2FTKA

Berylloflouride spo0f complex with spo0b
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
181
structure length
181
Chain Sequence
ISDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEITSHECLIEIGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation initiation phosphotransferase B
publication title The Crystal Structure of Beryllofluoride Spo0F in Complex with the Phosphotransferase Spo0B Represents a Phosphotransfer Pretransition State.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 68
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature ec 2.7.-.-:
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14682 SPOB_ab Sporulation initiation phospho-transferase B, C-terminal
A PF14689 SPOB_a Sensor_kinase_SpoOB-type, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ftkA01
3.30.565.30 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Sporulation initiation phosphotransferase B (SpoOB), C-terminal domain 2ftkA02
4ZKIA 3P32A 2C2AA 3MD0A 3A0RA 4GT1A 4BIZA 4LC1A 5C93A 4QPKA 3D36A 2LFSA 4MT8A 5B1NA 4GCZA 4FMTA 2QM7A 4JASA 4JYBA 4U7NA 3ZCCA 4JYCA 2LFRA 4JAVA 3ZRVA 2WWWA 2FTKA 4U7OA 5B1OA 4I5SA 2QM8A 4KP4A 3ZRWB 4MTXA 3TK1A 4QPJA 3NXSA 3DGEA 1JOYA 1F51A 4Q20A 2P67A 3ZRWA 4JAUA 4BIUA 5IDJA 3ZRXA 1IXMA 4FPPA
chains in the Genus database with same CATH superfamily
3CC7V 4R8CA 2VCIA 1YTFD 4WBNA 2EXLA 1EI1A 3E8HA 2AZ0A 4MP2A 1N0JA 3TXSA 1IDSA 1VQ4V 3SL2A 3WHAA 3E8FA 3VOUA 1H7SA 1XNRB 3HKEB 4IIJA 1VF7A 4OXSA 1JCHA 2JEXA 4BIUA 3JAMN 2DQ0A 1I5CA 4MB9A 2HJDA 3TUHA 2NLJC 2YEEA 1QHTA 2BTZA 1L1FA 4L90A 4ASUG 4LR3A 2A06H 2F93B 1VQ5V 2ATKC 4H85A 4NH8A 2QJ1A 1M1KW 4O2BB 2EINC 2ZE6A 4DV2B 2YIBD 2QM8A 1W59A 3QTFA 2ZR3A 3ZHSA 5EK0A 2ZXWB 2YE6A 1N34B 1Y6XA 3T10A 3BHPA 3K06A 3OR7C 4CWFA 4AWQA 3H9VA 2GUZB 5CTXA 2CH7A 4KUMA 5FNDA 1OCZB 1GRJA 3IC7A 4X1IB 1J5EO 2A3QA 1F4NA 3E86A 4UCUA 3JASA 4JI4O 1T5EA 4MS2A 2Q7HA 3VQWA 3SPIA 5FNFA 4J80A 2YI8A 4DR4O 1Y74B 4QPJA 2YEGA 3AG2C 1VEWA 2WLLB 2HEPA 1AB3A 2BSKB 2JGDB 1KC8W 3SPHA 2GDSA 2CK3G 4LWFA 4YHHO 1E1QG 2Q2EB 2HHHB 4JI3B 4K8XA 3A0XA 2P5OA 2JJCA 3SGIA 1QLEC 3D36A 1N32O 3K0DA 2H8PC 3L75H 2P4VA 4N23A 2OIGA 3D3IA 2PI4A 3EHJA 4AHCA 1AMWA 2VWKA 4BQJA 3JALB 2CTQA 3WFVA 2CH4A 1E79G 4I50A 3H1HH 1XDCA 2HG5C 3D3QA 4HNAA 4A5UB 2WA4A 2BU8A 4GX5A 3J81N 1U97A 4I4TB 2VWJA 4I9WA 5LA6B 3FAVA 4G27B 3ZXOA 3ABMC 3VHCA 4PA9A 3TTZA 4DR3O 3FX7A 4O4IA 3L70H 4JZ2A 4OPHA 3HB3B 4NTYA 4AWOA 2UWDA 1FJGB 3WG7C 4OPAA 1EBOA 1EN5A 1F51A 2D2CB 2P67A 1VQPV 1EM1A 2JS3A 3CEIA 5IYZA 1O9GA 4NB5A 2QFOA 1HNWB 4GKKO 2ZDXA 1EN4A 1K34A 3JCZA 2XX4A 3T2MA 4MSWC 2QM4A 1MOFA 3KCXA 2DQ3A 1EFRG 1X4TA 4TV9B 3RWRD 3CMAV 2YK9A 3LSSA 3W7WA 1JR9A 2IM9A 2Q4PA 3K5OA 3B8MA 5B1OA 4EEHA 1BKNA 4WCEV 4F4LA 1GKFA 4X9LA 3F5WC 5A9GA 3O6OA 1XMOO 1DK1A 3SJBC 4O4LA 1HDJA 2ZE7A 1BL8A 4DV0O 2HG1A 3BA9A 3BA8A 3VQYA 3T4ZA 2EIMB 1UYMA 1TUBB 5HFLA 1IURA 2IU0A 1TC6A 5CMUA 1NS1A 3N2GB 4ZBMA 3HKCB 4RQFA 4R3AA 3ZJZA 1GKZA 4K0KO 1KMIZ 3ZMVA 1H8EG 2YXLA 5ITZB 1FD9A 3S3WA 1VQMV 1M90W 4I7ZB 4NYKA 3MHHC 4GEEA 3B8NA 3MD0A 1KZNA 3K3WA 5CN0A 3Q5KA 3CCSV 4X1YB 5DEDA 3AG4B 4FZ1A 3STLC 2YE2A 4XKKA 5LYJA 4DRXB 3MAQA 3JD1A 1MSDA 1QVGU 1Y66A 1UYIA 1SKVA 3ASOC 5CA1A 4TT3G 5CF0A 2WERA 5JVDB 3HZ5A 4CH6A 1CP9A 1DF5A 3CCQV 4I9QA 3RFRA 4FFBA 2RDCA 4XCJA 2EIJB 4NXNB 1WAZA 4DXWA 3GIEA 4LWGA 3JARB 4J42A 4JQLA 3CWVA 2WLNA 2GTSA 1ZWHA 5EYPA 3B25A 1JOYA 4CWQA 3ZN0A 2A79B 1P49A 3T4DA 1TGOA 2ZNIA 3OGIB 2AXTZ 4MTFA 3CX5F 3TCUA 1RM1C 3OW6A 4IGGA 1N36O 3ZHTA 5KX5B 2XAJA 3FKSG 1U96A 1QBZA 2F23A 2F95B 2UXDO 3ZM7A 4PV1B 1UYKA 3CJHA 2ADQB 2XAHA 3CRCA 3ICXA 3U67A 4JI7O 3TZ2A 3TK1A 1AI6A 2UXCO 2OCCC 4LFBB 2ESAA 2CH7B 5IJ0A 3SPGA 2CE4A 2UU9O 1WA8A 1HNXB 4HBNA 4EFUA 2ZIMA 5D6PA 5GTIZ 4IYHA 4HZ0A 1V55C 5JENA 2HCHA 2R9AA 3QF7A 3ZMUA 4X88A 2XJXA 3SDLA 1MG1A 3ZS8C 4B7EA 2Q9LA 2IORA 3R66A 2IBZH 1VQKV 1WJZA 3H1LH 3JATA 3INXA 4HYPA 5L3EA 3SJAC 4V26A 4EB6B 1RPRA 4UB8Z 3I55V 2Y69B 5M4NA 1ZL8A 2YEBA 2HFEC 4DV5B 2IWSA 2BTQB 1EZVH 1BT8A 1B06A 2PY5A 2LJ2A 4B3RB 4ZOLA 2NN4A 4JGSA 4Z2WA 1YERA 3A0YA 4DV1B 3EHFA 1V54B 3J80N 4LF9B 4KTNA 3K79A 2XDUA 4IHJB 3RYHB 3BAAA 1YXBA 4LF6O 3DTUB 2C1GA 3AG1B 2XABA 1XL4A 4XD8A 1NTZH 1NHJA 3KCYA 3K5MA 3T1YO 1QYEA 1Y8OA 1GN2A 4DK0A 4YIOA 3IAYA 4CWTA 2OIEA 1M56C 2XHTA 2KG7A 4J10A 3ZHUA 1ZWIC 1Q43A 2YXHA 3JYCA 2EILB 3A0HZ 1S72V 4V25A 4B3TO 1BSMA 3EVKA 1XQ8A 3PN1A 1VIBA 1H2GA 2YDEA 2Y0IA 4LWIA 3JSLA 1OCOB 4O05A 5F3KA 3UCSC 1BS3A 4JYAO 4EGIA 2YE7A 3OGCC 2ETNA 3OTOO 5B1NA 4LF7B 1SF9A 4LF5B 2KKWA 1YDXA 4YJ3A 2QKAA 1R6TA 4JAVA 1Z2GA 5LMNB 4GKJB 1B04A 4JI2O 5JJNB 1TA8A 2HP8A 2YC0A 1NI8A 4JI1O 5IN9A 3P3NA 1Q6HA 4AILC 1Z59A 5CTUA 1I94B 4KSHA 3FV5A 4NH7A 4UROA 5JCOC 5EIBD 1UY8A 4MPEA 4YKQA 3L74H 1MZFA 2ZXWC 3E83A 2WEPA 3CGZA 4X1KB 1P84F 1KKDA 5L3BA 2YEAA 1SQBH 1OCZC 4YY3O 3CCMV 4DR2O 4YJ2B 1I08A 4JV5O 1X59A 5KHJA 4NTXA 3QNEA 5LMUB 1MA1A 2YE9A 1IBMB 3OAAG 4X66O 1Y4UA 1HNZO 3LDEA 3J7AU 3OFNG 3ABLB 4WFAV 1GKXA 1OSFA 2XNDG 2F66C 3DXRA 3QO8A 1HP8A 1I59A 4GLXA 1UY9A 1GTOA 4CBCA 3T0ZA 5JCOA 5IY5C 1XMQO 2BSMA 2GV9A 4X20A 4ASAA 1EZJA 3JAKA 1UY6A 3LNMB 4XE2A 2YEIA 1Y8PA 5JH7A 1U0ZA 5KLVH 3RW0A 4O2AA 2YI5A 2E75B 3JD0A 4JASA 3H1JH 4X89A 1CEZA 4ASFA 2RN9A 1NBMG 3OUFA 1N4CA 4J7KA 4PA3A 4I5SA 1S16A 2QR4A 2WPDG 1JPXA 3H01A 4AI8A 1IBLB 3AK1A 2E5LO 3ZRWA 2PTMA 2UUBO 5IT9N 3U2KA 1MABG 4TSFG 4LFCO 5FNVA 3CCRV 2AZ2A 1KYOF 1AR5A 4YKXA 2XJGA 2HKOA 4KHPO 1NHHA 3EHGA 3S3XA 5LHHA 4B3MB 4P9OA 4JI6O 4EM7A 3GIFA 2WWWA 3K5NA 1AM1A 1DTOA 3CCEV 3SYPA 2Q8HA 2XX5A 2R9IA 4J9YB 4DK1A 2PF4E 1VF6C 3T1HB 2QF6A 4W4LA 4QJFB 4OX9O 1Q6IA 5B1BB 4HZ3A 2W6JG 3LNUA 3ZHRA 1F23A 2QDOA 4DV7B 1H2NA 3M7MX 2UUAB 3C0EA 2Q0AA 3WU2Z 4DR1O 3ABTA 5EZYA 3ZX6A 5KHIA 4U7OA 4QIWF 2Q7EA 1FPOA 2R70A 2EIMC 5LXTA 4O04A 4MW8A 3A0BZ 4LNUB 3TXQA 3K08A 2FWYA 3F7VC 2VQFB 4F6EA 2YS8A 5J2TB 1GJVA 3MDSA 1VQ6V 1YT1A 1VQLV 4L91A 4DV3B 3ZBHA 2LGQA 5EC2C 4GFNA 1I5XA 4FLXA 5FL7G 4JI0B 4LFAO 3UO2A 1Q82W 1OCRC 1VF6A 1P7GA 2BOCC 2GSMB 4HZ5A 2VQEO 3A2FA 2Q73A 3A0TA 4JTAB 3WQ9A 4DUYO 1YVWA 2B1IA 3BPZA 1BQZA 4YXWG 4DR7B 2KSDA 2IH3C 5EBWC 2XCMA 3AG7A 2ZD9A 4HXWA 2BTOA 1YITV 3CHXA 4PA7A 1BXDA 2NR5A 4UCOA 3E8GA 3C3TA 4RQEA 2LFRA 1KIJA 4DR6O 1SQXH 1JFFA 2CTPA 2D3OW 4JPRA 4MTOA 3U11A 4U93A 5F5RA 1FYJA 2R9RB 4EMVA 2YKCA 4LH7A 3B2EE 4D6TH 5M4KA 1SRYA 2UUCB 5D5PA 2Q8GA 4E4EA 3JAWB 4XC0A 4XIQA 2Y4UA 3QG5A 3CCJV 2E76B 4KFGA 5A2QN 1WB7A 2WLJA 4LF4B 2VW5A 5KHHA 2Y4TA 5D7CA 4B08A 2CTWA 3MNRP 2UXBB 3BVOA 3VHDA 3E22A 2YXYA 4ZHQA 1SQFA 4DO2A 5KA6A 4FLYA 2ZM6B 4FPPA 3CCUV 1OCCB 3R4NA 4FFKA 1PP9H 3N2KA 4WF9V 1THZA 1PL4A 2YKIA 4FMTA 3U10A 4I55B 3K57A 2L6LA 4O4JB 1MSWD 3GIGA 3R65A 4ASGA 3CC4V 4YKRA 5L3FA 2BOBC 5FPOA 4FJCC 1XNRO 3HHUA 3ABKB 1YSRA 3ZRXA 2GBOA 4TV8A 3OWBA 3LNNA 1Y4SA 4X8AA 1TIDA 1AILA 1OV9A 2Q67A 4LPBA 3C11A 4QPKA 4CWOA 3RYFB 4GCZA 1PNMA 4H13B 2R72A 4WUDA 1GN3A 1QR9A 4W4KA 1L0OA 2Y69C 5CA0B 1FS0G 1H8HG 4U3JB 4DV2O 3SJQC 1PV0A 3VQVA 3U0ZA 1BHBA 2EZOA 3M8AA 1U2OA 4KL1A 1SC5B 1N34O 2YIAA 3ZKDA 1ZXMA 1SQQH 5EC1C 5BMVB 4LWSB 4L8ZA 1FKAO 4O4HA 3P30A 5CB4A 3SPCA 4NVPA 3ZKBA 1CXZB 4ZI7B 2ZBKB 4FCQA 3ZN1A 2JIZG 4K8ZA 1NT2B 2ZE8A 4MP7A 4L93A 2Q68A 2PYJA 3G71V 1QU7A 3M99B 2X6AA 3SYQA 1Y67A 4K3AA 2EILC 1G8MA 1UYDA 2VCJA 4HYOA 2XUMA 2WI5A 1ZAUA 2HHHO 3HKDA 1YESA 1YC4A 2DYRC 5KA5A 3FT5A 2OYQA 4EGKA 4BIOA 4F6RB 2UXNA 4X64B 5M4HA 5GONB 1VQ8V 1S5HC 3IEDA 3QTCA 1UYEA 4DUZB 1JVMA 2CDYA 4GT8A 2H8MA 1R3JC 3WB2A 3TETA 4TUYB 1YCIA 5AG2A 1WLEA 5D7RA 5BZBA 3FB5C 5CBFA 4FCRA 5IWAB 3K59A 1I0HA 4FM1A 2YIBA 3R91A 2XD6A 3DC5A 1L0LH 3FB7C 3I56V 1J95A 5K1XA 4KQVA 2WLIA 1FJGO 3ETQA 4JZGA 4BXIA 1KD1W 1K4DC 4MVUA 2Y0PA 1NR7A 1UYCA 5LOVA 1A32A 1HNWO 3P3PA 4I0XA 2QWNB 5IYCO 3CYGA 3TZ0A 3H80A 3L73H 5IE9A 2DYSB 2BU6A 3G7BA 2W6IG 4XBFA 3INWA 4L94A 1US7A 4CZZA 2XHBA 2YJXA 2AHZA 3ABLC 2YKBA 4JAUA 4TQDA 4CH4A 1S14A 5DN6G 1W2BU 5LP6B 2ZR2A 3IFXA 4R1FA 1YEWA 2YICA 2YKEA 3HYZA 3OWDA 3U2DA 3ZMZA 5JQGA 3D0BA 4DV4B 1IVSA 1QVFU 1URFA 1GN4A 2H94A 3ABUA 2QG0A 2GHYA 3ZXQA 3GB7C 3VBBA 5L3JA 3EFFK 3EXAA 2XDKA 1SESA 4AWPA 1FXHA 2HR3A 4WBNB 2K5BA 2XAFA 2YEVA 1L8DA 2OTLV 1TILA 1B3QA 2K9PA 4EGHA 4X9QA 4IIJB 2L35A 3H1KH 3TGUH 3JD3A 4H81A 2ZT9B 3K04A 5FWKA 2MK3A 3WB0A 3RYIA 3LUTB 5JJEB 2YKJA 2XOKG 2YK2A 2IOPA 4KSGA 1YHQV 2UXDB 1LNQA 3CC2V 3DC6A 2LFSA 4G2KA 3UT5A 3GIGB 1W0JG 2YGEA 4DUHA 4U7NA 1M57B 2CG9A 4AQYB 3K60A 1R3IC 4DR5B 5KHGA 5B1BC 3AG3B 3RT3C 1UFIA 2JRIA 4XDKA 4P8OA 3W7XA 2Z3YA 2BU2A 1S5JA 4CH5A 4CWNA 2WSSG 3HKBA 4DZYA 1F4MA 3GWOA 4URMA 3JASB 3B77A 2YUAA 4G28B 5FPRA 3R4PA 2AKPA 1QR8A 4MT8A 1SQVH 2IWUA 3RVZA 4X62B 3A8TA 4WFFA 1WN7A 3ZRVA 2E3CA 4B3SB 3K99A 5L3DA 1R62A 3LMMA 2QTSA 2WI2A 4FM2A 1F7YA 3CXHF 3K9SA 1K9MW 3OD4A 4NXMB 1NU1H 4B7KA 2HKJA 2EINB 1I5BA 4PRXA 4IL6Z 4CH3A 2WI1A 2KQXA 1Z5WA 4LFBO 3HZ1A 1KB9F 2C2AA 2FKXA 2Q0OC 3NR7A 4LBEC 1HNXO 4UV8A 5H6RA 5JJJB 1IBKB 1XHXA 1Y76A 2EIKC 3AK3A 5TISZ 1JX9A 5BR8B 3H4LA 4HXZA 4XDLA 4I50B 3CCVV 1YZBA 1BCCH 3T2SA 4DV6B 1YJ9V 1Y4MA 4HNAB 3QO5A 4GX2A 4U3FH 3C3SA 1KU9A 2ARHA 1DF4A 1UJWB 4XIPA 2E0AA 3FAVB 1VF5B 4XITA 5IJ9A 2PYLA 2DWEC 1NKDA 1AJQA 3R92A 4O4IB 1R3KC 1FXKC 4DV5O 2Z5UA 2EJRA 4B3RO 1GK9A 1PD3A 4P30A 4O09A 5J2UA 4NKGB 1Z5AA 2YI9A 1TVKA 4J7ZA 1THNA 3BCCH 5IYZB 2A7WA 2XAQA 2CGFA 1FFXA 3LSQA 1BE3H 1SS3A 4DV1O 2HLDG 1JJ2U 4LF9O 1ORQC 2DW4A 1IXMA 2EZPA 4ZKIA 3HYYA 2P7TC 2XDXA 3P32A 3A0RA 4GT1A 1KP3A 2KB1A 3RYCA 1XNQB 4MVSA 2YGAA 4FLWA 4JI1B 1ZSPA 4YKWA 3BY6A 3QVNA 1VQ7V 4E02A 4O4LB 1RSOA 4EKWA 2XK2A 4UB6Z 3B28A 2XTAA 4LP0A 3K03A 3ML0A 1ID0A 3TZ4A 4BQGA 2CUGA 3KG2A 4MOTA 1SA0A 4CC5A 4J9ZB 5E1AC 4J11A 3FB8C 4X65B 5M4EA 4W7TA 3B26A 2IOQA 5D5QA 4JV5B 3ABKC 3B09A 5BOCA 2HHIA 4LF7O 2IH1C 4LF5O 2JS5A 1WPBA 4GYCB 1NHIA 4X66B 5LMNO 4GKJO 4LF8B 1FXVA 3HKEA 3CRAA 1AI5A 1VQOV 3RVYA 5LYJB 2F43G 1I94O 3E35A 2Q7GA 1ZXNA 5CA1B 1XMQB 3CYOA 3OW2U 4L87A 4WUBA 4O2BA 2F1MA 2JKIA 1IX9A 4ZVIA 4XDJA 1NTMH 2H3OA 4QE9A 2XT9A 1B63A 2DJVA 4FFBB 2FB5A 5BXZA 2BRCA 3F5TA 1HR0B 3DSQA 5C8YA 1IBMO 4UCSA 2GUZA 2LGWA 2N05A 2BU7A 3CXCU 3BM9A 4X1IA 1H2KA 5EYPB 2ZE5A 3E8BA 2WI7A 4H0LB 5HFMA 3CMEV 1R73A 4GZRB 5EIBC 3SYCA 2VRZA 4BR6A 4Q20A 2ZINA 3ZHQA 2IJHA 1Y74A 2WLLA 2JGUA 3ZHVA 1UYGA 2BSKA 2JGDA 4LC1A 1VQNV 3CJHB 4E2LA 1YC3A 1HWYA 5KMGA 5KAFZ 1YI2V 4JI8B 5IJ0B 5BODA 2CGOA 1WA8B 3K5LA 4R7CA 4UVAA 2FYUH 3JD2A 1AJNA 3JALA 4H33A 1IBLO 4JI5B 4PRVA 3SYAA 2XHXA 1SETA 3I5DA 1K8AW 4FCPA 2RCVA 1R1BA 2QM7A 1MU5A 4XKOA 2IU3A 2FMLA 2ZNJA 3JATB 4I4TA 4N21A 1M93A 5LA6A 2JK5C 1FFTB 3E89A 1PNLA 4WFBV 1SQGA 4WFEA 1RM1B 3CSXA 4B3MO 1AJ6A 1K3EA 3OR6C 1ZL8B 1N33B 4MTGA 3CD6V 1E1RG 2WI6A 4LCUC 5J6AA 4ZOLB 1RFYA 3ETDA 5LBQA 3RLQA 2DYSC 4LWEA 1AR1B 4YIPA 4BIZA 3T1HO 4K4OA 4RO2A 1I7FA 2VWCA 1H2LA 4DV7O 3L9DA 2UUAO 2DOSA 4H44B 4TV9A 1Y8NA 3LDCA 2PUSA 1GM8A 3BEHA 3DGEA 3FT8A 1AJPA 2PGGA 2G38A 1RPOA 4D7SA 5B1AB 1I5AA 2WAMA 3AG4C 2ODMA 2F4VB 1AI7A 3Q4HA 4IT5A 1KP2A 2Q8IA 1KKCA 1KBHA 2KG7B 4I3HA 2VQFO 1WNSA 5IYDO 1TUBA 1R6KA 4BAEA 4ZIBA 3T1KA 5CBHA 4DV3O 1XL6A 3N2GA 3HKCA 3ZIAG 1BQ0A 3O2FA 4PA4A 2CCUA 4JI0O 2EIJC 5H9CA 1DLBA 1XHZA 4J41A 3RYCB 2Q6AA 1S76D 2QKCA 4HAMA 4Q6GA 1OJHA 3KZIZ 4FZ0A 2WLKA 2IJKA 4YJ3B 4YKUA 2CCSA 4FLZA 4WFGA 4DR7O 3R4OA 4UVBA 4CWRA 4QNHB 2ZCEA 4X1YA 1VP7A 3LDDA 4CS4A 1O9HA 4DRXA 4RUEA 1BGQA 5H5NA 4HY6A 3UO3A 4DW0A 3FYEB 3AG3C 2Q5ZA 1I5YA 5JVDA 3FD9A 1JMKC 1ZUQA 2UUCO 4PDVA 4KP4A 1P4RA 4CE2A 3JARA 1AP6A 4JTDB 4FM0A 1YSCA 4MW3A 2B1GA 5KAIZ 3O0IA 4LF4O 1J5EB 4PU9A 2Z0AA 1BYQA 1NVPB 4JI4B 2UXBO 2WLMA 3DXRB 1EN6A 2ZM6O 3CRRA 2QSAA 3N27A 1UYFA 1WB8A 5K1PA 5FLXN 4DR4B 1YC1A 1UPGA 4JF3A 1Q6UA 4RWUA 3D36C 1ZX3A 5KX5A 1YJWV 1GMGA 1WP8A 4X20B 4YHHB 2P4KA 3JAKB 4PELA 3HEKA 1CPYA 5C8YB 5JH7B 3UM7A 1N32B 2O1WA 4O2AB 4TOIA 2CGNA 2YI0A 4PDMA 1V54C 5H6QA 3PEJA 5LGUA 2YE4A 5LGNA 2DMXA 3AG1C 4QGPA 1SZXA 1K33A 2AW9A 1YT0A 4WUCA 3ZRWB 5KUMA 3X2QB 3VQXA 3CPWU 2BU5A 5B5EZ 3D2RA 2XDLA 5FNVB 5DM6V 1IZ3A 4NR1A 4XDMA 1QQCA 4UCVA 2OTJV 4XTJA 3VADA 4HY1A 5KMGB 2CTRA 1PM9A 4EB6A 4DR3B 2YEFA 1JQ0A 5IY5B 1GM7A 4QE7A 3CGYA 2YE5A 4MVRA 3ZCCA 2BTQA 2BZ5A 4JI3O 1TC0A 3FFQA 1OCOC 3A0WA 4PDRA 2DN9A 3F7YC 2QWOB 4YKZA 4P7AA 4GUNA 1BHAA 3AK2A 2YI7A 4WFHA 4GKKB 3GVMA 3CP1A 4H37A 1DGSA 3JCUZ 4IHJA 3RYHA 3O9OA 4P2ZA 4LP8A 4DW1A 5LHGA 1Q81W 5EZYB 5M4PA 5M4MA 2B9ZA 1V9PA 3RLRA 1K5SA 5GTHZ 1A4HA 2XDSA 1I5DA 3NMQA 4CS3A 2JDIG 3B40A 4FLVA 5LXTB 3SJCC 3UKMA 1XMOB 4EFEA 4UCRA 4DV0B 2OCHA 2ZQMA 3ZMTA 5DECA 2C1IA 1GN6A 2DWDC 1Z5CA 3AEIA 5IDJA 2WI4A 5LL6Y 2Q69A 1OHHG 3RKZA 2ZKOA 4X64O 2MW2B 2W0FC 4MVZA 1ENVA 1K4CC 1JJOA 4DUZO 4TQFA 4K0KB 1S77D 1XI1A 4PD4F 4CWPA 4MVMA 4UCTA 2E74B 3Q4HB 2AHYA 3OPDA 4UVCA 5LGTA 2O1UA 2RMKB 5E79Z 5IWAO 2QKSA 4AS9A 2YEDA 3JD4A 1EA6A 3R4MA 5C93A 3K97A 3O65A 3ETGA 3G4SV 3EKOA 4IYIA 1KQSU 1JFFB 2IJJA 2ILMA 1LUWA 4XKAA 1YIJV 1TBWA 4R6ZA 1YF2A 2N74A 2PI5A 1AP5A 2GFDA 4X1KA 3RLPA 2ZDYA 1K92A 5JWPA 3KKYA 2BE3A 4YJ2A 1OCRB 2O1VA 2QG2A 4BAYA 1YETA 2P6JA 2BREA 5FNCA 1AROP 2QWRB 1NQTA 2XASA 3W7TA 2P06A 5L3CA 4JYYA 4MPCA 3E22B 4ZHQB 2YSUB 4XCLA 3OTFA 1Z5BA 1MNGA 1TUEB 4DV4O 3ASNB 1BGYH 3N2KB 3SR2C 5F2VO 2ZIOA 1PNKA 3HPLC 3T1CA 2QA4V 1N36B 3EHHA 2BYHA 4FVMA 2LW7A 2X7RB 4PDLA 4BW9A 1AH8A 1PPJH 1B6QA 3BRCA 3W7SA 4JI7B 3CWBH 1QNMA 4GQTA 1Q90D 2UXCB 1VMGA 2ZDIC 5B3SB 5GGZA 1B62A 1LUVA 2ZKJA 3B24A 2JVDA 2UU9B 4NXNO 3OEEG 2QWQB 2XX2A 3JZ3A 2IW5A 4TV8B 1XEQA 4B7PA 2X0LA 4FLTA 2OWOA 1NH2B 1ROPA 2FTKA 4P9PA 5J71A 3SYOA 3OMAB 2RJZA 1S3JA 3CE2A 1SERA 2GTAA 3WB1A 3K98A 1XOUA 2ITCC 4J7JA 2A0LA 2NNUA 3UQ8A 4AQYO 3ETEA 2YIDA 4DR5O 4L8JA 1UYHA 2RQ6A 5LHIA 3HR0A 2ZDIA 4O4HB 3BABA 1XBLA 1UY7A 5CB4B 4PL9A 1UYLA 1M4UA 3JSNA 1QLNA 4PI0A 4EFBA 3CRLA 3FYIB 4UUJC 5B1AC 4LF6B 1PL0A 2HVKC 1JA8A 1D2DA 5EBLC 4X62O 4B3SO 2P22C 3OMIB 1YSZA 1K73W 1R3LC 2P90A 3T1YB 4E00A 4GGLA 3ZRSA 4LNUA 4NXMO 3Q5JA 1NVPD 4O07A 4YKYA 1ZTEA 1YTFB 4CWSA 3HKDB 3AG2B 4NTWA 5J2TA 2Q8VA 4JYBA 4UXNA 4LWHA 1US6A 4B3TB 4CS2A 1IBKO 2YEHA 1G6UA 1KECA 2QE7G 3CRQA 3CCLV 4R50A 1QLEB 1GM9A 2FWZA 5BR8O 4JYAB 1H7UA 2YE8A 2QTOA 3SPJA 4DV6O 3OTOB 2VS0A 2EULA 2PZSA 3APQA 1Q86W 3THOA 4JI2B 4HYMA 1TAEA 1FAFA 3CRMA 4KFMA 3STZC 1Q3EA 4B6CA 4K35A 1OCCC 2A9HA 1MX0A 2XAGA 2WLIB 1SQPH 4Z1VA 3ABMB 1H2SB 4URLA 1L0NH 2DYRB 1FXKA 5LOVB 4I0XB 3BMYA 3WG7B 3K58A 3OM3B 1RP3B 2B5UA 4ABMA 1Q5OA 2CCTA 3APOA 4YY3B 5EBMC 4RAIA 4DR2B 2V7QG 5H2FZ 2HJFC 1XNQO 3JAWA 1VARA 5CA3A 1AI4A 4MTXA 2X6CA 3OT7A 5BY1A 2M6YA 1YS3A 3PEHA 3IJ4A 1HNZB 1AR4A 2X6BA 4NH9A 5L3GA 3CRKA 4ASBA 3G6BA 4KXRA 4GX0A 2YGFA 2WLHA 2Y48A 3G6EV 5JQGB 2EBOA 4CE1A 4X65O 1YJNV 3MHSC 4C7UA 1COWG 3OMNB 3B27A 2JJ2G 3E2EA 4JAAA 5D6QA 4CE3A 3FB6C 1AH6A 2LQTA 4I55A 3A0ZA 4O4JA 1LR1A 2WI3A 4PI2A 1M9NA 3LSUA 3W7UA 1S5LZ 3OEHG 4BW5A 2FL4A 2YEVB 1GAXA 5CTYA 3ZEDA 3RGBA 4MVOA 3IGAC 5IYBO 4YKTA 2LO1A 4LF8O 2CAZC 3X2QC 3ZMSA 3S5TA 3OMUA 5CBGA 5LMUO 3RYIB 1WPXA 4JYCA 2M7WA 3K0GA 4GX1A 2K1EA 4FIPC 3RYFA 5CPHA 2E5LB 1Q8IA 2BYIA 3QO7A 2UUBB 2YI6A 1G4YB 2UXXA 1OZ0A 3NXSA 2RNBA 4LFCB 2LW1A 3TZ5A 2QGNA 5CA0A 4URNA 4KHPB 4U3JA 3UT5B 5B66Z 1NJIW 3KE6A 2PNRA 4JI6B 1AVMA 2IWXA 3ASOB 1Z5VA 4H7QA 4UV9A 5KUKA 2XHRA 1W0KG 2FYPA 3OE7G 1HR0O 5IDMA 3C90A 2LP7A 5BMVA 4LWSA 4OGQB 2OT5A 3H1IH 3HKBB 4OX9B 1GO3F 3RN4A 4ZI7A 3G80A 4MBCA 2BT0A 1H38A 1WP7A 2ADPA 2FXSA 4DR1B 4Z1MG 2EJ7A 3IC9A 5CTWA 3LPSA 1I58A 3TJTA 1JM6A 1QY8A 2V4DA 1ZW9A 3VHAA 4MPNA 4E72A 1K5QA 1M5IA 2V1DA 4JI8O 3K9AA 2YE3A 1R6NA 2JJ1G 4DYLA 3B4SA 4F6RA 2N04A 1HW7A 2O57A 1Y76B 5GONA 1N8RW 4PJ0Z 2OCCB 1G1XB 4PA6A 4TWKA 4LFAB 1MMMA 4R3MA 1D5AA 4JI5O 2HVJC 2JEUA 1ZLZA 2VQEB 4TUYA 1NZ6A 4BWAA 1K97A 1V55B 1BZKA 3L71H 2DE0X 4DUYB 5J9PC 2ITDC 2YECA 3D8CA 1VQ9V 3G7EA 5LP6C 5GW7A 5IJ9B 2IJIA 3T0HA 1TH8A 1QZRA 4EEQA 1GH6A 1NH2D 1XREA 1MZEA 4JTCB 1N33O 1P7BA 4DR6B 1NR1A 5KHKA 1H2MA 2YJWA 1YT2A 5J2UB 3BFRA 3QDDA 2W0XA 1TVKB 3CB2A 4CC6A 1FFXB 1SZTA 3Q5LA 1QCEA 2Q8FA 5D7DA 4LH6A 4FLUA 4PHZA 1XUQA 2EIKB 1XILA 2QEXV 4RUFA 4ICGA 1PKXA 3PJSK 1Q7YW 3CS5A 4MVQA 1KUQA 5ITZA 4O0BA 2BCCH 3GWKC 1N0NA 2XJJA 4UFZA 1RSOB 3OUSA 2H55A 1D5NA 2F4VO 4FK5C 2QWPB 3RBZA 3ASNC 5LP6A 1IXBA 4E01A 2EX3A 4XIRA 3G75A 1SA0B 1PVGA 1BMFG 1NTKH 1K7DA 2WA3A 3G67A 2WEQA 1S0VA 1FXKB 3L72H 3EKRA 2GQPA 4EFTA 4D7TA 2AGAA 1M56B 2YEJA 3EHBB 1M57C 5B3SC
chains in the Genus database with same CATH topology
2Q69A 1OHHG 3CC7V 4R8CA 3LNMB 2W0FC 2C2AA 4MVZA 1ENVA 4LBEC 1K4CC 4UV8A 5H6RA 1YTFD 3RW0A 3JD0A 4JASA 2EIKC 4X89A 3E8HA 1CEZA 1S77D 1JX9A 1NBMG 3OUFA 1VQ4V 3E8FA 4XDLA 4PA3A 4I5SA 3VOUA 3CCVV 4MVMA 2WPDG 1JPXA 3H01A 2AHYA 4OXSA 1Y4MA 1YJ9V 3QO5A 4GX2A 1JCHA 2JEXA 4UVCA 4BIUA 1DF4A 2DQ0A 3ZRWA 5LGTA 1UJWB 1MABG 2QKSA 2NLJC 4TSFG 3CCRV 3JD4A 2DWEC 1NKDA 1L1FA 5C93A 4ASUG 1AJQA 2HKOA 3G4SV 3ETGA 1R3KC 1VQ5V 5LHHA 2ATKC 1KQSU 1FXKC 2IJJA 1M1KW 2Z5UA 4P9OA 2EINC 2EJRA 1GK9A 2WWWA 1PD3A 1YIJV 4P30A 2QM8A 4R6ZA 2PI5A 1DTOA 3CCEV 2XAQA 3LSQA 2ZR3A 3SYPA 2HLDG 2R9IA 5EK0A 1JJ2U 2ZXWB 4J9YB 1K92A 1ORQC 2DW4A 3K06A 3OR7C 1IXMA 1OCRB 4QJFB 2EZPA 4ZKIA 2P7TC 5B1BB 4HZ3A 2P6JA 2W6JG 3P32A 4BAYA 4KUMA 1AROP 1OCZB 1F23A 3A0RA 4GT1A 3IC7A 1KP3A 2KB1A 4MVSA 1F4NA 3E86A 1NQTA 2XASA 3ABTA 3W7TA 3BY6A 4MS2A 1VQ7V 5L3CA 4EKWA 4U7OA 3SPIA 4QIWF 3K03A 3ML0A 2YSUB 2EIMC 4MW8A 3KG2A 4QPJA 3AG2C 1TUEB 3ASNB 2WLLB 3K08A 1PNKA 1KC8W 3F7VC 3HPLC 4J9ZB 3SPHA 3T1CA 5E1AC 2QA4V 2CK3G 3FB8C 1VQ6V 1E1QG 2X7RB 4PDLA 1VQLV 1QLEC 3D36A 3K0DA 2H8PC 5EC2C 1B6QA 3W7SA 1I5XA 2ZDIC 5B3SB 4N23A 3ABKC 3D3IA 2PI4A 5FL7G 1Q82W 1OCRC 2IH1C 3OEEG 2BOCC 2GSMB 2IW5A 3WFVA 4JTAB 1E79G 2X0LA 1FXVA 2HG5C 1NH2B 2B1IA 2FTKA 1ROPA 4YXWG 1AI5A 2IH3C 4P9PA 1VQOV 4GX5A 3SYOA 3RVYA 5EBWC 2F43G 3E35A 2ZD9A 3OMAB 4I9WA 1YITV 4PA7A 1S3JA 4G27B 3ABMC 3E8GA 1SERA 4PA9A 4RQEA 2LFRA 3CYOA 3OW2U 4L87A 3HB3B 2ITCC 2D3OW 2A0LA 2NNUA 3ETEA 3WG7C 1EBOA 1F51A 4JPRA 4MTOA 2P67A 1VQPV 4XDJA 4QE9A 5LHIA 2R9RB 2ZDIA 1SRYA 1K34A 3JCZA 3T2MA 4MSWC 1MOFA 2DQ3A 1EFRG 1QLNA 3FYIB 4UUJC 5B1AC 3CXCU 3CMAV 3LSSA 3CCJV 3W7WA 1PL0A 3B8MA 2HVKC 5B1OA 3E8BA 4WCEV 2WLJA 5HFMA 4F4LA 1GKFA 5EBLC 3F5WC 3CMEV 1R73A 3SYCA 3OMIB 1K73W 1R3LC 1BL8A 2P90A 4Q20A 3ZRSA 4DO2A 5KA6A 2IJHA 4FPPA 3T4ZA 3CCUV 1OCCB 2WLLA 2EIMB 1NVPD 4WF9V 5HFLA 4LC1A 1THZA 1YTFB 1VQNV 2IU0A 3AG2B 5CMUA 4E2LA 1HWYA 4FMTA 4JYBA 4UXNA 4ZBMA 4RQFA 1YI2V 3ZJZA 1KECA 1MSWD 2QE7G 3R65A 3CCLV 3ZMVA 1H8EG 4R50A 1QLEB 1GM9A 3CC4V 5L3FA 4R7CA 4UVAA 2BOBC 2QTOA 4FJCC 3SPJA 1VQMV 1M90W 3ABKB 3ZRXA 3JD2A 1AJNA 4H33A 3MHHC 3B8NA 3MD0A 4X8AA 3SYAA 3K3WA 5CN0A 1SETA 1K8AW 1Q86W 2Q67A 4QPKA 3CCSV 4GCZA 1PNMA 2QM7A 3AG4B 3STLC 2IU3A 1QR9A 4KFMA 4N21A 3STZC 2JK5C 2Y69C 1FFTB 3E89A 1PNLA 3JD1A 4WFBV 1OCCC 4WFEA 1RM1B 1Y66A 2A9HA 1FS0G 1QVGU 1H8HG 2XAGA 3ASOC 1K3EA 2WLIB 3OR6C 4TT3G 3SJQC 4MTGA 3ABMB 3CD6V 1E1RG 4LCUC 1BHBA 2EZOA 2DYRB 3ETDA 5LBQA 1CP9A 1DF5A 1FXKA 2DYSC 3CCQV 1AR1B 4BIZA 3WG7B 3OM3B 2EIJB 5EC1C 2B5UA 4RO2A 4DXWA 5EBMC 3P30A 4RAIA 2V7QG 2HJFC 3SPCA 5CA3A 2WLNA 1AI4A 4MTXA 2X6CA 3LDCA 3ZN1A 1GM8A 2JIZG 3BEHA 3DGEA 1JOYA 1AJPA 3ZN0A 2A79B 1RPOA 5B1AB 2Q68A 2WAMA 2X6BA 3AG4C 3T4DA 5L3GA 1AI7A 3G71V 3M99B 2X6AA 4MTFA 1KP2A 3TCUA 3SYQA 4GX0A 2EILC 2WLHA 1G8MA 2Y48A 3G6EV 1RM1C 2EBOA 2XAJA 4HYOA 5IYDO 3FKSG 1YJNV 1R6KA 3MHSC 1COWG 3OMNB 1QBZA 2JJ2G 3E2EA 5CBHA 1XL6A 2DYRC 3FB6C 5KA5A 2XAHA 3TK1A 1AI6A 3ZIAG 2OCCC 4PA4A 2UXNA 3SPGA 1VQ8V 2EIJC 1S5HC 1DLBA 1M9NA 5H9CA 3W7UA 2Q6AA 3OEHG 4BW5A 1JVMA 1S76D 2YEVB 4HAMA 4MVOA 2WLKA 1V55C 2IJKA 3IGAC 5IYBO 1R3JC 3ZMUA 3TETA 3X2QC 4X88A 3ZMSA 4WFGA 5CBGA 1MG1A 1WPXA 4UVBA 4JYCA 2M7WA 1WLEA 4QNHB 3K0GA 5BZBA 4GX1A 3FB5C 2K1EA 4FIPC 3LDDA 5CBFA 3QO7A 1VQKV 1G4YB 2UXXA 1OZ0A 5L3EA 3NXSA 4RUEA 1RPRA 3FB7C 3I56V 1J95A 2WLIA 2Y69B 3I55V 2HFEC 3FYEB 1NJIW 3AG3C 1I5YA 1KD1W 1K4DC 3ASOB 4MVUA 1NR7A 4UV9A 4JGSA 5KUKA 1W0KG 5IYCO 3OE7G 4PDVA 2LP7A 1V54B 2DYSB 4KP4A 1P4RA 2OT5A 3K79A 2W6IG 4XBFA 4JTDB 1YSCA 4MW3A 4CZZA 2B1GA 2AHZA 1GO3F 3ABLC 4JAUA 3DTUB 3AG1B 1H38A 1XL4A 1NVPB 4Z1MG 5DN6G 2WLMA 1W2BU 2ZR2A 3IFXA 1M56C 3ZMZA 4JF3A 1ZWIC 1QVFU 3JYCA 1YJWV 2EILB 1GMGA 1S72V 1K5QA 2H94A 3ABUA 2GHYA 2V1DA 3GB7C 3VBBA 3K9AA 1R6NA 3EFFK 2JJ1G 4PELA 1SESA 1H2GA 1CPYA 3UM7A 1FXHA 2HR3A 1OCOB 1N8RW 4PDMA 1V54C 2OCCB 2XAFA 5H6QA 2YEVA 4PA6A 4TWKA 3OGCC 5LGUA 2OTLV 5B1NA 2HVJC 2JEUA 5LGNA 4JAVA 3JD3A 3AG1C 3K04A 1K97A 1V55B 1K33A 2MK3A 3LUTB 3ZRWB 5J9PC 5KUMA 3X2QB 2ITDC 3CPWU 1VQ9V 5GW7A 2XOKG 5DM6V 2IJIA 1NH2D 2OTJV 4JTCB 1YHQV 1P7BA 1LNQA 1JQ0A 3CC2V 1NR1A 5IY5B 1GM7A 2LFSA 4G2KA 4QE7A 1W0JG 4U7NA 4MVRA 1M57B 2ZXWC 3E83A 3ZCCA 1SZTA 1R3IC 1QCEA 1KKDA 1OCOC 5B1BC 5L3BA 3AG3B 4PDRA 3CCMV 1OCZC 3F7YC 4XDKA 2EIKB 1BHAA 4WFHA 2QEXV 3W7XA 2Z3YA 3CP1A 3QNEA 4RUFA 4H37A 1PKXA 2WSSG 3PJSK 4P2ZA 3OAAG 1F4MA 3GWOA 4LP8A 4MVQA 1Q7YW 5LHGA 1Q81W 3B77A 4G28B 3LDEA 3OUSA 1K5SA 3OFNG 1QR8A 3ABLB 4MT8A 4WFAV 4FK5C 3RVZA 2JDIG 3RBZA 3ASNC 4WFFA 3UKMA 2XNDG 3ZRVA 3QO8A 5L3DA 1BMFG 1K7DA 1GTOA 1S0VA 2ZQMA 3ZMTA 4CBCA 1K9MW 1FXKB 2DWDC 5IY5C 3AEIA 5IDJA 1M56B 2EINB 3EHBB 1EZJA 1M57C 5B3SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKI A;  3P32 A;  2C2A A;  3MD0 A;  3A0R A;  4GT1 A;  4BIZ A;  4LC1 A;  5C93 A;  4QPK A;  3D36 A;  2LFS A;  4MT8 A;  5B1N A;  4GCZ A;  4FMT A;  2QM7 A;  4JAS A;  4JYB A;  4U7N A;  3ZCC A;  4JYC A;  2LFR A;  4JAV A;  3ZRV A;  2WWW A;  2FTK A;  4U7O A;  5B1O A;  4I5S A;  2QM8 A;  4KP4 A;  3ZRW B;  4MTX A;  3TK1 A;  4QPJ A;  3NXS A;  3DGE A;  1JOY A;  1F51 A;  4Q20 A;  2P67 A;  3ZRW A;  4JAU A;  4BIU A;  5IDJ A;  3ZRX A;  1IXM A;  4FPP A; 
#chains in the Genus database with same CATH topology
 3CC7 V;  4R8C A;  2VCI A;  1YTF D;  4WBN A;  2EXL A;  1EI1 A;  3E8H A;  2AZ0 A;  4MP2 A;  1N0J A;  3TXS A;  1IDS A;  1VQ4 V;  3SL2 A;  3WHA A;  3E8F A;  3VOU A;  1H7S A;  1XNR B;  3HKE B;  4IIJ A;  1VF7 A;  4OXS A;  1JCH A;  2JEX A;  4BIU A;  3JAM N;  2DQ0 A;  1I5C A;  4MB9 A;  2HJD A;  3TUH A;  2NLJ C;  2YEE A;  1QHT A;  2BTZ A;  1L1F A;  4L90 A;  4ASU G;  4LR3 A;  2A06 H;  2F93 B;  1VQ5 V;  2ATK C;  4H85 A;  4NH8 A;  2QJ1 A;  1M1K W;  4O2B B;  2EIN C;  2ZE6 A;  4DV2 B;  2YIB D;  2QM8 A;  1W59 A;  3QTF A;  2ZR3 A;  3ZHS A;  5EK0 A;  2ZXW B;  2YE6 A;  1N34 B;  1Y6X A;  3T10 A;  3BHP A;  3K06 A;  3OR7 C;  4CWF A;  4AWQ A;  3H9V A;  2GUZ B;  5CTX A;  2CH7 A;  4KUM A;  5FND A;  1OCZ B;  1GRJ A;  3IC7 A;  4X1I B;  1J5E O;  2A3Q A;  1F4N A;  3E86 A;  4UCU A;  3JAS A;  4JI4 O;  1T5E A;  4MS2 A;  2Q7H A;  3VQW A;  3SPI A;  5FNF A;  4J80 A;  2YI8 A;  4DR4 O;  1Y74 B;  4QPJ A;  2YEG A;  3AG2 C;  1VEW A;  2WLL B;  2HEP A;  1AB3 A;  2BSK B;  2JGD B;  1KC8 W;  3SPH A;  2GDS A;  2CK3 G;  4LWF A;  4YHH O;  1E1Q G;  2Q2E B;  2HHH B;  4JI3 B;  4K8X A;  3A0X A;  2P5O A;  2JJC A;  3SGI A;  1QLE C;  3D36 A;  1N32 O;  3K0D A;  2H8P C;  3L75 H;  2P4V A;  4N23 A;  2OIG A;  3D3I A;  2PI4 A;  3EHJ A;  4AHC A;  1AMW A;  2VWK A;  4BQJ A;  3JAL B;  2CTQ A;  3WFV A;  2CH4 A;  1E79 G;  4I50 A;  3H1H H;  1XDC A;  2HG5 C;  3D3Q A;  4HNA A;  4A5U B;  2WA4 A;  2BU8 A;  4GX5 A;  3J81 N;  1U97 A;  4I4T B;  2VWJ A;  4I9W A;  5LA6 B;  3FAV A;  4G27 B;  3ZXO A;  3ABM C;  3VHC A;  4PA9 A;  3TTZ A;  4DR3 O;  3FX7 A;  4O4I A;  3L70 H;  4JZ2 A;  4OPH A;  3HB3 B;  4NTY A;  4AWO A;  2UWD A;  1FJG B;  3WG7 C;  4OPA A;  1EBO A;  1EN5 A;  1F51 A;  2D2C B;  2P67 A;  1VQP V;  1EM1 A;  2JS3 A;  3CEI A;  5IYZ A;  1O9G A;  4NB5 A;  2QFO A;  1HNW B;  4GKK O;  2ZDX A;  1EN4 A;  1K34 A;  3JCZ A;  2XX4 A;  3T2M A;  4MSW C;  2QM4 A;  1MOF A;  3KCX A;  2DQ3 A;  1EFR G;  1X4T A;  4TV9 B;  3RWR D;  3CMA V;  2YK9 A;  3LSS A;  3W7W A;  1JR9 A;  2IM9 A;  2Q4P A;  3K5O A;  3B8M A;  5B1O A;  4EEH A;  1BKN A;  4WCE V;  4F4L A;  1GKF A;  4X9L A;  3F5W C;  5A9G A;  3O6O A;  1XMO O;  1DK1 A;  3SJB C;  4O4L A;  1HDJ A;  2ZE7 A;  1BL8 A;  4DV0 O;  2HG1 A;  3BA9 A;  3BA8 A;  3VQY A;  3T4Z A;  2EIM B;  1UYM A;  1TUB B;  5HFL A;  1IUR A;  2IU0 A;  1TC6 A;  5CMU A;  1NS1 A;  3N2G B;  4ZBM A;  3HKC B;  4RQF A;  4R3A A;  3ZJZ A;  1GKZ A;  4K0K O;  1KMI Z;  3ZMV A;  1H8E G;  2YXL A;  5ITZ B;  1FD9 A;  3S3W A;  1VQM V;  1M90 W;  4I7Z B;  4NYK A;  3MHH C;  4GEE A;  3B8N A;  3MD0 A;  1KZN A;  3K3W A;  5CN0 A;  3Q5K A;  3CCS V;  4X1Y B;  5DED A;  3AG4 B;  4FZ1 A;  3STL C;  2YE2 A;  4XKK A;  5LYJ A;  4DRX B;  3MAQ A;  3JD1 A;  1MSD A;  1QVG U;  1Y66 A;  1UYI A;  1SKV A;  3ASO C;  5CA1 A;  4TT3 G;  5CF0 A;  2WER A;  5JVD B;  3HZ5 A;  4CH6 A;  1CP9 A;  1DF5 A;  3CCQ V;  4I9Q A;  3RFR A;  4FFB A;  2RDC A;  4XCJ A;  2EIJ B;  4NXN B;  1WAZ A;  4DXW A;  3GIE A;  4LWG A;  3JAR B;  4J42 A;  4JQL A;  3CWV A;  2WLN A;  2GTS A;  1ZWH A;  5EYP A;  3B25 A;  1JOY A;  4CWQ A;  3ZN0 A;  2A79 B;  1P49 A;  3T4D A;  1TGO A;  2ZNI A;  3OGI B;  2AXT Z;  4MTF A;  3CX5 F;  3TCU A;  1RM1 C;  3OW6 A;  4IGG A;  1N36 O;  3ZHT A;  5KX5 B;  2XAJ A;  3FKS G;  1U96 A;  1QBZ A;  2F23 A;  2F95 B;  2UXD O;  3ZM7 A;  4PV1 B;  1UYK A;  3CJH A;  2ADQ B;  2XAH A;  3CRC A;  3ICX A;  3U67 A;  4JI7 O;  3TZ2 A;  3TK1 A;  1AI6 A;  2UXC O;  2OCC C;  4LFB B;  2ESA A;  2CH7 B;  5IJ0 A;  3SPG A;  2CE4 A;  2UU9 O;  1WA8 A;  1HNX B;  4HBN A;  4EFU A;  2ZIM A;  5D6P A;  5GTI Z;  4IYH A;  4HZ0 A;  1V55 C;  5JEN A;  2HCH A;  2R9A A;  3QF7 A;  3ZMU A;  4X88 A;  2XJX A;  3SDL A;  1MG1 A;  3ZS8 C;  4B7E A;  2Q9L A;  2IOR A;  3R66 A;  2IBZ H;  1VQK V;  1WJZ A;  3H1L H;  3JAT A;  3INX A;  4HYP A;  5L3E A;  3SJA C;  4V26 A;  4EB6 B;  1RPR A;  4UB8 Z;  3I55 V;  2Y69 B;  5M4N A;  1ZL8 A;  2YEB A;  2HFE C;  4DV5 B;  2IWS A;  2BTQ B;  1EZV H;  1BT8 A;  1B06 A;  2PY5 A;  2LJ2 A;  4B3R B;  4ZOL A;  2NN4 A;  4JGS A;  4Z2W A;  1YER A;  3A0Y A;  4DV1 B;  3EHF A;  1V54 B;  3J80 N;  4LF9 B;  4KTN A;  3K79 A;  2XDU A;  4IHJ B;  3RYH B;  3BAA A;  1YXB A;  4LF6 O;  3DTU B;  2C1G A;  3AG1 B;  2XAB A;  1XL4 A;  4XD8 A;  1NTZ H;  1NHJ A;  3KCY A;  3K5M A;  3T1Y O;  1QYE A;  1Y8O A;  1GN2 A;  4DK0 A;  4YIO A;  3IAY A;  4CWT A;  2OIE A;  1M56 C;  2XHT A;  2KG7 A;  4J10 A;  3ZHU A;  1ZWI C;  1Q43 A;  2YXH A;  3JYC A;  2EIL B;  3A0H Z;  1S72 V;  4V25 A;  4B3T O;  1BSM A;  3EVK A;  1XQ8 A;  3PN1 A;  1VIB A;  1H2G A;  2YDE A;  2Y0I A;  4LWI A;  3JSL A;  1OCO B;  4O05 A;  5F3K A;  3UCS C;  1BS3 A;  4JYA O;  4EGI A;  2YE7 A;  3OGC C;  2ETN A;  3OTO O;  5B1N A;  4LF7 B;  1SF9 A;  4LF5 B;  2KKW A;  1YDX A;  4YJ3 A;  2QKA A;  1R6T A;  4JAV A;  1Z2G A;  5LMN B;  4GKJ B;  1B04 A;  4JI2 O;  5JJN B;  1TA8 A;  2HP8 A;  2YC0 A;  1NI8 A;  4JI1 O;  5IN9 A;  3P3N A;  1Q6H A;  4AIL C;  1Z59 A;  5CTU A;  1I94 B;  4KSH A;  3FV5 A;  4NH7 A;  4URO A;  5JCO C;  5EIB D;  1UY8 A;  4MPE A;  4YKQ A;  3L74 H;  1MZF A;  2ZXW C;  3E83 A;  2WEP A;  3CGZ A;  4X1K B;  1P84 F;  1KKD A;  5L3B A;  2YEA A;  1SQB H;  1OCZ C;  4YY3 O;  3CCM V;  4DR2 O;  4YJ2 B;  1I08 A;  4JV5 O;  1X59 A;  5KHJ A;  4NTX A;  3QNE A;  5LMU B;  1MA1 A;  2YE9 A;  1IBM B;  3OAA G;  4X66 O;  1Y4U A;  1HNZ O;  3LDE A;  3J7A U;  3OFN G;  3ABL B;  4WFA V;  1GKX A;  1OSF A;  2XND G;  2F66 C;  3DXR A;  3QO8 A;  1HP8 A;  1I59 A;  4GLX A;  1UY9 A;  1GTO A;  4CBC A;  3T0Z A;  5JCO A;  5IY5 C;  1XMQ O;  2BSM A;  2GV9 A;  4X20 A;  4ASA A;  1EZJ A;  3JAK A;  1UY6 A;  3LNM B;  4XE2 A;  2YEI A;  1Y8P A;  5JH7 A;  1U0Z A;  5KLV H;  3RW0 A;  4O2A A;  2YI5 A;  2E75 B;  3JD0 A;  4JAS A;  3H1J H;  4X89 A;  1CEZ A;  4ASF A;  2RN9 A;  1NBM G;  3OUF A;  1N4C A;  4J7K A;  4PA3 A;  4I5S A;  1S16 A;  2QR4 A;  2WPD G;  1JPX A;  3H01 A;  4AI8 A;  1IBL B;  3AK1 A;  2E5L O;  3ZRW A;  2PTM A;  2UUB O;  5IT9 N;  3U2K A;  1MAB G;  4TSF G;  4LFC O;  5FNV A;  3CCR V;  2AZ2 A;  1KYO F;  1AR5 A;  4YKX A;  2XJG A;  2HKO A;  4KHP O;  1NHH A;  3EHG A;  3S3X A;  5LHH A;  4B3M B;  4P9O A;  4JI6 O;  4EM7 A;  3GIF A;  2WWW A;  3K5N A;  1AM1 A;  1DTO A;  3CCE V;  3SYP A;  2Q8H A;  2XX5 A;  2R9I A;  4J9Y B;  4DK1 A;  2PF4 E;  1VF6 C;  3T1H B;  2QF6 A;  4W4L A;  4QJF B;  4OX9 O;  1Q6I A;  5B1B B;  4HZ3 A;  2W6J G;  3LNU A;  3ZHR A;  1F23 A;  2QDO A;  4DV7 B;  1H2N A;  3M7M X;  2UUA B;  3C0E A;  2Q0A A;  3WU2 Z;  4DR1 O;  3ABT A;  5EZY A;  3ZX6 A;  5KHI A;  4U7O A;  4QIW F;  2Q7E A;  1FPO A;  2R70 A;  2EIM C;  5LXT A;  4O04 A;  4MW8 A;  3A0B Z;  4LNU B;  3TXQ A;  3K08 A;  2FWY A;  3F7V C;  2VQF B;  4F6E A;  2YS8 A;  5J2T B;  1GJV A;  3MDS A;  1VQ6 V;  1YT1 A;  1VQL V;  4L91 A;  4DV3 B;  3ZBH A;  2LGQ A;  5EC2 C;  4GFN A;  1I5X A;  4FLX A;  5FL7 G;  4JI0 B;  4LFA O;  3UO2 A;  1Q82 W;  1OCR C;  1VF6 A;  1P7G A;  2BOC C;  2GSM B;  4HZ5 A;  2VQE O;  3A2F A;  2Q73 A;  3A0T A;  4JTA B;  3WQ9 A;  4DUY O;  1YVW A;  2B1I A;  3BPZ A;  1BQZ A;  4YXW G;  4DR7 B;  2KSD A;  2IH3 C;  5EBW C;  2XCM A;  3AG7 A;  2ZD9 A;  4HXW A;  2BTO A;  1YIT V;  3CHX A;  4PA7 A;  1BXD A;  2NR5 A;  4UCO A;  3E8G A;  3C3T A;  4RQE A;  2LFR A;  1KIJ A;  4DR6 O;  1SQX H;  1JFF A;  2CTP A;  2D3O W;  4JPR A;  4MTO A;  3U11 A;  4U93 A;  5F5R A;  1FYJ A;  2R9R B;  4EMV A;  2YKC A;  4LH7 A;  3B2E E;  4D6T H;  5M4K A;  1SRY A;  2UUC B;  5D5P A;  2Q8G A;  4E4E A;  3JAW B;  4XC0 A;  4XIQ A;  2Y4U A;  3QG5 A;  3CCJ V;  2E76 B;  4KFG A;  5A2Q N;  1WB7 A;  2WLJ A;  4LF4 B;  2VW5 A;  5KHH A;  2Y4T A;  5D7C A;  4B08 A;  2CTW A;  3MNR P;  2UXB B;  3BVO A;  3VHD A;  3E22 A;  2YXY A;  4ZHQ A;  1SQF A;  4DO2 A;  5KA6 A;  4FLY A;  2ZM6 B;  4FPP A;  3CCU V;  1OCC B;  3R4N A;  4FFK A;  1PP9 H;  3N2K A;  4WF9 V;  1THZ A;  1PL4 A;  2YKI A;  4FMT A;  3U10 A;  4I55 B;  3K57 A;  2L6L A;  4O4J B;  1MSW D;  3GIG A;  3R65 A;  4ASG A;  3CC4 V;  4YKR A;  5L3F A;  2BOB C;  5FPO A;  4FJC C;  1XNR O;  3HHU A;  3ABK B;  1YSR A;  3ZRX A;  2GBO A;  4TV8 A;  3OWB A;  3LNN A;  1Y4S A;  4X8A A;  1TID A;  1AIL A;  1OV9 A;  2Q67 A;  4LPB A;  3C11 A;  4QPK A;  4CWO A;  3RYF B;  4GCZ A;  1PNM A;  4H13 B;  2R72 A;  4WUD A;  1GN3 A;  1QR9 A;  4W4K A;  1L0O A;  2Y69 C;  5CA0 B;  1FS0 G;  1H8H G;  4U3J B;  4DV2 O;  3SJQ C;  1PV0 A;  3VQV A;  3U0Z A;  1BHB A;  2EZO A;  3M8A A;  1U2O A;  4KL1 A;  1SC5 B;  1N34 O;  2YIA A;  3ZKD A;  1ZXM A;  1SQQ H;  5EC1 C;  5BMV B;  4LWS B;  4L8Z A;  1FKA O;  4O4H A;  3P30 A;  5CB4 A;  3SPC A;  4NVP A;  3ZKB A;  1CXZ B;  4ZI7 B;  2ZBK B;  4FCQ A;  3ZN1 A;  2JIZ G;  4K8Z A;  1NT2 B;  2ZE8 A;  4MP7 A;  4L93 A;  2Q68 A;  2PYJ A;  3G71 V;  1QU7 A;  3M99 B;  2X6A A;  3SYQ A;  1Y67 A;  4K3A A;  2EIL C;  1G8M A;  1UYD A;  2VCJ A;  4HYO A;  2XUM A;  2WI5 A;  1ZAU A;  2HHH O;  3HKD A;  1YES A;  1YC4 A;  2DYR C;  5KA5 A;  3FT5 A;  2OYQ A;  4EGK A;  4BIO A;  4F6R B;  2UXN A;  4X64 B;  5M4H A;  5GON B;  1VQ8 V;  1S5H C;  3IED A;  3QTC A;  1UYE A;  4DUZ B;  1JVM A;  2CDY A;  4GT8 A;  2H8M A;  1R3J C;  3WB2 A;  3TET A;  4TUY B;  1YCI A;  5AG2 A;  1WLE A;  5D7R A;  5BZB A;  3FB5 C;  5CBF A;  4FCR A;  5IWA B;  3K59 A;  1I0H A;  4FM1 A;  2YIB A;  3R91 A;  2XD6 A;  3DC5 A;  1L0L H;  3FB7 C;  3I56 V;  1J95 A;  5K1X A;  4KQV A;  2WLI A;  1FJG O;  3ETQ A;  4JZG A;  4BXI A;  1KD1 W;  1K4D C;  4MVU A;  2Y0P A;  1NR7 A;  1UYC A;  5LOV A;  1A32 A;  1HNW O;  3P3P A;  4I0X A;  2QWN B;  5IYC O;  3CYG A;  3TZ0 A;  3H80 A;  3L73 H;  5IE9 A;  2DYS B;  2BU6 A;  3G7B A;  2W6I G;  4XBF A;  3INW A;  4L94 A;  1US7 A;  4CZZ A;  2XHB A;  2YJX A;  2AHZ A;  3ABL C;  2YKB A;  4JAU A;  4TQD A;  4CH4 A;  1S14 A;  5DN6 G;  1W2B U;  5LP6 B;  2ZR2 A;  3IFX A;  4R1F A;  1YEW A;  2YIC A;  2YKE A;  3HYZ A;  3OWD A;  3U2D A;  3ZMZ A;  5JQG A;  3D0B A;  4DV4 B;  1IVS A;  1QVF U;  1URF A;  1GN4 A;  2H94 A;  3ABU A;  2QG0 A;  2GHY A;  3ZXQ A;  3GB7 C;  3VBB A;  5L3J A;  3EFF K;  3EXA A;  2XDK A;  1SES A;  4AWP A;  1FXH A;  2HR3 A;  4WBN B;  2K5B A;  2XAF A;  2YEV A;  1L8D A;  2OTL V;  1TIL A;  1B3Q A;  2K9P A;  4EGH A;  4X9Q A;  4IIJ B;  2L35 A;  3H1K H;  3TGU H;  3JD3 A;  4H81 A;  2ZT9 B;  3K04 A;  5FWK A;  2MK3 A;  3WB0 A;  3RYI A;  3LUT B;  5JJE B;  2YKJ A;  2XOK G;  2YK2 A;  2IOP A;  4KSG A;  1YHQ V;  2UXD B;  1LNQ A;  3CC2 V;  3DC6 A;  2LFS A;  4G2K A;  3UT5 A;  3GIG B;  1W0J G;  2YGE A;  4DUH A;  4U7N A;  1M57 B;  2CG9 A;  4AQY B;  3K60 A;  1R3I C;  4DR5 B;  5KHG A;  5B1B C;  3AG3 B;  3RT3 C;  1UFI A;  2JRI A;  4XDK A;  4P8O A;  3W7X A;  2Z3Y A;  2BU2 A;  1S5J A;  4CH5 A;  4CWN A;  2WSS G;  3HKB A;  4DZY A;  1F4M A;  3GWO A;  4URM A;  3JAS B;  3B77 A;  2YUA A;  4G28 B;  5FPR A;  3R4P A;  2AKP A;  1QR8 A;  4MT8 A;  1SQV H;  2IWU A;  3RVZ A;  4X62 B;  3A8T A;  4WFF A;  1WN7 A;  3ZRV A;  2E3C A;  4B3S B;  3K99 A;  5L3D A;  1R62 A;  3LMM A;  2QTS A;  2WI2 A;  4FM2 A;  1F7Y A;  3CXH F;  3K9S A;  1K9M W;  3OD4 A;  4NXM B;  1NU1 H;  4B7K A;  2HKJ A;  2EIN B;  1I5B A;  4PRX A;  4IL6 Z;  4CH3 A;  2WI1 A;  2KQX A;  1Z5W A;  4LFB O;  3HZ1 A;  1KB9 F;  2C2A A;  2FKX A;  2Q0O C;  3NR7 A;  4LBE C;  1HNX O;  4UV8 A;  5H6R A;  5JJJ B;  1IBK B;  1XHX A;  1Y76 A;  2EIK C;  3AK3 A;  5TIS Z;  1JX9 A;  5BR8 B;  3H4L A;  4HXZ A;  4XDL A;  4I50 B;  3CCV V;  1YZB A;  1BCC H;  3T2S A;  4DV6 B;  1YJ9 V;  1Y4M A;  4HNA B;  3QO5 A;  4GX2 A;  4U3F H;  3C3S A;  1KU9 A;  2ARH A;  1DF4 A;  1UJW B;  4XIP A;  2E0A A;  3FAV B;  1VF5 B;  4XIT A;  5IJ9 A;  2PYL A;  2DWE C;  1NKD A;  1AJQ A;  3R92 A;  4O4I B;  1R3K C;  1FXK C;  4DV5 O;  2Z5U A;  2EJR A;  4B3R O;  1GK9 A;  1PD3 A;  4P30 A;  4O09 A;  5J2U A;  4NKG B;  1Z5A A;  2YI9 A;  1TVK A;  4J7Z A;  1THN A;  3BCC H;  5IYZ B;  2A7W A;  2XAQ A;  2CGF A;  1FFX A;  3LSQ A;  1BE3 H;  1SS3 A;  4DV1 O;  2HLD G;  1JJ2 U;  4LF9 O;  1ORQ C;  2DW4 A;  1IXM A;  2EZP A;  4ZKI A;  3HYY A;  2P7T C;  2XDX A;  3P32 A;  3A0R A;  4GT1 A;  1KP3 A;  2KB1 A;  3RYC A;  1XNQ B;  4MVS A;  2YGA A;  4FLW A;  4JI1 B;  1ZSP A;  4YKW A;  3BY6 A;  3QVN A;  1VQ7 V;  4E02 A;  4O4L B;  1RSO A;  4EKW A;  2XK2 A;  4UB6 Z;  3B28 A;  2XTA A;  4LP0 A;  3K03 A;  3ML0 A;  1ID0 A;  3TZ4 A;  4BQG A;  2CUG A;  3KG2 A;  4MOT A;  1SA0 A;  4CC5 A;  4J9Z B;  5E1A C;  4J11 A;  3FB8 C;  4X65 B;  5M4E A;  4W7T A;  3B26 A;  2IOQ A;  5D5Q A;  4JV5 B;  3ABK C;  3B09 A;  5BOC A;  2HHI A;  4LF7 O;  2IH1 C;  4LF5 O;  2JS5 A;  1WPB A;  4GYC B;  1NHI A;  4X66 B;  5LMN O;  4GKJ O;  4LF8 B;  1FXV A;  3HKE A;  3CRA A;  1AI5 A;  1VQO V;  3RVY A;  5LYJ B;  2F43 G;  1I94 O;  3E35 A;  2Q7G A;  1ZXN A;  5CA1 B;  1XMQ B;  3CYO A;  3OW2 U;  4L87 A;  4WUB A;  4O2B A;  2F1M A;  2JKI A;  1IX9 A;  4ZVI A;  4XDJ A;  1NTM H;  2H3O A;  4QE9 A;  2XT9 A;  1B63 A;  2DJV A;  4FFB B;  2FB5 A;  5BXZ A;  2BRC A;  3F5T A;  1HR0 B;  3DSQ A;  5C8Y A;  1IBM O;  4UCS A;  2GUZ A;  2LGW A;  2N05 A;  2BU7 A;  3CXC U;  3BM9 A;  4X1I A;  1H2K A;  5EYP B;  2ZE5 A;  3E8B A;  2WI7 A;  4H0L B;  5HFM A;  3CME V;  1R73 A;  4GZR B;  5EIB C;  3SYC A;  2VRZ A;  4BR6 A;  4Q20 A;  2ZIN A;  3ZHQ A;  2IJH A;  1Y74 A;  2WLL A;  2JGU A;  3ZHV A;  1UYG A;  2BSK A;  2JGD A;  4LC1 A;  1VQN V;  3CJH B;  4E2L A;  1YC3 A;  1HWY A;  5KMG A;  5KAF Z;  1YI2 V;  4JI8 B;  5IJ0 B;  5BOD A;  2CGO A;  1WA8 B;  3K5L A;  4R7C A;  4UVA A;  2FYU H;  3JD2 A;  1AJN A;  3JAL A;  4H33 A;  1IBL O;  4JI5 B;  4PRV A;  3SYA A;  2XHX A;  1SET A;  3I5D A;  1K8A W;  4FCP A;  2RCV A;  1R1B A;  2QM7 A;  1MU5 A;  4XKO A;  2IU3 A;  2FML A;  2ZNJ A;  3JAT B;  4I4T A;  4N21 A;  1M93 A;  5LA6 A;  2JK5 C;  1FFT B;  3E89 A;  1PNL A;  4WFB V;  1SQG A;  4WFE A;  1RM1 B;  3CSX A;  4B3M O;  1AJ6 A;  1K3E A;  3OR6 C;  1ZL8 B;  1N33 B;  4MTG A;  3CD6 V;  1E1R G;  2WI6 A;  4LCU C;  5J6A A;  4ZOL B;  1RFY A;  3ETD A;  5LBQ A;  3RLQ A;  2DYS C;  4LWE A;  1AR1 B;  4YIP A;  4BIZ A;  3T1H O;  4K4O A;  4RO2 A;  1I7F A;  2VWC A;  1H2L A;  4DV7 O;  3L9D A;  2UUA O;  2DOS A;  4H44 B;  4TV9 A;  1Y8N A;  3LDC A;  2PUS A;  1GM8 A;  3BEH A;  3DGE A;  3FT8 A;  1AJP A;  2PGG A;  2G38 A;  1RPO A;  4D7S A;  5B1A B;  1I5A A;  2WAM A;  3AG4 C;  2ODM A;  2F4V B;  1AI7 A;  3Q4H A;  4IT5 A;  1KP2 A;  2Q8I A;  1KKC A;  1KBH A;  2KG7 B;  4I3H A;  2VQF O;  1WNS A;  5IYD O;  1TUB A;  1R6K A;  4BAE A;  4ZIB A;  3T1K A;  5CBH A;  4DV3 O;  1XL6 A;  3N2G A;  3HKC A;  3ZIA G;  1BQ0 A;  3O2F A;  4PA4 A;  2CCU A;  4JI0 O;  2EIJ C;  5H9C A;  1DLB A;  1XHZ A;  4J41 A;  3RYC B;  2Q6A A;  1S76 D;  2QKC A;  4HAM A;  4Q6G A;  1OJH A;  3KZI Z;  4FZ0 A;  2WLK A;  2IJK A;  4YJ3 B;  4YKU A;  2CCS A;  4FLZ A;  4WFG A;  4DR7 O;  3R4O A;  4UVB A;  4CWR A;  4QNH B;  2ZCE A;  4X1Y A;  1VP7 A;  3LDD A;  4CS4 A;  1O9H A;  4DRX A;  4RUE A;  1BGQ A;  5H5N A;  4HY6 A;  3UO3 A;  4DW0 A;  3FYE B;  3AG3 C;  2Q5Z A;  1I5Y A;  5JVD A;  3FD9 A;  1JMK C;  1ZUQ A;  2UUC O;  4PDV A;  4KP4 A;  1P4R A;  4CE2 A;  3JAR A;  1AP6 A;  4JTD B;  4FM0 A;  1YSC A;  4MW3 A;  2B1G A;  5KAI Z;  3O0I A;  4LF4 O;  1J5E B;  4PU9 A;  2Z0A A;  1BYQ A;  1NVP B;  4JI4 B;  2UXB O;  2WLM A;  3DXR B;  1EN6 A;  2ZM6 O;  3CRR A;  2QSA A;  3N27 A;  1UYF A;  1WB8 A;  5K1P A;  5FLX N;  4DR4 B;  1YC1 A;  1UPG A;  4JF3 A;  1Q6U A;  4RWU A;  3D36 C;  1ZX3 A;  5KX5 A;  1YJW V;  1GMG A;  1WP8 A;  4X20 B;  4YHH B;  2P4K A;  3JAK B;  4PEL A;  3HEK A;  1CPY A;  5C8Y B;  5JH7 B;  3UM7 A;  1N32 B;  2O1W A;  4O2A B;  4TOI A;  2CGN A;  2YI0 A;  4PDM A;  1V54 C;  5H6Q A;  3PEJ A;  5LGU A;  2YE4 A;  5LGN A;  2DMX A;  3AG1 C;  4QGP A;  1SZX A;  1K33 A;  2AW9 A;  1YT0 A;  4WUC A;  3ZRW B;  5KUM A;  3X2Q B;  3VQX A;  3CPW U;  2BU5 A;  5B5E Z;  3D2R A;  2XDL A;  5FNV B;  5DM6 V;  1IZ3 A;  4NR1 A;  4XDM A;  1QQC A;  4UCV A;  2OTJ V;  4XTJ A;  3VAD A;  4HY1 A;  5KMG B;  2CTR A;  1PM9 A;  4EB6 A;  4DR3 B;  2YEF A;  1JQ0 A;  5IY5 B;  1GM7 A;  4QE7 A;  3CGY A;  2YE5 A;  4MVR A;  3ZCC A;  2BTQ A;  2BZ5 A;  4JI3 O;  1TC0 A;  3FFQ A;  1OCO C;  3A0W A;  4PDR A;  2DN9 A;  3F7Y C;  2QWO B;  4YKZ A;  4P7A A;  4GUN A;  1BHA A;  3AK2 A;  2YI7 A;  4WFH A;  4GKK B;  3GVM A;  3CP1 A;  4H37 A;  1DGS A;  3JCU Z;  4IHJ A;  3RYH A;  3O9O A;  4P2Z A;  4LP8 A;  4DW1 A;  5LHG A;  1Q81 W;  5EZY B;  5M4P A;  5M4M A;  2B9Z A;  1V9P A;  3RLR A;  1K5S A;  5GTH Z;  1A4H A;  2XDS A;  1I5D A;  3NMQ A;  4CS3 A;  2JDI G;  3B40 A;  4FLV A;  5LXT B;  3SJC C;  3UKM A;  1XMO B;  4EFE A;  4UCR A;  4DV0 B;  2OCH A;  2ZQM A;  3ZMT A;  5DEC A;  2C1I A;  1GN6 A;  2DWD C;  1Z5C A;  3AEI A;  5IDJ A;  2WI4 A;  5LL6 Y;  2Q69 A;  1OHH G;  3RKZ A;  2ZKO A;  4X64 O;  2MW2 B;  2W0F C;  4MVZ A;  1ENV A;  1K4C C;  1JJO A;  4DUZ O;  4TQF A;  4K0K B;  1S77 D;  1XI1 A;  4PD4 F;  4CWP A;  4MVM A;  4UCT A;  2E74 B;  3Q4H B;  2AHY A;  3OPD A;  4UVC A;  5LGT A;  2O1U A;  2RMK B;  5E79 Z;  5IWA O;  2QKS A;  4AS9 A;  2YED A;  3JD4 A;  1EA6 A;  3R4M A;  5C93 A;  3K97 A;  3O65 A;  3ETG A;  3G4S V;  3EKO A;  4IYI A;  1KQS U;  1JFF B;  2IJJ A;  2ILM A;  1LUW A;  4XKA A;  1YIJ V;  1TBW A;  4R6Z A;  1YF2 A;  2N74 A;  2PI5 A;  1AP5 A;  2GFD A;  4X1K A;  3RLP A;  2ZDY A;  1K92 A;  5JWP A;  3KKY A;  2BE3 A;  4YJ2 A;  1OCR B;  2O1V A;  2QG2 A;  4BAY A;  1YET A;  2P6J A;  2BRE A;  5FNC A;  1ARO P;  2QWR B;  1NQT A;  2XAS A;  3W7T A;  2P06 A;  5L3C A;  4JYY A;  4MPC A;  3E22 B;  4ZHQ B;  2YSU B;  4XCL A;  3OTF A;  1Z5B A;  1MNG A;  1TUE B;  4DV4 O;  3ASN B;  1BGY H;  3N2K B;  3SR2 C;  5F2V O;  2ZIO A;  1PNK A;  3HPL C;  3T1C A;  2QA4 V;  1N36 B;  3EHH A;  2BYH A;  4FVM A;  2LW7 A;  2X7R B;  4PDL A;  4BW9 A;  1AH8 A;  1PPJ H;  1B6Q A;  3BRC A;  3W7S A;  4JI7 B;  3CWB H;  1QNM A;  4GQT A;  1Q90 D;  2UXC B;  1VMG A;  2ZDI C;  5B3S B;  5GGZ A;  1B62 A;  1LUV A;  2ZKJ A;  3B24 A;  2JVD A;  2UU9 B;  4NXN O;  3OEE G;  2QWQ B;  2XX2 A;  3JZ3 A;  2IW5 A;  4TV8 B;  1XEQ A;  4B7P A;  2X0L A;  4FLT A;  2OWO A;  1NH2 B;  1ROP A;  2FTK A;  4P9P A;  5J71 A;  3SYO A;  3OMA B;  2RJZ A;  1S3J A;  3CE2 A;  1SER A;  2GTA A;  3WB1 A;  3K98 A;  1XOU A;  2ITC C;  4J7J A;  2A0L A;  2NNU A;  3UQ8 A;  4AQY O;  3ETE A;  2YID A;  4DR5 O;  4L8J A;  1UYH A;  2RQ6 A;  5LHI A;  3HR0 A;  2ZDI A;  4O4H B;  3BAB A;  1XBL A;  1UY7 A;  5CB4 B;  4PL9 A;  1UYL A;  1M4U A;  3JSN A;  1QLN A;  4PI0 A;  4EFB A;  3CRL A;  3FYI B;  4UUJ C;  5B1A C;  4LF6 B;  1PL0 A;  2HVK C;  1JA8 A;  1D2D A;  5EBL C;  4X62 O;  4B3S O;  2P22 C;  3OMI B;  1YSZ A;  1K73 W;  1R3L C;  2P90 A;  3T1Y B;  4E00 A;  4GGL A;  3ZRS A;  4LNU A;  4NXM O;  3Q5J A;  1NVP D;  4O07 A;  4YKY A;  1ZTE A;  1YTF B;  4CWS A;  3HKD B;  3AG2 B;  4NTW A;  5J2T A;  2Q8V A;  4JYB A;  4UXN A;  4LWH A;  1US6 A;  4B3T B;  4CS2 A;  1IBK O;  2YEH A;  1G6U A;  1KEC A;  2QE7 G;  3CRQ A;  3CCL V;  4R50 A;  1QLE B;  1GM9 A;  2FWZ A;  5BR8 O;  4JYA B;  1H7U A;  2YE8 A;  2QTO A;  3SPJ A;  4DV6 O;  3OTO B;  2VS0 A;  2EUL A;  2PZS A;  3APQ A;  1Q86 W;  3THO A;  4JI2 B;  4HYM A;  1TAE A;  1FAF A;  3CRM A;  4KFM A;  3STZ C;  1Q3E A;  4B6C A;  4K35 A;  1OCC C;  2A9H A;  1MX0 A;  2XAG A;  2WLI B;  1SQP H;  4Z1V A;  3ABM B;  1H2S B;  4URL A;  1L0N H;  2DYR B;  1FXK A;  5LOV B;  4I0X B;  3BMY A;  3WG7 B;  3K58 A;  3OM3 B;  1RP3 B;  2B5U A;  4ABM A;  1Q5O A;  2CCT A;  3APO A;  4YY3 B;  5EBM C;  4RAI A;  4DR2 B;  2V7Q G;  5H2F Z;  2HJF C;  1XNQ O;  3JAW A;  1VAR A;  5CA3 A;  1AI4 A;  4MTX A;  2X6C A;  3OT7 A;  5BY1 A;  2M6Y A;  1YS3 A;  3PEH A;  3IJ4 A;  1HNZ B;  1AR4 A;  2X6B A;  4NH9 A;  5L3G A;  3CRK A;  4ASB A;  3G6B A;  4KXR A;  4GX0 A;  2YGF A;  2WLH A;  2Y48 A;  3G6E V;  5JQG B;  2EBO A;  4CE1 A;  4X65 O;  1YJN V;  3MHS C;  4C7U A;  1COW G;  3OMN B;  3B27 A;  2JJ2 G;  3E2E A;  4JAA A;  5D6Q A;  4CE3 A;  3FB6 C;  1AH6 A;  2LQT A;  4I55 A;  3A0Z A;  4O4J A;  1LR1 A;  2WI3 A;  4PI2 A;  1M9N A;  3LSU A;  3W7U A;  1S5L Z;  3OEH G;  4BW5 A;  2FL4 A;  2YEV B;  1GAX A;  5CTY A;  3ZED A;  3RGB A;  4MVO A;  3IGA C;  5IYB O;  4YKT A;  2LO1 A;  4LF8 O;  2CAZ C;  3X2Q C;  3ZMS A;  3S5T A;  3OMU A;  5CBG A;  5LMU O;  3RYI B;  1WPX A;  4JYC A;  2M7W A;  3K0G A;  4GX1 A;  2K1E A;  4FIP C;  3RYF A;  5CPH A;  2E5L B;  1Q8I A;  2BYI A;  3QO7 A;  2UUB B;  2YI6 A;  1G4Y B;  2UXX A;  1OZ0 A;  3NXS A;  2RNB A;  4LFC B;  2LW1 A;  3TZ5 A;  2QGN A;  5CA0 A;  4URN A;  4KHP B;  4U3J A;  3UT5 B;  5B66 Z;  1NJI W;  3KE6 A;  2PNR A;  4JI6 B;  1AVM A;  2IWX A;  3ASO B;  1Z5V A;  4H7Q A;  4UV9 A;  5KUK A;  2XHR A;  1W0K G;  2FYP A;  3OE7 G;  1HR0 O;  5IDM A;  3C90 A;  2LP7 A;  5BMV A;  4LWS A;  4OGQ B;  2OT5 A;  3H1I H;  3HKB B;  4OX9 B;  1GO3 F;  3RN4 A;  4ZI7 A;  3G80 A;  4MBC A;  2BT0 A;  1H38 A;  1WP7 A;  2ADP A;  2FXS A;  4DR1 B;  4Z1M G;  2EJ7 A;  3IC9 A;  5CTW A;  3LPS A;  1I58 A;  3TJT A;  1JM6 A;  1QY8 A;  2V4D A;  1ZW9 A;  3VHA A;  4MPN A;  4E72 A;  1K5Q A;  1M5I A;  2V1D A;  4JI8 O;  3K9A A;  2YE3 A;  1R6N A;  2JJ1 G;  4DYL A;  3B4S A;  4F6R A;  2N04 A;  1HW7 A;  2O57 A;  1Y76 B;  5GON A;  1N8R W;  4PJ0 Z;  2OCC B;  1G1X B;  4PA6 A;  4TWK A;  4LFA B;  1MMM A;  4R3M A;  1D5A A;  4JI5 O;  2HVJ C;  2JEU A;  1ZLZ A;  2VQE B;  4TUY A;  1NZ6 A;  4BWA A;  1K97 A;  1V55 B;  1BZK A;  3L71 H;  2DE0 X;  4DUY B;  5J9P C;  2ITD C;  2YEC A;  3D8C A;  1VQ9 V;  3G7E A;  5LP6 C;  5GW7 A;  5IJ9 B;  2IJI A;  3T0H A;  1TH8 A;  1QZR A;  4EEQ A;  1GH6 A;  1NH2 D;  1XRE A;  1MZE A;  4JTC B;  1N33 O;  1P7B A;  4DR6 B;  1NR1 A;  5KHK A;  1H2M A;  2YJW A;  1YT2 A;  5J2U B;  3BFR A;  3QDD A;  2W0X A;  1TVK B;  3CB2 A;  4CC6 A;  1FFX B;  1SZT A;  3Q5L A;  1QCE A;  2Q8F A;  5D7D A;  4LH6 A;  4FLU A;  4PHZ A;  1XUQ A;  2EIK B;  1XIL A;  2QEX V;  4RUF A;  4ICG A;  1PKX A;  3PJS K;  1Q7Y W;  3CS5 A;  4MVQ A;  1KUQ A;  5ITZ A;  4O0B A;  2BCC H;  3GWK C;  1N0N A;  2XJJ A;  4UFZ A;  1RSO B;  3OUS A;  2H55 A;  1D5N A;  2F4V O;  4FK5 C;  2QWP B;  3RBZ A;  3ASN C;  5LP6 A;  1IXB A;  4E01 A;  2EX3 A;  4XIR A;  3G75 A;  1SA0 B;  1PVG A;  1BMF G;  1NTK H;  1K7D A;  2WA3 A;  3G67 A;  2WEQ A;  1S0V A;  1FXK B;  3L72 H;  3EKR A;  2GQP A;  4EFT A;  4D7T A;  2AGA A;  1M56 B;  2YEJ A;  3EHB B;  1M57 C;  5B3S C; 
#chains in the Genus database with same CATH homology
 2Q69 A;  1OHH G;  3CC7 V;  4R8C A;  3LNM B;  2W0F C;  2C2A A;  4MVZ A;  1ENV A;  4LBE C;  1K4C C;  4UV8 A;  5H6R A;  1YTF D;  3RW0 A;  3JD0 A;  4JAS A;  2EIK C;  4X89 A;  3E8H A;  1CEZ A;  1S77 D;  1JX9 A;  1NBM G;  3OUF A;  1VQ4 V;  3E8F A;  4XDL A;  4PA3 A;  4I5S A;  3VOU A;  3CCV V;  4MVM A;  2WPD G;  1JPX A;  3H01 A;  2AHY A;  4OXS A;  1Y4M A;  1YJ9 V;  3QO5 A;  4GX2 A;  1JCH A;  2JEX A;  4UVC A;  4BIU A;  1DF4 A;  2DQ0 A;  3ZRW A;  5LGT A;  1UJW B;  1MAB G;  2QKS A;  2NLJ C;  4TSF G;  3CCR V;  3JD4 A;  2DWE C;  1NKD A;  1L1F A;  5C93 A;  4ASU G;  1AJQ A;  2HKO A;  3G4S V;  3ETG A;  1R3K C;  1VQ5 V;  5LHH A;  2ATK C;  1KQS U;  1FXK C;  2IJJ A;  1M1K W;  2Z5U A;  4P9O A;  2EIN C;  2EJR A;  1GK9 A;  2WWW A;  1PD3 A;  1YIJ V;  4P30 A;  2QM8 A;  4R6Z A;  2PI5 A;  1DTO A;  3CCE V;  2XAQ A;  3LSQ A;  2ZR3 A;  3SYP A;  2HLD G;  2R9I A;  5EK0 A;  1JJ2 U;  2ZXW B;  4J9Y B;  1K92 A;  1ORQ C;  2DW4 A;  3K06 A;  3OR7 C;  1IXM A;  1OCR B;  4QJF B;  2EZP A;  4ZKI A;  2P7T C;  5B1B B;  4HZ3 A;  2P6J A;  2W6J G;  3P32 A;  4BAY A;  4KUM A;  1ARO P;  1OCZ B;  1F23 A;  3A0R A;  4GT1 A;  3IC7 A;  1KP3 A;  2KB1 A;  4MVS A;  1F4N A;  3E86 A;  1NQT A;  2XAS A;  3ABT A;  3W7T A;  3BY6 A;  4MS2 A;  1VQ7 V;  5L3C A;  4EKW A;  4U7O A;  3SPI A;  4QIW F;  3K03 A;  3ML0 A;  2YSU B;  2EIM C;  4MW8 A;  3KG2 A;  4QPJ A;  3AG2 C;  1TUE B;  3ASN B;  2WLL B;  3K08 A;  1PNK A;  1KC8 W;  3F7V C;  3HPL C;  4J9Z B;  3SPH A;  3T1C A;  5E1A C;  2QA4 V;  2CK3 G;  3FB8 C;  1VQ6 V;  1E1Q G;  2X7R B;  4PDL A;  1VQL V;  1QLE C;  3D36 A;  3K0D A;  2H8P C;  5EC2 C;  1B6Q A;  3W7S A;  1I5X A;  2ZDI C;  5B3S B;  4N23 A;  3ABK C;  3D3I A;  2PI4 A;  5FL7 G;  1Q82 W;  1OCR C;  2IH1 C;  3OEE G;  2BOC C;  2GSM B;  2IW5 A;  3WFV A;  4JTA B;  1E79 G;  2X0L A;  1FXV A;  2HG5 C;  1NH2 B;  2B1I A;  2FTK A;  1ROP A;  4YXW G;  1AI5 A;  2IH3 C;  4P9P A;  1VQO V;  4GX5 A;  3SYO A;  3RVY A;  5EBW C;  2F43 G;  3E35 A;  2ZD9 A;  3OMA B;  4I9W A;  1YIT V;  4PA7 A;  1S3J A;  4G27 B;  3ABM C;  3E8G A;  1SER A;  4PA9 A;  4RQE A;  2LFR A;  3CYO A;  3OW2 U;  4L87 A;  3HB3 B;  2ITC C;  2D3O W;  2A0L A;  2NNU A;  3ETE A;  3WG7 C;  1EBO A;  1F51 A;  4JPR A;  4MTO A;  2P67 A;  1VQP V;  4XDJ A;  4QE9 A;  5LHI A;  2R9R B;  2ZDI A;  1SRY A;  1K34 A;  3JCZ A;  3T2M A;  4MSW C;  1MOF A;  2DQ3 A;  1EFR G;  1QLN A;  3FYI B;  4UUJ C;  5B1A C;  3CXC U;  3CMA V;  3LSS A;  3CCJ V;  3W7W A;  1PL0 A;  3B8M A;  2HVK C;  5B1O A;  3E8B A;  4WCE V;  2WLJ A;  5HFM A;  4F4L A;  1GKF A;  5EBL C;  3F5W C;  3CME V;  1R73 A;  3SYC A;  3OMI B;  1K73 W;  1R3L C;  1BL8 A;  2P90 A;  4Q20 A;  3ZRS A;  4DO2 A;  5KA6 A;  2IJH A;  4FPP A;  3T4Z A;  3CCU V;  1OCC B;  2WLL A;  2EIM B;  1NVP D;  4WF9 V;  5HFL A;  4LC1 A;  1THZ A;  1YTF B;  1VQN V;  2IU0 A;  3AG2 B;  5CMU A;  4E2L A;  1HWY A;  4FMT A;  4JYB A;  4UXN A;  4ZBM A;  4RQF A;  1YI2 V;  3ZJZ A;  1KEC A;  1MSW D;  2QE7 G;  3R65 A;  3CCL V;  3ZMV A;  1H8E G;  4R50 A;  1QLE B;  1GM9 A;  3CC4 V;  5L3F A;  4R7C A;  4UVA A;  2BOB C;  2QTO A;  4FJC C;  3SPJ A;  1VQM V;  1M90 W;  3ABK B;  3ZRX A;  3JD2 A;  1AJN A;  4H33 A;  3MHH C;  3B8N A;  3MD0 A;  4X8A A;  3SYA A;  3K3W A;  5CN0 A;  1SET A;  1K8A W;  1Q86 W;  2Q67 A;  4QPK A;  3CCS V;  4GCZ A;  1PNM A;  2QM7 A;  3AG4 B;  3STL C;  2IU3 A;  1QR9 A;  4KFM A;  4N21 A;  3STZ C;  2JK5 C;  2Y69 C;  1FFT B;  3E89 A;  1PNL A;  3JD1 A;  4WFB V;  1OCC C;  4WFE A;  1RM1 B;  1Y66 A;  2A9H A;  1FS0 G;  1QVG U;  1H8H G;  2XAG A;  3ASO C;  1K3E A;  2WLI B;  3OR6 C;  4TT3 G;  3SJQ C;  4MTG A;  3ABM B;  3CD6 V;  1E1R G;  4LCU C;  1BHB A;  2EZO A;  2DYR B;  3ETD A;  5LBQ A;  1CP9 A;  1DF5 A;  1FXK A;  2DYS C;  3CCQ V;  1AR1 B;  4BIZ A;  3WG7 B;  3OM3 B;  2EIJ B;  5EC1 C;  2B5U A;  4RO2 A;  4DXW A;  5EBM C;  3P30 A;  4RAI A;  2V7Q G;  2HJF C;  3SPC A;  5CA3 A;  2WLN A;  1AI4 A;  4MTX A;  2X6C A;  3LDC A;  3ZN1 A;  1GM8 A;  2JIZ G;  3BEH A;  3DGE A;  1JOY A;  1AJP A;  3ZN0 A;  2A79 B;  1RPO A;  5B1A B;  2Q68 A;  2WAM A;  2X6B A;  3AG4 C;  3T4D A;  5L3G A;  1AI7 A;  3G71 V;  3M99 B;  2X6A A;  4MTF A;  1KP2 A;  3TCU A;  3SYQ A;  4GX0 A;  2EIL C;  2WLH A;  1G8M A;  2Y48 A;  3G6E V;  1RM1 C;  2EBO A;  2XAJ A;  4HYO A;  5IYD O;  3FKS G;  1YJN V;  1R6K A;  3MHS C;  1COW G;  3OMN B;  1QBZ A;  2JJ2 G;  3E2E A;  5CBH A;  1XL6 A;  2DYR C;  3FB6 C;  5KA5 A;  2XAH A;  3TK1 A;  1AI6 A;  3ZIA G;  2OCC C;  4PA4 A;  2UXN A;  3SPG A;  1VQ8 V;  2EIJ C;  1S5H C;  1DLB A;  1M9N A;  5H9C A;  3W7U A;  2Q6A A;  3OEH G;  4BW5 A;  1JVM A;  1S76 D;  2YEV B;  4HAM A;  4MVO A;  2WLK A;  1V55 C;  2IJK A;  3IGA C;  5IYB O;  1R3J C;  3ZMU A;  3TET A;  3X2Q C;  4X88 A;  3ZMS A;  4WFG A;  5CBG A;  1MG1 A;  1WPX A;  4UVB A;  4JYC A;  2M7W A;  1WLE A;  4QNH B;  3K0G A;  5BZB A;  4GX1 A;  3FB5 C;  2K1E A;  4FIP C;  3LDD A;  5CBF A;  3QO7 A;  1VQK V;  1G4Y B;  2UXX A;  1OZ0 A;  5L3E A;  3NXS A;  4RUE A;  1RPR A;  3FB7 C;  3I56 V;  1J95 A;  2WLI A;  2Y69 B;  3I55 V;  2HFE C;  3FYE B;  1NJI W;  3AG3 C;  1I5Y A;  1KD1 W;  1K4D C;  3ASO B;  4MVU A;  1NR7 A;  4UV9 A;  4JGS A;  5KUK A;  1W0K G;  5IYC O;  3OE7 G;  4PDV A;  2LP7 A;  1V54 B;  2DYS B;  4KP4 A;  1P4R A;  2OT5 A;  3K79 A;  2W6I G;  4XBF A;  4JTD B;  1YSC A;  4MW3 A;  4CZZ A;  2B1G A;  2AHZ A;  1GO3 F;  3ABL C;  4JAU A;  3DTU B;  3AG1 B;  1H38 A;  1XL4 A;  1NVP B;  4Z1M G;  5DN6 G;  2WLM A;  1W2B U;  2ZR2 A;  3IFX A;  1M56 C;  3ZMZ A;  4JF3 A;  1ZWI C;  1QVF U;  3JYC A;  1YJW V;  2EIL B;  1GMG A;  1S72 V;  1K5Q A;  2H94 A;  3ABU A;  2GHY A;  2V1D A;  3GB7 C;  3VBB A;  3K9A A;  1R6N A;  3EFF K;  2JJ1 G;  4PEL A;  1SES A;  1H2G A;  1CPY A;  3UM7 A;  1FXH A;  2HR3 A;  1OCO B;  1N8R W;  4PDM A;  1V54 C;  2OCC B;  2XAF A;  5H6Q A;  2YEV A;  4PA6 A;  4TWK A;  3OGC C;  5LGU A;  2OTL V;  5B1N A;  2HVJ C;  2JEU A;  5LGN A;  4JAV A;  3JD3 A;  3AG1 C;  3K04 A;  1K97 A;  1V55 B;  1K33 A;  2MK3 A;  3LUT B;  3ZRW B;  5J9P C;  5KUM A;  3X2Q B;  2ITD C;  3CPW U;  1VQ9 V;  5GW7 A;  2XOK G;  5DM6 V;  2IJI A;  1NH2 D;  2OTJ V;  4JTC B;  1YHQ V;  1P7B A;  1LNQ A;  1JQ0 A;  3CC2 V;  1NR1 A;  5IY5 B;  1GM7 A;  2LFS A;  4G2K A;  4QE7 A;  1W0J G;  4U7N A;  4MVR A;  1M57 B;  2ZXW C;  3E83 A;  3ZCC A;  1SZT A;  1R3I C;  1QCE A;  1KKD A;  1OCO C;  5B1B C;  5L3B A;  3AG3 B;  4PDR A;  3CCM V;  1OCZ C;  3F7Y C;  4XDK A;  2EIK B;  1BHA A;  4WFH A;  2QEX V;  3W7X A;  2Z3Y A;  3CP1 A;  3QNE A;  4RUF A;  4H37 A;  1PKX A;  2WSS G;  3PJS K;  4P2Z A;  3OAA G;  1F4M A;  3GWO A;  4LP8 A;  4MVQ A;  1Q7Y W;  5LHG A;  1Q81 W;  3B77 A;  4G28 B;  3LDE A;  3OUS A;  1K5S A;  3OFN G;  1QR8 A;  3ABL B;  4MT8 A;  4WFA V;  4FK5 C;  3RVZ A;  2JDI G;  3RBZ A;  3ASN C;  4WFF A;  3UKM A;  2XND G;  3ZRV A;  3QO8 A;  5L3D A;  1BMF G;  1K7D A;  1GTO A;  1S0V A;  2ZQM A;  3ZMT A;  4CBC A;  1K9M W;  1FXK B;  2DWD C;  5IY5 C;  3AEI A;  5IDJ A;  1M56 B;  2EIN B;  3EHB B;  1EZJ A;  1M57 C;  5B3S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...