4URMA

Crystal structure of staph gyraseb 24kda in complex with kibdelomycin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
207
structure length
194
Chain Sequence
LEAARKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords DNA GYRASE SUBUNIT B
publication title Structures of Kibdelomycin Bound to Staphylococcus Aureus Gyrb and Pare Showed a Novel U-Shaped Binding Mode.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 57
structure length 194
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4urmA00
4MP2A 1US7A 4R3AA 5D7DA 5CF0A 2YE3A 1UYIA 1ZWHA 3OMUA 4EFTA 4HZ0A 4R1FA 4CWRA 5IDMA 3PEJA 4YKUA 3OWBA 4WUBA 2BU7A 4FMTA 1TBWA 3ZXOA 4LWGA 4O0BA 2WI6A 1AH6A 4YKQA 2YI6A 3HEKA 4HXWA 2WEPA 4I5SA 5CTXA 3LNUA 5CTWA 1UY9A 4XIQA 5FNCA 2IORA 3O2FA 3IEDA 3G75A 1H7UA 4HYPA 1I5AA 4ZKIA 2JKIA 4CWFA 2YGEA 4LP0A 3QDDA 2BU8A 2BTZA 2IOPA 3T1KA 4GCZA 3ZXQA 2BREA 4CE3A 3B25A 4X9LA 3TZ2A 3ZM7A 2ZBKB 4AWOA 3R91A 1YT2A 1THNA 3GIEA 3VHCA 3RKZA 5M4EA 1EA6A 4GQTA 2QG2A 1QZRA 4DUHA 2YEBA 1YC4A 4LWHA 3H80A 2Q8HA 2YKCA 4L91A 3INWA 1YETA 1ZW9A 5C93A 4AS9A 4GT8A 4I3HA 2IWXA 1I5CA 2YI0A 5J6AA 4PRXA 2HG1A 2BU6A 1YT0A 3A0TA 3TZ5A 3B28A 5CTUA 4CWQA 1NHHA 2H55A 2XDKA 2WI5A 4EEHA 4KP4A 2XDSA 2EXLA 3BM9A 4E00A 2BU2A 3FT8A 3U2KA 5F3KA 2YE6A 4CWTA 4L94A 3WQ9A 4B7PA 3HYZA 2BRCA 1H7SA 2XD6A 4KSHA 5CTYA 3A0XA 3PEHA 2YJWA 3WHAA 1UYGA 4EMVA 1NHJA 4ASAA 1B63A 3C11A 2YE2A 1ZXMA 1I5BA 2FWZA 1UY6A 1TH8A 1YC1A 2ESAA 3RLPA 5IN9A 1GKZA 1UYKA 1Y4SA 2Q2EB 2XDLA 4P8OA 1BYQA 3OPDA 5BODA 4MOTA 1U2OA 1AJ6A 3CRKA 4E01A 4XITA 4GGLA 3HHUA 2JJCA 4YKZA 4EGKA 3K60A 1OSFA 3R92A 4O09A 4XKAA 4AWQA 2VWCA 2YJXA 1EI1A 4B6CA 4XKKA 3OWDA 1YT1A 4LWEA 2VCJA 1GKXA 5IDJA 2ZKJA 4ASBA 1Y8NA 2CGFA 4JAUA 2WI1A 3EHFA 3FT5A 4YKXA 1UY7A 2YGFA 4HY1A 2FWYA 5BOCA 1YSZA 4JASA 3GIFA 3R4NA 4YKWA 1ID0A 1I58A 4UROA 3INXA 4JAVA 2YEIA 2YE5A 4JQLA 4H85A 2O1UA 4H7QA 2YE8A 4O07A 4BQGA 3O0IA 4KQVA 3ZKBA 1MU5A 4XCLA 3CRLA 3EHHA 1MX0A 2YK2A 1A4HA 2XHXA 3R4MA 4GEEA 3Q5KA 4O04A 3NMQA 4MBCA 3EHGA 2E0AA 3K98A 4ZVIA 4EM7A 2YE4A 2BU5A 4FCRA 4EFUA 2XX2A 4L93A 1S16A 4QPJA 4FCPA 4EGHA 4V25A 1B3QA 1ZXNA 2YE9A 3A0RA 3GIGA 4U7OA 4Q20A 3EKRA 2XCMA 3GIGB 5GGZA 1I59A 2YKIA 4GFNA 4PU9A 3T0HA 3T0ZA 1BGQA 5FNDA 2Q8GA 4YKRA 1R62A 4MPEA 2WERA 4MB9A 2XJXA 2BYHA 1YESA 1AMWA 3FV5A 2FYPA 4XDMA 3A0WA 2YKJA 3O6OA 4O05A 1Y8OA 1YERA 4U7NA 4MPNA 1TC6A 1TILA 4CWPA 4HXZA 3VHDA 2CCSA 1YC3A 1JM6A 3KE6A 3TTZA 2IOQA 5M4PA 2XABA 3HYYA 5D7RA 4XTJA 1UYEA 3R4OA 1Y8PA 2H8MA 4KFGA 4EGIA 2XDXA 5FNFA 4KSGA 2Q8IA 1QY8A 4URNA 3B24A 3TZ0A 3TUHA 3OW6A 2CG9A 3D36A 4WUDA 1NHIA 2YKEA 5D7CA 3VHAA 3HZ1A 2XJJA 1UY8A 3DGEA 3LPSA 1AH8A 5M4KA 2VW5A 5M4HA 3A0YA 3U67A 2QG0A 2XDUA 3G7BA 5D6QA 1TIDA 2YK9A 2YI5A 4QPKA 4PL9A 1I5DA 4H81A 5J71A 2YEEA 1Z5AA 3D2RA 2Q8FA 2IWSA 5L3JA 3CWVA 2BYIA 2PNRA 3RLRA 4XCJA 1YS3A 3K97A 3K99A 2HKJA 2WEQA 4CWOA 4XD8A 4DZYA 1BXDA 4L90A 4XIRA 2QF6A 4V26A 1YSRA 2VCIA 3JZ3A 5M4MA 4ASGA 2XX4A 4NH7A 2YI7A 5FWKA 2WI4A 4K4OA 1KIJA 2XX5A 1B62A 4FCQA 3B27A 4MPCA 1QYEA 1Z5BA 3C0EA 3TZ4A 2UWDA 4HZ5A 2WI2A 5F5RA 4LWFA 4CE2A 1UYFA 4XC0A 4XE2A 4YKYA 2BT0A 4URLA 2XHRA 2YE7A 1UYDA 2YEFA 1UYHA 4XKOA 1PVGA 3EHJA 2GFDA 3SL2A 3ZKDA 4U93A 5M4NA 5CPHA 2ZDYA 1BKNA 3Q5LA 2YEJA 1Z59A 2O1VA 2XK2A 4W7TA 2YECA 3D0BA 3QTFA 1TC0A 4BAEA 2CCUA 3U2DA 2BSMA 2YEHA 2YEGA 2BZ5A 2C2AA 4NH9A 1Y4UA 4HY6A 3EKOA 2CCTA 5D6PA 1AM1A 2K5BA 2YKBA 2AKPA 4AWPA 2WI7A 3H4LA 4LWIA 3CGYA 4FPPA 3G7EA 3RLQA 3T2SA 1UYLA 2YGAA 2GQPA 2ZDXA 4URMA 1U0ZA 3BMYA 3R4PA 3VADA 1Z5CA 2XJGA 2IWUA 4CWNA 3A0ZA 2CH4A 1UYCA 4ASFA 1S14A 2QFOA 4XIPA 3MNRP 4KTNA 4BQJA 2YEDA 4BIUA 4MP7A 3HZ5A 4NH8A 4CE1A 4HYMA 4L8ZA 4YKTA 2XHTA 4BXIA 3Q5JA 2FXSA 1KZNA 2YEAA 1GJVA 2HCHA 3T10A 4BIZA 4LPBA 4CWSA 1UYMA 1L0OA 4PRVA 4E02A 3B26A 3CGZA 4R3MA 4P7AA 2O1WA 2WI3A 4WUCA
chains in the Genus database with same CATH superfamily
4MP2A 1US7A 4R3AA 5D7DA 5CF0A 2YE3A 1UYIA 1ZWHA 3OMUA 4EFTA 4HZ0A 4R1FA 4CWRA 5IDMA 3PEJA 4YKUA 3OWBA 4WUBA 2BU7A 4FMTA 1TBWA 3ZXOA 4LWGA 4O0BA 2WI6A 1AH6A 4YKQA 2YI6A 3HEKA 4HXWA 2WEPA 4I5SA 5CTXA 3LNUA 5CTWA 1UY9A 4XIQA 5FNCA 2IORA 3O2FA 3IEDA 5JENA 3G75A 1H7UA 4HYPA 1I5AA 4ZKIA 2JKIA 4CWFA 2YGEA 4LP0A 3QDDA 2BU8A 2BTZA 2IOPA 3T1KA 4GCZA 3ZXQA 2BREA 4CE3A 3B25A 4X9LA 3TZ2A 3ZM7A 2ZBKB 4AWOA 3R91A 1YT2A 1THNA 3GIEA 3VHCA 3RKZA 5M4EA 1EA6A 4GQTA 2QG2A 1QZRA 4DUHA 2YEBA 1YC4A 4LWHA 3H80A 2Q8HA 2YKCA 4L91A 3INWA 1YETA 1ZW9A 5C93A 4AS9A 4GT8A 4I3HA 2IWXA 1I5CA 2YI0A 5J6AA 4PRXA 2HG1A 2BU6A 1YT0A 3A0TA 3TZ5A 3B28A 5CTUA 4CWQA 1NHHA 2H55A 2XDKA 2WI5A 4EEHA 4KP4A 2XDSA 2EXLA 3BM9A 4E00A 2BU2A 3FT8A 3U2KA 5F3KA 2YE6A 4CWTA 4L94A 3WQ9A 4B7PA 3HYZA 2BRCA 1H7SA 2XD6A 4KSHA 5CTYA 3A0XA 3PEHA 2YJWA 3WHAA 1UYGA 4EMVA 1NHJA 4ASAA 1B63A 3C11A 2YE2A 1ZXMA 1I5BA 2FWZA 1UY6A 1TH8A 1YC1A 2ESAA 3RLPA 5IN9A 1GKZA 1UYKA 1Y4SA 2Q2EB 2XDLA 4P8OA 1BYQA 3OPDA 5BODA 4MOTA 1U2OA 1AJ6A 3CRKA 4E01A 4XITA 4GGLA 3HHUA 2JJCA 4YKZA 4EGKA 3K60A 1OSFA 3R92A 4O09A 4XKAA 4AWQA 2VWCA 2YJXA 1EI1A 4B6CA 4XKKA 3OWDA 1YT1A 4LWEA 2VCJA 2C1IA 1GKXA 5IDJA 2ZKJA 4ASBA 1Y8NA 2CGFA 4JAUA 2WI1A 3EHFA 3FT5A 4YKXA 1UY7A 2YGFA 4HY1A 2FWYA 5BOCA 1YSZA 4JASA 3S5TA 3GIFA 3R4NA 4YKWA 1ID0A 1I58A 4UROA 3INXA 4JAVA 2YEIA 2FTKA 2YE5A 4JQLA 4H85A 2O1UA 4H7QA 2YE8A 4O07A 4BQGA 3O0IA 4KQVA 3ZKBA 1MU5A 4XCLA 3CRLA 3EHHA 1MX0A 2YK2A 1A4HA 2XHXA 3R4MA 4GEEA 3Q5KA 4O04A 3NMQA 4MBCA 3EHGA 2E0AA 3K98A 4ZVIA 4EM7A 2YE4A 2BU5A 4FCRA 4EFUA 2XX2A 4L93A 1S16A 4QPJA 4FCPA 4EGHA 4V25A 1B3QA 1ZXNA 2YE9A 3A0RA 3GIGA 4U7OA 4Q20A 3EKRA 2XCMA 3GIGB 5GGZA 1I59A 2YKIA 4GFNA 4PU9A 3T0HA 3T0ZA 1BGQA 5FNDA 3CYGA 2Q8GA 3LMMA 4YKRA 1R62A 4MPEA 2WERA 4MB9A 2XJXA 2BYHA 1YESA 1AMWA 3FV5A 2FYPA 4XDMA 3A0WA 2YKJA 3O6OA 4O05A 1Y8OA 1YERA 4E72A 4U7NA 4MPNA 1TC6A 1TILA 4CWPA 4HXZA 3VHDA 2CCSA 1YC3A 1JM6A 3KE6A 3TTZA 2IOQA 5M4PA 2XABA 3HYYA 5D7RA 4XTJA 1UYEA 3R4OA 1Y8PA 2H8MA 4KFGA 4EGIA 2HHIA 2XDXA 1F51A 5FNFA 4KSGA 2Q8IA 1QY8A 4URNA 3B24A 3TZ0A 3TUHA 3OW6A 2CG9A 3D36A 4WUDA 1NHIA 2YKEA 5D7CA 3VHAA 3HZ1A 2XJJA 1UY8A 3DGEA 2C1GA 3LPSA 1AH8A 5M4KA 2VW5A 5M4HA 3A0YA 3U67A 2QG0A 2XDUA 3G7BA 5D6QA 1TIDA 2YK9A 2YI5A 4QPKA 4PL9A 1I5DA 4H81A 5J71A 2YEEA 1Z5AA 3D2RA 2Q8FA 2IWSA 5L3JA 3CWVA 2BYIA 2PNRA 3RLRA 4XCJA 1YS3A 3K97A 3K99A 2HKJA 2WEQA 4CWOA 4XD8A 4DZYA 1BXDA 4L90A 4XIRA 2QF6A 4V26A 1YSRA 2VCIA 3JZ3A 5M4MA 4ASGA 2XX4A 4NH7A 2YI7A 5FWKA 2WI4A 4K4OA 1KIJA 2XX5A 1B62A 4FCQA 3B27A 4MPCA 1QYEA 1Z5BA 3C0EA 3TZ4A 2UWDA 4HZ5A 2WI2A 5F5RA 4LWFA 4CE2A 1UYFA 4XC0A 4XE2A 4YKYA 2BT0A 4URLA 2XHRA 2YE7A 1UYDA 2YEFA 1UYHA 4XKOA 1PVGA 3EHJA 2GFDA 3SL2A 3ZKDA 4U93A 5M4NA 5CPHA 2ZDYA 1BKNA 3Q5LA 2YEJA 1Z59A 2O1VA 2XK2A 4W7TA 2YECA 3D0BA 3QTFA 1TC0A 4BAEA 2CCUA 3U2DA 2BSMA 2YEHA 2YEGA 2BZ5A 2C2AA 4NH9A 1Y4UA 4HY6A 3EKOA 2CCTA 5D6PA 1AM1A 2K5BA 2YKBA 2AKPA 4AWPA 2WI7A 3H4LA 4LWIA 3CGYA 4FPPA 3G7EA 3RLQA 3T2SA 1UYLA 2YGAA 2GQPA 2ZDXA 4URMA 1U0ZA 3BMYA 3R4PA 3VADA 1Z5CA 2XJGA 2IWUA 4CWNA 3A0ZA 2CH4A 1UYCA 4ASFA 1S14A 2QFOA 4XIPA 3MNRP 4KTNA 4BQJA 2YEDA 4BIUA 4MP7A 3HZ5A 4NH8A 4CE1A 4HYMA 4L8ZA 4YKTA 2XHTA 4BXIA 3Q5JA 2FXSA 1KZNA 2YEAA 1GJVA 2HCHA 3T10A 4BIZA 4LPBA 1IXMA 4CWSA 1UYMA 1L0OA 4PRVA 4E02A 3B26A 3CGZA 4R3MA 4P7AA 2O1WA 2WI3A 4WUCA
chains in the Genus database with same CATH topology
4MP2A 1US7A 4R3AA 5D7DA 5CF0A 2YE3A 1UYIA 1ZWHA 3OMUA 4EFTA 4HZ0A 4R1FA 4CWRA 5IDMA 3PEJA 4YKUA 3OWBA 4WUBA 2BU7A 4FMTA 1TBWA 3ZXOA 4LWGA 4O0BA 2WI6A 1AH6A 4YKQA 2YI6A 3HEKA 4HXWA 2WEPA 4I5SA 5CTXA 3LNUA 5CTWA 1UY9A 4XIQA 5FNCA 2IORA 3O2FA 3IEDA 3G75A 1H7UA 4HYPA 1I5AA 4ZKIA 2JKIA 4CWFA 2YGEA 4LP0A 3QDDA 2BU8A 2BTZA 2IOPA 3T1KA 4GCZA 3ZXQA 2BREA 4CE3A 3B25A 4X9LA 3TZ2A 3ZM7A 2ZBKB 4AWOA 3R91A 1YT2A 1THNA 3GIEA 3VHCA 3RKZA 5M4EA 1EA6A 4GQTA 2QG2A 1QZRA 4DUHA 2YEBA 1YC4A 4LWHA 3H80A 2Q8HA 2YKCA 4L91A 3INWA 1YETA 1ZW9A 5C93A 4AS9A 4GT8A 4I3HA 2IWXA 1I5CA 2YI0A 5J6AA 4PRXA 2HG1A 2BU6A 1YT0A 3A0TA 3TZ5A 3B28A 5CTUA 4CWQA 1NHHA 2H55A 2XDKA 2WI5A 4EEHA 4KP4A 2XDSA 2EXLA 3BM9A 4E00A 2BU2A 3FT8A 3U2KA 5F3KA 2YE6A 4CWTA 4L94A 3WQ9A 4B7PA 3HYZA 2BRCA 1H7SA 2XD6A 4KSHA 5CTYA 3A0XA 3PEHA 2YJWA 3WHAA 1UYGA 4EMVA 1NHJA 4ASAA 1B63A 3C11A 2YE2A 1ZXMA 1I5BA 2FWZA 1UY6A 1TH8A 1YC1A 2ESAA 3RLPA 5IN9A 1GKZA 1UYKA 1Y4SA 2Q2EB 2XDLA 4P8OA 1BYQA 3OPDA 5BODA 4MOTA 1U2OA 1AJ6A 3CRKA 4E01A 4XITA 4GGLA 3HHUA 2JJCA 4YKZA 4EGKA 3K60A 1OSFA 3R92A 4O09A 4XKAA 4AWQA 2VWCA 2YJXA 1EI1A 4B6CA 4XKKA 3OWDA 1YT1A 4LWEA 2VCJA 1GKXA 5IDJA 2ZKJA 4ASBA 1Y8NA 2CGFA 4JAUA 2WI1A 3EHFA 3FT5A 4YKXA 1UY7A 2YGFA 4HY1A 2FWYA 5BOCA 1YSZA 4JASA 3GIFA 3R4NA 4YKWA 1ID0A 1I58A 4UROA 3INXA 4JAVA 2YEIA 2YE5A 4JQLA 4H85A 2O1UA 4H7QA 2YE8A 4O07A 4BQGA 3O0IA 4KQVA 3ZKBA 1MU5A 4XCLA 3CRLA 3EHHA 1MX0A 2YK2A 1A4HA 2XHXA 3R4MA 4GEEA 3Q5KA 4O04A 3NMQA 4MBCA 3EHGA 2E0AA 3K98A 4ZVIA 4EM7A 2YE4A 2BU5A 4FCRA 4EFUA 2XX2A 4L93A 1S16A 4QPJA 4FCPA 4EGHA 4V25A 1B3QA 1ZXNA 2YE9A 3A0RA 3GIGA 4U7OA 4Q20A 3EKRA 2XCMA 3GIGB 5GGZA 1I59A 2YKIA 4GFNA 4PU9A 3T0HA 3T0ZA 1BGQA 5FNDA 2Q8GA 4YKRA 1R62A 4MPEA 2WERA 4MB9A 2XJXA 2BYHA 1YESA 1AMWA 3FV5A 2FYPA 4XDMA 3A0WA 2YKJA 3O6OA 4O05A 1Y8OA 1YERA 4U7NA 4MPNA 1TC6A 1TILA 4CWPA 4HXZA 3VHDA 2CCSA 1YC3A 1JM6A 3KE6A 3TTZA 2IOQA 5M4PA 2XABA 3HYYA 5D7RA 4XTJA 1UYEA 3R4OA 1Y8PA 2H8MA 4KFGA 4EGIA 2XDXA 5FNFA 4KSGA 2Q8IA 1QY8A 4URNA 3B24A 3TZ0A 3TUHA 3OW6A 2CG9A 3D36A 4WUDA 1NHIA 2YKEA 5D7CA 3VHAA 3HZ1A 2XJJA 1UY8A 3DGEA 3LPSA 1AH8A 5M4KA 2VW5A 5M4HA 3A0YA 3U67A 2QG0A 2XDUA 3G7BA 5D6QA 1TIDA 2YK9A 2YI5A 4QPKA 4PL9A 1I5DA 4H81A 5J71A 2YEEA 1Z5AA 3D2RA 2Q8FA 2IWSA 5L3JA 3CWVA 2BYIA 2PNRA 3RLRA 4XCJA 1YS3A 3K97A 3K99A 2HKJA 2WEQA 4CWOA 4XD8A 4DZYA 1BXDA 4L90A 4XIRA 2QF6A 4V26A 1YSRA 2VCIA 3JZ3A 5M4MA 4ASGA 2XX4A 4NH7A 2YI7A 5FWKA 2WI4A 4K4OA 1KIJA 2XX5A 1B62A 4FCQA 3B27A 4MPCA 1QYEA 1Z5BA 3C0EA 3TZ4A 2UWDA 4HZ5A 2WI2A 5F5RA 4LWFA 4CE2A 1UYFA 4XC0A 4XE2A 4YKYA 2BT0A 4URLA 2XHRA 2YE7A 1UYDA 2YEFA 1UYHA 4XKOA 1PVGA 3EHJA 2GFDA 3SL2A 3ZKDA 4U93A 5M4NA 5CPHA 2ZDYA 1BKNA 3Q5LA 2YEJA 1Z59A 2O1VA 2XK2A 4W7TA 2YECA 3D0BA 3QTFA 1TC0A 4BAEA 2CCUA 3U2DA 2BSMA 2YEHA 2YEGA 2BZ5A 2C2AA 4NH9A 1Y4UA 4HY6A 3EKOA 2CCTA 5D6PA 1AM1A 2K5BA 2YKBA 2AKPA 4AWPA 2WI7A 3H4LA 4LWIA 3CGYA 4FPPA 3G7EA 3RLQA 3T2SA 1UYLA 2YGAA 2GQPA 2ZDXA 4URMA 1U0ZA 3BMYA 3R4PA 3VADA 1Z5CA 2XJGA 2IWUA 4CWNA 3A0ZA 2CH4A 1UYCA 4ASFA 1S14A 2QFOA 4XIPA 3MNRP 4KTNA 4BQJA 2YEDA 4BIUA 4MP7A 3HZ5A 4NH8A 4CE1A 4HYMA 4L8ZA 4YKTA 2XHTA 4BXIA 3Q5JA 2FXSA 1KZNA 2YEAA 1GJVA 2HCHA 3T10A 4BIZA 4LPBA 4CWSA 1UYMA 1L0OA 4PRVA 4E02A 3B26A 3CGZA 4R3MA 4P7AA 2O1WA 2WI3A 4WUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MP2 A;  1US7 A;  4R3A A;  5D7D A;  5CF0 A;  2YE3 A;  1UYI A;  1ZWH A;  3OMU A;  4EFT A;  4HZ0 A;  4R1F A;  4CWR A;  5IDM A;  3PEJ A;  4YKU A;  3OWB A;  4WUB A;  2BU7 A;  4FMT A;  1TBW A;  3ZXO A;  4LWG A;  4O0B A;  2WI6 A;  1AH6 A;  4YKQ A;  2YI6 A;  3HEK A;  4HXW A;  2WEP A;  4I5S A;  5CTX A;  3LNU A;  5CTW A;  1UY9 A;  4XIQ A;  5FNC A;  2IOR A;  3O2F A;  3IED A;  3G75 A;  1H7U A;  4HYP A;  1I5A A;  4ZKI A;  2JKI A;  4CWF A;  2YGE A;  4LP0 A;  3QDD A;  2BU8 A;  2BTZ A;  2IOP A;  3T1K A;  4GCZ A;  3ZXQ A;  2BRE A;  4CE3 A;  3B25 A;  4X9L A;  3TZ2 A;  3ZM7 A;  2ZBK B;  4AWO A;  3R91 A;  1YT2 A;  1THN A;  3GIE A;  3VHC A;  3RKZ A;  5M4E A;  1EA6 A;  4GQT A;  2QG2 A;  1QZR A;  4DUH A;  2YEB A;  1YC4 A;  4LWH A;  3H80 A;  2Q8H A;  2YKC A;  4L91 A;  3INW A;  1YET A;  1ZW9 A;  5C93 A;  4AS9 A;  4GT8 A;  4I3H A;  2IWX A;  1I5C A;  2YI0 A;  5J6A A;  4PRX A;  2HG1 A;  2BU6 A;  1YT0 A;  3A0T A;  3TZ5 A;  3B28 A;  5CTU A;  4CWQ A;  1NHH A;  2H55 A;  2XDK A;  2WI5 A;  4EEH A;  4KP4 A;  2XDS A;  2EXL A;  3BM9 A;  4E00 A;  2BU2 A;  3FT8 A;  3U2K A;  5F3K A;  2YE6 A;  4CWT A;  4L94 A;  3WQ9 A;  4B7P A;  3HYZ A;  2BRC A;  1H7S A;  2XD6 A;  4KSH A;  5CTY A;  3A0X A;  3PEH A;  2YJW A;  3WHA A;  1UYG A;  4EMV A;  1NHJ A;  4ASA A;  1B63 A;  3C11 A;  2YE2 A;  1ZXM A;  1I5B A;  2FWZ A;  1UY6 A;  1TH8 A;  1YC1 A;  2ESA A;  3RLP A;  5IN9 A;  1GKZ A;  1UYK A;  1Y4S A;  2Q2E B;  2XDL A;  4P8O A;  1BYQ A;  3OPD A;  5BOD A;  4MOT A;  1U2O A;  1AJ6 A;  3CRK A;  4E01 A;  4XIT A;  4GGL A;  3HHU A;  2JJC A;  4YKZ A;  4EGK A;  3K60 A;  1OSF A;  3R92 A;  4O09 A;  4XKA A;  4AWQ A;  2VWC A;  2YJX A;  1EI1 A;  4B6C A;  4XKK A;  3OWD A;  1YT1 A;  4LWE A;  2VCJ A;  1GKX A;  5IDJ A;  2ZKJ A;  4ASB A;  1Y8N A;  2CGF A;  4JAU A;  2WI1 A;  3EHF A;  3FT5 A;  4YKX A;  1UY7 A;  2YGF A;  4HY1 A;  2FWY A;  5BOC A;  1YSZ A;  4JAS A;  3GIF A;  3R4N A;  4YKW A;  1ID0 A;  1I58 A;  4URO A;  3INX A;  4JAV A;  2YEI A;  2YE5 A;  4JQL A;  4H85 A;  2O1U A;  4H7Q A;  2YE8 A;  4O07 A;  4BQG A;  3O0I A;  4KQV A;  3ZKB A;  1MU5 A;  4XCL A;  3CRL A;  3EHH A;  1MX0 A;  2YK2 A;  1A4H A;  2XHX A;  3R4M A;  4GEE A;  3Q5K A;  4O04 A;  3NMQ A;  4MBC A;  3EHG A;  2E0A A;  3K98 A;  4ZVI A;  4EM7 A;  2YE4 A;  2BU5 A;  4FCR A;  4EFU A;  2XX2 A;  4L93 A;  1S16 A;  4QPJ A;  4FCP A;  4EGH A;  4V25 A;  1B3Q A;  1ZXN A;  2YE9 A;  3A0R A;  3GIG A;  4U7O A;  4Q20 A;  3EKR A;  2XCM A;  3GIG B;  5GGZ A;  1I59 A;  2YKI A;  4GFN A;  4PU9 A;  3T0H A;  3T0Z A;  1BGQ A;  5FND A;  2Q8G A;  4YKR A;  1R62 A;  4MPE A;  2WER A;  4MB9 A;  2XJX A;  2BYH A;  1YES A;  1AMW A;  3FV5 A;  2FYP A;  4XDM A;  3A0W A;  2YKJ A;  3O6O A;  4O05 A;  1Y8O A;  1YER A;  4U7N A;  4MPN A;  1TC6 A;  1TIL A;  4CWP A;  4HXZ A;  3VHD A;  2CCS A;  1YC3 A;  1JM6 A;  3KE6 A;  3TTZ A;  2IOQ A;  5M4P A;  2XAB A;  3HYY A;  5D7R A;  4XTJ A;  1UYE A;  3R4O A;  1Y8P A;  2H8M A;  4KFG A;  4EGI A;  2XDX A;  5FNF A;  4KSG A;  2Q8I A;  1QY8 A;  4URN A;  3B24 A;  3TZ0 A;  3TUH A;  3OW6 A;  2CG9 A;  3D36 A;  4WUD A;  1NHI A;  2YKE A;  5D7C A;  3VHA A;  3HZ1 A;  2XJJ A;  1UY8 A;  3DGE A;  3LPS A;  1AH8 A;  5M4K A;  2VW5 A;  5M4H A;  3A0Y A;  3U67 A;  2QG0 A;  2XDU A;  3G7B A;  5D6Q A;  1TID A;  2YK9 A;  2YI5 A;  4QPK A;  4PL9 A;  1I5D A;  4H81 A;  5J71 A;  2YEE A;  1Z5A A;  3D2R A;  2Q8F A;  2IWS A;  5L3J A;  3CWV A;  2BYI A;  2PNR A;  3RLR A;  4XCJ A;  1YS3 A;  3K97 A;  3K99 A;  2HKJ A;  2WEQ A;  4CWO A;  4XD8 A;  4DZY A;  1BXD A;  4L90 A;  4XIR A;  2QF6 A;  4V26 A;  1YSR A;  2VCI A;  3JZ3 A;  5M4M A;  4ASG A;  2XX4 A;  4NH7 A;  2YI7 A;  5FWK A;  2WI4 A;  4K4O A;  1KIJ A;  2XX5 A;  1B62 A;  4FCQ A;  3B27 A;  4MPC A;  1QYE A;  1Z5B A;  3C0E A;  3TZ4 A;  2UWD A;  4HZ5 A;  2WI2 A;  5F5R A;  4LWF A;  4CE2 A;  1UYF A;  4XC0 A;  4XE2 A;  4YKY A;  2BT0 A;  4URL A;  2XHR A;  2YE7 A;  1UYD A;  2YEF A;  1UYH A;  4XKO A;  1PVG A;  3EHJ A;  2GFD A;  3SL2 A;  3ZKD A;  4U93 A;  5M4N A;  5CPH A;  2ZDY A;  1BKN A;  3Q5L A;  2YEJ A;  1Z59 A;  2O1V A;  2XK2 A;  4W7T A;  2YEC A;  3D0B A;  3QTF A;  1TC0 A;  4BAE A;  2CCU A;  3U2D A;  2BSM A;  2YEH A;  2YEG A;  2BZ5 A;  2C2A A;  4NH9 A;  1Y4U A;  4HY6 A;  3EKO A;  2CCT A;  5D6P A;  1AM1 A;  2K5B A;  2YKB A;  2AKP A;  4AWP A;  2WI7 A;  3H4L A;  4LWI A;  3CGY A;  4FPP A;  3G7E A;  3RLQ A;  3T2S A;  1UYL A;  2YGA A;  2GQP A;  2ZDX A;  4URM A;  1U0Z A;  3BMY A;  3R4P A;  3VAD A;  1Z5C A;  2XJG A;  2IWU A;  4CWN A;  3A0Z A;  2CH4 A;  1UYC A;  4ASF A;  1S14 A;  2QFO A;  4XIP A;  3MNR P;  4KTN A;  4BQJ A;  2YED A;  4BIU A;  4MP7 A;  3HZ5 A;  4NH8 A;  4CE1 A;  4HYM A;  4L8Z A;  4YKT A;  2XHT A;  4BXI A;  3Q5J A;  2FXS A;  1KZN A;  2YEA A;  1GJV A;  2HCH A;  3T10 A;  4BIZ A;  4LPB A;  4CWS A;  1UYM A;  1L0O A;  4PRV A;  4E02 A;  3B26 A;  3CGZ A;  4R3M A;  4P7A A;  2O1W A;  2WI3 A;  4WUC A; 
#chains in the Genus database with same CATH topology
 4MP2 A;  1US7 A;  4R3A A;  5D7D A;  5CF0 A;  2YE3 A;  1UYI A;  1ZWH A;  3OMU A;  4EFT A;  4HZ0 A;  4R1F A;  4CWR A;  5IDM A;  3PEJ A;  4YKU A;  3OWB A;  4WUB A;  2BU7 A;  4FMT A;  1TBW A;  3ZXO A;  4LWG A;  4O0B A;  2WI6 A;  1AH6 A;  4YKQ A;  2YI6 A;  3HEK A;  4HXW A;  2WEP A;  4I5S A;  5CTX A;  3LNU A;  5CTW A;  1UY9 A;  4XIQ A;  5FNC A;  2IOR A;  3O2F A;  3IED A;  5JEN A;  3G75 A;  1H7U A;  4HYP A;  1I5A A;  4ZKI A;  2JKI A;  4CWF A;  2YGE A;  4LP0 A;  3QDD A;  2BU8 A;  2BTZ A;  2IOP A;  3T1K A;  4GCZ A;  3ZXQ A;  2BRE A;  4CE3 A;  3B25 A;  4X9L A;  3TZ2 A;  3ZM7 A;  2ZBK B;  4AWO A;  3R91 A;  1YT2 A;  1THN A;  3GIE A;  3VHC A;  3RKZ A;  5M4E A;  1EA6 A;  4GQT A;  2QG2 A;  1QZR A;  4DUH A;  2YEB A;  1YC4 A;  4LWH A;  3H80 A;  2Q8H A;  2YKC A;  4L91 A;  3INW A;  1YET A;  1ZW9 A;  5C93 A;  4AS9 A;  4GT8 A;  4I3H A;  2IWX A;  1I5C A;  2YI0 A;  5J6A A;  4PRX A;  2HG1 A;  2BU6 A;  1YT0 A;  3A0T A;  3TZ5 A;  3B28 A;  5CTU A;  4CWQ A;  1NHH A;  2H55 A;  2XDK A;  2WI5 A;  4EEH A;  4KP4 A;  2XDS A;  2EXL A;  3BM9 A;  4E00 A;  2BU2 A;  3FT8 A;  3U2K A;  5F3K A;  2YE6 A;  4CWT A;  4L94 A;  3WQ9 A;  4B7P A;  3HYZ A;  2BRC A;  1H7S A;  2XD6 A;  4KSH A;  5CTY A;  3A0X A;  3PEH A;  2YJW A;  3WHA A;  1UYG A;  4EMV A;  1NHJ A;  4ASA A;  1B63 A;  3C11 A;  2YE2 A;  1ZXM A;  1I5B A;  2FWZ A;  1UY6 A;  1TH8 A;  1YC1 A;  2ESA A;  3RLP A;  5IN9 A;  1GKZ A;  1UYK A;  1Y4S A;  2Q2E B;  2XDL A;  4P8O A;  1BYQ A;  3OPD A;  5BOD A;  4MOT A;  1U2O A;  1AJ6 A;  3CRK A;  4E01 A;  4XIT A;  4GGL A;  3HHU A;  2JJC A;  4YKZ A;  4EGK A;  3K60 A;  1OSF A;  3R92 A;  4O09 A;  4XKA A;  4AWQ A;  2VWC A;  2YJX A;  1EI1 A;  4B6C A;  4XKK A;  3OWD A;  1YT1 A;  4LWE A;  2VCJ A;  2C1I A;  1GKX A;  5IDJ A;  2ZKJ A;  4ASB A;  1Y8N A;  2CGF A;  4JAU A;  2WI1 A;  3EHF A;  3FT5 A;  4YKX A;  1UY7 A;  2YGF A;  4HY1 A;  2FWY A;  5BOC A;  1YSZ A;  4JAS A;  3S5T A;  3GIF A;  3R4N A;  4YKW A;  1ID0 A;  1I58 A;  4URO A;  3INX A;  4JAV A;  2YEI A;  2FTK A;  2YE5 A;  4JQL A;  4H85 A;  2O1U A;  4H7Q A;  2YE8 A;  4O07 A;  4BQG A;  3O0I A;  4KQV A;  3ZKB A;  1MU5 A;  4XCL A;  3CRL A;  3EHH A;  1MX0 A;  2YK2 A;  1A4H A;  2XHX A;  3R4M A;  4GEE A;  3Q5K A;  4O04 A;  3NMQ A;  4MBC A;  3EHG A;  2E0A A;  3K98 A;  4ZVI A;  4EM7 A;  2YE4 A;  2BU5 A;  4FCR A;  4EFU A;  2XX2 A;  4L93 A;  1S16 A;  4QPJ A;  4FCP A;  4EGH A;  4V25 A;  1B3Q A;  1ZXN A;  2YE9 A;  3A0R A;  3GIG A;  4U7O A;  4Q20 A;  3EKR A;  2XCM A;  3GIG B;  5GGZ A;  1I59 A;  2YKI A;  4GFN A;  4PU9 A;  3T0H A;  3T0Z A;  1BGQ A;  5FND A;  3CYG A;  2Q8G A;  3LMM A;  4YKR A;  1R62 A;  4MPE A;  2WER A;  4MB9 A;  2XJX A;  2BYH A;  1YES A;  1AMW A;  3FV5 A;  2FYP A;  4XDM A;  3A0W A;  2YKJ A;  3O6O A;  4O05 A;  1Y8O A;  1YER A;  4E72 A;  4U7N A;  4MPN A;  1TC6 A;  1TIL A;  4CWP A;  4HXZ A;  3VHD A;  2CCS A;  1YC3 A;  1JM6 A;  3KE6 A;  3TTZ A;  2IOQ A;  5M4P A;  2XAB A;  3HYY A;  5D7R A;  4XTJ A;  1UYE A;  3R4O A;  1Y8P A;  2H8M A;  4KFG A;  4EGI A;  2HHI A;  2XDX A;  1F51 A;  5FNF A;  4KSG A;  2Q8I A;  1QY8 A;  4URN A;  3B24 A;  3TZ0 A;  3TUH A;  3OW6 A;  2CG9 A;  3D36 A;  4WUD A;  1NHI A;  2YKE A;  5D7C A;  3VHA A;  3HZ1 A;  2XJJ A;  1UY8 A;  3DGE A;  2C1G A;  3LPS A;  1AH8 A;  5M4K A;  2VW5 A;  5M4H A;  3A0Y A;  3U67 A;  2QG0 A;  2XDU A;  3G7B A;  5D6Q A;  1TID A;  2YK9 A;  2YI5 A;  4QPK A;  4PL9 A;  1I5D A;  4H81 A;  5J71 A;  2YEE A;  1Z5A A;  3D2R A;  2Q8F A;  2IWS A;  5L3J A;  3CWV A;  2BYI A;  2PNR A;  3RLR A;  4XCJ A;  1YS3 A;  3K97 A;  3K99 A;  2HKJ A;  2WEQ A;  4CWO A;  4XD8 A;  4DZY A;  1BXD A;  4L90 A;  4XIR A;  2QF6 A;  4V26 A;  1YSR A;  2VCI A;  3JZ3 A;  5M4M A;  4ASG A;  2XX4 A;  4NH7 A;  2YI7 A;  5FWK A;  2WI4 A;  4K4O A;  1KIJ A;  2XX5 A;  1B62 A;  4FCQ A;  3B27 A;  4MPC A;  1QYE A;  1Z5B A;  3C0E A;  3TZ4 A;  2UWD A;  4HZ5 A;  2WI2 A;  5F5R A;  4LWF A;  4CE2 A;  1UYF A;  4XC0 A;  4XE2 A;  4YKY A;  2BT0 A;  4URL A;  2XHR A;  2YE7 A;  1UYD A;  2YEF A;  1UYH A;  4XKO A;  1PVG A;  3EHJ A;  2GFD A;  3SL2 A;  3ZKD A;  4U93 A;  5M4N A;  5CPH A;  2ZDY A;  1BKN A;  3Q5L A;  2YEJ A;  1Z59 A;  2O1V A;  2XK2 A;  4W7T A;  2YEC A;  3D0B A;  3QTF A;  1TC0 A;  4BAE A;  2CCU A;  3U2D A;  2BSM A;  2YEH A;  2YEG A;  2BZ5 A;  2C2A A;  4NH9 A;  1Y4U A;  4HY6 A;  3EKO A;  2CCT A;  5D6P A;  1AM1 A;  2K5B A;  2YKB A;  2AKP A;  4AWP A;  2WI7 A;  3H4L A;  4LWI A;  3CGY A;  4FPP A;  3G7E A;  3RLQ A;  3T2S A;  1UYL A;  2YGA A;  2GQP A;  2ZDX A;  4URM A;  1U0Z A;  3BMY A;  3R4P A;  3VAD A;  1Z5C A;  2XJG A;  2IWU A;  4CWN A;  3A0Z A;  2CH4 A;  1UYC A;  4ASF A;  1S14 A;  2QFO A;  4XIP A;  3MNR P;  4KTN A;  4BQJ A;  2YED A;  4BIU A;  4MP7 A;  3HZ5 A;  4NH8 A;  4CE1 A;  4HYM A;  4L8Z A;  4YKT A;  2XHT A;  4BXI A;  3Q5J A;  2FXS A;  1KZN A;  2YEA A;  1GJV A;  2HCH A;  3T10 A;  4BIZ A;  4LPB A;  1IXM A;  4CWS A;  1UYM A;  1L0O A;  4PRV A;  4E02 A;  3B26 A;  3CGZ A;  4R3M A;  4P7A A;  2O1W A;  2WI3 A;  4WUC A; 
#chains in the Genus database with same CATH homology
 4MP2 A;  1US7 A;  4R3A A;  5D7D A;  5CF0 A;  2YE3 A;  1UYI A;  1ZWH A;  3OMU A;  4EFT A;  4HZ0 A;  4R1F A;  4CWR A;  5IDM A;  3PEJ A;  4YKU A;  3OWB A;  4WUB A;  2BU7 A;  4FMT A;  1TBW A;  3ZXO A;  4LWG A;  4O0B A;  2WI6 A;  1AH6 A;  4YKQ A;  2YI6 A;  3HEK A;  4HXW A;  2WEP A;  4I5S A;  5CTX A;  3LNU A;  5CTW A;  1UY9 A;  4XIQ A;  5FNC A;  2IOR A;  3O2F A;  3IED A;  3G75 A;  1H7U A;  4HYP A;  1I5A A;  4ZKI A;  2JKI A;  4CWF A;  2YGE A;  4LP0 A;  3QDD A;  2BU8 A;  2BTZ A;  2IOP A;  3T1K A;  4GCZ A;  3ZXQ A;  2BRE A;  4CE3 A;  3B25 A;  4X9L A;  3TZ2 A;  3ZM7 A;  2ZBK B;  4AWO A;  3R91 A;  1YT2 A;  1THN A;  3GIE A;  3VHC A;  3RKZ A;  5M4E A;  1EA6 A;  4GQT A;  2QG2 A;  1QZR A;  4DUH A;  2YEB A;  1YC4 A;  4LWH A;  3H80 A;  2Q8H A;  2YKC A;  4L91 A;  3INW A;  1YET A;  1ZW9 A;  5C93 A;  4AS9 A;  4GT8 A;  4I3H A;  2IWX A;  1I5C A;  2YI0 A;  5J6A A;  4PRX A;  2HG1 A;  2BU6 A;  1YT0 A;  3A0T A;  3TZ5 A;  3B28 A;  5CTU A;  4CWQ A;  1NHH A;  2H55 A;  2XDK A;  2WI5 A;  4EEH A;  4KP4 A;  2XDS A;  2EXL A;  3BM9 A;  4E00 A;  2BU2 A;  3FT8 A;  3U2K A;  5F3K A;  2YE6 A;  4CWT A;  4L94 A;  3WQ9 A;  4B7P A;  3HYZ A;  2BRC A;  1H7S A;  2XD6 A;  4KSH A;  5CTY A;  3A0X A;  3PEH A;  2YJW A;  3WHA A;  1UYG A;  4EMV A;  1NHJ A;  4ASA A;  1B63 A;  3C11 A;  2YE2 A;  1ZXM A;  1I5B A;  2FWZ A;  1UY6 A;  1TH8 A;  1YC1 A;  2ESA A;  3RLP A;  5IN9 A;  1GKZ A;  1UYK A;  1Y4S A;  2Q2E B;  2XDL A;  4P8O A;  1BYQ A;  3OPD A;  5BOD A;  4MOT A;  1U2O A;  1AJ6 A;  3CRK A;  4E01 A;  4XIT A;  4GGL A;  3HHU A;  2JJC A;  4YKZ A;  4EGK A;  3K60 A;  1OSF A;  3R92 A;  4O09 A;  4XKA A;  4AWQ A;  2VWC A;  2YJX A;  1EI1 A;  4B6C A;  4XKK A;  3OWD A;  1YT1 A;  4LWE A;  2VCJ A;  1GKX A;  5IDJ A;  2ZKJ A;  4ASB A;  1Y8N A;  2CGF A;  4JAU A;  2WI1 A;  3EHF A;  3FT5 A;  4YKX A;  1UY7 A;  2YGF A;  4HY1 A;  2FWY A;  5BOC A;  1YSZ A;  4JAS A;  3GIF A;  3R4N A;  4YKW A;  1ID0 A;  1I58 A;  4URO A;  3INX A;  4JAV A;  2YEI A;  2YE5 A;  4JQL A;  4H85 A;  2O1U A;  4H7Q A;  2YE8 A;  4O07 A;  4BQG A;  3O0I A;  4KQV A;  3ZKB A;  1MU5 A;  4XCL A;  3CRL A;  3EHH A;  1MX0 A;  2YK2 A;  1A4H A;  2XHX A;  3R4M A;  4GEE A;  3Q5K A;  4O04 A;  3NMQ A;  4MBC A;  3EHG A;  2E0A A;  3K98 A;  4ZVI A;  4EM7 A;  2YE4 A;  2BU5 A;  4FCR A;  4EFU A;  2XX2 A;  4L93 A;  1S16 A;  4QPJ A;  4FCP A;  4EGH A;  4V25 A;  1B3Q A;  1ZXN A;  2YE9 A;  3A0R A;  3GIG A;  4U7O A;  4Q20 A;  3EKR A;  2XCM A;  3GIG B;  5GGZ A;  1I59 A;  2YKI A;  4GFN A;  4PU9 A;  3T0H A;  3T0Z A;  1BGQ A;  5FND A;  2Q8G A;  4YKR A;  1R62 A;  4MPE A;  2WER A;  4MB9 A;  2XJX A;  2BYH A;  1YES A;  1AMW A;  3FV5 A;  2FYP A;  4XDM A;  3A0W A;  2YKJ A;  3O6O A;  4O05 A;  1Y8O A;  1YER A;  4U7N A;  4MPN A;  1TC6 A;  1TIL A;  4CWP A;  4HXZ A;  3VHD A;  2CCS A;  1YC3 A;  1JM6 A;  3KE6 A;  3TTZ A;  2IOQ A;  5M4P A;  2XAB A;  3HYY A;  5D7R A;  4XTJ A;  1UYE A;  3R4O A;  1Y8P A;  2H8M A;  4KFG A;  4EGI A;  2XDX A;  5FNF A;  4KSG A;  2Q8I A;  1QY8 A;  4URN A;  3B24 A;  3TZ0 A;  3TUH A;  3OW6 A;  2CG9 A;  3D36 A;  4WUD A;  1NHI A;  2YKE A;  5D7C A;  3VHA A;  3HZ1 A;  2XJJ A;  1UY8 A;  3DGE A;  3LPS A;  1AH8 A;  5M4K A;  2VW5 A;  5M4H A;  3A0Y A;  3U67 A;  2QG0 A;  2XDU A;  3G7B A;  5D6Q A;  1TID A;  2YK9 A;  2YI5 A;  4QPK A;  4PL9 A;  1I5D A;  4H81 A;  5J71 A;  2YEE A;  1Z5A A;  3D2R A;  2Q8F A;  2IWS A;  5L3J A;  3CWV A;  2BYI A;  2PNR A;  3RLR A;  4XCJ A;  1YS3 A;  3K97 A;  3K99 A;  2HKJ A;  2WEQ A;  4CWO A;  4XD8 A;  4DZY A;  1BXD A;  4L90 A;  4XIR A;  2QF6 A;  4V26 A;  1YSR A;  2VCI A;  3JZ3 A;  5M4M A;  4ASG A;  2XX4 A;  4NH7 A;  2YI7 A;  5FWK A;  2WI4 A;  4K4O A;  1KIJ A;  2XX5 A;  1B62 A;  4FCQ A;  3B27 A;  4MPC A;  1QYE A;  1Z5B A;  3C0E A;  3TZ4 A;  2UWD A;  4HZ5 A;  2WI2 A;  5F5R A;  4LWF A;  4CE2 A;  1UYF A;  4XC0 A;  4XE2 A;  4YKY A;  2BT0 A;  4URL A;  2XHR A;  2YE7 A;  1UYD A;  2YEF A;  1UYH A;  4XKO A;  1PVG A;  3EHJ A;  2GFD A;  3SL2 A;  3ZKD A;  4U93 A;  5M4N A;  5CPH A;  2ZDY A;  1BKN A;  3Q5L A;  2YEJ A;  1Z59 A;  2O1V A;  2XK2 A;  4W7T A;  2YEC A;  3D0B A;  3QTF A;  1TC0 A;  4BAE A;  2CCU A;  3U2D A;  2BSM A;  2YEH A;  2YEG A;  2BZ5 A;  2C2A A;  4NH9 A;  1Y4U A;  4HY6 A;  3EKO A;  2CCT A;  5D6P A;  1AM1 A;  2K5B A;  2YKB A;  2AKP A;  4AWP A;  2WI7 A;  3H4L A;  4LWI A;  3CGY A;  4FPP A;  3G7E A;  3RLQ A;  3T2S A;  1UYL A;  2YGA A;  2GQP A;  2ZDX A;  4URM A;  1U0Z A;  3BMY A;  3R4P A;  3VAD A;  1Z5C A;  2XJG A;  2IWU A;  4CWN A;  3A0Z A;  2CH4 A;  1UYC A;  4ASF A;  1S14 A;  2QFO A;  4XIP A;  3MNR P;  4KTN A;  4BQJ A;  2YED A;  4BIU A;  4MP7 A;  3HZ5 A;  4NH8 A;  4CE1 A;  4HYM A;  4L8Z A;  4YKT A;  2XHT A;  4BXI A;  3Q5J A;  2FXS A;  1KZN A;  2YEA A;  1GJV A;  2HCH A;  3T10 A;  4BIZ A;  4LPB A;  4CWS A;  1UYM A;  1L0O A;  4PRV A;  4E02 A;  3B26 A;  3CGZ A;  4R3M A;  4P7A A;  2O1W A;  2WI3 A;  4WUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...