2C2AA

Structure of the entire cytoplasmic portion of a sensor histidine kinase protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
240
Chain Sequence
MENVTESKELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENSOR HISTIDINE KINASE
publication title Structure of the Entire Cytoplasmic Portion of a Sensor Histidine-Kinase Protein.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 81
structure length 240
sequence length 249
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2c2aA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2c2aA02
1MU5A 4EFUA 2CGFA 1NHIA 2AKPA 3B28A 4XIRA 3D36A 1TILA 4L94A 2YE2A 3B27A 1BXDA 4E02A 4U7OA 1YT1A 4HZ5A 4LP0A 1QY8A 2Q2EB 4X9LA 4I3HA 3INWA 1Z5CA 2XX4A 1YSZA 3CRLA 1ZXNA 2YKIA 2WI1A 5BODA 4JASA 4JAVA 1GKZA 4KQVA 1YESA 4LC1A 3JZ3A 2XDUA 2WI6A 1EI1A 3RLQA 3GIGB 4K4OA 5CF0A 3TUHA 3ZCCA 4XD8A 2QM7A 2XJXA 1B63A 2BZ5A 4HZ0A 2CG9A 3FV5A 1Y4SA 2YJWA 2E0AA 4CWTA 5IDMA 1ZWHA 3A0WA 1Y8OA 4FCQA 3BMYA 4MPEA 5L3JA 3R4NA 2FYPA 4PU9A 2XHXA 4B6CA 2YI0A 4XC0A 2BU7A 3R4MA 3MD0A 4MPNA 1YS3A 2O1UA 1Z59A 2CCSA 2YE5A 4CE2A 3VHAA 2XHRA 4CWRA 4GGLA 4MBCA 5B1OA 4MP7A 2XX2A 1Y4UA 1JOYA 2BYIA 4NH9A 3EHFA 1U0ZA 2UWDA 4KSHA 4NH7A 3PEHA 1BKNA 3T0ZA 3QTFA 1UY9A 3O2FA 5M4EA 3T0HA 3TZ2A 4ASFA 2YK9A 1UYHA 1YC4A 5CTWA 3LNUA 1AMWA 1UYCA 1IXMA 5B1NA 2JJCA 3BM9A 4EGKA 3Q5KA 1QYEA 4L91A 2IOPA 5D6QA 2XABA 2IOQA 2YE7A 3CRKA 5F3KA 2Q8HA 2YKBA 4GEEA 3K97A 4XKOA 1B3QA 4B7PA 5BOCA 3G75A 5CTYA 4AS9A 4EMVA 4L93A 2HCHA 3TK1A 2YE6A 5D7DA 3U2DA 4XKAA 2LFSA 4HY6A 1US7A 1AM1A 2XDLA 3WQ9A 3IEDA 4L90A 2YE9A 1U2OA 4MP2A 4CWNA 3EHJA 4BIZA 1TC6A 4ASAA 2FWYA 5M4HA 2YE3A 1I5AA 4FCRA 1UYIA 4WUDA 3C0EA 2BU6A 4CWOA 2YK2A 4URMA 4UROA 4JQLA 3ZM7A 3RLRA 4GCZA 2XDKA 3K99A 2HKJA 3GIGA 2ZKJA 2VCIA 4XIQA 1YETA 4JYCA 1I59A 4O05A 4BIUA 3Q5LA 3O0IA 1H7UA 3WHAA 1TBWA 2K5BA 1H7SA 2YKCA 4GFNA 2YECA 2YEEA 4YKUA 3HHUA 1R62A 2Q8IA 4O04A 2Q8GA 4DUHA 1YC3A 3HYYA 4YKZA 2BT0A 2WI3A 3B25A 2VWCA 3HEKA 4BQGA 3R91A 2JKIA 2XD6A 2XDXA 1KIJA 5CPHA 3HZ5A 4R3MA 4WUBA 4E01A 2Q8FA 2YI5A 2FWZA 4LWEA 3A0RA 2IWXA 1I5CA 5J6AA 4EFTA 4FMTA 5M4NA 2VCJA 2YGAA 5D7RA 4KFGA 2YEBA 5F5RA 4V25A 5C93A 3ZKBA 2QM8A 2YEAA 2YEDA 3SL2A 4MB9A 4CE1A 1UY7A 1UYLA 4LWHA 5D7CA 4CWFA 2IWSA 3VHCA 2YE4A 2YGFA 4LPBA 2PNRA 2XJJA 2YEJA 2FTKA 1Z5AA 4AWQA 4XKKA 3T1KA 4CWPA 4FCPA 4PRXA 1ID0A 1KZNA 1NHHA 1UYDA 3D0BA 1GJVA 4O07A 2WWWA 3NMQA 5FNDA 1GKXA 4YKRA 3A0YA 4U93A 4XCLA 4P7AA 4ASGA 4GT1A 3R4PA 1UYMA 3A0XA 4HY1A 4LWFA 2WEPA 3EHGA 5FNFA 2CCUA 4HXZA 2WEQA 5M4KA 4AWPA 2ZDYA 4YKQA 1QZRA 2O1WA 4I5SA 4BAEA 2HG1A 1JM6A 1EA6A 5FWKA 3VHDA 1I5BA 3OWBA 3HZ1A 1S16A 2ZBKB 3EHHA 4HYMA 1L0OA 2BU2A 4H81A 5D6PA 4GT8A 2FXSA 2BU8A 3Q5JA 2QG0A 3ZRXA 4AWOA 4QPJA 3B26A 4YKTA 4EGHA 4KP4A 1AH8A 4XDMA 3TZ4A 2CCTA 2LFRA 3RLPA 5M4PA 1UYFA 2XDSA 2YKJA 4L8ZA 2H8MA 3A0ZA 3MNRP 4BXIA 3G7BA 4V26A 3OWDA 1B62A 2QG2A 2YEIA 4URNA 3TTZA 2YE8A 4ASBA 4P8OA 4JAUA 2WI7A 4ZVIA 3T2SA 3K98A 2XCMA 3ZRWB 3CGZA 2YKEA 4U7NA 2XJGA 4XITA 3CWVA 4YKYA 3O6OA 1YT2A 4O09A 2H55A 3FT8A 2WI4A 3EKRA 2YEHA 4MT8A 1UYEA 1BYQA 2BREA 1NHJA 3HYZA 1AH6A 5CTXA 4MTXA 2CH4A 4KSGA 3RKZA 4CE3A 2XK2A 1YERA 4CWQA 1I5DA 2ESAA 1AJ6A 1UYKA 2O1VA 1PVGA 3QDDA 2WERA 3R4OA 3G7EA 2EXLA 4H85A 4Q20A 1TH8A 2BRCA 3R92A 1I58A 2QFOA 2BU5A 4ZKIA 2WI5A 4PL9A 4WUCA 4XIPA 3ZXOA 2P67A 1F51A 1TC0A 1UYGA 4PRVA 4XE2A 1MX0A 4MOTA 1A4HA 3TZ0A 2BYHA 3A0TA 3T10A 4YKXA 2YGEA 4XCJA 1ZXMA 3KE6A 1YT0A 4W7TA 2WI2A 4O0BA 1S14A 3U2KA 3FT5A 2IORA 4URLA 3CGYA 4E00A 4H7QA 3GIFA 1YC1A 2BSMA 3PEJA 1ZW9A 4JYBA 3U67A 3INXA 4GQTA 4MPCA 2YEFA 4EEHA 5CTUA 3P32A 3OW6A 3NXSA 5FNCA 4YKWA 1UY8A 3TZ5A 4R3AA 2YI7A 5IN9A 1BGQA 5GGZA 2ZDXA 3ZXQA 2QF6A 3GIEA 3C11A 1THNA 2YJXA 4KTNA 5J71A 3K60A 4LWIA 3H80A 2C2AA 3OPDA 2YEGA 4FPPA 4DZYA 3EKOA 4BQJA 1TIDA 1OSFA 3ZKDA 2XX5A 4LWGA 3LPSA 3DGEA 3H4LA 4HXWA 4XTJA 3B24A 4R1FA 5M4MA 2GFDA 3VADA 4EGIA 4HYPA 2VW5A 4NH8A 2GQPA 2XHTA 3ZRWA 2YI6A 2IWUA 1Y8NA 4EM7A 1Y8PA 1Z5BA 4QPKA 3ZRVA 1UY6A 3D2RA 2BTZA 3OMUA 4CWSA 1YSRA 5IDJA
chains in the Genus database with same CATH superfamily
1W0KG 2Q7EA 3CC2V 2F95B 1DF5A 2OCCC 2AKPA 4MW8A 2GHYA 4L94A 2YE2A 1YJ9V 4X1KB 3B27A 2EIMC 4E02A 4U7OA 2V1DA 3UCSC 4LP0A 3LDEA 2HHHO 2HHHB 3K06A 2A79B 4UXNA 1S72V 4X9LA 2NLJC 1MZFA 3CPWU 1GK9A 4NYKA 3QTCA 5TISZ 3OMNB 5BODA 3JAMN 4OGQB 3ZN0A 5H6QA 5JWPA 3CRRA 2XDUA 4UCUA 1K73W 1VIBA 4K4OA 4FLWA 3TUHA 4ZI7A 5L3BA 2Q69A 2XJXA 4UV8A 1FD9A 3BPZA 3RYFA 4Z1VA 3K04A 3QO5A 5CB4B 4JI7O 4JI7B 3ZEDA 4CWTA 4FCQA 4MPEA 3BMYA 5CMUA 3R4NA 1XMQB 2AGAA 4B6CA 4YJ2A 1YTFD 4MPNA 1YS3A 2DWDC 1M1KW 2ADQB 2ZR3A 2WPDG 2XHRA 4CWRA 2YSUB 3ABUA 5B1OA 4B3MB 4F6EA 4B3MO 4GGLA 2XX2A 1Y4UA 2YS8A 3W7WA 5GONA 3OE7G 4KSHA 4NH7A 3QVNA 3T0ZA 1VARA 2IU0A 2ODMA 3JATA 3QTFA 4ASFA 1EBOA 3ML0A 1YC4A 1K4DC 5CTWA 1F4NA 3LNUA 1AMWA 3ASNC 5B1NA 2KKWA 2HP8A 4J7KA 3D36C 4DV3O 4DV3B 4DV5O 4DV5B 2IOPA 1Y67A 3GWOA 1OHHG 2BSKA 2A9HA 3CRKA 5CBFA 4NVPA 3H1KH 5F3KA 1WP7A 2V7QG 5CA1B 2XAHA 1OCOC 1R3IC 3K97A 2VQFO 4OX9O 1CP9A 1KD1W 1NTZH 4HYOA 3G75A 4B3RB 4B3RO 1K92A 2NN4A 2VRZA 5CTYA 1PL0A 5D7DA 4HY6A 4X1YB 1US7A 4B7EA 3SPGA 3RT3C 2KG7A 4DUYO 1BSMA 1L8DA 3ABMC 5JVDA 3E8FA 1VP7A 3CCUV 3E35A 4KUMA 2OTJV 1TC6A 3M8AA 3K3WA 2HR3A 1I5AA 4EB6A 3APOA 4WUDA 3C0EA 2QM4A 4DW0A 1CEZA 2AHZA 2YI8A 5DECA 5KHIA 2QGNA 4JQLA 5LA6B 1JA8A 1F23A 3ZM7A 3RLRA 3JSLA 3K99A 1X4TA 5K1PA 3GIGA 2ZKJA 2VCIA 1JPXA 1R6NA 1AI6A 3IAYA 5BR8O 5BR8B 5AG2A 2PF4E 4B7KA 3Q5LA 4I9WA 1OCCC 2ZINA 5IYCO 2CGNA 1H7UA 4DYLA 3WG7C 4X1IB 1H7SA 3A0BZ 4GFNA 1P84F 2YEEA 2GUZA 1FJGB 4O04A 4K0KB 1XNRB 1XNRO 4K0KO 1HP8A 3BFRA 2Y69C 4EKWA 4YKZA 4LNUA 4WFAV 4RQEA 4X64B 5KLVH 2ITCC 2JS5A 5DM6V 1IBMO 1L1FA 1IBMB 2HKOA 4BQGA 1MMMA 3G6BA 4GX0A 2DE0X 4IGGA 3HZ5A 4WUBA 4E01A 1AVMA 1XOUA 3C3TA 4DR6O 4DR6B 2JRIA 3ABLC 3A0RA 2IWXA 2LW1A 3H01A 3CMAV 5J6AA 3LSQA 2EX3A 1VQPV 3DSQA 3JALB 2ZDIC 4J42A 1TUBA 2BTQA 3B4SA 5D7RA 5KUMA 2OIEA 1NZ6A 2YEBA 1NKDA 4DR5O 4DR5B 1UPGA 4PI2A 1W59A 3AG7A 1PM9A 2QM8A 5EK0A 4LH6A 3K03A 3OD4A 1XUQA 4DR3O 4DR3B 1GAXA 2F4VB 2F4VO 2ZM6B 1RM1C 1NH2B 2M7WA 4PV1B 1KBHA 1YXBA 3SYPA 3OFNG 1X59A 3LDDA 1QR8A 2IWSA 1RPOA 1G1XB 2RN9A 4Z2WA 2XJJA 4J11A 4FLVA 2HJFC 5LYJB 1Z5AA 4MVRA 3RYHA 3RYFB 4FCPA 4O07A 1BL8A 2E5LO 2EZOA 5EYPA 3A0YA 4U93A 1O9GA 4PA4A 4MVMA 4EEQA 1NR7A 4N21A 1G6UA 3A0XA 2OCCB 3G4SV 2ZD9A 4AQYO 4AQYB 1AJPA 4OPAA 2WEPA 5FNFA 4KL1A 2WEQA 1M5IA 2ZDIA 2EIMB 3WB1A 3H1JH 1NBMG 4NTXA 5EZYA 2O1WA 2R9IA 1BGYH 2X6CA 4BAEA 4X62B 1WJZA 3RVZA 1DK1A 4JTAB 1IURA 1I5BA 3AK2A 4RO2A 1Q6HA 2OYQA 3JCUZ 5KUKA 1M90W 3HZ1A 3JAKA 1N36O 3EHHA 1IVSA 4HYMA 1L0OA 5D6PA 2Y48A 2FXSA 3Q5JA 3OTOO 2LJ2A 4MTFA 3VOUA 4LF4B 1EN4A 1OV9A 2Q73A 1AH8A 3TZ4A 2JVDA 2LFRA 2ZT9B 3JD4A 2XDSA 5B3SC 2Z5UA 2P06A 1S5JA 3A0ZA 3G7BA 1V54C 3STZC 4DV4O 4DV4B 1B62A 2QG2A 4LF7O 3FAVB 1GN6A 3TTZA 2X6BA 4P8OA 3G6EV 5HFLA 3CCLV 3UT5B 2XCMA 2QWOB 1HR0O 1HR0B 3ZRWB 3DC6A 1MA1A 4W4LA 4UVBA 3DC5A 2XJGA 3T4DA 1NJIW 1QQCA 1XBLA 1Q3EA 1ZLZA 2W6IG 1DTOA 2H55A 3EKRA 2YEHA 2A06H 3ASNB 2QKSA 5BMVA 3UQ8A 1AH6A 3HYZA 4MTXA 1F4MA 3JYCA 4C7UA 1FXKC 2EZPA 2JJ2G 3RKZA 4JYYA 4CWQA 1N0JA 3N2KB 2EIJC 1UYKA 4I0XA 1OCOB 3TXSA 4B3SO 2WERA 4JYAO 3G7EA 2EXLA 2DQ3A 1I58A 1IXBA 3RN4A 3RYCB 1HNXB 1JJ2U 5IYBO 1TC0A 3CP1A 4JI2B 4PRVA 2DYRC 5LXTB 3IGAC 4MOTA 3JARA 3HPLC 3ABMB 2PZSA 5H2FZ 2H94A 4W7TA 1S14A 3FT5A 2YIBA 3CGYA 1MNGA 3ZMVA 2LGWA 3PEJA 2FYUH 4GQTA 2ARHA 3N27A 4UB8Z 2YEFA 2YEVA 1SKVA 1Q82W 1H2MA 1K7DA 3SJAC 4R3AA 2IH1C 3N2GA 3M99B 3CJHA 3D8CA 2QF6A 1OCCB 1H2NA 3PJSK 3RBZA 1XNQO 1FKAO 1THNA 3H80A 3WG7B 1SQFA 1AB3A 1Z5VA 5JJNB 2YEGA 2RJZA 4FPPA 4DV6O 4DV6B 4DZYA 3EHBB 3CYGA 3BA9A 4WBNA 2H8PC 3ZKDA 3OEEG 4UCTA 4JZ2A 2XAFA 4I50B 4LWGA 2BOCC 3DGEA 2QA4V 2IBZH 5LP6C 4DV7O 4GKKO 4EGIA 4Q6GA 3VQYA 3K59A 3F5WC 1SETA 2ZKOA 2R72A 4MVUA 4QPKA 2BTZA 4ZOLA 3TJTA 2LW7A 3ABLB 1NHIA 3JSNA 5H6RA 3B28A 4DR1B 4KFMA 4XIRA 1NTKH 1AI7A 4IT5A 4GLXA 5KHHA 4YY3O 4YY3B 2V4DA 4I3HA 3INWA 2GV9A 1YSZA 3E89A 1VQ9V 2WLIB 1ENVA 4R8CA 4FFBB 1JX9A 4F4LA 1YJNV 2ZIMA 1HWYA 2QKCA 4KQVA 1RM1B 1YESA 3U10A 4LC1A 3F5TA 3RLQA 1FXHA 4UCOA 4JI1O 4JI1B 4H0LB 5LP6A 4TV8B 3ZCCA 1SQBH 3MAQA 1QVGU 5LOVA 2CG9A 1WP8A 5KMGA 4J7JA 4DK0A 5IDMA 3A0WA 3Q4HA 1WA8A 1JVMA 4PA7A 2XHXA 2C1IA 4BW5A 3MD0A 3E83A 3RYIB 1Z59A 3SPHA 2YXHA 4YJ3A 1RSOA 3VHAA 5J2UA 4PELA 5B5EZ 2BYIA 4NH9A 2IU3A 4FLZA 1U0ZA 1BCCH 1JFFA 4MVOA 5CA0A 3TZ2A 2YK9A 1UYHA 2X6AA 2ZR2A 5D5QA 4CC6A 2UXNA 4FVMA 2HFEC 2CH7B 1KUQA 1BHAA 2JJCA 3RGBA 4RAIA 1URFA 4UFZA 3CE2A 4CH4A 5LMNB 1M4UA 3HR0A 4H37A 4L91A 1SS3A 1SQXH 3CCVV 3FYIB 2YXYA 3OM3B 2XABA 2E3CA 2YE7A 1KP2A 3CRQA 3BA8A 1EZJA 1U97A 3SDLA 1VQOV 1GH6A 4XKOA 2KSDA 4EMVA 4PJ0Z 3I5DA 5B3SB 2HCHA 2HVKC 3O65A 3JCZA 4FZ1A 3LDCA 1V54B 4DR7B 1J95A 3K5NA 2PYLA 2EINC 1M57C 1GRJA 4L90A 1VQ6V 3OUFA 2YIAA 4HBNA 4AI8A 4CWNA 3EHJA 2RMKB 4BIZA 4G2KA 3CXCU 2O57A 3ZMUA 3O9OA 2BU6A 4NB5A 2YK2A 4URMA 1FXVA 3AK3A 5JENA 3S3XA 2XDKA 1FXKB 1I5YA 4I4TB 1I59A 4D7TA 1VQ4V 4BIUA 2EIJB 5DN6G 4E4EA 3O0IA 3VQXA 1WPBA 3WHAA 3E86A 3JD0A 1TBWA 3T2MA 2YKCA 5KHKA 4YKUA 3HHUA 3ZHVA 2Q8IA 4CH5A 5JCOA 1H38A 2UUAB 1GM8A 2ZE8A 1IX9A 3B09A 2BT0A 4LP8A 3ZS8C 2DYRB 2UXBB 2UXBO 2WI3A 3B25A 4J10A 4U3JA 2ZE5A 2KB1A 1BQZA 2AZ0A 2XD6A 4LWSA 4CC5A 2QSAA 3ASOC 1TVKA 5EIBC 1MSDA 1E1RG 4O4IB 3B2EE 1GN2A 1SESA 1XMQO 2XAJA 3H1LH 4IHJB 3SPIA 1YSCA 3E2EA 2MK3A 5M4NA 1VQ7V 1R3LC 4A5UB 4WFBV 3L70H 2YGAA 5B1AC 1VEWA 3B40A 3OT7A 1Q90D 1Y76A 5C93A 1YITV 2YEAA 4I55B 3W7UA 3CHXA 3OR6C 4MB9A 1PPJH 4FJCC 2IJHA 1KKCA 1YJWV 4LFBB 3JD3A 1ZTEA 4CWFA 1I5XA 1QU7A 1NTMH 3CC4V 1TA8A 5B66Z 2GDSA 4X88A 3X2QC 3ZMZA 1D2DA 5FPRA 3T1KA 3ZX6A 4IL6Z 4PRXA 1S5HC 5LOVB 1ID0A 1UYDA 1GJVA 4YXWG 2IJIA 2WWWA 3TCUA 4YKRA 4ZBMA 1XHXA 5LMUO 5LMUB 1WA8B 1SQVH 5IYDO 3L75H 3KG2A 4NKGB 4MS2A 4GT1A 3WU2Z 3R4PA 4LWFA 1ZSPA 2QE7G 4ZHQA 5KX5B 3ABTA 5JH7A 2ZDYA 4FM0A 4YKQA 1OJHA 5L3EA 5CN0A 5IJ0B 4LR3A 2Q6AA 4O2AA 1QZRA 3EVKA 2EBOA 5BZBA 4IIJB 2HG1A 5FWKA 3VHDA 3MHHC 3CEIA 4CBCA 2QR4A 1S16A 2AXTZ 4ASUG 4JAAA 4HAMA 3S5TA 2E76B 3B8NA 4NTWA 2P7TC 2Q8VA 1EZVH 1F7YA 2ZBKB 3G80A 2JIZG 4X20A 3UKMA 1YIJV 1N32B 4TV9A 4O4JB 3QO7A 1NQTA 1QBZA 2WLNA 4GT8A 2BU8A 2QG0A 3ZRXA 1WN7A 3CCSV 1EN6A 3EXAA 4MTOA 4XDMA 5ITZA 1PNMA 4DV1B 3RLPA 2YKJA 3VQWA 4L8ZA 4O2BB 1FJGO 1VQNV 3OWDA 3JD1A 2ZE6A 4URNA 2YE8A 4JAUA 1TAEA 3OW2U 4X64O 2WI7A 1VF5B 3HKCA 1V9PA 4QE7A 4FM2A 3WB0A 3EFFK 2OCHA 3ZMSA 1RP3B 3THOA 2YI9A 1QNMA 4YKYA 3O6OA 1YT2A 3ABKB 2WI4A 5C8YA 2HLDG 2BOBC 1UYEA 1SRYA 4UV9A 1VF6A 4UB6Z 3CCJV 2CGOA 5FNVA 4UCRA 4KSGA 1FFXA 1US6A 1BZKA 3JASA 1LUVA 1I5DA 2EILB 2ESAA 3KZIZ 1AJ6A 3I56V 3SJBC 3QDDA 4CH3A 1NH2D 2Y0PA 2HJDA 1L0NH 1Z2GA 4Q20A 3UM7A 1ZX3A 3R92A 2WLLA 1H2GA 2ZM6O 3G67A 4ZKIA 2EJRA 2N74A 4WUCA 4LBEC 4XIPA 4XE2A 2EINB 1M57B 1Y74A 2BYHA 3T10A 4YKXA 4CZZA 4ZI7B 4XCJA 3CMEV 3CXHF 1ZXMA 1YT0A 1KB9F 4NXMO 4NXMB 4UCVA 2IORA 4YIPA 4QNHB 3NR7A 5LHHA 5L3FA 4O4LA 3J7AU 1DF4A 3GIFA 4TQDA 2QWPB 3U67A 4MPCA 2WLHA 4TOIA 4YJ2B 4BAYA 4EEHA 3OW6A 3K5MA 5FNCA 4X66B 4TT3G 3TZ5A 2YI7A 5IN9A 3A2FA 2PUSA 1FS0G 2ZDXA 2EULA 2ILMA 2B1GA 1SF9A 5GONB 3ZXQA 2Q7GA 2A3QA 4K8XA 1B04A 1DGSA 3JATB 3C11A 3H9VA 4WFHA 4HNAA 4X62O 3J81N 4KTNA 4N23A 4LWIA 2RQ6A 3OPDA 4BWAA 2M6YA 3E8BA 3CRAA 3RWRD 1NI8A 1AJQA 2XX5A 3J80N 3H4LA 3KKYA 5M4MA 3VADA 2BSKB 4NH8A 2GQPA 2DYSC 1GMGA 4I9QA 2DN9A 5KA6A 2MW2B 2OT5A 4GKJB 4GKJO 4LF4O 1FYJA 1M56C 1Z5BA 3OMUA 2ZXWC 1UY6A 4CWSA 2CUGA 1YSRA 5IDJA 4DV2O 4JGSA 4DV2B 1XREA 4NXNO 2XT9A 1SQQH 4NXNB 4EFUA 2CGFA 5IWAB 5IWAO 1MSWD 2VS0A 3CCEV 2KG7B 2QWNB 1YT1A 5B1AB 1AR1B 5JVDB 2WLKA 3JAWA 4F6RA 2RDCA 1ORQC 5CA3A 2YIDA 5IJ9A 1ZXNA 2YKIA 4EB6B 1EM1A 4DUZB 2VWKA 3LSSA 4LF5B 2P4VA 1PL4A 5EBWC 5J2TA 3GIGB 3CD6V 1NU1H 2B5UA 5LGUA 4LF6O 4LF6B 4XD8A 2QM7A 3HKEA 3CRMA 1B63A 4HZ0A 2FKXA 3FV5A 1Y4SA 2YJWA 5LGTA 2GUZB 4DW1A 3L71H 1HNXO 2BU7A 3R4MA 4LNUB 3DXRA 2O1UA 1B6QA 3AG4C 1XI1A 3BY6A 4JI2O 2P4KA 1J5EO 3P30A 1J5EB 2YE5A 4CE2A 1BE3H 2XUMA 4MP7A 4PDVA 1JOYA 3T4ZA 2QJ1A 2UWDA 5LBQA 2K9PA 3PEHA 2YDEA 1K3EA 3T1YB 3HKDA 2F93B 5M4EA 3AK1A 1BMFG 3F7VC 5BY1A 2DJVA 1IDSA 2XTAA 1UYCA 1IXMA 3WFVA 3LUTB 5KAIZ 2UXXA 4EFBA 3CYOA 3Q5KA 4DRXA 1QYEA 1SA0A 1AP6A 2IJKA 1AR5A 1TUBB 2BTQB 2CTPA 4LF9O 4LF9B 3K5OA 1AILA 1AI5A 1GM7A 4G27B 1GKFA 5JQGA 1YCIA 5CBGA 4GEEA 1P7BA 1XEQA 3GVMA 1B3QA 4B7PA 1Y6XA 5BOCA 3U11A 3B8MA 4PD4F 4L93A 3TK1A 3U2DA 1XL6A 2JGUA 2LFSA 4AHCA 1XL4A 1AM1A 2XDLA 2Y69B 1V55C 3A8TA 4WFGA 4I7ZB 1G8MA 3IEDA 4X1KA 4J41A 1GTOA 1ZWIC 1Q86W 3H1HH 1QCEA 1K97A 3RYHB 3FFQA 4TQFA 2FWYA 5M4HA 2YE3A 2IH3C 2NR5A 5EYPB 1UYIA 3BRCA 4QGPA 4UROA 3W7TA 2PGGA 4GCZA 2Y0IA 4DR1O 1R73A 2HKJA 1PKXA 2ZNJA 2BTOA 1I08A 4KHPB 2KQXA 4JYCA 3ZHRA 3QF7A 3T1HO 3T1HB 3IJ4A 1I94O 1I94B 5EZYB 4JI8O 4JI8B 1UFIA 4FFKA 2VQEO 2VQEB 5CB4A 2EIKC 1AI4A 1H2SB 1Q8IA 4H44B 1NVPB 1R62A 1FFTB 4JI0O 2N05A 2PYJA 4JI0B 3JAKB 2BCCH 3HYYA 2JDIG 5JJJB 1AP5A 4GZRB 1I0HA 1KYOF 2JEXA 3HEKA 2ZNIA 3KCXA 4JPRA 3CS5A 4FZ0A 2L35A 2D2CB 3ZIAG 3R91A 2JKIA 2XDXA 4OXSA 1GN4A 4CS2A 5FLXN 4R6ZA 3S3WA 3FB5C 3K58A 4IYIA 2Q8FA 4FLXA 4ICGA 2FWZA 1K4CC 5FL7G 3VQVA 1DLBA 4IYHA 1SQGA 4NTYA 1QHTA 3TGUH 4RQFA 4FK5C 4QJFB 4KFGA 1Y4MA 1YEWA 4TUYA 4V25A 3OTFA 4Z1MG 1Y66A 3ZKBA 4MVZA 2GSMB 5CA1A 5IJ9B 4FIPC 3FD9A 4L87A 4X8AA 2YEDA 1HW7A 1KP3A 4J9YB 3GB7C 3CC7V 4CE1A 5BMVB 2IW5A 1KKDA 5D7CA 5LMNO 1S3JA 2AW9A 2K1EA 2YGFA 4LPBA 4XDLA 4TWKA 5EBMC 1OCZC 2FTKA 1D5AA 2A7WA 2DYSB 4I0XB 3ZBHA 1N33B 3D0BA 1S0VA 3NMQA 1N4CA 5EC2C 5FNDA 3FB7C 1M56B 5A2QN 1EN5A 2ZXWB 3FB8C 3LNMB 2JJ1G 4XCLA 4P7AA 2JS3A 5JCOC 2R9AA 1UYMA 2ZE7A 1H2KA 4U3FH 4PA6A 5LA6A 1QLEC 4DR7O 3AG2C 2CCUA 4HXZA 3GWKC 2HEPA 3JARB 5M4KA 2XHBA 1N8RW 3W7SA 2ADPA 2GTAA 1PV0A 4I5SA 1JM6A 3D3QA 4J7ZA 2FB5A 4X1IA 3OWBA 3A0HZ 3W7XA 3LSUA 5B1BC 2YEVB 1QLNA 1PP9H 4L8JA 3STLC 1EFRG 2ZQMA 3N2GB 4D7SA 3CJHB 4QPJA 3ZHUA 4YKTA 1WAZA 1OCRC 2QTSA 4KP4A 1Q6UA 4JI5B 4JI5O 2CCTA 3L9DA 3E8HA 1PD3A 4JI6B 4JI6O 3MNRP 4BXIA 3SYCA 4WBNB 4V26A 2UUAO 3JALA 1H8HG 2EJ7A 3ICXA 3AG4B 4ZVIA 3T2SA 1H8EG 1P4RA 1QR9A 4U7NA 4UVCA 1XILA 2DOSA 3CWVA 1P7GA 3L73H 2HHIA 1JCHA 1AR4A 4MT8A 4ZOLB 5EBLC 3G71V 1BYQA 1NHJA 1Q7YW 4LF8B 5FPOA 4LF8O 1BQ0A 2Q9LA 2OWOA 2P6JA 2PTMA 2CH4A 4UCSA 2CAZC 2XK2A 3CCRV 2QDOA 2XAQA 5LYJA 1Q43A 1JR9A 4MW3A 4R7CA 2UUCO 2UUCB 3ETEA 3SR2C 2JGDA 4H85A 5JJEB 2PY5A 4PL9A 1LUWA 2P22C 4LFBO 3ZXOA 1COWG 2P67A 1V55B 1IBKB 1IBKO 1SZTA 4DR4B 4DR4O 5IYZA 3TZ0A 1MG1A 1YTFB 3A0TA 3JD2A 3R66A 5LP6B 2YGEA 1IBLB 3D3IA 2HVJC 1IBLO 2WI2A 1PNLA 2PI4A 3U2KA 4URLA 1YHQV 2WLJA 4H7QA 4E00A 5KMGB 1GO3F 5LGNA 3L74H 3LNNA 4BR6A 1D5NA 3Q4HB 5E79Z 1YC1A 4JYBA 5LHIA 1K9MW 1FPOA 5LHGA 5CTUA 3P32A 3ZJZA 1XDCA 3CWBH 3NXSA 3MDSA 4G28B 1AJNA 4YJ3B 4YKWA 1RSOB 5J2UB 4TUYB 2P90A 1A32A 1VQMV 5HFMA 1Q6IA 2UXDO 2UXDB 2YC0A 3SJCC 3WB2A 2VQFB 4OX9B 1JFFB 5CA0B 3GIEA 2C2AA 4CS4A 2EIKB 3SYAA 3QNEA 1KMIZ 1VF6C 3EKOA 1TGOA 4GUNA 4BQJA 4DK1A 4NR1A 3APQA 3FAVA 4D6TH 3LPSA 4DUYB 1N32O 3FYEB 3B24A 3UT5A 5BXZA 2GFDA 1P49A 2VW5A 3K9SA 2XHTA 3ZRWA 2CTWA 3F7YC 4GX1A 4J9ZB 2B1IA 2QWRB 1Y8NA 3ETDA 3P3NA 1Y8PA 3ZRVA 3D2RA 4DV1O 4ABMA 3K0GA 4MTGA 3RW0A 1SZXA 1MU5A 3E22A 1R6KA 4GYCB 4CS3A 1VQ8V 5A9GA 3D36A 1TILA 5KHGA 2W6JG 3AG1C 4RUFA 1BXDA 1W0JG 1R1BA 4HZ5A 2UU9O 2UU9B 1QY8A 5IT9N 2Q2EB 3N2KA 1Z5CA 2XX4A 4H33A 2Z0AA 1YDXA 4QIWF 4PDMA 3CRLA 3K57A 2WI1A 4BW9A 5IY5C 3OAAG 4DXWA 3SYQA 2AZ2A 4JASA 4JAVA 1GKZA 3RYCA 5CBHA 3JZ3A 1NS1A 2W0XA 3IC9A 2WI6A 1EI1A 5LXTA 5CF0A 2Q5ZA 1OCZB 2DW4A 2Q7HA 1OZ0A 2BZ5A 1RPRA 1CPYA 3HB3B 4MVQA 2L6LA 2E0AA 1AROP 4P2ZA 1Y8OA 1ZWHA 5L3JA 2FYPA 4PU9A 4LFCB 4LFCO 4UUJC 2YI0A 4XC0A 1S5LZ 3OGIB 4J80A 1QLEB 3AG2B 3BABA 2Q0AA 2CCSA 4U3JB 2DWEC 4MBCA 1E1QG 3SPJA 4DV0O 4DV0B 2FL4A 3EHFA 4LWSB 2CK3G 2X0LA 2C1GA 2JK5C 3OUSA 1BKNA 3BHPA 1TVKB 3M7MX 1UY9A 3O2FA 3T0HA 1PNKA 1VQ5V 3QO8A 1GM9A 5KAFZ 2LQTA 3AG3C 3UO3A 3ZHSA 3BM9A 4EGKA 4YIOA 2UUBO 2UUBB 5B1BB 1N34B 1N34O 4I50A 2CDYA 4YHHO 4YHHB 4FLTA 2P5OA 1K5QA 5D6QA 3ZHTA 4X66O 1BHBA 3K9AA 2IOQA 4XDKA 3ETGA 1Y76B 2Q8HA 2YKBA 3K08A 2E5LB 2JGDB 1OCRB 5D5PA 3E8GA 2LP7A 4AS9A 1LNQA 1KC8W 2YE6A 2E75B 4XKAA 1VQLV 4LH7A 3WQ9A 2AHYA 5IYZB 4JTDB 4O4HA 1N0NA 3HKBA 2YE9A 1U2OA 1HNWB 1HNWO 5KHJA 4MP2A 2YXLA 4R50A 3KCYA 1U96A 5EIBD 4ASAA 1SC5B 2CE4A 2WLIA 5IE9A 4FCRA 3ASOB 2Z3YA 4FFBA 1KU9A 4P30A 4B08A 4CWOA 2H3OA 1GN3A 2OIGA 5K1XA 1N36B 1VQKV 2QWQB 4JI3O 4JI3B 4PI0A 5LL6Y 3T1CA 4ZHQB 3OMAB 3CCQV 3MHSC 3RFRA 4XIQA 1YETA 4P9OA 3OTOB 1WNSA 4PDRA 5JH7B 1G4YB 4O05A 4TV8A 4PHZA 4O2AB 2B9ZA 2ATKC 4DO2A 1YZBA 4JF3A 4RUEA 2K5BA 2F66C 5L3GA 2YECA 4DUZO 4LF5O 1S77D 1XHZA 4RWUA 4MVSA 1LR1A 2Q8GA 4JV5B 4JV5O 4DUHA 1YC3A 3K5LA 1H2LA 1K5SA 4LF7B 4X20B 1S76D 3RYIA 4TV9B 3RVYA 2YUAA 2VWCA 4X65O 4X65B 1M9NA 1W2BU 2W0FC 3SYOA 2BE3A 1KIJA 5CPHA 3X2QB 4B3TO 4B3TB 5ITZB 4PA9A 4R3MA 2FMLA 4FLYA 2UXCB 2UXCO 2Q67A 5L3DA 3E22B 3ZHQA 5GTIZ 2YI5A 4LWEA 2F1MA 1ZL8A 2CH7A 1I5CA 2Q68A 4EFTA 1R3JC 4FMTA 2VCJA 1XMOB 1XMOO 2ZCEA 2DQ0A 3HKCB 5F5RA 3U0ZA 4P9PA 4B3SB 4JYAB 3T1YO 3CX5F 1M93A 4W4KA 3CRCA 2ZIOA 4CH6A 1JMKC 3SL2A 5C8YB 2Y4UA 1UY7A 1UYLA 4HZ3A 4LWHA 3ETQA 4LFAO 4LFAB 3TXQA 2D3OW 1VF7A 5FNVB 1Q5OA 3R65A 2YE4A 3VHCA 1FFXB 3AEIA 2PNRA 4PA3A 3JASB 2YEJA 2F43G 2CTQA 5F2VO 4AWQA 4XKKA 4CWPA 1K33A 1KZNA 1NHHA 1GKXA 2WA4A 3C3SA 2XAGA 4ASGA 2WLLB 1VMGA 2QKAA 4XDJA 1UJWB 4HY1A 1K34A 1E79G 2OTLV 1YF2A 3SJQC 3EHGA 1CXZB 1R6TA 3SPCA 1FXKA 4GX2A 1Y74B 1I7FA 5KA5A 3AG1B 2WLMA 4AWPA 4I4TA 3UO2A 1BT8A 2GBOA 4K3AA 3FKSG 2DMXA 4GX5A 1XNQB 5E1AC 1MOFA 5GW7A 1EA6A 4O4LB 2QEXV 1NR1A 2XOKG 3OMIB 5IY5B 1SERA 3LMMA 3PN1A 1YI2V 5DEDA 2R70A 1WB8A 3P3PA 2YICA 4QE9A 2WSSG 2LO1A 2WAMA 2XNDG 4DV7B 4GKKB 3B77A 2BU2A 4H81A 1T5EA 4KHPO 1NT2B 2X7RB 4AWOA 1YVWA 3B26A 1TUEB 4UVAA 1BS3A 4ZIBA 1NVPD 3OGCC 4EGHA 2QTOA 4HNAB 3L72H 3BAAA 5M4PA 1ZUQA 1UYFA 4O4IA 2ETNA 2H8MA 4JI4O 4JI4B 1IZ3A 4IHJA 2YEIA 4O4HB 3SGIA 1HNZO 1HNZB 3HKBB 3VBBA 4ASBA 2Q0OC 4X9QA 3K98A 3CCMV 2Q4PA 4JZGA 4TSFG 2YKEA 3CGZA 1WPXA 2ITDC 4XITA 1HDJA 4K8ZA 4I55A 4O09A 3TETA 4JTCB 3FT8A 2JEUA 3CSXA 2BREA 2CTRA 2VWJA 4DR2B 4DR2O 5CTXA 3AG3B 3IFXA 2A0LA 1RFYA 2WA3A 1KQSU 5H9CA 1FAFA 2RCVA 4CE3A 4FLUA 4FM1A 1YERA 2R9RB 3JAWB 4F6RB 5GTHZ 4WFEA 1K8AW 4E2LA 3DTUB 4E72A 3IC7A 5H5NA 3OEHG 3ZN1A 2O1VA 1PVGA 2F23A 1ROPA 3R4OA 1TH8A 2BRCA 2QFOA 2BU5A 3BEHA 2WI5A 4WFFA 3C90A 4OPHA 1Q81W 1F51A 1MABG 1WLEA 4X1YA 1UYGA 5J2TB 1MX0A 1A4HA 2XASA 5KX5A 3ZRSA 3I55V 2E74B 3KE6A 1Z5WA 3HKEB 4PDLA 4O0BA 5IJ0A 3ABKC 1N33O 1QVFU 4AILC 4IIJA 1SQPH 1R3KC 4LCUC 2Y4TA 2IM9A 2BSMA 1ZW9A 1JJOA 1ZL8B 3CB2A 1JQ0A 4WF9V 3K79A 3INXA 4EFEA 3DXRB 1L0LH 4BIOA 2GTSA 1UY8A 1THZA 2EILC 3K0DA 4O4JA 5J9PC 4H13B 3BCCH 1BGQA 5GGZA 2YIBD 2G38A 2N04A 2HG5C 3HKDB 2RNBA 1KECA 2YJXA 5J71A 3K60A 1B06A 4K35A 4XBFA 3ZMTA 3OR7C 4O2BA 5L3CA 3BVOA 4DRXB 1TIDA 1OSFA 1SA0B 2PI5A 3H1IH 4MSWC 4HXWA 4XTJA 4R1FA 5JQGB 4HYPA 4WCEV 3FB6C 4KXRA 1XQ8A 4X89A 5EC1C 2IJJA 2LGQA 2YI6A 1O9HA 2IWUA 4EM7A 1WB7A 3QG5A 1MZEA 3FX7A 1ZAUA 2NNUA
chains in the Genus database with same CATH topology
1W0KG 3CC2V 1DF5A 2OCCC 2AKPA 4MW8A 2GHYA 4L94A 2YE2A 1YJ9V 3B27A 2EIMC 4E02A 4U7OA 2V1DA 4LP0A 3LDEA 3K06A 2A79B 4UXNA 1S72V 4X9LA 2NLJC 3CPWU 1GK9A 3OMNB 5BODA 3ZN0A 5H6QA 2XDUA 1K73W 4K4OA 3TUHA 5L3BA 2Q69A 2XJXA 4UV8A 3K04A 3QO5A 4CWTA 4FCQA 4MPEA 3BMYA 5CMUA 3R4NA 4B6CA 1YTFD 4MPNA 1YS3A 2DWDC 1M1KW 2ZR3A 2WPDG 2XHRA 4CWRA 3ABUA 2YSUB 5B1OA 4GGLA 2XX2A 1Y4UA 3W7WA 3OE7G 4KSHA 4NH7A 3T0ZA 3QTFA 2IU0A 4ASFA 1EBOA 3ML0A 1YC4A 1K4DC 5CTWA 1F4NA 3LNUA 1AMWA 3ASNC 5B1NA 2IOPA 3GWOA 1OHHG 2A9HA 3CRKA 5CBFA 5F3KA 2V7QG 2XAHA 1OCOC 1R3IC 3K97A 1CP9A 1KD1W 4HYOA 3G75A 5CTYA 1K92A 1PL0A 5D7DA 4HY6A 1US7A 3SPGA 3ABMC 3E8FA 3CCUV 3E35A 4KUMA 2OTJV 1TC6A 3K3WA 2HR3A 1I5AA 4WUDA 3C0EA 1CEZA 2AHZA 4JQLA 1F23A 3ZM7A 3RLRA 3K99A 3GIGA 2ZKJA 2VCIA 1JPXA 1R6NA 1AI6A 3Q5LA 4I9WA 1OCCC 5IYCO 1H7UA 3WG7C 1H7SA 4GFNA 2YEEA 4O04A 2Y69C 4EKWA 4YKZA 4WFAV 4RQEA 2ITCC 5DM6V 1L1FA 4BQGA 2HKOA 4GX0A 3HZ5A 4WUBA 4E01A 3ABLC 3A0RA 2IWXA 3H01A 3CMAV 5J6AA 3LSQA 1VQPV 2ZDIC 5D7RA 5KUMA 2YEBA 1NKDA 2QM8A 5EK0A 3K03A 1RM1C 1NH2B 2M7WA 3SYPA 3OFNG 3LDDA 1QR8A 2IWSA 1RPOA 2XJJA 2HJFC 1Z5AA 4MVRA 4FCPA 4O07A 1BL8A 2EZOA 3A0YA 4U93A 4PA4A 4MVMA 1NR7A 4N21A 3A0XA 2OCCB 3G4SV 2ZD9A 1AJPA 2WEPA 5FNFA 2WEQA 2ZDIA 2EIMB 1NBMG 2O1WA 2R9IA 2X6CA 4BAEA 3RVZA 4JTAB 1I5BA 4RO2A 5KUKA 1M90W 3HZ1A 3EHHA 4HYMA 1L0OA 5D6PA 2Y48A 2FXSA 3Q5JA 4MTFA 3VOUA 1AH8A 3TZ4A 2LFRA 3JD4A 2XDSA 5B3SC 2Z5UA 3A0ZA 3G7BA 1V54C 3STZC 1B62A 2QG2A 3TTZA 2X6BA 4P8OA 3G6EV 5HFLA 3CCLV 2XCMA 3ZRWB 4UVBA 2XJGA 3T4DA 1NJIW 2W6IG 1DTOA 2H55A 3EKRA 2YEHA 3ASNB 2QKSA 1AH6A 3HYZA 4MTXA 1F4MA 3JYCA 1FXKC 2EZPA 2JJ2G 3RKZA 4CWQA 2EIJC 1UYKA 1OCOB 2WERA 3G7EA 2EXLA 2DQ3A 1I58A 1JJ2U 5IYBO 1TC0A 3CP1A 4PRVA 2DYRC 3IGAC 4MOTA 3HPLC 3ABMB 2H94A 4W7TA 1S14A 3FT5A 3CGYA 3ZMVA 3PEJA 4GQTA 2YEFA 2YEVA 1Q82W 1K7DA 4R3AA 2IH1C 3M99B 2QF6A 1OCCB 3PJSK 3RBZA 1THNA 3H80A 3WG7B 2YEGA 4FPPA 4DZYA 3EHBB 2H8PC 3ZKDA 3OEEG 2XAFA 4LWGA 2BOCC 3DGEA 2QA4V 4EGIA 3F5WC 1SETA 4MVUA 4QPKA 2BTZA 3ABLB 1NHIA 5H6RA 3B28A 4XIRA 4KFMA 1AI7A 4I3HA 3INWA 1YSZA 3E89A 1VQ9V 2WLIB 1ENVA 4R8CA 1JX9A 4F4LA 1YJNV 1HWYA 4KQVA 1RM1B 1YESA 4LC1A 3RLQA 1FXHA 3ZCCA 1QVGU 2CG9A 5IDMA 3A0WA 1JVMA 4PA7A 2XHXA 4BW5A 3MD0A 3E83A 1Z59A 3SPHA 3VHAA 4PELA 2BYIA 4NH9A 2IU3A 1U0ZA 4MVOA 3TZ2A 2YK9A 1UYHA 2X6AA 2ZR2A 2UXNA 2HFEC 2JJCA 1BHAA 4RAIA 4H37A 4L91A 3CCVV 3FYIB 3OM3B 2XABA 2YE7A 1KP2A 1EZJA 1VQOV 4XKOA 4EMVA 5B3SB 2HCHA 2HVKC 3JCZA 3LDCA 1V54B 1J95A 2EINC 1M57C 4L90A 1VQ6V 3OUFA 4CWNA 3EHJA 4BIZA 4G2KA 3CXCU 3ZMUA 2BU6A 2YK2A 4URMA 1FXVA 2XDKA 1FXKB 1I5YA 1I59A 1VQ4V 4BIUA 2EIJB 5DN6G 3O0IA 3WHAA 3E86A 3JD0A 1TBWA 3T2MA 2YKCA 4YKUA 3HHUA 2Q8IA 1H38A 1GM8A 2BT0A 4LP8A 2DYRB 2WI3A 3B25A 2KB1A 2XD6A 3ASOC 1E1RG 1SESA 2XAJA 3SPIA 1YSCA 3E2EA 2MK3A 5M4NA 1VQ7V 1R3LC 4WFBV 2YGAA 5B1AC 5C93A 1YITV 2YEAA 3W7UA 3OR6C 4MB9A 4FJCC 2IJHA 1YJWV 3JD3A 4CWFA 1I5XA 3CC4V 4X88A 3X2QC 3ZMZA 3T1KA 4PRXA 1S5HC 1ID0A 1UYDA 1GJVA 4YXWG 2IJIA 2WWWA 3TCUA 4YKRA 4ZBMA 5IYDO 3KG2A 4MS2A 4GT1A 3R4PA 4LWFA 2QE7G 3ABTA 2ZDYA 4YKQA 5L3EA 5CN0A 2Q6AA 1QZRA 2EBOA 5BZBA 2HG1A 5FWKA 3VHDA 3MHHC 4CBCA 1S16A 4ASUG 4HAMA 3B8NA 2P7TC 2ZBKB 2JIZG 3UKMA 1YIJV 3QO7A 1NQTA 1QBZA 2WLNA 4GT8A 2BU8A 2QG0A 3ZRXA 3CCSV 4MTOA 4XDMA 1PNMA 3RLPA 2YKJA 4L8ZA 1VQNV 3OWDA 3JD1A 4URNA 2YE8A 4JAUA 3OW2U 2WI7A 4QE7A 3EFFK 3ZMSA 4YKYA 3O6OA 1YT2A 3ABKB 2WI4A 2HLDG 2BOBC 1UYEA 1SRYA 4UV9A 3CCJV 4KSGA 1I5DA 2EILB 2ESAA 1AJ6A 3I56V 3QDDA 1NH2D 4Q20A 3UM7A 3R92A 2WLLA 1H2GA 4ZKIA 2EJRA 4WUCA 4LBEC 4XIPA 4XE2A 2EINB 1M57B 2BYHA 3T10A 4YKXA 4CZZA 4XCJA 3CMEV 1ZXMA 1YT0A 2IORA 4QNHB 5LHHA 5L3FA 1DF4A 3GIFA 3U67A 4MPCA 2WLHA 4BAYA 4EEHA 3OW6A 5FNCA 4TT3G 3TZ5A 2YI7A 5IN9A 1FS0G 2ZDXA 2B1GA 3ZXQA 3C11A 4WFHA 4KTNA 4N23A 4LWIA 3OPDA 3E8BA 1AJQA 2XX5A 3H4LA 5M4MA 3VADA 4NH8A 2GQPA 2DYSC 1GMGA 5KA6A 2OT5A 1M56C 1Z5BA 3OMUA 2ZXWC 1UY6A 4CWSA 1YSRA 5IDJA 4JGSA 4EFUA 2CGFA 1MSWD 3CCEV 1YT1A 5B1AB 1AR1B 2WLKA 1ORQC 5CA3A 1ZXNA 2YKIA 3LSSA 5EBWC 3GIGB 3CD6V 2B5UA 5LGUA 4XD8A 2QM7A 1B63A 4HZ0A 3FV5A 1Y4SA 2YJWA 5LGTA 2BU7A 3R4MA 2O1UA 1B6QA 3AG4C 3BY6A 3P30A 2YE5A 4CE2A 4MP7A 4PDVA 1JOYA 3T4ZA 2UWDA 5LBQA 3PEHA 1K3EA 5M4EA 3F7VC 1BMFG 1UYCA 1IXMA 3WFVA 3LUTB 2UXXA 3CYOA 3Q5KA 1QYEA 2IJKA 1AI5A 1GM7A 4G27B 1GKFA 5CBGA 4GEEA 1P7BA 1B3QA 4B7PA 5BOCA 3B8MA 4L93A 3TK1A 3U2DA 1XL6A 2LFSA 1XL4A 1AM1A 2XDLA 2Y69B 1V55C 4WFGA 1G8MA 3IEDA 1GTOA 1ZWIC 1Q86W 1QCEA 1K97A 2FWYA 5M4HA 2YE3A 2IH3C 1UYIA 4UROA 3W7TA 4GCZA 1R73A 2HKJA 1PKXA 4JYCA 2EIKC 1AI4A 1NVPB 1R62A 1FFTB 3HYYA 2JDIG 2JEXA 3HEKA 4JPRA 3ZIAG 3R91A 2JKIA 2XDXA 4OXSA 4R6ZA 3FB5C 2Q8FA 2FWZA 1K4CC 5FL7G 1DLBA 4RQFA 4FK5C 4QJFB 4KFGA 1Y4MA 4V25A 4Z1MG 1Y66A 3ZKBA 4MVZA 2GSMB 4FIPC 4L87A 4X8AA 2YEDA 1KP3A 4J9YB 3GB7C 3CC7V 4CE1A 2IW5A 1KKDA 5D7CA 1S3JA 2K1EA 2YGFA 4LPBA 4XDLA 4TWKA 5EBMC 1OCZC 2FTKA 2DYSB 3D0BA 1S0VA 3NMQA 5EC2C 5FNDA 3FB7C 1M56B 2ZXWB 3FB8C 3LNMB 2JJ1G 4XCLA 4P7AA 1UYMA 4PA6A 1QLEC 3AG2C 2CCUA 4HXZA 5M4KA 1N8RW 3W7SA 4I5SA 1JM6A 3OWBA 3W7XA 5B1BC 2YEVB 1QLNA 3STLC 1EFRG 2ZQMA 4QPJA 4YKTA 1OCRC 4KP4A 2CCTA 3E8HA 1PD3A 3MNRP 4BXIA 3SYCA 4V26A 1H8HG 3AG4B 4ZVIA 3T2SA 1H8EG 1P4RA 1QR9A 4U7NA 4UVCA 3CWVA 1JCHA 4MT8A 5EBLC 3G71V 1BYQA 1NHJA 1Q7YW 2P6JA 2CH4A 2XK2A 3CCRV 2XAQA 4MW3A 4R7CA 3ETEA 4H85A 4PL9A 3ZXOA 1COWG 2P67A 1V55B 1SZTA 3TZ0A 1MG1A 1YTFB 3A0TA 3JD2A 2YGEA 3D3IA 2HVJC 2WI2A 1PNLA 2PI4A 3U2KA 4URLA 1YHQV 2WLJA 4H7QA 4E00A 1GO3F 5LGNA 1YC1A 4JYBA 5LHIA 1K9MW 5LHGA 5CTUA 3P32A 3ZJZA 3NXSA 4G28B 4YKWA 1AJNA 2P90A 1VQMV 5HFMA 3GIEA 2C2AA 2EIKB 3SYAA 3QNEA 3EKOA 4BQJA 3LPSA 3FYEB 3B24A 2GFDA 2VW5A 2XHTA 3ZRWA 3F7YC 4GX1A 4J9ZB 2B1IA 1Y8NA 3ETDA 1Y8PA 3ZRVA 3D2RA 3K0GA 3RW0A 4MTGA 1MU5A 1R6KA 1VQ8V 3D36A 1TILA 2W6JG 3AG1C 4RUFA 1BXDA 1W0JG 4HZ5A 1QY8A 2Q2EB 1Z5CA 2XX4A 4H33A 4QIWF 4PDMA 3CRLA 2WI1A 5IY5C 3OAAG 4DXWA 3SYQA 4JASA 4JAVA 1GKZA 5CBHA 3JZ3A 2WI6A 1EI1A 5CF0A 1OCZB 2DW4A 1OZ0A 2BZ5A 1RPRA 1CPYA 3HB3B 4MVQA 2E0AA 1AROP 4P2ZA 1Y8OA 1ZWHA 5L3JA 2FYPA 4PU9A 4UUJC 2YI0A 4XC0A 1QLEB 3AG2B 2CCSA 2DWEC 4MBCA 1E1QG 3SPJA 3EHFA 2CK3G 2X0LA 2JK5C 3OUSA 1BKNA 1UY9A 3O2FA 3T0HA 1PNKA 1VQ5V 3QO8A 1GM9A 3AG3C 3BM9A 4EGKA 5B1BB 1K5QA 5D6QA 1BHBA 3K9AA 2IOQA 4XDKA 3ETGA 2Q8HA 2YKBA 3K08A 1OCRB 3E8GA 2LP7A 4AS9A 1LNQA 1KC8W 2YE6A 4XKAA 1VQLV 3WQ9A 2AHYA 4JTDB 2YE9A 1U2OA 4MP2A 4R50A 4ASAA 2WLIA 4FCRA 3ASOB 2Z3YA 4P30A 4CWOA 1VQKV 3T1CA 3OMAB 4XIQA 3MHSC 3CCQV 1YETA 4P9OA 4PDRA 1G4YB 4O05A 2ATKC 4DO2A 4JF3A 4RUEA 2K5BA 5L3GA 2YECA 1S77D 4MVSA 2Q8GA 4DUHA 1YC3A 1K5SA 1S76D 3RVYA 2VWCA 1M9NA 1W2BU 2W0FC 3SYOA 1KIJA 5CPHA 3X2QB 4PA9A 4R3MA 2Q67A 5L3DA 2YI5A 4LWEA 1I5CA 2Q68A 4EFTA 1R3JC 4FMTA 2VCJA 2DQ0A 5F5RA 4P9PA 3SL2A 1UY7A 1UYLA 4HZ3A 4LWHA 2D3OW 3R65A 3VHCA 2YE4A 3AEIA 2PNRA 4PA3A 2YEJA 2F43G 4AWQA 4XKKA 4CWPA 1K33A 1KZNA 1NHHA 1GKXA 2XAGA 4ASGA 2WLLB 4XDJA 1UJWB 4HY1A 1K34A 1E79G 2OTLV 3SJQC 3EHGA 3SPCA 1FXKA 4GX2A 5KA5A 3AG1B 2WLMA 4AWPA 3FKSG 4GX5A 5E1AC 1MOFA 5GW7A 1EA6A 2QEXV 1NR1A 2XOKG 3OMIB 5IY5B 1SERA 1YI2V 4QE9A 2WSSG 2WAMA 2XNDG 2BU2A 3B77A 4H81A 2X7RB 4AWOA 3B26A 1TUEB 4UVAA 1NVPD 3OGCC 4EGHA 2QTOA 5M4PA 1UYFA 2H8MA 2YEIA 3VBBA 4ASBA 3K98A 3CCMV 4TSFG 3CGZA 2YKEA 1WPXA 4XITA 4O09A 3TETA 4JTCB 3FT8A 2JEUA 2BREA 5CTXA 3AG3B 3IFXA 2A0LA 1KQSU 5H9CA 4CE3A 1YERA 2R9RB 4WFEA 1K8AW 4E2LA 3DTUB 3IC7A 3OEHG 3ZN1A 2O1VA 1PVGA 1ROPA 3R4OA 1TH8A 2BRCA 2QFOA 2BU5A 3BEHA 2WI5A 4WFFA 1Q81W 1F51A 1MABG 1WLEA 1UYGA 1MX0A 1A4HA 2XASA 3ZRSA 3I55V 3KE6A 4PDLA 4O0BA 3ABKC 1QVFU 1R3KC 4LCUC 2BSMA 1ZW9A 4WF9V 1JQ0A 3K79A 3INXA 1UY8A 1THZA 2EILC 3K0DA 5J9PC 1BGQA 5GGZA 2HG5C 1KECA 2YJXA 5J71A 3K60A 4XBFA 3ZMTA 3OR7C 5L3CA 1TIDA 1OSFA 2PI5A 4MSWC 4HXWA 4XTJA 4R1FA 4HYPA 4WCEV 3FB6C 4X89A 5EC1C 2IJJA 2YI6A 2IWUA 4EM7A 2ITDC 2NNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MU5 A;  4EFU A;  2CGF A;  1NHI A;  2AKP A;  3B28 A;  4XIR A;  3D36 A;  1TIL A;  4L94 A;  2YE2 A;  3B27 A;  1BXD A;  4E02 A;  4U7O A;  1YT1 A;  4HZ5 A;  4LP0 A;  1QY8 A;  2Q2E B;  4X9L A;  4I3H A;  3INW A;  1Z5C A;  2XX4 A;  1YSZ A;  3CRL A;  1ZXN A;  2YKI A;  2WI1 A;  5BOD A;  4JAS A;  4JAV A;  1GKZ A;  4KQV A;  1YES A;  4LC1 A;  3JZ3 A;  2XDU A;  2WI6 A;  1EI1 A;  3RLQ A;  3GIG B;  4K4O A;  5CF0 A;  3TUH A;  3ZCC A;  4XD8 A;  2QM7 A;  2XJX A;  1B63 A;  2BZ5 A;  4HZ0 A;  2CG9 A;  3FV5 A;  1Y4S A;  2YJW A;  2E0A A;  4CWT A;  5IDM A;  1ZWH A;  3A0W A;  1Y8O A;  4FCQ A;  3BMY A;  4MPE A;  5L3J A;  3R4N A;  2FYP A;  4PU9 A;  2XHX A;  4B6C A;  2YI0 A;  4XC0 A;  2BU7 A;  3R4M A;  3MD0 A;  4MPN A;  1YS3 A;  2O1U A;  1Z59 A;  2CCS A;  2YE5 A;  4CE2 A;  3VHA A;  2XHR A;  4CWR A;  4GGL A;  4MBC A;  5B1O A;  4MP7 A;  2XX2 A;  1Y4U A;  1JOY A;  2BYI A;  4NH9 A;  3EHF A;  1U0Z A;  2UWD A;  4KSH A;  4NH7 A;  3PEH A;  1BKN A;  3T0Z A;  3QTF A;  1UY9 A;  3O2F A;  5M4E A;  3T0H A;  3TZ2 A;  4ASF A;  2YK9 A;  1UYH A;  1YC4 A;  5CTW A;  3LNU A;  1AMW A;  1UYC A;  1IXM A;  5B1N A;  2JJC A;  3BM9 A;  4EGK A;  3Q5K A;  1QYE A;  4L91 A;  2IOP A;  5D6Q A;  2XAB A;  2IOQ A;  2YE7 A;  3CRK A;  5F3K A;  2Q8H A;  2YKB A;  4GEE A;  3K97 A;  4XKO A;  1B3Q A;  4B7P A;  5BOC A;  3G75 A;  5CTY A;  4AS9 A;  4EMV A;  4L93 A;  2HCH A;  3TK1 A;  2YE6 A;  5D7D A;  3U2D A;  4XKA A;  2LFS A;  4HY6 A;  1US7 A;  1AM1 A;  2XDL A;  3WQ9 A;  3IED A;  4L90 A;  2YE9 A;  1U2O A;  4MP2 A;  4CWN A;  3EHJ A;  4BIZ A;  1TC6 A;  4ASA A;  2FWY A;  5M4H A;  2YE3 A;  1I5A A;  4FCR A;  1UYI A;  4WUD A;  3C0E A;  2BU6 A;  4CWO A;  2YK2 A;  4URM A;  4URO A;  4JQL A;  3ZM7 A;  3RLR A;  4GCZ A;  2XDK A;  3K99 A;  2HKJ A;  3GIG A;  2ZKJ A;  2VCI A;  4XIQ A;  1YET A;  4JYC A;  1I59 A;  4O05 A;  4BIU A;  3Q5L A;  3O0I A;  1H7U A;  3WHA A;  1TBW A;  2K5B A;  1H7S A;  2YKC A;  4GFN A;  2YEC A;  2YEE A;  4YKU A;  3HHU A;  1R62 A;  2Q8I A;  4O04 A;  2Q8G A;  4DUH A;  1YC3 A;  3HYY A;  4YKZ A;  2BT0 A;  2WI3 A;  3B25 A;  2VWC A;  3HEK A;  4BQG A;  3R91 A;  2JKI A;  2XD6 A;  2XDX A;  1KIJ A;  5CPH A;  3HZ5 A;  4R3M A;  4WUB A;  4E01 A;  2Q8F A;  2YI5 A;  2FWZ A;  4LWE A;  3A0R A;  2IWX A;  1I5C A;  5J6A A;  4EFT A;  4FMT A;  5M4N A;  2VCJ A;  2YGA A;  5D7R A;  4KFG A;  2YEB A;  5F5R A;  4V25 A;  5C93 A;  3ZKB A;  2QM8 A;  2YEA A;  2YED A;  3SL2 A;  4MB9 A;  4CE1 A;  1UY7 A;  1UYL A;  4LWH A;  5D7C A;  4CWF A;  2IWS A;  3VHC A;  2YE4 A;  2YGF A;  4LPB A;  2PNR A;  2XJJ A;  2YEJ A;  2FTK A;  1Z5A A;  4AWQ A;  4XKK A;  3T1K A;  4CWP A;  4FCP A;  4PRX A;  1ID0 A;  1KZN A;  1NHH A;  1UYD A;  3D0B A;  1GJV A;  4O07 A;  2WWW A;  3NMQ A;  5FND A;  1GKX A;  4YKR A;  3A0Y A;  4U93 A;  4XCL A;  4P7A A;  4ASG A;  4GT1 A;  3R4P A;  1UYM A;  3A0X A;  4HY1 A;  4LWF A;  2WEP A;  3EHG A;  5FNF A;  2CCU A;  4HXZ A;  2WEQ A;  5M4K A;  4AWP A;  2ZDY A;  4YKQ A;  1QZR A;  2O1W A;  4I5S A;  4BAE A;  2HG1 A;  1JM6 A;  1EA6 A;  5FWK A;  3VHD A;  1I5B A;  3OWB A;  3HZ1 A;  1S16 A;  2ZBK B;  3EHH A;  4HYM A;  1L0O A;  2BU2 A;  4H81 A;  5D6P A;  4GT8 A;  2FXS A;  2BU8 A;  3Q5J A;  2QG0 A;  3ZRX A;  4AWO A;  4QPJ A;  3B26 A;  4YKT A;  4EGH A;  4KP4 A;  1AH8 A;  4XDM A;  3TZ4 A;  2CCT A;  2LFR A;  3RLP A;  5M4P A;  1UYF A;  2XDS A;  2YKJ A;  4L8Z A;  2H8M A;  3A0Z A;  3MNR P;  4BXI A;  3G7B A;  4V26 A;  3OWD A;  1B62 A;  2QG2 A;  2YEI A;  4URN A;  3TTZ A;  2YE8 A;  4ASB A;  4P8O A;  4JAU A;  2WI7 A;  4ZVI A;  3T2S A;  3K98 A;  2XCM A;  3ZRW B;  3CGZ A;  2YKE A;  4U7N A;  2XJG A;  4XIT A;  3CWV A;  4YKY A;  3O6O A;  1YT2 A;  4O09 A;  2H55 A;  3FT8 A;  2WI4 A;  3EKR A;  2YEH A;  4MT8 A;  1UYE A;  1BYQ A;  2BRE A;  1NHJ A;  3HYZ A;  1AH6 A;  5CTX A;  4MTX A;  2CH4 A;  4KSG A;  3RKZ A;  4CE3 A;  2XK2 A;  1YER A;  4CWQ A;  1I5D A;  2ESA A;  1AJ6 A;  1UYK A;  2O1V A;  1PVG A;  3QDD A;  2WER A;  3R4O A;  3G7E A;  2EXL A;  4H85 A;  4Q20 A;  1TH8 A;  2BRC A;  3R92 A;  1I58 A;  2QFO A;  2BU5 A;  4ZKI A;  2WI5 A;  4PL9 A;  4WUC A;  4XIP A;  3ZXO A;  2P67 A;  1F51 A;  1TC0 A;  1UYG A;  4PRV A;  4XE2 A;  1MX0 A;  4MOT A;  1A4H A;  3TZ0 A;  2BYH A;  3A0T A;  3T10 A;  4YKX A;  2YGE A;  4XCJ A;  1ZXM A;  3KE6 A;  1YT0 A;  4W7T A;  2WI2 A;  4O0B A;  1S14 A;  3U2K A;  3FT5 A;  2IOR A;  4URL A;  3CGY A;  4E00 A;  4H7Q A;  3GIF A;  1YC1 A;  2BSM A;  3PEJ A;  1ZW9 A;  4JYB A;  3U67 A;  3INX A;  4GQT A;  4MPC A;  2YEF A;  4EEH A;  5CTU A;  3P32 A;  3OW6 A;  3NXS A;  5FNC A;  4YKW A;  1UY8 A;  3TZ5 A;  4R3A A;  2YI7 A;  5IN9 A;  1BGQ A;  5GGZ A;  2ZDX A;  3ZXQ A;  2QF6 A;  3GIE A;  3C11 A;  1THN A;  2YJX A;  4KTN A;  5J71 A;  3K60 A;  4LWI A;  3H80 A;  2C2A A;  3OPD A;  2YEG A;  4FPP A;  4DZY A;  3EKO A;  4BQJ A;  1TID A;  1OSF A;  3ZKD A;  2XX5 A;  4LWG A;  3LPS A;  3DGE A;  3H4L A;  4HXW A;  4XTJ A;  3B24 A;  4R1F A;  5M4M A;  2GFD A;  3VAD A;  4EGI A;  4HYP A;  2VW5 A;  4NH8 A;  2GQP A;  2XHT A;  3ZRW A;  2YI6 A;  2IWU A;  1Y8N A;  4EM7 A;  1Y8P A;  1Z5B A;  4QPK A;  3ZRV A;  1UY6 A;  3D2R A;  2BTZ A;  3OMU A;  4CWS A;  1YSR A;  5IDJ A; 
#chains in the Genus database with same CATH topology
 1W0K G;  2Q7E A;  3CC2 V;  2F95 B;  1DF5 A;  2OCC C;  2AKP A;  4MW8 A;  2GHY A;  4L94 A;  2YE2 A;  1YJ9 V;  4X1K B;  3B27 A;  2EIM C;  4E02 A;  4U7O A;  2V1D A;  3UCS C;  4LP0 A;  3LDE A;  2HHH O;  2HHH B;  3K06 A;  2A79 B;  4UXN A;  1S72 V;  4X9L A;  2NLJ C;  1MZF A;  3CPW U;  1GK9 A;  4NYK A;  3QTC A;  5TIS Z;  3OMN B;  5BOD A;  3JAM N;  4OGQ B;  3ZN0 A;  5H6Q A;  5JWP A;  3CRR A;  2XDU A;  4UCU A;  1K73 W;  1VIB A;  4K4O A;  4FLW A;  3TUH A;  4ZI7 A;  5L3B A;  2Q69 A;  2XJX A;  4UV8 A;  1FD9 A;  3BPZ A;  3RYF A;  4Z1V A;  3K04 A;  3QO5 A;  5CB4 B;  4JI7 O;  4JI7 B;  3ZED A;  4CWT A;  4FCQ A;  4MPE A;  3BMY A;  5CMU A;  3R4N A;  1XMQ B;  2AGA A;  4B6C A;  4YJ2 A;  1YTF D;  4MPN A;  1YS3 A;  2DWD C;  1M1K W;  2ADQ B;  2ZR3 A;  2WPD G;  2XHR A;  4CWR A;  2YSU B;  3ABU A;  5B1O A;  4B3M B;  4F6E A;  4B3M O;  4GGL A;  2XX2 A;  1Y4U A;  2YS8 A;  3W7W A;  5GON A;  3OE7 G;  4KSH A;  4NH7 A;  3QVN A;  3T0Z A;  1VAR A;  2IU0 A;  2ODM A;  3JAT A;  3QTF A;  4ASF A;  1EBO A;  3ML0 A;  1YC4 A;  1K4D C;  5CTW A;  1F4N A;  3LNU A;  1AMW A;  3ASN C;  5B1N A;  2KKW A;  2HP8 A;  4J7K A;  3D36 C;  4DV3 O;  4DV3 B;  4DV5 O;  4DV5 B;  2IOP A;  1Y67 A;  3GWO A;  1OHH G;  2BSK A;  2A9H A;  3CRK A;  5CBF A;  4NVP A;  3H1K H;  5F3K A;  1WP7 A;  2V7Q G;  5CA1 B;  2XAH A;  1OCO C;  1R3I C;  3K97 A;  2VQF O;  4OX9 O;  1CP9 A;  1KD1 W;  1NTZ H;  4HYO A;  3G75 A;  4B3R B;  4B3R O;  1K92 A;  2NN4 A;  2VRZ A;  5CTY A;  1PL0 A;  5D7D A;  4HY6 A;  4X1Y B;  1US7 A;  4B7E A;  3SPG A;  3RT3 C;  2KG7 A;  4DUY O;  1BSM A;  1L8D A;  3ABM C;  5JVD A;  3E8F A;  1VP7 A;  3CCU V;  3E35 A;  4KUM A;  2OTJ V;  1TC6 A;  3M8A A;  3K3W A;  2HR3 A;  1I5A A;  4EB6 A;  3APO A;  4WUD A;  3C0E A;  2QM4 A;  4DW0 A;  1CEZ A;  2AHZ A;  2YI8 A;  5DEC A;  5KHI A;  2QGN A;  4JQL A;  5LA6 B;  1JA8 A;  1F23 A;  3ZM7 A;  3RLR A;  3JSL A;  3K99 A;  1X4T A;  5K1P A;  3GIG A;  2ZKJ A;  2VCI A;  1JPX A;  1R6N A;  1AI6 A;  3IAY A;  5BR8 O;  5BR8 B;  5AG2 A;  2PF4 E;  4B7K A;  3Q5L A;  4I9W A;  1OCC C;  2ZIN A;  5IYC O;  2CGN A;  1H7U A;  4DYL A;  3WG7 C;  4X1I B;  1H7S A;  3A0B Z;  4GFN A;  1P84 F;  2YEE A;  2GUZ A;  1FJG B;  4O04 A;  4K0K B;  1XNR B;  1XNR O;  4K0K O;  1HP8 A;  3BFR A;  2Y69 C;  4EKW A;  4YKZ A;  4LNU A;  4WFA V;  4RQE A;  4X64 B;  5KLV H;  2ITC C;  2JS5 A;  5DM6 V;  1IBM O;  1L1F A;  1IBM B;  2HKO A;  4BQG A;  1MMM A;  3G6B A;  4GX0 A;  2DE0 X;  4IGG A;  3HZ5 A;  4WUB A;  4E01 A;  1AVM A;  1XOU A;  3C3T A;  4DR6 O;  4DR6 B;  2JRI A;  3ABL C;  3A0R A;  2IWX A;  2LW1 A;  3H01 A;  3CMA V;  5J6A A;  3LSQ A;  2EX3 A;  1VQP V;  3DSQ A;  3JAL B;  2ZDI C;  4J42 A;  1TUB A;  2BTQ A;  3B4S A;  5D7R A;  5KUM A;  2OIE A;  1NZ6 A;  2YEB A;  1NKD A;  4DR5 O;  4DR5 B;  1UPG A;  4PI2 A;  1W59 A;  3AG7 A;  1PM9 A;  2QM8 A;  5EK0 A;  4LH6 A;  3K03 A;  3OD4 A;  1XUQ A;  4DR3 O;  4DR3 B;  1GAX A;  2F4V B;  2F4V O;  2ZM6 B;  1RM1 C;  1NH2 B;  2M7W A;  4PV1 B;  1KBH A;  1YXB A;  3SYP A;  3OFN G;  1X59 A;  3LDD A;  1QR8 A;  2IWS A;  1RPO A;  1G1X B;  2RN9 A;  4Z2W A;  2XJJ A;  4J11 A;  4FLV A;  2HJF C;  5LYJ B;  1Z5A A;  4MVR A;  3RYH A;  3RYF B;  4FCP A;  4O07 A;  1BL8 A;  2E5L O;  2EZO A;  5EYP A;  3A0Y A;  4U93 A;  1O9G A;  4PA4 A;  4MVM A;  4EEQ A;  1NR7 A;  4N21 A;  1G6U A;  3A0X A;  2OCC B;  3G4S V;  2ZD9 A;  4AQY O;  4AQY B;  1AJP A;  4OPA A;  2WEP A;  5FNF A;  4KL1 A;  2WEQ A;  1M5I A;  2ZDI A;  2EIM B;  3WB1 A;  3H1J H;  1NBM G;  4NTX A;  5EZY A;  2O1W A;  2R9I A;  1BGY H;  2X6C A;  4BAE A;  4X62 B;  1WJZ A;  3RVZ A;  1DK1 A;  4JTA B;  1IUR A;  1I5B A;  3AK2 A;  4RO2 A;  1Q6H A;  2OYQ A;  3JCU Z;  5KUK A;  1M90 W;  3HZ1 A;  3JAK A;  1N36 O;  3EHH A;  1IVS A;  4HYM A;  1L0O A;  5D6P A;  2Y48 A;  2FXS A;  3Q5J A;  3OTO O;  2LJ2 A;  4MTF A;  3VOU A;  4LF4 B;  1EN4 A;  1OV9 A;  2Q73 A;  1AH8 A;  3TZ4 A;  2JVD A;  2LFR A;  2ZT9 B;  3JD4 A;  2XDS A;  5B3S C;  2Z5U A;  2P06 A;  1S5J A;  3A0Z A;  3G7B A;  1V54 C;  3STZ C;  4DV4 O;  4DV4 B;  1B62 A;  2QG2 A;  4LF7 O;  3FAV B;  1GN6 A;  3TTZ A;  2X6B A;  4P8O A;  3G6E V;  5HFL A;  3CCL V;  3UT5 B;  2XCM A;  2QWO B;  1HR0 O;  1HR0 B;  3ZRW B;  3DC6 A;  1MA1 A;  4W4L A;  4UVB A;  3DC5 A;  2XJG A;  3T4D A;  1NJI W;  1QQC A;  1XBL A;  1Q3E A;  1ZLZ A;  2W6I G;  1DTO A;  2H55 A;  3EKR A;  2YEH A;  2A06 H;  3ASN B;  2QKS A;  5BMV A;  3UQ8 A;  1AH6 A;  3HYZ A;  4MTX A;  1F4M A;  3JYC A;  4C7U A;  1FXK C;  2EZP A;  2JJ2 G;  3RKZ A;  4JYY A;  4CWQ A;  1N0J A;  3N2K B;  2EIJ C;  1UYK A;  4I0X A;  1OCO B;  3TXS A;  4B3S O;  2WER A;  4JYA O;  3G7E A;  2EXL A;  2DQ3 A;  1I58 A;  1IXB A;  3RN4 A;  3RYC B;  1HNX B;  1JJ2 U;  5IYB O;  1TC0 A;  3CP1 A;  4JI2 B;  4PRV A;  2DYR C;  5LXT B;  3IGA C;  4MOT A;  3JAR A;  3HPL C;  3ABM B;  2PZS A;  5H2F Z;  2H94 A;  4W7T A;  1S14 A;  3FT5 A;  2YIB A;  3CGY A;  1MNG A;  3ZMV A;  2LGW A;  3PEJ A;  2FYU H;  4GQT A;  2ARH A;  3N27 A;  4UB8 Z;  2YEF A;  2YEV A;  1SKV A;  1Q82 W;  1H2M A;  1K7D A;  3SJA C;  4R3A A;  2IH1 C;  3N2G A;  3M99 B;  3CJH A;  3D8C A;  2QF6 A;  1OCC B;  1H2N A;  3PJS K;  3RBZ A;  1XNQ O;  1FKA O;  1THN A;  3H80 A;  3WG7 B;  1SQF A;  1AB3 A;  1Z5V A;  5JJN B;  2YEG A;  2RJZ A;  4FPP A;  4DV6 O;  4DV6 B;  4DZY A;  3EHB B;  3CYG A;  3BA9 A;  4WBN A;  2H8P C;  3ZKD A;  3OEE G;  4UCT A;  4JZ2 A;  2XAF A;  4I50 B;  4LWG A;  2BOC C;  3DGE A;  2QA4 V;  2IBZ H;  5LP6 C;  4DV7 O;  4GKK O;  4EGI A;  4Q6G A;  3VQY A;  3K59 A;  3F5W C;  1SET A;  2ZKO A;  2R72 A;  4MVU A;  4QPK A;  2BTZ A;  4ZOL A;  3TJT A;  2LW7 A;  3ABL B;  1NHI A;  3JSN A;  5H6R A;  3B28 A;  4DR1 B;  4KFM A;  4XIR A;  1NTK H;  1AI7 A;  4IT5 A;  4GLX A;  5KHH A;  4YY3 O;  4YY3 B;  2V4D A;  4I3H A;  3INW A;  2GV9 A;  1YSZ A;  3E89 A;  1VQ9 V;  2WLI B;  1ENV A;  4R8C A;  4FFB B;  1JX9 A;  4F4L A;  1YJN V;  2ZIM A;  1HWY A;  2QKC A;  4KQV A;  1RM1 B;  1YES A;  3U10 A;  4LC1 A;  3F5T A;  3RLQ A;  1FXH A;  4UCO A;  4JI1 O;  4JI1 B;  4H0L B;  5LP6 A;  4TV8 B;  3ZCC A;  1SQB H;  3MAQ A;  1QVG U;  5LOV A;  2CG9 A;  1WP8 A;  5KMG A;  4J7J A;  4DK0 A;  5IDM A;  3A0W A;  3Q4H A;  1WA8 A;  1JVM A;  4PA7 A;  2XHX A;  2C1I A;  4BW5 A;  3MD0 A;  3E83 A;  3RYI B;  1Z59 A;  3SPH A;  2YXH A;  4YJ3 A;  1RSO A;  3VHA A;  5J2U A;  4PEL A;  5B5E Z;  2BYI A;  4NH9 A;  2IU3 A;  4FLZ A;  1U0Z A;  1BCC H;  1JFF A;  4MVO A;  5CA0 A;  3TZ2 A;  2YK9 A;  1UYH A;  2X6A A;  2ZR2 A;  5D5Q A;  4CC6 A;  2UXN A;  4FVM A;  2HFE C;  2CH7 B;  1KUQ A;  1BHA A;  2JJC A;  3RGB A;  4RAI A;  1URF A;  4UFZ A;  3CE2 A;  4CH4 A;  5LMN B;  1M4U A;  3HR0 A;  4H37 A;  4L91 A;  1SS3 A;  1SQX H;  3CCV V;  3FYI B;  2YXY A;  3OM3 B;  2XAB A;  2E3C A;  2YE7 A;  1KP2 A;  3CRQ A;  3BA8 A;  1EZJ A;  1U97 A;  3SDL A;  1VQO V;  1GH6 A;  4XKO A;  2KSD A;  4EMV A;  4PJ0 Z;  3I5D A;  5B3S B;  2HCH A;  2HVK C;  3O65 A;  3JCZ A;  4FZ1 A;  3LDC A;  1V54 B;  4DR7 B;  1J95 A;  3K5N A;  2PYL A;  2EIN C;  1M57 C;  1GRJ A;  4L90 A;  1VQ6 V;  3OUF A;  2YIA A;  4HBN A;  4AI8 A;  4CWN A;  3EHJ A;  2RMK B;  4BIZ A;  4G2K A;  3CXC U;  2O57 A;  3ZMU A;  3O9O A;  2BU6 A;  4NB5 A;  2YK2 A;  4URM A;  1FXV A;  3AK3 A;  5JEN A;  3S3X A;  2XDK A;  1FXK B;  1I5Y A;  4I4T B;  1I59 A;  4D7T A;  1VQ4 V;  4BIU A;  2EIJ B;  5DN6 G;  4E4E A;  3O0I A;  3VQX A;  1WPB A;  3WHA A;  3E86 A;  3JD0 A;  1TBW A;  3T2M A;  2YKC A;  5KHK A;  4YKU A;  3HHU A;  3ZHV A;  2Q8I A;  4CH5 A;  5JCO A;  1H38 A;  2UUA B;  1GM8 A;  2ZE8 A;  1IX9 A;  3B09 A;  2BT0 A;  4LP8 A;  3ZS8 C;  2DYR B;  2UXB B;  2UXB O;  2WI3 A;  3B25 A;  4J10 A;  4U3J A;  2ZE5 A;  2KB1 A;  1BQZ A;  2AZ0 A;  2XD6 A;  4LWS A;  4CC5 A;  2QSA A;  3ASO C;  1TVK A;  5EIB C;  1MSD A;  1E1R G;  4O4I B;  3B2E E;  1GN2 A;  1SES A;  1XMQ O;  2XAJ A;  3H1L H;  4IHJ B;  3SPI A;  1YSC A;  3E2E A;  2MK3 A;  5M4N A;  1VQ7 V;  1R3L C;  4A5U B;  4WFB V;  3L70 H;  2YGA A;  5B1A C;  1VEW A;  3B40 A;  3OT7 A;  1Q90 D;  1Y76 A;  5C93 A;  1YIT V;  2YEA A;  4I55 B;  3W7U A;  3CHX A;  3OR6 C;  4MB9 A;  1PPJ H;  4FJC C;  2IJH A;  1KKC A;  1YJW V;  4LFB B;  3JD3 A;  1ZTE A;  4CWF A;  1I5X A;  1QU7 A;  1NTM H;  3CC4 V;  1TA8 A;  5B66 Z;  2GDS A;  4X88 A;  3X2Q C;  3ZMZ A;  1D2D A;  5FPR A;  3T1K A;  3ZX6 A;  4IL6 Z;  4PRX A;  1S5H C;  5LOV B;  1ID0 A;  1UYD A;  1GJV A;  4YXW G;  2IJI A;  2WWW A;  3TCU A;  4YKR A;  4ZBM A;  1XHX A;  5LMU O;  5LMU B;  1WA8 B;  1SQV H;  5IYD O;  3L75 H;  3KG2 A;  4NKG B;  4MS2 A;  4GT1 A;  3WU2 Z;  3R4P A;  4LWF A;  1ZSP A;  2QE7 G;  4ZHQ A;  5KX5 B;  3ABT A;  5JH7 A;  2ZDY A;  4FM0 A;  4YKQ A;  1OJH A;  5L3E A;  5CN0 A;  5IJ0 B;  4LR3 A;  2Q6A A;  4O2A A;  1QZR A;  3EVK A;  2EBO A;  5BZB A;  4IIJ B;  2HG1 A;  5FWK A;  3VHD A;  3MHH C;  3CEI A;  4CBC A;  2QR4 A;  1S16 A;  2AXT Z;  4ASU G;  4JAA A;  4HAM A;  3S5T A;  2E76 B;  3B8N A;  4NTW A;  2P7T C;  2Q8V A;  1EZV H;  1F7Y A;  2ZBK B;  3G80 A;  2JIZ G;  4X20 A;  3UKM A;  1YIJ V;  1N32 B;  4TV9 A;  4O4J B;  3QO7 A;  1NQT A;  1QBZ A;  2WLN A;  4GT8 A;  2BU8 A;  2QG0 A;  3ZRX A;  1WN7 A;  3CCS V;  1EN6 A;  3EXA A;  4MTO A;  4XDM A;  5ITZ A;  1PNM A;  4DV1 B;  3RLP A;  2YKJ A;  3VQW A;  4L8Z A;  4O2B B;  1FJG O;  1VQN V;  3OWD A;  3JD1 A;  2ZE6 A;  4URN A;  2YE8 A;  4JAU A;  1TAE A;  3OW2 U;  4X64 O;  2WI7 A;  1VF5 B;  3HKC A;  1V9P A;  4QE7 A;  4FM2 A;  3WB0 A;  3EFF K;  2OCH A;  3ZMS A;  1RP3 B;  3THO A;  2YI9 A;  1QNM A;  4YKY A;  3O6O A;  1YT2 A;  3ABK B;  2WI4 A;  5C8Y A;  2HLD G;  2BOB C;  1UYE A;  1SRY A;  4UV9 A;  1VF6 A;  4UB6 Z;  3CCJ V;  2CGO A;  5FNV A;  4UCR A;  4KSG A;  1FFX A;  1US6 A;  1BZK A;  3JAS A;  1LUV A;  1I5D A;  2EIL B;  2ESA A;  3KZI Z;  1AJ6 A;  3I56 V;  3SJB C;  3QDD A;  4CH3 A;  1NH2 D;  2Y0P A;  2HJD A;  1L0N H;  1Z2G A;  4Q20 A;  3UM7 A;  1ZX3 A;  3R92 A;  2WLL A;  1H2G A;  2ZM6 O;  3G67 A;  4ZKI A;  2EJR A;  2N74 A;  4WUC A;  4LBE C;  4XIP A;  4XE2 A;  2EIN B;  1M57 B;  1Y74 A;  2BYH A;  3T10 A;  4YKX A;  4CZZ A;  4ZI7 B;  4XCJ A;  3CME V;  3CXH F;  1ZXM A;  1YT0 A;  1KB9 F;  4NXM O;  4NXM B;  4UCV A;  2IOR A;  4YIP A;  4QNH B;  3NR7 A;  5LHH A;  5L3F A;  4O4L A;  3J7A U;  1DF4 A;  3GIF A;  4TQD A;  2QWP B;  3U67 A;  4MPC A;  2WLH A;  4TOI A;  4YJ2 B;  4BAY A;  4EEH A;  3OW6 A;  3K5M A;  5FNC A;  4X66 B;  4TT3 G;  3TZ5 A;  2YI7 A;  5IN9 A;  3A2F A;  2PUS A;  1FS0 G;  2ZDX A;  2EUL A;  2ILM A;  2B1G A;  1SF9 A;  5GON B;  3ZXQ A;  2Q7G A;  2A3Q A;  4K8X A;  1B04 A;  1DGS A;  3JAT B;  3C11 A;  3H9V A;  4WFH A;  4HNA A;  4X62 O;  3J81 N;  4KTN A;  4N23 A;  4LWI A;  2RQ6 A;  3OPD A;  4BWA A;  2M6Y A;  3E8B A;  3CRA A;  3RWR D;  1NI8 A;  1AJQ A;  2XX5 A;  3J80 N;  3H4L A;  3KKY A;  5M4M A;  3VAD A;  2BSK B;  4NH8 A;  2GQP A;  2DYS C;  1GMG A;  4I9Q A;  2DN9 A;  5KA6 A;  2MW2 B;  2OT5 A;  4GKJ B;  4GKJ O;  4LF4 O;  1FYJ A;  1M56 C;  1Z5B A;  3OMU A;  2ZXW C;  1UY6 A;  4CWS A;  2CUG A;  1YSR A;  5IDJ A;  4DV2 O;  4JGS A;  4DV2 B;  1XRE A;  4NXN O;  2XT9 A;  1SQQ H;  4NXN B;  4EFU A;  2CGF A;  5IWA B;  5IWA O;  1MSW D;  2VS0 A;  3CCE V;  2KG7 B;  2QWN B;  1YT1 A;  5B1A B;  1AR1 B;  5JVD B;  2WLK A;  3JAW A;  4F6R A;  2RDC A;  1ORQ C;  5CA3 A;  2YID A;  5IJ9 A;  1ZXN A;  2YKI A;  4EB6 B;  1EM1 A;  4DUZ B;  2VWK A;  3LSS A;  4LF5 B;  2P4V A;  1PL4 A;  5EBW C;  5J2T A;  3GIG B;  3CD6 V;  1NU1 H;  2B5U A;  5LGU A;  4LF6 O;  4LF6 B;  4XD8 A;  2QM7 A;  3HKE A;  3CRM A;  1B63 A;  4HZ0 A;  2FKX A;  3FV5 A;  1Y4S A;  2YJW A;  5LGT A;  2GUZ B;  4DW1 A;  3L71 H;  1HNX O;  2BU7 A;  3R4M A;  4LNU B;  3DXR A;  2O1U A;  1B6Q A;  3AG4 C;  1XI1 A;  3BY6 A;  4JI2 O;  2P4K A;  1J5E O;  3P30 A;  1J5E B;  2YE5 A;  4CE2 A;  1BE3 H;  2XUM A;  4MP7 A;  4PDV A;  1JOY A;  3T4Z A;  2QJ1 A;  2UWD A;  5LBQ A;  2K9P A;  3PEH A;  2YDE A;  1K3E A;  3T1Y B;  3HKD A;  2F93 B;  5M4E A;  3AK1 A;  1BMF G;  3F7V C;  5BY1 A;  2DJV A;  1IDS A;  2XTA A;  1UYC A;  1IXM A;  3WFV A;  3LUT B;  5KAI Z;  2UXX A;  4EFB A;  3CYO A;  3Q5K A;  4DRX A;  1QYE A;  1SA0 A;  1AP6 A;  2IJK A;  1AR5 A;  1TUB B;  2BTQ B;  2CTP A;  4LF9 O;  4LF9 B;  3K5O A;  1AIL A;  1AI5 A;  1GM7 A;  4G27 B;  1GKF A;  5JQG A;  1YCI A;  5CBG A;  4GEE A;  1P7B A;  1XEQ A;  3GVM A;  1B3Q A;  4B7P A;  1Y6X A;  5BOC A;  3U11 A;  3B8M A;  4PD4 F;  4L93 A;  3TK1 A;  3U2D A;  1XL6 A;  2JGU A;  2LFS A;  4AHC A;  1XL4 A;  1AM1 A;  2XDL A;  2Y69 B;  1V55 C;  3A8T A;  4WFG A;  4I7Z B;  1G8M A;  3IED A;  4X1K A;  4J41 A;  1GTO A;  1ZWI C;  1Q86 W;  3H1H H;  1QCE A;  1K97 A;  3RYH B;  3FFQ A;  4TQF A;  2FWY A;  5M4H A;  2YE3 A;  2IH3 C;  2NR5 A;  5EYP B;  1UYI A;  3BRC A;  4QGP A;  4URO A;  3W7T A;  2PGG A;  4GCZ A;  2Y0I A;  4DR1 O;  1R73 A;  2HKJ A;  1PKX A;  2ZNJ A;  2BTO A;  1I08 A;  4KHP B;  2KQX A;  4JYC A;  3ZHR A;  3QF7 A;  3T1H O;  3T1H B;  3IJ4 A;  1I94 O;  1I94 B;  5EZY B;  4JI8 O;  4JI8 B;  1UFI A;  4FFK A;  2VQE O;  2VQE B;  5CB4 A;  2EIK C;  1AI4 A;  1H2S B;  1Q8I A;  4H44 B;  1NVP B;  1R62 A;  1FFT B;  4JI0 O;  2N05 A;  2PYJ A;  4JI0 B;  3JAK B;  2BCC H;  3HYY A;  2JDI G;  5JJJ B;  1AP5 A;  4GZR B;  1I0H A;  1KYO F;  2JEX A;  3HEK A;  2ZNI A;  3KCX A;  4JPR A;  3CS5 A;  4FZ0 A;  2L35 A;  2D2C B;  3ZIA G;  3R91 A;  2JKI A;  2XDX A;  4OXS A;  1GN4 A;  4CS2 A;  5FLX N;  4R6Z A;  3S3W A;  3FB5 C;  3K58 A;  4IYI A;  2Q8F A;  4FLX A;  4ICG A;  2FWZ A;  1K4C C;  5FL7 G;  3VQV A;  1DLB A;  4IYH A;  1SQG A;  4NTY A;  1QHT A;  3TGU H;  4RQF A;  4FK5 C;  4QJF B;  4KFG A;  1Y4M A;  1YEW A;  4TUY A;  4V25 A;  3OTF A;  4Z1M G;  1Y66 A;  3ZKB A;  4MVZ A;  2GSM B;  5CA1 A;  5IJ9 B;  4FIP C;  3FD9 A;  4L87 A;  4X8A A;  2YED A;  1HW7 A;  1KP3 A;  4J9Y B;  3GB7 C;  3CC7 V;  4CE1 A;  5BMV B;  2IW5 A;  1KKD A;  5D7C A;  5LMN O;  1S3J A;  2AW9 A;  2K1E A;  2YGF A;  4LPB A;  4XDL A;  4TWK A;  5EBM C;  1OCZ C;  2FTK A;  1D5A A;  2A7W A;  2DYS B;  4I0X B;  3ZBH A;  1N33 B;  3D0B A;  1S0V A;  3NMQ A;  1N4C A;  5EC2 C;  5FND A;  3FB7 C;  1M56 B;  5A2Q N;  1EN5 A;  2ZXW B;  3FB8 C;  3LNM B;  2JJ1 G;  4XCL A;  4P7A A;  2JS3 A;  5JCO C;  2R9A A;  1UYM A;  2ZE7 A;  1H2K A;  4U3F H;  4PA6 A;  5LA6 A;  1QLE C;  4DR7 O;  3AG2 C;  2CCU A;  4HXZ A;  3GWK C;  2HEP A;  3JAR B;  5M4K A;  2XHB A;  1N8R W;  3W7S A;  2ADP A;  2GTA A;  1PV0 A;  4I5S A;  1JM6 A;  3D3Q A;  4J7Z A;  2FB5 A;  4X1I A;  3OWB A;  3A0H Z;  3W7X A;  3LSU A;  5B1B C;  2YEV B;  1QLN A;  1PP9 H;  4L8J A;  3STL C;  1EFR G;  2ZQM A;  3N2G B;  4D7S A;  3CJH B;  4QPJ A;  3ZHU A;  4YKT A;  1WAZ A;  1OCR C;  2QTS A;  4KP4 A;  1Q6U A;  4JI5 B;  4JI5 O;  2CCT A;  3L9D A;  3E8H A;  1PD3 A;  4JI6 B;  4JI6 O;  3MNR P;  4BXI A;  3SYC A;  4WBN B;  4V26 A;  2UUA O;  3JAL A;  1H8H G;  2EJ7 A;  3ICX A;  3AG4 B;  4ZVI A;  3T2S A;  1H8E G;  1P4R A;  1QR9 A;  4U7N A;  4UVC A;  1XIL A;  2DOS A;  3CWV A;  1P7G A;  3L73 H;  2HHI A;  1JCH A;  1AR4 A;  4MT8 A;  4ZOL B;  5EBL C;  3G71 V;  1BYQ A;  1NHJ A;  1Q7Y W;  4LF8 B;  5FPO A;  4LF8 O;  1BQ0 A;  2Q9L A;  2OWO A;  2P6J A;  2PTM A;  2CH4 A;  4UCS A;  2CAZ C;  2XK2 A;  3CCR V;  2QDO A;  2XAQ A;  5LYJ A;  1Q43 A;  1JR9 A;  4MW3 A;  4R7C A;  2UUC O;  2UUC B;  3ETE A;  3SR2 C;  2JGD A;  4H85 A;  5JJE B;  2PY5 A;  4PL9 A;  1LUW A;  2P22 C;  4LFB O;  3ZXO A;  1COW G;  2P67 A;  1V55 B;  1IBK B;  1IBK O;  1SZT A;  4DR4 B;  4DR4 O;  5IYZ A;  3TZ0 A;  1MG1 A;  1YTF B;  3A0T A;  3JD2 A;  3R66 A;  5LP6 B;  2YGE A;  1IBL B;  3D3I A;  2HVJ C;  1IBL O;  2WI2 A;  1PNL A;  2PI4 A;  3U2K A;  4URL A;  1YHQ V;  2WLJ A;  4H7Q A;  4E00 A;  5KMG B;  1GO3 F;  5LGN A;  3L74 H;  3LNN A;  4BR6 A;  1D5N A;  3Q4H B;  5E79 Z;  1YC1 A;  4JYB A;  5LHI A;  1K9M W;  1FPO A;  5LHG A;  5CTU A;  3P32 A;  3ZJZ A;  1XDC A;  3CWB H;  3NXS A;  3MDS A;  4G28 B;  1AJN A;  4YJ3 B;  4YKW A;  1RSO B;  5J2U B;  4TUY B;  2P90 A;  1A32 A;  1VQM V;  5HFM A;  1Q6I A;  2UXD O;  2UXD B;  2YC0 A;  3SJC C;  3WB2 A;  2VQF B;  4OX9 B;  1JFF B;  5CA0 B;  3GIE A;  2C2A A;  4CS4 A;  2EIK B;  3SYA A;  3QNE A;  1KMI Z;  1VF6 C;  3EKO A;  1TGO A;  4GUN A;  4BQJ A;  4DK1 A;  4NR1 A;  3APQ A;  3FAV A;  4D6T H;  3LPS A;  4DUY B;  1N32 O;  3FYE B;  3B24 A;  3UT5 A;  5BXZ A;  2GFD A;  1P49 A;  2VW5 A;  3K9S A;  2XHT A;  3ZRW A;  2CTW A;  3F7Y C;  4GX1 A;  4J9Z B;  2B1I A;  2QWR B;  1Y8N A;  3ETD A;  3P3N A;  1Y8P A;  3ZRV A;  3D2R A;  4DV1 O;  4ABM A;  3K0G A;  4MTG A;  3RW0 A;  1SZX A;  1MU5 A;  3E22 A;  1R6K A;  4GYC B;  4CS3 A;  1VQ8 V;  5A9G A;  3D36 A;  1TIL A;  5KHG A;  2W6J G;  3AG1 C;  4RUF A;  1BXD A;  1W0J G;  1R1B A;  4HZ5 A;  2UU9 O;  2UU9 B;  1QY8 A;  5IT9 N;  2Q2E B;  3N2K A;  1Z5C A;  2XX4 A;  4H33 A;  2Z0A A;  1YDX A;  4QIW F;  4PDM A;  3CRL A;  3K57 A;  2WI1 A;  4BW9 A;  5IY5 C;  3OAA G;  4DXW A;  3SYQ A;  2AZ2 A;  4JAS A;  4JAV A;  1GKZ A;  3RYC A;  5CBH A;  3JZ3 A;  1NS1 A;  2W0X A;  3IC9 A;  2WI6 A;  1EI1 A;  5LXT A;  5CF0 A;  2Q5Z A;  1OCZ B;  2DW4 A;  2Q7H A;  1OZ0 A;  2BZ5 A;  1RPR A;  1CPY A;  3HB3 B;  4MVQ A;  2L6L A;  2E0A A;  1ARO P;  4P2Z A;  1Y8O A;  1ZWH A;  5L3J A;  2FYP A;  4PU9 A;  4LFC B;  4LFC O;  4UUJ C;  2YI0 A;  4XC0 A;  1S5L Z;  3OGI B;  4J80 A;  1QLE B;  3AG2 B;  3BAB A;  2Q0A A;  2CCS A;  4U3J B;  2DWE C;  4MBC A;  1E1Q G;  3SPJ A;  4DV0 O;  4DV0 B;  2FL4 A;  3EHF A;  4LWS B;  2CK3 G;  2X0L A;  2C1G A;  2JK5 C;  3OUS A;  1BKN A;  3BHP A;  1TVK B;  3M7M X;  1UY9 A;  3O2F A;  3T0H A;  1PNK A;  1VQ5 V;  3QO8 A;  1GM9 A;  5KAF Z;  2LQT A;  3AG3 C;  3UO3 A;  3ZHS A;  3BM9 A;  4EGK A;  4YIO A;  2UUB O;  2UUB B;  5B1B B;  1N34 B;  1N34 O;  4I50 A;  2CDY A;  4YHH O;  4YHH B;  4FLT A;  2P5O A;  1K5Q A;  5D6Q A;  3ZHT A;  4X66 O;  1BHB A;  3K9A A;  2IOQ A;  4XDK A;  3ETG A;  1Y76 B;  2Q8H A;  2YKB A;  3K08 A;  2E5L B;  2JGD B;  1OCR B;  5D5P A;  3E8G A;  2LP7 A;  4AS9 A;  1LNQ A;  1KC8 W;  2YE6 A;  2E75 B;  4XKA A;  1VQL V;  4LH7 A;  3WQ9 A;  2AHY A;  5IYZ B;  4JTD B;  4O4H A;  1N0N A;  3HKB A;  2YE9 A;  1U2O A;  1HNW B;  1HNW O;  5KHJ A;  4MP2 A;  2YXL A;  4R50 A;  3KCY A;  1U96 A;  5EIB D;  4ASA A;  1SC5 B;  2CE4 A;  2WLI A;  5IE9 A;  4FCR A;  3ASO B;  2Z3Y A;  4FFB A;  1KU9 A;  4P30 A;  4B08 A;  4CWO A;  2H3O A;  1GN3 A;  2OIG A;  5K1X A;  1N36 B;  1VQK V;  2QWQ B;  4JI3 O;  4JI3 B;  4PI0 A;  5LL6 Y;  3T1C A;  4ZHQ B;  3OMA B;  3CCQ V;  3MHS C;  3RFR A;  4XIQ A;  1YET A;  4P9O A;  3OTO B;  1WNS A;  4PDR A;  5JH7 B;  1G4Y B;  4O05 A;  4TV8 A;  4PHZ A;  4O2A B;  2B9Z A;  2ATK C;  4DO2 A;  1YZB A;  4JF3 A;  4RUE A;  2K5B A;  2F66 C;  5L3G A;  2YEC A;  4DUZ O;  4LF5 O;  1S77 D;  1XHZ A;  4RWU A;  4MVS A;  1LR1 A;  2Q8G A;  4JV5 B;  4JV5 O;  4DUH A;  1YC3 A;  3K5L A;  1H2L A;  1K5S A;  4LF7 B;  4X20 B;  1S76 D;  3RYI A;  4TV9 B;  3RVY A;  2YUA A;  2VWC A;  4X65 O;  4X65 B;  1M9N A;  1W2B U;  2W0F C;  3SYO A;  2BE3 A;  1KIJ A;  5CPH A;  3X2Q B;  4B3T O;  4B3T B;  5ITZ B;  4PA9 A;  4R3M A;  2FML A;  4FLY A;  2UXC B;  2UXC O;  2Q67 A;  5L3D A;  3E22 B;  3ZHQ A;  5GTI Z;  2YI5 A;  4LWE A;  2F1M A;  1ZL8 A;  2CH7 A;  1I5C A;  2Q68 A;  4EFT A;  1R3J C;  4FMT A;  2VCJ A;  1XMO B;  1XMO O;  2ZCE A;  2DQ0 A;  3HKC B;  5F5R A;  3U0Z A;  4P9P A;  4B3S B;  4JYA B;  3T1Y O;  3CX5 F;  1M93 A;  4W4K A;  3CRC A;  2ZIO A;  4CH6 A;  1JMK C;  3SL2 A;  5C8Y B;  2Y4U A;  1UY7 A;  1UYL A;  4HZ3 A;  4LWH A;  3ETQ A;  4LFA O;  4LFA B;  3TXQ A;  2D3O W;  1VF7 A;  5FNV B;  1Q5O A;  3R65 A;  2YE4 A;  3VHC A;  1FFX B;  3AEI A;  2PNR A;  4PA3 A;  3JAS B;  2YEJ A;  2F43 G;  2CTQ A;  5F2V O;  4AWQ A;  4XKK A;  4CWP A;  1K33 A;  1KZN A;  1NHH A;  1GKX A;  2WA4 A;  3C3S A;  2XAG A;  4ASG A;  2WLL B;  1VMG A;  2QKA A;  4XDJ A;  1UJW B;  4HY1 A;  1K34 A;  1E79 G;  2OTL V;  1YF2 A;  3SJQ C;  3EHG A;  1CXZ B;  1R6T A;  3SPC A;  1FXK A;  4GX2 A;  1Y74 B;  1I7F A;  5KA5 A;  3AG1 B;  2WLM A;  4AWP A;  4I4T A;  3UO2 A;  1BT8 A;  2GBO A;  4K3A A;  3FKS G;  2DMX A;  4GX5 A;  1XNQ B;  5E1A C;  1MOF A;  5GW7 A;  1EA6 A;  4O4L B;  2QEX V;  1NR1 A;  2XOK G;  3OMI B;  5IY5 B;  1SER A;  3LMM A;  3PN1 A;  1YI2 V;  5DED A;  2R70 A;  1WB8 A;  3P3P A;  2YIC A;  4QE9 A;  2WSS G;  2LO1 A;  2WAM A;  2XND G;  4DV7 B;  4GKK B;  3B77 A;  2BU2 A;  4H81 A;  1T5E A;  4KHP O;  1NT2 B;  2X7R B;  4AWO A;  1YVW A;  3B26 A;  1TUE B;  4UVA A;  1BS3 A;  4ZIB A;  1NVP D;  3OGC C;  4EGH A;  2QTO A;  4HNA B;  3L72 H;  3BAA A;  5M4P A;  1ZUQ A;  1UYF A;  4O4I A;  2ETN A;  2H8M A;  4JI4 O;  4JI4 B;  1IZ3 A;  4IHJ A;  2YEI A;  4O4H B;  3SGI A;  1HNZ O;  1HNZ B;  3HKB B;  3VBB A;  4ASB A;  2Q0O C;  4X9Q A;  3K98 A;  3CCM V;  2Q4P A;  4JZG A;  4TSF G;  2YKE A;  3CGZ A;  1WPX A;  2ITD C;  4XIT A;  1HDJ A;  4K8Z A;  4I55 A;  4O09 A;  3TET A;  4JTC B;  3FT8 A;  2JEU A;  3CSX A;  2BRE A;  2CTR A;  2VWJ A;  4DR2 B;  4DR2 O;  5CTX A;  3AG3 B;  3IFX A;  2A0L A;  1RFY A;  2WA3 A;  1KQS U;  5H9C A;  1FAF A;  2RCV A;  4CE3 A;  4FLU A;  4FM1 A;  1YER A;  2R9R B;  3JAW B;  4F6R B;  5GTH Z;  4WFE A;  1K8A W;  4E2L A;  3DTU B;  4E72 A;  3IC7 A;  5H5N A;  3OEH G;  3ZN1 A;  2O1V A;  1PVG A;  2F23 A;  1ROP A;  3R4O A;  1TH8 A;  2BRC A;  2QFO A;  2BU5 A;  3BEH A;  2WI5 A;  4WFF A;  3C90 A;  4OPH A;  1Q81 W;  1F51 A;  1MAB G;  1WLE A;  4X1Y A;  1UYG A;  5J2T B;  1MX0 A;  1A4H A;  2XAS A;  5KX5 A;  3ZRS A;  3I55 V;  2E74 B;  3KE6 A;  1Z5W A;  3HKE B;  4PDL A;  4O0B A;  5IJ0 A;  3ABK C;  1N33 O;  1QVF U;  4AIL C;  4IIJ A;  1SQP H;  1R3K C;  4LCU C;  2Y4T A;  2IM9 A;  2BSM A;  1ZW9 A;  1JJO A;  1ZL8 B;  3CB2 A;  1JQ0 A;  4WF9 V;  3K79 A;  3INX A;  4EFE A;  3DXR B;  1L0L H;  4BIO A;  2GTS A;  1UY8 A;  1THZ A;  2EIL C;  3K0D A;  4O4J A;  5J9P C;  4H13 B;  3BCC H;  1BGQ A;  5GGZ A;  2YIB D;  2G38 A;  2N04 A;  2HG5 C;  3HKD B;  2RNB A;  1KEC A;  2YJX A;  5J71 A;  3K60 A;  1B06 A;  4K35 A;  4XBF A;  3ZMT A;  3OR7 C;  4O2B A;  5L3C A;  3BVO A;  4DRX B;  1TID A;  1OSF A;  1SA0 B;  2PI5 A;  3H1I H;  4MSW C;  4HXW A;  4XTJ A;  4R1F A;  5JQG B;  4HYP A;  4WCE V;  3FB6 C;  4KXR A;  1XQ8 A;  4X89 A;  5EC1 C;  2IJJ A;  2LGQ A;  2YI6 A;  1O9H A;  2IWU A;  4EM7 A;  1WB7 A;  3QG5 A;  1MZE A;  3FX7 A;  1ZAU A;  2NNU A; 
#chains in the Genus database with same CATH homology
 1W0K G;  3CC2 V;  1DF5 A;  2OCC C;  2AKP A;  4MW8 A;  2GHY A;  4L94 A;  2YE2 A;  1YJ9 V;  3B27 A;  2EIM C;  4E02 A;  4U7O A;  2V1D A;  4LP0 A;  3LDE A;  3K06 A;  2A79 B;  4UXN A;  1S72 V;  4X9L A;  2NLJ C;  3CPW U;  1GK9 A;  3OMN B;  5BOD A;  3ZN0 A;  5H6Q A;  2XDU A;  1K73 W;  4K4O A;  3TUH A;  5L3B A;  2Q69 A;  2XJX A;  4UV8 A;  3K04 A;  3QO5 A;  4CWT A;  4FCQ A;  4MPE A;  3BMY A;  5CMU A;  3R4N A;  4B6C A;  1YTF D;  4MPN A;  1YS3 A;  2DWD C;  1M1K W;  2ZR3 A;  2WPD G;  2XHR A;  4CWR A;  3ABU A;  2YSU B;  5B1O A;  4GGL A;  2XX2 A;  1Y4U A;  3W7W A;  3OE7 G;  4KSH A;  4NH7 A;  3T0Z A;  3QTF A;  2IU0 A;  4ASF A;  1EBO A;  3ML0 A;  1YC4 A;  1K4D C;  5CTW A;  1F4N A;  3LNU A;  1AMW A;  3ASN C;  5B1N A;  2IOP A;  3GWO A;  1OHH G;  2A9H A;  3CRK A;  5CBF A;  5F3K A;  2V7Q G;  2XAH A;  1OCO C;  1R3I C;  3K97 A;  1CP9 A;  1KD1 W;  4HYO A;  3G75 A;  5CTY A;  1K92 A;  1PL0 A;  5D7D A;  4HY6 A;  1US7 A;  3SPG A;  3ABM C;  3E8F A;  3CCU V;  3E35 A;  4KUM A;  2OTJ V;  1TC6 A;  3K3W A;  2HR3 A;  1I5A A;  4WUD A;  3C0E A;  1CEZ A;  2AHZ A;  4JQL A;  1F23 A;  3ZM7 A;  3RLR A;  3K99 A;  3GIG A;  2ZKJ A;  2VCI A;  1JPX A;  1R6N A;  1AI6 A;  3Q5L A;  4I9W A;  1OCC C;  5IYC O;  1H7U A;  3WG7 C;  1H7S A;  4GFN A;  2YEE A;  4O04 A;  2Y69 C;  4EKW A;  4YKZ A;  4WFA V;  4RQE A;  2ITC C;  5DM6 V;  1L1F A;  4BQG A;  2HKO A;  4GX0 A;  3HZ5 A;  4WUB A;  4E01 A;  3ABL C;  3A0R A;  2IWX A;  3H01 A;  3CMA V;  5J6A A;  3LSQ A;  1VQP V;  2ZDI C;  5D7R A;  5KUM A;  2YEB A;  1NKD A;  2QM8 A;  5EK0 A;  3K03 A;  1RM1 C;  1NH2 B;  2M7W A;  3SYP A;  3OFN G;  3LDD A;  1QR8 A;  2IWS A;  1RPO A;  2XJJ A;  2HJF C;  1Z5A A;  4MVR A;  4FCP A;  4O07 A;  1BL8 A;  2EZO A;  3A0Y A;  4U93 A;  4PA4 A;  4MVM A;  1NR7 A;  4N21 A;  3A0X A;  2OCC B;  3G4S V;  2ZD9 A;  1AJP A;  2WEP A;  5FNF A;  2WEQ A;  2ZDI A;  2EIM B;  1NBM G;  2O1W A;  2R9I A;  2X6C A;  4BAE A;  3RVZ A;  4JTA B;  1I5B A;  4RO2 A;  5KUK A;  1M90 W;  3HZ1 A;  3EHH A;  4HYM A;  1L0O A;  5D6P A;  2Y48 A;  2FXS A;  3Q5J A;  4MTF A;  3VOU A;  1AH8 A;  3TZ4 A;  2LFR A;  3JD4 A;  2XDS A;  5B3S C;  2Z5U A;  3A0Z A;  3G7B A;  1V54 C;  3STZ C;  1B62 A;  2QG2 A;  3TTZ A;  2X6B A;  4P8O A;  3G6E V;  5HFL A;  3CCL V;  2XCM A;  3ZRW B;  4UVB A;  2XJG A;  3T4D A;  1NJI W;  2W6I G;  1DTO A;  2H55 A;  3EKR A;  2YEH A;  3ASN B;  2QKS A;  1AH6 A;  3HYZ A;  4MTX A;  1F4M A;  3JYC A;  1FXK C;  2EZP A;  2JJ2 G;  3RKZ A;  4CWQ A;  2EIJ C;  1UYK A;  1OCO B;  2WER A;  3G7E A;  2EXL A;  2DQ3 A;  1I58 A;  1JJ2 U;  5IYB O;  1TC0 A;  3CP1 A;  4PRV A;  2DYR C;  3IGA C;  4MOT A;  3HPL C;  3ABM B;  2H94 A;  4W7T A;  1S14 A;  3FT5 A;  3CGY A;  3ZMV A;  3PEJ A;  4GQT A;  2YEF A;  2YEV A;  1Q82 W;  1K7D A;  4R3A A;  2IH1 C;  3M99 B;  2QF6 A;  1OCC B;  3PJS K;  3RBZ A;  1THN A;  3H80 A;  3WG7 B;  2YEG A;  4FPP A;  4DZY A;  3EHB B;  2H8P C;  3ZKD A;  3OEE G;  2XAF A;  4LWG A;  2BOC C;  3DGE A;  2QA4 V;  4EGI A;  3F5W C;  1SET A;  4MVU A;  4QPK A;  2BTZ A;  3ABL B;  1NHI A;  5H6R A;  3B28 A;  4XIR A;  4KFM A;  1AI7 A;  4I3H A;  3INW A;  1YSZ A;  3E89 A;  1VQ9 V;  2WLI B;  1ENV A;  4R8C A;  1JX9 A;  4F4L A;  1YJN V;  1HWY A;  4KQV A;  1RM1 B;  1YES A;  4LC1 A;  3RLQ A;  1FXH A;  3ZCC A;  1QVG U;  2CG9 A;  5IDM A;  3A0W A;  1JVM A;  4PA7 A;  2XHX A;  4BW5 A;  3MD0 A;  3E83 A;  1Z59 A;  3SPH A;  3VHA A;  4PEL A;  2BYI A;  4NH9 A;  2IU3 A;  1U0Z A;  4MVO A;  3TZ2 A;  2YK9 A;  1UYH A;  2X6A A;  2ZR2 A;  2UXN A;  2HFE C;  2JJC A;  1BHA A;  4RAI A;  4H37 A;  4L91 A;  3CCV V;  3FYI B;  3OM3 B;  2XAB A;  2YE7 A;  1KP2 A;  1EZJ A;  1VQO V;  4XKO A;  4EMV A;  5B3S B;  2HCH A;  2HVK C;  3JCZ A;  3LDC A;  1V54 B;  1J95 A;  2EIN C;  1M57 C;  4L90 A;  1VQ6 V;  3OUF A;  4CWN A;  3EHJ A;  4BIZ A;  4G2K A;  3CXC U;  3ZMU A;  2BU6 A;  2YK2 A;  4URM A;  1FXV A;  2XDK A;  1FXK B;  1I5Y A;  1I59 A;  1VQ4 V;  4BIU A;  2EIJ B;  5DN6 G;  3O0I A;  3WHA A;  3E86 A;  3JD0 A;  1TBW A;  3T2M A;  2YKC A;  4YKU A;  3HHU A;  2Q8I A;  1H38 A;  1GM8 A;  2BT0 A;  4LP8 A;  2DYR B;  2WI3 A;  3B25 A;  2KB1 A;  2XD6 A;  3ASO C;  1E1R G;  1SES A;  2XAJ A;  3SPI A;  1YSC A;  3E2E A;  2MK3 A;  5M4N A;  1VQ7 V;  1R3L C;  4WFB V;  2YGA A;  5B1A C;  5C93 A;  1YIT V;  2YEA A;  3W7U A;  3OR6 C;  4MB9 A;  4FJC C;  2IJH A;  1YJW V;  3JD3 A;  4CWF A;  1I5X A;  3CC4 V;  4X88 A;  3X2Q C;  3ZMZ A;  3T1K A;  4PRX A;  1S5H C;  1ID0 A;  1UYD A;  1GJV A;  4YXW G;  2IJI A;  2WWW A;  3TCU A;  4YKR A;  4ZBM A;  5IYD O;  3KG2 A;  4MS2 A;  4GT1 A;  3R4P A;  4LWF A;  2QE7 G;  3ABT A;  2ZDY A;  4YKQ A;  5L3E A;  5CN0 A;  2Q6A A;  1QZR A;  2EBO A;  5BZB A;  2HG1 A;  5FWK A;  3VHD A;  3MHH C;  4CBC A;  1S16 A;  4ASU G;  4HAM A;  3B8N A;  2P7T C;  2ZBK B;  2JIZ G;  3UKM A;  1YIJ V;  3QO7 A;  1NQT A;  1QBZ A;  2WLN A;  4GT8 A;  2BU8 A;  2QG0 A;  3ZRX A;  3CCS V;  4MTO A;  4XDM A;  1PNM A;  3RLP A;  2YKJ A;  4L8Z A;  1VQN V;  3OWD A;  3JD1 A;  4URN A;  2YE8 A;  4JAU A;  3OW2 U;  2WI7 A;  4QE7 A;  3EFF K;  3ZMS A;  4YKY A;  3O6O A;  1YT2 A;  3ABK B;  2WI4 A;  2HLD G;  2BOB C;  1UYE A;  1SRY A;  4UV9 A;  3CCJ V;  4KSG A;  1I5D A;  2EIL B;  2ESA A;  1AJ6 A;  3I56 V;  3QDD A;  1NH2 D;  4Q20 A;  3UM7 A;  3R92 A;  2WLL A;  1H2G A;  4ZKI A;  2EJR A;  4WUC A;  4LBE C;  4XIP A;  4XE2 A;  2EIN B;  1M57 B;  2BYH A;  3T10 A;  4YKX A;  4CZZ A;  4XCJ A;  3CME V;  1ZXM A;  1YT0 A;  2IOR A;  4QNH B;  5LHH A;  5L3F A;  1DF4 A;  3GIF A;  3U67 A;  4MPC A;  2WLH A;  4BAY A;  4EEH A;  3OW6 A;  5FNC A;  4TT3 G;  3TZ5 A;  2YI7 A;  5IN9 A;  1FS0 G;  2ZDX A;  2B1G A;  3ZXQ A;  3C11 A;  4WFH A;  4KTN A;  4N23 A;  4LWI A;  3OPD A;  3E8B A;  1AJQ A;  2XX5 A;  3H4L A;  5M4M A;  3VAD A;  4NH8 A;  2GQP A;  2DYS C;  1GMG A;  5KA6 A;  2OT5 A;  1M56 C;  1Z5B A;  3OMU A;  2ZXW C;  1UY6 A;  4CWS A;  1YSR A;  5IDJ A;  4JGS A;  4EFU A;  2CGF A;  1MSW D;  3CCE V;  1YT1 A;  5B1A B;  1AR1 B;  2WLK A;  1ORQ C;  5CA3 A;  1ZXN A;  2YKI A;  3LSS A;  5EBW C;  3GIG B;  3CD6 V;  2B5U A;  5LGU A;  4XD8 A;  2QM7 A;  1B63 A;  4HZ0 A;  3FV5 A;  1Y4S A;  2YJW A;  5LGT A;  2BU7 A;  3R4M A;  2O1U A;  1B6Q A;  3AG4 C;  3BY6 A;  3P30 A;  2YE5 A;  4CE2 A;  4MP7 A;  4PDV A;  1JOY A;  3T4Z A;  2UWD A;  5LBQ A;  3PEH A;  1K3E A;  5M4E A;  3F7V C;  1BMF G;  1UYC A;  1IXM A;  3WFV A;  3LUT B;  2UXX A;  3CYO A;  3Q5K A;  1QYE A;  2IJK A;  1AI5 A;  1GM7 A;  4G27 B;  1GKF A;  5CBG A;  4GEE A;  1P7B A;  1B3Q A;  4B7P A;  5BOC A;  3B8M A;  4L93 A;  3TK1 A;  3U2D A;  1XL6 A;  2LFS A;  1XL4 A;  1AM1 A;  2XDL A;  2Y69 B;  1V55 C;  4WFG A;  1G8M A;  3IED A;  1GTO A;  1ZWI C;  1Q86 W;  1QCE A;  1K97 A;  2FWY A;  5M4H A;  2YE3 A;  2IH3 C;  1UYI A;  4URO A;  3W7T A;  4GCZ A;  1R73 A;  2HKJ A;  1PKX A;  4JYC A;  2EIK C;  1AI4 A;  1NVP B;  1R62 A;  1FFT B;  3HYY A;  2JDI G;  2JEX A;  3HEK A;  4JPR A;  3ZIA G;  3R91 A;  2JKI A;  2XDX A;  4OXS A;  4R6Z A;  3FB5 C;  2Q8F A;  2FWZ A;  1K4C C;  5FL7 G;  1DLB A;  4RQF A;  4FK5 C;  4QJF B;  4KFG A;  1Y4M A;  4V25 A;  4Z1M G;  1Y66 A;  3ZKB A;  4MVZ A;  2GSM B;  4FIP C;  4L87 A;  4X8A A;  2YED A;  1KP3 A;  4J9Y B;  3GB7 C;  3CC7 V;  4CE1 A;  2IW5 A;  1KKD A;  5D7C A;  1S3J A;  2K1E A;  2YGF A;  4LPB A;  4XDL A;  4TWK A;  5EBM C;  1OCZ C;  2FTK A;  2DYS B;  3D0B A;  1S0V A;  3NMQ A;  5EC2 C;  5FND A;  3FB7 C;  1M56 B;  2ZXW B;  3FB8 C;  3LNM B;  2JJ1 G;  4XCL A;  4P7A A;  1UYM A;  4PA6 A;  1QLE C;  3AG2 C;  2CCU A;  4HXZ A;  5M4K A;  1N8R W;  3W7S A;  4I5S A;  1JM6 A;  3OWB A;  3W7X A;  5B1B C;  2YEV B;  1QLN A;  3STL C;  1EFR G;  2ZQM A;  4QPJ A;  4YKT A;  1OCR C;  4KP4 A;  2CCT A;  3E8H A;  1PD3 A;  3MNR P;  4BXI A;  3SYC A;  4V26 A;  1H8H G;  3AG4 B;  4ZVI A;  3T2S A;  1H8E G;  1P4R A;  1QR9 A;  4U7N A;  4UVC A;  3CWV A;  1JCH A;  4MT8 A;  5EBL C;  3G71 V;  1BYQ A;  1NHJ A;  1Q7Y W;  2P6J A;  2CH4 A;  2XK2 A;  3CCR V;  2XAQ A;  4MW3 A;  4R7C A;  3ETE A;  4H85 A;  4PL9 A;  3ZXO A;  1COW G;  2P67 A;  1V55 B;  1SZT A;  3TZ0 A;  1MG1 A;  1YTF B;  3A0T A;  3JD2 A;  2YGE A;  3D3I A;  2HVJ C;  2WI2 A;  1PNL A;  2PI4 A;  3U2K A;  4URL A;  1YHQ V;  2WLJ A;  4H7Q A;  4E00 A;  1GO3 F;  5LGN A;  1YC1 A;  4JYB A;  5LHI A;  1K9M W;  5LHG A;  5CTU A;  3P32 A;  3ZJZ A;  3NXS A;  4G28 B;  4YKW A;  1AJN A;  2P90 A;  1VQM V;  5HFM A;  3GIE A;  2C2A A;  2EIK B;  3SYA A;  3QNE A;  3EKO A;  4BQJ A;  3LPS A;  3FYE B;  3B24 A;  2GFD A;  2VW5 A;  2XHT A;  3ZRW A;  3F7Y C;  4GX1 A;  4J9Z B;  2B1I A;  1Y8N A;  3ETD A;  1Y8P A;  3ZRV A;  3D2R A;  3K0G A;  3RW0 A;  4MTG A;  1MU5 A;  1R6K A;  1VQ8 V;  3D36 A;  1TIL A;  2W6J G;  3AG1 C;  4RUF A;  1BXD A;  1W0J G;  4HZ5 A;  1QY8 A;  2Q2E B;  1Z5C A;  2XX4 A;  4H33 A;  4QIW F;  4PDM A;  3CRL A;  2WI1 A;  5IY5 C;  3OAA G;  4DXW A;  3SYQ A;  4JAS A;  4JAV A;  1GKZ A;  5CBH A;  3JZ3 A;  2WI6 A;  1EI1 A;  5CF0 A;  1OCZ B;  2DW4 A;  1OZ0 A;  2BZ5 A;  1RPR A;  1CPY A;  3HB3 B;  4MVQ A;  2E0A A;  1ARO P;  4P2Z A;  1Y8O A;  1ZWH A;  5L3J A;  2FYP A;  4PU9 A;  4UUJ C;  2YI0 A;  4XC0 A;  1QLE B;  3AG2 B;  2CCS A;  2DWE C;  4MBC A;  1E1Q G;  3SPJ A;  3EHF A;  2CK3 G;  2X0L A;  2JK5 C;  3OUS A;  1BKN A;  1UY9 A;  3O2F A;  3T0H A;  1PNK A;  1VQ5 V;  3QO8 A;  1GM9 A;  3AG3 C;  3BM9 A;  4EGK A;  5B1B B;  1K5Q A;  5D6Q A;  1BHB A;  3K9A A;  2IOQ A;  4XDK A;  3ETG A;  2Q8H A;  2YKB A;  3K08 A;  1OCR B;  3E8G A;  2LP7 A;  4AS9 A;  1LNQ A;  1KC8 W;  2YE6 A;  4XKA A;  1VQL V;  3WQ9 A;  2AHY A;  4JTD B;  2YE9 A;  1U2O A;  4MP2 A;  4R50 A;  4ASA A;  2WLI A;  4FCR A;  3ASO B;  2Z3Y A;  4P30 A;  4CWO A;  1VQK V;  3T1C A;  3OMA B;  4XIQ A;  3MHS C;  3CCQ V;  1YET A;  4P9O A;  4PDR A;  1G4Y B;  4O05 A;  2ATK C;  4DO2 A;  4JF3 A;  4RUE A;  2K5B A;  5L3G A;  2YEC A;  1S77 D;  4MVS A;  2Q8G A;  4DUH A;  1YC3 A;  1K5S A;  1S76 D;  3RVY A;  2VWC A;  1M9N A;  1W2B U;  2W0F C;  3SYO A;  1KIJ A;  5CPH A;  3X2Q B;  4PA9 A;  4R3M A;  2Q67 A;  5L3D A;  2YI5 A;  4LWE A;  1I5C A;  2Q68 A;  4EFT A;  1R3J C;  4FMT A;  2VCJ A;  2DQ0 A;  5F5R A;  4P9P A;  3SL2 A;  1UY7 A;  1UYL A;  4HZ3 A;  4LWH A;  2D3O W;  3R65 A;  3VHC A;  2YE4 A;  3AEI A;  2PNR A;  4PA3 A;  2YEJ A;  2F43 G;  4AWQ A;  4XKK A;  4CWP A;  1K33 A;  1KZN A;  1NHH A;  1GKX A;  2XAG A;  4ASG A;  2WLL B;  4XDJ A;  1UJW B;  4HY1 A;  1K34 A;  1E79 G;  2OTL V;  3SJQ C;  3EHG A;  3SPC A;  1FXK A;  4GX2 A;  5KA5 A;  3AG1 B;  2WLM A;  4AWP A;  3FKS G;  4GX5 A;  5E1A C;  1MOF A;  5GW7 A;  1EA6 A;  2QEX V;  1NR1 A;  2XOK G;  3OMI B;  5IY5 B;  1SER A;  1YI2 V;  4QE9 A;  2WSS G;  2WAM A;  2XND G;  2BU2 A;  3B77 A;  4H81 A;  2X7R B;  4AWO A;  3B26 A;  1TUE B;  4UVA A;  1NVP D;  3OGC C;  4EGH A;  2QTO A;  5M4P A;  1UYF A;  2H8M A;  2YEI A;  3VBB A;  4ASB A;  3K98 A;  3CCM V;  4TSF G;  3CGZ A;  2YKE A;  1WPX A;  4XIT A;  4O09 A;  3TET A;  4JTC B;  3FT8 A;  2JEU A;  2BRE A;  5CTX A;  3AG3 B;  3IFX A;  2A0L A;  1KQS U;  5H9C A;  4CE3 A;  1YER A;  2R9R B;  4WFE A;  1K8A W;  4E2L A;  3DTU B;  3IC7 A;  3OEH G;  3ZN1 A;  2O1V A;  1PVG A;  1ROP A;  3R4O A;  1TH8 A;  2BRC A;  2QFO A;  2BU5 A;  3BEH A;  2WI5 A;  4WFF A;  1Q81 W;  1F51 A;  1MAB G;  1WLE A;  1UYG A;  1MX0 A;  1A4H A;  2XAS A;  3ZRS A;  3I55 V;  3KE6 A;  4PDL A;  4O0B A;  3ABK C;  1QVF U;  1R3K C;  4LCU C;  2BSM A;  1ZW9 A;  4WF9 V;  1JQ0 A;  3K79 A;  3INX A;  1UY8 A;  1THZ A;  2EIL C;  3K0D A;  5J9P C;  1BGQ A;  5GGZ A;  2HG5 C;  1KEC A;  2YJX A;  5J71 A;  3K60 A;  4XBF A;  3ZMT A;  3OR7 C;  5L3C A;  1TID A;  1OSF A;  2PI5 A;  4MSW C;  4HXW A;  4XTJ A;  4R1F A;  4HYP A;  4WCE V;  3FB6 C;  4X89 A;  5EC1 C;  2IJJ A;  2YI6 A;  2IWU A;  4EM7 A;  2ITD C;  2NNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...