2C2AA

Structure of the entire cytoplasmic portion of a sensor histidine kinase protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
240
Chain Sequence
MENVTESKELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENSOR HISTIDINE KINASE
publication title Structure of the Entire Cytoplasmic Portion of a Sensor Histidine-Kinase Protein.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 81
structure length 240
sequence length 249
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2c2aA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2c2aA02
4Q20A 2WI6A 3DGEA 4U7NA 3HHUA 4O07A 2ESAA 2XX4A 4PU9A 1YT2A 2BZ5A 2YKEA 4XTJA 2WI1A 4K4OA 2IOPA 2YEGA 1YC3A 2QM7A 3NXSA 4XKKA 4L94A 3ZRWB 4EFTA 1BYQA 2IORA 3O0IA 1YT1A 1Y8NA 4UROA 5FNDA 1YERA 2FWYA 4JAVA 2YI7A 2K5BA 2YK2A 1AM1A 1JOYA 3CRKA 3WHAA 4P8OA 2WI3A 5M4KA 2YEHA 4BIUA 4R3AA 3R4MA 4FCRA 1Y4SA 2E0AA 4HZ5A 3A0XA 5B1NA 2XCMA 4BIZA 3TK1A 1UYMA 2IOQA 4GEEA 3R91A 2XDUA 3T10A 1H7UA 3K99A 4WUDA 3TZ0A 5F5RA 2VWCA 2YGFA 4EM7A 2YEIA 3RLQA 2XHTA 3A0RA 4XD8A 4MTXA 3BMYA 2BSMA 3EKRA 2GFDA 1UY7A 2WI4A 3OWBA 4HZ0A 4URNA 2YEAA 4WUBA 3D36A 1Z5CA 2YE6A 2YKCA 2XDLA 2IWUA 5J6AA 1YETA 3INWA 2YGEA 2XX2A 4XCJA 3IEDA 2FWZA 1YC4A 4EMVA 4YKXA 3U2DA 4LWFA 5B1OA 4CWTA 4U93A 4KFGA 2WI7A 2YE8A 4QPJA 3EHJA 3TUHA 4EGKA 2P67A 1TILA 1U2OA 2CCSA 4URMA 2YE9A 1QZRA 4LWIA 1BXDA 1F51A 4CE3A 1H7SA 2JKIA 4JYCA 4BQGA 1TC6A 5M4HA 2XJXA 2YJXA 3A0TA 4YKUA 1GJVA 2PNRA 4HYPA 5BODA 4HY6A 3Q5JA 2ZDYA 2XJGA 2QFOA 2BTZA 3VADA 2HKJA 2XDKA 1Y4UA 3O6OA 4E01A 2Q8IA 1JM6A 2YE4A 4JASA 3D0BA 4L93A 2XX5A 2CCTA 2O1UA 2BU8A 4CWFA 4FPPA 4ASFA 1YT0A 1UY9A 2BU2A 3ZXQA 4LWHA 5F3KA 5FWKA 1EI1A 4R1FA 4BXIA 4LPBA 1NHHA 1TH8A 4W7TA 4KP4A 3T0ZA 4B7PA 3FV5A 2YE2A 4YKQA 1PVGA 1I58A 4CWPA 5CTUA 4HY1A 3OW6A 1AJ6A 1UYFA 4MP2A 3C0EA 1EA6A 4L8ZA 3ZKBA 1R62A 4NH9A 3P32A 4I5SA 2YE5A 1QYEA 2ZBKB 4FMTA 3T1KA 3JZ3A 1UYCA 3CRLA 2YE3A 5CF0A 4GFNA 3ZRWA 1UYGA 3MNRP 4FCQA 1I5CA 4EEHA 2YI5A 1Z5AA 2Q8GA 2AKPA 3T0HA 4H81A 4CWRA 2YGAA 4O04A 3CGZA 4GCZA 4XC0A 2YEDA 3WQ9A 2YEBA 2BRCA 3TZ2A 3GIGB 1Z5BA 1BGQA 4V26A 2YK9A 3EHHA 2YECA 2CG9A 1QY8A 3ZXOA 4MPCA 3KE6A 1UYKA 2YKBA 1Y8OA 2ZKJA 1AMWA 4E02A 4LP0A 4YKYA 2WEQA 1UYIA 3GIGA 2JJCA 2YEJA 3K98A 1ZW9A 1UY8A 4XKOA 2BU5A 4DZYA 4YKZA 3INXA 1S16A 4X9LA 3O2FA 1NHIA 4CWQA 2HG1A 3CWVA 2YI0A 2BT0A 2QM8A 5M4EA 4YKRA 4KTNA 4ASBA 3BM9A 2YI6A 2Q8FA 4URLA 1TC0A 4O09A 4XITA 4AWQA 5M4MA 3ZRVA 5BOCA 1KZNA 4XKAA 4CWOA 4U7OA 4PRVA 4HXZA 1AH8A 2VCJA 3LPSA 3OWDA 4LWEA 4CE2A 1YESA 1UYDA 2XDXA 4EFUA 1TIDA 4XIQA 3TZ5A 3RLRA 1U0ZA 3QDDA 5FNFA 4WUCA 5M4PA 2XDSA 4I3HA 4LC1A 4L90A 1YS3A 4MPEA 4MBCA 2FTKA 4PRXA 4ASGA 3ZM7A 3FT8A 4NH8A 1ZWHA 1ZXNA 5CTYA 5IDMA 1UYLA 3HZ1A 1NHJA 1MU5A 1TBWA 4QPKA 1B3QA 3PEJA 2H8MA 2Q8HA 2QF6A 2XHRA 1OSFA 3Q5LA 2BYHA 4EGIA 1THNA 1I5AA 3HZ5A 4P7AA 5L3JA 1ID0A 3ZCCA 1GKXA 4MP7A 2CH4A 3CGYA 4CWSA 5J71A 4KSGA 2XJJA 1ZXMA 3EKOA 2YJWA 4GT1A 4O05A 4JYBA 3HYYA 1IXMA 3OMUA 5D7CA 2WI2A 1I5DA 2XABA 2QG0A 2H55A 5M4NA 1L0OA 3MD0A 4FCPA 3A0WA 4V25A 5IDJA 2BREA 3A0ZA 3LNUA 3R4NA 4H85A 4JQLA 4AWPA 5D7RA 1UY6A 4XIRA 4XDMA 2YKJA 4YKWA 3R4OA 2FYPA 2XHXA 1Y8PA 4GGLA 3C11A 2CGFA 4GT8A 5IN9A 5FNCA 3GIFA 3RKZA 1I59A 4PL9A 1AH6A 3VHCA 4B6CA 2O1WA 2UWDA 4CWNA 3EHGA 3B28A 4MOTA 4MT8A 2YE7A 3B25A 4O0BA 5D6QA 1B63A 4XE2A 2LFSA 1MX0A 2GQPA 2FXSA 3T2SA 1UYEA 2WI5A 3HEKA 3D2RA 2Q2EB 3B24A 1I5BA 1UYHA 3ZRXA 1GKZA 1YC1A 4KSHA 3R4PA 4BQJA 3B27A 4KQVA 4JAUA 3FT5A 2BU6A 4LWGA 3Q5KA 3K97A 2QG2A 1A4HA 3U2KA 3QTFA 3R92A 3B26A 4XCLA 5C93A 3VHAA 4AWOA 3A0YA 4EGHA 3HYZA 4YKTA 3TZ4A 4ZKIA 4HXWA 3G75A 3U67A 4MB9A 2YEEA 5CTXA 3K60A 1B62A 2YEFA 2CCUA 4HYMA 2YKIA 2VCIA 4MPNA 2BU7A 3EHFA 2VW5A 2WERA 2ZDXA 4H7QA 4GQTA 2XD6A 2WEPA 4XIPA 4R3MA 1Z59A 1YSZA 5D7DA 4E00A 5CTWA 2IWXA 3H4LA 3VHDA 2LFRA 2EXLA 5GGZA 2BYIA 5D6PA 3ZKDA 2WWWA 1YSRA 3PEHA 4DUHA 2IWSA 4NH7A 4AS9A 3G7BA 2O1VA 4ZVIA 1BKNA 2HCHA 3SL2A 4L91A 1S14A 3RLPA 1KIJA 3GIEA 3OPDA 3G7EA 5CPHA 4ASAA 3NMQA 4CE1A 2XK2A 3TTZA 4BAEA 1US7A 2C2AA 3H80A
chains in the Genus database with same CATH superfamily
4Q20A 2OTJV 4L8JA 2OWOA 2VRZA 2F43G 1J95A 2Y69C 3VQWA 4EB6B 4JI5O 3CP1A 3HKBA 3OTFA 1Q90D 1BYQA 2CH7B 1YT1A 1GM9A 1YERA 1MSWD 2F4VO 5J2UB 1KECA 2YI7A 1JOYA 2QWQB 5CBGA 1TUBA 4EB6A 1GN2A 2DQ0A 4HYOA 2R70A 4U3JA 1Y4SA 4HZ5A 4BIZA 3TK1A 3OMAB 4WFAV 5J2UA 3T1CA 4NTXA 3W7UA 2IOQA 2LGQA 1SESA 3T1HB 1H7UA 2YEIA 4I50B 1E79G 2YEVB 1UFIA 4JTDB 1WAZA 3A2FA 3SPJA 3AG1B 2IH3C 1PNMA 1BGYH 1PM9A 3GB7C 3WG7B 3ASNB 3L71H 1UY7A 3B77A 4JZGA 2XT9A 4URNA 2EIKB 1AJNA 3OMNB 2YEAA 2YEVA 3IAYA 1Z5CA 4H44B 1IX9A 5J6AA 1YETA 3ZJZA 4DRXA 1BS3A 3APQA 3U11A 2XX2A 1SQBH 3FD9A 4P9PA 1WB7A 4DW1A 1K73W 4DR4O 2RMKB 1YC4A 4DV0O 4EMVA 2JJ2G 4YKXA 4LWFA 1XHZA 5KUMA 4U93A 4KFGA 2WI7A 3UKMA 1BCCH 2YXYA 3CX5F 3HKDA 3JSLA 3E8HA 4O4IA 5C8YA 5JJEB 4LF7O 2CCSA 2G38A 2YE9A 4URMA 4J9YB 4LP8A 3ZMSA 1NTMH 3W7XA 3OAAG 4HNAA 3MDSA 1WP7A 1TC6A 2XJXA 2LQTA 1N0NA 5BODA 4PA4A 4P9OA 2XJGA 4CH4A 2QFOA 3JAKA 4JPRA 3JD3A 4X62O 1YJNV 3RYHA 3O6OA 1QR9A 4PD4F 1VQKV 4UUJC 2Y69B 4DV6B 4DV3B 4UCSA 1K4DC 5KLVH 3LDEA 1IBKO 4QGPA 1R3KC 2QWPB 3SJQC 1FJGO 2EULA 1HNWB 3C3SA 3DTUB 1UY9A 2N05A 4R1FA 2WLMA 4BXIA 2IM9A 4MW8A 4B7PA 1ENVA 2UUCB 3K0DA 4JGSA 2AXTZ 2PY5A 2VWKA 1G6UA 2HHIA 3OTOB 4IL6Z 3OW6A 3FYIB 3C0EA 4MVZA 2EX3A 3Q4HA 1KMIZ 4Z2WA 4NR1A 2DE0X 1L0LH 1PPJH 1ZWIC 1P7BA 2ZR3A 4X88A 3K58A 2ZBKB 1NQTA 3E8GA 1UYCA 2BE3A 4FLYA 4G2KA 1V9PA 2CUGA 3ZRWA 4FLVA 4GFNA 4B3TB 3E22B 1SQXH 1JJOA 1T5EA 1CEZA 5EC2C 4U3FH 4JI8O 5TISZ 3K9SA 4ZIBA 2AHZA 3CCVV 2BRCA 3OFNG 1YVWA 3GIGB 1GH6A 1Z5BA 3OMIB 2YK9A 3E86A 3J7AU 2YECA 2Q67A 5GW7A 5JQGA 4TQFA 3ABKC 1KB9F 3E8FA 4E02A 4LP0A 5B1BB 4JI4B 4I4TB 3GIGA 2PI5A 5GONB 4CBCA 5K1PA 2H94A 3ASOB 2Z0AA 2Q7GA 4JI1B 2QM8A 1YITV 2VQEB 2QKCA 3KG2A 5L3DA 4DR3B 2GBOA 2Q8FA 4URLA 4JI2B 1TC0A 4O09A 3ZRVA 5L3GA 4K3AA 4XKAA 4U7OA 3OE7G 4HXZA 3CS5A 1EZJA 3OWDA 4O4JA 4LWEA 2PI4A 4CE2A 1YESA 4KHPO 1GO3F 3CYOA 1KQSU 3DC5A 5LGTA 2XDXA 2WLNA 2X7RB 3WU2Z 3TZ5A 4NTYA 3K57A 3CC4V 1U0ZA 4OGQB 2B1IA 2HHHB 4QE9A 5JCOC 2E3CA 1V55C 2UUAO 3KCXA 1SRYA 5M4PA 5JJJB 1FFXA 2GSMB 3T1YB 2UXBO 3TJTA 2C2AA 2HVKC 4FZ0A 2QKAA 5J2TB 4MVUA 5CA1A 3ZMTA 3E2EA 2DW4A 5JVDB 2XAGA 4LF8O 5CTYA 3QO5A 4O2BB 4J42A 2L35A 1Q6HA 4NTWA 2P7TC 3A0BZ 2QF6A 4FM0A 3Q5LA 2BYHA 1AI7A 2DWDC 3I55V 4EGIA 1THNA 5LYJA 2WAMA 1I5AA 3HZ5A 2QKSA 2P6JA 4DR6B 3ZCCA 2VWJA 4ABMA 2CH4A 3SYQA 1URFA 4F6EA 1AB3A 1E1QG 1HNXO 2ITCC 2OYQA 4X66B 3CRQA 5ITZB 3OUFA 4UXNA 4JYBA 3RYIB 1YJ9V 2ZIMA 1IXMA 3OMUA 4MSWC 5KHKA 2WI2A 4BW5A 3AK2A 2XABA 1XNQO 1ZUQA 2YIBD 3MD0A 4B7EA 4PV1B 2B1GA 2RCVA 1D5AA 2QSAA 3HKEB 2WLHA 3A0WA 5ITZA 2BREA 4B3RB 3HKCA 1H38A 1ZL8B 1UY6A 1YTFD 5A9GA 1XBLA 3R4OA 2XHXA 2OIGA 1S5LZ 4GGLA 2CGFA 2L6LA 3WB1A 1QCEA 1AROP 1VF6A 4XDLA 3RKZA 5LMUB 1AH6A 3STLC 3JD0A 4B3MB 3SYOA 4B6CA 1V54B 3A8TA 1H2KA 2O1WA 1N32O 4PA6A 3B8MA 4MT8A 1U96A 1XMQB 5D6QA 1VQ9V 3LNNA 1KP3A 1HNZO 1QLEB 2XAHA 2VS0A 1XI1A 1UYEA 2UXXA 4MTOA 1OZ0A 3HEKA 3JAWB 2Q2EB 2E74B 3D8CA 4AQYO 4WFGA 3R4PA 2YSUB 3RFRA 1H2SB 2ITDC 1P4RA 3QF7A 2BU6A 4GYCB 4LWGA 3H80A 3KZIZ 3SJAC 3UT5B 3JARB 2QG2A 5EYPB 3B26A 4AWOA 1PP9H 4LF4O 5E1AC 3K60A 3OGIB 4BWAA 3JCUZ 4FLUA 5B3SC 4XDKA 1I5YA 1OCZC 3CRMA 5EYPA 4DV1B 2WEPA 1JVMA 4XIPA 1K92A 1Z59A 1YSZA 1R3JC 4JI6B 3TETA 3I56V 1XQ8A 4FJCC 2IWXA 1R6NA 2LFRA 2EXLA 3RYCA 3CC2V 3G71V 1N33B 4D7SA 1XL4A 3STZC 1RPOA 1DLBA 2LW7A 5D6PA 4JI7B 1PKXA 2KG7A 4TV8B 4W4LA 3RN4A 2BTQB 4ZVIA 2Q9LA 1BKNA 3LSQA 4NYKA 4L91A 3AG2B 3IGAC 4BR6A 1OCRC 4LF6O 3G7EA 5LP6A 1XDCA 1P7GA 5IWAO 3TTZA 2AHYA 2YUAA 2EILB 4GX2A 2EZOA 1DGSA 1CXZB 2GTAA 1Q6IA 2RDCA 3FB8C 1IURA 4NKGB 2ESAA 1JA8A 3B09A 5FNVB 1ROPA 4XTJA 4K4OA 2EINC 1WP8A 4PDMA 2QM7A 4RQFA 4K35A 4XKKA 3S5TA 5BR8O 4EFTA 3O0IA 4NXNO 1Y8NA 1N34O 4UROA 2UXCO 1XUQA 5JH7A 4JI5B 2UXDO 1D5NA 1GK9A 1AM1A 1OCCB 2EIJB 1MG1A 3OEHG 4P8OA 2QDOA 1NBMG 4BIUA 2KB1A 2O57A 4ASUG 3A0XA 5IJ9B 3MAQA 2XCMA 1AVMA 1WJZA 5EBLC 4GUNA 1SA0B 2DOSA 4CC6A 4GKJB 4GEEA 3R91A 2XDUA 2UU9B 3ZHSA 3K99A 1Q81W 5F5RA 2XTAA 2YGFA 3RLQA 3EFFK 3A0RA 3ZRSA 3N2GB 4G28B 5H6QA 5E79Z 2OTLV 4XD8A 1SS3A 3BMYA 1FXKC 1AJQA 1JFFB 2QTOA 4HZ3A 5LOVB 1Y4MA 4J7JA 3EKRA 3SPGA 1VQ5V 2GFDA 2WI4A 3RYFA 2B9ZA 4YXWG 3IFXA 3RBZA 3OT7A 5K1XA 3X2QB 4PELA 1LNQA 4E2LA 1JCHA 4JV5O 4X65O 2VQFB 2FWZA 4DV7O 3CPWU 5LGNA 3SYAA 3OGCC 3JSNA 1MOFA 4X64B 4JTAB 4IIJA 3A0HZ 2WLJA 3UQ8A 1QR8A 3AG4C 1PL0A 4YY3O 1THZA 4LF9B 3EHJA 1H8EG 4XBFA 2OCHA 2DYRB 1FPOA 1Q8IA 5EBMC 2JEXA 1TILA 1VMGA 3P30A 5KX5A 1X4TA 4PDLA 2DJVA 1QZRA 1BXDA 1NU1H 4RQEA 4YIPA 3EVKA 2FKXA 5M4HA 4UCOA 2Q7EA 3A0TA 2HP8A 4GX5A 4WF9V 2YIDA 3D3QA 1I94O 2HKJA 4KUMA 4LFCB 1RSOB 4E01A 4D6TH 1TAEA 1M4UA 3CE2A 4Z1MG 1IBLO 4L93A 4DV4O 1I7FA 3SJBC 4CWFA 2JEUA 1MNGA 3ZXQA 5FWKA 1IBKB 4LPBA 3BA9A 1XMOB 4YJ2B 1NHHA 1TH8A 5LXTB 4W4KA 3T0ZA 1KUQA 4LFBB 3H01A 1Z5WA 4IT5A 1K33A 5H2FZ 1OCOB 4AI8A 3FV5A 1I0HA 4YKQA 1PVGA 4YJ3A 4ZOLA 1D2DA 2ETNA 1VP7A 2ODMA 3FB7C 1KD1W 3VBBA 2LGWA 1VQ7V 1R62A 1SF9A 3SPIA 4X9QA 1RM1C 2YE5A 1QYEA 4FMTA 3J80N 1M5IA 3CRLA 4H37A 4JI0B 3TXSA 4F4LA 4EEHA 2YI5A 2CH7A 1KC8W 2NNUA 4QE7A 4FFBB 1P49A 3T0HA 4H81A 5EC1C 3WB0A 2EIMC 3UO2A 2YGAA 5A2QN 4GCZA 3SR2C 3ZHQA 3CC7V 2YEDA 2ZNJA 3G6BA 2YEBA 4MTFA 4J80A 3AG3C 4F6RB 2DQ3A 2CG9A 1VF7A 3ZXOA 4I9WA 2ZE5A 5L3BA 1Y8OA 5IT9N 4I50A 4LWSB 2ZKJA 1J5EB 2ZXWC 4YHHB 2YEJA 3GWKC 1VF5B 1UY8A 4XKOA 4ZBMA 1KKCA 4DR7O 4LFAB 4JYAO 4K0KO 1GAXA 2X6BA 3CCJV 5BY1A 2BT0A 2UUBO 2A7WA 4FZ1A 4ASBA 5EIBC 3VOUA 4X8AA 5BOCA 3JD2A 1KZNA 3D36C 1GM7A 1SQFA 3F5TA 3LPSA 1MMMA 2RN9A 1XREA 1GRJA 4UCUA 5EK0A 2E5LB 3RLRA 3ZN1A 4KHPB 3LDCA 2JRIA 3K5OA 4O4LB 1B06A 3L9DA 4PDRA 1VQ8V 2WPDG 2PTMA 1IZ3A 4LC1A 3CEIA 5CBFA 2YS8A 4O4LA 2BCCH 1FXHA 1FYJA 3BPZA 3H1IH 3FAVB 1OJHA 5CMUA 2CTQA 1M93A 4DUYO 1ZAUA 3FT8A 3ZMVA 2OCCC 4GLXA 2PGGA 1FAFA 2QJ1A 3HZ1A 2CAZC 1LR1A 4ZHQB 4HAMA 3RT3C 3CCMV 2H8MA 4UB8Z 4DK1A 1BE3H 5IYCO 1DK1A 2CTWA 5HFLA 5L3JA 1ID0A 2XNDG 4FK5C 2FB5A 1GKXA 4MP7A 2E76B 3APOA 4GKKB 3G6EV 5LA6B 2P4KA 1FD9A 5CA0B 4TV9B 4O05A 5FPOA 1NJIW 3K5MA 2QM4A 3C90A 2PF4E 5D7CA 1G4YB 1YEWA 5M4NA 1L0OA 3THOA 1H2MA 3E22A 3R4NA 1X59A 2CK3G 5D7RA 1XNQB 4XIRA 2ADPA 2YI8A 4XDMA 1F7YA 2YKJA 1AR1B 4DR1B 1K9MW 2XUMA 4C7UA 3T1HO 1TA8A 3C11A 2R9IA 4GT8A 3GIFA 4DV5B 2PUSA 3CRRA 4PL9A 5KHGA 2HKOA 4IYIA 1HR0B 3VHCA 1BQZA 1Y74B 1N36B 4D7TA 4XDJA 1B04A 3P3NA 2Y48A 1P84F 2MW2B 2YE7A 2ATKC 5FPRA 1IVSA 5B66Z 2PZSA 1MX0A 1FXVA 4UVAA 5D5QA 1VQ4V 4I4TA 4ZI7B 3T2SA 2EJ7A 5GONA 2GUZB 2WI5A 3K3WA 4OXSA 4E72A 5BZBA 1VF6C 4KSHA 1VQLV 1SZXA 2DN9A 5CBHA 4BQJA 1NR7A 4DXWA 1UJWB 3B27A 1AR5A 3FT5A 3ZHTA 1M56C 3Q5KA 2GTSA 3U2KA 5KHJA 1Q86W 1RPRA 2V7QG 2HJDA 4PI0A 3A0YA 1NTZH 2QE7G 1MSDA 2AZ2A 3CXHF 2CCUA 4MPNA 3EHFA 3QNEA 2WERA 1YZBA 1M9NA 2JIZG 3R66A 4KFMA 2GV9A 1FKAO 1IDSA 1SQGA 4UCTA 4IYHA 3JD1A 1K7DA 4QIWF 1S76D 5CTWA 2R9AA 4QJFB 3L75H 4CS3A 1U97A 2H3OA 4FLZA 4J7KA 5KAIZ 5L3EA 4DV6O 3SGIA 3CRCA 2BYIA 3CSXA 2HLDG 5BMVB 4WFBV 2WWWA 4B7KA 3PEHA 1QHTA 2IWSA 4FIPC 1HNWO 5KMGB 3RGBA 1AR4A 2JVDA 3AK1A 1KBHA 3SL2A 5J2TA 5JJNB 4Q6GA 3OPDA 4ASAA 5JVDA 4CZZA 2OT5A 4MVOA 2XK2A 2JGDB 3NR7A 1R6KA 5FL7G 2WI6A 3DGEA 4O2BA 4U7NA 1QNMA 1WN7A 3OTOO 2IJKA 3H1KH 1YT2A 2ZDIC 4H33A 2HVJC 4I7ZB 1UPGA 4BAYA 5LHHA 2YKEA 3M7MX 1N8RW 4AILC 1DTOA 1YC3A 2YEGA 2E75B 4MVMA 4J11A 4L94A 3AK3A 2QA4V 3ABKB 2D2CB 1EFRG 5H6RA 2FWYA 4I55B 5LMNB 2QWRB 4B3TO 2Y4UA 2YK2A 1A32A 4LR3A 5LP6C 3RYIA 3WHAA 3S3WA 2WI3A 5M4KA 4NXNB 2YXHA 2JGUA 4J41A 2UXCB 3R4MA 4FCRA 4PA9A 2E0AA 1WA8B 3K06A 2Q7HA 4I55A 3ETQA 2P06A 3HKEA 3OM3B 1R6TA 1R3IC 2R9RB 2V1DA 5KHIA 4QNHB 3T10A 1FS0G 3CCUV 1Q7YW 1ZL8A 4WUDA 3TZ0A 3ZS8C 4A5UB 2XHTA 1WA8A 5LL6Y 1IBMB 4I0XB 2EJRA 3U10A 4UVBA 2NN4A 3HPLC 4BIOA 4HZ0A 3OWBA 2KKWA 1H2NA 3H1LH 2F1MA 2Q0OC 4WUBA 2YE6A 4G27B 4I0XA 1JR9A 1AI4A 3RWRD 2YIBA 2XDLA 4O4HB 4X20B 1V55B 4JI1O 2YGEA 2M6YA 2IJJA 4XCJA 2ZE7A 3IEDA 1JMKC 2LO1A 2VQEO 3CCSV 3K0GA 3CJHB 4DR3O 2CGOA 3U2DA 1K5SA 5FLXN 1Q82W 4JI2O 4UV8A 5JENA 4K8ZA 3BAAA 4CWTA 4O4HA 3JAWA 5JCOA 3VQXA 4DUZB 3G67A 4DK0A 4QPJA 3ABMC 4EGKA 3M99B 2P67A 3CD6V 3CCQV 5H9CA 3JARA 3LUTB 1LUWA 3UT5A 4GX1A 3ZBHA 3N2KB 3L70H 1O9GA 1YI2V 4CE3A 1H7SA 4DR2B 2FMLA 3H1JH 4DO2A 2HHHO 4N23A 3CCLV 2JKIA 2Q73A 2W6JG 1W2BU 4NXMB 4KXRA 2PNRA 2A0LA 2Z5UA 2JS3A 2ZR2A 5IY5C 4HYPA 3FFQA 3T1YO 3Q5JA 5IJ0B 1S0VA 1NVPB 2BTZA 2CGNA 3ZHUA 2XDKA 1E1RG 2Q8IA 2YE4A 4O2AB 4JASA 2DYSC 2CCTA 2X0LA 1YHQV 2O1UA 4OX9B 3ZHVA 3FB6C 4FPPA 1YT0A 4X1KB 2BU2A 1YCIA 1EI1A 2Z3YA 4LF5B 4TV8A 4ICGA 2BTQA 2DMXA 4KP4A 3T2MA 3F5WC 5HFMA 1S5JA 2X6CA 4DV2B 1N4CA 2YE2A 1OV9A 4CH6A 4CWPA 5CTUA 4HY1A 2LP7A 4DR6O 1AILA 1AJ6A 1UYFA 2D3OW 4X66O 1XOUA 4EFBA 3ZKBA 1YDXA 4NH9A 3ZHRA 5FNVA 4I5SA 2AGAA 2Q69A 1AI6A 5IYZB 3JZ3A 4EEQA 2YC0A 1VQOV 4N21A 2F4VB 1I5CA 3PJSK 1JQ0A 1MZEA 2AKPA 3OW2U 4B3RO 5L3FA 3UO3A 1K97A 3CMEV 5IYZA 1R3LC 4O04A 3ETDA 2F66C 1ORQC 3IJ4A 4IHJB 4UV9A 5IJ9A 2CE4A 1L8DA 5DEDA 3IC7A 3ML0A 4JF3A 4V26A 1SA0A 4B3MO 3EHHA 1NH2D 3KKYA 4TQDA 3QTCA 4MPCA 4RO2A 1BMFG 4X89A 2ADQB 4IHJA 3N2GA 5B1AC 4YKYA 2Q4PA 1EM1A 1UYIA 2WEQA 1ZLZA 4PI2A 5B3SB 2JJCA 3K98A 1JFFA 1OCZB 5LOVA 1TGOA 1B6QA 2BU5A 3K9AA 4DZYA 3LSSA 1S16A 4R8CA 4X9LA 2LJ2A 1QVFU 1NHIA 4LH7A 2M7WA 3CWVA 4WBNB 2YI0A 2ZM6O 2WLLB 3G80A 3MHHC 4LH6A 4DR4B 4K0KB 4DYLA 4DV0B 3BM9A 1W0KG 1NH2B 3K5NA 2YI6A 4YIOA 2AZ0A 2F95B 5M4MA 2YICA 1SC5B 4WBNA 2C1GA 3AG1C 3BVOA 1M90W 1PL4A 2VCJA 2BSKB 4OPAA 4JI3O 4LNUB 3CMAV 4LF7B 1OCRB 1AP6A 2H8PC 1Y6XA 5BXZA 4XIQA 4DV1O 2EIKC 3T4DA 3QDDA 4MW3A 1Z2GA 1L0NH 3FKSG 2K1EA 2K9PA 4WUCA 2XDSA 2EINB 3U0ZA 1N33O 4I3HA 4FM2A 2A9HA 4B3SO 4L90A 4X62B 3ZMZA 1ZX3A 3MHSC 5GTIZ 4JI7O 4MPEA 1EN4A 4MBCA 4X1IB 1RSOA 1FJGB 4PRXA 4ASGA 1NS1A 1ZWHA 2WLKA 1RFYA 3F7VC 1UYLA 1TBWA 2IH1C 2QWOB 4QPKA 3P3PA 3CWBH 3W7WA 2XOKG 1B3QA 2JK5C 2XAJA 2XHRA 1OSFA 2QR4A 4YJ2A 5LXTA 3OR6C 1XNRO 5H5NA 3JALB 3HKBB 3M8AA 2CDYA 3CGYA 1NTKH 1HW7A 5J71A 1XHXA 4KSGA 2XJJA 3FYEB 1FXKB 1ZXMA 3EKOA 2YJWA 4GT1A 1TUBB 5IYDO 4TOIA 1NI8A 2NR5A 3JALA 1L1FA 4NB5A 4U3JB 2N04A 2QG0A 3CHXA 2H55A 5B1AB 3LSUA 3GVMA 1GN6A 2XASA 1FXKA 3W7TA 3D3IA 3ZEDA 2IU3A 3B40A 4TSFG 1BZKA 3A0ZA 3LNUA 4JQLA 4AWPA 2KSDA 4JI8B 5KA5A 4YKWA 4FFBA 4GKJO 3JCZA 5DECA 3QO7A 2UU9O 1Y8PA 4FFKA 3SDLA 3JYCA 1G1XB 4MS2A 5CB4B 1KU9A 1I59A 3AG4B 4DW0A 4PDVA 4L87A 4E4EA 1WPBA 3TCUA 3B28A 4MOTA 4PA3A 1NR1A 2OIEA 4F6RA 5B5EZ 3J81N 4O0BA 4DRXB 5LGUA 1B63A 5CB4A 4JAAA 4LWSA 2GQPA 3ABLC 3DSQA 2B5UA 3OUSA 2FXSA 4UCVA 3BFRA 1QBZA 2VQFO 4UFZA 1W0JG 2EZPA 4DR5O 1I5BA 1GKZA 1YC1A 2YIAA 3FB5C 3HKDB 5LHIA 2ZKOA 4O4IB 4X64O 5C8YB 3K97A 4LF9O 2FYUH 3B4SA 3R92A 2Y4TA 1NZ6A 3VHAA 4OPHA 1BSMA 4HNAB 4ZKIA 2YEEA 1B62A 2YKIA 3VQVA 2VCIA 4PA7A 1HDJA 5B1BC 3OEEG 1VQPV 1MABG 3N27A 4H7QA 1BQ0A 2HJFC 3JAKB 3ASOC 3RYHB 5D7DA 1SETA 2UUAB 1Q43A 3VHDA 2Q0AA 4X1YB 1S77D 4LFCO 3WB2A 2UXBB 3E35A 1RM1B 2A06H 5DM6V 3ZKDA 4NH7A 4AS9A 3G7BA 1S5HC 1QLNA 1QU7A 3UM7A 2HCHA 4X1YA 1SERA 4LF8B 3C3TA 3HR0A 3K08A 3CRAA 3ZX6A 4MVQA 1XMOO 1S14A 3FAVA 3GIEA 1ZTEA 4AHCA 3NMQA 2V4DA 4CE1A 5CN0A 4LFBO 1Z5VA 1Y67A 2EIMB 5KHHA 1US7A 1NKDA 4CS2A 4ZHQA 2PYLA 3K03A 3HHUA 3BHPA 4O07A 2XX4A 3Q4HB 4PU9A 4R50A 3GWOA 2BZ5A 2W0FC 2JS5A 2WI1A 5EIBD 3AG3B 2IOPA 5DN6G 3LNMB 3NXSA 1WB8A 1HNXB 4IGGA 3ZRWB 5EBWC 3CXCU 1VIBA 1TVKB 2IORA 2ZXWB 4JI0O 5FNDA 1RP3B 3K04A 4JAVA 5LA6A 2K5BA 2ZQMA 3L72H 5CA0A 2P4VA 3CRKA 1DF5A 4TV9A 1KKDA 3BCCH 2ZE8A 2YEHA 3PN1A 4R3AA 4UCRA 3CB2A 3AG7A 1TVKA 1HWYA 2KQXA 5B1NA 2YI9A 3ABLB 4MTGA 3ETEA 2BOBC 1UYMA 3ZMUA 3H9VA 4K8XA 1K34A 3H1HH 5JQGB 1Q6UA 2VWCA 1BHAA 4EM7A 3ETGA 5KA6A 3RVZA 2RQ6A 4MTXA 1J5EO 3DXRB 1N32B 2BSMA 4YHHO 1VQ6V 2IJHA 3K59A 2CTRA 4FLTA 3UCSC 1Y74A 3D36A 2YKCA 2ZD9A 4LFAO 2HEPA 2ZT9B 2DWEC 1HNZB 2IWUA 3ZN0A 3INWA 2IW5A 3DXRA 4WCEV 4B08A 3S3XA 3CYGA 4ZI7A 3OD4A 3ICXA 2GUZA 2W6IG 4WFFA 4AQYB 3KCYA 4J10A 4KL1A 5B1OA 3EHBB 4O4JB 3VQYA 2YE8A 3TUHA 1VQNV 2Q5ZA 3JASB 2OCCB 1V54C 2XHBA 3BY6A 1I08A 1AP5A 1U2OA 1GTOA 4LWIA 4LF4B 5L3CA 1F51A 1WLEA 1GKFA 2YDEA 2Q68A 4MVSA 2E5LO 1FFXB 4JYCA 1BL8A 4BQGA 1CP9A 2AW9A 2ZCEA 2WLIB 1QLEC 3JAMN 2YJXA 4YKUA 3JASA 1GJVA 1M57C 2XAQA 4DV3O 4HY6A 2X6AA 2ZDYA 4EKWA 4GX0A 3VADA 5CA1B 1Y4UA 2ZNIA 3E89A 5IYBO 4RAIA 1H2GA 1JM6A 4JYYA 2WLIA 4MVRA 3D0BA 1AI5A 2XX5A 2BU8A 1QVGU 2UUCO 4ASFA 5BMVA 4LWHA 5F3KA 1Y76B 5JWPA 3TXQA 5KMGA 3RVYA 2IBZH 3HB3B 4W7TA 3SYCA 4LF6B 4UVCA 1FFTB 2QWNB 5LYJB 5IWAB 2ILMA 1H8HG 4CS4A 5IE9A 2A3QA 5J9PC 1I58A 2JGDA 3ABTA 1Y76A 2W0XA 4MP2A 3O65A 4TT3G 4GKKO 1EA6A 4L8ZA 3FX7A 3P32A 2RJZA 5BR8B 2NLJC 3W7SA 3T1KA 4RUFA 5LBQA 4FVMA 2YE3A 5KAFZ 1N34B 5CF0A 1UYGA 2UXDB 1F23A 3MNRP 4FCQA 3HKCB 4CH5A 1Z5AA 2Q8GA 3ZIAG 1JPXA 3AG2C 4BW9A 1I5XA 2Y0IA 3TGUH 4CWRA 2EILC 4DR1O 1S3JA 1YF2A 1YIJV 1GN4A 3CGZA 4XC0A 1PNLA 1JJ2U 3WQ9A 5EZYB 4DV5O 4UB6Z 3LDDA 1M56B 3TZ2A 2Q6AA 1HR0O 1BGQA 1N0JA 3AEIA 2EBOA 4JI4O 1QY8A 1N36O 3KE6A 1UYKA 2YKBA 1EN6A 2CTPA 4J7ZA 5LHGA 3QVNA 5EZYA 1AMWA 2ARHA 1W59A 2QGNA 2WA3A 1OCCC 2EIJC 1ZW9A 4PHZA 4YKZA 2RNBA 3INXA 3O2FA 1XILA 2GDSA 4CWQA 2HG1A 1KP2A 3BA8A 2P22C 3CCRV 3DC6A 1YTFB 5M4EA 4YKRA 4JV5B 1NVPD 1R73A 3T4ZA 4X65B 4KTNA 4WFEA 4X20A 2YXLA 1M57B 1ZSPA 2HFEC 1NT2B 1F4NA 5GTHZ 4DV7B 2MK3A 2ZM6B 4XITA 4AWQA 2QEXV 3CJHA 3O9OA 4CWOA 3I5DA 4PRVA 1SQVH 4YY3B 1AH8A 1EBOA 1G8MA 4GZRB 1VQMV 4J9ZB 2JJ1G 1UYDA 4WFHA 3BABA 1QQCA 4EFUA 1TIDA 1O9HA 4JI3B 3SJCC 1OHHG 3G4SV 4NVPA 1GN3A 3JD4A 1GMGA 3X2QC 3RYCB 3N2KA 5FNFA 5AG2A 4CC5A 1PNKA 3K79A 2ZIOA 2ZE6A 2WSSG 1DF4A 1XEQA 3R65A 1I94B 2KG7B 1YS3A 1IXBA 4LBEC 5IJ0A 1SKVA 1K3EA 1MA1A 3F7YC 1US6A 4JZ2A 1Y66A 3L73H 4B3SB 2ZDIA 3B8NA 1IBLB 2IJIA 2FTKA 4DV4B 3JATB 5LP6B 3ZM7A 4O2AA 2DYRC 1EN5A 4NH8A 1ZXNA 5IDMA 1NHJA 5CA3A 1MU5A 1VARA 2F93B 2ZINA 4X1KA 4LCUC 3PEJA 2P5OA 2Q8HA 2R72A 3JATA 1S72V 4FLXA 1SQQH 1LUVA 2WA4A 4FM1A 4P7AA 2Q8VA 4CWSA 3BEHA 5KUKA 5JH7B 1VEWA 1PD3A 4TUYB 1XNRB 2F23A 3HYYA 5LMNO 1EZVH 2N74A 1I5DA 4RUEA 4JTCB 4FCPA 3K5LA 4TUYA 2QTSA 4Z1VA 4V25A 5IDJA 1YSCA 4H85A 5F2VO 2HR3A 3E8BA 3IC9A 4RWUA 4CH3A 5LMUO 2FYPA 1OCOC 2P90A 2HG5C 2FL4A 1TUEB 2C1IA 5IN9A 1K5QA 5FNCA 2BTOA 1WNSA 1IBMO 1JX9A 4H0LB 3ABMB 1COWG 1XMQO 3RYFB 2UWDA 4TWKA 4CWNA 3OR7C 3EHGA 3L74H 1YJWV 3QG5A 4EFEA 3B25A 1XL6A 1CPYA 4R7CA 5D5PA 4PJ0Z 1R1BA 1PV0A 4XE2A 2LFSA 2GHYA 1H2LA 3CCEV 5IY5B 4DR7B 4JYAB 2JDIG 1F4MA 1HP8A 3LMMA 3SYPA 3D2RA 2UUBB 3B24A 1UYHA 3ZRXA 4IIJB 2LW1A 4DUZO 4KQVA 2WLLA 4JAUA 1Q5OA 2DYSB 1MZFA 4DR5B 1A4HA 3QTFA 5KX5B 1WPXA 3E83A 4XCLA 5C93A 3WG7C 4EGHA 3ASNC 3EXAA 4FLWA 3HYZA 4YKTA 3TZ4A 1AJPA 4HXWA 3G75A 3U67A 4MB9A 5CTXA 2Y0PA 2YEFA 4HYMA 2BU7A 4DR2O 2VW5A 4JI6O 2ZDXA 2BSKA 4LNUA 1YXBA 3QO8A 4GQTA 2XD6A 4HBNA 4NXMO 1K8AW 1M1KW 4P30A 2PYJA 4R3MA 2UXNA 3ABUA 3SPCA 4E00A 3H4LA 1KYOF 1GM8A 2XAFA 4R6ZA 4P2ZA 1SZTA 1BHBA 2IU0A 5GGZA 1YSRA 4DUHA 4OX9O 3SPHA 2O1VA 3WFVA 4DUYB 1K4CC 4LF5O 3RLPA 4I9QA 1KIJA 4X1IA 1SQPH 5CPHA 3RW0A 1BT8A 2A79B 2BOCC 4BAEA 4ZOLB 4YJ3B 1Q3EA 4DV2O 4H13B 3BRCA 3B2EE
chains in the Genus database with same CATH topology
4Q20A 2OTJV 2F43G 1J95A 2Y69C 3CP1A 1BYQA 1YT1A 1GM9A 1YERA 1MSWD 1KECA 2YI7A 1JOYA 5CBGA 2DQ0A 4HYOA 1Y4SA 4HZ5A 4BIZA 3TK1A 3OMAB 4WFAV 3T1CA 3W7UA 2IOQA 1SESA 1H7UA 2YEIA 1E79G 2YEVB 4JTDB 3SPJA 3AG1B 2IH3C 1PNMA 3GB7C 3WG7B 3ASNB 1UY7A 3B77A 4URNA 2EIKB 1AJNA 3OMNB 2YEAA 2YEVA 1Z5CA 5J6AA 1YETA 3ZJZA 2XX2A 4P9PA 1K73W 1YC4A 4EMVA 2JJ2G 4YKXA 4LWFA 5KUMA 4U93A 4KFGA 2WI7A 3UKMA 3E8HA 2CCSA 4URMA 2YE9A 4J9YB 4LP8A 3ZMSA 3W7XA 3OAAG 1TC6A 2XJXA 5BODA 4PA4A 4P9OA 2XJGA 2QFOA 4JPRA 3JD3A 1YJNV 3O6OA 1QR9A 1VQKV 4UUJC 2Y69B 1K4DC 3LDEA 3SJQC 1R3KC 3DTUB 1UY9A 4R1FA 2WLMA 4BXIA 4MW8A 4B7PA 1ENVA 3K0DA 4JGSA 3OW6A 3FYIB 3C0EA 4MVZA 1ZWIC 1P7BA 2ZR3A 2ZBKB 4X88A 1NQTA 3E8GA 1UYCA 4G2KA 4GFNA 3ZRWA 1CEZA 5EC2C 2AHZA 3CCVV 2BRCA 3OFNG 3GIGB 1Z5BA 3OMIB 2YK9A 3E86A 2YECA 2Q67A 5GW7A 3ABKC 3E8FA 4E02A 4LP0A 5B1BB 3GIGA 2PI5A 4CBCA 2H94A 3ASOB 2QM8A 1YITV 3KG2A 5L3DA 2Q8FA 4URLA 1TC0A 4O09A 3ZRVA 5L3GA 4XKAA 4U7OA 3OE7G 4HXZA 1EZJA 3OWDA 4LWEA 2PI4A 4CE2A 1YESA 1GO3F 3CYOA 1KQSU 5LGTA 2XDXA 2WLNA 2X7RB 3TZ5A 3CC4V 1U0ZA 2B1IA 4QE9A 1V55C 1SRYA 5M4PA 2GSMB 2HVKC 4MVUA 3ZMTA 3E2EA 2DW4A 2XAGA 5CTYA 3QO5A 2P7TC 2QF6A 3Q5LA 2BYHA 1AI7A 2DWDC 3I55V 4EGIA 1THNA 2WAMA 1I5AA 3HZ5A 2QKSA 2P6JA 3ZCCA 2CH4A 3SYQA 1E1QG 2ITCC 3OUFA 4UXNA 4JYBA 1YJ9V 1IXMA 3OMUA 4MSWC 2WI2A 4BW5A 2XABA 3MD0A 2B1GA 2WLHA 3A0WA 2BREA 1H38A 1UY6A 1YTFD 3R4OA 2XHXA 4GGLA 2CGFA 1QCEA 1AROP 4XDLA 3RKZA 1AH6A 3STLC 3JD0A 3SYOA 4B6CA 1V54B 2O1WA 4PA6A 3B8MA 4MT8A 5D6QA 1VQ9V 1KP3A 1QLEB 2XAHA 1UYEA 2UXXA 4MTOA 1OZ0A 3HEKA 2Q2EB 4WFGA 3R4PA 2YSUB 2ITDC 1P4RA 2BU6A 4LWGA 2QG2A 3B26A 4AWOA 5E1AC 3K60A 5B3SC 4XDKA 1I5YA 1OCZC 2WEPA 1JVMA 4XIPA 1K92A 1Z59A 1YSZA 1R3JC 3TETA 3I56V 4FJCC 2IWXA 1R6NA 2LFRA 2EXLA 3CC2V 3G71V 1XL4A 3STZC 1RPOA 1DLBA 5D6PA 1PKXA 4ZVIA 1BKNA 3LSQA 4L91A 3AG2B 3IGAC 3G7EA 1OCRC 3TTZA 2AHYA 2EILB 4GX2A 2EZOA 3FB8C 2ESAA 1ROPA 4XTJA 4K4OA 2EINC 4PDMA 2QM7A 4RQFA 4XKKA 4EFTA 3O0IA 1Y8NA 4UROA 1GK9A 1AM1A 1OCCB 2EIJB 1MG1A 3OEHG 4P8OA 1NBMG 4BIUA 2KB1A 4ASUG 3A0XA 2XCMA 5EBLC 4GEEA 3R91A 2XDUA 3K99A 1Q81W 5F5RA 2YGFA 3RLQA 3EFFK 3A0RA 3ZRSA 4G28B 4XD8A 5H6QA 2OTLV 3BMYA 1FXKC 1AJQA 2QTOA 4HZ3A 1Y4MA 3EKRA 3SPGA 1VQ5V 2GFDA 2WI4A 4YXWG 3IFXA 3RBZA 3X2QB 4PELA 1LNQA 4E2LA 1JCHA 2FWZA 3CPWU 5LGNA 3SYAA 3OGCC 1MOFA 4JTAB 2WLJA 1QR8A 3AG4C 1PL0A 3EHJA 1THZA 1H8EG 4XBFA 2DYRB 5EBMC 2JEXA 1TILA 3P30A 4PDLA 1QZRA 1BXDA 4RQEA 5M4HA 3A0TA 4GX5A 4WF9V 2HKJA 4KUMA 4E01A 4Z1MG 4L93A 4CWFA 2JEUA 3ZXQA 5FWKA 4LPBA 1NHHA 1TH8A 3T0ZA 3H01A 1K33A 3FV5A 1OCOB 4YKQA 1PVGA 3FB7C 1KD1W 3VBBA 1VQ7V 1R62A 3SPIA 1RM1C 2YE5A 1QYEA 4FMTA 3CRLA 4H37A 4F4LA 4EEHA 2YI5A 1KC8W 2NNUA 4QE7A 3T0HA 4H81A 5EC1C 2EIMC 2YGAA 4GCZA 3CC7V 2YEDA 2YEBA 4MTFA 3AG3C 2DQ3A 2CG9A 3ZXOA 4I9WA 5L3BA 1Y8OA 2ZKJA 2ZXWC 2YEJA 1UY8A 4XKOA 4ZBMA 2X6BA 3CCJV 2BT0A 4ASBA 3VOUA 4X8AA 5BOCA 3JD2A 1KZNA 1GM7A 3LPSA 5EK0A 3RLRA 3ZN1A 3LDCA 4PDRA 1VQ8V 2WPDG 4LC1A 5CBFA 1FXHA 5CMUA 3FT8A 3ZMVA 2OCCC 3HZ1A 4HAMA 3CCMV 2H8MA 5IYCO 5HFLA 5L3JA 1ID0A 2XNDG 4FK5C 1GKXA 4MP7A 3G6EV 4O05A 1NJIW 5D7CA 1G4YB 5M4NA 1L0OA 3R4NA 2CK3G 5D7RA 4XIRA 4XDMA 2YKJA 1AR1B 1K9MW 3C11A 2R9IA 4GT8A 3GIFA 4PL9A 2HKOA 3VHCA 4XDJA 2Y48A 2YE7A 2ATKC 1MX0A 1FXVA 4UVAA 1VQ4V 3T2SA 2WI5A 3K3WA 4OXSA 5BZBA 4KSHA 1VQLV 5CBHA 4BQJA 1NR7A 4DXWA 1UJWB 3B27A 3FT5A 3Q5KA 1M56C 3U2KA 1Q86W 1RPRA 2V7QG 3A0YA 2QE7G 2CCUA 4MPNA 3EHFA 3QNEA 2WERA 1M9NA 2JIZG 4KFMA 3JD1A 1K7DA 4QIWF 1S76D 5CTWA 4QJFB 5L3EA 2BYIA 2HLDG 4WFBV 2WWWA 3PEHA 2IWSA 4FIPC 3SL2A 3OPDA 4ASAA 4CZZA 2OT5A 4MVOA 2XK2A 1R6KA 5FL7G 2WI6A 3DGEA 4U7NA 2IJKA 1YT2A 2ZDIC 4H33A 2HVJC 4BAYA 5LHHA 2YKEA 1N8RW 2YEGA 1DTOA 1YC3A 4MVMA 4L94A 2QA4V 3ABKB 1EFRG 5H6RA 2FWYA 2YK2A 3WHAA 2WI3A 5M4KA 3R4MA 4FCRA 4PA9A 2E0AA 3K06A 3OM3B 1R3IC 2R9RB 2V1DA 3T10A 4QNHB 1FS0G 3CCUV 1Q7YW 4WUDA 3TZ0A 2XHTA 2EJRA 4UVBA 3HPLC 4HZ0A 3OWBA 4WUBA 2YE6A 4G27B 1AI4A 2XDLA 1V55B 2YGEA 2IJJA 4XCJA 3IEDA 3CCSV 3K0GA 3U2DA 1K5SA 1Q82W 4UV8A 4CWTA 4QPJA 3ABMC 4EGKA 3M99B 2P67A 3CD6V 3CCQV 5H9CA 3LUTB 4GX1A 1YI2V 4CE3A 1H7SA 4DO2A 4N23A 3CCLV 2JKIA 2W6JG 1W2BU 2PNRA 2A0LA 2Z5UA 2ZR2A 5IY5C 4HYPA 3Q5JA 1S0VA 1NVPB 2BTZA 2XDKA 1E1RG 2Q8IA 2YE4A 4JASA 2DYSC 2CCTA 2X0LA 1YHQV 2O1UA 3FB6C 4FPPA 1YT0A 2BU2A 1EI1A 2Z3YA 4KP4A 3T2MA 3F5WC 5HFMA 2X6CA 2YE2A 4CWPA 5CTUA 4HY1A 2LP7A 1AJ6A 1UYFA 2D3OW 3ZKBA 4NH9A 4I5SA 2Q69A 1AI6A 3JZ3A 1VQOV 4N21A 1I5CA 3PJSK 1JQ0A 2AKPA 3OW2U 5L3FA 1K97A 3CMEV 1R3LC 4O04A 3ETDA 1ORQC 4UV9A 3IC7A 3ML0A 4JF3A 4V26A 3EHHA 1NH2D 4MPCA 4RO2A 1BMFG 4X89A 5B1AC 4YKYA 2WEQA 1UYIA 5B3SB 2JJCA 3K98A 1OCZB 1B6QA 2BU5A 3K9AA 4DZYA 3LSSA 1S16A 4R8CA 4X9LA 1QVFU 1NHIA 2M7WA 3CWVA 2YI0A 2WLLB 3MHHC 3BM9A 1W0KG 1NH2B 2YI6A 5M4MA 3AG1C 1M90W 2VCJA 3CMAV 1OCRB 2H8PC 4XIQA 2EIKC 3T4DA 3QDDA 4MW3A 3FKSG 2K1EA 4WUCA 2XDSA 2EINB 4I3HA 2A9HA 4L90A 3ZMZA 3MHSC 4MPEA 4MBCA 4PRXA 4ASGA 1ZWHA 2WLKA 3F7VC 1UYLA 1TBWA 2IH1C 4QPKA 3W7WA 2XOKG 1B3QA 2JK5C 2XAJA 2XHRA 1OSFA 3OR6C 3CGYA 5J71A 4KSGA 2XJJA 3FYEB 1FXKB 1ZXMA 3EKOA 2YJWA 4GT1A 5IYDO 1L1FA 2QG0A 2H55A 5B1AB 2XASA 1FXKA 3W7TA 3D3IA 2IU3A 4TSFG 3A0ZA 3LNUA 4JQLA 4AWPA 5KA5A 4YKWA 3JCZA 3QO7A 1Y8PA 3JYCA 4MS2A 1I59A 3AG4B 4PDVA 4L87A 3TCUA 3B28A 4MOTA 4PA3A 1NR1A 4O0BA 5LGUA 1B63A 2GQPA 3ABLC 2B5UA 3OUSA 2FXSA 1QBZA 1W0JG 2EZPA 1I5BA 1YC1A 1GKZA 3FB5C 5LHIA 3K97A 3R92A 3VHAA 4ZKIA 2YEEA 1B62A 2YKIA 2VCIA 4PA7A 5B1BC 3OEEG 1VQPV 1MABG 4H7QA 2HJFC 3ASOC 5D7DA 1SETA 3VHDA 1S77D 3E35A 1RM1B 3ZKDA 5DM6V 4NH7A 4AS9A 3G7BA 1S5HC 1QLNA 3UM7A 2HCHA 1SERA 3K08A 1S14A 4MVQA 3GIEA 3NMQA 4CE1A 5CN0A 2EIMB 1US7A 1NKDA 3K03A 3HHUA 4O07A 2XX4A 4PU9A 4R50A 3GWOA 2BZ5A 2W0FC 2WI1A 3AG3B 2IOPA 5DN6G 3LNMB 3NXSA 3ZRWB 5EBWC 3CXCU 2IORA 2ZXWB 5FNDA 3K04A 4JAVA 2K5BA 2ZQMA 3CRKA 1DF5A 1KKDA 2YEHA 4R3AA 1HWYA 5B1NA 3ABLB 4MTGA 3ETEA 2BOBC 1UYMA 3ZMUA 1K34A 2VWCA 1BHAA 4EM7A 3ETGA 5KA6A 3RVZA 4MTXA 2BSMA 1VQ6V 2IJHA 3D36A 2YKCA 2ZD9A 2DWEC 2IWUA 3ZN0A 3INWA 2IW5A 4WCEV 2W6IG 4WFFA 5B1OA 3EHBB 2YE8A 3TUHA 1VQNV 2OCCB 1V54C 3BY6A 1U2OA 1GTOA 4LWIA 5L3CA 1F51A 1WLEA 1GKFA 2Q68A 4MVSA 4JYCA 4BQGA 1BL8A 1CP9A 2WLIB 1QLEC 2YJXA 4YKUA 1GJVA 1M57C 2XAQA 4HY6A 2X6AA 2ZDYA 4EKWA 4GX0A 3VADA 1Y4UA 3E89A 5IYBO 4RAIA 1H2GA 1JM6A 2WLIA 4MVRA 3D0BA 1AI5A 2XX5A 2BU8A 1QVGU 4ASFA 4LWHA 5F3KA 3RVYA 3HB3B 4W7TA 3SYCA 4UVCA 1FFTB 1H8HG 5J9PC 1I58A 3ABTA 4MP2A 4TT3G 1EA6A 4L8ZA 3P32A 2NLJC 3W7SA 3T1KA 4RUFA 5LBQA 2YE3A 5CF0A 1UYGA 3MNRP 1F23A 4FCQA 1Z5AA 2Q8GA 3ZIAG 1JPXA 3AG2C 1I5XA 4CWRA 2EILC 1S3JA 1YIJV 3CGZA 4XC0A 1PNLA 1JJ2U 3WQ9A 3LDDA 1M56B 3TZ2A 2Q6AA 1BGQA 3AEIA 2EBOA 1QY8A 3KE6A 1UYKA 2YKBA 5LHGA 1AMWA 1OCCC 2EIJC 1ZW9A 4YKZA 3INXA 3O2FA 4CWQA 2HG1A 1KP2A 3CCRV 1YTFB 5M4EA 4YKRA 1NVPD 1R73A 3T4ZA 4KTNA 4WFEA 1M57B 2HFEC 1F4NA 2MK3A 4AWQA 4XITA 2QEXV 4CWOA 4PRVA 1AH8A 1EBOA 1G8MA 1VQMV 4J9ZB 2JJ1G 1UYDA 4WFHA 4EFUA 1TIDA 1OHHG 3G4SV 3JD4A 1GMGA 3X2QC 5FNFA 1PNKA 3K79A 2WSSG 1DF4A 3R65A 1YS3A 4LBEC 1K3EA 3F7YC 1Y66A 2ZDIA 3B8NA 2IJIA 2FTKA 3ZM7A 2DYRC 4NH8A 1ZXNA 5IDMA 1NHJA 5CA3A 1MU5A 4LCUC 3PEJA 2Q8HA 1S72V 4P7AA 4CWSA 3BEHA 5KUKA 1PD3A 3HYYA 1I5DA 4RUEA 4JTCB 4FCPA 4V25A 5IDJA 1YSCA 4H85A 2HR3A 3E8BA 2FYPA 1OCOC 2P90A 2HG5C 1TUEB 5IN9A 1K5QA 5FNCA 1JX9A 3ABMB 1COWG 2UWDA 4TWKA 4CWNA 3OR7C 3EHGA 1YJWV 3B25A 1XL6A 1CPYA 4R7CA 4XE2A 2LFSA 2GHYA 3CCEV 5IY5B 2JDIG 1F4MA 3SYPA 3D2RA 3B24A 1UYHA 3ZRXA 4KQVA 2WLLA 4JAUA 2DYSB 1A4HA 3QTFA 1WPXA 3E83A 4XCLA 5C93A 3WG7C 4EGHA 3ASNC 3HYZA 4YKTA 3TZ4A 1AJPA 4HXWA 3G75A 3U67A 4MB9A 5CTXA 2YEFA 4HYMA 2BU7A 2VW5A 2ZDXA 3QO8A 4GQTA 2XD6A 1K8AW 1M1KW 4P30A 4R3MA 2UXNA 3ABUA 3SPCA 4E00A 3H4LA 1GM8A 2XAFA 4R6ZA 4P2ZA 1SZTA 1BHBA 2IU0A 5GGZA 1YSRA 4DUHA 3SPHA 2O1VA 3WFVA 1K4CC 3RLPA 1KIJA 5CPHA 3RW0A 2A79B 2BOCC 4BAEA 2C2AA 3H80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q20 A;  2WI6 A;  3DGE A;  4U7N A;  3HHU A;  4O07 A;  2ESA A;  2XX4 A;  4PU9 A;  1YT2 A;  2BZ5 A;  2YKE A;  4XTJ A;  2WI1 A;  4K4O A;  2IOP A;  2YEG A;  1YC3 A;  2QM7 A;  3NXS A;  4XKK A;  4L94 A;  3ZRW B;  4EFT A;  1BYQ A;  2IOR A;  3O0I A;  1YT1 A;  1Y8N A;  4URO A;  5FND A;  1YER A;  2FWY A;  4JAV A;  2YI7 A;  2K5B A;  2YK2 A;  1AM1 A;  1JOY A;  3CRK A;  3WHA A;  4P8O A;  2WI3 A;  5M4K A;  2YEH A;  4BIU A;  4R3A A;  3R4M A;  4FCR A;  1Y4S A;  2E0A A;  4HZ5 A;  3A0X A;  5B1N A;  2XCM A;  4BIZ A;  3TK1 A;  1UYM A;  2IOQ A;  4GEE A;  3R91 A;  2XDU A;  3T10 A;  1H7U A;  3K99 A;  4WUD A;  3TZ0 A;  5F5R A;  2VWC A;  2YGF A;  4EM7 A;  2YEI A;  3RLQ A;  2XHT A;  3A0R A;  4XD8 A;  4MTX A;  3BMY A;  2BSM A;  3EKR A;  2GFD A;  1UY7 A;  2WI4 A;  3OWB A;  4HZ0 A;  4URN A;  2YEA A;  4WUB A;  3D36 A;  1Z5C A;  2YE6 A;  2YKC A;  2XDL A;  2IWU A;  5J6A A;  1YET A;  3INW A;  2YGE A;  2XX2 A;  4XCJ A;  3IED A;  2FWZ A;  1YC4 A;  4EMV A;  4YKX A;  3U2D A;  4LWF A;  5B1O A;  4CWT A;  4U93 A;  4KFG A;  2WI7 A;  2YE8 A;  4QPJ A;  3EHJ A;  3TUH A;  4EGK A;  2P67 A;  1TIL A;  1U2O A;  2CCS A;  4URM A;  2YE9 A;  1QZR A;  4LWI A;  1BXD A;  1F51 A;  4CE3 A;  1H7S A;  2JKI A;  4JYC A;  4BQG A;  1TC6 A;  5M4H A;  2XJX A;  2YJX A;  3A0T A;  4YKU A;  1GJV A;  2PNR A;  4HYP A;  5BOD A;  4HY6 A;  3Q5J A;  2ZDY A;  2XJG A;  2QFO A;  2BTZ A;  3VAD A;  2HKJ A;  2XDK A;  1Y4U A;  3O6O A;  4E01 A;  2Q8I A;  1JM6 A;  2YE4 A;  4JAS A;  3D0B A;  4L93 A;  2XX5 A;  2CCT A;  2O1U A;  2BU8 A;  4CWF A;  4FPP A;  4ASF A;  1YT0 A;  1UY9 A;  2BU2 A;  3ZXQ A;  4LWH A;  5F3K A;  5FWK A;  1EI1 A;  4R1F A;  4BXI A;  4LPB A;  1NHH A;  1TH8 A;  4W7T A;  4KP4 A;  3T0Z A;  4B7P A;  3FV5 A;  2YE2 A;  4YKQ A;  1PVG A;  1I58 A;  4CWP A;  5CTU A;  4HY1 A;  3OW6 A;  1AJ6 A;  1UYF A;  4MP2 A;  3C0E A;  1EA6 A;  4L8Z A;  3ZKB A;  1R62 A;  4NH9 A;  3P32 A;  4I5S A;  2YE5 A;  1QYE A;  2ZBK B;  4FMT A;  3T1K A;  3JZ3 A;  1UYC A;  3CRL A;  2YE3 A;  5CF0 A;  4GFN A;  3ZRW A;  1UYG A;  3MNR P;  4FCQ A;  1I5C A;  4EEH A;  2YI5 A;  1Z5A A;  2Q8G A;  2AKP A;  3T0H A;  4H81 A;  4CWR A;  2YGA A;  4O04 A;  3CGZ A;  4GCZ A;  4XC0 A;  2YED A;  3WQ9 A;  2YEB A;  2BRC A;  3TZ2 A;  3GIG B;  1Z5B A;  1BGQ A;  4V26 A;  2YK9 A;  3EHH A;  2YEC A;  2CG9 A;  1QY8 A;  3ZXO A;  4MPC A;  3KE6 A;  1UYK A;  2YKB A;  1Y8O A;  2ZKJ A;  1AMW A;  4E02 A;  4LP0 A;  4YKY A;  2WEQ A;  1UYI A;  3GIG A;  2JJC A;  2YEJ A;  3K98 A;  1ZW9 A;  1UY8 A;  4XKO A;  2BU5 A;  4DZY A;  4YKZ A;  3INX A;  1S16 A;  4X9L A;  3O2F A;  1NHI A;  4CWQ A;  2HG1 A;  3CWV A;  2YI0 A;  2BT0 A;  2QM8 A;  5M4E A;  4YKR A;  4KTN A;  4ASB A;  3BM9 A;  2YI6 A;  2Q8F A;  4URL A;  1TC0 A;  4O09 A;  4XIT A;  4AWQ A;  5M4M A;  3ZRV A;  5BOC A;  1KZN A;  4XKA A;  4CWO A;  4U7O A;  4PRV A;  4HXZ A;  1AH8 A;  2VCJ A;  3LPS A;  3OWD A;  4LWE A;  4CE2 A;  1YES A;  1UYD A;  2XDX A;  4EFU A;  1TID A;  4XIQ A;  3TZ5 A;  3RLR A;  1U0Z A;  3QDD A;  5FNF A;  4WUC A;  5M4P A;  2XDS A;  4I3H A;  4LC1 A;  4L90 A;  1YS3 A;  4MPE A;  4MBC A;  2FTK A;  4PRX A;  4ASG A;  3ZM7 A;  3FT8 A;  4NH8 A;  1ZWH A;  1ZXN A;  5CTY A;  5IDM A;  1UYL A;  3HZ1 A;  1NHJ A;  1MU5 A;  1TBW A;  4QPK A;  1B3Q A;  3PEJ A;  2H8M A;  2Q8H A;  2QF6 A;  2XHR A;  1OSF A;  3Q5L A;  2BYH A;  4EGI A;  1THN A;  1I5A A;  3HZ5 A;  4P7A A;  5L3J A;  1ID0 A;  3ZCC A;  1GKX A;  4MP7 A;  2CH4 A;  3CGY A;  4CWS A;  5J71 A;  4KSG A;  2XJJ A;  1ZXM A;  3EKO A;  2YJW A;  4GT1 A;  4O05 A;  4JYB A;  3HYY A;  1IXM A;  3OMU A;  5D7C A;  2WI2 A;  1I5D A;  2XAB A;  2QG0 A;  2H55 A;  5M4N A;  1L0O A;  3MD0 A;  4FCP A;  3A0W A;  4V25 A;  5IDJ A;  2BRE A;  3A0Z A;  3LNU A;  3R4N A;  4H85 A;  4JQL A;  4AWP A;  5D7R A;  1UY6 A;  4XIR A;  4XDM A;  2YKJ A;  4YKW A;  3R4O A;  2FYP A;  2XHX A;  1Y8P A;  4GGL A;  3C11 A;  2CGF A;  4GT8 A;  5IN9 A;  5FNC A;  3GIF A;  3RKZ A;  1I59 A;  4PL9 A;  1AH6 A;  3VHC A;  4B6C A;  2O1W A;  2UWD A;  4CWN A;  3EHG A;  3B28 A;  4MOT A;  4MT8 A;  2YE7 A;  3B25 A;  4O0B A;  5D6Q A;  1B63 A;  4XE2 A;  2LFS A;  1MX0 A;  2GQP A;  2FXS A;  3T2S A;  1UYE A;  2WI5 A;  3HEK A;  3D2R A;  2Q2E B;  3B24 A;  1I5B A;  1UYH A;  3ZRX A;  1GKZ A;  1YC1 A;  4KSH A;  3R4P A;  4BQJ A;  3B27 A;  4KQV A;  4JAU A;  3FT5 A;  2BU6 A;  4LWG A;  3Q5K A;  3K97 A;  2QG2 A;  1A4H A;  3U2K A;  3QTF A;  3R92 A;  3B26 A;  4XCL A;  5C93 A;  3VHA A;  4AWO A;  3A0Y A;  4EGH A;  3HYZ A;  4YKT A;  3TZ4 A;  4ZKI A;  4HXW A;  3G75 A;  3U67 A;  4MB9 A;  2YEE A;  5CTX A;  3K60 A;  1B62 A;  2YEF A;  2CCU A;  4HYM A;  2YKI A;  2VCI A;  4MPN A;  2BU7 A;  3EHF A;  2VW5 A;  2WER A;  2ZDX A;  4H7Q A;  4GQT A;  2XD6 A;  2WEP A;  4XIP A;  4R3M A;  1Z59 A;  1YSZ A;  5D7D A;  4E00 A;  5CTW A;  2IWX A;  3H4L A;  3VHD A;  2LFR A;  2EXL A;  5GGZ A;  2BYI A;  5D6P A;  3ZKD A;  2WWW A;  1YSR A;  3PEH A;  4DUH A;  2IWS A;  4NH7 A;  4AS9 A;  3G7B A;  2O1V A;  4ZVI A;  1BKN A;  2HCH A;  3SL2 A;  4L91 A;  1S14 A;  3RLP A;  1KIJ A;  3GIE A;  3OPD A;  3G7E A;  5CPH A;  4ASA A;  3NMQ A;  4CE1 A;  2XK2 A;  3TTZ A;  4BAE A;  1US7 A;  2C2A A;  3H80 A; 
#chains in the Genus database with same CATH topology
 4Q20 A;  2OTJ V;  4L8J A;  2OWO A;  2VRZ A;  2F43 G;  1J95 A;  2Y69 C;  3VQW A;  4EB6 B;  4JI5 O;  3CP1 A;  3HKB A;  3OTF A;  1Q90 D;  1BYQ A;  2CH7 B;  1YT1 A;  1GM9 A;  1YER A;  1MSW D;  2F4V O;  5J2U B;  1KEC A;  2YI7 A;  1JOY A;  2QWQ B;  5CBG A;  1TUB A;  4EB6 A;  1GN2 A;  2DQ0 A;  4HYO A;  2R70 A;  4U3J A;  1Y4S A;  4HZ5 A;  4BIZ A;  3TK1 A;  3OMA B;  4WFA V;  5J2U A;  3T1C A;  4NTX A;  3W7U A;  2IOQ A;  2LGQ A;  1SES A;  3T1H B;  1H7U A;  2YEI A;  4I50 B;  1E79 G;  2YEV B;  1UFI A;  4JTD B;  1WAZ A;  3A2F A;  3SPJ A;  3AG1 B;  2IH3 C;  1PNM A;  1BGY H;  1PM9 A;  3GB7 C;  3WG7 B;  3ASN B;  3L71 H;  1UY7 A;  3B77 A;  4JZG A;  2XT9 A;  4URN A;  2EIK B;  1AJN A;  3OMN B;  2YEA A;  2YEV A;  3IAY A;  1Z5C A;  4H44 B;  1IX9 A;  5J6A A;  1YET A;  3ZJZ A;  4DRX A;  1BS3 A;  3APQ A;  3U11 A;  2XX2 A;  1SQB H;  3FD9 A;  4P9P A;  1WB7 A;  4DW1 A;  1K73 W;  4DR4 O;  2RMK B;  1YC4 A;  4DV0 O;  4EMV A;  2JJ2 G;  4YKX A;  4LWF A;  1XHZ A;  5KUM A;  4U93 A;  4KFG A;  2WI7 A;  3UKM A;  1BCC H;  2YXY A;  3CX5 F;  3HKD A;  3JSL A;  3E8H A;  4O4I A;  5C8Y A;  5JJE B;  4LF7 O;  2CCS A;  2G38 A;  2YE9 A;  4URM A;  4J9Y B;  4LP8 A;  3ZMS A;  1NTM H;  3W7X A;  3OAA G;  4HNA A;  3MDS A;  1WP7 A;  1TC6 A;  2XJX A;  2LQT A;  1N0N A;  5BOD A;  4PA4 A;  4P9O A;  2XJG A;  4CH4 A;  2QFO A;  3JAK A;  4JPR A;  3JD3 A;  4X62 O;  1YJN V;  3RYH A;  3O6O A;  1QR9 A;  4PD4 F;  1VQK V;  4UUJ C;  2Y69 B;  4DV6 B;  4DV3 B;  4UCS A;  1K4D C;  5KLV H;  3LDE A;  1IBK O;  4QGP A;  1R3K C;  2QWP B;  3SJQ C;  1FJG O;  2EUL A;  1HNW B;  3C3S A;  3DTU B;  1UY9 A;  2N05 A;  4R1F A;  2WLM A;  4BXI A;  2IM9 A;  4MW8 A;  4B7P A;  1ENV A;  2UUC B;  3K0D A;  4JGS A;  2AXT Z;  2PY5 A;  2VWK A;  1G6U A;  2HHI A;  3OTO B;  4IL6 Z;  3OW6 A;  3FYI B;  3C0E A;  4MVZ A;  2EX3 A;  3Q4H A;  1KMI Z;  4Z2W A;  4NR1 A;  2DE0 X;  1L0L H;  1PPJ H;  1ZWI C;  1P7B A;  2ZR3 A;  4X88 A;  3K58 A;  2ZBK B;  1NQT A;  3E8G A;  1UYC A;  2BE3 A;  4FLY A;  4G2K A;  1V9P A;  2CUG A;  3ZRW A;  4FLV A;  4GFN A;  4B3T B;  3E22 B;  1SQX H;  1JJO A;  1T5E A;  1CEZ A;  5EC2 C;  4U3F H;  4JI8 O;  5TIS Z;  3K9S A;  4ZIB A;  2AHZ A;  3CCV V;  2BRC A;  3OFN G;  1YVW A;  3GIG B;  1GH6 A;  1Z5B A;  3OMI B;  2YK9 A;  3E86 A;  3J7A U;  2YEC A;  2Q67 A;  5GW7 A;  5JQG A;  4TQF A;  3ABK C;  1KB9 F;  3E8F A;  4E02 A;  4LP0 A;  5B1B B;  4JI4 B;  4I4T B;  3GIG A;  2PI5 A;  5GON B;  4CBC A;  5K1P A;  2H94 A;  3ASO B;  2Z0A A;  2Q7G A;  4JI1 B;  2QM8 A;  1YIT V;  2VQE B;  2QKC A;  3KG2 A;  5L3D A;  4DR3 B;  2GBO A;  2Q8F A;  4URL A;  4JI2 B;  1TC0 A;  4O09 A;  3ZRV A;  5L3G A;  4K3A A;  4XKA A;  4U7O A;  3OE7 G;  4HXZ A;  3CS5 A;  1EZJ A;  3OWD A;  4O4J A;  4LWE A;  2PI4 A;  4CE2 A;  1YES A;  4KHP O;  1GO3 F;  3CYO A;  1KQS U;  3DC5 A;  5LGT A;  2XDX A;  2WLN A;  2X7R B;  3WU2 Z;  3TZ5 A;  4NTY A;  3K57 A;  3CC4 V;  1U0Z A;  4OGQ B;  2B1I A;  2HHH B;  4QE9 A;  5JCO C;  2E3C A;  1V55 C;  2UUA O;  3KCX A;  1SRY A;  5M4P A;  5JJJ B;  1FFX A;  2GSM B;  3T1Y B;  2UXB O;  3TJT A;  2C2A A;  2HVK C;  4FZ0 A;  2QKA A;  5J2T B;  4MVU A;  5CA1 A;  3ZMT A;  3E2E A;  2DW4 A;  5JVD B;  2XAG A;  4LF8 O;  5CTY A;  3QO5 A;  4O2B B;  4J42 A;  2L35 A;  1Q6H A;  4NTW A;  2P7T C;  3A0B Z;  2QF6 A;  4FM0 A;  3Q5L A;  2BYH A;  1AI7 A;  2DWD C;  3I55 V;  4EGI A;  1THN A;  5LYJ A;  2WAM A;  1I5A A;  3HZ5 A;  2QKS A;  2P6J A;  4DR6 B;  3ZCC A;  2VWJ A;  4ABM A;  2CH4 A;  3SYQ A;  1URF A;  4F6E A;  1AB3 A;  1E1Q G;  1HNX O;  2ITC C;  2OYQ A;  4X66 B;  3CRQ A;  5ITZ B;  3OUF A;  4UXN A;  4JYB A;  3RYI B;  1YJ9 V;  2ZIM A;  1IXM A;  3OMU A;  4MSW C;  5KHK A;  2WI2 A;  4BW5 A;  3AK2 A;  2XAB A;  1XNQ O;  1ZUQ A;  2YIB D;  3MD0 A;  4B7E A;  4PV1 B;  2B1G A;  2RCV A;  1D5A A;  2QSA A;  3HKE B;  2WLH A;  3A0W A;  5ITZ A;  2BRE A;  4B3R B;  3HKC A;  1H38 A;  1ZL8 B;  1UY6 A;  1YTF D;  5A9G A;  1XBL A;  3R4O A;  2XHX A;  2OIG A;  1S5L Z;  4GGL A;  2CGF A;  2L6L A;  3WB1 A;  1QCE A;  1ARO P;  1VF6 A;  4XDL A;  3RKZ A;  5LMU B;  1AH6 A;  3STL C;  3JD0 A;  4B3M B;  3SYO A;  4B6C A;  1V54 B;  3A8T A;  1H2K A;  2O1W A;  1N32 O;  4PA6 A;  3B8M A;  4MT8 A;  1U96 A;  1XMQ B;  5D6Q A;  1VQ9 V;  3LNN A;  1KP3 A;  1HNZ O;  1QLE B;  2XAH A;  2VS0 A;  1XI1 A;  1UYE A;  2UXX A;  4MTO A;  1OZ0 A;  3HEK A;  3JAW B;  2Q2E B;  2E74 B;  3D8C A;  4AQY O;  4WFG A;  3R4P A;  2YSU B;  3RFR A;  1H2S B;  2ITD C;  1P4R A;  3QF7 A;  2BU6 A;  4GYC B;  4LWG A;  3H80 A;  3KZI Z;  3SJA C;  3UT5 B;  3JAR B;  2QG2 A;  5EYP B;  3B26 A;  4AWO A;  1PP9 H;  4LF4 O;  5E1A C;  3K60 A;  3OGI B;  4BWA A;  3JCU Z;  4FLU A;  5B3S C;  4XDK A;  1I5Y A;  1OCZ C;  3CRM A;  5EYP A;  4DV1 B;  2WEP A;  1JVM A;  4XIP A;  1K92 A;  1Z59 A;  1YSZ A;  1R3J C;  4JI6 B;  3TET A;  3I56 V;  1XQ8 A;  4FJC C;  2IWX A;  1R6N A;  2LFR A;  2EXL A;  3RYC A;  3CC2 V;  3G71 V;  1N33 B;  4D7S A;  1XL4 A;  3STZ C;  1RPO A;  1DLB A;  2LW7 A;  5D6P A;  4JI7 B;  1PKX A;  2KG7 A;  4TV8 B;  4W4L A;  3RN4 A;  2BTQ B;  4ZVI A;  2Q9L A;  1BKN A;  3LSQ A;  4NYK A;  4L91 A;  3AG2 B;  3IGA C;  4BR6 A;  1OCR C;  4LF6 O;  3G7E A;  5LP6 A;  1XDC A;  1P7G A;  5IWA O;  3TTZ A;  2AHY A;  2YUA A;  2EIL B;  4GX2 A;  2EZO A;  1DGS A;  1CXZ B;  2GTA A;  1Q6I A;  2RDC A;  3FB8 C;  1IUR A;  4NKG B;  2ESA A;  1JA8 A;  3B09 A;  5FNV B;  1ROP A;  4XTJ A;  4K4O A;  2EIN C;  1WP8 A;  4PDM A;  2QM7 A;  4RQF A;  4K35 A;  4XKK A;  3S5T A;  5BR8 O;  4EFT A;  3O0I A;  4NXN O;  1Y8N A;  1N34 O;  4URO A;  2UXC O;  1XUQ A;  5JH7 A;  4JI5 B;  2UXD O;  1D5N A;  1GK9 A;  1AM1 A;  1OCC B;  2EIJ B;  1MG1 A;  3OEH G;  4P8O A;  2QDO A;  1NBM G;  4BIU A;  2KB1 A;  2O57 A;  4ASU G;  3A0X A;  5IJ9 B;  3MAQ A;  2XCM A;  1AVM A;  1WJZ A;  5EBL C;  4GUN A;  1SA0 B;  2DOS A;  4CC6 A;  4GKJ B;  4GEE A;  3R91 A;  2XDU A;  2UU9 B;  3ZHS A;  3K99 A;  1Q81 W;  5F5R A;  2XTA A;  2YGF A;  3RLQ A;  3EFF K;  3A0R A;  3ZRS A;  3N2G B;  4G28 B;  5H6Q A;  5E79 Z;  2OTL V;  4XD8 A;  1SS3 A;  3BMY A;  1FXK C;  1AJQ A;  1JFF B;  2QTO A;  4HZ3 A;  5LOV B;  1Y4M A;  4J7J A;  3EKR A;  3SPG A;  1VQ5 V;  2GFD A;  2WI4 A;  3RYF A;  2B9Z A;  4YXW G;  3IFX A;  3RBZ A;  3OT7 A;  5K1X A;  3X2Q B;  4PEL A;  1LNQ A;  4E2L A;  1JCH A;  4JV5 O;  4X65 O;  2VQF B;  2FWZ A;  4DV7 O;  3CPW U;  5LGN A;  3SYA A;  3OGC C;  3JSN A;  1MOF A;  4X64 B;  4JTA B;  4IIJ A;  3A0H Z;  2WLJ A;  3UQ8 A;  1QR8 A;  3AG4 C;  1PL0 A;  4YY3 O;  1THZ A;  4LF9 B;  3EHJ A;  1H8E G;  4XBF A;  2OCH A;  2DYR B;  1FPO A;  1Q8I A;  5EBM C;  2JEX A;  1TIL A;  1VMG A;  3P30 A;  5KX5 A;  1X4T A;  4PDL A;  2DJV A;  1QZR A;  1BXD A;  1NU1 H;  4RQE A;  4YIP A;  3EVK A;  2FKX A;  5M4H A;  4UCO A;  2Q7E A;  3A0T A;  2HP8 A;  4GX5 A;  4WF9 V;  2YID A;  3D3Q A;  1I94 O;  2HKJ A;  4KUM A;  4LFC B;  1RSO B;  4E01 A;  4D6T H;  1TAE A;  1M4U A;  3CE2 A;  4Z1M G;  1IBL O;  4L93 A;  4DV4 O;  1I7F A;  3SJB C;  4CWF A;  2JEU A;  1MNG A;  3ZXQ A;  5FWK A;  1IBK B;  4LPB A;  3BA9 A;  1XMO B;  4YJ2 B;  1NHH A;  1TH8 A;  5LXT B;  4W4K A;  3T0Z A;  1KUQ A;  4LFB B;  3H01 A;  1Z5W A;  4IT5 A;  1K33 A;  5H2F Z;  1OCO B;  4AI8 A;  3FV5 A;  1I0H A;  4YKQ A;  1PVG A;  4YJ3 A;  4ZOL A;  1D2D A;  2ETN A;  1VP7 A;  2ODM A;  3FB7 C;  1KD1 W;  3VBB A;  2LGW A;  1VQ7 V;  1R62 A;  1SF9 A;  3SPI A;  4X9Q A;  1RM1 C;  2YE5 A;  1QYE A;  4FMT A;  3J80 N;  1M5I A;  3CRL A;  4H37 A;  4JI0 B;  3TXS A;  4F4L A;  4EEH A;  2YI5 A;  2CH7 A;  1KC8 W;  2NNU A;  4QE7 A;  4FFB B;  1P49 A;  3T0H A;  4H81 A;  5EC1 C;  3WB0 A;  2EIM C;  3UO2 A;  2YGA A;  5A2Q N;  4GCZ A;  3SR2 C;  3ZHQ A;  3CC7 V;  2YED A;  2ZNJ A;  3G6B A;  2YEB A;  4MTF A;  4J80 A;  3AG3 C;  4F6R B;  2DQ3 A;  2CG9 A;  1VF7 A;  3ZXO A;  4I9W A;  2ZE5 A;  5L3B A;  1Y8O A;  5IT9 N;  4I50 A;  4LWS B;  2ZKJ A;  1J5E B;  2ZXW C;  4YHH B;  2YEJ A;  3GWK C;  1VF5 B;  1UY8 A;  4XKO A;  4ZBM A;  1KKC A;  4DR7 O;  4LFA B;  4JYA O;  4K0K O;  1GAX A;  2X6B A;  3CCJ V;  5BY1 A;  2BT0 A;  2UUB O;  2A7W A;  4FZ1 A;  4ASB A;  5EIB C;  3VOU A;  4X8A A;  5BOC A;  3JD2 A;  1KZN A;  3D36 C;  1GM7 A;  1SQF A;  3F5T A;  3LPS A;  1MMM A;  2RN9 A;  1XRE A;  1GRJ A;  4UCU A;  5EK0 A;  2E5L B;  3RLR A;  3ZN1 A;  4KHP B;  3LDC A;  2JRI A;  3K5O A;  4O4L B;  1B06 A;  3L9D A;  4PDR A;  1VQ8 V;  2WPD G;  2PTM A;  1IZ3 A;  4LC1 A;  3CEI A;  5CBF A;  2YS8 A;  4O4L A;  2BCC H;  1FXH A;  1FYJ A;  3BPZ A;  3H1I H;  3FAV B;  1OJH A;  5CMU A;  2CTQ A;  1M93 A;  4DUY O;  1ZAU A;  3FT8 A;  3ZMV A;  2OCC C;  4GLX A;  2PGG A;  1FAF A;  2QJ1 A;  3HZ1 A;  2CAZ C;  1LR1 A;  4ZHQ B;  4HAM A;  3RT3 C;  3CCM V;  2H8M A;  4UB8 Z;  4DK1 A;  1BE3 H;  5IYC O;  1DK1 A;  2CTW A;  5HFL A;  5L3J A;  1ID0 A;  2XND G;  4FK5 C;  2FB5 A;  1GKX A;  4MP7 A;  2E76 B;  3APO A;  4GKK B;  3G6E V;  5LA6 B;  2P4K A;  1FD9 A;  5CA0 B;  4TV9 B;  4O05 A;  5FPO A;  1NJI W;  3K5M A;  2QM4 A;  3C90 A;  2PF4 E;  5D7C A;  1G4Y B;  1YEW A;  5M4N A;  1L0O A;  3THO A;  1H2M A;  3E22 A;  3R4N A;  1X59 A;  2CK3 G;  5D7R A;  1XNQ B;  4XIR A;  2ADP A;  2YI8 A;  4XDM A;  1F7Y A;  2YKJ A;  1AR1 B;  4DR1 B;  1K9M W;  2XUM A;  4C7U A;  3T1H O;  1TA8 A;  3C11 A;  2R9I A;  4GT8 A;  3GIF A;  4DV5 B;  2PUS A;  3CRR A;  4PL9 A;  5KHG A;  2HKO A;  4IYI A;  1HR0 B;  3VHC A;  1BQZ A;  1Y74 B;  1N36 B;  4D7T A;  4XDJ A;  1B04 A;  3P3N A;  2Y48 A;  1P84 F;  2MW2 B;  2YE7 A;  2ATK C;  5FPR A;  1IVS A;  5B66 Z;  2PZS A;  1MX0 A;  1FXV A;  4UVA A;  5D5Q A;  1VQ4 V;  4I4T A;  4ZI7 B;  3T2S A;  2EJ7 A;  5GON A;  2GUZ B;  2WI5 A;  3K3W A;  4OXS A;  4E72 A;  5BZB A;  1VF6 C;  4KSH A;  1VQL V;  1SZX A;  2DN9 A;  5CBH A;  4BQJ A;  1NR7 A;  4DXW A;  1UJW B;  3B27 A;  1AR5 A;  3FT5 A;  3ZHT A;  1M56 C;  3Q5K A;  2GTS A;  3U2K A;  5KHJ A;  1Q86 W;  1RPR A;  2V7Q G;  2HJD A;  4PI0 A;  3A0Y A;  1NTZ H;  2QE7 G;  1MSD A;  2AZ2 A;  3CXH F;  2CCU A;  4MPN A;  3EHF A;  3QNE A;  2WER A;  1YZB A;  1M9N A;  2JIZ G;  3R66 A;  4KFM A;  2GV9 A;  1FKA O;  1IDS A;  1SQG A;  4UCT A;  4IYH A;  3JD1 A;  1K7D A;  4QIW F;  1S76 D;  5CTW A;  2R9A A;  4QJF B;  3L75 H;  4CS3 A;  1U97 A;  2H3O A;  4FLZ A;  4J7K A;  5KAI Z;  5L3E A;  4DV6 O;  3SGI A;  3CRC A;  2BYI A;  3CSX A;  2HLD G;  5BMV B;  4WFB V;  2WWW A;  4B7K A;  3PEH A;  1QHT A;  2IWS A;  4FIP C;  1HNW O;  5KMG B;  3RGB A;  1AR4 A;  2JVD A;  3AK1 A;  1KBH A;  3SL2 A;  5J2T A;  5JJN B;  4Q6G A;  3OPD A;  4ASA A;  5JVD A;  4CZZ A;  2OT5 A;  4MVO A;  2XK2 A;  2JGD B;  3NR7 A;  1R6K A;  5FL7 G;  2WI6 A;  3DGE A;  4O2B A;  4U7N A;  1QNM A;  1WN7 A;  3OTO O;  2IJK A;  3H1K H;  1YT2 A;  2ZDI C;  4H33 A;  2HVJ C;  4I7Z B;  1UPG A;  4BAY A;  5LHH A;  2YKE A;  3M7M X;  1N8R W;  4AIL C;  1DTO A;  1YC3 A;  2YEG A;  2E75 B;  4MVM A;  4J11 A;  4L94 A;  3AK3 A;  2QA4 V;  3ABK B;  2D2C B;  1EFR G;  5H6R A;  2FWY A;  4I55 B;  5LMN B;  2QWR B;  4B3T O;  2Y4U A;  2YK2 A;  1A32 A;  4LR3 A;  5LP6 C;  3RYI A;  3WHA A;  3S3W A;  2WI3 A;  5M4K A;  4NXN B;  2YXH A;  2JGU A;  4J41 A;  2UXC B;  3R4M A;  4FCR A;  4PA9 A;  2E0A A;  1WA8 B;  3K06 A;  2Q7H A;  4I55 A;  3ETQ A;  2P06 A;  3HKE A;  3OM3 B;  1R6T A;  1R3I C;  2R9R B;  2V1D A;  5KHI A;  4QNH B;  3T10 A;  1FS0 G;  3CCU V;  1Q7Y W;  1ZL8 A;  4WUD A;  3TZ0 A;  3ZS8 C;  4A5U B;  2XHT A;  1WA8 A;  5LL6 Y;  1IBM B;  4I0X B;  2EJR A;  3U10 A;  4UVB A;  2NN4 A;  3HPL C;  4BIO A;  4HZ0 A;  3OWB A;  2KKW A;  1H2N A;  3H1L H;  2F1M A;  2Q0O C;  4WUB A;  2YE6 A;  4G27 B;  4I0X A;  1JR9 A;  1AI4 A;  3RWR D;  2YIB A;  2XDL A;  4O4H B;  4X20 B;  1V55 B;  4JI1 O;  2YGE A;  2M6Y A;  2IJJ A;  4XCJ A;  2ZE7 A;  3IED A;  1JMK C;  2LO1 A;  2VQE O;  3CCS V;  3K0G A;  3CJH B;  4DR3 O;  2CGO A;  3U2D A;  1K5S A;  5FLX N;  1Q82 W;  4JI2 O;  4UV8 A;  5JEN A;  4K8Z A;  3BAA A;  4CWT A;  4O4H A;  3JAW A;  5JCO A;  3VQX A;  4DUZ B;  3G67 A;  4DK0 A;  4QPJ A;  3ABM C;  4EGK A;  3M99 B;  2P67 A;  3CD6 V;  3CCQ V;  5H9C A;  3JAR A;  3LUT B;  1LUW A;  3UT5 A;  4GX1 A;  3ZBH A;  3N2K B;  3L70 H;  1O9G A;  1YI2 V;  4CE3 A;  1H7S A;  4DR2 B;  2FML A;  3H1J H;  4DO2 A;  2HHH O;  4N23 A;  3CCL V;  2JKI A;  2Q73 A;  2W6J G;  1W2B U;  4NXM B;  4KXR A;  2PNR A;  2A0L A;  2Z5U A;  2JS3 A;  2ZR2 A;  5IY5 C;  4HYP A;  3FFQ A;  3T1Y O;  3Q5J A;  5IJ0 B;  1S0V A;  1NVP B;  2BTZ A;  2CGN A;  3ZHU A;  2XDK A;  1E1R G;  2Q8I A;  2YE4 A;  4O2A B;  4JAS A;  2DYS C;  2CCT A;  2X0L A;  1YHQ V;  2O1U A;  4OX9 B;  3ZHV A;  3FB6 C;  4FPP A;  1YT0 A;  4X1K B;  2BU2 A;  1YCI A;  1EI1 A;  2Z3Y A;  4LF5 B;  4TV8 A;  4ICG A;  2BTQ A;  2DMX A;  4KP4 A;  3T2M A;  3F5W C;  5HFM A;  1S5J A;  2X6C A;  4DV2 B;  1N4C A;  2YE2 A;  1OV9 A;  4CH6 A;  4CWP A;  5CTU A;  4HY1 A;  2LP7 A;  4DR6 O;  1AIL A;  1AJ6 A;  1UYF A;  2D3O W;  4X66 O;  1XOU A;  4EFB A;  3ZKB A;  1YDX A;  4NH9 A;  3ZHR A;  5FNV A;  4I5S A;  2AGA A;  2Q69 A;  1AI6 A;  5IYZ B;  3JZ3 A;  4EEQ A;  2YC0 A;  1VQO V;  4N21 A;  2F4V B;  1I5C A;  3PJS K;  1JQ0 A;  1MZE A;  2AKP A;  3OW2 U;  4B3R O;  5L3F A;  3UO3 A;  1K97 A;  3CME V;  5IYZ A;  1R3L C;  4O04 A;  3ETD A;  2F66 C;  1ORQ C;  3IJ4 A;  4IHJ B;  4UV9 A;  5IJ9 A;  2CE4 A;  1L8D A;  5DED A;  3IC7 A;  3ML0 A;  4JF3 A;  4V26 A;  1SA0 A;  4B3M O;  3EHH A;  1NH2 D;  3KKY A;  4TQD A;  3QTC A;  4MPC A;  4RO2 A;  1BMF G;  4X89 A;  2ADQ B;  4IHJ A;  3N2G A;  5B1A C;  4YKY A;  2Q4P A;  1EM1 A;  1UYI A;  2WEQ A;  1ZLZ A;  4PI2 A;  5B3S B;  2JJC A;  3K98 A;  1JFF A;  1OCZ B;  5LOV A;  1TGO A;  1B6Q A;  2BU5 A;  3K9A A;  4DZY A;  3LSS A;  1S16 A;  4R8C A;  4X9L A;  2LJ2 A;  1QVF U;  1NHI A;  4LH7 A;  2M7W A;  3CWV A;  4WBN B;  2YI0 A;  2ZM6 O;  2WLL B;  3G80 A;  3MHH C;  4LH6 A;  4DR4 B;  4K0K B;  4DYL A;  4DV0 B;  3BM9 A;  1W0K G;  1NH2 B;  3K5N A;  2YI6 A;  4YIO A;  2AZ0 A;  2F95 B;  5M4M A;  2YIC A;  1SC5 B;  4WBN A;  2C1G A;  3AG1 C;  3BVO A;  1M90 W;  1PL4 A;  2VCJ A;  2BSK B;  4OPA A;  4JI3 O;  4LNU B;  3CMA V;  4LF7 B;  1OCR B;  1AP6 A;  2H8P C;  1Y6X A;  5BXZ A;  4XIQ A;  4DV1 O;  2EIK C;  3T4D A;  3QDD A;  4MW3 A;  1Z2G A;  1L0N H;  3FKS G;  2K1E A;  2K9P A;  4WUC A;  2XDS A;  2EIN B;  3U0Z A;  1N33 O;  4I3H A;  4FM2 A;  2A9H A;  4B3S O;  4L90 A;  4X62 B;  3ZMZ A;  1ZX3 A;  3MHS C;  5GTI Z;  4JI7 O;  4MPE A;  1EN4 A;  4MBC A;  4X1I B;  1RSO A;  1FJG B;  4PRX A;  4ASG A;  1NS1 A;  1ZWH A;  2WLK A;  1RFY A;  3F7V C;  1UYL A;  1TBW A;  2IH1 C;  2QWO B;  4QPK A;  3P3P A;  3CWB H;  3W7W A;  2XOK G;  1B3Q A;  2JK5 C;  2XAJ A;  2XHR A;  1OSF A;  2QR4 A;  4YJ2 A;  5LXT A;  3OR6 C;  1XNR O;  5H5N A;  3JAL B;  3HKB B;  3M8A A;  2CDY A;  3CGY A;  1NTK H;  1HW7 A;  5J71 A;  1XHX A;  4KSG A;  2XJJ A;  3FYE B;  1FXK B;  1ZXM A;  3EKO A;  2YJW A;  4GT1 A;  1TUB B;  5IYD O;  4TOI A;  1NI8 A;  2NR5 A;  3JAL A;  1L1F A;  4NB5 A;  4U3J B;  2N04 A;  2QG0 A;  3CHX A;  2H55 A;  5B1A B;  3LSU A;  3GVM A;  1GN6 A;  2XAS A;  1FXK A;  3W7T A;  3D3I A;  3ZED A;  2IU3 A;  3B40 A;  4TSF G;  1BZK A;  3A0Z A;  3LNU A;  4JQL A;  4AWP A;  2KSD A;  4JI8 B;  5KA5 A;  4YKW A;  4FFB A;  4GKJ O;  3JCZ A;  5DEC A;  3QO7 A;  2UU9 O;  1Y8P A;  4FFK A;  3SDL A;  3JYC A;  1G1X B;  4MS2 A;  5CB4 B;  1KU9 A;  1I59 A;  3AG4 B;  4DW0 A;  4PDV A;  4L87 A;  4E4E A;  1WPB A;  3TCU A;  3B28 A;  4MOT A;  4PA3 A;  1NR1 A;  2OIE A;  4F6R A;  5B5E Z;  3J81 N;  4O0B A;  4DRX B;  5LGU A;  1B63 A;  5CB4 A;  4JAA A;  4LWS A;  2GQP A;  3ABL C;  3DSQ A;  2B5U A;  3OUS A;  2FXS A;  4UCV A;  3BFR A;  1QBZ A;  2VQF O;  4UFZ A;  1W0J G;  2EZP A;  4DR5 O;  1I5B A;  1GKZ A;  1YC1 A;  2YIA A;  3FB5 C;  3HKD B;  5LHI A;  2ZKO A;  4O4I B;  4X64 O;  5C8Y B;  3K97 A;  4LF9 O;  2FYU H;  3B4S A;  3R92 A;  2Y4T A;  1NZ6 A;  3VHA A;  4OPH A;  1BSM A;  4HNA B;  4ZKI A;  2YEE A;  1B62 A;  2YKI A;  3VQV A;  2VCI A;  4PA7 A;  1HDJ A;  5B1B C;  3OEE G;  1VQP V;  1MAB G;  3N27 A;  4H7Q A;  1BQ0 A;  2HJF C;  3JAK B;  3ASO C;  3RYH B;  5D7D A;  1SET A;  2UUA B;  1Q43 A;  3VHD A;  2Q0A A;  4X1Y B;  1S77 D;  4LFC O;  3WB2 A;  2UXB B;  3E35 A;  1RM1 B;  2A06 H;  5DM6 V;  3ZKD A;  4NH7 A;  4AS9 A;  3G7B A;  1S5H C;  1QLN A;  1QU7 A;  3UM7 A;  2HCH A;  4X1Y A;  1SER A;  4LF8 B;  3C3T A;  3HR0 A;  3K08 A;  3CRA A;  3ZX6 A;  4MVQ A;  1XMO O;  1S14 A;  3FAV A;  3GIE A;  1ZTE A;  4AHC A;  3NMQ A;  2V4D A;  4CE1 A;  5CN0 A;  4LFB O;  1Z5V A;  1Y67 A;  2EIM B;  5KHH A;  1US7 A;  1NKD A;  4CS2 A;  4ZHQ A;  2PYL A;  3K03 A;  3HHU A;  3BHP A;  4O07 A;  2XX4 A;  3Q4H B;  4PU9 A;  4R50 A;  3GWO A;  2BZ5 A;  2W0F C;  2JS5 A;  2WI1 A;  5EIB D;  3AG3 B;  2IOP A;  5DN6 G;  3LNM B;  3NXS A;  1WB8 A;  1HNX B;  4IGG A;  3ZRW B;  5EBW C;  3CXC U;  1VIB A;  1TVK B;  2IOR A;  2ZXW B;  4JI0 O;  5FND A;  1RP3 B;  3K04 A;  4JAV A;  5LA6 A;  2K5B A;  2ZQM A;  3L72 H;  5CA0 A;  2P4V A;  3CRK A;  1DF5 A;  4TV9 A;  1KKD A;  3BCC H;  2ZE8 A;  2YEH A;  3PN1 A;  4R3A A;  4UCR A;  3CB2 A;  3AG7 A;  1TVK A;  1HWY A;  2KQX A;  5B1N A;  2YI9 A;  3ABL B;  4MTG A;  3ETE A;  2BOB C;  1UYM A;  3ZMU A;  3H9V A;  4K8X A;  1K34 A;  3H1H H;  5JQG B;  1Q6U A;  2VWC A;  1BHA A;  4EM7 A;  3ETG A;  5KA6 A;  3RVZ A;  2RQ6 A;  4MTX A;  1J5E O;  3DXR B;  1N32 B;  2BSM A;  4YHH O;  1VQ6 V;  2IJH A;  3K59 A;  2CTR A;  4FLT A;  3UCS C;  1Y74 A;  3D36 A;  2YKC A;  2ZD9 A;  4LFA O;  2HEP A;  2ZT9 B;  2DWE C;  1HNZ B;  2IWU A;  3ZN0 A;  3INW A;  2IW5 A;  3DXR A;  4WCE V;  4B08 A;  3S3X A;  3CYG A;  4ZI7 A;  3OD4 A;  3ICX A;  2GUZ A;  2W6I G;  4WFF A;  4AQY B;  3KCY A;  4J10 A;  4KL1 A;  5B1O A;  3EHB B;  4O4J B;  3VQY A;  2YE8 A;  3TUH A;  1VQN V;  2Q5Z A;  3JAS B;  2OCC B;  1V54 C;  2XHB A;  3BY6 A;  1I08 A;  1AP5 A;  1U2O A;  1GTO A;  4LWI A;  4LF4 B;  5L3C A;  1F51 A;  1WLE A;  1GKF A;  2YDE A;  2Q68 A;  4MVS A;  2E5L O;  1FFX B;  4JYC A;  1BL8 A;  4BQG A;  1CP9 A;  2AW9 A;  2ZCE A;  2WLI B;  1QLE C;  3JAM N;  2YJX A;  4YKU A;  3JAS A;  1GJV A;  1M57 C;  2XAQ A;  4DV3 O;  4HY6 A;  2X6A A;  2ZDY A;  4EKW A;  4GX0 A;  3VAD A;  5CA1 B;  1Y4U A;  2ZNI A;  3E89 A;  5IYB O;  4RAI A;  1H2G A;  1JM6 A;  4JYY A;  2WLI A;  4MVR A;  3D0B A;  1AI5 A;  2XX5 A;  2BU8 A;  1QVG U;  2UUC O;  4ASF A;  5BMV A;  4LWH A;  5F3K A;  1Y76 B;  5JWP A;  3TXQ A;  5KMG A;  3RVY A;  2IBZ H;  3HB3 B;  4W7T A;  3SYC A;  4LF6 B;  4UVC A;  1FFT B;  2QWN B;  5LYJ B;  5IWA B;  2ILM A;  1H8H G;  4CS4 A;  5IE9 A;  2A3Q A;  5J9P C;  1I58 A;  2JGD A;  3ABT A;  1Y76 A;  2W0X A;  4MP2 A;  3O65 A;  4TT3 G;  4GKK O;  1EA6 A;  4L8Z A;  3FX7 A;  3P32 A;  2RJZ A;  5BR8 B;  2NLJ C;  3W7S A;  3T1K A;  4RUF A;  5LBQ A;  4FVM A;  2YE3 A;  5KAF Z;  1N34 B;  5CF0 A;  1UYG A;  2UXD B;  1F23 A;  3MNR P;  4FCQ A;  3HKC B;  4CH5 A;  1Z5A A;  2Q8G A;  3ZIA G;  1JPX A;  3AG2 C;  4BW9 A;  1I5X A;  2Y0I A;  3TGU H;  4CWR A;  2EIL C;  4DR1 O;  1S3J A;  1YF2 A;  1YIJ V;  1GN4 A;  3CGZ A;  4XC0 A;  1PNL A;  1JJ2 U;  3WQ9 A;  5EZY B;  4DV5 O;  4UB6 Z;  3LDD A;  1M56 B;  3TZ2 A;  2Q6A A;  1HR0 O;  1BGQ A;  1N0J A;  3AEI A;  2EBO A;  4JI4 O;  1QY8 A;  1N36 O;  3KE6 A;  1UYK A;  2YKB A;  1EN6 A;  2CTP A;  4J7Z A;  5LHG A;  3QVN A;  5EZY A;  1AMW A;  2ARH A;  1W59 A;  2QGN A;  2WA3 A;  1OCC C;  2EIJ C;  1ZW9 A;  4PHZ A;  4YKZ A;  2RNB A;  3INX A;  3O2F A;  1XIL A;  2GDS A;  4CWQ A;  2HG1 A;  1KP2 A;  3BA8 A;  2P22 C;  3CCR V;  3DC6 A;  1YTF B;  5M4E A;  4YKR A;  4JV5 B;  1NVP D;  1R73 A;  3T4Z A;  4X65 B;  4KTN A;  4WFE A;  4X20 A;  2YXL A;  1M57 B;  1ZSP A;  2HFE C;  1NT2 B;  1F4N A;  5GTH Z;  4DV7 B;  2MK3 A;  2ZM6 B;  4XIT A;  4AWQ A;  2QEX V;  3CJH A;  3O9O A;  4CWO A;  3I5D A;  4PRV A;  1SQV H;  4YY3 B;  1AH8 A;  1EBO A;  1G8M A;  4GZR B;  1VQM V;  4J9Z B;  2JJ1 G;  1UYD A;  4WFH A;  3BAB A;  1QQC A;  4EFU A;  1TID A;  1O9H A;  4JI3 B;  3SJC C;  1OHH G;  3G4S V;  4NVP A;  1GN3 A;  3JD4 A;  1GMG A;  3X2Q C;  3RYC B;  3N2K A;  5FNF A;  5AG2 A;  4CC5 A;  1PNK A;  3K79 A;  2ZIO A;  2ZE6 A;  2WSS G;  1DF4 A;  1XEQ A;  3R65 A;  1I94 B;  2KG7 B;  1YS3 A;  1IXB A;  4LBE C;  5IJ0 A;  1SKV A;  1K3E A;  1MA1 A;  3F7Y C;  1US6 A;  4JZ2 A;  1Y66 A;  3L73 H;  4B3S B;  2ZDI A;  3B8N A;  1IBL B;  2IJI A;  2FTK A;  4DV4 B;  3JAT B;  5LP6 B;  3ZM7 A;  4O2A A;  2DYR C;  1EN5 A;  4NH8 A;  1ZXN A;  5IDM A;  1NHJ A;  5CA3 A;  1MU5 A;  1VAR A;  2F93 B;  2ZIN A;  4X1K A;  4LCU C;  3PEJ A;  2P5O A;  2Q8H A;  2R72 A;  3JAT A;  1S72 V;  4FLX A;  1SQQ H;  1LUV A;  2WA4 A;  4FM1 A;  4P7A A;  2Q8V A;  4CWS A;  3BEH A;  5KUK A;  5JH7 B;  1VEW A;  1PD3 A;  4TUY B;  1XNR B;  2F23 A;  3HYY A;  5LMN O;  1EZV H;  2N74 A;  1I5D A;  4RUE A;  4JTC B;  4FCP A;  3K5L A;  4TUY A;  2QTS A;  4Z1V A;  4V25 A;  5IDJ A;  1YSC A;  4H85 A;  5F2V O;  2HR3 A;  3E8B A;  3IC9 A;  4RWU A;  4CH3 A;  5LMU O;  2FYP A;  1OCO C;  2P90 A;  2HG5 C;  2FL4 A;  1TUE B;  2C1I A;  5IN9 A;  1K5Q A;  5FNC A;  2BTO A;  1WNS A;  1IBM O;  1JX9 A;  4H0L B;  3ABM B;  1COW G;  1XMQ O;  3RYF B;  2UWD A;  4TWK A;  4CWN A;  3OR7 C;  3EHG A;  3L74 H;  1YJW V;  3QG5 A;  4EFE A;  3B25 A;  1XL6 A;  1CPY A;  4R7C A;  5D5P A;  4PJ0 Z;  1R1B A;  1PV0 A;  4XE2 A;  2LFS A;  2GHY A;  1H2L A;  3CCE V;  5IY5 B;  4DR7 B;  4JYA B;  2JDI G;  1F4M A;  1HP8 A;  3LMM A;  3SYP A;  3D2R A;  2UUB B;  3B24 A;  1UYH A;  3ZRX A;  4IIJ B;  2LW1 A;  4DUZ O;  4KQV A;  2WLL A;  4JAU A;  1Q5O A;  2DYS B;  1MZF A;  4DR5 B;  1A4H A;  3QTF A;  5KX5 B;  1WPX A;  3E83 A;  4XCL A;  5C93 A;  3WG7 C;  4EGH A;  3ASN C;  3EXA A;  4FLW A;  3HYZ A;  4YKT A;  3TZ4 A;  1AJP A;  4HXW A;  3G75 A;  3U67 A;  4MB9 A;  5CTX A;  2Y0P A;  2YEF A;  4HYM A;  2BU7 A;  4DR2 O;  2VW5 A;  4JI6 O;  2ZDX A;  2BSK A;  4LNU A;  1YXB A;  3QO8 A;  4GQT A;  2XD6 A;  4HBN A;  4NXM O;  1K8A W;  1M1K W;  4P30 A;  2PYJ A;  4R3M A;  2UXN A;  3ABU A;  3SPC A;  4E00 A;  3H4L A;  1KYO F;  1GM8 A;  2XAF A;  4R6Z A;  4P2Z A;  1SZT A;  1BHB A;  2IU0 A;  5GGZ A;  1YSR A;  4DUH A;  4OX9 O;  3SPH A;  2O1V A;  3WFV A;  4DUY B;  1K4C C;  4LF5 O;  3RLP A;  4I9Q A;  1KIJ A;  4X1I A;  1SQP H;  5CPH A;  3RW0 A;  1BT8 A;  2A79 B;  2BOC C;  4BAE A;  4ZOL B;  4YJ3 B;  1Q3E A;  4DV2 O;  4H13 B;  3BRC A;  3B2E E; 
#chains in the Genus database with same CATH homology
 4Q20 A;  2OTJ V;  2F43 G;  1J95 A;  2Y69 C;  3CP1 A;  1BYQ A;  1YT1 A;  1GM9 A;  1YER A;  1MSW D;  1KEC A;  2YI7 A;  1JOY A;  5CBG A;  2DQ0 A;  4HYO A;  1Y4S A;  4HZ5 A;  4BIZ A;  3TK1 A;  3OMA B;  4WFA V;  3T1C A;  3W7U A;  2IOQ A;  1SES A;  1H7U A;  2YEI A;  1E79 G;  2YEV B;  4JTD B;  3SPJ A;  3AG1 B;  2IH3 C;  1PNM A;  3GB7 C;  3WG7 B;  3ASN B;  1UY7 A;  3B77 A;  4URN A;  2EIK B;  1AJN A;  3OMN B;  2YEA A;  2YEV A;  1Z5C A;  5J6A A;  1YET A;  3ZJZ A;  2XX2 A;  4P9P A;  1K73 W;  1YC4 A;  4EMV A;  2JJ2 G;  4YKX A;  4LWF A;  5KUM A;  4U93 A;  4KFG A;  2WI7 A;  3UKM A;  3E8H A;  2CCS A;  4URM A;  2YE9 A;  4J9Y B;  4LP8 A;  3ZMS A;  3W7X A;  3OAA G;  1TC6 A;  2XJX A;  5BOD A;  4PA4 A;  4P9O A;  2XJG A;  2QFO A;  4JPR A;  3JD3 A;  1YJN V;  3O6O A;  1QR9 A;  1VQK V;  4UUJ C;  2Y69 B;  1K4D C;  3LDE A;  3SJQ C;  1R3K C;  3DTU B;  1UY9 A;  4R1F A;  2WLM A;  4BXI A;  4MW8 A;  4B7P A;  1ENV A;  3K0D A;  4JGS A;  3OW6 A;  3FYI B;  3C0E A;  4MVZ A;  1ZWI C;  1P7B A;  2ZR3 A;  2ZBK B;  4X88 A;  1NQT A;  3E8G A;  1UYC A;  4G2K A;  4GFN A;  3ZRW A;  1CEZ A;  5EC2 C;  2AHZ A;  3CCV V;  2BRC A;  3OFN G;  3GIG B;  1Z5B A;  3OMI B;  2YK9 A;  3E86 A;  2YEC A;  2Q67 A;  5GW7 A;  3ABK C;  3E8F A;  4E02 A;  4LP0 A;  5B1B B;  3GIG A;  2PI5 A;  4CBC A;  2H94 A;  3ASO B;  2QM8 A;  1YIT V;  3KG2 A;  5L3D A;  2Q8F A;  4URL A;  1TC0 A;  4O09 A;  3ZRV A;  5L3G A;  4XKA A;  4U7O A;  3OE7 G;  4HXZ A;  1EZJ A;  3OWD A;  4LWE A;  2PI4 A;  4CE2 A;  1YES A;  1GO3 F;  3CYO A;  1KQS U;  5LGT A;  2XDX A;  2WLN A;  2X7R B;  3TZ5 A;  3CC4 V;  1U0Z A;  2B1I A;  4QE9 A;  1V55 C;  1SRY A;  5M4P A;  2GSM B;  2HVK C;  4MVU A;  3ZMT A;  3E2E A;  2DW4 A;  2XAG A;  5CTY A;  3QO5 A;  2P7T C;  2QF6 A;  3Q5L A;  2BYH A;  1AI7 A;  2DWD C;  3I55 V;  4EGI A;  1THN A;  2WAM A;  1I5A A;  3HZ5 A;  2QKS A;  2P6J A;  3ZCC A;  2CH4 A;  3SYQ A;  1E1Q G;  2ITC C;  3OUF A;  4UXN A;  4JYB A;  1YJ9 V;  1IXM A;  3OMU A;  4MSW C;  2WI2 A;  4BW5 A;  2XAB A;  3MD0 A;  2B1G A;  2WLH A;  3A0W A;  2BRE A;  1H38 A;  1UY6 A;  1YTF D;  3R4O A;  2XHX A;  4GGL A;  2CGF A;  1QCE A;  1ARO P;  4XDL A;  3RKZ A;  1AH6 A;  3STL C;  3JD0 A;  3SYO A;  4B6C A;  1V54 B;  2O1W A;  4PA6 A;  3B8M A;  4MT8 A;  5D6Q A;  1VQ9 V;  1KP3 A;  1QLE B;  2XAH A;  1UYE A;  2UXX A;  4MTO A;  1OZ0 A;  3HEK A;  2Q2E B;  4WFG A;  3R4P A;  2YSU B;  2ITD C;  1P4R A;  2BU6 A;  4LWG A;  2QG2 A;  3B26 A;  4AWO A;  5E1A C;  3K60 A;  5B3S C;  4XDK A;  1I5Y A;  1OCZ C;  2WEP A;  1JVM A;  4XIP A;  1K92 A;  1Z59 A;  1YSZ A;  1R3J C;  3TET A;  3I56 V;  4FJC C;  2IWX A;  1R6N A;  2LFR A;  2EXL A;  3CC2 V;  3G71 V;  1XL4 A;  3STZ C;  1RPO A;  1DLB A;  5D6P A;  1PKX A;  4ZVI A;  1BKN A;  3LSQ A;  4L91 A;  3AG2 B;  3IGA C;  3G7E A;  1OCR C;  3TTZ A;  2AHY A;  2EIL B;  4GX2 A;  2EZO A;  3FB8 C;  2ESA A;  1ROP A;  4XTJ A;  4K4O A;  2EIN C;  4PDM A;  2QM7 A;  4RQF A;  4XKK A;  4EFT A;  3O0I A;  1Y8N A;  4URO A;  1GK9 A;  1AM1 A;  1OCC B;  2EIJ B;  1MG1 A;  3OEH G;  4P8O A;  1NBM G;  4BIU A;  2KB1 A;  4ASU G;  3A0X A;  2XCM A;  5EBL C;  4GEE A;  3R91 A;  2XDU A;  3K99 A;  1Q81 W;  5F5R A;  2YGF A;  3RLQ A;  3EFF K;  3A0R A;  3ZRS A;  4G28 B;  4XD8 A;  5H6Q A;  2OTL V;  3BMY A;  1FXK C;  1AJQ A;  2QTO A;  4HZ3 A;  1Y4M A;  3EKR A;  3SPG A;  1VQ5 V;  2GFD A;  2WI4 A;  4YXW G;  3IFX A;  3RBZ A;  3X2Q B;  4PEL A;  1LNQ A;  4E2L A;  1JCH A;  2FWZ A;  3CPW U;  5LGN A;  3SYA A;  3OGC C;  1MOF A;  4JTA B;  2WLJ A;  1QR8 A;  3AG4 C;  1PL0 A;  3EHJ A;  1THZ A;  1H8E G;  4XBF A;  2DYR B;  5EBM C;  2JEX A;  1TIL A;  3P30 A;  4PDL A;  1QZR A;  1BXD A;  4RQE A;  5M4H A;  3A0T A;  4GX5 A;  4WF9 V;  2HKJ A;  4KUM A;  4E01 A;  4Z1M G;  4L93 A;  4CWF A;  2JEU A;  3ZXQ A;  5FWK A;  4LPB A;  1NHH A;  1TH8 A;  3T0Z A;  3H01 A;  1K33 A;  3FV5 A;  1OCO B;  4YKQ A;  1PVG A;  3FB7 C;  1KD1 W;  3VBB A;  1VQ7 V;  1R62 A;  3SPI A;  1RM1 C;  2YE5 A;  1QYE A;  4FMT A;  3CRL A;  4H37 A;  4F4L A;  4EEH A;  2YI5 A;  1KC8 W;  2NNU A;  4QE7 A;  3T0H A;  4H81 A;  5EC1 C;  2EIM C;  2YGA A;  4GCZ A;  3CC7 V;  2YED A;  2YEB A;  4MTF A;  3AG3 C;  2DQ3 A;  2CG9 A;  3ZXO A;  4I9W A;  5L3B A;  1Y8O A;  2ZKJ A;  2ZXW C;  2YEJ A;  1UY8 A;  4XKO A;  4ZBM A;  2X6B A;  3CCJ V;  2BT0 A;  4ASB A;  3VOU A;  4X8A A;  5BOC A;  3JD2 A;  1KZN A;  1GM7 A;  3LPS A;  5EK0 A;  3RLR A;  3ZN1 A;  3LDC A;  4PDR A;  1VQ8 V;  2WPD G;  4LC1 A;  5CBF A;  1FXH A;  5CMU A;  3FT8 A;  3ZMV A;  2OCC C;  3HZ1 A;  4HAM A;  3CCM V;  2H8M A;  5IYC O;  5HFL A;  5L3J A;  1ID0 A;  2XND G;  4FK5 C;  1GKX A;  4MP7 A;  3G6E V;  4O05 A;  1NJI W;  5D7C A;  1G4Y B;  5M4N A;  1L0O A;  3R4N A;  2CK3 G;  5D7R A;  4XIR A;  4XDM A;  2YKJ A;  1AR1 B;  1K9M W;  3C11 A;  2R9I A;  4GT8 A;  3GIF A;  4PL9 A;  2HKO A;  3VHC A;  4XDJ A;  2Y48 A;  2YE7 A;  2ATK C;  1MX0 A;  1FXV A;  4UVA A;  1VQ4 V;  3T2S A;  2WI5 A;  3K3W A;  4OXS A;  5BZB A;  4KSH A;  1VQL V;  5CBH A;  4BQJ A;  1NR7 A;  4DXW A;  1UJW B;  3B27 A;  3FT5 A;  3Q5K A;  1M56 C;  3U2K A;  1Q86 W;  1RPR A;  2V7Q G;  3A0Y A;  2QE7 G;  2CCU A;  4MPN A;  3EHF A;  3QNE A;  2WER A;  1M9N A;  2JIZ G;  4KFM A;  3JD1 A;  1K7D A;  4QIW F;  1S76 D;  5CTW A;  4QJF B;  5L3E A;  2BYI A;  2HLD G;  4WFB V;  2WWW A;  3PEH A;  2IWS A;  4FIP C;  3SL2 A;  3OPD A;  4ASA A;  4CZZ A;  2OT5 A;  4MVO A;  2XK2 A;  1R6K A;  5FL7 G;  2WI6 A;  3DGE A;  4U7N A;  2IJK A;  1YT2 A;  2ZDI C;  4H33 A;  2HVJ C;  4BAY A;  5LHH A;  2YKE A;  1N8R W;  2YEG A;  1DTO A;  1YC3 A;  4MVM A;  4L94 A;  2QA4 V;  3ABK B;  1EFR G;  5H6R A;  2FWY A;  2YK2 A;  3WHA A;  2WI3 A;  5M4K A;  3R4M A;  4FCR A;  4PA9 A;  2E0A A;  3K06 A;  3OM3 B;  1R3I C;  2R9R B;  2V1D A;  3T10 A;  4QNH B;  1FS0 G;  3CCU V;  1Q7Y W;  4WUD A;  3TZ0 A;  2XHT A;  2EJR A;  4UVB A;  3HPL C;  4HZ0 A;  3OWB A;  4WUB A;  2YE6 A;  4G27 B;  1AI4 A;  2XDL A;  1V55 B;  2YGE A;  2IJJ A;  4XCJ A;  3IED A;  3CCS V;  3K0G A;  3U2D A;  1K5S A;  1Q82 W;  4UV8 A;  4CWT A;  4QPJ A;  3ABM C;  4EGK A;  3M99 B;  2P67 A;  3CD6 V;  3CCQ V;  5H9C A;  3LUT B;  4GX1 A;  1YI2 V;  4CE3 A;  1H7S A;  4DO2 A;  4N23 A;  3CCL V;  2JKI A;  2W6J G;  1W2B U;  2PNR A;  2A0L A;  2Z5U A;  2ZR2 A;  5IY5 C;  4HYP A;  3Q5J A;  1S0V A;  1NVP B;  2BTZ A;  2XDK A;  1E1R G;  2Q8I A;  2YE4 A;  4JAS A;  2DYS C;  2CCT A;  2X0L A;  1YHQ V;  2O1U A;  3FB6 C;  4FPP A;  1YT0 A;  2BU2 A;  1EI1 A;  2Z3Y A;  4KP4 A;  3T2M A;  3F5W C;  5HFM A;  2X6C A;  2YE2 A;  4CWP A;  5CTU A;  4HY1 A;  2LP7 A;  1AJ6 A;  1UYF A;  2D3O W;  3ZKB A;  4NH9 A;  4I5S A;  2Q69 A;  1AI6 A;  3JZ3 A;  1VQO V;  4N21 A;  1I5C A;  3PJS K;  1JQ0 A;  2AKP A;  3OW2 U;  5L3F A;  1K97 A;  3CME V;  1R3L C;  4O04 A;  3ETD A;  1ORQ C;  4UV9 A;  3IC7 A;  3ML0 A;  4JF3 A;  4V26 A;  3EHH A;  1NH2 D;  4MPC A;  4RO2 A;  1BMF G;  4X89 A;  5B1A C;  4YKY A;  2WEQ A;  1UYI A;  5B3S B;  2JJC A;  3K98 A;  1OCZ B;  1B6Q A;  2BU5 A;  3K9A A;  4DZY A;  3LSS A;  1S16 A;  4R8C A;  4X9L A;  1QVF U;  1NHI A;  2M7W A;  3CWV A;  2YI0 A;  2WLL B;  3MHH C;  3BM9 A;  1W0K G;  1NH2 B;  2YI6 A;  5M4M A;  3AG1 C;  1M90 W;  2VCJ A;  3CMA V;  1OCR B;  2H8P C;  4XIQ A;  2EIK C;  3T4D A;  3QDD A;  4MW3 A;  3FKS G;  2K1E A;  4WUC A;  2XDS A;  2EIN B;  4I3H A;  2A9H A;  4L90 A;  3ZMZ A;  3MHS C;  4MPE A;  4MBC A;  4PRX A;  4ASG A;  1ZWH A;  2WLK A;  3F7V C;  1UYL A;  1TBW A;  2IH1 C;  4QPK A;  3W7W A;  2XOK G;  1B3Q A;  2JK5 C;  2XAJ A;  2XHR A;  1OSF A;  3OR6 C;  3CGY A;  5J71 A;  4KSG A;  2XJJ A;  3FYE B;  1FXK B;  1ZXM A;  3EKO A;  2YJW A;  4GT1 A;  5IYD O;  1L1F A;  2QG0 A;  2H55 A;  5B1A B;  2XAS A;  1FXK A;  3W7T A;  3D3I A;  2IU3 A;  4TSF G;  3A0Z A;  3LNU A;  4JQL A;  4AWP A;  5KA5 A;  4YKW A;  3JCZ A;  3QO7 A;  1Y8P A;  3JYC A;  4MS2 A;  1I59 A;  3AG4 B;  4PDV A;  4L87 A;  3TCU A;  3B28 A;  4MOT A;  4PA3 A;  1NR1 A;  4O0B A;  5LGU A;  1B63 A;  2GQP A;  3ABL C;  2B5U A;  3OUS A;  2FXS A;  1QBZ A;  1W0J G;  2EZP A;  1I5B A;  1YC1 A;  1GKZ A;  3FB5 C;  5LHI A;  3K97 A;  3R92 A;  3VHA A;  4ZKI A;  2YEE A;  1B62 A;  2YKI A;  2VCI A;  4PA7 A;  5B1B C;  3OEE G;  1VQP V;  1MAB G;  4H7Q A;  2HJF C;  3ASO C;  5D7D A;  1SET A;  3VHD A;  1S77 D;  3E35 A;  1RM1 B;  3ZKD A;  5DM6 V;  4NH7 A;  4AS9 A;  3G7B A;  1S5H C;  1QLN A;  3UM7 A;  2HCH A;  1SER A;  3K08 A;  1S14 A;  4MVQ A;  3GIE A;  3NMQ A;  4CE1 A;  5CN0 A;  2EIM B;  1US7 A;  1NKD A;  3K03 A;  3HHU A;  4O07 A;  2XX4 A;  4PU9 A;  4R50 A;  3GWO A;  2BZ5 A;  2W0F C;  2WI1 A;  3AG3 B;  2IOP A;  5DN6 G;  3LNM B;  3NXS A;  3ZRW B;  5EBW C;  3CXC U;  2IOR A;  2ZXW B;  5FND A;  3K04 A;  4JAV A;  2K5B A;  2ZQM A;  3CRK A;  1DF5 A;  1KKD A;  2YEH A;  4R3A A;  1HWY A;  5B1N A;  3ABL B;  4MTG A;  3ETE A;  2BOB C;  1UYM A;  3ZMU A;  1K34 A;  2VWC A;  1BHA A;  4EM7 A;  3ETG A;  5KA6 A;  3RVZ A;  4MTX A;  2BSM A;  1VQ6 V;  2IJH A;  3D36 A;  2YKC A;  2ZD9 A;  2DWE C;  2IWU A;  3ZN0 A;  3INW A;  2IW5 A;  4WCE V;  2W6I G;  4WFF A;  5B1O A;  3EHB B;  2YE8 A;  3TUH A;  1VQN V;  2OCC B;  1V54 C;  3BY6 A;  1U2O A;  1GTO A;  4LWI A;  5L3C A;  1F51 A;  1WLE A;  1GKF A;  2Q68 A;  4MVS A;  4JYC A;  4BQG A;  1BL8 A;  1CP9 A;  2WLI B;  1QLE C;  2YJX A;  4YKU A;  1GJV A;  1M57 C;  2XAQ A;  4HY6 A;  2X6A A;  2ZDY A;  4EKW A;  4GX0 A;  3VAD A;  1Y4U A;  3E89 A;  5IYB O;  4RAI A;  1H2G A;  1JM6 A;  2WLI A;  4MVR A;  3D0B A;  1AI5 A;  2XX5 A;  2BU8 A;  1QVG U;  4ASF A;  4LWH A;  5F3K A;  3RVY A;  3HB3 B;  4W7T A;  3SYC A;  4UVC A;  1FFT B;  1H8H G;  5J9P C;  1I58 A;  3ABT A;  4MP2 A;  4TT3 G;  1EA6 A;  4L8Z A;  3P32 A;  2NLJ C;  3W7S A;  3T1K A;  4RUF A;  5LBQ A;  2YE3 A;  5CF0 A;  1UYG A;  3MNR P;  1F23 A;  4FCQ A;  1Z5A A;  2Q8G A;  3ZIA G;  1JPX A;  3AG2 C;  1I5X A;  4CWR A;  2EIL C;  1S3J A;  1YIJ V;  3CGZ A;  4XC0 A;  1PNL A;  1JJ2 U;  3WQ9 A;  3LDD A;  1M56 B;  3TZ2 A;  2Q6A A;  1BGQ A;  3AEI A;  2EBO A;  1QY8 A;  3KE6 A;  1UYK A;  2YKB A;  5LHG A;  1AMW A;  1OCC C;  2EIJ C;  1ZW9 A;  4YKZ A;  3INX A;  3O2F A;  4CWQ A;  2HG1 A;  1KP2 A;  3CCR V;  1YTF B;  5M4E A;  4YKR A;  1NVP D;  1R73 A;  3T4Z A;  4KTN A;  4WFE A;  1M57 B;  2HFE C;  1F4N A;  2MK3 A;  4AWQ A;  4XIT A;  2QEX V;  4CWO A;  4PRV A;  1AH8 A;  1EBO A;  1G8M A;  1VQM V;  4J9Z B;  2JJ1 G;  1UYD A;  4WFH A;  4EFU A;  1TID A;  1OHH G;  3G4S V;  3JD4 A;  1GMG A;  3X2Q C;  5FNF A;  1PNK A;  3K79 A;  2WSS G;  1DF4 A;  3R65 A;  1YS3 A;  4LBE C;  1K3E A;  3F7Y C;  1Y66 A;  2ZDI A;  3B8N A;  2IJI A;  2FTK A;  3ZM7 A;  2DYR C;  4NH8 A;  1ZXN A;  5IDM A;  1NHJ A;  5CA3 A;  1MU5 A;  4LCU C;  3PEJ A;  2Q8H A;  1S72 V;  4P7A A;  4CWS A;  3BEH A;  5KUK A;  1PD3 A;  3HYY A;  1I5D A;  4RUE A;  4JTC B;  4FCP A;  4V25 A;  5IDJ A;  1YSC A;  4H85 A;  2HR3 A;  3E8B A;  2FYP A;  1OCO C;  2P90 A;  2HG5 C;  1TUE B;  5IN9 A;  1K5Q A;  5FNC A;  1JX9 A;  3ABM B;  1COW G;  2UWD A;  4TWK A;  4CWN A;  3OR7 C;  3EHG A;  1YJW V;  3B25 A;  1XL6 A;  1CPY A;  4R7C A;  4XE2 A;  2LFS A;  2GHY A;  3CCE V;  5IY5 B;  2JDI G;  1F4M A;  3SYP A;  3D2R A;  3B24 A;  1UYH A;  3ZRX A;  4KQV A;  2WLL A;  4JAU A;  2DYS B;  1A4H A;  3QTF A;  1WPX A;  3E83 A;  4XCL A;  5C93 A;  3WG7 C;  4EGH A;  3ASN C;  3HYZ A;  4YKT A;  3TZ4 A;  1AJP A;  4HXW A;  3G75 A;  3U67 A;  4MB9 A;  5CTX A;  2YEF A;  4HYM A;  2BU7 A;  2VW5 A;  2ZDX A;  3QO8 A;  4GQT A;  2XD6 A;  1K8A W;  1M1K W;  4P30 A;  4R3M A;  2UXN A;  3ABU A;  3SPC A;  4E00 A;  3H4L A;  1GM8 A;  2XAF A;  4R6Z A;  4P2Z A;  1SZT A;  1BHB A;  2IU0 A;  5GGZ A;  1YSR A;  4DUH A;  3SPH A;  2O1V A;  3WFV A;  1K4C C;  3RLP A;  1KIJ A;  5CPH A;  3RW0 A;  2A79 B;  2BOC C;  4BAE A;  2C2A A;  3H80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...