2C2AA

Structure of the entire cytoplasmic portion of a sensor histidine kinase protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
240
Chain Sequence
b'MENVTESKELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENSOR HISTIDINE KINASE
publication title Structure of the Entire Cytoplasmic Portion of a Sensor Histidine-Kinase Protein.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 81
structure length 240
sequence length 249
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2c2aA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2c2aA02
2K5BA 2WI1A 2YEGA 5IN9A 2XHRA 1UYHA 4KSGA 4CWRA 1I5AA 5CTYA 4GT1A 2QM8A 4LP0A 2YE7A 4L93A 2YKJA 2C2AA 3FT5A 4I3HA 2AKPA 4PU9A 4ASGA 2O1VA 1YESA 2YI5A 2CCSA 5CPHA 2WEQA 4QPKA 1MU5A 3LPSA 3OWDA 4HY6A 3ZCCA 4E02A 1OSFA 3MD0A 4MTXA 4MPEA 4XTJA 3PEHA 2QG0A 2HKJA 2Q8IA 4YKRA 4MBCA 3RKZA 2XJXA 4JAVA 3QDDA 2YKCA 1U2OA 5C93A 3A0ZA 4ASBA 3ZKBA 4HXZA 4EEHA 2IWXA 4ZKIA 3ZKDA 2JKIA 1YT0A 4CWOA 4O04A 2YKEA 3ZRVA 2YI6A 2H8MA 4FCPA 4X9LA 5FNCA 2Q8GA 1U0ZA 2ZBKB 2WI2A 2BTZA 4MP2A 4MPCA 5D6PA 5FNDA 1UY9A 3A0RA 4YKYA 2YKBA 4YKWA 4H81A 2Q8FA 3RLPA 3K97A 3R92A 2YGFA 3TTZA 2ESAA 4PRXA 1YC4A 2BU8A 4CWQA 4XIRA 4KSHA 3ZRXA 2YJXA 4YKTA 3A0WA 2BZ5A 1I5CA 1Y4UA 4L8ZA 1Z5AA 2IOQA 4CE3A 4DUHA 3GIFA 4URLA 5M4PA 3B25A 2PNRA 5D6QA 2YEHA 4BQGA 3LNUA 1GKXA 5FWKA 3NMQA 1ZW9A 3TZ4A 4CWFA 3B28A 3KE6A 3Q5KA 5J71A 3PEJA 5L3JA 1THNA 2CH4A 2WI5A 5D7RA 4LC1A 4URMA 4V26A 4WUDA 2VCJA 4XCLA 3C0EA 1B3QA 4ASAA 2BREA 2WI4A 4JAUA 2XDKA 2XDUA 2YE6A 4CWPA 2YI7A 4QPJA 4JQLA 3VHCA 3TZ5A 2BU5A 2CGFA 1YS3A 1UYCA 1QYEA 3A0XA 2LFSA 5CTWA 1ZXMA 2QM7A 5B1NA 1TH8A 4CWSA 2YECA 2BYHA 3A0YA 3T1KA 1YC3A 4LWIA 4HY1A 3IEDA 2XDSA 3ZXQA 2O1WA 1I5BA 2BSMA 4U93A 1QY8A 3TK1A 2BYIA 4ZVIA 5IDMA 4XKOA 3D2RA 1S14A 1S16A 4XD8A 4U7OA 1YSZA 4L94A 4L90A 3B26A 1ZXNA 3NXSA 1AH8A 4Q20A 4LWFA 4B7PA 1PVGA 2YEFA 1BYQA 4R3AA 4E00A 3O2FA 2WI7A 4EGKA 2VWCA 2FXSA 2XABA 1TC6A 2FTKA 4GFNA 1UY7A 1QZRA 1UYMA 3FT8A 3CGYA 3GIGA 4KFGA 4BIZA 4FPPA 2XHXA 4FCQA 5FNFA 3T0ZA 1F51A 4FCRA 4NH9A 3HYZA 2YKIA 3O0IA 4H7QA 3ZRWA 2UWDA 3OWBA 4AS9A 4GT8A 4AWOA 3WQ9A 2YE5A 4AWQA 2BT0A 1UYEA 4XKKA 2YE8A 3WHAA 3G75A 3OMUA 4MOTA 4HYMA 4P8OA 1I59A 1ZWHA 3EHGA 2WI3A 1H7UA 2ZDXA 3EHHA 3HEKA 4XIQA 2YK2A 4MP7A 1Z5BA 1YETA 4CE2A 4YKZA 4BQJA 3SL2A 3D36A 1BGQA 3HYYA 1L0OA 5IDJA 3TZ2A 3FV5A 3VADA 3HZ5A 2WEPA 4MT8A 1NHIA 5M4NA 3OPDA 5BODA 3Q5LA 4XIPA 4BAEA 3TZ0A 1JOYA 4HZ5A 2P67A 3R4MA 5D7CA 1AJ6A 2YEDA 5CF0A 4CWTA 1I5DA 3P32A 4EFUA 4E01A 3U67A 3CWVA 1UYFA 5M4HA 1YT1A 1A4HA 2XX4A 4YKXA 3A0TA 5CTUA 4AWPA 3INXA 2IWSA 3T2SA 3EHJA 1NHHA 2YGEA 1Z59A 3U2DA 2BU6A 2BU2A 1GKZA 4NH7A 4LWHA 3CGZA 2CCTA 2YK9A 4L91A 3B24A 4MPNA 5BOCA 2BU7A 2WWWA 4XCJA 3K60A 3MNRP 2QF6A 2FWZA 5CTXA 3T0HA 5J6AA 3Q5JA 3ZXOA 2IWUA 2HCHA 4HZ0A 1UYGA 2XHTA 4UROA 2FYPA 3D0BA 4LWEA 2GFDA 1EI1A 4XKAA 3JZ3A 4FMTA 1KIJA 2O1UA 4O0BA 4EFTA 2YEEA 3H80A 3R91A 4H85A 1NHJA 3B27A 1AMWA 4O07A 2YJWA 1YERA 1YSRA 4KQVA 3G7BA 1UY8A 2YEIA 4K4OA 2QFOA 3OW6A 1B63A 4BXIA 4U7NA 4NH8A 2VW5A 3INWA 4JASA 4LWGA 3RLRA 3T10A 2YEJA 3R4PA 1Y8PA 4O09A 3TUHA 3ZM7A 2XJGA 2HG1A 1AM1A 1KZNA 1Y8OA 1UYLA 4ASFA 2VCIA 2XX2A 1H7SA 2XX5A 4XITA 1BXDA 3HZ1A 4JYCA 4KP4A 4EGIA 2JJCA 1YC1A 4HXWA 3K98A 4GEEA 3CRLA 2YE2A 5F5RA 2ZKJA 4WUCA 4XDMA 2FWYA 2GQPA 1AH6A 2BRCA 5D7DA 3VHDA 4EGHA 1BKNA 3O6OA 1Y4SA 1UYDA 4URNA 3R4OA 3DGEA 1EA6A 3H4LA 2CCUA 4CWNA 4DZYA 1YT2A 2EXLA 4R3MA 4YKQA 1UY6A 4JYBA 1US7A 3EHFA 1ID0A 2XDLA 3GIEA 4R1FA 2XD6A 3QTFA 2XDXA 4O05A 3BMYA 1JM6A 4MB9A 2CG9A 2ZDYA 2XJJA 3BM9A 4V25A 3RLQA 2IORA 1TILA 1TIDA 1R62A 2YE3A 1Y8NA 4XC0A 3HHUA 2YEBA 3K99A 1Z5CA 3GIGB 5GGZA 4EMVA 3U2KA 2E0AA 4GQTA 2WI6A 3EKOA 2YEAA 2XK2A 4B6CA 3ZRWB 2WERA 2H55A 4XE2A 1IXMA 4W7TA 2LFRA 4WUBA 2YE4A 2XCMA 3VHAA 3G7EA 4GCZA 2Q2EB 5M4KA 4EM7A 3EKRA 5F3KA 3C11A 1I58A 1TBWA 4PL9A 4BIUA 1B62A 3CRKA 2YI0A 4GGLA 2Q8HA 4YKUA 2IOPA 1GJVA 1MX0A 4KTNA 1UYIA 2YE9A 5B1OA 4P7AA 5M4MA 4CE1A 2QG2A 4HYPA 3R4NA 4I5SA 2YGAA 4PRVA 1UYKA 5M4EA 1TC0A 4LPBA
chains in the Genus database with same CATH superfamily
4B3TO 4DV3O 2KQXA 1Q8IA 2XASA 3R65A 4KSGA 1I5AA 4UB8Z 3CCLV 2UXDO 5LA6A 2BCCH 2ZE7A 2C2AA 4QGPA 4RQFA 4GKJB 4GZRB 3RYFB 4ASGA 4DRXB 4J7KA 4YJ2A 2GSMB 5CA3A 2PY5A 1KMIZ 3IC9A 5JVDB 1YESA 4MW3A 3E83A 5E79Z 3BFRA 4QPKA 1MU5A 1XUQA 2DOSA 2OCCB 2CGOA 3L73H 3OMAB 2D2CB 2ILMA 2GTSA 2ADQB 2Y4UA 4L8JA 1GMGA 4WF9V 4R7CA 3K0GA 4ICGA 4LF8B 1Q6HA 4IHJA 2HKJA 2Q8IA 4MBCA 1NT2B 4JAVA 4P9PA 5IJ9A 3JARA 2WLLB 3JAMN 3B77A 1LUWA 1G8MA 4HXZA 2EIKB 5DEDA 4FLVA 3OM3B 2A7WA 4LF7B 1GN2A 5CBGA 4O04A 3OR6C 4JV5B 3ZRVA 1R6KA 4CH4A 2HG5C 2BTQA 3FFQA 4JYAO 2YI6A 1WB8A 1YDXA 2YUAA 4X9LA 2Q8GA 2LJ2A 2M6YA 2BTZA 3D3QA 4FM1A 5D6PA 5FNDA 5IWAO 2EINC 1Y76A 2YKBA 4JAAA 4YKWA 4H81A 2Q8FA 4X9QA 2BSKB 1CPYA 3K97A 2CTWA 3CS5A 4CS2A 3TTZA 1BGYH 3K5LA 3NR7A 3ABLC 2IJJA 4O2AB 4PA3A 2QWRB 3RW0A 4KSHA 1U97A 4Q6GA 4YJ3B 4DV4B 1YEWA 1JVMA 1Z5AA 3ETEA 4L8ZA 1TUEB 2YIDA 2IOQA 5J2TA 4FM2A 4B3MB 4URLA 5M4PA 5D5PA 4NKGB 3RYCB 2PNRA 1M4UA 3JD2A 2DYRB 4U3FH 4EB6B 3JALB 2QSAA 3TZ4A 4PJ0Z 3RYHB 3B28A 1VQ4V 5J71A 1JPXA 1S5JA 2YI9A 2WI5A 5JQGB 4URMA 2VCJA 1B3QA 4ASAA 1S5HC 4JAUA 1KP2A 2XDUA 4CWPA 4ZOLB 2YI7A 5L3CA 2ZDIA 2QWNB 2JRIA 4WBNA 3VHCA 4X20A 2EIMC 2LO1A 4J10A 4TV9A 1VQMV 1N36O 4CH5A 1YS3A 3DXRA 5CTWA 5B1NA 1M5IA 2BYHA 1Q90D 3FKSG 4LWIA 2IJIA 3ZMVA 5EBMC 3ZXQA 2O1WA 3T4ZA 4RQEA 4O4IB 1OCOC 3OUSA 2K9PA 5AG2A 4YIPA 4EFEA 2BSMA 2VQFO 2YIAA 2BYIA 3X2QC 4YHHB 2Y69C 1K34A 5CMUA 4FLWA 4FZ0A 4XD8A 5CBHA 5C8YA 4DV2B 1DTOA 3P30A 5KHIA 1MOFA 2UUAO 2ZNIA 4EFBA 4B7PA 3JATB 3LDCA 2ZM6O 2AZ2A 3TGUH 4EGKA 4DR3B 1TC6A 3RFRA 2FTKA 1QZRA 1UYMA 1URFA 4WFHA 4I0XB 4UV8A 5TISZ 4B3TB 4DV3B 1H8HG 4FPPA 4NTXA 2JEXA 4JI5O 4R6ZA 2X6CA 5L3GA 1NI8A 3SGIA 4DV6O 5FNFA 3WB2A 3T0ZA 3FAVB 2WLMA 1S5LZ 2EJRA 3B09A 2R72A 3HYZA 3CRAA 2Q0OC 4IT5A 3OWBA 2QEXV 1XREA 4H13B 2F66C 4AWOA 3QNEA 3SYOA 2V4DA 4CS3A 2YE5A 2ADPA 2Q9LA 1HP8A 5LP6C 3W7WA 3OMUA 3ZJZA 3ASOB 1VQ6V 4WFBV 3WG7C 3HEKA 5CB4A 2XAFA 4DXWA 2PZSA 3I56V 4TT3G 4CE2A 4DV0O 4BQJA 4CC6A 2Q0AA 2YC0A 3SPGA 3HZ5A 4DK1A 5FPOA 4O4LB 3JAKA 2QE7G 1LNQA 4R50A 3SPHA 5BZBA 4IL6Z 4DR6B 3Q5LA 4XIPA 4GKKB 2HEPA 2LP7A 3B40A 2P67A 3R4MA 4JYAB 3ABKB 2QKAA 3RYFA 3AG1C 3WB1A 4DRXA 4TUYB 2RQ6A 2XX4A 4FLYA 2JJ1G 5KHGA 3A0TA 3CRQA 4AWPA 5LMUO 1IDSA 3EHJA 2YGEA 3JD4A 1AI6A 4FLZA 2BU2A 5EZYB 1GKZA 3OAAG 3T1HO 1FFXB 3CCRV 3B24A 1ZAUA 5BOCA 1P7BA 2LW7A 3MNRP 3A0BZ 3IC7A 4UB6Z 3T0HA 5J6AA 3UT5B 2IWUA 1VQPV 1GN6A 2WLLA 4UCRA 2YS8A 1WPXA 4UROA 2FYPA 1EBOA 4DR2B 1ZUQA 1KBHA 3GVMA 3JZ3A 1SERA 2F1MA 4NXNO 4FMTA 1KIJA 5LHIA 2O1UA 3N27A 1VF5B 3E8GA 4LWSB 3A2FA 4AHCA 5KX5B 4UUJC 4FFKA 1X4TA 2HP8A 1K5QA 4TV8B 5JJNB 2XAJA 1NHJA 2P5OA 1YSRA 3CX5F 3FB5C 4BW5A 5JH7B 1AI7A 1N0NA 3SJAC 1Q43A 2YEIA 1I5XA 2Z5UA 4K4OA 2QFOA 2BSKA 1B06A 3CCSV 2OYQA 2E75B 4O2AA 4X89A 1VQ5V 2JGDB 3R4PA 2GDSA 1VQLV 4RUEA 1XI1A 4DYLA 1Y8OA 3K57A 1Z5VA 2VCIA 4MS2A 4YJ3A 4X8AA 3ZHRA 1R3KC 4DR5O 2OWOA 2KG7A 2P4VA 4HXWA 1VEWA 4FJCC 3K06A 1SZTA 3F7YC 3RYCA 1PD3A 3BA9A 1ZTEA 2W6IG 4BAYA 1HW7A 1GN4A 4DR1O 3JALA 4EGHA 1BKNA 2EINB 1UYDA 1Y4SA 1AI4A 3RYHA 3MHHC 4CC5A 1YIJV 3R4OA 1DGSA 5LA6B 3H4LA 2P06A 3LNMB 3LSQA 1XBLA 2P6JA 4YJ2B 3ABLB 3EHFA 4LF5B 3GIEA 3B4SA 4OXSA 5B3SC 4ZOLA 2XDXA 3AG3C 3BMYA 2HFEC 1NH2D 2UXNA 5LL6Y 4KHPB 2N04A 5CBFA 2XJJA 3RLQA 1Z2GA 1Y8NA 3QO5A 4XC0A 3HHUA 1YJNV 1IZ3A 4ZHQA 4IHJB 4O4IA 3K99A 1IXBA 3OTOO 2R70A 3ML0A 4HYOA 5GGZA 1KB9F 4X62B 4BR6A 4TWKA 2VWKA 3P3NA 1VQOV 5LMNO 1KYOF 2IM9A 4JI1B 2YIBA 1R6NA 1M1KW 2EIMB 3AG2C 4I7ZB 4XE2A 1IXMA 2BTQB 2JIZG 2ZNJA 1L0LH 4LF4O 1FS0G 4R8CA 4DV0B 3EKRA 1Z5WA 2Y0IA 1CP9A 1RPOA 3H1LH 4DW0A 2D3OW 1YVWA 1MMMA 5BR8O 1K3EA 1MA1A 4I0XA 4UCVA 3E8BA 1OCOB 4EKWA 4BIUA 4ZI7B 4PL9A 3CRKA 4RAIA 1ROPA 4H44B 4JYYA 1BQZA 4DV1O 1KKDA 4KTNA 3X2QB 2Y69B 1PV0A 3JD1A 1A32A 2QG2A 5GTIZ 2BOBC 3R4NA 2HKOA 1UYKA 4LPBA 1NZ6A 4L87A 2WI1A 2YEGA 4N23A 1UYHA 5J2TB 1HR0B 1NR1A 3ABUA 5CTYA 3L74H 3K08A 4LP0A 3T1HB 3K9SA 4L93A 2YKJA 4PU9A 1I0HA 5EBLC 1IBKB 4NR1A 3KZIZ 5EK0A 1ZL8B 4UCTA 4JI7O 2YI5A 3KG2A 4YY3B 1CXZB 1L1FA 3DSQA 2WEQA 4BIOA 3LPSA 2GHYA 2P4KA 3OWDA 3UM7A 3JSLA 3QF7A 1TVKB 4E02A 3E8HA 4FLXA 1OSFA 3ZMSA 4O4LA 3MD0A 4X20B 4RWUA 5JENA 4DV7O 3BAAA 1SQVH 4MPEA 1M56C 2ZIMA 2E5LO 5LP6B 3QDDA 1WPBA 1U2OA 1IBMB 4ASBA 3K3WA 4MVQA 3LDDA 2YICA 2YIBD 3WG7B 1R3JC 4JI0O 2E3CA 1VP7A 2IWXA 2E76B 5LBQA 1FD9A 1K9MW 4ZKIA 1Y4MA 3BEHA 1YT0A 1GTOA 2Q5ZA 4CWOA 2YKEA 3TXQA 1YJWV 1FFXA 1I7FA 3CXHF 5C8YB 4FCPA 2F23A 2ZBKB 5JWPA 4JI8O 1H2GA 2G38A 2MK3A 3UT5A 3WB0A 4DR5B 4YKYA 5LHHA 1GRJA 4ASUG 3AG1B 1HNWB 4FM0A 2FKXA 4PRXA 2BU8A 4CWQA 1S76D 1Q81W 4LF6O 4B7KA 2Q4PA 1D5AA 1OCCC 4J41A 4DV5B 4PDMA 4LWSA 5KX5A 2A79B 4B3SO 4TV8A 1D2DA 1V54C 1NKDA 4GYCB 2OIGA 4DUHA 5JH7A 2ZR3A 3EHBB 4PELA 2YEHA 3LNUA 1GKXA 1GKFA 3PN1A 1VQ8V 3ETDA 2NNUA 1ZW9A 4CWFA 1FXHA 3SYPA 1SQGA 1THNA 2GUZA 2IJKA 2JGDA 1SQFA 3HPLC 2Q69A 4WUDA 1BQ0A 5CB4B 2RMKB 2P7TC 4PA4A 2XDKA 3OMNB 1BL8A 5KHJA 4MTGA 2BU5A 1ZXMA 2QM7A 1EZVH 4MTFA 5LMNB 3T1KA 1KU9A 1D5NA 2WLNA 2AHZA 1E1QG 3HKCB 2P90A 1BS3A 1I5BA 5BMVB 4U93A 4JTDB 3TK1A 1IURA 3L70H 4E72A 3BCCH 2ZQMA 3CRRA 3OUFA 3D3IA 3D36C 3D2RA 1S14A 1MABG 1YSZA 4L94A 3EVKA 2UUCO 1WAZA 1JX9A 4L90A 1R73A 3CSXA 4DV1B 1ZXNA 3HB3B 1AH8A 1PVGA 1I5YA 1TAEA 1BYQA 3U10A 3O2FA 4TQFA 1UPGA 2EIJC 4CZZA 2XABA 5H9CA 1NH2B 2O57A 2OT5A 3FT8A 5K1XA 3K58A 4KFGA 4BIZA 1SF9A 4I55A 1KQSU 5LYJB 3RGBA 1OHHG 3QG5A 1F4MA 5B3SB 2ZE5A 3GWKC 3AG3B 3I55V 4AS9A 4JZ2A 2PGGA 4KXRA 3H01A 3WQ9A 2DWDC 2B1GA 2YE8A 3WHAA 1K7DA 3UQ8A 4GX1A 4HYMA 5CN0A 4BW9A 5DN6G 4ZI7A 5JCOA 1F7YA 3CCMV 3EHGA 4DV7B 2ZDXA 2HVJC 2HJFC 2CTRA 4DW1A 4XIQA 2E5LB 2OTJV 5B66Z 2BOCC 1Z5BA 1E1RG 2RNBA 4ABMA 4LBEC 3G6BA 2X6AA 4YKZA 1AROP 3HKEB 3FV5A 2F4VB 1ZSPA 3A0HZ 4BWAA 2KG7B 3AG2B 1VQ9V 3E35A 2Z0AA 3MHSC 5E1AC 4W4LA 5D7CA 4HZ5A 3K79A 1AJ6A 2YEDA 5CF0A 5GONB 1QBZA 3U67A 3FYIB 1UYFA 1UFIA 1ZL8A 4JI8B 4YKXA 3IAYA 1J5EB 3MAQA 3QO8A 2IWSA 2JS3A 2QDOA 3T2SA 1NHHA 1Z59A 3U2DA 2BU6A 1OCZC 4NH7A 1OZ0A 3SPJA 1TVKA 3W7SA 3S5TA 4MW8A 2YK9A 2OTLV 4MPNA 3AK2A 4LF6B 2WWWA 3GWOA 3K60A 2FWZA 1QU7A 5LP6A 2QTSA 2PUSA 4ZHQB 1F4NA 2EZOA 4LFAO 2UXXA 5JCOC 2DWEC 4P9OA 3QO7A 4LWEA 2GFDA 2RCVA 4XKAA 2XTAA 5H6QA 3QTCA 5HFMA 1JR9A 4XDLA 1MSDA 2VS0A 3OGIB 4EFTA 3H80A 3CE2A 3CRCA 4H85A 1SQXH 3ZN0A 2Y48A 3HKBB 4O07A 4J9ZB 1YERA 4KQVA 3BHPA 1YTFD 4GX0A 1M56B 5FPRA 3OW6A 1XOUA 1B63A 2N05A 4JF3A 4NH8A 4CBCA 3K59A 2XAQA 3IFXA 5J2UA 3RLRA 2YEJA 4DUYB 4O09A 3TUHA 3ZHUA 5KHKA 2XJGA 2YXYA 5H6RA 2KKWA 3RVZA 2HG1A 4O2BB 1AM1A 2JDIG 1KZNA 1UYLA 4ASFA 2UXDB 2XX2A 1H7SA 3S3XA 4KP4A 3HZ1A 2GBOA 1MSWD 1YC1A 2JVDA 2YE2A 4O4HB 4B3RO 2BRCA 1RFYA 3VHDA 1W0KG 4ZIBA 4URNA 2X0LA 4H37A 2CCUA 1PM9A 2BE3A 3UKMA 1YT2A 4DZYA 4YKQA 4HAMA 2XUMA 1XQ8A 1PNMA 2XDLA 1N8RW 2CK3G 3H1IH 4R1FA 5CA0B 4F4LA 3QTFA 1OCCB 4CH3A 4WFEA 2DQ3A 1H2SB 3BPZA 1JM6A 1XHXA 4MB9A 2N74A 5A2QN 3CMEV 5CA1B 1Q82W 1YITV 1WB7A 3BM9A 4V25A 3OT7A 1V54B 2AXTZ 1TIDA 4TOIA 1R62A 2YE3A 2XT9A 1ZWIC 1AP6A 4JPRA 2ITCC 3HKCA 2Q7EA 3EFFK 4I9QA 1FPOA 1J95A 3D8CA 1TGOA 2H94A 1RP3B 5BMVA 3GIGB 1SS3A 3E89A 4X65O 3U2KA 2E0AA 1LUVA 4GQTA 4B08A 4X64O 2WI6A 3FB7C 5IWAB 3TJTA 1XMOO 2XK2A 4LF9O 4DR7O 4QE7A 1QR9A 1N32O 1K92A 4KUMA 3ZRWB 1SA0B 4E4EA 1BT8A 3LSSA 4W7TA 4WUBA 2XCMA 1Y6XA 4GCZA 1YHQV 5M4KA 2Z3YA 4F6RA 4EM7A 2VQEO 4C7UA 1FJGO 1G4YB 4XDJA 2CDYA 4GGLA 2Q8HA 1DF5A 4YKUA 1QLEC 4J9YB 4UCUA 1GJVA 1WA8B 5LYJA 2WA3A 5B1OA 3CC4V 1VF6C 1IBLO 2YGAA 1AVMA 5KA5A 4PRVA 1O9GA 2RDCA 4PA6A 4PI0A 2K5BA 4DUZO 3S3WA 3TETA 1M90W 5KA6A 5IN9A 4CWRA 4DO2A 1WP8A 4Z1VA 2ZIOA 2QM4A 2QM8A 3SJBC 2DE0X 3SJCC 2YE7A 2EIJB 1XNQO 4I3HA 2AKPA 4UVBA 4JTCB 1N36B 1G1XB 3HKDB 2CCSA 1US6A 2GUZB 2B1IA 3LSUA 4AQYO 5CPHA 3EXAA 2QWPB 4NXMO 3HKEA 3TXSA 3ZCCA 4LFAB 3AK1A 1NTZH 2VQFB 2P22C 2QJ1A 4MTXA 3K03A 4XTJA 2DQ0A 2QG0A 4UV9A 1R3IC 4YKRA 4NTWA 5GONA 1P7GA 3H1KH 5C93A 3A0ZA 4PI2A 3OTFA 3ABMC 1H2MA 5H5NA 2UUAB 4EEHA 2R9AA 4PDRA 2V7QG 1X59A 3N2GB 2Q73A 4I50B 2ZM6B 3CYGA 2WLIA 2JKIA 2AGAA 3T1CA 1JFFB 2DYSC 1RPRA 2EULA 1GM7A 1S72V 2C1GA 2ZE6A 2UXCO 1HNXO 5L3BA 4OGQB 4X66O 5FNCA 4JI5B 3ZRSA 3AEIA 2WI2A 5FNVA 4MP2A 4DV6B 4MPCA 1UY9A 3Q4HB 1EZJA 2IU0A 3RLPA 2RJZA 1I08A 3FD9A 4FLTA 2Y4TA 4EEQA 2ESAA 4XIRA 4I55B 1XHZA 4YKTA 3A0WA 3T1YO 2BZ5A 1I5CA 1OCZB 3R66A 1ENVA 5KMGB 4CE3A 4K35A 3HKBA 1KC8W 2QTOA 3GIFA 1B6QA 4JI6O 3VQWA 5D6QA 1V55C 4BQGA 5FWKA 2IU3A 3DTUB 3M7MX 3NMQA 3B2EE 1AR4A 1SESA 5EBWC 3Q5KA 1BMFG 2VWJA 3PEJA 4NB5A 2CH4A 2CUGA 1YTFB 4O2BA 2WI4A 1QHTA 1ZX3A 1SETA 2YE6A 2YSUB 3CJHA 3CXCU 2QGNA 4QPJA 4JQLA 3T2MA 1W59A 3CCEV 2DW4A 1N0JA 2WA4A 4X65B 3CC2V 3VQYA 3A0XA 1UYCA 3FB6C 2LFSA 4UXNA 4X64B 1IX9A 3BA8A 1JJOA 4O4HA 3WU2Z 1TH8A 4CWSA 5LMUB 1XEQA 2YECA 3OW2U 1YCIA 2H8PC 1YC3A 2L35A 4HY1A 3E8FA 3RN4A 4UCOA 2XDSA 1SQPH 2JS5A 4KL1A 4X88A 1QY8A 4UFZA 1BE3H 5LOVA 2PF4E 4JI4O 4ZVIA 3ASNC 4CH6A 4LF8O 5IDMA 2VQEB 5CA0A 1FXKC 5D5QA 4K0KO 1Q7YW 3ZHSA 3B8NA 1B04A 5LGTA 1S16A 4U7OA 2B5UA 2QR4A 2Q6AA 3CCJV 3B26A 5CA1A 3NXSA 3HR0A 4Q20A 4LWFA 3P3PA 4NTYA 4NXNB 2WI7A 4LF7O 1IBLB 2FXSA 1R6TA 2C1IA 2HJDA 4GFNA 1XDCA 3GIGA 2XAHA 1PP9H 2Q7GA 4DUZB 3F5TA 4I4TB 5FL7G 3K0DA 1F51A 5LHGA 1MNGA 4IGGA 4FCRA 3AG4C 4H7QA 3ZRWA 1SA0A 2Y0PA 2CAZC 1W0JG 5IJ0A 1XILA 4GT8A 2W0FC 5K1PA 2BT0A 1UYEA 4QE9A 4NXMB 1K97A 4MOTA 4P8OA 1I59A 2EILC 3DC6A 5KUKA 2UXBO 1ZWHA 2PYJA 2WAMA 1M93A 2WI3A 1H7UA 3EHHA 1OCRC 1M57C 3CYOA 5J2UB 2XNDG 3VQXA 3J80N 1WA8A 3G80A 4MVOA 1NBMG 4DR1B 1YETA 3OEEG 4WFGA 3D36A 1BGQA 1L0OA 5IYDO 4G28B 1XMQO 2WEPA 4MT8A 1NHIA 5M4NA 2X7RB 3OPDA 3ZHVA 5BODA 4PV1B 4BAEA 3JSNA 3TZ0A 2ZD9A 3IGAC 4CWTA 4X66B 3G67A 3AG7A 3HKDA 3CB2A 4AILC 1YF2A 1QLEB 4J80A 3L71H 2WPDG 1PPJH 3OTOB 3ZMUA 2CCTA 1AR5A 1DLBA 4XCJA 3CRMA 3T1YB 4DK0A 2W0XA 5CTXA 4TSFG 3ZXOA 2HCHA 1UYGA 4DV2O 4J42A 4O4JB 2YI8A 4JI6B 3D0BA 4X1IA 4LF4B 1KECA 2FL4A 5KHHA 3N2GA 1EI1A 4I50A 2JEUA 3T4DA 1JFFA 2DMXA 3L72H 3SDLA 1AJPA 3ETQA 5BR8B 2YEEA 1Y74A 1JA8A 4OPHA 3G7BA 1UY8A 3Q4HA 4F6RB 1W2BU 2QKSA 3ZMTA 4PD4F 4JASA 2UU9O 2V1DA 3CWBH 3T10A 1Y8PA 3ABMB 1AJNA 4MTOA 3ZM7A 4D7SA 3K5NA 2LGWA 1VARA 4Z2WA 3OEHG 3I5DA 2OIEA 3G6EV 4D6TH 4XITA 2DYSB 4UVAA 1BXDA 3THOA 4P2ZA 3VBBA 4EGIA 2JJCA 2NN4A 2LW1A 2ZR2A 3BVOA 4JI4B 5KMGA 5JJEB 4JI7B 2ZKJA 4LH6A 4WUCA 4XDMA 4K0KB 2HHIA 2FWYA 2ZT9B 3K5OA 4JI3O 3O6OA 5DM6V 2YDEA 1NTKH 2A0LA 1KD1W 2KB1A 2ITDC 1PNKA 1EA6A 2RN9A 4R3MA 1FXVA 3O9OA 3W7UA 3CPWU 2ZCEA 1US7A 3F5WC 5JJJB 4DR6O 4H0LB 3RYIA 4GKKO 3ICXA 4PDLA 2XD6A 5ITZA 5IY5C 2YEVA 5LXTB 4MSWC 1E79G 1QVFU 3ZX6A 4JI0B 2IORA 1TILA 5B1AC 1FAFA 3C90A 3AK3A 1V55B 2ZKOA 2QA4V 2YEBA 2IJHA 1Z5CA 2DN9A 4N21A 5KLVH 1AB3A 1H8EG 2YXLA 4K8ZA 2WLKA 3UCSC 2UUBO 1JQ0A 4FFBB 4EMVA 2YEAA 1ZLZA 4A5UB 2UXBB 2E74B 2WLIB 5L3FA 4FVMA 1SQQH 3APOA 2QKCA 1H2NA 2NR5A 2H55A 4RUFA 5B5EZ 2JK5C 3VHAA 4DR2O 4NYKA 3LMMA 2Q2EB 4J11A 2HHHO 5FNVB 1Q6UA 3E2EA 1XMQB 4B3SB 1OJHA 1WN7A 1NS1A 2QWOB 2X6BA 1B62A 2YI0A 1SQBH 3L75H 4I4TA 2IOPA 3LDEA 2YE9A 3ASNB 2CH7A 3STZC 4P7AA 4CE1A 4JGSA 1FXKB 4HYPA 1XL4A 1K5SA 1P49A 4I5SA 2FMLA 1UJWB 1Y66A 3C3SA 5M4EA 1XNRO 1TC0A 3LNNA 3QVNA 1QR8A 2XHRA 2Q8VA 4DR4O 1GAXA 4GT1A 2LGQA 5IYZB 2XOKG 1F23A 3O65A 3FT5A 2AZ0A 3ZHTA 1DK1A 3RVYA 2O1VA 5BXZA 3ZMZA 1FYJA 2ETNA 2F43G 4LNUB 4LFCO 2FB5A 4HY6A 2OCHA 3M8AA 1GO3F 3ZS8C 3CJHB 3AG4B 1N4CA 4F6EA 3ZHQA 1QQCA 3OFNG 1SKVA 4IIJB 5IYCO 1YI2V 2ARHA 3PEHA 4LF5O 1YSCA 3RKZA 2XAGA 1V9PA 2XJXA 5EIBC 4U3JB 4LR3A 2YKCA 2H3OA 1R3LC 2UUCB 1WP7A 2EILB 4KHPO 3OMIB 4GUNA 3ZKBA 3W7XA 1N34O 3W7TA 2ODMA 1OCRB 1M57B 3ZKDA 1S3JA 1H2LA 5LOVB 3B8MA 4HBNA 4JI2O 3L9DA 2ZDIC 1Y67A 4GLXA 2AHYA 4QIWF 4D7TA 2UU9B 5EIBD 1VF6A 2CE4A 1S77D 4X62O 2H8MA 4WFAV 1U0ZA 4I9WA 3E22A 1Q3EA 3GB7C 3JASB 3A0RA 2PTMA 3APQA 4X1KA 4JI1O 2LQTA 3TCUA 3JCZA 3BABA 3H1JH 3JAWA 3R92A 4O4JA 2YGFA 1PL0A 1EN6A 5IYBO 3N2KB 4JI3B 1YC4A 3KCXA 2QWQB 2CTPA 3ZRXA 1EFRG 4LFBO 2YJXA 4QNHB 3J7AU 4HNAB 4LCUC 2A3QA 5LGUA 3CCVV 2FYUH 1Y4UA 1AILA 3CMAV 5IT9N 3ZEDA 1SC5B 2GTAA 1NTMH 5IJ0B 3B25A 1WNSA 1RM1C 1KP3A 2IBZH 1XL6A 1P84F 1AI5A 3LUTB 2EBOA 1NQTA 1RSOB 3CCQV 3KE6A 1EM1A 3K04A 5JVDA 3G4SV 5KUMA 2VRZA 5L3JA 2ZINA 5D7RA 4LC1A 1KKCA 5B1BC 4V26A 2EX3A 4XCLA 3C0EA 4FLUA 1HR0O 2BREA 1LR1A 2ZE8A 4MVRA 3TZ5A 4FIPC 1L0NH 2UUBB 4TQDA 1IBKO 2CGFA 3RT3C 1QYEA 1K4DC 4J7JA 3VQVA 4J7ZA 4YY3O 3IJ4A 3A0YA 1I94O 3IEDA 3SYAA 1Q86W 3UO3A 3RBZA 4MVZA 1TUBB 1GN3A 5J9PC 1AP5A 1MZFA 2ZXWC 2HHHB 3OD4A 3CP1A 1VQNV 4XKOA 4XBFA 3DC5A 2A9HA 4B7EA 1JJ2U 1S0VA 1KUQA 2WSSG 4E2LA 1IBMO 4OX9O 5LXTA 1L8DA 2Q68A 4PDVA 4KFMA 1VF7A 1NVPD 1YZBA 3MDSA 5FLXN 2WLJA 2F93B 2YEFA 4PA7A 4R3AA 1CEZA 4E00A 2B9ZA 1Q5OA 2VWCA 1O9HA 2R9IA 4JTAB 3BRCA 1M9NA 4NVPA 1UY7A 4XDKA 3SR2C 3CGYA 1XNRB 3M99B 1EN4A 4FFBA 4X1YB 4LP8A 2XHXA 3OGCC 4DR4B 4FZ1A 4FCQA 4X1IB 2OCCC 5GW7A 1GK9A 4NH9A 1K4CC 1N33O 2YKIA 3O0IA 5IY5B 2UWDA 5EYPB 3ZBHA 1HNWO 1VIBA 4EB6A 4YIOA 4LFCB 4AWQA 1OV9A 1Y74B 4K8XA 2W6JG 3SJQC 4XKKA 5B1AB 4AI8A 1GH6A 1GM8A 3G75A 1PKXA 5A9GA 4DV5O 2F95B 3CCUV 3ZIAG 4MVSA 5JQGA 2EIKC 4CS4A 2M7WA 1QVGU 1BZKA 2YK2A 4MP7A 4B3RB 2YXHA 3SYCA 1MZEA 2Q67A 1FXKA 3SL2A 3HYYA 2HLDG 5IDJA 3TZ2A 3VADA 1N34B 3CC7V 3ETGA 5H2FZ 1HNZO 3E86A 4JI2B 1AJQA 4UCSA 5KAIZ 5IYZA 3OR7C 1QNMA 2PI4A 1JOYA 4JZGA 5IJ9B 3JARB 1I5DA 1BCCH 2DJVA 3P32A 4E01A 3CWVA 1NR7A 4EFUA 5M4HA 3H1HH 1A4HA 1YT1A 3FB8C 5BY1A 5CTUA 2IH3C 4Z1MG 3INXA 1COWG 4LNUA 2HR3A 1PL4A 3RYIB 1BHBA 4LWHA 3FYEB 3KCYA 3ABTA 3CGZA 4UVCA 5ITZB 3JATA 4L91A 2YEVB 4GKJO 3J81N 4IIJA 1PNLA 2BU7A 4LFBB 1BSMA 2DYRC 2R9RB 2QF6A 1P4RA 1TA8A 1XMOB 4U3JA 3Q5JA 4FK5C 2Q7HA 1Y76B 4DR7B 4LF9B 1N32B 2MW2B 4GX2A 4HZ0A 1VQ7V 5EC1C 2XHTA 3SYQA 2CGNA 3FAVA 3U11A 4IYIA 2XHBA 3A8TA 1H38A 3JD3A 1HWYA 1THZA 4O0BA 3R91A 1JCHA 1YJ9V 1FJGB 1QLNA 5GTHZ 1K33A 3B27A 1AMWA 5DECA 2YJWA 1EN5A 2NLJC 3JASA 4MVMA 5KAFZ 3JD0A 3CHXA 3H9VA 1U96A 4U7NA 3UO2A 3ZN1A 4BXIA 2VW5A 4GX5A 1VQKV 3INWA 4JV5O 4LWGA 1Q6IA 2PI5A 3N2KA 3KKYA 5L3EA 2KSDA 3F7VC 1I94B 1VMGA 4G27B 4HNAA 2XX5A 3JCUZ 4JYCA 2CH7B 4WBNB 1XNQB 1G6UA 4TV9B 2WLHA 4H33A 4PHZA 4K3AA 5EC2C 3K98A 4GEEA 3CRLA 3DXRB 5F5RA 1WLEA 2IW5A 3STLC 4QJFB 4AQYB 1K8AW 1AH6A 2GQPA 2AW9A 5D7DA 3K5MA 3CD6V 1QCEA 3SPIA 4OX9B 1RSOA 4TUYA 4LH7A 3DGEA 3SPCA 2CTQA 2F4VO 2ATKC 1R1BA 4DV4O 2EXLA 4CWNA 3OE7G 1UY6A 4G2KA 4JYBA 1ID0A 5HFLA 3FX7A 3JYCA 4ZBMA 4B3MO 3VOUA 5EZYA 4HZ3A 4O05A 3K9AA 4OPAA 2CG9A 1ORQC 1SZXA 3WFVA 2ZDYA 1J5EO 1MG1A 1RM1B 1N33B 3ASOC 1IVSA 2PYLA 1H2KA 3U0ZA 2UXCB 1HNXB 1TUBA 4MVUA 4YXWG 2A06H 4WCEV 3C3TA 5L3DA 1JMKC 2EZPA 1YXBA 5B1BB 3EKOA 2HVKC 4B6CA 4PA9A 1AR1B 1K73W 2WERA 1BHAA 2BTOA 2LFRA 2YE4A 3G7EA 1NJIW 2L6LA 4WFFA 1SRYA 5F3KA 3C11A 4YHHO 1I58A 3E22B 3G71V 3ABKC 5LGNA 1GM9A 1TBWA 1HNZB 4X1KB 2JGUA 1NVPB 2K1EA 1HDJA 3PJSK 1DF4A 2JJ2G 4X1YA 3JAWB 4W4KA 1MX0A 2IH1C 2ZXWB 1UYIA 3CEIA 3RWRD 5M4MA 4P30A 5F2VO 4RO2A 2EJ7A 1T5EA 1WJZA 2GV9A 5EYPA 1NU1H 3BY6A 4DR3O 1FKAO 4IYHA 1FFTB 5IE9A 4DUYO 3JAKB
chains in the Genus database with same CATH topology
2XASA 3R65A 4KSGA 1I5AA 3CCLV 2C2AA 4RQFA 4ASGA 2GSMB 5CA3A 1YESA 4MW3A 3E83A 4QPKA 1MU5A 2OCCB 3OMAB 1GMGA 4WF9V 4R7CA 3K0GA 2HKJA 2Q8IA 4MBCA 4JAVA 4P9PA 2WLLB 3B77A 1G8MA 4HXZA 2EIKB 3OM3B 5CBGA 4O04A 3OR6C 3ZRVA 1R6KA 2HG5C 2YI6A 4X9LA 2Q8GA 2BTZA 5D6PA 5FNDA 2EINC 2YKBA 4YKWA 4H81A 2Q8FA 1CPYA 3K97A 3TTZA 3ABLC 2IJJA 4PA3A 3RW0A 4KSHA 4L8ZA 1JVMA 1Z5AA 3ETEA 1TUEB 2IOQA 4URLA 5M4PA 2PNRA 3JD2A 2DYRB 3TZ4A 3B28A 1VQ4V 5J71A 1JPXA 2WI5A 4URMA 2VCJA 1B3QA 4ASAA 1S5HC 4JAUA 1KP2A 2XDUA 4CWPA 2YI7A 5L3CA 2ZDIA 3VHCA 2EIMC 1VQMV 1YS3A 5CTWA 5B1NA 2BYHA 3FKSG 4LWIA 2IJIA 3ZMVA 5EBMC 3ZXQA 2O1WA 3T4ZA 4RQEA 1OCOC 3OUSA 2BSMA 2BYIA 3X2QC 2Y69C 1K34A 5CMUA 4XD8A 5CBHA 1DTOA 3P30A 1MOFA 4B7PA 3LDCA 4EGKA 1TC6A 2FTKA 1QZRA 1UYMA 4WFHA 4UV8A 1H8HG 4FPPA 2JEXA 4R6ZA 2X6CA 5L3GA 5FNFA 3T0ZA 2WLMA 2EJRA 3HYZA 3OWBA 2QEXV 4AWOA 3QNEA 3SYOA 2YE5A 3W7WA 3OMUA 3ZJZA 3ASOB 1VQ6V 4WFBV 3WG7C 3HEKA 2XAFA 4DXWA 3I56V 4TT3G 4CE2A 4BQJA 3SPGA 3HZ5A 3SPHA 2QE7G 1LNQA 4R50A 5BZBA 3Q5LA 4XIPA 2LP7A 2P67A 3R4MA 3ABKB 3AG1C 2XX4A 2JJ1G 3A0TA 4AWPA 3EHJA 2YGEA 3JD4A 1AI6A 2BU2A 1GKZA 3OAAG 3CCRV 3B24A 5BOCA 1P7BA 3MNRP 3IC7A 3T0HA 5J6AA 2IWUA 1VQPV 2WLLA 1WPXA 4UROA 2FYPA 1EBOA 3JZ3A 1SERA 4FMTA 1KIJA 5LHIA 2O1UA 3E8GA 4UUJC 1K5QA 1NHJA 2XAJA 1YSRA 3FB5C 4BW5A 1AI7A 2YEIA 1I5XA 2Z5UA 4K4OA 2QFOA 3CCSV 3R4PA 4X89A 1VQ5V 1VQLV 4RUEA 1Y8OA 2VCIA 4MS2A 4X8AA 1R3KC 4HXWA 4FJCC 3K06A 1SZTA 3F7YC 1PD3A 2W6IG 4BAYA 4EGHA 1BKNA 2EINB 1UYDA 1Y4SA 1AI4A 3MHHC 1YIJV 3R4OA 3H4LA 3LNMB 3LSQA 2P6JA 3ABLB 3EHFA 3GIEA 4OXSA 5B3SC 2XDXA 3AG3C 3BMYA 2HFEC 1NH2D 2UXNA 5CBFA 2XJJA 3RLQA 1Y8NA 3QO5A 4XC0A 3HHUA 1YJNV 3K99A 3ML0A 4HYOA 5GGZA 4TWKA 1VQOV 1R6NA 1M1KW 2EIMB 3AG2C 4XE2A 1IXMA 2JIZG 1FS0G 4R8CA 3EKRA 1CP9A 1RPOA 2D3OW 1K3EA 4PL9A 1OCOB 3E8BA 4BIUA 4EKWA 3CRKA 4RAIA 1ROPA 1KKDA 4KTNA 3X2QB 2Y69B 3JD1A 2QG2A 2BOBC 3R4NA 2HKOA 1UYKA 4LPBA 4L87A 2WI1A 2YEGA 4N23A 1UYHA 1NR1A 3ABUA 5CTYA 3K08A 4LP0A 4L93A 2YKJA 4PU9A 5EBLC 5EK0A 2YI5A 3KG2A 1L1FA 2WEQA 3LPSA 2GHYA 3OWDA 3UM7A 4E02A 3E8HA 1OSFA 3ZMSA 3MD0A 4MPEA 1M56C 3QDDA 1U2OA 4ASBA 3K3WA 4MVQA 3LDDA 3WG7B 1R3JC 2IWXA 5LBQA 1K9MW 4ZKIA 1Y4MA 3BEHA 1YT0A 1GTOA 4CWOA 2YKEA 1YJWV 4FCPA 2ZBKB 1H2GA 2MK3A 4YKYA 5LHHA 4ASUG 3AG1B 4PRXA 2BU8A 4CWQA 1S76D 1Q81W 1OCCC 4PDMA 2A79B 1V54C 1NKDA 4DUHA 2ZR3A 3EHBB 4PELA 2YEHA 3LNUA 1GKXA 1GKFA 1VQ8V 3ETDA 2NNUA 1ZW9A 4CWFA 1FXHA 3SYPA 1THNA 2IJKA 3HPLC 2Q69A 4WUDA 2P7TC 4PA4A 2XDKA 3OMNB 1BL8A 4MTGA 2BU5A 1ZXMA 2QM7A 4MTFA 3T1KA 2WLNA 2AHZA 1E1QG 2P90A 1I5BA 4U93A 4JTDB 3TK1A 2ZQMA 3OUFA 3D3IA 3D2RA 1S14A 1MABG 1YSZA 4L94A 1JX9A 4L90A 1R73A 1ZXNA 3HB3B 1AH8A 1PVGA 1I5YA 1BYQA 3O2FA 2EIJC 4CZZA 2XABA 5H9CA 1NH2B 2OT5A 3FT8A 4KFGA 4BIZA 1KQSU 1OHHG 1F4MA 5B3SB 3AG3B 3I55V 4AS9A 3H01A 3WQ9A 2DWDC 2B1GA 2YE8A 3WHAA 1K7DA 4GX1A 4HYMA 5CN0A 5DN6G 3CCMV 3EHGA 2ZDXA 2HVJC 2HJFC 4XIQA 2OTJV 2BOCC 1Z5BA 1E1RG 4LBEC 2X6AA 4YKZA 1AROP 3FV5A 1VQ9V 3AG2B 3E35A 3MHSC 5E1AC 5D7CA 4HZ5A 3K79A 1AJ6A 2YEDA 5CF0A 1QBZA 3U67A 3FYIB 1UYFA 4YKXA 3QO8A 2IWSA 3T2SA 1NHHA 1Z59A 3U2DA 2BU6A 1OCZC 4NH7A 1OZ0A 3SPJA 3W7SA 4MW8A 2YK9A 2OTLV 4MPNA 2WWWA 3GWOA 3K60A 2FWZA 1F4NA 2EZOA 2UXXA 2DWEC 4P9OA 3QO7A 4LWEA 2GFDA 4XKAA 5H6QA 5HFMA 4XDLA 4EFTA 3H80A 4H85A 3ZN0A 2Y48A 4O07A 4J9ZB 1YERA 4KQVA 1YTFD 4GX0A 1M56B 3OW6A 1B63A 4JF3A 4NH8A 4CBCA 2XAQA 3IFXA 3RLRA 2YEJA 4O09A 3TUHA 2XJGA 5H6RA 3RVZA 2HG1A 1AM1A 2JDIG 1KZNA 1UYLA 4ASFA 2XX2A 1H7SA 4KP4A 3HZ1A 1MSWD 1YC1A 2YE2A 2BRCA 3VHDA 1W0KG 4URNA 2X0LA 4H37A 2CCUA 4DZYA 3UKMA 1YT2A 4YKQA 4HAMA 1PNMA 2XDLA 1N8RW 2CK3G 4R1FA 4F4LA 3QTFA 1OCCB 4WFEA 2DQ3A 1JM6A 4MB9A 3CMEV 1Q82W 1YITV 3BM9A 4V25A 1V54B 1TIDA 1R62A 2YE3A 1ZWIC 4JPRA 2ITCC 3EFFK 1J95A 2H94A 3GIGB 3E89A 3U2KA 2E0AA 4GQTA 2WI6A 3FB7C 2XK2A 4QE7A 1QR9A 1K92A 4KUMA 3ZRWB 3LSSA 4W7TA 4WUBA 2XCMA 4GCZA 1YHQV 5M4KA 2Z3YA 4EM7A 1G4YB 4XDJA 4GGLA 2Q8HA 1DF5A 4YKUA 1QLEC 4J9YB 1GJVA 5B1OA 3CC4V 2YGAA 5KA5A 4PRVA 4PA6A 2K5BA 3TETA 1M90W 5KA6A 5IN9A 4CWRA 4DO2A 2QM8A 2YE7A 2EIJB 4I3HA 2AKPA 4UVBA 4JTCB 2CCSA 2B1IA 5CPHA 3ZCCA 4MTXA 3K03A 4XTJA 2DQ0A 2QG0A 4UV9A 1R3IC 4YKRA 5C93A 3A0ZA 3ABMC 4EEHA 4PDRA 2V7QG 2WLIA 2JKIA 3T1CA 2DYSC 1RPRA 1GM7A 1S72V 5L3BA 5FNCA 3ZRSA 3AEIA 2WI2A 4MP2A 4MPCA 1UY9A 1EZJA 2IU0A 3RLPA 2ESAA 4XIRA 4YKTA 3A0WA 2BZ5A 1I5CA 1OCZB 1ENVA 4CE3A 1KC8W 2QTOA 3GIFA 1B6QA 5D6QA 1V55C 4BQGA 5FWKA 2IU3A 3DTUB 3NMQA 1SESA 5EBWC 3Q5KA 1BMFG 3PEJA 2CH4A 1YTFB 2WI4A 1SETA 2YE6A 2YSUB 3CXCU 4QPJA 4JQLA 3T2MA 3CCEV 2DW4A 3CC2V 3A0XA 1UYCA 3FB6C 2LFSA 4UXNA 1TH8A 4CWSA 2YECA 3OW2U 2H8PC 1YC3A 4HY1A 3E8FA 2XDSA 4X88A 1QY8A 4ZVIA 3ASNC 5IDMA 1FXKC 1Q7YW 3B8NA 5LGTA 1S16A 4U7OA 2B5UA 2Q6AA 3CCJV 3B26A 3NXSA 4Q20A 4LWFA 2WI7A 2FXSA 4GFNA 3GIGA 2XAHA 5FL7G 3K0DA 1F51A 5LHGA 4FCRA 3AG4C 4H7QA 3ZRWA 1W0JG 4GT8A 2W0FC 2BT0A 1UYEA 4QE9A 1K97A 4MOTA 4P8OA 1I59A 2EILC 5KUKA 1ZWHA 2WAMA 2WI3A 1H7UA 3EHHA 1OCRC 1M57C 3CYOA 2XNDG 4MVOA 1NBMG 1YETA 3OEEG 4WFGA 3D36A 1BGQA 1L0OA 5IYDO 4G28B 2WEPA 4MT8A 1NHIA 5M4NA 2X7RB 3OPDA 5BODA 4BAEA 3TZ0A 2ZD9A 3IGAC 4CWTA 1QLEB 2WPDG 3ZMUA 2CCTA 1DLBA 4XCJA 5CTXA 4TSFG 3ZXOA 2HCHA 1UYGA 3D0BA 1KECA 1EI1A 2JEUA 3T4DA 1AJPA 2YEEA 3G7BA 1UY8A 1W2BU 2QKSA 3ZMTA 4JASA 2V1DA 3T10A 1Y8PA 3ABMB 1AJNA 4MTOA 3ZM7A 3OEHG 3G6EV 4XITA 2DYSB 4UVAA 1BXDA 4P2ZA 3VBBA 4EGIA 2JJCA 2ZR2A 2ZKJA 4WUCA 4XDMA 2FWYA 3O6OA 5DM6V 2A0LA 1KD1W 2KB1A 2ITDC 1PNKA 1EA6A 4R3MA 1FXVA 3W7UA 3CPWU 1US7A 3F5WC 4PDLA 2XD6A 5IY5C 2YEVA 4MSWC 1E79G 1QVFU 2IORA 1TILA 5B1AC 1V55B 2QA4V 2YEBA 2IJHA 1Z5CA 4N21A 1H8EG 2WLKA 1JQ0A 4EMVA 2YEAA 2WLIB 5L3FA 2H55A 4RUFA 2JK5C 3VHAA 2Q2EB 3E2EA 1B62A 2X6BA 2YI0A 2IOPA 3LDEA 2YE9A 3ASNB 4P7AA 3STZC 4CE1A 4JGSA 1FXKB 4HYPA 1XL4A 1K5SA 4I5SA 1UJWB 1Y66A 5M4EA 1TC0A 1QR8A 2XHRA 4GT1A 2XOKG 1F23A 3FT5A 3RVYA 2O1VA 3ZMZA 2F43G 4HY6A 1GO3F 3AG4B 3OFNG 5IYCO 1YI2V 3PEHA 1YSCA 3RKZA 2XAGA 2XJXA 2YKCA 1R3LC 2EILB 3OMIB 3ZKBA 3W7XA 3W7TA 1OCRB 1M57B 3ZKDA 1S3JA 3B8MA 2ZDIC 2AHYA 4QIWF 1S77D 2H8MA 4WFAV 1U0ZA 4I9WA 3GB7C 3A0RA 3TCUA 3JCZA 3R92A 2YGFA 1PL0A 5IYBO 1YC4A 3ZRXA 1EFRG 2YJXA 4QNHB 4LCUC 5LGUA 3CCVV 1Y4UA 3CMAV 3B25A 1RM1C 1KP3A 1XL6A 1AI5A 3LUTB 2EBOA 1NQTA 3CCQV 3KE6A 3K04A 3G4SV 5KUMA 5L3JA 5D7RA 4LC1A 5B1BC 4V26A 4XCLA 3C0EA 2BREA 4MVRA 3TZ5A 4FIPC 2CGFA 1QYEA 1K4DC 3A0YA 3IEDA 3SYAA 1Q86W 3RBZA 4MVZA 5J9PC 2ZXWC 3CP1A 1VQNV 4XKOA 4XBFA 2A9HA 1JJ2U 1S0VA 2WSSG 4E2LA 2Q68A 4PDVA 4KFMA 1NVPD 2WLJA 2YEFA 4PA7A 4R3AA 1CEZA 4E00A 2VWCA 2R9IA 4JTAB 1M9NA 1UY7A 4XDKA 3CGYA 3M99B 2XHXA 4LP8A 3OGCC 4FCQA 2OCCC 5GW7A 1GK9A 4NH9A 1K4CC 2YKIA 3O0IA 5IY5B 2UWDA 4AWQA 2W6JG 3SJQC 4XKKA 5B1AB 1GM8A 3G75A 1PKXA 3CCUV 3ZIAG 4MVSA 2EIKC 2M7WA 1QVGU 2YK2A 4MP7A 3SYCA 2Q67A 1FXKA 3SL2A 3HYYA 2HLDG 5IDJA 3TZ2A 3VADA 3CC7V 3ETGA 3E86A 1AJQA 3OR7C 1JOYA 2PI4A 1I5DA 3P32A 4EFUA 4E01A 3CWVA 1NR7A 5M4HA 1YT1A 1A4HA 3FB8C 5CTUA 2IH3C 4Z1MG 3INXA 1COWG 2HR3A 1BHBA 4LWHA 3FYEB 3ABTA 3CGZA 4UVCA 4L91A 2YEVB 1PNLA 2BU7A 2DYRC 2R9RB 2QF6A 1P4RA 3Q5JA 4FK5C 4GX2A 4HZ0A 1VQ7V 5EC1C 2XHTA 3SYQA 1H38A 3JD3A 1HWYA 1THZA 4O0BA 3R91A 1JCHA 1YJ9V 1QLNA 1K33A 3B27A 1AMWA 2YJWA 2NLJC 4MVMA 3JD0A 4BXIA 4U7NA 3ZN1A 2VW5A 4GX5A 1VQKV 3INWA 4LWGA 2PI5A 5L3EA 3F7VC 4G27B 2XX5A 4JYCA 2WLHA 4H33A 5EC2C 3K98A 4GEEA 3CRLA 5F5RA 1WLEA 2IW5A 3STLC 4QJFB 2GQPA 1K8AW 1AH6A 5D7DA 3CD6V 1QCEA 3SPIA 3DGEA 3SPCA 2ATKC 4CWNA 2EXLA 3OE7G 1UY6A 4G2KA 4JYBA 1ID0A 5HFLA 3JYCA 4ZBMA 3VOUA 4HZ3A 4O05A 3K9AA 2CG9A 1ORQC 2ZDYA 3WFVA 1MG1A 1RM1B 3ASOC 4MVUA 4YXWG 4WCEV 5L3DA 2EZPA 5B1BB 3EKOA 2HVKC 4B6CA 4PA9A 1AR1B 1K73W 2WERA 1BHAA 2LFRA 2YE4A 3G7EA 1NJIW 4WFFA 1SRYA 5F3KA 3C11A 1I58A 3G71V 3ABKC 5LGNA 1GM9A 1TBWA 1NVPB 2K1EA 3PJSK 1DF4A 2JJ2G 1MX0A 2IH1C 2ZXWB 1UYIA 5M4MA 4P30A 4RO2A 3BY6A 1FFTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5B A;  2WI1 A;  2YEG A;  5IN9 A;  2XHR A;  1UYH A;  4KSG A;  4CWR A;  1I5A A;  5CTY A;  4GT1 A;  2QM8 A;  4LP0 A;  2YE7 A;  4L93 A;  2YKJ A;  2C2A A;  3FT5 A;  4I3H A;  2AKP A;  4PU9 A;  4ASG A;  2O1V A;  1YES A;  2YI5 A;  2CCS A;  5CPH A;  2WEQ A;  4QPK A;  1MU5 A;  3LPS A;  3OWD A;  4HY6 A;  3ZCC A;  4E02 A;  1OSF A;  3MD0 A;  4MTX A;  4MPE A;  4XTJ A;  3PEH A;  2QG0 A;  2HKJ A;  2Q8I A;  4YKR A;  4MBC A;  3RKZ A;  2XJX A;  4JAV A;  3QDD A;  2YKC A;  1U2O A;  5C93 A;  3A0Z A;  4ASB A;  3ZKB A;  4HXZ A;  4EEH A;  2IWX A;  4ZKI A;  3ZKD A;  2JKI A;  1YT0 A;  4CWO A;  4O04 A;  2YKE A;  3ZRV A;  2YI6 A;  2H8M A;  4FCP A;  4X9L A;  5FNC A;  2Q8G A;  1U0Z A;  2ZBK B;  2WI2 A;  2BTZ A;  4MP2 A;  4MPC A;  5D6P A;  5FND A;  1UY9 A;  3A0R A;  4YKY A;  2YKB A;  4YKW A;  4H81 A;  2Q8F A;  3RLP A;  3K97 A;  3R92 A;  2YGF A;  3TTZ A;  2ESA A;  4PRX A;  1YC4 A;  2BU8 A;  4CWQ A;  4XIR A;  4KSH A;  3ZRX A;  2YJX A;  4YKT A;  3A0W A;  2BZ5 A;  1I5C A;  1Y4U A;  4L8Z A;  1Z5A A;  2IOQ A;  4CE3 A;  4DUH A;  3GIF A;  4URL A;  5M4P A;  3B25 A;  2PNR A;  5D6Q A;  2YEH A;  4BQG A;  3LNU A;  1GKX A;  5FWK A;  3NMQ A;  1ZW9 A;  3TZ4 A;  4CWF A;  3B28 A;  3KE6 A;  3Q5K A;  5J71 A;  3PEJ A;  5L3J A;  1THN A;  2CH4 A;  2WI5 A;  5D7R A;  4LC1 A;  4URM A;  4V26 A;  4WUD A;  2VCJ A;  4XCL A;  3C0E A;  1B3Q A;  4ASA A;  2BRE A;  2WI4 A;  4JAU A;  2XDK A;  2XDU A;  2YE6 A;  4CWP A;  2YI7 A;  4QPJ A;  4JQL A;  3VHC A;  3TZ5 A;  2BU5 A;  2CGF A;  1YS3 A;  1UYC A;  1QYE A;  3A0X A;  2LFS A;  5CTW A;  1ZXM A;  2QM7 A;  5B1N A;  1TH8 A;  4CWS A;  2YEC A;  2BYH A;  3A0Y A;  3T1K A;  1YC3 A;  4LWI A;  4HY1 A;  3IED A;  2XDS A;  3ZXQ A;  2O1W A;  1I5B A;  2BSM A;  4U93 A;  1QY8 A;  3TK1 A;  2BYI A;  4ZVI A;  5IDM A;  4XKO A;  3D2R A;  1S14 A;  1S16 A;  4XD8 A;  4U7O A;  1YSZ A;  4L94 A;  4L90 A;  3B26 A;  1ZXN A;  3NXS A;  1AH8 A;  4Q20 A;  4LWF A;  4B7P A;  1PVG A;  2YEF A;  1BYQ A;  4R3A A;  4E00 A;  3O2F A;  2WI7 A;  4EGK A;  2VWC A;  2FXS A;  2XAB A;  1TC6 A;  2FTK A;  4GFN A;  1UY7 A;  1QZR A;  1UYM A;  3FT8 A;  3CGY A;  3GIG A;  4KFG A;  4BIZ A;  4FPP A;  2XHX A;  4FCQ A;  5FNF A;  3T0Z A;  1F51 A;  4FCR A;  4NH9 A;  3HYZ A;  2YKI A;  3O0I A;  4H7Q A;  3ZRW A;  2UWD A;  3OWB A;  4AS9 A;  4GT8 A;  4AWO A;  3WQ9 A;  2YE5 A;  4AWQ A;  2BT0 A;  1UYE A;  4XKK A;  2YE8 A;  3WHA A;  3G75 A;  3OMU A;  4MOT A;  4HYM A;  4P8O A;  1I59 A;  1ZWH A;  3EHG A;  2WI3 A;  1H7U A;  2ZDX A;  3EHH A;  3HEK A;  4XIQ A;  2YK2 A;  4MP7 A;  1Z5B A;  1YET A;  4CE2 A;  4YKZ A;  4BQJ A;  3SL2 A;  3D36 A;  1BGQ A;  3HYY A;  1L0O A;  5IDJ A;  3TZ2 A;  3FV5 A;  3VAD A;  3HZ5 A;  2WEP A;  4MT8 A;  1NHI A;  5M4N A;  3OPD A;  5BOD A;  3Q5L A;  4XIP A;  4BAE A;  3TZ0 A;  1JOY A;  4HZ5 A;  2P67 A;  3R4M A;  5D7C A;  1AJ6 A;  2YED A;  5CF0 A;  4CWT A;  1I5D A;  3P32 A;  4EFU A;  4E01 A;  3U67 A;  3CWV A;  1UYF A;  5M4H A;  1YT1 A;  1A4H A;  2XX4 A;  4YKX A;  3A0T A;  5CTU A;  4AWP A;  3INX A;  2IWS A;  3T2S A;  3EHJ A;  1NHH A;  2YGE A;  1Z59 A;  3U2D A;  2BU6 A;  2BU2 A;  1GKZ A;  4NH7 A;  4LWH A;  3CGZ A;  2CCT A;  2YK9 A;  4L91 A;  3B24 A;  4MPN A;  5BOC A;  2BU7 A;  2WWW A;  4XCJ A;  3K60 A;  3MNR P;  2QF6 A;  2FWZ A;  5CTX A;  3T0H A;  5J6A A;  3Q5J A;  3ZXO A;  2IWU A;  2HCH A;  4HZ0 A;  1UYG A;  2XHT A;  4URO A;  2FYP A;  3D0B A;  4LWE A;  2GFD A;  1EI1 A;  4XKA A;  3JZ3 A;  4FMT A;  1KIJ A;  2O1U A;  4O0B A;  4EFT A;  2YEE A;  3H80 A;  3R91 A;  4H85 A;  1NHJ A;  3B27 A;  1AMW A;  4O07 A;  2YJW A;  1YER A;  1YSR A;  4KQV A;  3G7B A;  1UY8 A;  2YEI A;  4K4O A;  2QFO A;  3OW6 A;  1B63 A;  4BXI A;  4U7N A;  4NH8 A;  2VW5 A;  3INW A;  4JAS A;  4LWG A;  3RLR A;  3T10 A;  2YEJ A;  3R4P A;  1Y8P A;  4O09 A;  3TUH A;  3ZM7 A;  2XJG A;  2HG1 A;  1AM1 A;  1KZN A;  1Y8O A;  1UYL A;  4ASF A;  2VCI A;  2XX2 A;  1H7S A;  2XX5 A;  4XIT A;  1BXD A;  3HZ1 A;  4JYC A;  4KP4 A;  4EGI A;  2JJC A;  1YC1 A;  4HXW A;  3K98 A;  4GEE A;  3CRL A;  2YE2 A;  5F5R A;  2ZKJ A;  4WUC A;  4XDM A;  2FWY A;  2GQP A;  1AH6 A;  2BRC A;  5D7D A;  3VHD A;  4EGH A;  1BKN A;  3O6O A;  1Y4S A;  1UYD A;  4URN A;  3R4O A;  3DGE A;  1EA6 A;  3H4L A;  2CCU A;  4CWN A;  4DZY A;  1YT2 A;  2EXL A;  4R3M A;  4YKQ A;  1UY6 A;  4JYB A;  1US7 A;  3EHF A;  1ID0 A;  2XDL A;  3GIE A;  4R1F A;  2XD6 A;  3QTF A;  2XDX A;  4O05 A;  3BMY A;  1JM6 A;  4MB9 A;  2CG9 A;  2ZDY A;  2XJJ A;  3BM9 A;  4V25 A;  3RLQ A;  2IOR A;  1TIL A;  1TID A;  1R62 A;  2YE3 A;  1Y8N A;  4XC0 A;  3HHU A;  2YEB A;  3K99 A;  1Z5C A;  3GIG B;  5GGZ A;  4EMV A;  3U2K A;  2E0A A;  4GQT A;  2WI6 A;  3EKO A;  2YEA A;  2XK2 A;  4B6C A;  3ZRW B;  2WER A;  2H55 A;  4XE2 A;  1IXM A;  4W7T A;  2LFR A;  4WUB A;  2YE4 A;  2XCM A;  3VHA A;  3G7E A;  4GCZ A;  2Q2E B;  5M4K A;  4EM7 A;  3EKR A;  5F3K A;  3C11 A;  1I58 A;  1TBW A;  4PL9 A;  4BIU A;  1B62 A;  3CRK A;  2YI0 A;  4GGL A;  2Q8H A;  4YKU A;  2IOP A;  1GJV A;  1MX0 A;  4KTN A;  1UYI A;  2YE9 A;  5B1O A;  4P7A A;  5M4M A;  4CE1 A;  2QG2 A;  4HYP A;  3R4N A;  4I5S A;  2YGA A;  4PRV A;  1UYK A;  5M4E A;  1TC0 A;  4LPB A; 
#chains in the Genus database with same CATH topology
 4B3T O;  4DV3 O;  2KQX A;  1Q8I A;  2XAS A;  3R65 A;  4KSG A;  1I5A A;  4UB8 Z;  3CCL V;  2UXD O;  5LA6 A;  2BCC H;  2ZE7 A;  2C2A A;  4QGP A;  4RQF A;  4GKJ B;  4GZR B;  3RYF B;  4ASG A;  4DRX B;  4J7K A;  4YJ2 A;  2GSM B;  5CA3 A;  2PY5 A;  1KMI Z;  3IC9 A;  5JVD B;  1YES A;  4MW3 A;  3E83 A;  5E79 Z;  3BFR A;  4QPK A;  1MU5 A;  1XUQ A;  2DOS A;  2OCC B;  2CGO A;  3L73 H;  3OMA B;  2D2C B;  2ILM A;  2GTS A;  2ADQ B;  2Y4U A;  4L8J A;  1GMG A;  4WF9 V;  4R7C A;  3K0G A;  4ICG A;  4LF8 B;  1Q6H A;  4IHJ A;  2HKJ A;  2Q8I A;  4MBC A;  1NT2 B;  4JAV A;  4P9P A;  5IJ9 A;  3JAR A;  2WLL B;  3JAM N;  3B77 A;  1LUW A;  1G8M A;  4HXZ A;  2EIK B;  5DED A;  4FLV A;  3OM3 B;  2A7W A;  4LF7 B;  1GN2 A;  5CBG A;  4O04 A;  3OR6 C;  4JV5 B;  3ZRV A;  1R6K A;  4CH4 A;  2HG5 C;  2BTQ A;  3FFQ A;  4JYA O;  2YI6 A;  1WB8 A;  1YDX A;  2YUA A;  4X9L A;  2Q8G A;  2LJ2 A;  2M6Y A;  2BTZ A;  3D3Q A;  4FM1 A;  5D6P A;  5FND A;  5IWA O;  2EIN C;  1Y76 A;  2YKB A;  4JAA A;  4YKW A;  4H81 A;  2Q8F A;  4X9Q A;  2BSK B;  1CPY A;  3K97 A;  2CTW A;  3CS5 A;  4CS2 A;  3TTZ A;  1BGY H;  3K5L A;  3NR7 A;  3ABL C;  2IJJ A;  4O2A B;  4PA3 A;  2QWR B;  3RW0 A;  4KSH A;  1U97 A;  4Q6G A;  4YJ3 B;  4DV4 B;  1YEW A;  1JVM A;  1Z5A A;  3ETE A;  4L8Z A;  1TUE B;  2YID A;  2IOQ A;  5J2T A;  4FM2 A;  4B3M B;  4URL A;  5M4P A;  5D5P A;  4NKG B;  3RYC B;  2PNR A;  1M4U A;  3JD2 A;  2DYR B;  4U3F H;  4EB6 B;  3JAL B;  2QSA A;  3TZ4 A;  4PJ0 Z;  3RYH B;  3B28 A;  1VQ4 V;  5J71 A;  1JPX A;  1S5J A;  2YI9 A;  2WI5 A;  5JQG B;  4URM A;  2VCJ A;  1B3Q A;  4ASA A;  1S5H C;  4JAU A;  1KP2 A;  2XDU A;  4CWP A;  4ZOL B;  2YI7 A;  5L3C A;  2ZDI A;  2QWN B;  2JRI A;  4WBN A;  3VHC A;  4X20 A;  2EIM C;  2LO1 A;  4J10 A;  4TV9 A;  1VQM V;  1N36 O;  4CH5 A;  1YS3 A;  3DXR A;  5CTW A;  5B1N A;  1M5I A;  2BYH A;  1Q90 D;  3FKS G;  4LWI A;  2IJI A;  3ZMV A;  5EBM C;  3ZXQ A;  2O1W A;  3T4Z A;  4RQE A;  4O4I B;  1OCO C;  3OUS A;  2K9P A;  5AG2 A;  4YIP A;  4EFE A;  2BSM A;  2VQF O;  2YIA A;  2BYI A;  3X2Q C;  4YHH B;  2Y69 C;  1K34 A;  5CMU A;  4FLW A;  4FZ0 A;  4XD8 A;  5CBH A;  5C8Y A;  4DV2 B;  1DTO A;  3P30 A;  5KHI A;  1MOF A;  2UUA O;  2ZNI A;  4EFB A;  4B7P A;  3JAT B;  3LDC A;  2ZM6 O;  2AZ2 A;  3TGU H;  4EGK A;  4DR3 B;  1TC6 A;  3RFR A;  2FTK A;  1QZR A;  1UYM A;  1URF A;  4WFH A;  4I0X B;  4UV8 A;  5TIS Z;  4B3T B;  4DV3 B;  1H8H G;  4FPP A;  4NTX A;  2JEX A;  4JI5 O;  4R6Z A;  2X6C A;  5L3G A;  1NI8 A;  3SGI A;  4DV6 O;  5FNF A;  3WB2 A;  3T0Z A;  3FAV B;  2WLM A;  1S5L Z;  2EJR A;  3B09 A;  2R72 A;  3HYZ A;  3CRA A;  2Q0O C;  4IT5 A;  3OWB A;  2QEX V;  1XRE A;  4H13 B;  2F66 C;  4AWO A;  3QNE A;  3SYO A;  2V4D A;  4CS3 A;  2YE5 A;  2ADP A;  2Q9L A;  1HP8 A;  5LP6 C;  3W7W A;  3OMU A;  3ZJZ A;  3ASO B;  1VQ6 V;  4WFB V;  3WG7 C;  3HEK A;  5CB4 A;  2XAF A;  4DXW A;  2PZS A;  3I56 V;  4TT3 G;  4CE2 A;  4DV0 O;  4BQJ A;  4CC6 A;  2Q0A A;  2YC0 A;  3SPG A;  3HZ5 A;  4DK1 A;  5FPO A;  4O4L B;  3JAK A;  2QE7 G;  1LNQ A;  4R50 A;  3SPH A;  5BZB A;  4IL6 Z;  4DR6 B;  3Q5L A;  4XIP A;  4GKK B;  2HEP A;  2LP7 A;  3B40 A;  2P67 A;  3R4M A;  4JYA B;  3ABK B;  2QKA A;  3RYF A;  3AG1 C;  3WB1 A;  4DRX A;  4TUY B;  2RQ6 A;  2XX4 A;  4FLY A;  2JJ1 G;  5KHG A;  3A0T A;  3CRQ A;  4AWP A;  5LMU O;  1IDS A;  3EHJ A;  2YGE A;  3JD4 A;  1AI6 A;  4FLZ A;  2BU2 A;  5EZY B;  1GKZ A;  3OAA G;  3T1H O;  1FFX B;  3CCR V;  3B24 A;  1ZAU A;  5BOC A;  1P7B A;  2LW7 A;  3MNR P;  3A0B Z;  3IC7 A;  4UB6 Z;  3T0H A;  5J6A A;  3UT5 B;  2IWU A;  1VQP V;  1GN6 A;  2WLL A;  4UCR A;  2YS8 A;  1WPX A;  4URO A;  2FYP A;  1EBO A;  4DR2 B;  1ZUQ A;  1KBH A;  3GVM A;  3JZ3 A;  1SER A;  2F1M A;  4NXN O;  4FMT A;  1KIJ A;  5LHI A;  2O1U A;  3N27 A;  1VF5 B;  3E8G A;  4LWS B;  3A2F A;  4AHC A;  5KX5 B;  4UUJ C;  4FFK A;  1X4T A;  2HP8 A;  1K5Q A;  4TV8 B;  5JJN B;  2XAJ A;  1NHJ A;  2P5O A;  1YSR A;  3CX5 F;  3FB5 C;  4BW5 A;  5JH7 B;  1AI7 A;  1N0N A;  3SJA C;  1Q43 A;  2YEI A;  1I5X A;  2Z5U A;  4K4O A;  2QFO A;  2BSK A;  1B06 A;  3CCS V;  2OYQ A;  2E75 B;  4O2A A;  4X89 A;  1VQ5 V;  2JGD B;  3R4P A;  2GDS A;  1VQL V;  4RUE A;  1XI1 A;  4DYL A;  1Y8O A;  3K57 A;  1Z5V A;  2VCI A;  4MS2 A;  4YJ3 A;  4X8A A;  3ZHR A;  1R3K C;  4DR5 O;  2OWO A;  2KG7 A;  2P4V A;  4HXW A;  1VEW A;  4FJC C;  3K06 A;  1SZT A;  3F7Y C;  3RYC A;  1PD3 A;  3BA9 A;  1ZTE A;  2W6I G;  4BAY A;  1HW7 A;  1GN4 A;  4DR1 O;  3JAL A;  4EGH A;  1BKN A;  2EIN B;  1UYD A;  1Y4S A;  1AI4 A;  3RYH A;  3MHH C;  4CC5 A;  1YIJ V;  3R4O A;  1DGS A;  5LA6 B;  3H4L A;  2P06 A;  3LNM B;  3LSQ A;  1XBL A;  2P6J A;  4YJ2 B;  3ABL B;  3EHF A;  4LF5 B;  3GIE A;  3B4S A;  4OXS A;  5B3S C;  4ZOL A;  2XDX A;  3AG3 C;  3BMY A;  2HFE C;  1NH2 D;  2UXN A;  5LL6 Y;  4KHP B;  2N04 A;  5CBF A;  2XJJ A;  3RLQ A;  1Z2G A;  1Y8N A;  3QO5 A;  4XC0 A;  3HHU A;  1YJN V;  1IZ3 A;  4ZHQ A;  4IHJ B;  4O4I A;  3K99 A;  1IXB A;  3OTO O;  2R70 A;  3ML0 A;  4HYO A;  5GGZ A;  1KB9 F;  4X62 B;  4BR6 A;  4TWK A;  2VWK A;  3P3N A;  1VQO V;  5LMN O;  1KYO F;  2IM9 A;  4JI1 B;  2YIB A;  1R6N A;  1M1K W;  2EIM B;  3AG2 C;  4I7Z B;  4XE2 A;  1IXM A;  2BTQ B;  2JIZ G;  2ZNJ A;  1L0L H;  4LF4 O;  1FS0 G;  4R8C A;  4DV0 B;  3EKR A;  1Z5W A;  2Y0I A;  1CP9 A;  1RPO A;  3H1L H;  4DW0 A;  2D3O W;  1YVW A;  1MMM A;  5BR8 O;  1K3E A;  1MA1 A;  4I0X A;  4UCV A;  3E8B A;  1OCO B;  4EKW A;  4BIU A;  4ZI7 B;  4PL9 A;  3CRK A;  4RAI A;  1ROP A;  4H44 B;  4JYY A;  1BQZ A;  4DV1 O;  1KKD A;  4KTN A;  3X2Q B;  2Y69 B;  1PV0 A;  3JD1 A;  1A32 A;  2QG2 A;  5GTI Z;  2BOB C;  3R4N A;  2HKO A;  1UYK A;  4LPB A;  1NZ6 A;  4L87 A;  2WI1 A;  2YEG A;  4N23 A;  1UYH A;  5J2T B;  1HR0 B;  1NR1 A;  3ABU A;  5CTY A;  3L74 H;  3K08 A;  4LP0 A;  3T1H B;  3K9S A;  4L93 A;  2YKJ A;  4PU9 A;  1I0H A;  5EBL C;  1IBK B;  4NR1 A;  3KZI Z;  5EK0 A;  1ZL8 B;  4UCT A;  4JI7 O;  2YI5 A;  3KG2 A;  4YY3 B;  1CXZ B;  1L1F A;  3DSQ A;  2WEQ A;  4BIO A;  3LPS A;  2GHY A;  2P4K A;  3OWD A;  3UM7 A;  3JSL A;  3QF7 A;  1TVK B;  4E02 A;  3E8H A;  4FLX A;  1OSF A;  3ZMS A;  4O4L A;  3MD0 A;  4X20 B;  4RWU A;  5JEN A;  4DV7 O;  3BAA A;  1SQV H;  4MPE A;  1M56 C;  2ZIM A;  2E5L O;  5LP6 B;  3QDD A;  1WPB A;  1U2O A;  1IBM B;  4ASB A;  3K3W A;  4MVQ A;  3LDD A;  2YIC A;  2YIB D;  3WG7 B;  1R3J C;  4JI0 O;  2E3C A;  1VP7 A;  2IWX A;  2E76 B;  5LBQ A;  1FD9 A;  1K9M W;  4ZKI A;  1Y4M A;  3BEH A;  1YT0 A;  1GTO A;  2Q5Z A;  4CWO A;  2YKE A;  3TXQ A;  1YJW V;  1FFX A;  1I7F A;  3CXH F;  5C8Y B;  4FCP A;  2F23 A;  2ZBK B;  5JWP A;  4JI8 O;  1H2G A;  2G38 A;  2MK3 A;  3UT5 A;  3WB0 A;  4DR5 B;  4YKY A;  5LHH A;  1GRJ A;  4ASU G;  3AG1 B;  1HNW B;  4FM0 A;  2FKX A;  4PRX A;  2BU8 A;  4CWQ A;  1S76 D;  1Q81 W;  4LF6 O;  4B7K A;  2Q4P A;  1D5A A;  1OCC C;  4J41 A;  4DV5 B;  4PDM A;  4LWS A;  5KX5 A;  2A79 B;  4B3S O;  4TV8 A;  1D2D A;  1V54 C;  1NKD A;  4GYC B;  2OIG A;  4DUH A;  5JH7 A;  2ZR3 A;  3EHB B;  4PEL A;  2YEH A;  3LNU A;  1GKX A;  1GKF A;  3PN1 A;  1VQ8 V;  3ETD A;  2NNU A;  1ZW9 A;  4CWF A;  1FXH A;  3SYP A;  1SQG A;  1THN A;  2GUZ A;  2IJK A;  2JGD A;  1SQF A;  3HPL C;  2Q69 A;  4WUD A;  1BQ0 A;  5CB4 B;  2RMK B;  2P7T C;  4PA4 A;  2XDK A;  3OMN B;  1BL8 A;  5KHJ A;  4MTG A;  2BU5 A;  1ZXM A;  2QM7 A;  1EZV H;  4MTF A;  5LMN B;  3T1K A;  1KU9 A;  1D5N A;  2WLN A;  2AHZ A;  1E1Q G;  3HKC B;  2P90 A;  1BS3 A;  1I5B A;  5BMV B;  4U93 A;  4JTD B;  3TK1 A;  1IUR A;  3L70 H;  4E72 A;  3BCC H;  2ZQM A;  3CRR A;  3OUF A;  3D3I A;  3D36 C;  3D2R A;  1S14 A;  1MAB G;  1YSZ A;  4L94 A;  3EVK A;  2UUC O;  1WAZ A;  1JX9 A;  4L90 A;  1R73 A;  3CSX A;  4DV1 B;  1ZXN A;  3HB3 B;  1AH8 A;  1PVG A;  1I5Y A;  1TAE A;  1BYQ A;  3U10 A;  3O2F A;  4TQF A;  1UPG A;  2EIJ C;  4CZZ A;  2XAB A;  5H9C A;  1NH2 B;  2O57 A;  2OT5 A;  3FT8 A;  5K1X A;  3K58 A;  4KFG A;  4BIZ A;  1SF9 A;  4I55 A;  1KQS U;  5LYJ B;  3RGB A;  1OHH G;  3QG5 A;  1F4M A;  5B3S B;  2ZE5 A;  3GWK C;  3AG3 B;  3I55 V;  4AS9 A;  4JZ2 A;  2PGG A;  4KXR A;  3H01 A;  3WQ9 A;  2DWD C;  2B1G A;  2YE8 A;  3WHA A;  1K7D A;  3UQ8 A;  4GX1 A;  4HYM A;  5CN0 A;  4BW9 A;  5DN6 G;  4ZI7 A;  5JCO A;  1F7Y A;  3CCM V;  3EHG A;  4DV7 B;  2ZDX A;  2HVJ C;  2HJF C;  2CTR A;  4DW1 A;  4XIQ A;  2E5L B;  2OTJ V;  5B66 Z;  2BOC C;  1Z5B A;  1E1R G;  2RNB A;  4ABM A;  4LBE C;  3G6B A;  2X6A A;  4YKZ A;  1ARO P;  3HKE B;  3FV5 A;  2F4V B;  1ZSP A;  3A0H Z;  4BWA A;  2KG7 B;  3AG2 B;  1VQ9 V;  3E35 A;  2Z0A A;  3MHS C;  5E1A C;  4W4L A;  5D7C A;  4HZ5 A;  3K79 A;  1AJ6 A;  2YED A;  5CF0 A;  5GON B;  1QBZ A;  3U67 A;  3FYI B;  1UYF A;  1UFI A;  1ZL8 A;  4JI8 B;  4YKX A;  3IAY A;  1J5E B;  3MAQ A;  3QO8 A;  2IWS A;  2JS3 A;  2QDO A;  3T2S A;  1NHH A;  1Z59 A;  3U2D A;  2BU6 A;  1OCZ C;  4NH7 A;  1OZ0 A;  3SPJ A;  1TVK A;  3W7S A;  3S5T A;  4MW8 A;  2YK9 A;  2OTL V;  4MPN A;  3AK2 A;  4LF6 B;  2WWW A;  3GWO A;  3K60 A;  2FWZ A;  1QU7 A;  5LP6 A;  2QTS A;  2PUS A;  4ZHQ B;  1F4N A;  2EZO A;  4LFA O;  2UXX A;  5JCO C;  2DWE C;  4P9O A;  3QO7 A;  4LWE A;  2GFD A;  2RCV A;  4XKA A;  2XTA A;  5H6Q A;  3QTC A;  5HFM A;  1JR9 A;  4XDL A;  1MSD A;  2VS0 A;  3OGI B;  4EFT A;  3H80 A;  3CE2 A;  3CRC A;  4H85 A;  1SQX H;  3ZN0 A;  2Y48 A;  3HKB B;  4O07 A;  4J9Z B;  1YER A;  4KQV A;  3BHP A;  1YTF D;  4GX0 A;  1M56 B;  5FPR A;  3OW6 A;  1XOU A;  1B63 A;  2N05 A;  4JF3 A;  4NH8 A;  4CBC A;  3K59 A;  2XAQ A;  3IFX A;  5J2U A;  3RLR A;  2YEJ A;  4DUY B;  4O09 A;  3TUH A;  3ZHU A;  5KHK A;  2XJG A;  2YXY A;  5H6R A;  2KKW A;  3RVZ A;  2HG1 A;  4O2B B;  1AM1 A;  2JDI G;  1KZN A;  1UYL A;  4ASF A;  2UXD B;  2XX2 A;  1H7S A;  3S3X A;  4KP4 A;  3HZ1 A;  2GBO A;  1MSW D;  1YC1 A;  2JVD A;  2YE2 A;  4O4H B;  4B3R O;  2BRC A;  1RFY A;  3VHD A;  1W0K G;  4ZIB A;  4URN A;  2X0L A;  4H37 A;  2CCU A;  1PM9 A;  2BE3 A;  3UKM A;  1YT2 A;  4DZY A;  4YKQ A;  4HAM A;  2XUM A;  1XQ8 A;  1PNM A;  2XDL A;  1N8R W;  2CK3 G;  3H1I H;  4R1F A;  5CA0 B;  4F4L A;  3QTF A;  1OCC B;  4CH3 A;  4WFE A;  2DQ3 A;  1H2S B;  3BPZ A;  1JM6 A;  1XHX A;  4MB9 A;  2N74 A;  5A2Q N;  3CME V;  5CA1 B;  1Q82 W;  1YIT V;  1WB7 A;  3BM9 A;  4V25 A;  3OT7 A;  1V54 B;  2AXT Z;  1TID A;  4TOI A;  1R62 A;  2YE3 A;  2XT9 A;  1ZWI C;  1AP6 A;  4JPR A;  2ITC C;  3HKC A;  2Q7E A;  3EFF K;  4I9Q A;  1FPO A;  1J95 A;  3D8C A;  1TGO A;  2H94 A;  1RP3 B;  5BMV A;  3GIG B;  1SS3 A;  3E89 A;  4X65 O;  3U2K A;  2E0A A;  1LUV A;  4GQT A;  4B08 A;  4X64 O;  2WI6 A;  3FB7 C;  5IWA B;  3TJT A;  1XMO O;  2XK2 A;  4LF9 O;  4DR7 O;  4QE7 A;  1QR9 A;  1N32 O;  1K92 A;  4KUM A;  3ZRW B;  1SA0 B;  4E4E A;  1BT8 A;  3LSS A;  4W7T A;  4WUB A;  2XCM A;  1Y6X A;  4GCZ A;  1YHQ V;  5M4K A;  2Z3Y A;  4F6R A;  4EM7 A;  2VQE O;  4C7U A;  1FJG O;  1G4Y B;  4XDJ A;  2CDY A;  4GGL A;  2Q8H A;  1DF5 A;  4YKU A;  1QLE C;  4J9Y B;  4UCU A;  1GJV A;  1WA8 B;  5LYJ A;  2WA3 A;  5B1O A;  3CC4 V;  1VF6 C;  1IBL O;  2YGA A;  1AVM A;  5KA5 A;  4PRV A;  1O9G A;  2RDC A;  4PA6 A;  4PI0 A;  2K5B A;  4DUZ O;  3S3W A;  3TET A;  1M90 W;  5KA6 A;  5IN9 A;  4CWR A;  4DO2 A;  1WP8 A;  4Z1V A;  2ZIO A;  2QM4 A;  2QM8 A;  3SJB C;  2DE0 X;  3SJC C;  2YE7 A;  2EIJ B;  1XNQ O;  4I3H A;  2AKP A;  4UVB A;  4JTC B;  1N36 B;  1G1X B;  3HKD B;  2CCS A;  1US6 A;  2GUZ B;  2B1I A;  3LSU A;  4AQY O;  5CPH A;  3EXA A;  2QWP B;  4NXM O;  3HKE A;  3TXS A;  3ZCC A;  4LFA B;  3AK1 A;  1NTZ H;  2VQF B;  2P22 C;  2QJ1 A;  4MTX A;  3K03 A;  4XTJ A;  2DQ0 A;  2QG0 A;  4UV9 A;  1R3I C;  4YKR A;  4NTW A;  5GON A;  1P7G A;  3H1K H;  5C93 A;  3A0Z A;  4PI2 A;  3OTF A;  3ABM C;  1H2M A;  5H5N A;  2UUA B;  4EEH A;  2R9A A;  4PDR A;  2V7Q G;  1X59 A;  3N2G B;  2Q73 A;  4I50 B;  2ZM6 B;  3CYG A;  2WLI A;  2JKI A;  2AGA A;  3T1C A;  1JFF B;  2DYS C;  1RPR A;  2EUL A;  1GM7 A;  1S72 V;  2C1G A;  2ZE6 A;  2UXC O;  1HNX O;  5L3B A;  4OGQ B;  4X66 O;  5FNC A;  4JI5 B;  3ZRS A;  3AEI A;  2WI2 A;  5FNV A;  4MP2 A;  4DV6 B;  4MPC A;  1UY9 A;  3Q4H B;  1EZJ A;  2IU0 A;  3RLP A;  2RJZ A;  1I08 A;  3FD9 A;  4FLT A;  2Y4T A;  4EEQ A;  2ESA A;  4XIR A;  4I55 B;  1XHZ A;  4YKT A;  3A0W A;  3T1Y O;  2BZ5 A;  1I5C A;  1OCZ B;  3R66 A;  1ENV A;  5KMG B;  4CE3 A;  4K35 A;  3HKB A;  1KC8 W;  2QTO A;  3GIF A;  1B6Q A;  4JI6 O;  3VQW A;  5D6Q A;  1V55 C;  4BQG A;  5FWK A;  2IU3 A;  3DTU B;  3M7M X;  3NMQ A;  3B2E E;  1AR4 A;  1SES A;  5EBW C;  3Q5K A;  1BMF G;  2VWJ A;  3PEJ A;  4NB5 A;  2CH4 A;  2CUG A;  1YTF B;  4O2B A;  2WI4 A;  1QHT A;  1ZX3 A;  1SET A;  2YE6 A;  2YSU B;  3CJH A;  3CXC U;  2QGN A;  4QPJ A;  4JQL A;  3T2M A;  1W59 A;  3CCE V;  2DW4 A;  1N0J A;  2WA4 A;  4X65 B;  3CC2 V;  3VQY A;  3A0X A;  1UYC A;  3FB6 C;  2LFS A;  4UXN A;  4X64 B;  1IX9 A;  3BA8 A;  1JJO A;  4O4H A;  3WU2 Z;  1TH8 A;  4CWS A;  5LMU B;  1XEQ A;  2YEC A;  3OW2 U;  1YCI A;  2H8P C;  1YC3 A;  2L35 A;  4HY1 A;  3E8F A;  3RN4 A;  4UCO A;  2XDS A;  1SQP H;  2JS5 A;  4KL1 A;  4X88 A;  1QY8 A;  4UFZ A;  1BE3 H;  5LOV A;  2PF4 E;  4JI4 O;  4ZVI A;  3ASN C;  4CH6 A;  4LF8 O;  5IDM A;  2VQE B;  5CA0 A;  1FXK C;  5D5Q A;  4K0K O;  1Q7Y W;  3ZHS A;  3B8N A;  1B04 A;  5LGT A;  1S16 A;  4U7O A;  2B5U A;  2QR4 A;  2Q6A A;  3CCJ V;  3B26 A;  5CA1 A;  3NXS A;  3HR0 A;  4Q20 A;  4LWF A;  3P3P A;  4NTY A;  4NXN B;  2WI7 A;  4LF7 O;  1IBL B;  2FXS A;  1R6T A;  2C1I A;  2HJD A;  4GFN A;  1XDC A;  3GIG A;  2XAH A;  1PP9 H;  2Q7G A;  4DUZ B;  3F5T A;  4I4T B;  5FL7 G;  3K0D A;  1F51 A;  5LHG A;  1MNG A;  4IGG A;  4FCR A;  3AG4 C;  4H7Q A;  3ZRW A;  1SA0 A;  2Y0P A;  2CAZ C;  1W0J G;  5IJ0 A;  1XIL A;  4GT8 A;  2W0F C;  5K1P A;  2BT0 A;  1UYE A;  4QE9 A;  4NXM B;  1K97 A;  4MOT A;  4P8O A;  1I59 A;  2EIL C;  3DC6 A;  5KUK A;  2UXB O;  1ZWH A;  2PYJ A;  2WAM A;  1M93 A;  2WI3 A;  1H7U A;  3EHH A;  1OCR C;  1M57 C;  3CYO A;  5J2U B;  2XND G;  3VQX A;  3J80 N;  1WA8 A;  3G80 A;  4MVO A;  1NBM G;  4DR1 B;  1YET A;  3OEE G;  4WFG A;  3D36 A;  1BGQ A;  1L0O A;  5IYD O;  4G28 B;  1XMQ O;  2WEP A;  4MT8 A;  1NHI A;  5M4N A;  2X7R B;  3OPD A;  3ZHV A;  5BOD A;  4PV1 B;  4BAE A;  3JSN A;  3TZ0 A;  2ZD9 A;  3IGA C;  4CWT A;  4X66 B;  3G67 A;  3AG7 A;  3HKD A;  3CB2 A;  4AIL C;  1YF2 A;  1QLE B;  4J80 A;  3L71 H;  2WPD G;  1PPJ H;  3OTO B;  3ZMU A;  2CCT A;  1AR5 A;  1DLB A;  4XCJ A;  3CRM A;  3T1Y B;  4DK0 A;  2W0X A;  5CTX A;  4TSF G;  3ZXO A;  2HCH A;  1UYG A;  4DV2 O;  4J42 A;  4O4J B;  2YI8 A;  4JI6 B;  3D0B A;  4X1I A;  4LF4 B;  1KEC A;  2FL4 A;  5KHH A;  3N2G A;  1EI1 A;  4I50 A;  2JEU A;  3T4D A;  1JFF A;  2DMX A;  3L72 H;  3SDL A;  1AJP A;  3ETQ A;  5BR8 B;  2YEE A;  1Y74 A;  1JA8 A;  4OPH A;  3G7B A;  1UY8 A;  3Q4H A;  4F6R B;  1W2B U;  2QKS A;  3ZMT A;  4PD4 F;  4JAS A;  2UU9 O;  2V1D A;  3CWB H;  3T10 A;  1Y8P A;  3ABM B;  1AJN A;  4MTO A;  3ZM7 A;  4D7S A;  3K5N A;  2LGW A;  1VAR A;  4Z2W A;  3OEH G;  3I5D A;  2OIE A;  3G6E V;  4D6T H;  4XIT A;  2DYS B;  4UVA A;  1BXD A;  3THO A;  4P2Z A;  3VBB A;  4EGI A;  2JJC A;  2NN4 A;  2LW1 A;  2ZR2 A;  3BVO A;  4JI4 B;  5KMG A;  5JJE B;  4JI7 B;  2ZKJ A;  4LH6 A;  4WUC A;  4XDM A;  4K0K B;  2HHI A;  2FWY A;  2ZT9 B;  3K5O A;  4JI3 O;  3O6O A;  5DM6 V;  2YDE A;  1NTK H;  2A0L A;  1KD1 W;  2KB1 A;  2ITD C;  1PNK A;  1EA6 A;  2RN9 A;  4R3M A;  1FXV A;  3O9O A;  3W7U A;  3CPW U;  2ZCE A;  1US7 A;  3F5W C;  5JJJ B;  4DR6 O;  4H0L B;  3RYI A;  4GKK O;  3ICX A;  4PDL A;  2XD6 A;  5ITZ A;  5IY5 C;  2YEV A;  5LXT B;  4MSW C;  1E79 G;  1QVF U;  3ZX6 A;  4JI0 B;  2IOR A;  1TIL A;  5B1A C;  1FAF A;  3C90 A;  3AK3 A;  1V55 B;  2ZKO A;  2QA4 V;  2YEB A;  2IJH A;  1Z5C A;  2DN9 A;  4N21 A;  5KLV H;  1AB3 A;  1H8E G;  2YXL A;  4K8Z A;  2WLK A;  3UCS C;  2UUB O;  1JQ0 A;  4FFB B;  4EMV A;  2YEA A;  1ZLZ A;  4A5U B;  2UXB B;  2E74 B;  2WLI B;  5L3F A;  4FVM A;  1SQQ H;  3APO A;  2QKC A;  1H2N A;  2NR5 A;  2H55 A;  4RUF A;  5B5E Z;  2JK5 C;  3VHA A;  4DR2 O;  4NYK A;  3LMM A;  2Q2E B;  4J11 A;  2HHH O;  5FNV B;  1Q6U A;  3E2E A;  1XMQ B;  4B3S B;  1OJH A;  1WN7 A;  1NS1 A;  2QWO B;  2X6B A;  1B62 A;  2YI0 A;  1SQB H;  3L75 H;  4I4T A;  2IOP A;  3LDE A;  2YE9 A;  3ASN B;  2CH7 A;  3STZ C;  4P7A A;  4CE1 A;  4JGS A;  1FXK B;  4HYP A;  1XL4 A;  1K5S A;  1P49 A;  4I5S A;  2FML A;  1UJW B;  1Y66 A;  3C3S A;  5M4E A;  1XNR O;  1TC0 A;  3LNN A;  3QVN A;  1QR8 A;  2XHR A;  2Q8V A;  4DR4 O;  1GAX A;  4GT1 A;  2LGQ A;  5IYZ B;  2XOK G;  1F23 A;  3O65 A;  3FT5 A;  2AZ0 A;  3ZHT A;  1DK1 A;  3RVY A;  2O1V A;  5BXZ A;  3ZMZ A;  1FYJ A;  2ETN A;  2F43 G;  4LNU B;  4LFC O;  2FB5 A;  4HY6 A;  2OCH A;  3M8A A;  1GO3 F;  3ZS8 C;  3CJH B;  3AG4 B;  1N4C A;  4F6E A;  3ZHQ A;  1QQC A;  3OFN G;  1SKV A;  4IIJ B;  5IYC O;  1YI2 V;  2ARH A;  3PEH A;  4LF5 O;  1YSC A;  3RKZ A;  2XAG A;  1V9P A;  2XJX A;  5EIB C;  4U3J B;  4LR3 A;  2YKC A;  2H3O A;  1R3L C;  2UUC B;  1WP7 A;  2EIL B;  4KHP O;  3OMI B;  4GUN A;  3ZKB A;  3W7X A;  1N34 O;  3W7T A;  2ODM A;  1OCR B;  1M57 B;  3ZKD A;  1S3J A;  1H2L A;  5LOV B;  3B8M A;  4HBN A;  4JI2 O;  3L9D A;  2ZDI C;  1Y67 A;  4GLX A;  2AHY A;  4QIW F;  4D7T A;  2UU9 B;  5EIB D;  1VF6 A;  2CE4 A;  1S77 D;  4X62 O;  2H8M A;  4WFA V;  1U0Z A;  4I9W A;  3E22 A;  1Q3E A;  3GB7 C;  3JAS B;  3A0R A;  2PTM A;  3APQ A;  4X1K A;  4JI1 O;  2LQT A;  3TCU A;  3JCZ A;  3BAB A;  3H1J H;  3JAW A;  3R92 A;  4O4J A;  2YGF A;  1PL0 A;  1EN6 A;  5IYB O;  3N2K B;  4JI3 B;  1YC4 A;  3KCX A;  2QWQ B;  2CTP A;  3ZRX A;  1EFR G;  4LFB O;  2YJX A;  4QNH B;  3J7A U;  4HNA B;  4LCU C;  2A3Q A;  5LGU A;  3CCV V;  2FYU H;  1Y4U A;  1AIL A;  3CMA V;  5IT9 N;  3ZED A;  1SC5 B;  2GTA A;  1NTM H;  5IJ0 B;  3B25 A;  1WNS A;  1RM1 C;  1KP3 A;  2IBZ H;  1XL6 A;  1P84 F;  1AI5 A;  3LUT B;  2EBO A;  1NQT A;  1RSO B;  3CCQ V;  3KE6 A;  1EM1 A;  3K04 A;  5JVD A;  3G4S V;  5KUM A;  2VRZ A;  5L3J A;  2ZIN A;  5D7R A;  4LC1 A;  1KKC A;  5B1B C;  4V26 A;  2EX3 A;  4XCL A;  3C0E A;  4FLU A;  1HR0 O;  2BRE A;  1LR1 A;  2ZE8 A;  4MVR A;  3TZ5 A;  4FIP C;  1L0N H;  2UUB B;  4TQD A;  1IBK O;  2CGF A;  3RT3 C;  1QYE A;  1K4D C;  4J7J A;  3VQV A;  4J7Z A;  4YY3 O;  3IJ4 A;  3A0Y A;  1I94 O;  3IED A;  3SYA A;  1Q86 W;  3UO3 A;  3RBZ A;  4MVZ A;  1TUB B;  1GN3 A;  5J9P C;  1AP5 A;  1MZF A;  2ZXW C;  2HHH B;  3OD4 A;  3CP1 A;  1VQN V;  4XKO A;  4XBF A;  3DC5 A;  2A9H A;  4B7E A;  1JJ2 U;  1S0V A;  1KUQ A;  2WSS G;  4E2L A;  1IBM O;  4OX9 O;  5LXT A;  1L8D A;  2Q68 A;  4PDV A;  4KFM A;  1VF7 A;  1NVP D;  1YZB A;  3MDS A;  5FLX N;  2WLJ A;  2F93 B;  2YEF A;  4PA7 A;  4R3A A;  1CEZ A;  4E00 A;  2B9Z A;  1Q5O A;  2VWC A;  1O9H A;  2R9I A;  4JTA B;  3BRC A;  1M9N A;  4NVP A;  1UY7 A;  4XDK A;  3SR2 C;  3CGY A;  1XNR B;  3M99 B;  1EN4 A;  4FFB A;  4X1Y B;  4LP8 A;  2XHX A;  3OGC C;  4DR4 B;  4FZ1 A;  4FCQ A;  4X1I B;  2OCC C;  5GW7 A;  1GK9 A;  4NH9 A;  1K4C C;  1N33 O;  2YKI A;  3O0I A;  5IY5 B;  2UWD A;  5EYP B;  3ZBH A;  1HNW O;  1VIB A;  4EB6 A;  4YIO A;  4LFC B;  4AWQ A;  1OV9 A;  1Y74 B;  4K8X A;  2W6J G;  3SJQ C;  4XKK A;  5B1A B;  4AI8 A;  1GH6 A;  1GM8 A;  3G75 A;  1PKX A;  5A9G A;  4DV5 O;  2F95 B;  3CCU V;  3ZIA G;  4MVS A;  5JQG A;  2EIK C;  4CS4 A;  2M7W A;  1QVG U;  1BZK A;  2YK2 A;  4MP7 A;  4B3R B;  2YXH A;  3SYC A;  1MZE A;  2Q67 A;  1FXK A;  3SL2 A;  3HYY A;  2HLD G;  5IDJ A;  3TZ2 A;  3VAD A;  1N34 B;  3CC7 V;  3ETG A;  5H2F Z;  1HNZ O;  3E86 A;  4JI2 B;  1AJQ A;  4UCS A;  5KAI Z;  5IYZ A;  3OR7 C;  1QNM A;  2PI4 A;  1JOY A;  4JZG A;  5IJ9 B;  3JAR B;  1I5D A;  1BCC H;  2DJV A;  3P32 A;  4E01 A;  3CWV A;  1NR7 A;  4EFU A;  5M4H A;  3H1H H;  1A4H A;  1YT1 A;  3FB8 C;  5BY1 A;  5CTU A;  2IH3 C;  4Z1M G;  3INX A;  1COW G;  4LNU A;  2HR3 A;  1PL4 A;  3RYI B;  1BHB A;  4LWH A;  3FYE B;  3KCY A;  3ABT A;  3CGZ A;  4UVC A;  5ITZ B;  3JAT A;  4L91 A;  2YEV B;  4GKJ O;  3J81 N;  4IIJ A;  1PNL A;  2BU7 A;  4LFB B;  1BSM A;  2DYR C;  2R9R B;  2QF6 A;  1P4R A;  1TA8 A;  1XMO B;  4U3J A;  3Q5J A;  4FK5 C;  2Q7H A;  1Y76 B;  4DR7 B;  4LF9 B;  1N32 B;  2MW2 B;  4GX2 A;  4HZ0 A;  1VQ7 V;  5EC1 C;  2XHT A;  3SYQ A;  2CGN A;  3FAV A;  3U11 A;  4IYI A;  2XHB A;  3A8T A;  1H38 A;  3JD3 A;  1HWY A;  1THZ A;  4O0B A;  3R91 A;  1JCH A;  1YJ9 V;  1FJG B;  1QLN A;  5GTH Z;  1K33 A;  3B27 A;  1AMW A;  5DEC A;  2YJW A;  1EN5 A;  2NLJ C;  3JAS A;  4MVM A;  5KAF Z;  3JD0 A;  3CHX A;  3H9V A;  1U96 A;  4U7N A;  3UO2 A;  3ZN1 A;  4BXI A;  2VW5 A;  4GX5 A;  1VQK V;  3INW A;  4JV5 O;  4LWG A;  1Q6I A;  2PI5 A;  3N2K A;  3KKY A;  5L3E A;  2KSD A;  3F7V C;  1I94 B;  1VMG A;  4G27 B;  4HNA A;  2XX5 A;  3JCU Z;  4JYC A;  2CH7 B;  4WBN B;  1XNQ B;  1G6U A;  4TV9 B;  2WLH A;  4H33 A;  4PHZ A;  4K3A A;  5EC2 C;  3K98 A;  4GEE A;  3CRL A;  3DXR B;  5F5R A;  1WLE A;  2IW5 A;  3STL C;  4QJF B;  4AQY B;  1K8A W;  1AH6 A;  2GQP A;  2AW9 A;  5D7D A;  3K5M A;  3CD6 V;  1QCE A;  3SPI A;  4OX9 B;  1RSO A;  4TUY A;  4LH7 A;  3DGE A;  3SPC A;  2CTQ A;  2F4V O;  2ATK C;  1R1B A;  4DV4 O;  2EXL A;  4CWN A;  3OE7 G;  1UY6 A;  4G2K A;  4JYB A;  1ID0 A;  5HFL A;  3FX7 A;  3JYC A;  4ZBM A;  4B3M O;  3VOU A;  5EZY A;  4HZ3 A;  4O05 A;  3K9A A;  4OPA A;  2CG9 A;  1ORQ C;  1SZX A;  3WFV A;  2ZDY A;  1J5E O;  1MG1 A;  1RM1 B;  1N33 B;  3ASO C;  1IVS A;  2PYL A;  1H2K A;  3U0Z A;  2UXC B;  1HNX B;  1TUB A;  4MVU A;  4YXW G;  2A06 H;  4WCE V;  3C3T A;  5L3D A;  1JMK C;  2EZP A;  1YXB A;  5B1B B;  3EKO A;  2HVK C;  4B6C A;  4PA9 A;  1AR1 B;  1K73 W;  2WER A;  1BHA A;  2BTO A;  2LFR A;  2YE4 A;  3G7E A;  1NJI W;  2L6L A;  4WFF A;  1SRY A;  5F3K A;  3C11 A;  4YHH O;  1I58 A;  3E22 B;  3G71 V;  3ABK C;  5LGN A;  1GM9 A;  1TBW A;  1HNZ B;  4X1K B;  2JGU A;  1NVP B;  2K1E A;  1HDJ A;  3PJS K;  1DF4 A;  2JJ2 G;  4X1Y A;  3JAW B;  4W4K A;  1MX0 A;  2IH1 C;  2ZXW B;  1UYI A;  3CEI A;  3RWR D;  5M4M A;  4P30 A;  5F2V O;  4RO2 A;  2EJ7 A;  1T5E A;  1WJZ A;  2GV9 A;  5EYP A;  1NU1 H;  3BY6 A;  4DR3 O;  1FKA O;  4IYH A;  1FFT B;  5IE9 A;  4DUY O;  3JAK B; 
#chains in the Genus database with same CATH homology
 2XAS A;  3R65 A;  4KSG A;  1I5A A;  3CCL V;  2C2A A;  4RQF A;  4ASG A;  2GSM B;  5CA3 A;  1YES A;  4MW3 A;  3E83 A;  4QPK A;  1MU5 A;  2OCC B;  3OMA B;  1GMG A;  4WF9 V;  4R7C A;  3K0G A;  2HKJ A;  2Q8I A;  4MBC A;  4JAV A;  4P9P A;  2WLL B;  3B77 A;  1G8M A;  4HXZ A;  2EIK B;  3OM3 B;  5CBG A;  4O04 A;  3OR6 C;  3ZRV A;  1R6K A;  2HG5 C;  2YI6 A;  4X9L A;  2Q8G A;  2BTZ A;  5D6P A;  5FND A;  2EIN C;  2YKB A;  4YKW A;  4H81 A;  2Q8F A;  1CPY A;  3K97 A;  3TTZ A;  3ABL C;  2IJJ A;  4PA3 A;  3RW0 A;  4KSH A;  4L8Z A;  1JVM A;  1Z5A A;  3ETE A;  1TUE B;  2IOQ A;  4URL A;  5M4P A;  2PNR A;  3JD2 A;  2DYR B;  3TZ4 A;  3B28 A;  1VQ4 V;  5J71 A;  1JPX A;  2WI5 A;  4URM A;  2VCJ A;  1B3Q A;  4ASA A;  1S5H C;  4JAU A;  1KP2 A;  2XDU A;  4CWP A;  2YI7 A;  5L3C A;  2ZDI A;  3VHC A;  2EIM C;  1VQM V;  1YS3 A;  5CTW A;  5B1N A;  2BYH A;  3FKS G;  4LWI A;  2IJI A;  3ZMV A;  5EBM C;  3ZXQ A;  2O1W A;  3T4Z A;  4RQE A;  1OCO C;  3OUS A;  2BSM A;  2BYI A;  3X2Q C;  2Y69 C;  1K34 A;  5CMU A;  4XD8 A;  5CBH A;  1DTO A;  3P30 A;  1MOF A;  4B7P A;  3LDC A;  4EGK A;  1TC6 A;  2FTK A;  1QZR A;  1UYM A;  4WFH A;  4UV8 A;  1H8H G;  4FPP A;  2JEX A;  4R6Z A;  2X6C A;  5L3G A;  5FNF A;  3T0Z A;  2WLM A;  2EJR A;  3HYZ A;  3OWB A;  2QEX V;  4AWO A;  3QNE A;  3SYO A;  2YE5 A;  3W7W A;  3OMU A;  3ZJZ A;  3ASO B;  1VQ6 V;  4WFB V;  3WG7 C;  3HEK A;  2XAF A;  4DXW A;  3I56 V;  4TT3 G;  4CE2 A;  4BQJ A;  3SPG A;  3HZ5 A;  3SPH A;  2QE7 G;  1LNQ A;  4R50 A;  5BZB A;  3Q5L A;  4XIP A;  2LP7 A;  2P67 A;  3R4M A;  3ABK B;  3AG1 C;  2XX4 A;  2JJ1 G;  3A0T A;  4AWP A;  3EHJ A;  2YGE A;  3JD4 A;  1AI6 A;  2BU2 A;  1GKZ A;  3OAA G;  3CCR V;  3B24 A;  5BOC A;  1P7B A;  3MNR P;  3IC7 A;  3T0H A;  5J6A A;  2IWU A;  1VQP V;  2WLL A;  1WPX A;  4URO A;  2FYP A;  1EBO A;  3JZ3 A;  1SER A;  4FMT A;  1KIJ A;  5LHI A;  2O1U A;  3E8G A;  4UUJ C;  1K5Q A;  1NHJ A;  2XAJ A;  1YSR A;  3FB5 C;  4BW5 A;  1AI7 A;  2YEI A;  1I5X A;  2Z5U A;  4K4O A;  2QFO A;  3CCS V;  3R4P A;  4X89 A;  1VQ5 V;  1VQL V;  4RUE A;  1Y8O A;  2VCI A;  4MS2 A;  4X8A A;  1R3K C;  4HXW A;  4FJC C;  3K06 A;  1SZT A;  3F7Y C;  1PD3 A;  2W6I G;  4BAY A;  4EGH A;  1BKN A;  2EIN B;  1UYD A;  1Y4S A;  1AI4 A;  3MHH C;  1YIJ V;  3R4O A;  3H4L A;  3LNM B;  3LSQ A;  2P6J A;  3ABL B;  3EHF A;  3GIE A;  4OXS A;  5B3S C;  2XDX A;  3AG3 C;  3BMY A;  2HFE C;  1NH2 D;  2UXN A;  5CBF A;  2XJJ A;  3RLQ A;  1Y8N A;  3QO5 A;  4XC0 A;  3HHU A;  1YJN V;  3K99 A;  3ML0 A;  4HYO A;  5GGZ A;  4TWK A;  1VQO V;  1R6N A;  1M1K W;  2EIM B;  3AG2 C;  4XE2 A;  1IXM A;  2JIZ G;  1FS0 G;  4R8C A;  3EKR A;  1CP9 A;  1RPO A;  2D3O W;  1K3E A;  4PL9 A;  1OCO B;  3E8B A;  4BIU A;  4EKW A;  3CRK A;  4RAI A;  1ROP A;  1KKD A;  4KTN A;  3X2Q B;  2Y69 B;  3JD1 A;  2QG2 A;  2BOB C;  3R4N A;  2HKO A;  1UYK A;  4LPB A;  4L87 A;  2WI1 A;  2YEG A;  4N23 A;  1UYH A;  1NR1 A;  3ABU A;  5CTY A;  3K08 A;  4LP0 A;  4L93 A;  2YKJ A;  4PU9 A;  5EBL C;  5EK0 A;  2YI5 A;  3KG2 A;  1L1F A;  2WEQ A;  3LPS A;  2GHY A;  3OWD A;  3UM7 A;  4E02 A;  3E8H A;  1OSF A;  3ZMS A;  3MD0 A;  4MPE A;  1M56 C;  3QDD A;  1U2O A;  4ASB A;  3K3W A;  4MVQ A;  3LDD A;  3WG7 B;  1R3J C;  2IWX A;  5LBQ A;  1K9M W;  4ZKI A;  1Y4M A;  3BEH A;  1YT0 A;  1GTO A;  4CWO A;  2YKE A;  1YJW V;  4FCP A;  2ZBK B;  1H2G A;  2MK3 A;  4YKY A;  5LHH A;  4ASU G;  3AG1 B;  4PRX A;  2BU8 A;  4CWQ A;  1S76 D;  1Q81 W;  1OCC C;  4PDM A;  2A79 B;  1V54 C;  1NKD A;  4DUH A;  2ZR3 A;  3EHB B;  4PEL A;  2YEH A;  3LNU A;  1GKX A;  1GKF A;  1VQ8 V;  3ETD A;  2NNU A;  1ZW9 A;  4CWF A;  1FXH A;  3SYP A;  1THN A;  2IJK A;  3HPL C;  2Q69 A;  4WUD A;  2P7T C;  4PA4 A;  2XDK A;  3OMN B;  1BL8 A;  4MTG A;  2BU5 A;  1ZXM A;  2QM7 A;  4MTF A;  3T1K A;  2WLN A;  2AHZ A;  1E1Q G;  2P90 A;  1I5B A;  4U93 A;  4JTD B;  3TK1 A;  2ZQM A;  3OUF A;  3D3I A;  3D2R A;  1S14 A;  1MAB G;  1YSZ A;  4L94 A;  1JX9 A;  4L90 A;  1R73 A;  1ZXN A;  3HB3 B;  1AH8 A;  1PVG A;  1I5Y A;  1BYQ A;  3O2F A;  2EIJ C;  4CZZ A;  2XAB A;  5H9C A;  1NH2 B;  2OT5 A;  3FT8 A;  4KFG A;  4BIZ A;  1KQS U;  1OHH G;  1F4M A;  5B3S B;  3AG3 B;  3I55 V;  4AS9 A;  3H01 A;  3WQ9 A;  2DWD C;  2B1G A;  2YE8 A;  3WHA A;  1K7D A;  4GX1 A;  4HYM A;  5CN0 A;  5DN6 G;  3CCM V;  3EHG A;  2ZDX A;  2HVJ C;  2HJF C;  4XIQ A;  2OTJ V;  2BOC C;  1Z5B A;  1E1R G;  4LBE C;  2X6A A;  4YKZ A;  1ARO P;  3FV5 A;  1VQ9 V;  3AG2 B;  3E35 A;  3MHS C;  5E1A C;  5D7C A;  4HZ5 A;  3K79 A;  1AJ6 A;  2YED A;  5CF0 A;  1QBZ A;  3U67 A;  3FYI B;  1UYF A;  4YKX A;  3QO8 A;  2IWS A;  3T2S A;  1NHH A;  1Z59 A;  3U2D A;  2BU6 A;  1OCZ C;  4NH7 A;  1OZ0 A;  3SPJ A;  3W7S A;  4MW8 A;  2YK9 A;  2OTL V;  4MPN A;  2WWW A;  3GWO A;  3K60 A;  2FWZ A;  1F4N A;  2EZO A;  2UXX A;  2DWE C;  4P9O A;  3QO7 A;  4LWE A;  2GFD A;  4XKA A;  5H6Q A;  5HFM A;  4XDL A;  4EFT A;  3H80 A;  4H85 A;  3ZN0 A;  2Y48 A;  4O07 A;  4J9Z B;  1YER A;  4KQV A;  1YTF D;  4GX0 A;  1M56 B;  3OW6 A;  1B63 A;  4JF3 A;  4NH8 A;  4CBC A;  2XAQ A;  3IFX A;  3RLR A;  2YEJ A;  4O09 A;  3TUH A;  2XJG A;  5H6R A;  3RVZ A;  2HG1 A;  1AM1 A;  2JDI G;  1KZN A;  1UYL A;  4ASF A;  2XX2 A;  1H7S A;  4KP4 A;  3HZ1 A;  1MSW D;  1YC1 A;  2YE2 A;  2BRC A;  3VHD A;  1W0K G;  4URN A;  2X0L A;  4H37 A;  2CCU A;  4DZY A;  3UKM A;  1YT2 A;  4YKQ A;  4HAM A;  1PNM A;  2XDL A;  1N8R W;  2CK3 G;  4R1F A;  4F4L A;  3QTF A;  1OCC B;  4WFE A;  2DQ3 A;  1JM6 A;  4MB9 A;  3CME V;  1Q82 W;  1YIT V;  3BM9 A;  4V25 A;  1V54 B;  1TID A;  1R62 A;  2YE3 A;  1ZWI C;  4JPR A;  2ITC C;  3EFF K;  1J95 A;  2H94 A;  3GIG B;  3E89 A;  3U2K A;  2E0A A;  4GQT A;  2WI6 A;  3FB7 C;  2XK2 A;  4QE7 A;  1QR9 A;  1K92 A;  4KUM A;  3ZRW B;  3LSS A;  4W7T A;  4WUB A;  2XCM A;  4GCZ A;  1YHQ V;  5M4K A;  2Z3Y A;  4EM7 A;  1G4Y B;  4XDJ A;  4GGL A;  2Q8H A;  1DF5 A;  4YKU A;  1QLE C;  4J9Y B;  1GJV A;  5B1O A;  3CC4 V;  2YGA A;  5KA5 A;  4PRV A;  4PA6 A;  2K5B A;  3TET A;  1M90 W;  5KA6 A;  5IN9 A;  4CWR A;  4DO2 A;  2QM8 A;  2YE7 A;  2EIJ B;  4I3H A;  2AKP A;  4UVB A;  4JTC B;  2CCS A;  2B1I A;  5CPH A;  3ZCC A;  4MTX A;  3K03 A;  4XTJ A;  2DQ0 A;  2QG0 A;  4UV9 A;  1R3I C;  4YKR A;  5C93 A;  3A0Z A;  3ABM C;  4EEH A;  4PDR A;  2V7Q G;  2WLI A;  2JKI A;  3T1C A;  2DYS C;  1RPR A;  1GM7 A;  1S72 V;  5L3B A;  5FNC A;  3ZRS A;  3AEI A;  2WI2 A;  4MP2 A;  4MPC A;  1UY9 A;  1EZJ A;  2IU0 A;  3RLP A;  2ESA A;  4XIR A;  4YKT A;  3A0W A;  2BZ5 A;  1I5C A;  1OCZ B;  1ENV A;  4CE3 A;  1KC8 W;  2QTO A;  3GIF A;  1B6Q A;  5D6Q A;  1V55 C;  4BQG A;  5FWK A;  2IU3 A;  3DTU B;  3NMQ A;  1SES A;  5EBW C;  3Q5K A;  1BMF G;  3PEJ A;  2CH4 A;  1YTF B;  2WI4 A;  1SET A;  2YE6 A;  2YSU B;  3CXC U;  4QPJ A;  4JQL A;  3T2M A;  3CCE V;  2DW4 A;  3CC2 V;  3A0X A;  1UYC A;  3FB6 C;  2LFS A;  4UXN A;  1TH8 A;  4CWS A;  2YEC A;  3OW2 U;  2H8P C;  1YC3 A;  4HY1 A;  3E8F A;  2XDS A;  4X88 A;  1QY8 A;  4ZVI A;  3ASN C;  5IDM A;  1FXK C;  1Q7Y W;  3B8N A;  5LGT A;  1S16 A;  4U7O A;  2B5U A;  2Q6A A;  3CCJ V;  3B26 A;  3NXS A;  4Q20 A;  4LWF A;  2WI7 A;  2FXS A;  4GFN A;  3GIG A;  2XAH A;  5FL7 G;  3K0D A;  1F51 A;  5LHG A;  4FCR A;  3AG4 C;  4H7Q A;  3ZRW A;  1W0J G;  4GT8 A;  2W0F C;  2BT0 A;  1UYE A;  4QE9 A;  1K97 A;  4MOT A;  4P8O A;  1I59 A;  2EIL C;  5KUK A;  1ZWH A;  2WAM A;  2WI3 A;  1H7U A;  3EHH A;  1OCR C;  1M57 C;  3CYO A;  2XND G;  4MVO A;  1NBM G;  1YET A;  3OEE G;  4WFG A;  3D36 A;  1BGQ A;  1L0O A;  5IYD O;  4G28 B;  2WEP A;  4MT8 A;  1NHI A;  5M4N A;  2X7R B;  3OPD A;  5BOD A;  4BAE A;  3TZ0 A;  2ZD9 A;  3IGA C;  4CWT A;  1QLE B;  2WPD G;  3ZMU A;  2CCT A;  1DLB A;  4XCJ A;  5CTX A;  4TSF G;  3ZXO A;  2HCH A;  1UYG A;  3D0B A;  1KEC A;  1EI1 A;  2JEU A;  3T4D A;  1AJP A;  2YEE A;  3G7B A;  1UY8 A;  1W2B U;  2QKS A;  3ZMT A;  4JAS A;  2V1D A;  3T10 A;  1Y8P A;  3ABM B;  1AJN A;  4MTO A;  3ZM7 A;  3OEH G;  3G6E V;  4XIT A;  2DYS B;  4UVA A;  1BXD A;  4P2Z A;  3VBB A;  4EGI A;  2JJC A;  2ZR2 A;  2ZKJ A;  4WUC A;  4XDM A;  2FWY A;  3O6O A;  5DM6 V;  2A0L A;  1KD1 W;  2KB1 A;  2ITD C;  1PNK A;  1EA6 A;  4R3M A;  1FXV A;  3W7U A;  3CPW U;  1US7 A;  3F5W C;  4PDL A;  2XD6 A;  5IY5 C;  2YEV A;  4MSW C;  1E79 G;  1QVF U;  2IOR A;  1TIL A;  5B1A C;  1V55 B;  2QA4 V;  2YEB A;  2IJH A;  1Z5C A;  4N21 A;  1H8E G;  2WLK A;  1JQ0 A;  4EMV A;  2YEA A;  2WLI B;  5L3F A;  2H55 A;  4RUF A;  2JK5 C;  3VHA A;  2Q2E B;  3E2E A;  1B62 A;  2X6B A;  2YI0 A;  2IOP A;  3LDE A;  2YE9 A;  3ASN B;  4P7A A;  3STZ C;  4CE1 A;  4JGS A;  1FXK B;  4HYP A;  1XL4 A;  1K5S A;  4I5S A;  1UJW B;  1Y66 A;  5M4E A;  1TC0 A;  1QR8 A;  2XHR A;  4GT1 A;  2XOK G;  1F23 A;  3FT5 A;  3RVY A;  2O1V A;  3ZMZ A;  2F43 G;  4HY6 A;  1GO3 F;  3AG4 B;  3OFN G;  5IYC O;  1YI2 V;  3PEH A;  1YSC A;  3RKZ A;  2XAG A;  2XJX A;  2YKC A;  1R3L C;  2EIL B;  3OMI B;  3ZKB A;  3W7X A;  3W7T A;  1OCR B;  1M57 B;  3ZKD A;  1S3J A;  3B8M A;  2ZDI C;  2AHY A;  4QIW F;  1S77 D;  2H8M A;  4WFA V;  1U0Z A;  4I9W A;  3GB7 C;  3A0R A;  3TCU A;  3JCZ A;  3R92 A;  2YGF A;  1PL0 A;  5IYB O;  1YC4 A;  3ZRX A;  1EFR G;  2YJX A;  4QNH B;  4LCU C;  5LGU A;  3CCV V;  1Y4U A;  3CMA V;  3B25 A;  1RM1 C;  1KP3 A;  1XL6 A;  1AI5 A;  3LUT B;  2EBO A;  1NQT A;  3CCQ V;  3KE6 A;  3K04 A;  3G4S V;  5KUM A;  5L3J A;  5D7R A;  4LC1 A;  5B1B C;  4V26 A;  4XCL A;  3C0E A;  2BRE A;  4MVR A;  3TZ5 A;  4FIP C;  2CGF A;  1QYE A;  1K4D C;  3A0Y A;  3IED A;  3SYA A;  1Q86 W;  3RBZ A;  4MVZ A;  5J9P C;  2ZXW C;  3CP1 A;  1VQN V;  4XKO A;  4XBF A;  2A9H A;  1JJ2 U;  1S0V A;  2WSS G;  4E2L A;  2Q68 A;  4PDV A;  4KFM A;  1NVP D;  2WLJ A;  2YEF A;  4PA7 A;  4R3A A;  1CEZ A;  4E00 A;  2VWC A;  2R9I A;  4JTA B;  1M9N A;  1UY7 A;  4XDK A;  3CGY A;  3M99 B;  2XHX A;  4LP8 A;  3OGC C;  4FCQ A;  2OCC C;  5GW7 A;  1GK9 A;  4NH9 A;  1K4C C;  2YKI A;  3O0I A;  5IY5 B;  2UWD A;  4AWQ A;  2W6J G;  3SJQ C;  4XKK A;  5B1A B;  1GM8 A;  3G75 A;  1PKX A;  3CCU V;  3ZIA G;  4MVS A;  2EIK C;  2M7W A;  1QVG U;  2YK2 A;  4MP7 A;  3SYC A;  2Q67 A;  1FXK A;  3SL2 A;  3HYY A;  2HLD G;  5IDJ A;  3TZ2 A;  3VAD A;  3CC7 V;  3ETG A;  3E86 A;  1AJQ A;  3OR7 C;  1JOY A;  2PI4 A;  1I5D A;  3P32 A;  4EFU A;  4E01 A;  3CWV A;  1NR7 A;  5M4H A;  1YT1 A;  1A4H A;  3FB8 C;  5CTU A;  2IH3 C;  4Z1M G;  3INX A;  1COW G;  2HR3 A;  1BHB A;  4LWH A;  3FYE B;  3ABT A;  3CGZ A;  4UVC A;  4L91 A;  2YEV B;  1PNL A;  2BU7 A;  2DYR C;  2R9R B;  2QF6 A;  1P4R A;  3Q5J A;  4FK5 C;  4GX2 A;  4HZ0 A;  1VQ7 V;  5EC1 C;  2XHT A;  3SYQ A;  1H38 A;  3JD3 A;  1HWY A;  1THZ A;  4O0B A;  3R91 A;  1JCH A;  1YJ9 V;  1QLN A;  1K33 A;  3B27 A;  1AMW A;  2YJW A;  2NLJ C;  4MVM A;  3JD0 A;  4BXI A;  4U7N A;  3ZN1 A;  2VW5 A;  4GX5 A;  1VQK V;  3INW A;  4LWG A;  2PI5 A;  5L3E A;  3F7V C;  4G27 B;  2XX5 A;  4JYC A;  2WLH A;  4H33 A;  5EC2 C;  3K98 A;  4GEE A;  3CRL A;  5F5R A;  1WLE A;  2IW5 A;  3STL C;  4QJF B;  2GQP A;  1K8A W;  1AH6 A;  5D7D A;  3CD6 V;  1QCE A;  3SPI A;  3DGE A;  3SPC A;  2ATK C;  4CWN A;  2EXL A;  3OE7 G;  1UY6 A;  4G2K A;  4JYB A;  1ID0 A;  5HFL A;  3JYC A;  4ZBM A;  3VOU A;  4HZ3 A;  4O05 A;  3K9A A;  2CG9 A;  1ORQ C;  2ZDY A;  3WFV A;  1MG1 A;  1RM1 B;  3ASO C;  4MVU A;  4YXW G;  4WCE V;  5L3D A;  2EZP A;  5B1B B;  3EKO A;  2HVK C;  4B6C A;  4PA9 A;  1AR1 B;  1K73 W;  2WER A;  1BHA A;  2LFR A;  2YE4 A;  3G7E A;  1NJI W;  4WFF A;  1SRY A;  5F3K A;  3C11 A;  1I58 A;  3G71 V;  3ABK C;  5LGN A;  1GM9 A;  1TBW A;  1NVP B;  2K1E A;  3PJS K;  1DF4 A;  2JJ2 G;  1MX0 A;  2IH1 C;  2ZXW B;  1UYI A;  5M4M A;  4P30 A;  4RO2 A;  3BY6 A;  1FFT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...