2C2AA

Structure of the entire cytoplasmic portion of a sensor histidine kinase protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
240
Chain Sequence
MENVTESKELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SENSOR HISTIDINE KINASE
publication title Structure of the Entire Cytoplasmic Portion of a Sensor Histidine-Kinase Protein.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 81
structure length 240
sequence length 249
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2c2aA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2c2aA02
1L0OA 4H81A 4LWEA 3INWA 3TUHA 1UYIA 4GT8A 4WUBA 4NH9A 2FTKA 1JM6A 4EM7A 4ASFA 1EA6A 3OPDA 2BU5A 3ZKDA 2XCMA 4JQLA 3B24A 5CF0A 3GIGB 5D7RA 1Y8OA 3CGYA 1GKXA 2ZDYA 3BM9A 4YKYA 1S16A 1YC3A 4CWFA 3VHDA 1I5DA 4PRXA 1UYLA 2XX4A 1QZRA 4P8OA 4CWNA 3U2KA 2YE6A 2YI7A 2YEAA 2HG1A 1MX0A 2BTZA 1UYMA 2YKCA 5J6AA 3PEJA 3VHAA 2BYHA 5F5RA 2Q2EB 2YE7A 4KSGA 2JJCA 5IDMA 4I3HA 1BKNA 1F51A 3KE6A 4AWOA 2IOQA 2VW5A 4LPBA 2FXSA 1YC4A 2Q8HA 1UYHA 4GT1A 5L3JA 1YESA 4X9LA 4AWQA 3R4PA 3R4MA 1Z5CA 4HYMA 3ZM7A 2Q8IA 1R62A 4KTNA 3A0WA 4E02A 2K5BA 2H8MA 3R4NA 2YKIA 3R91A 3CRLA 4EGHA 1ZWHA 4JYCA 4I5SA 2WI4A 1AM1A 5D7CA 3DGEA 3OMUA 3ZCCA 4GEEA 5M4NA 3T10A 1EI1A 2WERA 3ZXQA 4ZKIA 2CH4A 2XJXA 4E01A 3HZ1A 3WHAA 3P32A 1TBWA 2BSMA 1I5CA 2BU7A 1Y8PA 2YKEA 4XKKA 2YJWA 3ZRWA 4HY1A 4HYPA 1H7SA 4XE2A 2YECA 2YE9A 4YKRA 1AH6A 3TZ0A 4MT8A 2WI6A 3PEHA 3G7EA 3A0RA 2CG9A 2WWWA 4CWTA 2FWZA 3INXA 4YKWA 1AMWA 2YEDA 3D36A 1ZXMA 3G75A 3T0ZA 4XKAA 4H85A 1YSRA 3G7BA 3HYZA 2BYIA 2E0AA 5CPHA 1UYDA 3QTFA 3H80A 2GFDA 5CTWA 2YKJA 3A0ZA 3GIGA 2O1VA 4DZYA 5J71A 4LWIA 4WUCA 1QYEA 4W7TA 3CGZA 4MP2A 3MNRP 3VHCA 4CE2A 3T1KA 3OW6A 4MTXA 4E00A 1B62A 4ASBA 1Z5AA 3OWBA 4U7OA 2YE4A 2XDLA 4MOTA 4L93A 3D0BA 1UYKA 5D6QA 4CWOA 3Q5LA 4LWGA 4XIPA 3TZ4A 2WI2A 2EXLA 2YKBA 2JKIA 5IN9A 4MP7A 2YI5A 4XIRA 2QG0A 4R1FA 1GJVA 5FNDA 2WEPA 4JASA 2YEHA 1YERA 4YKTA 1QY8A 5BODA 2XHXA 3K97A 4QPJA 1A4HA 2CCUA 2IWUA 2XDXA 4JAUA 3D2RA 4YKQA 4HXZA 3Q5KA 2LFRA 3R92A 4XC0A 1KIJA 2XDKA 2WI1A 1Z59A 3HZ5A 4DUHA 1YT1A 5BOCA 2YEJA 1TILA 2VWCA 3ZXOA 1NHJA 1ZXNA 2QFOA 1AH8A 2PNRA 4BAEA 3NXSA 2BU8A 2ZBKB 4MPCA 2IORA 4NH8A 1I59A 2YGAA 2QF6A 2XDSA 1TH8A 4U7NA 3ZRVA 3B27A 3K98A 3BMYA 3T0HA 2XDUA 4YKXA 4MPNA 1THNA 3T2SA 2BU6A 1I58A 4B7PA 4O07A 4LWHA 4MPEA 3LNUA 1ZW9A 4FCQA 4GCZA 3EHFA 2YEIA 4R3MA 1NHIA 3O0IA 5FWKA 1UYGA 3U67A 5M4PA 1B63A 3R4OA 3NMQA 1B3QA 4PRVA 4FMTA 1TC0A 4YKZA 4BQJA 4BQGA 5CTYA 1YSZA 1UYFA 4L91A 2YK9A 4KP4A 1GKZA 5FNFA 3FV5A 1BGQA 3WQ9A 4BXIA 4CE3A 1UYCA 2XD6A 4CWRA 4ASGA 1I5BA 4LWFA 3B25A 4UROA 5CTXA 2Q8FA 2VCJA 4NH7A 3QDDA 4BIUA 4CWQA 3O6OA 4HXWA 2YE5A 4HY6A 4URLA 1UY6A 4XDMA 4KSHA 2XHRA 5M4KA 1ID0A 2BT0A 1U0ZA 1Y4SA 1BXDA 4L8ZA 1YT2A 4AS9A 1MU5A 2XABA 3EHHA 3OWDA 2C2AA 4O04A 1H7UA 2FWYA 3EHJA 1Y4UA 5CTUA 2YE3A 1US7A 3TZ5A 2IOPA 2HCHA 1UY8A 5D7DA 2GQPA 4XIQA 1YC1A 4QPKA 4L94A 3Q5JA 2UWDA 4U93A 4CWPA 2FYPA 1UY9A 5IDJA 3A0YA 2Q8GA 2CGFA 2BU2A 2YEGA 5C93A 4XTJA 1KZNA 3HEKA 4ZVIA 2YEEA 3MD0A 4WUDA 2BRCA 3CRKA 4K4OA 1PVGA 2O1UA 2H55A 3RLPA 2WEQA 4EFUA 5B1OA 4GFNA 2ZDXA 4URMA 4H7QA 4URNA 1OSFA 5M4MA 1JOYA 4ASAA 3B28A 4EMVA 2VCIA 1UY7A 4CE1A 2IWXA 5B1NA 4B6CA 5D6PA 3O2FA 3FT8A 3B26A 3GIFA 2BREA 1IXMA 4HZ5A 2YE8A 3A0TA 3ZRXA 4GGLA 4PU9A 1U2OA 1TC6A 2XX2A 1Z5BA 4FCPA 3EHGA 3EKOA 4LP0A 4AWPA 3C11A 4CWSA 2YI6A 2ESAA 2WI5A 3VADA 3ZKBA 1BYQA 2YEFA 2XX5A 3EKRA 2ZKJA 4XKOA 3U2DA 5M4HA 1AJ6A 2O1WA 4JAVA 2YK2A 3IEDA 2XJJA 4FCRA 2P67A 3HYYA 2QM8A 2YGEA 4GQTA 2XHTA 3JZ3A 4XD8A 3RKZA 3H4LA 3HHUA 1TIDA 1Y8NA 5FNCA 3RLRA 4P7AA 4EGKA 2WI3A 4EGIA 4KQVA 1YS3A 2YJXA 4LC1A 4MB9A 4JYBA 2WI7A 1S14A 4KFGA 4XITA 4V25A 2YI0A 2YE2A 2QG2A 2BZ5A 4HZ0A 1YT0A 4FPPA 3SL2A 4V26A 4BIZA 2AKPA 4Q20A 4XCJA 3TTZA 2CCTA 2YEBA 2HKJA 3CWVA 4O09A 3K99A 3FT5A 4EFTA 1YETA 5GGZA 2IWSA 2XJGA 4L90A 3C0EA 1NHHA 2YGFA 3RLQA 3TK1A 4XCLA 3ZRWB 4O0BA 3LPSA 4YKUA 1UYEA 2XK2A 1I5AA 4O05A 4EEHA 4R3AA 3A0XA 5M4EA 3TZ2A 2CCSA 2LFSA 2QM7A 5F3KA 4MBCA 3GIEA 3K60A 4PL9A
chains in the Genus database with same CATH superfamily
1E1QG 1BHAA 3C90A 1AR1B 1R3KC 5IJ9B 1UYIA 1K73W 1B04A 4DR6B 3BABA 3OPDA 3P30A 1FXKB 3ZKDA 2Q6AA 1SA0A 4JQLA 2EIMC 2YSUB 4MVQA 4DV0B 1H2SB 1Y8OA 4MVSA 4I4TB 1KU9A 2ZDYA 5JENA 3JYCA 2PY5A 1GMGA 1HR0O 3VHDA 1WN7A 3CCRV 2ZNJA 3FX7A 3AG3C 3JSNA 4MTFA 4PRXA 2XX4A 4PI2A 2QE7G 4TOIA 1SQPH 4CWNA 5B1AB 3ETEA 2YE6A 3L73H 4U3FH 1AB3A 5LYJA 1HP8A 2RQ6A 4CH4A 4GKJB 1IBLB 2PI5A 4RQFA 2NNUA 4X20A 3PEJA 3VHAA 2E3CA 2BTQB 1GM9A 4OX9O 1GM8A 3ZHTA 4JF3A 2JJCA 4I3HA 1M4UA 4JI5O 1PD3A 2ZCEA 1BKNA 4AWOA 2VW5A 3MHSC 3HKCB 3IC7A 4LFCO 1EBOA 3JAMN 3LNMB 3C3TA 4IYHA 5L3JA 5LMUB 2BOBC 1PKXA 3AG2C 4FLWA 4DR3B 1FFXA 1Z5CA 4J10A 1NVPD 4KTNA 1QVGU 2HR3A 4E02A 1ZAUA 3C3SA 1HNWO 2ZIOA 2UUAB 1XNRB 1GRJA 4TSFG 3W7SA 2EIJC 1DGSA 1IBMO 1QU7A 3K04A 3WG7C 5J2UB 1G4YB 1AM1A 5D7CA 1S5LZ 3ASNB 3OMUA 5M4NA 1OV9A 3T10A 2WERA 1QR9A 4ZKIA 1NH2D 1N32O 2CH4A 4E01A 4F6RA 3P32A 1I5CA 2P7TC 3CX5F 2YJWA 3ZRWA 4HY1A 1VQ9V 2RNBA 1F23A 3U0ZA 2YE9A 4MT8A 3W7UA 3PEHA 3LNNA 4X62O 3G7EA 4KFMA 1NTZH 4CWTA 1XQ8A 2F93B 2FWZA 3N2GB 3T0ZA 3D36A 4XKAA 2Y69C 1GK9A 5H9CA 4LFAO 1YSRA 3G7BA 3CC4V 3ETDA 4JI8B 1NTKH 1X59A 4TQFA 3GIGA 4J42A 3LDEA 4LR3A 5C8YB 2QWQB 4MVZA 1ZUQA 1FXKC 2AHYA 4W7TA 3CCVV 3U11A 5LOVA 3VHCA 2P5OA 2HLDG 4NR1A 3T1KA 3K3WA 4LWSB 1S0VA 3BAAA 2UXCO 4ASBA 1FFTB 3ZN0A 3J81N 1XI1A 4PA6A 4U7OA 4DUYO 1YJNV 3QTCA 4WFEA 3BA8A 2HVJC 2WLIB 3OMNB 3RYIA 4MTGA 2IH1C 1QCEA 5B1AC 3UO3A 5BY1A 4CWOA 2N74A 3AG4C 1P7GA 5CMUA 3JD3A 4O4JA 1W2BU 2OTLV 4AI8A 1XL4A 3TZ4A 2WI2A 3HKDB 2EXLA 5LA6B 1HDJA 2DOSA 5JJJB 4KUMA 1PL4A 1KKDA 2QG0A 1H8EG 1BS3A 4ZOLB 4LF9O 4BIOA 5FNDA 2CK3G 3CEIA 4WF9V 4H13B 5IYZB 2ZE5A 4KHPO 4FLYA 5KHIA 2XHBA 1TUEB 3Q4HA 2XHXA 1WA8B 4QPJA 1AI5A 4G2KA 3TXQA 4DV4O 2XAJA 2XDXA 3SYPA 4DW1A 3B40A 4LBEC 3R92A 1WB8A 4GX5A 4ZI7B 5L3FA 4XC0A 1Z59A 1EN4A 3K08A 4JI0O 5IWAO 3CJHB 1OCOB 5D5QA 5BOCA 4HNAB 3ASNC 3SPGA 2LGWA 2PNRA 1LNQA 1K5SA 4MPCA 1SZTA 1KP3A 5F2VO 4E72A 4X1YA 1VQOV 4O4IB 2OTJV 2XOKG 2XDSA 1AILA 3IFXA 1YIJV 3ZX6A 2UXNA 3OGCC 4I0XB 2HHHB 2WLLA 4IIJB 4YKXA 3FAVA 1KD1W 1I58A 1R3JC 1VQNV 2JDIG 4FCQA 3ASOB 3VBBA 2YEIA 5KAFZ 4PV1B 1NHIA 1VQ4V 1NZ6A 5KHGA 1IBLO 5M4PA 1B63A 4QGPA 2DN9A 4H37A 4PRVA 4FMTA 4MVOA 1BE3H 4YKZA 2Q73A 4H33A 2RN9A 4U3JB 1IVSA 2XAQA 2M7WA 3OT7A 4CC6A 4PA9A 2QWNB 1UYFA 1Z5WA 4KP4A 4EB6B 5JQGA 5BR8O 4CS2A 4J7KA 1UYCA 2XD6A 1NVPB 4ASGA 2Q4PA 1Y76A 1PM9A 2XTAA 2VCJA 2F23A 3OGIB 4DR3O 4CWQA 4Z2WA 4HXWA 2JIZG 2YE5A 4HY6A 4URLA 4B3TB 1UY6A 1L0NH 4XDMA 4TV8B 5GW7A 1XNRO 1MG1A 2JS5A 2BT0A 3JAWB 1GM7A 4AS9A 1I94B 2QGNA 1GTOA 2P4VA 1JJ2U 5H6RA 2BCCH 3EHJA 4K3AA 2UXBO 4WBNB 3TZ5A 5EC1C 2GQPA 2RMKB 2EBOA 4PDVA 1B6QA 4RQEA 2AZ2A 4L94A 5J2TA 2N05A 2YXYA 3E35A 4R8CA 2ZT9B 4DRXB 2FYPA 5IDJA 2G38A 3ABLB 5TISZ 2Q8GA 1ZLZA 3HKBA 4X89A 3T4DA 1U97A 2YEEA 3OTOO 1XOUA 1IZ3A 3K60A 1US6A 3THOA 3A0BZ 1PVGA 4PA4A 2Y4UA 3GVMA 1NI8A 3ZJZA 2A0LA 1PP9H 4GFNA 4FK5C 1NS1A 1OCOC 4LF4O 4H7QA 4URNA 2JGDA 2GTAA 1PNLA 2AGAA 3F7YC 1M1KW 4UB6Z 1Q90D 4NB5A 2F4VO 5E79Z 4IHJA 4RUFA 2E5LB 1S77D 1UY7A 2OIGA 4FLUA 3OMAB 3B26A 1RSOA 3CRMA 5CB4B 4J9YB 1X4TA 3WB2A 3A0TA 3K5OA 4WFBV 4PU9A 4CH6A 1M5IA 4DV6O 1W0KG 3EKOA 1H2NA 1XDCA 3RYHB 3JALB 4LP0A 5JCOC 5IE9A 4DV2B 4DYLA 4CWSA 1OCCB 3UT5B 2PYJA 3VADA 3BRCA 4K0KO 2YEFA 4YJ3B 2NR5A 5M4HA 2YK2A 4ZIBA 4JAAA 2ZDIC 5B3SB 4X1IA 1TIDA 1TUBA 1Y8NA 4EGKA 2WI3A 2YJXA 5L3DA 3RYFA 4MB9A 4XITA 3OW2U 5ITZA 4HZ0A 1YT0A 3MDSA 1AI4A 2LJ2A 4FPPA 3SL2A 4Q20A 3TTZA 2CCTA 2YI8A 3K99A 2P90A 1P84F 3B2EE 5BXZA 1YETA 3KKYA 5IYBO 1VQ7V 2QTSA 4Q6GA 4J80A 1VF7A 3G67A 4XDKA 1GN3A 4L90A 3F5WC 3QO7A 2YGFA 1I5XA 3RLQA 1K92A 4JI3B 4JI5B 4XCLA 3WFVA 4FJCC 1H2GA 1I5AA 3TZ2A 4LFCB 3RVZA 3LSQA 1AI7A 3E8BA 5IT9N 5IY5B 3INWA 1Q3EA 5LMNB 3X2QB 1FYJA 3JASB 2JS3A 1HNWB 3TXSA 4EM7A 3DTUB 1EA6A 4LFBB 1YZBA 2QEXV 3BA9A 2XCMA 4P9OA 3CMEV 3P3NA 1IBMB 1PNMA 3OUFA 2FKXA 3CRAA 3ZHUA 5LP6A 4G28B 3CGYA 1MMMA 1GKXA 1N32B 3BM9A 2A9HA 4YKYA 3FKSG 1YC3A 1DTOA 2RCVA 1BT8A 1I5DA 4YJ2A 1UYLA 2MK3A 2UU9B 3AK3A 2YEVA 3CCMV 4B3RB 2B5UA 2P22C 3CCQV 4NTXA 3U2KA 4L8JA 2HG1A 2BTZA 2H3OA 1SETA 2YKCA 5A2QN 2BYHA 1KECA 1YEWA 4LFAB 1KYOF 4B3TO 4KSGA 3SR2C 2IJJA 2BSKA 4BR6A 3RYCA 3OFNG 2KG7A 2QA4V 1OCCC 1WJZA 4GT1A 4NXMB 4JV5B 1YESA 2EJ7A 4JI7O 2WA4A 3PN1A 4IGGA 3ZM7A 4XDJA 3D8CA 4QIWF 5B3SC 1J5EB 1YHQV 3JD1A 3KG2A 4GZRB 1ZWHA 1PL0A 4E4EA 2EX3A 4G27B 1YXBA 1IXBA 3ZCCA 3G6EV 3ZXQA 4QJFB 1AJNA 3N2KB 2IJHA 1O9HA 2HFEC 2XJXA 3WHAA 2R70A 4O4LA 2OIEA 4GUNA 2YKEA 4XKKA 1JMKC 1MZFA 3B77A 3ABMC 5B1BC 1FXVA 4RO2A 1GO3F 5EYPB 3STLC 4HYPA 4YKRA 2ZR3A 1AH6A 4GKKB 4BAYA 4LF9B 1Q82W 2WI6A 1SQQH 2XAHA 2DJVA 2Y48A 1XHZA 3CE2A 2CG9A 2WWWA 1AP5A 3IC9A 4YKWA 3G75A 1ZXMA 2X6CA 3JATB 3JD0A 1M9NA 4LF7B 3SJQC 2BYIA 2CH7A 3SPJA 4DV4B 5KX5B 4MVRA 2E75B 5CTWA 3EHBB 4DR2O 1TVKB 1JQ0A 2O1VA 2AZ0A 3VQXA 2QR4A 1ROPA 1I7FA 1XUQA 4WUCA 5FNVA 4DV2O 4DR5B 4MP2A 5J9PC 1SS3A 2V1DA 1XL6A 3OW6A 4LF6O 1K8AW 1B62A 1Q5OA 4B7EA 1OCZB 1S76D 3APOA 3M99B 3P3PA 1YDXA 4LCUC 2YE4A 5CA1A 2WAMA 1UYKA 3D0BA 5D6QA 3Q5LA 5KUKA 3O65A 4CS4A 4B3SO 2QJ1A 4YY3O 4XIRA 4PDRA 4JI4B 3JARB 4QE9A 4DV5O 1I08A 3AG4B 1AJPA 4JASA 4NTWA 4O2AA 5CA3A 2ILMA 5CA0A 2QSAA 4YKTA 5BODA 1H2MA 1BL8A 2R9RB 3ZMVA 1KKCA 1E1RG 3ICXA 4JI3O 5KMGB 2CCUA 5BR8B 2IWUA 4AHCA 3I5DA 1Q86W 1R6NA 2ZM6O 3ZEDA 2PUSA 1BSMA 5LMNO 1YF2A 1YT1A 4DV1B 2YEJA 3J7AU 2VWCA 1NHJA 1ZXNA 2QFOA 1PV0A 3D3IA 4BAEA 2YC0A 3CYGA 4LFBO 4FLZA 2VRZA 3NXSA 2VWJA 1H2LA 5JJEB 1WP7A 2YGAA 1VF6C 5EBMC 3HYYA 3NR7A 1T5EA 3U10A 3DXRB 3ZS8C 2AXTZ 3JCUZ 4XBFA 2EJRA 4JTCB 2UXBB 1BQZA 1FD9A 2Q7HA 2R9IA 3W7XA 3T2SA 2Q5ZA 2VS0A 2UU9O 1JCHA 4B7PA 4B3RO 4O07A 1R1BA 4LF8O 4MPEA 1ZWIC 3H1JH 1ZW9A 4GCZA 3EHFA 3OTOB 1YSCA 5JJNB 1Y74A 3O0IA 5FWKA 3BCCH 1YITV 1SQVH 1IURA 3IJ4A 2W6JG 1B3QA 1Q43A 5BZBA 1BCCH 3G4SV 2FL4A 2ZE8A 1N36O 3ABKB 1P7BA 2LW1A 4CC5A 4BQGA 5CTYA 4I55B 2HEPA 4ASUG 3SYOA 2YK9A 1GKZA 5FNFA 4LF4B 3S3WA 3WQ9A 4N21A 4O4HB 4OPAA 2QKSA 4NXMO 3CXHF 4JV5O 2Q8FA 2F4VB 1AI6A 4TV9A 3QO8A 3QDDA 1OCZC 1VF5B 3G71V 2P06A 1RM1B 4R6ZA 3K79A 1J5EO 3CRQA 1YCIA 2CGOA 3ZHVA 1U0ZA 1Y4SA 4L8ZA 1YT2A 2DQ3A 4ZHQA 3EHHA 4HZ3A 5JVDB 4DV6B 3OWDA 4O04A 2FWYA 3SYQA 1Y4UA 4HYOA 1R6TA 1M57C 3ZHSA 1K34A 4D7SA 2QDOA 4K0KB 4U93A 3BFRA 2JJ1G 1XBLA 3DC5A 2V7QG 3A0HZ 2YEGA 5C93A 4DK1A 1VMGA 4GKKO 4MVMA 1M93A 2YUAA 1UFIA 3ETGA 3GB7C 5FPOA 3E22B 2OCCC 1DF4A 3MD0A 2BRCA 5JWPA 1AROP 3OEHG 2H55A 3KCYA 5FL7G 1KUQA 4LF7O 3L74H 3DC6A 2ZDXA 1A32A 1SA0B 4URMA 2ZIMA 2JRIA 1OSFA 1NTMH 2CTQA 5K1PA 1BZKA 4JZGA 2HJFC 1YVWA 4ABMA 3J80N 2W6IG 4ASAA 4FVMA 4DUZO 4EMVA 5IJ0A 4XDLA 4DR5O 4B6CA 5D6PA 1BHBA 4X64O 4JYYA 2BREA 1IXMA 2LGQA 2BE3A 2P4KA 1V55B 4LH6A 5LYJB 1U2OA 1TC6A 3E8FA 1XMOB 1HNZO 4YIOA 3LMMA 3G6BA 4X20B 1D2DA 4AWPA 5JH7A 3S3XA 3EVKA 3B09A 5EIBD 5KUMA 2WI5A 1BYQA 2WSSG 4PL9A 1NR7A 2W0XA 2XX5A 2EZPA 3EKRA 4JI4O 3U2DA 1N0NA 4EFEA 3IEDA 2XJJA 2P67A 2YGEA 1SERA 3ABKC 1FJGO 4XD8A 3RKZA 1THZA 3H4LA 4FZ0A 3HHUA 4EEQA 1J95A 1UJWB 3RLRA 1FFXB 2IM9A 1QLEB 1AR4A 4JTDB 2WI7A 4KFGA 3K58A 3CWBH 5EK0A 3IGAC 5K1XA 5EZYA 2AKPA 2EINB 2HKJA 3K03A 1RM1C 3TGUH 1P4RA 4F6RB 4B08A 4DV1O 2IJKA 2VWKA 3ZHRA 4HBNA 1ZSPA 3HB3B 3ZRWB 4YKUA 2XK2A 2CGNA 4LNUA 3K9AA 1NH2B 4NTYA 4C7UA 4R3AA 3A0XA 5M4EA 2CCSA 2LFSA 4MW3A 1JFFA 2XASA 4JI7B 4X66B 1L0OA 4X65B 2GUZA 3TUHA 1TA8A 2IH3C 3W7WA 4GT8A 4NH9A 4WUBA 1Q8IA 1JM6A 1PPJH 3CYOA 1HNXB 2BU5A 3APQA 3HKEA 1PNKA 1G6UA 2Q0OC 2IU3A 4P9PA 3GIGB 4DR1B 5D7RA 4O2BA 1KBHA 1TAEA 4QNHB 4UVBA 3L9DA 4CWFA 1MNGA 5LOVB 3VQWA 3T1HO 2PTMA 1QVFU 4P8OA 3ZHQA 2JJ2G 2YI7A 5FLXN 2ZE7A 4GX2A 3RYIB 4P2ZA 3A8TA 4TUYA 5H6QA 4MS2A 5KHKA 3ABTA 1V55C 4O4JB 5EBWC 2WLJA 2Q2EB 1SQGA 2YE7A 4N23A 5GONA 3KCXA 1F51A 1XMQO 5DEDA 1XREA 2IOQA 4PDLA 2HP8A 4DR2B 4LPBA 5BMVA 4FFBA 5LGNA 2Q8HA 1UYHA 4KXRA 4UB8Z 2ZXWB 1I0HA 3ZMUA 3R4MA 1COWG 4FLVA 4HYMA 3Q4HB 4ICGA 1ZL8A 1B06A 4LF6B 1YTFD 1QLEC 3STZC 1CEZA 4JYCA 2GV9A 2WI4A 3LSUA 4GEEA 1F4NA 1KMIZ 3ML0A 4D7TA 1JVMA 1ZTEA 4I50A 1TBWA 2EINC 4I9QA 4B3SB 3FYEB 2BU7A 3K57A 2GDSA 4YY3B 3CD6V 1H7SA 4XE2A 2DMXA 4DV5B 2XNDG 1IDSA 4X1YB 3SPIA 3TZ0A 4CH5A 1S5HC 1AR5A 3W7TA 3A0RA 4AQYB 3E83A 3DSQA 5B1BB 3D3QA 3ABMB 5L3GA 3K06A 5LXTA 1HWYA 3INXA 1AMWA 2YEDA 4X8AA 3HR0A 5IJ9A 2WLLB 4H85A 2UUCB 3M7MX 3VOUA 3HYZA 1MOFA 3FAVB 2E0AA 5CPHA 3CCEV 4L87A 4UVCA 4FM1A 1NJIW 1FXKA 2L35A 3CB2A 3L75H 4DV7O 2GFDA 3D36C 1WPXA 1GKFA 5J71A 1ZX3A 3OMIB 1VQLV 2JGUA 1XMOO 3SJAC 2ZM6B 3RW0A 1NU1H 4I4TA 3SGIA 3UCSC 2UUBO 2F66C 5HFLA 2AHZA 3CRRA 4K8XA 1IBKO 4WFFA 4MSWC 4E00A 1BQ0A 5JQGB 2ARHA 2ADPA 1Y76B 1H2KA 1Q6UA 3F7VC 4DR4O 4PA3A 3UQ8A 2C1IA 2BTQA 4LWGA 2LP7A 2NN4A 1MZEA 2YKBA 4E2LA 4MP7A 3AG7A 1OZ0A 4LF8B 1GJVA 4LNUB 1CXZB 4YHHB 3S5TA 1R6KA 1HW7A 2HKOA 3HKCA 2E76B 4JGSA 1URFA 1SZXA 4K8ZA 1H38A 5GTHZ 1YERA 3CC2V 1L1FA 1N36B 1AP6A 5J2TB 4FLTA 2ZXWC 2A3QA 4UFZA 5IYCO 3HKEB 1LR1A 3HKBB 4JAUA 2F95B 2VQFO 5J2UA 3Q5KA 1NBMG 3QNEA 4TQDA 2DQ0A 2WI1A 4YIPA 1VIBA 3HZ5A 4DUHA 4X66O 2XAFA 4X65O 3B4SA 1Q7YW 1TILA 3ZXOA 1Y6XA 1AH8A 3JAKA 2YIDA 4HAMA 3CCUV 1HNXO 2WLNA 2ZBKB 4NH8A 1I59A 2EIKC 4JYAB 5KLVH 2JGDB 4DR1O 2VQEB 1S3JA 2LO1A 2UXDB 1GN4A 1TGOA 4FFKA 3I56V 1UPGA 2PGGA 3N2GA 4IHJB 2YS8A 3BMYA 2B9ZA 3G80A 2Y0IA 2F43G 2YXLA 4JTAB 1RSOB 1THNA 2BU6A 4PD4F 4LWHA 3K59A 4UCSA 1QBZA 3LNUA 1RPRA 5E1AC 2PYLA 2WPDG 2KQXA 3BPZA 3JCZA 5DECA 5C8YA 5B66Z 4R3MA 1UYGA 3U67A 3EXAA 1TC0A 4LWSA 4J9ZB 4L91A 4JI2O 4BXIA 4CWRA 1L0LH 4GLXA 4X1IB 1Q81W 2WLIA 2Y0PA 1I5BA 5CTXA 4UROA 1D5AA 1D5NA 4H44B 4PA7A 1TUBB 2X7RB 2QTOA 2Q0AA 2YIBD 4R50A 4UV8A 4BIUA 4DUZB 4NH7A 3O6OA 2A06H 3RYFB 1G8MA 3HKDA 5H2FZ 4X64B 5LA6A 5ITZB 1VQKV 2CE4A 5M4KA 1ID0A 2YIBA 1BXDA 4NXNO 1WNSA 1Q6HA 2GSMB 4ZOLA 2XABA 3CC7V 3E8GA 4CBCA 4OXSA 1ORQC 1EZJA 2KSDA 3EFFK 1HNZB 3OUSA 2DE0X 5IYZA 3RN4A 2DWEC 2YE3A 1US7A 3K5NA 5CBHA 2HCHA 5D7DA 1WA8A 4OGQB 4JI1B 5LHGA 3SJCC 1UY9A 2CGFA 2BU2A 1M57B 1VQ5V 1KZNA 2WLMA 1FJGB 1BMFG 4PHZA 4ZI7A 4UXNA 4AQYO 5FPRA 2DW4A 3B8MA 3OAAG 1RFYA 1RP3B 2Q9LA 1N34O 3CJHA 4K4OA 4D6TH 4DXWA 1N33B 2BTOA 1Z2GA 1YJ9V 2O1UA 3RLPA 3CCLV 2IJIA 4HNAA 3K5MA 2UUCO 2WEQA 4ZBMA 2B1GA 2OCCB 3K0DA 4EFUA 5B1OA 1QLNA 4UCTA 2ZKOA 3GWOA 2YDEA 4O4IA 5LP6B 4FLXA 1JOYA 1K3EA 2AW9A 2EZOA 1R73A 1XEQA 2VCIA 4CE1A 2M6YA 4I0XA 3TETA 2PI4A 4EFBA 2HHIA 1QNMA 2BOCC 4IIJA 3O2FA 4YJ2B 2YEVB 3RWRD 1MSWD 5JCOA 2RJZA 1XHXA 4RUEA 3RFRA 4GX0A 3ZRXA 2DYRB 2Z3YA 2YICA 4GGLA 2XX2A 2IW5A 1Z5BA 1SQXH 3FB7C 2DYSC 2LW7A 3UO2A 5L3CA 5KHJA 5EC2C 2ZDIA 1VQPV 2YI6A 2ESAA 4U3JA 1M56C 4JI0B 2BSKB 2ZKJA 1MA1A 4EB6A 1K9MW 3RYCB 4JAVA 2ADQB 4YHHO 1ENVA 3L70H 3CSXA 1LUVA 1XNQB 2KG7B 2GBOA 2Q69A 4GQTA 2K9PA 3JZ3A 3O9OA 3VQVA 2XUMA 1JR9A 4UV9A 3GWKC 4DO2A 4P7AA 1Y66A 3QG5A 4EGIA 4EKWA 1M90W 1LUWA 4DV3O 4KQVA 3UM7A 3H9VA 3T1HB 1S14A 2HVKC 4KL1A 4WFAV 4V25A 3JAKB 4TV8A 2YI0A 3CHXA 2QWRB 3L72H 2YE2A 5A9GA 3E8HA 2BZ5A 2OT5A 2D3OW 2YIAA 3JAWA 3CWVA 3FFQA 4O09A 3ABUA 1K4DC 1AJQA 3FT5A 2F1MA 2IWSA 5GGZA 2JEXA 1FXHA 2FYUH 2HG5C 4WBNA 1VEWA 4O4LB 5LGTA 3T2MA 3TK1A 4PI0A 4TT3G 1YI2V 4DRXA 4O0BA 3LPSA 1XMQB 5L3EA 2UXXA 1EN5A 3T1YB 3KZIZ 4BW9A 4JYAO 1W59A 5F3KA 1CP9A 2VQEO 2N04A 2UXDO 1K97A 4DR7B 3ZMSA 1S5JA 4H81A 4LWEA 1KQSU 1O9GA 1SKVA 2FTKA 2CH7B 1FAFA 4ASFA 2L6LA 3WU2Z 2KKWA 4FIPC 4W4LA 1JJOA 1EZVH 3AK1A 1K4CC 4IYIA 3B24A 5CF0A 1K7DA 2Y4TA 5LL6Y 5CBFA 1JA8A 5FNVB 3CRCA 3K5LA 3SDLA 4CS3A 2Z0AA 1S16A 2ITDC 2IU0A 1Y67A 2OYQA 5LP6C 3CCSV 2CUGA 3JSLA 1QZRA 5CB4A 3QF7A 2YEAA 1MX0A 4JI6B 1FKAO 2XAGA 5CA1B 3RYHA 3JALA 3TCUA 1UYMA 1CPYA 3UKMA 5J6AA 3OEEG 2DYRC 5F5RA 2OCHA 2JK5C 3UT5A 5IDMA 1P49A 2K1EA 1FS0G 4YJ3A 4DV7B 3KE6A 1NQTA 1Q6IA 1DF5A 3JD4A 2FXSA 1YC4A 4TWKA 3WB1A 4O2AB 2Q67A 3AK2A 4X9LA 4AWQA 3R4PA 2UUBB 5CA0B 2KB1A 3FB5C 1OCRB 4LP8A 2Q8IA 1R62A 3A0WA 3QVNA 1IBKB 1E79G 2K5BA 4DR6O 2R72A 2H8MA 4WFGA 4JI1O 2YKIA 3R4NA 2ZQMA 3BHPA 3R91A 1VP7A 1F4MA 2GTSA 3CRLA 4EGHA 2RDCA 3BY6A 3LUTB 4I5SA 3DGEA 4DV0O 4B3MB 4DR4B 4X88A 2YI9A 1EI1A 3MAQA 1NKDA 2CTPA 1EN6A 3HZ1A 3L71H 1N33O 2BSMA 2ZR2A 1Y8PA 4J7JA 4OPHA 5KAIZ 3H1HH 1V54B 2MW2B 2YECA 1XILA 2C1GA 5LBQA 5KA6A 3IAYA 3CXCU 4GKJO 4CH3A 5HFMA 4K35A 3JASA 5B5EZ 2OWOA 3F5TA 4BW5A 3T4ZA 4X1KA 1UYDA 3QTFA 3H80A 1VQMV 2YKJA 1WAZA 1VQ8V 2VQFB 3A0ZA 4DZYA 4I9WA 1Y74B 3JD2A 4MW8A 4LWIA 5LMUO 1QYEA 3ZN1A 4JPRA 3CGZA 3E2EA 3MNRP 4CE2A 1VARA 3OD4A 2UUAO 2H94A 4MTXA 3OE7G 1Z5AA 5DM6V 1XNQO 3OWBA 2QWPB 1EFRG 2FMLA 2YXHA 2XDLA 4MOTA 4TV9B 1KB9F 4L93A 4DK0A 5IWAB 3AG1B 4NVPA 1K33A 2D2CB 4XIPA 2ZE6A 4BWAA 2JKIA 5IN9A 3RGBA 5LGUA 2YI5A 4R1FA 3SYCA 5LHHA 4ZHQB 4WCEV 3H1LH 2WEPA 3H1KH 2YEHA 3E89A 5LHIA 4FZ1A 1QY8A 2JEUA 4IT5A 1OJHA 1MSDA 4FM0A 2EILB 3K97A 4LF5B 2WLHA 1A4HA 2H8PC 3MHHC 4JI8O 4JI2B 1BGYH 3T1YO 4JZ2A 1OCRC 3D2RA 4YKQA 3ETQA 4HXZA 5H5NA 1WPBA 1GN2A 2LFRA 2QKCA 4RAIA 1KIJA 2XDKA 4NKGB 1RPOA 4DR7O 3N2KA 2CAZC 3LDCA 1VF6A 4UCOA 2QM4A 1FPOA 5GTIZ 3E86A 5EYPA 2BU8A 2IORA 4Z1MG 4NXNB 1IX9A 2QF6A 4F4LA 2LQTA 4UUJC 2QWOB 4X9QA 4YXWG 1TH8A 4U7NA 2Q8VA 1V54C 3ZRVA 3BEHA 3B27A 3K0GA 2Q7EA 5IJ0B 3K98A 2EIKB 4I7ZB 3T0HA 3JATA 2XDUA 3ASOC 1R3LC 4MPNA 3H1IH 2A79B 5KX5A 1F7YA 4PELA 3OTFA 1KP2A 1TVKA 3RVYA 3FB8C 4JI6O 1N34B 3R4OA 3NMQA 3FB6C 1SC5B 5JH7B 4FM2A 1HR0B 3R65A 2ETNA 4BQJA 1Y4MA 5D5PA 2B1IA 1YSZA 3ZIAG 2Q7GA 5KA5A 3FV5A 1BGQA 3CP1A 4CE3A 3ZMZA 4LWFA 5CN0A 3B25A 5CBGA 1SRYA 1YJWV 2ODMA 4MTOA 4R7CA 1N8RW 3CCJV 4OX9B 2X6AA 2ITCC 4GYCB 5AG2A 1SQBH 4KSHA 2XHRA 3T1CA 3TJTA 4J7ZA 4UCVA 3JARA 3AG1C 3N27A 3R66A 5EZYB 1AVMA 1MU5A 4NYKA 2IBZH 3ZBHA 1DLBA 1JX9A 3SYAA 1SQFA 2C2AA 4B3MO 2EULA 1H7UA 2DWDC 3AEIA 3ABLC 2JVDA 3SJBC 5CTUA 3LDDA 1I5YA 4H0LB 2IOPA 1UY8A 2HHHO 4UVAA 4XIQA 1YC1A 4F6EA 4QPKA 3Q5JA 2UWDA 1QR8A 4X1KB 5KMGA 3CMAV 4CWPA 3A0YA 2W0FC 3RBZA 2CDYA 4XTJA 3HEKA 4ZVIA 2EILC 1JFFB 4WUDA 3M8AA 3I55V 3CRKA 2GUZB 4DV3B 4AILC 1QHTA 1GH6A 3H01A 2EIMB 4GX1A 1Z5VA 4DW0A 1WB7A 1SESA 2O57A 4X62B 3AG3B 1OHHG 3DXRA 5M4MA 2ZNIA 4O2BB 3SPHA 3B28A 4WFHA 2ZINA 4LH7A 2IWXA 5B1NA 4PDMA 3FT8A 1GN6A 3GIFA 3B8NA 3PJSK 1VQ6V 1GAXA 2YE8A 3OR6C 4HZ5A 1WLEA 4MVUA 4UCRA 2ZD9A 1I94O 2X6BA 4FCPA 3EHGA 2PZSA 4TUYB 3WB0A 2HJDA 2P6JA 3ZRSA 1W0JG 1L8DA 1WP8A 3C11A 2NLJC 2FB5A 2XT9A 1JPXA 4P30A 3A2FA 3QO5A 3ZKBA 2WLKA 5GONB 4B7KA 3OM3B 1QQCA 4Z1VA 3AG2B 1KC8W 1K5QA 2V4DA 4I55A 2UXCB 4XKOA 2DYSB 1AJ6A 1S72V 2O1WA 4FCRA 2WA3A 1SF9A 2QM8A 5BMVB 4FFBB 2GHYA 3VQYA 4O4HA 4DUYB 2XHTA 1R3IC 1N4CA 1M56B 1N0JA 2Q68A 4J41A 1G1XB 2ATKC 5FNCA 2EIJB 2R9AA 1YS3A 4LC1A 3FD9A 4JYBA 3CPWU 3WG7B 5EIBC 4PJ0Z 1NT2B 4LF5O 1ZL8B 5L3BA 2QG2A 4CZZA 1NR1A 4IL6Z 3ZMTA 1MABG 4V26A 4BIZA 4XCJA 2YEBA 1EM1A 5IYDO 1H8HG 5JVDA 2X0LA 4EFTA 1DK1A 2CTWA 3RT3C 4RWUA 2A7WA 3LSSA 2E74B 3BVOA 4KHPB 2PF4E 2QKAA 3SPCA 2XJGA 4I50B 1YTFB 2E5LO 3C0EA 1NHHA 1V9PA 3HPLC 3CS5A 5DN6G 5KHHA 1UYEA 2CTRA 4O05A 4EEHA 5IY5C 3OR7C 4W4KA 4UCUA 2Y69B 3FYIB 1U96A 3X2QC 2QM7A 3K9SA 4J11A 4MBCA 3E22A 3GIEA 4QE7A 2Z5UA 4A5UB 5LXTB 5EBLC
chains in the Genus database with same CATH topology
1E1QG 1BHAA 1AR1B 1R3KC 1UYIA 1K73W 3OPDA 3P30A 1FXKB 3ZKDA 2Q6AA 4JQLA 2EIMC 2YSUB 4MVQA 1Y8OA 4MVSA 2ZDYA 3JYCA 1GMGA 3VHDA 3CCRV 3AG3C 4MTFA 4PRXA 2XX4A 2QE7G 4CWNA 5B1AB 3ETEA 2YE6A 2PI5A 4RQFA 2NNUA 3PEJA 3VHAA 1GM9A 1GM8A 4JF3A 2JJCA 4I3HA 1PD3A 1BKNA 4AWOA 2VW5A 3MHSC 3IC7A 1EBOA 3LNMB 5L3JA 2BOBC 1PKXA 3AG2C 1Z5CA 1NVPD 4KTNA 1QVGU 2HR3A 4E02A 4TSFG 3W7SA 2EIJC 3K04A 3WG7C 1AM1A 1G4YB 5D7CA 3ASNB 3OMUA 5M4NA 3T10A 2WERA 1QR9A 4ZKIA 1NH2D 2CH4A 4E01A 3P32A 1I5CA 2P7TC 2YJWA 3ZRWA 4HY1A 1VQ9V 1F23A 2YE9A 4MT8A 3W7UA 3PEHA 3G7EA 4KFMA 4CWTA 2FWZA 3T0ZA 3D36A 4XKAA 2Y69C 1GK9A 5H9CA 1YSRA 3G7BA 3CC4V 3ETDA 3GIGA 3LDEA 4MVZA 1FXKC 2AHYA 4W7TA 3CCVV 3VHCA 2HLDG 3T1KA 3K3WA 1S0VA 4ASBA 1FFTB 3ZN0A 4PA6A 4U7OA 1YJNV 4WFEA 2HVJC 2WLIB 3OMNB 4MTGA 2IH1C 1QCEA 5B1AC 4CWOA 3AG4C 5CMUA 3JD3A 1W2BU 2OTLV 1XL4A 3TZ4A 2WI2A 2EXLA 4KUMA 1KKDA 2QG0A 1H8EG 5FNDA 2CK3G 4WF9V 1TUEB 2XHXA 4QPJA 1AI5A 4G2KA 2XAJA 2XDXA 3SYPA 4LBEC 3R92A 4GX5A 5L3FA 4XC0A 1Z59A 3K08A 1OCOB 2Z5UA 5BOCA 3ASNC 3SPGA 2PNRA 1LNQA 1K5SA 4MPCA 1SZTA 1KP3A 1VQOV 2OTJV 2XOKG 2XDSA 3IFXA 1YIJV 2UXNA 3OGCC 2WLLA 4YKXA 1KD1W 1I58A 1R3JC 1VQNV 2JDIG 4FCQA 3ASOB 3VBBA 2YEIA 1NHIA 1VQ4V 5M4PA 1B63A 4H37A 4PRVA 4FMTA 4MVOA 4YKZA 4H33A 2XAQA 2M7WA 4PA9A 1UYFA 4KP4A 1UYCA 2XD6A 1NVPB 4ASGA 2VCJA 4CWQA 4HXWA 2JIZG 2YE5A 4HY6A 4URLA 1UY6A 4XDMA 5GW7A 1MG1A 2BT0A 4AS9A 1GM7A 1GTOA 1JJ2U 5H6RA 3EHJA 3TZ5A 5EC1C 2GQPA 2EBOA 4PDVA 1B6QA 4RQEA 4L94A 3E35A 4R8CA 2FYPA 5IDJA 3ABLB 2Q8GA 4X89A 3T4DA 2YEEA 1PVGA 4PA4A 3ZJZA 2A0LA 4GFNA 4FK5C 1OCOC 4H7QA 4URNA 1PNLA 3F7YC 1M1KW 4RUFA 1UY7A 1S77D 3OMAB 3B26A 4J9YB 3A0TA 4WFBV 4PU9A 1W0KG 3EKOA 4LP0A 4CWSA 1OCCB 3VADA 2YEFA 5M4HA 2YK2A 2ZDIC 5B3SB 1TIDA 1Y8NA 4EGKA 2WI3A 2YJXA 5L3DA 4MB9A 4XITA 3OW2U 4HZ0A 1YT0A 1AI4A 4FPPA 3SL2A 4Q20A 3TTZA 2CCTA 3K99A 2P90A 1YETA 1VQ7V 5IYBO 4XDKA 4L90A 3F5WC 3QO7A 2YGFA 1I5XA 3RLQA 1K92A 4XCLA 3WFVA 4FJCC 1H2GA 1I5AA 3TZ2A 3RVZA 3LSQA 1AI7A 3E8BA 5IY5B 3INWA 3X2QB 4EM7A 3DTUB 1EA6A 2QEXV 2XCMA 4P9OA 3CMEV 1PNMA 3OUFA 4G28B 3CGYA 1GKXA 3BM9A 2A9HA 4YKYA 3FKSG 1YC3A 1DTOA 1I5DA 1UYLA 2MK3A 2YEVA 3CCMV 2B5UA 3CCQV 3U2KA 2HG1A 2BTZA 1SETA 2YKCA 2BYHA 1KECA 4KSGA 2IJJA 3OFNG 2QA4V 1OCCC 4GT1A 1YESA 3ZM7A 4XDJA 4QIWF 5B3SC 1YHQV 3JD1A 3KG2A 1ZWHA 1PL0A 4G27B 3ZCCA 3G6EV 3ZXQA 4QJFB 1AJNA 2IJHA 2HFEC 2XJXA 3WHAA 2YKEA 4XKKA 5B1BC 3B77A 3ABMC 1FXVA 4RO2A 1GO3F 3STLC 4HYPA 4YKRA 2ZR3A 1AH6A 4BAYA 1Q82W 2WI6A 2XAHA 2Y48A 2CG9A 2WWWA 4YKWA 3G75A 1ZXMA 2X6CA 3JD0A 1M9NA 3SJQC 2BYIA 3SPJA 4MVRA 5CTWA 3EHBB 1JQ0A 2O1VA 1ROPA 4WUCA 4MP2A 5J9PC 2V1DA 1XL6A 3OW6A 1K8AW 1B62A 1OCZB 1S76D 3M99B 4LCUC 2YE4A 2WAMA 1UYKA 3D0BA 5D6QA 3Q5LA 5KUKA 4XIRA 4PDRA 4QE9A 3AG4B 1AJPA 4JASA 5CA3A 4YKTA 5BODA 3ZMVA 2R9RB 1BL8A 1E1RG 2CCUA 2IWUA 1Q86W 1R6NA 1YT1A 2YEJA 2VWCA 1NHJA 1ZXNA 2QFOA 3D3IA 4BAEA 3NXSA 2YGAA 5EBMC 4XBFA 2EJRA 4JTCB 2R9IA 3W7XA 3T2SA 1JCHA 4B7PA 4O07A 4MPEA 1ZWIC 1ZW9A 4GCZA 3EHFA 1YSCA 3O0IA 5FWKA 1YITV 2W6JG 1B3QA 5BZBA 3G4SV 3ABKB 1P7BA 4BQGA 5CTYA 4ASUG 3SYOA 2YK9A 1GKZA 5FNFA 3WQ9A 4N21A 2QKSA 2Q8FA 1AI6A 3QDDA 3QO8A 1OCZC 3G71V 1RM1B 4R6ZA 3K79A 1U0ZA 1Y4SA 4L8ZA 1YT2A 2DQ3A 3EHHA 4HZ3A 3OWDA 4O04A 2FWYA 3SYQA 1Y4UA 4HYOA 1M57C 1K34A 4U93A 2JJ1G 2V7QG 2YEGA 5C93A 4MVMA 3ETGA 3GB7C 2OCCC 1DF4A 3MD0A 2BRCA 1AROP 3OEHG 2H55A 5FL7G 2ZDXA 4URMA 1OSFA 2HJFC 2W6IG 4ASAA 4EMVA 4XDLA 4B6CA 5D6PA 1BHBA 2BREA 1IXMA 1V55B 1U2OA 1TC6A 3E8FA 4AWPA 5KUMA 2WI5A 1BYQA 2WSSG 1NR7A 2XX5A 2EZPA 3EKRA 3U2DA 3IEDA 2XJJA 2P67A 2YGEA 1SERA 3ABKC 4XD8A 3RKZA 1THZA 3H4LA 3HHUA 1J95A 1UJWB 3RLRA 1QLEB 4JTDB 2WI7A 4KFGA 5EK0A 3IGAC 2AKPA 2EINB 2HKJA 3K03A 1RM1C 1P4RA 2IJKA 3HB3B 3ZRWB 4YKUA 2XK2A 1NH2B 3K9AA 4R3AA 3A0XA 5M4EA 2CCSA 2LFSA 4MW3A 2XASA 1L0OA 3TUHA 2IH3C 3W7WA 4GT8A 4NH9A 4WUBA 1JM6A 3CYOA 2BU5A 1PNKA 2IU3A 4P9PA 3GIGB 5D7RA 4QNHB 4UVBA 4CWFA 1QVFU 4P8OA 2JJ2G 2YI7A 4GX2A 4P2ZA 5H6QA 4MS2A 3ABTA 1V55C 5EBWC 2WLJA 2Q2EB 2YE7A 4N23A 1F51A 2IOQA 4PDLA 4LPBA 5LGNA 2Q8HA 1UYHA 2ZXWB 3ZMUA 3R4MA 1COWG 4HYMA 1YTFD 1QLEC 3STZC 1CEZA 4JYCA 2WI4A 4GEEA 1F4NA 3ML0A 1JVMA 1TBWA 2EINC 2BU7A 3FYEB 3CD6V 1H7SA 4XE2A 2XNDG 3SPIA 3TZ0A 1S5HC 3W7TA 3A0RA 3E83A 5B1BB 3ABMB 5L3GA 3K06A 1HWYA 3INXA 1AMWA 2YEDA 4X8AA 2WLLB 4H85A 3VOUA 3HYZA 1MOFA 2E0AA 5CPHA 3CCEV 4L87A 4UVCA 1NJIW 1FXKA 2GFDA 1WPXA 1GKFA 5J71A 3OMIB 1VQLV 3RW0A 5HFLA 2AHZA 4WFFA 4MSWC 4E00A 3F7VC 4PA3A 4LWGA 2LP7A 2YKBA 4E2LA 4MP7A 1OZ0A 1GJVA 1R6KA 2HKOA 4JGSA 1H38A 1YERA 3CC2V 1L1FA 2ZXWC 5IYCO 4JAUA 3Q5KA 1NBMG 3QNEA 2DQ0A 2WI1A 3HZ5A 4DUHA 2XAFA 1Q7YW 1TILA 3ZXOA 1AH8A 4HAMA 3CCUV 2WLNA 2ZBKB 4NH8A 1I59A 2EIKC 1S3JA 3I56V 3BMYA 2F43G 4JTAB 1THNA 2BU6A 4LWHA 1QBZA 3LNUA 1RPRA 5E1AC 2WPDG 3JCZA 4R3MA 1UYGA 3U67A 1TC0A 4J9ZB 4L91A 4BXIA 4CWRA 1Q81W 2WLIA 1I5BA 5CTXA 4UROA 4PA7A 4NH7A 2X7RB 2QTOA 4R50A 4UV8A 4BIUA 3O6OA 1G8MA 1VQKV 5M4KA 1ID0A 1BXDA 2GSMB 2XABA 3CC7V 3E8GA 4CBCA 4OXSA 1ORQC 1EZJA 3EFFK 3OUSA 2DWEC 2YE3A 1US7A 5CBHA 2HCHA 5D7DA 5LHGA 1UY9A 2CGFA 2BU2A 1M57B 1VQ5V 1KZNA 2WLMA 1BMFG 4UXNA 2DW4A 3B8MA 3OAAG 4K4OA 4DXWA 1YJ9V 2O1UA 3RLPA 3CCLV 2IJIA 2WEQA 4ZBMA 2B1GA 2OCCB 3K0DA 4EFUA 5B1OA 1QLNA 3GWOA 1JOYA 1K3EA 2EZOA 1R73A 2VCIA 4CE1A 3TETA 2PI4A 2BOCC 3O2FA 2YEVB 1MSWD 4RUEA 4GX0A 3ZRXA 2DYRB 2Z3YA 4GGLA 2XX2A 2IW5A 1Z5BA 3FB7C 2DYSC 5L3CA 5EC2C 2ZDIA 1VQPV 2YI6A 2ESAA 1M56C 2ZKJA 1K9MW 4JAVA 1ENVA 2Q69A 4GQTA 3JZ3A 4UV9A 4DO2A 4P7AA 1Y66A 4EGIA 4EKWA 1M90W 4KQVA 3UM7A 1S14A 2HVKC 4WFAV 4V25A 2YI0A 2YE2A 3E8HA 2BZ5A 2OT5A 2D3OW 3CWVA 4O09A 3ABUA 1K4DC 1AJQA 3FT5A 5GGZA 2IWSA 2JEXA 1FXHA 2HG5C 5LGTA 3T2MA 3TK1A 4TT3G 1YI2V 4O0BA 3LPSA 5L3EA 2UXXA 5F3KA 1CP9A 1K97A 3ZMSA 4H81A 4LWEA 1KQSU 2FTKA 4ASFA 4FIPC 1K4CC 3B24A 5CF0A 1K7DA 5CBFA 1S16A 2ITDC 2IU0A 3CCSV 1QZRA 2YEAA 1MX0A 2XAGA 3TCUA 1UYMA 1CPYA 3UKMA 5J6AA 3OEEG 2DYRC 5F5RA 2JK5C 5IDMA 2K1EA 1FS0G 3KE6A 1NQTA 1DF5A 3JD4A 2FXSA 1YC4A 4TWKA 2Q67A 4X9LA 4AWQA 3R4PA 2KB1A 3FB5C 1OCRB 4LP8A 2Q8IA 1R62A 3A0WA 1E79G 2K5BA 2H8MA 3R4NA 4WFGA 2YKIA 2ZQMA 3R91A 1F4MA 3CRLA 4EGHA 3BY6A 3LUTB 4I5SA 3DGEA 4X88A 1EI1A 1NKDA 3HZ1A 2BSMA 2ZR2A 1Y8PA 1V54B 2YECA 5LBQA 5KA6A 3CXCU 5HFMA 4BW5A 3T4ZA 1UYDA 3QTFA 3H80A 1VQMV 2YKJA 1VQ8V 3A0ZA 4DZYA 4I9WA 3JD2A 4MW8A 4LWIA 1QYEA 3ZN1A 4JPRA 3CGZA 3E2EA 3MNRP 4CE2A 2H94A 4MTXA 3OE7G 1Z5AA 5DM6V 3OWBA 1EFRG 2XDLA 4MOTA 4L93A 3AG1B 1K33A 4XIPA 2JKIA 5IN9A 5LGUA 2YI5A 4R1FA 3SYCA 5LHHA 4WCEV 2WEPA 2YEHA 3E89A 5LHIA 1QY8A 2JEUA 3K97A 2EILB 2WLHA 1A4HA 2H8PC 3MHHC 1OCRC 3D2RA 4YKQA 4HXZA 2LFRA 4RAIA 1KIJA 2XDKA 1RPOA 3LDCA 3E86A 2BU8A 2IORA 4Z1MG 2QF6A 4F4LA 4UUJC 4YXWG 1TH8A 4U7NA 1V54C 3ZRVA 3BEHA 3B27A 3K0GA 3K98A 2EIKB 3T0HA 2XDUA 3ASOC 1R3LC 4MPNA 2A79B 4PELA 1KP2A 3RVYA 3FB8C 3R4OA 3NMQA 3FB6C 3R65A 4BQJA 1Y4MA 2B1IA 1YSZA 3ZIAG 5KA5A 3FV5A 1BGQA 3CP1A 4CE3A 3ZMZA 4LWFA 5CN0A 3B25A 5CBGA 1SRYA 1YJWV 4MTOA 4R7CA 1N8RW 3CCJV 2X6AA 2ITCC 4KSHA 2XHRA 3T1CA 3AG1C 1MU5A 1DLBA 1JX9A 3SYAA 2C2AA 1H7UA 2DWDC 3AEIA 3ABLC 5CTUA 3LDDA 1I5YA 2IOPA 1UY8A 4UVAA 4XIQA 1YC1A 4QPKA 3Q5JA 2UWDA 1QR8A 3CMAV 4CWPA 3A0YA 2W0FC 3RBZA 4XTJA 3HEKA 4ZVIA 2EILC 4WUDA 3I55V 3CRKA 3H01A 2EIMB 4GX1A 1SESA 3AG3B 1OHHG 5M4MA 3SPHA 3B28A 4WFHA 2IWXA 5B1NA 4PDMA 3FT8A 3GIFA 3B8NA 3PJSK 1VQ6V 4HZ5A 2YE8A 3OR6C 1WLEA 4MVUA 2ZD9A 2X6BA 4FCPA 3EHGA 2P6JA 3ZRSA 1W0JG 3C11A 2NLJC 1JPXA 4P30A 3QO5A 3ZKBA 2WLKA 3OM3B 3AG2B 1KC8W 1K5QA 4XKOA 2DYSB 1AJ6A 1S72V 2O1WA 4FCRA 3HYYA 2QM8A 2GHYA 2XHTA 1R3IC 1M56B 2Q68A 2ATKC 5FNCA 2EIJB 1YS3A 4LC1A 4JYBA 3CPWU 3WG7B 5L3BA 2QG2A 4CZZA 1NR1A 3ZMTA 1MABG 4V26A 4BIZA 4XCJA 2YEBA 5IYDO 1H8HG 2X0LA 4EFTA 3LSSA 3SPCA 2XJGA 1YTFB 3C0EA 1NHHA 3HPLC 5DN6G 1UYEA 4O05A 4EEHA 5IY5C 3OR7C 2Y69B 3FYIB 3X2QC 2QM7A 4MBCA 3GIEA 4QE7A 3K60A 4PL9A 5EBLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0O A;  4H81 A;  4LWE A;  3INW A;  3TUH A;  1UYI A;  4GT8 A;  4WUB A;  4NH9 A;  2FTK A;  1JM6 A;  4EM7 A;  4ASF A;  1EA6 A;  3OPD A;  2BU5 A;  3ZKD A;  2XCM A;  4JQL A;  3B24 A;  5CF0 A;  3GIG B;  5D7R A;  1Y8O A;  3CGY A;  1GKX A;  2ZDY A;  3BM9 A;  4YKY A;  1S16 A;  1YC3 A;  4CWF A;  3VHD A;  1I5D A;  4PRX A;  1UYL A;  2XX4 A;  1QZR A;  4P8O A;  4CWN A;  3U2K A;  2YE6 A;  2YI7 A;  2YEA A;  2HG1 A;  1MX0 A;  2BTZ A;  1UYM A;  2YKC A;  5J6A A;  3PEJ A;  3VHA A;  2BYH A;  5F5R A;  2Q2E B;  2YE7 A;  4KSG A;  2JJC A;  5IDM A;  4I3H A;  1BKN A;  1F51 A;  3KE6 A;  4AWO A;  2IOQ A;  2VW5 A;  4LPB A;  2FXS A;  1YC4 A;  2Q8H A;  1UYH A;  4GT1 A;  5L3J A;  1YES A;  4X9L A;  4AWQ A;  3R4P A;  3R4M A;  1Z5C A;  4HYM A;  3ZM7 A;  2Q8I A;  1R62 A;  4KTN A;  3A0W A;  4E02 A;  2K5B A;  2H8M A;  3R4N A;  2YKI A;  3R91 A;  3CRL A;  4EGH A;  1ZWH A;  4JYC A;  4I5S A;  2WI4 A;  1AM1 A;  5D7C A;  3DGE A;  3OMU A;  3ZCC A;  4GEE A;  5M4N A;  3T10 A;  1EI1 A;  2WER A;  3ZXQ A;  4ZKI A;  2CH4 A;  2XJX A;  4E01 A;  3HZ1 A;  3WHA A;  3P32 A;  1TBW A;  2BSM A;  1I5C A;  2BU7 A;  1Y8P A;  2YKE A;  4XKK A;  2YJW A;  3ZRW A;  4HY1 A;  4HYP A;  1H7S A;  4XE2 A;  2YEC A;  2YE9 A;  4YKR A;  1AH6 A;  3TZ0 A;  4MT8 A;  2WI6 A;  3PEH A;  3G7E A;  3A0R A;  2CG9 A;  2WWW A;  4CWT A;  2FWZ A;  3INX A;  4YKW A;  1AMW A;  2YED A;  3D36 A;  1ZXM A;  3G75 A;  3T0Z A;  4XKA A;  4H85 A;  1YSR A;  3G7B A;  3HYZ A;  2BYI A;  2E0A A;  5CPH A;  1UYD A;  3QTF A;  3H80 A;  2GFD A;  5CTW A;  2YKJ A;  3A0Z A;  3GIG A;  2O1V A;  4DZY A;  5J71 A;  4LWI A;  4WUC A;  1QYE A;  4W7T A;  3CGZ A;  4MP2 A;  3MNR P;  3VHC A;  4CE2 A;  3T1K A;  3OW6 A;  4MTX A;  4E00 A;  1B62 A;  4ASB A;  1Z5A A;  3OWB A;  4U7O A;  2YE4 A;  2XDL A;  4MOT A;  4L93 A;  3D0B A;  1UYK A;  5D6Q A;  4CWO A;  3Q5L A;  4LWG A;  4XIP A;  3TZ4 A;  2WI2 A;  2EXL A;  2YKB A;  2JKI A;  5IN9 A;  4MP7 A;  2YI5 A;  4XIR A;  2QG0 A;  4R1F A;  1GJV A;  5FND A;  2WEP A;  4JAS A;  2YEH A;  1YER A;  4YKT A;  1QY8 A;  5BOD A;  2XHX A;  3K97 A;  4QPJ A;  1A4H A;  2CCU A;  2IWU A;  2XDX A;  4JAU A;  3D2R A;  4YKQ A;  4HXZ A;  3Q5K A;  2LFR A;  3R92 A;  4XC0 A;  1KIJ A;  2XDK A;  2WI1 A;  1Z59 A;  3HZ5 A;  4DUH A;  1YT1 A;  5BOC A;  2YEJ A;  1TIL A;  2VWC A;  3ZXO A;  1NHJ A;  1ZXN A;  2QFO A;  1AH8 A;  2PNR A;  4BAE A;  3NXS A;  2BU8 A;  2ZBK B;  4MPC A;  2IOR A;  4NH8 A;  1I59 A;  2YGA A;  2QF6 A;  2XDS A;  1TH8 A;  4U7N A;  3ZRV A;  3B27 A;  3K98 A;  3BMY A;  3T0H A;  2XDU A;  4YKX A;  4MPN A;  1THN A;  3T2S A;  2BU6 A;  1I58 A;  4B7P A;  4O07 A;  4LWH A;  4MPE A;  3LNU A;  1ZW9 A;  4FCQ A;  4GCZ A;  3EHF A;  2YEI A;  4R3M A;  1NHI A;  3O0I A;  5FWK A;  1UYG A;  3U67 A;  5M4P A;  1B63 A;  3R4O A;  3NMQ A;  1B3Q A;  4PRV A;  4FMT A;  1TC0 A;  4YKZ A;  4BQJ A;  4BQG A;  5CTY A;  1YSZ A;  1UYF A;  4L91 A;  2YK9 A;  4KP4 A;  1GKZ A;  5FNF A;  3FV5 A;  1BGQ A;  3WQ9 A;  4BXI A;  4CE3 A;  1UYC A;  2XD6 A;  4CWR A;  4ASG A;  1I5B A;  4LWF A;  3B25 A;  4URO A;  5CTX A;  2Q8F A;  2VCJ A;  4NH7 A;  3QDD A;  4BIU A;  4CWQ A;  3O6O A;  4HXW A;  2YE5 A;  4HY6 A;  4URL A;  1UY6 A;  4XDM A;  4KSH A;  2XHR A;  5M4K A;  1ID0 A;  2BT0 A;  1U0Z A;  1Y4S A;  1BXD A;  4L8Z A;  1YT2 A;  4AS9 A;  1MU5 A;  2XAB A;  3EHH A;  3OWD A;  2C2A A;  4O04 A;  1H7U A;  2FWY A;  3EHJ A;  1Y4U A;  5CTU A;  2YE3 A;  1US7 A;  3TZ5 A;  2IOP A;  2HCH A;  1UY8 A;  5D7D A;  2GQP A;  4XIQ A;  1YC1 A;  4QPK A;  4L94 A;  3Q5J A;  2UWD A;  4U93 A;  4CWP A;  2FYP A;  1UY9 A;  5IDJ A;  3A0Y A;  2Q8G A;  2CGF A;  2BU2 A;  2YEG A;  5C93 A;  4XTJ A;  1KZN A;  3HEK A;  4ZVI A;  2YEE A;  3MD0 A;  4WUD A;  2BRC A;  3CRK A;  4K4O A;  1PVG A;  2O1U A;  2H55 A;  3RLP A;  2WEQ A;  4EFU A;  5B1O A;  4GFN A;  2ZDX A;  4URM A;  4H7Q A;  4URN A;  1OSF A;  5M4M A;  1JOY A;  4ASA A;  3B28 A;  4EMV A;  2VCI A;  1UY7 A;  4CE1 A;  2IWX A;  5B1N A;  4B6C A;  5D6P A;  3O2F A;  3FT8 A;  3B26 A;  3GIF A;  2BRE A;  1IXM A;  4HZ5 A;  2YE8 A;  3A0T A;  3ZRX A;  4GGL A;  4PU9 A;  1U2O A;  1TC6 A;  2XX2 A;  1Z5B A;  4FCP A;  3EHG A;  3EKO A;  4LP0 A;  4AWP A;  3C11 A;  4CWS A;  2YI6 A;  2ESA A;  2WI5 A;  3VAD A;  3ZKB A;  1BYQ A;  2YEF A;  2XX5 A;  3EKR A;  2ZKJ A;  4XKO A;  3U2D A;  5M4H A;  1AJ6 A;  2O1W A;  4JAV A;  2YK2 A;  3IED A;  2XJJ A;  4FCR A;  2P67 A;  3HYY A;  2QM8 A;  2YGE A;  4GQT A;  2XHT A;  3JZ3 A;  4XD8 A;  3RKZ A;  3H4L A;  3HHU A;  1TID A;  1Y8N A;  5FNC A;  3RLR A;  4P7A A;  4EGK A;  2WI3 A;  4EGI A;  4KQV A;  1YS3 A;  2YJX A;  4LC1 A;  4MB9 A;  4JYB A;  2WI7 A;  1S14 A;  4KFG A;  4XIT A;  4V25 A;  2YI0 A;  2YE2 A;  2QG2 A;  2BZ5 A;  4HZ0 A;  1YT0 A;  4FPP A;  3SL2 A;  4V26 A;  4BIZ A;  2AKP A;  4Q20 A;  4XCJ A;  3TTZ A;  2CCT A;  2YEB A;  2HKJ A;  3CWV A;  4O09 A;  3K99 A;  3FT5 A;  4EFT A;  1YET A;  5GGZ A;  2IWS A;  2XJG A;  4L90 A;  3C0E A;  1NHH A;  2YGF A;  3RLQ A;  3TK1 A;  4XCL A;  3ZRW B;  4O0B A;  3LPS A;  4YKU A;  1UYE A;  2XK2 A;  1I5A A;  4O05 A;  4EEH A;  4R3A A;  3A0X A;  5M4E A;  3TZ2 A;  2CCS A;  2LFS A;  2QM7 A;  5F3K A;  4MBC A;  3GIE A;  3K60 A;  4PL9 A; 
#chains in the Genus database with same CATH topology
 1E1Q G;  1BHA A;  3C90 A;  1AR1 B;  1R3K C;  5IJ9 B;  1UYI A;  1K73 W;  1B04 A;  4DR6 B;  3BAB A;  3OPD A;  3P30 A;  1FXK B;  3ZKD A;  2Q6A A;  1SA0 A;  4JQL A;  2EIM C;  2YSU B;  4MVQ A;  4DV0 B;  1H2S B;  1Y8O A;  4MVS A;  4I4T B;  1KU9 A;  2ZDY A;  5JEN A;  3JYC A;  2PY5 A;  1GMG A;  1HR0 O;  3VHD A;  1WN7 A;  3CCR V;  2ZNJ A;  3FX7 A;  3AG3 C;  3JSN A;  4MTF A;  4PRX A;  2XX4 A;  4PI2 A;  2QE7 G;  4TOI A;  1SQP H;  4CWN A;  5B1A B;  3ETE A;  2YE6 A;  3L73 H;  4U3F H;  1AB3 A;  5LYJ A;  1HP8 A;  2RQ6 A;  4CH4 A;  4GKJ B;  1IBL B;  2PI5 A;  4RQF A;  2NNU A;  4X20 A;  3PEJ A;  3VHA A;  2E3C A;  2BTQ B;  1GM9 A;  4OX9 O;  1GM8 A;  3ZHT A;  4JF3 A;  2JJC A;  4I3H A;  1M4U A;  4JI5 O;  1PD3 A;  2ZCE A;  1BKN A;  4AWO A;  2VW5 A;  3MHS C;  3HKC B;  3IC7 A;  4LFC O;  1EBO A;  3JAM N;  3LNM B;  3C3T A;  4IYH A;  5L3J A;  5LMU B;  2BOB C;  1PKX A;  3AG2 C;  4FLW A;  4DR3 B;  1FFX A;  1Z5C A;  4J10 A;  1NVP D;  4KTN A;  1QVG U;  2HR3 A;  4E02 A;  1ZAU A;  3C3S A;  1HNW O;  2ZIO A;  2UUA B;  1XNR B;  1GRJ A;  4TSF G;  3W7S A;  2EIJ C;  1DGS A;  1IBM O;  1QU7 A;  3K04 A;  3WG7 C;  5J2U B;  1G4Y B;  1AM1 A;  5D7C A;  1S5L Z;  3ASN B;  3OMU A;  5M4N A;  1OV9 A;  3T10 A;  2WER A;  1QR9 A;  4ZKI A;  1NH2 D;  1N32 O;  2CH4 A;  4E01 A;  4F6R A;  3P32 A;  1I5C A;  2P7T C;  3CX5 F;  2YJW A;  3ZRW A;  4HY1 A;  1VQ9 V;  2RNB A;  1F23 A;  3U0Z A;  2YE9 A;  4MT8 A;  3W7U A;  3PEH A;  3LNN A;  4X62 O;  3G7E A;  4KFM A;  1NTZ H;  4CWT A;  1XQ8 A;  2F93 B;  2FWZ A;  3N2G B;  3T0Z A;  3D36 A;  4XKA A;  2Y69 C;  1GK9 A;  5H9C A;  4LFA O;  1YSR A;  3G7B A;  3CC4 V;  3ETD A;  4JI8 B;  1NTK H;  1X59 A;  4TQF A;  3GIG A;  4J42 A;  3LDE A;  4LR3 A;  5C8Y B;  2QWQ B;  4MVZ A;  1ZUQ A;  1FXK C;  2AHY A;  4W7T A;  3CCV V;  3U11 A;  5LOV A;  3VHC A;  2P5O A;  2HLD G;  4NR1 A;  3T1K A;  3K3W A;  4LWS B;  1S0V A;  3BAA A;  2UXC O;  4ASB A;  1FFT B;  3ZN0 A;  3J81 N;  1XI1 A;  4PA6 A;  4U7O A;  4DUY O;  1YJN V;  3QTC A;  4WFE A;  3BA8 A;  2HVJ C;  2WLI B;  3OMN B;  3RYI A;  4MTG A;  2IH1 C;  1QCE A;  5B1A C;  3UO3 A;  5BY1 A;  4CWO A;  2N74 A;  3AG4 C;  1P7G A;  5CMU A;  3JD3 A;  4O4J A;  1W2B U;  2OTL V;  4AI8 A;  1XL4 A;  3TZ4 A;  2WI2 A;  3HKD B;  2EXL A;  5LA6 B;  1HDJ A;  2DOS A;  5JJJ B;  4KUM A;  1PL4 A;  1KKD A;  2QG0 A;  1H8E G;  1BS3 A;  4ZOL B;  4LF9 O;  4BIO A;  5FND A;  2CK3 G;  3CEI A;  4WF9 V;  4H13 B;  5IYZ B;  2ZE5 A;  4KHP O;  4FLY A;  5KHI A;  2XHB A;  1TUE B;  3Q4H A;  2XHX A;  1WA8 B;  4QPJ A;  1AI5 A;  4G2K A;  3TXQ A;  4DV4 O;  2XAJ A;  2XDX A;  3SYP A;  4DW1 A;  3B40 A;  4LBE C;  3R92 A;  1WB8 A;  4GX5 A;  4ZI7 B;  5L3F A;  4XC0 A;  1Z59 A;  1EN4 A;  3K08 A;  4JI0 O;  5IWA O;  3CJH B;  1OCO B;  5D5Q A;  5BOC A;  4HNA B;  3ASN C;  3SPG A;  2LGW A;  2PNR A;  1LNQ A;  1K5S A;  4MPC A;  1SZT A;  1KP3 A;  5F2V O;  4E72 A;  4X1Y A;  1VQO V;  4O4I B;  2OTJ V;  2XOK G;  2XDS A;  1AIL A;  3IFX A;  1YIJ V;  3ZX6 A;  2UXN A;  3OGC C;  4I0X B;  2HHH B;  2WLL A;  4IIJ B;  4YKX A;  3FAV A;  1KD1 W;  1I58 A;  1R3J C;  1VQN V;  2JDI G;  4FCQ A;  3ASO B;  3VBB A;  2YEI A;  5KAF Z;  4PV1 B;  1NHI A;  1VQ4 V;  1NZ6 A;  5KHG A;  1IBL O;  5M4P A;  1B63 A;  4QGP A;  2DN9 A;  4H37 A;  4PRV A;  4FMT A;  4MVO A;  1BE3 H;  4YKZ A;  2Q73 A;  4H33 A;  2RN9 A;  4U3J B;  1IVS A;  2XAQ A;  2M7W A;  3OT7 A;  4CC6 A;  4PA9 A;  2QWN B;  1UYF A;  1Z5W A;  4KP4 A;  4EB6 B;  5JQG A;  5BR8 O;  4CS2 A;  4J7K A;  1UYC A;  2XD6 A;  1NVP B;  4ASG A;  2Q4P A;  1Y76 A;  1PM9 A;  2XTA A;  2VCJ A;  2F23 A;  3OGI B;  4DR3 O;  4CWQ A;  4Z2W A;  4HXW A;  2JIZ G;  2YE5 A;  4HY6 A;  4URL A;  4B3T B;  1UY6 A;  1L0N H;  4XDM A;  4TV8 B;  5GW7 A;  1XNR O;  1MG1 A;  2JS5 A;  2BT0 A;  3JAW B;  1GM7 A;  4AS9 A;  1I94 B;  2QGN A;  1GTO A;  2P4V A;  1JJ2 U;  5H6R A;  2BCC H;  3EHJ A;  4K3A A;  2UXB O;  4WBN B;  3TZ5 A;  5EC1 C;  2GQP A;  2RMK B;  2EBO A;  4PDV A;  1B6Q A;  4RQE A;  2AZ2 A;  4L94 A;  5J2T A;  2N05 A;  2YXY A;  3E35 A;  4R8C A;  2ZT9 B;  4DRX B;  2FYP A;  5IDJ A;  2G38 A;  3ABL B;  5TIS Z;  2Q8G A;  1ZLZ A;  3HKB A;  4X89 A;  3T4D A;  1U97 A;  2YEE A;  3OTO O;  1XOU A;  1IZ3 A;  3K60 A;  1US6 A;  3THO A;  3A0B Z;  1PVG A;  4PA4 A;  2Y4U A;  3GVM A;  1NI8 A;  3ZJZ A;  2A0L A;  1PP9 H;  4GFN A;  4FK5 C;  1NS1 A;  1OCO C;  4LF4 O;  4H7Q A;  4URN A;  2JGD A;  2GTA A;  1PNL A;  2AGA A;  3F7Y C;  1M1K W;  4UB6 Z;  1Q90 D;  4NB5 A;  2F4V O;  5E79 Z;  4IHJ A;  4RUF A;  2E5L B;  1S77 D;  1UY7 A;  2OIG A;  4FLU A;  3OMA B;  3B26 A;  1RSO A;  3CRM A;  5CB4 B;  4J9Y B;  1X4T A;  3WB2 A;  3A0T A;  3K5O A;  4WFB V;  4PU9 A;  4CH6 A;  1M5I A;  4DV6 O;  1W0K G;  3EKO A;  1H2N A;  1XDC A;  3RYH B;  3JAL B;  4LP0 A;  5JCO C;  5IE9 A;  4DV2 B;  4DYL A;  4CWS A;  1OCC B;  3UT5 B;  2PYJ A;  3VAD A;  3BRC A;  4K0K O;  2YEF A;  4YJ3 B;  2NR5 A;  5M4H A;  2YK2 A;  4ZIB A;  4JAA A;  2ZDI C;  5B3S B;  4X1I A;  1TID A;  1TUB A;  1Y8N A;  4EGK A;  2WI3 A;  2YJX A;  5L3D A;  3RYF A;  4MB9 A;  4XIT A;  3OW2 U;  5ITZ A;  4HZ0 A;  1YT0 A;  3MDS A;  1AI4 A;  2LJ2 A;  4FPP A;  3SL2 A;  4Q20 A;  3TTZ A;  2CCT A;  2YI8 A;  3K99 A;  2P90 A;  1P84 F;  3B2E E;  5BXZ A;  1YET A;  3KKY A;  5IYB O;  1VQ7 V;  2QTS A;  4Q6G A;  4J80 A;  1VF7 A;  3G67 A;  4XDK A;  1GN3 A;  4L90 A;  3F5W C;  3QO7 A;  2YGF A;  1I5X A;  3RLQ A;  1K92 A;  4JI3 B;  4JI5 B;  4XCL A;  3WFV A;  4FJC C;  1H2G A;  1I5A A;  3TZ2 A;  4LFC B;  3RVZ A;  3LSQ A;  1AI7 A;  3E8B A;  5IT9 N;  5IY5 B;  3INW A;  1Q3E A;  5LMN B;  3X2Q B;  1FYJ A;  3JAS B;  2JS3 A;  1HNW B;  3TXS A;  4EM7 A;  3DTU B;  1EA6 A;  4LFB B;  1YZB A;  2QEX V;  3BA9 A;  2XCM A;  4P9O A;  3CME V;  3P3N A;  1IBM B;  1PNM A;  3OUF A;  2FKX A;  3CRA A;  3ZHU A;  5LP6 A;  4G28 B;  3CGY A;  1MMM A;  1GKX A;  1N32 B;  3BM9 A;  2A9H A;  4YKY A;  3FKS G;  1YC3 A;  1DTO A;  2RCV A;  1BT8 A;  1I5D A;  4YJ2 A;  1UYL A;  2MK3 A;  2UU9 B;  3AK3 A;  2YEV A;  3CCM V;  4B3R B;  2B5U A;  2P22 C;  3CCQ V;  4NTX A;  3U2K A;  4L8J A;  2HG1 A;  2BTZ A;  2H3O A;  1SET A;  2YKC A;  5A2Q N;  2BYH A;  1KEC A;  1YEW A;  4LFA B;  1KYO F;  4B3T O;  4KSG A;  3SR2 C;  2IJJ A;  2BSK A;  4BR6 A;  3RYC A;  3OFN G;  2KG7 A;  2QA4 V;  1OCC C;  1WJZ A;  4GT1 A;  4NXM B;  4JV5 B;  1YES A;  2EJ7 A;  4JI7 O;  2WA4 A;  3PN1 A;  4IGG A;  3ZM7 A;  4XDJ A;  3D8C A;  4QIW F;  5B3S C;  1J5E B;  1YHQ V;  3JD1 A;  3KG2 A;  4GZR B;  1ZWH A;  1PL0 A;  4E4E A;  2EX3 A;  4G27 B;  1YXB A;  1IXB A;  3ZCC A;  3G6E V;  3ZXQ A;  4QJF B;  1AJN A;  3N2K B;  2IJH A;  1O9H A;  2HFE C;  2XJX A;  3WHA A;  2R70 A;  4O4L A;  2OIE A;  4GUN A;  2YKE A;  4XKK A;  1JMK C;  1MZF A;  3B77 A;  3ABM C;  5B1B C;  1FXV A;  4RO2 A;  1GO3 F;  5EYP B;  3STL C;  4HYP A;  4YKR A;  2ZR3 A;  1AH6 A;  4GKK B;  4BAY A;  4LF9 B;  1Q82 W;  2WI6 A;  1SQQ H;  2XAH A;  2DJV A;  2Y48 A;  1XHZ A;  3CE2 A;  2CG9 A;  2WWW A;  1AP5 A;  3IC9 A;  4YKW A;  3G75 A;  1ZXM A;  2X6C A;  3JAT B;  3JD0 A;  1M9N A;  4LF7 B;  3SJQ C;  2BYI A;  2CH7 A;  3SPJ A;  4DV4 B;  5KX5 B;  4MVR A;  2E75 B;  5CTW A;  3EHB B;  4DR2 O;  1TVK B;  1JQ0 A;  2O1V A;  2AZ0 A;  3VQX A;  2QR4 A;  1ROP A;  1I7F A;  1XUQ A;  4WUC A;  5FNV A;  4DV2 O;  4DR5 B;  4MP2 A;  5J9P C;  1SS3 A;  2V1D A;  1XL6 A;  3OW6 A;  4LF6 O;  1K8A W;  1B62 A;  1Q5O A;  4B7E A;  1OCZ B;  1S76 D;  3APO A;  3M99 B;  3P3P A;  1YDX A;  4LCU C;  2YE4 A;  5CA1 A;  2WAM A;  1UYK A;  3D0B A;  5D6Q A;  3Q5L A;  5KUK A;  3O65 A;  4CS4 A;  4B3S O;  2QJ1 A;  4YY3 O;  4XIR A;  4PDR A;  4JI4 B;  3JAR B;  4QE9 A;  4DV5 O;  1I08 A;  3AG4 B;  1AJP A;  4JAS A;  4NTW A;  4O2A A;  5CA3 A;  2ILM A;  5CA0 A;  2QSA A;  4YKT A;  5BOD A;  1H2M A;  1BL8 A;  2R9R B;  3ZMV A;  1KKC A;  1E1R G;  3ICX A;  4JI3 O;  5KMG B;  2CCU A;  5BR8 B;  2IWU A;  4AHC A;  3I5D A;  1Q86 W;  1R6N A;  2ZM6 O;  3ZED A;  2PUS A;  1BSM A;  5LMN O;  1YF2 A;  1YT1 A;  4DV1 B;  2YEJ A;  3J7A U;  2VWC A;  1NHJ A;  1ZXN A;  2QFO A;  1PV0 A;  3D3I A;  4BAE A;  2YC0 A;  3CYG A;  4LFB O;  4FLZ A;  2VRZ A;  3NXS A;  2VWJ A;  1H2L A;  5JJE B;  1WP7 A;  2YGA A;  1VF6 C;  5EBM C;  3HYY A;  3NR7 A;  1T5E A;  3U10 A;  3DXR B;  3ZS8 C;  2AXT Z;  3JCU Z;  4XBF A;  2EJR A;  4JTC B;  2UXB B;  1BQZ A;  1FD9 A;  2Q7H A;  2R9I A;  3W7X A;  3T2S A;  2Q5Z A;  2VS0 A;  2UU9 O;  1JCH A;  4B7P A;  4B3R O;  4O07 A;  1R1B A;  4LF8 O;  4MPE A;  1ZWI C;  3H1J H;  1ZW9 A;  4GCZ A;  3EHF A;  3OTO B;  1YSC A;  5JJN B;  1Y74 A;  3O0I A;  5FWK A;  3BCC H;  1YIT V;  1SQV H;  1IUR A;  3IJ4 A;  2W6J G;  1B3Q A;  1Q43 A;  5BZB A;  1BCC H;  3G4S V;  2FL4 A;  2ZE8 A;  1N36 O;  3ABK B;  1P7B A;  2LW1 A;  4CC5 A;  4BQG A;  5CTY A;  4I55 B;  2HEP A;  4ASU G;  3SYO A;  2YK9 A;  1GKZ A;  5FNF A;  4LF4 B;  3S3W A;  3WQ9 A;  4N21 A;  4O4H B;  4OPA A;  2QKS A;  4NXM O;  3CXH F;  4JV5 O;  2Q8F A;  2F4V B;  1AI6 A;  4TV9 A;  3QO8 A;  3QDD A;  1OCZ C;  1VF5 B;  3G71 V;  2P06 A;  1RM1 B;  4R6Z A;  3K79 A;  1J5E O;  3CRQ A;  1YCI A;  2CGO A;  3ZHV A;  1U0Z A;  1Y4S A;  4L8Z A;  1YT2 A;  2DQ3 A;  4ZHQ A;  3EHH A;  4HZ3 A;  5JVD B;  4DV6 B;  3OWD A;  4O04 A;  2FWY A;  3SYQ A;  1Y4U A;  4HYO A;  1R6T A;  1M57 C;  3ZHS A;  1K34 A;  4D7S A;  2QDO A;  4K0K B;  4U93 A;  3BFR A;  2JJ1 G;  1XBL A;  3DC5 A;  2V7Q G;  3A0H Z;  2YEG A;  5C93 A;  4DK1 A;  1VMG A;  4GKK O;  4MVM A;  1M93 A;  2YUA A;  1UFI A;  3ETG A;  3GB7 C;  5FPO A;  3E22 B;  2OCC C;  1DF4 A;  3MD0 A;  2BRC A;  5JWP A;  1ARO P;  3OEH G;  2H55 A;  3KCY A;  5FL7 G;  1KUQ A;  4LF7 O;  3L74 H;  3DC6 A;  2ZDX A;  1A32 A;  1SA0 B;  4URM A;  2ZIM A;  2JRI A;  1OSF A;  1NTM H;  2CTQ A;  5K1P A;  1BZK A;  4JZG A;  2HJF C;  1YVW A;  4ABM A;  3J80 N;  2W6I G;  4ASA A;  4FVM A;  4DUZ O;  4EMV A;  5IJ0 A;  4XDL A;  4DR5 O;  4B6C A;  5D6P A;  1BHB A;  4X64 O;  4JYY A;  2BRE A;  1IXM A;  2LGQ A;  2BE3 A;  2P4K A;  1V55 B;  4LH6 A;  5LYJ B;  1U2O A;  1TC6 A;  3E8F A;  1XMO B;  1HNZ O;  4YIO A;  3LMM A;  3G6B A;  4X20 B;  1D2D A;  4AWP A;  5JH7 A;  3S3X A;  3EVK A;  3B09 A;  5EIB D;  5KUM A;  2WI5 A;  1BYQ A;  2WSS G;  4PL9 A;  1NR7 A;  2W0X A;  2XX5 A;  2EZP A;  3EKR A;  4JI4 O;  3U2D A;  1N0N A;  4EFE A;  3IED A;  2XJJ A;  2P67 A;  2YGE A;  1SER A;  3ABK C;  1FJG O;  4XD8 A;  3RKZ A;  1THZ A;  3H4L A;  4FZ0 A;  3HHU A;  4EEQ A;  1J95 A;  1UJW B;  3RLR A;  1FFX B;  2IM9 A;  1QLE B;  1AR4 A;  4JTD B;  2WI7 A;  4KFG A;  3K58 A;  3CWB H;  5EK0 A;  3IGA C;  5K1X A;  5EZY A;  2AKP A;  2EIN B;  2HKJ A;  3K03 A;  1RM1 C;  3TGU H;  1P4R A;  4F6R B;  4B08 A;  4DV1 O;  2IJK A;  2VWK A;  3ZHR A;  4HBN A;  1ZSP A;  3HB3 B;  3ZRW B;  4YKU A;  2XK2 A;  2CGN A;  4LNU A;  3K9A A;  1NH2 B;  4NTY A;  4C7U A;  4R3A A;  3A0X A;  5M4E A;  2CCS A;  2LFS A;  4MW3 A;  1JFF A;  2XAS A;  4JI7 B;  4X66 B;  1L0O A;  4X65 B;  2GUZ A;  3TUH A;  1TA8 A;  2IH3 C;  3W7W A;  4GT8 A;  4NH9 A;  4WUB A;  1Q8I A;  1JM6 A;  1PPJ H;  3CYO A;  1HNX B;  2BU5 A;  3APQ A;  3HKE A;  1PNK A;  1G6U A;  2Q0O C;  2IU3 A;  4P9P A;  3GIG B;  4DR1 B;  5D7R A;  4O2B A;  1KBH A;  1TAE A;  4QNH B;  4UVB A;  3L9D A;  4CWF A;  1MNG A;  5LOV B;  3VQW A;  3T1H O;  2PTM A;  1QVF U;  4P8O A;  3ZHQ A;  2JJ2 G;  2YI7 A;  5FLX N;  2ZE7 A;  4GX2 A;  3RYI B;  4P2Z A;  3A8T A;  4TUY A;  5H6Q A;  4MS2 A;  5KHK A;  3ABT A;  1V55 C;  4O4J B;  5EBW C;  2WLJ A;  2Q2E B;  1SQG A;  2YE7 A;  4N23 A;  5GON A;  3KCX A;  1F51 A;  1XMQ O;  5DED A;  1XRE A;  2IOQ A;  4PDL A;  2HP8 A;  4DR2 B;  4LPB A;  5BMV A;  4FFB A;  5LGN A;  2Q8H A;  1UYH A;  4KXR A;  4UB8 Z;  2ZXW B;  1I0H A;  3ZMU A;  3R4M A;  1COW G;  4FLV A;  4HYM A;  3Q4H B;  4ICG A;  1ZL8 A;  1B06 A;  4LF6 B;  1YTF D;  1QLE C;  3STZ C;  1CEZ A;  4JYC A;  2GV9 A;  2WI4 A;  3LSU A;  4GEE A;  1F4N A;  1KMI Z;  3ML0 A;  4D7T A;  1JVM A;  1ZTE A;  4I50 A;  1TBW A;  2EIN C;  4I9Q A;  4B3S B;  3FYE B;  2BU7 A;  3K57 A;  2GDS A;  4YY3 B;  3CD6 V;  1H7S A;  4XE2 A;  2DMX A;  4DV5 B;  2XND G;  1IDS A;  4X1Y B;  3SPI A;  3TZ0 A;  4CH5 A;  1S5H C;  1AR5 A;  3W7T A;  3A0R A;  4AQY B;  3E83 A;  3DSQ A;  5B1B B;  3D3Q A;  3ABM B;  5L3G A;  3K06 A;  5LXT A;  1HWY A;  3INX A;  1AMW A;  2YED A;  4X8A A;  3HR0 A;  5IJ9 A;  2WLL B;  4H85 A;  2UUC B;  3M7M X;  3VOU A;  3HYZ A;  1MOF A;  3FAV B;  2E0A A;  5CPH A;  3CCE V;  4L87 A;  4UVC A;  4FM1 A;  1NJI W;  1FXK A;  2L35 A;  3CB2 A;  3L75 H;  4DV7 O;  2GFD A;  3D36 C;  1WPX A;  1GKF A;  5J71 A;  1ZX3 A;  3OMI B;  1VQL V;  2JGU A;  1XMO O;  3SJA C;  2ZM6 B;  3RW0 A;  1NU1 H;  4I4T A;  3SGI A;  3UCS C;  2UUB O;  2F66 C;  5HFL A;  2AHZ A;  3CRR A;  4K8X A;  1IBK O;  4WFF A;  4MSW C;  4E00 A;  1BQ0 A;  5JQG B;  2ARH A;  2ADP A;  1Y76 B;  1H2K A;  1Q6U A;  3F7V C;  4DR4 O;  4PA3 A;  3UQ8 A;  2C1I A;  2BTQ A;  4LWG A;  2LP7 A;  2NN4 A;  1MZE A;  2YKB A;  4E2L A;  4MP7 A;  3AG7 A;  1OZ0 A;  4LF8 B;  1GJV A;  4LNU B;  1CXZ B;  4YHH B;  3S5T A;  1R6K A;  1HW7 A;  2HKO A;  3HKC A;  2E76 B;  4JGS A;  1URF A;  1SZX A;  4K8Z A;  1H38 A;  5GTH Z;  1YER A;  3CC2 V;  1L1F A;  1N36 B;  1AP6 A;  5J2T B;  4FLT A;  2ZXW C;  2A3Q A;  4UFZ A;  5IYC O;  3HKE B;  1LR1 A;  3HKB B;  4JAU A;  2F95 B;  2VQF O;  5J2U A;  3Q5K A;  1NBM G;  3QNE A;  4TQD A;  2DQ0 A;  2WI1 A;  4YIP A;  1VIB A;  3HZ5 A;  4DUH A;  4X66 O;  2XAF A;  4X65 O;  3B4S A;  1Q7Y W;  1TIL A;  3ZXO A;  1Y6X A;  1AH8 A;  3JAK A;  2YID A;  4HAM A;  3CCU V;  1HNX O;  2WLN A;  2ZBK B;  4NH8 A;  1I59 A;  2EIK C;  4JYA B;  5KLV H;  2JGD B;  4DR1 O;  2VQE B;  1S3J A;  2LO1 A;  2UXD B;  1GN4 A;  1TGO A;  4FFK A;  3I56 V;  1UPG A;  2PGG A;  3N2G A;  4IHJ B;  2YS8 A;  3BMY A;  2B9Z A;  3G80 A;  2Y0I A;  2F43 G;  2YXL A;  4JTA B;  1RSO B;  1THN A;  2BU6 A;  4PD4 F;  4LWH A;  3K59 A;  4UCS A;  1QBZ A;  3LNU A;  1RPR A;  5E1A C;  2PYL A;  2WPD G;  2KQX A;  3BPZ A;  3JCZ A;  5DEC A;  5C8Y A;  5B66 Z;  4R3M A;  1UYG A;  3U67 A;  3EXA A;  1TC0 A;  4LWS A;  4J9Z B;  4L91 A;  4JI2 O;  4BXI A;  4CWR A;  1L0L H;  4GLX A;  4X1I B;  1Q81 W;  2WLI A;  2Y0P A;  1I5B A;  5CTX A;  4URO A;  1D5A A;  1D5N A;  4H44 B;  4PA7 A;  1TUB B;  2X7R B;  2QTO A;  2Q0A A;  2YIB D;  4R50 A;  4UV8 A;  4BIU A;  4DUZ B;  4NH7 A;  3O6O A;  2A06 H;  3RYF B;  1G8M A;  3HKD A;  5H2F Z;  4X64 B;  5LA6 A;  5ITZ B;  1VQK V;  2CE4 A;  5M4K A;  1ID0 A;  2YIB A;  1BXD A;  4NXN O;  1WNS A;  1Q6H A;  2GSM B;  4ZOL A;  2XAB A;  3CC7 V;  3E8G A;  4CBC A;  4OXS A;  1ORQ C;  1EZJ A;  2KSD A;  3EFF K;  1HNZ B;  3OUS A;  2DE0 X;  5IYZ A;  3RN4 A;  2DWE C;  2YE3 A;  1US7 A;  3K5N A;  5CBH A;  2HCH A;  5D7D A;  1WA8 A;  4OGQ B;  4JI1 B;  5LHG A;  3SJC C;  1UY9 A;  2CGF A;  2BU2 A;  1M57 B;  1VQ5 V;  1KZN A;  2WLM A;  1FJG B;  1BMF G;  4PHZ A;  4ZI7 A;  4UXN A;  4AQY O;  5FPR A;  2DW4 A;  3B8M A;  3OAA G;  1RFY A;  1RP3 B;  2Q9L A;  1N34 O;  3CJH A;  4K4O A;  4D6T H;  4DXW A;  1N33 B;  2BTO A;  1Z2G A;  1YJ9 V;  2O1U A;  3RLP A;  3CCL V;  2IJI A;  4HNA A;  3K5M A;  2UUC O;  2WEQ A;  4ZBM A;  2B1G A;  2OCC B;  3K0D A;  4EFU A;  5B1O A;  1QLN A;  4UCT A;  2ZKO A;  3GWO A;  2YDE A;  4O4I A;  5LP6 B;  4FLX A;  1JOY A;  1K3E A;  2AW9 A;  2EZO A;  1R73 A;  1XEQ A;  2VCI A;  4CE1 A;  2M6Y A;  4I0X A;  3TET A;  2PI4 A;  4EFB A;  2HHI A;  1QNM A;  2BOC C;  4IIJ A;  3O2F A;  4YJ2 B;  2YEV B;  3RWR D;  1MSW D;  5JCO A;  2RJZ A;  1XHX A;  4RUE A;  3RFR A;  4GX0 A;  3ZRX A;  2DYR B;  2Z3Y A;  2YIC A;  4GGL A;  2XX2 A;  2IW5 A;  1Z5B A;  1SQX H;  3FB7 C;  2DYS C;  2LW7 A;  3UO2 A;  5L3C A;  5KHJ A;  5EC2 C;  2ZDI A;  1VQP V;  2YI6 A;  2ESA A;  4U3J A;  1M56 C;  4JI0 B;  2BSK B;  2ZKJ A;  1MA1 A;  4EB6 A;  1K9M W;  3RYC B;  4JAV A;  2ADQ B;  4YHH O;  1ENV A;  3L70 H;  3CSX A;  1LUV A;  1XNQ B;  2KG7 B;  2GBO A;  2Q69 A;  4GQT A;  2K9P A;  3JZ3 A;  3O9O A;  3VQV A;  2XUM A;  1JR9 A;  4UV9 A;  3GWK C;  4DO2 A;  4P7A A;  1Y66 A;  3QG5 A;  4EGI A;  4EKW A;  1M90 W;  1LUW A;  4DV3 O;  4KQV A;  3UM7 A;  3H9V A;  3T1H B;  1S14 A;  2HVK C;  4KL1 A;  4WFA V;  4V25 A;  3JAK B;  4TV8 A;  2YI0 A;  3CHX A;  2QWR B;  3L72 H;  2YE2 A;  5A9G A;  3E8H A;  2BZ5 A;  2OT5 A;  2D3O W;  2YIA A;  3JAW A;  3CWV A;  3FFQ A;  4O09 A;  3ABU A;  1K4D C;  1AJQ A;  3FT5 A;  2F1M A;  2IWS A;  5GGZ A;  2JEX A;  1FXH A;  2FYU H;  2HG5 C;  4WBN A;  1VEW A;  4O4L B;  5LGT A;  3T2M A;  3TK1 A;  4PI0 A;  4TT3 G;  1YI2 V;  4DRX A;  4O0B A;  3LPS A;  1XMQ B;  5L3E A;  2UXX A;  1EN5 A;  3T1Y B;  3KZI Z;  4BW9 A;  4JYA O;  1W59 A;  5F3K A;  1CP9 A;  2VQE O;  2N04 A;  2UXD O;  1K97 A;  4DR7 B;  3ZMS A;  1S5J A;  4H81 A;  4LWE A;  1KQS U;  1O9G A;  1SKV A;  2FTK A;  2CH7 B;  1FAF A;  4ASF A;  2L6L A;  3WU2 Z;  2KKW A;  4FIP C;  4W4L A;  1JJO A;  1EZV H;  3AK1 A;  1K4C C;  4IYI A;  3B24 A;  5CF0 A;  1K7D A;  2Y4T A;  5LL6 Y;  5CBF A;  1JA8 A;  5FNV B;  3CRC A;  3K5L A;  3SDL A;  4CS3 A;  2Z0A A;  1S16 A;  2ITD C;  2IU0 A;  1Y67 A;  2OYQ A;  5LP6 C;  3CCS V;  2CUG A;  3JSL A;  1QZR A;  5CB4 A;  3QF7 A;  2YEA A;  1MX0 A;  4JI6 B;  1FKA O;  2XAG A;  5CA1 B;  3RYH A;  3JAL A;  3TCU A;  1UYM A;  1CPY A;  3UKM A;  5J6A A;  3OEE G;  2DYR C;  5F5R A;  2OCH A;  2JK5 C;  3UT5 A;  5IDM A;  1P49 A;  2K1E A;  1FS0 G;  4YJ3 A;  4DV7 B;  3KE6 A;  1NQT A;  1Q6I A;  1DF5 A;  3JD4 A;  2FXS A;  1YC4 A;  4TWK A;  3WB1 A;  4O2A B;  2Q67 A;  3AK2 A;  4X9L A;  4AWQ A;  3R4P A;  2UUB B;  5CA0 B;  2KB1 A;  3FB5 C;  1OCR B;  4LP8 A;  2Q8I A;  1R62 A;  3A0W A;  3QVN A;  1IBK B;  1E79 G;  2K5B A;  4DR6 O;  2R72 A;  2H8M A;  4WFG A;  4JI1 O;  2YKI A;  3R4N A;  2ZQM A;  3BHP A;  3R91 A;  1VP7 A;  1F4M A;  2GTS A;  3CRL A;  4EGH A;  2RDC A;  3BY6 A;  3LUT B;  4I5S A;  3DGE A;  4DV0 O;  4B3M B;  4DR4 B;  4X88 A;  2YI9 A;  1EI1 A;  3MAQ A;  1NKD A;  2CTP A;  1EN6 A;  3HZ1 A;  3L71 H;  1N33 O;  2BSM A;  2ZR2 A;  1Y8P A;  4J7J A;  4OPH A;  5KAI Z;  3H1H H;  1V54 B;  2MW2 B;  2YEC A;  1XIL A;  2C1G A;  5LBQ A;  5KA6 A;  3IAY A;  3CXC U;  4GKJ O;  4CH3 A;  5HFM A;  4K35 A;  3JAS A;  5B5E Z;  2OWO A;  3F5T A;  4BW5 A;  3T4Z A;  4X1K A;  1UYD A;  3QTF A;  3H80 A;  1VQM V;  2YKJ A;  1WAZ A;  1VQ8 V;  2VQF B;  3A0Z A;  4DZY A;  4I9W A;  1Y74 B;  3JD2 A;  4MW8 A;  4LWI A;  5LMU O;  1QYE A;  3ZN1 A;  4JPR A;  3CGZ A;  3E2E A;  3MNR P;  4CE2 A;  1VAR A;  3OD4 A;  2UUA O;  2H94 A;  4MTX A;  3OE7 G;  1Z5A A;  5DM6 V;  1XNQ O;  3OWB A;  2QWP B;  1EFR G;  2FML A;  2YXH A;  2XDL A;  4MOT A;  4TV9 B;  1KB9 F;  4L93 A;  4DK0 A;  5IWA B;  3AG1 B;  4NVP A;  1K33 A;  2D2C B;  4XIP A;  2ZE6 A;  4BWA A;  2JKI A;  5IN9 A;  3RGB A;  5LGU A;  2YI5 A;  4R1F A;  3SYC A;  5LHH A;  4ZHQ B;  4WCE V;  3H1L H;  2WEP A;  3H1K H;  2YEH A;  3E89 A;  5LHI A;  4FZ1 A;  1QY8 A;  2JEU A;  4IT5 A;  1OJH A;  1MSD A;  4FM0 A;  2EIL B;  3K97 A;  4LF5 B;  2WLH A;  1A4H A;  2H8P C;  3MHH C;  4JI8 O;  4JI2 B;  1BGY H;  3T1Y O;  4JZ2 A;  1OCR C;  3D2R A;  4YKQ A;  3ETQ A;  4HXZ A;  5H5N A;  1WPB A;  1GN2 A;  2LFR A;  2QKC A;  4RAI A;  1KIJ A;  2XDK A;  4NKG B;  1RPO A;  4DR7 O;  3N2K A;  2CAZ C;  3LDC A;  1VF6 A;  4UCO A;  2QM4 A;  1FPO A;  5GTI Z;  3E86 A;  5EYP A;  2BU8 A;  2IOR A;  4Z1M G;  4NXN B;  1IX9 A;  2QF6 A;  4F4L A;  2LQT A;  4UUJ C;  2QWO B;  4X9Q A;  4YXW G;  1TH8 A;  4U7N A;  2Q8V A;  1V54 C;  3ZRV A;  3BEH A;  3B27 A;  3K0G A;  2Q7E A;  5IJ0 B;  3K98 A;  2EIK B;  4I7Z B;  3T0H A;  3JAT A;  2XDU A;  3ASO C;  1R3L C;  4MPN A;  3H1I H;  2A79 B;  5KX5 A;  1F7Y A;  4PEL A;  3OTF A;  1KP2 A;  1TVK A;  3RVY A;  3FB8 C;  4JI6 O;  1N34 B;  3R4O A;  3NMQ A;  3FB6 C;  1SC5 B;  5JH7 B;  4FM2 A;  1HR0 B;  3R65 A;  2ETN A;  4BQJ A;  1Y4M A;  5D5P A;  2B1I A;  1YSZ A;  3ZIA G;  2Q7G A;  5KA5 A;  3FV5 A;  1BGQ A;  3CP1 A;  4CE3 A;  3ZMZ A;  4LWF A;  5CN0 A;  3B25 A;  5CBG A;  1SRY A;  1YJW V;  2ODM A;  4MTO A;  4R7C A;  1N8R W;  3CCJ V;  4OX9 B;  2X6A A;  2ITC C;  4GYC B;  5AG2 A;  1SQB H;  4KSH A;  2XHR A;  3T1C A;  3TJT A;  4J7Z A;  4UCV A;  3JAR A;  3AG1 C;  3N27 A;  3R66 A;  5EZY B;  1AVM A;  1MU5 A;  4NYK A;  2IBZ H;  3ZBH A;  1DLB A;  1JX9 A;  3SYA A;  1SQF A;  2C2A A;  4B3M O;  2EUL A;  1H7U A;  2DWD C;  3AEI A;  3ABL C;  2JVD A;  3SJB C;  5CTU A;  3LDD A;  1I5Y A;  4H0L B;  2IOP A;  1UY8 A;  2HHH O;  4UVA A;  4XIQ A;  1YC1 A;  4F6E A;  4QPK A;  3Q5J A;  2UWD A;  1QR8 A;  4X1K B;  5KMG A;  3CMA V;  4CWP A;  3A0Y A;  2W0F C;  3RBZ A;  2CDY A;  4XTJ A;  3HEK A;  4ZVI A;  2EIL C;  1JFF B;  4WUD A;  3M8A A;  3I55 V;  3CRK A;  2GUZ B;  4DV3 B;  4AIL C;  1QHT A;  1GH6 A;  3H01 A;  2EIM B;  4GX1 A;  1Z5V A;  4DW0 A;  1WB7 A;  1SES A;  2O57 A;  4X62 B;  3AG3 B;  1OHH G;  3DXR A;  5M4M A;  2ZNI A;  4O2B B;  3SPH A;  3B28 A;  4WFH A;  2ZIN A;  4LH7 A;  2IWX A;  5B1N A;  4PDM A;  3FT8 A;  1GN6 A;  3GIF A;  3B8N A;  3PJS K;  1VQ6 V;  1GAX A;  2YE8 A;  3OR6 C;  4HZ5 A;  1WLE A;  4MVU A;  4UCR A;  2ZD9 A;  1I94 O;  2X6B A;  4FCP A;  3EHG A;  2PZS A;  4TUY B;  3WB0 A;  2HJD A;  2P6J A;  3ZRS A;  1W0J G;  1L8D A;  1WP8 A;  3C11 A;  2NLJ C;  2FB5 A;  2XT9 A;  1JPX A;  4P30 A;  3A2F A;  3QO5 A;  3ZKB A;  2WLK A;  5GON B;  4B7K A;  3OM3 B;  1QQC A;  4Z1V A;  3AG2 B;  1KC8 W;  1K5Q A;  2V4D A;  4I55 A;  2UXC B;  4XKO A;  2DYS B;  1AJ6 A;  1S72 V;  2O1W A;  4FCR A;  2WA3 A;  1SF9 A;  2QM8 A;  5BMV B;  4FFB B;  2GHY A;  3VQY A;  4O4H A;  4DUY B;  2XHT A;  1R3I C;  1N4C A;  1M56 B;  1N0J A;  2Q68 A;  4J41 A;  1G1X B;  2ATK C;  5FNC A;  2EIJ B;  2R9A A;  1YS3 A;  4LC1 A;  3FD9 A;  4JYB A;  3CPW U;  3WG7 B;  5EIB C;  4PJ0 Z;  1NT2 B;  4LF5 O;  1ZL8 B;  5L3B A;  2QG2 A;  4CZZ A;  1NR1 A;  4IL6 Z;  3ZMT A;  1MAB G;  4V26 A;  4BIZ A;  4XCJ A;  2YEB A;  1EM1 A;  5IYD O;  1H8H G;  5JVD A;  2X0L A;  4EFT A;  1DK1 A;  2CTW A;  3RT3 C;  4RWU A;  2A7W A;  3LSS A;  2E74 B;  3BVO A;  4KHP B;  2PF4 E;  2QKA A;  3SPC A;  2XJG A;  4I50 B;  1YTF B;  2E5L O;  3C0E A;  1NHH A;  1V9P A;  3HPL C;  3CS5 A;  5DN6 G;  5KHH A;  1UYE A;  2CTR A;  4O05 A;  4EEH A;  5IY5 C;  3OR7 C;  4W4K A;  4UCU A;  2Y69 B;  3FYI B;  1U96 A;  3X2Q C;  2QM7 A;  3K9S A;  4J11 A;  4MBC A;  3E22 A;  3GIE A;  4QE7 A;  2Z5U A;  4A5U B;  5LXT B;  5EBL C; 
#chains in the Genus database with same CATH homology
 1E1Q G;  1BHA A;  1AR1 B;  1R3K C;  1UYI A;  1K73 W;  3OPD A;  3P30 A;  1FXK B;  3ZKD A;  2Q6A A;  4JQL A;  2EIM C;  2YSU B;  4MVQ A;  1Y8O A;  4MVS A;  2ZDY A;  3JYC A;  1GMG A;  3VHD A;  3CCR V;  3AG3 C;  4MTF A;  4PRX A;  2XX4 A;  2QE7 G;  4CWN A;  5B1A B;  3ETE A;  2YE6 A;  2PI5 A;  4RQF A;  2NNU A;  3PEJ A;  3VHA A;  1GM9 A;  1GM8 A;  4JF3 A;  2JJC A;  4I3H A;  1PD3 A;  1BKN A;  4AWO A;  2VW5 A;  3MHS C;  3IC7 A;  1EBO A;  3LNM B;  5L3J A;  2BOB C;  1PKX A;  3AG2 C;  1Z5C A;  1NVP D;  4KTN A;  1QVG U;  2HR3 A;  4E02 A;  4TSF G;  3W7S A;  2EIJ C;  3K04 A;  3WG7 C;  1AM1 A;  1G4Y B;  5D7C A;  3ASN B;  3OMU A;  5M4N A;  3T10 A;  2WER A;  1QR9 A;  4ZKI A;  1NH2 D;  2CH4 A;  4E01 A;  3P32 A;  1I5C A;  2P7T C;  2YJW A;  3ZRW A;  4HY1 A;  1VQ9 V;  1F23 A;  2YE9 A;  4MT8 A;  3W7U A;  3PEH A;  3G7E A;  4KFM A;  4CWT A;  2FWZ A;  3T0Z A;  3D36 A;  4XKA A;  2Y69 C;  1GK9 A;  5H9C A;  1YSR A;  3G7B A;  3CC4 V;  3ETD A;  3GIG A;  3LDE A;  4MVZ A;  1FXK C;  2AHY A;  4W7T A;  3CCV V;  3VHC A;  2HLD G;  3T1K A;  3K3W A;  1S0V A;  4ASB A;  1FFT B;  3ZN0 A;  4PA6 A;  4U7O A;  1YJN V;  4WFE A;  2HVJ C;  2WLI B;  3OMN B;  4MTG A;  2IH1 C;  1QCE A;  5B1A C;  4CWO A;  3AG4 C;  5CMU A;  3JD3 A;  1W2B U;  2OTL V;  1XL4 A;  3TZ4 A;  2WI2 A;  2EXL A;  4KUM A;  1KKD A;  2QG0 A;  1H8E G;  5FND A;  2CK3 G;  4WF9 V;  1TUE B;  2XHX A;  4QPJ A;  1AI5 A;  4G2K A;  2XAJ A;  2XDX A;  3SYP A;  4LBE C;  3R92 A;  4GX5 A;  5L3F A;  4XC0 A;  1Z59 A;  3K08 A;  1OCO B;  2Z5U A;  5BOC A;  3ASN C;  3SPG A;  2PNR A;  1LNQ A;  1K5S A;  4MPC A;  1SZT A;  1KP3 A;  1VQO V;  2OTJ V;  2XOK G;  2XDS A;  3IFX A;  1YIJ V;  2UXN A;  3OGC C;  2WLL A;  4YKX A;  1KD1 W;  1I58 A;  1R3J C;  1VQN V;  2JDI G;  4FCQ A;  3ASO B;  3VBB A;  2YEI A;  1NHI A;  1VQ4 V;  5M4P A;  1B63 A;  4H37 A;  4PRV A;  4FMT A;  4MVO A;  4YKZ A;  4H33 A;  2XAQ A;  2M7W A;  4PA9 A;  1UYF A;  4KP4 A;  1UYC A;  2XD6 A;  1NVP B;  4ASG A;  2VCJ A;  4CWQ A;  4HXW A;  2JIZ G;  2YE5 A;  4HY6 A;  4URL A;  1UY6 A;  4XDM A;  5GW7 A;  1MG1 A;  2BT0 A;  4AS9 A;  1GM7 A;  1GTO A;  1JJ2 U;  5H6R A;  3EHJ A;  3TZ5 A;  5EC1 C;  2GQP A;  2EBO A;  4PDV A;  1B6Q A;  4RQE A;  4L94 A;  3E35 A;  4R8C A;  2FYP A;  5IDJ A;  3ABL B;  2Q8G A;  4X89 A;  3T4D A;  2YEE A;  1PVG A;  4PA4 A;  3ZJZ A;  2A0L A;  4GFN A;  4FK5 C;  1OCO C;  4H7Q A;  4URN A;  1PNL A;  3F7Y C;  1M1K W;  4RUF A;  1UY7 A;  1S77 D;  3OMA B;  3B26 A;  4J9Y B;  3A0T A;  4WFB V;  4PU9 A;  1W0K G;  3EKO A;  4LP0 A;  4CWS A;  1OCC B;  3VAD A;  2YEF A;  5M4H A;  2YK2 A;  2ZDI C;  5B3S B;  1TID A;  1Y8N A;  4EGK A;  2WI3 A;  2YJX A;  5L3D A;  4MB9 A;  4XIT A;  3OW2 U;  4HZ0 A;  1YT0 A;  1AI4 A;  4FPP A;  3SL2 A;  4Q20 A;  3TTZ A;  2CCT A;  3K99 A;  2P90 A;  1YET A;  1VQ7 V;  5IYB O;  4XDK A;  4L90 A;  3F5W C;  3QO7 A;  2YGF A;  1I5X A;  3RLQ A;  1K92 A;  4XCL A;  3WFV A;  4FJC C;  1H2G A;  1I5A A;  3TZ2 A;  3RVZ A;  3LSQ A;  1AI7 A;  3E8B A;  5IY5 B;  3INW A;  3X2Q B;  4EM7 A;  3DTU B;  1EA6 A;  2QEX V;  2XCM A;  4P9O A;  3CME V;  1PNM A;  3OUF A;  4G28 B;  3CGY A;  1GKX A;  3BM9 A;  2A9H A;  4YKY A;  3FKS G;  1YC3 A;  1DTO A;  1I5D A;  1UYL A;  2MK3 A;  2YEV A;  3CCM V;  2B5U A;  3CCQ V;  3U2K A;  2HG1 A;  2BTZ A;  1SET A;  2YKC A;  2BYH A;  1KEC A;  4KSG A;  2IJJ A;  3OFN G;  2QA4 V;  1OCC C;  4GT1 A;  1YES A;  3ZM7 A;  4XDJ A;  4QIW F;  5B3S C;  1YHQ V;  3JD1 A;  3KG2 A;  1ZWH A;  1PL0 A;  4G27 B;  3ZCC A;  3G6E V;  3ZXQ A;  4QJF B;  1AJN A;  2IJH A;  2HFE C;  2XJX A;  3WHA A;  2YKE A;  4XKK A;  5B1B C;  3B77 A;  3ABM C;  1FXV A;  4RO2 A;  1GO3 F;  3STL C;  4HYP A;  4YKR A;  2ZR3 A;  1AH6 A;  4BAY A;  1Q82 W;  2WI6 A;  2XAH A;  2Y48 A;  2CG9 A;  2WWW A;  4YKW A;  3G75 A;  1ZXM A;  2X6C A;  3JD0 A;  1M9N A;  3SJQ C;  2BYI A;  3SPJ A;  4MVR A;  5CTW A;  3EHB B;  1JQ0 A;  2O1V A;  1ROP A;  4WUC A;  4MP2 A;  5J9P C;  2V1D A;  1XL6 A;  3OW6 A;  1K8A W;  1B62 A;  1OCZ B;  1S76 D;  3M99 B;  4LCU C;  2YE4 A;  2WAM A;  1UYK A;  3D0B A;  5D6Q A;  3Q5L A;  5KUK A;  4XIR A;  4PDR A;  4QE9 A;  3AG4 B;  1AJP A;  4JAS A;  5CA3 A;  4YKT A;  5BOD A;  3ZMV A;  2R9R B;  1BL8 A;  1E1R G;  2CCU A;  2IWU A;  1Q86 W;  1R6N A;  1YT1 A;  2YEJ A;  2VWC A;  1NHJ A;  1ZXN A;  2QFO A;  3D3I A;  4BAE A;  3NXS A;  2YGA A;  5EBM C;  4XBF A;  2EJR A;  4JTC B;  2R9I A;  3W7X A;  3T2S A;  1JCH A;  4B7P A;  4O07 A;  4MPE A;  1ZWI C;  1ZW9 A;  4GCZ A;  3EHF A;  1YSC A;  3O0I A;  5FWK A;  1YIT V;  2W6J G;  1B3Q A;  5BZB A;  3G4S V;  3ABK B;  1P7B A;  4BQG A;  5CTY A;  4ASU G;  3SYO A;  2YK9 A;  1GKZ A;  5FNF A;  3WQ9 A;  4N21 A;  2QKS A;  2Q8F A;  1AI6 A;  3QDD A;  3QO8 A;  1OCZ C;  3G71 V;  1RM1 B;  4R6Z A;  3K79 A;  1U0Z A;  1Y4S A;  4L8Z A;  1YT2 A;  2DQ3 A;  3EHH A;  4HZ3 A;  3OWD A;  4O04 A;  2FWY A;  3SYQ A;  1Y4U A;  4HYO A;  1M57 C;  1K34 A;  4U93 A;  2JJ1 G;  2V7Q G;  2YEG A;  5C93 A;  4MVM A;  3ETG A;  3GB7 C;  2OCC C;  1DF4 A;  3MD0 A;  2BRC A;  1ARO P;  3OEH G;  2H55 A;  5FL7 G;  2ZDX A;  4URM A;  1OSF A;  2HJF C;  2W6I G;  4ASA A;  4EMV A;  4XDL A;  4B6C A;  5D6P A;  1BHB A;  2BRE A;  1IXM A;  1V55 B;  1U2O A;  1TC6 A;  3E8F A;  4AWP A;  5KUM A;  2WI5 A;  1BYQ A;  2WSS G;  1NR7 A;  2XX5 A;  2EZP A;  3EKR A;  3U2D A;  3IED A;  2XJJ A;  2P67 A;  2YGE A;  1SER A;  3ABK C;  4XD8 A;  3RKZ A;  1THZ A;  3H4L A;  3HHU A;  1J95 A;  1UJW B;  3RLR A;  1QLE B;  4JTD B;  2WI7 A;  4KFG A;  5EK0 A;  3IGA C;  2AKP A;  2EIN B;  2HKJ A;  3K03 A;  1RM1 C;  1P4R A;  2IJK A;  3HB3 B;  3ZRW B;  4YKU A;  2XK2 A;  1NH2 B;  3K9A A;  4R3A A;  3A0X A;  5M4E A;  2CCS A;  2LFS A;  4MW3 A;  2XAS A;  1L0O A;  3TUH A;  2IH3 C;  3W7W A;  4GT8 A;  4NH9 A;  4WUB A;  1JM6 A;  3CYO A;  2BU5 A;  1PNK A;  2IU3 A;  4P9P A;  3GIG B;  5D7R A;  4QNH B;  4UVB A;  4CWF A;  1QVF U;  4P8O A;  2JJ2 G;  2YI7 A;  4GX2 A;  4P2Z A;  5H6Q A;  4MS2 A;  3ABT A;  1V55 C;  5EBW C;  2WLJ A;  2Q2E B;  2YE7 A;  4N23 A;  1F51 A;  2IOQ A;  4PDL A;  4LPB A;  5LGN A;  2Q8H A;  1UYH A;  2ZXW B;  3ZMU A;  3R4M A;  1COW G;  4HYM A;  1YTF D;  1QLE C;  3STZ C;  1CEZ A;  4JYC A;  2WI4 A;  4GEE A;  1F4N A;  3ML0 A;  1JVM A;  1TBW A;  2EIN C;  2BU7 A;  3FYE B;  3CD6 V;  1H7S A;  4XE2 A;  2XND G;  3SPI A;  3TZ0 A;  1S5H C;  3W7T A;  3A0R A;  3E83 A;  5B1B B;  3ABM B;  5L3G A;  3K06 A;  1HWY A;  3INX A;  1AMW A;  2YED A;  4X8A A;  2WLL B;  4H85 A;  3VOU A;  3HYZ A;  1MOF A;  2E0A A;  5CPH A;  3CCE V;  4L87 A;  4UVC A;  1NJI W;  1FXK A;  2GFD A;  1WPX A;  1GKF A;  5J71 A;  3OMI B;  1VQL V;  3RW0 A;  5HFL A;  2AHZ A;  4WFF A;  4MSW C;  4E00 A;  3F7V C;  4PA3 A;  4LWG A;  2LP7 A;  2YKB A;  4E2L A;  4MP7 A;  1OZ0 A;  1GJV A;  1R6K A;  2HKO A;  4JGS A;  1H38 A;  1YER A;  3CC2 V;  1L1F A;  2ZXW C;  5IYC O;  4JAU A;  3Q5K A;  1NBM G;  3QNE A;  2DQ0 A;  2WI1 A;  3HZ5 A;  4DUH A;  2XAF A;  1Q7Y W;  1TIL A;  3ZXO A;  1AH8 A;  4HAM A;  3CCU V;  2WLN A;  2ZBK B;  4NH8 A;  1I59 A;  2EIK C;  1S3J A;  3I56 V;  3BMY A;  2F43 G;  4JTA B;  1THN A;  2BU6 A;  4LWH A;  1QBZ A;  3LNU A;  1RPR A;  5E1A C;  2WPD G;  3JCZ A;  4R3M A;  1UYG A;  3U67 A;  1TC0 A;  4J9Z B;  4L91 A;  4BXI A;  4CWR A;  1Q81 W;  2WLI A;  1I5B A;  5CTX A;  4URO A;  4PA7 A;  4NH7 A;  2X7R B;  2QTO A;  4R50 A;  4UV8 A;  4BIU A;  3O6O A;  1G8M A;  1VQK V;  5M4K A;  1ID0 A;  1BXD A;  2GSM B;  2XAB A;  3CC7 V;  3E8G A;  4CBC A;  4OXS A;  1ORQ C;  1EZJ A;  3EFF K;  3OUS A;  2DWE C;  2YE3 A;  1US7 A;  5CBH A;  2HCH A;  5D7D A;  5LHG A;  1UY9 A;  2CGF A;  2BU2 A;  1M57 B;  1VQ5 V;  1KZN A;  2WLM A;  1BMF G;  4UXN A;  2DW4 A;  3B8M A;  3OAA G;  4K4O A;  4DXW A;  1YJ9 V;  2O1U A;  3RLP A;  3CCL V;  2IJI A;  2WEQ A;  4ZBM A;  2B1G A;  2OCC B;  3K0D A;  4EFU A;  5B1O A;  1QLN A;  3GWO A;  1JOY A;  1K3E A;  2EZO A;  1R73 A;  2VCI A;  4CE1 A;  3TET A;  2PI4 A;  2BOC C;  3O2F A;  2YEV B;  1MSW D;  4RUE A;  4GX0 A;  3ZRX A;  2DYR B;  2Z3Y A;  4GGL A;  2XX2 A;  2IW5 A;  1Z5B A;  3FB7 C;  2DYS C;  5L3C A;  5EC2 C;  2ZDI A;  1VQP V;  2YI6 A;  2ESA A;  1M56 C;  2ZKJ A;  1K9M W;  4JAV A;  1ENV A;  2Q69 A;  4GQT A;  3JZ3 A;  4UV9 A;  4DO2 A;  4P7A A;  1Y66 A;  4EGI A;  4EKW A;  1M90 W;  4KQV A;  3UM7 A;  1S14 A;  2HVK C;  4WFA V;  4V25 A;  2YI0 A;  2YE2 A;  3E8H A;  2BZ5 A;  2OT5 A;  2D3O W;  3CWV A;  4O09 A;  3ABU A;  1K4D C;  1AJQ A;  3FT5 A;  5GGZ A;  2IWS A;  2JEX A;  1FXH A;  2HG5 C;  5LGT A;  3T2M A;  3TK1 A;  4TT3 G;  1YI2 V;  4O0B A;  3LPS A;  5L3E A;  2UXX A;  5F3K A;  1CP9 A;  1K97 A;  3ZMS A;  4H81 A;  4LWE A;  1KQS U;  2FTK A;  4ASF A;  4FIP C;  1K4C C;  3B24 A;  5CF0 A;  1K7D A;  5CBF A;  1S16 A;  2ITD C;  2IU0 A;  3CCS V;  1QZR A;  2YEA A;  1MX0 A;  2XAG A;  3TCU A;  1UYM A;  1CPY A;  3UKM A;  5J6A A;  3OEE G;  2DYR C;  5F5R A;  2JK5 C;  5IDM A;  2K1E A;  1FS0 G;  3KE6 A;  1NQT A;  1DF5 A;  3JD4 A;  2FXS A;  1YC4 A;  4TWK A;  2Q67 A;  4X9L A;  4AWQ A;  3R4P A;  2KB1 A;  3FB5 C;  1OCR B;  4LP8 A;  2Q8I A;  1R62 A;  3A0W A;  1E79 G;  2K5B A;  2H8M A;  3R4N A;  4WFG A;  2YKI A;  2ZQM A;  3R91 A;  1F4M A;  3CRL A;  4EGH A;  3BY6 A;  3LUT B;  4I5S A;  3DGE A;  4X88 A;  1EI1 A;  1NKD A;  3HZ1 A;  2BSM A;  2ZR2 A;  1Y8P A;  1V54 B;  2YEC A;  5LBQ A;  5KA6 A;  3CXC U;  5HFM A;  4BW5 A;  3T4Z A;  1UYD A;  3QTF A;  3H80 A;  1VQM V;  2YKJ A;  1VQ8 V;  3A0Z A;  4DZY A;  4I9W A;  3JD2 A;  4MW8 A;  4LWI A;  1QYE A;  3ZN1 A;  4JPR A;  3CGZ A;  3E2E A;  3MNR P;  4CE2 A;  2H94 A;  4MTX A;  3OE7 G;  1Z5A A;  5DM6 V;  3OWB A;  1EFR G;  2XDL A;  4MOT A;  4L93 A;  3AG1 B;  1K33 A;  4XIP A;  2JKI A;  5IN9 A;  5LGU A;  2YI5 A;  4R1F A;  3SYC A;  5LHH A;  4WCE V;  2WEP A;  2YEH A;  3E89 A;  5LHI A;  1QY8 A;  2JEU A;  3K97 A;  2EIL B;  2WLH A;  1A4H A;  2H8P C;  3MHH C;  1OCR C;  3D2R A;  4YKQ A;  4HXZ A;  2LFR A;  4RAI A;  1KIJ A;  2XDK A;  1RPO A;  3LDC A;  3E86 A;  2BU8 A;  2IOR A;  4Z1M G;  2QF6 A;  4F4L A;  4UUJ C;  4YXW G;  1TH8 A;  4U7N A;  1V54 C;  3ZRV A;  3BEH A;  3B27 A;  3K0G A;  3K98 A;  2EIK B;  3T0H A;  2XDU A;  3ASO C;  1R3L C;  4MPN A;  2A79 B;  4PEL A;  1KP2 A;  3RVY A;  3FB8 C;  3R4O A;  3NMQ A;  3FB6 C;  3R65 A;  4BQJ A;  1Y4M A;  2B1I A;  1YSZ A;  3ZIA G;  5KA5 A;  3FV5 A;  1BGQ A;  3CP1 A;  4CE3 A;  3ZMZ A;  4LWF A;  5CN0 A;  3B25 A;  5CBG A;  1SRY A;  1YJW V;  4MTO A;  4R7C A;  1N8R W;  3CCJ V;  2X6A A;  2ITC C;  4KSH A;  2XHR A;  3T1C A;  3AG1 C;  1MU5 A;  1DLB A;  1JX9 A;  3SYA A;  2C2A A;  1H7U A;  2DWD C;  3AEI A;  3ABL C;  5CTU A;  3LDD A;  1I5Y A;  2IOP A;  1UY8 A;  4UVA A;  4XIQ A;  1YC1 A;  4QPK A;  3Q5J A;  2UWD A;  1QR8 A;  3CMA V;  4CWP A;  3A0Y A;  2W0F C;  3RBZ A;  4XTJ A;  3HEK A;  4ZVI A;  2EIL C;  4WUD A;  3I55 V;  3CRK A;  3H01 A;  2EIM B;  4GX1 A;  1SES A;  3AG3 B;  1OHH G;  5M4M A;  3SPH A;  3B28 A;  4WFH A;  2IWX A;  5B1N A;  4PDM A;  3FT8 A;  3GIF A;  3B8N A;  3PJS K;  1VQ6 V;  4HZ5 A;  2YE8 A;  3OR6 C;  1WLE A;  4MVU A;  2ZD9 A;  2X6B A;  4FCP A;  3EHG A;  2P6J A;  3ZRS A;  1W0J G;  3C11 A;  2NLJ C;  1JPX A;  4P30 A;  3QO5 A;  3ZKB A;  2WLK A;  3OM3 B;  3AG2 B;  1KC8 W;  1K5Q A;  4XKO A;  2DYS B;  1AJ6 A;  1S72 V;  2O1W A;  4FCR A;  3HYY A;  2QM8 A;  2GHY A;  2XHT A;  1R3I C;  1M56 B;  2Q68 A;  2ATK C;  5FNC A;  2EIJ B;  1YS3 A;  4LC1 A;  4JYB A;  3CPW U;  3WG7 B;  5L3B A;  2QG2 A;  4CZZ A;  1NR1 A;  3ZMT A;  1MAB G;  4V26 A;  4BIZ A;  4XCJ A;  2YEB A;  5IYD O;  1H8H G;  2X0L A;  4EFT A;  3LSS A;  3SPC A;  2XJG A;  1YTF B;  3C0E A;  1NHH A;  3HPL C;  5DN6 G;  1UYE A;  4O05 A;  4EEH A;  5IY5 C;  3OR7 C;  2Y69 B;  3FYI B;  3X2Q C;  2QM7 A;  4MBC A;  3GIE A;  4QE7 A;  3K60 A;  4PL9 A;  5EBL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...