1BKNA

Crystal structure of an n-terminal 40kd fragment of e. coli dna mismatch repair protein mutl
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
312
structure length
272
Chain Sequence
VERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCGIKKDELALALAIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAWQAYAVTVKPAAHPVGTTLEVLDTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVSRLVHDFIYQGVLSVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna repair
molecule keywords MUTL
publication title Crystal structure and ATPase activity of MutL: implications for DNA repair and mutagenesis.
pubmed doi rcsb
source organism Escherichia coli k12
total genus 75
structure length 272
sequence length 312
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain
A PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1bknA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1bknA01
4XD8A 4FWDA 4OX9E 2CCSA 3O2FA 3TZ4A 4HYPA 4ZKIA 3K17A 2QG0A 4LPBA 1H7SA 2DEIA 2YECA 2BM1A 1XMOE 4LFAI 4KP4A 4JASA 1PKPA 4DR3E 4DR1E 2YKBA 4YKQA 1A6FA 1Z59A 4JV5I 2BU7A 4EEHA 4DUYI 2YEHA 3A0TA 3QT5A 1Z0BA 4LF4E 2BSMA 2UWDA 3VHAA 1UY6A 2YEBA 4XDMA 4BXIA 4CWQA 1GKXA 3BMYA 1KKHA 3ZM7A 2Q8HA 2EXLA 4MBCA 4AWPA 2E5LI 1UYCA 5GGZA 3HHUA 3K99A 3B8HA 2R42A 2VQEI 1HNZE 1KVKA 1Z0GA 4K4OA 1B3QA 1I5AA 4ASFA 4NH7A 3PYEA 5LL6R 4X64E 5C93A 4NXMI 3FT5A 2XCMA 3Q5JA 3MNRP 3B28A 3RLPA 3A0WA 2OI2A 4JI8I 3RLRA 5FNCA 5M4KA 4DR4I 1BXDA 3SL2A 4DR5E 4K0KI 2UXDE 1FI4A 2YKIA 3HZ5A 2A2DA 3QT6A 4DV7E 4LF8I 1U0ZA 1UYDA 3EHHA 4JAVA 2UUAI 2ZBKB 4PU9A 5CTYA 1R62A 3M6AA 4LF7E 2BTZA 1J5EI 4MB9A 1FNMA 4DV5I 4ED4A 4BAEA 4EMDA 4DR6I 1HR0I 3R4NA 2C2AA 1BGQA 3R4PA 3ZXOA 4DV1E 3V5RA 4L8ZA 1UYMA 1S16A 2FYPA 3V2UC 5D6QA 2CGFA 1H73A 1Z0WA 4OX9I 1XMQE 3K1JA 4Z7YA 1QZRA 1L0OA 1ZM3A 1YT0A 2YKJA 5D7CA 5BOCA 5IDJA 1N32I 4GGLA 4O05A 4R3MA 5LMNE 1FWLA 4WUBA 4DR3I 2UXCE 2YI5A 5CTUA 4CWSA 4XIPA 4LWIA 2ZITA 4KTNA 2PNRA 1Z5AA 1Z5BA 3INWA 3T10A 2YGEA 5M4MA 2FWZA 1UY9A 3T0ZA 4LF4I 5CTWA 3J7AM 2YEFA 1YS3A 3TUHA 2WEPA 3Q5LA 3WU5A 4L93A 3LPSA 5M4HA 1RR9A 5FNDA 3U67A 4KFGA 3NMQA 1Z0VA 1IBME 3GIFA 3GIGA 4AQYI 1I94E 2FWYA 4MYTA 2JJCA 3HULA 1TBWA 1Y8NA 2VW5A 4B3RE 4YKTA 4GKKI 1DARA 4CWTA 3INXA 2XHXA 2YE4A 4X64I 4JI0E 3D36A 3CRKA 4O09A 4FPPA 3R91A 2IWUA 2Q8GA 4USMA 4DUHA 4DV0I 4H7QA 4AS9A 2WW4A 1JM6A 4HYMA 5IT9Q 4JAUA 4KQVA 2UXDI 4LWGA 2YE8A 3H4LA 1THNA 4HACA 4DV7I 4LF5E 1OJ4A 2WI7A 4LWHA 3B82A 4B3SE 4LF7I 3U2DA 2XX5A 1NHHA 4I5SA 4V26A 1ZWHA 3T1YI 3OWDA 5IN9A 2UUBE 4FWGA 1N36E 2YK9A 1YC4A 4DV1I 1MX0A 4YY3I 1TC0A 5J71A 3PEJA 4DU7A 2UXBE 4RPFA 2VQFE 2YE7A 4JI7E 4LF6I 5M4NA 5IT9C 4MP7A 1U2RA 2XHRA 3D4JA 2QFOA 3HEKA 4B7PA 4JI1E 1XMQI 1N34E 4GFNA 1YT1A 4EFUA 4X66E 4USKA 4FW9A 4GKJE 2CCTA 1ZM2A 2HKJA 1I59A 1US7A 1Z0CA 2XDKA 3R92A 2HCHA 1YESA 2UXCI 3OW6A 1YC3A 4FCPA 2YGAA 1N33E 5M4EA 1N0UA 1Z0TA 4DZYA 4E02A 3C0EA 4LFCE 4KSHA 4CWPA 4B3ME 4KHPE 1YT2A 4MPNA 3A0XA 1KZNA 4X65E 4YHHI 1Z5CA 1IBLE 4LFBE 3IEDA 5LMUE 4JI6I 2ZM6E 4P8OA 5BODA 1I94I 2IWXA 4R3AA 4HZ5A 3JAMQ 1GKZA 2VWCA 1AM1A 4M1KA 1XNQE 2BT0A 1HNXE 1HNWE 4JG4A 4DV6E 4FWHA 4WUCA 1Y8OA 4Q20A 1K47A 2ZKJA 4X9LA 4LWFA 4DV4E 4XIQA 2V8PA 1YC1A 2WEQA 4JI5E 2QF6A 2XJGA 4EMVA 4UROA 4CE2A 1QY8A 1NZ0A 2VF3A 4DUZI 2O1VA 1I5CA 2BU8A 1RREA 3JAMC 4LF5I 5FNFA 1WUUA 4GT8A 2AJ4A 2BYHA 3B24A 2ZDYA 3TZ0A 1IBKE 1Y8PA 4EFTA 2UUBI 1XNRE 1TH8A 2XX2A 4B3TI 1H7UA 3ZZTA 1YSZA 2YE5A 3EHFA 4JI7I 4JYAE 3H80A 4GCZA 4JI4E 4P52A 2O1UA 2BU6A 3TZ2A 3PYGA 4CE3A 3T0HA 4DR2E 1XMOI 4DPTA 4HXZA 4X66I 1Y4SA 2AKPA 3O0IA 4DR1I 4GKJI 4O04A 2WI5A 2YI6A 5BR8E 3T1KA 2YE9A 4DR7E 1UYEA 3R4MA 4E01A 1Y4UA 1I5DA 3A0ZA 2V2ZA 4XE2A 5L3JA 1N33I 2BU2A 2HHHE 1I58A 2VCIA 1XHKA 4O0BA 1UYGA 3G75A 1B63A 2IORA 4NH9A 2QG2A 4LFCI 3PYDA 3B27A 3JZ3A 5A2QQ 3K97A 4B3MI 3Q5KA 4LFAE 1FJGE 4AWOA 4DXLA 2CZ9A 3CGZA 2YKCA 3T2SA 1S14A 3WHAA 3ZZ0A 4X65I 1IBLI 4LFBI 2O1WA 5D6PA 1UYLA 4DUYE 4YKRA 4FCRA 1BKNA 1HNZI 2XEXA 3WU6A 2YEAA 2R3VA 3T1HE 1XNQI 2HK2A 1HNXI 1HNWI 2FXSA 4YKUA 2XJJA 2HK3A 3EHGA 3GIEA 5A2QC 3OTOE 2YE3A 3VADA 5IDMA 1KIJA 4YKZA 4DR5I 3BM9A 2XK2A 4KSGA 2Q8IA 4B6CA 5D7RA 3RLQA 3OPDA 4HY1A 1UYKA 3Q1QA 2YI7A 4XKAA 4QPJA 2XX4A 4L94A 4NXME 1OSFA 4W7TA 3PYFA 5GMEA 2HKEA 1UYHA 2XDUA 2IOPA 4NH8A 1IBKI 4GEEA 3HYZA 5F5RA 3TZ5A 5D7DA 1YSRA 3LNUA 4MYUA 5IWAE 1TIDA 4LWEA 3KE6A 1ZXMA 4R1FA 3EKOA 4JQLA 2GFDA 4XCJA 4DV2E 4HZ0A 2YI0A 4BQJA 4DV5E 3HYYA 4JI3E 4DR6E 1HR0E 4PRXA 5LMNI 1EI1A 3EHJA 2CG9A 4JI2E 2WI4A 2WERA 1S4EA 1U2OA 2X7IA 4MPEA 4BIUA 1N0VC 1B62A 4YKYA 4LF9E 2F4VE 2HHHI 2HG1A 4MPCA 4URMA 5CPHA 4AWQA 3U2KA 3WU4A 3CRLA 1ZW9A 4H85A 5GMDA 3G7BA 5M4PA 1N32E 3QDDA 3D2RA 1QYEA 1FJGI 3ZKDA 4L90A 2BU5A 4I3HA 2UU9E 1AJ6A 2BRCA 2XDSA 3QT7A 2YJWA 2CH4A 3ZXQA 4FN5A 1IBMI 3F0NA 1ELOA 2NPFA 4MOTA 2BYIA 4Z7CA 5FWKA 4B3RI 2V2QA 5F3KA 1MG7A 2BV3A 2EFGA 3A0YA 3T1HI 4JI0I 2YE2A 4DPYA 2V34A 1UYFA 2J7KA 4U93A 1GJVA 2YKEA 4FMTA 2X36A 3OTOI 1A4HA 4MP2A 1AMWA 5CTXA 4U7OA 4CWOA 3GONA 4AQYE 3K60A 3K98A 2BZ5A 3G7EA 2XD6A 4XC0A 4V25A 4GKKE 1UYIA 4B3SI 4ASGA 3GIGB 3R4OA 2ESAA 2XDXA 2YGFA 4ASAA 3FT8A 1Z0EA 4U7NA 4NXNE 3PEHA 1KTVA 4DV0E 1N36I 2YEGA 4XKKA 4FCQA 4EGKA 2UXBI 2DEJA 2VQFI 2JKIA 3J80Q 5FLXQ 2UUCE 1PIEA 5IWAI 2IWSA 2YK2A 3LTOA 2XJXA 4JI1I 1N34I 4YKXA 1YERA 1ZXNA 2BM0A 4PRVA 4DV2I 3B26A 2ZDXA 4EGHA 1NHJA 4XCLA 4DV3E 3T1YE 4JI3I 4X62E 4HACB 2LJPA 3C11A 4HY6A 3ZZUA 1FKAE 4YY3E 4JI2I 3J7AG 4CE1A 4XIRA 2YEDA 2WI3A 4LF6E 1EA6A 3J80C 1VISA 5FLXC 3B25A 1ZM9A 1ID0A 4XTJA 4LF9I 2F4VI 4KHPI 1MU5A 2HFSA 3ZKBA 3O6OA 2IOQA 1ZM4A 1UY7A 3FV5A 4L91A 4URLA 2GS8A 4JV5E 2CCUA 4LP0A 2UU9I 4HXWA 4UTGA 5LMUI 1NHIA 4BIZA 2ZM6I 3EKRA 4CWFA 4DPUA 1D6TA 1PVGA 3B78A 4P7AA 3QT8A 3OWBA 1AH8A 3VHDA 4DV6I 3TTZA 2WI1A 4DV4I 2E5LE 2V2VA 4GQTA 2XHTA 2WI2A 4JI5I 1YETA 4YHHE 4DU8A 5CF0A 4UT4A 3QTFA 4JI6E 1AH6A 1TC6A 2VQEE 2E1RA 1BYQA 2XABA 3HZ1A 3VHCA 4E00A 3RKZA 2HFUA 1UY8A 2XDLA 2YE6A 4DPXA 3CGYA 1TILA 3J81Q 2K5BA 3WQ9A 2Q2EB 4EM7A 4WUDA 2H8MA 4CWNA 4H81A 3WU3A 2YJXA 4ASBA 2GQPA 4JI8E 2YEIA 4DR4E 2E0AA 5J6AA 4YKWA 2A2CA 4O07A 4NXNI 4K0KE 4XITA 1XNRI 2VCJA 4LF8E 2Q8FA 1H72C 1H74A 4DUZE 2UUAE 4JYAI 3DGEA 2UUCI 4ZVIA 1J5EE 3OMUA 4JI4I 1UEKA 2WI6A 4EGIA 3CWVA 4DR2I 3J81C 1I5BA 4CWRA 4QPKA 4BQGA 4DPWA 4DV3I 5BR8I 4X62I 4DR7I 2YEEA 2YEJA 4URNA 2H55A 1FWKA 3D0BA 4XKOA 4B3TE 2BREA 4PL9A 3A0RA
chains in the Genus database with same CATH superfamily
4XD8A 4FWDA 4OX9E 2CCSA 3O2FA 3TZ4A 4HYPA 4ZKIA 3K17A 4J3DA 2QG0A 4LPBA 1H7SA 2DEIA 2JEAA 2YECA 2BM1A 1XMOE 4LFAI 4KP4A 5DRQA 4JASA 1PKPA 4DR3E 2BR2A 4DR1E 2HHIA 2YKBA 4YKQA 1A6FA 1Z59A 4JV5I 2BU7A 5C0XB 4DUYI 4EEHA 2YEHA 2WNRA 3UHMA 3A0TA 3QT5A 1Z0BA 4MU1A 4LF4E 2BSMA 2UWDA 3VHAA 1UY6A 2YEBA 4XDMA 4BXIA 3CDJA 4CWQA 4LCFA 1GKXA 3BMYA 1KKHA 3ZM7A 2Q8HA 2BA0D 2EXLA 4MBCA 4AWPA 2E5LI 2C39A 1UYCA 5GGZA 2FTKA 3HHUA 3K99A 3B8HA 2R42A 2VQEI 1HNZE 4OO1B 4E72A 1KVKA 1Z0GA 4AM3A 4K4OA 1B3QA 1I5AA 4ASFA 4FW7A 4NH7A 3PYEA 5LL6R 3B4TA 4X64E 5C93A 4NXMI 1R6LA 3FT5A 2XCMA 3Q5JA 3MNRP 3B28A 3RLPA 3A0WA 2OI2A 4JI8I 3RLRA 2PO0A 5FNCA 5M4KA 4DR4I 5K36D 1BXDA 3SL2A 4DR5E 4K0KI 2UXDE 1FI4A 2YKIA 3HZ5A 2A2DA 3QT6A 3L7ZB 4DV7E 4LF8I 1U0ZA 1UYDA 4OKGA 3EHHA 4JAVA 2UUAI 2ZBKB 4PU9A 5CTYA 1R62A 3M6AA 4LF7E 2BTZA 1J5EI 4MB9A 1FNMA 4DV5I 4ED4A 4BAEA 4IS9A 4EMDA 4DR6I 1HR0I 3R4NA 2C2AA 1BGQA 2Z5CA 3R4PA 3ZXOA 4DV1E 3Q6NA 2AE8A 3V5RA 2NN6C 4L8ZA 1UYMA 1S16A 1UDQA 5DNXA 2FYPA 3V2UC 5D6QA 2CGFA 1H73A 1Z0WA 4OX9I 1XMQE 3K1JA 4Z7YA 1QZRA 2BA1D 1ZM3A 1L0OA 1YT0A 2YKJA 5D7CA 2C38A 5BOCA 5IDJA 3P06A 1N32I 4GGLA 4O05A 4R3MA 5LMNE 1FWLA 4WUBA 4DR3I 2UXCE 2YI5A 2NN6D 4BA1B 5CTUA 4CWSA 4QNKA 4LWIA 4XIPA 2ZITA 4KTNA 2PNRA 1Z5AA 1Z5BA 3INWA 3T10A 2YGEA 5M4MA 2FWZA 1UY9A 3T0ZA 4LF4I 5CTWA 3J7AM 2YEFA 1YS3A 1E3HA 3TUHA 2WEPA 3KRNA 3Q5LA 3WU5A 4L93A 3LPSA 5M4HA 5JEAD 1RR9A 5FNDA 3U67A 4KFGA 3NMQA 1Z0VA 1IBME 3GIFA 3GIGA 4AQYI 1I94E 2FWYA 2C37A 4MYTA 2JJCA 3HULA 1TBWA 1Y8NA 2VW5A 4B3RE 5K36E 4YKTA 4GKKI 1DARA 4CWTA 3INXA 2XHXA 2YE4A 4IFDF 4X64I 5DROA 4JI0E 3PRYA 3D36A 3CRKA 4O09A 4FPPA 3R91A 2WNRB 2IWUA 2Q8GA 4USMA 4DUHA 4DV0I 4H7QA 4AS9A 2WW4A 3PS2A 4U3BA 4MU0A 2JEBB 1JM6A 4HYMA 5IT9Q 4JAUA 4KQVA 2JE6B 2UXDI 4LWGA 2YE8A 3H4LA 1THNA 1UDSA 4HACA 5DRRA 4DV7I 1OYRA 1OJ4A 4LF5E 2PO2A 2WI7A 1UDOA 4LWHA 5DRPA 3B82A 4B3SE 4LF7I 3U2DA 2XX5A 1NHHA 4I5SA 2Z5EA 1ZWHA 4V26A 3T1YI 3OWDA 5C0XF 5IN9A 2UUBE 4FWGA 1N36E 2YK9A 1YC4A 4DV1I 1MX0A 4YY3I 5EL9A 1TC0A 3PEJA 4DU7A 2UXBE 4RPFA 2VQFE 2YE7A 4JI7E 4LF6I 5J71A 5M4NA 5IT9C 1RHYA 4MP7A 1U2RA 2XHRA 3D4JA 2CGEA 2QFOA 2NN6E 3HEKA 4B7PA 2CVEA 2PNZA 4JI1E 1XMQI 1N34E 4GFNA 1P42A 1YT1A 2GO4A 4X66E 4EFUA 4USKA 4FW9A 4IZKA 4GKJE 2CCTA 1ZM2A 2HKJA 1I59A 1US7A 1Z0CA 2XDKA 3R92A 2HCHA 1YESA 4OO1F 2UXCI 3OW6A 1YC3A 4FCPA 2PO1B 5K36B 2YGAA 1N33E 5M4EA 1N0UA 4MU3A 1Z0TA 5JEAE 4DZYA 4E02A 2GQ0A 3C0EA 2WP8B 4LFCE 4KSHA 4CWPA 4B3ME 4KHPE 1YT2A 4MPNA 3A0XA 1KZNA 5K36C 4X65E 4YHHI 1Z5CA 1IBLE 4LFBE 3IEDA 5LMUE 4JI6I 2ZM6E 4P8OA 5BODA 1I94I 2IWXA 4R3AA 4HZ5A 3JAMQ 1GKZA 3M85D 2VWCA 1AM1A 4M1KA 1XNQE 2BT0A 1HNXE 1HNWE 4JG4A 4DV6E 4FWHA 4WUCA 1Y8OA 4Q20A 4FW5A 1K47A 2ZKJA 4X9LA 4BA2A 4DV4E 4LWFA 4XIQA 2V8PA 1YC1A 2BREA 2WEQA 4JI5E 2QF6A 2XJGA 3DD6A 4EMVA 4UROA 2NN6B 4CE2A 1QY8A 3LMMA 1NZ0A 2VF3A 4DUZI 2O1VA 1Y60A 4IFDA 1I5CA 2BU8A 1RREA 3JAMC 4LF5I 4NBQA 5FNFA 1WUUA 4GT8A 2AJ4A 2BYHA 3B24A 4OZEA 2ZDYA 3TZ0A 1IBKE 1Y8PA 1YH8A 4EFTA 2UUBI 5JEAB 1XNRE 1TH8A 2XX2A 4B3TI 1H7UA 3ZZTA 1YSZA 2GO3A 2YE5A 3EHFA 4JI7I 4JYAE 3H80A 4GCZA 4JI4E 2O1UA 4P52A 2BU6A 3TZ2A 3PYGA 5C0XA 4CE3A 3T0HA 4DR2E 4DPTA 4HXZA 1Y4SA 4X66I 1XMOI 2AKPA 3O0IA 4DR1I 4GKJI 5JEAC 4O04A 2WI5A 2YI6A 5BR8E 3T1KA 2C1IA 2YE9A 4DR7E 1R6MA 1UYEA 3R4MA 4FW4A 4E01A 1Y4UA 3U1KA 1I5DA 1IXMA 3A0ZA 2V2ZA 4XE2A 5L3JA 1N33I 2BU2A 2HHHE 1I58A 2VCIA 1XHKA 4O0BA 4LCGA 1UYGA 3G75A 1B63A 2IORA 4NH9A 2QG2A 2BA0G 4LFCI 3PYDA 3B27A 3JZ3A 5A2QQ 3K97A 4B3MI 3Q5KA 3P76A 4LFAE 1FJGE 4DXLA 2CZ9A 3H1CA 4OO1A 4AWOA 3CDIA 1UDNA 3CGZA 4IZJA 2YKCA 3T2SA 1S14A 3WHAA 3ZZ0A 2O1WA 4X65I 1IBLI 4LFBI 2JEAB 1UYLA 4DUYE 4YKRA 5D6PA 4FCRA 3M85G 1BKNA 1HNZI 2BR2B 2XEXA 3WU6A 2YEAA 2R3VA 3T1HE 1XNQI 5EKWA 2HK2A 1HNXI 1HNWI 2FXSA 4YKUA 2XJJA 4N3OA 2HK3A 3EHGA 3L7ZA 5A2QC 3GIEA 3OTOE 2YE3A 3VADA 5IDMA 1KIJA 4YKZA 4DR5I 3BM9A 4QNJA 2XK2A 4KSGA 2Q8IA 4B6CA 4MDTA 5D7RA 3RLQA 3OPDA 4HY1A 2C39B 1F51A 3Q1QA 1UYKA 2YI7A 2C1GA 4QPJA 4XKAA 2XX4A 4L94A 4NXME 1OSFA 4W7TA 3PYFA 5GMEA 4ISAA 2HKEA 1UYHA 5K36F 2XDUA 2IOPA 4NH8A 2IERA 1IBKI 4GEEA 3HYZA 5F5RA 3M7ND 3NZKA 3TZ5A 5D7DA 1YSRA 3LNUA 4MYUA 5IWAE 1VI7A 1TIDA 4FW6A 2BA1G 1ZXMA 2Z5BA 3KE6A 4LWEA 4R1FA 3EKOA 3GMEA 2PO0B 4JQLA 2GFDA 4BA1A 4XCJA 5DNLA 4DV2E 4HZ0A 2YI0A 4BQJA 4DV5E 3HYYA 4JI3E 4DR6E 4U3DA 1HR0E 4PRXA 5LMNI 1EI1A 3EHJA 2CG9A 4JI2E 2WI4A 4IFDB 3HJCA 2WERA 1S4EA 1U2OA 2X7IA 4MPEA 4BIUA 1N0VC 1B62A 2Z5CB 4LCHA 4YKYA 4LF9E 2F4VE 2HHHI 2HG1A 4MPCA 4URMA 5CPHA 4AWQA 3U2KA 3K85A 3WU4A 3CRLA 1ZW9A 4H85A 5GMDA 3G7BA 5M4PA 1N32E 3QDDA 4IFDC 1QYEA 3D2RA 1FJGI 3ZKDA 4L90A 1Y5YA 2NN6F 2BU5A 4I3HA 2UU9E 1AJ6A 2BRCA 1OYPA 2XDSA 3QT7A 2YJWA 2CH4A 3ZXQA 4FN5A 1IBMI 5ELWA 3F0NA 2C38B 1ELOA 2NPFA 4MOTA 2BYIA 4Z7CA 5FWKA 4B3RI 2V2QA 5F3KA 1MG7A 2BV3A 2EFGA 2JEBA 3A0YA 3T1HI 4JI0I 2JE6A 2YE2A 4IFDD 4DPYA 2PNLA 5JEAF 2V34A 1UYFA 2J7KA 4U93A 1GJVA 2YKEA 4FMTA 2X36A 3OTOI 1A4HA 4MP2A 5C0XC 1AMWA 4U7OA 5CTXA 4CWOA 4LPFA 3GONA 4AQYE 3K60A 4LOMA 3K98A 2BZ5A 2JT2A 2IESA 3G7EA 2XD6A 2VESA 4XC0A 4V25A 4GKKE 4IZJB 1UYIA 4B3SI 4ASGA 4MQYA 3GIGB 3R4OA 2ESAA 2C37B 2XDXA 2YGFA 4ASAA 3FT8A 1Z0EA 4U7NA 4NXNE 3M7NG 3PEHA 1KTVA 4DV0E 5C0XD 1N36I 2YEGA 4XKKA 4FCQA 4EGKA 2UXBI 2DEJA 4FW3A 2VQFI 4OO1C 2JKIA 2O3ZA 3J80Q 5FLXQ 2UUCE 1PIEA 5IWAI 2IWSA 2YK2A 3LTOA 3U1YA 2XJXA 4JI1I 1N34I 4YKXA 1YERA 1ZXNA 2BM0A 2PO1A 5K36A 4PRVA 4DV2I 3B26A 2ZDXA 4EGHA 1NHJA 4XCLA 4DV3E 3GLLA 3T1YE 1XXEA 4X62E 4JI3I 4HACB 2LJPA 3C11A 2O1TA 2WP8A 2PO2B 4HY6A 2J65A 3ZZUA 4YY3E 1FKAE 4JI2I 3J7AG 4CE1A 4OO1D 5JENA 4XIRA 2YEDA 2WI3A 4GQUA 1USVA 4IZJD 4LF6E 1EA6A 3J80C 1VISA 5FLXC 3B25A 1ZM9A 1ID0A 4XTJA 4LF9I 3GCMA 2F4VI 4KHPI 1MU5A 2HFSA 3ZKBA 3O6OA 2IOQA 1ZM4A 1UY7A 3FV5A 4L91A 2Z5BB 4URLA 2GS8A 4JV5E 1OYSA 1USUA 2PNZB 2UU9I 2CCUA 4HXWA 4LP0A 4MU4A 4UTGA 5LMUI 1NHIA 4IFDE 2ZM6I 4BIZA 3EKRA 4CWFA 4IZKB 4DPUA 1D6TA 1PVGA 3B78A 3PS3A 3QT8A 4P7AA 3OWBA 1AH8A 3VHDA 2NN6A 4DV6I 3TTZA 2WI1A 1HK7A 3P3EA 4DV4I 2E5LE 1Y6ZA 2V2VA 4GQTA 4AIDA 2WI2A 4JI5I 1YETA 2XHTA 4YHHE 4DU8A 5CF0A 4UT4A 3QTFA 4JI6E 1AH6A 1TC6A 2VQEE 2E1RA 1BYQA 2XABA 3HZ1A 3VHCA 4E00A 3RKZA 2HFUA 1UY8A 2XDLA 2YE6A 4DPXA 5C0XE 3CGYA 1TILA 3J81Q 1E3PA 5JEAA 2K5BA 3WQ9A 2Q2EB 4EM7A 4WUDA 2H8MA 4CWNA 4H81A 3WU3A 2YJXA 4ASBA 2GQPA 4JI8E 2YEIA 4DR4E 3Q6MA 2E0AA 4YKWA 2A2CA 5J6AA 4O07A 4NXNI 4K0KE 4XITA 1XNRI 4AIMA 2VCJA 4LF8E 2Q8FA 1H72C 1H74A 1YHCA 4DUZE 2UUAE 4BA2B 4JYAI 2UUCI 3DGEA 4ZVIA 1J5EE 3S5TA 3OMUA 3P3GA 4JI4I 3P3CA 1UEKA 4OO1E 2WI6A 3CYGA 4EGIA 3CWVA 4DR2I 3J81C 2F1DA 3HKMA 1I5BA 4CWRA 4QPKA 3PS1A 4BQGA 4DPWA 4DV3I 5BR8I 4X62I 4DR7I 2YEEA 2YEJA 4URNA 2H55A 1FWKA 3D0BA 4XKOA 4B3TE 2PNMA 4PL9A 3A0RA
chains in the Genus database with same CATH topology
4XD8A 4FWDA 4OX9E 2CCSA 3O2FA 3TZ4A 4HYPA 4ZKIA 3K17A 2QG0A 4LPBA 1H7SA 2DEIA 2YECA 2BM1A 1XMOE 4LFAI 4KP4A 4JASA 1PKPA 4DR3E 4DR1E 2YKBA 4YKQA 1A6FA 1Z59A 4JV5I 2BU7A 4EEHA 4DUYI 2YEHA 3A0TA 3QT5A 1Z0BA 4LF4E 2BSMA 2UWDA 3VHAA 1UY6A 2YEBA 4XDMA 4BXIA 4CWQA 1GKXA 3BMYA 1KKHA 3ZM7A 2Q8HA 2EXLA 4MBCA 4AWPA 2E5LI 1UYCA 5GGZA 3HHUA 3K99A 3B8HA 2R42A 2VQEI 1HNZE 1KVKA 1Z0GA 4K4OA 1B3QA 1I5AA 4ASFA 4NH7A 3PYEA 5LL6R 4X64E 5C93A 4NXMI 3FT5A 2XCMA 3Q5JA 3MNRP 3B28A 3RLPA 3A0WA 2OI2A 4JI8I 3RLRA 5FNCA 5M4KA 4DR4I 1BXDA 3SL2A 4DR5E 4K0KI 2UXDE 1FI4A 2YKIA 3HZ5A 2A2DA 3QT6A 4DV7E 4LF8I 1U0ZA 1UYDA 3EHHA 4JAVA 2UUAI 2ZBKB 4PU9A 5CTYA 1R62A 3M6AA 4LF7E 2BTZA 1J5EI 4MB9A 1FNMA 4DV5I 4ED4A 4BAEA 4EMDA 4DR6I 1HR0I 3R4NA 2C2AA 1BGQA 2Z5CA 3R4PA 3ZXOA 4DV1E 3Q6NA 3V5RA 4L8ZA 1UYMA 1S16A 2FYPA 3V2UC 5D6QA 2CGFA 1H73A 1Z0WA 4OX9I 1XMQE 3K1JA 4Z7YA 1QZRA 1L0OA 1ZM3A 1YT0A 2YKJA 5D7CA 5BOCA 5IDJA 3P06A 1N32I 4GGLA 4O05A 4R3MA 5LMNE 1FWLA 4WUBA 4DR3I 2UXCE 2YI5A 5CTUA 4CWSA 4XIPA 4LWIA 2ZITA 4KTNA 2PNRA 1Z5AA 1Z5BA 3INWA 3T10A 2YGEA 5M4MA 2FWZA 1UY9A 3T0ZA 4LF4I 5CTWA 3J7AM 2YEFA 1YS3A 3TUHA 2WEPA 3Q5LA 3WU5A 4L93A 3LPSA 5M4HA 1RR9A 5FNDA 3U67A 4KFGA 3NMQA 1Z0VA 1IBME 3GIFA 3GIGA 4AQYI 1I94E 2FWYA 4MYTA 2JJCA 3HULA 1TBWA 1Y8NA 2VW5A 4B3RE 4YKTA 4GKKI 1DARA 4CWTA 3INXA 2XHXA 2YE4A 4X64I 4JI0E 3PRYA 3D36A 3CRKA 4O09A 4FPPA 3R91A 2IWUA 2Q8GA 4USMA 4DUHA 4DV0I 4H7QA 4AS9A 2WW4A 1JM6A 4HYMA 5IT9Q 4JAUA 4KQVA 2UXDI 4LWGA 2YE8A 3H4LA 1THNA 4HACA 4DV7I 4LF5E 1OJ4A 2WI7A 4LWHA 3B82A 4B3SE 4LF7I 3U2DA 2XX5A 1NHHA 4I5SA 2Z5EA 1ZWHA 4V26A 3T1YI 3OWDA 5IN9A 2UUBE 4FWGA 1N36E 2YK9A 1YC4A 4DV1I 1MX0A 4YY3I 1TC0A 5J71A 3PEJA 4DU7A 2UXBE 4RPFA 2VQFE 2YE7A 4JI7E 4LF6I 5M4NA 5IT9C 4MP7A 1U2RA 2XHRA 3D4JA 2CGEA 2QFOA 3HEKA 4B7PA 4JI1E 1XMQI 1N34E 4GFNA 1YT1A 4EFUA 4X66E 4USKA 4FW9A 4IZKA 4GKJE 2CCTA 1ZM2A 2HKJA 1I59A 1US7A 1Z0CA 2XDKA 3R92A 2HCHA 1YESA 2UXCI 3OW6A 1YC3A 4FCPA 2YGAA 1N33E 5M4EA 1N0UA 1Z0TA 4DZYA 4E02A 2GQ0A 3C0EA 4LFCE 4KSHA 4CWPA 4B3ME 4KHPE 1YT2A 4MPNA 3A0XA 1KZNA 4X65E 4YHHI 1Z5CA 1IBLE 4LFBE 3IEDA 5LMUE 4JI6I 2ZM6E 4P8OA 5BODA 1I94I 2IWXA 4R3AA 4HZ5A 3JAMQ 1GKZA 2VWCA 1AM1A 4M1KA 1XNQE 2BT0A 1HNXE 1HNWE 4JG4A 4DV6E 4FWHA 4WUCA 1Y8OA 4Q20A 1K47A 2ZKJA 4X9LA 4LWFA 4DV4E 4XIQA 2V8PA 1YC1A 2BREA 2WEQA 4JI5E 2QF6A 2XJGA 4EMVA 4UROA 4CE2A 1QY8A 1NZ0A 2VF3A 4DUZI 2O1VA 1I5CA 2BU8A 1RREA 3JAMC 4LF5I 5FNFA 1WUUA 4GT8A 2AJ4A 2BYHA 3B24A 2ZDYA 3TZ0A 1IBKE 1Y8PA 4EFTA 2UUBI 1XNRE 1TH8A 2XX2A 4B3TI 1H7UA 3ZZTA 1YSZA 2YE5A 3EHFA 4JI7I 4JYAE 3H80A 4GCZA 4JI4E 2O1UA 4P52A 2BU6A 3TZ2A 3PYGA 4CE3A 3T0HA 4DR2E 1XMOI 4HXZA 4DPTA 4X66I 1Y4SA 2AKPA 3O0IA 4DR1I 4GKJI 4O04A 2WI5A 2YI6A 5BR8E 3T1KA 2YE9A 4DR7E 1UYEA 3R4MA 4E01A 1Y4UA 1I5DA 3A0ZA 2V2ZA 4XE2A 5L3JA 1N33I 2BU2A 2HHHE 1I58A 2VCIA 1XHKA 4O0BA 1UYGA 3G75A 1B63A 2IORA 4NH9A 2QG2A 4LFCI 3PYDA 3B27A 3JZ3A 5A2QQ 3K97A 4B3MI 3Q5KA 4LFAE 1FJGE 4AWOA 4DXLA 2CZ9A 3CGZA 4IZJA 2YKCA 3T2SA 1S14A 3WHAA 3ZZ0A 2O1WA 4X65I 1IBLI 4LFBI 5D6PA 1UYLA 4DUYE 4YKRA 4FCRA 1BKNA 1HNZI 2XEXA 3WU6A 2YEAA 2R3VA 3T1HE 1XNQI 2HK2A 1HNXI 1HNWI 2FXSA 4YKUA 2XJJA 4N3OA 2HK3A 3EHGA 3GIEA 5A2QC 3OTOE 2YE3A 3VADA 5IDMA 1KIJA 4YKZA 4DR5I 3BM9A 2XK2A 4KSGA 2Q8IA 4B6CA 5D7RA 3RLQA 3OPDA 4HY1A 1UYKA 3Q1QA 2YI7A 4XKAA 4QPJA 2XX4A 4L94A 4NXME 1OSFA 4W7TA 3PYFA 5GMEA 2HKEA 1UYHA 2XDUA 2IOPA 4NH8A 1IBKI 4GEEA 3HYZA 5F5RA 3TZ5A 5D7DA 1YSRA 3LNUA 4MYUA 5IWAE 1TIDA 4LWEA 2Z5BA 1ZXMA 3KE6A 4R1FA 3EKOA 4JQLA 2GFDA 4XCJA 4DV2E 4HZ0A 2YI0A 4BQJA 4DV5E 3HYYA 4JI3E 4DR6E 1HR0E 4PRXA 5LMNI 1EI1A 3EHJA 2CG9A 4JI2E 2WI4A 3HJCA 2WERA 1S4EA 1U2OA 2X7IA 4MPEA 4BIUA 1N0VC 1B62A 2Z5CB 4YKYA 4LF9E 2F4VE 2HHHI 2HG1A 4MPCA 4URMA 5CPHA 4AWQA 3U2KA 3K85A 3WU4A 3CRLA 1ZW9A 4H85A 5GMDA 3G7BA 5M4PA 1N32E 3QDDA 3D2RA 1QYEA 1FJGI 3ZKDA 4L90A 2BU5A 4I3HA 2UU9E 1AJ6A 2BRCA 2XDSA 3QT7A 2YJWA 2CH4A 3ZXQA 4FN5A 1IBMI 3F0NA 1ELOA 2NPFA 4MOTA 2BYIA 4Z7CA 5FWKA 4B3RI 2V2QA 5F3KA 1MG7A 2BV3A 2EFGA 3A0YA 3T1HI 4JI0I 2YE2A 4DPYA 2PNLA 2V34A 1UYFA 2J7KA 4U93A 1GJVA 2YKEA 4FMTA 2X36A 3OTOI 1A4HA 4MP2A 1AMWA 5CTXA 4U7OA 4CWOA 3GONA 4AQYE 3K60A 3K98A 2BZ5A 3G7EA 2XD6A 4XC0A 4V25A 4GKKE 4IZJB 1UYIA 4B3SI 4ASGA 3GIGB 3R4OA 2ESAA 2XDXA 2YGFA 4ASAA 3FT8A 1Z0EA 4U7NA 4NXNE 3PEHA 1KTVA 4DV0E 1N36I 2YEGA 4XKKA 4FCQA 4EGKA 2UXBI 2DEJA 2VQFI 2JKIA 3J80Q 5FLXQ 2UUCE 1PIEA 5IWAI 2IWSA 2YK2A 3LTOA 2XJXA 4JI1I 1N34I 4YKXA 1YERA 1ZXNA 2BM0A 4PRVA 4DV2I 3B26A 2ZDXA 4EGHA 1NHJA 4XCLA 4DV3E 3T1YE 4JI3I 4X62E 4HACB 2LJPA 3C11A 2O1TA 4HY6A 3ZZUA 1FKAE 4YY3E 4JI2I 3J7AG 4CE1A 4XIRA 2YEDA 2WI3A 4IZJD 1USVA 4LF6E 1EA6A 3J80C 1VISA 5FLXC 3B25A 1ZM9A 1ID0A 4XTJA 4LF9I 2F4VI 4KHPI 1MU5A 2HFSA 3ZKBA 3O6OA 2IOQA 1ZM4A 1UY7A 3FV5A 4L91A 2Z5BB 4URLA 2GS8A 4JV5E 1USUA 2CCUA 4LP0A 2UU9I 4HXWA 4UTGA 5LMUI 1NHIA 4BIZA 2ZM6I 3EKRA 4CWFA 4IZKB 4DPUA 1D6TA 1PVGA 3B78A 4P7AA 3QT8A 3OWBA 1AH8A 3VHDA 4DV6I 3TTZA 2WI1A 1HK7A 4DV4I 2E5LE 1Y6ZA 2V2VA 4GQTA 2XHTA 2WI2A 4JI5I 1YETA 4YHHE 4DU8A 5CF0A 4UT4A 3QTFA 4JI6E 1AH6A 1TC6A 2VQEE 2E1RA 1BYQA 2XABA 3HZ1A 3VHCA 4E00A 3RKZA 2HFUA 1UY8A 2XDLA 2YE6A 4DPXA 3CGYA 1TILA 3J81Q 2K5BA 3WQ9A 2Q2EB 4EM7A 4WUDA 2H8MA 4CWNA 4H81A 3WU3A 2YJXA 4ASBA 2GQPA 4JI8E 2YEIA 4DR4E 3Q6MA 2E0AA 4YKWA 2A2CA 5J6AA 4O07A 4NXNI 4K0KE 4XITA 1XNRI 2VCJA 4LF8E 2Q8FA 1H72C 1H74A 4DUZE 2UUAE 4JYAI 3DGEA 2UUCI 4ZVIA 1J5EE 3OMUA 4JI4I 1UEKA 2WI6A 4EGIA 3CWVA 4DR2I 3J81C 1I5BA 4CWRA 4QPKA 4BQGA 4DPWA 4DV3I 5BR8I 4X62I 4DR7I 2YEEA 2YEJA 4URNA 2H55A 1FWKA 3D0BA 4XKOA 4B3TE 2PNMA 4PL9A 3A0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XD8 A;  4FWD A;  4OX9 E;  2CCS A;  3O2F A;  3TZ4 A;  4HYP A;  4ZKI A;  3K17 A;  2QG0 A;  4LPB A;  1H7S A;  2DEI A;  2YEC A;  2BM1 A;  1XMO E;  4LFA I;  4KP4 A;  4JAS A;  1PKP A;  4DR3 E;  4DR1 E;  2YKB A;  4YKQ A;  1A6F A;  1Z59 A;  4JV5 I;  2BU7 A;  4EEH A;  4DUY I;  2YEH A;  3A0T A;  3QT5 A;  1Z0B A;  4LF4 E;  2BSM A;  2UWD A;  3VHA A;  1UY6 A;  2YEB A;  4XDM A;  4BXI A;  4CWQ A;  1GKX A;  3BMY A;  1KKH A;  3ZM7 A;  2Q8H A;  2EXL A;  4MBC A;  4AWP A;  2E5L I;  1UYC A;  5GGZ A;  3HHU A;  3K99 A;  3B8H A;  2R42 A;  2VQE I;  1HNZ E;  1KVK A;  1Z0G A;  4K4O A;  1B3Q A;  1I5A A;  4ASF A;  4NH7 A;  3PYE A;  5LL6 R;  4X64 E;  5C93 A;  4NXM I;  3FT5 A;  2XCM A;  3Q5J A;  3MNR P;  3B28 A;  3RLP A;  3A0W A;  2OI2 A;  4JI8 I;  3RLR A;  5FNC A;  5M4K A;  4DR4 I;  1BXD A;  3SL2 A;  4DR5 E;  4K0K I;  2UXD E;  1FI4 A;  2YKI A;  3HZ5 A;  2A2D A;  3QT6 A;  4DV7 E;  4LF8 I;  1U0Z A;  1UYD A;  3EHH A;  4JAV A;  2UUA I;  2ZBK B;  4PU9 A;  5CTY A;  1R62 A;  3M6A A;  4LF7 E;  2BTZ A;  1J5E I;  4MB9 A;  1FNM A;  4DV5 I;  4ED4 A;  4BAE A;  4EMD A;  4DR6 I;  1HR0 I;  3R4N A;  2C2A A;  1BGQ A;  3R4P A;  3ZXO A;  4DV1 E;  3V5R A;  4L8Z A;  1UYM A;  1S16 A;  2FYP A;  3V2U C;  5D6Q A;  2CGF A;  1H73 A;  1Z0W A;  4OX9 I;  1XMQ E;  3K1J A;  4Z7Y A;  1QZR A;  1L0O A;  1ZM3 A;  1YT0 A;  2YKJ A;  5D7C A;  5BOC A;  5IDJ A;  1N32 I;  4GGL A;  4O05 A;  4R3M A;  5LMN E;  1FWL A;  4WUB A;  4DR3 I;  2UXC E;  2YI5 A;  5CTU A;  4CWS A;  4XIP A;  4LWI A;  2ZIT A;  4KTN A;  2PNR A;  1Z5A A;  1Z5B A;  3INW A;  3T10 A;  2YGE A;  5M4M A;  2FWZ A;  1UY9 A;  3T0Z A;  4LF4 I;  5CTW A;  3J7A M;  2YEF A;  1YS3 A;  3TUH A;  2WEP A;  3Q5L A;  3WU5 A;  4L93 A;  3LPS A;  5M4H A;  1RR9 A;  5FND A;  3U67 A;  4KFG A;  3NMQ A;  1Z0V A;  1IBM E;  3GIF A;  3GIG A;  4AQY I;  1I94 E;  2FWY A;  4MYT A;  2JJC A;  3HUL A;  1TBW A;  1Y8N A;  2VW5 A;  4B3R E;  4YKT A;  4GKK I;  1DAR A;  4CWT A;  3INX A;  2XHX A;  2YE4 A;  4X64 I;  4JI0 E;  3D36 A;  3CRK A;  4O09 A;  4FPP A;  3R91 A;  2IWU A;  2Q8G A;  4USM A;  4DUH A;  4DV0 I;  4H7Q A;  4AS9 A;  2WW4 A;  1JM6 A;  4HYM A;  5IT9 Q;  4JAU A;  4KQV A;  2UXD I;  4LWG A;  2YE8 A;  3H4L A;  1THN A;  4HAC A;  4DV7 I;  4LF5 E;  1OJ4 A;  2WI7 A;  4LWH A;  3B82 A;  4B3S E;  4LF7 I;  3U2D A;  2XX5 A;  1NHH A;  4I5S A;  4V26 A;  1ZWH A;  3T1Y I;  3OWD A;  5IN9 A;  2UUB E;  4FWG A;  1N36 E;  2YK9 A;  1YC4 A;  4DV1 I;  1MX0 A;  4YY3 I;  1TC0 A;  5J71 A;  3PEJ A;  4DU7 A;  2UXB E;  4RPF A;  2VQF E;  2YE7 A;  4JI7 E;  4LF6 I;  5M4N A;  5IT9 C;  4MP7 A;  1U2R A;  2XHR A;  3D4J A;  2QFO A;  3HEK A;  4B7P A;  4JI1 E;  1XMQ I;  1N34 E;  4GFN A;  1YT1 A;  4EFU A;  4X66 E;  4USK A;  4FW9 A;  4GKJ E;  2CCT A;  1ZM2 A;  2HKJ A;  1I59 A;  1US7 A;  1Z0C A;  2XDK A;  3R92 A;  2HCH A;  1YES A;  2UXC I;  3OW6 A;  1YC3 A;  4FCP A;  2YGA A;  1N33 E;  5M4E A;  1N0U A;  1Z0T A;  4DZY A;  4E02 A;  3C0E A;  4LFC E;  4KSH A;  4CWP A;  4B3M E;  4KHP E;  1YT2 A;  4MPN A;  3A0X A;  1KZN A;  4X65 E;  4YHH I;  1Z5C A;  1IBL E;  4LFB E;  3IED A;  5LMU E;  4JI6 I;  2ZM6 E;  4P8O A;  5BOD A;  1I94 I;  2IWX A;  4R3A A;  4HZ5 A;  3JAM Q;  1GKZ A;  2VWC A;  1AM1 A;  4M1K A;  1XNQ E;  2BT0 A;  1HNX E;  1HNW E;  4JG4 A;  4DV6 E;  4FWH A;  4WUC A;  1Y8O A;  4Q20 A;  1K47 A;  2ZKJ A;  4X9L A;  4LWF A;  4DV4 E;  4XIQ A;  2V8P A;  1YC1 A;  2WEQ A;  4JI5 E;  2QF6 A;  2XJG A;  4EMV A;  4URO A;  4CE2 A;  1QY8 A;  1NZ0 A;  2VF3 A;  4DUZ I;  2O1V A;  1I5C A;  2BU8 A;  1RRE A;  3JAM C;  4LF5 I;  5FNF A;  1WUU A;  4GT8 A;  2AJ4 A;  2BYH A;  3B24 A;  2ZDY A;  3TZ0 A;  1IBK E;  1Y8P A;  4EFT A;  2UUB I;  1XNR E;  1TH8 A;  2XX2 A;  4B3T I;  1H7U A;  3ZZT A;  1YSZ A;  2YE5 A;  3EHF A;  4JI7 I;  4JYA E;  3H80 A;  4GCZ A;  4JI4 E;  4P52 A;  2O1U A;  2BU6 A;  3TZ2 A;  3PYG A;  4CE3 A;  3T0H A;  4DR2 E;  1XMO I;  4DPT A;  4HXZ A;  4X66 I;  1Y4S A;  2AKP A;  3O0I A;  4DR1 I;  4GKJ I;  4O04 A;  2WI5 A;  2YI6 A;  5BR8 E;  3T1K A;  2YE9 A;  4DR7 E;  1UYE A;  3R4M A;  4E01 A;  1Y4U A;  1I5D A;  3A0Z A;  2V2Z A;  4XE2 A;  5L3J A;  1N33 I;  2BU2 A;  2HHH E;  1I58 A;  2VCI A;  1XHK A;  4O0B A;  1UYG A;  3G75 A;  1B63 A;  2IOR A;  4NH9 A;  2QG2 A;  4LFC I;  3PYD A;  3B27 A;  3JZ3 A;  5A2Q Q;  3K97 A;  4B3M I;  3Q5K A;  4LFA E;  1FJG E;  4AWO A;  4DXL A;  2CZ9 A;  3CGZ A;  2YKC A;  3T2S A;  1S14 A;  3WHA A;  3ZZ0 A;  4X65 I;  1IBL I;  4LFB I;  2O1W A;  5D6P A;  1UYL A;  4DUY E;  4YKR A;  4FCR A;  1BKN A;  1HNZ I;  2XEX A;  3WU6 A;  2YEA A;  2R3V A;  3T1H E;  1XNQ I;  2HK2 A;  1HNX I;  1HNW I;  2FXS A;  4YKU A;  2XJJ A;  2HK3 A;  3EHG A;  3GIE A;  5A2Q C;  3OTO E;  2YE3 A;  3VAD A;  5IDM A;  1KIJ A;  4YKZ A;  4DR5 I;  3BM9 A;  2XK2 A;  4KSG A;  2Q8I A;  4B6C A;  5D7R A;  3RLQ A;  3OPD A;  4HY1 A;  1UYK A;  3Q1Q A;  2YI7 A;  4XKA A;  4QPJ A;  2XX4 A;  4L94 A;  4NXM E;  1OSF A;  4W7T A;  3PYF A;  5GME A;  2HKE A;  1UYH A;  2XDU A;  2IOP A;  4NH8 A;  1IBK I;  4GEE A;  3HYZ A;  5F5R A;  3TZ5 A;  5D7D A;  1YSR A;  3LNU A;  4MYU A;  5IWA E;  1TID A;  4LWE A;  3KE6 A;  1ZXM A;  4R1F A;  3EKO A;  4JQL A;  2GFD A;  4XCJ A;  4DV2 E;  4HZ0 A;  2YI0 A;  4BQJ A;  4DV5 E;  3HYY A;  4JI3 E;  4DR6 E;  1HR0 E;  4PRX A;  5LMN I;  1EI1 A;  3EHJ A;  2CG9 A;  4JI2 E;  2WI4 A;  2WER A;  1S4E A;  1U2O A;  2X7I A;  4MPE A;  4BIU A;  1N0V C;  1B62 A;  4YKY A;  4LF9 E;  2F4V E;  2HHH I;  2HG1 A;  4MPC A;  4URM A;  5CPH A;  4AWQ A;  3U2K A;  3WU4 A;  3CRL A;  1ZW9 A;  4H85 A;  5GMD A;  3G7B A;  5M4P A;  1N32 E;  3QDD A;  3D2R A;  1QYE A;  1FJG I;  3ZKD A;  4L90 A;  2BU5 A;  4I3H A;  2UU9 E;  1AJ6 A;  2BRC A;  2XDS A;  3QT7 A;  2YJW A;  2CH4 A;  3ZXQ A;  4FN5 A;  1IBM I;  3F0N A;  1ELO A;  2NPF A;  4MOT A;  2BYI A;  4Z7C A;  5FWK A;  4B3R I;  2V2Q A;  5F3K A;  1MG7 A;  2BV3 A;  2EFG A;  3A0Y A;  3T1H I;  4JI0 I;  2YE2 A;  4DPY A;  2V34 A;  1UYF A;  2J7K A;  4U93 A;  1GJV A;  2YKE A;  4FMT A;  2X36 A;  3OTO I;  1A4H A;  4MP2 A;  1AMW A;  5CTX A;  4U7O A;  4CWO A;  3GON A;  4AQY E;  3K60 A;  3K98 A;  2BZ5 A;  3G7E A;  2XD6 A;  4XC0 A;  4V25 A;  4GKK E;  1UYI A;  4B3S I;  4ASG A;  3GIG B;  3R4O A;  2ESA A;  2XDX A;  2YGF A;  4ASA A;  3FT8 A;  1Z0E A;  4U7N A;  4NXN E;  3PEH A;  1KTV A;  4DV0 E;  1N36 I;  2YEG A;  4XKK A;  4FCQ A;  4EGK A;  2UXB I;  2DEJ A;  2VQF I;  2JKI A;  3J80 Q;  5FLX Q;  2UUC E;  1PIE A;  5IWA I;  2IWS A;  2YK2 A;  3LTO A;  2XJX A;  4JI1 I;  1N34 I;  4YKX A;  1YER A;  1ZXN A;  2BM0 A;  4PRV A;  4DV2 I;  3B26 A;  2ZDX A;  4EGH A;  1NHJ A;  4XCL A;  4DV3 E;  3T1Y E;  4JI3 I;  4X62 E;  4HAC B;  2LJP A;  3C11 A;  4HY6 A;  3ZZU A;  1FKA E;  4YY3 E;  4JI2 I;  3J7A G;  4CE1 A;  4XIR A;  2YED A;  2WI3 A;  4LF6 E;  1EA6 A;  3J80 C;  1VIS A;  5FLX C;  3B25 A;  1ZM9 A;  1ID0 A;  4XTJ A;  4LF9 I;  2F4V I;  4KHP I;  1MU5 A;  2HFS A;  3ZKB A;  3O6O A;  2IOQ A;  1ZM4 A;  1UY7 A;  3FV5 A;  4L91 A;  4URL A;  2GS8 A;  4JV5 E;  2CCU A;  4LP0 A;  2UU9 I;  4HXW A;  4UTG A;  5LMU I;  1NHI A;  4BIZ A;  2ZM6 I;  3EKR A;  4CWF A;  4DPU A;  1D6T A;  1PVG A;  3B78 A;  4P7A A;  3QT8 A;  3OWB A;  1AH8 A;  3VHD A;  4DV6 I;  3TTZ A;  2WI1 A;  4DV4 I;  2E5L E;  2V2V A;  4GQT A;  2XHT A;  2WI2 A;  4JI5 I;  1YET A;  4YHH E;  4DU8 A;  5CF0 A;  4UT4 A;  3QTF A;  4JI6 E;  1AH6 A;  1TC6 A;  2VQE E;  2E1R A;  1BYQ A;  2XAB A;  3HZ1 A;  3VHC A;  4E00 A;  3RKZ A;  2HFU A;  1UY8 A;  2XDL A;  2YE6 A;  4DPX A;  3CGY A;  1TIL A;  3J81 Q;  2K5B A;  3WQ9 A;  2Q2E B;  4EM7 A;  4WUD A;  2H8M A;  4CWN A;  4H81 A;  3WU3 A;  2YJX A;  4ASB A;  2GQP A;  4JI8 E;  2YEI A;  4DR4 E;  2E0A A;  5J6A A;  4YKW A;  2A2C A;  4O07 A;  4NXN I;  4K0K E;  4XIT A;  1XNR I;  2VCJ A;  4LF8 E;  2Q8F A;  1H72 C;  1H74 A;  4DUZ E;  2UUA E;  4JYA I;  3DGE A;  2UUC I;  4ZVI A;  1J5E E;  3OMU A;  4JI4 I;  1UEK A;  2WI6 A;  4EGI A;  3CWV A;  4DR2 I;  3J81 C;  1I5B A;  4CWR A;  4QPK A;  4BQG A;  4DPW A;  4DV3 I;  5BR8 I;  4X62 I;  4DR7 I;  2YEE A;  2YEJ A;  4URN A;  2H55 A;  1FWK A;  3D0B A;  4XKO A;  4B3T E;  2BRE A;  4PL9 A;  3A0R A; 
#chains in the Genus database with same CATH topology
 4XD8 A;  4FWD A;  4OX9 E;  2CCS A;  3O2F A;  3TZ4 A;  4HYP A;  4ZKI A;  3K17 A;  4J3D A;  2QG0 A;  4LPB A;  1H7S A;  2DEI A;  2JEA A;  2YEC A;  2BM1 A;  1XMO E;  4LFA I;  4KP4 A;  5DRQ A;  4JAS A;  1PKP A;  4DR3 E;  2BR2 A;  4DR1 E;  2HHI A;  2YKB A;  4YKQ A;  1A6F A;  1Z59 A;  4JV5 I;  2BU7 A;  5C0X B;  4DUY I;  4EEH A;  2YEH A;  2WNR A;  3UHM A;  3A0T A;  3QT5 A;  1Z0B A;  4MU1 A;  4LF4 E;  2BSM A;  2UWD A;  3VHA A;  1UY6 A;  2YEB A;  4XDM A;  4BXI A;  3CDJ A;  4CWQ A;  4LCF A;  1GKX A;  3BMY A;  1KKH A;  3ZM7 A;  2Q8H A;  2BA0 D;  2EXL A;  4MBC A;  4AWP A;  2E5L I;  2C39 A;  1UYC A;  5GGZ A;  2FTK A;  3HHU A;  3K99 A;  3B8H A;  2R42 A;  2VQE I;  1HNZ E;  4OO1 B;  4E72 A;  1KVK A;  1Z0G A;  4AM3 A;  4K4O A;  1B3Q A;  1I5A A;  4ASF A;  4FW7 A;  4NH7 A;  3PYE A;  5LL6 R;  3B4T A;  4X64 E;  5C93 A;  4NXM I;  1R6L A;  3FT5 A;  2XCM A;  3Q5J A;  3MNR P;  3B28 A;  3RLP A;  3A0W A;  2OI2 A;  4JI8 I;  3RLR A;  2PO0 A;  5FNC A;  5M4K A;  4DR4 I;  5K36 D;  1BXD A;  3SL2 A;  4DR5 E;  4K0K I;  2UXD E;  1FI4 A;  2YKI A;  3HZ5 A;  2A2D A;  3QT6 A;  3L7Z B;  4DV7 E;  4LF8 I;  1U0Z A;  1UYD A;  4OKG A;  3EHH A;  4JAV A;  2UUA I;  2ZBK B;  4PU9 A;  5CTY A;  1R62 A;  3M6A A;  4LF7 E;  2BTZ A;  1J5E I;  4MB9 A;  1FNM A;  4DV5 I;  4ED4 A;  4BAE A;  4IS9 A;  4EMD A;  4DR6 I;  1HR0 I;  3R4N A;  2C2A A;  1BGQ A;  2Z5C A;  3R4P A;  3ZXO A;  4DV1 E;  3Q6N A;  2AE8 A;  3V5R A;  2NN6 C;  4L8Z A;  1UYM A;  1S16 A;  1UDQ A;  5DNX A;  2FYP A;  3V2U C;  5D6Q A;  2CGF A;  1H73 A;  1Z0W A;  4OX9 I;  1XMQ E;  3K1J A;  4Z7Y A;  1QZR A;  2BA1 D;  1ZM3 A;  1L0O A;  1YT0 A;  2YKJ A;  5D7C A;  2C38 A;  5BOC A;  5IDJ A;  3P06 A;  1N32 I;  4GGL A;  4O05 A;  4R3M A;  5LMN E;  1FWL A;  4WUB A;  4DR3 I;  2UXC E;  2YI5 A;  2NN6 D;  4BA1 B;  5CTU A;  4CWS A;  4QNK A;  4LWI A;  4XIP A;  2ZIT A;  4KTN A;  2PNR A;  1Z5A A;  1Z5B A;  3INW A;  3T10 A;  2YGE A;  5M4M A;  2FWZ A;  1UY9 A;  3T0Z A;  4LF4 I;  5CTW A;  3J7A M;  2YEF A;  1YS3 A;  1E3H A;  3TUH A;  2WEP A;  3KRN A;  3Q5L A;  3WU5 A;  4L93 A;  3LPS A;  5M4H A;  5JEA D;  1RR9 A;  5FND A;  3U67 A;  4KFG A;  3NMQ A;  1Z0V A;  1IBM E;  3GIF A;  3GIG A;  4AQY I;  1I94 E;  2FWY A;  2C37 A;  4MYT A;  2JJC A;  3HUL A;  1TBW A;  1Y8N A;  2VW5 A;  4B3R E;  5K36 E;  4YKT A;  4GKK I;  1DAR A;  4CWT A;  3INX A;  2XHX A;  2YE4 A;  4IFD F;  4X64 I;  5DRO A;  4JI0 E;  3PRY A;  3D36 A;  3CRK A;  4O09 A;  4FPP A;  3R91 A;  2WNR B;  2IWU A;  2Q8G A;  4USM A;  4DUH A;  4DV0 I;  4H7Q A;  4AS9 A;  2WW4 A;  3PS2 A;  4U3B A;  4MU0 A;  2JEB B;  1JM6 A;  4HYM A;  5IT9 Q;  4JAU A;  4KQV A;  2JE6 B;  2UXD I;  4LWG A;  2YE8 A;  3H4L A;  1THN A;  1UDS A;  4HAC A;  5DRR A;  4DV7 I;  1OYR A;  1OJ4 A;  4LF5 E;  2PO2 A;  2WI7 A;  1UDO A;  4LWH A;  5DRP A;  3B82 A;  4B3S E;  4LF7 I;  3U2D A;  2XX5 A;  1NHH A;  4I5S A;  2Z5E A;  1ZWH A;  4V26 A;  3T1Y I;  3OWD A;  5C0X F;  5IN9 A;  2UUB E;  4FWG A;  1N36 E;  2YK9 A;  1YC4 A;  4DV1 I;  1MX0 A;  4YY3 I;  5EL9 A;  1TC0 A;  3PEJ A;  4DU7 A;  2UXB E;  4RPF A;  2VQF E;  2YE7 A;  4JI7 E;  4LF6 I;  5J71 A;  5M4N A;  5IT9 C;  1RHY A;  4MP7 A;  1U2R A;  2XHR A;  3D4J A;  2CGE A;  2QFO A;  2NN6 E;  3HEK A;  4B7P A;  2CVE A;  2PNZ A;  4JI1 E;  1XMQ I;  1N34 E;  4GFN A;  1P42 A;  1YT1 A;  2GO4 A;  4X66 E;  4EFU A;  4USK A;  4FW9 A;  4IZK A;  4GKJ E;  2CCT A;  1ZM2 A;  2HKJ A;  1I59 A;  1US7 A;  1Z0C A;  2XDK A;  3R92 A;  2HCH A;  1YES A;  4OO1 F;  2UXC I;  3OW6 A;  1YC3 A;  4FCP A;  2PO1 B;  5K36 B;  2YGA A;  1N33 E;  5M4E A;  1N0U A;  4MU3 A;  1Z0T A;  5JEA E;  4DZY A;  4E02 A;  2GQ0 A;  3C0E A;  2WP8 B;  4LFC E;  4KSH A;  4CWP A;  4B3M E;  4KHP E;  1YT2 A;  4MPN A;  3A0X A;  1KZN A;  5K36 C;  4X65 E;  4YHH I;  1Z5C A;  1IBL E;  4LFB E;  3IED A;  5LMU E;  4JI6 I;  2ZM6 E;  4P8O A;  5BOD A;  1I94 I;  2IWX A;  4R3A A;  4HZ5 A;  3JAM Q;  1GKZ A;  3M85 D;  2VWC A;  1AM1 A;  4M1K A;  1XNQ E;  2BT0 A;  1HNX E;  1HNW E;  4JG4 A;  4DV6 E;  4FWH A;  4WUC A;  1Y8O A;  4Q20 A;  4FW5 A;  1K47 A;  2ZKJ A;  4X9L A;  4BA2 A;  4DV4 E;  4LWF A;  4XIQ A;  2V8P A;  1YC1 A;  2BRE A;  2WEQ A;  4JI5 E;  2QF6 A;  2XJG A;  3DD6 A;  4EMV A;  4URO A;  2NN6 B;  4CE2 A;  1QY8 A;  3LMM A;  1NZ0 A;  2VF3 A;  4DUZ I;  2O1V A;  1Y60 A;  4IFD A;  1I5C A;  2BU8 A;  1RRE A;  3JAM C;  4LF5 I;  4NBQ A;  5FNF A;  1WUU A;  4GT8 A;  2AJ4 A;  2BYH A;  3B24 A;  4OZE A;  2ZDY A;  3TZ0 A;  1IBK E;  1Y8P A;  1YH8 A;  4EFT A;  2UUB I;  5JEA B;  1XNR E;  1TH8 A;  2XX2 A;  4B3T I;  1H7U A;  3ZZT A;  1YSZ A;  2GO3 A;  2YE5 A;  3EHF A;  4JI7 I;  4JYA E;  3H80 A;  4GCZ A;  4JI4 E;  2O1U A;  4P52 A;  2BU6 A;  3TZ2 A;  3PYG A;  5C0X A;  4CE3 A;  3T0H A;  4DR2 E;  4DPT A;  4HXZ A;  1Y4S A;  4X66 I;  1XMO I;  2AKP A;  3O0I A;  4DR1 I;  4GKJ I;  5JEA C;  4O04 A;  2WI5 A;  2YI6 A;  5BR8 E;  3T1K A;  2C1I A;  2YE9 A;  4DR7 E;  1R6M A;  1UYE A;  3R4M A;  4FW4 A;  4E01 A;  1Y4U A;  3U1K A;  1I5D A;  1IXM A;  3A0Z A;  2V2Z A;  4XE2 A;  5L3J A;  1N33 I;  2BU2 A;  2HHH E;  1I58 A;  2VCI A;  1XHK A;  4O0B A;  4LCG A;  1UYG A;  3G75 A;  1B63 A;  2IOR A;  4NH9 A;  2QG2 A;  2BA0 G;  4LFC I;  3PYD A;  3B27 A;  3JZ3 A;  5A2Q Q;  3K97 A;  4B3M I;  3Q5K A;  3P76 A;  4LFA E;  1FJG E;  4DXL A;  2CZ9 A;  3H1C A;  4OO1 A;  4AWO A;  3CDI A;  1UDN A;  3CGZ A;  4IZJ A;  2YKC A;  3T2S A;  1S14 A;  3WHA A;  3ZZ0 A;  2O1W A;  4X65 I;  1IBL I;  4LFB I;  2JEA B;  1UYL A;  4DUY E;  4YKR A;  5D6P A;  4FCR A;  3M85 G;  1BKN A;  1HNZ I;  2BR2 B;  2XEX A;  3WU6 A;  2YEA A;  2R3V A;  3T1H E;  1XNQ I;  5EKW A;  2HK2 A;  1HNX I;  1HNW I;  2FXS A;  4YKU A;  2XJJ A;  4N3O A;  2HK3 A;  3EHG A;  3L7Z A;  5A2Q C;  3GIE A;  3OTO E;  2YE3 A;  3VAD A;  5IDM A;  1KIJ A;  4YKZ A;  4DR5 I;  3BM9 A;  4QNJ A;  2XK2 A;  4KSG A;  2Q8I A;  4B6C A;  4MDT A;  5D7R A;  3RLQ A;  3OPD A;  4HY1 A;  2C39 B;  1F51 A;  3Q1Q A;  1UYK A;  2YI7 A;  2C1G A;  4QPJ A;  4XKA A;  2XX4 A;  4L94 A;  4NXM E;  1OSF A;  4W7T A;  3PYF A;  5GME A;  4ISA A;  2HKE A;  1UYH A;  5K36 F;  2XDU A;  2IOP A;  4NH8 A;  2IER A;  1IBK I;  4GEE A;  3HYZ A;  5F5R A;  3M7N D;  3NZK A;  3TZ5 A;  5D7D A;  1YSR A;  3LNU A;  4MYU A;  5IWA E;  1VI7 A;  1TID A;  4FW6 A;  2BA1 G;  1ZXM A;  2Z5B A;  3KE6 A;  4LWE A;  4R1F A;  3EKO A;  3GME A;  2PO0 B;  4JQL A;  2GFD A;  4BA1 A;  4XCJ A;  5DNL A;  4DV2 E;  4HZ0 A;  2YI0 A;  4BQJ A;  4DV5 E;  3HYY A;  4JI3 E;  4DR6 E;  4U3D A;  1HR0 E;  4PRX A;  5LMN I;  1EI1 A;  3EHJ A;  2CG9 A;  4JI2 E;  2WI4 A;  4IFD B;  3HJC A;  2WER A;  1S4E A;  1U2O A;  2X7I A;  4MPE A;  4BIU A;  1N0V C;  1B62 A;  2Z5C B;  4LCH A;  4YKY A;  4LF9 E;  2F4V E;  2HHH I;  2HG1 A;  4MPC A;  4URM A;  5CPH A;  4AWQ A;  3U2K A;  3K85 A;  3WU4 A;  3CRL A;  1ZW9 A;  4H85 A;  5GMD A;  3G7B A;  5M4P A;  1N32 E;  3QDD A;  4IFD C;  1QYE A;  3D2R A;  1FJG I;  3ZKD A;  4L90 A;  1Y5Y A;  2NN6 F;  2BU5 A;  4I3H A;  2UU9 E;  1AJ6 A;  2BRC A;  1OYP A;  2XDS A;  3QT7 A;  2YJW A;  2CH4 A;  3ZXQ A;  4FN5 A;  1IBM I;  5ELW A;  3F0N A;  2C38 B;  1ELO A;  2NPF A;  4MOT A;  2BYI A;  4Z7C A;  5FWK A;  4B3R I;  2V2Q A;  5F3K A;  1MG7 A;  2BV3 A;  2EFG A;  2JEB A;  3A0Y A;  3T1H I;  4JI0 I;  2JE6 A;  2YE2 A;  4IFD D;  4DPY A;  2PNL A;  5JEA F;  2V34 A;  1UYF A;  2J7K A;  4U93 A;  1GJV A;  2YKE A;  4FMT A;  2X36 A;  3OTO I;  1A4H A;  4MP2 A;  5C0X C;  1AMW A;  4U7O A;  5CTX A;  4CWO A;  4LPF A;  3GON A;  4AQY E;  3K60 A;  4LOM A;  3K98 A;  2BZ5 A;  2JT2 A;  2IES A;  3G7E A;  2XD6 A;  2VES A;  4XC0 A;  4V25 A;  4GKK E;  4IZJ B;  1UYI A;  4B3S I;  4ASG A;  4MQY A;  3GIG B;  3R4O A;  2ESA A;  2C37 B;  2XDX A;  2YGF A;  4ASA A;  3FT8 A;  1Z0E A;  4U7N A;  4NXN E;  3M7N G;  3PEH A;  1KTV A;  4DV0 E;  5C0X D;  1N36 I;  2YEG A;  4XKK A;  4FCQ A;  4EGK A;  2UXB I;  2DEJ A;  4FW3 A;  2VQF I;  4OO1 C;  2JKI A;  2O3Z A;  3J80 Q;  5FLX Q;  2UUC E;  1PIE A;  5IWA I;  2IWS A;  2YK2 A;  3LTO A;  3U1Y A;  2XJX A;  4JI1 I;  1N34 I;  4YKX A;  1YER A;  1ZXN A;  2BM0 A;  2PO1 A;  5K36 A;  4PRV A;  4DV2 I;  3B26 A;  2ZDX A;  4EGH A;  1NHJ A;  4XCL A;  4DV3 E;  3GLL A;  3T1Y E;  1XXE A;  4X62 E;  4JI3 I;  4HAC B;  2LJP A;  3C11 A;  2O1T A;  2WP8 A;  2PO2 B;  4HY6 A;  2J65 A;  3ZZU A;  4YY3 E;  1FKA E;  4JI2 I;  3J7A G;  4CE1 A;  4OO1 D;  5JEN A;  4XIR A;  2YED A;  2WI3 A;  4GQU A;  1USV A;  4IZJ D;  4LF6 E;  1EA6 A;  3J80 C;  1VIS A;  5FLX C;  3B25 A;  1ZM9 A;  1ID0 A;  4XTJ A;  4LF9 I;  3GCM A;  2F4V I;  4KHP I;  1MU5 A;  2HFS A;  3ZKB A;  3O6O A;  2IOQ A;  1ZM4 A;  1UY7 A;  3FV5 A;  4L91 A;  2Z5B B;  4URL A;  2GS8 A;  4JV5 E;  1OYS A;  1USU A;  2PNZ B;  2UU9 I;  2CCU A;  4HXW A;  4LP0 A;  4MU4 A;  4UTG A;  5LMU I;  1NHI A;  4IFD E;  2ZM6 I;  4BIZ A;  3EKR A;  4CWF A;  4IZK B;  4DPU A;  1D6T A;  1PVG A;  3B78 A;  3PS3 A;  3QT8 A;  4P7A A;  3OWB A;  1AH8 A;  3VHD A;  2NN6 A;  4DV6 I;  3TTZ A;  2WI1 A;  1HK7 A;  3P3E A;  4DV4 I;  2E5L E;  1Y6Z A;  2V2V A;  4GQT A;  4AID A;  2WI2 A;  4JI5 I;  1YET A;  2XHT A;  4YHH E;  4DU8 A;  5CF0 A;  4UT4 A;  3QTF A;  4JI6 E;  1AH6 A;  1TC6 A;  2VQE E;  2E1R A;  1BYQ A;  2XAB A;  3HZ1 A;  3VHC A;  4E00 A;  3RKZ A;  2HFU A;  1UY8 A;  2XDL A;  2YE6 A;  4DPX A;  5C0X E;  3CGY A;  1TIL A;  3J81 Q;  1E3P A;  5JEA A;  2K5B A;  3WQ9 A;  2Q2E B;  4EM7 A;  4WUD A;  2H8M A;  4CWN A;  4H81 A;  3WU3 A;  2YJX A;  4ASB A;  2GQP A;  4JI8 E;  2YEI A;  4DR4 E;  3Q6M A;  2E0A A;  4YKW A;  2A2C A;  5J6A A;  4O07 A;  4NXN I;  4K0K E;  4XIT A;  1XNR I;  4AIM A;  2VCJ A;  4LF8 E;  2Q8F A;  1H72 C;  1H74 A;  1YHC A;  4DUZ E;  2UUA E;  4BA2 B;  4JYA I;  2UUC I;  3DGE A;  4ZVI A;  1J5E E;  3S5T A;  3OMU A;  3P3G A;  4JI4 I;  3P3C A;  1UEK A;  4OO1 E;  2WI6 A;  3CYG A;  4EGI A;  3CWV A;  4DR2 I;  3J81 C;  2F1D A;  3HKM A;  1I5B A;  4CWR A;  4QPK A;  3PS1 A;  4BQG A;  4DPW A;  4DV3 I;  5BR8 I;  4X62 I;  4DR7 I;  2YEE A;  2YEJ A;  4URN A;  2H55 A;  1FWK A;  3D0B A;  4XKO A;  4B3T E;  2PNM A;  4PL9 A;  3A0R A; 
#chains in the Genus database with same CATH homology
 4XD8 A;  4FWD A;  4OX9 E;  2CCS A;  3O2F A;  3TZ4 A;  4HYP A;  4ZKI A;  3K17 A;  2QG0 A;  4LPB A;  1H7S A;  2DEI A;  2YEC A;  2BM1 A;  1XMO E;  4LFA I;  4KP4 A;  4JAS A;  1PKP A;  4DR3 E;  4DR1 E;  2YKB A;  4YKQ A;  1A6F A;  1Z59 A;  4JV5 I;  2BU7 A;  4EEH A;  4DUY I;  2YEH A;  3A0T A;  3QT5 A;  1Z0B A;  4LF4 E;  2BSM A;  2UWD A;  3VHA A;  1UY6 A;  2YEB A;  4XDM A;  4BXI A;  4CWQ A;  1GKX A;  3BMY A;  1KKH A;  3ZM7 A;  2Q8H A;  2EXL A;  4MBC A;  4AWP A;  2E5L I;  1UYC A;  5GGZ A;  3HHU A;  3K99 A;  3B8H A;  2R42 A;  2VQE I;  1HNZ E;  1KVK A;  1Z0G A;  4K4O A;  1B3Q A;  1I5A A;  4ASF A;  4NH7 A;  3PYE A;  5LL6 R;  4X64 E;  5C93 A;  4NXM I;  3FT5 A;  2XCM A;  3Q5J A;  3MNR P;  3B28 A;  3RLP A;  3A0W A;  2OI2 A;  4JI8 I;  3RLR A;  5FNC A;  5M4K A;  4DR4 I;  1BXD A;  3SL2 A;  4DR5 E;  4K0K I;  2UXD E;  1FI4 A;  2YKI A;  3HZ5 A;  2A2D A;  3QT6 A;  4DV7 E;  4LF8 I;  1U0Z A;  1UYD A;  3EHH A;  4JAV A;  2UUA I;  2ZBK B;  4PU9 A;  5CTY A;  1R62 A;  3M6A A;  4LF7 E;  2BTZ A;  1J5E I;  4MB9 A;  1FNM A;  4DV5 I;  4ED4 A;  4BAE A;  4EMD A;  4DR6 I;  1HR0 I;  3R4N A;  2C2A A;  1BGQ A;  2Z5C A;  3R4P A;  3ZXO A;  4DV1 E;  3Q6N A;  3V5R A;  4L8Z A;  1UYM A;  1S16 A;  2FYP A;  3V2U C;  5D6Q A;  2CGF A;  1H73 A;  1Z0W A;  4OX9 I;  1XMQ E;  3K1J A;  4Z7Y A;  1QZR A;  1L0O A;  1ZM3 A;  1YT0 A;  2YKJ A;  5D7C A;  5BOC A;  5IDJ A;  3P06 A;  1N32 I;  4GGL A;  4O05 A;  4R3M A;  5LMN E;  1FWL A;  4WUB A;  4DR3 I;  2UXC E;  2YI5 A;  5CTU A;  4CWS A;  4XIP A;  4LWI A;  2ZIT A;  4KTN A;  2PNR A;  1Z5A A;  1Z5B A;  3INW A;  3T10 A;  2YGE A;  5M4M A;  2FWZ A;  1UY9 A;  3T0Z A;  4LF4 I;  5CTW A;  3J7A M;  2YEF A;  1YS3 A;  3TUH A;  2WEP A;  3Q5L A;  3WU5 A;  4L93 A;  3LPS A;  5M4H A;  1RR9 A;  5FND A;  3U67 A;  4KFG A;  3NMQ A;  1Z0V A;  1IBM E;  3GIF A;  3GIG A;  4AQY I;  1I94 E;  2FWY A;  4MYT A;  2JJC A;  3HUL A;  1TBW A;  1Y8N A;  2VW5 A;  4B3R E;  4YKT A;  4GKK I;  1DAR A;  4CWT A;  3INX A;  2XHX A;  2YE4 A;  4X64 I;  4JI0 E;  3PRY A;  3D36 A;  3CRK A;  4O09 A;  4FPP A;  3R91 A;  2IWU A;  2Q8G A;  4USM A;  4DUH A;  4DV0 I;  4H7Q A;  4AS9 A;  2WW4 A;  1JM6 A;  4HYM A;  5IT9 Q;  4JAU A;  4KQV A;  2UXD I;  4LWG A;  2YE8 A;  3H4L A;  1THN A;  4HAC A;  4DV7 I;  4LF5 E;  1OJ4 A;  2WI7 A;  4LWH A;  3B82 A;  4B3S E;  4LF7 I;  3U2D A;  2XX5 A;  1NHH A;  4I5S A;  2Z5E A;  1ZWH A;  4V26 A;  3T1Y I;  3OWD A;  5IN9 A;  2UUB E;  4FWG A;  1N36 E;  2YK9 A;  1YC4 A;  4DV1 I;  1MX0 A;  4YY3 I;  1TC0 A;  5J71 A;  3PEJ A;  4DU7 A;  2UXB E;  4RPF A;  2VQF E;  2YE7 A;  4JI7 E;  4LF6 I;  5M4N A;  5IT9 C;  4MP7 A;  1U2R A;  2XHR A;  3D4J A;  2CGE A;  2QFO A;  3HEK A;  4B7P A;  4JI1 E;  1XMQ I;  1N34 E;  4GFN A;  1YT1 A;  4EFU A;  4X66 E;  4USK A;  4FW9 A;  4IZK A;  4GKJ E;  2CCT A;  1ZM2 A;  2HKJ A;  1I59 A;  1US7 A;  1Z0C A;  2XDK A;  3R92 A;  2HCH A;  1YES A;  2UXC I;  3OW6 A;  1YC3 A;  4FCP A;  2YGA A;  1N33 E;  5M4E A;  1N0U A;  1Z0T A;  4DZY A;  4E02 A;  2GQ0 A;  3C0E A;  4LFC E;  4KSH A;  4CWP A;  4B3M E;  4KHP E;  1YT2 A;  4MPN A;  3A0X A;  1KZN A;  4X65 E;  4YHH I;  1Z5C A;  1IBL E;  4LFB E;  3IED A;  5LMU E;  4JI6 I;  2ZM6 E;  4P8O A;  5BOD A;  1I94 I;  2IWX A;  4R3A A;  4HZ5 A;  3JAM Q;  1GKZ A;  2VWC A;  1AM1 A;  4M1K A;  1XNQ E;  2BT0 A;  1HNX E;  1HNW E;  4JG4 A;  4DV6 E;  4FWH A;  4WUC A;  1Y8O A;  4Q20 A;  1K47 A;  2ZKJ A;  4X9L A;  4LWF A;  4DV4 E;  4XIQ A;  2V8P A;  1YC1 A;  2BRE A;  2WEQ A;  4JI5 E;  2QF6 A;  2XJG A;  4EMV A;  4URO A;  4CE2 A;  1QY8 A;  1NZ0 A;  2VF3 A;  4DUZ I;  2O1V A;  1I5C A;  2BU8 A;  1RRE A;  3JAM C;  4LF5 I;  5FNF A;  1WUU A;  4GT8 A;  2AJ4 A;  2BYH A;  3B24 A;  2ZDY A;  3TZ0 A;  1IBK E;  1Y8P A;  4EFT A;  2UUB I;  1XNR E;  1TH8 A;  2XX2 A;  4B3T I;  1H7U A;  3ZZT A;  1YSZ A;  2YE5 A;  3EHF A;  4JI7 I;  4JYA E;  3H80 A;  4GCZ A;  4JI4 E;  2O1U A;  4P52 A;  2BU6 A;  3TZ2 A;  3PYG A;  4CE3 A;  3T0H A;  4DR2 E;  1XMO I;  4HXZ A;  4DPT A;  4X66 I;  1Y4S A;  2AKP A;  3O0I A;  4DR1 I;  4GKJ I;  4O04 A;  2WI5 A;  2YI6 A;  5BR8 E;  3T1K A;  2YE9 A;  4DR7 E;  1UYE A;  3R4M A;  4E01 A;  1Y4U A;  1I5D A;  3A0Z A;  2V2Z A;  4XE2 A;  5L3J A;  1N33 I;  2BU2 A;  2HHH E;  1I58 A;  2VCI A;  1XHK A;  4O0B A;  1UYG A;  3G75 A;  1B63 A;  2IOR A;  4NH9 A;  2QG2 A;  4LFC I;  3PYD A;  3B27 A;  3JZ3 A;  5A2Q Q;  3K97 A;  4B3M I;  3Q5K A;  4LFA E;  1FJG E;  4AWO A;  4DXL A;  2CZ9 A;  3CGZ A;  4IZJ A;  2YKC A;  3T2S A;  1S14 A;  3WHA A;  3ZZ0 A;  2O1W A;  4X65 I;  1IBL I;  4LFB I;  5D6P A;  1UYL A;  4DUY E;  4YKR A;  4FCR A;  1BKN A;  1HNZ I;  2XEX A;  3WU6 A;  2YEA A;  2R3V A;  3T1H E;  1XNQ I;  2HK2 A;  1HNX I;  1HNW I;  2FXS A;  4YKU A;  2XJJ A;  4N3O A;  2HK3 A;  3EHG A;  3GIE A;  5A2Q C;  3OTO E;  2YE3 A;  3VAD A;  5IDM A;  1KIJ A;  4YKZ A;  4DR5 I;  3BM9 A;  2XK2 A;  4KSG A;  2Q8I A;  4B6C A;  5D7R A;  3RLQ A;  3OPD A;  4HY1 A;  1UYK A;  3Q1Q A;  2YI7 A;  4XKA A;  4QPJ A;  2XX4 A;  4L94 A;  4NXM E;  1OSF A;  4W7T A;  3PYF A;  5GME A;  2HKE A;  1UYH A;  2XDU A;  2IOP A;  4NH8 A;  1IBK I;  4GEE A;  3HYZ A;  5F5R A;  3TZ5 A;  5D7D A;  1YSR A;  3LNU A;  4MYU A;  5IWA E;  1TID A;  4LWE A;  2Z5B A;  1ZXM A;  3KE6 A;  4R1F A;  3EKO A;  4JQL A;  2GFD A;  4XCJ A;  4DV2 E;  4HZ0 A;  2YI0 A;  4BQJ A;  4DV5 E;  3HYY A;  4JI3 E;  4DR6 E;  1HR0 E;  4PRX A;  5LMN I;  1EI1 A;  3EHJ A;  2CG9 A;  4JI2 E;  2WI4 A;  3HJC A;  2WER A;  1S4E A;  1U2O A;  2X7I A;  4MPE A;  4BIU A;  1N0V C;  1B62 A;  2Z5C B;  4YKY A;  4LF9 E;  2F4V E;  2HHH I;  2HG1 A;  4MPC A;  4URM A;  5CPH A;  4AWQ A;  3U2K A;  3K85 A;  3WU4 A;  3CRL A;  1ZW9 A;  4H85 A;  5GMD A;  3G7B A;  5M4P A;  1N32 E;  3QDD A;  3D2R A;  1QYE A;  1FJG I;  3ZKD A;  4L90 A;  2BU5 A;  4I3H A;  2UU9 E;  1AJ6 A;  2BRC A;  2XDS A;  3QT7 A;  2YJW A;  2CH4 A;  3ZXQ A;  4FN5 A;  1IBM I;  3F0N A;  1ELO A;  2NPF A;  4MOT A;  2BYI A;  4Z7C A;  5FWK A;  4B3R I;  2V2Q A;  5F3K A;  1MG7 A;  2BV3 A;  2EFG A;  3A0Y A;  3T1H I;  4JI0 I;  2YE2 A;  4DPY A;  2PNL A;  2V34 A;  1UYF A;  2J7K A;  4U93 A;  1GJV A;  2YKE A;  4FMT A;  2X36 A;  3OTO I;  1A4H A;  4MP2 A;  1AMW A;  5CTX A;  4U7O A;  4CWO A;  3GON A;  4AQY E;  3K60 A;  3K98 A;  2BZ5 A;  3G7E A;  2XD6 A;  4XC0 A;  4V25 A;  4GKK E;  4IZJ B;  1UYI A;  4B3S I;  4ASG A;  3GIG B;  3R4O A;  2ESA A;  2XDX A;  2YGF A;  4ASA A;  3FT8 A;  1Z0E A;  4U7N A;  4NXN E;  3PEH A;  1KTV A;  4DV0 E;  1N36 I;  2YEG A;  4XKK A;  4FCQ A;  4EGK A;  2UXB I;  2DEJ A;  2VQF I;  2JKI A;  3J80 Q;  5FLX Q;  2UUC E;  1PIE A;  5IWA I;  2IWS A;  2YK2 A;  3LTO A;  2XJX A;  4JI1 I;  1N34 I;  4YKX A;  1YER A;  1ZXN A;  2BM0 A;  4PRV A;  4DV2 I;  3B26 A;  2ZDX A;  4EGH A;  1NHJ A;  4XCL A;  4DV3 E;  3T1Y E;  4JI3 I;  4X62 E;  4HAC B;  2LJP A;  3C11 A;  2O1T A;  4HY6 A;  3ZZU A;  1FKA E;  4YY3 E;  4JI2 I;  3J7A G;  4CE1 A;  4XIR A;  2YED A;  2WI3 A;  4IZJ D;  1USV A;  4LF6 E;  1EA6 A;  3J80 C;  1VIS A;  5FLX C;  3B25 A;  1ZM9 A;  1ID0 A;  4XTJ A;  4LF9 I;  2F4V I;  4KHP I;  1MU5 A;  2HFS A;  3ZKB A;  3O6O A;  2IOQ A;  1ZM4 A;  1UY7 A;  3FV5 A;  4L91 A;  2Z5B B;  4URL A;  2GS8 A;  4JV5 E;  1USU A;  2CCU A;  4LP0 A;  2UU9 I;  4HXW A;  4UTG A;  5LMU I;  1NHI A;  4BIZ A;  2ZM6 I;  3EKR A;  4CWF A;  4IZK B;  4DPU A;  1D6T A;  1PVG A;  3B78 A;  4P7A A;  3QT8 A;  3OWB A;  1AH8 A;  3VHD A;  4DV6 I;  3TTZ A;  2WI1 A;  1HK7 A;  4DV4 I;  2E5L E;  1Y6Z A;  2V2V A;  4GQT A;  2XHT A;  2WI2 A;  4JI5 I;  1YET A;  4YHH E;  4DU8 A;  5CF0 A;  4UT4 A;  3QTF A;  4JI6 E;  1AH6 A;  1TC6 A;  2VQE E;  2E1R A;  1BYQ A;  2XAB A;  3HZ1 A;  3VHC A;  4E00 A;  3RKZ A;  2HFU A;  1UY8 A;  2XDL A;  2YE6 A;  4DPX A;  3CGY A;  1TIL A;  3J81 Q;  2K5B A;  3WQ9 A;  2Q2E B;  4EM7 A;  4WUD A;  2H8M A;  4CWN A;  4H81 A;  3WU3 A;  2YJX A;  4ASB A;  2GQP A;  4JI8 E;  2YEI A;  4DR4 E;  3Q6M A;  2E0A A;  4YKW A;  2A2C A;  5J6A A;  4O07 A;  4NXN I;  4K0K E;  4XIT A;  1XNR I;  2VCJ A;  4LF8 E;  2Q8F A;  1H72 C;  1H74 A;  4DUZ E;  2UUA E;  4JYA I;  3DGE A;  2UUC I;  4ZVI A;  1J5E E;  3OMU A;  4JI4 I;  1UEK A;  2WI6 A;  4EGI A;  3CWV A;  4DR2 I;  3J81 C;  1I5B A;  4CWR A;  4QPK A;  4BQG A;  4DPW A;  4DV3 I;  5BR8 I;  4X62 I;  4DR7 I;  2YEE A;  2YEJ A;  4URN A;  2H55 A;  1FWK A;  3D0B A;  4XKO A;  4B3T E;  2PNM A;  4PL9 A;  3A0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...