2FTKA

Berylloflouride spo0f complex with spo0b
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
181
structure length
181
Chain Sequence
ISDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEITSHECLIEIGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sporulation initiation phosphotransferase B
publication title The Crystal Structure of Beryllofluoride Spo0F in Complex with the Phosphotransferase Spo0B Represents a Phosphotransfer Pretransition State.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 68
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature ec 2.7.-.-:
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14682 SPOB_ab Sporulation initiation phospho-transferase B, C-terminal
A PF14689 SPOB_a Sensor_kinase_SpoOB-type, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ftkA01
3.30.565.30 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Sporulation initiation phosphotransferase B (SpoOB), C-terminal domain 2ftkA02
1IXMA 4GCZA 4JYCA 3TK1A 2LFSA 3NXSA 4U7OA 4ZKIA 5B1NA 4KP4A 2C2AA 4JAVA 4JASA 4QPJA 4BIZA 3ZCCA 4BIUA 2P67A 4JAUA 2WWWA 4QPKA 5C93A 3ZRXA 3ZRWA 4I5SA 4JYBA 2LFRA 3A0RA 2QM8A 3DGEA 3ZRVA 1F51A 4MTXA 3D36A 2FTKA 4FPPA 3MD0A 4U7NA 4LC1A 3ZRWB 4Q20A 5IDJA 5B1OA 1JOYA 3P32A 4MT8A 4FMTA 4GT1A 2QM7A
chains in the Genus database with same CATH superfamily
4CZZA 3FAVB 1MA1A 3T4ZA 1Y8NA 2C2AA 3ZMZA 2PNRA 2YI5A 4DRXA 3ZRSA 1O9GA 2WWWA 3SL2A 1Y74B 1SZTA 3SYAA 5DECA 1HNWO 2BT0A 4O4HA 4WFFA 1NI8A 1GO3F 1OCOB 1TC0A 3OMIB 4JYYA 1AJQA 3LDEA 1QQCA 4RO2A 2EIJC 4MVMA 2DYRC 4I0XB 3O9OA 3JAMN 3B2EE 5LA6A 2JGDB 2ZR3A 1WPXA 1QLNA 4BIZA 4O04A 4RQFA 4J11A 1ZAUA 3JSNA 2YKIA 3JASA 1P7BA 2IU0A 3AG7A 3QVNA 2BE3A 2Q73A 2BTOA 4URNA 1AMWA 3L74H 1ZXNA 3LNUA 2QWPB 5IJ9A 4NXNO 1SKVA 2BOBC 3BAAA 2QG2A 2XAFA 4YJ2A 1TUBB 4GCZA 2OTLV 2YUAA 3TUHA 4MP2A 2PYLA 3OTFA 5L3FA 3T1HB 4B3TO 4QPKA 2IOPA 2QEXV 3GIEA 2CUGA 5LMNO 4JI6B 4X1IB 4ZIBA 3HKDB 1YC4A 4RUEA 1NBMG 4FLVA 2IW5A 3U2KA 2XDXA 2NNUA 2V7QG 3APQA 4I55A 1JR9A 3BCCH 1Q6HA 3RYHB 3OR7C 2YE5A 1US7A 2UUBB 1K9MW 2HHHO 2QFOA 5FLXN 3OGIB 1AR5A 2EJ7A 4JI1B 5L3DA 3RGBA 1PNKA 1NH2B 1UYCA 1I5AA 5HFLA 2IJJA 2VW5A 3ZKDA 1HR0B 3ZHTA 2UXDO 4FVMA 4URLA 5LGTA 5IYBO 5IYCO 1XUQA 3M99B 5L3CA 4X64B 1BHAA 1QU7A 4ABMA 2HHIA 1YXBA 5BR8O 4I7ZB 1NH2D 1V55B 3JSLA 1WAZA 2HG5C 1RPOA 5KX5A 3RYIB 3SPCA 1KZNA 1TVKA 2AHYA 2UXBB 1EA6A 1BXDA 3AG3C 4KUMA 1OZ0A 2XT9A 1Q6IA 3GB7C 4DV2B 1FXKA 4UCSA 1VQ6V 2WLKA 5BZBA 3A0YA 5CA0A 5LYJB 3DXRA 1QCEA 4EB6A 1AROP 4NVPA 3WG7C 3INXA 4X20A 3WU2Z 5JENA 1N32O 1I0HA 3ETQA 4MPEA 3CYOA 2C1IA 3KZIZ 4OPAA 3T10A 4MTGA 4LF5O 1S14A 1MG1A 3VOUA 1VQ5V 1N4CA 2YC0A 5JCOC 4BW5A 2ZM6B 3W7TA 4LP0A 4B3MB 2BU2A 4LF7O 3EKRA 2YEVA 4QPJA 3B09A 1VIBA 1GM8A 5B5EZ 1PVGA 1KP2A 3ASNC 1I08A 1IBMB 1Q7YW 1FKAO 2LO1A 5EYPA 1EBOA 1Q86W 1IBLO 4TQDA 4KHPO 1L0LH 3QNEA 3SJAC 2Q8IA 4IT5A 1P49A 1NQTA 4TV9B 1B63A 4U3FH 4H0LB 4UVBA 3K5LA 4L93A 3ZEDA 3WFVA 5KMGB 4UV8A 4HBNA 5IJ0B 2JS3A 4E2LA 4YJ3B 2ZKOA 2OYQA 2KG7B 5GTIZ 3K0GA 1SC5B 5JJNB 2E5LB 4DUZO 3A0WA 3TXQA 4NH8A 3K3WA 3I5DA 2FYUH 3JCZA 4IHJA 4X66B 1AILA 2IJHA 3G4SV 2PUSA 4DUHA 2ZNJA 3MD0A 2YKCA 4BW9A 1UYHA 2YIBD 1QBZA 2B9ZA 4DXWA 4XC0A 2ODMA 2XJGA 3Q5JA 4GX0A 3RVYA 5KLVH 2BREA 3IEDA 1NTZH 2LJ2A 4ASFA 3R92A 4PV1B 4UXNA 2G38A 4H81A 2XDLA 4KFGA 2WLNA 5KHIA 1VF6C 1H8HG 4RAIA 2XHXA 2YECA 2EINB 3E8HA 1H2SB 3CP1A 4U93A 4J9YB 1YI2V 3B26A 1L1FA 2H8MA 2YEJA 4JI8B 1PNLA 2P90A 3K59A 1IXMA 2B1IA 3ABLB 4DZYA 4JI7O 3EHJA 4LNUA 1M90W 5KHHA 2W6IG 3LNNA 5D7RA 2DYSB 4JGSA 3JAWB 3N2GA 1SQFA 2ZDIA 2HVKC 4V26A 2P06A 2WLIA 2E75B 2YK2A 2WI6A 3ZN1A 2ESAA 1MABG 1W0KG 5EBWC 1IVSA 5H9CA 3SPGA 1US6A 4CWNA 3OTOO 2YGAA 2Y48A 3HKEB 3SYOA 1M56B 4GZRB 1QNMA 1OSFA 5E1AC 2A3QA 5GONA 1KU9A 4LWGA 4FLTA 5L3GA 3JAKB 1ZUQA 4MVZA 2YEAA 2YE8A 1ENVA 3FD9A 1YVWA 1K5QA 3FAVA 2Y69B 4BR6A 1XNRB 2X6CA 4X1KA 1G6UA 3ABMB 3KE6A 3EVKA 1YSZA 1NTKH 1QHTA 2WAMA 4YKXA 5M4NA 4X9QA 1Y74A 1WB7A 5D6PA 4A5UB 2OCHA 3ETEA 2QJ1A 2UXXA 2BCCH 4FCQA 3CXCU 4DV4O 1N36B 1Q8IA 2OWOA 1N33O 2RN9A 1YETA 4YHHB 2YEEA 1M9NA 3HEKA 4YKUA 2XAHA 4X65B 3F5TA 2FXSA 4I0XA 1I5BA 3HKBB 2JGDA 3APOA 2YI9A 4PI0A 2GDSA 1N0JA 4DV7B 2BOCC 3MHHC 1W59A 2ZINA 3NXSA 4EKWA 4CWFA 3BHPA 4LF8B 4QGPA 2EIKB 4BWAA 4ZHQA 3QO8A 3A0RA 4PI2A 1XNQB 1TUBA 4L8ZA 1F4MA 1H2LA 1X59A 4AWOA 2ZDYA 3CWBH 3LSUA 1YIJV 2QKCA 3B8NA 1YERA 4G2KA 4MVUA 3CGZA 1ORQC 4X1YB 1Y8OA 4X1IA 2F43G 2ITCC 2Q69A 3HKDA 3OWDA 4FFKA 1VQPV 4I9WA 1I5YA 3VQWA 2XDSA 2QM8A 4AQYB 3RYHA 1H7UA 2IOQA 4GQTA 4XITA 1VEWA 3SJBC 4C7UA 3B25A 2QTOA 3ZMSA 2IH3C 3T1YB 2ZE7A 1NJIW 4HAMA 4NTWA 4DR2B 4DR6B 1Y4MA 4JZGA 5B1BC 1S5LZ 4LWIA 4LFBO 3OD4A 2P5OA 1Y6XA 3BEHA 3STLC 2F95B 2EX3A 2QKAA 3E8FA 3R91A 3FB5C 3CJHB 1XBLA 3ZHVA 4ASAA 3CRQA 4N23A 1MMMA 4PD4F 5B1OA 4JYAO 1SS3A 5A2QN 3QO7A 1NR7A 2P4KA 1N0NA 5BY1A 2UUCO 1M5IA 4CBCA 2UXNA 3C3SA 4G28B 4HZ5A 3FT8A 3K58A 3D36C 3JD0A 3RYIA 1G8MA 2Q8HA 1VQ9V 1YZBA 5KUMA 1UYKA 2EZOA 4UVCA 1GN3A 5JJJB 1FXKB 4CH4A 1AH6A 4EB6B 3G75A 1L0NH 1U2OA 5B66Z 2GSMB 2YS8A 5LYJA 4R50A 1CPYA 4D6TH 1UY7A 4FZ1A 3LMMA 1U97A 3ZHSA 3UCSC 3BPZA 1J5EB 3T2SA 4V25A 4L90A 4OX9B 3ABKB 5B1NA 1B62A 4JI0B 3CYGA 5EC1C 2ZD9A 2B5UA 1HNZB 1K7DA 2MK3A 2YICA 2Q2EB 4H37A 1JJOA 2AXTZ 2QWQB 3K08A 4PDMA 2YJWA 3JD2A 4DO2A 3AEIA 5EYPB 2CTWA 3SPJA 4CWTA 1K4CC 4K4OA 4DV6B 4P8OA 3WHAA 1OHHG 3T0ZA 2CGNA 4W4LA 2EIMB 4YKYA 2H55A 4JTCB 1KIJA 1Q90D 1WPBA 2YI8A 4CE1A 4AS9A 1KKCA 1XHXA 3S5TA 4DR1O 2LW7A 1NHJA 2OCCB 1DK1A 1I5XA 5M4HA 4FPPA 5KMGA 3K60A 2DW4A 3F7VC 2CH7B 2YIBA 5IJ0A 2XX2A 4YJ3A 4AI8A 3CCRV 3PEHA 2KG7A 3UQ8A 3L73H 1FJGO 4LP8A 3PN1A 4ASUG 4W4KA 3JD3A 3ZMUA 5LMUB 2YJXA 2EZPA 4EEHA 2WI1A 5C93A 1D2DA 1R62A 1RM1C 1OCCB 3AG1B 2CK3G 4MPNA 4O0BA 4YKRA 5CA3A 2WI3A 2R9RB 4YKZA 4Z1MG 4TWKA 4P7AA 3FFQA 5LXTB 3N2KB 1I94B 5KHKA 2Z3YA 1NKDA 1NHHA 2OIGA 2RMKB 4OGQB 2DE0X 4GFNA 4RQEA 3IC7A 1MSWD 5FNDA 3INWA 1BE3H 3W7WA 3H4LA 5JQGB 4D7SA 2JGUA 1CP9A 2PY5A 1DLBA 1BT8A 2FTKA 2E76B 4FCPA 1B6QA 1CEZA 3J81N 2RNBA 3AK1A 5KHJA 1N34B 3MAQA 3HKCB 5L3BA 1KBHA 3ETDA 4HXWA 4WUDA 5CTXA 4HNAB 4YXWG 5EC2C 3HZ1A 1TAEA 3FB8C 4ZVIA 1BQ0A 4LF9B 2PI4A 3RW0A 5GONB 2E3CA 4FZ0A 1B3QA 2ZXWC 3HKEA 2XNDG 3H1LH 2D2CB 3CHXA 4KFMA 2XJJA 2R70A 5CTYA 3JAKA 4AHCA 2DYRB 3OM3B 2LFSA 1YJWV 3T1HO 4GGLA 4MVRA 4X1KB 3WQ9A 1KKDA 4LFAB 1E1QG 2HEPA 4OPHA 1QLEB 4JI6O 2HP8A 4EFEA 2BU5A 3RYFB 3B77A 5EZYA 4L87A 4LFCB 3CE2A 4I4TA 3RN4A 4UFZA 4O2BB 4PA6A 2XASA 5EIBC 1AM1A 2UU9B 1XI1A 2UUBO 2QGNA 4WBNA 5D7CA 3AG2C 1NVPB 2UUAB 2E74B 1FFXB 3JCUZ 1I59A 4JI1O 2HVJC 4GKKB 3RLRA 4BAEA 4CWQA 1JA8A 2K9PA 3U67A 1COWG 1HR0O 2WEQA 3HKBA 3CWVA 1XMOB 2Q0OC 1NHIA 4CH3A 2HLDG 1EN4A 1JPXA 4X64O 4LC1A 4R7CA 5E79Z 5KA6A 1K92A 4ZHQB 3OT7A 1QY8A 3AG4B 3R4NA 4WFEA 2YEGA 5ITZB 1H2MA 1FD9A 4AWQA 3BVOA 1YSRA 4CE2A 3L75H 4CS3A 3M8AA 1JX9A 2UXBO 2WI7A 1XDCA 4JAAA 2XJXA 1RP3B 3SPIA 4DV2O 1WJZA 2QA4V 4X1YA 5H6QA 5EK0A 4DR4B 3O2FA 4Q20A 4UCOA 1OCOC 2CAZC 3E89A 1GN4A 3RWRD 1Q43A 1VQ4V 2YEHA 3MNRP 5D7DA 1SA0B 3U0ZA 2JS5A 1UYMA 1PKXA 4KP4A 4LCUC 3UO3A 4LH6A 1EI1A 4FLXA 1YC1A 2ZIOA 4J80A 4XCJA 1F7YA 4TOIA 3ABUA 2D3OW 3VHAA 2VWCA 2Q8GA 4W7TA 5CBHA 2ZM6O 4K8ZA 3FX7A 4J7KA 4B3MO 1W0JG 4FMTA 1P84F 1IBMO 4PL9A 2XTAA 3CJHA 4XBFA 1MZEA 1VQKV 2ARHA 2GV9A 1THZA 5BXZA 4LF4B 1FAFA 1AJ6A 3SPHA 3SYCA 2QSAA 1QR8A 3OE7G 3LUTB 3T1KA 2OT5A 4DW1A 1M57B 3E2EA 1UY6A 3HR0A 4CWOA 2R72A 1ZX3A 3BY6A 1DF5A 4MVOA 1L8DA 3LDCA 4LPBA 3HYZA 4MPCA 2E5LO 3SR2C 1GRJA 1XILA 3ASNB 1UYIA 4X66O 4UV9A 5CN0A 2QF6A 3CCSV 3EKOA 3OGCC 4JV5B 4CWSA 4I9QA 4LWFA 1VQLV 4PHZA 4FLZA 1GH6A 4XDLA 1E79G 4B7PA 4B7KA 2ZCEA 2YE4A 3TXSA 2EXLA 3GVMA 4O4IB 4CC5A 1Z2GA 4NTXA 4NYKA 4JI5B 3LNMB 5C8YA 2DQ3A 5IY5B 3CCEV 3GIGB 1H38A 1V55C 3EFFK 3K0DA 5IWAB 4DR3B 2Q7EA 2YGEA 1SQXH 4B3SB 4IYHA 1VQNV 1LUVA 4R6ZA 4JI8O 1Z5AA 4PELA 3OR6C 1I7FA 3SJQC 1AI4A 4XD8A 2QWNB 5LHHA 3CCJV 4GKJB 3VQYA 4O4LB 4NH9A 1GKXA 4IL6Z 2C1GA 5CA1B 5L3JA 1L0OA 2O57A 2CDYA 5H6RA 2CH7A 5D6QA 1YT0A 3DTUB 1FXHA 5K1PA 3STZC 2FB5A 3ZBHA 3T4DA 3KCXA 1ZSPA 2WA4A 4AILC 2W0FC 1EZJA 5J2TA 4TQFA 1YITV 1TC6A 3WB1A 1T5EA 4JASA 3RLPA 3G6EV 4MP7A 4X62B 1GN2A 3QDDA 1KECA 1WNSA 3TTZA 1ZXMA 3CRMA 1XNRO 3OMUA 5LXTA 3N2KA 1VF5B 4MW8A 5IYZB 3G7EA 5JVDB 2BYHA 1GJVA 3Q5KA 1W2BU 1WN7A 5JQGA 1M93A 4NH7A 1GMGA 2YI7A 1UY8A 4ASGA 5FL7G 1BGQA 1XMQB 2ZE6A 1N36O 4XIPA 3JATA 3TZ0A 2L35A 5LHIA 4YHHO 1XREA 4DR5B 4LF6B 4X65O 2H8PC 2AZ0A 1K8AW 1WLEA 3HKCA 3S3WA 2VQEB 2Q4PA 1FXVA 5BODA 3BMYA 1Q6UA 2Q7HA 4DV7O 5IDJA 4PA3A 1S77D 4HNAA 1S3JA 3L70H 2WSSG 1MSDA 4DV1B 4J7JA 4ZI7B 2L6LA 2YI6A 4LF8O 3FB6C 4MVSA 4JAVA 5FNVB 3K99A 1V54C 3ZIAG 4DR7B 4QJFB 1XNQO 3OW6A 4E02A 3ZXQA 5F3KA 4JTDB 2WERA 3IAYA 2NR5A 4X9LA 1H8EG 2EINC 3LSSA 2Q67A 1ZL8B 1PL4A 4O05A 4CWRA 5EZYB 4I4TB 3H1HH 4MSWC 3BA9A 3RYFA 1HW7A 3ABLC 1YEWA 2W6JG 2LP7A 3AK2A 3GIFA 5B1AB 4EM7A 1H2NA 1R1BA 1OCRB 2WLJA 4O2BA 3T0HA 2DYSC 3K97A 1I5CA 4H7QA 4WBNB 4AQYO 2HG1A 4WUCA 4UB8Z 3B8MA 4H33A 1Y66A 4ZBMA 4DK0A 1K4DC 2YEDA 2HJFC 4JI4B 4MTXA 1UFIA 2QKSA 3T1YO 3SDLA 3L71H 1FFXA 1EN5A 3ZRWB 4DR2O 1H2KA 4HZ3A 4DR6O 5JH7B 2MW2B 3P32A 3EHGA 1R3LC 4JYCA 2IWXA 3ZHUA 3OEHG 5EBLC 1O9HA 2N05A 3ZHRA 2FKXA 4UCUA 2GQPA 1UYFA 3GWKC 1S72V 2XX5A 4QE9A 4YKQA 3DGEA 5ITZA 2RQ6A 3G67A 2Y69C 1CXZB 3MDSA 3O0IA 2AW9A 3CD6V 3ABMC 5M4PA 2K5BA 2IH1C 3BA8A 1Z5CA 3B24A 4NR1A 3WB2A 4F6EA 3QG5A 5B1BB 4FLWA 5H2FZ 3C90A 2F1MA 4GUNA 2GBOA 3ASOC 5CPHA 4JI3B 2EILC 3EXAA 1AI6A 3QO5A 3TZ5A 2BSKA 3E83A 2P7TC 5BOCA 2VCJA 1UYLA 1SA0A 2KSDA 1THNA 2XHTA 1B06A 2JEUA 1FYJA 1J5EO 4FIPC 1AJPA 4OX9O 3HB3B 1NR1A 4JI0O 2Y4UA 2AKPA 1HNZO 1S16A 4CH6A 1MOFA 5B3SB 3ABTA 2O1WA 1QYEA 3CRLA 4EGKA 3F5WC 4NXMB 4WUBA 2EIKC 3L9DA 4I5SA 4YIOA 4XTJA 2JJCA 2YGFA 1Z5VA 1S5HC 4TT3G 4DV6O 1BHBA 1TIDA 2YXHA 3W7UA 3ZMVA 3ZKBA 5FPRA 3CGYA 3H80A 3ML0A 5TISZ 2M6YA 5F5RA 2YSUB 4PDVA 3NMQA 3RVZA 1YSCA 2BU6A 2BTQA 3LPSA 4PU9A 3X2QC 5CF0A 5JCOA 2X6AA 1YCIA 5DN6G 1BSMA 1SQBH 4BQGA 1TH8A 1LUWA 4X88A 5LMUO 2VCIA 4WFAV 4EGHA 1S5JA 4U3JB 4O2AA 2KB1A 4K0KB 4RUFA 2M7WA 1RPRA 3DC6A 1H2GA 1SQGA 1SZXA 1TBWA 5C8YB 1IURA 1VQMV 4O4IA 3D3QA 3E8GA 4Z2WA 1I94O 5LP6B 5EBMC 2HKJA 4U7NA 4B6CA 5FNCA 1NZ6A 5IDMA 3JALB 4JI2B 1V9PA 1HDJA 3GIGA 4IGGA 1BL8A 4E00A 4F6RB 3CPWU 1SESA 4H85A 2HFEC 1VQOV 1ZTEA 5IT9N 1P4RA 4DV3B 1FXKC 3ZXOA 2HR3A 2GFDA 1OCZB 4JQLA 1BZKA 1N34O 2XHRA 5DEDA 4RWUA 2YDEA 2EULA 2PF4E 4DV0B 5LGUA 4O4LA 2V4DA 3A0TA 1F23A 2GTAA 1UJWB 1S0VA 1ZLZA 5CA1A 1XEQA 1VQ8V 4XDMA 1UYDA 1YDXA 3JZ3A 1EZVH 4B3RB 3ABKC 5KHGA 4LF9O 4PDLA 3CRAA 3ZMTA 2CTPA 5J2TB 4WCEV 2QR4A 3VHCA 4UVAA 3SJCC 1U96A 4XKOA 1P7GA 2NN4A 4J41A 3OEEG 4LWEA 5M4EA 4Q6GA 5J6AA 5KUKA 4O07A 5FWKA 1OV9A 4UROA 4LFAO 3HHUA 1IXBA 5CBFA 3OAAG 4GLXA 5IYZA 3OUFA 2Q8FA 5JVDA 4J10A 4LFCO 4FFBB 3RKZA 4GEEA 4OXSA 2YE3A 1I58A 1RSOB 2ZXWB 4FM1A 3JATB 2OCCC 2UU9O 4B7EA 2NLJC 4EGIA 3CXHF 2UUAO 3D3IA 1R6KA 4NB5A 1YJNV 5DM6V 4GKKO 4KQVA 5J71A 3K5OA 3BRCA 2DWDC 1XMOO 2X6BA 2OTJV 1KMIZ 2XD6A 2WA3A 4BIOA 4CS4A 3ZJZA 5KAIZ 1OCCC 3AG1C 2DN9A 2JJ2G 3O6OA 3RFRA 3CRCA 1JVMA 2QE7G 1Z59A 4ZI7A 3PJSK 4HY1A 2A7WA 2BU7A 5FNVA 4YY3B 3L72H 2VS0A 3J80N 2EIJB 4R3MA 4XCLA 2OIEA 1PPJH 3U2DA 3ICXA 1K5SA 1HNXB 3HZ5A 1YJ9V 3VADA 1ZL8A 1KC8W 1SETA 2CG9A 1D5AA 4KSGA 1VMGA 4DR4O 4E72A 4QIWF 2X7RB 2H94A 4PDRA 4WFBV 2VQFB 2ZE5A 1MZFA 3KG2A 1K3EA 2R9AA 1UY9A 5F2VO 2YI0A 2ZDIC 1AJNA 1TILA 3K03A 3R4MA 1YS3A 4FLUA 2Q8VA 3ZCCA 2BRCA 1LR1A 3ZRWA 5JH7A 4JPRA 2RJZA 5IN9A 2YE6A 2BZ5A 1NTMH 4F4LA 4MTOA 1XHZA 3QTCA 1NVPD 1PNMA 2VRZA 2DOSA 2UXCB 4MS2A 2R9IA 3Q4HB 5D5PA 2QTSA 4I50B 3MHSC 1DGSA 3H1KH 2LQTA 4HYOA 3U10A 4LF4O 3R4OA 2CE4A 2AHZA 3IC9A 4E4EA 1QLEC 4MW3A 1IBKB 2RCVA 1M4UA 3D2RA 4ICGA 2LFRA 2X0LA 2IJIA 4AWPA 1SQVH 1KYOF 1JJ2U 4D7TA 2A79B 4HXZA 2JJ1G 4QNHB 2BSKB 2YEFA 2XAQA 1K33A 4DUYB 3CCQV 3HPLC 2ATKC 2A9HA 1XQ8A 3OWBA 1EN6A 3D0BA 4K8XA 3JARB 4JV5O 3B40A 2ZE8A 3R65A 3CCVV 1MU5A 3O65A 1AVMA 3K57A 2WEPA 1A4HA 5H5NA 1WP7A 3CC7V 3AG3B 1ROPA 3D36A 1TA8A 3FT5A 3C11A 3ZM7A 4JI5O 2YIDA 1HNWB 1D5NA 5CTWA 4BQJA 3EHHA 3U11A 3AG4C 2GTSA 3TK1A 3A0ZA 2PTMA 4PRVA 3WG7B 5IWAO 4DR3O 2WPDG 3E86A 4FM0A 4B3SO 4UCRA 4DK1A 3OMAB 3AK3A 4G27B 4CC6A 2YE9A 2GHYA 4ZOLB 2BTQB 2CGFA 3TZ2A 1GKZA 1JQ0A 2A06H 3UT5A 1BGYH 1EFRG 2A0LA 4WFGA 4GKJO 4NXNB 1UYGA 3K79A 1OJHA 4MVQA 3CCUV 4O4JB 1GAXA 1MX0A 2IM9A 4J7ZA 2P67A 2WI4A 2QM4A 3W7XA 3TCUA 4P30A 1XOUA 3FYEB 2CCUA 1QR9A 3OMNB 4B3TB 4O2AB 1AI5A 4LWSB 4XDKA 2XCMA 3A8TA 5LMNB 5LOVB 4KTNA 1UPGA 4U3JA 1JOYA 2JDIG 4TSFG 4CS2A 1Y4UA 4P9OA 4CE3A 4X62O 3FYIB 2YEIA 5LBQA 1KP3A 2XAGA 2XUMA 4J42A 3P3PA 5LGNA 5J2UB 1Z5BA 4MBCA 5HFMA 5LP6A 5CTUA 4L94A 2PI5A 2N74A 2HHHB 2ZNIA 2ZIMA 3JALA 1Y4SA 4YKTA 1WP8A 4UB6Z 2DJVA 1J95A 1M57C 4F6RA 3CSXA 3JD4A 3SYQA 4O09A 3H1IH 2UXDB 1XMQO 1AP6A 4IYIA 3H9VA 4PRXA 3CX5F 4DR5O 4ZKIA 4LF6O 2KKWA 5IE9A 1Q81W 4GX1A 3I56V 1PM9A 2VQEO 1JCHA 5BR8B 2XAJA 3Q5LA 2WLMA 2XOKG 3DC5A 1YHQV 1AP5A 2CH4A 1KUQA 4DV1O 5GGZA 3A2FA 4J9ZB 4JTAB 3M7MX 3CCMV 4NKGB 1YT1A 4DR7O 2JEXA 5IY5C 3KCYA 2GUZB 5LL6Y 2JVDA 1WA8A 3CEIA 2FWZA 1VP7A 2PYJA 1TGOA 4LH7A 3OFNG 2FYPA 3UM7A 1YC3A 5M4KA 2WI5A 3E22B 5AG2A 4BAYA 1N32B 2WI2A 4UCTA 4HZ0A 1UYEA 4LF5B 2QM7A 4XIQA 2WLLB 4FFBA 4FJCC 3FV5A 1RSOA 1Y8PA 1V54B 3TJTA 3EHFA 4FCRA 3OPDA 4JI4O 4LF7B 4E01A 2DWEC 3I55V 4LBEC 1DTOA 1B04A 2QWRB 3KKYA 1JMKC 5GW7A 3OW2U 3QTFA 3ZRVA 3UO2A 2FL4A 1F51A 4XIRA 1SF9A 4KXRA 4P2ZA 4WF9V 1GM7A 1IBLB 3RBZA 4PA7A 4KHPB 1TUEB 3CMEV 3LDDA 2XK2A 1K97A 4MB9A 1Y76B 3P3NA 4YKWA 5KAFZ 3R66A 4TV8B 2Z5UA 3NR7A 3N27A 4TUYA 4FK5C 3RYCB 1IZ3A 5BMVB 4JAUA 1QVFU 4GX2A 2HJDA 4L8JA 3ZS8C 1MNGA 5CB4B 2YK9A 4DUZB 3VHDA 2Q6AA 1K73W 3R4PA 3DSQA 4PJ0Z 3ZX6A 4KSHA 4H44B 3ZN0A 3WB0A 4P9PA 3K98A 4GT8A 4LR3A 2XABA 2VWKA 2N04A 4JI3O 1U0ZA 1JFFB 2PGGA 3B27A 2O1UA 4IIJB 1I5DA 3C0EA 2BSMA 4EFUA 2Y0PA 1BYQA 3S3XA 5JJEB 3A0XA 2JIZG 4NTYA 1XL4A 4DRXB 3E8BA 4HY6A 3P30A 3PEJA 4XKAA 5FPOA 2AZ2A 5J9PC 3CCLV 3CB2A 1AR4A 5IYDO 2Y4TA 4O4HB 1YTFB 4XDJA 4MOTA 3RLQA 1FS0G 4U7OA 4NXMO 2ZDXA 1ZWHA 1M56C 2DQ0A 2Q5ZA 3ASOB 3B4SA 3FB7C 2VWJA 2EILB 1QVGU 2ZT9B 4BIUA 2ILMA 4JI7B 3J7AU 3TGUH 1SQPH 5LA6B 2Z0AA 2QDOA 3A0HZ 4ASBA 2ZR2A 2CTRA 2Y0IA 3IJ4A 1K34A 2V1DA 4H13B 4X89A 2ADPA 4UCVA 3Q4HA 3JASB 1YTFD 4X8AA 4I50A 4GT1A 1HWYA 2QG0A 2LGQA 2E0AA 3H1JH 3IFXA 2Q68A 5IJ9B 4CH5A 2AGAA 5B1AC 3OTOB 2YKBA 2ZQMA 4YJ2B 1OCRC 5JWPA 1R3IC 3CRRA 2FMLA 4I3HA 3TETA 4PA9A 4BXIA 3W7SA 3VQXA 3LSQA 2ZBKB 1RFYA 1R73A 1NT2B 2XDUA 2P6JA 5K1XA 3CC4V 4JF3A 1E1RG 3IGAC 1KD1W 1SQQH 3JARA 1NU1H 4K0KO 2F66C 1PP9H 2F93B 4I55B 2F23A 3G7BA 3X2QB 4EEQA 3BFRA 4K3AA 4DV4B 4KL1A 2LGWA 4MTFA 5LHGA 1N33B 5GTHZ 3UKMA 1H7SA 2IJKA 5L3EA 4JI2O 1R6NA 4XE2A 1YT2A 1IDSA 3G71V 2HKOA 3SYPA 1XL6A 2HCHA 2EJRA 4WFHA 1GTOA 2PZSA 4DV3O 3UT5B 1IX9A 1WB8A 2IORA 4ZOLA 3TZ4A 4DV5O 3K04A 1Y67A 1Z5WA 2UWDA 4DV0O 1Q3EA 2W0XA 1X4TA 2YKJA 3CRKA 1DF4A 2ZKJA 4YIPA 5KX5B 4URMA 1TVKB 4B3RO 4O4JA 4Z1VA 5KA5A 1BCCH 3QF7A 1GM9A 4LWSA 5B3SC 4R8CA 5CA0B 5LOVA 3ZRXA 3F7YC 3DXRB 4JYBA 1S76D 2XDKA 3BM9A 4DYLA 4B08A 1BKNA 2YIAA 4X20B 2H3OA 1AI7A 1G4YB 5J2UA 5CMUA 2YXYA 4FM2A 2BYIA 1KB9F 2B1GA 1QZRA 3OUSA 2EBOA 3K06A 4EFTA 1BS3A 2CTQA 1BQZA 1N8RW 4K35A 4HYMA 2Q9LA 1M1KW 1RM1B 2DMXA 2K1EA 2YEVB 4LFBB 4DV5B 1LNQA 1AH8A 1A32A 1KQSU 2YE2A 3T2MA 2XX4A 2P4VA 1PD3A 1G1XB 1AR1B 1SRYA 4JYAB 4R1FA 1R6TA 2UUCB 1VF6A 2WLHA 4QE7A 3ZHQA 3K5NA 1Q82W 1JM6A 2CGOA 3D8CA 3SGIA 2QWOB 1HP8A 2IU3A 2ITDC 4TV9A 1FFTB 2YXLA 2YE7A 3CS5A 4CWPA 3T1CA 3JYCA 2F4VO 1ZWIC 3VQVA 4YY3O 5LP6C 3BABA 1WA8B 4HYPA 3K9SA 3RT3C 2GUZA 4IHJB 2YKEA 1ZW9A 2IBZH 2IWSA 2XHBA 1HNXO 2CCSA 3A0BZ 2EIMC 3G80A 1EM1A 3E22A 2O1VA 1GN6A 4PA4A 1BMFG 2FWYA 1PL0A 3JD1A 2ETNA 2LW1A 2VQFO 1OCZC 1VARA 2WLLA 1F4NA 5FNFA 3K9AA 3H01A 2IWUA 5CBGA 1FPOA 4MT8A 2BU8A 3K5MA 1URFA 1SERA 3VBBA 2P22C 3HYYA 3ETGA 4FLYA 2CCTA 3C3TA 1R3JC 4DW0A 1YESA 4LNUB 4JZ2A 3B28A 3GWOA 4LWHA 4TUYB 4DR1B 1Y76A 2RDCA 4N21A 4TV8A 2UXCO 4R3AA 4L91A 3N2GB 1VQ7V 4XKKA 3RYCA 3E35A 1GK9A 5D5QA 4GX5A 2WLIB 2F4VB 3AG2B 5BMVA 2Q0AA 1R3KC 3JAWA 3CMAV 3FKSG 4GYCB 3G6BA 2BTZA 1PV0A 1IBKO 2JRIA 5CB4A 1YF2A 1FJGB 1Q5OA 3THOA 5M4MA 1GKFA 3CC2V 2JK5C 2JKIA 1ID0A 5EIBD 1VF7A 1NS1A 2ADQB 4EFBA 4EMVA 1JFFA 3EHBB 4DUYO 2Q7GA 2YEBA 4UUJC 1AB3A 4IIJA 5A9GA 2KQXA
chains in the Genus database with same CATH topology
4P9OA 4MSWC 4CZZA 3ABLC 3FYIB 2W6JG 5LBQA 1KP3A 2XAGA 3T4ZA 2LP7A 5LGNA 3ABKB 5B1AB 5B1NA 2C2AA 1OCRB 2WLJA 5EC1C 3ZMZA 2ZD9A 3ZRSA 5HFMA 2DYSC 2B5UA 2WWWA 1K7DA 2MK3A 2PI5A 3B8MA 4H33A 1SZTA 4H37A 3SYAA 1Y66A 4ZBMA 1K4DC 3K08A 2HJFC 4WFFA 4MTXA 4PDMA 2QKSA 3JD2A 4DO2A 3AEIA 1J95A 1GO3F 1M57C 3ZRWB 1OCOB 3JD4A 3OMIB 4HZ3A 3SYQA 3P32A 3SPJA 1AJQA 1K4CC 1R3LC 3LDEA 4RO2A 2EIJC 4JYCA 1OHHG 2DYRC 4MVMA 4ZKIA 2EIMB 4JTCB 2ZR3A 1WPXA 1Q81W 1QLNA 4BIZA 3OEHG 5EBLC 4RQFA 4GX1A 3I56V 1JCHA 1P7BA 2IU0A 1S72V 4QE9A 2XAJA 2OCCB 2WLMA 2XOKG 3DGEA 1YHQV 1I5XA 4FPPA 2DW4A 2Y69C 3F7VC 3CD6V 3ABMC 2BOBC 2XAFA 4J9ZB 2IH1C 3CCRV 4JTAB 4GCZA 3CCMV 2OTLV 4LP8A 5B1BB 4ASUG 3JD3A 2JEXA 5IY5C 3ZMUA 3ASOC 2EZPA 2EILC 5L3FA 4QPKA 1AI6A 5C93A 3QO5A 2QEXV 1RM1C 1OCCB 3AG1B 2CK3G 3E83A 3OFNG 2P7TC 3UM7A 4BAYA 5CA3A 2R9RB 4RUEA 1NBMG 2IW5A 4Z1MG 4TWKA 2JEUA 4FIPC 2NNUA 2V7QG 1AJPA 3HB3B 1NR1A 2Z3YA 1NKDA 2QM7A 2WLLB 3OR7C 4RQEA 3IC7A 4FJCC 1MSWD 1K9MW 1V54B 3W7WA 1MOFA 5B3SB 3ABTA 3F5WC 2DWEC 3I55V 4LBEC 1DTOA 5L3DA 1PNKA 2EIKC 4I5SA 5GW7A 1NH2B 3OW2U 5HFLA 2IJJA 3ZRVA 1F51A 1CP9A 1DLBA 2FTKA 5LGTA 4TT3G 1S5HC 4P2ZA 5IYBO 1B6QA 4WF9V 1GM7A 3RBZA 4PA7A 5IYCO 1CEZA 3M99B 1BHBA 3W7UA 1TUEB 3ZMVA 3CMEV 3LDDA 5L3CA 5L3BA 1BHAA 1K97A 3ML0A 3ETDA 2YSUB 4PDVA 2Z5UA 3RVZA 4FK5C 1YSCA 4YXWG 1NH2D 5EC2C 1V55B 3FB8C 4JAUA 1QVFU 4GX2A 3X2QC 2PI4A 2HG5C 1RPOA 3RW0A 3SPCA 2X6AA 2AHYA 3AG3C 5DN6G 2ZXWC 2Q6AA 1K73W 2XNDG 4KUMA 1OZ0A 3GB7C 4KFMA 3ZN0A 4P9PA 4X88A 1FXKA 2DYRB 2WLKA 5BZBA 1VQ6V 3OM3B 2LFSA 4WFAV 1YJWV 1QCEA 4MVRA 1KKDA 1AROP 1E1QG 2KB1A 1QLEB 4RUFA 3WG7C 2M7WA 1RPRA 1H2GA 3B77A 2JIZG 3CYOA 4L87A 1VQMV 1XL4A 3E8GA 4PA6A 5EBMC 4MTGA 3E8BA 2XASA 4U7NA 1MG1A 3VOUA 3P30A 1VQ5V 5J9PC 3CCLV 5IYDO 4BW5A 1YTFB 3AG2C 4XDJA 3W7TA 1NVPB 1FS0G 4U7OA 1BL8A 1M56C 2HVJC 2DQ0A 3FB7C 3ASOB 3CPWU 1SESA 2YEVA 4QPJA 2EILB 1GM8A 2HFEC 1QVGU 1KP2A 3ASNC 1VQOV 4BIUA 1Q7YW 1COWG 1P4RA 1FXKC 1EBOA 2HR3A 1Q86W 1OCZB 3QNEA 2ZR2A 1K34A 2HLDG 2V1DA 4X89A 1JPXA 4LC1A 1NQTA 4R7CA 5LGUA 1YTFD 4X8AA 5KA6A 1K92A 3AG4B 1F23A 1UJWB 1S0VA 4UVBA 4WFEA 4GT1A 1HWYA 1VQ8V 3WFVA 3IFXA 2Q68A 3ABKC 4UV8A 5B1AC 2ZQMA 1OCRC 4E2LA 1R3IC 4PDLA 3K0GA 1JX9A 3ZMTA 3TETA 4PA9A 3W7SA 3LSQA 3K3WA 4WCEV 1R73A 3SPIA 3JCZA 2IJHA 2P6JA 3G4SV 4UVAA 3MD0A 2QA4V 3OEEG 5H6QA 3CC4V 5EK0A 4Q20A 4JF3A 1OCOC 1E1RG 3IGAC 5KUKA 1KD1W 3E89A 1VQ4V 1QBZA 4DXWA 5CBFA 3OAAG 4GX0A 3RVYA 1PKXA 4KP4A 4LCUC 3OUFA 4OXSA 3X2QB 4UXNA 2WLNA 3ABUA 2D3OW 2ZXWB 1H8HG 4RAIA 2OCCC 4MTFA 5LHGA 2EINB 3E8HA 3UKMA 2NLJC 5CBHA 2IJKA 5L3EA 3CP1A 1R6NA 4J9YB 1YI2V 1L1FA 3G71V 2HKOA 3SYPA 1XL6A 1W0JG 3D3IA 1PNLA 1R6KA 2P90A 4FMTA 1YJNV 1IXMA 2EJRA 4WFHA 5DM6V 2B1IA 3ABLB 1GTOA 1M90W 2W6IG 2DWDC 2DYSB 2X6BA 4XBFA 2OTJV 1VQKV 4JGSA 3K04A 1THZA 3ZJZA 1OCCC 3AG1C 2JJ2G 3SPHA 3SYCA 2ZDIA 2HVKC 2WLIA 1QR8A 1JVMA 3OE7G 3LUTB 2QE7G 2OT5A 3ZN1A 1MABG 1M57B 1W0KG 5EBWC 5H9CA 1DF4A 3E2EA 3PJSK 3SPGA 3BY6A 1DF5A 4MVOA 2EIJB 2Y48A 3LDCA 3SYOA 5KA5A 1M56B 5E1AC 1GM9A 3ASNB 5L3GA 5B3SC 1K5SA 4R8CA 4MVZA 4UV9A 5CN0A 1YJ9V 3ZRXA 3CCSV 1SETA 3F7YC 1KC8W 4JYBA 1S76D 3OGCC 1ENVA 1VQLV 1K5QA 4QIWF 2X7RB 2H94A 4XDLA 1E79G 4PDRA 2Y69B 4WFBV 2X6CA 1AI7A 3ABMB 1G4YB 3KG2A 1K3EA 5CMUA 2WAMA 2ZDIC 1AJNA 3LNMB 2B1GA 3OUSA 2DQ3A 2EBOA 3K03A 3K06A 3ETEA 5IY5B 2UXXA 1N8RW 3ZCCA 3CXCU 3CCEV 1M1KW 1H38A 1V55C 3EFFK 1RM1B 3K0DA 3ZRWA 1M9NA 2K1EA 2YEVB 4JPRA 1LNQA 1VQNV 1KQSU 2XAHA 4R6ZA 4PELA 3OR6C 4F4LA 3T2MA 4MTOA 3SJQC 1AI4A 1NVPD 1PNMA 5LHHA 3CCJV 1PD3A 1AR1B 2BOCC 3MHHC 4MS2A 2R9IA 1SRYA 3NXSA 4EKWA 3MHSC 2WLHA 4QE7A 4HYOA 1Q82W 2AHZA 1QLEC 2IU3A 2ITDC 4MW3A 2EIKB 1FFTB 5H6RA 2LFRA 2X0LA 3QO8A 3A0RA 2IJIA 3T1CA 3JYCA 3DTUB 1ZWIC 1F4MA 1FXHA 1JJ2U 3STZC 2A79B 2JJ1G 3T4DA 4QNHB 2W0FC 2XAQA 1EZJA 1YIJV 1K33A 3B8NA 4G2KA 3HPLC 2ATKC 3CCQV 1YITV 4MVUA 1ORQC 2A9HA 2EIMC 4JASA 2F43G 2ITCC 3G6EV 2Q69A 3R65A 3CCVV 4PA4A 1BMFG 1KECA 1PL0A 1VQPV 3JD1A 4I9WA 1I5YA 4MW8A 1OCZC 2QM8A 3CC7V 3AG3B 2WLLA 1F4NA 1ROPA 3D36A 2QTOA 3ZMSA 2IH3C 1W2BU 3K9AA 3H01A 5CBGA 3AG4C 4MT8A 1NJIW 4HAMA 1GMGA 5FL7G 3TK1A 1Y4MA 1SERA 3VBBA 5B1BC 3WG7B 5LHIA 3ETGA 2WPDG 1R3JC 3E86A 3BEHA 2H8PC 3STLC 1K8AW 3E8FA 3OMAB 4G27B 3GWOA 1WLEA 3FB5C 2GHYA 4N21A 1FXVA 1JQ0A 4N23A 1EFRG 5IDJA 1VQ7V 5B1OA 4PA3A 1S77D 3E35A 2A0LA 1S3JA 3QO7A 1GK9A 4WFGA 4GX5A 2WLIB 1NR7A 3AG2B 2WSSG 4CBCA 2UXNA 4G28B 1R3KC 3CMAV 3FKSG 3JD0A 3K79A 3FB6C 1G8MA 4MVSA 4JAVA 1VQ9V 1V54C 5KUMA 4MVQA 3CCUV 2EZOA 4UVCA 3ZIAG 4QJFB 2P67A 1GKFA 3CC2V 1FXKB 3W7XA 3TCUA 2JK5C 4P30A 4JTDB 3FYEB 1QR9A 3OMNB 4XDKA 1AI5A 1H8EG 2EINC 3LSSA 2GSMB 4R50A 1CPYA 2Q67A 3EHBB 1JOYA 2JDIG 4TSFG 4UUJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IXM A;  4GCZ A;  4JYC A;  3TK1 A;  2LFS A;  3NXS A;  4U7O A;  4ZKI A;  5B1N A;  4KP4 A;  2C2A A;  4JAV A;  4JAS A;  4QPJ A;  4BIZ A;  3ZCC A;  4BIU A;  2P67 A;  4JAU A;  2WWW A;  4QPK A;  5C93 A;  3ZRX A;  3ZRW A;  4I5S A;  4JYB A;  2LFR A;  3A0R A;  2QM8 A;  3DGE A;  3ZRV A;  1F51 A;  4MTX A;  3D36 A;  2FTK A;  4FPP A;  3MD0 A;  4U7N A;  4LC1 A;  3ZRW B;  4Q20 A;  5IDJ A;  5B1O A;  1JOY A;  3P32 A;  4MT8 A;  4FMT A;  4GT1 A;  2QM7 A; 
#chains in the Genus database with same CATH topology
 4CZZ A;  3FAV B;  1MA1 A;  3T4Z A;  1Y8N A;  2C2A A;  3ZMZ A;  2PNR A;  2YI5 A;  4DRX A;  3ZRS A;  1O9G A;  2WWW A;  3SL2 A;  1Y74 B;  1SZT A;  3SYA A;  5DEC A;  1HNW O;  2BT0 A;  4O4H A;  4WFF A;  1NI8 A;  1GO3 F;  1OCO B;  1TC0 A;  3OMI B;  4JYY A;  1AJQ A;  3LDE A;  1QQC A;  4RO2 A;  2EIJ C;  4MVM A;  2DYR C;  4I0X B;  3O9O A;  3JAM N;  3B2E E;  5LA6 A;  2JGD B;  2ZR3 A;  1WPX A;  1QLN A;  4BIZ A;  4O04 A;  4RQF A;  4J11 A;  1ZAU A;  3JSN A;  2YKI A;  3JAS A;  1P7B A;  2IU0 A;  3AG7 A;  3QVN A;  2BE3 A;  2Q73 A;  2BTO A;  4URN A;  1AMW A;  3L74 H;  1ZXN A;  3LNU A;  2QWP B;  5IJ9 A;  4NXN O;  1SKV A;  2BOB C;  3BAA A;  2QG2 A;  2XAF A;  4YJ2 A;  1TUB B;  4GCZ A;  2OTL V;  2YUA A;  3TUH A;  4MP2 A;  2PYL A;  3OTF A;  5L3F A;  3T1H B;  4B3T O;  4QPK A;  2IOP A;  2QEX V;  3GIE A;  2CUG A;  5LMN O;  4JI6 B;  4X1I B;  4ZIB A;  3HKD B;  1YC4 A;  4RUE A;  1NBM G;  4FLV A;  2IW5 A;  3U2K A;  2XDX A;  2NNU A;  2V7Q G;  3APQ A;  4I55 A;  1JR9 A;  3BCC H;  1Q6H A;  3RYH B;  3OR7 C;  2YE5 A;  1US7 A;  2UUB B;  1K9M W;  2HHH O;  2QFO A;  5FLX N;  3OGI B;  1AR5 A;  2EJ7 A;  4JI1 B;  5L3D A;  3RGB A;  1PNK A;  1NH2 B;  1UYC A;  1I5A A;  5HFL A;  2IJJ A;  2VW5 A;  3ZKD A;  1HR0 B;  3ZHT A;  2UXD O;  4FVM A;  4URL A;  5LGT A;  5IYB O;  5IYC O;  1XUQ A;  3M99 B;  5L3C A;  4X64 B;  1BHA A;  1QU7 A;  4ABM A;  2HHI A;  1YXB A;  5BR8 O;  4I7Z B;  1NH2 D;  1V55 B;  3JSL A;  1WAZ A;  2HG5 C;  1RPO A;  5KX5 A;  3RYI B;  3SPC A;  1KZN A;  1TVK A;  2AHY A;  2UXB B;  1EA6 A;  1BXD A;  3AG3 C;  4KUM A;  1OZ0 A;  2XT9 A;  1Q6I A;  3GB7 C;  4DV2 B;  1FXK A;  4UCS A;  1VQ6 V;  2WLK A;  5BZB A;  3A0Y A;  5CA0 A;  5LYJ B;  3DXR A;  1QCE A;  4EB6 A;  1ARO P;  4NVP A;  3WG7 C;  3INX A;  4X20 A;  3WU2 Z;  5JEN A;  1N32 O;  1I0H A;  3ETQ A;  4MPE A;  3CYO A;  2C1I A;  3KZI Z;  4OPA A;  3T10 A;  4MTG A;  4LF5 O;  1S14 A;  1MG1 A;  3VOU A;  1VQ5 V;  1N4C A;  2YC0 A;  5JCO C;  4BW5 A;  2ZM6 B;  3W7T A;  4LP0 A;  4B3M B;  2BU2 A;  4LF7 O;  3EKR A;  2YEV A;  4QPJ A;  3B09 A;  1VIB A;  1GM8 A;  5B5E Z;  1PVG A;  1KP2 A;  3ASN C;  1I08 A;  1IBM B;  1Q7Y W;  1FKA O;  2LO1 A;  5EYP A;  1EBO A;  1Q86 W;  1IBL O;  4TQD A;  4KHP O;  1L0L H;  3QNE A;  3SJA C;  2Q8I A;  4IT5 A;  1P49 A;  1NQT A;  4TV9 B;  1B63 A;  4U3F H;  4H0L B;  4UVB A;  3K5L A;  4L93 A;  3ZED A;  3WFV A;  5KMG B;  4UV8 A;  4HBN A;  5IJ0 B;  2JS3 A;  4E2L A;  4YJ3 B;  2ZKO A;  2OYQ A;  2KG7 B;  5GTI Z;  3K0G A;  1SC5 B;  5JJN B;  2E5L B;  4DUZ O;  3A0W A;  3TXQ A;  4NH8 A;  3K3W A;  3I5D A;  2FYU H;  3JCZ A;  4IHJ A;  4X66 B;  1AIL A;  2IJH A;  3G4S V;  2PUS A;  4DUH A;  2ZNJ A;  3MD0 A;  2YKC A;  4BW9 A;  1UYH A;  2YIB D;  1QBZ A;  2B9Z A;  4DXW A;  4XC0 A;  2ODM A;  2XJG A;  3Q5J A;  4GX0 A;  3RVY A;  5KLV H;  2BRE A;  3IED A;  1NTZ H;  2LJ2 A;  4ASF A;  3R92 A;  4PV1 B;  4UXN A;  2G38 A;  4H81 A;  2XDL A;  4KFG A;  2WLN A;  5KHI A;  1VF6 C;  1H8H G;  4RAI A;  2XHX A;  2YEC A;  2EIN B;  3E8H A;  1H2S B;  3CP1 A;  4U93 A;  4J9Y B;  1YI2 V;  3B26 A;  1L1F A;  2H8M A;  2YEJ A;  4JI8 B;  1PNL A;  2P90 A;  3K59 A;  1IXM A;  2B1I A;  3ABL B;  4DZY A;  4JI7 O;  3EHJ A;  4LNU A;  1M90 W;  5KHH A;  2W6I G;  3LNN A;  5D7R A;  2DYS B;  4JGS A;  3JAW B;  3N2G A;  1SQF A;  2ZDI A;  2HVK C;  4V26 A;  2P06 A;  2WLI A;  2E75 B;  2YK2 A;  2WI6 A;  3ZN1 A;  2ESA A;  1MAB G;  1W0K G;  5EBW C;  1IVS A;  5H9C A;  3SPG A;  1US6 A;  4CWN A;  3OTO O;  2YGA A;  2Y48 A;  3HKE B;  3SYO A;  1M56 B;  4GZR B;  1QNM A;  1OSF A;  5E1A C;  2A3Q A;  5GON A;  1KU9 A;  4LWG A;  4FLT A;  5L3G A;  3JAK B;  1ZUQ A;  4MVZ A;  2YEA A;  2YE8 A;  1ENV A;  3FD9 A;  1YVW A;  1K5Q A;  3FAV A;  2Y69 B;  4BR6 A;  1XNR B;  2X6C A;  4X1K A;  1G6U A;  3ABM B;  3KE6 A;  3EVK A;  1YSZ A;  1NTK H;  1QHT A;  2WAM A;  4YKX A;  5M4N A;  4X9Q A;  1Y74 A;  1WB7 A;  5D6P A;  4A5U B;  2OCH A;  3ETE A;  2QJ1 A;  2UXX A;  2BCC H;  4FCQ A;  3CXC U;  4DV4 O;  1N36 B;  1Q8I A;  2OWO A;  1N33 O;  2RN9 A;  1YET A;  4YHH B;  2YEE A;  1M9N A;  3HEK A;  4YKU A;  2XAH A;  4X65 B;  3F5T A;  2FXS A;  4I0X A;  1I5B A;  3HKB B;  2JGD A;  3APO A;  2YI9 A;  4PI0 A;  2GDS A;  1N0J A;  4DV7 B;  2BOC C;  3MHH C;  1W59 A;  2ZIN A;  3NXS A;  4EKW A;  4CWF A;  3BHP A;  4LF8 B;  4QGP A;  2EIK B;  4BWA A;  4ZHQ A;  3QO8 A;  3A0R A;  4PI2 A;  1XNQ B;  1TUB A;  4L8Z A;  1F4M A;  1H2L A;  1X59 A;  4AWO A;  2ZDY A;  3CWB H;  3LSU A;  1YIJ V;  2QKC A;  3B8N A;  1YER A;  4G2K A;  4MVU A;  3CGZ A;  1ORQ C;  4X1Y B;  1Y8O A;  4X1I A;  2F43 G;  2ITC C;  2Q69 A;  3HKD A;  3OWD A;  4FFK A;  1VQP V;  4I9W A;  1I5Y A;  3VQW A;  2XDS A;  2QM8 A;  4AQY B;  3RYH A;  1H7U A;  2IOQ A;  4GQT A;  4XIT A;  1VEW A;  3SJB C;  4C7U A;  3B25 A;  2QTO A;  3ZMS A;  2IH3 C;  3T1Y B;  2ZE7 A;  1NJI W;  4HAM A;  4NTW A;  4DR2 B;  4DR6 B;  1Y4M A;  4JZG A;  5B1B C;  1S5L Z;  4LWI A;  4LFB O;  3OD4 A;  2P5O A;  1Y6X A;  3BEH A;  3STL C;  2F95 B;  2EX3 A;  2QKA A;  3E8F A;  3R91 A;  3FB5 C;  3CJH B;  1XBL A;  3ZHV A;  4ASA A;  3CRQ A;  4N23 A;  1MMM A;  4PD4 F;  5B1O A;  4JYA O;  1SS3 A;  5A2Q N;  3QO7 A;  1NR7 A;  2P4K A;  1N0N A;  5BY1 A;  2UUC O;  1M5I A;  4CBC A;  2UXN A;  3C3S A;  4G28 B;  4HZ5 A;  3FT8 A;  3K58 A;  3D36 C;  3JD0 A;  3RYI A;  1G8M A;  2Q8H A;  1VQ9 V;  1YZB A;  5KUM A;  1UYK A;  2EZO A;  4UVC A;  1GN3 A;  5JJJ B;  1FXK B;  4CH4 A;  1AH6 A;  4EB6 B;  3G75 A;  1L0N H;  1U2O A;  5B66 Z;  2GSM B;  2YS8 A;  5LYJ A;  4R50 A;  1CPY A;  4D6T H;  1UY7 A;  4FZ1 A;  3LMM A;  1U97 A;  3ZHS A;  3UCS C;  3BPZ A;  1J5E B;  3T2S A;  4V25 A;  4L90 A;  4OX9 B;  3ABK B;  5B1N A;  1B62 A;  4JI0 B;  3CYG A;  5EC1 C;  2ZD9 A;  2B5U A;  1HNZ B;  1K7D A;  2MK3 A;  2YIC A;  2Q2E B;  4H37 A;  1JJO A;  2AXT Z;  2QWQ B;  3K08 A;  4PDM A;  2YJW A;  3JD2 A;  4DO2 A;  3AEI A;  5EYP B;  2CTW A;  3SPJ A;  4CWT A;  1K4C C;  4K4O A;  4DV6 B;  4P8O A;  3WHA A;  1OHH G;  3T0Z A;  2CGN A;  4W4L A;  2EIM B;  4YKY A;  2H55 A;  4JTC B;  1KIJ A;  1Q90 D;  1WPB A;  2YI8 A;  4CE1 A;  4AS9 A;  1KKC A;  1XHX A;  3S5T A;  4DR1 O;  2LW7 A;  1NHJ A;  2OCC B;  1DK1 A;  1I5X A;  5M4H A;  4FPP A;  5KMG A;  3K60 A;  2DW4 A;  3F7V C;  2CH7 B;  2YIB A;  5IJ0 A;  2XX2 A;  4YJ3 A;  4AI8 A;  3CCR V;  3PEH A;  2KG7 A;  3UQ8 A;  3L73 H;  1FJG O;  4LP8 A;  3PN1 A;  4ASU G;  4W4K A;  3JD3 A;  3ZMU A;  5LMU B;  2YJX A;  2EZP A;  4EEH A;  2WI1 A;  5C93 A;  1D2D A;  1R62 A;  1RM1 C;  1OCC B;  3AG1 B;  2CK3 G;  4MPN A;  4O0B A;  4YKR A;  5CA3 A;  2WI3 A;  2R9R B;  4YKZ A;  4Z1M G;  4TWK A;  4P7A A;  3FFQ A;  5LXT B;  3N2K B;  1I94 B;  5KHK A;  2Z3Y A;  1NKD A;  1NHH A;  2OIG A;  2RMK B;  4OGQ B;  2DE0 X;  4GFN A;  4RQE A;  3IC7 A;  1MSW D;  5FND A;  3INW A;  1BE3 H;  3W7W A;  3H4L A;  5JQG B;  4D7S A;  2JGU A;  1CP9 A;  2PY5 A;  1DLB A;  1BT8 A;  2FTK A;  2E76 B;  4FCP A;  1B6Q A;  1CEZ A;  3J81 N;  2RNB A;  3AK1 A;  5KHJ A;  1N34 B;  3MAQ A;  3HKC B;  5L3B A;  1KBH A;  3ETD A;  4HXW A;  4WUD A;  5CTX A;  4HNA B;  4YXW G;  5EC2 C;  3HZ1 A;  1TAE A;  3FB8 C;  4ZVI A;  1BQ0 A;  4LF9 B;  2PI4 A;  3RW0 A;  5GON B;  2E3C A;  4FZ0 A;  1B3Q A;  2ZXW C;  3HKE A;  2XND G;  3H1L H;  2D2C B;  3CHX A;  4KFM A;  2XJJ A;  2R70 A;  5CTY A;  3JAK A;  4AHC A;  2DYR B;  3OM3 B;  2LFS A;  1YJW V;  3T1H O;  4GGL A;  4MVR A;  4X1K B;  3WQ9 A;  1KKD A;  4LFA B;  1E1Q G;  2HEP A;  4OPH A;  1QLE B;  4JI6 O;  2HP8 A;  4EFE A;  2BU5 A;  3RYF B;  3B77 A;  5EZY A;  4L87 A;  4LFC B;  3CE2 A;  4I4T A;  3RN4 A;  4UFZ A;  4O2B B;  4PA6 A;  2XAS A;  5EIB C;  1AM1 A;  2UU9 B;  1XI1 A;  2UUB O;  2QGN A;  4WBN A;  5D7C A;  3AG2 C;  1NVP B;  2UUA B;  2E74 B;  1FFX B;  3JCU Z;  1I59 A;  4JI1 O;  2HVJ C;  4GKK B;  3RLR A;  4BAE A;  4CWQ A;  1JA8 A;  2K9P A;  3U67 A;  1COW G;  1HR0 O;  2WEQ A;  3HKB A;  3CWV A;  1XMO B;  2Q0O C;  1NHI A;  4CH3 A;  2HLD G;  1EN4 A;  1JPX A;  4X64 O;  4LC1 A;  4R7C A;  5E79 Z;  5KA6 A;  1K92 A;  4ZHQ B;  3OT7 A;  1QY8 A;  3AG4 B;  3R4N A;  4WFE A;  2YEG A;  5ITZ B;  1H2M A;  1FD9 A;  4AWQ A;  3BVO A;  1YSR A;  4CE2 A;  3L75 H;  4CS3 A;  3M8A A;  1JX9 A;  2UXB O;  2WI7 A;  1XDC A;  4JAA A;  2XJX A;  1RP3 B;  3SPI A;  4DV2 O;  1WJZ A;  2QA4 V;  4X1Y A;  5H6Q A;  5EK0 A;  4DR4 B;  3O2F A;  4Q20 A;  4UCO A;  1OCO C;  2CAZ C;  3E89 A;  1GN4 A;  3RWR D;  1Q43 A;  1VQ4 V;  2YEH A;  3MNR P;  5D7D A;  1SA0 B;  3U0Z A;  2JS5 A;  1UYM A;  1PKX A;  4KP4 A;  4LCU C;  3UO3 A;  4LH6 A;  1EI1 A;  4FLX A;  1YC1 A;  2ZIO A;  4J80 A;  4XCJ A;  1F7Y A;  4TOI A;  3ABU A;  2D3O W;  3VHA A;  2VWC A;  2Q8G A;  4W7T A;  5CBH A;  2ZM6 O;  4K8Z A;  3FX7 A;  4J7K A;  4B3M O;  1W0J G;  4FMT A;  1P84 F;  1IBM O;  4PL9 A;  2XTA A;  3CJH A;  4XBF A;  1MZE A;  1VQK V;  2ARH A;  2GV9 A;  1THZ A;  5BXZ A;  4LF4 B;  1FAF A;  1AJ6 A;  3SPH A;  3SYC A;  2QSA A;  1QR8 A;  3OE7 G;  3LUT B;  3T1K A;  2OT5 A;  4DW1 A;  1M57 B;  3E2E A;  1UY6 A;  3HR0 A;  4CWO A;  2R72 A;  1ZX3 A;  3BY6 A;  1DF5 A;  4MVO A;  1L8D A;  3LDC A;  4LPB A;  3HYZ A;  4MPC A;  2E5L O;  3SR2 C;  1GRJ A;  1XIL A;  3ASN B;  1UYI A;  4X66 O;  4UV9 A;  5CN0 A;  2QF6 A;  3CCS V;  3EKO A;  3OGC C;  4JV5 B;  4CWS A;  4I9Q A;  4LWF A;  1VQL V;  4PHZ A;  4FLZ A;  1GH6 A;  4XDL A;  1E79 G;  4B7P A;  4B7K A;  2ZCE A;  2YE4 A;  3TXS A;  2EXL A;  3GVM A;  4O4I B;  4CC5 A;  1Z2G A;  4NTX A;  4NYK A;  4JI5 B;  3LNM B;  5C8Y A;  2DQ3 A;  5IY5 B;  3CCE V;  3GIG B;  1H38 A;  1V55 C;  3EFF K;  3K0D A;  5IWA B;  4DR3 B;  2Q7E A;  2YGE A;  1SQX H;  4B3S B;  4IYH A;  1VQN V;  1LUV A;  4R6Z A;  4JI8 O;  1Z5A A;  4PEL A;  3OR6 C;  1I7F A;  3SJQ C;  1AI4 A;  4XD8 A;  2QWN B;  5LHH A;  3CCJ V;  4GKJ B;  3VQY A;  4O4L B;  4NH9 A;  1GKX A;  4IL6 Z;  2C1G A;  5CA1 B;  5L3J A;  1L0O A;  2O57 A;  2CDY A;  5H6R A;  2CH7 A;  5D6Q A;  1YT0 A;  3DTU B;  1FXH A;  5K1P A;  3STZ C;  2FB5 A;  3ZBH A;  3T4D A;  3KCX A;  1ZSP A;  2WA4 A;  4AIL C;  2W0F C;  1EZJ A;  5J2T A;  4TQF A;  1YIT V;  1TC6 A;  3WB1 A;  1T5E A;  4JAS A;  3RLP A;  3G6E V;  4MP7 A;  4X62 B;  1GN2 A;  3QDD A;  1KEC A;  1WNS A;  3TTZ A;  1ZXM A;  3CRM A;  1XNR O;  3OMU A;  5LXT A;  3N2K A;  1VF5 B;  4MW8 A;  5IYZ B;  3G7E A;  5JVD B;  2BYH A;  1GJV A;  3Q5K A;  1W2B U;  1WN7 A;  5JQG A;  1M93 A;  4NH7 A;  1GMG A;  2YI7 A;  1UY8 A;  4ASG A;  5FL7 G;  1BGQ A;  1XMQ B;  2ZE6 A;  1N36 O;  4XIP A;  3JAT A;  3TZ0 A;  2L35 A;  5LHI A;  4YHH O;  1XRE A;  4DR5 B;  4LF6 B;  4X65 O;  2H8P C;  2AZ0 A;  1K8A W;  1WLE A;  3HKC A;  3S3W A;  2VQE B;  2Q4P A;  1FXV A;  5BOD A;  3BMY A;  1Q6U A;  2Q7H A;  4DV7 O;  5IDJ A;  4PA3 A;  1S77 D;  4HNA A;  1S3J A;  3L70 H;  2WSS G;  1MSD A;  4DV1 B;  4J7J A;  4ZI7 B;  2L6L A;  2YI6 A;  4LF8 O;  3FB6 C;  4MVS A;  4JAV A;  5FNV B;  3K99 A;  1V54 C;  3ZIA G;  4DR7 B;  4QJF B;  1XNQ O;  3OW6 A;  4E02 A;  3ZXQ A;  5F3K A;  4JTD B;  2WER A;  3IAY A;  2NR5 A;  4X9L A;  1H8E G;  2EIN C;  3LSS A;  2Q67 A;  1ZL8 B;  1PL4 A;  4O05 A;  4CWR A;  5EZY B;  4I4T B;  3H1H H;  4MSW C;  3BA9 A;  3RYF A;  1HW7 A;  3ABL C;  1YEW A;  2W6J G;  2LP7 A;  3AK2 A;  3GIF A;  5B1A B;  4EM7 A;  1H2N A;  1R1B A;  1OCR B;  2WLJ A;  4O2B A;  3T0H A;  2DYS C;  3K97 A;  1I5C A;  4H7Q A;  4WBN B;  4AQY O;  2HG1 A;  4WUC A;  4UB8 Z;  3B8M A;  4H33 A;  1Y66 A;  4ZBM A;  4DK0 A;  1K4D C;  2YED A;  2HJF C;  4JI4 B;  4MTX A;  1UFI A;  2QKS A;  3T1Y O;  3SDL A;  3L71 H;  1FFX A;  1EN5 A;  3ZRW B;  4DR2 O;  1H2K A;  4HZ3 A;  4DR6 O;  5JH7 B;  2MW2 B;  3P32 A;  3EHG A;  1R3L C;  4JYC A;  2IWX A;  3ZHU A;  3OEH G;  5EBL C;  1O9H A;  2N05 A;  3ZHR A;  2FKX A;  4UCU A;  2GQP A;  1UYF A;  3GWK C;  1S72 V;  2XX5 A;  4QE9 A;  4YKQ A;  3DGE A;  5ITZ A;  2RQ6 A;  3G67 A;  2Y69 C;  1CXZ B;  3MDS A;  3O0I A;  2AW9 A;  3CD6 V;  3ABM C;  5M4P A;  2K5B A;  2IH1 C;  3BA8 A;  1Z5C A;  3B24 A;  4NR1 A;  3WB2 A;  4F6E A;  3QG5 A;  5B1B B;  4FLW A;  5H2F Z;  3C90 A;  2F1M A;  4GUN A;  2GBO A;  3ASO C;  5CPH A;  4JI3 B;  2EIL C;  3EXA A;  1AI6 A;  3QO5 A;  3TZ5 A;  2BSK A;  3E83 A;  2P7T C;  5BOC A;  2VCJ A;  1UYL A;  1SA0 A;  2KSD A;  1THN A;  2XHT A;  1B06 A;  2JEU A;  1FYJ A;  1J5E O;  4FIP C;  1AJP A;  4OX9 O;  3HB3 B;  1NR1 A;  4JI0 O;  2Y4U A;  2AKP A;  1HNZ O;  1S16 A;  4CH6 A;  1MOF A;  5B3S B;  3ABT A;  2O1W A;  1QYE A;  3CRL A;  4EGK A;  3F5W C;  4NXM B;  4WUB A;  2EIK C;  3L9D A;  4I5S A;  4YIO A;  4XTJ A;  2JJC A;  2YGF A;  1Z5V A;  1S5H C;  4TT3 G;  4DV6 O;  1BHB A;  1TID A;  2YXH A;  3W7U A;  3ZMV A;  3ZKB A;  5FPR A;  3CGY A;  3H80 A;  3ML0 A;  5TIS Z;  2M6Y A;  5F5R A;  2YSU B;  4PDV A;  3NMQ A;  3RVZ A;  1YSC A;  2BU6 A;  2BTQ A;  3LPS A;  4PU9 A;  3X2Q C;  5CF0 A;  5JCO A;  2X6A A;  1YCI A;  5DN6 G;  1BSM A;  1SQB H;  4BQG A;  1TH8 A;  1LUW A;  4X88 A;  5LMU O;  2VCI A;  4WFA V;  4EGH A;  1S5J A;  4U3J B;  4O2A A;  2KB1 A;  4K0K B;  4RUF A;  2M7W A;  1RPR A;  3DC6 A;  1H2G A;  1SQG A;  1SZX A;  1TBW A;  5C8Y B;  1IUR A;  1VQM V;  4O4I A;  3D3Q A;  3E8G A;  4Z2W A;  1I94 O;  5LP6 B;  5EBM C;  2HKJ A;  4U7N A;  4B6C A;  5FNC A;  1NZ6 A;  5IDM A;  3JAL B;  4JI2 B;  1V9P A;  1HDJ A;  3GIG A;  4IGG A;  1BL8 A;  4E00 A;  4F6R B;  3CPW U;  1SES A;  4H85 A;  2HFE C;  1VQO V;  1ZTE A;  5IT9 N;  1P4R A;  4DV3 B;  1FXK C;  3ZXO A;  2HR3 A;  2GFD A;  1OCZ B;  4JQL A;  1BZK A;  1N34 O;  2XHR A;  5DED A;  4RWU A;  2YDE A;  2EUL A;  2PF4 E;  4DV0 B;  5LGU A;  4O4L A;  2V4D A;  3A0T A;  1F23 A;  2GTA A;  1UJW B;  1S0V A;  1ZLZ A;  5CA1 A;  1XEQ A;  1VQ8 V;  4XDM A;  1UYD A;  1YDX A;  3JZ3 A;  1EZV H;  4B3R B;  3ABK C;  5KHG A;  4LF9 O;  4PDL A;  3CRA A;  3ZMT A;  2CTP A;  5J2T B;  4WCE V;  2QR4 A;  3VHC A;  4UVA A;  3SJC C;  1U96 A;  4XKO A;  1P7G A;  2NN4 A;  4J41 A;  3OEE G;  4LWE A;  5M4E A;  4Q6G A;  5J6A A;  5KUK A;  4O07 A;  5FWK A;  1OV9 A;  4URO A;  4LFA O;  3HHU A;  1IXB A;  5CBF A;  3OAA G;  4GLX A;  5IYZ A;  3OUF A;  2Q8F A;  5JVD A;  4J10 A;  4LFC O;  4FFB B;  3RKZ A;  4GEE A;  4OXS A;  2YE3 A;  1I58 A;  1RSO B;  2ZXW B;  4FM1 A;  3JAT B;  2OCC C;  2UU9 O;  4B7E A;  2NLJ C;  4EGI A;  3CXH F;  2UUA O;  3D3I A;  1R6K A;  4NB5 A;  1YJN V;  5DM6 V;  4GKK O;  4KQV A;  5J71 A;  3K5O A;  3BRC A;  2DWD C;  1XMO O;  2X6B A;  2OTJ V;  1KMI Z;  2XD6 A;  2WA3 A;  4BIO A;  4CS4 A;  3ZJZ A;  5KAI Z;  1OCC C;  3AG1 C;  2DN9 A;  2JJ2 G;  3O6O A;  3RFR A;  3CRC A;  1JVM A;  2QE7 G;  1Z59 A;  4ZI7 A;  3PJS K;  4HY1 A;  2A7W A;  2BU7 A;  5FNV A;  4YY3 B;  3L72 H;  2VS0 A;  3J80 N;  2EIJ B;  4R3M A;  4XCL A;  2OIE A;  1PPJ H;  3U2D A;  3ICX A;  1K5S A;  1HNX B;  3HZ5 A;  1YJ9 V;  3VAD A;  1ZL8 A;  1KC8 W;  1SET A;  2CG9 A;  1D5A A;  4KSG A;  1VMG A;  4DR4 O;  4E72 A;  4QIW F;  2X7R B;  2H94 A;  4PDR A;  4WFB V;  2VQF B;  2ZE5 A;  1MZF A;  3KG2 A;  1K3E A;  2R9A A;  1UY9 A;  5F2V O;  2YI0 A;  2ZDI C;  1AJN A;  1TIL A;  3K03 A;  3R4M A;  1YS3 A;  4FLU A;  2Q8V A;  3ZCC A;  2BRC A;  1LR1 A;  3ZRW A;  5JH7 A;  4JPR A;  2RJZ A;  5IN9 A;  2YE6 A;  2BZ5 A;  1NTM H;  4F4L A;  4MTO A;  1XHZ A;  3QTC A;  1NVP D;  1PNM A;  2VRZ A;  2DOS A;  2UXC B;  4MS2 A;  2R9I A;  3Q4H B;  5D5P A;  2QTS A;  4I50 B;  3MHS C;  1DGS A;  3H1K H;  2LQT A;  4HYO A;  3U10 A;  4LF4 O;  3R4O A;  2CE4 A;  2AHZ A;  3IC9 A;  4E4E A;  1QLE C;  4MW3 A;  1IBK B;  2RCV A;  1M4U A;  3D2R A;  4ICG A;  2LFR A;  2X0L A;  2IJI A;  4AWP A;  1SQV H;  1KYO F;  1JJ2 U;  4D7T A;  2A79 B;  4HXZ A;  2JJ1 G;  4QNH B;  2BSK B;  2YEF A;  2XAQ A;  1K33 A;  4DUY B;  3CCQ V;  3HPL C;  2ATK C;  2A9H A;  1XQ8 A;  3OWB A;  1EN6 A;  3D0B A;  4K8X A;  3JAR B;  4JV5 O;  3B40 A;  2ZE8 A;  3R65 A;  3CCV V;  1MU5 A;  3O65 A;  1AVM A;  3K57 A;  2WEP A;  1A4H A;  5H5N A;  1WP7 A;  3CC7 V;  3AG3 B;  1ROP A;  3D36 A;  1TA8 A;  3FT5 A;  3C11 A;  3ZM7 A;  4JI5 O;  2YID A;  1HNW B;  1D5N A;  5CTW A;  4BQJ A;  3EHH A;  3U11 A;  3AG4 C;  2GTS A;  3TK1 A;  3A0Z A;  2PTM A;  4PRV A;  3WG7 B;  5IWA O;  4DR3 O;  2WPD G;  3E86 A;  4FM0 A;  4B3S O;  4UCR A;  4DK1 A;  3OMA B;  3AK3 A;  4G27 B;  4CC6 A;  2YE9 A;  2GHY A;  4ZOL B;  2BTQ B;  2CGF A;  3TZ2 A;  1GKZ A;  1JQ0 A;  2A06 H;  3UT5 A;  1BGY H;  1EFR G;  2A0L A;  4WFG A;  4GKJ O;  4NXN B;  1UYG A;  3K79 A;  1OJH A;  4MVQ A;  3CCU V;  4O4J B;  1GAX A;  1MX0 A;  2IM9 A;  4J7Z A;  2P67 A;  2WI4 A;  2QM4 A;  3W7X A;  3TCU A;  4P30 A;  1XOU A;  3FYE B;  2CCU A;  1QR9 A;  3OMN B;  4B3T B;  4O2A B;  1AI5 A;  4LWS B;  4XDK A;  2XCM A;  3A8T A;  5LMN B;  5LOV B;  4KTN A;  1UPG A;  4U3J A;  1JOY A;  2JDI G;  4TSF G;  4CS2 A;  1Y4U A;  4P9O A;  4CE3 A;  4X62 O;  3FYI B;  2YEI A;  5LBQ A;  1KP3 A;  2XAG A;  2XUM A;  4J42 A;  3P3P A;  5LGN A;  5J2U B;  1Z5B A;  4MBC A;  5HFM A;  5LP6 A;  5CTU A;  4L94 A;  2PI5 A;  2N74 A;  2HHH B;  2ZNI A;  2ZIM A;  3JAL A;  1Y4S A;  4YKT A;  1WP8 A;  4UB6 Z;  2DJV A;  1J95 A;  1M57 C;  4F6R A;  3CSX A;  3JD4 A;  3SYQ A;  4O09 A;  3H1I H;  2UXD B;  1XMQ O;  1AP6 A;  4IYI A;  3H9V A;  4PRX A;  3CX5 F;  4DR5 O;  4ZKI A;  4LF6 O;  2KKW A;  5IE9 A;  1Q81 W;  4GX1 A;  3I56 V;  1PM9 A;  2VQE O;  1JCH A;  5BR8 B;  2XAJ A;  3Q5L A;  2WLM A;  2XOK G;  3DC5 A;  1YHQ V;  1AP5 A;  2CH4 A;  1KUQ A;  4DV1 O;  5GGZ A;  3A2F A;  4J9Z B;  4JTA B;  3M7M X;  3CCM V;  4NKG B;  1YT1 A;  4DR7 O;  2JEX A;  5IY5 C;  3KCY A;  2GUZ B;  5LL6 Y;  2JVD A;  1WA8 A;  3CEI A;  2FWZ A;  1VP7 A;  2PYJ A;  1TGO A;  4LH7 A;  3OFN G;  2FYP A;  3UM7 A;  1YC3 A;  5M4K A;  2WI5 A;  3E22 B;  5AG2 A;  4BAY A;  1N32 B;  2WI2 A;  4UCT A;  4HZ0 A;  1UYE A;  4LF5 B;  2QM7 A;  4XIQ A;  2WLL B;  4FFB A;  4FJC C;  3FV5 A;  1RSO A;  1Y8P A;  1V54 B;  3TJT A;  3EHF A;  4FCR A;  3OPD A;  4JI4 O;  4LF7 B;  4E01 A;  2DWE C;  3I55 V;  4LBE C;  1DTO A;  1B04 A;  2QWR B;  3KKY A;  1JMK C;  5GW7 A;  3OW2 U;  3QTF A;  3ZRV A;  3UO2 A;  2FL4 A;  1F51 A;  4XIR A;  1SF9 A;  4KXR A;  4P2Z A;  4WF9 V;  1GM7 A;  1IBL B;  3RBZ A;  4PA7 A;  4KHP B;  1TUE B;  3CME V;  3LDD A;  2XK2 A;  1K97 A;  4MB9 A;  1Y76 B;  3P3N A;  4YKW A;  5KAF Z;  3R66 A;  4TV8 B;  2Z5U A;  3NR7 A;  3N27 A;  4TUY A;  4FK5 C;  3RYC B;  1IZ3 A;  5BMV B;  4JAU A;  1QVF U;  4GX2 A;  2HJD A;  4L8J A;  3ZS8 C;  1MNG A;  5CB4 B;  2YK9 A;  4DUZ B;  3VHD A;  2Q6A A;  1K73 W;  3R4P A;  3DSQ A;  4PJ0 Z;  3ZX6 A;  4KSH A;  4H44 B;  3ZN0 A;  3WB0 A;  4P9P A;  3K98 A;  4GT8 A;  4LR3 A;  2XAB A;  2VWK A;  2N04 A;  4JI3 O;  1U0Z A;  1JFF B;  2PGG A;  3B27 A;  2O1U A;  4IIJ B;  1I5D A;  3C0E A;  2BSM A;  4EFU A;  2Y0P A;  1BYQ A;  3S3X A;  5JJE B;  3A0X A;  2JIZ G;  4NTY A;  1XL4 A;  4DRX B;  3E8B A;  4HY6 A;  3P30 A;  3PEJ A;  4XKA A;  5FPO A;  2AZ2 A;  5J9P C;  3CCL V;  3CB2 A;  1AR4 A;  5IYD O;  2Y4T A;  4O4H B;  1YTF B;  4XDJ A;  4MOT A;  3RLQ A;  1FS0 G;  4U7O A;  4NXM O;  2ZDX A;  1ZWH A;  1M56 C;  2DQ0 A;  2Q5Z A;  3ASO B;  3B4S A;  3FB7 C;  2VWJ A;  2EIL B;  1QVG U;  2ZT9 B;  4BIU A;  2ILM A;  4JI7 B;  3J7A U;  3TGU H;  1SQP H;  5LA6 B;  2Z0A A;  2QDO A;  3A0H Z;  4ASB A;  2ZR2 A;  2CTR A;  2Y0I A;  3IJ4 A;  1K34 A;  2V1D A;  4H13 B;  4X89 A;  2ADP A;  4UCV A;  3Q4H A;  3JAS B;  1YTF D;  4X8A A;  4I50 A;  4GT1 A;  1HWY A;  2QG0 A;  2LGQ A;  2E0A A;  3H1J H;  3IFX A;  2Q68 A;  5IJ9 B;  4CH5 A;  2AGA A;  5B1A C;  3OTO B;  2YKB A;  2ZQM A;  4YJ2 B;  1OCR C;  5JWP A;  1R3I C;  3CRR A;  2FML A;  4I3H A;  3TET A;  4PA9 A;  4BXI A;  3W7S A;  3VQX A;  3LSQ A;  2ZBK B;  1RFY A;  1R73 A;  1NT2 B;  2XDU A;  2P6J A;  5K1X A;  3CC4 V;  4JF3 A;  1E1R G;  3IGA C;  1KD1 W;  1SQQ H;  3JAR A;  1NU1 H;  4K0K O;  2F66 C;  1PP9 H;  2F93 B;  4I55 B;  2F23 A;  3G7B A;  3X2Q B;  4EEQ A;  3BFR A;  4K3A A;  4DV4 B;  4KL1 A;  2LGW A;  4MTF A;  5LHG A;  1N33 B;  5GTH Z;  3UKM A;  1H7S A;  2IJK A;  5L3E A;  4JI2 O;  1R6N A;  4XE2 A;  1YT2 A;  1IDS A;  3G71 V;  2HKO A;  3SYP A;  1XL6 A;  2HCH A;  2EJR A;  4WFH A;  1GTO A;  2PZS A;  4DV3 O;  3UT5 B;  1IX9 A;  1WB8 A;  2IOR A;  4ZOL A;  3TZ4 A;  4DV5 O;  3K04 A;  1Y67 A;  1Z5W A;  2UWD A;  4DV0 O;  1Q3E A;  2W0X A;  1X4T A;  2YKJ A;  3CRK A;  1DF4 A;  2ZKJ A;  4YIP A;  5KX5 B;  4URM A;  1TVK B;  4B3R O;  4O4J A;  4Z1V A;  5KA5 A;  1BCC H;  3QF7 A;  1GM9 A;  4LWS A;  5B3S C;  4R8C A;  5CA0 B;  5LOV A;  3ZRX A;  3F7Y C;  3DXR B;  4JYB A;  1S76 D;  2XDK A;  3BM9 A;  4DYL A;  4B08 A;  1BKN A;  2YIA A;  4X20 B;  2H3O A;  1AI7 A;  1G4Y B;  5J2U A;  5CMU A;  2YXY A;  4FM2 A;  2BYI A;  1KB9 F;  2B1G A;  1QZR A;  3OUS A;  2EBO A;  3K06 A;  4EFT A;  1BS3 A;  2CTQ A;  1BQZ A;  1N8R W;  4K35 A;  4HYM A;  2Q9L A;  1M1K W;  1RM1 B;  2DMX A;  2K1E A;  2YEV B;  4LFB B;  4DV5 B;  1LNQ A;  1AH8 A;  1A32 A;  1KQS U;  2YE2 A;  3T2M A;  2XX4 A;  2P4V A;  1PD3 A;  1G1X B;  1AR1 B;  1SRY A;  4JYA B;  4R1F A;  1R6T A;  2UUC B;  1VF6 A;  2WLH A;  4QE7 A;  3ZHQ A;  3K5N A;  1Q82 W;  1JM6 A;  2CGO A;  3D8C A;  3SGI A;  2QWO B;  1HP8 A;  2IU3 A;  2ITD C;  4TV9 A;  1FFT B;  2YXL A;  2YE7 A;  3CS5 A;  4CWP A;  3T1C A;  3JYC A;  2F4V O;  1ZWI C;  3VQV A;  4YY3 O;  5LP6 C;  3BAB A;  1WA8 B;  4HYP A;  3K9S A;  3RT3 C;  2GUZ A;  4IHJ B;  2YKE A;  1ZW9 A;  2IBZ H;  2IWS A;  2XHB A;  1HNX O;  2CCS A;  3A0B Z;  2EIM C;  3G80 A;  1EM1 A;  3E22 A;  2O1V A;  1GN6 A;  4PA4 A;  1BMF G;  2FWY A;  1PL0 A;  3JD1 A;  2ETN A;  2LW1 A;  2VQF O;  1OCZ C;  1VAR A;  2WLL A;  1F4N A;  5FNF A;  3K9A A;  3H01 A;  2IWU A;  5CBG A;  1FPO A;  4MT8 A;  2BU8 A;  3K5M A;  1URF A;  1SER A;  3VBB A;  2P22 C;  3HYY A;  3ETG A;  4FLY A;  2CCT A;  3C3T A;  1R3J C;  4DW0 A;  1YES A;  4LNU B;  4JZ2 A;  3B28 A;  3GWO A;  4LWH A;  4TUY B;  4DR1 B;  1Y76 A;  2RDC A;  4N21 A;  4TV8 A;  2UXC O;  4R3A A;  4L91 A;  3N2G B;  1VQ7 V;  4XKK A;  3RYC A;  3E35 A;  1GK9 A;  5D5Q A;  4GX5 A;  2WLI B;  2F4V B;  3AG2 B;  5BMV A;  2Q0A A;  1R3K C;  3JAW A;  3CMA V;  3FKS G;  4GYC B;  3G6B A;  2BTZ A;  1PV0 A;  1IBK O;  2JRI A;  5CB4 A;  1YF2 A;  1FJG B;  1Q5O A;  3THO A;  5M4M A;  1GKF A;  3CC2 V;  2JK5 C;  2JKI A;  1ID0 A;  5EIB D;  1VF7 A;  1NS1 A;  2ADQ B;  4EFB A;  4EMV A;  1JFF A;  3EHB B;  4DUY O;  2Q7G A;  2YEB A;  4UUJ C;  1AB3 A;  4IIJ A;  5A9G A;  2KQX A; 
#chains in the Genus database with same CATH homology
 4P9O A;  4MSW C;  4CZZ A;  3ABL C;  3FYI B;  2W6J G;  5LBQ A;  1KP3 A;  2XAG A;  3T4Z A;  2LP7 A;  5LGN A;  3ABK B;  5B1A B;  5B1N A;  2C2A A;  1OCR B;  2WLJ A;  5EC1 C;  3ZMZ A;  2ZD9 A;  3ZRS A;  5HFM A;  2DYS C;  2B5U A;  2WWW A;  1K7D A;  2MK3 A;  2PI5 A;  3B8M A;  4H33 A;  1SZT A;  4H37 A;  3SYA A;  1Y66 A;  4ZBM A;  1K4D C;  3K08 A;  2HJF C;  4WFF A;  4MTX A;  4PDM A;  2QKS A;  3JD2 A;  4DO2 A;  3AEI A;  1J95 A;  1GO3 F;  1M57 C;  3ZRW B;  1OCO B;  3JD4 A;  3OMI B;  4HZ3 A;  3SYQ A;  3P32 A;  3SPJ A;  1AJQ A;  1K4C C;  1R3L C;  3LDE A;  4RO2 A;  2EIJ C;  4JYC A;  1OHH G;  2DYR C;  4MVM A;  4ZKI A;  2EIM B;  4JTC B;  2ZR3 A;  1WPX A;  1Q81 W;  1QLN A;  4BIZ A;  3OEH G;  5EBL C;  4RQF A;  4GX1 A;  3I56 V;  1JCH A;  1P7B A;  2IU0 A;  1S72 V;  4QE9 A;  2XAJ A;  2OCC B;  2WLM A;  2XOK G;  3DGE A;  1YHQ V;  1I5X A;  4FPP A;  2DW4 A;  2Y69 C;  3F7V C;  3CD6 V;  3ABM C;  2BOB C;  2XAF A;  4J9Z B;  2IH1 C;  3CCR V;  4JTA B;  4GCZ A;  3CCM V;  2OTL V;  4LP8 A;  5B1B B;  4ASU G;  3JD3 A;  2JEX A;  5IY5 C;  3ZMU A;  3ASO C;  2EZP A;  2EIL C;  5L3F A;  4QPK A;  1AI6 A;  5C93 A;  3QO5 A;  2QEX V;  1RM1 C;  1OCC B;  3AG1 B;  2CK3 G;  3E83 A;  3OFN G;  2P7T C;  3UM7 A;  4BAY A;  5CA3 A;  2R9R B;  4RUE A;  1NBM G;  2IW5 A;  4Z1M G;  4TWK A;  2JEU A;  4FIP C;  2NNU A;  2V7Q G;  1AJP A;  3HB3 B;  1NR1 A;  2Z3Y A;  1NKD A;  2QM7 A;  2WLL B;  3OR7 C;  4RQE A;  3IC7 A;  4FJC C;  1MSW D;  1K9M W;  1V54 B;  3W7W A;  1MOF A;  5B3S B;  3ABT A;  3F5W C;  2DWE C;  3I55 V;  4LBE C;  1DTO A;  5L3D A;  1PNK A;  2EIK C;  4I5S A;  5GW7 A;  1NH2 B;  3OW2 U;  5HFL A;  2IJJ A;  3ZRV A;  1F51 A;  1CP9 A;  1DLB A;  2FTK A;  5LGT A;  4TT3 G;  1S5H C;  4P2Z A;  5IYB O;  1B6Q A;  4WF9 V;  1GM7 A;  3RBZ A;  4PA7 A;  5IYC O;  1CEZ A;  3M99 B;  1BHB A;  3W7U A;  1TUE B;  3ZMV A;  3CME V;  3LDD A;  5L3C A;  5L3B A;  1BHA A;  1K97 A;  3ML0 A;  3ETD A;  2YSU B;  4PDV A;  2Z5U A;  3RVZ A;  4FK5 C;  1YSC A;  4YXW G;  1NH2 D;  5EC2 C;  1V55 B;  3FB8 C;  4JAU A;  1QVF U;  4GX2 A;  3X2Q C;  2PI4 A;  2HG5 C;  1RPO A;  3RW0 A;  3SPC A;  2X6A A;  2AHY A;  3AG3 C;  5DN6 G;  2ZXW C;  2Q6A A;  1K73 W;  2XND G;  4KUM A;  1OZ0 A;  3GB7 C;  4KFM A;  3ZN0 A;  4P9P A;  4X88 A;  1FXK A;  2DYR B;  2WLK A;  5BZB A;  1VQ6 V;  3OM3 B;  2LFS A;  4WFA V;  1YJW V;  1QCE A;  4MVR A;  1KKD A;  1ARO P;  1E1Q G;  2KB1 A;  1QLE B;  4RUF A;  3WG7 C;  2M7W A;  1RPR A;  1H2G A;  3B77 A;  2JIZ G;  3CYO A;  4L87 A;  1VQM V;  1XL4 A;  3E8G A;  4PA6 A;  5EBM C;  4MTG A;  3E8B A;  2XAS A;  4U7N A;  1MG1 A;  3VOU A;  3P30 A;  1VQ5 V;  5J9P C;  3CCL V;  5IYD O;  4BW5 A;  1YTF B;  3AG2 C;  4XDJ A;  3W7T A;  1NVP B;  1FS0 G;  4U7O A;  1BL8 A;  1M56 C;  2HVJ C;  2DQ0 A;  3FB7 C;  3ASO B;  3CPW U;  1SES A;  2YEV A;  4QPJ A;  2EIL B;  1GM8 A;  2HFE C;  1QVG U;  1KP2 A;  3ASN C;  1VQO V;  4BIU A;  1Q7Y W;  1COW G;  1P4R A;  1FXK C;  1EBO A;  2HR3 A;  1Q86 W;  1OCZ B;  3QNE A;  2ZR2 A;  1K34 A;  2HLD G;  2V1D A;  4X89 A;  1JPX A;  4LC1 A;  1NQT A;  4R7C A;  5LGU A;  1YTF D;  4X8A A;  5KA6 A;  1K92 A;  3AG4 B;  1F23 A;  1UJW B;  1S0V A;  4UVB A;  4WFE A;  4GT1 A;  1HWY A;  1VQ8 V;  3WFV A;  3IFX A;  2Q68 A;  3ABK C;  4UV8 A;  5B1A C;  2ZQM A;  1OCR C;  4E2L A;  1R3I C;  4PDL A;  3K0G A;  1JX9 A;  3ZMT A;  3TET A;  4PA9 A;  3W7S A;  3LSQ A;  3K3W A;  4WCE V;  1R73 A;  3SPI A;  3JCZ A;  2IJH A;  2P6J A;  3G4S V;  4UVA A;  3MD0 A;  2QA4 V;  3OEE G;  5H6Q A;  3CC4 V;  5EK0 A;  4Q20 A;  4JF3 A;  1OCO C;  1E1R G;  3IGA C;  5KUK A;  1KD1 W;  3E89 A;  1VQ4 V;  1QBZ A;  4DXW A;  5CBF A;  3OAA G;  4GX0 A;  3RVY A;  1PKX A;  4KP4 A;  4LCU C;  3OUF A;  4OXS A;  3X2Q B;  4UXN A;  2WLN A;  3ABU A;  2D3O W;  2ZXW B;  1H8H G;  4RAI A;  2OCC C;  4MTF A;  5LHG A;  2EIN B;  3E8H A;  3UKM A;  2NLJ C;  5CBH A;  2IJK A;  5L3E A;  3CP1 A;  1R6N A;  4J9Y B;  1YI2 V;  1L1F A;  3G71 V;  2HKO A;  3SYP A;  1XL6 A;  1W0J G;  3D3I A;  1PNL A;  1R6K A;  2P90 A;  4FMT A;  1YJN V;  1IXM A;  2EJR A;  4WFH A;  5DM6 V;  2B1I A;  3ABL B;  1GTO A;  1M90 W;  2W6I G;  2DWD C;  2DYS B;  2X6B A;  4XBF A;  2OTJ V;  1VQK V;  4JGS A;  3K04 A;  1THZ A;  3ZJZ A;  1OCC C;  3AG1 C;  2JJ2 G;  3SPH A;  3SYC A;  2ZDI A;  2HVK C;  2WLI A;  1QR8 A;  1JVM A;  3OE7 G;  3LUT B;  2QE7 G;  2OT5 A;  3ZN1 A;  1MAB G;  1M57 B;  1W0K G;  5EBW C;  5H9C A;  1DF4 A;  3E2E A;  3PJS K;  3SPG A;  3BY6 A;  1DF5 A;  4MVO A;  2EIJ B;  2Y48 A;  3LDC A;  3SYO A;  5KA5 A;  1M56 B;  5E1A C;  1GM9 A;  3ASN B;  5L3G A;  5B3S C;  1K5S A;  4R8C A;  4MVZ A;  4UV9 A;  5CN0 A;  1YJ9 V;  3ZRX A;  3CCS V;  1SET A;  3F7Y C;  1KC8 W;  4JYB A;  1S76 D;  3OGC C;  1ENV A;  1VQL V;  1K5Q A;  4QIW F;  2X7R B;  2H94 A;  4XDL A;  1E79 G;  4PDR A;  2Y69 B;  4WFB V;  2X6C A;  1AI7 A;  3ABM B;  1G4Y B;  3KG2 A;  1K3E A;  5CMU A;  2WAM A;  2ZDI C;  1AJN A;  3LNM B;  2B1G A;  3OUS A;  2DQ3 A;  2EBO A;  3K03 A;  3K06 A;  3ETE A;  5IY5 B;  2UXX A;  1N8R W;  3ZCC A;  3CXC U;  3CCE V;  1M1K W;  1H38 A;  1V55 C;  3EFF K;  1RM1 B;  3K0D A;  3ZRW A;  1M9N A;  2K1E A;  2YEV B;  4JPR A;  1LNQ A;  1VQN V;  1KQS U;  2XAH A;  4R6Z A;  4PEL A;  3OR6 C;  4F4L A;  3T2M A;  4MTO A;  3SJQ C;  1AI4 A;  1NVP D;  1PNM A;  5LHH A;  3CCJ V;  1PD3 A;  1AR1 B;  2BOC C;  3MHH C;  4MS2 A;  2R9I A;  1SRY A;  3NXS A;  4EKW A;  3MHS C;  2WLH A;  4QE7 A;  4HYO A;  1Q82 W;  2AHZ A;  1QLE C;  2IU3 A;  2ITD C;  4MW3 A;  2EIK B;  1FFT B;  5H6R A;  2LFR A;  2X0L A;  3QO8 A;  3A0R A;  2IJI A;  3T1C A;  3JYC A;  3DTU B;  1ZWI C;  1F4M A;  1FXH A;  1JJ2 U;  3STZ C;  2A79 B;  2JJ1 G;  3T4D A;  4QNH B;  2W0F C;  2XAQ A;  1EZJ A;  1YIJ V;  1K33 A;  3B8N A;  4G2K A;  3HPL C;  2ATK C;  3CCQ V;  1YIT V;  4MVU A;  1ORQ C;  2A9H A;  2EIM C;  4JAS A;  2F43 G;  2ITC C;  3G6E V;  2Q69 A;  3R65 A;  3CCV V;  4PA4 A;  1BMF G;  1KEC A;  1PL0 A;  1VQP V;  3JD1 A;  4I9W A;  1I5Y A;  4MW8 A;  1OCZ C;  2QM8 A;  3CC7 V;  3AG3 B;  2WLL A;  1F4N A;  1ROP A;  3D36 A;  2QTO A;  3ZMS A;  2IH3 C;  1W2B U;  3K9A A;  3H01 A;  5CBG A;  3AG4 C;  4MT8 A;  1NJI W;  4HAM A;  1GMG A;  5FL7 G;  3TK1 A;  1Y4M A;  1SER A;  3VBB A;  5B1B C;  3WG7 B;  5LHI A;  3ETG A;  2WPD G;  1R3J C;  3E86 A;  3BEH A;  2H8P C;  3STL C;  1K8A W;  3E8F A;  3OMA B;  4G27 B;  3GWO A;  1WLE A;  3FB5 C;  2GHY A;  4N21 A;  1FXV A;  1JQ0 A;  4N23 A;  1EFR G;  5IDJ A;  1VQ7 V;  5B1O A;  4PA3 A;  1S77 D;  3E35 A;  2A0L A;  1S3J A;  3QO7 A;  1GK9 A;  4WFG A;  4GX5 A;  2WLI B;  1NR7 A;  3AG2 B;  2WSS G;  4CBC A;  2UXN A;  4G28 B;  1R3K C;  3CMA V;  3FKS G;  3JD0 A;  3K79 A;  3FB6 C;  1G8M A;  4MVS A;  4JAV A;  1VQ9 V;  1V54 C;  5KUM A;  4MVQ A;  3CCU V;  2EZO A;  4UVC A;  3ZIA G;  4QJF B;  2P67 A;  1GKF A;  3CC2 V;  1FXK B;  3W7X A;  3TCU A;  2JK5 C;  4P30 A;  4JTD B;  3FYE B;  1QR9 A;  3OMN B;  4XDK A;  1AI5 A;  1H8E G;  2EIN C;  3LSS A;  2GSM B;  4R50 A;  1CPY A;  2Q67 A;  3EHB B;  1JOY A;  2JDI G;  4TSF G;  4UUJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...