2FTKA

Berylloflouride spo0f complex with spo0b
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
181
structure length
181
Chain Sequence
b'ISDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEITSHECLIEIGLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation initiation phosphotransferase B
publication title The Crystal Structure of Beryllofluoride Spo0F in Complex with the Phosphotransferase Spo0B Represents a Phosphotransfer Pretransition State.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 68
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature ec 2.7.-.-:
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14682 SPOB_ab Sporulation initiation phospho-transferase B, C-terminal
A PF14689 SPOB_a Sensor_kinase_SpoOB-type, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ftkA01
3.30.565.30 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Sporulation initiation phosphotransferase B (SpoOB), C-terminal domain 2ftkA02
2LFRA 4JYBA 2QM7A 4GT1A 2QM8A 3MD0A 1IXMA 4JAUA 4ZKIA 2P67A 3TK1A 2FTKA 3ZRVA 3ZRXA 4FMTA 1F51A 4BIUA 2C2AA 4JAVA 5B1OA 4JASA 4QPKA 4U7NA 4GCZA 3D36A 4KP4A 3ZRWA 4LC1A 4U7OA 1JOYA 5IDJA 3A0RA 3ZCCA 4FPPA 4I5SA 3NXSA 4JYCA 2WWWA 5B1NA 4MTXA 3ZRWB 4BIZA 4QPJA 3P32A 2LFSA 4Q20A 3DGEA 4MT8A 5C93A
chains in the Genus database with same CATH superfamily
4Z1MG 2GQPA 1N4CA 4NB5A 3EKOA 2Q5ZA 2C2AA 4DRXA 2CGFA 5CA1A 4LP8A 2F43G 3BM9A 3K57A 1OZ0A 4LF4B 1JFFA 4WFBV 1X4TA 1P84F 4JI7B 1SQVH 2QKCA 3FB5C 2M6YA 4RQFA 2IJIA 2E75B 4O2BA 3C0EA 1M57C 5CPHA 3RYIA 5FLXN 3LSSA 2YE8A 4GKKO 4AQYO 1ZWHA 4LF6B 1QR8A 2VCJA 2YE7A 4MVUA 4DR2B 3OR6C 2FWYA 5B66Z 4IGGA 5E1AC 2F93B 1QR9A 3ZHVA 1QLEC 4FLTA 1MZFA 5JJEB 4PA9A 3RKZA 2XHBA 2XT9A 1Q43A 4TV9B 3JASA 3E22A 4AI8A 1IDSA 1A32A 4GT1A 5L3JA 3ETGA 2YE2A 2KQXA 4YJ2A 3D8CA 1AJPA 4BAEA 1M56B 1GRJA 2FYUH 4E01A 4DRXB 4E02A 4J9ZB 1JOYA 3K60A 5HFLA 4LFAO 1EI1A 2YEBA 1Y74A 5CF0A 2DYRC 2YKIA 2OTLV 3HEKA 1FXHA 1JFFB 5F5RA 4JV5O 4RO2A 1UY6A 1XI1A 3CGZA 3QF7A 2H3OA 5J6AA 2BU6A 3TZ0A 3RYFA 1QQCA 2JEXA 1TBWA 2YK2A 1M93A 2A0LA 3T0HA 1B06A 1NTKH 5BODA 1Y4MA 2YICA 1WB7A 3JCUZ 3GIFA 2HKOA 2WLHA 3ZRWA 1G6UA 3BABA 4DUYO 4TUYB 4GKKB 4L91A 4AQYB 1HNWO 4P9PA 1BGQA 1WAZA 1YC3A 3MAQA 4LF5O 3TXQA 2IM9A 2XJGA 3CMEV 1S5HC 4L90A 3DXRB 1DF5A 5IY5B 2UUCO 3JASB 1IXMA 4PI0A 2VW5A 1IBLO 5LA6A 1BQZA 4H33A 3SL2A 4B7EA 1EZJA 3O2FA 4QE9A 4YJ2B 2N74A 1SZXA 1UYGA 5E79Z 4HXWA 1Q81W 2Y0IA 4LNUB 1Y74B 4CE1A 1RPOA 3K9AA 4LFAB 3PEHA 4KUMA 1KUQA 4FIPC 1VEWA 2Y69B 1TUEB 4JV5B 1AH6A 1PL0A 2ZIMA 1L1FA 3LNMB 1Q8IA 1SERA 2ITCC 2JS5A 3ZHQA 2UXCO 2VCIA 4CC6A 3CPWU 1KB9F 1VQ6V 4URLA 1XDCA 2YKCA 2R72A 2UXXA 4UB6Z 4XIRA 5IYZA 1I59A 4QPJA 3HKEA 3JAMN 1K9MW 4HY6A 4L93A 3WFVA 1US6A 1HNWB 4K0KO 4NH8A 3T1YO 4LWIA 3CWBH 1GKFA 4LF5B 4OPHA 3OE7G 2K5BA 3TZ5A 5K1XA 3EHBB 1ROPA 3HKDA 5LA6B 1V54B 2XDKA 5TISZ 1NR7A 4PV1B 2UUCB 1S16A 3IFXA 3QVNA 5FNVB 1IBLB 4JI3O 4QIWF 2X6CA 4MP7A 3ETEA 2AZ2A 2H55A 5BY1A 2YI8A 3E8FA 2WLLA 1QBZA 3B25A 1OCOC 1G1XB 4O2AB 1Q3EA 5EIBC 2B5UA 3J7AU 1IVSA 2QWOB 4H7QA 2QTOA 1Q6IA 3CCUV 1R1BA 2ATKC 2YSUB 4G28B 1VP7A 1QY8A 5EC2C 1Q86W 1AILA 3CB2A 1GMGA 5D7CA 3A8TA 3ASNB 1YDXA 2CG9A 4E00A 4XKAA 3T4DA 2UXCB 3UO3A 2VWKA 3L72H 1BSMA 1BCCH 3U11A 4J80A 2E0AA 5IYZB 4NH7A 2K1EA 3LNNA 4XKKA 3SYOA 3H4LA 3K0DA 2GHYA 4XDKA 5M4PA 3T2SA 2R9RB 4BR6A 1KMIZ 3JSNA 1VQ9V 2YI6A 3A0BZ 5ITZA 4K0KB 3T1YB 4UCSA 2BZ5A 2Q67A 1V55B 1UPGA 2WLNA 1EN4A 3HKDB 1YTFD 1K73W 1N32O 3UO2A 4WFEA 5C8YA 1YTFB 1BE3H 4JI3B 5KUKA 2QF6A 1RP3B 4DW1A 2IWSA 2H8PC 1VARA 4LF9B 3OGIB 2WLLB 3H1HH 1AVMA 1YZBA 4X1KA 2X6AA 2Q9LA 2LO1A 2FTKA 2WA4A 1WNSA 3ZMTA 3L71H 2ILMA 2LQTA 2QKSA 4FM1A 3HKCA 3K06A 3UT5B 3I5DA 4FLZA 1RM1B 5K1PA 2OTJV 1VQ8V 1Z5BA 1UYKA 3HKBA 1YERA 2BOCC 2ZD9A 1AB3A 4XIPA 4JI5O 2HHHO 4DV2O 5KHGA 2FWZA 1YC1A 4GCZA 2YK9A 5ITZB 4DO2A 3BRCA 2IWUA 2V1DA 4CWQA 1Z5VA 3CEIA 4NTXA 1QNMA 2XASA 2WEQA 4AS9A 4HYOA 3OMNB 5KUMA 4XCJA 1JJ2U 2AKPA 2HG1A 1N32B 2LFRA 2AZ0A 3B26A 1D2DA 4CE3A 2WI1A 4XTJA 3JD4A 1CEZA 2HVKC 1TIDA 2R70A 5JCOC 1YXBA 2W0XA 4X1KB 4P9OA 3OTOO 1M56C 1N34O 4MPEA 2XK2A 5D6PA 4X1YA 1NTMH 3PEJA 5CA0B 1NT2B 2DWEC 2OIGA 1VMGA 2XHXA 3LPSA 3HKCB 3CCQV 3TXSA 1XILA 3W7UA 4RUEA 1QZRA 2NR5A 3HKBB 2HFEC 1I0HA 4DR7O 1Q82W 3H1JH 4CWPA 3JYCA 4GX5A 4BQJA 2YI0A 4JI5B 2HHHB 4DV2B 1R3KC 1UY9A 1K92A 2B9ZA 1IBKO 1GK9A 3TETA 3APOA 1ZL8A 2ZKOA 2EIMC 3E86A 3ZEDA 5LYJA 4KSHA 3AK1A 4IYHA 1BQ0A 5KA6A 3H01A 1N0NA 5IYDO 3K5MA 1VF6C 3E8BA 3RYCA 1AMWA 2Q0AA 4FFKA 4X9LA 1GN2A 1DF4A 1OCZB 2A3QA 3TZ2A 2CUGA 5LL6Y 4D7TA 4KP4A 4J11A 4MVZA 3WG7B 5IDJA 1VQLV 1XHZA 4NTWA 3OTOB 1NHJA 2YECA 2VS0A 1I5DA 1N34B 2F66C 4TSFG 4JTAB 3NMQA 1BHAA 1VQ7V 2XAHA 1QU7A 2IU3A 5A2QN 3ETQA 2Y69C 1S5LZ 5BXZA 3BHPA 3LSUA 1QVGU 3WB0A 5BZBA 4J7JA 1XUQA 1BHBA 3U67A 2NN4A 2QTSA 4DZYA 4DV4O 3SJCC 2FXSA 2YI7A 1LNQA 4I0XA 4DR7B 1I94O 3Q5KA 2O1UA 1YCIA 3L73H 3R4NA 3FB8C 2UU9O 3SPIA 5FWKA 2WLIA 1IBKB 4Z2WA 2HVJC 3H1LH 1SKVA 3CRAA 3JATA 4O4IB 1OJHA 5IN9A 2UXDO 2Q7GA 2Z5UA 3RYCB 3T0ZA 1GTOA 3CRMA 3EHGA 2Z0AA 4MW3A 2OCCC 3RVYA 4RAIA 1JMKC 4MVMA 1QYEA 3N2KA 5EBLC 1ZWIC 4UV8A 1FXKC 4RWUA 1N0JA 1PD3A 1XNRB 2MW2B 4HXZA 3ETDA 3ZMZA 2CTRA 1UYMA 4OX9O 3MNRP 1UYIA 3HHUA 1VQPV 4DV4B 3B4SA 4I0XB 1M1KW 4Q20A 2FYPA 4JI1O 2EZOA 5JENA 2EINC 1I94B 4H0LB 2YE4A 1T5EA 2PY5A 3T2MA 1BKNA 4KSGA 3ZIAG 2UU9B 4FMTA 4WUCA 3RLPA 5H6RA 3JATB 4R6ZA 3U10A 2UWDA 5GONA 1JJOA 4MB9A 3EHHA 2GUZA 2XAGA 2Q7HA 2P4KA 2EILC 3SR2C 4XE2A 4URNA 4UVAA 4FZ1A 4KTNA 2QR4A 3O65A 4DR5O 1WP8A 3KG2A 2CTWA 3E8HA 2WI4A 4YIOA 4YKUA 2PTMA 4ZVIA 1MSDA 1YJWV 2YXLA 1OV9A 2UXNA 3IAYA 1GM8A 5IJ0A 4ZI7A 2YKJA 3WU2Z 5B1NA 1RM1C 3CWVA 3IEDA 2O1WA 4O07A 4YKZA 3PJSK 4AWOA 2JGDB 2YEHA 4EKWA 2EJ7A 2ZQMA 2JJ2G 4PU9A 4CZZA 2WI6A 3G75A 4JI1B 1TVKA 2P7TC 4ASAA 3D36A 1QLNA 1OCCB 4X8AA 2A7WA 3ABKC 3G71V 3B27A 2GUZB 3BY6A 4BIZA 3W7TA 5M4NA 1SRYA 4QNHB 2LW1A 1OSFA 2BTZA 1DLBA 2QWNB 4MW8A 1SQQH 2XUMA 1IBMO 4CWOA 2CCUA 3TK1A 2DOSA 2Q73A 2YXHA 4DR5B 4L94A 1WA8A 2IJKA 2GTAA 4KQVA 2BU2A 2H8MA 1Y76A 4O4HA 4UV9A 3JAWA 2CCSA 4ZI7B 4I50B 2E5LO 1VQ5V 2QA4V 5B1AC 1GM7A 2ZE7A 4MSWC 5LHGA 3INWA 3IJ4A 4YKYA 2PZSA 5IE9A 1MA1A 2Q8IA 4E2LA 4FCRA 3OR7C 5L3FA 2ZXWB 1WB8A 1AJNA 2QEXV 2HCHA 4QGPA 1ZXNA 4EEHA 3LSQA 1LUVA 3BEHA 3AEIA 4JI2O 4O0BA 4PJ0Z 4MVQA 2YXYA 5EK0A 4WUDA 3RVZA 3S3WA 1S0VA 2YKEA 4UB8Z 4FLWA 1Q7YW 5LP6C 1FD9A 3A2FA 4KL1A 5JCOA 3ZS8C 5GTIZ 2KKWA 2DQ3A 3MD0A 3OD4A 1GM9A 5B1OA 4DUZB 4YJ3A 2BE3A 4JI8O 1TGOA 1AR4A 3GIEA 2ZDIC 1IBMB 1K3EA 3K59A 3CCRV 1B6QA 2X6BA 2YEDA 1G4YB 5F3KA 2RQ6A 3SPJA 2GBOA 5DEDA 1YHQV 3FYEB 1Y67A 3FD9A 4ZHQB 3OAAG 5LXTB 2XX4A 4X62O 2KG7B 5B3SC 3W7SA 3JAWB 2WI3A 2PUSA 1CPYA 4TT3G 3AG2C 1F4NA 2PI5A 2E5LB 5CTYA 1W2BU 1VQNV 3VHCA 3N2GA 4B08A 1XNQB 2UUBO 1WJZA 3MDSA 1MMMA 2EXLA 4ICGA 5CA1B 1SQBH 3JD1A 4GUNA 5JJNB 3KE6A 2QWRB 3P32A 1VF6A 3DGEA 4LCUC 4MT8A 2VQFO 4JI2B 1U2OA 1HW7A 1A4HA 1NZ6A 4K3AA 1J5EO 4F6RA 3DC5A 3OWBA 4AILC 1K8AW 2JJCA 3IGAC 1H2SB 3G80A 4O2BB 3LUTB 2W6JG 3ZRSA 4D7SA 3JARA 3ZKDA 1GN4A 2YJWA 2HP8A 3RYIB 3SDLA 4YJ3B 3S3XA 2ESAA 4HZ5A 3ZXQA 4MVOA 3RYHA 3FV5A 3ZX6A 4JI8B 2YEGA 3T1KA 2IH1C 3X2QB 1TUBA 1KBHA 2YEVA 1K4CC 3QG5A 2XX2A 1YESA 2XJXA 2XAQA 5KX5A 1NVPD 2NLJC 1Y66A 1PVGA 2OIEA 5KHHA 1K7DA 1NVPB 3THOA 3E22B 1SESA 5GTHZ 2IBZH 1YJ9V 4TQFA 1DK1A 2P5OA 3N2GB 1Q90D 4MTGA 1AI7A 2PGGA 1HNXO 2UUBB 1GN3A 5B1BB 1Y6XA 2WI5A 4TV8A 1KD1W 3K79A 1IZ3A 1UYHA 1FJGO 1JR9A 1B62A 1PV0A 4FZ0A 3ABMC 3IC7A 3G4SV 1Y8OA 3CYOA 3CP1A 2VQFB 4K35A 1S76D 3NR7A 1AI4A 4HYPA 2M7WA 1H2NA 1J5EB 3RYFB 4DV7O 1R62A 1D5NA 5EZYA 4XBFA 4FLXA 2BU7A 3JARB 3SPGA 1BT8A 1AP5A 4DXWA 2F4VO 3ZRWB 3A0XA 4GQTA 1FXKA 4DUYB 3K3WA 1TUBB 2YEVB 3FAVA 5D5QA 4DV3O 5HFMA 3WQ9A 3KCXA 5KX5B 4EGIA 4LH7A 5M4MA 1L0OA 4JASA 4HNAA 3OMUA 1EN6A 1FFTB 5JVDA 2YIBA 1UYFA 4PA3A 2XJJA 1XL4A 4MVRA 2HR3A 4FPPA 2ARHA 1JCHA 2QG2A 3AG4B 4CWSA 5IJ9A 1YS3A 2XD6A 4HAMA 3CCEV 4ZIBA 2DN9A 4JYAO 3R65A 4EFBA 1H2LA 2VRZA 1XREA 2QM8A 2GTSA 1I08A 1UY8A 3B24A 1FJGB 3INXA 1ZUQA 4U7NA 1S77D 4X64O 1VQMV 5EZYB 1AROP 3CRQA 4DV7B 1F23A 2O1VA 5D7RA 2ZIOA 2F4VB 2X7RB 4R50A 3TUHA 3JZ3A 3HKEB 4CBCA 4UXNA 3FAVB 2IW5A 3LDEA 2N04A 3APQA 1XMOO 4DV3B 5LGUA 4R3MA 1QCEA 5CB4A 4NVPA 1W0KG 4DV0O 5CBHA 4FM2A 2YIBD 4E72A 4U3JA 3RFRA 1H8HG 4UVCA 3CYGA 5B5EZ 2Q8FA 4H44B 4DR1O 5IT9N 4XKOA 2QSAA 1R6TA 1FXVA 3BMYA 5IJ9B 4UUJC 4YHHO 5D6QA 2R9IA 3SYQA 1RPRA 3H80A 2JIZG 3EVKA 3K58A 3CC7V 3JALA 4OPAA 4JYAB 2Q69A 1NU1H 2Q8VA 3SJAC 5FPOA 1NR1A 2ZCEA 3R4OA 2WI7A 4AHCA 1US7A 4MTXA 4NXMO 4B7KA 3T4ZA 5CA3A 4GZRB 1I5BA 4X64B 5EC1C 3CXCU 5C93A 2BOBC 3DTUB 1D5AA 3ZHSA 4LWFA 1Z5WA 4JF3A 5DECA 4K8XA 4CWNA 3UCSC 4E4EA 3H1IH 1SZTA 2ADPA 4XCLA 1BXDA 3U2DA 5CB4B 3ZCCA 1XMOB 3K9SA 4MPNA 4U3JB 3CRCA 4I9QA 2YI5A 1Z5AA 1K5QA 5C8YB 3OEEG 1NBMG 3QDDA 1SF9A 4DR1B 3ZRVA 2RN9A 4LPBA 3JAKA 4FVMA 1E1QG 2HEPA 3MHHC 1FFXA 2ITDC 3JALB 1KZNA 1MOFA 2CH4A 5AG2A 2WLJA 2ZR3A 2QE7G 4PHZA 2AGAA 4FLVA 1L0LH 5LP6A 3F5WC 2YDEA 1H2KA 3ASOB 1PNLA 3LNUA 3KKYA 2DYSB 4NXMB 2RMKB 3QNEA 4I55A 1BMFG 1WPBA 3B8NA 4CH3A 3R4PA 5KHKA 4GKJO 1NQTA 2PYJA 1H2MA 4JPRA 2CAZC 1SQFA 4ASUG 2AHYA 2BRCA 2FMLA 1NHIA 2OCHA 4GEEA 4WF9V 1PM9A 2P06A 4B3MO 1KC8W 2YGAA 4L8JA 2WWWA 2BSKA 2QM4A 2P6JA 1N33O 3BVOA 4JQLA 1V9PA 1OCRB 3CJHA 3HYZA 2ZDYA 1RSOA 2E76B 5IY5C 2PI4A 2R9AA 4TWKA 1YI2V 4PD4F 2O57A 4CS2A 4NH9A 5H6QA 5CTUA 1ZW9A 4WFGA 4V26A 4A5UB 3JAKB 2ZR2A 1KKCA 1F7YA 1Z2GA 4HYMA 2A06H 1F4MA 2F23A 4K4OA 1LR1A 4CWRA 4X1YB 4FLUA 4B3TO 3QO5A 1ZSPA 2ZM6O 1M57B 3HZ1A 3B40A 4X88A 3GWKC 4R7CA 1ZTEA 2ZBKB 1UY7A 4AWQA 2QWPB 4P2ZA 1KU9A 3GB7C 4GKJB 1O9HA 3F7VC 3OFNG 2GDSA 3QTCA 1QLEB 4X9QA 4NYKA 3TCUA 1S5JA 4B3MB 5H9CA 3T1HO 1P4RA 2BSKB 3JSLA 4EFEA 1ZL8B 1VQ4V 4IL6Z 5LYJB 3A0WA 4X1IA 3CJHB 1YJNV 4B7PA 1N33B 4V25A 1RSOB 1K97A 4NR1A 1M90W 1EN5A 3FYIB 1V54C 2BSMA 2KB1A 4DV6O 3TZ4A 3HPLC 3D2RA 1URFA 2GFDA 4OGQB 4U3FH 2WSSG 4PA4A 4JAAA 4P30A 1LUWA 4DR3O 2V4DA 1TILA 3JD3A 3DSQA 2EIJB 2IH3C 3BA9A 3ZMVA 3K5NA 3O6OA 3QO7A 5GGZA 3FB7C 5L3BA 2L35A 4ABMA 1GKXA 2BREA 3SYAA 1H38A 4B3TB 2DMXA 4LFCO 2XAJA 3STZC 3LDDA 4EB6A 3RT3C 2ZM6B 3K98A 1P49A 3M7MX 4LC1A 1Z59A 5D7DA 3PN1A 3ASNC 2Q4PA 2K9PA 1X59A 2OT5A 3SGIA 1THZA 2WLKA 4LF7O 3RWRD 2A79B 1VF7A 3TJTA 1UYLA 2JVDA 4DR4O 3B77A 4NTYA 3Q4HA 1PNKA 1ZXMA 2LW7A 2WLIB 3T1HB 3P30A 2YI9A 2W6IG 2ODMA 3KCYA 5L3EA 4EGKA 1V55C 1R3JC 2YGFA 4N21A 2RDCA 5LGNA 4H85A 1I5XA 5EBWC 4MTOA 5CTWA 3CGYA 1E1RG 2QGNA 1R6KA 4GX0A 2UXDB 4DV6B 2ZDXA 5LMNO 3A0HZ 5LHIA 1S14A 4EFTA 4DK1A 2H94A 4JAUA 4DR3B 3N2KB 2CCTA 5FPRA 4LFCB 2ZE6A 5J71A 4EB6B 3A0YA 3EHJA 1BL8A 2MK3A 3CD6V 2IU0A 3ZHUA 3ZKBA 2XDXA 4G27B 4YKQA 1BS3A 2YEEA 1BGYH 3W7XA 1YT2A 3E8GA 5H2FZ 2Y0PA 4MPCA 4OX9B 2HHIA 2V7QG 3O0IA 1THNA 2E74B 2Q8HA 4DR4B 3Q4HB 1AR1B 1R3LC 1K34A 3K5OA 4R3AA 5GONB 5IDMA 3FB6C 1GJVA 1JM6A 1XBLA 3K5LA 1NJIW 4I9WA 1OCOB 3B09A 1VQKV 1I5CA 3HZ5A 2G38A 1K4DC 3SJQC 1F51A 2NNUA 4LF4O 2F1MA 2YEAA 3U2KA 4BIUA 1GO3F 3E89A 4WUBA 3G7BA 3A0TA 4PRXA 3UKMA 2BTQA 3NXSA 3OWDA 4MTFA 2WAMA 4BW5A 3CCJV 5IJ0B 4CH6A 1OHHG 2OWOA 3OT7A 3OPDA 3VQXA 3OMIB 2DYSC 4QE7A 3VQYA 3OTFA 4AWPA 4J41A 3H1KH 2RNBA 1IX9A 3AG3B 2ADQB 5J9PC 4DW0A 3I55V 2IOPA 1NI8A 3WB1A 1TVKB 4HZ0A 5D5PA 2XAFA 1FAFA 4TV9A 1TA8A 2YIAA 2XABA 3UM7A 3ZHTA 4LH6A 4B6CA 2JDIG 2C1IA 3K97A 4YKRA 4PDRA 4GX1A 2DE0X 1YITV 1H7UA 3L9DA 2W0FC 4EEQA 2XX5A 2CGOA 2E3CA 2ZKJA 1OCZC 1YF2A 2QJ1A 3WG7C 2Y4UA 2YUAA 1AI5A 4UCUA 2BYIA 1WA8B 2X0LA 2HLDG 1XEQA 1JVMA 4ZBMA 3L75H 3CRKA 2BTQB 1Y76B 4O4HB 4IIJA 4JTCB 3ZHRA 2EJRA 5A9GA 3QO8A 5H5NA 1XMQO 3LMMA 3FX7A 3CE2A 4O04A 3M8AA 1EBOA 3S5TA 1UYEA 5JJJB 2Q7EA 3SYCA 4TUYA 2OYQA 3K99A 5IYCO 5BOCA 5EYPA 2PF4E 1PPJH 3CCSV 3DXRA 4URMA 3CXHF 2YC0A 5KAIZ 3VHAA 3VOUA 2YIDA 3TTZA 3D3IA 1SQXH 2YEIA 5KLVH 3C11A 4DR6O 1RFYA 1Y4SA 3OMAB 4H37A 3GIGA 1ID0A 3FT8A 3R66A 4LNUA 4XD8A 1NHHA 1SC5B 4GYCB 1WPXA 1Y4UA 2JRIA 2EIJC 4MBCA 4MP2A 2Q8GA 3ZM7A 4JI6O 4RUFA 4CH5A 1SA0A 3FKSG 4UCVA 4W7TA 1R6NA 4JI0O 2IORA 4IIJB 1Q6UA 4LWSA 4X66O 4X62B 4CH4A 2BT0A 2JKIA 1NKDA 1J95A 3BAAA 5FNFA 1U0ZA 1XMQB 1MABG 2Q2EB 2WA3A 2D2CB 1EA6A 3A0RA 2ZNJA 3SYPA 3AK3A 1XHXA 1Z5CA 1JX9A 4JYCA 1I5YA 1IURA 3UQ8A 3R4MA 5EYPB 1L0NH 2EIMB 2YE9A 3AG7A 2XTAA 1YSZA 3VBBA 4CS3A 4BW9A 4KXRA 4HY1A 3ZJZA 1R73A 3CSXA 5FNVA 1SQGA 4F6RB 1ZX3A 3M99B 1O9GA 3GWOA 3P3PA 3BCCH 1L8DA 1M5IA 5KAFZ 1ZAUA 3FT5A 2ZE8A 3GIGB 3VADA 3CS5A 3WHAA 4DR6B 3JD0A 4X20A 4O2AA 4B3RO 4L87A 2A9HA 3RYHB 3WB2A 2Z3YA 3N27A 1TC0A 2BCCH 4PELA 1KIJA 4U93A 2QDOA 3ZMUA 2Q6AA 2BYHA 1SA0B 4W4KA 4Z1VA 4JI6B 4F6EA 4FLYA 4LWSB 4JI0B 1GH6A 4Q6GA 4R8CA 4X66B 2HKJA 4DYLA 1UFIA 4IT5A 4U7OA 1KQSU 4JTDB 2EIKB 1SS3A 4FCQA 1H8EG 1MG1A 2LJ2A 4EMVA 2L6LA 3G6BA 4O4LA 1TC6A 4DV5O 4CE2A 3CHXA 3AG1B 1HNXB 3ABLB 3VHDA 3Q5LA 4JYBA 4J9YB 4TV8B 4UCOA 2CDYA 1H2GA 3RLRA 1H7SA 4PDLA 4MOTA 5CTXA 1OCCC 2WPDG 4FK5C 3DC6A 3I56V 3E35A 4JZGA 4I5SA 4LF9O 3CRRA 2OCCB 2YE5A 1QHTA 4QJFB 2UUAO 4X65O 1PL4A 2XHRA 2HJFC 4UCRA 1WN7A 2BTOA 2IJHA 1B63A 4X20B 5F2VO 1Q5OA 2N05A 4L8ZA 1FXKB 4B3RB 4ZKIA 1AJQA 4WCEV 5KMGA 1VF5B 3ABTA 4JAVA 1M9NA 1GKZA 1K33A 2CH7A 3IC9A 3UT5A 2YGEA 4ASBA 4WFHA 2VQEO 4HNAB 4JYYA 1MNGA 5JVDB 1MZEA 3K04A 5IYBO 4IHJA 4O4LB 3R91A 2EINB 2QM7A 2ZT9B 2YE6A 5GW7A 3BFRA 2XDLA 2P4VA 3AG3C 3OUSA 4DV5B 1YC4A 3O9OA 4PA7A 2VWJA 4BXIA 2ZXWC 4CWFA 1EZVH 1NH2D 3KZIZ 3SPHA 3D36C 2EILB 1NH2B 4BWAA 2YEJA 4WFFA 5LOVA 2CGNA 5FL7G 1VIBA 4YXWG 2HG5C 3SPCA 2WEPA 1HDJA 1E79G 2UUAB 4X65B 4I4TA 5LGTA 2IJJA 1KP2A 3E83A 4FFBA 5LMUO 1YEWA 4JZ2A 3ZXOA 3K03A 5CA0A 1HR0O 2C1GA 5KMGB 2YJXA 4H81A 2CH7B 4LWHA 4EM7A 1JQ0A 4DUHA 5M4EA 4DV0B 2QG0A 3ZN1A 2Q0OC 4LBEC 3GVMA 2VQEB 4WFAV 4P7AA 1DTOA 5J2TA 1DGSA 4IHJB 2CK3G 2FKXA 3RW0A 1HP8A 3ZRXA 3L74H 1FKAO 1AH8A 3C3TA 4GLXA 2B1GA 4YHHB 2DWDC 1I7FA 4PDVA 3HR0A 3OW6A 3CX5F 3EXAA 3ABKB 3W7WA 1AJ6A 3CCLV 2FB5A 1EM1A 4IYIA 3OGCC 3C3SA 5LOVB 2WERA 3B2EE 4HBNA 2ZNIA 1YETA 4TOIA 4GGLA 4O4JA 1MU5A 4KHPO 3B8MA 5KHJA 2AHZA 2P67A 2HJDA 2ZDIA 3LDCA 2ZE5A 4J10A 4I4TB 2P22C 2BU8A 4QPKA 4FFBB 4G2KA 4DV1O 3F7YC 3G7EA 1G8MA 1YIJV 5LMUB 3JD2A 1GN6A 5EBMC 3RBZA 3X2QC 1SQPH 1HR0B 1YT0A 5CMUA 5LBQA 3CCMV 1HNZO 5B1AB 1UJWB 1UYCA 1PP9H 5LHHA 3CC4V 1IXBA 1P7GA 1I58A 5FNCA 4XC0A 2UXBO 5J2TB 2F95B 3CRLA 5IWAO 1W0JG 5KHIA 5M4KA 3U0ZA 4I7ZB 1FS0G 1FFXB 5B1BC 1XOUA 4LWEA 5M4HA 1KECA 2ETNA 3G67A 4O4IA 4WBNA 2XOKG 4BIOA 1B04A 1AI6A 4ZOLA 3CMAV 5LP6B 3OW2U 1KKDA 2XHTA 4PA6A 4O4JB 1P7BA 3R92A 1NS1A 2Y4TA 3ZMSA 4I55B 1AM1A 4KHPB 4JGSA 3SJBC 5J2UA 1FYJA 3ABUA 2P90A 4PRVA 2CTPA 2DJVA 5DM6V 1JA8A 2AW9A 4W4LA 1Y8NA 3ZN0A 4DV1B 3T1CA 4DK0A 2ZINA 1AR5A 4XDLA 3RN4A 3EHFA 5B3SB 4F4LA 3H9VA 1XNRO 4CWTA 3E2EA 4XITA 1N8RW 3AG2B 3A0ZA 4H13B 3RGBA 1HNZB 4BAYA 3B28A 4LP0A 2Y48A 5KA5A 3ICXA 2QFOA 5CBGA 2UXBB 2LGWA 5DN6G 2EIKC 4B3SO 2AXTZ 2QKAA 1U97A 4C7UA 1QVFU 1YT1A 1PNMA 5IWAB 3AG4C 4UVBA 4UCTA 1ENVA 2DYRB 4TQDA 3TGUH 5L3DA 4YIPA 5JH7A 3AG1C 3ABLC 3OEHG 3EKRA 2CE4A 4O09A 1S72V 1B3QA 3F5TA 4WBNB 4ZOLB 3C90A 4LFBO 4ASFA 3FFQA 2JEUA 3VQWA 2KSDA 1FPOA 4X89A 4PI2A 2BU5A 1PKXA 4OXSA 1WLEA 5L3GA 4YKXA 3K08A 4EFUA 5J2UB 4FCPA 1ZLZA 5CBFA 2XNDG 1CXZB 2QWQB 5FNDA 2D3OW 4YKTA 4MVSA 2PYLA 2YKBA 4NXNO 3D3QA 3CCVV 4RQEA 1VQOV 3CC2V 2Q68A 4LR3A 1SETA 4LWGA 4ASGA 4X1IB 4R1FA 2GV9A 4GFNA 1YSCA 1MX0A 1XQ8A 3BA8A 4LF8O 2EULA 2JGDA 3G6EV 3BPZA 4FM0A 2IWXA 4HZ3A 3QTFA 4B3SB 4KFGA 3ML0A 1R3IC 2XCMA 5JH7B 1CP9A 4KFMA 3ABMB 1TH8A 4O05A 5CN0A 1ORQC 4D6TH 1NTZH 4MS2A 1TAEA 1I5AA 1Q6HA 2LP7A 2EX3A 2JS3A 4LFBB 3OM3B 1M4UA 2RJZA 2GSMB 5BR8O 1EFRG 1XL6A 1N36O 4N23A 1Y8PA 1W59A 3J80N 2JK5C 3Q5JA 2LFSA 2DQ0A 2FL4A 1S3JA 2XDUA 2RCVA 4UFZA 4YY3O 3JCZA 5BMVA 1WP7A 4JI4O 5JQGA 3ZBHA 3K0GA 4CS4A 4LF7B 1BYQA 2EZPA 1K5SA 2WI2A 4J42A 4NXNB 4UROA 4PL9A 2WLMA 5JWPA 4I50A 4XDJA 2YE3A 4CC5A 2DW4A 4K8ZA 1UYDA 3J81N 4XDMA 4LF8B 3EFFK 5L3CA 3AK2A 5EIBD 4XIQA 1COWG 4EGHA 1KP3A 5LMNB 4J7ZA 1YSRA 4I3HA 3HYYA 4GX2A 2CTQA 4JI7O 3P3NA 3D0BA 2JJ1G 2YEFA 1U96A 3T10A 4BQGA 2YS8A 3ASOC 5BR8B 1AP6A 2XDSA 2LGQA 4DUZO 1N36B 1GAXA 4LF6O 4J7KA 1YVWA 5BMVB 4DR2O 3RLQA 5JQGB 4YY3B 3MHSC 4FJCC 3OUFA 3STLC 1JPXA 3VQVA 4NKGB 4JI4B 2VWCA 2JGUA 3HB3B 4GT8A 2PNRA 2B1IA 4ZHQA 1MSWD 1KYOF 5LXTA 4P8OA 4YKWA 2KG7A 3L70H 1HWYA 4PDMA 1OCRC 2IOQA 2EBOA 1BZKA 1XNQO
chains in the Genus database with same CATH topology
4UV8A 4Z1MG 1FXKC 3ZMUA 2Q6AA 3ZRVA 1PD3A 2C2AA 1E1QG 4LP8A 3MHHC 2ITDC 4R8CA 2F43G 1MOFA 3ETDA 2WLJA 2ZR3A 4U7OA 1KQSU 2QE7G 1OZ0A 3ZMZA 4JTDB 2EIKB 4WFBV 1H8EG 1MG1A 1VQPV 3F5WC 1M1KW 3FB5C 4Q20A 3ASOB 1PNLA 4RQFA 2IJIA 3AG1B 3ABLB 2EZOA 4JYBA 2DYSB 2EINC 4J9YB 1M57C 3QNEA 1H2GA 3T2MA 1BMFG 3ZIAG 3B8NA 4FMTA 3LSSA 5H6RA 1NQTA 4R6ZA 4JPRA 4PDLA 4ASUG 2AHYA 1OCCC 1QR8A 2WPDG 4FK5C 3I56V 3E35A 4MVUA 2XAGA 4WF9V 3OR6C 5E1AC 2EILC 1KC8W 4I5SA 2OCCB 1QR9A 2WWWA 1QLEC 4QJFB 4UVAA 2P6JA 4PA9A 2HJFC 1OCRB 2IJHA 5IY5C 3KG2A 1FXKB 2PI4A 3E8HA 4GT1A 4ZKIA 4TWKA 3ETGA 1YI2V 1AJQA 4WCEV 3ABTA 4JAVA 1M9NA 5H6QA 1AJPA 1K33A 5EBLC 1YJWV 4WFGA 1M56B 2UXNA 2ZR2A 1GM8A 4WFHA 4J9ZB 1JOYA 5HFLA 1F4MA 2DYRC 5B1NA 2OTLV 1RM1C 3CCRV 1FXHA 3K04A 3PJSK 4RO2A 5IYBO 3QO5A 4EKWA 2EINB 2QM7A 1M57B 2ZQMA 5GW7A 3AG3C 2JJ2G 3OUSA 2JEXA 4X88A 2A0LA 4CZZA 4PA7A 4R7CA 2P7TC 2ZXWC 1Y4MA 3D36A 1QLNA 1NH2D 1OCCB 2HKOA 2WLHA 4X8AA 3ZRWA 4P2ZA 3SPHA 3ABKC 3GB7C 3G71V 3F7VC 2EILB 3OFNG 4P9PA 1NH2B 3BY6A 4WFFA 1QLEB 4BIZA 3W7TA 3TCUA 1SRYA 5FL7G 4YXWG 4QNHB 3CMEV 1DLBA 1S5HC 2HG5C 4MW8A 1P4RA 5H9CA 3SPCA 1DF5A 1E79G 1VQ4V 5IY5B 1YJNV 5LGTA 1IXMA 1KP2A 2IJJA 3E83A 3TK1A 1K97A 4H33A 1M90W 3K03A 1EZJA 1V54C 3FYIB 2KB1A 3HPLC 4QE9A 2IJKA 2WSSG 4PA4A 4UV9A 1Q81W 4P30A 1JQ0A 3ZN1A 3JD3A 4LBEC 2EIJB 2IH3C 3ZMVA 1RPOA 3QO7A 4WFAV 2QA4V 3FB7C 3K9AA 5B1AC 1VQ5V 5L3BA 4KUMA 1DTOA 1GM7A 4MSWC 4FIPC 5LHGA 2CK3G 2Y69B 3RW0A 3SYAA 1TUEB 1H38A 2XAJA 1PL0A 3ZRXA 3STZC 4E2LA 3LDDA 3LNMB 1L1FA 1SERA 3OR7C 5L3FA 2ITCC 2ZXWB 2B1GA 1AJNA 2QEXV 2DWDC 3CPWU 1VQ6V 4LC1A 4PDVA 3LSQA 3BEHA 3AEIA 3ASNC 2UXXA 3ABKB 3W7WA 2OT5A 4MVQA 1THZA 3CCLV 2WLKA 4QPJA 5EK0A 2A79B 3RVZA 1K9MW 3WFVA 1S0VA 3OGCC 1Q7YW 1GKFA 3B77A 3B8MA 3OE7G 3MD0A 2DQ3A 2AHZA 2P67A 1GM9A 1PNKA 2ZDIA 2WLIB 3LDCA 3EHBB 3P30A 5B1OA 1ROPA 2W6IG 4QPKA 5L3EA 1V55C 1R3JC 1V54B 2ZDIC 1K3EA 1NR7A 3F7YC 1B6QA 2X6BA 4G2KA 1G4YB 3IFXA 4N21A 1G8MA 5LGNA 1I5XA 1YIJV 5EBWC 3JD2A 5EBMC 4MTOA 3RBZA 4QIWF 2X6CA 3SPJA 1E1RG 1YHQV 1R6KA 4GX0A 3ETEA 3FYEB 3X2QC 3OAAG 5CMUA 3E8FA 5B3SC 2WLLA 1QBZA 5LBQA 3W7SA 3CCMV 5LHIA 5B1AB 1UJWB 1OCOC 5LHHA 3CC4V 1CPYA 4TT3G 2B5UA 3AG2C 1F4NA 2PI5A 2H94A 4JAUA 1W2BU 1VQNV 2QTOA 4PELA 3CCUV 2ATKC 2YSUB 4G28B 1W0JG 5EC2C 1Q86W 1BL8A 2MK3A 3CD6V 1GMGA 2IU0A 1FS0G 3ASNB 3JD1A 5B1BC 4G27B 3T4DA 1KECA 3W7XA 3P32A 3E8GA 3DGEA 4LCUC 4MT8A 2XOKG 3CMAV 1AI6A 3OW2U 2K1EA 1KKDA 3SYOA 3K0DA 2GHYA 2V7QG 1K8AW 4XDKA 3IGAC 2R9RB 4PA6A 1P7BA 1VQ9V 3LUTB 2W6JG 3ZRSA 3ZMSA 1AR1B 2Q67A 1V55B 4JGSA 1R3LC 2WLNA 3ABUA 2P90A 1YTFD 1K34A 1K73W 4MVOA 5DM6V 3FB6C 3ZN0A 4WFEA 2IH1C 3X2QB 3T1CA 1YTFB 2YEVA 1K4CC 4XDLA 5KUKA 2XAQA 5B3SB 4F4LA 1NVPD 2NLJC 2H8PC 1Y66A 1NJIW 4I9WA 1OCOB 1VQKV 2WLLB 3E2EA 1N8RW 3AG2B 1K4DC 1K7DA 2X6AA 1NVPB 2FTKA 3SJQC 1F51A 1SESA 2NNUA 4BAYA 4BIUA 2Y48A 1YJ9V 5KA5A 1GO3F 3ZMTA 5CBGA 3E89A 4MTGA 1AI7A 5DN6G 2EIKC 2QKSA 1QVFU 3UKMA 3K06A 3NXSA 1PNMA 2WAMA 4MTFA 4BW5A 3CCJV 5B1BB 3AG4C 4UVBA 1ENVA 1OHHG 2DYRB 5L3DA 1RM1B 3AG1C 1KD1W 3ABLC 3K79A 3OMIB 2DYSC 4QE7A 2OTJV 3OEHG 1VQ8V 3ABMC 2BOCC 2ZD9A 3IC7A 3G4SV 1S72V 3AG3B 3CYOA 3CP1A 1S76D 2JEUA 1AI4A 2M7WA 5J9PC 3I55V 4X89A 1PKXA 4GCZA 4XBFA 4OXSA 1WLEA 4DO2A 5L3GA 2V1DA 3K08A 3SPGA 2XAFA 5CBFA 4DXWA 2XNDG 3ZRWB 3UM7A 2XASA 2JDIG 4HYOA 3OMNB 1FXKA 5KUMA 2D3OW 1JJ2U 3K3WA 4MVSA 2YEVB 4PDRA 2LFRA 4GX1A 5HFMA 1YITV 3CCVV 3JD4A 2W0FC 4RQEA 1VQOV 3CC2V 1CEZA 2HVKC 2Q68A 1SETA 4JASA 4P9OA 1M56C 1OCZC 1FFTB 1YSCA 3WG7C 4PA3A 1AI5A 1XL4A 4MVRA 2HR3A 2DWEC 2X0LA 4FPPA 3G6EV 2HLDG 1JCHA 1JVMA 4HZ3A 3AG4B 4ZBMA 4HAMA 3CCEV 3CCQV 3ML0A 1R3IC 4JTCB 3R65A 1CP9A 4KFMA 2EJRA 3QO8A 3W7UA 2QM8A 3ABMB 4RUEA 1EBOA 5CN0A 1ORQC 2HFEC 4U7NA 1Q82W 3SYCA 4MS2A 3JYCA 4GX5A 2LP7A 5IYCO 1S77D 3OM3B 1R3KC 1K92A 2GSMB 1VQMV 1EFRG 1XL6A 3CCSV 1AROP 1GK9A 3TETA 4N23A 2EIMC 3E86A 1F23A 5KA6A 3H01A 2JK5C 2LFSA 2DQ0A 1S3JA 3VOUA 3D3IA 5IYDO 3JCZA 2X7RB 4R50A 3K0GA 4CBCA 4UXNA 3E8BA 2EZPA 2IW5A 1K5SA 1DF4A 3LDEA 5LGUA 3OMAB 1OCZB 1QCEA 4H37A 1W0KG 2WLMA 5CBHA 4KP4A 4MVZA 3WG7B 4XDJA 5IDJA 1VQLV 2DW4A 1H8HG 4UVCA 1WPXA 2EIJC 4TSFG 4JTAB 3EFFK 1BHAA 5L3CA 4RUFA 1FXVA 2XAHA 1VQ7V 2IU3A 1COWG 3FKSG 4UUJC 2Y69C 1R6NA 2R9IA 3SYQA 1RPRA 1KP3A 2JIZG 1QVGU 5BZBA 3CC7V 1NKDA 1J95A 4GX2A 1BHBA 2Q69A 1MABG 2JJ1G 1NR1A 1LNQA 3A0RA 3SYPA 1JX9A 4JYCA 1I5YA 4MTXA 2EIMB 3T4ZA 3FB8C 5CA3A 3ASOC 5EC1C 3CXCU 3SPIA 5C93A 2BOBC 2WLIA 3VBBA 2HVJC 3DTUB 3ZJZA 1R73A 3MHSC 4FJCC 3OUFA 2Z5UA 1JPXA 3M99B 4JF3A 3STLC 3HB3B 3GWOA 1SZTA 2B1IA 1MSWD 1GTOA 3ZCCA 4MW3A 2OCCC 3JD0A 3RVYA 4RAIA 4MVMA 1HWYA 1K5QA 4L87A 4PDMA 2A9HA 1OCRC 2Z3YA 2EBOA 3OEEG 1NBMG 1ZWIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LFR A;  4JYB A;  2QM7 A;  4GT1 A;  2QM8 A;  3MD0 A;  1IXM A;  4JAU A;  4ZKI A;  2P67 A;  3TK1 A;  2FTK A;  3ZRV A;  3ZRX A;  4FMT A;  1F51 A;  4BIU A;  2C2A A;  4JAV A;  5B1O A;  4JAS A;  4QPK A;  4U7N A;  4GCZ A;  3D36 A;  4KP4 A;  3ZRW A;  4LC1 A;  4U7O A;  1JOY A;  5IDJ A;  3A0R A;  3ZCC A;  4FPP A;  4I5S A;  3NXS A;  4JYC A;  2WWW A;  5B1N A;  4MTX A;  3ZRW B;  4BIZ A;  4QPJ A;  3P32 A;  2LFS A;  4Q20 A;  3DGE A;  4MT8 A;  5C93 A; 
#chains in the Genus database with same CATH topology
 4Z1M G;  2GQP A;  1N4C A;  4NB5 A;  3EKO A;  2Q5Z A;  2C2A A;  4DRX A;  2CGF A;  5CA1 A;  4LP8 A;  2F43 G;  3BM9 A;  3K57 A;  1OZ0 A;  4LF4 B;  1JFF A;  4WFB V;  1X4T A;  1P84 F;  4JI7 B;  1SQV H;  2QKC A;  3FB5 C;  2M6Y A;  4RQF A;  2IJI A;  2E75 B;  4O2B A;  3C0E A;  1M57 C;  5CPH A;  3RYI A;  5FLX N;  3LSS A;  2YE8 A;  4GKK O;  4AQY O;  1ZWH A;  4LF6 B;  1QR8 A;  2VCJ A;  2YE7 A;  4MVU A;  4DR2 B;  3OR6 C;  2FWY A;  5B66 Z;  4IGG A;  5E1A C;  2F93 B;  1QR9 A;  3ZHV A;  1QLE C;  4FLT A;  1MZF A;  5JJE B;  4PA9 A;  3RKZ A;  2XHB A;  2XT9 A;  1Q43 A;  4TV9 B;  3JAS A;  3E22 A;  4AI8 A;  1IDS A;  1A32 A;  4GT1 A;  5L3J A;  3ETG A;  2YE2 A;  2KQX A;  4YJ2 A;  3D8C A;  1AJP A;  4BAE A;  1M56 B;  1GRJ A;  2FYU H;  4E01 A;  4DRX B;  4E02 A;  4J9Z B;  1JOY A;  3K60 A;  5HFL A;  4LFA O;  1EI1 A;  2YEB A;  1Y74 A;  5CF0 A;  2DYR C;  2YKI A;  2OTL V;  3HEK A;  1FXH A;  1JFF B;  5F5R A;  4JV5 O;  4RO2 A;  1UY6 A;  1XI1 A;  3CGZ A;  3QF7 A;  2H3O A;  5J6A A;  2BU6 A;  3TZ0 A;  3RYF A;  1QQC A;  2JEX A;  1TBW A;  2YK2 A;  1M93 A;  2A0L A;  3T0H A;  1B06 A;  1NTK H;  5BOD A;  1Y4M A;  2YIC A;  1WB7 A;  3JCU Z;  3GIF A;  2HKO A;  2WLH A;  3ZRW A;  1G6U A;  3BAB A;  4DUY O;  4TUY B;  4GKK B;  4L91 A;  4AQY B;  1HNW O;  4P9P A;  1BGQ A;  1WAZ A;  1YC3 A;  3MAQ A;  4LF5 O;  3TXQ A;  2IM9 A;  2XJG A;  3CME V;  1S5H C;  4L90 A;  3DXR B;  1DF5 A;  5IY5 B;  2UUC O;  3JAS B;  1IXM A;  4PI0 A;  2VW5 A;  1IBL O;  5LA6 A;  1BQZ A;  4H33 A;  3SL2 A;  4B7E A;  1EZJ A;  3O2F A;  4QE9 A;  4YJ2 B;  2N74 A;  1SZX A;  1UYG A;  5E79 Z;  4HXW A;  1Q81 W;  2Y0I A;  4LNU B;  1Y74 B;  4CE1 A;  1RPO A;  3K9A A;  4LFA B;  3PEH A;  4KUM A;  1KUQ A;  4FIP C;  1VEW A;  2Y69 B;  1TUE B;  4JV5 B;  1AH6 A;  1PL0 A;  2ZIM A;  1L1F A;  3LNM B;  1Q8I A;  1SER A;  2ITC C;  2JS5 A;  3ZHQ A;  2UXC O;  2VCI A;  4CC6 A;  3CPW U;  1KB9 F;  1VQ6 V;  4URL A;  1XDC A;  2YKC A;  2R72 A;  2UXX A;  4UB6 Z;  4XIR A;  5IYZ A;  1I59 A;  4QPJ A;  3HKE A;  3JAM N;  1K9M W;  4HY6 A;  4L93 A;  3WFV A;  1US6 A;  1HNW B;  4K0K O;  4NH8 A;  3T1Y O;  4LWI A;  3CWB H;  1GKF A;  4LF5 B;  4OPH A;  3OE7 G;  2K5B A;  3TZ5 A;  5K1X A;  3EHB B;  1ROP A;  3HKD A;  5LA6 B;  1V54 B;  2XDK A;  5TIS Z;  1NR7 A;  4PV1 B;  2UUC B;  1S16 A;  3IFX A;  3QVN A;  5FNV B;  1IBL B;  4JI3 O;  4QIW F;  2X6C A;  4MP7 A;  3ETE A;  2AZ2 A;  2H55 A;  5BY1 A;  2YI8 A;  3E8F A;  2WLL A;  1QBZ A;  3B25 A;  1OCO C;  1G1X B;  4O2A B;  1Q3E A;  5EIB C;  2B5U A;  3J7A U;  1IVS A;  2QWO B;  4H7Q A;  2QTO A;  1Q6I A;  3CCU V;  1R1B A;  2ATK C;  2YSU B;  4G28 B;  1VP7 A;  1QY8 A;  5EC2 C;  1Q86 W;  1AIL A;  3CB2 A;  1GMG A;  5D7C A;  3A8T A;  3ASN B;  1YDX A;  2CG9 A;  4E00 A;  4XKA A;  3T4D A;  2UXC B;  3UO3 A;  2VWK A;  3L72 H;  1BSM A;  1BCC H;  3U11 A;  4J80 A;  2E0A A;  5IYZ B;  4NH7 A;  2K1E A;  3LNN A;  4XKK A;  3SYO A;  3H4L A;  3K0D A;  2GHY A;  4XDK A;  5M4P A;  3T2S A;  2R9R B;  4BR6 A;  1KMI Z;  3JSN A;  1VQ9 V;  2YI6 A;  3A0B Z;  5ITZ A;  4K0K B;  3T1Y B;  4UCS A;  2BZ5 A;  2Q67 A;  1V55 B;  1UPG A;  2WLN A;  1EN4 A;  3HKD B;  1YTF D;  1K73 W;  1N32 O;  3UO2 A;  4WFE A;  5C8Y A;  1YTF B;  1BE3 H;  4JI3 B;  5KUK A;  2QF6 A;  1RP3 B;  4DW1 A;  2IWS A;  2H8P C;  1VAR A;  4LF9 B;  3OGI B;  2WLL B;  3H1H H;  1AVM A;  1YZB A;  4X1K A;  2X6A A;  2Q9L A;  2LO1 A;  2FTK A;  2WA4 A;  1WNS A;  3ZMT A;  3L71 H;  2ILM A;  2LQT A;  2QKS A;  4FM1 A;  3HKC A;  3K06 A;  3UT5 B;  3I5D A;  4FLZ A;  1RM1 B;  5K1P A;  2OTJ V;  1VQ8 V;  1Z5B A;  1UYK A;  3HKB A;  1YER A;  2BOC C;  2ZD9 A;  1AB3 A;  4XIP A;  4JI5 O;  2HHH O;  4DV2 O;  5KHG A;  2FWZ A;  1YC1 A;  4GCZ A;  2YK9 A;  5ITZ B;  4DO2 A;  3BRC A;  2IWU A;  2V1D A;  4CWQ A;  1Z5V A;  3CEI A;  4NTX A;  1QNM A;  2XAS A;  2WEQ A;  4AS9 A;  4HYO A;  3OMN B;  5KUM A;  4XCJ A;  1JJ2 U;  2AKP A;  2HG1 A;  1N32 B;  2LFR A;  2AZ0 A;  3B26 A;  1D2D A;  4CE3 A;  2WI1 A;  4XTJ A;  3JD4 A;  1CEZ A;  2HVK C;  1TID A;  2R70 A;  5JCO C;  1YXB A;  2W0X A;  4X1K B;  4P9O A;  3OTO O;  1M56 C;  1N34 O;  4MPE A;  2XK2 A;  5D6P A;  4X1Y A;  1NTM H;  3PEJ A;  5CA0 B;  1NT2 B;  2DWE C;  2OIG A;  1VMG A;  2XHX A;  3LPS A;  3HKC B;  3CCQ V;  3TXS A;  1XIL A;  3W7U A;  4RUE A;  1QZR A;  2NR5 A;  3HKB B;  2HFE C;  1I0H A;  4DR7 O;  1Q82 W;  3H1J H;  4CWP A;  3JYC A;  4GX5 A;  4BQJ A;  2YI0 A;  4JI5 B;  2HHH B;  4DV2 B;  1R3K C;  1UY9 A;  1K92 A;  2B9Z A;  1IBK O;  1GK9 A;  3TET A;  3APO A;  1ZL8 A;  2ZKO A;  2EIM C;  3E86 A;  3ZED A;  5LYJ A;  4KSH A;  3AK1 A;  4IYH A;  1BQ0 A;  5KA6 A;  3H01 A;  1N0N A;  5IYD O;  3K5M A;  1VF6 C;  3E8B A;  3RYC A;  1AMW A;  2Q0A A;  4FFK A;  4X9L A;  1GN2 A;  1DF4 A;  1OCZ B;  2A3Q A;  3TZ2 A;  2CUG A;  5LL6 Y;  4D7T A;  4KP4 A;  4J11 A;  4MVZ A;  3WG7 B;  5IDJ A;  1VQL V;  1XHZ A;  4NTW A;  3OTO B;  1NHJ A;  2YEC A;  2VS0 A;  1I5D A;  1N34 B;  2F66 C;  4TSF G;  4JTA B;  3NMQ A;  1BHA A;  1VQ7 V;  2XAH A;  1QU7 A;  2IU3 A;  5A2Q N;  3ETQ A;  2Y69 C;  1S5L Z;  5BXZ A;  3BHP A;  3LSU A;  1QVG U;  3WB0 A;  5BZB A;  4J7J A;  1XUQ A;  1BHB A;  3U67 A;  2NN4 A;  2QTS A;  4DZY A;  4DV4 O;  3SJC C;  2FXS A;  2YI7 A;  1LNQ A;  4I0X A;  4DR7 B;  1I94 O;  3Q5K A;  2O1U A;  1YCI A;  3L73 H;  3R4N A;  3FB8 C;  2UU9 O;  3SPI A;  5FWK A;  2WLI A;  1IBK B;  4Z2W A;  2HVJ C;  3H1L H;  1SKV A;  3CRA A;  3JAT A;  4O4I B;  1OJH A;  5IN9 A;  2UXD O;  2Q7G A;  2Z5U A;  3RYC B;  3T0Z A;  1GTO A;  3CRM A;  3EHG A;  2Z0A A;  4MW3 A;  2OCC C;  3RVY A;  4RAI A;  1JMK C;  4MVM A;  1QYE A;  3N2K A;  5EBL C;  1ZWI C;  4UV8 A;  1FXK C;  4RWU A;  1N0J A;  1PD3 A;  1XNR B;  2MW2 B;  4HXZ A;  3ETD A;  3ZMZ A;  2CTR A;  1UYM A;  4OX9 O;  3MNR P;  1UYI A;  3HHU A;  1VQP V;  4DV4 B;  3B4S A;  4I0X B;  1M1K W;  4Q20 A;  2FYP A;  4JI1 O;  2EZO A;  5JEN A;  2EIN C;  1I94 B;  4H0L B;  2YE4 A;  1T5E A;  2PY5 A;  3T2M A;  1BKN A;  4KSG A;  3ZIA G;  2UU9 B;  4FMT A;  4WUC A;  3RLP A;  5H6R A;  3JAT B;  4R6Z A;  3U10 A;  2UWD A;  5GON A;  1JJO A;  4MB9 A;  3EHH A;  2GUZ A;  2XAG A;  2Q7H A;  2P4K A;  2EIL C;  3SR2 C;  4XE2 A;  4URN A;  4UVA A;  4FZ1 A;  4KTN A;  2QR4 A;  3O65 A;  4DR5 O;  1WP8 A;  3KG2 A;  2CTW A;  3E8H A;  2WI4 A;  4YIO A;  4YKU A;  2PTM A;  4ZVI A;  1MSD A;  1YJW V;  2YXL A;  1OV9 A;  2UXN A;  3IAY A;  1GM8 A;  5IJ0 A;  4ZI7 A;  2YKJ A;  3WU2 Z;  5B1N A;  1RM1 C;  3CWV A;  3IED A;  2O1W A;  4O07 A;  4YKZ A;  3PJS K;  4AWO A;  2JGD B;  2YEH A;  4EKW A;  2EJ7 A;  2ZQM A;  2JJ2 G;  4PU9 A;  4CZZ A;  2WI6 A;  3G75 A;  4JI1 B;  1TVK A;  2P7T C;  4ASA A;  3D36 A;  1QLN A;  1OCC B;  4X8A A;  2A7W A;  3ABK C;  3G71 V;  3B27 A;  2GUZ B;  3BY6 A;  4BIZ A;  3W7T A;  5M4N A;  1SRY A;  4QNH B;  2LW1 A;  1OSF A;  2BTZ A;  1DLB A;  2QWN B;  4MW8 A;  1SQQ H;  2XUM A;  1IBM O;  4CWO A;  2CCU A;  3TK1 A;  2DOS A;  2Q73 A;  2YXH A;  4DR5 B;  4L94 A;  1WA8 A;  2IJK A;  2GTA A;  4KQV A;  2BU2 A;  2H8M A;  1Y76 A;  4O4H A;  4UV9 A;  3JAW A;  2CCS A;  4ZI7 B;  4I50 B;  2E5L O;  1VQ5 V;  2QA4 V;  5B1A C;  1GM7 A;  2ZE7 A;  4MSW C;  5LHG A;  3INW A;  3IJ4 A;  4YKY A;  2PZS A;  5IE9 A;  1MA1 A;  2Q8I A;  4E2L A;  4FCR A;  3OR7 C;  5L3F A;  2ZXW B;  1WB8 A;  1AJN A;  2QEX V;  2HCH A;  4QGP A;  1ZXN A;  4EEH A;  3LSQ A;  1LUV A;  3BEH A;  3AEI A;  4JI2 O;  4O0B A;  4PJ0 Z;  4MVQ A;  2YXY A;  5EK0 A;  4WUD A;  3RVZ A;  3S3W A;  1S0V A;  2YKE A;  4UB8 Z;  4FLW A;  1Q7Y W;  5LP6 C;  1FD9 A;  3A2F A;  4KL1 A;  5JCO A;  3ZS8 C;  5GTI Z;  2KKW A;  2DQ3 A;  3MD0 A;  3OD4 A;  1GM9 A;  5B1O A;  4DUZ B;  4YJ3 A;  2BE3 A;  4JI8 O;  1TGO A;  1AR4 A;  3GIE A;  2ZDI C;  1IBM B;  1K3E A;  3K59 A;  3CCR V;  1B6Q A;  2X6B A;  2YED A;  1G4Y B;  5F3K A;  2RQ6 A;  3SPJ A;  2GBO A;  5DED A;  1YHQ V;  3FYE B;  1Y67 A;  3FD9 A;  4ZHQ B;  3OAA G;  5LXT B;  2XX4 A;  4X62 O;  2KG7 B;  5B3S C;  3W7S A;  3JAW B;  2WI3 A;  2PUS A;  1CPY A;  4TT3 G;  3AG2 C;  1F4N A;  2PI5 A;  2E5L B;  5CTY A;  1W2B U;  1VQN V;  3VHC A;  3N2G A;  4B08 A;  1XNQ B;  2UUB O;  1WJZ A;  3MDS A;  1MMM A;  2EXL A;  4ICG A;  5CA1 B;  1SQB H;  3JD1 A;  4GUN A;  5JJN B;  3KE6 A;  2QWR B;  3P32 A;  1VF6 A;  3DGE A;  4LCU C;  4MT8 A;  2VQF O;  4JI2 B;  1U2O A;  1HW7 A;  1A4H A;  1NZ6 A;  4K3A A;  1J5E O;  4F6R A;  3DC5 A;  3OWB A;  4AIL C;  1K8A W;  2JJC A;  3IGA C;  1H2S B;  3G80 A;  4O2B B;  3LUT B;  2W6J G;  3ZRS A;  4D7S A;  3JAR A;  3ZKD A;  1GN4 A;  2YJW A;  2HP8 A;  3RYI B;  3SDL A;  4YJ3 B;  3S3X A;  2ESA A;  4HZ5 A;  3ZXQ A;  4MVO A;  3RYH A;  3FV5 A;  3ZX6 A;  4JI8 B;  2YEG A;  3T1K A;  2IH1 C;  3X2Q B;  1TUB A;  1KBH A;  2YEV A;  1K4C C;  3QG5 A;  2XX2 A;  1YES A;  2XJX A;  2XAQ A;  5KX5 A;  1NVP D;  2NLJ C;  1Y66 A;  1PVG A;  2OIE A;  5KHH A;  1K7D A;  1NVP B;  3THO A;  3E22 B;  1SES A;  5GTH Z;  2IBZ H;  1YJ9 V;  4TQF A;  1DK1 A;  2P5O A;  3N2G B;  1Q90 D;  4MTG A;  1AI7 A;  2PGG A;  1HNX O;  2UUB B;  1GN3 A;  5B1B B;  1Y6X A;  2WI5 A;  4TV8 A;  1KD1 W;  3K79 A;  1IZ3 A;  1UYH A;  1FJG O;  1JR9 A;  1B62 A;  1PV0 A;  4FZ0 A;  3ABM C;  3IC7 A;  3G4S V;  1Y8O A;  3CYO A;  3CP1 A;  2VQF B;  4K35 A;  1S76 D;  3NR7 A;  1AI4 A;  4HYP A;  2M7W A;  1H2N A;  1J5E B;  3RYF B;  4DV7 O;  1R62 A;  1D5N A;  5EZY A;  4XBF A;  4FLX A;  2BU7 A;  3JAR B;  3SPG A;  1BT8 A;  1AP5 A;  4DXW A;  2F4V O;  3ZRW B;  3A0X A;  4GQT A;  1FXK A;  4DUY B;  3K3W A;  1TUB B;  2YEV B;  3FAV A;  5D5Q A;  4DV3 O;  5HFM A;  3WQ9 A;  3KCX A;  5KX5 B;  4EGI A;  4LH7 A;  5M4M A;  1L0O A;  4JAS A;  4HNA A;  3OMU A;  1EN6 A;  1FFT B;  5JVD A;  2YIB A;  1UYF A;  4PA3 A;  2XJJ A;  1XL4 A;  4MVR A;  2HR3 A;  4FPP A;  2ARH A;  1JCH A;  2QG2 A;  3AG4 B;  4CWS A;  5IJ9 A;  1YS3 A;  2XD6 A;  4HAM A;  3CCE V;  4ZIB A;  2DN9 A;  4JYA O;  3R65 A;  4EFB A;  1H2L A;  2VRZ A;  1XRE A;  2QM8 A;  2GTS A;  1I08 A;  1UY8 A;  3B24 A;  1FJG B;  3INX A;  1ZUQ A;  4U7N A;  1S77 D;  4X64 O;  1VQM V;  5EZY B;  1ARO P;  3CRQ A;  4DV7 B;  1F23 A;  2O1V A;  5D7R A;  2ZIO A;  2F4V B;  2X7R B;  4R50 A;  3TUH A;  3JZ3 A;  3HKE B;  4CBC A;  4UXN A;  3FAV B;  2IW5 A;  3LDE A;  2N04 A;  3APQ A;  1XMO O;  4DV3 B;  5LGU A;  4R3M A;  1QCE A;  5CB4 A;  4NVP A;  1W0K G;  4DV0 O;  5CBH A;  4FM2 A;  2YIB D;  4E72 A;  4U3J A;  3RFR A;  1H8H G;  4UVC A;  3CYG A;  5B5E Z;  2Q8F A;  4H44 B;  4DR1 O;  5IT9 N;  4XKO A;  2QSA A;  1R6T A;  1FXV A;  3BMY A;  5IJ9 B;  4UUJ C;  4YHH O;  5D6Q A;  2R9I A;  3SYQ A;  1RPR A;  3H80 A;  2JIZ G;  3EVK A;  3K58 A;  3CC7 V;  3JAL A;  4OPA A;  4JYA B;  2Q69 A;  1NU1 H;  2Q8V A;  3SJA C;  5FPO A;  1NR1 A;  2ZCE A;  3R4O A;  2WI7 A;  4AHC A;  1US7 A;  4MTX A;  4NXM O;  4B7K A;  3T4Z A;  5CA3 A;  4GZR B;  1I5B A;  4X64 B;  5EC1 C;  3CXC U;  5C93 A;  2BOB C;  3DTU B;  1D5A A;  3ZHS A;  4LWF A;  1Z5W A;  4JF3 A;  5DEC A;  4K8X A;  4CWN A;  3UCS C;  4E4E A;  3H1I H;  1SZT A;  2ADP A;  4XCL A;  1BXD A;  3U2D A;  5CB4 B;  3ZCC A;  1XMO B;  3K9S A;  4MPN A;  4U3J B;  3CRC A;  4I9Q A;  2YI5 A;  1Z5A A;  1K5Q A;  5C8Y B;  3OEE G;  1NBM G;  3QDD A;  1SF9 A;  4DR1 B;  3ZRV A;  2RN9 A;  4LPB A;  3JAK A;  4FVM A;  1E1Q G;  2HEP A;  3MHH C;  1FFX A;  2ITD C;  3JAL B;  1KZN A;  1MOF A;  2CH4 A;  5AG2 A;  2WLJ A;  2ZR3 A;  2QE7 G;  4PHZ A;  2AGA A;  4FLV A;  1L0L H;  5LP6 A;  3F5W C;  2YDE A;  1H2K A;  3ASO B;  1PNL A;  3LNU A;  3KKY A;  2DYS B;  4NXM B;  2RMK B;  3QNE A;  4I55 A;  1BMF G;  1WPB A;  3B8N A;  4CH3 A;  3R4P A;  5KHK A;  4GKJ O;  1NQT A;  2PYJ A;  1H2M A;  4JPR A;  2CAZ C;  1SQF A;  4ASU G;  2AHY A;  2BRC A;  2FML A;  1NHI A;  2OCH A;  4GEE A;  4WF9 V;  1PM9 A;  2P06 A;  4B3M O;  1KC8 W;  2YGA A;  4L8J A;  2WWW A;  2BSK A;  2QM4 A;  2P6J A;  1N33 O;  3BVO A;  4JQL A;  1V9P A;  1OCR B;  3CJH A;  3HYZ A;  2ZDY A;  1RSO A;  2E76 B;  5IY5 C;  2PI4 A;  2R9A A;  4TWK A;  1YI2 V;  4PD4 F;  2O57 A;  4CS2 A;  4NH9 A;  5H6Q A;  5CTU A;  1ZW9 A;  4WFG A;  4V26 A;  4A5U B;  3JAK B;  2ZR2 A;  1KKC A;  1F7Y A;  1Z2G A;  4HYM A;  2A06 H;  1F4M A;  2F23 A;  4K4O A;  1LR1 A;  4CWR A;  4X1Y B;  4FLU A;  4B3T O;  3QO5 A;  1ZSP A;  2ZM6 O;  1M57 B;  3HZ1 A;  3B40 A;  4X88 A;  3GWK C;  4R7C A;  1ZTE A;  2ZBK B;  1UY7 A;  4AWQ A;  2QWP B;  4P2Z A;  1KU9 A;  3GB7 C;  4GKJ B;  1O9H A;  3F7V C;  3OFN G;  2GDS A;  3QTC A;  1QLE B;  4X9Q A;  4NYK A;  3TCU A;  1S5J A;  4B3M B;  5H9C A;  3T1H O;  1P4R A;  2BSK B;  3JSL A;  4EFE A;  1ZL8 B;  1VQ4 V;  4IL6 Z;  5LYJ B;  3A0W A;  4X1I A;  3CJH B;  1YJN V;  4B7P A;  1N33 B;  4V25 A;  1RSO B;  1K97 A;  4NR1 A;  1M90 W;  1EN5 A;  3FYI B;  1V54 C;  2BSM A;  2KB1 A;  4DV6 O;  3TZ4 A;  3HPL C;  3D2R A;  1URF A;  2GFD A;  4OGQ B;  4U3F H;  2WSS G;  4PA4 A;  4JAA A;  4P30 A;  1LUW A;  4DR3 O;  2V4D A;  1TIL A;  3JD3 A;  3DSQ A;  2EIJ B;  2IH3 C;  3BA9 A;  3ZMV A;  3K5N A;  3O6O A;  3QO7 A;  5GGZ A;  3FB7 C;  5L3B A;  2L35 A;  4ABM A;  1GKX A;  2BRE A;  3SYA A;  1H38 A;  4B3T B;  2DMX A;  4LFC O;  2XAJ A;  3STZ C;  3LDD A;  4EB6 A;  3RT3 C;  2ZM6 B;  3K98 A;  1P49 A;  3M7M X;  4LC1 A;  1Z59 A;  5D7D A;  3PN1 A;  3ASN C;  2Q4P A;  2K9P A;  1X59 A;  2OT5 A;  3SGI A;  1THZ A;  2WLK A;  4LF7 O;  3RWR D;  2A79 B;  1VF7 A;  3TJT A;  1UYL A;  2JVD A;  4DR4 O;  3B77 A;  4NTY A;  3Q4H A;  1PNK A;  1ZXM A;  2LW7 A;  2WLI B;  3T1H B;  3P30 A;  2YI9 A;  2W6I G;  2ODM A;  3KCY A;  5L3E A;  4EGK A;  1V55 C;  1R3J C;  2YGF A;  4N21 A;  2RDC A;  5LGN A;  4H85 A;  1I5X A;  5EBW C;  4MTO A;  5CTW A;  3CGY A;  1E1R G;  2QGN A;  1R6K A;  4GX0 A;  2UXD B;  4DV6 B;  2ZDX A;  5LMN O;  3A0H Z;  5LHI A;  1S14 A;  4EFT A;  4DK1 A;  2H94 A;  4JAU A;  4DR3 B;  3N2K B;  2CCT A;  5FPR A;  4LFC B;  2ZE6 A;  5J71 A;  4EB6 B;  3A0Y A;  3EHJ A;  1BL8 A;  2MK3 A;  3CD6 V;  2IU0 A;  3ZHU A;  3ZKB A;  2XDX A;  4G27 B;  4YKQ A;  1BS3 A;  2YEE A;  1BGY H;  3W7X A;  1YT2 A;  3E8G A;  5H2F Z;  2Y0P A;  4MPC A;  4OX9 B;  2HHI A;  2V7Q G;  3O0I A;  1THN A;  2E74 B;  2Q8H A;  4DR4 B;  3Q4H B;  1AR1 B;  1R3L C;  1K34 A;  3K5O A;  4R3A A;  5GON B;  5IDM A;  3FB6 C;  1GJV A;  1JM6 A;  1XBL A;  3K5L A;  1NJI W;  4I9W A;  1OCO B;  3B09 A;  1VQK V;  1I5C A;  3HZ5 A;  2G38 A;  1K4D C;  3SJQ C;  1F51 A;  2NNU A;  4LF4 O;  2F1M A;  2YEA A;  3U2K A;  4BIU A;  1GO3 F;  3E89 A;  4WUB A;  3G7B A;  3A0T A;  4PRX A;  3UKM A;  2BTQ A;  3NXS A;  3OWD A;  4MTF A;  2WAM A;  4BW5 A;  3CCJ V;  5IJ0 B;  4CH6 A;  1OHH G;  2OWO A;  3OT7 A;  3OPD A;  3VQX A;  3OMI B;  2DYS C;  4QE7 A;  3VQY A;  3OTF A;  4AWP A;  4J41 A;  3H1K H;  2RNB A;  1IX9 A;  3AG3 B;  2ADQ B;  5J9P C;  4DW0 A;  3I55 V;  2IOP A;  1NI8 A;  3WB1 A;  1TVK B;  4HZ0 A;  5D5P A;  2XAF A;  1FAF A;  4TV9 A;  1TA8 A;  2YIA A;  2XAB A;  3UM7 A;  3ZHT A;  4LH6 A;  4B6C A;  2JDI G;  2C1I A;  3K97 A;  4YKR A;  4PDR A;  4GX1 A;  2DE0 X;  1YIT V;  1H7U A;  3L9D A;  2W0F C;  4EEQ A;  2XX5 A;  2CGO A;  2E3C A;  2ZKJ A;  1OCZ C;  1YF2 A;  2QJ1 A;  3WG7 C;  2Y4U A;  2YUA A;  1AI5 A;  4UCU A;  2BYI A;  1WA8 B;  2X0L A;  2HLD G;  1XEQ A;  1JVM A;  4ZBM A;  3L75 H;  3CRK A;  2BTQ B;  1Y76 B;  4O4H B;  4IIJ A;  4JTC B;  3ZHR A;  2EJR A;  5A9G A;  3QO8 A;  5H5N A;  1XMQ O;  3LMM A;  3FX7 A;  3CE2 A;  4O04 A;  3M8A A;  1EBO A;  3S5T A;  1UYE A;  5JJJ B;  2Q7E A;  3SYC A;  4TUY A;  2OYQ A;  3K99 A;  5IYC O;  5BOC A;  5EYP A;  2PF4 E;  1PPJ H;  3CCS V;  3DXR A;  4URM A;  3CXH F;  2YC0 A;  5KAI Z;  3VHA A;  3VOU A;  2YID A;  3TTZ A;  3D3I A;  1SQX H;  2YEI A;  5KLV H;  3C11 A;  4DR6 O;  1RFY A;  1Y4S A;  3OMA B;  4H37 A;  3GIG A;  1ID0 A;  3FT8 A;  3R66 A;  4LNU A;  4XD8 A;  1NHH A;  1SC5 B;  4GYC B;  1WPX A;  1Y4U A;  2JRI A;  2EIJ C;  4MBC A;  4MP2 A;  2Q8G A;  3ZM7 A;  4JI6 O;  4RUF A;  4CH5 A;  1SA0 A;  3FKS G;  4UCV A;  4W7T A;  1R6N A;  4JI0 O;  2IOR A;  4IIJ B;  1Q6U A;  4LWS A;  4X66 O;  4X62 B;  4CH4 A;  2BT0 A;  2JKI A;  1NKD A;  1J95 A;  3BAA A;  5FNF A;  1U0Z A;  1XMQ B;  1MAB G;  2Q2E B;  2WA3 A;  2D2C B;  1EA6 A;  3A0R A;  2ZNJ A;  3SYP A;  3AK3 A;  1XHX A;  1Z5C A;  1JX9 A;  4JYC A;  1I5Y A;  1IUR A;  3UQ8 A;  3R4M A;  5EYP B;  1L0N H;  2EIM B;  2YE9 A;  3AG7 A;  2XTA A;  1YSZ A;  3VBB A;  4CS3 A;  4BW9 A;  4KXR A;  4HY1 A;  3ZJZ A;  1R73 A;  3CSX A;  5FNV A;  1SQG A;  4F6R B;  1ZX3 A;  3M99 B;  1O9G A;  3GWO A;  3P3P A;  3BCC H;  1L8D A;  1M5I A;  5KAF Z;  1ZAU A;  3FT5 A;  2ZE8 A;  3GIG B;  3VAD A;  3CS5 A;  3WHA A;  4DR6 B;  3JD0 A;  4X20 A;  4O2A A;  4B3R O;  4L87 A;  2A9H A;  3RYH B;  3WB2 A;  2Z3Y A;  3N27 A;  1TC0 A;  2BCC H;  4PEL A;  1KIJ A;  4U93 A;  2QDO A;  3ZMU A;  2Q6A A;  2BYH A;  1SA0 B;  4W4K A;  4Z1V A;  4JI6 B;  4F6E A;  4FLY A;  4LWS B;  4JI0 B;  1GH6 A;  4Q6G A;  4R8C A;  4X66 B;  2HKJ A;  4DYL A;  1UFI A;  4IT5 A;  4U7O A;  1KQS U;  4JTD B;  2EIK B;  1SS3 A;  4FCQ A;  1H8E G;  1MG1 A;  2LJ2 A;  4EMV A;  2L6L A;  3G6B A;  4O4L A;  1TC6 A;  4DV5 O;  4CE2 A;  3CHX A;  3AG1 B;  1HNX B;  3ABL B;  3VHD A;  3Q5L A;  4JYB A;  4J9Y B;  4TV8 B;  4UCO A;  2CDY A;  1H2G A;  3RLR A;  1H7S A;  4PDL A;  4MOT A;  5CTX A;  1OCC C;  2WPD G;  4FK5 C;  3DC6 A;  3I56 V;  3E35 A;  4JZG A;  4I5S A;  4LF9 O;  3CRR A;  2OCC B;  2YE5 A;  1QHT A;  4QJF B;  2UUA O;  4X65 O;  1PL4 A;  2XHR A;  2HJF C;  4UCR A;  1WN7 A;  2BTO A;  2IJH A;  1B63 A;  4X20 B;  5F2V O;  1Q5O A;  2N05 A;  4L8Z A;  1FXK B;  4B3R B;  4ZKI A;  1AJQ A;  4WCE V;  5KMG A;  1VF5 B;  3ABT A;  4JAV A;  1M9N A;  1GKZ A;  1K33 A;  2CH7 A;  3IC9 A;  3UT5 A;  2YGE A;  4ASB A;  4WFH A;  2VQE O;  4HNA B;  4JYY A;  1MNG A;  5JVD B;  1MZE A;  3K04 A;  5IYB O;  4IHJ A;  4O4L B;  3R91 A;  2EIN B;  2QM7 A;  2ZT9 B;  2YE6 A;  5GW7 A;  3BFR A;  2XDL A;  2P4V A;  3AG3 C;  3OUS A;  4DV5 B;  1YC4 A;  3O9O A;  4PA7 A;  2VWJ A;  4BXI A;  2ZXW C;  4CWF A;  1EZV H;  1NH2 D;  3KZI Z;  3SPH A;  3D36 C;  2EIL B;  1NH2 B;  4BWA A;  2YEJ A;  4WFF A;  5LOV A;  2CGN A;  5FL7 G;  1VIB A;  4YXW G;  2HG5 C;  3SPC A;  2WEP A;  1HDJ A;  1E79 G;  2UUA B;  4X65 B;  4I4T A;  5LGT A;  2IJJ A;  1KP2 A;  3E83 A;  4FFB A;  5LMU O;  1YEW A;  4JZ2 A;  3ZXO A;  3K03 A;  5CA0 A;  1HR0 O;  2C1G A;  5KMG B;  2YJX A;  4H81 A;  2CH7 B;  4LWH A;  4EM7 A;  1JQ0 A;  4DUH A;  5M4E A;  4DV0 B;  2QG0 A;  3ZN1 A;  2Q0O C;  4LBE C;  3GVM A;  2VQE B;  4WFA V;  4P7A A;  1DTO A;  5J2T A;  1DGS A;  4IHJ B;  2CK3 G;  2FKX A;  3RW0 A;  1HP8 A;  3ZRX A;  3L74 H;  1FKA O;  1AH8 A;  3C3T A;  4GLX A;  2B1G A;  4YHH B;  2DWD C;  1I7F A;  4PDV A;  3HR0 A;  3OW6 A;  3CX5 F;  3EXA A;  3ABK B;  3W7W A;  1AJ6 A;  3CCL V;  2FB5 A;  1EM1 A;  4IYI A;  3OGC C;  3C3S A;  5LOV B;  2WER A;  3B2E E;  4HBN A;  2ZNI A;  1YET A;  4TOI A;  4GGL A;  4O4J A;  1MU5 A;  4KHP O;  3B8M A;  5KHJ A;  2AHZ A;  2P67 A;  2HJD A;  2ZDI A;  3LDC A;  2ZE5 A;  4J10 A;  4I4T B;  2P22 C;  2BU8 A;  4QPK A;  4FFB B;  4G2K A;  4DV1 O;  3F7Y C;  3G7E A;  1G8M A;  1YIJ V;  5LMU B;  3JD2 A;  1GN6 A;  5EBM C;  3RBZ A;  3X2Q C;  1SQP H;  1HR0 B;  1YT0 A;  5CMU A;  5LBQ A;  3CCM V;  1HNZ O;  5B1A B;  1UJW B;  1UYC A;  1PP9 H;  5LHH A;  3CC4 V;  1IXB A;  1P7G A;  1I58 A;  5FNC A;  4XC0 A;  2UXB O;  5J2T B;  2F95 B;  3CRL A;  5IWA O;  1W0J G;  5KHI A;  5M4K A;  3U0Z A;  4I7Z B;  1FS0 G;  1FFX B;  5B1B C;  1XOU A;  4LWE A;  5M4H A;  1KEC A;  2ETN A;  3G67 A;  4O4I A;  4WBN A;  2XOK G;  4BIO A;  1B04 A;  1AI6 A;  4ZOL A;  3CMA V;  5LP6 B;  3OW2 U;  1KKD A;  2XHT A;  4PA6 A;  4O4J B;  1P7B A;  3R92 A;  1NS1 A;  2Y4T A;  3ZMS A;  4I55 B;  1AM1 A;  4KHP B;  4JGS A;  3SJB C;  5J2U A;  1FYJ A;  3ABU A;  2P90 A;  4PRV A;  2CTP A;  2DJV A;  5DM6 V;  1JA8 A;  2AW9 A;  4W4L A;  1Y8N A;  3ZN0 A;  4DV1 B;  3T1C A;  4DK0 A;  2ZIN A;  1AR5 A;  4XDL A;  3RN4 A;  3EHF A;  5B3S B;  4F4L A;  3H9V A;  1XNR O;  4CWT A;  3E2E A;  4XIT A;  1N8R W;  3AG2 B;  3A0Z A;  4H13 B;  3RGB A;  1HNZ B;  4BAY A;  3B28 A;  4LP0 A;  2Y48 A;  5KA5 A;  3ICX A;  2QFO A;  5CBG A;  2UXB B;  2LGW A;  5DN6 G;  2EIK C;  4B3S O;  2AXT Z;  2QKA A;  1U97 A;  4C7U A;  1QVF U;  1YT1 A;  1PNM A;  5IWA B;  3AG4 C;  4UVB A;  4UCT A;  1ENV A;  2DYR B;  4TQD A;  3TGU H;  5L3D A;  4YIP A;  5JH7 A;  3AG1 C;  3ABL C;  3OEH G;  3EKR A;  2CE4 A;  4O09 A;  1S72 V;  1B3Q A;  3F5T A;  4WBN B;  4ZOL B;  3C90 A;  4LFB O;  4ASF A;  3FFQ A;  2JEU A;  3VQW A;  2KSD A;  1FPO A;  4X89 A;  4PI2 A;  2BU5 A;  1PKX A;  4OXS A;  1WLE A;  5L3G A;  4YKX A;  3K08 A;  4EFU A;  5J2U B;  4FCP A;  1ZLZ A;  5CBF A;  2XND G;  1CXZ B;  2QWQ B;  5FND A;  2D3O W;  4YKT A;  4MVS A;  2PYL A;  2YKB A;  4NXN O;  3D3Q A;  3CCV V;  4RQE A;  1VQO V;  3CC2 V;  2Q68 A;  4LR3 A;  1SET A;  4LWG A;  4ASG A;  4X1I B;  4R1F A;  2GV9 A;  4GFN A;  1YSC A;  1MX0 A;  1XQ8 A;  3BA8 A;  4LF8 O;  2EUL A;  2JGD A;  3G6E V;  3BPZ A;  4FM0 A;  2IWX A;  4HZ3 A;  3QTF A;  4B3S B;  4KFG A;  3ML0 A;  1R3I C;  2XCM A;  5JH7 B;  1CP9 A;  4KFM A;  3ABM B;  1TH8 A;  4O05 A;  5CN0 A;  1ORQ C;  4D6T H;  1NTZ H;  4MS2 A;  1TAE A;  1I5A A;  1Q6H A;  2LP7 A;  2EX3 A;  2JS3 A;  4LFB B;  3OM3 B;  1M4U A;  2RJZ A;  2GSM B;  5BR8 O;  1EFR G;  1XL6 A;  1N36 O;  4N23 A;  1Y8P A;  1W59 A;  3J80 N;  2JK5 C;  3Q5J A;  2LFS A;  2DQ0 A;  2FL4 A;  1S3J A;  2XDU A;  2RCV A;  4UFZ A;  4YY3 O;  3JCZ A;  5BMV A;  1WP7 A;  4JI4 O;  5JQG A;  3ZBH A;  3K0G A;  4CS4 A;  4LF7 B;  1BYQ A;  2EZP A;  1K5S A;  2WI2 A;  4J42 A;  4NXN B;  4URO A;  4PL9 A;  2WLM A;  5JWP A;  4I50 A;  4XDJ A;  2YE3 A;  4CC5 A;  2DW4 A;  4K8Z A;  1UYD A;  3J81 N;  4XDM A;  4LF8 B;  3EFF K;  5L3C A;  3AK2 A;  5EIB D;  4XIQ A;  1COW G;  4EGH A;  1KP3 A;  5LMN B;  4J7Z A;  1YSR A;  4I3H A;  3HYY A;  4GX2 A;  2CTQ A;  4JI7 O;  3P3N A;  3D0B A;  2JJ1 G;  2YEF A;  1U96 A;  3T10 A;  4BQG A;  2YS8 A;  3ASO C;  5BR8 B;  1AP6 A;  2XDS A;  2LGQ A;  4DUZ O;  1N36 B;  1GAX A;  4LF6 O;  4J7K A;  1YVW A;  5BMV B;  4DR2 O;  3RLQ A;  5JQG B;  4YY3 B;  3MHS C;  4FJC C;  3OUF A;  3STL C;  1JPX A;  3VQV A;  4NKG B;  4JI4 B;  2VWC A;  2JGU A;  3HB3 B;  4GT8 A;  2PNR A;  2B1I A;  4ZHQ A;  1MSW D;  1KYO F;  5LXT A;  4P8O A;  4YKW A;  2KG7 A;  3L70 H;  1HWY A;  4PDM A;  1OCR C;  2IOQ A;  2EBO A;  1BZK A;  1XNQ O; 
#chains in the Genus database with same CATH homology
 4UV8 A;  4Z1M G;  1FXK C;  3ZMU A;  2Q6A A;  3ZRV A;  1PD3 A;  2C2A A;  1E1Q G;  4LP8 A;  3MHH C;  2ITD C;  4R8C A;  2F43 G;  1MOF A;  3ETD A;  2WLJ A;  2ZR3 A;  4U7O A;  1KQS U;  2QE7 G;  1OZ0 A;  3ZMZ A;  4JTD B;  2EIK B;  4WFB V;  1H8E G;  1MG1 A;  1VQP V;  3F5W C;  1M1K W;  3FB5 C;  4Q20 A;  3ASO B;  1PNL A;  4RQF A;  2IJI A;  3AG1 B;  3ABL B;  2EZO A;  4JYB A;  2DYS B;  2EIN C;  4J9Y B;  1M57 C;  3QNE A;  1H2G A;  3T2M A;  1BMF G;  3ZIA G;  3B8N A;  4FMT A;  3LSS A;  5H6R A;  1NQT A;  4R6Z A;  4JPR A;  4PDL A;  4ASU G;  2AHY A;  1OCC C;  1QR8 A;  2WPD G;  4FK5 C;  3I56 V;  3E35 A;  4MVU A;  2XAG A;  4WF9 V;  3OR6 C;  5E1A C;  2EIL C;  1KC8 W;  4I5S A;  2OCC B;  1QR9 A;  2WWW A;  1QLE C;  4QJF B;  4UVA A;  2P6J A;  4PA9 A;  2HJF C;  1OCR B;  2IJH A;  5IY5 C;  3KG2 A;  1FXK B;  2PI4 A;  3E8H A;  4GT1 A;  4ZKI A;  4TWK A;  3ETG A;  1YI2 V;  1AJQ A;  4WCE V;  3ABT A;  4JAV A;  1M9N A;  5H6Q A;  1AJP A;  1K33 A;  5EBL C;  1YJW V;  4WFG A;  1M56 B;  2UXN A;  2ZR2 A;  1GM8 A;  4WFH A;  4J9Z B;  1JOY A;  5HFL A;  1F4M A;  2DYR C;  5B1N A;  2OTL V;  1RM1 C;  3CCR V;  1FXH A;  3K04 A;  3PJS K;  4RO2 A;  5IYB O;  3QO5 A;  4EKW A;  2EIN B;  2QM7 A;  1M57 B;  2ZQM A;  5GW7 A;  3AG3 C;  2JJ2 G;  3OUS A;  2JEX A;  4X88 A;  2A0L A;  4CZZ A;  4PA7 A;  4R7C A;  2P7T C;  2ZXW C;  1Y4M A;  3D36 A;  1QLN A;  1NH2 D;  1OCC B;  2HKO A;  2WLH A;  4X8A A;  3ZRW A;  4P2Z A;  3SPH A;  3ABK C;  3GB7 C;  3G71 V;  3F7V C;  2EIL B;  3OFN G;  4P9P A;  1NH2 B;  3BY6 A;  4WFF A;  1QLE B;  4BIZ A;  3W7T A;  3TCU A;  1SRY A;  5FL7 G;  4YXW G;  4QNH B;  3CME V;  1DLB A;  1S5H C;  2HG5 C;  4MW8 A;  1P4R A;  5H9C A;  3SPC A;  1DF5 A;  1E79 G;  1VQ4 V;  5IY5 B;  1YJN V;  5LGT A;  1IXM A;  1KP2 A;  2IJJ A;  3E83 A;  3TK1 A;  1K97 A;  4H33 A;  1M90 W;  3K03 A;  1EZJ A;  1V54 C;  3FYI B;  2KB1 A;  3HPL C;  4QE9 A;  2IJK A;  2WSS G;  4PA4 A;  4UV9 A;  1Q81 W;  4P30 A;  1JQ0 A;  3ZN1 A;  3JD3 A;  4LBE C;  2EIJ B;  2IH3 C;  3ZMV A;  1RPO A;  3QO7 A;  4WFA V;  2QA4 V;  3FB7 C;  3K9A A;  5B1A C;  1VQ5 V;  5L3B A;  4KUM A;  1DTO A;  1GM7 A;  4MSW C;  4FIP C;  5LHG A;  2CK3 G;  2Y69 B;  3RW0 A;  3SYA A;  1TUE B;  1H38 A;  2XAJ A;  1PL0 A;  3ZRX A;  3STZ C;  4E2L A;  3LDD A;  3LNM B;  1L1F A;  1SER A;  3OR7 C;  5L3F A;  2ITC C;  2ZXW B;  2B1G A;  1AJN A;  2QEX V;  2DWD C;  3CPW U;  1VQ6 V;  4LC1 A;  4PDV A;  3LSQ A;  3BEH A;  3AEI A;  3ASN C;  2UXX A;  3ABK B;  3W7W A;  2OT5 A;  4MVQ A;  1THZ A;  3CCL V;  2WLK A;  4QPJ A;  5EK0 A;  2A79 B;  3RVZ A;  1K9M W;  3WFV A;  1S0V A;  3OGC C;  1Q7Y W;  1GKF A;  3B77 A;  3B8M A;  3OE7 G;  3MD0 A;  2DQ3 A;  2AHZ A;  2P67 A;  1GM9 A;  1PNK A;  2ZDI A;  2WLI B;  3LDC A;  3EHB B;  3P30 A;  5B1O A;  1ROP A;  2W6I G;  4QPK A;  5L3E A;  1V55 C;  1R3J C;  1V54 B;  2ZDI C;  1K3E A;  1NR7 A;  3F7Y C;  1B6Q A;  2X6B A;  4G2K A;  1G4Y B;  3IFX A;  4N21 A;  1G8M A;  5LGN A;  1I5X A;  1YIJ V;  5EBW C;  3JD2 A;  5EBM C;  4MTO A;  3RBZ A;  4QIW F;  2X6C A;  3SPJ A;  1E1R G;  1YHQ V;  1R6K A;  4GX0 A;  3ETE A;  3FYE B;  3X2Q C;  3OAA G;  5CMU A;  3E8F A;  5B3S C;  2WLL A;  1QBZ A;  5LBQ A;  3W7S A;  3CCM V;  5LHI A;  5B1A B;  1UJW B;  1OCO C;  5LHH A;  3CC4 V;  1CPY A;  4TT3 G;  2B5U A;  3AG2 C;  1F4N A;  2PI5 A;  2H94 A;  4JAU A;  1W2B U;  1VQN V;  2QTO A;  4PEL A;  3CCU V;  2ATK C;  2YSU B;  4G28 B;  1W0J G;  5EC2 C;  1Q86 W;  1BL8 A;  2MK3 A;  3CD6 V;  1GMG A;  2IU0 A;  1FS0 G;  3ASN B;  3JD1 A;  5B1B C;  4G27 B;  3T4D A;  1KEC A;  3W7X A;  3P32 A;  3E8G A;  3DGE A;  4LCU C;  4MT8 A;  2XOK G;  3CMA V;  1AI6 A;  3OW2 U;  2K1E A;  1KKD A;  3SYO A;  3K0D A;  2GHY A;  2V7Q G;  1K8A W;  4XDK A;  3IGA C;  2R9R B;  4PA6 A;  1P7B A;  1VQ9 V;  3LUT B;  2W6J G;  3ZRS A;  3ZMS A;  1AR1 B;  2Q67 A;  1V55 B;  4JGS A;  1R3L C;  2WLN A;  3ABU A;  2P90 A;  1YTF D;  1K34 A;  1K73 W;  4MVO A;  5DM6 V;  3FB6 C;  3ZN0 A;  4WFE A;  2IH1 C;  3X2Q B;  3T1C A;  1YTF B;  2YEV A;  1K4C C;  4XDL A;  5KUK A;  2XAQ A;  5B3S B;  4F4L A;  1NVP D;  2NLJ C;  2H8P C;  1Y66 A;  1NJI W;  4I9W A;  1OCO B;  1VQK V;  2WLL B;  3E2E A;  1N8R W;  3AG2 B;  1K4D C;  1K7D A;  2X6A A;  1NVP B;  2FTK A;  3SJQ C;  1F51 A;  1SES A;  2NNU A;  4BAY A;  4BIU A;  2Y48 A;  1YJ9 V;  5KA5 A;  1GO3 F;  3ZMT A;  5CBG A;  3E89 A;  4MTG A;  1AI7 A;  5DN6 G;  2EIK C;  2QKS A;  1QVF U;  3UKM A;  3K06 A;  3NXS A;  1PNM A;  2WAM A;  4MTF A;  4BW5 A;  3CCJ V;  5B1B B;  3AG4 C;  4UVB A;  1ENV A;  1OHH G;  2DYR B;  5L3D A;  1RM1 B;  3AG1 C;  1KD1 W;  3ABL C;  3K79 A;  3OMI B;  2DYS C;  4QE7 A;  2OTJ V;  3OEH G;  1VQ8 V;  3ABM C;  2BOC C;  2ZD9 A;  3IC7 A;  3G4S V;  1S72 V;  3AG3 B;  3CYO A;  3CP1 A;  1S76 D;  2JEU A;  1AI4 A;  2M7W A;  5J9P C;  3I55 V;  4X89 A;  1PKX A;  4GCZ A;  4XBF A;  4OXS A;  1WLE A;  4DO2 A;  5L3G A;  2V1D A;  3K08 A;  3SPG A;  2XAF A;  5CBF A;  4DXW A;  2XND G;  3ZRW B;  3UM7 A;  2XAS A;  2JDI G;  4HYO A;  3OMN B;  1FXK A;  5KUM A;  2D3O W;  1JJ2 U;  3K3W A;  4MVS A;  2YEV B;  4PDR A;  2LFR A;  4GX1 A;  5HFM A;  1YIT V;  3CCV V;  3JD4 A;  2W0F C;  4RQE A;  1VQO V;  3CC2 V;  1CEZ A;  2HVK C;  2Q68 A;  1SET A;  4JAS A;  4P9O A;  1M56 C;  1OCZ C;  1FFT B;  1YSC A;  3WG7 C;  4PA3 A;  1AI5 A;  1XL4 A;  4MVR A;  2HR3 A;  2DWE C;  2X0L A;  4FPP A;  3G6E V;  2HLD G;  1JCH A;  1JVM A;  4HZ3 A;  3AG4 B;  4ZBM A;  4HAM A;  3CCE V;  3CCQ V;  3ML0 A;  1R3I C;  4JTC B;  3R65 A;  1CP9 A;  4KFM A;  2EJR A;  3QO8 A;  3W7U A;  2QM8 A;  3ABM B;  4RUE A;  1EBO A;  5CN0 A;  1ORQ C;  2HFE C;  4U7N A;  1Q82 W;  3SYC A;  4MS2 A;  3JYC A;  4GX5 A;  2LP7 A;  5IYC O;  1S77 D;  3OM3 B;  1R3K C;  1K92 A;  2GSM B;  1VQM V;  1EFR G;  1XL6 A;  3CCS V;  1ARO P;  1GK9 A;  3TET A;  4N23 A;  2EIM C;  3E86 A;  1F23 A;  5KA6 A;  3H01 A;  2JK5 C;  2LFS A;  2DQ0 A;  1S3J A;  3VOU A;  3D3I A;  5IYD O;  3JCZ A;  2X7R B;  4R50 A;  3K0G A;  4CBC A;  4UXN A;  3E8B A;  2EZP A;  2IW5 A;  1K5S A;  1DF4 A;  3LDE A;  5LGU A;  3OMA B;  1OCZ B;  1QCE A;  4H37 A;  1W0K G;  2WLM A;  5CBH A;  4KP4 A;  4MVZ A;  3WG7 B;  4XDJ A;  5IDJ A;  1VQL V;  2DW4 A;  1H8H G;  4UVC A;  1WPX A;  2EIJ C;  4TSF G;  4JTA B;  3EFF K;  1BHA A;  5L3C A;  4RUF A;  1FXV A;  2XAH A;  1VQ7 V;  2IU3 A;  1COW G;  3FKS G;  4UUJ C;  2Y69 C;  1R6N A;  2R9I A;  3SYQ A;  1RPR A;  1KP3 A;  2JIZ G;  1QVG U;  5BZB A;  3CC7 V;  1NKD A;  1J95 A;  4GX2 A;  1BHB A;  2Q69 A;  1MAB G;  2JJ1 G;  1NR1 A;  1LNQ A;  3A0R A;  3SYP A;  1JX9 A;  4JYC A;  1I5Y A;  4MTX A;  2EIM B;  3T4Z A;  3FB8 C;  5CA3 A;  3ASO C;  5EC1 C;  3CXC U;  3SPI A;  5C93 A;  2BOB C;  2WLI A;  3VBB A;  2HVJ C;  3DTU B;  3ZJZ A;  1R73 A;  3MHS C;  4FJC C;  3OUF A;  2Z5U A;  1JPX A;  3M99 B;  4JF3 A;  3STL C;  3HB3 B;  3GWO A;  1SZT A;  2B1I A;  1MSW D;  1GTO A;  3ZCC A;  4MW3 A;  2OCC C;  3JD0 A;  3RVY A;  4RAI A;  4MVM A;  1HWY A;  1K5Q A;  4L87 A;  4PDM A;  2A9H A;  1OCR C;  2Z3Y A;  2EBO A;  3OEE G;  1NBM G;  1ZWI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...