1BKNA

Crystal structure of an n-terminal 40kd fragment of e. coli dna mismatch repair protein mutl
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
312
structure length
272
Chain Sequence
b'VERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCGIKKDELALALAIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAWQAYAVTVKPAAHPVGTTLEVLDTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVSRLVHDFIYQGVLSVLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUTL
publication title Crystal structure and ATPase activity of MutL: implications for DNA repair and mutagenesis.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Dna repair
total genus 75
structure length 272
sequence length 312
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain
A PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1bknA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1bknA01
3TZ0A 5IN9A 2UUAI 4B3RI 1AJ6A 2WERA 1I5CA 4URNA 2VQFE 3F0NA 2UUCI 5LMUE 4GKKE 4NH9A 3OMUA 3INWA 2V34A 1Y8PA 4YHHI 2E1RA 2HHHI 2WI1A 1NHJA 1N33E 2WI4A 5IT9Q 3HZ5A 1U2RA 5D7DA 4LFBE 1UYHA 1Z5CA 4CWQA 2XHRA 3U67A 4RPFA 4USMA 2HG1A 2BU8A 3U2DA 4DUYE 4NH8A 3B78A 4JAUA 1UYMA 4XCLA 2QF6A 4YKQA 1Z0EA 2UUAE 4JI7I 4B3RE 1YC4A 4DV5I 2F4VI 1Y8OA 5GMDA 1I5DA 4JI8E 1IBMI 4XKOA 4X62I 3CRKA 2ESAA 2UXBI 3JZ3A 4YHHE 1H7UA 3WU5A 2HHHE 2VF3A 5CTWA 2VQEI 2HK3A 5FLXC 2YGAA 2WI6A 3D36A 2C2AA 2V2VA 3R91A 4X64I 2BRCA 3G7EA 4YY3I 2YI0A 2YE4A 4JI4I 4DUZI 3PEHA 4JI7E 4LWFA 1YESA 4DV5E 2F4VE 4FMTA 4O05A 4Z7CA 2XDKA 3K60A 2YJXA 5D7CA 4BIUA 1YSRA 4X62E 5J71A 3HYYA 4LF5E 4X65I 1Z0TA 2UXBE 5D7RA 3VADA 4WUBA 4LP0A 4I5SA 4DZYA 2YEJA 3G7BA 1MG7A 2DEJA 1Z0GA 2XJJA 1XHKA 3GIFA 3QT5A 4X64E 4WUDA 1NHHA 4FCRA 3ZKBA 3HHUA 3EHJA 4YY3E 4XITA 4DPTA 5IT9C 4JI4E 2WI7A 4GEEA 3EHHA 4DV2I 4R1FA 1Z0VA 3B24A 3J80Q 3TUHA 4X65E 4XD8A 2AJ4A 5IDJA 1Y4UA 3IEDA 4JG4A 1UY6A 2CCTA 3T0ZA 4CWNA 4LF9I 4DR4I 2WI5A 4JI3I 4LFCE 1BXDA 4URMA 3LTOA 4AQYI 1YETA 4JI5I 1ZWHA 4P7AA 1EA6A 1FWKA 4MPEA 4DV0E 1NZ0A 4DUHA 4DV2E 4DPUA 1N36I 2UWDA 3Q5JA 4XIRA 4BQJA 5IDMA 2YK2A 1AMWA 1N0UA 3B82A 1KVKA 3WHAA 4M1KA 5FNDA 4EGHA 5F5RA 4FCQA 5D6QA 3OWDA 3G75A 3RLRA 4LF9E 4DR4E 2GS8A 4HZ5A 4JI3E 1OSFA 4GKJI 2BU6A 3BM9A 4AWQA 4U93A 4AQYE 1I94E 4HACA 4AWPA 4JI5E 1Y4SA 3ZM7A 4YKWA 2R3VA 5BOCA 4DV7I 2YI5A 3B28A 2YEBA 4FW9A 1UYFA 1N36E 2BT0A 4HXWA 4URLA 4QPJA 1ZM3A 2BM0A 2GQPA 2WW4A 5LMNI 2CZ9A 1RR9A 3RKZA 3R92A 5M4NA 1YSZA 4MPNA 1ZM2A 4LF7I 4FWHA 2Q2EB 2FWZA 1FKAE 2V2QA 5CTUA 4DU8A 4E02A 2YEHA 2CH4A 3O6OA 4R3MA 2YI6A 5IWAE 4DV7E 4PU9A 1YS3A 1S16A 1AM1A 1N32I 3A0ZA 1A4HA 4O09A 3PYEA 2HKEA 4YKTA 4YKZA 2XX5A 5LMNE 4NXMI 4L90A 2HFSA 1KZNA 1J5EI 1UY9A 4P52A 4XTJA 4DV3E 4LF7E 2FXSA 2YEAA 3R4MA 2YEIA 1YERA 2YE5A 2BZ5A 5GMEA 4DR7I 3PYFA 4WUCA 1ZM4A 3R4NA 2ZM6I 4HY1A 4KHPE 3JAMQ 3INXA 1YC3A 3GONA 3T0HA 4EFUA 2WI2A 1N32E 4L94A 1B63A 1UYDA 2HKJA 3FV5A 4NXME 2YE8A 2H8MA 4DV1I 3SL2A 4KP4A 2UUCE 2WEPA 2QFOA 3O2FA 3LNUA 1YT2A 3FT8A 4UROA 3D0BA 3ZZ0A 4DR7E 4JI6I 1XNRI 4B3MI 5LL6R 4K4OA 4LWEA 1UEKA 2YGFA 3A0WA 2BTZA 3GIGA 4B7PA 4PRXA 3WQ9A 1K47A 3ZXOA 4CE2A 5CTYA 3QDDA 4L91A 4CWTA 1GJVA 4DV1E 3B25A 2GFDA 2YE9A 2YKJA 4FWDA 1IBME 1FWLA 2H55A 4AS9A 1L0OA 4JI6E 2A2DA 1XNRE 4H85A 4CWSA 3PYDA 4X66I 2VQEE 2ZKJA 4DXLA 1FNMA 3Q5LA 4ASFA 3BMYA 1TIDA 2YE2A 3V2UC 2V2ZA 2CCUA 4DUZE 3PYGA 1AH6A 3JAMC 2CCSA 2ZITA 3A0XA 4Q20A 3J7AM 4H7QA 4BAEA 3D4JA 4Z7YA 4X66E 1ZW9A 4GCZA 4ZVIA 1R62A 4FPPA 5M4PA 4UTGA 4L93A 2YE3A 4LFAI 2X36A 3QTFA 4XIPA 4K0KI 2JKIA 2IOQA 4HZ0A 1Z5BA 5A2QC 2IWXA 4KFGA 4U7NA 1JM6A 2QG0A 1N34I 4XC0A 3J81C 4JI0I 1IBLI 3K17A 4X9LA 4O07A 4O0BA 1KKHA 2XD6A 1Z59A 3TZ2A 2WI3A 1BYQA 3TTZA 4EM7A 4B3TI 1B3QA 1ZM9A 4DPWA 4BQGA 2A2CA 1TC6A 3WU4A 1I58A 2R42A 3T1YI 3HZ1A 4OX9I 3Q5KA 4GFNA 4LFAE 3RLQA 4K0KE 2YEDA 4DR1I 1U0ZA 3ZXQA 4CWPA 2ZBKB 3EHFA 4GQTA 3T1KA 3B8HA 3CGYA 4DR3I 2BU2A 1TH8A 2O1VA 1IBLE 4JI0E 2FYPA 4DR5I 4B3TE 4LPBA 2XDSA 1UY7A 1PKPA 2BU5A 3MNRP 2BYIA 3J7AG 1THNA 3RLPA 3VHDA 1TC0A 4W7TA 1ELOA 3T1YE 2QG2A 4HY6A 3V5RA 4GKJE 3CRLA 3H80A 4B6CA 4DV4I 4B3SI 2VCJA 3B27A 4OX9E 2OI2A 5L3JA 1Z0BA 1BKNA 2CG9A 2XDXA 3TZ5A 2ZDYA 2XEXA 4FWGA 1XMOI 1HNZI 4MPCA 1MU5A 4LWIA 2XK2A 1H7SA 2BREA 1MX0A 3EKRA 4LF6I 1HR0I 4DR3E 4EEHA 4EMVA 4JYAI 1Z0CA 4DR5E 2XHTA 3FT5A 4LWGA 2UXCI 1N0VC 1PIEA 2UUBI 1U2OA 1KTVA 2BV3A 1WUUA 4MYTA 2YKCA 2FWYA 2LJPA 3K98A 1AH8A 4DV4E 3ZZTA 4B3SE 2Q8FA 4JV5I 1UYGA 1ZXNA 2IOPA 4KSHA 4BXIA 1S14A 1QYEA 1HNZE 1XMOE 3A0RA 1UYIA 3U2KA 3QT7A 1YT1A 2YECA 4XDMA 2AKPA 1UYCA 4U7OA 4LF6E 1FJGI 1VISA 2NPFA 1BGQA 2IORA 1H73A 4JYAE 1GKZA 2XJGA 4JAVA 4YKYA 2VWCA 5CPHA 1XMQI 3VHAA 2XDLA 3CWVA 2UXCE 2UUBE 4HYMA 1J5EE 4LWHA 5CF0A 4JI8I 4LF4I 4QPKA 4E00A 4HACB 1QY8A 2YI7A 2XX4A 2J7KA 4JV5E 3ZZUA 3H4LA 4XIQA 3T10A 3LPSA 2E5LI 2ZM6E 5A2QQ 3T1HI 4JI2I 4DR6I 1UY8A 4JQLA 4ZKIA 3OTOI 4H81A 1FJGE 4PRVA 2Q8HA 4GT8A 1Y8NA 3J81Q 2BSMA 1I5AA 1XMQE 3K1JA 3ZKDA 3HULA 3M6AA 4EMDA 4XKAA 1UYKA 3A0YA 1B62A 4LF4E 2PNRA 3OPDA 1XNQI 4LF5I 2VCIA 5GGZA 4ASAA 4L8ZA 4UT4A 2CGFA 4B3ME 4AWOA 1HNXI 2BU7A 3PEJA 4ASBA 2E5LE 2V8PA 3T1HE 4JI2E 4DR6E 2UXDI 1D6TA 1TBWA 3OTOE 2O1UA 3C11A 4EGIA 2ZDXA 2XCMA 1FI4A 2YEGA 4YKXA 4CWRA 2E0AA 4PL9A 2YEFA 1I5BA 3HEKA 5J6AA 3A0TA 1XNQE 3QT6A 1Z0WA 4USKA 4ED4A 4XCJA 3K99A 3EKOA 4MOTA 4CE1A 2HK2A 1HNXE 4DR2I 4MYUA 4NXNI 2Q8IA 2UXDE 5C93A 2HCHA 4DPYA 2YKIA 4LFCI 4MP2A 1A6FA 2JJCA 1YC1A 2YKBA 4YKUA 4HXZA 4DV0I 4MP7A 1IBKI 2IWUA 5F3KA 2YE6A 2YE7A 5M4EA 1H74A 2XHXA 4EFTA 4XKKA 1KIJA 4CWOA 5M4MA 2WEQA 4XE2A 4CE3A 2X7IA 4DR2E 3OW6A 1Z5AA 4NH7A 4NXNE 2XX2A 3GIGB 5FWKA 1TILA 1UYLA 4DPXA 2YEEA 4MBCA 4V26A 3T2SA 1I94I 3C0EA 1NHIA 2YKEA 3VHCA 1IBKE 2BYHA 2XABA 2DEIA 4HYPA 3NMQA 1N34E 4FCPA 3EHGA 1RREA 3Q1QA 2BM1A 4LF8I 1HNWI 2YK9A 1EI1A 4DV6I 3GIEA 2IWSA 3B26A 2UU9I 3O0IA 4MB9A 2XJXA 2EFGA 5CTXA 4I3HA 2K5BA 4JI1I 4CWFA 1DARA 2O1WA 3CGZA 3QT8A 1ID0A 4EGKA 4DR1E 2Q8GA 4KQVA 5IWAI 3DGEA 5BR8I 4E01A 1ZXMA 5D6PA 5FNFA 2EXLA 4O04A 1S4EA 4YKRA 4R3AA 1US7A 5FNCA 1I59A 4KTNA 3OWBA 4LF8E 1HNWE 4GGLA 4FN5A 4DV6E 4DU7A 2VQFI 3J80C 5BODA 2UU9E 2YJWA 1GKXA 2HFUA 4DV3I 5LMUI 1PVGA 5FLXQ 4GKKI 3K97A 3R4OA 3WU6A 4JI1E 3TZ4A 1OJ4A 3KE6A 5M4KA 1QZRA 1N33I 2XDUA 4LFBI 4P8OA 4JASA 2YGEA 3R4PA 3D2RA 3HYZA 5BR8E 5M4HA 4DUYI 4KHPI 1UYEA 1H72C 3WU3A 1HR0E 4ASGA 4KSGA 4BIZA 2VW5A 4V25A 1YT0A
chains in the Genus database with same CATH superfamily
3TZ0A 5IN9A 2C39B 2UUAI 4U3DA 4BA2B 4B3RI 1AJ6A 4IFDD 1I5CA 2WERA 2JEAA 2VQFE 4URNA 4AIDA 2WP8B 3F0NA 4LOMA 2UUCI 5LMUE 4GKKE 4NH9A 3OMUA 3INWA 2V34A 1Y8PA 2PO2A 2E1RA 4YHHI 2HHHI 1NHJA 2O3ZA 1N33E 5IT9Q 2WI1A 1U2RA 2WI4A 4LFBE 3HZ5A 1UYHA 1Z5CA 4CWQA 2XHRA 3U67A 4RPFA 4USMA 2HG1A 2BU8A 3U2DA 4DUYE 4NH8A 2Z5EA 3B78A 2Z5BA 1UYMA 4JAUA 4XCLA 2BA1D 2QF6A 4YKQA 1Z0EA 2UUAE 4JI7I 4B3RE 1YC4A 4DV5I 2F4VI 1Y8OA 5GMDA 1I5DA 2C1IA 1YHCA 4JI8E 1IBMI 4XKOA 4X62I 3CRKA 2ESAA 2PO0A 4FW3A 2UXBI 3JZ3A 2PNZA 4YHHE 1H7UA 3WU5A 2HHHE 2VF3A 5CTWA 4IFDF 2JEBA 2VQEI 2HK3A 5FLXC 2YGAA 2WI6A 5K36A 2C2AA 2V2VA 3D36A 4X64I 2BRCA 3KRNA 3R91A 1R6MA 3G7EA 4YY3I 2YI0A 2YE4A 4JI4I 4DUZI 2BR2B 4OO1A 3PEHA 4JI7E 4LWFA 2AE8A 2JE6B 4DV5E 2F4VE 1YESA 4FMTA 4O05A 4Z7CA 2XDKA 3K60A 2YJXA 5D7CA 4BIUA 1YSRA 4X62E 5J71A 3HYYA 4LF5E 4X65I 1Z0TA 2UXBE 5D7RA 5JEAC 4WUBA 4LP0A 4I5SA 5D7DA 2YEJA 3VADA 4DZYA 3G7BA 1MG7A 2DEJA 1Z0GA 2XJJA 3Q6NA 1XHKA 3GIFA 3QT5A 4X64E 4WUDA 1NHHA 4AM3A 4FCRA 3ZKBA 3HHUA 5C0XD 3EHJA 4YY3E 4XITA 4DPTA 5IT9C 4JI4E 4MU4A 2O1TA 2WI7A 2PNLA 2JEAB 4GEEA 2BA0G 3EHHA 4DV2I 4R1FA 1Z0VA 3B24A 5DROA 3J80Q 3TUHA 1F51A 2WNRB 4X65E 4XD8A 2AJ4A 5IDJA 1Y4UA 3IEDA 4JG4A 1UY6A 2CCTA 3T0ZA 4CWNA 4LCFA 4LF9I 4DR4I 2WI5A 4JI3I 4LFCE 1BXDA 4URMA 3LTOA 4AQYI 1YETA 4JI5I 1ZWHA 4P7AA 2PO1B 1EA6A 1FWKA 4MPEA 4DV0E 3UHMA 1OYSA 1E3PA 1NZ0A 4NBQA 4DUHA 4DV2E 4DPUA 1N36I 5K36F 2UWDA 3Q5JA 4XIRA 4BQJA 2YK2A 1AMWA 2PO0B 5IDMA 1N0UA 3B82A 1KVKA 3M7NG 4M1KA 3WHAA 2JEBB 5FNDA 4EGHA 5F5RA 4FCQA 2VESA 4OO1F 5D6QA 5C0XB 3P3CA 3PRYA 4LPFA 3G75A 3OWDA 4LF9E 3RLRA 4DR4E 2GS8A 5DRRA 4HZ5A 4JI3E 1OSFA 4GKJI 2BU6A 3BM9A 4AWQA 4U93A 4AQYE 1I94E 4HACA 4AWPA 4JI5E 1Y4SA 3L7ZA 3ZM7A 4YKWA 2R3VA 5BOCA 4DV7I 2YI5A 3B28A 2YEBA 4FW9A 1UYFA 1N36E 2BT0A 4HXWA 4URLA 5JEAA 4QPJA 1ZM3A 2BM0A 2GQPA 2WW4A 5LMNI 3LMMA 2CZ9A 1RR9A 3RKZA 3R92A 5M4NA 1YSZA 4MPNA 1ZM2A 4LF7I 4FWHA 2Q2EB 2FWZA 1FKAE 2V2QA 5CTUA 4DU8A 4E02A 2YEHA 2CH4A 3O6OA 4R3MA 5DRQA 3P3GA 2YI6A 5IWAE 4DV7E 4PU9A 1YS3A 1S16A 1AM1A 1N32I 4ISAA 3A0ZA 1A4HA 5JEAD 4O09A 4FW5A 3PYEA 2HKEA 4YKTA 4YKZA 2XX5A 5LMNE 4NXMI 4L90A 2HFSA 1KZNA 1J5EI 1UY9A 4P52A 3CDJA 5EKWA 3DD6A 4XTJA 4DV3E 4LF7E 2FXSA 3HJCA 2YEAA 3R4MA 2YEIA 2PNMA 1YERA 2YE5A 2BZ5A 5GMEA 4DR7I 2IESA 3PYFA 4WUCA 5EL9A 1ZM4A 3R4NA 2ZM6I 4HY1A 4MU3A 4KHPE 3JAMQ 3INXA 1YC3A 3GONA 2JT2A 3T0HA 2IERA 5DNLA 4EFUA 2WI2A 1N32E 4L94A 1B63A 1UYDA 2HKJA 3FV5A 3S5TA 2Z5CB 4NXME 2YE8A 2H8MA 4DV1I 3SL2A 4KP4A 2UUCE 2WEPA 2QFOA 3O2FA 3LNUA 1YT2A 3FT8A 4UROA 3D0BA 3ZZ0A 5JEAF 4DR7E 4JI6I 1XNRI 4B3MI 5LL6R 4AIMA 4K4OA 4LWEA 1UEKA 2YGFA 3A0WA 5JEAB 2FTKA 2BTZA 3GIGA 4B7PA 4IFDB 4PRXA 3WQ9A 1K47A 3ZXOA 1Y6ZA 2C38A 5CTYA 4CE2A 3NZKA 3QDDA 4L91A 4IZJA 3PS1A 4CWTA 1GJVA 5JENA 4DV1E 3B25A 2GFDA 2YE9A 2YKJA 4FWDA 1IBME 1FWLA 2H55A 3K85A 5C0XE 4AS9A 2NN6C 1L0OA 1RHYA 4JI6E 2A2DA 1XNRE 4H85A 4CWSA 3PYDA 4X66I 2VQEE 2ZKJA 4DXLA 1FNMA 3Q5LA 4ASFA 3BMYA 4N3OA 5K36D 4FW6A 1TIDA 2YE2A 3CDIA 3V2UC 2V2ZA 2CCUA 4DUZE 3PYGA 1AH6A 3JAMC 4OO1D 2CCSA 4IZJD 2ZITA 3A0XA 4Q20A 2PO2B 5DRPA 3J7AM 4H7QA 4BAEA 3D4JA 4Z7YA 4X66E 1ZW9A 4GCZA 2Z5BB 4ZVIA 1R62A 4FPPA 5M4PA 4UTGA 4L93A 2YE3A 4LFAI 2X36A 3QTFA 4XIPA 4K0KI 2JKIA 2IOQA 4HZ0A 1Z5BA 3HKMA 5A2QC 2IWXA 4KFGA 4U7NA 1JM6A 2QG0A 1N34I 4XC0A 2F1DA 3J81C 4JI0I 2PNZB 3K17A 1IBLI 4X9LA 4O07A 4O0BA 1KKHA 2XD6A 1Z59A 3TZ2A 2WI3A 1BYQA 3TTZA 4EM7A 4BA1A 4B3TI 5K36B 1B3QA 1ZM9A 4DPWA 4BQGA 4BA2A 2A2CA 1TC6A 3U1KA 3WU4A 1I58A 2R42A 4MQYA 4OKGA 3T1YI 2WP8A 3HZ1A 1USUA 4OX9I 4OO1B 3Q5KA 4GFNA 4LFAE 3RLQA 4K0KE 2YEDA 4J3DA 4DR1I 1U0ZA 3ZXQA 4CWPA 2ZBKB 3EHFA 4GQTA 3T1KA 3B8HA 4QNJA 2NN6A 3CGYA 4DR3I 2BU2A 1TH8A 2O1VA 1IBLE 4JI0E 2FYPA 4DR5I 3TZ5A 2BA0D 5DNXA 1R6LA 4B3TE 3P06A 4LPBA 2XDSA 3CYGA 1UY7A 1PKPA 2BU5A 3MNRP 2BYIA 3J7AG 2GO4A 1THNA 3RLPA 3VHDA 1TC0A 4W7TA 1ELOA 3T1YE 2QG2A 4HY6A 3V5RA 4GKJE 3CRLA 3H80A 4B6CA 4DV4I 1OYPA 4B3SI 2VCJA 3B27A 4OX9E 2OI2A 2C1GA 1XXEA 5L3JA 1Z0BA 1BKNA 2CG9A 4MU1A 1UDOA 2BA1G 5JEAE 2XDXA 2XEXA 4FWGA 1XMOI 1HNZI 4IFDE 2ZDYA 1MU5A 4MPCA 4LWIA 2XK2A 1H7SA 2BREA 1MX0A 3EKRA 4LF6I 1HR0I 4DR3E 4EEHA 4EMVA 2NN6D 4JYAI 2C37A 1Z0CA 4DR5E 2XHTA 3FT5A 4OZEA 4LWGA 2UXCI 1N0VC 1PIEA 3M85D 2BR2A 2UUBI 1U2OA 1KTVA 2BV3A 1WUUA 2JE6A 4MYTA 2FWYA 2YKCA 3M7ND 2LJPA 3K98A 3PS2A 1AH8A 4DV4E 3ZZTA 4B3SE 2Q8FA 2IOPA 4JV5I 1ZXNA 1UYGA 4KSHA 4BXIA 1S14A 4MU0A 1QYEA 1HNZE 1XMOE 3A0RA 4IZKA 1UYIA 3U2KA 3QT7A 1YT1A 2YECA 4XDMA 2AKPA 1UYCA 4U7OA 4LF6E 1FJGI 1VISA 2NPFA 1BGQA 2IORA 1H73A 4JYAE 1GKZA 2XJGA 4JAVA 4YKYA 2VWCA 5CPHA 4BA1B 3GCMA 4IS9A 1XMQI 3VHAA 2XDLA 3CWVA 2UXCE 2UUBE 4HYMA 1J5EE 4LWHA 5CF0A 4JI8I 4LF4I 4QPKA 2NN6F 2CGEA 4E00A 4HACB 1QY8A 2YI7A 2WNRA 2J7KA 3L7ZB 2XX4A 4JV5E 3ZZUA 3H4LA 4XIQA 1HK7A 3T10A 3LPSA 2ZM6E 2E5LI 2NN6B 5A2QQ 3T1HI 4JI2I 4DR6I 1UY8A 4JQLA 3OTOI 4ZKIA 4H81A 1FJGE 4PRVA 2Q8HA 4GT8A 1Y8NA 3J81Q 2BSMA 1I5AA 1XMQE 3K1JA 3ZKDA 3HULA 3M6AA 2PO1A 4EMDA 4XKAA 1UYKA 1YH8A 3A0YA 1B62A 5K36E 4LF4E 2PNRA 3OPDA 1XNQI 4LF5I 2VCIA 5GGZA 4ASAA 1OYRA 3B4TA 4L8ZA 4UT4A 2CGFA 4B3ME 4AWOA 1HNXI 2BU7A 3PEJA 4ASBA 4OO1E 2E5LE 2V8PA 2CVEA 5C0XA 2O1UA 3T1HE 4JI2E 4DR6E 3OTOE 2UXDI 1D6TA 1TBWA 3C11A 2C37B 2ZDXA 2XCMA 4EGIA 1FI4A 1E3HA 2YEGA 4YKXA 4CWRA 2E0AA 3P3EA 3P76A 4PL9A 2YEFA 1I5BA 3HEKA 5J6AA 4GQUA 3A0TA 4FW7A 1XNQE 3QT6A 1Z0WA 4USKA 4ED4A 4XCJA 3K99A 3EKOA 4MOTA 4CE1A 1UDNA 2HK2A 3H1CA 4IZKB 1HNXE 4DR2I 2GQ0A 4IFDC 4MYUA 4NXNI 2Q8IA 2UXDE 5C93A 2HCHA 4DPYA 4LCGA 4LFCI 2YKIA 4MP2A 1A6FA 2JJCA 1YC1A 2YKBA 4YKUA 4HXZA 4DV0I 4MP7A 1IBKI 2IWUA 3Q6MA 5F3KA 2YE6A 2YE7A 5M4EA 1H74A 2XHXA 4EFTA 4XKKA 1KIJA 4CWOA 5M4MA 2WEQA 2C39A 4E72A 4XE2A 4CE3A 2X7IA 4DR2E 3OW6A 1Z5AA 4QNKA 3GMEA 1Y60A 4NXNE 5FWKA 2XX2A 3GIGB 4NH7A 1TILA 3PS3A 1UYLA 4DPXA 2YEEA 4MBCA 2C38B 4V26A 3T2SA 1I94I 3C0EA 4IZJB 1NHIA 1P42A 3GLLA 2YKEA 3VHCA 1IBKE 2BYHA 2XABA 2DEIA 4HYPA 4U3BA 3M85G 5C0XF 3NMQA 1N34E 4FCPA 3EHGA 1RREA 1UDQA 1IXMA 3Q1QA 2BM1A 4LF8I 1USVA 1HNWI 1UDSA 2YK9A 1EI1A 4DV6I 3GIEA 2IWSA 3B26A 2UU9I 3O0IA 4MB9A 2Z5CA 2XJXA 2EFGA 5CTXA 4I3HA 2K5BA 4JI1I 4CWFA 1DARA 2O1WA 3CGZA 2NN6E 2GO3A 3QT8A 1ID0A 4EGKA 4DR1E 2Q8GA 4KQVA 3U1YA 5IWAI 5BR8I 3DGEA 1ZXMA 5D6PA 4E01A 5FNFA 2EXLA 2J65A 4O04A 1S4EA 5K36C 4YKRA 5C0XC 1US7A 4R3AA 5FNCA 1I59A 4KTNA 3OWBA 4LF8E 4IFDA 1HNWE 4GGLA 4FN5A 4DV6E 4DU7A 2VQFI 1VI7A 3J80C 5BODA 2UU9E 4FW4A 4OO1C 2YJWA 1GKXA 4MDTA 2HFUA 1PVGA 5FLXQ 5LMUI 4DV3I 4GKKI 3K97A 3R4OA 3WU6A 4JI1E 3TZ4A 5ELWA 1OJ4A 3KE6A 1Y5YA 5M4KA 1QZRA 1N33I 2XDUA 4LFBI 4P8OA 4JASA 2YGEA 3R4PA 3D2RA 3HYZA 4LCHA 5BR8E 4DUYI 4KHPI 1UYEA 2HHIA 1H72C 5M4HA 3WU3A 1HR0E 4ASGA 4KSGA 4BIZA 2VW5A 4V25A 1YT0A
chains in the Genus database with same CATH topology
3TZ0A 5IN9A 2UUAI 4B3RI 1AJ6A 2WERA 1I5CA 4URNA 2VQFE 3F0NA 2UUCI 5LMUE 4GKKE 4NH9A 3OMUA 3INWA 2V34A 1Y8PA 4YHHI 2E1RA 2HHHI 2WI1A 1NHJA 1N33E 2WI4A 5IT9Q 3HZ5A 1U2RA 5D7DA 4LFBE 1UYHA 1Z5CA 4CWQA 2XHRA 3U67A 4RPFA 4USMA 2HG1A 2BU8A 3U2DA 4DUYE 4NH8A 2Z5EA 3B78A 2Z5BA 1UYMA 4JAUA 4XCLA 2QF6A 4YKQA 1Z0EA 2UUAE 4JI7I 4B3RE 1YC4A 4DV5I 2F4VI 1Y8OA 5GMDA 1I5DA 4JI8E 1IBMI 4XKOA 4X62I 3CRKA 2ESAA 2UXBI 3JZ3A 4YHHE 1H7UA 3WU5A 2HHHE 2VF3A 5CTWA 2VQEI 2HK3A 5FLXC 2YGAA 2WI6A 3D36A 2C2AA 2V2VA 3R91A 4X64I 2BRCA 3G7EA 4YY3I 2YI0A 2YE4A 4JI4I 4DUZI 3PEHA 4JI7E 4LWFA 1YESA 4DV5E 2F4VE 4FMTA 4O05A 4Z7CA 2XDKA 3K60A 2YJXA 5D7CA 4BIUA 1YSRA 4X62E 5J71A 3HYYA 4LF5E 4X65I 1Z0TA 2UXBE 5D7RA 3VADA 4WUBA 4LP0A 4I5SA 4DZYA 2YEJA 3G7BA 1MG7A 2DEJA 1Z0GA 2XJJA 3Q6NA 1XHKA 3GIFA 3QT5A 4X64E 4WUDA 1NHHA 4FCRA 3ZKBA 3HHUA 3EHJA 4YY3E 4XITA 4DPTA 5IT9C 4JI4E 2O1TA 2WI7A 2PNLA 4GEEA 3EHHA 4DV2I 4R1FA 1Z0VA 3B24A 3J80Q 3TUHA 4X65E 4XD8A 2AJ4A 5IDJA 1Y4UA 3IEDA 4JG4A 1UY6A 2CCTA 3T0ZA 4CWNA 4LF9I 4DR4I 2WI5A 4JI3I 4LFCE 1BXDA 4URMA 3LTOA 4AQYI 1YETA 4JI5I 1ZWHA 4P7AA 1EA6A 1FWKA 4MPEA 4DV0E 1NZ0A 4DUHA 4DV2E 1N36I 4DPUA 2UWDA 3Q5JA 4XIRA 4BQJA 5IDMA 2YK2A 1AMWA 1N0UA 3B82A 1KVKA 3WHAA 4M1KA 5FNDA 4EGHA 5F5RA 4FCQA 5D6QA 3PRYA 3OWDA 3G75A 3RLRA 4LF9E 4DR4E 2GS8A 4HZ5A 4JI3E 1OSFA 4GKJI 2BU6A 3BM9A 4AWQA 4U93A 4AQYE 1I94E 4HACA 4AWPA 4JI5E 1Y4SA 3ZM7A 4YKWA 2R3VA 5BOCA 4DV7I 2YI5A 3B28A 2YEBA 4FW9A 1UYFA 1N36E 2BT0A 4HXWA 4URLA 4QPJA 1ZM3A 2BM0A 2GQPA 2WW4A 5LMNI 2CZ9A 1RR9A 3RKZA 3R92A 5M4NA 1YSZA 4MPNA 1ZM2A 4LF7I 4FWHA 2Q2EB 2FWZA 1FKAE 2V2QA 5CTUA 4DU8A 4E02A 2YEHA 2CH4A 3O6OA 4R3MA 2YI6A 5IWAE 4DV7E 4PU9A 1YS3A 1S16A 1AM1A 1N32I 3A0ZA 1A4HA 4O09A 3PYEA 2HKEA 4YKTA 4YKZA 2XX5A 5LMNE 4NXMI 4L90A 2HFSA 1KZNA 1J5EI 1UY9A 4P52A 4XTJA 4DV3E 4LF7E 2FXSA 3HJCA 2YEAA 3R4MA 2YEIA 2PNMA 1YERA 2YE5A 2BZ5A 5GMEA 4DR7I 3PYFA 4WUCA 1ZM4A 3R4NA 2ZM6I 4HY1A 4KHPE 3JAMQ 3INXA 1YC3A 3GONA 3T0HA 4EFUA 2WI2A 1N32E 4L94A 1B63A 1UYDA 2HKJA 3FV5A 2Z5CB 4NXME 2YE8A 2H8MA 4DV1I 3SL2A 4KP4A 2UUCE 2WEPA 2QFOA 3O2FA 3LNUA 1YT2A 3FT8A 4UROA 3D0BA 3ZZ0A 4DR7E 4JI6I 1XNRI 4B3MI 5LL6R 4K4OA 4LWEA 1UEKA 2YGFA 3A0WA 2BTZA 3GIGA 4B7PA 4PRXA 3WQ9A 1K47A 3ZXOA 1Y6ZA 4CE2A 5CTYA 3QDDA 4L91A 4IZJA 4CWTA 1GJVA 4DV1E 3B25A 2GFDA 2YE9A 2YKJA 4FWDA 1IBME 1FWLA 2H55A 3K85A 4AS9A 1L0OA 4JI6E 2A2DA 1XNRE 4H85A 4CWSA 3PYDA 4X66I 2VQEE 2ZKJA 4DXLA 1FNMA 3Q5LA 4ASFA 3BMYA 4N3OA 1TIDA 2YE2A 3V2UC 2V2ZA 2CCUA 4DUZE 3PYGA 1AH6A 3JAMC 2CCSA 4IZJD 2ZITA 3A0XA 4Q20A 3J7AM 4H7QA 4BAEA 3D4JA 4Z7YA 4X66E 1ZW9A 4GCZA 2Z5BB 4ZVIA 1R62A 4FPPA 5M4PA 4UTGA 4L93A 2YE3A 4LFAI 2X36A 3QTFA 4XIPA 4K0KI 2JKIA 2IOQA 4HZ0A 1Z5BA 5A2QC 2IWXA 4KFGA 4U7NA 1JM6A 2QG0A 1N34I 4XC0A 3J81C 4JI0I 1IBLI 3K17A 4X9LA 4O07A 4O0BA 1KKHA 2XD6A 1Z59A 3TZ2A 2WI3A 1BYQA 3TTZA 4EM7A 4B3TI 1B3QA 1ZM9A 4DPWA 4BQGA 2A2CA 1TC6A 3WU4A 1I58A 2R42A 3T1YI 3HZ1A 1USUA 4OX9I 3Q5KA 4GFNA 4LFAE 3RLQA 4K0KE 2YEDA 4DR1I 1U0ZA 3ZXQA 4CWPA 2ZBKB 3EHFA 4GQTA 3T1KA 3B8HA 3CGYA 4DR3I 2BU2A 1TH8A 2O1VA 1IBLE 4JI0E 2FYPA 4DR5I 4B3TE 3P06A 4LPBA 2XDSA 1UY7A 1PKPA 2BU5A 3MNRP 2BYIA 3J7AG 1THNA 3RLPA 3VHDA 1TC0A 4W7TA 1ELOA 3T1YE 2QG2A 4HY6A 3V5RA 4GKJE 3CRLA 3H80A 4B6CA 4DV4I 4B3SI 2VCJA 3B27A 4OX9E 2OI2A 5L3JA 1Z0BA 2CG9A 1BKNA 2XDXA 3TZ5A 2ZDYA 2XEXA 4FWGA 1XMOI 1HNZI 4MPCA 1MU5A 4LWIA 2XK2A 1H7SA 2BREA 1MX0A 3EKRA 4LF6I 1HR0I 4DR3E 4EEHA 4EMVA 4JYAI 1Z0CA 4DR5E 2XHTA 3FT5A 4LWGA 2UXCI 1N0VC 1PIEA 2UUBI 1U2OA 1KTVA 2BV3A 1WUUA 4MYTA 2YKCA 2FWYA 2LJPA 3K98A 1AH8A 4DV4E 3ZZTA 4B3SE 2Q8FA 2IOPA 4JV5I 1ZXNA 1UYGA 4KSHA 4BXIA 1S14A 1QYEA 1HNZE 1XMOE 3A0RA 4IZKA 1UYIA 3U2KA 3QT7A 1YT1A 2YECA 4XDMA 2AKPA 1UYCA 4U7OA 4LF6E 1FJGI 1VISA 2NPFA 1BGQA 2IORA 1H73A 4JYAE 1GKZA 2XJGA 4JAVA 4YKYA 2VWCA 5CPHA 1XMQI 3VHAA 2XDLA 3CWVA 2UXCE 2UUBE 4HYMA 1J5EE 4LWHA 5CF0A 4JI8I 4LF4I 4QPKA 2CGEA 4E00A 4HACB 1QY8A 2YI7A 2XX4A 2J7KA 4JV5E 3ZZUA 3H4LA 4XIQA 1HK7A 3T10A 3LPSA 2ZM6E 2E5LI 5A2QQ 3T1HI 4JI2I 4DR6I 1UY8A 4JQLA 4ZKIA 3OTOI 4H81A 1FJGE 4PRVA 2Q8HA 4GT8A 1Y8NA 3J81Q 2BSMA 1I5AA 1XMQE 3K1JA 3ZKDA 3HULA 3M6AA 4EMDA 4XKAA 1UYKA 3A0YA 1B62A 4LF4E 2PNRA 3OPDA 1XNQI 4LF5I 2VCIA 5GGZA 4ASAA 4L8ZA 4UT4A 2CGFA 4B3ME 4AWOA 1HNXI 2BU7A 3PEJA 4ASBA 2E5LE 2V8PA 3T1HE 4JI2E 2O1UA 4DR6E 2UXDI 1D6TA 3OTOE 1TBWA 3C11A 4EGIA 2ZDXA 2XCMA 1FI4A 2YEGA 4YKXA 4CWRA 2E0AA 4PL9A 2YEFA 1I5BA 3HEKA 5J6AA 3A0TA 1XNQE 3QT6A 1Z0WA 4USKA 4ED4A 4XCJA 3K99A 3EKOA 4MOTA 4CE1A 2HK2A 4IZKB 1HNXE 4DR2I 2GQ0A 4MYUA 4NXNI 2Q8IA 2UXDE 5C93A 2HCHA 4DPYA 2YKIA 4LFCI 4MP2A 1A6FA 2JJCA 1YC1A 2YKBA 4YKUA 4HXZA 4DV0I 4MP7A 1IBKI 2IWUA 3Q6MA 5F3KA 2YE6A 2YE7A 5M4EA 1H74A 2XHXA 4EFTA 4XKKA 1KIJA 4CWOA 5M4MA 2WEQA 4XE2A 4CE3A 2X7IA 4DR2E 3OW6A 1Z5AA 4NH7A 4NXNE 5FWKA 2XX2A 3GIGB 1TILA 1UYLA 4DPXA 2YEEA 4MBCA 4V26A 3T2SA 1I94I 3C0EA 4IZJB 1NHIA 2YKEA 3VHCA 1IBKE 2BYHA 2XABA 2DEIA 4HYPA 3NMQA 1N34E 4FCPA 3EHGA 1RREA 3Q1QA 2BM1A 4LF8I 1USVA 1HNWI 2YK9A 1EI1A 4DV6I 3GIEA 2IWSA 3B26A 2UU9I 3O0IA 4MB9A 2Z5CA 2XJXA 2EFGA 5CTXA 4I3HA 2K5BA 4JI1I 4CWFA 1DARA 2O1WA 3CGZA 3QT8A 1ID0A 4EGKA 4DR1E 2Q8GA 4KQVA 5IWAI 3DGEA 5BR8I 4E01A 1ZXMA 5D6PA 5FNFA 2EXLA 4O04A 1S4EA 4YKRA 4R3AA 1US7A 5FNCA 1I59A 4KTNA 3OWBA 4LF8E 1HNWE 4GGLA 4FN5A 4DV6E 4DU7A 2VQFI 3J80C 5BODA 2UU9E 2YJWA 1GKXA 2HFUA 4DV3I 5LMUI 1PVGA 5FLXQ 4GKKI 3K97A 3R4OA 3WU6A 4JI1E 3TZ4A 1OJ4A 3KE6A 5M4KA 1QZRA 1N33I 2XDUA 4LFBI 4P8OA 4JASA 2YGEA 3R4PA 3D2RA 3HYZA 5BR8E 5M4HA 4DUYI 4KHPI 1UYEA 1H72C 3WU3A 1HR0E 4ASGA 4KSGA 4BIZA 2VW5A 4V25A 1YT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TZ0 A;  5IN9 A;  2UUA I;  4B3R I;  1AJ6 A;  2WER A;  1I5C A;  4URN A;  2VQF E;  3F0N A;  2UUC I;  5LMU E;  4GKK E;  4NH9 A;  3OMU A;  3INW A;  2V34 A;  1Y8P A;  4YHH I;  2E1R A;  2HHH I;  2WI1 A;  1NHJ A;  1N33 E;  2WI4 A;  5IT9 Q;  3HZ5 A;  1U2R A;  5D7D A;  4LFB E;  1UYH A;  1Z5C A;  4CWQ A;  2XHR A;  3U67 A;  4RPF A;  4USM A;  2HG1 A;  2BU8 A;  3U2D A;  4DUY E;  4NH8 A;  3B78 A;  4JAU A;  1UYM A;  4XCL A;  2QF6 A;  4YKQ A;  1Z0E A;  2UUA E;  4JI7 I;  4B3R E;  1YC4 A;  4DV5 I;  2F4V I;  1Y8O A;  5GMD A;  1I5D A;  4JI8 E;  1IBM I;  4XKO A;  4X62 I;  3CRK A;  2ESA A;  2UXB I;  3JZ3 A;  4YHH E;  1H7U A;  3WU5 A;  2HHH E;  2VF3 A;  5CTW A;  2VQE I;  2HK3 A;  5FLX C;  2YGA A;  2WI6 A;  3D36 A;  2C2A A;  2V2V A;  3R91 A;  4X64 I;  2BRC A;  3G7E A;  4YY3 I;  2YI0 A;  2YE4 A;  4JI4 I;  4DUZ I;  3PEH A;  4JI7 E;  4LWF A;  1YES A;  4DV5 E;  2F4V E;  4FMT A;  4O05 A;  4Z7C A;  2XDK A;  3K60 A;  2YJX A;  5D7C A;  4BIU A;  1YSR A;  4X62 E;  5J71 A;  3HYY A;  4LF5 E;  4X65 I;  1Z0T A;  2UXB E;  5D7R A;  3VAD A;  4WUB A;  4LP0 A;  4I5S A;  4DZY A;  2YEJ A;  3G7B A;  1MG7 A;  2DEJ A;  1Z0G A;  2XJJ A;  1XHK A;  3GIF A;  3QT5 A;  4X64 E;  4WUD A;  1NHH A;  4FCR A;  3ZKB A;  3HHU A;  3EHJ A;  4YY3 E;  4XIT A;  4DPT A;  5IT9 C;  4JI4 E;  2WI7 A;  4GEE A;  3EHH A;  4DV2 I;  4R1F A;  1Z0V A;  3B24 A;  3J80 Q;  3TUH A;  4X65 E;  4XD8 A;  2AJ4 A;  5IDJ A;  1Y4U A;  3IED A;  4JG4 A;  1UY6 A;  2CCT A;  3T0Z A;  4CWN A;  4LF9 I;  4DR4 I;  2WI5 A;  4JI3 I;  4LFC E;  1BXD A;  4URM A;  3LTO A;  4AQY I;  1YET A;  4JI5 I;  1ZWH A;  4P7A A;  1EA6 A;  1FWK A;  4MPE A;  4DV0 E;  1NZ0 A;  4DUH A;  4DV2 E;  4DPU A;  1N36 I;  2UWD A;  3Q5J A;  4XIR A;  4BQJ A;  5IDM A;  2YK2 A;  1AMW A;  1N0U A;  3B82 A;  1KVK A;  3WHA A;  4M1K A;  5FND A;  4EGH A;  5F5R A;  4FCQ A;  5D6Q A;  3OWD A;  3G75 A;  3RLR A;  4LF9 E;  4DR4 E;  2GS8 A;  4HZ5 A;  4JI3 E;  1OSF A;  4GKJ I;  2BU6 A;  3BM9 A;  4AWQ A;  4U93 A;  4AQY E;  1I94 E;  4HAC A;  4AWP A;  4JI5 E;  1Y4S A;  3ZM7 A;  4YKW A;  2R3V A;  5BOC A;  4DV7 I;  2YI5 A;  3B28 A;  2YEB A;  4FW9 A;  1UYF A;  1N36 E;  2BT0 A;  4HXW A;  4URL A;  4QPJ A;  1ZM3 A;  2BM0 A;  2GQP A;  2WW4 A;  5LMN I;  2CZ9 A;  1RR9 A;  3RKZ A;  3R92 A;  5M4N A;  1YSZ A;  4MPN A;  1ZM2 A;  4LF7 I;  4FWH A;  2Q2E B;  2FWZ A;  1FKA E;  2V2Q A;  5CTU A;  4DU8 A;  4E02 A;  2YEH A;  2CH4 A;  3O6O A;  4R3M A;  2YI6 A;  5IWA E;  4DV7 E;  4PU9 A;  1YS3 A;  1S16 A;  1AM1 A;  1N32 I;  3A0Z A;  1A4H A;  4O09 A;  3PYE A;  2HKE A;  4YKT A;  4YKZ A;  2XX5 A;  5LMN E;  4NXM I;  4L90 A;  2HFS A;  1KZN A;  1J5E I;  1UY9 A;  4P52 A;  4XTJ A;  4DV3 E;  4LF7 E;  2FXS A;  2YEA A;  3R4M A;  2YEI A;  1YER A;  2YE5 A;  2BZ5 A;  5GME A;  4DR7 I;  3PYF A;  4WUC A;  1ZM4 A;  3R4N A;  2ZM6 I;  4HY1 A;  4KHP E;  3JAM Q;  3INX A;  1YC3 A;  3GON A;  3T0H A;  4EFU A;  2WI2 A;  1N32 E;  4L94 A;  1B63 A;  1UYD A;  2HKJ A;  3FV5 A;  4NXM E;  2YE8 A;  2H8M A;  4DV1 I;  3SL2 A;  4KP4 A;  2UUC E;  2WEP A;  2QFO A;  3O2F A;  3LNU A;  1YT2 A;  3FT8 A;  4URO A;  3D0B A;  3ZZ0 A;  4DR7 E;  4JI6 I;  1XNR I;  4B3M I;  5LL6 R;  4K4O A;  4LWE A;  1UEK A;  2YGF A;  3A0W A;  2BTZ A;  3GIG A;  4B7P A;  4PRX A;  3WQ9 A;  1K47 A;  3ZXO A;  4CE2 A;  5CTY A;  3QDD A;  4L91 A;  4CWT A;  1GJV A;  4DV1 E;  3B25 A;  2GFD A;  2YE9 A;  2YKJ A;  4FWD A;  1IBM E;  1FWL A;  2H55 A;  4AS9 A;  1L0O A;  4JI6 E;  2A2D A;  1XNR E;  4H85 A;  4CWS A;  3PYD A;  4X66 I;  2VQE E;  2ZKJ A;  4DXL A;  1FNM A;  3Q5L A;  4ASF A;  3BMY A;  1TID A;  2YE2 A;  3V2U C;  2V2Z A;  2CCU A;  4DUZ E;  3PYG A;  1AH6 A;  3JAM C;  2CCS A;  2ZIT A;  3A0X A;  4Q20 A;  3J7A M;  4H7Q A;  4BAE A;  3D4J A;  4Z7Y A;  4X66 E;  1ZW9 A;  4GCZ A;  4ZVI A;  1R62 A;  4FPP A;  5M4P A;  4UTG A;  4L93 A;  2YE3 A;  4LFA I;  2X36 A;  3QTF A;  4XIP A;  4K0K I;  2JKI A;  2IOQ A;  4HZ0 A;  1Z5B A;  5A2Q C;  2IWX A;  4KFG A;  4U7N A;  1JM6 A;  2QG0 A;  1N34 I;  4XC0 A;  3J81 C;  4JI0 I;  1IBL I;  3K17 A;  4X9L A;  4O07 A;  4O0B A;  1KKH A;  2XD6 A;  1Z59 A;  3TZ2 A;  2WI3 A;  1BYQ A;  3TTZ A;  4EM7 A;  4B3T I;  1B3Q A;  1ZM9 A;  4DPW A;  4BQG A;  2A2C A;  1TC6 A;  3WU4 A;  1I58 A;  2R42 A;  3T1Y I;  3HZ1 A;  4OX9 I;  3Q5K A;  4GFN A;  4LFA E;  3RLQ A;  4K0K E;  2YED A;  4DR1 I;  1U0Z A;  3ZXQ A;  4CWP A;  2ZBK B;  3EHF A;  4GQT A;  3T1K A;  3B8H A;  3CGY A;  4DR3 I;  2BU2 A;  1TH8 A;  2O1V A;  1IBL E;  4JI0 E;  2FYP A;  4DR5 I;  4B3T E;  4LPB A;  2XDS A;  1UY7 A;  1PKP A;  2BU5 A;  3MNR P;  2BYI A;  3J7A G;  1THN A;  3RLP A;  3VHD A;  1TC0 A;  4W7T A;  1ELO A;  3T1Y E;  2QG2 A;  4HY6 A;  3V5R A;  4GKJ E;  3CRL A;  3H80 A;  4B6C A;  4DV4 I;  4B3S I;  2VCJ A;  3B27 A;  4OX9 E;  2OI2 A;  5L3J A;  1Z0B A;  1BKN A;  2CG9 A;  2XDX A;  3TZ5 A;  2ZDY A;  2XEX A;  4FWG A;  1XMO I;  1HNZ I;  4MPC A;  1MU5 A;  4LWI A;  2XK2 A;  1H7S A;  2BRE A;  1MX0 A;  3EKR A;  4LF6 I;  1HR0 I;  4DR3 E;  4EEH A;  4EMV A;  4JYA I;  1Z0C A;  4DR5 E;  2XHT A;  3FT5 A;  4LWG A;  2UXC I;  1N0V C;  1PIE A;  2UUB I;  1U2O A;  1KTV A;  2BV3 A;  1WUU A;  4MYT A;  2YKC A;  2FWY A;  2LJP A;  3K98 A;  1AH8 A;  4DV4 E;  3ZZT A;  4B3S E;  2Q8F A;  4JV5 I;  1UYG A;  1ZXN A;  2IOP A;  4KSH A;  4BXI A;  1S14 A;  1QYE A;  1HNZ E;  1XMO E;  3A0R A;  1UYI A;  3U2K A;  3QT7 A;  1YT1 A;  2YEC A;  4XDM A;  2AKP A;  1UYC A;  4U7O A;  4LF6 E;  1FJG I;  1VIS A;  2NPF A;  1BGQ A;  2IOR A;  1H73 A;  4JYA E;  1GKZ A;  2XJG A;  4JAV A;  4YKY A;  2VWC A;  5CPH A;  1XMQ I;  3VHA A;  2XDL A;  3CWV A;  2UXC E;  2UUB E;  4HYM A;  1J5E E;  4LWH A;  5CF0 A;  4JI8 I;  4LF4 I;  4QPK A;  4E00 A;  4HAC B;  1QY8 A;  2YI7 A;  2XX4 A;  2J7K A;  4JV5 E;  3ZZU A;  3H4L A;  4XIQ A;  3T10 A;  3LPS A;  2E5L I;  2ZM6 E;  5A2Q Q;  3T1H I;  4JI2 I;  4DR6 I;  1UY8 A;  4JQL A;  4ZKI A;  3OTO I;  4H81 A;  1FJG E;  4PRV A;  2Q8H A;  4GT8 A;  1Y8N A;  3J81 Q;  2BSM A;  1I5A A;  1XMQ E;  3K1J A;  3ZKD A;  3HUL A;  3M6A A;  4EMD A;  4XKA A;  1UYK A;  3A0Y A;  1B62 A;  4LF4 E;  2PNR A;  3OPD A;  1XNQ I;  4LF5 I;  2VCI A;  5GGZ A;  4ASA A;  4L8Z A;  4UT4 A;  2CGF A;  4B3M E;  4AWO A;  1HNX I;  2BU7 A;  3PEJ A;  4ASB A;  2E5L E;  2V8P A;  3T1H E;  4JI2 E;  4DR6 E;  2UXD I;  1D6T A;  1TBW A;  3OTO E;  2O1U A;  3C11 A;  4EGI A;  2ZDX A;  2XCM A;  1FI4 A;  2YEG A;  4YKX A;  4CWR A;  2E0A A;  4PL9 A;  2YEF A;  1I5B A;  3HEK A;  5J6A A;  3A0T A;  1XNQ E;  3QT6 A;  1Z0W A;  4USK A;  4ED4 A;  4XCJ A;  3K99 A;  3EKO A;  4MOT A;  4CE1 A;  2HK2 A;  1HNX E;  4DR2 I;  4MYU A;  4NXN I;  2Q8I A;  2UXD E;  5C93 A;  2HCH A;  4DPY A;  2YKI A;  4LFC I;  4MP2 A;  1A6F A;  2JJC A;  1YC1 A;  2YKB A;  4YKU A;  4HXZ A;  4DV0 I;  4MP7 A;  1IBK I;  2IWU A;  5F3K A;  2YE6 A;  2YE7 A;  5M4E A;  1H74 A;  2XHX A;  4EFT A;  4XKK A;  1KIJ A;  4CWO A;  5M4M A;  2WEQ A;  4XE2 A;  4CE3 A;  2X7I A;  4DR2 E;  3OW6 A;  1Z5A A;  4NH7 A;  4NXN E;  2XX2 A;  3GIG B;  5FWK A;  1TIL A;  1UYL A;  4DPX A;  2YEE A;  4MBC A;  4V26 A;  3T2S A;  1I94 I;  3C0E A;  1NHI A;  2YKE A;  3VHC A;  1IBK E;  2BYH A;  2XAB A;  2DEI A;  4HYP A;  3NMQ A;  1N34 E;  4FCP A;  3EHG A;  1RRE A;  3Q1Q A;  2BM1 A;  4LF8 I;  1HNW I;  2YK9 A;  1EI1 A;  4DV6 I;  3GIE A;  2IWS A;  3B26 A;  2UU9 I;  3O0I A;  4MB9 A;  2XJX A;  2EFG A;  5CTX A;  4I3H A;  2K5B A;  4JI1 I;  4CWF A;  1DAR A;  2O1W A;  3CGZ A;  3QT8 A;  1ID0 A;  4EGK A;  4DR1 E;  2Q8G A;  4KQV A;  5IWA I;  3DGE A;  5BR8 I;  4E01 A;  1ZXM A;  5D6P A;  5FNF A;  2EXL A;  4O04 A;  1S4E A;  4YKR A;  4R3A A;  1US7 A;  5FNC A;  1I59 A;  4KTN A;  3OWB A;  4LF8 E;  1HNW E;  4GGL A;  4FN5 A;  4DV6 E;  4DU7 A;  2VQF I;  3J80 C;  5BOD A;  2UU9 E;  2YJW A;  1GKX A;  2HFU A;  4DV3 I;  5LMU I;  1PVG A;  5FLX Q;  4GKK I;  3K97 A;  3R4O A;  3WU6 A;  4JI1 E;  3TZ4 A;  1OJ4 A;  3KE6 A;  5M4K A;  1QZR A;  1N33 I;  2XDU A;  4LFB I;  4P8O A;  4JAS A;  2YGE A;  3R4P A;  3D2R A;  3HYZ A;  5BR8 E;  5M4H A;  4DUY I;  4KHP I;  1UYE A;  1H72 C;  3WU3 A;  1HR0 E;  4ASG A;  4KSG A;  4BIZ A;  2VW5 A;  4V25 A;  1YT0 A; 
#chains in the Genus database with same CATH topology
 3TZ0 A;  5IN9 A;  2C39 B;  2UUA I;  4U3D A;  4BA2 B;  4B3R I;  1AJ6 A;  4IFD D;  1I5C A;  2WER A;  2JEA A;  2VQF E;  4URN A;  4AID A;  2WP8 B;  3F0N A;  4LOM A;  2UUC I;  5LMU E;  4GKK E;  4NH9 A;  3OMU A;  3INW A;  2V34 A;  1Y8P A;  2PO2 A;  2E1R A;  4YHH I;  2HHH I;  1NHJ A;  2O3Z A;  1N33 E;  5IT9 Q;  2WI1 A;  1U2R A;  2WI4 A;  4LFB E;  3HZ5 A;  1UYH A;  1Z5C A;  4CWQ A;  2XHR A;  3U67 A;  4RPF A;  4USM A;  2HG1 A;  2BU8 A;  3U2D A;  4DUY E;  4NH8 A;  2Z5E A;  3B78 A;  2Z5B A;  1UYM A;  4JAU A;  4XCL A;  2BA1 D;  2QF6 A;  4YKQ A;  1Z0E A;  2UUA E;  4JI7 I;  4B3R E;  1YC4 A;  4DV5 I;  2F4V I;  1Y8O A;  5GMD A;  1I5D A;  2C1I A;  1YHC A;  4JI8 E;  1IBM I;  4XKO A;  4X62 I;  3CRK A;  2ESA A;  2PO0 A;  4FW3 A;  2UXB I;  3JZ3 A;  2PNZ A;  4YHH E;  1H7U A;  3WU5 A;  2HHH E;  2VF3 A;  5CTW A;  4IFD F;  2JEB A;  2VQE I;  2HK3 A;  5FLX C;  2YGA A;  2WI6 A;  5K36 A;  2C2A A;  2V2V A;  3D36 A;  4X64 I;  2BRC A;  3KRN A;  3R91 A;  1R6M A;  3G7E A;  4YY3 I;  2YI0 A;  2YE4 A;  4JI4 I;  4DUZ I;  2BR2 B;  4OO1 A;  3PEH A;  4JI7 E;  4LWF A;  2AE8 A;  2JE6 B;  4DV5 E;  2F4V E;  1YES A;  4FMT A;  4O05 A;  4Z7C A;  2XDK A;  3K60 A;  2YJX A;  5D7C A;  4BIU A;  1YSR A;  4X62 E;  5J71 A;  3HYY A;  4LF5 E;  4X65 I;  1Z0T A;  2UXB E;  5D7R A;  5JEA C;  4WUB A;  4LP0 A;  4I5S A;  5D7D A;  2YEJ A;  3VAD A;  4DZY A;  3G7B A;  1MG7 A;  2DEJ A;  1Z0G A;  2XJJ A;  3Q6N A;  1XHK A;  3GIF A;  3QT5 A;  4X64 E;  4WUD A;  1NHH A;  4AM3 A;  4FCR A;  3ZKB A;  3HHU A;  5C0X D;  3EHJ A;  4YY3 E;  4XIT A;  4DPT A;  5IT9 C;  4JI4 E;  4MU4 A;  2O1T A;  2WI7 A;  2PNL A;  2JEA B;  4GEE A;  2BA0 G;  3EHH A;  4DV2 I;  4R1F A;  1Z0V A;  3B24 A;  5DRO A;  3J80 Q;  3TUH A;  1F51 A;  2WNR B;  4X65 E;  4XD8 A;  2AJ4 A;  5IDJ A;  1Y4U A;  3IED A;  4JG4 A;  1UY6 A;  2CCT A;  3T0Z A;  4CWN A;  4LCF A;  4LF9 I;  4DR4 I;  2WI5 A;  4JI3 I;  4LFC E;  1BXD A;  4URM A;  3LTO A;  4AQY I;  1YET A;  4JI5 I;  1ZWH A;  4P7A A;  2PO1 B;  1EA6 A;  1FWK A;  4MPE A;  4DV0 E;  3UHM A;  1OYS A;  1E3P A;  1NZ0 A;  4NBQ A;  4DUH A;  4DV2 E;  4DPU A;  1N36 I;  5K36 F;  2UWD A;  3Q5J A;  4XIR A;  4BQJ A;  2YK2 A;  1AMW A;  2PO0 B;  5IDM A;  1N0U A;  3B82 A;  1KVK A;  3M7N G;  4M1K A;  3WHA A;  2JEB B;  5FND A;  4EGH A;  5F5R A;  4FCQ A;  2VES A;  4OO1 F;  5D6Q A;  5C0X B;  3P3C A;  3PRY A;  4LPF A;  3G75 A;  3OWD A;  4LF9 E;  3RLR A;  4DR4 E;  2GS8 A;  5DRR A;  4HZ5 A;  4JI3 E;  1OSF A;  4GKJ I;  2BU6 A;  3BM9 A;  4AWQ A;  4U93 A;  4AQY E;  1I94 E;  4HAC A;  4AWP A;  4JI5 E;  1Y4S A;  3L7Z A;  3ZM7 A;  4YKW A;  2R3V A;  5BOC A;  4DV7 I;  2YI5 A;  3B28 A;  2YEB A;  4FW9 A;  1UYF A;  1N36 E;  2BT0 A;  4HXW A;  4URL A;  5JEA A;  4QPJ A;  1ZM3 A;  2BM0 A;  2GQP A;  2WW4 A;  5LMN I;  3LMM A;  2CZ9 A;  1RR9 A;  3RKZ A;  3R92 A;  5M4N A;  1YSZ A;  4MPN A;  1ZM2 A;  4LF7 I;  4FWH A;  2Q2E B;  2FWZ A;  1FKA E;  2V2Q A;  5CTU A;  4DU8 A;  4E02 A;  2YEH A;  2CH4 A;  3O6O A;  4R3M A;  5DRQ A;  3P3G A;  2YI6 A;  5IWA E;  4DV7 E;  4PU9 A;  1YS3 A;  1S16 A;  1AM1 A;  1N32 I;  4ISA A;  3A0Z A;  1A4H A;  5JEA D;  4O09 A;  4FW5 A;  3PYE A;  2HKE A;  4YKT A;  4YKZ A;  2XX5 A;  5LMN E;  4NXM I;  4L90 A;  2HFS A;  1KZN A;  1J5E I;  1UY9 A;  4P52 A;  3CDJ A;  5EKW A;  3DD6 A;  4XTJ A;  4DV3 E;  4LF7 E;  2FXS A;  3HJC A;  2YEA A;  3R4M A;  2YEI A;  2PNM A;  1YER A;  2YE5 A;  2BZ5 A;  5GME A;  4DR7 I;  2IES A;  3PYF A;  4WUC A;  5EL9 A;  1ZM4 A;  3R4N A;  2ZM6 I;  4HY1 A;  4MU3 A;  4KHP E;  3JAM Q;  3INX A;  1YC3 A;  3GON A;  2JT2 A;  3T0H A;  2IER A;  5DNL A;  4EFU A;  2WI2 A;  1N32 E;  4L94 A;  1B63 A;  1UYD A;  2HKJ A;  3FV5 A;  3S5T A;  2Z5C B;  4NXM E;  2YE8 A;  2H8M A;  4DV1 I;  3SL2 A;  4KP4 A;  2UUC E;  2WEP A;  2QFO A;  3O2F A;  3LNU A;  1YT2 A;  3FT8 A;  4URO A;  3D0B A;  3ZZ0 A;  5JEA F;  4DR7 E;  4JI6 I;  1XNR I;  4B3M I;  5LL6 R;  4AIM A;  4K4O A;  4LWE A;  1UEK A;  2YGF A;  3A0W A;  5JEA B;  2FTK A;  2BTZ A;  3GIG A;  4B7P A;  4IFD B;  4PRX A;  3WQ9 A;  1K47 A;  3ZXO A;  1Y6Z A;  2C38 A;  5CTY A;  4CE2 A;  3NZK A;  3QDD A;  4L91 A;  4IZJ A;  3PS1 A;  4CWT A;  1GJV A;  5JEN A;  4DV1 E;  3B25 A;  2GFD A;  2YE9 A;  2YKJ A;  4FWD A;  1IBM E;  1FWL A;  2H55 A;  3K85 A;  5C0X E;  4AS9 A;  2NN6 C;  1L0O A;  1RHY A;  4JI6 E;  2A2D A;  1XNR E;  4H85 A;  4CWS A;  3PYD A;  4X66 I;  2VQE E;  2ZKJ A;  4DXL A;  1FNM A;  3Q5L A;  4ASF A;  3BMY A;  4N3O A;  5K36 D;  4FW6 A;  1TID A;  2YE2 A;  3CDI A;  3V2U C;  2V2Z A;  2CCU A;  4DUZ E;  3PYG A;  1AH6 A;  3JAM C;  4OO1 D;  2CCS A;  4IZJ D;  2ZIT A;  3A0X A;  4Q20 A;  2PO2 B;  5DRP A;  3J7A M;  4H7Q A;  4BAE A;  3D4J A;  4Z7Y A;  4X66 E;  1ZW9 A;  4GCZ A;  2Z5B B;  4ZVI A;  1R62 A;  4FPP A;  5M4P A;  4UTG A;  4L93 A;  2YE3 A;  4LFA I;  2X36 A;  3QTF A;  4XIP A;  4K0K I;  2JKI A;  2IOQ A;  4HZ0 A;  1Z5B A;  3HKM A;  5A2Q C;  2IWX A;  4KFG A;  4U7N A;  1JM6 A;  2QG0 A;  1N34 I;  4XC0 A;  2F1D A;  3J81 C;  4JI0 I;  2PNZ B;  3K17 A;  1IBL I;  4X9L A;  4O07 A;  4O0B A;  1KKH A;  2XD6 A;  1Z59 A;  3TZ2 A;  2WI3 A;  1BYQ A;  3TTZ A;  4EM7 A;  4BA1 A;  4B3T I;  5K36 B;  1B3Q A;  1ZM9 A;  4DPW A;  4BQG A;  4BA2 A;  2A2C A;  1TC6 A;  3U1K A;  3WU4 A;  1I58 A;  2R42 A;  4MQY A;  4OKG A;  3T1Y I;  2WP8 A;  3HZ1 A;  1USU A;  4OX9 I;  4OO1 B;  3Q5K A;  4GFN A;  4LFA E;  3RLQ A;  4K0K E;  2YED A;  4J3D A;  4DR1 I;  1U0Z A;  3ZXQ A;  4CWP A;  2ZBK B;  3EHF A;  4GQT A;  3T1K A;  3B8H A;  4QNJ A;  2NN6 A;  3CGY A;  4DR3 I;  2BU2 A;  1TH8 A;  2O1V A;  1IBL E;  4JI0 E;  2FYP A;  4DR5 I;  3TZ5 A;  2BA0 D;  5DNX A;  1R6L A;  4B3T E;  3P06 A;  4LPB A;  2XDS A;  3CYG A;  1UY7 A;  1PKP A;  2BU5 A;  3MNR P;  2BYI A;  3J7A G;  2GO4 A;  1THN A;  3RLP A;  3VHD A;  1TC0 A;  4W7T A;  1ELO A;  3T1Y E;  2QG2 A;  4HY6 A;  3V5R A;  4GKJ E;  3CRL A;  3H80 A;  4B6C A;  4DV4 I;  1OYP A;  4B3S I;  2VCJ A;  3B27 A;  4OX9 E;  2OI2 A;  2C1G A;  1XXE A;  5L3J A;  1Z0B A;  1BKN A;  2CG9 A;  4MU1 A;  1UDO A;  2BA1 G;  5JEA E;  2XDX A;  2XEX A;  4FWG A;  1XMO I;  1HNZ I;  4IFD E;  2ZDY A;  1MU5 A;  4MPC A;  4LWI A;  2XK2 A;  1H7S A;  2BRE A;  1MX0 A;  3EKR A;  4LF6 I;  1HR0 I;  4DR3 E;  4EEH A;  4EMV A;  2NN6 D;  4JYA I;  2C37 A;  1Z0C A;  4DR5 E;  2XHT A;  3FT5 A;  4OZE A;  4LWG A;  2UXC I;  1N0V C;  1PIE A;  3M85 D;  2BR2 A;  2UUB I;  1U2O A;  1KTV A;  2BV3 A;  1WUU A;  2JE6 A;  4MYT A;  2FWY A;  2YKC A;  3M7N D;  2LJP A;  3K98 A;  3PS2 A;  1AH8 A;  4DV4 E;  3ZZT A;  4B3S E;  2Q8F A;  2IOP A;  4JV5 I;  1ZXN A;  1UYG A;  4KSH A;  4BXI A;  1S14 A;  4MU0 A;  1QYE A;  1HNZ E;  1XMO E;  3A0R A;  4IZK A;  1UYI A;  3U2K A;  3QT7 A;  1YT1 A;  2YEC A;  4XDM A;  2AKP A;  1UYC A;  4U7O A;  4LF6 E;  1FJG I;  1VIS A;  2NPF A;  1BGQ A;  2IOR A;  1H73 A;  4JYA E;  1GKZ A;  2XJG A;  4JAV A;  4YKY A;  2VWC A;  5CPH A;  4BA1 B;  3GCM A;  4IS9 A;  1XMQ I;  3VHA A;  2XDL A;  3CWV A;  2UXC E;  2UUB E;  4HYM A;  1J5E E;  4LWH A;  5CF0 A;  4JI8 I;  4LF4 I;  4QPK A;  2NN6 F;  2CGE A;  4E00 A;  4HAC B;  1QY8 A;  2YI7 A;  2WNR A;  2J7K A;  3L7Z B;  2XX4 A;  4JV5 E;  3ZZU A;  3H4L A;  4XIQ A;  1HK7 A;  3T10 A;  3LPS A;  2ZM6 E;  2E5L I;  2NN6 B;  5A2Q Q;  3T1H I;  4JI2 I;  4DR6 I;  1UY8 A;  4JQL A;  3OTO I;  4ZKI A;  4H81 A;  1FJG E;  4PRV A;  2Q8H A;  4GT8 A;  1Y8N A;  3J81 Q;  2BSM A;  1I5A A;  1XMQ E;  3K1J A;  3ZKD A;  3HUL A;  3M6A A;  2PO1 A;  4EMD A;  4XKA A;  1UYK A;  1YH8 A;  3A0Y A;  1B62 A;  5K36 E;  4LF4 E;  2PNR A;  3OPD A;  1XNQ I;  4LF5 I;  2VCI A;  5GGZ A;  4ASA A;  1OYR A;  3B4T A;  4L8Z A;  4UT4 A;  2CGF A;  4B3M E;  4AWO A;  1HNX I;  2BU7 A;  3PEJ A;  4ASB A;  4OO1 E;  2E5L E;  2V8P A;  2CVE A;  5C0X A;  2O1U A;  3T1H E;  4JI2 E;  4DR6 E;  3OTO E;  2UXD I;  1D6T A;  1TBW A;  3C11 A;  2C37 B;  2ZDX A;  2XCM A;  4EGI A;  1FI4 A;  1E3H A;  2YEG A;  4YKX A;  4CWR A;  2E0A A;  3P3E A;  3P76 A;  4PL9 A;  2YEF A;  1I5B A;  3HEK A;  5J6A A;  4GQU A;  3A0T A;  4FW7 A;  1XNQ E;  3QT6 A;  1Z0W A;  4USK A;  4ED4 A;  4XCJ A;  3K99 A;  3EKO A;  4MOT A;  4CE1 A;  1UDN A;  2HK2 A;  3H1C A;  4IZK B;  1HNX E;  4DR2 I;  2GQ0 A;  4IFD C;  4MYU A;  4NXN I;  2Q8I A;  2UXD E;  5C93 A;  2HCH A;  4DPY A;  4LCG A;  4LFC I;  2YKI A;  4MP2 A;  1A6F A;  2JJC A;  1YC1 A;  2YKB A;  4YKU A;  4HXZ A;  4DV0 I;  4MP7 A;  1IBK I;  2IWU A;  3Q6M A;  5F3K A;  2YE6 A;  2YE7 A;  5M4E A;  1H74 A;  2XHX A;  4EFT A;  4XKK A;  1KIJ A;  4CWO A;  5M4M A;  2WEQ A;  2C39 A;  4E72 A;  4XE2 A;  4CE3 A;  2X7I A;  4DR2 E;  3OW6 A;  1Z5A A;  4QNK A;  3GME A;  1Y60 A;  4NXN E;  5FWK A;  2XX2 A;  3GIG B;  4NH7 A;  1TIL A;  3PS3 A;  1UYL A;  4DPX A;  2YEE A;  4MBC A;  2C38 B;  4V26 A;  3T2S A;  1I94 I;  3C0E A;  4IZJ B;  1NHI A;  1P42 A;  3GLL A;  2YKE A;  3VHC A;  1IBK E;  2BYH A;  2XAB A;  2DEI A;  4HYP A;  4U3B A;  3M85 G;  5C0X F;  3NMQ A;  1N34 E;  4FCP A;  3EHG A;  1RRE A;  1UDQ A;  1IXM A;  3Q1Q A;  2BM1 A;  4LF8 I;  1USV A;  1HNW I;  1UDS A;  2YK9 A;  1EI1 A;  4DV6 I;  3GIE A;  2IWS A;  3B26 A;  2UU9 I;  3O0I A;  4MB9 A;  2Z5C A;  2XJX A;  2EFG A;  5CTX A;  4I3H A;  2K5B A;  4JI1 I;  4CWF A;  1DAR A;  2O1W A;  3CGZ A;  2NN6 E;  2GO3 A;  3QT8 A;  1ID0 A;  4EGK A;  4DR1 E;  2Q8G A;  4KQV A;  3U1Y A;  5IWA I;  5BR8 I;  3DGE A;  1ZXM A;  5D6P A;  4E01 A;  5FNF A;  2EXL A;  2J65 A;  4O04 A;  1S4E A;  5K36 C;  4YKR A;  5C0X C;  1US7 A;  4R3A A;  5FNC A;  1I59 A;  4KTN A;  3OWB A;  4LF8 E;  4IFD A;  1HNW E;  4GGL A;  4FN5 A;  4DV6 E;  4DU7 A;  2VQF I;  1VI7 A;  3J80 C;  5BOD A;  2UU9 E;  4FW4 A;  4OO1 C;  2YJW A;  1GKX A;  4MDT A;  2HFU A;  1PVG A;  5FLX Q;  5LMU I;  4DV3 I;  4GKK I;  3K97 A;  3R4O A;  3WU6 A;  4JI1 E;  3TZ4 A;  5ELW A;  1OJ4 A;  3KE6 A;  1Y5Y A;  5M4K A;  1QZR A;  1N33 I;  2XDU A;  4LFB I;  4P8O A;  4JAS A;  2YGE A;  3R4P A;  3D2R A;  3HYZ A;  4LCH A;  5BR8 E;  4DUY I;  4KHP I;  1UYE A;  2HHI A;  1H72 C;  5M4H A;  3WU3 A;  1HR0 E;  4ASG A;  4KSG A;  4BIZ A;  2VW5 A;  4V25 A;  1YT0 A; 
#chains in the Genus database with same CATH homology
 3TZ0 A;  5IN9 A;  2UUA I;  4B3R I;  1AJ6 A;  2WER A;  1I5C A;  4URN A;  2VQF E;  3F0N A;  2UUC I;  5LMU E;  4GKK E;  4NH9 A;  3OMU A;  3INW A;  2V34 A;  1Y8P A;  4YHH I;  2E1R A;  2HHH I;  2WI1 A;  1NHJ A;  1N33 E;  2WI4 A;  5IT9 Q;  3HZ5 A;  1U2R A;  5D7D A;  4LFB E;  1UYH A;  1Z5C A;  4CWQ A;  2XHR A;  3U67 A;  4RPF A;  4USM A;  2HG1 A;  2BU8 A;  3U2D A;  4DUY E;  4NH8 A;  2Z5E A;  3B78 A;  2Z5B A;  1UYM A;  4JAU A;  4XCL A;  2QF6 A;  4YKQ A;  1Z0E A;  2UUA E;  4JI7 I;  4B3R E;  1YC4 A;  4DV5 I;  2F4V I;  1Y8O A;  5GMD A;  1I5D A;  4JI8 E;  1IBM I;  4XKO A;  4X62 I;  3CRK A;  2ESA A;  2UXB I;  3JZ3 A;  4YHH E;  1H7U A;  3WU5 A;  2HHH E;  2VF3 A;  5CTW A;  2VQE I;  2HK3 A;  5FLX C;  2YGA A;  2WI6 A;  3D36 A;  2C2A A;  2V2V A;  3R91 A;  4X64 I;  2BRC A;  3G7E A;  4YY3 I;  2YI0 A;  2YE4 A;  4JI4 I;  4DUZ I;  3PEH A;  4JI7 E;  4LWF A;  1YES A;  4DV5 E;  2F4V E;  4FMT A;  4O05 A;  4Z7C A;  2XDK A;  3K60 A;  2YJX A;  5D7C A;  4BIU A;  1YSR A;  4X62 E;  5J71 A;  3HYY A;  4LF5 E;  4X65 I;  1Z0T A;  2UXB E;  5D7R A;  3VAD A;  4WUB A;  4LP0 A;  4I5S A;  4DZY A;  2YEJ A;  3G7B A;  1MG7 A;  2DEJ A;  1Z0G A;  2XJJ A;  3Q6N A;  1XHK A;  3GIF A;  3QT5 A;  4X64 E;  4WUD A;  1NHH A;  4FCR A;  3ZKB A;  3HHU A;  3EHJ A;  4YY3 E;  4XIT A;  4DPT A;  5IT9 C;  4JI4 E;  2O1T A;  2WI7 A;  2PNL A;  4GEE A;  3EHH A;  4DV2 I;  4R1F A;  1Z0V A;  3B24 A;  3J80 Q;  3TUH A;  4X65 E;  4XD8 A;  2AJ4 A;  5IDJ A;  1Y4U A;  3IED A;  4JG4 A;  1UY6 A;  2CCT A;  3T0Z A;  4CWN A;  4LF9 I;  4DR4 I;  2WI5 A;  4JI3 I;  4LFC E;  1BXD A;  4URM A;  3LTO A;  4AQY I;  1YET A;  4JI5 I;  1ZWH A;  4P7A A;  1EA6 A;  1FWK A;  4MPE A;  4DV0 E;  1NZ0 A;  4DUH A;  4DV2 E;  1N36 I;  4DPU A;  2UWD A;  3Q5J A;  4XIR A;  4BQJ A;  5IDM A;  2YK2 A;  1AMW A;  1N0U A;  3B82 A;  1KVK A;  3WHA A;  4M1K A;  5FND A;  4EGH A;  5F5R A;  4FCQ A;  5D6Q A;  3PRY A;  3OWD A;  3G75 A;  3RLR A;  4LF9 E;  4DR4 E;  2GS8 A;  4HZ5 A;  4JI3 E;  1OSF A;  4GKJ I;  2BU6 A;  3BM9 A;  4AWQ A;  4U93 A;  4AQY E;  1I94 E;  4HAC A;  4AWP A;  4JI5 E;  1Y4S A;  3ZM7 A;  4YKW A;  2R3V A;  5BOC A;  4DV7 I;  2YI5 A;  3B28 A;  2YEB A;  4FW9 A;  1UYF A;  1N36 E;  2BT0 A;  4HXW A;  4URL A;  4QPJ A;  1ZM3 A;  2BM0 A;  2GQP A;  2WW4 A;  5LMN I;  2CZ9 A;  1RR9 A;  3RKZ A;  3R92 A;  5M4N A;  1YSZ A;  4MPN A;  1ZM2 A;  4LF7 I;  4FWH A;  2Q2E B;  2FWZ A;  1FKA E;  2V2Q A;  5CTU A;  4DU8 A;  4E02 A;  2YEH A;  2CH4 A;  3O6O A;  4R3M A;  2YI6 A;  5IWA E;  4DV7 E;  4PU9 A;  1YS3 A;  1S16 A;  1AM1 A;  1N32 I;  3A0Z A;  1A4H A;  4O09 A;  3PYE A;  2HKE A;  4YKT A;  4YKZ A;  2XX5 A;  5LMN E;  4NXM I;  4L90 A;  2HFS A;  1KZN A;  1J5E I;  1UY9 A;  4P52 A;  4XTJ A;  4DV3 E;  4LF7 E;  2FXS A;  3HJC A;  2YEA A;  3R4M A;  2YEI A;  2PNM A;  1YER A;  2YE5 A;  2BZ5 A;  5GME A;  4DR7 I;  3PYF A;  4WUC A;  1ZM4 A;  3R4N A;  2ZM6 I;  4HY1 A;  4KHP E;  3JAM Q;  3INX A;  1YC3 A;  3GON A;  3T0H A;  4EFU A;  2WI2 A;  1N32 E;  4L94 A;  1B63 A;  1UYD A;  2HKJ A;  3FV5 A;  2Z5C B;  4NXM E;  2YE8 A;  2H8M A;  4DV1 I;  3SL2 A;  4KP4 A;  2UUC E;  2WEP A;  2QFO A;  3O2F A;  3LNU A;  1YT2 A;  3FT8 A;  4URO A;  3D0B A;  3ZZ0 A;  4DR7 E;  4JI6 I;  1XNR I;  4B3M I;  5LL6 R;  4K4O A;  4LWE A;  1UEK A;  2YGF A;  3A0W A;  2BTZ A;  3GIG A;  4B7P A;  4PRX A;  3WQ9 A;  1K47 A;  3ZXO A;  1Y6Z A;  4CE2 A;  5CTY A;  3QDD A;  4L91 A;  4IZJ A;  4CWT A;  1GJV A;  4DV1 E;  3B25 A;  2GFD A;  2YE9 A;  2YKJ A;  4FWD A;  1IBM E;  1FWL A;  2H55 A;  3K85 A;  4AS9 A;  1L0O A;  4JI6 E;  2A2D A;  1XNR E;  4H85 A;  4CWS A;  3PYD A;  4X66 I;  2VQE E;  2ZKJ A;  4DXL A;  1FNM A;  3Q5L A;  4ASF A;  3BMY A;  4N3O A;  1TID A;  2YE2 A;  3V2U C;  2V2Z A;  2CCU A;  4DUZ E;  3PYG A;  1AH6 A;  3JAM C;  2CCS A;  4IZJ D;  2ZIT A;  3A0X A;  4Q20 A;  3J7A M;  4H7Q A;  4BAE A;  3D4J A;  4Z7Y A;  4X66 E;  1ZW9 A;  4GCZ A;  2Z5B B;  4ZVI A;  1R62 A;  4FPP A;  5M4P A;  4UTG A;  4L93 A;  2YE3 A;  4LFA I;  2X36 A;  3QTF A;  4XIP A;  4K0K I;  2JKI A;  2IOQ A;  4HZ0 A;  1Z5B A;  5A2Q C;  2IWX A;  4KFG A;  4U7N A;  1JM6 A;  2QG0 A;  1N34 I;  4XC0 A;  3J81 C;  4JI0 I;  1IBL I;  3K17 A;  4X9L A;  4O07 A;  4O0B A;  1KKH A;  2XD6 A;  1Z59 A;  3TZ2 A;  2WI3 A;  1BYQ A;  3TTZ A;  4EM7 A;  4B3T I;  1B3Q A;  1ZM9 A;  4DPW A;  4BQG A;  2A2C A;  1TC6 A;  3WU4 A;  1I58 A;  2R42 A;  3T1Y I;  3HZ1 A;  1USU A;  4OX9 I;  3Q5K A;  4GFN A;  4LFA E;  3RLQ A;  4K0K E;  2YED A;  4DR1 I;  1U0Z A;  3ZXQ A;  4CWP A;  2ZBK B;  3EHF A;  4GQT A;  3T1K A;  3B8H A;  3CGY A;  4DR3 I;  2BU2 A;  1TH8 A;  2O1V A;  1IBL E;  4JI0 E;  2FYP A;  4DR5 I;  4B3T E;  3P06 A;  4LPB A;  2XDS A;  1UY7 A;  1PKP A;  2BU5 A;  3MNR P;  2BYI A;  3J7A G;  1THN A;  3RLP A;  3VHD A;  1TC0 A;  4W7T A;  1ELO A;  3T1Y E;  2QG2 A;  4HY6 A;  3V5R A;  4GKJ E;  3CRL A;  3H80 A;  4B6C A;  4DV4 I;  4B3S I;  2VCJ A;  3B27 A;  4OX9 E;  2OI2 A;  5L3J A;  1Z0B A;  2CG9 A;  1BKN A;  2XDX A;  3TZ5 A;  2ZDY A;  2XEX A;  4FWG A;  1XMO I;  1HNZ I;  4MPC A;  1MU5 A;  4LWI A;  2XK2 A;  1H7S A;  2BRE A;  1MX0 A;  3EKR A;  4LF6 I;  1HR0 I;  4DR3 E;  4EEH A;  4EMV A;  4JYA I;  1Z0C A;  4DR5 E;  2XHT A;  3FT5 A;  4LWG A;  2UXC I;  1N0V C;  1PIE A;  2UUB I;  1U2O A;  1KTV A;  2BV3 A;  1WUU A;  4MYT A;  2YKC A;  2FWY A;  2LJP A;  3K98 A;  1AH8 A;  4DV4 E;  3ZZT A;  4B3S E;  2Q8F A;  2IOP A;  4JV5 I;  1ZXN A;  1UYG A;  4KSH A;  4BXI A;  1S14 A;  1QYE A;  1HNZ E;  1XMO E;  3A0R A;  4IZK A;  1UYI A;  3U2K A;  3QT7 A;  1YT1 A;  2YEC A;  4XDM A;  2AKP A;  1UYC A;  4U7O A;  4LF6 E;  1FJG I;  1VIS A;  2NPF A;  1BGQ A;  2IOR A;  1H73 A;  4JYA E;  1GKZ A;  2XJG A;  4JAV A;  4YKY A;  2VWC A;  5CPH A;  1XMQ I;  3VHA A;  2XDL A;  3CWV A;  2UXC E;  2UUB E;  4HYM A;  1J5E E;  4LWH A;  5CF0 A;  4JI8 I;  4LF4 I;  4QPK A;  2CGE A;  4E00 A;  4HAC B;  1QY8 A;  2YI7 A;  2XX4 A;  2J7K A;  4JV5 E;  3ZZU A;  3H4L A;  4XIQ A;  1HK7 A;  3T10 A;  3LPS A;  2ZM6 E;  2E5L I;  5A2Q Q;  3T1H I;  4JI2 I;  4DR6 I;  1UY8 A;  4JQL A;  4ZKI A;  3OTO I;  4H81 A;  1FJG E;  4PRV A;  2Q8H A;  4GT8 A;  1Y8N A;  3J81 Q;  2BSM A;  1I5A A;  1XMQ E;  3K1J A;  3ZKD A;  3HUL A;  3M6A A;  4EMD A;  4XKA A;  1UYK A;  3A0Y A;  1B62 A;  4LF4 E;  2PNR A;  3OPD A;  1XNQ I;  4LF5 I;  2VCI A;  5GGZ A;  4ASA A;  4L8Z A;  4UT4 A;  2CGF A;  4B3M E;  4AWO A;  1HNX I;  2BU7 A;  3PEJ A;  4ASB A;  2E5L E;  2V8P A;  3T1H E;  4JI2 E;  2O1U A;  4DR6 E;  2UXD I;  1D6T A;  3OTO E;  1TBW A;  3C11 A;  4EGI A;  2ZDX A;  2XCM A;  1FI4 A;  2YEG A;  4YKX A;  4CWR A;  2E0A A;  4PL9 A;  2YEF A;  1I5B A;  3HEK A;  5J6A A;  3A0T A;  1XNQ E;  3QT6 A;  1Z0W A;  4USK A;  4ED4 A;  4XCJ A;  3K99 A;  3EKO A;  4MOT A;  4CE1 A;  2HK2 A;  4IZK B;  1HNX E;  4DR2 I;  2GQ0 A;  4MYU A;  4NXN I;  2Q8I A;  2UXD E;  5C93 A;  2HCH A;  4DPY A;  2YKI A;  4LFC I;  4MP2 A;  1A6F A;  2JJC A;  1YC1 A;  2YKB A;  4YKU A;  4HXZ A;  4DV0 I;  4MP7 A;  1IBK I;  2IWU A;  3Q6M A;  5F3K A;  2YE6 A;  2YE7 A;  5M4E A;  1H74 A;  2XHX A;  4EFT A;  4XKK A;  1KIJ A;  4CWO A;  5M4M A;  2WEQ A;  4XE2 A;  4CE3 A;  2X7I A;  4DR2 E;  3OW6 A;  1Z5A A;  4NH7 A;  4NXN E;  5FWK A;  2XX2 A;  3GIG B;  1TIL A;  1UYL A;  4DPX A;  2YEE A;  4MBC A;  4V26 A;  3T2S A;  1I94 I;  3C0E A;  4IZJ B;  1NHI A;  2YKE A;  3VHC A;  1IBK E;  2BYH A;  2XAB A;  2DEI A;  4HYP A;  3NMQ A;  1N34 E;  4FCP A;  3EHG A;  1RRE A;  3Q1Q A;  2BM1 A;  4LF8 I;  1USV A;  1HNW I;  2YK9 A;  1EI1 A;  4DV6 I;  3GIE A;  2IWS A;  3B26 A;  2UU9 I;  3O0I A;  4MB9 A;  2Z5C A;  2XJX A;  2EFG A;  5CTX A;  4I3H A;  2K5B A;  4JI1 I;  4CWF A;  1DAR A;  2O1W A;  3CGZ A;  3QT8 A;  1ID0 A;  4EGK A;  4DR1 E;  2Q8G A;  4KQV A;  5IWA I;  3DGE A;  5BR8 I;  4E01 A;  1ZXM A;  5D6P A;  5FNF A;  2EXL A;  4O04 A;  1S4E A;  4YKR A;  4R3A A;  1US7 A;  5FNC A;  1I59 A;  4KTN A;  3OWB A;  4LF8 E;  1HNW E;  4GGL A;  4FN5 A;  4DV6 E;  4DU7 A;  2VQF I;  3J80 C;  5BOD A;  2UU9 E;  2YJW A;  1GKX A;  2HFU A;  4DV3 I;  5LMU I;  1PVG A;  5FLX Q;  4GKK I;  3K97 A;  3R4O A;  3WU6 A;  4JI1 E;  3TZ4 A;  1OJ4 A;  3KE6 A;  5M4K A;  1QZR A;  1N33 I;  2XDU A;  4LFB I;  4P8O A;  4JAS A;  2YGE A;  3R4P A;  3D2R A;  3HYZ A;  5BR8 E;  5M4H A;  4DUY I;  4KHP I;  1UYE A;  1H72 C;  3WU3 A;  1HR0 E;  4ASG A;  4KSG A;  4BIZ A;  2VW5 A;  4V25 A;  1YT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...