2C2AA

Structure of the entire cytoplasmic portion of a sensor histidine kinase protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
240
Chain Sequence
MENVTESKELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Entire Cytoplasmic Portion of a Sensor Histidine-Kinase Protein.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords SENSOR HISTIDINE KINASE
total genus 81
structure length 240
sequence length 249
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2c2aA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2c2aA02
4YKYA 4NH7A 3KE6A 4LWIA 2CG9A 3D2RA 4UROA 5B1OA 2YGAA 1UYIA 4LWGA 2YI5A 1AJ6A 2QG2A 3CWVA 1I58A 1YC1A 1F51A 2BYHA 2BU7A 4MPEA 1Y8OA 4PRVA 3BMYA 4XKOA 1UYHA 1IXMA 4AS9A 4XKAA 1ZXNA 2YE2A 2YI7A 3FT8A 4GT1A 1YSZA 1UYFA 2YEHA 5IDJA 2BZ5A 3C0EA 3B27A 3OWBA 1Z5BA 4NH8A 3FV5A 4MP7A 5M4EA 3RLQA 4AWPA 2BU8A 3ZRVA 2IOQA 4L91A 3T10A 3EHFA 2YKEA 2XHRA 2IORA 3INWA 3PEJA 2YI6A 5FNDA 5GGZA 4DZYA 5M4KA 3T0HA 2YEAA 5CTXA 4FCQA 4EFUA 4YKUA 4XTJA 1YT0A 5BODA 1GKXA 5F5RA 2YEEA 3P32A 4MBCA 3R4OA 2XCMA 2LFRA 1I5AA 3NXSA 2XK2A 1H7SA 1KZNA 5D7DA 3D0BA 4WUDA 4MP2A 4FPPA 2QG0A 2WI5A 2BSMA 4LWHA 1PVGA 3A0WA 4DUHA 4HXZA 3LPSA 4QPJA 2HG1A 4Q20A 4MB9A 3HZ5A 3RKZA 1UYEA 1TIDA 4MOTA 5J6AA 3G75A 1UY9A 2O1UA 4YKWA 4LWFA 4YKXA 3G7BA 1AMWA 1Z59A 3H4LA 3SL2A 1OSFA 2BTZA 2WI6A 3K97A 2VCIA 5FNCA 4HY6A 2YE4A 2FXSA 2FTKA 1A4HA 4CE2A 1QY8A 3MD0A 3HYYA 3HHUA 4ZKIA 3GIGA 2WEQA 1MU5A 1TILA 1B3QA 1UY7A 2Q8IA 4LPBA 4BXIA 4EEHA 2YE9A 4EMVA 3T0ZA 4H7QA 4KFGA 1Y8NA 4XIQA 3EHGA 4O04A 2O1VA 5B1NA 4XITA 1L0OA 4FCPA 1UY8A 4CWRA 5IN9A 4BQGA 1I5DA 2YEJA 4L90A 3R4NA 2CGFA 1QZRA 2HCHA 4EGHA 3OMUA 2FWYA 3B24A 3Q5KA 5M4PA 4KTNA 4EGIA 4R1FA 3ZXQA 2XJXA 3VHDA 1ZXMA 1ID0A 2WI3A 3A0RA 4E00A 3R4MA 4HZ0A 4AWQA 1UY6A 3GIEA 3FT5A 3U2KA 4GCZA 2YI0A 2PNRA 2QF6A 2XJJA 4HXWA 4JYCA 1Y8PA 3T1KA 1NHJA 1H7UA 2IOPA 1EA6A 3ZRWA 4XE2A 5C93A 4H85A 3R4PA 2YK2A 2YJXA 3O2FA 3TZ4A 2YK9A 1YS3A 1B63A 4L93A 2C2AA 3INXA 2QM8A 3A0YA 4R3MA 4I5SA 2VW5A 3QDDA 4HZ5A 1TC6A 2YE7A 4XKKA 2XDKA 1GJVA 5M4NA 2Q2EB 5D6QA 2YEGA 5CTWA 4GGLA 4FCRA 3OWDA 4L94A 1UYCA 1TBWA 3ZRXA 3D36A 4JASA 2P67A 2GQPA 3TZ0A 1UYKA 4JQLA 3TZ2A 1YETA 2WI4A 3LNUA 2VWCA 3OPDA 4W7TA 2JKIA 4XCLA 2XDUA 4XIRA 2QM7A 3EHHA 4CWSA 1EI1A 4YKZA 4KP4A 4URLA 4GFNA 2H55A 4H81A 3TZ5A 5CF0A 3A0ZA 4EM7A 4CWNA 3U67A 2EXLA 2ESAA 2H8MA 2YKIA 1I59A 2YECA 4YKRA 2CCUA 2WI7A 4L8ZA 3O6OA 4R3AA 1UYLA 2BU6A 2HKJA 1Y4UA 4I3HA 3ZKDA 4QPKA 2WI1A 2YKCA 3RLRA 4U93A 5FNFA 1YSRA 4CE1A 2WWWA 3MNRP 3IEDA 2JJCA 3A0XA 2BU5A 4PU9A 4JAVA 1I5BA 1U0ZA 1TH8A 3BM9A 1YC4A 3EHJA 3ZM7A 1TC0A 2AKPA 2Q8HA 4MT8A 4MTXA 1Z5CA 2YEFA 1JM6A 2XDXA 2XHXA 4JYBA 3ZRWB 2CCSA 4CWFA 1QYEA 4CWPA 3K60A 3WHAA 5CTYA 3HZ1A 3H80A 1UYMA 2IWXA 3T2SA 4YKTA 2VCJA 5M4MA 4ASFA 3JZ3A 4KSHA 4NH9A 2YGEA 2YKBA 4WUBA 3R91A 2YEDA 1KIJA 1UYDA 4LP0A 4E02A 3C11A 4U7NA 4PL9A 4BIZA 1Z5AA 3VADA 4HY1A 1AM1A 4P7AA 3Q5JA 4O09A 2XX2A 4EFTA 1R62A 1ZW9A 3GIFA 4PRXA 4XC0A 5D6PA 3R92A 1UYGA 3B26A 3A0TA 4V25A 1YC3A 1AH8A 1S16A 3RLPA 3CGZA 4MPNA 5F3KA 5M4HA 4LWEA 4X9LA 4CWOA 2XHTA 2YEBA 2BT0A 2BU2A 5J71A 3VHAA 4B7PA 3CGYA 4WUCA 3K98A 4ZVIA 4BQJA 2ZDXA 2BRCA 1BGQA 2E0AA 2XX4A 5CTUA 4K4OA 4U7OA 2YKJA 4HYMA 4XCJA 4URMA 2ZKJA 4XD8A 2K5BA 5FWKA 3B25A 4ASBA 1THNA 5L3JA 1BXDA 2XDSA 4GQTA 4XIPA 3QTFA 3O0IA 4O07A 3NMQA 3Q5LA 4XDMA 2Q8FA 1U2OA 2BREA 2Q8GA 4B6CA 2YE3A 3DGEA 2GFDA 4E01A 4KQVA 1BYQA 2FYPA 2O1WA 3K99A 2LFSA 3OW6A 3PEHA 4O05A 2XX5A 4V26A 2YGFA 3ZXOA 4MPCA 2XJGA 3VHCA 2UWDA 2WEPA 5D7RA 4GT8A 4BIUA 4AWOA 1S14A 2YE8A 3WQ9A 3TUHA 2ZBKB 4ASGA 2XDLA 5CPHA 2YEIA 2XABA 2ZDYA 5D7CA 1AH6A 2YE6A 3TTZA 1US7A 1MX0A 2YJWA 1Y4SA 1BKNA 1ZWHA 1YESA 3EKOA 3EKRA 1YERA 1B62A 2WI2A 2WERA 2IWSA 1GKZA 2QFOA 4FMTA 3CRLA 2CH4A 4JAUA 2CCTA 4ASAA 1NHHA 3GIGB 4KSGA 3TK1A 3ZCCA 4YKQA 1YT1A 4CE3A 2XD6A 4EGKA 1JOYA 3CRKA 4URNA 4CWQA 5BOCA 3HYZA 1I5CA 3HEKA 2BYIA 3U2DA 3ZKBA 4O0BA 4BAEA 5IDMA 4P8OA 1YT2A 3G7EA 4GEEA 4CWTA 2IWUA 4HYPA 2FWZA 4LC1A 3B28A 2YE5A 1NHIA
chains in the Genus database with same CATH superfamily
2FKXA 4NH7A 4OPAA 4LWIA 3ABMC 2YI5A 3FFQA 4BW9A 1M5IA 3OT7A 3P30A 1XNQO 4FK5C 3W7SA 5KHIA 4MPEA 1Y8OA 4X1KB 1UYHA 2WSSG 5CBFA 1IZ3A 2ZDIC 4JI3O 1ZXNA 2YI7A 1Y6XA 3FB8C 1XQ8A 2JJ1G 5IDJA 3HKDA 3C0EA 5L3CA 1R3LC 1Z5BA 5CN0A 3ZHVA 4AWPA 2BU8A 1G6UA 4DR4O 2YC0A 1N34B 2YKEA 1TA8A 3INWA 3Q4HB 5FNDA 5GGZA 1JPXA 4YKUA 3I5DA 4XTJA 3K57A 1N8RW 5BODA 3CC2V 1AP5A 4X65B 4H0LB 2YEEA 4EFBA 1EN4A 5J2TA 3OR7C 3R4OA 2XCMA 5CBGA 2YXLA 4UV8A 1H7SA 5F2VO 4LF8O 1FXHA 4B3SO 5D7DA 3DC6A 4WBNA 4J9YB 2E5LB 2QE7G 3QG5A 4WUDA 1EN5A 4MP2A 5LMUB 1GM7A 3QF7A 1MG1A 2RCVA 4QJFB 1GO3F 2QM4A 2Q73A 1K5QA 4LWHA 3LPSA 3CP1A 5LOVB 4Q20A 3OFNG 2HEPA 4RO2A 3HZ5A 2GBOA 3CHXA 3RVYA 5GTIZ 3B09A 4LWSB 1JFFB 1XNRO 1I94O 2L35A 3UKMA 4O4LB 4YKXA 5JCOC 1YEWA 1XL6A 2VCIA 4P2ZA 1L1FA 2YE4A 2DMXA 4X64B 2RN9A 1H8HG 4CE2A 2AHZA 4FM2A 2WPDG 2JRIA 4PELA 4H13B 2PF4E 1WB7A 1UY7A 1AR5A 3WB2A 5CB4A 2YDEA 1H2KA 4EMVA 3T0ZA 3RYFB 4LR3A 1NH2B 4XIQA 1YI2V 3I56V 2WLKA 2Z5UA 5B5EZ 1YJWV 4FCPA 4LH7A 1UY8A 1L8DA 4MVSA 3K9SA 1UPGA 2YIBA 4L90A 2XT9A 4CC6A 3H9VA 3OMUA 1BCCH 1IDSA 1SZTA 4JI3B 4EGIA 4PDVA 1FXVA 3SYCA 4JI0O 2N05A 3OMNB 3L74H 3G71V 3A0RA 1H2GA 3R4MA 1SERA 1UY6A 3GIEA 1YXBA 4LFAO 1B06A 2PNRA 2QF6A 1PV0A 2P90A 3R4PA 2YJXA 1N34O 3QO8A 3TZ4A 1QCEA 3VBBA 1YS3A 4TV8B 5AG2A 4F4LA 2QM8A 4OX9O 4O4HA 3F7VC 4GZRB 1NQTA 5M4NA 4CC5A 4ZIBA 4GGLA 4B3MO 4FCRA 2QWRB 2ZXWB 5BR8O 2ZT9B 4DV2B 1K3EA 1TBWA 3D36A 4GKJO 4I7ZB 1WA8A 1FYJA 2X0LA 2AZ0A 4WCEV 5H5NA 1W2BU 4K0KB 1V55C 1L0LH 2WI4A 1MOFA 5A2QN 4W7TA 4JYAB 3E8BA 4B08A 3OR6C 2EINB 1XNRB 4H33A 4CWSA 2X7RB 1EI1A 3UO2A 2F43G 2GTSA 4KP4A 1WNSA 1FXKC 4WFAV 1N36O 3A0ZA 4EM7A 2EXLA 2YSUB 3ZJZA 2ESAA 4J10A 4YKRA 2VQFO 2WI7A 2EIJB 2Z3YA 3OEEG 1OZ0A 3OTOO 3O6OA 4LF5B 2B9ZA 2DWDC 4TUYA 1RM1B 3ZKDA 5LP6C 5KAFZ 4QPKA 3RYCB 2V4DA 5KHKA 5IE9A 2AHYA 3E83A 5FNFA 2WAMA 3DXRB 4MSWC 5EZYB 4NKGB 2JJCA 2B5UA 3A0XA 2IW5A 4L8JA 3AG2B 3ICXA 2CTQA 1NJIW 3FB7C 1YC4A 3EHJA 1P4RA 3HKEB 3CCJV 1KQSU 4UCRA 3N2KB 4UCVA 5EBWC 2IH1C 4LF6O 1Z5CA 2YEFA 2CH7A 1JM6A 2XDXA 4PDMA 4O2BB 2RMKB 3TXSA 3ZRWB 2CCSA 1MSDA 3K60A 2HG5C 5JH7A 4TUYB 3H80A 3FYIB 4YKTA 4WBNB 3W7TA 2UUAO 4NH9A 2YGEA 4O4IA 2WLJA 2YKBA 4QIWF 4LP0A 2KG7B 3ABUA 4YJ3B 3VADA 3JD4A 3Q5JA 3K58A 3TJTA 2BTOA 4GYCB 1Z5VA 3RBZA 1QQCA 5D6PA 5LHIA 3K5LA 4KHPB 5B1AB 1WA8B 3SYAA 4JGSA 4O2BA 4LCUC 1MABG 3ZBHA 3H1JH 1YC3A 3CCEV 1AJPA 1AH8A 5F3KA 4LWEA 5J2UB 3DTUB 4DV6B 4YIOA 2XHTA 2XASA 3BRCA 4LNUA 2BT0A 3LSSA 2BU2A 1RSOA 5B66Z 3JD1A 4OX9B 1EZJA 2QWOB 3G6BA 2A0LA 4CH4A 4TV8A 2GDSA 2PI5A 3K06A 4WUCA 2IH3C 2CTPA 2WLIB 3AG3B 4LF9B 1BGQA 5KLVH 3RYCA 5JQGA 3E22B 2OCCB 1FAFA 2W6JG 4K4OA 3SJCC 2PYLA 4XCJA 2ZKJA 2QTOA 2K5BA 1VQ4V 2EJRA 1DGSA 3W7UA 4FLWA 5EYPB 4TQDA 2Y0PA 3APOA 4GQTA 4XIPA 1K5SA 4O07A 4J42A 2MK3A 1W0KG 4XDMA 2CE4A 4LF8B 4E01A 1BYQA 3CRMA 3EHBB 3M99B 1IBLB 3OW6A 3PEHA 3RYIB 2YGFA 3ZXOA 3OMIB 5LMNO 3VHCA 1VQ9V 2UWDA 4GX1A 4QNHB 2HR3A 4NXMO 5KX5A 1VMGA 1PKXA 1XUQA 1S14A 4YJ3A 3CSXA 2EILB 2AZ2A 3QTCA 3HKCB 4PJ0Z 4X20B 1KP2A 2RQ6A 1J5EO 4R6ZA 4EEQA 1K7DA 2HHIA 2F4VO 1M57B 1US7A 1LUVA 2LW1A 3K0GA 1Y4SA 3GWKC 2ZR3A 3BCCH 3ZHQA 3EKOA 1QNMA 3EKRA 2JGUA 1B62A 2WI2A 3ASOC 3CYOA 1K9MW 1Q6HA 3H1IH 2JGDA 4YIPA 2CH4A 1Y74B 1GM9A 4ASAA 5KA6A 1NHHA 1WP8A 4YKQA 5CA0A 2XD6A 5LP6A 1JOYA 1IXBA 1ZX3A 4EGKA 3VQYA 3F5WC 3HYZA 2DE0X 5J9PC 2BYIA 4BAEA 1JJOA 4UVCA 4P8OA 1I5YA 3STZC 2A79B 2JK5C 5J2UA 3IJ4A 3U10A 1P49A 4HYPA 2V1DA 3MHHC 4LWSA 4LC1A 3L75H 2ITCC 2YE5A 1NHIA 4YKYA 3M7MX 4JI6O 2FYUH 4UROA 4CBCA 5B1OA 3FX7A 1N4CA 2B1IA 3CPWU 3D3QA 2IU0A 1VARA 1W59A 4F6RB 1R3KC 3CWVA 3CCLV 2BU7A 4BWAA 4DW0A 4B3MB 4XKOA 1M1KW 1XMQO 2ARHA 4YY3O 3H1KH 1D2DA 1NKDA 3FT8A 4GT1A 1YSZA 2UUBB 1UYFA 1PP9H 2Y4TA 3A8TA 2F66C 1CXZB 4AQYB 4B3RB 3B27A 2HHHB 2ZCEA 4NH8A 1Y76A 3RLQA 2E76B 5CB4B 1VEWA 2JS3A 4DV4B 4L91A 4DV7O 2LQTA 1M56B 4GLXA 2IORA 1BMFG 4D7SA 4I55B 4DRXB 3JCZA 4DV1O 4KFMA 1YT0A 4DR7O 4DR1O 2XTAA 3OGIB 1K8AW 1AI4A 4LF4B 4CS2A 4K8XA 1EBOA 4IT5A 4LFAB 1H2LA 3VQXA 3LNMB 3T1CA 4ASUG 2XK2A 2ZR2A 1H38A 3G6EV 3D0BA 2JDIG 1HR0O 5EC2C 4X1YA 2QG0A 1RPRA 5LL6Y 4RUEA 1KECA 3K5MA 4G2KA 2P7TC 2UXBB 3ZHUA 3LSUA 4NXMB 4NTWA 4MB9A 4IGGA 3ZN1A 2AW9A 2GTAA 4MOTA 4NR1A 5J6AA 1XL4A 2UXBO 5IWAB 2O1UA 4YKWA 3ZEDA 1RM1C 1Z59A 2BTZA 2WI6A 3ZHSA 5FNCA 4X66B 4HY6A 3CJHB 2FXSA 2FTKA 1AR4A 1YZBA 5E1AC 3JD0A 5K1XA 5FPOA 3JYCA 3HHUA 2L6LA 4ICGA 1SA0B 4YHHO 1OHHG 1F7YA 1YF2A 2WEQA 3RGBA 3UT5B 4MTFA 1IVSA 1FPOA 3ETQA 1XREA 1FXKB 1I7FA 2W0FC 4TQFA 5LBQA 2BSKA 2PZSA 4LFBB 1AILA 4HNAB 2EINC 2F4VB 2NLJC 4FLXA 2DJVA 3CCSV 1QVGU 4DV7B 5H6RA 4EKWA 1I08A 4JV5B 4LF9O 4CWRA 1WAZA 5IN9A 4GKKO 4QE9A 1OCZC 2CGFA 5LA6B 3C90A 3S3XA 3A2FA 1AVMA 2BCCH 2LGQA 2FWYA 1NTZH 1XMOO 2Y0IA 1BSMA 3B24A 4C7UA 1K33A 3Q5KA 4KTNA 5M4PA 4CZZA 4U3JB 3ZXQA 1QR9A 3VHDA 1ZXMA 1HR0B 1F23A 1A32A 2WLLB 5HFMA 4G28B 3O9OA 2HKOA 3FT5A 1MSWD 2DYSC 2Y69C 3E2EA 2K9PA 2YI0A 2HP8A 1URFA 2A06H 4NB5A 2XJJA 4JYCA 5B1BB 4N21A 2IOPA 4ZHQA 4JZ2A 4XE2A 5C93A 4H85A 1OCCC 3AK3A 4TWKA 1FFXB 3O2FA 4RQEA 3EVKA 3FKSG 3SJBC 4L93A 5IJ9A 4DR2O 2EZPA 1HDJA 1ZWIC 3BAAA 3ETEA 3A0YA 5BXZA 4JAAA 4B3RO 4I5SA 4PA4A 3N27A 3EXAA 2UXCB 4N23A 3QDDA 4HZ5A 1PPJH 4CH6A 3F5TA 5J2TB 3SYOA 2QR4A 1SF9A 3ZRSA 2UU9B 5IYCO 3K9AA 4DV6O 4IL6Z 1MZEA 2WLHA 1YIJV 5BY1A 4JI5B 4U3FH 3ZRXA 2XAGA 1M4UA 1XDCA 2P67A 4UVBA 1FXKA 1TVKA 3K03A 3LNUA 3OPDA 5H9CA 3UT5A 5IWAO 1Q43A 4XCLA 1SQPH 4IIJB 4UVAA 3W7XA 3B40A 3P3NA 2F93B 2IJIA 2ILMA 2ZE5A 5A9GA 1N32B 4X62O 3D8CA 2QKAA 1NBMG 3A0BZ 4DXWA 2D2CB 4H81A 3AG7A 1IBLO 3E86A 2W6IG 3U67A 3N2GB 2YKIA 2HJFC 3E89A 1OCRB 5EYPA 5LYJB 3MAQA 5LOVA 1LNQA 1VQ8V 4GX2A 4UXNA 3VQWA 4PI2A 4YJ2A 4FLTA 4I3HA 3BHPA 3CE2A 3RLRA 2RJZA 4X1YB 2FL4A 3AG4B 3KCYA 2JS5A 2WWWA 3MNRP 1JJ2U 5FL7G 3IEDA 3J81N 3K79A 4LNUB 3T1HB 2MW2B 1P7BA 2LGWA 4ZOLB 1U0ZA 1TH8A 3BM9A 1HNXB 3H1HH 5LGNA 3ZM7A 2HVJC 1VF5B 1S0VA 1JX9A 2PGGA 1M56C 2Q67A 1BE3H 2AKPA 3P3PA 2UUBO 1XILA 1JMKC 1YSCA 4UCTA 5KAIZ 4JYBA 1BZKA 4ZI7A 1H2NA 1QYEA 4CWPA 1Y76B 2IBZH 3B8NA 4LF5O 1Q5OA 3HZ1A 3T2SA 4RAIA 4ASFA 1VQNV 1VQKV 4KSHA 4JF3A 2YIAA 2QA4V 1R73A 2YXYA 2YEDA 4WUBA 1KIJA 1UYDA 3S3WA 3JAMN 1M90W 2WLLA 3OW2U 4BIZA 1Z5AA 2CTWA 5CA0B 4P7AA 3JSLA 1G1XB 4EFTA 1R62A 3KZIZ 1HNXO 5EK0A 4XC0A 3NR7A 4RUFA 1NI8A 4B7EA 4TT3G 3CCRV 3R92A 5D5QA 2IU3A 3FB6C 4DR3B 1UYGA 1DTOA 5LA6A 3OUSA 3LMMA 4MPNA 2P5OA 2ZIOA 4X20A 3QO5A 4DW1A 4I4TB 3HKCA 3ABLC 1LUWA 5JCOA 4K35A 3ASNB 1HNWO 3L71H 4R7CA 5KHHA 2Q6AA 1QLNA 5GONB 4DV1B 2EILC 1VQOV 5J71A 2DOSA 3JALB 3ASOB 3PJSK 3VHAA 4NXNO 3CGYA 3CD6V 2OTJV 3QNEA 3K98A 4BQJA 4E72A 4X88A 1BQ0A 2BRCA 2E0AA 4F6EA 1M57C 3X2QC 2XX4A 5CTUA 3OUFA 2HFEC 1S72V 3SR2C 5EIBC 2EIKC 2QKSA 3B25A 4ASBA 4TSFG 1BHAA 3G80A 1THNA 3CC7V 1SQGA 2NR5A 3X2QB 5L3JA 1N33O 3QTFA 1M93A 4I9QA 5JVDA 1FFTB 3ZS8C 4I0XB 5CA3A 2YE3A 5B3SB 2BOBC 1R6KA 4JTAB 1N36B 3UQ8A 4V26A 1I94B 2ATKC 1KUQA 2Y4UA 1FKAO 1IBMB 4MVOA 5TISZ 5KUKA 1GRJA 2YE8A 2YI8A 2H94A 1ROPA 3TUHA 2XDLA 5CPHA 1GN4A 5D7CA 3CCUV 3U11A 5LMNB 1TAEA 2ZQMA 2H8PC 1O9HA 1K92A 1K97A 1OJHA 2P6JA 3RW0A 2IWSA 1B6QA 4YHHB 2QFOA 1GM8A 4FLYA 4I0XA 4JAUA 2CCTA 3DSQA 3LDDA 3IC9A 3GIGB 4J41A 1KC8W 3CRKA 4CWQA 5IDMA 1SRYA 2KG7A 3SPJA 2PI4A 3SDLA 4O2AA 3ABKB 1YTFB 4UCOA 4A5UB 3G7EA 1WPBA 3ZMSA 1CPYA 2IWUA 1NU1H 3APQA 1YJNV 5B1AC 2OIEA 5JH7B 1F4MA 2CG9A 1JVMA 4I9WA 2YGAA 1H2MA 1UYIA 4LWGA 1TUBB 1NTMH 1VQ7V 1S76D 4JI5O 2EZOA 4X9QA 3OGCC 4GKJB 1AJ6A 1E1QG 2P4KA 3SJAC 2NNUA 1I58A 1F51A 4B3SB 4PRVA 5IYZA 3AG4C 4JI2B 1IXMA 2VQEO 4XKAA 1N33B 5DN6G 2E74B 1QLEC 2A3QA 1NH2D 3OMAB 2YEHA 2BZ5A 2OWOA 2BOCC 1VQLV 2Q4PA 4AILC 3JASA 3FV5A 5M4EA 2QWNB 2Q68A 1IBKO 3ZRVA 2IOQA 1Q90D 3CCQV 2PY5A 2XHRA 2HHHO 5M4KA 1SQQH 3N2KA 2YEAA 4FCQA 2IJHA 1O9GA 3GB7C 1GKXA 3DC5A 1FJGB 4JPRA 1QHTA 1I5AA 3NXSA 1KZNA 4E2LA 5CMUA 3JCUZ 3OEHG 4KL1A 1R1BA 2XOKG 4FPPA 4JI0B 4PV1B 4CS4A 2Q8VA 2BSMA 3ABTA 1PVGA 4O4JA 4DUHA 4FVMA 4QPJA 4BAYA 1NT2B 3RKZA 4TV9B 4O2AB 4XDJA 1Q6IA 4HZ3A 2Q0OC 3G75A 1UY9A 3ZIAG 4LWFA 4JYAO 4EB6A 1AMWA 3G7BA 3SL2A 4K0KO 1EFRG 3OD4A 4FLVA 3ABKC 1A4HA 4KUMA 3E22A 1QY8A 3MD0A 4W4LA 1IURA 3HYYA 2F23A 3GIGA 2AGAA 1ZL8A 4ZBMA 1TILA 1B3QA 2PUSA 1FS0G 4DUZB 2QWQB 3GWOA 4LPBA 4BXIA 4EEHA 2YE9A 3LDCA 4LP8A 1RSOB 1S5LZ 3HKBB 3G67A 2ETNA 5GONA 3I55V 4KFGA 1DK1A 1Y8NA 4O04A 2OYQA 3K5OA 1J5EB 3ETGA 3BA9A 4DR5O 1XBLA 2O1VA 3FAVB 5B1NA 1G8MA 5IY5B 1L0OA 3CRRA 1IBKB 4DR5B 4HAMA 1B04A 4X1KA 3E8GA 3CC4V 2EBOA 1BT8A 4CH5A 2HCHA 2XNDG 4EGHA 1E79G 4E4EA 3ZHRA 1H8EG 4PI0A 2UXDO 1YCIA 1V54B 1PL4A 4R1FA 2YIDA 3LDEA 2YEVA 2WI3A 1I5XA 4E00A 4X64O 1J95A 3RT3C 2CTRA 2ZM6O 4Z1VA 3B77A 3U2KA 4GCZA 4DUYB 1NS1A 1S5HC 4NTYA 1FD9A 4HXWA 3R66A 3SGIA 4XDLA 4X65O 1NHJA 2M7WA 4ZI7B 4O4JB 5IJ9B 2BSKB 2EIKB 4B3TO 2CH7B 2YK9A 1FFXA 2K1EA 3INXA 4ZHQB 4AQYO 5JJJB 4R3MA 1YVWA 2A9HA 1JCHA 4ZOLA 4Q6GA 2YE7A 4XKKA 3IC7A 2IJJA 3BA8A 4I4TA 2XDKA 4O4LA 5D6QA 3ZMTA 3H1LH 3STLC 3L73H 3BFRA 2QWPB 2QEXV 2ZM6B 2UXCO 2XAFA 3RFRA 3CMEV 4DYLA 1UYCA 4JASA 2GQPA 3TZ0A 1UYKA 3TZ2A 4IYHA 2JKIA 4JTCB 1R3IC 4LF7B 2OCHA 4JZGA 4MTOA 3JASB 4XIRA 2DYRB 4UB8Z 3EHHA 2DQ0A 3K0DA 2HLDG 2LW7A 1DF4A 3E35A 4LF7O 5L3GA 1U96A 1BQZA 3ZMVA 5CF0A 5FPRA 1ORQC 2EULA 5BMVB 2QKCA 1I59A 3QO7A 2CCUA 1G4YB 4UB6Z 1T5EA 4DR6O 4L8ZA 3D3IA 3HKBA 5EBMC 5DECA 2UXXA 1UYLA 2BU6A 2DWEC 1Y4UA 2YKCA 1AI7A 1EZVH 3LNNA 4Z2WA 3CRAA 1SC5B 3CB2A 3WU2Z 1YSRA 3W7WA 1NVPB 1KP3A 4R50A 5FNVA 2C1GA 4DR4B 2BU5A 4WFHA 4B3TB 1I5BA 1N0JA 1KKDA 3B4SA 2E75B 4J7KA 2Q0AA 4P30A 2LO1A 2Q7HA 1HW7A 2ODMA 4MT8A 2Q8HA 1GKFA 4HYOA 1HNWB 2Q69A 3CRQA 1WJZA 1P7GA 2JVDA 2XHXA 4L87A 1ZSPA 4DUYO 4FLZA 4CWFA 1NZ6A 2WLMA 4JI2O 3WHAA 5CTYA 1MNGA 1Q6UA 2IWXA 3JZ3A 1GMGA 5IJ0B 3AEIA 3R91A 4E02A 4DR3O 3J7AU 5HFLA 1GH6A 2UXDB 2DYRC 5LGUA 3N2GA 3BEHA 2UXNA 3ABMB 4WFFA 3SJQC 3KKYA 3CMAV 4DRXA 2KB1A 3HB3B 3TETA 2JGDB 3GIFA 1SKVA 1IX9A 4AHCA 2Y48A 2N74A 1S77D 1M9NA 3B26A 3A0TA 1K73W 2YUAA 2ZD9A 2E5LO 4V25A 4DV2O 5L3FA 3M8AA 4DO2A 4CH3A 1S16A 3CGZA 5M4HA 3SYPA 4IHJA 4CWOA 5KHGA 1XMOB 2CK3G 4J7ZA 4P9OA 3OTFA 5IYZB 3SPCA 4B7KA 2YEBA 4HNAA 4D6TH 3IAYA 2CGOA 3SPIA 4DR7B 5ITZB 1NTKH 3K04A 4X1IA 4B7PA 2OT5A 2CDYA 4OXSA 2YICA 1V54C 1XOUA 4TOIA 5IT9N 1RPOA 2P06A 3JATA 4X1IB 4RWUA 1NR7A 3JALA 3HPLC 4U7OA 2YKJA 1TGOA 4XD8A 4XDKA 1OCCB 1WLEA 1XHZA 2OCCC 4H44B 1VF6C 4OGQB 1VQ5V 4IHJB 1YTFD 2XDSA 3O0IA 1AP6A 2BE3A 2YEVB 1XNQB 2EX3A 1U2OA 1Y74A 4I50B 3JAKB 3RYHB 5CA1A 1KBHA 3IGAC 2FYPA 2N04A 4PA3A 2O1WA 1TUEB 3K99A 2IM9A 2LFSA 1QVFU 4O05A 2IJKA 2XJGA 1WP7A 3B2EE 5D7RA 1PL0A 4BIUA 1R3JC 1S5JA 3ZHTA 1AB3A 4AWOA 2DQ3A 2JIZG 4NYKA 1YDXA 3TGUH 2ZBKB 4ASGA 2DYSB 2QTSA 4PA9A 2XABA 2YEIA 4PDRA 2QJ1A 2ZDYA 3TCUA 3JD3A 4MW3A 1AH6A 3AG1C 4PDLA 2YE6A 3TTZA 3Q4HA 1HP8A 3GVMA 2R9RB 1JQ0A 2YJWA 2NN4A 1BKNA 1ZWHA 4LFCO 3RYIA 3CXHF 1YERA 2OIGA 1ZL8B 3U0ZA 4PA7A 1BL8A 2C1IA 2ZIMA 2A7WA 2CUGA 2VQEB 4FZ1A 1GN6A 4DR1B 4BIOA 1GN3A 1SA0A 2VQFB 1OCZB 3TK1A 1YT1A 5JVDB 4CE3A 4X89A 4URNA 2KQXA 5BOCA 3R65A 3FB5C 1I5CA 1R6NA 1SQBH 4JI1O 4DV4O 3ZKBA 3CJHA 5L3EA 4O0BA 3WB0A 1MZFA 1I0HA 3B8MA 1YT2A 5FNVB 4GEEA 4CWTA 1SESA 4O4IB 3CRCA 2LP7A 4WFEA 3JAWA 3K59A 2FWZA 4TV9A 3B28A 1F4NA 4MVMA 4HZ0A 5JQGB 3KE6A 2ZE7A 3T1YO 1VF6A 3D2RA 2EIMB 2RDCA 4BW5A 1VQPV 5BZBA 3KCXA 4NXNB 3LUTB 3BVOA 2P22C 1PM9A 4W4KA 5BR8B 2QG2A 1YC1A 2YIBD 2BYHA 4H37A 3BMYA 3ETDA 4FZ0A 1P84F 4AS9A 5H6QA 3ZN0A 2YE2A 4DUZO 1AROP 1FJGO 4JTDB 4JI6B 3WB1A 5LP6B 2YI9A 4PHZA 1THZA 2QGNA 4MS2A 4I55A 5L3BA 4PD4F 3OWBA 1GAXA 3RVZA 2EIJC 5JJNB 4WFBV 4MP7A 4DR2B 2UUCB 3L70H 3T2MA 1SS3A 1K4CC 2KKWA 2FB5A 4FM1A 2ADQB 3T1HO 3T10A 4JI1B 3EHFA 4YXWG 1QLEB 1CEZA 1KMIZ 3PEJA 1OV9A 2GUZB 2R9IA 2YI6A 4DV0O 4DZYA 3T0HA 5CTXA 3SPGA 5KUMA 1AJNA 4EFUA 5F5RA 3BY6A 3P32A 4MBCA 2ADPA 1QU7A 5KX5B 1LR1A 5LGTA 2LFRA 3IFXA 1AI6A 1D5AA 3AK1A 3JD2A 5IYDO 1ENVA 2Q5ZA 4XBFA 4PA6A 3VQVA 4MW8A 4GUNA 5EC1C 1QBZA 2V7QG 2Q7EA 3ZMZA 3F7YC 1MA1A 2WI5A 1XEQA 3CS5A 3CWBH 3S5TA 3UM7A 1Q82W 3A0WA 4HXZA 1XI1A 2HG1A 3TXQA 1GN2A 1SQVH 2PTMA 1TIDA 1UYEA 4WF9V 3HKEA 3K08A 3WG7C 3PN1A 4GX5A 3HR0A 1CP9A 1R6TA 3H4LA 4CS3A 1OSFA 3K97A 1DLBA 5C8YB 2VWJA 5EZYA 2ZKOA 5FLXN 2UUAB 4DV5B 4JYYA 4ZKIA 4JI8B 4U3JA 1MU5A 5IYBO 2Q8IA 4LF4O 4MVZA 4H7QA 4DV5O 5K1PA 5KMGB 3EHGA 2F1MA 1ZLZA 2H3OA 3ZX6A 4XITA 4P9PA 4UCSA 1SQXH 1SETA 4UUJC 1UJWB 2X6BA 4BQGA 1RP3B 5L3DA 1I5DA 3THOA 1KB9F 2YEJA 3FAVA 1HNZO 3R4NA 2RNBA 1Q8IA 4FFBB 4X62B 1QZRA 1IBMO 3C3SA 2GHYA 5B3SC 1OCOC 1H2SB 3AK2A 2HJDA 1N0NA 3G4SV 4JI4O 3JARB 4UV9A 4YY3B 1HWYA 2BTQA 2OTLV 5LXTA 4BR6A 4X8AA 4HBNA 5LMUO 2XJXA 1AJQA 1ID0A 2ZNIA 3CYGA 3FYEB 4DR6B 4AWQA 1PNKA 3FD9A 1UFIA 3CEIA 1KYOF 1PD3A 4OPHA 5LHGA 4EB6B 3ASNC 3ABLB 1WN7A 2VWKA 4G27B 4IYIA 1Y8PA 3T1KA 2XAJA 2QSAA 3BPZA 1N32O 2FMLA 1H7UA 1EA6A 3ZRWA 1JR9A 4DV3B 5LXTB 4K8ZA 2BTQB 3OE7G 5GTHZ 3T4DA 4GKKB 2YK2A 5D5PA 3LSQA 3JARA 1OCOB 2YS8A 3MHSC 2M6YA 4FJCC 1B63A 2C2AA 1Q86W 1E1RG 2XAQA 2JEUA 3AG3C 2VW5A 2PYJA 5C8YA 4R8CA 1ZUQA 1TC6A 4FIPC 4LFBO 1GJVA 2Q2EB 2YEGA 5CTWA 2DN9A 2KSDA 4MTGA 3K5NA 3UCSC 2E3CA 3RWRD 3J80N 3OWDA 4L94A 2ZDIA 2Q9LA 1US6A 5KMGA 2WLNA 1VQMV 1DF5A 4WFGA 4JQLA 1YETA 2VWCA 5EBLC 5IY5C 1AI5A 2JEXA 2XDUA 2QM7A 4K3AA 1VF7A 3E8FA 3BABA 3K3WA 4YKZA 4J7JA 2X6AA 2ITDC 4URLA 3T4ZA 4Z1MG 4GFNA 3WG7B 2H55A 1XHXA 2P4VA 3TZ5A 1NR1A 2VS0A 4CWNA 4LBEC 2H8MA 3D36C 5E79Z 2YECA 5JWPA 4J80A 4JI7O 4F6RA 2UU9O 4R3AA 2HKJA 5KA5A 2WI1A 3E8HA 3H01A 1K34A 4U93A 5JJEB 4LF6B 5ITZA 4CE1A 1OCRC 1U97A 2XAHA 3ML0A 2ZE6A 1BHBA 1Z2GA 4PU9A 4JAVA 4O4HB 1VP7A 2GSMB 1KU9A 3L72H 3DXRA 2EJ7A 2YXHA 1TC0A 2QDOA 1EM1A 4KXRA 4MTXA 1BS3A 3AG2C 2DW4A 4AI8A 3CX5F 2W0XA 2GV9A 2G38A 1RFYA 2R9AA 4NTXA 3CCMV 1XMQB 1MMMA 1Y67A 3CXCU 3RN4A 1W0JG 2EIMC 5JENA 3OTOB 1EN6A 4QE7A 3JAWB 1UYMA 1PNMA 2VCJA 5M4MA 4LH6A 1Q81W 5KHJA 3L9DA 4MVRA 4X66O 1COWG 1X59A 1Z5WA 4KHPO 4JI4B 3C11A 4U7NA 4PL9A 1Q7YW 1SQFA 2Q7GA 3WFVA 4HY1A 1S3JA 1AM1A 5IJ0A 4O09A 3OAAG 5H2FZ 1KD1W 2XX2A 1TUBA 4UCUA 1ZW9A 4PRXA 1TVKB 4JV5O 4FFKA 4IIJA 4FM0A 4FFBA 1BGYH 2WA4A 2JJ2G 1QR8A 3HKDB 3RLPA 3CCVV 3ZMUA 1V55B 4X9LA 1X4TA 1NVPD 3C3TA 2B1GA 4J11A 2R70A 4LFCB 5GW7A 1Q3EA 2ZXWC 4JI8O 2Y69B 3MDSA 3RYFA 2AXTZ 1PNLA 1WB8A 3OM3B 4MVUA 4J9ZB 1D5NA 1YHQV 4ZVIA 2CGNA 2ZINA 2ZDXA 4ABMA 2HVKC 5B1BC 2WLIA 3T1YB 2UUCO 4DV3O 3RYHA 4I50A 4YJ2B 3AG1B 5CA1B 1ZAUA 4HYMA 4URMA 4GX0A 5FWKA 3UO3A 4NVPA 2O57A 5LYJA 2CAZC 3SPHA 1BXDA 1JA8A 1JFFA 5BMVA 1VIBA 4UFZA 3NMQA 2XUMA 3Q5LA 2Q8FA 1GTOA 2BREA 2Q8GA 4B6CA 3EFFK 3JATB 3DGEA 2GFDA 4KQVA 2X6CA 1WPXA 4RQFA 1VQ6V 2XX5A 3JAKA 4MPCA 5LHHA 1AR1B 3QVNA 4QGPA 5EIBD 3O65A 2WEPA 4DV0B 4GT8A 2ZNJA 3WQ9A 2XHBA 3SYQA 1Y4MA 3VOUA 1Y66A 2GUZA 4FLUA 1L0NH 1MX0A 1YESA 4EFEA 1V9PA 1ZTEA 2ZE8A 2WERA 1GKZA 4FMTA 4D7TA 3CRLA 2VRZA 4JI7B 4KSGA 2LJ2A 1GK9A 3ZCCA 4DK0A 1K4DC 2D3OW 2Z0AA 2F95B 5DEDA 3KG2A 5DM6V 1KKCA 1SZXA 3HEKA 5CBHA 3U2DA 3JSNA 4MVQA 2R72A 3A0HZ 1YJ9V 1YITV 4DK1A 1HNZB 2WA3A
chains in the Genus database with same CATH topology
4YKYA 4NH7A 3KE6A 4LWIA 2CG9A 3T2SA 3D2RA 4UROA 4CBCA 5B1OA 2EIMB 4BW5A 2B1IA 1JVMA 4I9WA 3CPWU 1VQPV 5BZBA 2YGAA 3TZ2A 2IU0A 1UYIA 4LWGA 3ABMC 2YI5A 3LUTB 1VQ7V 1S76D 2EZOA 1AJ6A 3OGCC 2QG2A 1R3KC 1E1QG 3P30A 3CCLV 3CWVA 4FK5C 3W7SA 2NNUA 1I58A 1F51A 4H37A 1YC1A 2BU7A 1Y8OA 2BYHA 4MPEA 4PRVA 3BMYA 3AG4C 3ETDA 1M1KW 2WSSG 1IXMA 5CBFA 1UYHA 2ZDIC 4XKAA 1ZXNA 4AS9A 4JQLA 5H6QA 3ZN0A 2YE2A 1AROP 5DN6G 1NKDA 2YI7A 3FT8A 3FB8C 4JTDB 4GT1A 1YSZA 1QLEC 1UYFA 1THZA 4MS2A 2JJ1G 5L3BA 3OMAB 1NH2D 2YEHA 5IDJA 2BZ5A 3C0EA 2BOCC 5L3CA 1R3LC 1VQLV 3B27A 3OWBA 3RVZA 1Z5BA 2EIJC 5CN0A 4NH8A 4WFBV 3FV5A 4MP7A 5M4EA 2Q68A 3RLQA 4AWPA 2BU8A 3T2MA 3ZRVA 1K4CC 2IOQA 4L91A 3T10A 3EHFA 4YXWG 1QLEB 1M56B 3CCQV 2YKEA 2XHRA 1CEZA 2IORA 1BMFG 3INWA 3PEJA 2R9IA 2YI6A 5FNDA 5GGZA 4DZYA 5M4KA 3T0HA 1JPXA 3JCZA 2YEAA 3SPGA 5CTXA 4KFMA 5KUMA 1AJNA 4FCQA 4YKUA 4XTJA 4EFUA 2IJHA 1YT0A 1N8RW 4URLA 5BODA 1GKXA 3GB7C 3CC2V 5F5RA 2YEEA 3BY6A 1K8AW 1AI4A 3P32A 4MBCA 4JPRA 1EBOA 3OR7C 3R4OA 2XCMA 3LNMB 3T1CA 4ASUG 2LFRA 5CBGA 3IFXA 5LGTA 1AI6A 3NXSA 1I5AA 3JD2A 5IYDO 4UV8A 2XK2A 2ZR2A 1H38A 1H7SA 1ENVA 1KZNA 1FXHA 4E2LA 5CMUA 3G6EV 3OEHG 4XBFA 5D7DA 3D0BA 4PA6A 2JDIG 4J9YB 2QE7G 4WUDA 2XOKG 4MW8A 5EC2C 4FPPA 4MP2A 1GM7A 5EC1C 1QBZA 2V7QG 3ZMZA 1MG1A 2QG0A 3F7YC 2WI5A 4QJFB 1GO3F 1RPRA 4RUEA 1KECA 4G2KA 2P7TC 1K5QA 2BSMA 4LWHA 3ABTA 3UM7A 1Q82W 1PVGA 3A0WA 4DUHA 4HXZA 3LPSA 4QPJA 3CP1A 2HG1A 4BAYA 4Q20A 3OFNG 4RO2A 3HZ5A 4MB9A 3ZN1A 3RKZA 3RVYA 1UYEA 1TIDA 4MOTA 4XDJA 4WF9V 3K08A 4HZ3A 1XL4A 5J6AA 3WG7C 3G75A 1UY9A 4GX5A 3ZIAG 2O1UA 4YKWA 4LWFA 3UKMA 1RM1C 1CP9A 1AMWA 3G7BA 4YKXA 1Z59A 3H4LA 3SL2A 1OSFA 2BTZA 2WI6A 3K97A 1DLBA 1XL6A 2VCIA 5FNCA 4HY6A 1EFRG 4P2ZA 1L1FA 2YE4A 2FXSA 2FTKA 3R91A 3ABKC 1A4HA 4XKOA 1H8HG 3JD0A 4KUMA 5E1AC 4CE2A 2AHZA 1QY8A 3MD0A 3HYYA 3JYCA 2WPDG 3HHUA 4ZKIA 4PELA 2WEQA 1OHHG 3GIGA 4ZBMA 1MU5A 1TILA 1B3QA 5IYBO 1UY7A 1FS0G 4MTFA 3GWOA 2Q8IA 4LPBA 2W0FC 1FXKB 5LBQA 4BXIA 4EEHA 2YE9A 3LDCA 4LP8A 4EMVA 3T0ZA 4MVZA 4H7QA 3I55V 4KFGA 1NH2B 1Y8NA 4XIQA 3EHGA 2EINC 1YI2V 4O04A 3ETGA 2NLJC 3I56V 2O1VA 5B1NA 1G8MA 3CCSV 2WLKA 4XITA 1QVGU 4P9PA 2Z5UA 5IY5B 1L0OA 5H6RA 1SETA 4EKWA 1YJWV 4UUJC 1UJWB 1UY8A 4FCPA 2X6BA 4MVSA 4BQGA 4CWRA 5IN9A 5L3DA 1I5DA 2YEJA 4QE9A 4L90A 1OCZC 3R4NA 4HAMA 2CGFA 3E8GA 3CC4V 2EBOA 1QZRA 2HCHA 2XNDG 4EGHA 2GHYA 1E79G 1OCOC 5B3SC 3OMUA 1H8EG 2FWYA 3G4SV 3B24A 3Q5KA 1K33A 1SZTA 1V54B 4KTNA 4UV9A 4CZZA 4PDVA 4EGIA 1HWYA 5M4PA 4R1FA 3ZXQA 1FXVA 3LDEA 2OTLV 2XJXA 4X8AA 1QR9A 3SYCA 2YEVA 3VHDA 1AJQA 1ZXMA 1ID0A 3OMNB 2WI3A 3G71V 3A0RA 1I5XA 3FYEB 1H2GA 1F23A 3R4MA 2WLLB 1J95A 5HFMA 4G28B 4HZ0A 1SERA 4AWQA 1UY6A 1PNKA 2HKOA 3GIEA 3FT5A 1MSWD 2DYSC 2Y69C 1PD3A 3B77A 3E2EA 5LHGA 4GCZA 2YI0A 3U2KA 2PNRA 1S5HC 2QF6A 4WUCA 2XJJA 3ASNC 3ABLB 4G27B 4HXWA 4JYCA 1Y8PA 3T1KA 2XAJA 4XDLA 1NHJA 2M7WA 5B1BB 1H7UA 4N21A 2IOPA 1EA6A 3ZRWA 4XE2A 5C93A 2P90A 4H85A 3R4PA 2YK2A 3OE7G 3T4DA 2YJXA 1OCCC 2EIKB 3QO8A 4TWKA 4BQJA 3O2FA 3LSQA 3MHSC 1OCOB 1QCEA 4RQEA 2YK9A 3VBBA 1YS3A 3TZ4A 4FJCC 3FKSG 1B63A 4L93A 2K1EA 2C2AA 1Q86W 2EZPA 4F4LA 3INXA 2QM8A 1ZWIC 1E1RG 3ETEA 3A0YA 2XAQA 4R3MA 2JEUA 2A9HA 1JCHA 4I5SA 4PA4A 3AG3C 2VW5A 3F7VC 4N23A 4R8CA 3QDDA 1TC6A 2YE7A 4HZ5A 3IC7A 2IJJA 1NQTA 4FIPC 4XKKA 2XDKA 1GJVA 5M4NA 3SYOA 2Q2EB 5D6QA 3ZMTA 3ZRSA 2YEGA 5CTWA 4GGLA 4MTGA 5IYCO 3STLC 3K9AA 4FCRA 2QEXV 2WLHA 1YIJV 2ZXWB 3OWDA 4L94A 2XAFA 1K3EA 2ZDIA 3CMEV 1UYCA 1TBWA 2WLNA 3ZRXA 3D36A 1VQMV 2XAGA 2X0LA 4JASA 1DF5A 2P67A 4MVMA 4WCEV 4UVBA 2GQPA 4WFGA 1W2BU 1FXKA 1V55C 1UYKA 1YETA 3K03A 1MOFA 2WI4A 2VWCA 3LNUA 5EBLC 5H9CA 5IY5C 1AI5A 3OPDA 4W7TA 2JKIA 4JTCB 4XCLA 1R3IC 3E8BA 2JEXA 2XDUA 3OR6C 4UVAA 3W7XA 4MTOA 4XIRA 2EINB 2QM7A 2IJIA 2DYRB 3EHHA 3E8FA 4H33A 4CWSA 2DQ0A 2X7RB 3K0DA 3K3WA 2HLDG 1EI1A 2F43G 4YKZA 4KP4A 1FXKC 1DF4A 3E35A 2X6AA 2ITDC 1NBMG 3TZ0A 3T4ZA 4WFAV 4Z1MG 5L3GA 3WG7B 4DXWA 3ZMVA 2H55A 4GFNA 4H81A 1NR1A 3TZ5A 4E00A 5CF0A 3A0ZA 3E86A 2W6IG 4EM7A 4CWNA 3U67A 2EXLA 1ORQC 2YSUB 4LBEC 3ZJZA 2ESAA 2H8MA 2YKIA 1I59A 2YECA 4YKRA 2HJFC 3E89A 1OCRB 3QO7A 2CCUA 1G4YB 2WI7A 2EIJB 1LNQA 4L8ZA 2Z3YA 3D3IA 3OEEG 1OZ0A 5EBMC 3O6OA 2UXXA 2DWDC 4GX2A 1RM1B 4UXNA 1VQ8V 2DWEC 1UYLA 2BU6A 2HKJA 1Y4UA 4R3AA 5KA5A 4I3HA 3ZKDA 4QPKA 2WI1A 3E8HA 3H01A 2YKCA 1AI7A 3RLRA 1K34A 2AHYA 3E83A 3AG4B 4U93A 2WAMA 5FNFA 1YSRA 3W7WA 1NVPB 4MSWC 1KP3A 4R50A 2WWWA 3MNRP 4CE1A 1JJ2U 5FL7G 3IEDA 2JJCA 2B5UA 1OCRC 3A0XA 4ZVIA 2XAHA 2IW5A 3K79A 3AG2B 3ML0A 1BHBA 2BU5A 1P7BA 4WFHA 4PU9A 4JAVA 1NJIW 1KKDA 1I5BA 2GSMB 1TH8A 1U0ZA 3FB7C 3BM9A 1YC4A 3EHJA 1P4RA 5LGNA 2HVJC 3ZM7A 3CCJV 1JX9A 1S0VA 1M56C 4P30A 1TC0A 1KQSU 2Q67A 2AKPA 2Q8HA 4MT8A 2IH1C 5EBWC 4MTXA 1GKFA 3AG2C 4HYOA 1Z5CA 2YEFA 2DW4A 1YSCA 1JM6A 2Q69A 2XDXA 4PDMA 3CCMV 2XHXA 4L87A 4JYBA 3ZRWB 3CXCU 2CCSA 2WLMA 1QYEA 4CWFA 4CWPA 3K60A 1W0JG 2HG5C 3B8NA 3WHAA 2EIMC 5CTYA 3HZ1A 4QE7A 1UYMA 2IWXA 3FYIB 3H80A 1PNMA 4YKTA 4RAIA 3W7TA 2VCJA 1Q81W 1VQNV 1VQKV 3JZ3A 4KSHA 4ASFA 4NH9A 1GMGA 4JF3A 2YGEA 3AEIA 4MVRA 1COWG 1R73A 2WLJA 2QA4V 2YEDA 2YKBA 1KIJA 1UYDA 4QIWF 4LP0A 4WUBA 4E02A 5HFLA 3C11A 4U7NA 2DYRC 5LGUA 4PL9A 1M90W 3ABUA 1Q7YW 2WLLA 3BEHA 2UXNA 4BIZA 3ABMB 4WFFA 3OW2U 1Z5AA 3VADA 3WFVA 4HY1A 3SJQC 1S3JA 1AM1A 3JD4A 4P7AA 3Q5JA 3CMAV 3OAAG 1KD1W 4O09A 2XX2A 2KB1A 3HB3B 4EFTA 3TETA 1R62A 1ZW9A 5EK0A 3GIFA 4PRXA 4XC0A 3RBZA 4RUFA 2Y48A 5LHIA 5D6PA 4TT3G 3CCRV 5B1AB 3SYAA 3R92A 2IU3A 1S77D 3FB6C 1M9NA 1UYGA 4JGSA 3B26A 3A0TA 5M4MA 4LCUC 1MABG 1DTOA 1K73W 2ZD9A 3OUSA 4V25A 2JJ2G 1QR8A 5L3FA 1AJPA 4DO2A 3CCEV 1AH8A 1S16A 1YC3A 3CGZA 3RLPA 4MPNA 5F3KA 3CCVV 5M4HA 3SYPA 4LWEA 3ZMUA 1V55B 3DTUB 4X9LA 3QO5A 1NVPD 4CWOA 2XHTA 3ABLC 2B1GA 2XASA 2CK3G 3ASNB 4P9OA 5GW7A 2ZXWC 4R7CA 2YEBA 3SPCA 2Q6AA 2Y69B 1QLNA 2BT0A 3LSSA 2BU2A 3SPIA 1PNLA 2EILC 3JD1A 3OM3B 4MVUA 1VQOV 5J71A 1EZJA 3ASOB 3K04A 3PJSK 2A0LA 4J9ZB 1YHQV 3VHAA 4B7PA 2PI5A 3K06A 3CD6V 2OTJV 2IH3C 2OT5A 3QNEA 3CGYA 3K98A 4X88A 2ZDXA 2HVKC 2BRCA 2WLIB 5B1BC 3AG3B 1BGQA 2E0AA 4OXSA 2WLIA 1M57C 1V54C 3X2QC 2OCCB 2XX4A 5CTUA 1RPOA 2W6JG 4K4OA 3AG1B 1NR7A 3OUFA 3HPLC 4U7OA 2YKJA 4HYMA 4XCJA 4URMA 2HFEC 1S72V 2ZKJA 4XD8A 2QTOA 2K5BA 4XDKA 1VQ4V 2EJRA 4GX0A 5FWKA 1OCCB 2EIKC 1WLEA 2QKSA 3W7UA 3B25A 4ASBA 4TSFG 1BHAA 1THNA 2OCCC 3SPHA 3CC7V 5L3JA 3X2QB 1BXDA 1VQ5V 2XDSA 1YTFD 3QTFA 1K5SA 3O0IA 4GQTA 4O07A 3NMQA 4XIPA 2YEVB 2MK3A 3Q5LA 1W0KG 4XDMA 2Q8FA 1GTOA 1FFTB 1U2OA 2BREA 2Q8GA 4B6CA 3EFFK 5CA3A 2YE3A 3DGEA 2GFDA 5B3SB 4E01A 4KQVA 2BOBC 2X6CA 3IGAC 1BYQA 1WPXA 3EHBB 2FYPA 1R6KA 3M99B 4JTAB 4PA3A 2O1WA 1TUEB 3K99A 4RQFA 2LFSA 3OW6A 1QVFU 1VQ6V 2XX5A 3PEHA 4O05A 4V26A 2YGFA 2IJKA 2ATKC 3ZXOA 4MPCA 3OMIB 5LHHA 1AR1B 4MVOA 2XJGA 3VHCA 5KUKA 1VQ9V 2UWDA 4GX1A 2WEPA 5D7RA 4QNHB 1PL0A 2HR3A 4BIUA 4GT8A 1R3JC 4AWOA 1PKXA 2DQ3A 1S14A 2JIZG 2YE8A 3WQ9A 2H94A 1ROPA 3TUHA 2EILB 2ZBKB 3SYQA 4ASGA 2DYSB 2XDLA 5CPHA 4PA9A 2XABA 2YEIA 4PDRA 2YE5A 2ZDYA 3TCUA 5D7CA 3JD3A 4MW3A 1KP2A 1Y4MA 3AG1C 1AH6A 4PDLA 3CCUV 3VOUA 1Y66A 2YE6A 3TTZA 4R6ZA 1K7DA 2R9RB 1JQ0A 1M57B 1MX0A 1US7A 3K0GA 2YJWA 1Y4SA 2ZQMA 2H8PC 2ZR3A 1BKNA 1ZWHA 1K92A 1YESA 3EKOA 3EKRA 1K97A 1YERA 1B62A 2WI2A 2P6JA 4PA7A 1BL8A 3ASOC 3CYOA 2WERA 3RW0A 2IWSA 1K9MW 1GKZA 1B6QA 2QFOA 4FMTA 1GM8A 3CRLA 2CH4A 4JAUA 1GM9A 2CCTA 4ASAA 3LDDA 5KA6A 1NHHA 3GIGB 4KSGA 1OCZB 1GK9A 3TK1A 3ZCCA 1YT1A 4YKQA 4CE3A 1K4DC 4X89A 1KC8W 1JOYA 2D3OW 2XD6A 3CRKA 4EGKA 4URNA 3F5WC 3KG2A 3R65A 5DM6V 3HYZA 5BOCA 4CWQA 3FB5C 1I5CA 1R6NA 5J9PC 3HEKA 5CBHA 2BYIA 3U2DA 5L3EA 4O0BA 1SRYA 3ZKBA 4BAEA 5IDMA 4UVCA 3SPJA 2PI4A 1I5YA 4P8OA 3STZC 2A79B 2JK5C 3ABKB 3B8MA 4MVQA 1YTFB 1YT2A 3G7EA 4GEEA 4CWTA 3ZMSA 1SESA 1CPYA 2IWUA 2LP7A 4WFEA 4HYPA 1YJNV 2V1DA 5B1AC 3MHHC 1YJ9V 1YITV 2FWZA 4LC1A 3B28A 2ITCC 1F4NA 1F4MA 1NHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YKY A;  4NH7 A;  3KE6 A;  4LWI A;  2CG9 A;  3D2R A;  4URO A;  5B1O A;  2YGA A;  1UYI A;  4LWG A;  2YI5 A;  1AJ6 A;  2QG2 A;  3CWV A;  1I58 A;  1YC1 A;  1F51 A;  2BYH A;  2BU7 A;  4MPE A;  1Y8O A;  4PRV A;  3BMY A;  4XKO A;  1UYH A;  1IXM A;  4AS9 A;  4XKA A;  1ZXN A;  2YE2 A;  2YI7 A;  3FT8 A;  4GT1 A;  1YSZ A;  1UYF A;  2YEH A;  5IDJ A;  2BZ5 A;  3C0E A;  3B27 A;  3OWB A;  1Z5B A;  4NH8 A;  3FV5 A;  4MP7 A;  5M4E A;  3RLQ A;  4AWP A;  2BU8 A;  3ZRV A;  2IOQ A;  4L91 A;  3T10 A;  3EHF A;  2YKE A;  2XHR A;  2IOR A;  3INW A;  3PEJ A;  2YI6 A;  5FND A;  5GGZ A;  4DZY A;  5M4K A;  3T0H A;  2YEA A;  5CTX A;  4FCQ A;  4EFU A;  4YKU A;  4XTJ A;  1YT0 A;  5BOD A;  1GKX A;  5F5R A;  2YEE A;  3P32 A;  4MBC A;  3R4O A;  2XCM A;  2LFR A;  1I5A A;  3NXS A;  2XK2 A;  1H7S A;  1KZN A;  5D7D A;  3D0B A;  4WUD A;  4MP2 A;  4FPP A;  2QG0 A;  2WI5 A;  2BSM A;  4LWH A;  1PVG A;  3A0W A;  4DUH A;  4HXZ A;  3LPS A;  4QPJ A;  2HG1 A;  4Q20 A;  4MB9 A;  3HZ5 A;  3RKZ A;  1UYE A;  1TID A;  4MOT A;  5J6A A;  3G75 A;  1UY9 A;  2O1U A;  4YKW A;  4LWF A;  4YKX A;  3G7B A;  1AMW A;  1Z59 A;  3H4L A;  3SL2 A;  1OSF A;  2BTZ A;  2WI6 A;  3K97 A;  2VCI A;  5FNC A;  4HY6 A;  2YE4 A;  2FXS A;  2FTK A;  1A4H A;  4CE2 A;  1QY8 A;  3MD0 A;  3HYY A;  3HHU A;  4ZKI A;  3GIG A;  2WEQ A;  1MU5 A;  1TIL A;  1B3Q A;  1UY7 A;  2Q8I A;  4LPB A;  4BXI A;  4EEH A;  2YE9 A;  4EMV A;  3T0Z A;  4H7Q A;  4KFG A;  1Y8N A;  4XIQ A;  3EHG A;  4O04 A;  2O1V A;  5B1N A;  4XIT A;  1L0O A;  4FCP A;  1UY8 A;  4CWR A;  5IN9 A;  4BQG A;  1I5D A;  2YEJ A;  4L90 A;  3R4N A;  2CGF A;  1QZR A;  2HCH A;  4EGH A;  3OMU A;  2FWY A;  3B24 A;  3Q5K A;  5M4P A;  4KTN A;  4EGI A;  4R1F A;  3ZXQ A;  2XJX A;  3VHD A;  1ZXM A;  1ID0 A;  2WI3 A;  3A0R A;  4E00 A;  3R4M A;  4HZ0 A;  4AWQ A;  1UY6 A;  3GIE A;  3FT5 A;  3U2K A;  4GCZ A;  2YI0 A;  2PNR A;  2QF6 A;  2XJJ A;  4HXW A;  4JYC A;  1Y8P A;  3T1K A;  1NHJ A;  1H7U A;  2IOP A;  1EA6 A;  3ZRW A;  4XE2 A;  5C93 A;  4H85 A;  3R4P A;  2YK2 A;  2YJX A;  3O2F A;  3TZ4 A;  2YK9 A;  1YS3 A;  1B63 A;  4L93 A;  2C2A A;  3INX A;  2QM8 A;  3A0Y A;  4R3M A;  4I5S A;  2VW5 A;  3QDD A;  4HZ5 A;  1TC6 A;  2YE7 A;  4XKK A;  2XDK A;  1GJV A;  5M4N A;  2Q2E B;  5D6Q A;  2YEG A;  5CTW A;  4GGL A;  4FCR A;  3OWD A;  4L94 A;  1UYC A;  1TBW A;  3ZRX A;  3D36 A;  4JAS A;  2P67 A;  2GQP A;  3TZ0 A;  1UYK A;  4JQL A;  3TZ2 A;  1YET A;  2WI4 A;  3LNU A;  2VWC A;  3OPD A;  4W7T A;  2JKI A;  4XCL A;  2XDU A;  4XIR A;  2QM7 A;  3EHH A;  4CWS A;  1EI1 A;  4YKZ A;  4KP4 A;  4URL A;  4GFN A;  2H55 A;  4H81 A;  3TZ5 A;  5CF0 A;  3A0Z A;  4EM7 A;  4CWN A;  3U67 A;  2EXL A;  2ESA A;  2H8M A;  2YKI A;  1I59 A;  2YEC A;  4YKR A;  2CCU A;  2WI7 A;  4L8Z A;  3O6O A;  4R3A A;  1UYL A;  2BU6 A;  2HKJ A;  1Y4U A;  4I3H A;  3ZKD A;  4QPK A;  2WI1 A;  2YKC A;  3RLR A;  4U93 A;  5FNF A;  1YSR A;  4CE1 A;  2WWW A;  3MNR P;  3IED A;  2JJC A;  3A0X A;  2BU5 A;  4PU9 A;  4JAV A;  1I5B A;  1U0Z A;  1TH8 A;  3BM9 A;  1YC4 A;  3EHJ A;  3ZM7 A;  1TC0 A;  2AKP A;  2Q8H A;  4MT8 A;  4MTX A;  1Z5C A;  2YEF A;  1JM6 A;  2XDX A;  2XHX A;  4JYB A;  3ZRW B;  2CCS A;  4CWF A;  1QYE A;  4CWP A;  3K60 A;  3WHA A;  5CTY A;  3HZ1 A;  3H80 A;  1UYM A;  2IWX A;  3T2S A;  4YKT A;  2VCJ A;  5M4M A;  4ASF A;  3JZ3 A;  4KSH A;  4NH9 A;  2YGE A;  2YKB A;  4WUB A;  3R91 A;  2YED A;  1KIJ A;  1UYD A;  4LP0 A;  4E02 A;  3C11 A;  4U7N A;  4PL9 A;  4BIZ A;  1Z5A A;  3VAD A;  4HY1 A;  1AM1 A;  4P7A A;  3Q5J A;  4O09 A;  2XX2 A;  4EFT A;  1R62 A;  1ZW9 A;  3GIF A;  4PRX A;  4XC0 A;  5D6P A;  3R92 A;  1UYG A;  3B26 A;  3A0T A;  4V25 A;  1YC3 A;  1AH8 A;  1S16 A;  3RLP A;  3CGZ A;  4MPN A;  5F3K A;  5M4H A;  4LWE A;  4X9L A;  4CWO A;  2XHT A;  2YEB A;  2BT0 A;  2BU2 A;  5J71 A;  3VHA A;  4B7P A;  3CGY A;  4WUC A;  3K98 A;  4ZVI A;  4BQJ A;  2ZDX A;  2BRC A;  1BGQ A;  2E0A A;  2XX4 A;  5CTU A;  4K4O A;  4U7O A;  2YKJ A;  4HYM A;  4XCJ A;  4URM A;  2ZKJ A;  4XD8 A;  2K5B A;  5FWK A;  3B25 A;  4ASB A;  1THN A;  5L3J A;  1BXD A;  2XDS A;  4GQT A;  4XIP A;  3QTF A;  3O0I A;  4O07 A;  3NMQ A;  3Q5L A;  4XDM A;  2Q8F A;  1U2O A;  2BRE A;  2Q8G A;  4B6C A;  2YE3 A;  3DGE A;  2GFD A;  4E01 A;  4KQV A;  1BYQ A;  2FYP A;  2O1W A;  3K99 A;  2LFS A;  3OW6 A;  3PEH A;  4O05 A;  2XX5 A;  4V26 A;  2YGF A;  3ZXO A;  4MPC A;  2XJG A;  3VHC A;  2UWD A;  2WEP A;  5D7R A;  4GT8 A;  4BIU A;  4AWO A;  1S14 A;  2YE8 A;  3WQ9 A;  3TUH A;  2ZBK B;  4ASG A;  2XDL A;  5CPH A;  2YEI A;  2XAB A;  2ZDY A;  5D7C A;  1AH6 A;  2YE6 A;  3TTZ A;  1US7 A;  1MX0 A;  2YJW A;  1Y4S A;  1BKN A;  1ZWH A;  1YES A;  3EKO A;  3EKR A;  1YER A;  1B62 A;  2WI2 A;  2WER A;  2IWS A;  1GKZ A;  2QFO A;  4FMT A;  3CRL A;  2CH4 A;  4JAU A;  2CCT A;  4ASA A;  1NHH A;  3GIG B;  4KSG A;  3TK1 A;  3ZCC A;  4YKQ A;  1YT1 A;  4CE3 A;  2XD6 A;  4EGK A;  1JOY A;  3CRK A;  4URN A;  4CWQ A;  5BOC A;  3HYZ A;  1I5C A;  3HEK A;  2BYI A;  3U2D A;  3ZKB A;  4O0B A;  4BAE A;  5IDM A;  4P8O A;  1YT2 A;  3G7E A;  4GEE A;  4CWT A;  2IWU A;  4HYP A;  2FWZ A;  4LC1 A;  3B28 A;  2YE5 A;  1NHI A; 
#chains in the Genus database with same CATH topology
 2FKX A;  4NH7 A;  4OPA A;  4LWI A;  3ABM C;  2YI5 A;  3FFQ A;  4BW9 A;  1M5I A;  3OT7 A;  3P30 A;  1XNQ O;  4FK5 C;  3W7S A;  5KHI A;  4MPE A;  1Y8O A;  4X1K B;  1UYH A;  2WSS G;  5CBF A;  1IZ3 A;  2ZDI C;  4JI3 O;  1ZXN A;  2YI7 A;  1Y6X A;  3FB8 C;  1XQ8 A;  2JJ1 G;  5IDJ A;  3HKD A;  3C0E A;  5L3C A;  1R3L C;  1Z5B A;  5CN0 A;  3ZHV A;  4AWP A;  2BU8 A;  1G6U A;  4DR4 O;  2YC0 A;  1N34 B;  2YKE A;  1TA8 A;  3INW A;  3Q4H B;  5FND A;  5GGZ A;  1JPX A;  4YKU A;  3I5D A;  4XTJ A;  3K57 A;  1N8R W;  5BOD A;  3CC2 V;  1AP5 A;  4X65 B;  4H0L B;  2YEE A;  4EFB A;  1EN4 A;  5J2T A;  3OR7 C;  3R4O A;  2XCM A;  5CBG A;  2YXL A;  4UV8 A;  1H7S A;  5F2V O;  4LF8 O;  1FXH A;  4B3S O;  5D7D A;  3DC6 A;  4WBN A;  4J9Y B;  2E5L B;  2QE7 G;  3QG5 A;  4WUD A;  1EN5 A;  4MP2 A;  5LMU B;  1GM7 A;  3QF7 A;  1MG1 A;  2RCV A;  4QJF B;  1GO3 F;  2QM4 A;  2Q73 A;  1K5Q A;  4LWH A;  3LPS A;  3CP1 A;  5LOV B;  4Q20 A;  3OFN G;  2HEP A;  4RO2 A;  3HZ5 A;  2GBO A;  3CHX A;  3RVY A;  5GTI Z;  3B09 A;  4LWS B;  1JFF B;  1XNR O;  1I94 O;  2L35 A;  3UKM A;  4O4L B;  4YKX A;  5JCO C;  1YEW A;  1XL6 A;  2VCI A;  4P2Z A;  1L1F A;  2YE4 A;  2DMX A;  4X64 B;  2RN9 A;  1H8H G;  4CE2 A;  2AHZ A;  4FM2 A;  2WPD G;  2JRI A;  4PEL A;  4H13 B;  2PF4 E;  1WB7 A;  1UY7 A;  1AR5 A;  3WB2 A;  5CB4 A;  2YDE A;  1H2K A;  4EMV A;  3T0Z A;  3RYF B;  4LR3 A;  1NH2 B;  4XIQ A;  1YI2 V;  3I56 V;  2WLK A;  2Z5U A;  5B5E Z;  1YJW V;  4FCP A;  4LH7 A;  1UY8 A;  1L8D A;  4MVS A;  3K9S A;  1UPG A;  2YIB A;  4L90 A;  2XT9 A;  4CC6 A;  3H9V A;  3OMU A;  1BCC H;  1IDS A;  1SZT A;  4JI3 B;  4EGI A;  4PDV A;  1FXV A;  3SYC A;  4JI0 O;  2N05 A;  3OMN B;  3L74 H;  3G71 V;  3A0R A;  1H2G A;  3R4M A;  1SER A;  1UY6 A;  3GIE A;  1YXB A;  4LFA O;  1B06 A;  2PNR A;  2QF6 A;  1PV0 A;  2P90 A;  3R4P A;  2YJX A;  1N34 O;  3QO8 A;  3TZ4 A;  1QCE A;  3VBB A;  1YS3 A;  4TV8 B;  5AG2 A;  4F4L A;  2QM8 A;  4OX9 O;  4O4H A;  3F7V C;  4GZR B;  1NQT A;  5M4N A;  4CC5 A;  4ZIB A;  4GGL A;  4B3M O;  4FCR A;  2QWR B;  2ZXW B;  5BR8 O;  2ZT9 B;  4DV2 B;  1K3E A;  1TBW A;  3D36 A;  4GKJ O;  4I7Z B;  1WA8 A;  1FYJ A;  2X0L A;  2AZ0 A;  4WCE V;  5H5N A;  1W2B U;  4K0K B;  1V55 C;  1L0L H;  2WI4 A;  1MOF A;  5A2Q N;  4W7T A;  4JYA B;  3E8B A;  4B08 A;  3OR6 C;  2EIN B;  1XNR B;  4H33 A;  4CWS A;  2X7R B;  1EI1 A;  3UO2 A;  2F43 G;  2GTS A;  4KP4 A;  1WNS A;  1FXK C;  4WFA V;  1N36 O;  3A0Z A;  4EM7 A;  2EXL A;  2YSU B;  3ZJZ A;  2ESA A;  4J10 A;  4YKR A;  2VQF O;  2WI7 A;  2EIJ B;  2Z3Y A;  3OEE G;  1OZ0 A;  3OTO O;  3O6O A;  4LF5 B;  2B9Z A;  2DWD C;  4TUY A;  1RM1 B;  3ZKD A;  5LP6 C;  5KAF Z;  4QPK A;  3RYC B;  2V4D A;  5KHK A;  5IE9 A;  2AHY A;  3E83 A;  5FNF A;  2WAM A;  3DXR B;  4MSW C;  5EZY B;  4NKG B;  2JJC A;  2B5U A;  3A0X A;  2IW5 A;  4L8J A;  3AG2 B;  3ICX A;  2CTQ A;  1NJI W;  3FB7 C;  1YC4 A;  3EHJ A;  1P4R A;  3HKE B;  3CCJ V;  1KQS U;  4UCR A;  3N2K B;  4UCV A;  5EBW C;  2IH1 C;  4LF6 O;  1Z5C A;  2YEF A;  2CH7 A;  1JM6 A;  2XDX A;  4PDM A;  4O2B B;  2RMK B;  3TXS A;  3ZRW B;  2CCS A;  1MSD A;  3K60 A;  2HG5 C;  5JH7 A;  4TUY B;  3H80 A;  3FYI B;  4YKT A;  4WBN B;  3W7T A;  2UUA O;  4NH9 A;  2YGE A;  4O4I A;  2WLJ A;  2YKB A;  4QIW F;  4LP0 A;  2KG7 B;  3ABU A;  4YJ3 B;  3VAD A;  3JD4 A;  3Q5J A;  3K58 A;  3TJT A;  2BTO A;  4GYC B;  1Z5V A;  3RBZ A;  1QQC A;  5D6P A;  5LHI A;  3K5L A;  4KHP B;  5B1A B;  1WA8 B;  3SYA A;  4JGS A;  4O2B A;  4LCU C;  1MAB G;  3ZBH A;  3H1J H;  1YC3 A;  3CCE V;  1AJP A;  1AH8 A;  5F3K A;  4LWE A;  5J2U B;  3DTU B;  4DV6 B;  4YIO A;  2XHT A;  2XAS A;  3BRC A;  4LNU A;  2BT0 A;  3LSS A;  2BU2 A;  1RSO A;  5B66 Z;  3JD1 A;  4OX9 B;  1EZJ A;  2QWO B;  3G6B A;  2A0L A;  4CH4 A;  4TV8 A;  2GDS A;  2PI5 A;  3K06 A;  4WUC A;  2IH3 C;  2CTP A;  2WLI B;  3AG3 B;  4LF9 B;  1BGQ A;  5KLV H;  3RYC A;  5JQG A;  3E22 B;  2OCC B;  1FAF A;  2W6J G;  4K4O A;  3SJC C;  2PYL A;  4XCJ A;  2ZKJ A;  2QTO A;  2K5B A;  1VQ4 V;  2EJR A;  1DGS A;  3W7U A;  4FLW A;  5EYP B;  4TQD A;  2Y0P A;  3APO A;  4GQT A;  4XIP A;  1K5S A;  4O07 A;  4J42 A;  2MK3 A;  1W0K G;  4XDM A;  2CE4 A;  4LF8 B;  4E01 A;  1BYQ A;  3CRM A;  3EHB B;  3M99 B;  1IBL B;  3OW6 A;  3PEH A;  3RYI B;  2YGF A;  3ZXO A;  3OMI B;  5LMN O;  3VHC A;  1VQ9 V;  2UWD A;  4GX1 A;  4QNH B;  2HR3 A;  4NXM O;  5KX5 A;  1VMG A;  1PKX A;  1XUQ A;  1S14 A;  4YJ3 A;  3CSX A;  2EIL B;  2AZ2 A;  3QTC A;  3HKC B;  4PJ0 Z;  4X20 B;  1KP2 A;  2RQ6 A;  1J5E O;  4R6Z A;  4EEQ A;  1K7D A;  2HHI A;  2F4V O;  1M57 B;  1US7 A;  1LUV A;  2LW1 A;  3K0G A;  1Y4S A;  3GWK C;  2ZR3 A;  3BCC H;  3ZHQ A;  3EKO A;  1QNM A;  3EKR A;  2JGU A;  1B62 A;  2WI2 A;  3ASO C;  3CYO A;  1K9M W;  1Q6H A;  3H1I H;  2JGD A;  4YIP A;  2CH4 A;  1Y74 B;  1GM9 A;  4ASA A;  5KA6 A;  1NHH A;  1WP8 A;  4YKQ A;  5CA0 A;  2XD6 A;  5LP6 A;  1JOY A;  1IXB A;  1ZX3 A;  4EGK A;  3VQY A;  3F5W C;  3HYZ A;  2DE0 X;  5J9P C;  2BYI A;  4BAE A;  1JJO A;  4UVC A;  4P8O A;  1I5Y A;  3STZ C;  2A79 B;  2JK5 C;  5J2U A;  3IJ4 A;  3U10 A;  1P49 A;  4HYP A;  2V1D A;  3MHH C;  4LWS A;  4LC1 A;  3L75 H;  2ITC C;  2YE5 A;  1NHI A;  4YKY A;  3M7M X;  4JI6 O;  2FYU H;  4URO A;  4CBC A;  5B1O A;  3FX7 A;  1N4C A;  2B1I A;  3CPW U;  3D3Q A;  2IU0 A;  1VAR A;  1W59 A;  4F6R B;  1R3K C;  3CWV A;  3CCL V;  2BU7 A;  4BWA A;  4DW0 A;  4B3M B;  4XKO A;  1M1K W;  1XMQ O;  2ARH A;  4YY3 O;  3H1K H;  1D2D A;  1NKD A;  3FT8 A;  4GT1 A;  1YSZ A;  2UUB B;  1UYF A;  1PP9 H;  2Y4T A;  3A8T A;  2F66 C;  1CXZ B;  4AQY B;  4B3R B;  3B27 A;  2HHH B;  2ZCE A;  4NH8 A;  1Y76 A;  3RLQ A;  2E76 B;  5CB4 B;  1VEW A;  2JS3 A;  4DV4 B;  4L91 A;  4DV7 O;  2LQT A;  1M56 B;  4GLX A;  2IOR A;  1BMF G;  4D7S A;  4I55 B;  4DRX B;  3JCZ A;  4DV1 O;  4KFM A;  1YT0 A;  4DR7 O;  4DR1 O;  2XTA A;  3OGI B;  1K8A W;  1AI4 A;  4LF4 B;  4CS2 A;  4K8X A;  1EBO A;  4IT5 A;  4LFA B;  1H2L A;  3VQX A;  3LNM B;  3T1C A;  4ASU G;  2XK2 A;  2ZR2 A;  1H38 A;  3G6E V;  3D0B A;  2JDI G;  1HR0 O;  5EC2 C;  4X1Y A;  2QG0 A;  1RPR A;  5LL6 Y;  4RUE A;  1KEC A;  3K5M A;  4G2K A;  2P7T C;  2UXB B;  3ZHU A;  3LSU A;  4NXM B;  4NTW A;  4MB9 A;  4IGG A;  3ZN1 A;  2AW9 A;  2GTA A;  4MOT A;  4NR1 A;  5J6A A;  1XL4 A;  2UXB O;  5IWA B;  2O1U A;  4YKW A;  3ZED A;  1RM1 C;  1Z59 A;  2BTZ A;  2WI6 A;  3ZHS A;  5FNC A;  4X66 B;  4HY6 A;  3CJH B;  2FXS A;  2FTK A;  1AR4 A;  1YZB A;  5E1A C;  3JD0 A;  5K1X A;  5FPO A;  3JYC A;  3HHU A;  2L6L A;  4ICG A;  1SA0 B;  4YHH O;  1OHH G;  1F7Y A;  1YF2 A;  2WEQ A;  3RGB A;  3UT5 B;  4MTF A;  1IVS A;  1FPO A;  3ETQ A;  1XRE A;  1FXK B;  1I7F A;  2W0F C;  4TQF A;  5LBQ A;  2BSK A;  2PZS A;  4LFB B;  1AIL A;  4HNA B;  2EIN C;  2F4V B;  2NLJ C;  4FLX A;  2DJV A;  3CCS V;  1QVG U;  4DV7 B;  5H6R A;  4EKW A;  1I08 A;  4JV5 B;  4LF9 O;  4CWR A;  1WAZ A;  5IN9 A;  4GKK O;  4QE9 A;  1OCZ C;  2CGF A;  5LA6 B;  3C90 A;  3S3X A;  3A2F A;  1AVM A;  2BCC H;  2LGQ A;  2FWY A;  1NTZ H;  1XMO O;  2Y0I A;  1BSM A;  3B24 A;  4C7U A;  1K33 A;  3Q5K A;  4KTN A;  5M4P A;  4CZZ A;  4U3J B;  3ZXQ A;  1QR9 A;  3VHD A;  1ZXM A;  1HR0 B;  1F23 A;  1A32 A;  2WLL B;  5HFM A;  4G28 B;  3O9O A;  2HKO A;  3FT5 A;  1MSW D;  2DYS C;  2Y69 C;  3E2E A;  2K9P A;  2YI0 A;  2HP8 A;  1URF A;  2A06 H;  4NB5 A;  2XJJ A;  4JYC A;  5B1B B;  4N21 A;  2IOP A;  4ZHQ A;  4JZ2 A;  4XE2 A;  5C93 A;  4H85 A;  1OCC C;  3AK3 A;  4TWK A;  1FFX B;  3O2F A;  4RQE A;  3EVK A;  3FKS G;  3SJB C;  4L93 A;  5IJ9 A;  4DR2 O;  2EZP A;  1HDJ A;  1ZWI C;  3BAA A;  3ETE A;  3A0Y A;  5BXZ A;  4JAA A;  4B3R O;  4I5S A;  4PA4 A;  3N27 A;  3EXA A;  2UXC B;  4N23 A;  3QDD A;  4HZ5 A;  1PPJ H;  4CH6 A;  3F5T A;  5J2T B;  3SYO A;  2QR4 A;  1SF9 A;  3ZRS A;  2UU9 B;  5IYC O;  3K9A A;  4DV6 O;  4IL6 Z;  1MZE A;  2WLH A;  1YIJ V;  5BY1 A;  4JI5 B;  4U3F H;  3ZRX A;  2XAG A;  1M4U A;  1XDC A;  2P67 A;  4UVB A;  1FXK A;  1TVK A;  3K03 A;  3LNU A;  3OPD A;  5H9C A;  3UT5 A;  5IWA O;  1Q43 A;  4XCL A;  1SQP H;  4IIJ B;  4UVA A;  3W7X A;  3B40 A;  3P3N A;  2F93 B;  2IJI A;  2ILM A;  2ZE5 A;  5A9G A;  1N32 B;  4X62 O;  3D8C A;  2QKA A;  1NBM G;  3A0B Z;  4DXW A;  2D2C B;  4H81 A;  3AG7 A;  1IBL O;  3E86 A;  2W6I G;  3U67 A;  3N2G B;  2YKI A;  2HJF C;  3E89 A;  1OCR B;  5EYP A;  5LYJ B;  3MAQ A;  5LOV A;  1LNQ A;  1VQ8 V;  4GX2 A;  4UXN A;  3VQW A;  4PI2 A;  4YJ2 A;  4FLT A;  4I3H A;  3BHP A;  3CE2 A;  3RLR A;  2RJZ A;  4X1Y B;  2FL4 A;  3AG4 B;  3KCY A;  2JS5 A;  2WWW A;  3MNR P;  1JJ2 U;  5FL7 G;  3IED A;  3J81 N;  3K79 A;  4LNU B;  3T1H B;  2MW2 B;  1P7B A;  2LGW A;  4ZOL B;  1U0Z A;  1TH8 A;  3BM9 A;  1HNX B;  3H1H H;  5LGN A;  3ZM7 A;  2HVJ C;  1VF5 B;  1S0V A;  1JX9 A;  2PGG A;  1M56 C;  2Q67 A;  1BE3 H;  2AKP A;  3P3P A;  2UUB O;  1XIL A;  1JMK C;  1YSC A;  4UCT A;  5KAI Z;  4JYB A;  1BZK A;  4ZI7 A;  1H2N A;  1QYE A;  4CWP A;  1Y76 B;  2IBZ H;  3B8N A;  4LF5 O;  1Q5O A;  3HZ1 A;  3T2S A;  4RAI A;  4ASF A;  1VQN V;  1VQK V;  4KSH A;  4JF3 A;  2YIA A;  2QA4 V;  1R73 A;  2YXY A;  2YED A;  4WUB A;  1KIJ A;  1UYD A;  3S3W A;  3JAM N;  1M90 W;  2WLL A;  3OW2 U;  4BIZ A;  1Z5A A;  2CTW A;  5CA0 B;  4P7A A;  3JSL A;  1G1X B;  4EFT A;  1R62 A;  3KZI Z;  1HNX O;  5EK0 A;  4XC0 A;  3NR7 A;  4RUF A;  1NI8 A;  4B7E A;  4TT3 G;  3CCR V;  3R92 A;  5D5Q A;  2IU3 A;  3FB6 C;  4DR3 B;  1UYG A;  1DTO A;  5LA6 A;  3OUS A;  3LMM A;  4MPN A;  2P5O A;  2ZIO A;  4X20 A;  3QO5 A;  4DW1 A;  4I4T B;  3HKC A;  3ABL C;  1LUW A;  5JCO A;  4K35 A;  3ASN B;  1HNW O;  3L71 H;  4R7C A;  5KHH A;  2Q6A A;  1QLN A;  5GON B;  4DV1 B;  2EIL C;  1VQO V;  5J71 A;  2DOS A;  3JAL B;  3ASO B;  3PJS K;  3VHA A;  4NXN O;  3CGY A;  3CD6 V;  2OTJ V;  3QNE A;  3K98 A;  4BQJ A;  4E72 A;  4X88 A;  1BQ0 A;  2BRC A;  2E0A A;  4F6E A;  1M57 C;  3X2Q C;  2XX4 A;  5CTU A;  3OUF A;  2HFE C;  1S72 V;  3SR2 C;  5EIB C;  2EIK C;  2QKS A;  3B25 A;  4ASB A;  4TSF G;  1BHA A;  3G80 A;  1THN A;  3CC7 V;  1SQG A;  2NR5 A;  3X2Q B;  5L3J A;  1N33 O;  3QTF A;  1M93 A;  4I9Q A;  5JVD A;  1FFT B;  3ZS8 C;  4I0X B;  5CA3 A;  2YE3 A;  5B3S B;  2BOB C;  1R6K A;  4JTA B;  1N36 B;  3UQ8 A;  4V26 A;  1I94 B;  2ATK C;  1KUQ A;  2Y4U A;  1FKA O;  1IBM B;  4MVO A;  5TIS Z;  5KUK A;  1GRJ A;  2YE8 A;  2YI8 A;  2H94 A;  1ROP A;  3TUH A;  2XDL A;  5CPH A;  1GN4 A;  5D7C A;  3CCU V;  3U11 A;  5LMN B;  1TAE A;  2ZQM A;  2H8P C;  1O9H A;  1K92 A;  1K97 A;  1OJH A;  2P6J A;  3RW0 A;  2IWS A;  1B6Q A;  4YHH B;  2QFO A;  1GM8 A;  4FLY A;  4I0X A;  4JAU A;  2CCT A;  3DSQ A;  3LDD A;  3IC9 A;  3GIG B;  4J41 A;  1KC8 W;  3CRK A;  4CWQ A;  5IDM A;  1SRY A;  2KG7 A;  3SPJ A;  2PI4 A;  3SDL A;  4O2A A;  3ABK B;  1YTF B;  4UCO A;  4A5U B;  3G7E A;  1WPB A;  3ZMS A;  1CPY A;  2IWU A;  1NU1 H;  3APQ A;  1YJN V;  5B1A C;  2OIE A;  5JH7 B;  1F4M A;  2CG9 A;  1JVM A;  4I9W A;  2YGA A;  1H2M A;  1UYI A;  4LWG A;  1TUB B;  1NTM H;  1VQ7 V;  1S76 D;  4JI5 O;  2EZO A;  4X9Q A;  3OGC C;  4GKJ B;  1AJ6 A;  1E1Q G;  2P4K A;  3SJA C;  2NNU A;  1I58 A;  1F51 A;  4B3S B;  4PRV A;  5IYZ A;  3AG4 C;  4JI2 B;  1IXM A;  2VQE O;  4XKA A;  1N33 B;  5DN6 G;  2E74 B;  1QLE C;  2A3Q A;  1NH2 D;  3OMA B;  2YEH A;  2BZ5 A;  2OWO A;  2BOC C;  1VQL V;  2Q4P A;  4AIL C;  3JAS A;  3FV5 A;  5M4E A;  2QWN B;  2Q68 A;  1IBK O;  3ZRV A;  2IOQ A;  1Q90 D;  3CCQ V;  2PY5 A;  2XHR A;  2HHH O;  5M4K A;  1SQQ H;  3N2K A;  2YEA A;  4FCQ A;  2IJH A;  1O9G A;  3GB7 C;  1GKX A;  3DC5 A;  1FJG B;  4JPR A;  1QHT A;  1I5A A;  3NXS A;  1KZN A;  4E2L A;  5CMU A;  3JCU Z;  3OEH G;  4KL1 A;  1R1B A;  2XOK G;  4FPP A;  4JI0 B;  4PV1 B;  4CS4 A;  2Q8V A;  2BSM A;  3ABT A;  1PVG A;  4O4J A;  4DUH A;  4FVM A;  4QPJ A;  4BAY A;  1NT2 B;  3RKZ A;  4TV9 B;  4O2A B;  4XDJ A;  1Q6I A;  4HZ3 A;  2Q0O C;  3G75 A;  1UY9 A;  3ZIA G;  4LWF A;  4JYA O;  4EB6 A;  1AMW A;  3G7B A;  3SL2 A;  4K0K O;  1EFR G;  3OD4 A;  4FLV A;  3ABK C;  1A4H A;  4KUM A;  3E22 A;  1QY8 A;  3MD0 A;  4W4L A;  1IUR A;  3HYY A;  2F23 A;  3GIG A;  2AGA A;  1ZL8 A;  4ZBM A;  1TIL A;  1B3Q A;  2PUS A;  1FS0 G;  4DUZ B;  2QWQ B;  3GWO A;  4LPB A;  4BXI A;  4EEH A;  2YE9 A;  3LDC A;  4LP8 A;  1RSO B;  1S5L Z;  3HKB B;  3G67 A;  2ETN A;  5GON A;  3I55 V;  4KFG A;  1DK1 A;  1Y8N A;  4O04 A;  2OYQ A;  3K5O A;  1J5E B;  3ETG A;  3BA9 A;  4DR5 O;  1XBL A;  2O1V A;  3FAV B;  5B1N A;  1G8M A;  5IY5 B;  1L0O A;  3CRR A;  1IBK B;  4DR5 B;  4HAM A;  1B04 A;  4X1K A;  3E8G A;  3CC4 V;  2EBO A;  1BT8 A;  4CH5 A;  2HCH A;  2XND G;  4EGH A;  1E79 G;  4E4E A;  3ZHR A;  1H8E G;  4PI0 A;  2UXD O;  1YCI A;  1V54 B;  1PL4 A;  4R1F A;  2YID A;  3LDE A;  2YEV A;  2WI3 A;  1I5X A;  4E00 A;  4X64 O;  1J95 A;  3RT3 C;  2CTR A;  2ZM6 O;  4Z1V A;  3B77 A;  3U2K A;  4GCZ A;  4DUY B;  1NS1 A;  1S5H C;  4NTY A;  1FD9 A;  4HXW A;  3R66 A;  3SGI A;  4XDL A;  4X65 O;  1NHJ A;  2M7W A;  4ZI7 B;  4O4J B;  5IJ9 B;  2BSK B;  2EIK B;  4B3T O;  2CH7 B;  2YK9 A;  1FFX A;  2K1E A;  3INX A;  4ZHQ B;  4AQY O;  5JJJ B;  4R3M A;  1YVW A;  2A9H A;  1JCH A;  4ZOL A;  4Q6G A;  2YE7 A;  4XKK A;  3IC7 A;  2IJJ A;  3BA8 A;  4I4T A;  2XDK A;  4O4L A;  5D6Q A;  3ZMT A;  3H1L H;  3STL C;  3L73 H;  3BFR A;  2QWP B;  2QEX V;  2ZM6 B;  2UXC O;  2XAF A;  3RFR A;  3CME V;  4DYL A;  1UYC A;  4JAS A;  2GQP A;  3TZ0 A;  1UYK A;  3TZ2 A;  4IYH A;  2JKI A;  4JTC B;  1R3I C;  4LF7 B;  2OCH A;  4JZG A;  4MTO A;  3JAS B;  4XIR A;  2DYR B;  4UB8 Z;  3EHH A;  2DQ0 A;  3K0D A;  2HLD G;  2LW7 A;  1DF4 A;  3E35 A;  4LF7 O;  5L3G A;  1U96 A;  1BQZ A;  3ZMV A;  5CF0 A;  5FPR A;  1ORQ C;  2EUL A;  5BMV B;  2QKC A;  1I59 A;  3QO7 A;  2CCU A;  1G4Y B;  4UB6 Z;  1T5E A;  4DR6 O;  4L8Z A;  3D3I A;  3HKB A;  5EBM C;  5DEC A;  2UXX A;  1UYL A;  2BU6 A;  2DWE C;  1Y4U A;  2YKC A;  1AI7 A;  1EZV H;  3LNN A;  4Z2W A;  3CRA A;  1SC5 B;  3CB2 A;  3WU2 Z;  1YSR A;  3W7W A;  1NVP B;  1KP3 A;  4R50 A;  5FNV A;  2C1G A;  4DR4 B;  2BU5 A;  4WFH A;  4B3T B;  1I5B A;  1N0J A;  1KKD A;  3B4S A;  2E75 B;  4J7K A;  2Q0A A;  4P30 A;  2LO1 A;  2Q7H A;  1HW7 A;  2ODM A;  4MT8 A;  2Q8H A;  1GKF A;  4HYO A;  1HNW B;  2Q69 A;  3CRQ A;  1WJZ A;  1P7G A;  2JVD A;  2XHX A;  4L87 A;  1ZSP A;  4DUY O;  4FLZ A;  4CWF A;  1NZ6 A;  2WLM A;  4JI2 O;  3WHA A;  5CTY A;  1MNG A;  1Q6U A;  2IWX A;  3JZ3 A;  1GMG A;  5IJ0 B;  3AEI A;  3R91 A;  4E02 A;  4DR3 O;  3J7A U;  5HFL A;  1GH6 A;  2UXD B;  2DYR C;  5LGU A;  3N2G A;  3BEH A;  2UXN A;  3ABM B;  4WFF A;  3SJQ C;  3KKY A;  3CMA V;  4DRX A;  2KB1 A;  3HB3 B;  3TET A;  2JGD B;  3GIF A;  1SKV A;  1IX9 A;  4AHC A;  2Y48 A;  2N74 A;  1S77 D;  1M9N A;  3B26 A;  3A0T A;  1K73 W;  2YUA A;  2ZD9 A;  2E5L O;  4V25 A;  4DV2 O;  5L3F A;  3M8A A;  4DO2 A;  4CH3 A;  1S16 A;  3CGZ A;  5M4H A;  3SYP A;  4IHJ A;  4CWO A;  5KHG A;  1XMO B;  2CK3 G;  4J7Z A;  4P9O A;  3OTF A;  5IYZ B;  3SPC A;  4B7K A;  2YEB A;  4HNA A;  4D6T H;  3IAY A;  2CGO A;  3SPI A;  4DR7 B;  5ITZ B;  1NTK H;  3K04 A;  4X1I A;  4B7P A;  2OT5 A;  2CDY A;  4OXS A;  2YIC A;  1V54 C;  1XOU A;  4TOI A;  5IT9 N;  1RPO A;  2P06 A;  3JAT A;  4X1I B;  4RWU A;  1NR7 A;  3JAL A;  3HPL C;  4U7O A;  2YKJ A;  1TGO A;  4XD8 A;  4XDK A;  1OCC B;  1WLE A;  1XHZ A;  2OCC C;  4H44 B;  1VF6 C;  4OGQ B;  1VQ5 V;  4IHJ B;  1YTF D;  2XDS A;  3O0I A;  1AP6 A;  2BE3 A;  2YEV B;  1XNQ B;  2EX3 A;  1U2O A;  1Y74 A;  4I50 B;  3JAK B;  3RYH B;  5CA1 A;  1KBH A;  3IGA C;  2FYP A;  2N04 A;  4PA3 A;  2O1W A;  1TUE B;  3K99 A;  2IM9 A;  2LFS A;  1QVF U;  4O05 A;  2IJK A;  2XJG A;  1WP7 A;  3B2E E;  5D7R A;  1PL0 A;  4BIU A;  1R3J C;  1S5J A;  3ZHT A;  1AB3 A;  4AWO A;  2DQ3 A;  2JIZ G;  4NYK A;  1YDX A;  3TGU H;  2ZBK B;  4ASG A;  2DYS B;  2QTS A;  4PA9 A;  2XAB A;  2YEI A;  4PDR A;  2QJ1 A;  2ZDY A;  3TCU A;  3JD3 A;  4MW3 A;  1AH6 A;  3AG1 C;  4PDL A;  2YE6 A;  3TTZ A;  3Q4H A;  1HP8 A;  3GVM A;  2R9R B;  1JQ0 A;  2YJW A;  2NN4 A;  1BKN A;  1ZWH A;  4LFC O;  3RYI A;  3CXH F;  1YER A;  2OIG A;  1ZL8 B;  3U0Z A;  4PA7 A;  1BL8 A;  2C1I A;  2ZIM A;  2A7W A;  2CUG A;  2VQE B;  4FZ1 A;  1GN6 A;  4DR1 B;  4BIO A;  1GN3 A;  1SA0 A;  2VQF B;  1OCZ B;  3TK1 A;  1YT1 A;  5JVD B;  4CE3 A;  4X89 A;  4URN A;  2KQX A;  5BOC A;  3R65 A;  3FB5 C;  1I5C A;  1R6N A;  1SQB H;  4JI1 O;  4DV4 O;  3ZKB A;  3CJH A;  5L3E A;  4O0B A;  3WB0 A;  1MZF A;  1I0H A;  3B8M A;  1YT2 A;  5FNV B;  4GEE A;  4CWT A;  1SES A;  4O4I B;  3CRC A;  2LP7 A;  4WFE A;  3JAW A;  3K59 A;  2FWZ A;  4TV9 A;  3B28 A;  1F4N A;  4MVM A;  4HZ0 A;  5JQG B;  3KE6 A;  2ZE7 A;  3T1Y O;  1VF6 A;  3D2R A;  2EIM B;  2RDC A;  4BW5 A;  1VQP V;  5BZB A;  3KCX A;  4NXN B;  3LUT B;  3BVO A;  2P22 C;  1PM9 A;  4W4K A;  5BR8 B;  2QG2 A;  1YC1 A;  2YIB D;  2BYH A;  4H37 A;  3BMY A;  3ETD A;  4FZ0 A;  1P84 F;  4AS9 A;  5H6Q A;  3ZN0 A;  2YE2 A;  4DUZ O;  1ARO P;  1FJG O;  4JTD B;  4JI6 B;  3WB1 A;  5LP6 B;  2YI9 A;  4PHZ A;  1THZ A;  2QGN A;  4MS2 A;  4I55 A;  5L3B A;  4PD4 F;  3OWB A;  1GAX A;  3RVZ A;  2EIJ C;  5JJN B;  4WFB V;  4MP7 A;  4DR2 B;  2UUC B;  3L70 H;  3T2M A;  1SS3 A;  1K4C C;  2KKW A;  2FB5 A;  4FM1 A;  2ADQ B;  3T1H O;  3T10 A;  4JI1 B;  3EHF A;  4YXW G;  1QLE B;  1CEZ A;  1KMI Z;  3PEJ A;  1OV9 A;  2GUZ B;  2R9I A;  2YI6 A;  4DV0 O;  4DZY A;  3T0H A;  5CTX A;  3SPG A;  5KUM A;  1AJN A;  4EFU A;  5F5R A;  3BY6 A;  3P32 A;  4MBC A;  2ADP A;  1QU7 A;  5KX5 B;  1LR1 A;  5LGT A;  2LFR A;  3IFX A;  1AI6 A;  1D5A A;  3AK1 A;  3JD2 A;  5IYD O;  1ENV A;  2Q5Z A;  4XBF A;  4PA6 A;  3VQV A;  4MW8 A;  4GUN A;  5EC1 C;  1QBZ A;  2V7Q G;  2Q7E A;  3ZMZ A;  3F7Y C;  1MA1 A;  2WI5 A;  1XEQ A;  3CS5 A;  3CWB H;  3S5T A;  3UM7 A;  1Q82 W;  3A0W A;  4HXZ A;  1XI1 A;  2HG1 A;  3TXQ A;  1GN2 A;  1SQV H;  2PTM A;  1TID A;  1UYE A;  4WF9 V;  3HKE A;  3K08 A;  3WG7 C;  3PN1 A;  4GX5 A;  3HR0 A;  1CP9 A;  1R6T A;  3H4L A;  4CS3 A;  1OSF A;  3K97 A;  1DLB A;  5C8Y B;  2VWJ A;  5EZY A;  2ZKO A;  5FLX N;  2UUA B;  4DV5 B;  4JYY A;  4ZKI A;  4JI8 B;  4U3J A;  1MU5 A;  5IYB O;  2Q8I A;  4LF4 O;  4MVZ A;  4H7Q A;  4DV5 O;  5K1P A;  5KMG B;  3EHG A;  2F1M A;  1ZLZ A;  2H3O A;  3ZX6 A;  4XIT A;  4P9P A;  4UCS A;  1SQX H;  1SET A;  4UUJ C;  1UJW B;  2X6B A;  4BQG A;  1RP3 B;  5L3D A;  1I5D A;  3THO A;  1KB9 F;  2YEJ A;  3FAV A;  1HNZ O;  3R4N A;  2RNB A;  1Q8I A;  4FFB B;  4X62 B;  1QZR A;  1IBM O;  3C3S A;  2GHY A;  5B3S C;  1OCO C;  1H2S B;  3AK2 A;  2HJD A;  1N0N A;  3G4S V;  4JI4 O;  3JAR B;  4UV9 A;  4YY3 B;  1HWY A;  2BTQ A;  2OTL V;  5LXT A;  4BR6 A;  4X8A A;  4HBN A;  5LMU O;  2XJX A;  1AJQ A;  1ID0 A;  2ZNI A;  3CYG A;  3FYE B;  4DR6 B;  4AWQ A;  1PNK A;  3FD9 A;  1UFI A;  3CEI A;  1KYO F;  1PD3 A;  4OPH A;  5LHG A;  4EB6 B;  3ASN C;  3ABL B;  1WN7 A;  2VWK A;  4G27 B;  4IYI A;  1Y8P A;  3T1K A;  2XAJ A;  2QSA A;  3BPZ A;  1N32 O;  2FML A;  1H7U A;  1EA6 A;  3ZRW A;  1JR9 A;  4DV3 B;  5LXT B;  4K8Z A;  2BTQ B;  3OE7 G;  5GTH Z;  3T4D A;  4GKK B;  2YK2 A;  5D5P A;  3LSQ A;  3JAR A;  1OCO B;  2YS8 A;  3MHS C;  2M6Y A;  4FJC C;  1B63 A;  2C2A A;  1Q86 W;  1E1R G;  2XAQ A;  2JEU A;  3AG3 C;  2VW5 A;  2PYJ A;  5C8Y A;  4R8C A;  1ZUQ A;  1TC6 A;  4FIP C;  4LFB O;  1GJV A;  2Q2E B;  2YEG A;  5CTW A;  2DN9 A;  2KSD A;  4MTG A;  3K5N A;  3UCS C;  2E3C A;  3RWR D;  3J80 N;  3OWD A;  4L94 A;  2ZDI A;  2Q9L A;  1US6 A;  5KMG A;  2WLN A;  1VQM V;  1DF5 A;  4WFG A;  4JQL A;  1YET A;  2VWC A;  5EBL C;  5IY5 C;  1AI5 A;  2JEX A;  2XDU A;  2QM7 A;  4K3A A;  1VF7 A;  3E8F A;  3BAB A;  3K3W A;  4YKZ A;  4J7J A;  2X6A A;  2ITD C;  4URL A;  3T4Z A;  4Z1M G;  4GFN A;  3WG7 B;  2H55 A;  1XHX A;  2P4V A;  3TZ5 A;  1NR1 A;  2VS0 A;  4CWN A;  4LBE C;  2H8M A;  3D36 C;  5E79 Z;  2YEC A;  5JWP A;  4J80 A;  4JI7 O;  4F6R A;  2UU9 O;  4R3A A;  2HKJ A;  5KA5 A;  2WI1 A;  3E8H A;  3H01 A;  1K34 A;  4U93 A;  5JJE B;  4LF6 B;  5ITZ A;  4CE1 A;  1OCR C;  1U97 A;  2XAH A;  3ML0 A;  2ZE6 A;  1BHB A;  1Z2G A;  4PU9 A;  4JAV A;  4O4H B;  1VP7 A;  2GSM B;  1KU9 A;  3L72 H;  3DXR A;  2EJ7 A;  2YXH A;  1TC0 A;  2QDO A;  1EM1 A;  4KXR A;  4MTX A;  1BS3 A;  3AG2 C;  2DW4 A;  4AI8 A;  3CX5 F;  2W0X A;  2GV9 A;  2G38 A;  1RFY A;  2R9A A;  4NTX A;  3CCM V;  1XMQ B;  1MMM A;  1Y67 A;  3CXC U;  3RN4 A;  1W0J G;  2EIM C;  5JEN A;  3OTO B;  1EN6 A;  4QE7 A;  3JAW B;  1UYM A;  1PNM A;  2VCJ A;  5M4M A;  4LH6 A;  1Q81 W;  5KHJ A;  3L9D A;  4MVR A;  4X66 O;  1COW G;  1X59 A;  1Z5W A;  4KHP O;  4JI4 B;  3C11 A;  4U7N A;  4PL9 A;  1Q7Y W;  1SQF A;  2Q7G A;  3WFV A;  4HY1 A;  1S3J A;  1AM1 A;  5IJ0 A;  4O09 A;  3OAA G;  5H2F Z;  1KD1 W;  2XX2 A;  1TUB A;  4UCU A;  1ZW9 A;  4PRX A;  1TVK B;  4JV5 O;  4FFK A;  4IIJ A;  4FM0 A;  4FFB A;  1BGY H;  2WA4 A;  2JJ2 G;  1QR8 A;  3HKD B;  3RLP A;  3CCV V;  3ZMU A;  1V55 B;  4X9L A;  1X4T A;  1NVP D;  3C3T A;  2B1G A;  4J11 A;  2R70 A;  4LFC B;  5GW7 A;  1Q3E A;  2ZXW C;  4JI8 O;  2Y69 B;  3MDS A;  3RYF A;  2AXT Z;  1PNL A;  1WB8 A;  3OM3 B;  4MVU A;  4J9Z B;  1D5N A;  1YHQ V;  4ZVI A;  2CGN A;  2ZIN A;  2ZDX A;  4ABM A;  2HVK C;  5B1B C;  2WLI A;  3T1Y B;  2UUC O;  4DV3 O;  3RYH A;  4I50 A;  4YJ2 B;  3AG1 B;  5CA1 B;  1ZAU A;  4HYM A;  4URM A;  4GX0 A;  5FWK A;  3UO3 A;  4NVP A;  2O57 A;  5LYJ A;  2CAZ C;  3SPH A;  1BXD A;  1JA8 A;  1JFF A;  5BMV A;  1VIB A;  4UFZ A;  3NMQ A;  2XUM A;  3Q5L A;  2Q8F A;  1GTO A;  2BRE A;  2Q8G A;  4B6C A;  3EFF K;  3JAT B;  3DGE A;  2GFD A;  4KQV A;  2X6C A;  1WPX A;  4RQF A;  1VQ6 V;  2XX5 A;  3JAK A;  4MPC A;  5LHH A;  1AR1 B;  3QVN A;  4QGP A;  5EIB D;  3O65 A;  2WEP A;  4DV0 B;  4GT8 A;  2ZNJ A;  3WQ9 A;  2XHB A;  3SYQ A;  1Y4M A;  3VOU A;  1Y66 A;  2GUZ A;  4FLU A;  1L0N H;  1MX0 A;  1YES A;  4EFE A;  1V9P A;  1ZTE A;  2ZE8 A;  2WER A;  1GKZ A;  4FMT A;  4D7T A;  3CRL A;  2VRZ A;  4JI7 B;  4KSG A;  2LJ2 A;  1GK9 A;  3ZCC A;  4DK0 A;  1K4D C;  2D3O W;  2Z0A A;  2F95 B;  5DED A;  3KG2 A;  5DM6 V;  1KKC A;  1SZX A;  3HEK A;  5CBH A;  3U2D A;  3JSN A;  4MVQ A;  2R72 A;  3A0H Z;  1YJ9 V;  1YIT V;  4DK1 A;  1HNZ B;  2WA3 A; 
#chains in the Genus database with same CATH homology
 4YKY A;  4NH7 A;  3KE6 A;  4LWI A;  2CG9 A;  3T2S A;  3D2R A;  4URO A;  4CBC A;  5B1O A;  2EIM B;  4BW5 A;  2B1I A;  1JVM A;  4I9W A;  3CPW U;  1VQP V;  5BZB A;  2YGA A;  3TZ2 A;  2IU0 A;  1UYI A;  4LWG A;  3ABM C;  2YI5 A;  3LUT B;  1VQ7 V;  1S76 D;  2EZO A;  1AJ6 A;  3OGC C;  2QG2 A;  1R3K C;  1E1Q G;  3P30 A;  3CCL V;  3CWV A;  4FK5 C;  3W7S A;  2NNU A;  1I58 A;  1F51 A;  4H37 A;  1YC1 A;  2BU7 A;  1Y8O A;  2BYH A;  4MPE A;  4PRV A;  3BMY A;  3AG4 C;  3ETD A;  1M1K W;  2WSS G;  1IXM A;  5CBF A;  1UYH A;  2ZDI C;  4XKA A;  1ZXN A;  4AS9 A;  4JQL A;  5H6Q A;  3ZN0 A;  2YE2 A;  1ARO P;  5DN6 G;  1NKD A;  2YI7 A;  3FT8 A;  3FB8 C;  4JTD B;  4GT1 A;  1YSZ A;  1QLE C;  1UYF A;  1THZ A;  4MS2 A;  2JJ1 G;  5L3B A;  3OMA B;  1NH2 D;  2YEH A;  5IDJ A;  2BZ5 A;  3C0E A;  2BOC C;  5L3C A;  1R3L C;  1VQL V;  3B27 A;  3OWB A;  3RVZ A;  1Z5B A;  2EIJ C;  5CN0 A;  4NH8 A;  4WFB V;  3FV5 A;  4MP7 A;  5M4E A;  2Q68 A;  3RLQ A;  4AWP A;  2BU8 A;  3T2M A;  3ZRV A;  1K4C C;  2IOQ A;  4L91 A;  3T10 A;  3EHF A;  4YXW G;  1QLE B;  1M56 B;  3CCQ V;  2YKE A;  2XHR A;  1CEZ A;  2IOR A;  1BMF G;  3INW A;  3PEJ A;  2R9I A;  2YI6 A;  5FND A;  5GGZ A;  4DZY A;  5M4K A;  3T0H A;  1JPX A;  3JCZ A;  2YEA A;  3SPG A;  5CTX A;  4KFM A;  5KUM A;  1AJN A;  4FCQ A;  4YKU A;  4XTJ A;  4EFU A;  2IJH A;  1YT0 A;  1N8R W;  4URL A;  5BOD A;  1GKX A;  3GB7 C;  3CC2 V;  5F5R A;  2YEE A;  3BY6 A;  1K8A W;  1AI4 A;  3P32 A;  4MBC A;  4JPR A;  1EBO A;  3OR7 C;  3R4O A;  2XCM A;  3LNM B;  3T1C A;  4ASU G;  2LFR A;  5CBG A;  3IFX A;  5LGT A;  1AI6 A;  3NXS A;  1I5A A;  3JD2 A;  5IYD O;  4UV8 A;  2XK2 A;  2ZR2 A;  1H38 A;  1H7S A;  1ENV A;  1KZN A;  1FXH A;  4E2L A;  5CMU A;  3G6E V;  3OEH G;  4XBF A;  5D7D A;  3D0B A;  4PA6 A;  2JDI G;  4J9Y B;  2QE7 G;  4WUD A;  2XOK G;  4MW8 A;  5EC2 C;  4FPP A;  4MP2 A;  1GM7 A;  5EC1 C;  1QBZ A;  2V7Q G;  3ZMZ A;  1MG1 A;  2QG0 A;  3F7Y C;  2WI5 A;  4QJF B;  1GO3 F;  1RPR A;  4RUE A;  1KEC A;  4G2K A;  2P7T C;  1K5Q A;  2BSM A;  4LWH A;  3ABT A;  3UM7 A;  1Q82 W;  1PVG A;  3A0W A;  4DUH A;  4HXZ A;  3LPS A;  4QPJ A;  3CP1 A;  2HG1 A;  4BAY A;  4Q20 A;  3OFN G;  4RO2 A;  3HZ5 A;  4MB9 A;  3ZN1 A;  3RKZ A;  3RVY A;  1UYE A;  1TID A;  4MOT A;  4XDJ A;  4WF9 V;  3K08 A;  4HZ3 A;  1XL4 A;  5J6A A;  3WG7 C;  3G75 A;  1UY9 A;  4GX5 A;  3ZIA G;  2O1U A;  4YKW A;  4LWF A;  3UKM A;  1RM1 C;  1CP9 A;  1AMW A;  3G7B A;  4YKX A;  1Z59 A;  3H4L A;  3SL2 A;  1OSF A;  2BTZ A;  2WI6 A;  3K97 A;  1DLB A;  1XL6 A;  2VCI A;  5FNC A;  4HY6 A;  1EFR G;  4P2Z A;  1L1F A;  2YE4 A;  2FXS A;  2FTK A;  3R91 A;  3ABK C;  1A4H A;  4XKO A;  1H8H G;  3JD0 A;  4KUM A;  5E1A C;  4CE2 A;  2AHZ A;  1QY8 A;  3MD0 A;  3HYY A;  3JYC A;  2WPD G;  3HHU A;  4ZKI A;  4PEL A;  2WEQ A;  1OHH G;  3GIG A;  4ZBM A;  1MU5 A;  1TIL A;  1B3Q A;  5IYB O;  1UY7 A;  1FS0 G;  4MTF A;  3GWO A;  2Q8I A;  4LPB A;  2W0F C;  1FXK B;  5LBQ A;  4BXI A;  4EEH A;  2YE9 A;  3LDC A;  4LP8 A;  4EMV A;  3T0Z A;  4MVZ A;  4H7Q A;  3I55 V;  4KFG A;  1NH2 B;  1Y8N A;  4XIQ A;  3EHG A;  2EIN C;  1YI2 V;  4O04 A;  3ETG A;  2NLJ C;  3I56 V;  2O1V A;  5B1N A;  1G8M A;  3CCS V;  2WLK A;  4XIT A;  1QVG U;  4P9P A;  2Z5U A;  5IY5 B;  1L0O A;  5H6R A;  1SET A;  4EKW A;  1YJW V;  4UUJ C;  1UJW B;  1UY8 A;  4FCP A;  2X6B A;  4MVS A;  4BQG A;  4CWR A;  5IN9 A;  5L3D A;  1I5D A;  2YEJ A;  4QE9 A;  4L90 A;  1OCZ C;  3R4N A;  4HAM A;  2CGF A;  3E8G A;  3CC4 V;  2EBO A;  1QZR A;  2HCH A;  2XND G;  4EGH A;  2GHY A;  1E79 G;  1OCO C;  5B3S C;  3OMU A;  1H8E G;  2FWY A;  3G4S V;  3B24 A;  3Q5K A;  1K33 A;  1SZT A;  1V54 B;  4KTN A;  4UV9 A;  4CZZ A;  4PDV A;  4EGI A;  1HWY A;  5M4P A;  4R1F A;  3ZXQ A;  1FXV A;  3LDE A;  2OTL V;  2XJX A;  4X8A A;  1QR9 A;  3SYC A;  2YEV A;  3VHD A;  1AJQ A;  1ZXM A;  1ID0 A;  3OMN B;  2WI3 A;  3G71 V;  3A0R A;  1I5X A;  3FYE B;  1H2G A;  1F23 A;  3R4M A;  2WLL B;  1J95 A;  5HFM A;  4G28 B;  4HZ0 A;  1SER A;  4AWQ A;  1UY6 A;  1PNK A;  2HKO A;  3GIE A;  3FT5 A;  1MSW D;  2DYS C;  2Y69 C;  1PD3 A;  3B77 A;  3E2E A;  5LHG A;  4GCZ A;  2YI0 A;  3U2K A;  2PNR A;  1S5H C;  2QF6 A;  4WUC A;  2XJJ A;  3ASN C;  3ABL B;  4G27 B;  4HXW A;  4JYC A;  1Y8P A;  3T1K A;  2XAJ A;  4XDL A;  1NHJ A;  2M7W A;  5B1B B;  1H7U A;  4N21 A;  2IOP A;  1EA6 A;  3ZRW A;  4XE2 A;  5C93 A;  2P90 A;  4H85 A;  3R4P A;  2YK2 A;  3OE7 G;  3T4D A;  2YJX A;  1OCC C;  2EIK B;  3QO8 A;  4TWK A;  4BQJ A;  3O2F A;  3LSQ A;  3MHS C;  1OCO B;  1QCE A;  4RQE A;  2YK9 A;  3VBB A;  1YS3 A;  3TZ4 A;  4FJC C;  3FKS G;  1B63 A;  4L93 A;  2K1E A;  2C2A A;  1Q86 W;  2EZP A;  4F4L A;  3INX A;  2QM8 A;  1ZWI C;  1E1R G;  3ETE A;  3A0Y A;  2XAQ A;  4R3M A;  2JEU A;  2A9H A;  1JCH A;  4I5S A;  4PA4 A;  3AG3 C;  2VW5 A;  3F7V C;  4N23 A;  4R8C A;  3QDD A;  1TC6 A;  2YE7 A;  4HZ5 A;  3IC7 A;  2IJJ A;  1NQT A;  4FIP C;  4XKK A;  2XDK A;  1GJV A;  5M4N A;  3SYO A;  2Q2E B;  5D6Q A;  3ZMT A;  3ZRS A;  2YEG A;  5CTW A;  4GGL A;  4MTG A;  5IYC O;  3STL C;  3K9A A;  4FCR A;  2QEX V;  2WLH A;  1YIJ V;  2ZXW B;  3OWD A;  4L94 A;  2XAF A;  1K3E A;  2ZDI A;  3CME V;  1UYC A;  1TBW A;  2WLN A;  3ZRX A;  3D36 A;  1VQM V;  2XAG A;  2X0L A;  4JAS A;  1DF5 A;  2P67 A;  4MVM A;  4WCE V;  4UVB A;  2GQP A;  4WFG A;  1W2B U;  1FXK A;  1V55 C;  1UYK A;  1YET A;  3K03 A;  1MOF A;  2WI4 A;  2VWC A;  3LNU A;  5EBL C;  5H9C A;  5IY5 C;  1AI5 A;  3OPD A;  4W7T A;  2JKI A;  4JTC B;  4XCL A;  1R3I C;  3E8B A;  2JEX A;  2XDU A;  3OR6 C;  4UVA A;  3W7X A;  4MTO A;  4XIR A;  2EIN B;  2QM7 A;  2IJI A;  2DYR B;  3EHH A;  3E8F A;  4H33 A;  4CWS A;  2DQ0 A;  2X7R B;  3K0D A;  3K3W A;  2HLD G;  1EI1 A;  2F43 G;  4YKZ A;  4KP4 A;  1FXK C;  1DF4 A;  3E35 A;  2X6A A;  2ITD C;  1NBM G;  3TZ0 A;  3T4Z A;  4WFA V;  4Z1M G;  5L3G A;  3WG7 B;  4DXW A;  3ZMV A;  2H55 A;  4GFN A;  4H81 A;  1NR1 A;  3TZ5 A;  4E00 A;  5CF0 A;  3A0Z A;  3E86 A;  2W6I G;  4EM7 A;  4CWN A;  3U67 A;  2EXL A;  1ORQ C;  2YSU B;  4LBE C;  3ZJZ A;  2ESA A;  2H8M A;  2YKI A;  1I59 A;  2YEC A;  4YKR A;  2HJF C;  3E89 A;  1OCR B;  3QO7 A;  2CCU A;  1G4Y B;  2WI7 A;  2EIJ B;  1LNQ A;  4L8Z A;  2Z3Y A;  3D3I A;  3OEE G;  1OZ0 A;  5EBM C;  3O6O A;  2UXX A;  2DWD C;  4GX2 A;  1RM1 B;  4UXN A;  1VQ8 V;  2DWE C;  1UYL A;  2BU6 A;  2HKJ A;  1Y4U A;  4R3A A;  5KA5 A;  4I3H A;  3ZKD A;  4QPK A;  2WI1 A;  3E8H A;  3H01 A;  2YKC A;  1AI7 A;  3RLR A;  1K34 A;  2AHY A;  3E83 A;  3AG4 B;  4U93 A;  2WAM A;  5FNF A;  1YSR A;  3W7W A;  1NVP B;  4MSW C;  1KP3 A;  4R50 A;  2WWW A;  3MNR P;  4CE1 A;  1JJ2 U;  5FL7 G;  3IED A;  2JJC A;  2B5U A;  1OCR C;  3A0X A;  4ZVI A;  2XAH A;  2IW5 A;  3K79 A;  3AG2 B;  3ML0 A;  1BHB A;  2BU5 A;  1P7B A;  4WFH A;  4PU9 A;  4JAV A;  1NJI W;  1KKD A;  1I5B A;  2GSM B;  1TH8 A;  1U0Z A;  3FB7 C;  3BM9 A;  1YC4 A;  3EHJ A;  1P4R A;  5LGN A;  2HVJ C;  3ZM7 A;  3CCJ V;  1JX9 A;  1S0V A;  1M56 C;  4P30 A;  1TC0 A;  1KQS U;  2Q67 A;  2AKP A;  2Q8H A;  4MT8 A;  2IH1 C;  5EBW C;  4MTX A;  1GKF A;  3AG2 C;  4HYO A;  1Z5C A;  2YEF A;  2DW4 A;  1YSC A;  1JM6 A;  2Q69 A;  2XDX A;  4PDM A;  3CCM V;  2XHX A;  4L87 A;  4JYB A;  3ZRW B;  3CXC U;  2CCS A;  2WLM A;  1QYE A;  4CWF A;  4CWP A;  3K60 A;  1W0J G;  2HG5 C;  3B8N A;  3WHA A;  2EIM C;  5CTY A;  3HZ1 A;  4QE7 A;  1UYM A;  2IWX A;  3FYI B;  3H80 A;  1PNM A;  4YKT A;  4RAI A;  3W7T A;  2VCJ A;  1Q81 W;  1VQN V;  1VQK V;  3JZ3 A;  4KSH A;  4ASF A;  4NH9 A;  1GMG A;  4JF3 A;  2YGE A;  3AEI A;  4MVR A;  1COW G;  1R73 A;  2WLJ A;  2QA4 V;  2YED A;  2YKB A;  1KIJ A;  1UYD A;  4QIW F;  4LP0 A;  4WUB A;  4E02 A;  5HFL A;  3C11 A;  4U7N A;  2DYR C;  5LGU A;  4PL9 A;  1M90 W;  3ABU A;  1Q7Y W;  2WLL A;  3BEH A;  2UXN A;  4BIZ A;  3ABM B;  4WFF A;  3OW2 U;  1Z5A A;  3VAD A;  3WFV A;  4HY1 A;  3SJQ C;  1S3J A;  1AM1 A;  3JD4 A;  4P7A A;  3Q5J A;  3CMA V;  3OAA G;  1KD1 W;  4O09 A;  2XX2 A;  2KB1 A;  3HB3 B;  4EFT A;  3TET A;  1R62 A;  1ZW9 A;  5EK0 A;  3GIF A;  4PRX A;  4XC0 A;  3RBZ A;  4RUF A;  2Y48 A;  5LHI A;  5D6P A;  4TT3 G;  3CCR V;  5B1A B;  3SYA A;  3R92 A;  2IU3 A;  1S77 D;  3FB6 C;  1M9N A;  1UYG A;  4JGS A;  3B26 A;  3A0T A;  5M4M A;  4LCU C;  1MAB G;  1DTO A;  1K73 W;  2ZD9 A;  3OUS A;  4V25 A;  2JJ2 G;  1QR8 A;  5L3F A;  1AJP A;  4DO2 A;  3CCE V;  1AH8 A;  1S16 A;  1YC3 A;  3CGZ A;  3RLP A;  4MPN A;  5F3K A;  3CCV V;  5M4H A;  3SYP A;  4LWE A;  3ZMU A;  1V55 B;  3DTU B;  4X9L A;  3QO5 A;  1NVP D;  4CWO A;  2XHT A;  3ABL C;  2B1G A;  2XAS A;  2CK3 G;  3ASN B;  4P9O A;  5GW7 A;  2ZXW C;  4R7C A;  2YEB A;  3SPC A;  2Q6A A;  2Y69 B;  1QLN A;  2BT0 A;  3LSS A;  2BU2 A;  3SPI A;  1PNL A;  2EIL C;  3JD1 A;  3OM3 B;  4MVU A;  1VQO V;  5J71 A;  1EZJ A;  3ASO B;  3K04 A;  3PJS K;  2A0L A;  4J9Z B;  1YHQ V;  3VHA A;  4B7P A;  2PI5 A;  3K06 A;  3CD6 V;  2OTJ V;  2IH3 C;  2OT5 A;  3QNE A;  3CGY A;  3K98 A;  4X88 A;  2ZDX A;  2HVK C;  2BRC A;  2WLI B;  5B1B C;  3AG3 B;  1BGQ A;  2E0A A;  4OXS A;  2WLI A;  1M57 C;  1V54 C;  3X2Q C;  2OCC B;  2XX4 A;  5CTU A;  1RPO A;  2W6J G;  4K4O A;  3AG1 B;  1NR7 A;  3OUF A;  3HPL C;  4U7O A;  2YKJ A;  4HYM A;  4XCJ A;  4URM A;  2HFE C;  1S72 V;  2ZKJ A;  4XD8 A;  2QTO A;  2K5B A;  4XDK A;  1VQ4 V;  2EJR A;  4GX0 A;  5FWK A;  1OCC B;  2EIK C;  1WLE A;  2QKS A;  3W7U A;  3B25 A;  4ASB A;  4TSF G;  1BHA A;  1THN A;  2OCC C;  3SPH A;  3CC7 V;  5L3J A;  3X2Q B;  1BXD A;  1VQ5 V;  2XDS A;  1YTF D;  3QTF A;  1K5S A;  3O0I A;  4GQT A;  4O07 A;  3NMQ A;  4XIP A;  2YEV B;  2MK3 A;  3Q5L A;  1W0K G;  4XDM A;  2Q8F A;  1GTO A;  1FFT B;  1U2O A;  2BRE A;  2Q8G A;  4B6C A;  3EFF K;  5CA3 A;  2YE3 A;  3DGE A;  2GFD A;  5B3S B;  4E01 A;  4KQV A;  2BOB C;  2X6C A;  3IGA C;  1BYQ A;  1WPX A;  3EHB B;  2FYP A;  1R6K A;  3M99 B;  4JTA B;  4PA3 A;  2O1W A;  1TUE B;  3K99 A;  4RQF A;  2LFS A;  3OW6 A;  1QVF U;  1VQ6 V;  2XX5 A;  3PEH A;  4O05 A;  4V26 A;  2YGF A;  2IJK A;  2ATK C;  3ZXO A;  4MPC A;  3OMI B;  5LHH A;  1AR1 B;  4MVO A;  2XJG A;  3VHC A;  5KUK A;  1VQ9 V;  2UWD A;  4GX1 A;  2WEP A;  5D7R A;  4QNH B;  1PL0 A;  2HR3 A;  4BIU A;  4GT8 A;  1R3J C;  4AWO A;  1PKX A;  2DQ3 A;  1S14 A;  2JIZ G;  2YE8 A;  3WQ9 A;  2H94 A;  1ROP A;  3TUH A;  2EIL B;  2ZBK B;  3SYQ A;  4ASG A;  2DYS B;  2XDL A;  5CPH A;  4PA9 A;  2XAB A;  2YEI A;  4PDR A;  2YE5 A;  2ZDY A;  3TCU A;  5D7C A;  3JD3 A;  4MW3 A;  1KP2 A;  1Y4M A;  3AG1 C;  1AH6 A;  4PDL A;  3CCU V;  3VOU A;  1Y66 A;  2YE6 A;  3TTZ A;  4R6Z A;  1K7D A;  2R9R B;  1JQ0 A;  1M57 B;  1MX0 A;  1US7 A;  3K0G A;  2YJW A;  1Y4S A;  2ZQM A;  2H8P C;  2ZR3 A;  1BKN A;  1ZWH A;  1K92 A;  1YES A;  3EKO A;  3EKR A;  1K97 A;  1YER A;  1B62 A;  2WI2 A;  2P6J A;  4PA7 A;  1BL8 A;  3ASO C;  3CYO A;  2WER A;  3RW0 A;  2IWS A;  1K9M W;  1GKZ A;  1B6Q A;  2QFO A;  4FMT A;  1GM8 A;  3CRL A;  2CH4 A;  4JAU A;  1GM9 A;  2CCT A;  4ASA A;  3LDD A;  5KA6 A;  1NHH A;  3GIG B;  4KSG A;  1OCZ B;  1GK9 A;  3TK1 A;  3ZCC A;  1YT1 A;  4YKQ A;  4CE3 A;  1K4D C;  4X89 A;  1KC8 W;  1JOY A;  2D3O W;  2XD6 A;  3CRK A;  4EGK A;  4URN A;  3F5W C;  3KG2 A;  3R65 A;  5DM6 V;  3HYZ A;  5BOC A;  4CWQ A;  3FB5 C;  1I5C A;  1R6N A;  5J9P C;  3HEK A;  5CBH A;  2BYI A;  3U2D A;  5L3E A;  4O0B A;  1SRY A;  3ZKB A;  4BAE A;  5IDM A;  4UVC A;  3SPJ A;  2PI4 A;  1I5Y A;  4P8O A;  3STZ C;  2A79 B;  2JK5 C;  3ABK B;  3B8M A;  4MVQ A;  1YTF B;  1YT2 A;  3G7E A;  4GEE A;  4CWT A;  3ZMS A;  1SES A;  1CPY A;  2IWU A;  2LP7 A;  4WFE A;  4HYP A;  1YJN V;  2V1D A;  5B1A C;  3MHH C;  1YJ9 V;  1YIT V;  2FWZ A;  4LC1 A;  3B28 A;  2ITC C;  1F4N A;  1F4M A;  1NHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...