2FTKA

Berylloflouride spo0f complex with spo0b
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
181
structure length
181
Chain Sequence
ISDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEITSHECLIEIGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Beryllofluoride Spo0F in Complex with the Phosphotransferase Spo0B Represents a Phosphotransfer Pretransition State.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Sporulation initiation phosphotransferase B
total genus 68
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature ec 2.7.-.-:
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14682 SPOB_ab Sporulation initiation phospho-transferase B, C-terminal
A PF14689 SPOB_a Sensor_kinase_SpoOB-type, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ftkA01
3.30.565.30 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Sporulation initiation phosphotransferase B (SpoOB), C-terminal domain 2ftkA02
3D36A 3ZRWA 3MD0A 3P32A 2QM8A 4U7OA 3ZCCA 3ZRWB 4QPJA 4KP4A 5B1OA 3TK1A 2QM7A 2P67A 4JYBA 3A0RA 4GT1A 1IXMA 2C2AA 1F51A 4LC1A 4QPKA 4JAVA 3ZRVA 2LFRA 4GCZA 4FPPA 4BIZA 3NXSA 4ZKIA 2LFSA 4JAUA 4MT8A 4I5SA 1JOYA 4U7NA 4JYCA 3DGEA 4BIUA 4JASA 4Q20A 3ZRXA 5IDJA 5C93A 2FTKA 2WWWA 5B1NA 4MTXA 4FMTA
chains in the Genus database with same CATH superfamily
1M57C 1N0NA 1AI7A 3EKOA 1W59A 2B5UA 1EZVH 2Q0OC 4DV6O 1S3JA 1QQCA 5JVDA 2HJFC 2XCMA 4L90A 2HHHO 2YE2A 1AILA 3CHXA 3L72H 3DXRB 3THOA 4YJ2B 1YI2V 1IBKO 2EIKC 1GO3F 2LO1A 1QNMA 2WI3A 2AW9A 4LNUA 2EULA 3AG4B 5BY1A 4LF6O 2ADQB 3E22B 2N05A 3HKDA 3FX7A 3ZRXA 2QG2A 2IWUA 1EZJA 3R92A 4O04A 3WG7C 1XOUA 3H9VA 3K5OA 4CWRA 3WU2Z 5CB4B 2UXCO 1JJ2U 5D5PA 3H1JH 2JJ1G 4XBFA 2F4VB 4XDJA 1ENVA 1YVWA 1CPYA 4WCEV 3TUHA 1UYEA 1I94B 4DW1A 2QA4V 5A2QN 4JTCB 1F7YA 3UT5A 1B04A 2LQTA 2Q0AA 2XDKA 1Y8PA 2DW4A 1R6TA 3QTCA 4JTDB 1TH8A 2BZ5A 4H0LB 3CWBH 1IX9A 3JAKB 1PNLA 2XDSA 2RN9A 3VHDA 4FM1A 3DC5A 5IJ9B 3RYFA 2NR5A 4LCUC 2NN4A 3FYEB 1ZW9A 3NXSA 2HFEC 4MW3A 2WAMA 1KIJA 1PP9H 4MPCA 4B7KA 1YHQV 3OM3B 2N04A 3BRCA 3A0TA 5B1NA 4HZ0A 2BTOA 2RJZA 4G28B 5IYZB 2DYSB 2ZIMA 3B28A 5LA6A 3HKEB 2P5OA 5LBQA 3ABTA 2AGAA 2YEFA 3SJAC 4IL6Z 3UKMA 3ZRVA 3RVZA 4O4IB 3U2KA 2IBZH 1GK9A 4MSWC 1U2OA 2W0FC 4MP2A 2QWOB 2PYLA 1MSWD 1UY6A 5EIBD 4DV7B 3CCLV 3JCZA 4J41A 1L0LH 2FKXA 2WSSG 4DW0A 2Y0PA 1ZTEA 2Q8VA 2OYQA 1UY8A 2CH7A 5C8YA 2CCTA 3TCUA 3A0WA 3BPZA 3W7SA 4EFBA 4YJ3B 4P2ZA 1NS1A 4O4HA 4UCUA 5FPRA 1MSDA 2QWRB 2LW7A 3FB8C 5FL7G 2OCHA 3WG7B 2XTAA 1MX0A 3INWA 1FXKA 1WNSA 3HPLC 2XJGA 4XCLA 2Z0AA 4MW8A 1FKAO 4QE7A 2P90A 2YI7A 1H2MA 5B1BC 4LF8O 2Q6AA 1JPXA 1SKVA 2YDEA 5JH7A 3ZBHA 4GEEA 4O2AA 2VS0A 3E35A 5EZYB 3JZ3A 3CRMA 5JENA 1N4CA 4KXRA 1V55C 4BAYA 4NR1A 3TXSA 5IJ0A 1KBHA 4YKZA 2JRIA 3K0GA 1IZ3A 2HG5C 3ZN1A 3B77A 1IBKB 1AJNA 4LWSB 4I0XA 4TV8A 4ABMA 4EMVA 5IYDO 1IVSA 3IGAC 3APOA 1F51A 4DK0A 2XOKG 2LFRA 3CD6V 1R3JC 4BQGA 4B3SB 3BCCH 1VEWA 3QNEA 2HP8A 3BY6A 4GX1A 4UFZA 4WBNB 5CTXA 4V25A 4CBCA 4X1YA 2PGGA 2BOCC 2WLIB 2CDYA 5KMGA 3HYZA 2XNDG 1H7SA 4I55A 2IOPA 2UUAO 1NH2B 2YGFA 2ZKOA 3K99A 3OMIB 4H44B 4ZIBA 1QHTA 1HWYA 3ZMVA 2GTAA 4OPAA 4DR2O 1NJIW 2Q7EA 4EFTA 2F95B 3HB3B 5J2TB 3G75A 4NKGB 1Q6HA 3RGBA 1YERA 4FZ0A 2H55A 4DR3B 1S5LZ 4H7QA 3APQA 4NB5A 3JARA 2EIMB 4QGPA 2ZIOA 2PUSA 4P9PA 2FXSA 1NR1A 3RVYA 1KZNA 4Z1MG 2GHYA 4H13B 4MT8A 4GKJB 1NTMH 4HAMA 3VOUA 5L3CA 3RYIB 5CBFA 5KA6A 1US6A 3R91A 4E4EA 1ZWIC 3HEKA 3KZIZ 3GIGB 3QDDA 4R7CA 2VQFB 4X62B 5GONA 2XHRA 4PA9A 1NHJA 4UV9A 1MA1A 5CN0A 3JD4A 4O4JB 4KHPB 4B3SO 2KB1A 4I9QA 1GH6A 4GFNA 1K92A 4J9YB 1LUWA 4DXWA 2UXNA 4U3JA 3SYCA 3OGIB 2Q7GA 3K5NA 1S14A 2YKIA 1AROP 1PD3A 3K57A 2QEXV 4CH4A 3BHPA 1BZKA 4GYCB 1OV9A 2LGQA 2QWQB 2OT5A 3O0IA 4JI7B 3KCYA 2DYRB 2P06A 2XX5A 2WA4A 4IIJA 3TETA 3M7MX 2W6JG 2ZDXA 1TUBA 4LF5O 3BM9A 3CSXA 1H38A 3HKBA 3STLC 5LHGA 1NU1H 3IC9A 3JATB 1P4RA 2JGDB 3RT3C 4JI2O 2YIBA 4PRVA 4B3TB 1VQPV 4E72A 4GKKO 2YECA 4FK5C 4B3TO 4DV5B 1Y4SA 4PA7A 1N33O 4YKYA 2K1EA 5LGUA 4YKXA 5L3JA 1HW7A 1BXDA 4F6EA 5L3GA 3OR7C 4UUJC 5F3KA 4PDRA 5K1PA 4WFEA 4IHJB 2BSKB 2VWCA 2E74B 2VW5A 4KFGA 2YUAA 1WJZA 3DSQA 4L8ZA 2JKIA 4E01A 1MNGA 1PL0A 2PNRA 1QBZA 5BOCA 3QO5A 1GN3A 1P49A 2QF6A 4I3HA 4JV5B 4UB8Z 3T4ZA 4R3MA 2ZDYA 1OCOC 2ZXWC 3N2KA 2GTSA 3CP1A 4PDLA 2DN9A 2XDXA 2R9AA 3KCXA 2GV9A 1PVGA 3UT5B 2QWNB 3LSQA 2A7WA 2GBOA 4J9ZB 2YEBA 3HKCA 2QKAA 3RW0A 5B1BB 1N34O 1O9GA 4NYKA 2Q8FA 4XIQA 3ABKC 2GUZB 2RDCA 5LP6A 4O07A 1SQXH 2ADPA 1I5BA 3O9OA 1UFIA 1NVPB 4TQDA 1D2DA 1EI1A 4UVAA 4QIWF 4V26A 2YE8A 4FPPA 4LP8A 2BYIA 1Y66A 2JDIG 4CH3A 1K9MW 2WI5A 4UVCA 4MS2A 1YXBA 3A0HZ 4XKOA 5CA0B 2Q8IA 5AG2A 3RWRD 1M4UA 1VF6C 4RUFA 4JI6B 3ZXOA 1Q81W 3T1HO 3E89A 3ZIAG 2O57A 2X6AA 1XNQB 5FWKA 2C1IA 3IFXA 2YI8A 1KUQA 1XUQA 4DR5O 2EJRA 4IGGA 2HKOA 2BU8A 1XREA 1XL4A 3DGEA 2HEPA 5KAFZ 1XMOO 4GLXA 4U3FH 3SPCA 4KL1A 1B63A 3SPIA 5CB4A 5K1XA 2DJVA 4L8JA 1OSFA 1SS3A 3CXCU 3OMUA 4LP0A 5LGTA 1VQ9V 5BMVB 4XITA 4LF6B 3K08A 4WFFA 3U10A 2WEQA 4CWNA 1VQ7V 2IJIA 4TSFG 3H01A 3EHBB 4AILC 2LP7A 4J10A 4FFBB 4I5SA 4P7AA 5JCOC 1FS0G 4X88A 4P30A 3TTZA 2F66C 4RQFA 3RLPA 3OE7G 4DUYO 2F43G 4DR6B 2CTPA 1RP3B 2WPDG 3TZ0A 3OAAG 1KU9A 4PJ0Z 2YEHA 1ZUQA 3AK3A 2ZR3A 1X4TA 2JJCA 4JF3A 2UU9B 4JAUA 4A5UB 1WP8A 1JQ0A 4KFMA 2G38A 4QNHB 4FCQA 3MDSA 1QVGU 1CP9A 1GM7A 3TJTA 3B26A 3UCSC 1HNXB 1YJ9V 4I4TA 1I5CA 3EKRA 3U0ZA 3D8CA 5FNCA 3I5DA 4LF8B 3ASOC 4UCTA 3R4MA 2HHIA 3AEIA 4B3RO 2DWDC 1UYGA 5JQGB 3W7UA 1NVPD 2AXTZ 3BEHA 5EC2C 3RN4A 1MG1A 4JPRA 4X1YB 2GSMB 4DR4B 1OCRB 4MTOA 2YEGA 5BODA 2JJ2G 1GKZA 4HYOA 3ZHSA 2OTLV 3OFNG 3ZMTA 2CE4A 4U7OA 1GN4A 5FNVB 3VQWA 4LH7A 5DN6G 3AG7A 4DR2B 4PDMA 2IM9A 2YI6A 1PL4A 3J80N 1XNRB 5LGNA 2YE5A 2Q69A 1PPJH 2UXDO 3K0DA 1AM1A 2BTZA 3ETEA 4PHZA 5M4EA 3HKDB 1JCHA 3WB2A 3ZMSA 1H7UA 1U96A 1DF4A 5JH7B 3L73H 1OCOB 4O2AB 4O05A 3EVKA 4WFGA 1UYFA 1EN6A 1LR1A 4FZ1A 1R1BA 4IT5A 2XASA 3CCVV 2YKJA 2YEVA 3TZ5A 3CYOA 1I58A 5IDMA 1MZEA 4TV8B 2DE0X 1J5EO 4JYAB 2RQ6A 2BE3A 4O4JA 3EHFA 2C2AA 2A06H 3K58A 3OEHG 3A2FA 5BR8O 1UYIA 1H8EG 4MB9A 5C93A 2QTSA 4ZI7B 4LFAO 1TBWA 2YICA 1TILA 4WUBA 1G1XB 5JJNB 3C11A 3H1HH 5JJJB 2BOBC 1H2SB 4C7UA 1COWG 3M99B 4R3AA 1BSMA 2HVKC 5D7DA 4FM0A 3LDEA 1Q3EA 4K4OA 2Q8HA 3GIEA 2E5LO 1XHXA 1Y74B 2JIZG 1IXBA 2P4KA 1V54C 4JI6O 4LNUB 4CWPA 2Q5ZA 2OIGA 3ABLC 2JGDA 1Q82W 3E22A 1I5YA 4FLVA 3RFRA 3CGZA 1YSCA 1H2LA 2M6YA 3S3WA 3W7XA 1WB7A 1YJNV 1TIDA 3IEDA 1OCZB 5C8YB 5LP6C 4URNA 1HNWO 3K79A 2ETNA 2YXLA 1MOFA 4LF4O 3Q5JA 4DUHA 4JI4B 4IHJA 2ZM6O 1NQTA 3R4NA 3PEHA 4DV0O 2WI7A 5H5NA 1JX9A 1QLEC 3JD3A 1QVFU 1S0VA 1FXHA 2WI2A 2Z3YA 5B5EZ 2H3OA 5B3SC 3H4LA 4L91A 2QG0A 2OCCC 5J71A 1VF5B 5CBGA 1BGYH 5KAIZ 4CWOA 3N2KB 3CMAV 2E3CA 4LFBB 1WPBA 5JCOA 4UCOA 4X66B 1XMQO 2UXBO 3N2GB 1KP2A 3OT7A 2VCIA 2EJ7A 2WWWA 4KHPO 4JI1B 4LWHA 4MTGA 3CPWU 2L35A 1A4HA 5LYJA 3SYQA 2XD6A 2EILC 3QF7A 2EZPA 1P84F 2IU3A 3G67A 2ZNIA 3UQ8A 2YGAA 4TWKA 3SJCC 5LHHA 2Q67A 4NTYA 4XTJA 4OPHA 3CRLA 1XNRO 3ASNC 2ODMA 5J6AA 3HKBB 3B40A 2ZINA 1T5EA 3W7TA 2CTQA 3JATA 4GX2A 4WBNA 4H37A 1YT1A 2EINB 2NNUA 1VF7A 1WP7A 5HFMA 1HR0O 1FXKC 1PKXA 3K59A 2CH7B 1E1QG 3FYIB 5B1AB 1Y76B 2H8PC 4NH8A 1SQGA 4FCRA 4I55B 3EXAA 3X2QC 2BU7A 1HNZB 3B09A 1MMMA 5D5QA 4LF9B 2LJ2A 2QR4A 2YEJA 3VHAA 4DV2O 3ZM7A 2ZR2A 1NH2D 4JQLA 4JASA 4DV6B 5L3FA 5B1AC 1V54B 3ABUA 1VQNV 5KLVH 3RBZA 1K34A 2B1IA 3R4OA 3B24A 3ZRWB 4H33A 1AMWA 3RLRA 1R6NA 3K3WA 3JARB 2YI9A 1YSRA 2CCUA 4YY3B 3ASNB 3AG2C 4TQFA 1HR0B 2VQFO 1PNKA 3KG2A 5IJ0B 1VQLV 1AI6A 3P3NA 4UROA 1TGOA 1B62A 4KUMA 2BREA 2E76B 1SF9A 4LF4B 2YK9A 5LXTB 2KQXA 2Q7HA 5CTYA 3K9AA 2QM8A 3L71H 3AG2B 4HY1A 1QLEB 3HYYA 3LNNA 4OXSA 5KHIA 3A0XA 4GT8A 2K5BA 2GDSA 2YIBD 4PELA 4CS2A 3K9SA 2B9ZA 2RMKB 4GCZA 3G4SV 4U93A 1I7FA 2HVJC 3J7AU 3Q4HB 2EIJB 1AR5A 1UYDA 5FNDA 3ZXQA 3T1HB 1BT8A 3WFVA 3H1IH 1YIJV 4K8ZA 2MK3A 4U3JB 4X8AA 1TAEA 2ZQMA 1U0ZA 4XE2A 2WLMA 1F23A 2Q8GA 3D3IA 5J2UA 4DUZO 4UV8A 3ABLB 1TC0A 3HZ1A 5H6QA 4AWOA 5E1AC 2PZSA 4NXMB 2IOQA 1ZSPA 3ETDA 1AH8A 1I5AA 2YKBA 1AH6A 2V1DA 2IJJA 5BR8B 3SL2A 4DR5B 3SR2C 1NTKH 3CCJV 3JYCA 1E1RG 4AWPA 3OMNB 4LWGA 2ZM6B 4JI1O 4X20A 1K3EA 5BMVA 1Y8OA 1Q43A 1R6KA 2FB5A 1K5QA 1RM1C 1ZWHA 1RSOA 4LC1A 4DV7O 1VP7A 3GB7C 2YE4A 1VARA 1G6UA 1GKFA 1J95A 1Q6IA 3T2MA 4HNAA 5L3BA 2WI4A 2DQ3A 1FPOA 3T2SA 4MTXA 2YIDA 4WUDA 3IAYA 3B2EE 3C90A 4YKTA 2Q4PA 3SYPA 1TVKA 2KSDA 2ZCEA 5M4NA 1N34B 1K4DC 5ITZB 5KX5A 2ESAA 3BA8A 1JA8A 4XDKA 1M5IA 4PDVA 4Z1VA 3G7BA 3MNRP 4CWQA 4HY6A 4JI3O 1I94O 4O4LA 4X1IA 2PI5A 4EB6B 3FT8A 5TISZ 3VADA 4IYHA 3LSUA 1M93A 5D7CA 1GN2A 4HZ3A 4K0KO 3HKCB 1IBLO 3WHAA 4I4TB 4EEHA 3E86A 2WERA 5M4KA 4HYMA 4DRXA 5L3DA 4I50A 5LP6B 1BE3H 2AHYA 1YC4A 4ASBA 3SPHA 4QPKA 3B8NA 1KECA 1Q5OA 4EGHA 3FD9A 1GMGA 1EM1A 3DC6A 4CH6A 5H6RA 3OTFA 4TOIA 1N33B 1OCCC 4DYLA 1V55B 3CC7V 4D7TA 1YEWA 4PI2A 3R65A 3HHUA 3C3SA 3T1YO 1Y6XA 4JTAB 4IYIA 4LWFA 4PL9A 2P4VA 4U7NA 1F4NA 4D6TH 3UM7A 2YE9A 4X1KB 4ZHQB 4YKRA 1ROPA 2BSKA 3BAAA 4CWSA 2XAJA 1XQ8A 2Q68A 1XILA 1VQ4V 2UXDB 4ZVIA 3JASB 3LNUA 1R73A 4LWEA 4GZRB 4FLYA 3AK2A 2WLNA 4WFAV 3E8FA 4GT1A 1KKDA 2IH1C 1BQZA 2IH3C 4W4KA 2XJXA 2QKCA 5FNFA 4CH5A 4LF9O 2VWJA 1JOYA 2CGFA 1AJQA 1UYCA 2CK3G 4I9WA 4MVRA 4FLZA 4YIOA 4FLXA 5D6PA 4W4LA 1XEQA 3VBBA 1EBOA 4PD4F 4P8OA 2A9HA 4LH6A 4MBCA 4DV3B 2FYPA 3AG4C 4ASAA 3E8HA 1AI5A 3O2FA 2WLJA 3LUTB 2B1GA 3SPJA 3N27A 2HG1A 2BYHA 4FCPA 5EK0A 1K8AW 1CXZB 3RYHB 1SQFA 2IWXA 5LYJB 1QU7A 5KHKA 1FJGB 2XJJA 4CE3A 1F4MA 3JAMN 3WB0A 1ZLZA 5LL6Y 2FWYA 3QTFA 4Q6GA 1IBMO 4JZ2A 3FAVA 1Z59A 3OUSA 1VQKV 1Z5CA 2BTQA 2Y0IA 4BIZA 1MU5A 3I55V 1GTOA 2YJWA 2WLLB 5CMUA 4ZOLB 3O65A 2R9RB 3E2EA 3K03A 2UUAB 4TT3G 3OW2U 5IYBO 1HNXO 4N21A 1B6QA 4PV1B 2H8MA 1K7DA 5CBHA 3LMMA 3R4PA 4TV9B 2YGEA 3F7VC 4O09A 3EHHA 5CA1A 1THNA 3BFRA 4F6RB 1S77D 3OWBA 4FFBA 3MHHC 2C1GA 2X7RB 3QO7A 5LMNO 2CTWA 2NLJC 5EBMC 1PV0A 4DUYB 3ZRWA 3ZHUA 2IU0A 2DYRC 2DQ0A 4EM7A 2E75B 3OGCC 3OUFA 3JD1A 3G71V 3FFQA 2VQEB 3JALB 2ZE5A 1XL6A 2JGUA 2XUMA 2UWDA 4URLA 2Y4TA 2ATKC 5M4HA 2BSMA 2AKPA 2ZE7A 4FM2A 3PN1A 2UUBO 1N8RW 1NZ6A 1GJVA 5IDJA 3CGYA 1PNMA 1YJWV 1QLNA 1SQBH 2DWEC 1ZXNA 2ZNJA 3CRQA 4NH7A 4MVZA 1W0JG 4K0KB 1XMOB 2CG9A 1DLBA 4GKKB 1K73W 4XKAA 2EIJC 3OD4A 1BHAA 1RPOA 1FYJA 4QJFB 5GTIZ 4LR3A 1H2KA 4BW9A 5JQGA 3NR7A 4LWIA 4YKQA 3CCQV 1OHHG 1J5EB 2O1UA 4ZI7A 2XK2A 4FFKA 4F4LA 4YHHO 1Z2GA 4D7SA 3B8MA 3FB6C 3T1CA 2GFDA 4KQVA 1Q86W 2LW1A 3BA9A 3U11A 1JJOA 3OTOO 4OGQB 1TA8A 2QJ1A 4PA3A 3K97A 2R72A 4BR6A 2ZD9A 2AZ0A 3Q5LA 2YI0A 4MPNA 4DV1O 4XKKA 4DZYA 3ABMB 3QO8A 1I5DA 2RCVA 2W0XA 4X20B 2XX4A 1K97A 1US7A 5DECA 3JAWB 4JI5B 2BU6A 4E2LA 1BGQA 4X9QA 4I7ZB 3ZKBA 2YEIA 1SQVH 1YDXA 5KHHA 3UO3A 3T1KA 3SYAA 3PEJA 4EEQA 2ITCC 4OX9O 2N74A 1KMIZ 3CRRA 2YEVB 1KD1W 3CC4V 1PM9A 4XDMA 4J80A 4RQEA 1HDJA 2WEPA 1FFXB 5ITZA 4NTWA 5KX5B 1KC8W 3RLQA 3H1LH 4CS4A 2EXLA 3GWOA 1KYOF 3FB7C 4O2BB 4EFEA 2ZE8A 4X1IB 2FMLA 2A3QA 4HXZA 3MHSC 4HBNA 4JYYA 2EX3A 3X2QB 1WPXA 3G6EV 2XHTA 3SDLA 1R62A 4UCVA 3FKSG 4AQYB 5L3EA 5DM6V 4I50B 2EINC 1NT2B 2BU2A 5LOVB 2M7WA 4NVPA 1S76D 4LF5B 3T10A 2UUBB 1QZRA 3DTUB 5EIBC 1SQQH 1S5JA 3ZHQA 3NMQA 3OEEG 2BCCH 3F7YC 3TZ2A 1N32O 3G7EA 1Y74A 2KG7A 1UYHA 1AB3A 4DR7O 2ITDC 4TUYB 2FTKA 2V7QG 1I59A 4RAIA 2HHHB 5KUMA 2PYJA 2P22C 4JAAA 3P30A 3CRAA 4JI0O 1I08A 1Q7YW 4JGSA 3JD2A 4YJ2A 4DV2B 1GM9A 3W7WA 1Z5BA 3TZ4A 5FLXN 2OTJV 1Y76A 4JAVA 1IBMB 1HP8A 1MZFA 4EKWA 2YXHA 4HNAB 1BS3A 1CEZA 1NHIA 1GN6A 4Q20A 1U97A 3AG1B 4R6ZA 1ZL8B 2XAHA 3GVMA 2Q2EB 4UXNA 2Y4UA 2X0LA 1TVKB 1WA8A 1KB9F 1VMGA 1B06A 5B3SB 1BQ0A 2ZBKB 5D6QA 2DYSC 4O4LB 3ZJZA 1SQPH 1SA0B 2YKEA 4EB6A 2WLHA 2WI6A 2XDLA 3N2GA 4DO2A 5H2FZ 4X64O 1BKNA 4J11A 5EYPB 2ZDIC 3JAKA 2D2CB 4DRXB 2CAZC 2QGNA 5B66Z 1R3LC 1EFRG 3CYGA 1L1FA 2P7TC 2JS3A 1YC1A 5H9CA 5EBWC 3R66A 2EILB 2ZDIA 5GW7A 2KKWA 5D7RA 3ZHTA 4B08A 4ZKIA 3STZC 1LUVA 3UO2A 1UYKA 1THZA 1FAFA 2WI1A 4MOTA 3Q4HA 4JYCA 1SETA 3RYHA 1EN5A 4CWTA 2IW5A 4QPJA 3A0ZA 5IYZA 1YTFD 4UB6Z 1YF2A 4JI8O 3HKEA 1GAXA 5CA3A 2HCHA 3RYCA 2ZT9B 5FPOA 3CWVA 1A32A 1XI1A 3ASOB 3LDDA 4FJCC 4XC0A 4O4IA 1R3KC 1R3IC 1ZAUA 1SZTA 2YIAA 4ZOLA 4R1FA 4AWQA 3CJHA 1YC3A 1DGSA 2JEUA 3L75H 3OTOB 4ZHQA 1JFFA 1V9PA 3JASA 1EN4A 4H81A 3CX5F 3A0BZ 3D0BA 3ZCCA 4KSHA 1BCCH 2AHZA 2Y69C 3FB5C 1K5SA 3E8GA 3VHCA 4UVBA 1N32B 5IE9A 2PI4A 1DK1A 2Z5UA 2YXYA 1GKXA 1UJWB 4WFBV 1G4YB 1RSOB 4RO2A 1E79G 3OW6A 3T1YB 4XD8A 1QR9A 1D5NA 4LFCO 1AVMA 1SRYA 4MTFA 1N36B 4J42A 4NTXA 3QVNA 2YE6A 5LMUO 4JI4O 1KP3A 2JVDA 3C0EA 4Z2WA 2CCSA 1UYLA 2L6LA 3CMEV 1IBLB 3QG5A 1KKCA 4G27B 5LXTA 2A79B 5DEDA 3FT5A 4LFAB 2FYUH 1OCRC 2IWSA 4ICGA 1FXVA 1URFA 1IDSA 3RYFB 1GRJA 2DOSA 2XHBA 2JK5C 1AP5A 1H2NA 4LBEC 5KHJA 3WQ9A 2A0LA 2XDUA 4ASFA 3D2RA 4B6CA 2YC0A 1VQOV 1AR4A 4NH9A 4BWAA 4PU9A 1TC6A 4CS3A 4XDLA 4QE9A 2JEXA 1YT0A 2CGNA 4KP4A 5J2UB 3LDCA 1MABG 4OX9B 4JYBA 4DV4B 3OMAB 4YIPA 4MP7A 4ASUG 2WLLA 4NXNO 2LFSA 5CTUA 4JI3B 3IJ4A 3TGUH 1N36O 3L74H 3JCUZ 1H8HG 1G8MA 5M4PA 1XDCA 5CPHA 4FMTA 3HR0A 5KMGB 2UUCB 1OCCB 1BHBA 1S5HC 3A8TA 4JYAO 1P7GA 1QR8A 1KQSU 3INXA 4TV9A 1OZ0A 5JVDB 1WAZA 2H94A 2BRCA 5CA1B 2GQPA 3F5WC 4DV4O 3DXRA 2PY5A 3AG3B 2EIKB 1NTZH 3HZ5A 3M8AA 2P6JA 1TUEB 3K04A 4DUZB 2LGWA 5JJEB 4DK1A 2HJDA 4N23A 4CWFA 3MD0A 3ZRSA 3KE6A 5EC1C 1Z5VA 1ZXMA 4CE1A 1I5XA 1YZBA 1VQ5V 2EZOA 5IWAB 2P67A 4WUCA 2YKCA 3Q5KA 5HFLA 1VQ6V 4WF9V 2IJKA 1VF6A 1Q90D 2X6BA 2QTOA 3CS5A 2XX2A 1Q8IA 4W7TA 3G80A 4I0XB 3C3TA 2UXCB 3CCMV 2VWKA 3JSNA 5LMUB 3D3QA 4YKWA 5GONB 3IC7A 4X65O 4PRXA 3JSLA 2ZKJA 2CH4A 3EHJA 1Z5WA 5M4MA 3FV5A 1NKDA 1UY9A 5IJ9A 2E0AA 4DR1B 4HYPA 3KKYA 3B27A 2DMXA 4GX0A 2VQEO 5IYCO 5GTHZ 3ZMUA 3JD0A 2WA3A 3U67A 4GX5A 1O9HA 4BAEA 3ABKB 4DR6O 1RFYA 3T4DA 2YEDA 1P7BA 3P32A 5LMNB 2PF4E 1Y8NA 1I0HA 2YI5A 3BMYA 4BXIA 1JR9A 3GWKC 4DR1O 4XIPA 2D3OW 5GGZA 2ZXWB 2YK2A 4YY3O 3B4SA 4JI8B 1DTOA 2UU9O 1QYEA 3K60A 3EFFK 1Y4UA 1SZXA 1AI4A 5EBLC 2VCJA 4X1KA 3B25A 3ZX6A 3CCRV 3AG1C 1K33A 1YETA 2Y69B 2BT0A 4LF7B 4O4HB 5IT9N 2RNBA 3ZMZA 3CC2V 3H1KH 1SC5B 3RKZA 4FLTA 3OWDA 4R8CA 5IWAO 4DR3O 2V4DA 4F6RA 4HZ5A 1ZL8A 1M56C 1EA6A 2XAGA 2HKJA 1RPRA 1WA8B 4B3MO 1L0NH 3ZS8C 4MVMA 3ZHRA 3CCEV 5B1OA 5JWPA 2CTRA 1NHHA 1SA0A 4X66O 2W6IG 4LPBA 1NR7A 2ZE6A 1BL8A 1QY8A 4X9LA 4K8XA 1JM6A 1YITV 2HLDG 2Q9LA 1YESA 4R50A 5EYPA 2QWPB 3VQXA 1SERA 4MPEA 2UUCO 1DF5A 4JI5O 1XNQO 2YJXA 4DV0B 4EGKA 3T0HA 5LOVA 2R70A 1X59A 3TXQA 1RM1B 1YS3A 5LA6B 4CZZA 1IXMA 4E00A 1FD9A 3E83A 2Q73A 1HNWB 3K06A 3FAVB 4JI0B 3A0YA 3BABA 2KG7B 3SYOA 4GQTA 3EHGA 2UXXA 3CCUV 2BTQB 2QM4A 3ZEDA 4TUYA 4UCSA 4J7ZA 4LFBO 4BIUA 1YCIA 5CA0A 4PI0A 4FIPC 1M1KW 4K35A 3H80A 4URMA 3CRCA 4DR7B 1AJPA 4HXWA 1YTFB 3RYCB 5CF0A 4E02A 4EFUA 4P9OA 3ETQA 3K98A 2WLIA 3K5MA 2EBOA 3TK1A 2CGOA 4AS9A 2K9PA 1AJ6A 3A0RA 3LNMB 4YKUA 1AP6A 5F5RA 4YJ3A 4MVOA 3BVOA 3CXHF 4DV1B 4MVQA 2Y48A 2FL4A 3S5TA 4XIRA 2WLKA 4NXNB 1JFFB 2XAQA 2EIMC 2FWZA 3VQYA 1XHZA 2PTMA 1JVMA 5IY5B 5J2TA 1FXKB 2YE3A 4JI2B 4JV5O 2CUGA 1H2GA 3ABMC 2F4VO 5E79Z 1YSZA 4NXMO 1YT2A 1FFTB 3SPGA 4B7EA 3L9DA 4O0BA 2R9IA 3E8BA 1W2BU 3JALA 3CRKA 2OIEA 5EZYA 3LPSA 3ZN0A 1M90W 4JI7O 2E5LB 1S16A 1Q6UA 2YE7A 3P3PA 2ILMA 4CC6A 4ASGA 1BYQA 3D36A 2YSUB 3K5LA 1NI8A 4DV5O 4LWSA 1M56B 3ML0A 4YXWG 1L0OA 1VQ8V 1GM8A 3LSSA 3ZKDA 1FFXA 3GIFA 5KA5A 4B7PA 3U2DA 4FVMA 2O1WA 4O2BA 2XT9A 5LHIA 2MW2B 3PJSK 2BU5A 1Y67A 4L93A 4LFCB 1ID0A 5F2VO 5IY5C 4FLUA 4L87A 4PA4A 4J7JA 3T0ZA 4EGIA 4X62O 4BW5A 4RWUA 2XHXA 4FLWA 3CB2A 3CEIA 4BIOA 1AR1B 1QCEA 2F93B 2OCCB 3VQVA 3OR6C 1UYMA 4G2KA 1ORQC 3ICXA 3I56V 2QFOA 2QM7A 4KTNA 1WLEA 3CCSV 4GKJO 4GGLA 1ZX3A 1WN7A 3CJHB 1Y4MA 4YHHB 4IIJB 3ZHVA 1OJHA 1UY7A 2XABA 3S3XA 1TUBB 1HNZO 4J7KA 5IN9A 2QSAA 5FNVA 4RUEA 1SESA 2VRZA 4PA6A 2IJHA 3WB1A 4H85A 3JAWA 5CTWA 1LNQA 3ETGA 3D36C 2F1MA 4GUNA 4MVSA 4UCRA 4WFHA 1WB8A 1W0KG 5BXZA 1BMFG 2QDOA 2X6CA 4ZBMA 2ARHA 3MAQA 1S72V 3RYIA 5J9PC 3AK1A 2F23A 4B3MB 3F5TA 1IURA 1N0JA 3O6OA 3GIGA 4CE2A 4DR4O 3OPDA 1L8DA 4AI8A 1FJGO 1JMKC 1Z5AA 4X64B 5KUKA 3SGIA 2QE7G 1VIBA 2OWOA 4LF7O 4JZGA 4B3RB 2HR3A 3SJBC 2IORA 2UXBB 1K4CC 3SJQC 1XMQB 2YS8A 2YEAA 4KSGA 3J81N 4DV3O 1UPGA 5KHGA 2JS5A 3CE2A 5BZBA 1XBLA 5A9GA 2GUZA 2AZ2A 2QKSA 4BQJA 2O1VA 3AG3C 1OCZC 2YEEA 4AHCA 3L70H 1D5AA 1M57B 4CC5A 4X65B 4K3AA 4MVUA 1NBMG 1B3QA 2XAFA 1VQMV 4L94A 1M9NA 4X89A 3G6BA 4AQYO 4XCJA
chains in the Genus database with same CATH topology
1OCCC 3CMEV 4G27B 1M57C 2A79B 1AI7A 3OE7G 2F43G 1OCRC 2B5UA 2WPDG 1S3JA 1V55B 3OAAG 2HJFC 3CC7V 1FXVA 2ZR3A 3R65A 2JK5C 1YI2V 4LBEC 2EIKC 1GO3F 4JF3A 2A0LA 4JAUA 4JTAB 4QNHB 1JQ0A 4KFMA 3AG4B 4U7NA 1F4NA 3UM7A 3ZRXA 1QVGU 1CP9A 1VQOV 1GM7A 1ROPA 1EZJA 2XAJA 2Q68A 3WG7C 1VQ4V 1YJ9V 4XDLA 4QE9A 2JEXA 1R73A 1JJ2U 4XBFA 2JJ1G 4KP4A 4XDJA 3LDCA 3ASOC 1MABG 1ENVA 2WLNA 4JYBA 4WFAV 3E8FA 4GT1A 1KKDA 1CPYA 4WCEV 3OMAB 2IH1C 2IH3C 3AEIA 4ASUG 2WLLA 2DWDC 2LFSA 3W7UA 1NVPD 2QA4V 1JOYA 3BEHA 5EC2C 4JTCB 1AJQA 1MG1A 1H8HG 4JPRA 1G8MA 2GSMB 1OCRB 2CK3G 4I9WA 4MTOA 4MVRA 4FMTA 2DW4A 2JJ2G 4JTDB 1OCCB 4HYOA 2OTLV 1BHBA 1S5HC 3OFNG 3ZMTA 4U7OA 1PNLA 1QR8A 1KQSU 5DN6G 3VBBA 1EBOA 1OZ0A 2A9HA 2H94A 4PDMA 3F5WC 4LCUC 3AG4C 3E8HA 3FYEB 1AI5A 2WLJA 3NXSA 5LGNA 3LUTB 2HFEC 2B1GA 2Q69A 2WAMA 3AG3B 2EIKB 4MW3A 3K0DA 3SPJA 3ETEA 2P6JA 1TUEB 3K04A 1YHQV 3OM3B 5B1NA 5EK0A 1K8AW 4N23A 1JCHA 3MD0A 3ZMSA 3ZRSA 5EC1C 1DF4A 1F4MA 1OCOB 4G28B 1I5XA 2DYSB 1VQ5V 2EZOA 2P67A 4WFGA 5HFLA 5LBQA 3ABTA 3OUSA 4WF9V 1VQ6V 1VQKV 3UKMA 3ZRVA 3RVZA 2XASA 4BIZA 3CCVV 3I55V 1GK9A 4MSWC 1GTOA 2IJKA 2YEVA 2WLLB 5CMUA 2X6BA 2W0FC 2QTOA 2R9RB 3CYOA 1MSWD 3E2EA 3K03A 3CCLV 3JCZA 4TT3G 3CCMV 3OW2U 2WSSG 5IYBO 3IC7A 4N21A 1B6QA 3TCUA 3W7SA 1K7DA 4P2ZA 5CBHA 2C2AA 3F7VC 1NKDA 3FB8C 5FL7G 3OEHG 3WG7B 4GX0A 1S77D 5IYCO 3ZMUA 1H8EG 3JD0A 4GX5A 3MHHC 1FXKA 3HPLC 5C93A 2X7RB 3QO7A 3ABKB 2NLJC 5EBMC 4MW8A 3T4DA 4QE7A 3ZRWA 2P90A 1P7BA 3P32A 2IU0A 2DYRC 2DQ0A 5B1BC 2BOBC 1COWG 2Q6AA 1JPXA 3OGCC 3OUFA 3M99B 3JD1A 3G71V 2HVKC 3E35A 3LDEA 1XL6A 1V55C 4BAYA 2D3OW 2ZXWB 2ATKC 2JIZG 1V54C 3K0GA 1DTOA 2HG5C 3ZN1A 3EFFK 1N8RW 5IDJA 3B77A 1PNMA 3ABLC 1YJWV 1AJNA 1AI4A 5EBLC 1Q82W 1I5YA 1QLNA 2DWEC 1YSCA 1VQ7V 3CCRV 3W7XA 3AG1C 4MVZA 1W0JG 1K33A 5IYDO 1YJNV 1DLBA 1OCZB 1K73W 3IGAC 3K79A 2EIJC 1F51A 2Y69B 2XOKG 1BHAA 2LFRA 1RPOA 3ZMZA 1MOFA 1R3JC 3CC2V 3CD6V 4R8CA 4QJFB 1NQTA 3QNEA 3BY6A 4GX1A 1M56C 2XAGA 1S0VA 1JX9A 1QLEC 1RPRA 3JD3A 4CBCA 1FXHA 3CCQV 1QVFU 2Z3YA 1OHHG 5B3SC 2BOCC 2WLIB 4MVMA 2OCCC 2XNDG 5B1OA 3CCEV 4F4LA 5CBGA 3B8MA 3FB6C 1NH2B 2W6IG 3T1CA 3CMAV 3OMIB 1HWYA 1Q86W 1NR7A 1BL8A 3ZMVA 1YITV 2HLDG 1KP2A 1NJIW 4PA3A 4R50A 2ZD9A 3HB3B 1SERA 2WWWA 3ABMB 1DF5A 3QO8A 4MTGA 1K97A 3CPWU 3SYQA 2EILC 2EZPA 4E2LA 2EIMB 2IU3A 1RM1B 4P9PA 1NR1A 4CZZA 1IXMA 3E83A 3RVYA 3SYAA 3K06A 4TWKA 5LHHA 2Q67A 4Z1MG 2GHYA 3SYOA 4MT8A 2UXXA 2ITCC 3CCUV 3ASNC 4HAMA 2YEVB 3VOUA 4BIUA 1KD1W 1M1KW 4FIPC 5L3CA 3W7TA 5CBFA 3CC4V 5KA6A 4GX2A 4H37A 4RQEA 1AJPA 1ZWIC 2EINB 2NNUA 1YTFB 4P9OA 4R7CA 5HFMA 2WLIA 1FXKC 1KC8W 2EBOA 3TK1A 1PKXA 3FYIB 1E1QG 4PA9A 3A0RA 3GWOA 5B1AB 2H8PC 3FB7C 3LNMB 4UV9A 5CN0A 3X2QC 3JD4A 4MVOA 4MVQA 2KB1A 2Y48A 3MHSC 1K92A 2WLKA 4J9YB 2XAQA 2EIMC 4DXWA 2UXNA 3X2QB 1WPXA 2ZR2A 1NH2D 4JASA 3SYCA 3G6EV 1JVMA 5B1AC 5L3FA 1V54B 5IY5B 3ABUA 1VQNV 1FXKB 1AROP 1PD3A 3RBZA 2QEXV 1K34A 1H2GA 3ABMC 3FKSG 2B1IA 5L3EA 5DM6V 1FFTB 3SPGA 2EINC 4H33A 3ZRWB 2M7WA 2R9IA 3E8BA 1R6NA 1S76D 1W2BU 2OT5A 3K3WA 3DTUB 2DYRB 3ASNB 3ZN0A 1M90W 3AG2C 3OEEG 3TETA 1PNKA 3F7YC 2W6JG 3KG2A 1VQLV 1AI6A 1H38A 4KUMA 2ITDC 2FTKA 2V7QG 3STLC 4RAIA 5LHGA 3D36A 5KUMA 2YSUB 1P4RA 3K9AA 2QM8A 3AG2B 1QLEB 1VQPV 1M56B 3ML0A 3P30A 4FK5C 4YXWG 4OXSA 1Q7YW 1VQ8V 1GM8A 3LSSA 4JGSA 3JD2A 4PA7A 1GM9A 5KA5A 3W7WA 2K1EA 4PELA 2OTJV 5LGUA 4JAVA 4GCZA 3G4SV 5LHIA 4EKWA 2HVJC 3PJSK 5L3GA 2EIJB 3OR7C 4UUJC 1CEZA 4PDRA 5IY5C 4WFEA 4L87A 4PA4A 4Q20A 3WFVA 1YIJV 3AG1B 4R6ZA 4BW5A 2MK3A 4X8AA 2ZQMA 2XAHA 1PL0A 2WLMA 1F23A 4UXNA 2X0LA 1AR1B 1QCEA 2OCCB 3D3IA 1QBZA 4UV8A 3ABLB 3QO5A 5H6QA 3OR6C 5B3SB 5E1AC 4G2KA 1ORQC 3I56V 2QM7A 1WLEA 3CCSV 2DYSC 3ZJZA 3T4ZA 1OCOC 3ETDA 2ZXWC 3CP1A 2WLHA 1Y4MA 4PDLA 3LSQA 4J9ZB 2V1DA 2IJJA 4DO2A 3CCJV 3RW0A 3JYCA 5B1BB 1E1RG 2ZDIC 3OMNB 4RUEA 1SESA 3ABKC 4PA6A 1R3LC 2IJHA 1EFRG 1K3EA 1R6KA 1L1FA 1K5QA 2P7TC 1LNQA 1RM1C 3ETGA 5H9CA 5EBWC 1NVPB 2EILB 2ZDIA 4LC1A 4UVAA 5GW7A 4QIWF 4MVSA 3GB7C 4FPPA 4LP8A 4WFHA 4ZKIA 1GKFA 1J95A 1Y66A 3STZC 3T2MA 2JDIG 1THZA 1W0KG 1BMFG 2X6CA 4JYCA 5L3BA 1K9MW 2DQ3A 4ZBMA 1SETA 4UVCA 4MS2A 2IW5A 1S72V 4MTXA 4QPJA 5J9PC 4RUFA 1YTFD 1Q81W 3SYPA 5CA3A 3E89A 3ZIAG 2X6AA 3IFXA 3ASOB 3LDDA 1K4DC 4FJCC 4XDKA 4PDVA 5KUKA 1R3KC 1R3IC 2QE7G 2EJRA 1SZTA 2PI5A 2HKOA 2HR3A 2JEUA 1XL4A 1K4CC 3DGEA 3SJQC 4HZ3A 3SPCA 3SPIA 3E86A 3ZCCA 3CXCU 2AHZA 2Y69C 3FB5C 5BZBA 5L3DA 1K5SA 3E8GA 5LGTA 1VQ9V 4UVBA 2QKSA 3AG3C 2AHYA 1OCZC 2PI4A 3K08A 2Z5UA 4WFFA 3SPHA 4QPKA 3B8NA 1KECA 1UJWB 1G4YB 1E79G 2IJIA 4RO2A 4TSFG 1M57B 3H01A 4WFBV 1QR9A 3EHBB 1GMGA 2LP7A 4MVUA 1NBMG 1SRYA 4I5SA 4MTFA 1FS0G 2XAFA 4X88A 1KP3A 5H6RA 1VQMV 4P30A 1M9NA 4X89A 4RQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D36 A;  3ZRW A;  3MD0 A;  3P32 A;  2QM8 A;  4U7O A;  3ZCC A;  3ZRW B;  4QPJ A;  4KP4 A;  5B1O A;  3TK1 A;  2QM7 A;  2P67 A;  4JYB A;  3A0R A;  4GT1 A;  1IXM A;  2C2A A;  1F51 A;  4LC1 A;  4QPK A;  4JAV A;  3ZRV A;  2LFR A;  4GCZ A;  4FPP A;  4BIZ A;  3NXS A;  4ZKI A;  2LFS A;  4JAU A;  4MT8 A;  4I5S A;  1JOY A;  4U7N A;  4JYC A;  3DGE A;  4BIU A;  4JAS A;  4Q20 A;  3ZRX A;  5IDJ A;  5C93 A;  2FTK A;  2WWW A;  5B1N A;  4MTX A;  4FMT A; 
#chains in the Genus database with same CATH topology
 1M57 C;  1N0N A;  1AI7 A;  3EKO A;  1W59 A;  2B5U A;  1EZV H;  2Q0O C;  4DV6 O;  1S3J A;  1QQC A;  5JVD A;  2HJF C;  2XCM A;  4L90 A;  2HHH O;  2YE2 A;  1AIL A;  3CHX A;  3L72 H;  3DXR B;  3THO A;  4YJ2 B;  1YI2 V;  1IBK O;  2EIK C;  1GO3 F;  2LO1 A;  1QNM A;  2WI3 A;  2AW9 A;  4LNU A;  2EUL A;  3AG4 B;  5BY1 A;  4LF6 O;  2ADQ B;  3E22 B;  2N05 A;  3HKD A;  3FX7 A;  3ZRX A;  2QG2 A;  2IWU A;  1EZJ A;  3R92 A;  4O04 A;  3WG7 C;  1XOU A;  3H9V A;  3K5O A;  4CWR A;  3WU2 Z;  5CB4 B;  2UXC O;  1JJ2 U;  5D5P A;  3H1J H;  2JJ1 G;  4XBF A;  2F4V B;  4XDJ A;  1ENV A;  1YVW A;  1CPY A;  4WCE V;  3TUH A;  1UYE A;  1I94 B;  4DW1 A;  2QA4 V;  5A2Q N;  4JTC B;  1F7Y A;  3UT5 A;  1B04 A;  2LQT A;  2Q0A A;  2XDK A;  1Y8P A;  2DW4 A;  1R6T A;  3QTC A;  4JTD B;  1TH8 A;  2BZ5 A;  4H0L B;  3CWB H;  1IX9 A;  3JAK B;  1PNL A;  2XDS A;  2RN9 A;  3VHD A;  4FM1 A;  3DC5 A;  5IJ9 B;  3RYF A;  2NR5 A;  4LCU C;  2NN4 A;  3FYE B;  1ZW9 A;  3NXS A;  2HFE C;  4MW3 A;  2WAM A;  1KIJ A;  1PP9 H;  4MPC A;  4B7K A;  1YHQ V;  3OM3 B;  2N04 A;  3BRC A;  3A0T A;  5B1N A;  4HZ0 A;  2BTO A;  2RJZ A;  4G28 B;  5IYZ B;  2DYS B;  2ZIM A;  3B28 A;  5LA6 A;  3HKE B;  2P5O A;  5LBQ A;  3ABT A;  2AGA A;  2YEF A;  3SJA C;  4IL6 Z;  3UKM A;  3ZRV A;  3RVZ A;  4O4I B;  3U2K A;  2IBZ H;  1GK9 A;  4MSW C;  1U2O A;  2W0F C;  4MP2 A;  2QWO B;  2PYL A;  1MSW D;  1UY6 A;  5EIB D;  4DV7 B;  3CCL V;  3JCZ A;  4J41 A;  1L0L H;  2FKX A;  2WSS G;  4DW0 A;  2Y0P A;  1ZTE A;  2Q8V A;  2OYQ A;  1UY8 A;  2CH7 A;  5C8Y A;  2CCT A;  3TCU A;  3A0W A;  3BPZ A;  3W7S A;  4EFB A;  4YJ3 B;  4P2Z A;  1NS1 A;  4O4H A;  4UCU A;  5FPR A;  1MSD A;  2QWR B;  2LW7 A;  3FB8 C;  5FL7 G;  2OCH A;  3WG7 B;  2XTA A;  1MX0 A;  3INW A;  1FXK A;  1WNS A;  3HPL C;  2XJG A;  4XCL A;  2Z0A A;  4MW8 A;  1FKA O;  4QE7 A;  2P90 A;  2YI7 A;  1H2M A;  5B1B C;  4LF8 O;  2Q6A A;  1JPX A;  1SKV A;  2YDE A;  5JH7 A;  3ZBH A;  4GEE A;  4O2A A;  2VS0 A;  3E35 A;  5EZY B;  3JZ3 A;  3CRM A;  5JEN A;  1N4C A;  4KXR A;  1V55 C;  4BAY A;  4NR1 A;  3TXS A;  5IJ0 A;  1KBH A;  4YKZ A;  2JRI A;  3K0G A;  1IZ3 A;  2HG5 C;  3ZN1 A;  3B77 A;  1IBK B;  1AJN A;  4LWS B;  4I0X A;  4TV8 A;  4ABM A;  4EMV A;  5IYD O;  1IVS A;  3IGA C;  3APO A;  1F51 A;  4DK0 A;  2XOK G;  2LFR A;  3CD6 V;  1R3J C;  4BQG A;  4B3S B;  3BCC H;  1VEW A;  3QNE A;  2HP8 A;  3BY6 A;  4GX1 A;  4UFZ A;  4WBN B;  5CTX A;  4V25 A;  4CBC A;  4X1Y A;  2PGG A;  2BOC C;  2WLI B;  2CDY A;  5KMG A;  3HYZ A;  2XND G;  1H7S A;  4I55 A;  2IOP A;  2UUA O;  1NH2 B;  2YGF A;  2ZKO A;  3K99 A;  3OMI B;  4H44 B;  4ZIB A;  1QHT A;  1HWY A;  3ZMV A;  2GTA A;  4OPA A;  4DR2 O;  1NJI W;  2Q7E A;  4EFT A;  2F95 B;  3HB3 B;  5J2T B;  3G75 A;  4NKG B;  1Q6H A;  3RGB A;  1YER A;  4FZ0 A;  2H55 A;  4DR3 B;  1S5L Z;  4H7Q A;  3APQ A;  4NB5 A;  3JAR A;  2EIM B;  4QGP A;  2ZIO A;  2PUS A;  4P9P A;  2FXS A;  1NR1 A;  3RVY A;  1KZN A;  4Z1M G;  2GHY A;  4H13 B;  4MT8 A;  4GKJ B;  1NTM H;  4HAM A;  3VOU A;  5L3C A;  3RYI B;  5CBF A;  5KA6 A;  1US6 A;  3R91 A;  4E4E A;  1ZWI C;  3HEK A;  3KZI Z;  3GIG B;  3QDD A;  4R7C A;  2VQF B;  4X62 B;  5GON A;  2XHR A;  4PA9 A;  1NHJ A;  4UV9 A;  1MA1 A;  5CN0 A;  3JD4 A;  4O4J B;  4KHP B;  4B3S O;  2KB1 A;  4I9Q A;  1GH6 A;  4GFN A;  1K92 A;  4J9Y B;  1LUW A;  4DXW A;  2UXN A;  4U3J A;  3SYC A;  3OGI B;  2Q7G A;  3K5N A;  1S14 A;  2YKI A;  1ARO P;  1PD3 A;  3K57 A;  2QEX V;  4CH4 A;  3BHP A;  1BZK A;  4GYC B;  1OV9 A;  2LGQ A;  2QWQ B;  2OT5 A;  3O0I A;  4JI7 B;  3KCY A;  2DYR B;  2P06 A;  2XX5 A;  2WA4 A;  4IIJ A;  3TET A;  3M7M X;  2W6J G;  2ZDX A;  1TUB A;  4LF5 O;  3BM9 A;  3CSX A;  1H38 A;  3HKB A;  3STL C;  5LHG A;  1NU1 H;  3IC9 A;  3JAT B;  1P4R A;  2JGD B;  3RT3 C;  4JI2 O;  2YIB A;  4PRV A;  4B3T B;  1VQP V;  4E72 A;  4GKK O;  2YEC A;  4FK5 C;  4B3T O;  4DV5 B;  1Y4S A;  4PA7 A;  1N33 O;  4YKY A;  2K1E A;  5LGU A;  4YKX A;  5L3J A;  1HW7 A;  1BXD A;  4F6E A;  5L3G A;  3OR7 C;  4UUJ C;  5F3K A;  4PDR A;  5K1P A;  4WFE A;  4IHJ B;  2BSK B;  2VWC A;  2E74 B;  2VW5 A;  4KFG A;  2YUA A;  1WJZ A;  3DSQ A;  4L8Z A;  2JKI A;  4E01 A;  1MNG A;  1PL0 A;  2PNR A;  1QBZ A;  5BOC A;  3QO5 A;  1GN3 A;  1P49 A;  2QF6 A;  4I3H A;  4JV5 B;  4UB8 Z;  3T4Z A;  4R3M A;  2ZDY A;  1OCO C;  2ZXW C;  3N2K A;  2GTS A;  3CP1 A;  4PDL A;  2DN9 A;  2XDX A;  2R9A A;  3KCX A;  2GV9 A;  1PVG A;  3UT5 B;  2QWN B;  3LSQ A;  2A7W A;  2GBO A;  4J9Z B;  2YEB A;  3HKC A;  2QKA A;  3RW0 A;  5B1B B;  1N34 O;  1O9G A;  4NYK A;  2Q8F A;  4XIQ A;  3ABK C;  2GUZ B;  2RDC A;  5LP6 A;  4O07 A;  1SQX H;  2ADP A;  1I5B A;  3O9O A;  1UFI A;  1NVP B;  4TQD A;  1D2D A;  1EI1 A;  4UVA A;  4QIW F;  4V26 A;  2YE8 A;  4FPP A;  4LP8 A;  2BYI A;  1Y66 A;  2JDI G;  4CH3 A;  1K9M W;  2WI5 A;  4UVC A;  4MS2 A;  1YXB A;  3A0H Z;  4XKO A;  5CA0 B;  2Q8I A;  5AG2 A;  3RWR D;  1M4U A;  1VF6 C;  4RUF A;  4JI6 B;  3ZXO A;  1Q81 W;  3T1H O;  3E89 A;  3ZIA G;  2O57 A;  2X6A A;  1XNQ B;  5FWK A;  2C1I A;  3IFX A;  2YI8 A;  1KUQ A;  1XUQ A;  4DR5 O;  2EJR A;  4IGG A;  2HKO A;  2BU8 A;  1XRE A;  1XL4 A;  3DGE A;  2HEP A;  5KAF Z;  1XMO O;  4GLX A;  4U3F H;  3SPC A;  4KL1 A;  1B63 A;  3SPI A;  5CB4 A;  5K1X A;  2DJV A;  4L8J A;  1OSF A;  1SS3 A;  3CXC U;  3OMU A;  4LP0 A;  5LGT A;  1VQ9 V;  5BMV B;  4XIT A;  4LF6 B;  3K08 A;  4WFF A;  3U10 A;  2WEQ A;  4CWN A;  1VQ7 V;  2IJI A;  4TSF G;  3H01 A;  3EHB B;  4AIL C;  2LP7 A;  4J10 A;  4FFB B;  4I5S A;  4P7A A;  5JCO C;  1FS0 G;  4X88 A;  4P30 A;  3TTZ A;  2F66 C;  4RQF A;  3RLP A;  3OE7 G;  4DUY O;  2F43 G;  4DR6 B;  2CTP A;  1RP3 B;  2WPD G;  3TZ0 A;  3OAA G;  1KU9 A;  4PJ0 Z;  2YEH A;  1ZUQ A;  3AK3 A;  2ZR3 A;  1X4T A;  2JJC A;  4JF3 A;  2UU9 B;  4JAU A;  4A5U B;  1WP8 A;  1JQ0 A;  4KFM A;  2G38 A;  4QNH B;  4FCQ A;  3MDS A;  1QVG U;  1CP9 A;  1GM7 A;  3TJT A;  3B26 A;  3UCS C;  1HNX B;  1YJ9 V;  4I4T A;  1I5C A;  3EKR A;  3U0Z A;  3D8C A;  5FNC A;  3I5D A;  4LF8 B;  3ASO C;  4UCT A;  3R4M A;  2HHI A;  3AEI A;  4B3R O;  2DWD C;  1UYG A;  5JQG B;  3W7U A;  1NVP D;  2AXT Z;  3BEH A;  5EC2 C;  3RN4 A;  1MG1 A;  4JPR A;  4X1Y B;  2GSM B;  4DR4 B;  1OCR B;  4MTO A;  2YEG A;  5BOD A;  2JJ2 G;  1GKZ A;  4HYO A;  3ZHS A;  2OTL V;  3OFN G;  3ZMT A;  2CE4 A;  4U7O A;  1GN4 A;  5FNV B;  3VQW A;  4LH7 A;  5DN6 G;  3AG7 A;  4DR2 B;  4PDM A;  2IM9 A;  2YI6 A;  1PL4 A;  3J80 N;  1XNR B;  5LGN A;  2YE5 A;  2Q69 A;  1PPJ H;  2UXD O;  3K0D A;  1AM1 A;  2BTZ A;  3ETE A;  4PHZ A;  5M4E A;  3HKD B;  1JCH A;  3WB2 A;  3ZMS A;  1H7U A;  1U96 A;  1DF4 A;  5JH7 B;  3L73 H;  1OCO B;  4O2A B;  4O05 A;  3EVK A;  4WFG A;  1UYF A;  1EN6 A;  1LR1 A;  4FZ1 A;  1R1B A;  4IT5 A;  2XAS A;  3CCV V;  2YKJ A;  2YEV A;  3TZ5 A;  3CYO A;  1I58 A;  5IDM A;  1MZE A;  4TV8 B;  2DE0 X;  1J5E O;  4JYA B;  2RQ6 A;  2BE3 A;  4O4J A;  3EHF A;  2C2A A;  2A06 H;  3K58 A;  3OEH G;  3A2F A;  5BR8 O;  1UYI A;  1H8E G;  4MB9 A;  5C93 A;  2QTS A;  4ZI7 B;  4LFA O;  1TBW A;  2YIC A;  1TIL A;  4WUB A;  1G1X B;  5JJN B;  3C11 A;  3H1H H;  5JJJ B;  2BOB C;  1H2S B;  4C7U A;  1COW G;  3M99 B;  4R3A A;  1BSM A;  2HVK C;  5D7D A;  4FM0 A;  3LDE A;  1Q3E A;  4K4O A;  2Q8H A;  3GIE A;  2E5L O;  1XHX A;  1Y74 B;  2JIZ G;  1IXB A;  2P4K A;  1V54 C;  4JI6 O;  4LNU B;  4CWP A;  2Q5Z A;  2OIG A;  3ABL C;  2JGD A;  1Q82 W;  3E22 A;  1I5Y A;  4FLV A;  3RFR A;  3CGZ A;  1YSC A;  1H2L A;  2M6Y A;  3S3W A;  3W7X A;  1WB7 A;  1YJN V;  1TID A;  3IED A;  1OCZ B;  5C8Y B;  5LP6 C;  4URN A;  1HNW O;  3K79 A;  2ETN A;  2YXL A;  1MOF A;  4LF4 O;  3Q5J A;  4DUH A;  4JI4 B;  4IHJ A;  2ZM6 O;  1NQT A;  3R4N A;  3PEH A;  4DV0 O;  2WI7 A;  5H5N A;  1JX9 A;  1QLE C;  3JD3 A;  1QVF U;  1S0V A;  1FXH A;  2WI2 A;  2Z3Y A;  5B5E Z;  2H3O A;  5B3S C;  3H4L A;  4L91 A;  2QG0 A;  2OCC C;  5J71 A;  1VF5 B;  5CBG A;  1BGY H;  5KAI Z;  4CWO A;  3N2K B;  3CMA V;  2E3C A;  4LFB B;  1WPB A;  5JCO A;  4UCO A;  4X66 B;  1XMQ O;  2UXB O;  3N2G B;  1KP2 A;  3OT7 A;  2VCI A;  2EJ7 A;  2WWW A;  4KHP O;  4JI1 B;  4LWH A;  4MTG A;  3CPW U;  2L35 A;  1A4H A;  5LYJ A;  3SYQ A;  2XD6 A;  2EIL C;  3QF7 A;  2EZP A;  1P84 F;  2IU3 A;  3G67 A;  2ZNI A;  3UQ8 A;  2YGA A;  4TWK A;  3SJC C;  5LHH A;  2Q67 A;  4NTY A;  4XTJ A;  4OPH A;  3CRL A;  1XNR O;  3ASN C;  2ODM A;  5J6A A;  3HKB B;  3B40 A;  2ZIN A;  1T5E A;  3W7T A;  2CTQ A;  3JAT A;  4GX2 A;  4WBN A;  4H37 A;  1YT1 A;  2EIN B;  2NNU A;  1VF7 A;  1WP7 A;  5HFM A;  1HR0 O;  1FXK C;  1PKX A;  3K59 A;  2CH7 B;  1E1Q G;  3FYI B;  5B1A B;  1Y76 B;  2H8P C;  4NH8 A;  1SQG A;  4FCR A;  4I55 B;  3EXA A;  3X2Q C;  2BU7 A;  1HNZ B;  3B09 A;  1MMM A;  5D5Q A;  4LF9 B;  2LJ2 A;  2QR4 A;  2YEJ A;  3VHA A;  4DV2 O;  3ZM7 A;  2ZR2 A;  1NH2 D;  4JQL A;  4JAS A;  4DV6 B;  5L3F A;  5B1A C;  1V54 B;  3ABU A;  1VQN V;  5KLV H;  3RBZ A;  1K34 A;  2B1I A;  3R4O A;  3B24 A;  3ZRW B;  4H33 A;  1AMW A;  3RLR A;  1R6N A;  3K3W A;  3JAR B;  2YI9 A;  1YSR A;  2CCU A;  4YY3 B;  3ASN B;  3AG2 C;  4TQF A;  1HR0 B;  2VQF O;  1PNK A;  3KG2 A;  5IJ0 B;  1VQL V;  1AI6 A;  3P3N A;  4URO A;  1TGO A;  1B62 A;  4KUM A;  2BRE A;  2E76 B;  1SF9 A;  4LF4 B;  2YK9 A;  5LXT B;  2KQX A;  2Q7H A;  5CTY A;  3K9A A;  2QM8 A;  3L71 H;  3AG2 B;  4HY1 A;  1QLE B;  3HYY A;  3LNN A;  4OXS A;  5KHI A;  3A0X A;  4GT8 A;  2K5B A;  2GDS A;  2YIB D;  4PEL A;  4CS2 A;  3K9S A;  2B9Z A;  2RMK B;  4GCZ A;  3G4S V;  4U93 A;  1I7F A;  2HVJ C;  3J7A U;  3Q4H B;  2EIJ B;  1AR5 A;  1UYD A;  5FND A;  3ZXQ A;  3T1H B;  1BT8 A;  3WFV A;  3H1I H;  1YIJ V;  4K8Z A;  2MK3 A;  4U3J B;  4X8A A;  1TAE A;  2ZQM A;  1U0Z A;  4XE2 A;  2WLM A;  1F23 A;  2Q8G A;  3D3I A;  5J2U A;  4DUZ O;  4UV8 A;  3ABL B;  1TC0 A;  3HZ1 A;  5H6Q A;  4AWO A;  5E1A C;  2PZS A;  4NXM B;  2IOQ A;  1ZSP A;  3ETD A;  1AH8 A;  1I5A A;  2YKB A;  1AH6 A;  2V1D A;  2IJJ A;  5BR8 B;  3SL2 A;  4DR5 B;  3SR2 C;  1NTK H;  3CCJ V;  3JYC A;  1E1R G;  4AWP A;  3OMN B;  4LWG A;  2ZM6 B;  4JI1 O;  4X20 A;  1K3E A;  5BMV A;  1Y8O A;  1Q43 A;  1R6K A;  2FB5 A;  1K5Q A;  1RM1 C;  1ZWH A;  1RSO A;  4LC1 A;  4DV7 O;  1VP7 A;  3GB7 C;  2YE4 A;  1VAR A;  1G6U A;  1GKF A;  1J95 A;  1Q6I A;  3T2M A;  4HNA A;  5L3B A;  2WI4 A;  2DQ3 A;  1FPO A;  3T2S A;  4MTX A;  2YID A;  4WUD A;  3IAY A;  3B2E E;  3C90 A;  4YKT A;  2Q4P A;  3SYP A;  1TVK A;  2KSD A;  2ZCE A;  5M4N A;  1N34 B;  1K4D C;  5ITZ B;  5KX5 A;  2ESA A;  3BA8 A;  1JA8 A;  4XDK A;  1M5I A;  4PDV A;  4Z1V A;  3G7B A;  3MNR P;  4CWQ A;  4HY6 A;  4JI3 O;  1I94 O;  4O4L A;  4X1I A;  2PI5 A;  4EB6 B;  3FT8 A;  5TIS Z;  3VAD A;  4IYH A;  3LSU A;  1M93 A;  5D7C A;  1GN2 A;  4HZ3 A;  4K0K O;  3HKC B;  1IBL O;  3WHA A;  4I4T B;  4EEH A;  3E86 A;  2WER A;  5M4K A;  4HYM A;  4DRX A;  5L3D A;  4I50 A;  5LP6 B;  1BE3 H;  2AHY A;  1YC4 A;  4ASB A;  3SPH A;  4QPK A;  3B8N A;  1KEC A;  1Q5O A;  4EGH A;  3FD9 A;  1GMG A;  1EM1 A;  3DC6 A;  4CH6 A;  5H6R A;  3OTF A;  4TOI A;  1N33 B;  1OCC C;  4DYL A;  1V55 B;  3CC7 V;  4D7T A;  1YEW A;  4PI2 A;  3R65 A;  3HHU A;  3C3S A;  3T1Y O;  1Y6X A;  4JTA B;  4IYI A;  4LWF A;  4PL9 A;  2P4V A;  4U7N A;  1F4N A;  4D6T H;  3UM7 A;  2YE9 A;  4X1K B;  4ZHQ B;  4YKR A;  1ROP A;  2BSK A;  3BAA A;  4CWS A;  2XAJ A;  1XQ8 A;  2Q68 A;  1XIL A;  1VQ4 V;  2UXD B;  4ZVI A;  3JAS B;  3LNU A;  1R73 A;  4LWE A;  4GZR B;  4FLY A;  3AK2 A;  2WLN A;  4WFA V;  3E8F A;  4GT1 A;  1KKD A;  2IH1 C;  1BQZ A;  2IH3 C;  4W4K A;  2XJX A;  2QKC A;  5FNF A;  4CH5 A;  4LF9 O;  2VWJ A;  1JOY A;  2CGF A;  1AJQ A;  1UYC A;  2CK3 G;  4I9W A;  4MVR A;  4FLZ A;  4YIO A;  4FLX A;  5D6P A;  4W4L A;  1XEQ A;  3VBB A;  1EBO A;  4PD4 F;  4P8O A;  2A9H A;  4LH6 A;  4MBC A;  4DV3 B;  2FYP A;  3AG4 C;  4ASA A;  3E8H A;  1AI5 A;  3O2F A;  2WLJ A;  3LUT B;  2B1G A;  3SPJ A;  3N27 A;  2HG1 A;  2BYH A;  4FCP A;  5EK0 A;  1K8A W;  1CXZ B;  3RYH B;  1SQF A;  2IWX A;  5LYJ B;  1QU7 A;  5KHK A;  1FJG B;  2XJJ A;  4CE3 A;  1F4M A;  3JAM N;  3WB0 A;  1ZLZ A;  5LL6 Y;  2FWY A;  3QTF A;  4Q6G A;  1IBM O;  4JZ2 A;  3FAV A;  1Z59 A;  3OUS A;  1VQK V;  1Z5C A;  2BTQ A;  2Y0I A;  4BIZ A;  1MU5 A;  3I55 V;  1GTO A;  2YJW A;  2WLL B;  5CMU A;  4ZOL B;  3O65 A;  2R9R B;  3E2E A;  3K03 A;  2UUA B;  4TT3 G;  3OW2 U;  5IYB O;  1HNX O;  4N21 A;  1B6Q A;  4PV1 B;  2H8M A;  1K7D A;  5CBH A;  3LMM A;  3R4P A;  4TV9 B;  2YGE A;  3F7V C;  4O09 A;  3EHH A;  5CA1 A;  1THN A;  3BFR A;  4F6R B;  1S77 D;  3OWB A;  4FFB A;  3MHH C;  2C1G A;  2X7R B;  3QO7 A;  5LMN O;  2CTW A;  2NLJ C;  5EBM C;  1PV0 A;  4DUY B;  3ZRW A;  3ZHU A;  2IU0 A;  2DYR C;  2DQ0 A;  4EM7 A;  2E75 B;  3OGC C;  3OUF A;  3JD1 A;  3G71 V;  3FFQ A;  2VQE B;  3JAL B;  2ZE5 A;  1XL6 A;  2JGU A;  2XUM A;  2UWD A;  4URL A;  2Y4T A;  2ATK C;  5M4H A;  2BSM A;  2AKP A;  2ZE7 A;  4FM2 A;  3PN1 A;  2UUB O;  1N8R W;  1NZ6 A;  1GJV A;  5IDJ A;  3CGY A;  1PNM A;  1YJW V;  1QLN A;  1SQB H;  2DWE C;  1ZXN A;  2ZNJ A;  3CRQ A;  4NH7 A;  4MVZ A;  1W0J G;  4K0K B;  1XMO B;  2CG9 A;  1DLB A;  4GKK B;  1K73 W;  4XKA A;  2EIJ C;  3OD4 A;  1BHA A;  1RPO A;  1FYJ A;  4QJF B;  5GTI Z;  4LR3 A;  1H2K A;  4BW9 A;  5JQG A;  3NR7 A;  4LWI A;  4YKQ A;  3CCQ V;  1OHH G;  1J5E B;  2O1U A;  4ZI7 A;  2XK2 A;  4FFK A;  4F4L A;  4YHH O;  1Z2G A;  4D7S A;  3B8M A;  3FB6 C;  3T1C A;  2GFD A;  4KQV A;  1Q86 W;  2LW1 A;  3BA9 A;  3U11 A;  1JJO A;  3OTO O;  4OGQ B;  1TA8 A;  2QJ1 A;  4PA3 A;  3K97 A;  2R72 A;  4BR6 A;  2ZD9 A;  2AZ0 A;  3Q5L A;  2YI0 A;  4MPN A;  4DV1 O;  4XKK A;  4DZY A;  3ABM B;  3QO8 A;  1I5D A;  2RCV A;  2W0X A;  4X20 B;  2XX4 A;  1K97 A;  1US7 A;  5DEC A;  3JAW B;  4JI5 B;  2BU6 A;  4E2L A;  1BGQ A;  4X9Q A;  4I7Z B;  3ZKB A;  2YEI A;  1SQV H;  1YDX A;  5KHH A;  3UO3 A;  3T1K A;  3SYA A;  3PEJ A;  4EEQ A;  2ITC C;  4OX9 O;  2N74 A;  1KMI Z;  3CRR A;  2YEV B;  1KD1 W;  3CC4 V;  1PM9 A;  4XDM A;  4J80 A;  4RQE A;  1HDJ A;  2WEP A;  1FFX B;  5ITZ A;  4NTW A;  5KX5 B;  1KC8 W;  3RLQ A;  3H1L H;  4CS4 A;  2EXL A;  3GWO A;  1KYO F;  3FB7 C;  4O2B B;  4EFE A;  2ZE8 A;  4X1I B;  2FML A;  2A3Q A;  4HXZ A;  3MHS C;  4HBN A;  4JYY A;  2EX3 A;  3X2Q B;  1WPX A;  3G6E V;  2XHT A;  3SDL A;  1R62 A;  4UCV A;  3FKS G;  4AQY B;  5L3E A;  5DM6 V;  4I50 B;  2EIN C;  1NT2 B;  2BU2 A;  5LOV B;  2M7W A;  4NVP A;  1S76 D;  4LF5 B;  3T10 A;  2UUB B;  1QZR A;  3DTU B;  5EIB C;  1SQQ H;  1S5J A;  3ZHQ A;  3NMQ A;  3OEE G;  2BCC H;  3F7Y C;  3TZ2 A;  1N32 O;  3G7E A;  1Y74 A;  2KG7 A;  1UYH A;  1AB3 A;  4DR7 O;  2ITD C;  4TUY B;  2FTK A;  2V7Q G;  1I59 A;  4RAI A;  2HHH B;  5KUM A;  2PYJ A;  2P22 C;  4JAA A;  3P30 A;  3CRA A;  4JI0 O;  1I08 A;  1Q7Y W;  4JGS A;  3JD2 A;  4YJ2 A;  4DV2 B;  1GM9 A;  3W7W A;  1Z5B A;  3TZ4 A;  5FLX N;  2OTJ V;  1Y76 A;  4JAV A;  1IBM B;  1HP8 A;  1MZF A;  4EKW A;  2YXH A;  4HNA B;  1BS3 A;  1CEZ A;  1NHI A;  1GN6 A;  4Q20 A;  1U97 A;  3AG1 B;  4R6Z A;  1ZL8 B;  2XAH A;  3GVM A;  2Q2E B;  4UXN A;  2Y4U A;  2X0L A;  1TVK B;  1WA8 A;  1KB9 F;  1VMG A;  1B06 A;  5B3S B;  1BQ0 A;  2ZBK B;  5D6Q A;  2DYS C;  4O4L B;  3ZJZ A;  1SQP H;  1SA0 B;  2YKE A;  4EB6 A;  2WLH A;  2WI6 A;  2XDL A;  3N2G A;  4DO2 A;  5H2F Z;  4X64 O;  1BKN A;  4J11 A;  5EYP B;  2ZDI C;  3JAK A;  2D2C B;  4DRX B;  2CAZ C;  2QGN A;  5B66 Z;  1R3L C;  1EFR G;  3CYG A;  1L1F A;  2P7T C;  2JS3 A;  1YC1 A;  5H9C A;  5EBW C;  3R66 A;  2EIL B;  2ZDI A;  5GW7 A;  2KKW A;  5D7R A;  3ZHT A;  4B08 A;  4ZKI A;  3STZ C;  1LUV A;  3UO2 A;  1UYK A;  1THZ A;  1FAF A;  2WI1 A;  4MOT A;  3Q4H A;  4JYC A;  1SET A;  3RYH A;  1EN5 A;  4CWT A;  2IW5 A;  4QPJ A;  3A0Z A;  5IYZ A;  1YTF D;  4UB6 Z;  1YF2 A;  4JI8 O;  3HKE A;  1GAX A;  5CA3 A;  2HCH A;  3RYC A;  2ZT9 B;  5FPO A;  3CWV A;  1A32 A;  1XI1 A;  3ASO B;  3LDD A;  4FJC C;  4XC0 A;  4O4I A;  1R3K C;  1R3I C;  1ZAU A;  1SZT A;  2YIA A;  4ZOL A;  4R1F A;  4AWQ A;  3CJH A;  1YC3 A;  1DGS A;  2JEU A;  3L75 H;  3OTO B;  4ZHQ A;  1JFF A;  1V9P A;  3JAS A;  1EN4 A;  4H81 A;  3CX5 F;  3A0B Z;  3D0B A;  3ZCC A;  4KSH A;  1BCC H;  2AHZ A;  2Y69 C;  3FB5 C;  1K5S A;  3E8G A;  3VHC A;  4UVB A;  1N32 B;  5IE9 A;  2PI4 A;  1DK1 A;  2Z5U A;  2YXY A;  1GKX A;  1UJW B;  4WFB V;  1G4Y B;  1RSO B;  4RO2 A;  1E79 G;  3OW6 A;  3T1Y B;  4XD8 A;  1QR9 A;  1D5N A;  4LFC O;  1AVM A;  1SRY A;  4MTF A;  1N36 B;  4J42 A;  4NTX A;  3QVN A;  2YE6 A;  5LMU O;  4JI4 O;  1KP3 A;  2JVD A;  3C0E A;  4Z2W A;  2CCS A;  1UYL A;  2L6L A;  3CME V;  1IBL B;  3QG5 A;  1KKC A;  4G27 B;  5LXT A;  2A79 B;  5DED A;  3FT5 A;  4LFA B;  2FYU H;  1OCR C;  2IWS A;  4ICG A;  1FXV A;  1URF A;  1IDS A;  3RYF B;  1GRJ A;  2DOS A;  2XHB A;  2JK5 C;  1AP5 A;  1H2N A;  4LBE C;  5KHJ A;  3WQ9 A;  2A0L A;  2XDU A;  4ASF A;  3D2R A;  4B6C A;  2YC0 A;  1VQO V;  1AR4 A;  4NH9 A;  4BWA A;  4PU9 A;  1TC6 A;  4CS3 A;  4XDL A;  4QE9 A;  2JEX A;  1YT0 A;  2CGN A;  4KP4 A;  5J2U B;  3LDC A;  1MAB G;  4OX9 B;  4JYB A;  4DV4 B;  3OMA B;  4YIP A;  4MP7 A;  4ASU G;  2WLL A;  4NXN O;  2LFS A;  5CTU A;  4JI3 B;  3IJ4 A;  3TGU H;  1N36 O;  3L74 H;  3JCU Z;  1H8H G;  1G8M A;  5M4P A;  1XDC A;  5CPH A;  4FMT A;  3HR0 A;  5KMG B;  2UUC B;  1OCC B;  1BHB A;  1S5H C;  3A8T A;  4JYA O;  1P7G A;  1QR8 A;  1KQS U;  3INX A;  4TV9 A;  1OZ0 A;  5JVD B;  1WAZ A;  2H94 A;  2BRC A;  5CA1 B;  2GQP A;  3F5W C;  4DV4 O;  3DXR A;  2PY5 A;  3AG3 B;  2EIK B;  1NTZ H;  3HZ5 A;  3M8A A;  2P6J A;  1TUE B;  3K04 A;  4DUZ B;  2LGW A;  5JJE B;  4DK1 A;  2HJD A;  4N23 A;  4CWF A;  3MD0 A;  3ZRS A;  3KE6 A;  5EC1 C;  1Z5V A;  1ZXM A;  4CE1 A;  1I5X A;  1YZB A;  1VQ5 V;  2EZO A;  5IWA B;  2P67 A;  4WUC A;  2YKC A;  3Q5K A;  5HFL A;  1VQ6 V;  4WF9 V;  2IJK A;  1VF6 A;  1Q90 D;  2X6B A;  2QTO A;  3CS5 A;  2XX2 A;  1Q8I A;  4W7T A;  3G80 A;  4I0X B;  3C3T A;  2UXC B;  3CCM V;  2VWK A;  3JSN A;  5LMU B;  3D3Q A;  4YKW A;  5GON B;  3IC7 A;  4X65 O;  4PRX A;  3JSL A;  2ZKJ A;  2CH4 A;  3EHJ A;  1Z5W A;  5M4M A;  3FV5 A;  1NKD A;  1UY9 A;  5IJ9 A;  2E0A A;  4DR1 B;  4HYP A;  3KKY A;  3B27 A;  2DMX A;  4GX0 A;  2VQE O;  5IYC O;  5GTH Z;  3ZMU A;  3JD0 A;  2WA3 A;  3U67 A;  4GX5 A;  1O9H A;  4BAE A;  3ABK B;  4DR6 O;  1RFY A;  3T4D A;  2YED A;  1P7B A;  3P32 A;  5LMN B;  2PF4 E;  1Y8N A;  1I0H A;  2YI5 A;  3BMY A;  4BXI A;  1JR9 A;  3GWK C;  4DR1 O;  4XIP A;  2D3O W;  5GGZ A;  2ZXW B;  2YK2 A;  4YY3 O;  3B4S A;  4JI8 B;  1DTO A;  2UU9 O;  1QYE A;  3K60 A;  3EFF K;  1Y4U A;  1SZX A;  1AI4 A;  5EBL C;  2VCJ A;  4X1K A;  3B25 A;  3ZX6 A;  3CCR V;  3AG1 C;  1K33 A;  1YET A;  2Y69 B;  2BT0 A;  4LF7 B;  4O4H B;  5IT9 N;  2RNB A;  3ZMZ A;  3CC2 V;  3H1K H;  1SC5 B;  3RKZ A;  4FLT A;  3OWD A;  4R8C A;  5IWA O;  4DR3 O;  2V4D A;  4F6R A;  4HZ5 A;  1ZL8 A;  1M56 C;  1EA6 A;  2XAG A;  2HKJ A;  1RPR A;  1WA8 B;  4B3M O;  1L0N H;  3ZS8 C;  4MVM A;  3ZHR A;  3CCE V;  5B1O A;  5JWP A;  2CTR A;  1NHH A;  1SA0 A;  4X66 O;  2W6I G;  4LPB A;  1NR7 A;  2ZE6 A;  1BL8 A;  1QY8 A;  4X9L A;  4K8X A;  1JM6 A;  1YIT V;  2HLD G;  2Q9L A;  1YES A;  4R50 A;  5EYP A;  2QWP B;  3VQX A;  1SER A;  4MPE A;  2UUC O;  1DF5 A;  4JI5 O;  1XNQ O;  2YJX A;  4DV0 B;  4EGK A;  3T0H A;  5LOV A;  2R70 A;  1X59 A;  3TXQ A;  1RM1 B;  1YS3 A;  5LA6 B;  4CZZ A;  1IXM A;  4E00 A;  1FD9 A;  3E83 A;  2Q73 A;  1HNW B;  3K06 A;  3FAV B;  4JI0 B;  3A0Y A;  3BAB A;  2KG7 B;  3SYO A;  4GQT A;  3EHG A;  2UXX A;  3CCU V;  2BTQ B;  2QM4 A;  3ZED A;  4TUY A;  4UCS A;  4J7Z A;  4LFB O;  4BIU A;  1YCI A;  5CA0 A;  4PI0 A;  4FIP C;  1M1K W;  4K35 A;  3H80 A;  4URM A;  3CRC A;  4DR7 B;  1AJP A;  4HXW A;  1YTF B;  3RYC B;  5CF0 A;  4E02 A;  4EFU A;  4P9O A;  3ETQ A;  3K98 A;  2WLI A;  3K5M A;  2EBO A;  3TK1 A;  2CGO A;  4AS9 A;  2K9P A;  1AJ6 A;  3A0R A;  3LNM B;  4YKU A;  1AP6 A;  5F5R A;  4YJ3 A;  4MVO A;  3BVO A;  3CXH F;  4DV1 B;  4MVQ A;  2Y48 A;  2FL4 A;  3S5T A;  4XIR A;  2WLK A;  4NXN B;  1JFF B;  2XAQ A;  2EIM C;  2FWZ A;  3VQY A;  1XHZ A;  2PTM A;  1JVM A;  5IY5 B;  5J2T A;  1FXK B;  2YE3 A;  4JI2 B;  4JV5 O;  2CUG A;  1H2G A;  3ABM C;  2F4V O;  5E79 Z;  1YSZ A;  4NXM O;  1YT2 A;  1FFT B;  3SPG A;  4B7E A;  3L9D A;  4O0B A;  2R9I A;  3E8B A;  1W2B U;  3JAL A;  3CRK A;  2OIE A;  5EZY A;  3LPS A;  3ZN0 A;  1M90 W;  4JI7 O;  2E5L B;  1S16 A;  1Q6U A;  2YE7 A;  3P3P A;  2ILM A;  4CC6 A;  4ASG A;  1BYQ A;  3D36 A;  2YSU B;  3K5L A;  1NI8 A;  4DV5 O;  4LWS A;  1M56 B;  3ML0 A;  4YXW G;  1L0O A;  1VQ8 V;  1GM8 A;  3LSS A;  3ZKD A;  1FFX A;  3GIF A;  5KA5 A;  4B7P A;  3U2D A;  4FVM A;  2O1W A;  4O2B A;  2XT9 A;  5LHI A;  2MW2 B;  3PJS K;  2BU5 A;  1Y67 A;  4L93 A;  4LFC B;  1ID0 A;  5F2V O;  5IY5 C;  4FLU A;  4L87 A;  4PA4 A;  4J7J A;  3T0Z A;  4EGI A;  4X62 O;  4BW5 A;  4RWU A;  2XHX A;  4FLW A;  3CB2 A;  3CEI A;  4BIO A;  1AR1 B;  1QCE A;  2F93 B;  2OCC B;  3VQV A;  3OR6 C;  1UYM A;  4G2K A;  1ORQ C;  3ICX A;  3I56 V;  2QFO A;  2QM7 A;  4KTN A;  1WLE A;  3CCS V;  4GKJ O;  4GGL A;  1ZX3 A;  1WN7 A;  3CJH B;  1Y4M A;  4YHH B;  4IIJ B;  3ZHV A;  1OJH A;  1UY7 A;  2XAB A;  3S3X A;  1TUB B;  1HNZ O;  4J7K A;  5IN9 A;  2QSA A;  5FNV A;  4RUE A;  1SES A;  2VRZ A;  4PA6 A;  2IJH A;  3WB1 A;  4H85 A;  3JAW A;  5CTW A;  1LNQ A;  3ETG A;  3D36 C;  2F1M A;  4GUN A;  4MVS A;  4UCR A;  4WFH A;  1WB8 A;  1W0K G;  5BXZ A;  1BMF G;  2QDO A;  2X6C A;  4ZBM A;  2ARH A;  3MAQ A;  1S72 V;  3RYI A;  5J9P C;  3AK1 A;  2F23 A;  4B3M B;  3F5T A;  1IUR A;  1N0J A;  3O6O A;  3GIG A;  4CE2 A;  4DR4 O;  3OPD A;  1L8D A;  4AI8 A;  1FJG O;  1JMK C;  1Z5A A;  4X64 B;  5KUK A;  3SGI A;  2QE7 G;  1VIB A;  2OWO A;  4LF7 O;  4JZG A;  4B3R B;  2HR3 A;  3SJB C;  2IOR A;  2UXB B;  1K4C C;  3SJQ C;  1XMQ B;  2YS8 A;  2YEA A;  4KSG A;  3J81 N;  4DV3 O;  1UPG A;  5KHG A;  2JS5 A;  3CE2 A;  5BZB A;  1XBL A;  5A9G A;  2GUZ A;  2AZ2 A;  2QKS A;  4BQJ A;  2O1V A;  3AG3 C;  1OCZ C;  2YEE A;  4AHC A;  3L70 H;  1D5A A;  1M57 B;  4CC5 A;  4X65 B;  4K3A A;  4MVU A;  1NBM G;  1B3Q A;  2XAF A;  1VQM V;  4L94 A;  1M9N A;  4X89 A;  3G6B A;  4AQY O;  4XCJ A; 
#chains in the Genus database with same CATH homology
 1OCC C;  3CME V;  4G27 B;  1M57 C;  2A79 B;  1AI7 A;  3OE7 G;  2F43 G;  1OCR C;  2B5U A;  2WPD G;  1S3J A;  1V55 B;  3OAA G;  2HJF C;  3CC7 V;  1FXV A;  2ZR3 A;  3R65 A;  2JK5 C;  1YI2 V;  4LBE C;  2EIK C;  1GO3 F;  4JF3 A;  2A0L A;  4JAU A;  4JTA B;  4QNH B;  1JQ0 A;  4KFM A;  3AG4 B;  4U7N A;  1F4N A;  3UM7 A;  3ZRX A;  1QVG U;  1CP9 A;  1VQO V;  1GM7 A;  1ROP A;  1EZJ A;  2XAJ A;  2Q68 A;  3WG7 C;  1VQ4 V;  1YJ9 V;  4XDL A;  4QE9 A;  2JEX A;  1R73 A;  1JJ2 U;  4XBF A;  2JJ1 G;  4KP4 A;  4XDJ A;  3LDC A;  3ASO C;  1MAB G;  1ENV A;  2WLN A;  4JYB A;  4WFA V;  3E8F A;  4GT1 A;  1KKD A;  1CPY A;  4WCE V;  3OMA B;  2IH1 C;  2IH3 C;  3AEI A;  4ASU G;  2WLL A;  2DWD C;  2LFS A;  3W7U A;  1NVP D;  2QA4 V;  1JOY A;  3BEH A;  5EC2 C;  4JTC B;  1AJQ A;  1MG1 A;  1H8H G;  4JPR A;  1G8M A;  2GSM B;  1OCR B;  2CK3 G;  4I9W A;  4MTO A;  4MVR A;  4FMT A;  2DW4 A;  2JJ2 G;  4JTD B;  1OCC B;  4HYO A;  2OTL V;  1BHB A;  1S5H C;  3OFN G;  3ZMT A;  4U7O A;  1PNL A;  1QR8 A;  1KQS U;  5DN6 G;  3VBB A;  1EBO A;  1OZ0 A;  2A9H A;  2H94 A;  4PDM A;  3F5W C;  4LCU C;  3AG4 C;  3E8H A;  3FYE B;  1AI5 A;  2WLJ A;  3NXS A;  5LGN A;  3LUT B;  2HFE C;  2B1G A;  2Q69 A;  2WAM A;  3AG3 B;  2EIK B;  4MW3 A;  3K0D A;  3SPJ A;  3ETE A;  2P6J A;  1TUE B;  3K04 A;  1YHQ V;  3OM3 B;  5B1N A;  5EK0 A;  1K8A W;  4N23 A;  1JCH A;  3MD0 A;  3ZMS A;  3ZRS A;  5EC1 C;  1DF4 A;  1F4M A;  1OCO B;  4G28 B;  1I5X A;  2DYS B;  1VQ5 V;  2EZO A;  2P67 A;  4WFG A;  5HFL A;  5LBQ A;  3ABT A;  3OUS A;  4WF9 V;  1VQ6 V;  1VQK V;  3UKM A;  3ZRV A;  3RVZ A;  2XAS A;  4BIZ A;  3CCV V;  3I55 V;  1GK9 A;  4MSW C;  1GTO A;  2IJK A;  2YEV A;  2WLL B;  5CMU A;  2X6B A;  2W0F C;  2QTO A;  2R9R B;  3CYO A;  1MSW D;  3E2E A;  3K03 A;  3CCL V;  3JCZ A;  4TT3 G;  3CCM V;  3OW2 U;  2WSS G;  5IYB O;  3IC7 A;  4N21 A;  1B6Q A;  3TCU A;  3W7S A;  1K7D A;  4P2Z A;  5CBH A;  2C2A A;  3F7V C;  1NKD A;  3FB8 C;  5FL7 G;  3OEH G;  3WG7 B;  4GX0 A;  1S77 D;  5IYC O;  3ZMU A;  1H8E G;  3JD0 A;  4GX5 A;  3MHH C;  1FXK A;  3HPL C;  5C93 A;  2X7R B;  3QO7 A;  3ABK B;  2NLJ C;  5EBM C;  4MW8 A;  3T4D A;  4QE7 A;  3ZRW A;  2P90 A;  1P7B A;  3P32 A;  2IU0 A;  2DYR C;  2DQ0 A;  5B1B C;  2BOB C;  1COW G;  2Q6A A;  1JPX A;  3OGC C;  3OUF A;  3M99 B;  3JD1 A;  3G71 V;  2HVK C;  3E35 A;  3LDE A;  1XL6 A;  1V55 C;  4BAY A;  2D3O W;  2ZXW B;  2ATK C;  2JIZ G;  1V54 C;  3K0G A;  1DTO A;  2HG5 C;  3ZN1 A;  3EFF K;  1N8R W;  5IDJ A;  3B77 A;  1PNM A;  3ABL C;  1YJW V;  1AJN A;  1AI4 A;  5EBL C;  1Q82 W;  1I5Y A;  1QLN A;  2DWE C;  1YSC A;  1VQ7 V;  3CCR V;  3W7X A;  3AG1 C;  4MVZ A;  1W0J G;  1K33 A;  5IYD O;  1YJN V;  1DLB A;  1OCZ B;  1K73 W;  3IGA C;  3K79 A;  2EIJ C;  1F51 A;  2Y69 B;  2XOK G;  1BHA A;  2LFR A;  1RPO A;  3ZMZ A;  1MOF A;  1R3J C;  3CC2 V;  3CD6 V;  4R8C A;  4QJF B;  1NQT A;  3QNE A;  3BY6 A;  4GX1 A;  1M56 C;  2XAG A;  1S0V A;  1JX9 A;  1QLE C;  1RPR A;  3JD3 A;  4CBC A;  1FXH A;  3CCQ V;  1QVF U;  2Z3Y A;  1OHH G;  5B3S C;  2BOC C;  2WLI B;  4MVM A;  2OCC C;  2XND G;  5B1O A;  3CCE V;  4F4L A;  5CBG A;  3B8M A;  3FB6 C;  1NH2 B;  2W6I G;  3T1C A;  3CMA V;  3OMI B;  1HWY A;  1Q86 W;  1NR7 A;  1BL8 A;  3ZMV A;  1YIT V;  2HLD G;  1KP2 A;  1NJI W;  4PA3 A;  4R50 A;  2ZD9 A;  3HB3 B;  1SER A;  2WWW A;  3ABM B;  1DF5 A;  3QO8 A;  4MTG A;  1K97 A;  3CPW U;  3SYQ A;  2EIL C;  2EZP A;  4E2L A;  2EIM B;  2IU3 A;  1RM1 B;  4P9P A;  1NR1 A;  4CZZ A;  1IXM A;  3E83 A;  3RVY A;  3SYA A;  3K06 A;  4TWK A;  5LHH A;  2Q67 A;  4Z1M G;  2GHY A;  3SYO A;  4MT8 A;  2UXX A;  2ITC C;  3CCU V;  3ASN C;  4HAM A;  2YEV B;  3VOU A;  4BIU A;  1KD1 W;  1M1K W;  4FIP C;  5L3C A;  3W7T A;  5CBF A;  3CC4 V;  5KA6 A;  4GX2 A;  4H37 A;  4RQE A;  1AJP A;  1ZWI C;  2EIN B;  2NNU A;  1YTF B;  4P9O A;  4R7C A;  5HFM A;  2WLI A;  1FXK C;  1KC8 W;  2EBO A;  3TK1 A;  1PKX A;  3FYI B;  1E1Q G;  4PA9 A;  3A0R A;  3GWO A;  5B1A B;  2H8P C;  3FB7 C;  3LNM B;  4UV9 A;  5CN0 A;  3X2Q C;  3JD4 A;  4MVO A;  4MVQ A;  2KB1 A;  2Y48 A;  3MHS C;  1K92 A;  2WLK A;  4J9Y B;  2XAQ A;  2EIM C;  4DXW A;  2UXN A;  3X2Q B;  1WPX A;  2ZR2 A;  1NH2 D;  4JAS A;  3SYC A;  3G6E V;  1JVM A;  5B1A C;  5L3F A;  1V54 B;  5IY5 B;  3ABU A;  1VQN V;  1FXK B;  1ARO P;  1PD3 A;  3RBZ A;  2QEX V;  1K34 A;  1H2G A;  3ABM C;  3FKS G;  2B1I A;  5L3E A;  5DM6 V;  1FFT B;  3SPG A;  2EIN C;  4H33 A;  3ZRW B;  2M7W A;  2R9I A;  3E8B A;  1R6N A;  1S76 D;  1W2B U;  2OT5 A;  3K3W A;  3DTU B;  2DYR B;  3ASN B;  3ZN0 A;  1M90 W;  3AG2 C;  3OEE G;  3TET A;  1PNK A;  3F7Y C;  2W6J G;  3KG2 A;  1VQL V;  1AI6 A;  1H38 A;  4KUM A;  2ITD C;  2FTK A;  2V7Q G;  3STL C;  4RAI A;  5LHG A;  3D36 A;  5KUM A;  2YSU B;  1P4R A;  3K9A A;  2QM8 A;  3AG2 B;  1QLE B;  1VQP V;  1M56 B;  3ML0 A;  3P30 A;  4FK5 C;  4YXW G;  4OXS A;  1Q7Y W;  1VQ8 V;  1GM8 A;  3LSS A;  4JGS A;  3JD2 A;  4PA7 A;  1GM9 A;  5KA5 A;  3W7W A;  2K1E A;  4PEL A;  2OTJ V;  5LGU A;  4JAV A;  4GCZ A;  3G4S V;  5LHI A;  4EKW A;  2HVJ C;  3PJS K;  5L3G A;  2EIJ B;  3OR7 C;  4UUJ C;  1CEZ A;  4PDR A;  5IY5 C;  4WFE A;  4L87 A;  4PA4 A;  4Q20 A;  3WFV A;  1YIJ V;  3AG1 B;  4R6Z A;  4BW5 A;  2MK3 A;  4X8A A;  2ZQM A;  2XAH A;  1PL0 A;  2WLM A;  1F23 A;  4UXN A;  2X0L A;  1AR1 B;  1QCE A;  2OCC B;  3D3I A;  1QBZ A;  4UV8 A;  3ABL B;  3QO5 A;  5H6Q A;  3OR6 C;  5B3S B;  5E1A C;  4G2K A;  1ORQ C;  3I56 V;  2QM7 A;  1WLE A;  3CCS V;  2DYS C;  3ZJZ A;  3T4Z A;  1OCO C;  3ETD A;  2ZXW C;  3CP1 A;  2WLH A;  1Y4M A;  4PDL A;  3LSQ A;  4J9Z B;  2V1D A;  2IJJ A;  4DO2 A;  3CCJ V;  3RW0 A;  3JYC A;  5B1B B;  1E1R G;  2ZDI C;  3OMN B;  4RUE A;  1SES A;  3ABK C;  4PA6 A;  1R3L C;  2IJH A;  1EFR G;  1K3E A;  1R6K A;  1L1F A;  1K5Q A;  2P7T C;  1LNQ A;  1RM1 C;  3ETG A;  5H9C A;  5EBW C;  1NVP B;  2EIL B;  2ZDI A;  4LC1 A;  4UVA A;  5GW7 A;  4QIW F;  4MVS A;  3GB7 C;  4FPP A;  4LP8 A;  4WFH A;  4ZKI A;  1GKF A;  1J95 A;  1Y66 A;  3STZ C;  3T2M A;  2JDI G;  1THZ A;  1W0K G;  1BMF G;  2X6C A;  4JYC A;  5L3B A;  1K9M W;  2DQ3 A;  4ZBM A;  1SET A;  4UVC A;  4MS2 A;  2IW5 A;  1S72 V;  4MTX A;  4QPJ A;  5J9P C;  4RUF A;  1YTF D;  1Q81 W;  3SYP A;  5CA3 A;  3E89 A;  3ZIA G;  2X6A A;  3IFX A;  3ASO B;  3LDD A;  1K4D C;  4FJC C;  4XDK A;  4PDV A;  5KUK A;  1R3K C;  1R3I C;  2QE7 G;  2EJR A;  1SZT A;  2PI5 A;  2HKO A;  2HR3 A;  2JEU A;  1XL4 A;  1K4C C;  3DGE A;  3SJQ C;  4HZ3 A;  3SPC A;  3SPI A;  3E86 A;  3ZCC A;  3CXC U;  2AHZ A;  2Y69 C;  3FB5 C;  5BZB A;  5L3D A;  1K5S A;  3E8G A;  5LGT A;  1VQ9 V;  4UVB A;  2QKS A;  3AG3 C;  2AHY A;  1OCZ C;  2PI4 A;  3K08 A;  2Z5U A;  4WFF A;  3SPH A;  4QPK A;  3B8N A;  1KEC A;  1UJW B;  1G4Y B;  1E79 G;  2IJI A;  4RO2 A;  4TSF G;  1M57 B;  3H01 A;  4WFB V;  1QR9 A;  3EHB B;  1GMG A;  2LP7 A;  4MVU A;  1NBM G;  1SRY A;  4I5S A;  4MTF A;  1FS0 G;  2XAF A;  4X88 A;  1KP3 A;  5H6R A;  1VQM V;  4P30 A;  1M9N A;  4X89 A;  4RQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...