A;  3EHG A;  3EKR A;  1UYC A;  2C2A A;  1ZXM A;  2BU5 A;  4URL A;  4PRV A;  4LWG A;  3RLR A;  4CWO A;  4AWO A;  3K60 A;  2ZDX A;  4O07 A;  5D7R A;  3PEH A;  4I5S A;  1B63 A;  2YI6 A;  2WEP A;  3INW A;  4V26 A;  1AH8 A;  2YEF A;  2E0A A;  3G75 A;  4XIT A;  2YE5 A;  4HZ0 A;  4DUH A;  2YJW A;  2HKJ A;  3OPD A;  1TC0 A;  4DZY A;  5CTY A;  5CTX A;  1BXD A;  3U2D A;  1THN A;  1YER A;  1A4H A;  3C11 A;  3U2K A;  2YI5 A;  1EA6 A;  4LWI A;  1GKZ A;  1ZXN A;  3RLP A;  2H55 A;  3HEK A;  1UY7 A;  2WI4 A;  2YEA A;  2YEB A;  2Q2E B;  4HXZ A;  3R92 A;  3EHH A;  2XX4 A;  4LWE A;  2XDK A;  3GIG A;  4EFT A;  2YKB A;  1QYE A;  3MNR P;  1YT1 A;  4KTN A;  1ZWH A;  4YKX A;  2XDL A;  4CWT A;  2YE9 A;  4KSH A;  2XAB A;  1UYH A;  3O0I A;  4CE3 A;  4W7T A;  4XKA A;  5J6A A;  4R3A A;  5FNC A;  4EGK A;  4WUB A;  5CTW A;  3C0E A;  4BQG A;  1ID0 A;  4EEH A;  4MPC A;  5L3J A;  4LPB A;  4EM7 A;  3CGY A;  4H81 A;  2VCJ A;  1AMW A;  1Y8O A;  4KFG A;  3CWV A;  2XK2 A;  2UWD A;  2YK9 A;  4YKY A;  4ASG A;  1PVG A;  4CE1 A;  4JAS A;  1US7 A;  3T0H A;  4FMT A;  3R4M A;  3K98 A;  4GEE A;  5D6P A;  1I58 A;  4LWH A;  4URO A;  3TUH A;  5M4K A;  1YT0 A;  4URN A;  1AJ6 A;  3BMY A;  2IOP A;  3CRL A;  3TZ5 A;  3HHU A;  4EFU A;  4YKZ A;  3K99 A;  4H85 A;  4P8O A;  3WQ9 A;  3NMQ A;  3R4N A;  4JAV A;  3Q5L A;  4LWF A;  2YED A;  4AS9 A;  4XKO A;  4ASB A;  3D2R A;  1MX0 A;  1I5B A;  2ESA A;  2YE7 A;  4CWN A;  2QF6 A;  3CGZ A;  2IOQ A;  3A0X A;  4H7Q A;  4MP2 A;  4R3M A;  4FPP A;  1NHH A;  2CH4 A;  3RKZ A;  1GKX A;  3HYY A;  1Y4U A;  2YEG A;  2PNR A;  2BTZ A;  2FXS A;  1YC3 A;  2YGA A;  1H7S A;  1TIL A;  2EXL A;  4CWR A;  1UYD A;  4AWP A;  4XDM A;  3G7E A;  2XDX A;  5F5R A;  4MB9 A;  1UY6 A;  5M4H A;  2ZDY A;  5D7D A;  4X9L A;  4EMV A;  3O2F A;  4XIR A;  5IN9 A;  2IWU A;  1B62 A;  1UYM A;  2YE3 A;  3OWD A;  1R62 A;  2VCI A;  2GQP A;  1GJV A;  1NHJ A;  4AWQ A;  2CCT A;  4BXI A;  3VHD A;  1YT2 A;  4BIZ A;  5GGZ A;  2ZKJ A;  2BYI A;  2JKI A;  2BU6 A;  3O6O A;  1OSF A;  4ZKI A;  4CE2 A;  4V25 A;  2FYP A;  2YKE A;  5D7C A;  1UYI A;  4Q20 A;  2XJX A;  1U2O A;  1BGQ A;  2YGE A;  3A0Y A;  3HZ1 A;  4BAE A;  5CTU A;  4XE2 A;  3HYZ A;  2YKC A;  4HYP A;  1YC1 A;  1Y8N A;  2FWY A;  4PRX A;  3T2S A;  2XDU A;  4HZ5 A;  4GQT A;  4ASF A;  3GIF A;  3PEJ A;  1YS3 A;  3R91 A;  3QDD A;  2XJJ A;  3D0B A;  1KIJ A;  3G7B A;  4E02 A;  4KQV A;  5BOC A;  4HXW A;  4R1F A;  2YKI A;  2QG0 A;  3TTZ A;  1KZN A;  2YE6 A;  2IOR A;  1I59 A;  2CCU A;  4KP4 A;  1ZW9 A;  1UYF A;  4EGI A;  4PU9 A;  3B27 A;  2FWZ A;  2YE8 A;  2BT0 A;  2QFO A;  5D6Q A;  1Z5A A;  2BSM A;  2YEI A;  2O1V A;  1QZR A;  3TZ2 A;  4XC0 A;  1I5D A;  4E01 A;  4L93 A;  4U7O A;  1Y4S A;  1I5C A;  3R4O A;  2WI1 A;  5M4M A;  4O04 A;  3BM9 A;  2YEE A;  5M4N A;  3QTF A;  4L90 A;  3U67 A;  4L91 A;  4ASA A;  3JZ3 A;  4U7N A;  1S16 A;  2CGF A;  4MPE A;  4XD8 A;  2XHX A;  3EHJ A;  2BRE A;  3HZ5 A;  3H80 A;  1I5A A;  3LPS A;  2WI2 A;  2YK2 A;  4JAU A;  3TZ0 A;  1TID A;  1YSR A;  4GCZ A;  2Q8F A;  4MP7 A;  2YJX A;  1BYQ A;  5CPH A;  2VWC A;  4O05 A;  1AM1 A;  4BQJ A;  4EGH A;  5BOD A;  2YEJ A;  4CWP A;  1YSZ A;  4B7P A;  2YE4 A;  3FV5 A;  1UYK A;  1BKN A;  5CF0 A;  3LNU A;  5FNF A;  4P7A A;  4XCL A;  4XKK A;  3K97 A;  4NH9 A;  3VAD A;  2YI7 A;  3RLQ A;  1EI1 A;  4XIP A;  4B6C A;  3DGE A;  3OWB A;  2Q8I A;  2BU2 A;  3GIG B;  4HY6 A;  5M4E A;  2BZ5 A;  2XCM A;  3B28 A;  3VHA A;  4LP0 A;  4XCJ A;  3VHC A;  1Y8P A;  5IDM A;  2XHR A;  1MU5 A;  3T0Z A;  1Z59 A;  2XDS A;  2HG1 A;  3KE6 A;  4FCP A;  4NH7 A;  3TZ4 A;  1UYG A;  4O09 A;  3INX A;  2BYH A;  4YKW A;  1UYL A;  2BU7 A;  2QG2 A;  3Q5K A;  4YKR A;  1H7U A;  4GT8 A;  4GGL A;  4FCQ A;  2WER A;  3WHA A;  4E00 A;  2AKP A;  3GIE A;  3Q5J A;  2JJC A;  1AH6 A;  5FWK A;  3A0W A;  1Z5C A;  4QPJ A;  4L94 A;  5F3K A;  4MOT A;  3A0Z A;  4WUD A;  1YET A;  2ZBK B;  2Q8H A;  4HY1 A;  2BRC A;  2BU8 A;  2K5B A;  4CWQ A;  1QY8 A;  3T1K A;  2YGF A;  4GFN A;  3OMU A;  2YEC A;  2GFD A;  2H8M A;  4MBC A;  5M4P A;  4I3H A;  4QPK A;  2WI5 A;  3OW6 A;  2WEQ A;  4YKU A;  3ZXO A;  1YC4 A;  1B3Q A;  1NHI A;  2IWS A;  4MPN A;  4YKT A;  4XIQ A;  5IDJ A;  2YE2 A;  4NH8 A;  4CWF A;  1JM6 A;  3ZKB A;  4JQL A;  3FT5 A;  2CG9 A;  4YKQ A;  5J71 A;  4FCR A;  2IWX A;  3B25 A;  1S14 A;  2O1W A;  3R4P A;  3IED A;  4CWS A;  2HCH A;  1TC6 A;  3A0T A;  4PL9 A;  3SL2 A;  3T10 A;  4L8Z A;  1Z5B A;  2YKJ A;  2Q8G A;  5C93 A;  3ZXQ A;  4O0B A;  2XHT A;  4KSG A;  1U0Z A;  5FND A;  3EKO A;  4URM A;  4XTJ A;  2WI7 A;  4ZVI A;  3ZM7 A;  3A0R A;  2WI6 A;  2XX2 A;  1YES A;  2YI0 A;  1L0O A; 
#chains in the Genus database with same CATH topology
 2XD6 A;  3B26 A;  4U93 A;  2YEH A;  2WI3 A;  2VW5 A;  3CRK A;  4HYM A;  3H4L A;  2CCS A;  4BIU A;  1UYE A;  3ZKD A;  1TBW A;  2XX5 A;  2XJG A;  1UY9 A;  3FT8 A;  3D36 A;  2O1U A;  1TH8 A;  4K4O A;  3B24 A;  4WUC A;  1UY8 A;  3EHF A;  3EHG A;  3EKR A;  1UYC A;  2C2A A;  1ZXM A;  2BU5 A;  4URL A;  4PRV A;  4LWG A;  3RLR A;  4CWO A;  4AWO A;  3K60 A;  2ZDX A;  4O07 A;  5D7R A;  3PEH A;  4I5S A;  1B63 A;  2YI6 A;  2WEP A;  3INW A;  4V26 A;  1AH8 A;  4E72 A;  2YEF A;  2E0A A;  3G75 A;  4XIT A;  2YE5 A;  4HZ0 A;  4DUH A;  2YJW A;  2HKJ A;  3OPD A;  1TC0 A;  4DZY A;  5CTY A;  5CTX A;  1BXD A;  3U2D A;  1THN A;  1YER A;  1A4H A;  3C11 A;  3U2K A;  2YI5 A;  1EA6 A;  4LWI A;  1GKZ A;  1ZXN A;  3RLP A;  2H55 A;  3HEK A;  1UY7 A;  2WI4 A;  2YEA A;  2YEB A;  2Q2E B;  4HXZ A;  3R92 A;  3EHH A;  2XX4 A;  4LWE A;  2XDK A;  3GIG A;  4EFT A;  2YKB A;  1QYE A;  3MNR P;  1YT1 A;  4KTN A;  1ZWH A;  4YKX A;  2XDL A;  4CWT A;  2YE9 A;  4KSH A;  2XAB A;  1UYH A;  3O0I A;  4CE3 A;  4W7T A;  4XKA A;  5J6A A;  4R3A A;  5FNC A;  4EGK A;  4WUB A;  5CTW A;  3C0E A;  4BQG A;  1ID0 A;  4EEH A;  4MPC A;  5L3J A;  4LPB A;  4EM7 A;  3CGY A;  4H81 A;  2VCJ A;  1AMW A;  1Y8O A;  4KFG A;  3CWV A;  2XK2 A;  2UWD A;  2YK9 A;  4YKY A;  4ASG A;  1PVG A;  4CE1 A;  4JAS A;  1US7 A;  3T0H A;  4FMT A;  3R4M A;  3K98 A;  4GEE A;  5D6P A;  1I58 A;  4LWH A;  4URO A;  3TUH A;  5M4K A;  1YT0 A;  4URN A;  1AJ6 A;  3BMY A;  2IOP A;  3CRL A;  3TZ5 A;  3HHU A;  4EFU A;  4YKZ A;  3K99 A;  4H85 A;  4P8O A;  3WQ9 A;  3NMQ A;  3R4N A;  4JAV A;  3Q5L A;  4LWF A;  2YED A;  4AS9 A;  4XKO A;  4ASB A;  3D2R A;  1MX0 A;  1I5B A;  2ESA A;  2YE7 A;  4CWN A;  2QF6 A;  3CGZ A;  2IOQ A;  3A0X A;  4H7Q A;  4MP2 A;  4R3M A;  4FPP A;  1NHH A;  2CH4 A;  3RKZ A;  1GKX A;  3HYY A;  1Y4U A;  2YEG A;  2PNR A;  2BTZ A;  2FXS A;  1YC3 A;  2YGA A;  1H7S A;  1TIL A;  2EXL A;  4CWR A;  1UYD A;  4AWP A;  4XDM A;  3G7E A;  2XDX A;  5F5R A;  4MB9 A;  1UY6 A;  5M4H A;  5JEN A;  2ZDY A;  5D7D A;  4X9L A;  4EMV A;  3O2F A;  4XIR A;  5IN9 A;  2IWU A;  1B62 A;  1UYM A;  2YE3 A;  3OWD A;  1R62 A;  2VCI A;  2GQP A;  1GJV A;  1NHJ A;  4AWQ A;  2CCT A;  4BXI A;  3VHD A;  1YT2 A;  4BIZ A;  5GGZ A;  2ZKJ A;  2BYI A;  2JKI A;  2BU6 A;  3O6O A;  1OSF A;  4ZKI A;  4CE2 A;  4V25 A;  2FYP A;  2YKE A;  5D7C A;  1UYI A;  4Q20 A;  2XJX A;  1U2O A;  1BGQ A;  2YGE A;  3A0Y A;  3HZ1 A;  4BAE A;  5CTU A;  4XE2 A;  3HYZ A;  2YKC A;  4HYP A;  1YC1 A;  1Y8N A;  2FWY A;  4PRX A;  3T2S A;  2XDU A;  4HZ5 A;  4GQT A;  4ASF A;  3GIF A;  3PEJ A;  1YS3 A;  3R91 A;  3QDD A;  2XJJ A;  3D0B A;  1KIJ A;  3G7B A;  4E02 A;  4KQV A;  5BOC A;  4HXW A;  4R1F A;  2YKI A;  2QG0 A;  3TTZ A;  1KZN A;  2YE6 A;  2IOR A;  1I59 A;  2CCU A;  4KP4 A;  1ZW9 A;  1UYF A;  4EGI A;  4PU9 A;  3B27 A;  2FWZ A;  2YE8 A;  2BT0 A;  2QFO A;  5D6Q A;  1Z5A A;  2BSM A;  2YEI A;  2O1V A;  1QZR A;  3TZ2 A;  4XC0 A;  1I5D A;  4E01 A;  4L93 A;  4U7O A;  1Y4S A;  1I5C A;  3R4O A;  2WI1 A;  5M4M A;  4O04 A;  3BM9 A;  2YEE A;  3S5T A;  5M4N A;  3QTF A;  4L90 A;  3U67 A;  4L91 A;  4ASA A;  3JZ3 A;  2HHI A;  4U7N A;  1S16 A;  2CGF A;  4MPE A;  4XD8 A;  2XHX A;  3EHJ A;  2BRE A;  3HZ5 A;  3H80 A;  1I5A A;  3LPS A;  2WI2 A;  2YK2 A;  4JAU A;  3TZ0 A;  1TID A;  1YSR A;  4GCZ A;  2Q8F A;  4MP7 A;  2YJX A;  1BYQ A;  5CPH A;  1IXM A;  2VWC A;  4O05 A;  1AM1 A;  4BQJ A;  4EGH A;  5BOD A;  2YEJ A;  4CWP A;  1YSZ A;  4B7P A;  2YE4 A;  3FV5 A;  1UYK A;  1BKN A;  5CF0 A;  3LNU A;  5FNF A;  4P7A A;  4XCL A;  4XKK A;  2C1G A;  3K97 A;  4NH9 A;  3VAD A;  2YI7 A;  3RLQ A;  1EI1 A;  2C1I A;  4XIP A;  4B6C A;  3DGE A;  3OWB A;  2Q8I A;  2BU2 A;  3GIG B;  4HY6 A;  5M4E A;  2BZ5 A;  2XCM A;  3B28 A;  3VHA A;  4LP0 A;  4XCJ A;  3VHC A;  1Y8P A;  5IDM A;  2XHR A;  1MU5 A;  3T0Z A;  1Z59 A;  2XDS A;  2HG1 A;  3KE6 A;  4FCP A;  4NH7 A;  3TZ4 A;  1UYG A;  4O09 A;  3INX A;  2BYH A;  4YKW A;  1UYL A;  2BU7 A;  2QG2 A;  3Q5K A;  4YKR A;  1H7U A;  4GT8 A;  4GGL A;  4FCQ A;  2WER A;  3WHA A;  4E00 A;  2AKP A;  3GIE A;  3Q5J A;  2JJC A;  1AH6 A;  5FWK A;  3A0W A;  1Z5C A;  4QPJ A;  4L94 A;  5F3K A;  4MOT A;  3A0Z A;  4WUD A;  1YET A;  2ZBK B;  2Q8H A;  4HY1 A;  2BRC A;  2FTK A;  2BU8 A;  2K5B A;  4CWQ A;  1QY8 A;  3T1K A;  2YGF A;  4GFN A;  3OMU A;  2YEC A;  2GFD A;  2H8M A;  4MBC A;  5M4P A;  4I3H A;  4QPK A;  2WI5 A;  3OW6 A;  2WEQ A;  4YKU A;  3ZXO A;  1YC4 A;  1B3Q A;  1NHI A;  1F51 A;  2IWS A;  4MPN A;  4YKT A;  4XIQ A;  5IDJ A;  2YE2 A;  4NH8 A;  4CWF A;  1JM6 A;  3ZKB A;  4JQL A;  3FT5 A;  2CG9 A;  4YKQ A;  5J71 A;  4FCR A;  2IWX A;  3B25 A;  1S14 A;  2O1W A;  3R4P A;  3IED A;  4CWS A;  2HCH A;  1TC6 A;  3A0T A;  4PL9 A;  3SL2 A;  3T10 A;  4L8Z A;  3CYG A;  1Z5B A;  2YKJ A;  2Q8G A;  5C93 A;  3ZXQ A;  4O0B A;  2XHT A;  4KSG A;  1U0Z A;  3LMM A;  3EKO A;  4URM A;  5FND A;  4XTJ A;  2WI7 A;  4ZVI A;  3ZM7 A;  3A0R A;  2WI6 A;  2XX2 A;  1YES A;  2YI0 A;  1L0O A; 
#chains in the Genus database with same CATH homology
 2XD6 A;  3B26 A;  4U93 A;  2YEH A;  2WI3 A;  2VW5 A;  3CRK A;  4HYM A;  3H4L A;  2CCS A;  4BIU A;  1UYE A;  3ZKD A;  1TBW A;  2XX5 A;  2XJG A;  1UY9 A;  3FT8 A;  3D36 A;  2O1U A;  1TH8 A;  4K4O A;  3B24 A;  4WUC A;  1UY8 A;  3EHF A;  3EHG A;  3EKR A;  1UYC A;  2C2A A;  1ZXM A;  2BU5 A;  4URL A;  4PRV A;  4LWG A;  3RLR A;  4CWO A;  4AWO A;  3K60 A;  2ZDX A;  4O07 A;  5D7R A;  3PEH A;  4I5S A;  1B63 A;  2YI6 A;  2WEP A;  3INW A;  4V26 A;  1AH8 A;  2YEF A;  2E0A A;  3G75 A;  4XIT A;  2YE5 A;  4HZ0 A;  4DUH A;  2YJW A;  2HKJ A;  3OPD A;  1TC0 A;  4DZY A;  5CTY A;  5CTX A;  1BXD A;  3U2D A;  1THN A;  1YER A;  1A4H A;  3C11 A;  3U2K A;  2YI5 A;  1EA6 A;  4LWI A;  1GKZ A;  1ZXN A;  3RLP A;  2H55 A;  3HEK A;  1UY7 A;  2WI4 A;  2YEA A;  2YEB A;  2Q2E B;  4HXZ A;  3R92 A;  3EHH A;  2XX4 A;  4LWE A;  2XDK A;  3GIG A;  4EFT A;  2YKB A;  1QYE A;  3MNR P;  1YT1 A;  4KTN A;  1ZWH A;  4YKX A;  2XDL A;  4CWT A;  2YE9 A;  4KSH A;  2XAB A;  1UYH A;  3O0I A;  4CE3 A;  4W7T A;  4XKA A;  5J6A A;  4R3A A;  5FNC A;  4EGK A;  4WUB A;  5CTW A;  3C0E A;  4BQG A;  1ID0 A;  4EEH A;  4MPC A;  5L3J A;  4LPB A;  4EM7 A;  3CGY A;  4H81 A;  2VCJ A;  1AMW A;  1Y8O A;  4KFG A;  3CWV A;  2XK2 A;  2UWD A;  2YK9 A;  4YKY A;  4ASG A;  1PVG A;  4CE1 A;  4JAS A;  1US7 A;  3T0H A;  4FMT A;  3R4M A;  3K98 A;  4GEE A;  5D6P A;  1I58 A;  4LWH A;  4URO A;  3TUH A;  5M4K A;  1YT0 A;  4URN A;  1AJ6 A;  3BMY A;  2IOP A;  3CRL A;  3TZ5 A;  3HHU A;  4EFU A;  4YKZ A;  3K99 A;  4H85 A;  4P8O A;  3WQ9 A;  3NMQ A;  3R4N A;  4JAV A;  3Q5L A;  4LWF A;  2YED A;  4AS9 A;  4XKO A;  4ASB A;  3D2R A;  1MX0 A;  1I5B A;  2ESA A;  2YE7 A;  4CWN A;  2QF6 A;  3CGZ A;  2IOQ A;  3A0X A;  4H7Q A;  4MP2 A;  4R3M A;  4FPP A;  1NHH A;  2CH4 A;  3RKZ A;  1GKX A;  3HYY A;  1Y4U A;  2YEG A;  2PNR A;  2BTZ A;  2FXS A;  1YC3 A;  2YGA A;  1H7S A;  1TIL A;  2EXL A;  4CWR A;  1UYD A;  4AWP A;  4XDM A;  3G7E A;  2XDX A;  5F5R A;  4MB9 A;  1UY6 A;  5M4H A;  2ZDY A;  5D7D A;  4X9L A;  4EMV A;  3O2F A;  4XIR A;  5IN9 A;  2IWU A;  1B62 A;  1UYM A;  2YE3 A;  3OWD A;  1R62 A;  2VCI A;  2GQP A;  1GJV A;  1NHJ A;  4AWQ A;  2CCT A;  4BXI A;  3VHD A;  1YT2 A;  4BIZ A;  5GGZ A;  2ZKJ A;  2BYI A;  2JKI A;  2BU6 A;  3O6O A;  1OSF A;  4ZKI A;  4CE2 A;  4V25 A;  2FYP A;  2YKE A;  5D7C A;  1UYI A;  4Q20 A;  2XJX A;  1U2O A;  1BGQ A;  2YGE A;  3A0Y A;  3HZ1 A;  4BAE A;  5CTU A;  4XE2 A;  3HYZ A;  2YKC A;  4HYP A;  1YC1 A;  1Y8N A;  2FWY A;  4PRX A;  3T2S A;  2XDU A;  4HZ5 A;  4GQT A;  4ASF A;  3GIF A;  3PEJ A;  1YS3 A;  3R91 A;  3QDD A;  2XJJ A;  3D0B A;  1KIJ A;  3G7B A;  4E02 A;  4KQV A;  5BOC A;  4HXW A;  4R1F A;  2YKI A;  2QG0 A;  3TTZ A;  1KZN A;  2YE6 A;  2IOR A;  1I59 A;  2CCU A;  4KP4 A;  1ZW9 A;  1UYF A;  4EGI A;  4PU9 A;  3B27 A;  2FWZ A;  2YE8 A;  2BT0 A;  2QFO A;  5D6Q A;  1Z5A A;  2BSM A;  2YEI A;  2O1V A;  1QZR A;  3TZ2 A;  4XC0 A;  1I5D A;  4E01 A;  4L93 A;  4U7O A;  1Y4S A;  1I5C A;  3R4O A;  2WI1 A;  5M4M A;  4O04 A;  3BM9 A;  2YEE A;  5M4N A;  3QTF A;  4L90 A;  3U67 A;  4L91 A;  4ASA A;  3JZ3 A;  4U7N A;  1S16 A;  2CGF A;  4MPE A;  4XD8 A;  2XHX A;  3EHJ A;  2BRE A;  3HZ5 A;  3H80 A;  1I5A A;  3LPS A;  2WI2 A;  2YK2 A;  4JAU A;  3TZ0 A;  1TID A;  1YSR A;  4GCZ A;  2Q8F A;  4MP7 A;  2YJX A;  1BYQ A;  5CPH A;  2VWC A;  4O05 A;  1AM1 A;  4BQJ A;  4EGH A;  5BOD A;  2YEJ A;  4CWP A;  1YSZ A;  4B7P A;  2YE4 A;  3FV5 A;  1UYK A;  1BKN A;  5CF0 A;  3LNU A;  5FNF A;  4P7A A;  4XCL A;  4XKK A;  3K97 A;  4NH9 A;  3VAD A;  2YI7 A;  3RLQ A;  1EI1 A;  4XIP A;  4B6C A;  3DGE A;  3OWB A;  2Q8I A;  2BU2 A;  3GIG B;  4HY6 A;  5M4E A;  2BZ5 A;  2XCM A;  3B28 A;  3VHA A;  4LP0 A;  4XCJ A;  3VHC A;  1Y8P A;  5IDM A;  2XHR A;  1MU5 A;  3T0Z A;  1Z59 A;  2XDS A;  2HG1 A;  3KE6 A;  4FCP A;  4NH7 A;  3TZ4 A;  1UYG A;  4O09 A;  3INX A;  2BYH A;  4YKW A;  1UYL A;  2BU7 A;  2QG2 A;  3Q5K A;  4YKR A;  1H7U A;  4GT8 A;  4GGL A;  4FCQ A;  2WER A;  3WHA A;  4E00 A;  2AKP A;  3GIE A;  3Q5J A;  2JJC A;  1AH6 A;  5FWK A;  3A0W A;  1Z5C A;  4QPJ A;  4L94 A;  5F3K A;  4MOT A;  3A0Z A;  4WUD A;  1YET A;  2ZBK B;  2Q8H A;  4HY1 A;  2BRC A;  2BU8 A;  2K5B A;  4CWQ A;  1QY8 A;  3T1K A;  2YGF A;  4GFN A;  3OMU A;  2YEC A;  2GFD A;  2H8M A;  4MBC A;  5M4P A;  4I3H A;  4QPK A;  2WI5 A;  3OW6 A;  2WEQ A;  4YKU A;  3ZXO A;  1YC4 A;  1B3Q A;  1NHI A;  2IWS A;  4MPN A;  4YKT A;  4XIQ A;  5IDJ A;  2YE2 A;  4NH8 A;  4CWF A;  1JM6 A;  3ZKB A;  4JQL A;  3FT5 A;  2CG9 A;  4YKQ A;  5J71 A;  4FCR A;  2IWX A;  3B25 A;  1S14 A;  2O1W A;  3R4P A;  3IED A;  4CWS A;  2HCH A;  1TC6 A;  3A0T A;  4PL9 A;  3SL2 A;  3T10 A;  4L8Z A;  1Z5B A;  2YKJ A;  2Q8G A;  5C93 A;  3ZXQ A;  4O0B A;  2XHT A;  4KSG A;  1U0Z A;  5FND A;  3EKO A;  4URM A;  4XTJ A;  2WI7 A;  4ZVI A;  3ZM7 A;  3A0R A;  2WI6 A;  2XX2 A;  1YES A;  2YI0 A;  1L0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...