2C2AA

Structure of the entire cytoplasmic portion of a sensor histidine kinase protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
240
Chain Sequence
MENVTESKELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Entire Cytoplasmic Portion of a Sensor Histidine-Kinase Protein.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords SENSOR HISTIDINE KINASE
total genus 81
structure length 240
sequence length 249
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2c2aA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2c2aA02
2P67A 1BGQA 3VHCA 3FT5A 1NHJA 4W7TA 1Z5CA 4WUBA 3B24A 2CGFA 2HKJA 4PU9A 4LP0A 2QM7A 2BU7A 1S14A 3Q5JA 2YEHA 3T10A 2QM8A 3JZ3A 3LNUA 2WI6A 4KSGA 2AKPA 4LWEA 2YGAA 5M4HA 4LWFA 1YERA 4JYCA 3CGYA 4LWGA 2BU5A 1BYQA 4MT8A 2YI5A 4E00A 5M4NA 2ESAA 4ZVIA 2LFRA 4CWOA 1I58A 1YT2A 3SL2A 2CG9A 2YECA 2YEBA 4CWSA 2YI0A 2BYHA 3K99A 3O6OA 4BIUA 4XD8A 3T0HA 4KFGA 3NMQA 1YSZA 2XX4A 4MPEA 1A4HA 2FWYA 3TZ4A 3OPDA 3DGEA 3B25A 3EKOA 3Q5KA 3R4NA 4MPNA 3A0ZA 2WERA 1UYFA 2GFDA 3RKZA 2FYPA 4HY1A 1UYIA 4EFUA 4MOTA 2Q8FA 2Q8IA 1U0ZA 1QY8A 4HXZA 1ZXMA 3CGZA 4LPBA 4R3MA 3D0BA 4JAUA 3ZCCA 4AS9A 1I5BA 1KZNA 3QDDA 1YC3A 5CPHA 4DUHA 1QZRA 2O1UA 1JOYA 2WEQA 3EHJA 2BU2A 1ZW9A 3O0IA 4CWRA 1TH8A 4O05A 4BQGA 1UYHA 2BT0A 3EHFA 5BODA 1UY7A 3R91A 4V26A 4XKKA 2Q8HA 1UYLA 2BREA 4HY6A 4YKZA 5F3KA 2XDXA 3H80A 3NXSA 2WWWA 4H85A 3MD0A 3RLPA 1AH6A 4CWTA 3OWBA 3GIGA 3HEKA 1US7A 4YKQA 2YGFA 1I5AA 3R92A 3MNRP 4O07A 4FCPA 1TBWA 2IORA 2YJWA 1IXMA 3GIFA 3GIEA 1S16A 4AWQA 2XX5A 2YKJA 2QG0A 1YT1A 5J71A 2BU6A 2YE6A 2WI7A 1UY8A 4GGLA 3WQ9A 1Z59A 1YESA 1Z5BA 2XDKA 3BMYA 5CTWA 2XHRA 2ZDYA 2H55A 1Y8NA 3C11A 5FNDA 4MBCA 2YI6A 1YC4A 4NH7A 4O04A 4MP7A 4XIRA 4XTJA 2VW5A 4U93A 3OWDA 3TZ0A 1TIDA 3ZXOA 3U67A 4FCQA 4XITA 4H81A 4L91A 1TILA 2XCMA 2XD6A 1B63A 5D7CA 3U2KA 5L3JA 2ZBKB 2YKBA 5D6QA 3ZXQA 3CWVA 3CRLA 3INXA 4URNA 2BU8A 2XX2A 2HCHA 2WI3A 3D36A 4L93A 4Q20A 5D6PA 3K97A 3HHUA 3VADA 4O09A 4YKRA 4YKXA 2PNRA 2YE4A 5B1OA 2YEAA 3OW6A 2YE3A 3G7BA 1H7UA 4GT8A 2VCIA 1UYKA 4BAEA 2C2AA 2H8MA 3VHDA 1UY6A 1ZXNA 4DZYA 3HZ5A 5M4KA 3EHGA 3ZM7A 2JKIA 3CRKA 4ZKIA 1U2OA 2WI2A 4R3AA 3INWA 2YEIA 4PRVA 1Y4UA 1BXDA 3TUHA 4WUCA 2WI5A 2FTKA 1YT0A 5IDJA 3HZ1A 3RLRA 2JJCA 2YJXA 1NHIA 1I5CA 1YETA 3B28A 4HZ5A 1GKXA 3A0XA 4I5SA 4YKYA 2UWDA 4XIQA 5FNCA 4FPPA 1ZWHA 4U7OA 4URMA 1EI1A 1BKNA 4YKWA 2O1WA 2IOPA 3ZRWB 2VCJA 1AH8A 5M4PA 1F51A 4CE1A 2O1VA 4CWQA 2YE2A 4XDMA 2CCSA 2BYIA 2YK9A 3A0YA 2K5BA 3ZKDA 3G75A 4MP2A 4XKAA 2HG1A 3FV5A 4MTXA 3ZRWA 4UROA 4XE2A 4XIPA 4CWFA 2XDUA 4L8ZA 4CWPA 3IEDA 4O0BA 4QPKA 5CTYA 2YEGA 4FMTA 2EXLA 1KIJA 5M4EA 1JM6A 2QG2A 3K60A 4R1FA 3O2FA 4KP4A 4CE3A 1Y4SA 3TZ5A 2YE9A 2FWZA 1PVGA 4JASA 4H7QA 4CWNA 4L94A 4GEEA 3Q5LA 5B1NA 3A0WA 4HXWA 2YE5A 2CCUA 2VWCA 3ZRVA 3PEJA 1YS3A 2LFSA 2QFOA 3P32A 3HYYA 5GGZA 1I59A 2YEDA 1I5DA 4YKUA 4NH9A 1H7SA 4GCZA 4B6CA 4BXIA 5M4MA 2WI1A 4EEHA 4XCLA 4ASAA 3A0RA 2Q2EB 3KE6A 1MU5A 5IDMA 4MB9A 4P7AA 4GQTA 1UYMA 4E02A 3U2DA 3TZ2A 2ZKJA 3LPSA 4PL9A 4CE2A 1THNA 5D7DA 2GQPA 4K4OA 1NHHA 2XDSA 2Q8GA 2YI7A 2XDLA 5D7RA 3GIGB 4XKOA 4MPCA 3HYZA 5J6AA 1R62A 5F5RA 4LWHA 4QPJA 1B62A 3K98A 4URLA 4GT1A 2YE8A 1YC1A 1Y8PA 2IWUA 5C93A 3C0EA 3G7EA 4V25A 4XC0A 4KQVA 5BOCA 3D2RA 1AMWA 1UY9A 2BTZA 2XHTA 2XJGA 2IWSA 4ASFA 4KSHA 2XHXA 4X9LA 1AJ6A 4E01A 3ZKBA 1ID0A 4U7NA 4AWOA 4GFNA 3EHHA 3TK1A 3FT8A 3B27A 3A0TA 3R4PA 2YKEA 2XK2A 2WI4A 1QYEA 1Z5AA 4I3HA 1UYGA 3B26A 1OSFA 3TTZA 1GKZA 3VHAA 4LC1A 2BZ5A 2YKIA 4EGIA 3R4MA 4LWIA 4JAVA 1MX0A 1EA6A 1GJVA 1B3QA 3RLQA 4ASGA 1L0OA 2YEFA 2YEJA 3QTFA 2XJJA 5CTXA 1AM1A 1UYEA 2BSMA 3EKRA 3R4OA 2CH4A 4WUDA 2CCTA 1TC6A 2YEEA 4EMVA 3T1KA 1Y8OA 2XABA 4EGHA 4HYPA 5CTUA 2IOQA 5FNFA 4JQLA 3WHAA 5FWKA 2XJXA 5IN9A 2YK2A 2ZDXA 4BIZA 4EM7A 1UYCA 4EFTA 4L90A 3T0ZA 2QF6A 5CF0A 4EGKA 1UYDA 1TC0A 2YE7A 4ASBA 4B7PA 4YKTA 4XCJA 4FCRA 2E0AA 2YKCA 1YSRA 3ZRXA 4AWPA 3T2SA 3H4LA 2YGEA 4P8OA 2IWXA 3OMUA 4PRXA 4KTNA 4BQJA 2WEPA 2FXSA 3BM9A 4JYBA 4HZ0A 4NH8A 2BRCA 4HYMA 3PEHA
chains in the Genus database with same CATH superfamily
1BGQA 2YEVA 2A06H 4NXNB 5E1AC 4GX5A 2ZXWB 5JCOA 3B24A 4LFBO 4PU9A 1IURA 4O4LA 3X2QC 4TQDA 2YIBD 4JI0O 2BU7A 4B3TO 4MS2A 2QSAA 2YEHA 1EFRG 3JZ3A 3LNUA 2LW1A 2WI6A 4NTXA 4BAYA 4MW8A 4KL1A 1KD1W 4J7ZA 4JYCA 1D2DA 1M56C 2OCHA 5AG2A 4DR1O 5HFMA 2YI5A 2DW4A 1YDXA 2B5UA 2YUAA 4CWOA 2CG9A 2XAGA 2UUAO 4X20A 1NR7A 3K99A 1QLEB 3T0HA 1DF4A 1YSZA 5LMUB 4P30A 4XBFA 5JJNB 2PI5A 3E83A 2QWPB 3Q5KA 4MPNA 4MTFA 1RM1B 3A0ZA 1KP2A 4X9QA 1MG1A 4GX1A 5FPRA 4DK0A 4RQFA 3T1YO 1IZ3A 3AG1C 3R66A 2BSKA 2YICA 4EFUA 3JD1A 2X6AA 1ZXMA 3CGZA 1EN5A 1W2BU 4R3MA 4WFHA 3ZCCA 1RM1C 3QDDA 2PUSA 2ZM6O 1AR5A 1OZ0A 1V9PA 3VQVA 1GN4A 2P5OA 4X8AA 5LHGA 2WEQA 2LJ2A 5GTHZ 1ZW9A 3O0IA 2LP7A 1L0NH 4CWRA 5BR8B 4O05A 2V7QG 4BQGA 4DXWA 4RWUA 3AG7A 1HWYA 4BR6A 5IYBO 4EKWA 4YY3O 3CC4V 3E8BA 3G6BA 4XKKA 1N33O 1SESA 4J7KA 3CCSV 4HAMA 5LXTB 3B2EE 5GONA 4D6TH 4DUYO 1R6TA 2CUGA 4LF5B 1CEZA 1KU9A 1O9HA 4LH7A 4YJ3A 1AH6A 2R9AA 4GX2A 3OT7A 4Q6GA 1US7A 2ZE8A 1SQQH 2KB1A 4PI0A 1HDJA 1IXBA 3CXCU 3JASA 4LF4B 3T4DA 4K35A 3ZHQA 3LDDA 4YIOA 4FCPA 2IORA 2Q7GA 5J2TA 1VF6A 1IXMA 4G28B 3S3XA 3B8MA 3I5DA 2QWOB 1Y67A 2NR5A 1WP7A 4ZBMA 3W7SA 1UY8A 2F4VO 4XDJA 1Z59A 4W4LA 5CTWA 3L75H 2XHRA 2Q0AA 1T5EA 2OT5A 3D3QA 4P9OA 5FNDA 4LF9O 2F66C 2W0XA 4MP7A 2DQ3A 2H3OA 4TT3G 2XAQA 4O4HA 1YJ9V 1B63A 5D7CA 1KQSU 1RPRA 5L3JA 1DLBA 3I55V 2YKBA 3ZXQA 4F6RA 3H1IH 4FIPC 4DV0O 4URNA 4L8JA 2GTAA 5EBMC 2XX2A 2WAMA 2WI3A 2RQ6A 2L35A 4L93A 1OCRC 4B3MO 3K97A 2UUCO 4I55B 4O09A 4LFCB 3SPJA 4YKXA 1EN6A 2PNRA 1H2NA 5B1OA 1FXKC 2WLKA 3CB2A 3ZN0A 2Z5UA 1TVKA 1GKFA 2VCIA 1NTZH 2Q0OC 2C2AA 3HKDB 4ZHQB 1OCCC 1UY6A 4JI6B 3EHGA 5LMUO 3ZM7A 1UJWB 3KCXA 4B3TB 2DWEC 4QIWF 3W7WA 3AG2B 1GRJA 1VQ8V 4IT5A 3JYCA 4GKKO 4DV4O 3T2MA 3HZ1A 3CEIA 4UXNA 2AHZA 4MVZA 4E2LA 5H5NA 1NHIA 1K8AW 1FKAO 3B28A 1GKXA 2A3QA 2JDIG 4CC6A 4FFBB 4K3AA 2YIDA 4I0XB 3T4ZA 2WLMA 4FPPA 3UO3A 3JALA 3ZMUA 4YKWA 1VQMV 2JGDB 3BA8A 1S3JA 5GW7A 1K5QA 3WG7B 1SQXH 2O1VA 3E2EA 1JR9A 5EZYB 4EFEA 4GKKB 2F93B 2ZE6A 5KHIA 3E8GA 2YE2A 4XDMA 1K92A 4FFBA 2ZINA 3H01A 2OWOA 2JEXA 2YK9A 4E72A 4OPAA 4LWSA 2XTAA 3JD3A 1M57C 2VQFO 4MP2A 1Q90D 3JD2A 4UROA 4ICGA 1S0VA 3OM3B 1FAFA 3OEEG 2XDUA 4CWPA 5IY5B 3HPLC 4QPKA 3CCUV 1PNMA 2YEGA 2JIZG 4CS3A 3DC6A 4TV9B 2CTRA 1J95A 1YSCA 1JM6A 3E8FA 1Q43A 2A7WA 5D5PA 4KP4A 4CE3A 3TZ5A 2JVDA 2XOKG 4JV5B 4MVUA 3J7AU 1L8DA 1SC5B 5B1NA 4DR7O 1K97A 4R6ZA 3FB8C 4HXWA 3K9AA 5L3GA 4X66B 2EX3A 2QFOA 4LF4O 2HG5C 5GGZA 4MVQA 3Q4HB 1ZLZA 2VQEB 4MVOA 1BHBA 2P4VA 3SYAA 1I5DA 4B6CA 4BXIA 2RN9A 4ASAA 3K04A 3S3WA 5L3EA 1VF5B 1MU5A 1JQ0A 3ZX6A 3KE6A 1DK1A 1FD9A 3AK3A 1L1FA 4EFBA 3G4SV 1KKDA 3BFRA 1UYMA 3N2GA 4DR6B 4IIJB 5BMVB 5EYPB 1THNA 1ZX3A 1LR1A 4K4OA 1G6UA 1NHHA 3OMIB 2JGUA 3SJCC 3DTUB 4X66O 2XDLA 4ZIBA 4FK5C 3TCUA 3HYZA 1R62A 2UUCB 3K98A 4LF7O 1QHTA 2E74B 4GT1A 2YDEA 2C1IA 2OTLV 3CWBH 3T1HB 5GONB 5BY1A 5A9GA 3C0EA 4R8CA 2QWRB 2UXDO 4V25A 3JAKB 3D2RA 2XHTA 5CBHA 2XJGA 3BPZA 1XHXA 4W4KA 2N05A 3AK1A 4E01A 4PA7A 2EJ7A 1SETA 4NR1A 4B3MB 4A5UB 2CAZC 3ZRSA 3FT8A 3B27A 1SQVH 3MDSA 4TQFA 4X1KA 1QYEA 2JS5A 4U3FH 3I56V 1Z5AA 3C3SA 3VOUA 3RN4A 4YJ2A 3VHAA 1MZFA 4O4IA 2YKIA 4X65B 3ML0A 5D5QA 3DC5A 1MX0A 5H6RA 4DR2O 1URFA 4LH6A 4AHCA 1WAZA 4Z1MG 2R70A 4PI2A 4X1YA 4PV1B 4YHHO 2F43G 1YHQV 1VP7A 1AM1A 1X4TA 1RPOA 2ZD9A 1SZTA 4DRXB 1K4CC 1VQ5V 1GMGA 4J9ZB 2FL4A 1NTMH 4JI8B 4WUDA 3NR7A 5HFLA 3HKCB 4EB6A 1VQ6V 4PA3A 1F23A 1L0LH 2OYQA 5LGTA 3P3PA 1G1XB 2GUZB 3WHAA 3EXAA 4TV8A 4BIOA 2LGQA 4D7SA 4ZI7B 2QF6A 1UYDA 1I0HA 3ABLC 4DR1B 3HKBB 1M57B 5K1PA 1NVPB 4XCJA 2O57A 2E0AA 3M8AA 2EIKC 1YSRA 5LXTA 3CC7V 1YITV 2YGEA 3KZIZ 3CRRA 4GLXA 1R73A 3OMUA 4PRXA 4KTNA 2EILB 2FB5A 2FXSA 2WLIA 2PI4A 1SQBH 3JARB 4JYBA 2W6JG 2N04A 2PYJA 2WLNA 4UCOA 3HKDA 4H13B 3K79A 2R72A 3VHCA 3FT5A 3R65A 2RDCA 1SZXA 1N0JA 1SQPH 1Z5CA 1AP5A 2CGFA 1VQKV 3L73H 4BW5A 3ZHSA 1H2GA 4J11A 3Q5JA 2AW9A 3T10A 3DXRA 2AKPA 2R9RB 2EIJC 1BGYH 1YI2V 2FYUH 3AG4C 1Y76B 4MT8A 4E00A 5M4NA 1K4DC 1VARA 4ZVIA 1I58A 1YT2A 3J80N 5J2TB 2YEBA 2YI0A 1Y6XA 2MK3A 4XD8A 5CA3A 1N32O 4N21A 2XX4A 2Q73A 3D36C 3AG1B 2X0LA 1A4HA 3OPDA 3DGEA 5IJ9B 4KXRA 1RFYA 2VQEO 3O65A 2GFDA 1HNZB 4PJ0Z 4WFAV 4MW3A 2AGAA 2LGWA 1QLEC 5KUKA 1NZ6A 3SJQC 4LPBA 3K59A 5B1BC 1YJWV 5JQGB 1YC3A 1QZRA 2HVKC 5IYDO 1OCRB 4P2ZA 3BVOA 3BHPA 4WCEV 1TUBB 3WB0A 1UYHA 2BT0A 2HJDA 3R91A 2EIJB 3G80A 5LP6C 2Q8HA 3CC2V 4H33A 5EK0A 3SR2C 1SKVA 3ABKC 3KG2A 4PA4A 2JJ1G 2BREA 4HY6A 1GO3F 4YKZA 5F3KA 4UB8Z 5CBFA 1GAXA 1SERA 1N34O 1AP6A 3H80A 5JQGA 1I5XA 1YTFD 2UXBB 1GK9A 4LF6B 1N0NA 1TVKB 5DM6V 5CB4B 2QM4A 4ZOLB 2B9ZA 2YC0A 3CE2A 3N2GB 2YGFA 5C8YB 2AXTZ 2Y0PA 4CH5A 1TAEA 1B06A 1JPXA 5LGNA 1AI5A 1OCOB 3LSSA 2Q68A 2YKJA 5J71A 1NTKH 2BU6A 2EIKB 4PELA 1XMOB 2X7RB 4MTGA 1Z5BA 2X6CA 3BMYA 1MNGA 3SJAC 4IIJA 4DV3O 4X65O 5B3SB 2XAJA 2YI6A 2CGOA 3OWDA 3TZ0A 3CJHB 4I4TA 4E4EA 3U67A 1AI6A 2WLLA 4LF8B 1KC8W 1Q6IA 4L91A 2XCMA 1XL6A 4TUYA 1NQTA 1US6A 3LSUA 4J9YB 4WFGA 3K06A 1SA0A 3CHXA 2YXHA 1X59A 4ABMA 3HHUA 1XILA 3ZHRA 2ZNIA 3Q4HA 4GZRB 4RQEA 1S5HC 2DE0X 3TXSA 3OW6A 1VMGA 2ADQB 4JYAB 3G7BA 4O2AA 4GT8A 1BQZA 4LF9B 3QTCA 4MSWC 4BAEA 1HNWO 4LFBB 4UVAA 1RSOA 4NYKA 1ZXNA 4DZYA 2V1DA 1YEWA 3HZ5A 1H2MA 3N2KA 2HEPA 3LNNA 2JKIA 3CRKA 2YEIA 4PRVA 2UXNA 3JAWA 3FKSG 2EZPA 3LSQA 3TUHA 2FMLA 2H94A 4DR6O 2BOBC 1NR1A 4WFFA 1OCOC 3JATA 3RWRD 1E79G 3ABMB 4JYYA 4TV8B 3T1CA 3JAKA 2IJIA 5B1AC 2F1MA 2GV9A 4JGSA 3K58A 1G4YB 4I5SA 5CA1B 4YKYA 4LF8O 4XIQA 3L70H 1YTFB 1Q86W 3JAMN 5ITZB 1ZWHA 3D8CA 4U7OA 1VF7A 4URMA 1EI1A 2VS0A 2QWQB 3UT5B 2O1WA 4GKJB 3AEIA 1VQOV 4CE1A 4B08A 3E35A 4XDLA 4TV9A 3UM7A 3X2QB 3OTOB 3OGCC 2BYIA 2XNDG 1P7GA 1SRYA 2EINB 2XAFA 2K5BA 3ZKDA 4K8XA 1M1KW 3FV5A 3OE7G 1WP8A 5FNVA 1PL4A 5GTIZ 2ZM6B 1VQ4V 4UCRA 4KFMA 4YY3B 1W0KG 1Y74B 2JK5C 3QO5A 2EILC 3STZC 1KIJA 4QE7A 4YHHB 2HHHO 2GUZA 4KUMA 2UXXA 4DV5B 3O2FA 1XNRO 4JTCB 2YE9A 2HFEC 4O4LB 1PL0A 1PVGA 3UO2A 3JSLA 4GEEA 3ABLB 5DECA 2Q69A 4QNHB 1H2LA 3A0WA 3MHHC 2YE5A 2XASA 4CS4A 3ZRVA 4LFAO 1DF5A 1V55C 3JAWB 1VEWA 3P32A 1KUQA 5KX5A 2YEDA 3CCJV 4RO2A 1H7SA 3H1JH 1A32A 1K7DA 1Y4MA 4GX0A 5IJ9A 1AVMA 2XT9A 3AG4B 1HR0O 4JI4B 5JVDA 4CZZA 3ZMSA 3RYIA 4MB9A 3K57A 1GN3A 1Z5WA 2EIMB 2IU3A 4DR5B 4GQTA 4AQYB 3FFQA 4DUZB 2AZ2A 3TZ2A 4DV6B 2ZKJA 4PL9A 1JX9A 3VQWA 1XL4A 3WG7C 1U96A 3K9SA 3FX7A 4FM0A 3CCLV 3P30A 2WLHA 4CH6A 4I50B 4OX9O 1XEQA 3GIGB 4XKOA 4LNUA 2Q67A 2A0LA 4MPCA 3JD4A 4CH3A 5J6AA 1FJGB 1B62A 2ZDIC 2UXCB 3N27A 2YE8A 1YC1A 4DV5O 1FXKA 2UU9O 5C93A 2RMKB 2NN4A 4XC0A 1BS3A 1XBLA 4HNAB 3QF7A 2XAHA 1M90W 5H6QA 1NKDA 1K33A 2IWSA 4KSHA 3OUFA 4IL6Z 3CXHF 3RBZA 1AI4A 1EZJA 4ZOLA 3SDLA 1HR0B 4LFAB 1AJ6A 4PD4F 5LMNO 2PYLA 2KKWA 4U7NA 2P4KA 2HVJC 4GFNA 4I7ZB 3TK1A 3SPHA 4PDLA 1R3KC 3APOA 1MZEA 1NI8A 1OCZC 1UYGA 4FFKA 4DV7B 2R9IA 4QJFB 4HYOA 1AJPA 4LC1A 4O4HB 1JMKC 1XDCA 3FB5C 4LWIA 1XHZA 2V4DA 1EA6A 4ASGA 3OEHG 4X88A 3CCMV 1FFXA 3H1KH 4CH4A 1B6QA 1BCCH 2YXLA 5KHKA 2CH4A 3QNEA 2CCTA 3SYPA 1VQLV 5KHJA 5CTUA 3OW2U 2XJXA 5IN9A 2WA4A 2Y69B 1S5LZ 4BIZA 4EM7A 4X64O 1B04A 1XMQO 5H9CA 1PKXA 1TA8A 3ASNB 3SPGA 1AJQA 3BY6A 2LO1A 4I4TB 4AWPA 4PA9A 3T2SA 1I94B 1D5AA 3ZIAG 4P8OA 2CH7B 4BQJA 2WEPA 2BRCA 3JSNA 2BTOA 1R3JC 2P67A 3U0ZA 2F95B 5CB4A 4B7EA 2Y4UA 1SS3A 1WPXA 4W7TA 3ZN1A 1FXHA 4EEQA 2IH3C 3EHBB 1XQ8A 4LP0A 1XREA 2Q5ZA 2QM7A 5E79Z 4C7UA 2F23A 4D7TA 3JCUZ 1S14A 3T1YB 2RJZA 4DV2B 5EZYA 4KSGA 1M5IA 5KMGB 5M4HA 3OTFA 2Q7HA 4NKGB 1KB9F 1N36O 3K5LA 4RUFA 1OV9A 2ETNA 1DTOA 4LWGA 5LP6A 1BYQA 3CRMA 4X1IB 2B1GA 2LFRA 2B1IA 3SL2A 4KHPB 3H9VA 3ZHTA 4TOIA 4ZHQA 2YECA 3CPWU 3ASNC 1BT8A 1I5YA 2ADPA 3O6OA 2M6YA 4KFGA 3NMQA 2Y48A 1Q7YW 5JJEB 4K8ZA 1D5NA 2EZOA 5KMGA 4BW9A 2FWYA 1PPJH 2IJJA 2RNBA 3TZ4A 5J2UB 2OCCC 3AG2C 3EKOA 3C3TA 3R4NA 3LNMB 3MHSC 1OCCB 2WERA 3PJSK 1NJIW 4X1IA 2K1EA 3ETDA 4O2BB 3A2FA 5JWPA 2FYPA 2ILMA 3F5WC 1QQCA 3CJHA 1Q6UA 1UYIA 4HY1A 3BRCA 4R7CA 1QY8A 3P3NA 3HKEB 3RFRA 3D0BA 4JAUA 4AS9A 1I5BA 1KZNA 3ZBHA 2E3CA 5CPHA 1FXVA 1NBMG 2E5LO 1JOYA 2L6LA 3A8TA 2BU2A 4DV1B 1JFFB 2Q9LA 3HB3B 4H44B 1IBKO 4JI7O 3KCYA 3N2KB 1ROPA 5BODA 1UY7A 2CTWA 4V26A 3IGAC 2CDYA 1UYLA 1AI7A 3SYQA 1U97A 3JALB 2XDXA 3B09A 2Q7EA 3THOA 4G2KA 4O4JB 1COWG 4B7KA 3NXSA 2WWWA 1BE3H 4UVBA 3ZMVA 1NU1H 3MD0A 1ZWIC 3RLPA 4CWTA 3OWBA 3HEKA 3BCCH 4YKQA 3ZJZA 3GVMA 2OIGA 5LYJB 5CA0A 3R92A 2HP8A 2GTSA 4GKJO 1TBWA 3RYHA 4LBEC 3GIFA 2XUMA 1HW7A 4XDKA 4CC5A 1S16A 4AWQA 3UQ8A 2XX5A 5F2VO 2YE6A 5BR8O 2DYRB 4LFCO 1PP9H 3B8NA 2DMXA 1Z5VA 1QNMA 4GGLA 3WQ9A 1ZSPA 1YESA 2XDKA 3B77A 3OTOO 1QCEA 1JJOA 2H55A 4MVSA 1Y8NA 3ABMC 4GUNA 4NXMO 2BTQB 5K1XA 5LOVA 3C11A 1H38A 4MBCA 4NH7A 1F4NA 1N34B 4X89A 4XTJA 1QR8A 4P9PA 4U3JA 1BMFG 4U93A 5B5EZ 2HLDG 4IGGA 1GTOA 5IWAB 1TIDA 1GN2A 3U11A 3F7YC 5BMVA 4XITA 4UCVA 3CD6V 4MVRA 1Q82W 2W0FC 3IC9A 3CMEV 4UB6Z 1V55B 4WFEA 3SPIA 2JJ2G 2CGNA 1XOUA 1FXKB 4FM1A 1BZKA 3T1HO 4JAAA 2BU8A 5J9PC 3ABTA 3F7VC 2OTJV 3HKCA 3VADA 2PTMA 2W6IG 1MMMA 4JI6O 1R3IC 5KX5B 2YE4A 2HKOA 2YEAA 3ZMZA 1Y76A 1EBOA 1H7UA 2YSUB 4PDMA 4X1YB 2PY5A 2ZT9B 1FYJA 2H8MA 3VHDA 2CTPA 1TGOA 5M4KA 2KG7B 4JI4O 1U2OA 1JVMA 2WI2A 4R3AA 4JI0B 4DW0A 1GM7A 2WI5A 4DUZO 1V54C 2QR4A 3CP1A 2QEXV 3RW0A 2JJCA 3WB2A 2KQXA 1GM8A 1YETA 1GM9A 3BA9A 4HZ5A 4FJCC 4YJ3B 1ZAUA 2UWDA 2EINC 3K5NA 1MOFA 1UFIA 3SYCA 4UV9A 5DN6G 1E1QG 1WA8B 3K5OA 2DQ0A 2BCCH 5LL6Y 3QG5A 3STLC 1OHHG 1TUEB 2AZ0A 4JI3B 4U3JB 1WPBA 5B1AB 4LF5O 3ETQA 4FLUA 1IBLB 3M7MX 4CWQA 1HNXO 3AG3C 3GWOA 5CMUA 1M4UA 1XI1A 1YIJV 3G75A 4XKAA 2HG1A 1OJHA 2ZKOA 5IYZA 3FYIB 5IWAO 5B1BB 3U10A 3ABKB 4CWFA 4JTDB 4L8ZA 4O0BA 3OAAG 4EB6B 3L9DA 2EIMC 2EXLA 1WB7A 2D3OW 4N23A 3CX5F 3RGBA 2VQFB 2ZR3A 4R1FA 2NLJC 1Y4SA 3LDCA 2FWZA 4JASA 1ORQC 3L74H 5FLXN 4TSFG 1KP3A 2DYSC 3PEJA 1YZBA 4NTWA 2X6BA 5B66Z 1YS3A 1F7YA 2K9PA 3ABUA 3HYYA 1J5EO 3JARA 4ASUG 4YKUA 5M4MA 4HNAA 3WB1A 2WI1A 4EEHA 1SQGA 3A0RA 2ARHA 4JTAB 3K03A 4X64B 2VRZA 2UXBO 4E02A 3H1LH 5BXZA 3U2DA 1CP9A 2EULA 5D7DA 3ICXA 5IYZB 2D2CB 3OD4A 1O9GA 2XDSA 1LNQA 4YIPA 2Q8GA 1Q8IA 1YXBA 4F6RB 3RYCB 2H8PC 3QO8A 4LWHA 4QPJA 2DJVA 1IVSA 3FAVB 4URLA 3CS5A 4UCSA 4FLYA 1PNKA 2CE4A 1KKCA 3G6EV 2OIEA 2P90A 2IM9A 1IX9A 1N8RW 3G7EA 4DR5O 5BOCA 5KHGA 4WFBV 1V54B 4DV3B 2HHIA 3L72H 2QTSA 1MSWD 1UY9A 4DUYB 2ITCC 2IU0A 5JJJB 1I08A 4X9LA 3APQA 4DV0B 3ZKBA 1ID0A 2ZIOA 3LDEA 5LHIA 4FLZA 3EHHA 3LMMA 5ITZA 2YKEA 5KLVH 1BSMA 4JI5O 2AHYA 2BSKB 3SJBC 3TJTA 5LHHA 4I55A 3BABA 4KHPO 1OSFA 3B26A 3TTZA 4FLTA 4NXNO 5KUMA 1S72V 1JCHA 1GJVA 3RLQA 1UPGA 2UXCO 1L0OA 3OR7C 1XNQB 1M9NA 1E1RG 2DYSB 5CTXA 1UYEA 2PF4E 3EKRA 5KA5A 1RP3B 3VQYA 4X62B 4FVMA 4EMVA 3T1KA 1Y8OA 1R6NA 2XABA 2EJRA 3JASB 1NS1A 4HYPA 2PGGA 4WF9V 4JQLA 2GSMB 4WBNB 3CYOA 5KAFZ 2ZDXA 4LWSB 5FPOA 5BZBA 1IBMB 1XNRB 2ZQMA 4L90A 5CF0A 4LF6O 4EGKA 1EN4A 2IJHA 1TC0A 2WSSG 2NNUA 4ASBA 2A9HA 5L3CA 5L3BA 4FLWA 4YKTA 5C8YA 1S5JA 4AI8A 2DN9A 2WPDG 3ZRXA 4IYIA 4J7JA 5LMNB 2JGDA 4G27B 3WU2Z 1BQ0A 2QJ1A 4J41A 1FFTB 4H0LB 4OGQB 4NVPA 2ZNJA 3PEHA 4DV7O 5J2UA 3FB6C 5IYCO 1NHJA 4LCUC 1M56B 1AROP 4DO2A 4WUBA 1QR9A 2HKJA 5KA6A 4GYCB 2IBZH 1MSDA 3JCZA 3LUTB 2CTQA 3OFNG 3GWKC 4ZI7A 2QM8A 3IC7A 4J10A 3MAQA 3IAYA 4CBCA 4LWEA 5JVDB 2WLLB 2YGAA 1XUQA 1YERA 4LWFA 2YIBA 2YEVB 1I7FA 2E5LB 4DYLA 3RYFB 3C90A 4AILC 2Q6AA 3W7XA 3CGYA 2ZXWC 2ZCEA 4PDVA 3SPCA 3G71V 2Q8VA 2BU5A 3CCEV 1Q3EA 2ZDIA 1M93A 2ESAA 1K5SA 1QVFU 2UU9B 1WB8A 4CS2A 1XMQB 3RYHB 5H2FZ 4CWSA 2BYHA 1DGSA 2Z0AA 4BIUA 3TETA 1FJGO 3HR0A 3J81N 1Z2GA 2Y69C 4MPEA 3SGIA 3B40A 3B25A 3E86A 1JFFA 3K0DA 2QKAA 3ETEA 4NTYA 4UV8A 4TWKA 1GH6A 3VQXA 3ASOC 2KSDA 4DRXA 5LBQA 1UYFA 1H8EG 3RKZA 3KKYA 1G8MA 2N74A 4DV2O 1Q6HA 2JEUA 3CSXA 3K08A 4MOTA 2Q8FA 1VQNV 1ZL8A 2QKSA 1U0ZA 2Q8IA 2ZIMA 4HXZA 1N36B 4UCUA 1AB3A 1IBMO 1K34A 2VWKA 4UCTA 4F4LA 4DUHA 3PN1A 2O1UA 1R3LC 2P06A 1HNWB 3UKMA 3EHJA 2OCCB 1K3EA 4FZ1A 1R6KA 1TH8A 1WN7A 4JI1O 3EHFA 3TXQA 3AK2A 4JI8O 4NXMB 3W7UA 3HKBA 4B3SO 2WA3A 4RUEA 5EIBD 1YVWA 2DYRC 3ETGA 2HHHB 4H85A 3OMNB 5IT9N 3RVYA 3GIGA 2QKCA 3CRAA 1I5AA 3MNRP 4O07A 1CPYA 1IBKB 1I94O 2BOCC 2IH1C 4JI1B 2YJWA 3UT5A 3GB7C 3GIEA 1W0JG 4Z2WA 5A2QN 3RYCA 4L87A 2QG0A 1YT1A 1PM9A 3O9OA 2WI7A 1KMIZ 3K3WA 4HBNA 4O4IB 4JI7B 3S5TA 2XHBA 3FB7C 4DR4O 1JA8A 2ZDYA 1MABG 2BTQA 5LOVB 4BWAA 5L3DA 4FLVA 3ZEDA 3OMAB 4NB5A 3E89A 2FKXA 1YC4A 4O04A 4XIRA 2VW5A 5FNVB 4K0KO 4X20B 4R50A 5KHHA 3ZXOA 4FCQA 3CCRV 4H81A 1TILA 2HR3A 2XD6A 2GBOA 1PNLA 3U2KA 2G38A 3RT3C 1ZUQA 2ZBKB 5D6QA 4I50A 3CWVA 3CRLA 3INXA 2CK3G 2ITDC 2Y4TA 3ZMTA 2Z3YA 1LUWA 4F6EA 4FLXA 2HCHA 5JH7B 3D36A 5D6PA 4Q20A 4DR4B 4DV4B 1FS0G 1P84F 2MW2B 1N4CA 1XMOO 4YKRA 3QO7A 5EBWC 2YE3A 1IDSA 1W59A 2WLIB 2HJFC 2P7TC 4FM2A 1PV0A 4LNUB 5IY5C 3BAAA 3A0BZ 4JZGA 1UYKA 2VWJA 2BE3A 3WFVA 4Z1VA 4AQYO 1K9MW 4RAIA 4JPRA 1P4RA 3FAVA 5FL7G 3M99B 4ZKIA 1H2KA 1BHAA 3ZHVA 3INWA 1Y4UA 1OCZB 1BXDA 1VQ7V 5IJ0A 4WUCA 2FTKA 2P22C 1YT0A 3E8HA 5IDJA 4LR3A 3OR6C 1NT2B 3RLRA 4OX9B 4WBNA 3DXRB 2YJXA 3E22B 1I5CA 4YJ2B 1EM1A 3A0XA 2E76B 3VBBA 1KBHA 4PA6A 2EBOA 5FNCA 5EC2C 2DWDC 4JI2O 2GHYA 2ZE7A 4JZ2A 1ENVA 4DW1A 1BKNA 2IOPA 3H1HH 3K0GA 3ZRWB 2VCJA 1R1BA 5JH7A 4H37A 2QDOA 2IJKA 1AH8A 5M4PA 3CCVV 1F51A 3SYOA 1YJNV 4JV5O 1YCIA 3B4SA 1NVPD 3W7TA 2CCSA 2C1GA 1FFXB 3CMAV 3A0YA 2F4VB 1MA1A 1WJZA 4B3RB 1THZA 3IJ4A 4I0XA 2ATKC 4YXWG 1FPOA 5EBLC 1QBZA 4MTXA 3ZRWA 3JATB 4OXSA 1HNXB 5JENA 3FYEB 4XE2A 4XIPA 1JJ2U 3IEDA 3UCSC 5CTYA 4FMTA 1K73W 4DR7B 4JI3O 5M4EA 1VF6C 1WNSA 2YXYA 4PDRA 4UFZA 1QLNA 2QG2A 3K60A 3BEHA 4DR3B 1YF2A 5KAIZ 4TUYB 3OUSA 3IFXA 4IHJB 2DOSA 5LA6B 2Q4PA 3E22A 4H7QA 4CWNA 1VQ9V 4L94A 3Q5LA 4MTOA 4PHZA 3G67A 2CCUA 2YI9A 4DV1O 2VWCA 5IJ0B 5L3FA 2LFSA 2M7WA 3CRCA 1I59A 3ZS8C 2LQTA 1F4MA 2QE7G 1Q5OA 1Q81W 4NH9A 4GCZA 2JS3A 5LA6A 4DV6O 1N32B 4XCLA 3CCQV 4IHJA 4O2AB 2UUBB 2Q2EB 3EFFK 2RCVA 1ZTEA 5IDMA 3JD0A 4O2BA 4X1KB 1AR1B 1SQFA 1IBLO 3AG3B 2UXDB 1LUVA 2QTOA 4P7AA 3DSQA 4LP8A 3L71H 5B3SC 1Y74A 2P6JA 4HZ3A 3LPSA 2PZSA 2CH7A 4JF3A 4CE2A 1KECA 4JI5B 2ZE5A 2ZR2A 5DEDA 2GQPA 4MVMA 4LF7B 4IYHA 2YI7A 5LGUA 5JCOC 5D7RA 2UUAB 5F5RA 2JRIA 4DR2B 1P49A 4UUJC 5LYJA 5CA0B 1VIBA 1Y66A 1Y8PA 2ODMA 3OGIB 4J80A 5CN0A 4DR3O 4QGPA 4UVCA 2IWUA 3EVKA 4KQVA 1GN6A 3FD9A 4OPHA 1AMWA 1HNZO 2BTZA 1S77D 1SF9A 4ASFA 1RSOB 2XHXA 5CA1A 2QGNA 4K0KB 3RYFA 3ZHUA 1NH2D 4AWOA 5EYPA 1J5EB 1S76D 1H8HG 2Y0IA 5LP6B 1WA8A 3A0TA 3R4PA 2XK2A 2QWNB 2WI4A 4I3HA 1H2SB 3CYGA 1GKZA 2BZ5A 5IE9A 4EGIA 3R4MA 2YS8A 4JAVA 1AILA 1B3QA 3HKEA 2YEFA 2YEJA 1WLEA 1KYOF 2LW7A 1SA0B 3K5MA 2GDSA 3QTFA 2XJJA 1TUBA 1HP8A 2UUBO 2BSMA 1CXZB 1BL8A 3RVZA 3R4OA 2A79B 1TC6A 2YEEA 1ZL8B 3CRQA 1XNQO 4EGHA 1QVGU 2WLJA 2IOQA 5FNFA 5EC1C 1P7BA 1NH2B 5FWKA 2QA4V 2YK2A 4FZ0A 4O4JA 4J42A 1UYCA 3F5TA 4DK1A 4EFTA 3T0ZA 5TISZ 1VQPV 1AJNA 3ASOB 2YE7A 4B7PA 5EIBC 3TGUH 4B3SB 3RYIB 3D3IA 2KG7A 4I9QA 4FCRA 2YKCA 4B3RO 4I9WA 4JYAO 3H4LA 1PD3A 4X62O 2IWXA 1AR4A 1N33B 1QU7A 3QVNA 1EZVH 3BM9A 2IW5A 2YIAA 4HZ0A 4NH8A 4JI2B 2YI8A 2E75B 3A0HZ 4QE9A 4HYMA 5CBGA
chains in the Genus database with same CATH topology
3K79A 2P67A 1BGQA 3VHCA 3FT5A 2YEVA 3R65A 5IYCO 3FB6C 1NHJA 1WPXA 5E1AC 4GX5A 4LCUC 1M56B 2ZXWB 1FXHA 1AROP 3ZN1A 4DO2A 1Z5CA 4W7TA 3B24A 1QR9A 2IH3C 2CGFA 2HKJA 3EHBB 4PU9A 4WUBA 1VQKV 3X2QC 4BW5A 4LP0A 5KA6A 2QM7A 2BU7A 1H2GA 3JCZA 4MS2A 1S14A 3LUTB 3Q5JA 3OFNG 2YEHA 3T10A 1EFRG 2QM8A 3IC7A 3JZ3A 3LNUA 2WI6A 4KSGA 4CBCA 2R9RB 2AKPA 4LWEA 2WLLB 4BAYA 2YGAA 4MW8A 5M4HA 4LWFA 2EIJC 1YERA 1KD1W 2YEVB 2Q6AA 4JYCA 4RUFA 3W7XA 1YI2V 3CGYA 1M56C 2ZXWC 4PDVA 1DTOA 3AG4C 3SPCA 3G71V 2BU5A 4LWGA 5HFMA 1BYQA 4MT8A 3CCEV 2DW4A 2YI5A 4E00A 5M4NA 1K4DC 2ZDIA 2B1GA 2ESAA 2LFRA 4ZVIA 2B5UA 1K5SA 2B1IA 1QVFU 4CWOA 1I58A 1YT2A 3SL2A 2CG9A 2XAGA 2YECA 3CPWU 2YEBA 3ASNC 4CWSA 1I5YA 2YI0A 2MK3A 2BYHA 1NR7A 3K99A 3O6OA 1QLEB 4BIUA 5CA3A 3TETA 4XD8A 4KFGA 3T0HA 3NMQA 1DF4A 4N21A 2Y48A 1Q7YW 1YSZA 2XX4A 2EZOA 2Y69C 3AG1B 4P30A 4XBFA 4MPEA 2X0LA 1A4HA 2FWYA 2IJJA 2PI5A 3TZ4A 3E83A 3OPDA 3DGEA 3B25A 3E86A 2OCCC 3AG2C 3EKOA 3K0DA 3Q5KA 3R4NA 4MPNA 3ETEA 3LNMB 4UV8A 3MHSC 4MTFA 4TWKA 1OCCB 1RM1B 3A0ZA 1KP2A 2WERA 3ASOC 3PJSK 1NJIW 5LBQA 1UYFA 1MG1A 4GX1A 2K1EA 2GFDA 1H8EG 3ETDA 4WFAV 4RQFA 3RKZA 2FYPA 3F5WC 1G8MA 4MW3A 3AG1C 4HY1A 1UYIA 2JEUA 3K08A 4MOTA 4EFUA 2Q8FA 4R7CA 1VQNV 2QKSA 2Q8IA 3JD1A 1QLEC 5KUKA 1U0ZA 2X6AA 1QY8A 4HXZA 3SJQC 1ZXMA 3CGZA 4LPBA 1W2BU 4R3MA 4WFHA 1K34A 4JAUA 5B1BC 3ZCCA 1RM1C 1YJWV 1I5BA 1KZNA 1YC3A 3D0BA 4F4LA 1FXVA 1NBMG 1OZ0A 2HVKC 5IYDO 1QZRA 1OCRB 4P2ZA 2O1UA 1R3LC 1JOYA 4X8AA 5LHGA 4WCEV 3UKMA 2WEQA 2OCCB 2BU2A 3EHJA 1K3EA 1ZW9A 3O0IA 2LP7A 4CWRA 1R6KA 5CPHA 3HB3B 1TH8A 4O05A 2V7QG 4BQGA 4DXWA 1ROPA 1UYHA 2BT0A 3EHFA 5BODA 1UY7A 3R91A 1HWYA 2EIJB 4V26A 4XKKA 5IYBO 4EKWA 3IGAC 3W7UA 3E8BA 3CC4V 2Q8HA 3CC2V 4H33A 1SESA 5EK0A 3ABKC 4PA4A 3KG2A 4RUEA 3CCSV 1AI7A 2JJ1G 4HAMA 3SYQA 1UYLA 2BREA 4HY6A 1GO3F 4YKZA 5F3KA 2XDXA 5CBFA 5CTYA 1SERA 2DYRC 4G2KA 3ETGA 3H80A 1COWG 2WI2A 3NXSA 2WWWA 1I5XA 4UVBA 1YTFD 4H85A 3ZMVA 3MD0A 1CEZA 1GK9A 1ZWIC 3RLPA 3OMNB 1AH6A 4CWTA 4GX2A 3GIGA 3RVYA 5DM6V 3HEKA 3OWBA 1US7A 4YKQA 3ZJZA 2KB1A 2YGFA 1I5AA 3R92A 3MNRP 3CXCU 4O07A 1CPYA 3T4DA 3LDDA 2BOCC 2IH1C 1TBWA 2IORA 4FCPA 4G28B 1IXMA 2YJWA 1JPXA 4LBEC 1AI5A 3GB7C 1OCOB 4XDKA 5LGNA 1S16A 3GIEA 3GIFA 4AWQA 3B8MA 1W0JG 2XX5A 3LSSA 2Q68A 4L87A 1YT1A 2QG0A 2YKJA 5J71A 2BU6A 2EIKB 4ZBMA 4PELA 2WI7A 2YE6A 3W7SA 3K3WA 1UY8A 2DYRB 3B8NA 2X7RB 4MTGA 4XDJA 4GGLA 3WQ9A 4AS9A 1Z59A 1YESA 2X6CA 1Z5BA 2XDKA 3BMYA 5CTWA 3FB7C 2XHRA 3B77A 2ZDYA 1QCEA 1MABG 2OT5A 4MVSA 2H55A 1Y8NA 3ABMC 5B3SB 5L3DA 2XAJA 4P9OA 3C11A 3OMAB 5FNDA 1H38A 3E89A 2YI6A 4MBCA 1YC4A 4NH7A 4O04A 1F4NA 4MP7A 4X89A 4XIRA 1QR8A 4P9PA 2VW5A 1BMFG 2DQ3A 3OWDA 4U93A 2HLDG 1GTOA 4TT3G 3TZ0A 4R50A 1TIDA 3ZXOA 1AI6A 3U67A 3F7YC 2WLLA 3CCRV 4FCQA 1KC8W 4XITA 2XAQA 4H81A 3CD6V 1TILA 4L91A 4MVRA 2XCMA 2HR3A 1Q82W 2XD6A 1YJ9V 1XL6A 1PNLA 1B63A 2W0FC 3CMEV 5D7CA 1KQSU 3U2KA 1RPRA 1NQTA 4J9YB 1V55B 4WFEA 4WFGA 3K06A 3SPIA 2JJ2G 5L3JA 1DLBA 3I55V 2YKBA 2ZBKB 5D6QA 3ZXQA 3CWVA 3CRLA 3INXA 4FIPC 1FXKB 4URNA 2CK3G 2ITDC 3ZMTA 2Z3YA 5EBMC 2BU8A 2XX2A 2HCHA 2WAMA 2WI3A 3D36A 4L93A 4Q20A 5D6PA 5J9PC 1OCRC 3ABTA 1FS0G 3F7VC 2OTJV 3K97A 3HHUA 3VADA 2W6IG 4O09A 3SPJA 4YKRA 4YKXA 4RQEA 2PNRA 1S5HC 1R3IC 3QO7A 5EBWC 2YE4A 2HKOA 5B1OA 1FXKC 2YEAA 2YE3A 3OW6A 2WLIB 2HJFC 2WLKA 2P7TC 3ZMZA 3G7BA 1EBOA 1H7UA 2YSUB 3ZN0A 4PDMA 2Z5UA 4GT8A 5IY5C 4O0BA 1GKFA 4MSWC 1UYKA 2VCIA 4BAEA 2C2AA 3WFVA 2H8MA 3VHDA 1OCCC 4UVAA 1UY6A 1ZXNA 4DZYA 2V1DA 1K9MW 3HZ5A 3EHGA 5M4KA 3ZM7A 4RAIA 1UJWB 2JKIA 4JPRA 3CRKA 1P4RA 2DWEC 1JVMA 3M99B 4QIWF 3AG2B 5FL7G 4ZKIA 3W7WA 1BHAA 1U2OA 1Y4UA 2YEIA 1OCZB 2UXNA 3INWA 1VQ7V 3FKSG 2EZPA 3LSQA 3TUHA 1VQ8V 1BXDA 4WUCA 1GM7A 2WI5A 3JYCA 2FTKA 2H94A 1YT0A 2BOBC 4PRVA 1V54C 1NR1A 4WFFA 3E8HA 5IDJA 3CP1A 3OR6C 1OCOC 4UXNA 3T2MA 3HZ1A 2QEXV 3RLRA 3RW0A 1E79G 2AHZA 3ABMB 3T1CA 2JJCA 2IJIA 5B1AC 2YJXA 4MVZA 4E2LA 1NHIA 4CWPA 1GM8A 4JGSA 1K8AW 1I5CA 1YETA 1GM9A 3B28A 4HZ5A 1GKXA 3A0XA 4FJCC 2JDIG 1G4YB 4I5SA 3VBBA 4YKYA 2UWDA 2EINC 4PA6A 4XIQA 1MOFA 2EBOA 5FNCA 5EC2C 1YTFB 3SYCA 2DWDC 4UV9A 3T4ZA 2WLMA 1E1QG 2GHYA 4FPPA 5DN6G 1Q86W 1ZWHA 2DQ0A 4U7OA 4URMA 1ENVA 1BKNA 1EI1A 3ZMUA 4YKWA 3STLC 1VQMV 2O1WA 1OHHG 1TUEB 2IOPA 3K0GA 3ZRWB 2VCJA 1S3JA 4H37A 5GW7A 1K5QA 3WG7B 2IJKA 3AEIA 5B1AB 1AH8A 3CCVV 1F51A 1VQOV 2O1VA 3SYOA 3E2EA 4CE1A 5M4PA 3E35A 1YJNV 4XDLA 1NVPD 3W7TA 4CWQA 3AG3C 3E8GA 3GWOA 3UM7A 3X2QB 2YE2A 4XDMA 2CCSA 3OGCC 2BYIA 1K92A 3CMAV 2XNDG 3H01A 2YK9A 2JEXA 3A0YA 1SRYA 1THZA 2EINB 2XAFA 5CMUA 3JD3A 2K5BA 2ATKC 1YIJV 4YXWG 3ZKDA 3G75A 1M57C 5EBLC 2HG1A 4MP2A 1QBZA 4XKAA 1M1KW 3JD2A 3FV5A 3OE7G 4MTXA 3FYIB 3ZRWA 4OXSA 4UROA 5B1BB 1S0VA 3FYEB 3OM3B 4XE2A 4XIPA 3ABKB 4CWFA 4JTDB 3OEEG 1JJ2U 2XDUA 3IEDA 5IY5B 3HPLC 4QPKA 3OAAG 4KFMA 1PNMA 3CCUV 1VQ4V 1W0KG 2YEGA 4FMTA 2JIZG 2EIMC 2JK5C 3QO5A 2EXLA 2EILC 3STZC 1KIJA 1K73W 1J95A 2D3OW 4QE7A 4N23A 1YSCA 5M4EA 1JM6A 4PDRA 3E8FA 1QLNA 2QG2A 2ZR3A 4KUMA 2UXXA 3K60A 4R1FA 3BEHA 3O2FA 3OUSA 2NLJC 3IFXA 4KP4A 4CE3A 1Y4SA 3LDCA 4JTCB 2YE9A 3TZ5A 2HFEC 2XOKG 1PL0A 1PVGA 2FWZA 4JASA 4MVUA 1ORQC 4H7QA 4CWNA 1VQ9V 4L94A 4GEEA 3Q5LA 3ABLB 4MTOA 4TSFG 5B1NA 1K97A 2Q69A 4R6ZA 3FB8C 4QNHB 3A0WA 3MHHC 3K9AA 1KP3A 2YE5A 4HXWA 2CCUA 2XASA 2VWCA 2DYSC 3ZRVA 3PEJA 5L3GA 2X6BA 5L3FA 1DF5A 2LFSA 1V55C 1YS3A 2M7WA 3P32A 2QFOA 3ABUA 2HG5C 3HYYA 1I59A 2YEDA 4MVQA 4XTJA 1F4MA 5GGZA 2QE7G 4ASUG 3CCJV 4MVOA 4RO2A 1BHBA 1I5DA 3SYAA 1Q81W 1H7SA 4GCZA 4NH9A 4YKUA 4B6CA 2WI1A 4BXIA 1K7DA 4EEHA 1Y4MA 4XCLA 4ASAA 4GX0A 3K04A 3A0RA 3CCQV 2Q2EB 3EFFK 5L3EA 3AG4B 4JTAB 3KE6A 1MU5A 1JQ0A 3K03A 5IDMA 4CZZA 3JD0A 3ZMSA 1AR1B 4MB9A 1L1FA 3AG3B 2EIMB 3G4SV 2IU3A 2QTOA 4P7AA 5M4MA 1KKDA 4GQTA 4LP8A 5B3SC 1UYMA 4E02A 3U2DA 2P6JA 3TZ2A 4HZ3A 2ZKJA 3LPSA 1CP9A 1JX9A 4JF3A 4PL9A 1KECA 4CE2A 1THNA 5D7DA 1XL4A 3WG7C 2ZR2A 2GQPA 4K4OA 4MVMA 1NHHA 3CCLV 3P30A 2WLHA 3OMIB 2XDSA 1LNQA 3DTUB 2YI7A 2Q8GA 5LGUA 2XDLA 2H8PC 4FK5C 3TCUA 3GIGB 4XKOA 5D7RA 2Q67A 2A0LA 4MPCA 3JD4A 3HYZA 5J6AA 1R62A 5F5RA 3QO8A 4LWHA 3QDDA 4QPJA 1B62A 2ZDIC 3K98A 4URLA 4GT1A 2YE8A 4UUJC 1YC1A 2OTLV 1PNKA 1Y66A 1Y8PA 3G6EV 2P90A 1FXKA 5CN0A 4UVCA 2IWUA 5C93A 1N8RW 3C0EA 4R8CA 3G7EA 4V25A 4WFBV 4KQVA 1V54B 4XC0A 5BOCA 3D2RA 2XAHA 1AMWA 1MSWD 1UY9A 1S77D 1M90W 5H6QA 2BTZA 2XHTA 5CBHA 2ITCC 2XJGA 1NKDA 2IU0A 1K33A 2IWSA 4ASFA 4KSHA 3OUFA 3RBZA 2XHXA 4X9LA 1AI4A 1EZJA 1AJ6A 4PA7A 4E01A 1SETA 1ID0A 3ZKBA 4U7NA 3LDEA 5LHIA 4AWOA 1NH2D 2HVJC 1S76D 1H8HG 4GFNA 3ZRSA 3EHHA 3TK1A 3FT8A 3B27A 3A0TA 3SPHA 4PDLA 3R4PA 1R3KC 2YKEA 2XK2A 2WI4A 2AHYA 1QYEA 3I56V 1Z5AA 4I3HA 1UYGA 1OCZC 3VOUA 5LHHA 3B26A 1OSFA 3TTZA 2R9IA 4QJFB 4HYOA 1AJPA 1GKZA 3VHAA 4LC1A 2BZ5A 5KUMA 2YKIA 4DUHA 4EGIA 3R4MA 3FB5C 3ML0A 4LWIA 4JAVA 1S72V 1JCHA 5H6RA 1EA6A 1B3QA 1GJVA 1MX0A 3RLQA 4ASGA 1L0OA 3OEHG 4X88A 3OR7C 4Z1MG 2YEFA 2YEJA 3CCMV 1WLEA 3QTFA 2F43G 1YHQV 2XJJA 1M9NA 1E1RG 2DYSB 5CTXA 1AM1A 1UYEA 2BSMA 1RPOA 2ZD9A 1B6QA 1BL8A 3EKRA 1SZTA 5KA5A 1K4CC 3RVZA 1VQ5V 1GMGA 4J9ZB 3R4OA 2CH4A 2A79B 4WUDA 3QNEA 2CCTA 1TC6A 2YEEA 5HFLA 1VQ6V 4EMVA 4PA3A 3SYPA 1F23A 3T1KA 1Y8OA 1R6NA 1VQLV 5LGTA 2XABA 2EJRA 4EGHA 1QVGU 4HYPA 5CTUA 2WLJA 4WF9V 2IOQA 5FNFA 5EC1C 4JQLA 1P7BA 3OW2U 2GSMB 1NH2B 3WHAA 5FWKA 2XJXA 2QA4V 3CYOA 5IN9A 2Y69B 2YK2A 2ZDXA 4BIZA 4L8ZA 4EM7A 1UYCA 5BZBA 4EFTA 4L90A 2ZQMA 2QF6A 3T0ZA 5CF0A 4EGKA 5H9CA 1PKXA 1UYDA 2IJHA 3ABLC 3ASNB 1AJNA 2WSSG 1VQPV 2NNUA 3ASOB 1TC0A 2YE7A 4ASBA 4B7PA 3SPGA 2A9HA 5L3CA 5L3BA 1AJQA 4YKTA 3BY6A 1M57B 1NVPB 4XCJA 3D3IA 4FCRA 2E0AA 2YKCA 2WPDG 2EIKC 3ZRXA 1YSRA 4AWPA 4I9WA 4PA9A 3CC7V 1YITV 2YGEA 3H4LA 3T2SA 1PD3A 3ZIAG 4P8OA 4G27B 2IWXA 3OMUA 1R73A 4PRXA 4KTNA 4BQJA 2EILB 2WEPA 2FXSA 3BM9A 2WLIA 2IW5A 2PI4A 1FFTB 4JYBA 4HZ0A 2W6JG 4NH8A 4R3AA 2BRCA 4QE9A 2WLNA 4HYMA 5CBGA 3PEHA 1R3JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P67 A;  1BGQ A;  3VHC A;  3FT5 A;  1NHJ A;  4W7T A;  1Z5C A;  4WUB A;  3B24 A;  2CGF A;  2HKJ A;  4PU9 A;  4LP0 A;  2QM7 A;  2BU7 A;  1S14 A;  3Q5J A;  2YEH A;  3T10 A;  2QM8 A;  3JZ3 A;  3LNU A;  2WI6 A;  4KSG A;  2AKP A;  4LWE A;  2YGA A;  5M4H A;  4LWF A;  1YER A;  4JYC A;  3CGY A;  4LWG A;  2BU5 A;  1BYQ A;  4MT8 A;  2YI5 A;  4E00 A;  5M4N A;  2ESA A;  4ZVI A;  2LFR A;  4CWO A;  1I58 A;  1YT2 A;  3SL2 A;  2CG9 A;  2YEC A;  2YEB A;  4CWS A;  2YI0 A;  2BYH A;  3K99 A;  3O6O A;  4BIU A;  4XD8 A;  3T0H A;  4KFG A;  3NMQ A;  1YSZ A;  2XX4 A;  4MPE A;  1A4H A;  2FWY A;  3TZ4 A;  3OPD A;  3DGE A;  3B25 A;  3EKO A;  3Q5K A;  3R4N A;  4MPN A;  3A0Z A;  2WER A;  1UYF A;  2GFD A;  3RKZ A;  2FYP A;  4HY1 A;  1UYI A;  4EFU A;  4MOT A;  2Q8F A;  2Q8I A;  1U0Z A;  1QY8 A;  4HXZ A;  1ZXM A;  3CGZ A;  4LPB A;  4R3M A;  3D0B A;  4JAU A;  3ZCC A;  4AS9 A;  1I5B A;  1KZN A;  3QDD A;  1YC3 A;  5CPH A;  4DUH A;  1QZR A;  2O1U A;  1JOY A;  2WEQ A;  3EHJ A;  2BU2 A;  1ZW9 A;  3O0I A;  4CWR A;  1TH8 A;  4O05 A;  4BQG A;  1UYH A;  2BT0 A;  3EHF A;  5BOD A;  1UY7 A;  3R91 A;  4V26 A;  4XKK A;  2Q8H A;  1UYL A;  2BRE A;  4HY6 A;  4YKZ A;  5F3K A;  2XDX A;  3H80 A;  3NXS A;  2WWW A;  4H85 A;  3MD0 A;  3RLP A;  1AH6 A;  4CWT A;  3OWB A;  3GIG A;  3HEK A;  1US7 A;  4YKQ A;  2YGF A;  1I5A A;  3R92 A;  3MNR P;  4O07 A;  4FCP A;  1TBW A;  2IOR A;  2YJW A;  1IXM A;  3GIF A;  3GIE A;  1S16 A;  4AWQ A;  2XX5 A;  2YKJ A;  2QG0 A;  1YT1 A;  5J71 A;  2BU6 A;  2YE6 A;  2WI7 A;  1UY8 A;  4GGL A;  3WQ9 A;  1Z59 A;  1YES A;  1Z5B A;  2XDK A;  3BMY A;  5CTW A;  2XHR A;  2ZDY A;  2H55 A;  1Y8N A;  3C11 A;  5FND A;  4MBC A;  2YI6 A;  1YC4 A;  4NH7 A;  4O04 A;  4MP7 A;  4XIR A;  4XTJ A;  2VW5 A;  4U93 A;  3OWD A;  3TZ0 A;  1TID A;  3ZXO A;  3U67 A;  4FCQ A;  4XIT A;  4H81 A;  4L91 A;  1TIL A;  2XCM A;  2XD6 A;  1B63 A;  5D7C A;  3U2K A;  5L3J A;  2ZBK B;  2YKB A;  5D6Q A;  3ZXQ A;  3CWV A;  3CRL A;  3INX A;  4URN A;  2BU8 A;  2XX2 A;  2HCH A;  2WI3 A;  3D36 A;  4L93 A;  4Q20 A;  5D6P A;  3K97 A;  3HHU A;  3VAD A;  4O09 A;  4YKR A;  4YKX A;  2PNR A;  2YE4 A;  5B1O A;  2YEA A;  3OW6 A;  2YE3 A;  3G7B A;  1H7U A;  4GT8 A;  2VCI A;  1UYK A;  4BAE A;  2C2A A;  2H8M A;  3VHD A;  1UY6 A;  1ZXN A;  4DZY A;  3HZ5 A;  5M4K A;  3EHG A;  3ZM7 A;  2JKI A;  3CRK A;  4ZKI A;  1U2O A;  2WI2 A;  4R3A A;  3INW A;  2YEI A;  4PRV A;  1Y4U A;  1BXD A;  3TUH A;  4WUC A;  2WI5 A;  2FTK A;  1YT0 A;  5IDJ A;  3HZ1 A;  3RLR A;  2JJC A;  2YJX A;  1NHI A;  1I5C A;  1YET A;  3B28 A;  4HZ5 A;  1GKX A;  3A0X A;  4I5S A;  4YKY A;  2UWD A;  4XIQ A;  5FNC A;  4FPP A;  1ZWH A;  4U7O A;  4URM A;  1EI1 A;  1BKN A;  4YKW A;  2O1W A;  2IOP A;  3ZRW B;  2VCJ A;  1AH8 A;  5M4P A;  1F51 A;  4CE1 A;  2O1V A;  4CWQ A;  2YE2 A;  4XDM A;  2CCS A;  2BYI A;  2YK9 A;  3A0Y A;  2K5B A;  3ZKD A;  3G75 A;  4MP2 A;  4XKA A;  2HG1 A;  3FV5 A;  4MTX A;  3ZRW A;  4URO A;  4XE2 A;  4XIP A;  4CWF A;  2XDU A;  4L8Z A;  4CWP A;  3IED A;  4O0B A;  4QPK A;  5CTY A;  2YEG A;  4FMT A;  2EXL A;  1KIJ A;  5M4E A;  1JM6 A;  2QG2 A;  3K60 A;  4R1F A;  3O2F A;  4KP4 A;  4CE3 A;  1Y4S A;  3TZ5 A;  2YE9 A;  2FWZ A;  1PVG A;  4JAS A;  4H7Q A;  4CWN A;  4L94 A;  4GEE A;  3Q5L A;  5B1N A;  3A0W A;  4HXW A;  2YE5 A;  2CCU A;  2VWC A;  3ZRV A;  3PEJ A;  1YS3 A;  2LFS A;  2QFO A;  3P32 A;  3HYY A;  5GGZ A;  1I59 A;  2YED A;  1I5D A;  4YKU A;  4NH9 A;  1H7S A;  4GCZ A;  4B6C A;  4BXI A;  5M4M A;  2WI1 A;  4EEH A;  4XCL A;  4ASA A;  3A0R A;  2Q2E B;  3KE6 A;  1MU5 A;  5IDM A;  4MB9 A;  4P7A A;  4GQT A;  1UYM A;  4E02 A;  3U2D A;  3TZ2 A;  2ZKJ A;  3LPS A;  4PL9 A;  4CE2 A;  1THN A;  5D7D A;  2GQP A;  4K4O A;  1NHH A;  2XDS A;  2Q8G A;  2YI7 A;  2XDL A;  5D7R A;  3GIG B;  4XKO A;  4MPC A;  3HYZ A;  5J6A A;  1R62 A;  5F5R A;  4LWH A;  4QPJ A;  1B62 A;  3K98 A;  4URL A;  4GT1 A;  2YE8 A;  1YC1 A;  1Y8P A;  2IWU A;  5C93 A;  3C0E A;  3G7E A;  4V25 A;  4XC0 A;  4KQV A;  5BOC A;  3D2R A;  1AMW A;  1UY9 A;  2BTZ A;  2XHT A;  2XJG A;  2IWS A;  4ASF A;  4KSH A;  2XHX A;  4X9L A;  1AJ6 A;  4E01 A;  3ZKB A;  1ID0 A;  4U7N A;  4AWO A;  4GFN A;  3EHH A;  3TK1 A;  3FT8 A;  3B27 A;  3A0T A;  3R4P A;  2YKE A;  2XK2 A;  2WI4 A;  1QYE A;  1Z5A A;  4I3H A;  1UYG A;  3B26 A;  1OSF A;  3TTZ A;  1GKZ A;  3VHA A;  4LC1 A;  2BZ5 A;  2YKI A;  4EGI A;  3R4M A;  4LWI A;  4JAV A;  1MX0 A;  1EA6 A;  1GJV A;  1B3Q A;  3RLQ A;  4ASG A;  1L0O A;  2YEF A;  2YEJ A;  3QTF A;  2XJJ A;  5CTX A;  1AM1 A;  1UYE A;  2BSM A;  3EKR A;  3R4O A;  2CH4 A;  4WUD A;  2CCT A;  1TC6 A;  2YEE A;  4EMV A;  3T1K A;  1Y8O A;  2XAB A;  4EGH A;  4HYP A;  5CTU A;  2IOQ A;  5FNF A;  4JQL A;  3WHA A;  5FWK A;  2XJX A;  5IN9 A;  2YK2 A;  2ZDX A;  4BIZ A;  4EM7 A;  1UYC A;  4EFT A;  4L90 A;  3T0Z A;  2QF6 A;  5CF0 A;  4EGK A;  1UYD A;  1TC0 A;  2YE7 A;  4ASB A;  4B7P A;  4YKT A;  4XCJ A;  4FCR A;  2E0A A;  2YKC A;  1YSR A;  3ZRX A;  4AWP A;  3T2S A;  3H4L A;  2YGE A;  4P8O A;  2IWX A;  3OMU A;  4PRX A;  4KTN A;  4BQJ A;  2WEP A;  2FXS A;  3BM9 A;  4JYB A;  4HZ0 A;  4NH8 A;  2BRC A;  4HYM A;  3PEH A; 
#chains in the Genus database with same CATH topology
 1BGQ A;  2YEV A;  2A06 H;  4NXN B;  5E1A C;  4GX5 A;  2ZXW B;  5JCO A;  3B24 A;  4LFB O;  4PU9 A;  1IUR A;  4O4L A;  3X2Q C;  4TQD A;  2YIB D;  4JI0 O;  2BU7 A;  4B3T O;  4MS2 A;  2QSA A;  2YEH A;  1EFR G;  3JZ3 A;  3LNU A;  2LW1 A;  2WI6 A;  4NTX A;  4BAY A;  4MW8 A;  4KL1 A;  1KD1 W;  4J7Z A;  4JYC A;  1D2D A;  1M56 C;  2OCH A;  5AG2 A;  4DR1 O;  5HFM A;  2YI5 A;  2DW4 A;  1YDX A;  2B5U A;  2YUA A;  4CWO A;  2CG9 A;  2XAG A;  2UUA O;  4X20 A;  1NR7 A;  3K99 A;  1QLE B;  3T0H A;  1DF4 A;  1YSZ A;  5LMU B;  4P30 A;  4XBF A;  5JJN B;  2PI5 A;  3E83 A;  2QWP B;  3Q5K A;  4MPN A;  4MTF A;  1RM1 B;  3A0Z A;  1KP2 A;  4X9Q A;  1MG1 A;  4GX1 A;  5FPR A;  4DK0 A;  4RQF A;  3T1Y O;  1IZ3 A;  3AG1 C;  3R66 A;  2BSK A;  2YIC A;  4EFU A;  3JD1 A;  2X6A A;  1ZXM A;  3CGZ A;  1EN5 A;  1W2B U;  4R3M A;  4WFH A;  3ZCC A;  1RM1 C;  3QDD A;  2PUS A;  2ZM6 O;  1AR5 A;  1OZ0 A;  1V9P A;  3VQV A;  1GN4 A;  2P5O A;  4X8A A;  5LHG A;  2WEQ A;  2LJ2 A;  5GTH Z;  1ZW9 A;  3O0I A;  2LP7 A;  1L0N H;  4CWR A;  5BR8 B;  4O05 A;  2V7Q G;  4BQG A;  4DXW A;  4RWU A;  3AG7 A;  1HWY A;  4BR6 A;  5IYB O;  4EKW A;  4YY3 O;  3CC4 V;  3E8B A;  3G6B A;  4XKK A;  1N33 O;  1SES A;  4J7K A;  3CCS V;  4HAM A;  5LXT B;  3B2E E;  5GON A;  4D6T H;  4DUY O;  1R6T A;  2CUG A;  4LF5 B;  1CEZ A;  1KU9 A;  1O9H A;  4LH7 A;  4YJ3 A;  1AH6 A;  2R9A A;  4GX2 A;  3OT7 A;  4Q6G A;  1US7 A;  2ZE8 A;  1SQQ H;  2KB1 A;  4PI0 A;  1HDJ A;  1IXB A;  3CXC U;  3JAS A;  4LF4 B;  3T4D A;  4K35 A;  3ZHQ A;  3LDD A;  4YIO A;  4FCP A;  2IOR A;  2Q7G A;  5J2T A;  1VF6 A;  1IXM A;  4G28 B;  3S3X A;  3B8M A;  3I5D A;  2QWO B;  1Y67 A;  2NR5 A;  1WP7 A;  4ZBM A;  3W7S A;  1UY8 A;  2F4V O;  4XDJ A;  1Z59 A;  4W4L A;  5CTW A;  3L75 H;  2XHR A;  2Q0A A;  1T5E A;  2OT5 A;  3D3Q A;  4P9O A;  5FND A;  4LF9 O;  2F66 C;  2W0X A;  4MP7 A;  2DQ3 A;  2H3O A;  4TT3 G;  2XAQ A;  4O4H A;  1YJ9 V;  1B63 A;  5D7C A;  1KQS U;  1RPR A;  5L3J A;  1DLB A;  3I55 V;  2YKB A;  3ZXQ A;  4F6R A;  3H1I H;  4FIP C;  4DV0 O;  4URN A;  4L8J A;  2GTA A;  5EBM C;  2XX2 A;  2WAM A;  2WI3 A;  2RQ6 A;  2L35 A;  4L93 A;  1OCR C;  4B3M O;  3K97 A;  2UUC O;  4I55 B;  4O09 A;  4LFC B;  3SPJ A;  4YKX A;  1EN6 A;  2PNR A;  1H2N A;  5B1O A;  1FXK C;  2WLK A;  3CB2 A;  3ZN0 A;  2Z5U A;  1TVK A;  1GKF A;  2VCI A;  1NTZ H;  2Q0O C;  2C2A A;  3HKD B;  4ZHQ B;  1OCC C;  1UY6 A;  4JI6 B;  3EHG A;  5LMU O;  3ZM7 A;  1UJW B;  3KCX A;  4B3T B;  2DWE C;  4QIW F;  3W7W A;  3AG2 B;  1GRJ A;  1VQ8 V;  4IT5 A;  3JYC A;  4GKK O;  4DV4 O;  3T2M A;  3HZ1 A;  3CEI A;  4UXN A;  2AHZ A;  4MVZ A;  4E2L A;  5H5N A;  1NHI A;  1K8A W;  1FKA O;  3B28 A;  1GKX A;  2A3Q A;  2JDI G;  4CC6 A;  4FFB B;  4K3A A;  2YID A;  4I0X B;  3T4Z A;  2WLM A;  4FPP A;  3UO3 A;  3JAL A;  3ZMU A;  4YKW A;  1VQM V;  2JGD B;  3BA8 A;  1S3J A;  5GW7 A;  1K5Q A;  3WG7 B;  1SQX H;  2O1V A;  3E2E A;  1JR9 A;  5EZY B;  4EFE A;  4GKK B;  2F93 B;  2ZE6 A;  5KHI A;  3E8G A;  2YE2 A;  4XDM A;  1K92 A;  4FFB A;  2ZIN A;  3H01 A;  2OWO A;  2JEX A;  2YK9 A;  4E72 A;  4OPA A;  4LWS A;  2XTA A;  3JD3 A;  1M57 C;  2VQF O;  4MP2 A;  1Q90 D;  3JD2 A;  4URO A;  4ICG A;  1S0V A;  3OM3 B;  1FAF A;  3OEE G;  2XDU A;  4CWP A;  5IY5 B;  3HPL C;  4QPK A;  3CCU V;  1PNM A;  2YEG A;  2JIZ G;  4CS3 A;  3DC6 A;  4TV9 B;  2CTR A;  1J95 A;  1YSC A;  1JM6 A;  3E8F A;  1Q43 A;  2A7W A;  5D5P A;  4KP4 A;  4CE3 A;  3TZ5 A;  2JVD A;  2XOK G;  4JV5 B;  4MVU A;  3J7A U;  1L8D A;  1SC5 B;  5B1N A;  4DR7 O;  1K97 A;  4R6Z A;  3FB8 C;  4HXW A;  3K9A A;  5L3G A;  4X66 B;  2EX3 A;  2QFO A;  4LF4 O;  2HG5 C;  5GGZ A;  4MVQ A;  3Q4H B;  1ZLZ A;  2VQE B;  4MVO A;  1BHB A;  2P4V A;  3SYA A;  1I5D A;  4B6C A;  4BXI A;  2RN9 A;  4ASA A;  3K04 A;  3S3W A;  5L3E A;  1VF5 B;  1MU5 A;  1JQ0 A;  3ZX6 A;  3KE6 A;  1DK1 A;  1FD9 A;  3AK3 A;  1L1F A;  4EFB A;  3G4S V;  1KKD A;  3BFR A;  1UYM A;  3N2G A;  4DR6 B;  4IIJ B;  5BMV B;  5EYP B;  1THN A;  1ZX3 A;  1LR1 A;  4K4O A;  1G6U A;  1NHH A;  3OMI B;  2JGU A;  3SJC C;  3DTU B;  4X66 O;  2XDL A;  4ZIB A;  4FK5 C;  3TCU A;  3HYZ A;  1R62 A;  2UUC B;  3K98 A;  4LF7 O;  1QHT A;  2E74 B;  4GT1 A;  2YDE A;  2C1I A;  2OTL V;  3CWB H;  3T1H B;  5GON B;  5BY1 A;  5A9G A;  3C0E A;  4R8C A;  2QWR B;  2UXD O;  4V25 A;  3JAK B;  3D2R A;  2XHT A;  5CBH A;  2XJG A;  3BPZ A;  1XHX A;  4W4K A;  2N05 A;  3AK1 A;  4E01 A;  4PA7 A;  2EJ7 A;  1SET A;  4NR1 A;  4B3M B;  4A5U B;  2CAZ C;  3ZRS A;  3FT8 A;  3B27 A;  1SQV H;  3MDS A;  4TQF A;  4X1K A;  1QYE A;  2JS5 A;  4U3F H;  3I56 V;  1Z5A A;  3C3S A;  3VOU A;  3RN4 A;  4YJ2 A;  3VHA A;  1MZF A;  4O4I A;  2YKI A;  4X65 B;  3ML0 A;  5D5Q A;  3DC5 A;  1MX0 A;  5H6R A;  4DR2 O;  1URF A;  4LH6 A;  4AHC A;  1WAZ A;  4Z1M G;  2R70 A;  4PI2 A;  4X1Y A;  4PV1 B;  4YHH O;  2F43 G;  1YHQ V;  1VP7 A;  1AM1 A;  1X4T A;  1RPO A;  2ZD9 A;  1SZT A;  4DRX B;  1K4C C;  1VQ5 V;  1GMG A;  4J9Z B;  2FL4 A;  1NTM H;  4JI8 B;  4WUD A;  3NR7 A;  5HFL A;  3HKC B;  4EB6 A;  1VQ6 V;  4PA3 A;  1F23 A;  1L0L H;  2OYQ A;  5LGT A;  3P3P A;  1G1X B;  2GUZ B;  3WHA A;  3EXA A;  4TV8 A;  4BIO A;  2LGQ A;  4D7S A;  4ZI7 B;  2QF6 A;  1UYD A;  1I0H A;  3ABL C;  4DR1 B;  3HKB B;  1M57 B;  5K1P A;  1NVP B;  4XCJ A;  2O57 A;  2E0A A;  3M8A A;  2EIK C;  1YSR A;  5LXT A;  3CC7 V;  1YIT V;  2YGE A;  3KZI Z;  3CRR A;  4GLX A;  1R73 A;  3OMU A;  4PRX A;  4KTN A;  2EIL B;  2FB5 A;  2FXS A;  2WLI A;  2PI4 A;  1SQB H;  3JAR B;  4JYB A;  2W6J G;  2N04 A;  2PYJ A;  2WLN A;  4UCO A;  3HKD A;  4H13 B;  3K79 A;  2R72 A;  3VHC A;  3FT5 A;  3R65 A;  2RDC A;  1SZX A;  1N0J A;  1SQP H;  1Z5C A;  1AP5 A;  2CGF A;  1VQK V;  3L73 H;  4BW5 A;  3ZHS A;  1H2G A;  4J11 A;  3Q5J A;  2AW9 A;  3T10 A;  3DXR A;  2AKP A;  2R9R B;  2EIJ C;  1BGY H;  1YI2 V;  2FYU H;  3AG4 C;  1Y76 B;  4MT8 A;  4E00 A;  5M4N A;  1K4D C;  1VAR A;  4ZVI A;  1I58 A;  1YT2 A;  3J80 N;  5J2T B;  2YEB A;  2YI0 A;  1Y6X A;  2MK3 A;  4XD8 A;  5CA3 A;  1N32 O;  4N21 A;  2XX4 A;  2Q73 A;  3D36 C;  3AG1 B;  2X0L A;  1A4H A;  3OPD A;  3DGE A;  5IJ9 B;  4KXR A;  1RFY A;  2VQE O;  3O65 A;  2GFD A;  1HNZ B;  4PJ0 Z;  4WFA V;  4MW3 A;  2AGA A;  2LGW A;  1QLE C;  5KUK A;  1NZ6 A;  3SJQ C;  4LPB A;  3K59 A;  5B1B C;  1YJW V;  5JQG B;  1YC3 A;  1QZR A;  2HVK C;  5IYD O;  1OCR B;  4P2Z A;  3BVO A;  3BHP A;  4WCE V;  1TUB B;  3WB0 A;  1UYH A;  2BT0 A;  2HJD A;  3R91 A;  2EIJ B;  3G80 A;  5LP6 C;  2Q8H A;  3CC2 V;  4H33 A;  5EK0 A;  3SR2 C;  1SKV A;  3ABK C;  3KG2 A;  4PA4 A;  2JJ1 G;  2BRE A;  4HY6 A;  1GO3 F;  4YKZ A;  5F3K A;  4UB8 Z;  5CBF A;  1GAX A;  1SER A;  1N34 O;  1AP6 A;  3H80 A;  5JQG A;  1I5X A;  1YTF D;  2UXB B;  1GK9 A;  4LF6 B;  1N0N A;  1TVK B;  5DM6 V;  5CB4 B;  2QM4 A;  4ZOL B;  2B9Z A;  2YC0 A;  3CE2 A;  3N2G B;  2YGF A;  5C8Y B;  2AXT Z;  2Y0P A;  4CH5 A;  1TAE A;  1B06 A;  1JPX A;  5LGN A;  1AI5 A;  1OCO B;  3LSS A;  2Q68 A;  2YKJ A;  5J71 A;  1NTK H;  2BU6 A;  2EIK B;  4PEL A;  1XMO B;  2X7R B;  4MTG A;  1Z5B A;  2X6C A;  3BMY A;  1MNG A;  3SJA C;  4IIJ A;  4DV3 O;  4X65 O;  5B3S B;  2XAJ A;  2YI6 A;  2CGO A;  3OWD A;  3TZ0 A;  3CJH B;  4I4T A;  4E4E A;  3U67 A;  1AI6 A;  2WLL A;  4LF8 B;  1KC8 W;  1Q6I A;  4L91 A;  2XCM A;  1XL6 A;  4TUY A;  1NQT A;  1US6 A;  3LSU A;  4J9Y B;  4WFG A;  3K06 A;  1SA0 A;  3CHX A;  2YXH A;  1X59 A;  4ABM A;  3HHU A;  1XIL A;  3ZHR A;  2ZNI A;  3Q4H A;  4GZR B;  4RQE A;  1S5H C;  2DE0 X;  3TXS A;  3OW6 A;  1VMG A;  2ADQ B;  4JYA B;  3G7B A;  4O2A A;  4GT8 A;  1BQZ A;  4LF9 B;  3QTC A;  4MSW C;  4BAE A;  1HNW O;  4LFB B;  4UVA A;  1RSO A;  4NYK A;  1ZXN A;  4DZY A;  2V1D A;  1YEW A;  3HZ5 A;  1H2M A;  3N2K A;  2HEP A;  3LNN A;  2JKI A;  3CRK A;  2YEI A;  4PRV A;  2UXN A;  3JAW A;  3FKS G;  2EZP A;  3LSQ A;  3TUH A;  2FML A;  2H94 A;  4DR6 O;  2BOB C;  1NR1 A;  4WFF A;  1OCO C;  3JAT A;  3RWR D;  1E79 G;  3ABM B;  4JYY A;  4TV8 B;  3T1C A;  3JAK A;  2IJI A;  5B1A C;  2F1M A;  2GV9 A;  4JGS A;  3K58 A;  1G4Y B;  4I5S A;  5CA1 B;  4YKY A;  4LF8 O;  4XIQ A;  3L70 H;  1YTF B;  1Q86 W;  3JAM N;  5ITZ B;  1ZWH A;  3D8C A;  4U7O A;  1VF7 A;  4URM A;  1EI1 A;  2VS0 A;  2QWQ B;  3UT5 B;  2O1W A;  4GKJ B;  3AEI A;  1VQO V;  4CE1 A;  4B08 A;  3E35 A;  4XDL A;  4TV9 A;  3UM7 A;  3X2Q B;  3OTO B;  3OGC C;  2BYI A;  2XND G;  1P7G A;  1SRY A;  2EIN B;  2XAF A;  2K5B A;  3ZKD A;  4K8X A;  1M1K W;  3FV5 A;  3OE7 G;  1WP8 A;  5FNV A;  1PL4 A;  5GTI Z;  2ZM6 B;  1VQ4 V;  4UCR A;  4KFM A;  4YY3 B;  1W0K G;  1Y74 B;  2JK5 C;  3QO5 A;  2EIL C;  3STZ C;  1KIJ A;  4QE7 A;  4YHH B;  2HHH O;  2GUZ A;  4KUM A;  2UXX A;  4DV5 B;  3O2F A;  1XNR O;  4JTC B;  2YE9 A;  2HFE C;  4O4L B;  1PL0 A;  1PVG A;  3UO2 A;  3JSL A;  4GEE A;  3ABL B;  5DEC A;  2Q69 A;  4QNH B;  1H2L A;  3A0W A;  3MHH C;  2YE5 A;  2XAS A;  4CS4 A;  3ZRV A;  4LFA O;  1DF5 A;  1V55 C;  3JAW B;  1VEW A;  3P32 A;  1KUQ A;  5KX5 A;  2YED A;  3CCJ V;  4RO2 A;  1H7S A;  3H1J H;  1A32 A;  1K7D A;  1Y4M A;  4GX0 A;  5IJ9 A;  1AVM A;  2XT9 A;  3AG4 B;  1HR0 O;  4JI4 B;  5JVD A;  4CZZ A;  3ZMS A;  3RYI A;  4MB9 A;  3K57 A;  1GN3 A;  1Z5W A;  2EIM B;  2IU3 A;  4DR5 B;  4GQT A;  4AQY B;  3FFQ A;  4DUZ B;  2AZ2 A;  3TZ2 A;  4DV6 B;  2ZKJ A;  4PL9 A;  1JX9 A;  3VQW A;  1XL4 A;  3WG7 C;  1U96 A;  3K9S A;  3FX7 A;  4FM0 A;  3CCL V;  3P30 A;  2WLH A;  4CH6 A;  4I50 B;  4OX9 O;  1XEQ A;  3GIG B;  4XKO A;  4LNU A;  2Q67 A;  2A0L A;  4MPC A;  3JD4 A;  4CH3 A;  5J6A A;  1FJG B;  1B62 A;  2ZDI C;  2UXC B;  3N27 A;  2YE8 A;  1YC1 A;  4DV5 O;  1FXK A;  2UU9 O;  5C93 A;  2RMK B;  2NN4 A;  4XC0 A;  1BS3 A;  1XBL A;  4HNA B;  3QF7 A;  2XAH A;  1M90 W;  5H6Q A;  1NKD A;  1K33 A;  2IWS A;  4KSH A;  3OUF A;  4IL6 Z;  3CXH F;  3RBZ A;  1AI4 A;  1EZJ A;  4ZOL A;  3SDL A;  1HR0 B;  4LFA B;  1AJ6 A;  4PD4 F;  5LMN O;  2PYL A;  2KKW A;  4U7N A;  2P4K A;  2HVJ C;  4GFN A;  4I7Z B;  3TK1 A;  3SPH A;  4PDL A;  1R3K C;  3APO A;  1MZE A;  1NI8 A;  1OCZ C;  1UYG A;  4FFK A;  4DV7 B;  2R9I A;  4QJF B;  4HYO A;  1AJP A;  4LC1 A;  4O4H B;  1JMK C;  1XDC A;  3FB5 C;  4LWI A;  1XHZ A;  2V4D A;  1EA6 A;  4ASG A;  3OEH G;  4X88 A;  3CCM V;  1FFX A;  3H1K H;  4CH4 A;  1B6Q A;  1BCC H;  2YXL A;  5KHK A;  2CH4 A;  3QNE A;  2CCT A;  3SYP A;  1VQL V;  5KHJ A;  5CTU A;  3OW2 U;  2XJX A;  5IN9 A;  2WA4 A;  2Y69 B;  1S5L Z;  4BIZ A;  4EM7 A;  4X64 O;  1B04 A;  1XMQ O;  5H9C A;  1PKX A;  1TA8 A;  3ASN B;  3SPG A;  1AJQ A;  3BY6 A;  2LO1 A;  4I4T B;  4AWP A;  4PA9 A;  3T2S A;  1I94 B;  1D5A A;  3ZIA G;  4P8O A;  2CH7 B;  4BQJ A;  2WEP A;  2BRC A;  3JSN A;  2BTO A;  1R3J C;  2P67 A;  3U0Z A;  2F95 B;  5CB4 A;  4B7E A;  2Y4U A;  1SS3 A;  1WPX A;  4W7T A;  3ZN1 A;  1FXH A;  4EEQ A;  2IH3 C;  3EHB B;  1XQ8 A;  4LP0 A;  1XRE A;  2Q5Z A;  2QM7 A;  5E79 Z;  4C7U A;  2F23 A;  4D7T A;  3JCU Z;  1S14 A;  3T1Y B;  2RJZ A;  4DV2 B;  5EZY A;  4KSG A;  1M5I A;  5KMG B;  5M4H A;  3OTF A;  2Q7H A;  4NKG B;  1KB9 F;  1N36 O;  3K5L A;  4RUF A;  1OV9 A;  2ETN A;  1DTO A;  4LWG A;  5LP6 A;  1BYQ A;  3CRM A;  4X1I B;  2B1G A;  2LFR A;  2B1I A;  3SL2 A;  4KHP B;  3H9V A;  3ZHT A;  4TOI A;  4ZHQ A;  2YEC A;  3CPW U;  3ASN C;  1BT8 A;  1I5Y A;  2ADP A;  3O6O A;  2M6Y A;  4KFG A;  3NMQ A;  2Y48 A;  1Q7Y W;  5JJE B;  4K8Z A;  1D5N A;  2EZO A;  5KMG A;  4BW9 A;  2FWY A;  1PPJ H;  2IJJ A;  2RNB A;  3TZ4 A;  5J2U B;  2OCC C;  3AG2 C;  3EKO A;  3C3T A;  3R4N A;  3LNM B;  3MHS C;  1OCC B;  2WER A;  3PJS K;  1NJI W;  4X1I A;  2K1E A;  3ETD A;  4O2B B;  3A2F A;  5JWP A;  2FYP A;  2ILM A;  3F5W C;  1QQC A;  3CJH A;  1Q6U A;  1UYI A;  4HY1 A;  3BRC A;  4R7C A;  1QY8 A;  3P3N A;  3HKE B;  3RFR A;  3D0B A;  4JAU A;  4AS9 A;  1I5B A;  1KZN A;  3ZBH A;  2E3C A;  5CPH A;  1FXV A;  1NBM G;  2E5L O;  1JOY A;  2L6L A;  3A8T A;  2BU2 A;  4DV1 B;  1JFF B;  2Q9L A;  3HB3 B;  4H44 B;  1IBK O;  4JI7 O;  3KCY A;  3N2K B;  1ROP A;  5BOD A;  1UY7 A;  2CTW A;  4V26 A;  3IGA C;  2CDY A;  1UYL A;  1AI7 A;  3SYQ A;  1U97 A;  3JAL B;  2XDX A;  3B09 A;  2Q7E A;  3THO A;  4G2K A;  4O4J B;  1COW G;  4B7K A;  3NXS A;  2WWW A;  1BE3 H;  4UVB A;  3ZMV A;  1NU1 H;  3MD0 A;  1ZWI C;  3RLP A;  4CWT A;  3OWB A;  3HEK A;  3BCC H;  4YKQ A;  3ZJZ A;  3GVM A;  2OIG A;  5LYJ B;  5CA0 A;  3R92 A;  2HP8 A;  2GTS A;  4GKJ O;  1TBW A;  3RYH A;  4LBE C;  3GIF A;  2XUM A;  1HW7 A;  4XDK A;  4CC5 A;  1S16 A;  4AWQ A;  3UQ8 A;  2XX5 A;  5F2V O;  2YE6 A;  5BR8 O;  2DYR B;  4LFC O;  1PP9 H;  3B8N A;  2DMX A;  1Z5V A;  1QNM A;  4GGL A;  3WQ9 A;  1ZSP A;  1YES A;  2XDK A;  3B77 A;  3OTO O;  1QCE A;  1JJO A;  2H55 A;  4MVS A;  1Y8N A;  3ABM C;  4GUN A;  4NXM O;  2BTQ B;  5K1X A;  5LOV A;  3C11 A;  1H38 A;  4MBC A;  4NH7 A;  1F4N A;  1N34 B;  4X89 A;  4XTJ A;  1QR8 A;  4P9P A;  4U3J A;  1BMF G;  4U93 A;  5B5E Z;  2HLD G;  4IGG A;  1GTO A;  5IWA B;  1TID A;  1GN2 A;  3U11 A;  3F7Y C;  5BMV A;  4XIT A;  4UCV A;  3CD6 V;  4MVR A;  1Q82 W;  2W0F C;  3IC9 A;  3CME V;  4UB6 Z;  1V55 B;  4WFE A;  3SPI A;  2JJ2 G;  2CGN A;  1XOU A;  1FXK B;  4FM1 A;  1BZK A;  3T1H O;  4JAA A;  2BU8 A;  5J9P C;  3ABT A;  3F7V C;  2OTJ V;  3HKC A;  3VAD A;  2PTM A;  2W6I G;  1MMM A;  4JI6 O;  1R3I C;  5KX5 B;  2YE4 A;  2HKO A;  2YEA A;  3ZMZ A;  1Y76 A;  1EBO A;  1H7U A;  2YSU B;  4PDM A;  4X1Y B;  2PY5 A;  2ZT9 B;  1FYJ A;  2H8M A;  3VHD A;  2CTP A;  1TGO A;  5M4K A;  2KG7 B;  4JI4 O;  1U2O A;  1JVM A;  2WI2 A;  4R3A A;  4JI0 B;  4DW0 A;  1GM7 A;  2WI5 A;  4DUZ O;  1V54 C;  2QR4 A;  3CP1 A;  2QEX V;  3RW0 A;  2JJC A;  3WB2 A;  2KQX A;  1GM8 A;  1YET A;  1GM9 A;  3BA9 A;  4HZ5 A;  4FJC C;  4YJ3 B;  1ZAU A;  2UWD A;  2EIN C;  3K5N A;  1MOF A;  1UFI A;  3SYC A;  4UV9 A;  5DN6 G;  1E1Q G;  1WA8 B;  3K5O A;  2DQ0 A;  2BCC H;  5LL6 Y;  3QG5 A;  3STL C;  1OHH G;  1TUE B;  2AZ0 A;  4JI3 B;  4U3J B;  1WPB A;  5B1A B;  4LF5 O;  3ETQ A;  4FLU A;  1IBL B;  3M7M X;  4CWQ A;  1HNX O;  3AG3 C;  3GWO A;  5CMU A;  1M4U A;  1XI1 A;  1YIJ V;  3G75 A;  4XKA A;  2HG1 A;  1OJH A;  2ZKO A;  5IYZ A;  3FYI B;  5IWA O;  5B1B B;  3U10 A;  3ABK B;  4CWF A;  4JTD B;  4L8Z A;  4O0B A;  3OAA G;  4EB6 B;  3L9D A;  2EIM C;  2EXL A;  1WB7 A;  2D3O W;  4N23 A;  3CX5 F;  3RGB A;  2VQF B;  2ZR3 A;  4R1F A;  2NLJ C;  1Y4S A;  3LDC A;  2FWZ A;  4JAS A;  1ORQ C;  3L74 H;  5FLX N;  4TSF G;  1KP3 A;  2DYS C;  3PEJ A;  1YZB A;  4NTW A;  2X6B A;  5B66 Z;  1YS3 A;  1F7Y A;  2K9P A;  3ABU A;  3HYY A;  1J5E O;  3JAR A;  4ASU G;  4YKU A;  5M4M A;  4HNA A;  3WB1 A;  2WI1 A;  4EEH A;  1SQG A;  3A0R A;  2ARH A;  4JTA B;  3K03 A;  4X64 B;  2VRZ A;  2UXB O;  4E02 A;  3H1L H;  5BXZ A;  3U2D A;  1CP9 A;  2EUL A;  5D7D A;  3ICX A;  5IYZ B;  2D2C B;  3OD4 A;  1O9G A;  2XDS A;  1LNQ A;  4YIP A;  2Q8G A;  1Q8I A;  1YXB A;  4F6R B;  3RYC B;  2H8P C;  3QO8 A;  4LWH A;  4QPJ A;  2DJV A;  1IVS A;  3FAV B;  4URL A;  3CS5 A;  4UCS A;  4FLY A;  1PNK A;  2CE4 A;  1KKC A;  3G6E V;  2OIE A;  2P90 A;  2IM9 A;  1IX9 A;  1N8R W;  3G7E A;  4DR5 O;  5BOC A;  5KHG A;  4WFB V;  1V54 B;  4DV3 B;  2HHI A;  3L72 H;  2QTS A;  1MSW D;  1UY9 A;  4DUY B;  2ITC C;  2IU0 A;  5JJJ B;  1I08 A;  4X9L A;  3APQ A;  4DV0 B;  3ZKB A;  1ID0 A;  2ZIO A;  3LDE A;  5LHI A;  4FLZ A;  3EHH A;  3LMM A;  5ITZ A;  2YKE A;  5KLV H;  1BSM A;  4JI5 O;  2AHY A;  2BSK B;  3SJB C;  3TJT A;  5LHH A;  4I55 A;  3BAB A;  4KHP O;  1OSF A;  3B26 A;  3TTZ A;  4FLT A;  4NXN O;  5KUM A;  1S72 V;  1JCH A;  1GJV A;  3RLQ A;  1UPG A;  2UXC O;  1L0O A;  3OR7 C;  1XNQ B;  1M9N A;  1E1R G;  2DYS B;  5CTX A;  1UYE A;  2PF4 E;  3EKR A;  5KA5 A;  1RP3 B;  3VQY A;  4X62 B;  4FVM A;  4EMV A;  3T1K A;  1Y8O A;  1R6N A;  2XAB A;  2EJR A;  3JAS B;  1NS1 A;  4HYP A;  2PGG A;  4WF9 V;  4JQL A;  2GSM B;  4WBN B;  3CYO A;  5KAF Z;  2ZDX A;  4LWS B;  5FPO A;  5BZB A;  1IBM B;  1XNR B;  2ZQM A;  4L90 A;  5CF0 A;  4LF6 O;  4EGK A;  1EN4 A;  2IJH A;  1TC0 A;  2WSS G;  2NNU A;  4ASB A;  2A9H A;  5L3C A;  5L3B A;  4FLW A;  4YKT A;  5C8Y A;  1S5J A;  4AI8 A;  2DN9 A;  2WPD G;  3ZRX A;  4IYI A;  4J7J A;  5LMN B;  2JGD A;  4G27 B;  3WU2 Z;  1BQ0 A;  2QJ1 A;  4J41 A;  1FFT B;  4H0L B;  4OGQ B;  4NVP A;  2ZNJ A;  3PEH A;  4DV7 O;  5J2U A;  3FB6 C;  5IYC O;  1NHJ A;  4LCU C;  1M56 B;  1ARO P;  4DO2 A;  4WUB A;  1QR9 A;  2HKJ A;  5KA6 A;  4GYC B;  2IBZ H;  1MSD A;  3JCZ A;  3LUT B;  2CTQ A;  3OFN G;  3GWK C;  4ZI7 A;  2QM8 A;  3IC7 A;  4J10 A;  3MAQ A;  3IAY A;  4CBC A;  4LWE A;  5JVD B;  2WLL B;  2YGA A;  1XUQ A;  1YER A;  4LWF A;  2YIB A;  2YEV B;  1I7F A;  2E5L B;  4DYL A;  3RYF B;  3C90 A;  4AIL C;  2Q6A A;  3W7X A;  3CGY A;  2ZXW C;  2ZCE A;  4PDV A;  3SPC A;  3G71 V;  2Q8V A;  2BU5 A;  3CCE V;  1Q3E A;  2ZDI A;  1M93 A;  2ESA A;  1K5S A;  1QVF U;  2UU9 B;  1WB8 A;  4CS2 A;  1XMQ B;  3RYH B;  5H2F Z;  4CWS A;  2BYH A;  1DGS A;  2Z0A A;  4BIU A;  3TET A;  1FJG O;  3HR0 A;  3J81 N;  1Z2G A;  2Y69 C;  4MPE A;  3SGI A;  3B40 A;  3B25 A;  3E86 A;  1JFF A;  3K0D A;  2QKA A;  3ETE A;  4NTY A;  4UV8 A;  4TWK A;  1GH6 A;  3VQX A;  3ASO C;  2KSD A;  4DRX A;  5LBQ A;  1UYF A;  1H8E G;  3RKZ A;  3KKY A;  1G8M A;  2N74 A;  4DV2 O;  1Q6H A;  2JEU A;  3CSX A;  3K08 A;  4MOT A;  2Q8F A;  1VQN V;  1ZL8 A;  2QKS A;  1U0Z A;  2Q8I A;  2ZIM A;  4HXZ A;  1N36 B;  4UCU A;  1AB3 A;  1IBM O;  1K34 A;  2VWK A;  4UCT A;  4F4L A;  4DUH A;  3PN1 A;  2O1U A;  1R3L C;  2P06 A;  1HNW B;  3UKM A;  3EHJ A;  2OCC B;  1K3E A;  4FZ1 A;  1R6K A;  1TH8 A;  1WN7 A;  4JI1 O;  3EHF A;  3TXQ A;  3AK2 A;  4JI8 O;  4NXM B;  3W7U A;  3HKB A;  4B3S O;  2WA3 A;  4RUE A;  5EIB D;  1YVW A;  2DYR C;  3ETG A;  2HHH B;  4H85 A;  3OMN B;  5IT9 N;  3RVY A;  3GIG A;  2QKC A;  3CRA A;  1I5A A;  3MNR P;  4O07 A;  1CPY A;  1IBK B;  1I94 O;  2BOC C;  2IH1 C;  4JI1 B;  2YJW A;  3UT5 A;  3GB7 C;  3GIE A;  1W0J G;  4Z2W A;  5A2Q N;  3RYC A;  4L87 A;  2QG0 A;  1YT1 A;  1PM9 A;  3O9O A;  2WI7 A;  1KMI Z;  3K3W A;  4HBN A;  4O4I B;  4JI7 B;  3S5T A;  2XHB A;  3FB7 C;  4DR4 O;  1JA8 A;  2ZDY A;  1MAB G;  2BTQ A;  5LOV B;  4BWA A;  5L3D A;  4FLV A;  3ZED A;  3OMA B;  4NB5 A;  3E89 A;  2FKX A;  1YC4 A;  4O04 A;  4XIR A;  2VW5 A;  5FNV B;  4K0K O;  4X20 B;  4R50 A;  5KHH A;  3ZXO A;  4FCQ A;  3CCR V;  4H81 A;  1TIL A;  2HR3 A;  2XD6 A;  2GBO A;  1PNL A;  3U2K A;  2G38 A;  3RT3 C;  1ZUQ A;  2ZBK B;  5D6Q A;  4I50 A;  3CWV A;  3CRL A;  3INX A;  2CK3 G;  2ITD C;  2Y4T A;  3ZMT A;  2Z3Y A;  1LUW A;  4F6E A;  4FLX A;  2HCH A;  5JH7 B;  3D36 A;  5D6P A;  4Q20 A;  4DR4 B;  4DV4 B;  1FS0 G;  1P84 F;  2MW2 B;  1N4C A;  1XMO O;  4YKR A;  3QO7 A;  5EBW C;  2YE3 A;  1IDS A;  1W59 A;  2WLI B;  2HJF C;  2P7T C;  4FM2 A;  1PV0 A;  4LNU B;  5IY5 C;  3BAA A;  3A0B Z;  4JZG A;  1UYK A;  2VWJ A;  2BE3 A;  3WFV A;  4Z1V A;  4AQY O;  1K9M W;  4RAI A;  4JPR A;  1P4R A;  3FAV A;  5FL7 G;  3M99 B;  4ZKI A;  1H2K A;  1BHA A;  3ZHV A;  3INW A;  1Y4U A;  1OCZ B;  1BXD A;  1VQ7 V;  5IJ0 A;  4WUC A;  2FTK A;  2P22 C;  1YT0 A;  3E8H A;  5IDJ A;  4LR3 A;  3OR6 C;  1NT2 B;  3RLR A;  4OX9 B;  4WBN A;  3DXR B;  2YJX A;  3E22 B;  1I5C A;  4YJ2 B;  1EM1 A;  3A0X A;  2E76 B;  3VBB A;  1KBH A;  4PA6 A;  2EBO A;  5FNC A;  5EC2 C;  2DWD C;  4JI2 O;  2GHY A;  2ZE7 A;  4JZ2 A;  1ENV A;  4DW1 A;  1BKN A;  2IOP A;  3H1H H;  3K0G A;  3ZRW B;  2VCJ A;  1R1B A;  5JH7 A;  4H37 A;  2QDO A;  2IJK A;  1AH8 A;  5M4P A;  3CCV V;  1F51 A;  3SYO A;  1YJN V;  4JV5 O;  1YCI A;  3B4S A;  1NVP D;  3W7T A;  2CCS A;  2C1G A;  1FFX B;  3CMA V;  3A0Y A;  2F4V B;  1MA1 A;  1WJZ A;  4B3R B;  1THZ A;  3IJ4 A;  4I0X A;  2ATK C;  4YXW G;  1FPO A;  5EBL C;  1QBZ A;  4MTX A;  3ZRW A;  3JAT B;  4OXS A;  1HNX B;  5JEN A;  3FYE B;  4XE2 A;  4XIP A;  1JJ2 U;  3IED A;  3UCS C;  5CTY A;  4FMT A;  1K73 W;  4DR7 B;  4JI3 O;  5M4E A;  1VF6 C;  1WNS A;  2YXY A;  4PDR A;  4UFZ A;  1QLN A;  2QG2 A;  3K60 A;  3BEH A;  4DR3 B;  1YF2 A;  5KAI Z;  4TUY B;  3OUS A;  3IFX A;  4IHJ B;  2DOS A;  5LA6 B;  2Q4P A;  3E22 A;  4H7Q A;  4CWN A;  1VQ9 V;  4L94 A;  3Q5L A;  4MTO A;  4PHZ A;  3G67 A;  2CCU A;  2YI9 A;  4DV1 O;  2VWC A;  5IJ0 B;  5L3F A;  2LFS A;  2M7W A;  3CRC A;  1I59 A;  3ZS8 C;  2LQT A;  1F4M A;  2QE7 G;  1Q5O A;  1Q81 W;  4NH9 A;  4GCZ A;  2JS3 A;  5LA6 A;  4DV6 O;  1N32 B;  4XCL A;  3CCQ V;  4IHJ A;  4O2A B;  2UUB B;  2Q2E B;  3EFF K;  2RCV A;  1ZTE A;  5IDM A;  3JD0 A;  4O2B A;  4X1K B;  1AR1 B;  1SQF A;  1IBL O;  3AG3 B;  2UXD B;  1LUV A;  2QTO A;  4P7A A;  3DSQ A;  4LP8 A;  3L71 H;  5B3S C;  1Y74 A;  2P6J A;  4HZ3 A;  3LPS A;  2PZS A;  2CH7 A;  4JF3 A;  4CE2 A;  1KEC A;  4JI5 B;  2ZE5 A;  2ZR2 A;  5DED A;  2GQP A;  4MVM A;  4LF7 B;  4IYH A;  2YI7 A;  5LGU A;  5JCO C;  5D7R A;  2UUA B;  5F5R A;  2JRI A;  4DR2 B;  1P49 A;  4UUJ C;  5LYJ A;  5CA0 B;  1VIB A;  1Y66 A;  1Y8P A;  2ODM A;  3OGI B;  4J80 A;  5CN0 A;  4DR3 O;  4QGP A;  4UVC A;  2IWU A;  3EVK A;  4KQV A;  1GN6 A;  3FD9 A;  4OPH A;  1AMW A;  1HNZ O;  2BTZ A;  1S77 D;  1SF9 A;  4ASF A;  1RSO B;  2XHX A;  5CA1 A;  2QGN A;  4K0K B;  3RYF A;  3ZHU A;  1NH2 D;  4AWO A;  5EYP A;  1J5E B;  1S76 D;  1H8H G;  2Y0I A;  5LP6 B;  1WA8 A;  3A0T A;  3R4P A;  2XK2 A;  2QWN B;  2WI4 A;  4I3H A;  1H2S B;  3CYG A;  1GKZ A;  2BZ5 A;  5IE9 A;  4EGI A;  3R4M A;  2YS8 A;  4JAV A;  1AIL A;  1B3Q A;  3HKE A;  2YEF A;  2YEJ A;  1WLE A;  1KYO F;  2LW7 A;  1SA0 B;  3K5M A;  2GDS A;  3QTF A;  2XJJ A;  1TUB A;  1HP8 A;  2UUB O;  2BSM A;  1CXZ B;  1BL8 A;  3RVZ A;  3R4O A;  2A79 B;  1TC6 A;  2YEE A;  1ZL8 B;  3CRQ A;  1XNQ O;  4EGH A;  1QVG U;  2WLJ A;  2IOQ A;  5FNF A;  5EC1 C;  1P7B A;  1NH2 B;  5FWK A;  2QA4 V;  2YK2 A;  4FZ0 A;  4O4J A;  4J42 A;  1UYC A;  3F5T A;  4DK1 A;  4EFT A;  3T0Z A;  5TIS Z;  1VQP V;  1AJN A;  3ASO B;  2YE7 A;  4B7P A;  5EIB C;  3TGU H;  4B3S B;  3RYI B;  3D3I A;  2KG7 A;  4I9Q A;  4FCR A;  2YKC A;  4B3R O;  4I9W A;  4JYA O;  3H4L A;  1PD3 A;  4X62 O;  2IWX A;  1AR4 A;  1N33 B;  1QU7 A;  3QVN A;  1EZV H;  3BM9 A;  2IW5 A;  2YIA A;  4HZ0 A;  4NH8 A;  4JI2 B;  2YI8 A;  2E75 B;  3A0H Z;  4QE9 A;  4HYM A;  5CBG A; 
#chains in the Genus database with same CATH homology
 3K79 A;  2P67 A;  1BGQ A;  3VHC A;  3FT5 A;  2YEV A;  3R65 A;  5IYC O;  3FB6 C;  1NHJ A;  1WPX A;  5E1A C;  4GX5 A;  4LCU C;  1M56 B;  2ZXW B;  1FXH A;  1ARO P;  3ZN1 A;  4DO2 A;  1Z5C A;  4W7T A;  3B24 A;  1QR9 A;  2IH3 C;  2CGF A;  2HKJ A;  3EHB B;  4PU9 A;  4WUB A;  1VQK V;  3X2Q C;  4BW5 A;  4LP0 A;  5KA6 A;  2QM7 A;  2BU7 A;  1H2G A;  3JCZ A;  4MS2 A;  1S14 A;  3LUT B;  3Q5J A;  3OFN G;  2YEH A;  3T10 A;  1EFR G;  2QM8 A;  3IC7 A;  3JZ3 A;  3LNU A;  2WI6 A;  4KSG A;  4CBC A;  2R9R B;  2AKP A;  4LWE A;  2WLL B;  4BAY A;  2YGA A;  4MW8 A;  5M4H A;  4LWF A;  2EIJ C;  1YER A;  1KD1 W;  2YEV B;  2Q6A A;  4JYC A;  4RUF A;  3W7X A;  1YI2 V;  3CGY A;  1M56 C;  2ZXW C;  4PDV A;  1DTO A;  3AG4 C;  3SPC A;  3G71 V;  2BU5 A;  4LWG A;  5HFM A;  1BYQ A;  4MT8 A;  3CCE V;  2DW4 A;  2YI5 A;  4E00 A;  5M4N A;  1K4D C;  2ZDI A;  2B1G A;  2ESA A;  2LFR A;  4ZVI A;  2B5U A;  1K5S A;  2B1I A;  1QVF U;  4CWO A;  1I58 A;  1YT2 A;  3SL2 A;  2CG9 A;  2XAG A;  2YEC A;  3CPW U;  2YEB A;  3ASN C;  4CWS A;  1I5Y A;  2YI0 A;  2MK3 A;  2BYH A;  1NR7 A;  3K99 A;  3O6O A;  1QLE B;  4BIU A;  5CA3 A;  3TET A;  4XD8 A;  4KFG A;  3T0H A;  3NMQ A;  1DF4 A;  4N21 A;  2Y48 A;  1Q7Y W;  1YSZ A;  2XX4 A;  2EZO A;  2Y69 C;  3AG1 B;  4P30 A;  4XBF A;  4MPE A;  2X0L A;  1A4H A;  2FWY A;  2IJJ A;  2PI5 A;  3TZ4 A;  3E83 A;  3OPD A;  3DGE A;  3B25 A;  3E86 A;  2OCC C;  3AG2 C;  3EKO A;  3K0D A;  3Q5K A;  3R4N A;  4MPN A;  3ETE A;  3LNM B;  4UV8 A;  3MHS C;  4MTF A;  4TWK A;  1OCC B;  1RM1 B;  3A0Z A;  1KP2 A;  2WER A;  3ASO C;  3PJS K;  1NJI W;  5LBQ A;  1UYF A;  1MG1 A;  4GX1 A;  2K1E A;  2GFD A;  1H8E G;  3ETD A;  4WFA V;  4RQF A;  3RKZ A;  2FYP A;  3F5W C;  1G8M A;  4MW3 A;  3AG1 C;  4HY1 A;  1UYI A;  2JEU A;  3K08 A;  4MOT A;  4EFU A;  2Q8F A;  4R7C A;  1VQN V;  2QKS A;  2Q8I A;  3JD1 A;  1QLE C;  5KUK A;  1U0Z A;  2X6A A;  1QY8 A;  4HXZ A;  3SJQ C;  1ZXM A;  3CGZ A;  4LPB A;  1W2B U;  4R3M A;  4WFH A;  1K34 A;  4JAU A;  5B1B C;  3ZCC A;  1RM1 C;  1YJW V;  1I5B A;  1KZN A;  1YC3 A;  3D0B A;  4F4L A;  1FXV A;  1NBM G;  1OZ0 A;  2HVK C;  5IYD O;  1QZR A;  1OCR B;  4P2Z A;  2O1U A;  1R3L C;  1JOY A;  4X8A A;  5LHG A;  4WCE V;  3UKM A;  2WEQ A;  2OCC B;  2BU2 A;  3EHJ A;  1K3E A;  1ZW9 A;  3O0I A;  2LP7 A;  4CWR A;  1R6K A;  5CPH A;  3HB3 B;  1TH8 A;  4O05 A;  2V7Q G;  4BQG A;  4DXW A;  1ROP A;  1UYH A;  2BT0 A;  3EHF A;  5BOD A;  1UY7 A;  3R91 A;  1HWY A;  2EIJ B;  4V26 A;  4XKK A;  5IYB O;  4EKW A;  3IGA C;  3W7U A;  3E8B A;  3CC4 V;  2Q8H A;  3CC2 V;  4H33 A;  1SES A;  5EK0 A;  3ABK C;  4PA4 A;  3KG2 A;  4RUE A;  3CCS V;  1AI7 A;  2JJ1 G;  4HAM A;  3SYQ A;  1UYL A;  2BRE A;  4HY6 A;  1GO3 F;  4YKZ A;  5F3K A;  2XDX A;  5CBF A;  5CTY A;  1SER A;  2DYR C;  4G2K A;  3ETG A;  3H80 A;  1COW G;  2WI2 A;  3NXS A;  2WWW A;  1I5X A;  4UVB A;  1YTF D;  4H85 A;  3ZMV A;  3MD0 A;  1CEZ A;  1GK9 A;  1ZWI C;  3RLP A;  3OMN B;  1AH6 A;  4CWT A;  4GX2 A;  3GIG A;  3RVY A;  5DM6 V;  3HEK A;  3OWB A;  1US7 A;  4YKQ A;  3ZJZ A;  2KB1 A;  2YGF A;  1I5A A;  3R92 A;  3MNR P;  3CXC U;  4O07 A;  1CPY A;  3T4D A;  3LDD A;  2BOC C;  2IH1 C;  1TBW A;  2IOR A;  4FCP A;  4G28 B;  1IXM A;  2YJW A;  1JPX A;  4LBE C;  1AI5 A;  3GB7 C;  1OCO B;  4XDK A;  5LGN A;  1S16 A;  3GIE A;  3GIF A;  4AWQ A;  3B8M A;  1W0J G;  2XX5 A;  3LSS A;  2Q68 A;  4L87 A;  1YT1 A;  2QG0 A;  2YKJ A;  5J71 A;  2BU6 A;  2EIK B;  4ZBM A;  4PEL A;  2WI7 A;  2YE6 A;  3W7S A;  3K3W A;  1UY8 A;  2DYR B;  3B8N A;  2X7R B;  4MTG A;  4XDJ A;  4GGL A;  3WQ9 A;  4AS9 A;  1Z59 A;  1YES A;  2X6C A;  1Z5B A;  2XDK A;  3BMY A;  5CTW A;  3FB7 C;  2XHR A;  3B77 A;  2ZDY A;  1QCE A;  1MAB G;  2OT5 A;  4MVS A;  2H55 A;  1Y8N A;  3ABM C;  5B3S B;  5L3D A;  2XAJ A;  4P9O A;  3C11 A;  3OMA B;  5FND A;  1H38 A;  3E89 A;  2YI6 A;  4MBC A;  1YC4 A;  4NH7 A;  4O04 A;  1F4N A;  4MP7 A;  4X89 A;  4XIR A;  1QR8 A;  4P9P A;  2VW5 A;  1BMF G;  2DQ3 A;  3OWD A;  4U93 A;  2HLD G;  1GTO A;  4TT3 G;  3TZ0 A;  4R50 A;  1TID A;  3ZXO A;  1AI6 A;  3U67 A;  3F7Y C;  2WLL A;  3CCR V;  4FCQ A;  1KC8 W;  4XIT A;  2XAQ A;  4H81 A;  3CD6 V;  1TIL A;  4L91 A;  4MVR A;  2XCM A;  2HR3 A;  1Q82 W;  2XD6 A;  1YJ9 V;  1XL6 A;  1PNL A;  1B63 A;  2W0F C;  3CME V;  5D7C A;  1KQS U;  3U2K A;  1RPR A;  1NQT A;  4J9Y B;  1V55 B;  4WFE A;  4WFG A;  3K06 A;  3SPI A;  2JJ2 G;  5L3J A;  1DLB A;  3I55 V;  2YKB A;  2ZBK B;  5D6Q A;  3ZXQ A;  3CWV A;  3CRL A;  3INX A;  4FIP C;  1FXK B;  4URN A;  2CK3 G;  2ITD C;  3ZMT A;  2Z3Y A;  5EBM C;  2BU8 A;  2XX2 A;  2HCH A;  2WAM A;  2WI3 A;  3D36 A;  4L93 A;  4Q20 A;  5D6P A;  5J9P C;  1OCR C;  3ABT A;  1FS0 G;  3F7V C;  2OTJ V;  3K97 A;  3HHU A;  3VAD A;  2W6I G;  4O09 A;  3SPJ A;  4YKR A;  4YKX A;  4RQE A;  2PNR A;  1S5H C;  1R3I C;  3QO7 A;  5EBW C;  2YE4 A;  2HKO A;  5B1O A;  1FXK C;  2YEA A;  2YE3 A;  3OW6 A;  2WLI B;  2HJF C;  2WLK A;  2P7T C;  3ZMZ A;  3G7B A;  1EBO A;  1H7U A;  2YSU B;  3ZN0 A;  4PDM A;  2Z5U A;  4GT8 A;  5IY5 C;  4O0B A;  1GKF A;  4MSW C;  1UYK A;  2VCI A;  4BAE A;  2C2A A;  3WFV A;  2H8M A;  3VHD A;  1OCC C;  4UVA A;  1UY6 A;  1ZXN A;  4DZY A;  2V1D A;  1K9M W;  3HZ5 A;  3EHG A;  5M4K A;  3ZM7 A;  4RAI A;  1UJW B;  2JKI A;  4JPR A;  3CRK A;  1P4R A;  2DWE C;  1JVM A;  3M99 B;  4QIW F;  3AG2 B;  5FL7 G;  4ZKI A;  3W7W A;  1BHA A;  1U2O A;  1Y4U A;  2YEI A;  1OCZ B;  2UXN A;  3INW A;  1VQ7 V;  3FKS G;  2EZP A;  3LSQ A;  3TUH A;  1VQ8 V;  1BXD A;  4WUC A;  1GM7 A;  2WI5 A;  3JYC A;  2FTK A;  2H94 A;  1YT0 A;  2BOB C;  4PRV A;  1V54 C;  1NR1 A;  4WFF A;  3E8H A;  5IDJ A;  3CP1 A;  3OR6 C;  1OCO C;  4UXN A;  3T2M A;  3HZ1 A;  2QEX V;  3RLR A;  3RW0 A;  1E79 G;  2AHZ A;  3ABM B;  3T1C A;  2JJC A;  2IJI A;  5B1A C;  2YJX A;  4MVZ A;  4E2L A;  1NHI A;  4CWP A;  1GM8 A;  4JGS A;  1K8A W;  1I5C A;  1YET A;  1GM9 A;  3B28 A;  4HZ5 A;  1GKX A;  3A0X A;  4FJC C;  2JDI G;  1G4Y B;  4I5S A;  3VBB A;  4YKY A;  2UWD A;  2EIN C;  4PA6 A;  4XIQ A;  1MOF A;  2EBO A;  5FNC A;  5EC2 C;  1YTF B;  3SYC A;  2DWD C;  4UV9 A;  3T4Z A;  2WLM A;  1E1Q G;  2GHY A;  4FPP A;  5DN6 G;  1Q86 W;  1ZWH A;  2DQ0 A;  4U7O A;  4URM A;  1ENV A;  1BKN A;  1EI1 A;  3ZMU A;  4YKW A;  3STL C;  1VQM V;  2O1W A;  1OHH G;  1TUE B;  2IOP A;  3K0G A;  3ZRW B;  2VCJ A;  1S3J A;  4H37 A;  5GW7 A;  1K5Q A;  3WG7 B;  2IJK A;  3AEI A;  5B1A B;  1AH8 A;  3CCV V;  1F51 A;  1VQO V;  2O1V A;  3SYO A;  3E2E A;  4CE1 A;  5M4P A;  3E35 A;  1YJN V;  4XDL A;  1NVP D;  3W7T A;  4CWQ A;  3AG3 C;  3E8G A;  3GWO A;  3UM7 A;  3X2Q B;  2YE2 A;  4XDM A;  2CCS A;  3OGC C;  2BYI A;  1K92 A;  3CMA V;  2XND G;  3H01 A;  2YK9 A;  2JEX A;  3A0Y A;  1SRY A;  1THZ A;  2EIN B;  2XAF A;  5CMU A;  3JD3 A;  2K5B A;  2ATK C;  1YIJ V;  4YXW G;  3ZKD A;  3G75 A;  1M57 C;  5EBL C;  2HG1 A;  4MP2 A;  1QBZ A;  4XKA A;  1M1K W;  3JD2 A;  3FV5 A;  3OE7 G;  4MTX A;  3FYI B;  3ZRW A;  4OXS A;  4URO A;  5B1B B;  1S0V A;  3FYE B;  3OM3 B;  4XE2 A;  4XIP A;  3ABK B;  4CWF A;  4JTD B;  3OEE G;  1JJ2 U;  2XDU A;  3IED A;  5IY5 B;  3HPL C;  4QPK A;  3OAA G;  4KFM A;  1PNM A;  3CCU V;  1VQ4 V;  1W0K G;  2YEG A;  4FMT A;  2JIZ G;  2EIM C;  2JK5 C;  3QO5 A;  2EXL A;  2EIL C;  3STZ C;  1KIJ A;  1K73 W;  1J95 A;  2D3O W;  4QE7 A;  4N23 A;  1YSC A;  5M4E A;  1JM6 A;  4PDR A;  3E8F A;  1QLN A;  2QG2 A;  2ZR3 A;  4KUM A;  2UXX A;  3K60 A;  4R1F A;  3BEH A;  3O2F A;  3OUS A;  2NLJ C;  3IFX A;  4KP4 A;  4CE3 A;  1Y4S A;  3LDC A;  4JTC B;  2YE9 A;  3TZ5 A;  2HFE C;  2XOK G;  1PL0 A;  1PVG A;  2FWZ A;  4JAS A;  4MVU A;  1ORQ C;  4H7Q A;  4CWN A;  1VQ9 V;  4L94 A;  4GEE A;  3Q5L A;  3ABL B;  4MTO A;  4TSF G;  5B1N A;  1K97 A;  2Q69 A;  4R6Z A;  3FB8 C;  4QNH B;  3A0W A;  3MHH C;  3K9A A;  1KP3 A;  2YE5 A;  4HXW A;  2CCU A;  2XAS A;  2VWC A;  2DYS C;  3ZRV A;  3PEJ A;  5L3G A;  2X6B A;  5L3F A;  1DF5 A;  2LFS A;  1V55 C;  1YS3 A;  2M7W A;  3P32 A;  2QFO A;  3ABU A;  2HG5 C;  3HYY A;  1I59 A;  2YED A;  4MVQ A;  4XTJ A;  1F4M A;  5GGZ A;  2QE7 G;  4ASU G;  3CCJ V;  4MVO A;  4RO2 A;  1BHB A;  1I5D A;  3SYA A;  1Q81 W;  1H7S A;  4GCZ A;  4NH9 A;  4YKU A;  4B6C A;  2WI1 A;  4BXI A;  1K7D A;  4EEH A;  1Y4M A;  4XCL A;  4ASA A;  4GX0 A;  3K04 A;  3A0R A;  3CCQ V;  2Q2E B;  3EFF K;  5L3E A;  3AG4 B;  4JTA B;  3KE6 A;  1MU5 A;  1JQ0 A;  3K03 A;  5IDM A;  4CZZ A;  3JD0 A;  3ZMS A;  1AR1 B;  4MB9 A;  1L1F A;  3AG3 B;  2EIM B;  3G4S V;  2IU3 A;  2QTO A;  4P7A A;  5M4M A;  1KKD A;  4GQT A;  4LP8 A;  5B3S C;  1UYM A;  4E02 A;  3U2D A;  2P6J A;  3TZ2 A;  4HZ3 A;  2ZKJ A;  3LPS A;  1CP9 A;  1JX9 A;  4JF3 A;  4PL9 A;  1KEC A;  4CE2 A;  1THN A;  5D7D A;  1XL4 A;  3WG7 C;  2ZR2 A;  2GQP A;  4K4O A;  4MVM A;  1NHH A;  3CCL V;  3P30 A;  2WLH A;  3OMI B;  2XDS A;  1LNQ A;  3DTU B;  2YI7 A;  2Q8G A;  5LGU A;  2XDL A;  2H8P C;  4FK5 C;  3TCU A;  3GIG B;  4XKO A;  5D7R A;  2Q67 A;  2A0L A;  4MPC A;  3JD4 A;  3HYZ A;  5J6A A;  1R62 A;  5F5R A;  3QO8 A;  4LWH A;  3QDD A;  4QPJ A;  1B62 A;  2ZDI C;  3K98 A;  4URL A;  4GT1 A;  2YE8 A;  4UUJ C;  1YC1 A;  2OTL V;  1PNK A;  1Y66 A;  1Y8P A;  3G6E V;  2P90 A;  1FXK A;  5CN0 A;  4UVC A;  2IWU A;  5C93 A;  1N8R W;  3C0E A;  4R8C A;  3G7E A;  4V25 A;  4WFB V;  4KQV A;  1V54 B;  4XC0 A;  5BOC A;  3D2R A;  2XAH A;  1AMW A;  1MSW D;  1UY9 A;  1S77 D;  1M90 W;  5H6Q A;  2BTZ A;  2XHT A;  5CBH A;  2ITC C;  2XJG A;  1NKD A;  2IU0 A;  1K33 A;  2IWS A;  4ASF A;  4KSH A;  3OUF A;  3RBZ A;  2XHX A;  4X9L A;  1AI4 A;  1EZJ A;  1AJ6 A;  4PA7 A;  4E01 A;  1SET A;  1ID0 A;  3ZKB A;  4U7N A;  3LDE A;  5LHI A;  4AWO A;  1NH2 D;  2HVJ C;  1S76 D;  1H8H G;  4GFN A;  3ZRS A;  3EHH A;  3TK1 A;  3FT8 A;  3B27 A;  3A0T A;  3SPH A;  4PDL A;  3R4P A;  1R3K C;  2YKE A;  2XK2 A;  2WI4 A;  2AHY A;  1QYE A;  3I56 V;  1Z5A A;  4I3H A;  1UYG A;  1OCZ C;  3VOU A;  5LHH A;  3B26 A;  1OSF A;  3TTZ A;  2R9I A;  4QJF B;  4HYO A;  1AJP A;  1GKZ A;  3VHA A;  4LC1 A;  2BZ5 A;  5KUM A;  2YKI A;  4DUH A;  4EGI A;  3R4M A;  3FB5 C;  3ML0 A;  4LWI A;  4JAV A;  1S72 V;  1JCH A;  5H6R A;  1EA6 A;  1B3Q A;  1GJV A;  1MX0 A;  3RLQ A;  4ASG A;  1L0O A;  3OEH G;  4X88 A;  3OR7 C;  4Z1M G;  2YEF A;  2YEJ A;  3CCM V;  1WLE A;  3QTF A;  2F43 G;  1YHQ V;  2XJJ A;  1M9N A;  1E1R G;  2DYS B;  5CTX A;  1AM1 A;  1UYE A;  2BSM A;  1RPO A;  2ZD9 A;  1B6Q A;  1BL8 A;  3EKR A;  1SZT A;  5KA5 A;  1K4C C;  3RVZ A;  1VQ5 V;  1GMG A;  4J9Z B;  3R4O A;  2CH4 A;  2A79 B;  4WUD A;  3QNE A;  2CCT A;  1TC6 A;  2YEE A;  5HFL A;  1VQ6 V;  4EMV A;  4PA3 A;  3SYP A;  1F23 A;  3T1K A;  1Y8O A;  1R6N A;  1VQL V;  5LGT A;  2XAB A;  2EJR A;  4EGH A;  1QVG U;  4HYP A;  5CTU A;  2WLJ A;  4WF9 V;  2IOQ A;  5FNF A;  5EC1 C;  4JQL A;  1P7B A;  3OW2 U;  2GSM B;  1NH2 B;  3WHA A;  5FWK A;  2XJX A;  2QA4 V;  3CYO A;  5IN9 A;  2Y69 B;  2YK2 A;  2ZDX A;  4BIZ A;  4L8Z A;  4EM7 A;  1UYC A;  5BZB A;  4EFT A;  4L90 A;  2ZQM A;  2QF6 A;  3T0Z A;  5CF0 A;  4EGK A;  5H9C A;  1PKX A;  1UYD A;  2IJH A;  3ABL C;  3ASN B;  1AJN A;  2WSS G;  1VQP V;  2NNU A;  3ASO B;  1TC0 A;  2YE7 A;  4ASB A;  4B7P A;  3SPG A;  2A9H A;  5L3C A;  5L3B A;  1AJQ A;  4YKT A;  3BY6 A;  1M57 B;  1NVP B;  4XCJ A;  3D3I A;  4FCR A;  2E0A A;  2YKC A;  2WPD G;  2EIK C;  3ZRX A;  1YSR A;  4AWP A;  4I9W A;  4PA9 A;  3CC7 V;  1YIT V;  2YGE A;  3H4L A;  3T2S A;  1PD3 A;  3ZIA G;  4P8O A;  4G27 B;  2IWX A;  3OMU A;  1R73 A;  4PRX A;  4KTN A;  4BQJ A;  2EIL B;  2WEP A;  2FXS A;  3BM9 A;  2WLI A;  2IW5 A;  2PI4 A;  1FFT B;  4JYB A;  4HZ0 A;  2W6J G;  4NH8 A;  4R3A A;  2BRC A;  4QE9 A;  2WLN A;  4HYM A;  5CBG A;  3PEH A;  1R3J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...