1BKNA

Crystal structure of an n-terminal 40kd fragment of e. coli dna mismatch repair protein mutl
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
312
structure length
272
Chain Sequence
VERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCGIKKDELALALAIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAWQAYAVTVKPAAHPVGTTLEVLDTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVSRLVHDFIYQGVLSVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and ATPase activity of MutL: implications for DNA repair and mutagenesis.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Dna repair
molecule keywords MUTL
total genus 75
structure length 272
sequence length 312
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain
A PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1bknA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1bknA01
4KHPI 1OJ4A 4BIUA 4O04A 2GS8A 3D2RA 4XKOA 4X65I 5CTYA 4USKA 4LF6E 1UY6A 1ZWHA 2ZITA 3J7AM 4GCZA 4FWGA 4GKJI 1Y8PA 2XJJA 3PYEA 2XDUA 5D6QA 4HXWA 4XD8A 3U67A 3H80A 4LWFA 2V34A 2YEBA 3ZM7A 4CWPA 2YJXA 4DV4E 4MPEA 2UWDA 1S4EA 1IBKE 1GJVA 2QG0A 2HKEA 4DPXA 3K1JA 1US7A 5FNCA 4JI4I 4JV5E 3INWA 2YEFA 4LFCI 4X64E 4U93A 2BYIA 4JI0I 3QTFA 2Q8GA 2HG1A 4DV5E 1UY8A 4EGKA 2YEDA 1R62A 2BU7A 1ZXMA 4DR5I 1HNZE 4YKYA 2CH4A 1XMOE 1TH8A 3T1YE 2X7IA 2CG9A 4L91A 1HNZI 4V25A 4XDMA 4XITA 4YKUA 2BV3A 4USMA 4LF5I 1QY8A 2BTZA 2WI6A 2CCUA 2VCJA 1FWLA 4GKJE 3KE6A 2IOQA 2A2DA 4R3MA 2YKIA 3R4OA 1FI4A 2HHHI 3PEHA 4B3SE 4URLA 1YS3A 5A2QQ 3GIFA 3K60A 4K4OA 4DR6E 4UTGA 4L93A 4WUBA 4CE2A 3K98A 5A2QC 2F4VI 3JAMC 2YE6A 4EEHA 2VW5A 4DV6I 4ASGA 4R1FA 2VCIA 2WI5A 1XNRE 2GFDA 1TBWA 5LL6R 4X64I 1KKHA 2WI4A 3F0NA 2AKPA 4DR4E 2HKJA 2YKEA 2IOPA 4DUHA 1N34I 1UYGA 2BSMA 2UUBE 4X9LA 3RLQA 2VF3A 5GMEA 1IBKI 1XMQE 1HNXI 4Z7CA 4AQYI 4DR5E 1GKZA 4URNA 2UUAE 3FT8A 4P7AA 3CRLA 4EMVA 2IWXA 2VWCA 5CTXA 1J5EI 2IWSA 4LFCE 1N32E 1XHKA 1H73A 1ZXNA 4OX9I 4EM7A 3HULA 4DV1I 4H81A 4KP4A 3B82A 4JI2I 4YY3E 4NXME 4GKKI 2H55A 4NH7A 4CWRA 3V5RA 3ZKDA 1IBLE 2XABA 4JI5E 4DPTA 3TUHA 3V2UC 1FJGI 2BZ5A 3QDDA 3B78A 1B3QA 4I3HA 3LPSA 4CWOA 5BR8I 4P52A 1U2RA 2CCTA 4DPUA 1MX0A 3ZZ0A 5IWAE 4DV2I 3HYYA 1N0UA 1KVKA 4YHHI 4L94A 2IORA 2YGFA 3OWDA 4JI6I 4DV6E 4MP2A 4X66E 3JZ3A 2C2AA 3PYGA 3HEKA 4EFTA 4XIPA 4UROA 1N34E 4LF7I 4DR7E 2JJCA 2XDKA 2BU2A 4MOTA 2YEHA 4FPPA 1BYQA 4HY1A 4O0BA 4LFBE 2ZM6I 3TTZA 4BAEA 1YSRA 1RR9A 3JAMQ 2YE4A 2YKJA 4CE1A 1IBMI 1YERA 2YI7A 4XE2A 4BQJA 3PYFA 1I5BA 3WU6A 5BOCA 2OI2A 1Y8OA 4XKKA 2XDLA 1U2OA 3R91A 1OSFA 5LMNI 3H4LA 3NMQA 1AMWA 4MYTA 4CWSA 4DR1I 4BQGA 4LPBA 4JI1I 4HXZA 2BM0A 2YECA 1YESA 4X62I 2R3VA 5D7DA 4ZKIA 2YEJA 1YT0A 4DR3I 2YE3A 2Q8IA 1N33I 4GGLA 4LWIA 2XDXA 4LWHA 1B63A 2X36A 4DUZI 3B8HA 4O09A 3QT6A 2YGEA 4XCJA 1UYLA 2V2ZA 3T1HE 1HNWI 4JI6E 4FMTA 3J80Q 3BM9A 4CWNA 3MNRP 2Q8HA 1NZ0A 4DR4I 1GKXA 4DV3I 3DGEA 1KIJA 2YK2A 1UEKA 1ID0A 3A0YA 1Z59A 3G7EA 3IEDA 2FXSA 1UYFA 3RKZA 4R3AA 3ZZTA 3VADA 5IN9A 4B3RE 5M4HA 4X66I 1JM6A 3EHHA 1N0VC 2UUCI 4WUCA 2QF6A 1J5EE 1H7SA 4FN5A 3WU5A 5M4NA 1Z0CA 4HYMA 2YEGA 4LF9I 2E5LI 3RLRA 3Q1QA 2YI0A 2WI1A 5GMDA 4O05A 4JI1E 1FKAE 2WERA 4LF8I 3T1YI 5IT9Q 3J81C 2UXCE 1ZW9A 4YKXA 5FNDA 3T0ZA 4LWGA 1KTVA 3QT5A 3O0IA 4L90A 1HR0I 4CWTA 4Z7YA 1ZM3A 4HY6A 4HZ0A 1HR0E 4FWDA 4LF9E 3HYZA 2BU8A 2CZ9A 4JI3I 4AQYE 3INXA 4URMA 4KHPE 1Y4UA 4ED4A 3U2DA 5C93A 4U7NA 4XIRA 2XJGA 1I5AA 1RREA 2A2CA 4ASBA 3C0EA 2UU9E 5IT9C 4K0KE 3OTOE 4B3TE 1H72C 5CTWA 5CF0A 2FYPA 1UYIA 3K17A 1I58A 1UY9A 1A4HA 3WHAA 2ZBKB 1XNQE 5J71A 1YETA 3A0ZA 4JYAE 1I94E 4DV1E 1TILA 3B26A 3J80C 1XMOI 3SL2A 3CRKA 2NPFA 4DV7I 1KZNA 5D6PA 4JI8I 2XD6A 1Z0EA 1PIEA 4RPFA 4DPYA 1IBLI 1PVGA 4LFBI 2BT0A 3EKRA 4GEEA 1ELOA 4UT4A 4JI0E 2XX4A 3J81Q 3LTOA 1Z0TA 4YKTA 4JQLA 4GT8A 3G75A 2V8PA 4AWOA 2YE5A 1Z0BA 4DUZE 5CTUA 4MBCA 2VQEE 3WU4A 3GIEA 2HCHA 4DPWA 3Q5KA 3R4MA 4B3MI 5FNFA 2Q2EB 4K0KI 5F3KA 2YI6A 2QG2A 4B7PA 1YC4A 4LFAE 2YKBA 3D0BA 1MU5A 4DXLA 1UYKA 4GFNA 4P8OA 4HYPA 4DR6I 1YC1A 2VQFE 1FWKA 3R4NA 3ZZUA 1XMQI 1Z5AA 1S14A 4DU8A 1YT1A 3WU3A 4JAVA 2JKIA 2HK3A 1UYMA 4MP7A 3Q5LA 1UY7A 4JI3E 2UXDE 2E0AA 2YGAA 3PYDA 2ZM6E 3D36A 3OPDA 2HK2A 4E01A 1PKPA 2XX5A 5GGZA 2E1RA 1YT2A 3Q5JA 4AS9A 2UUCE 4LWEA 4XKAA 1UYDA 3PEJA 1NHJA 5M4MA 2ESAA 2Q8FA 3R92A 1MG7A 2FWZA 4PL9A 2UUBI 2WI2A 3O2FA 1B62A 3GIGB 4U7OA 1TC6A 1UYHA 3FV5A 4YHHE 3GIGA 5M4EA 4MYUA 2O1WA 4DV5I 1Z5CA 2VQEI 3J7AG 4CWFA 4DU7A 2XJXA 3OTOI 2ZKJA 4DZYA 2WI3A 2V2QA 1Z0WA 4JI7E 3B28A 4W7TA 2FWYA 4MPNA 4DUYI 3VHCA 5L3JA 1UYEA 3EKOA 1YSZA 4V26A 1S16A 2PNRA 1ZM9A 4PU9A 2CCSA 1I94I 4DV4I 3A0XA 4L8ZA 3EHJA 2DEIA 3RLPA 3CGZA 3OW6A 1THNA 5LMNE 3GONA 4JI5I 2K5BA 3HHUA 1EA6A 1N36E 4B3ME 3A0WA 4YY3I 4NXMI 3FT5A 2YI5A 4LF5E 4WUDA 1Y4SA 5IDMA 5IDJA 4LF6I 2XDSA 2CGFA 4DR3E 1BGQA 3B25A 3T1HI 1HNWE 1QZRA 1I5CA 4DR2E 2XCMA 2ZDYA 3T0HA 3TZ2A 4AWQA 2BM1A 3HZ5A 4O07A 1NHIA 4YKZA 4JYAI 4B3SI 3U2KA 3A0RA 5LMUI 4XC0A 3VHAA 1TC0A 3T10A 5LMUE 2UU9I 2LJPA 2BYHA 1AM1A 2XHTA 4B3TI 2J7KA 4JI4E 3TZ5A 1AH6A 4EGHA 4FWHA 4B6CA 2ZDXA 4YKQA 3CWVA 3EHGA 1ZM2A 4AWPA 4FW9A 1HNXE 5D7RA 4EFUA 5FWKA 1Z0GA 2VQFI 4KQVA 4PRXA 4DV0E 1VISA 2E5LE 1L0OA 4JAUA 4JG4A 2BREA 4E00A 3OMUA 5FLXC 2HFSA 1WUUA 4GKKE 3T2SA 2AJ4A 4CE3A 1XNRI 4MPCA 4HACB 1BKNA 4M1KA 4XCLA 2WEPA 2DEJA 2O1UA 2R42A 4HACA 2YE8A 4QPKA 5M4PA 3T1KA 4B3RI 4OX9E 3HZ1A 4HZ5A 1IBME 3TZ4A 4DR2I 2QFOA 1Y8NA 5F5RA 3D4JA 1D6TA 4LF4E 4KFGA 3A0TA 1N36I 2BU6A 3ZXOA 3ZXQA 4ASAA 4BXIA 4H7QA 4JV5I 3QT7A 4QPJA 2O1VA 4CWQA 4KSHA 5BODA 2HHHE 3K99A 3ZKBA 2YEAA 2YJWA 3M6AA 2BRCA 1FJGE 2BU5A 1BXDA 1FNMA 3G7BA 1K47A 3O6OA 5CPHA 3B24A 4DV3E 2WI7A 1I5DA 2XX2A 4JASA 4LF4I 1AJ6A 3C11A 2YK9A 1DARA 1YC3A 3K97A 4E02A 1EI1A 2YE7A 4JI8E 3BMYA 2XEXA 4X62E 3EHFA 4Q20A 2YE2A 4JI7I 2YE9A 4ZVIA 1NHHA 3VHDA 2XHXA 4GQTA 4FCRA 4PRVA 2YKCA 4MB9A 4LF7E 4DR7I 4XTJA 1TIDA 4NH8A 2UXDI 2HFUA 1UYCA 4X65E 1H74A 1QYEA 2UXCI 4DUYE 2WW4A 1N32I 4KTNA 3WQ9A 1A6FA 5J6AA 2YEIA 4BIZA 2EFGA 1XNQI 1Z5BA 3R4PA 5D7CA 2XK2A 4YKWA 1Z0VA 2H8MA 4FCQA 4KSGA 4XIQA 4JI2E 2UUAI 5BR8E 3QT8A 4ASFA 4LF8E 4NH9A 4DV7E 2XHRA 2GQPA 3B27A 2F4VE 4NXNI 2UXBE 3LNUA 3OWBA 4YKRA 2IWUA 2YEEA 4FCPA 1I59A 4NXNE 2UXBI 4H85A 4DR1E 4LFAI 4I5SA 1ZM4A 2WEQA 4LP0A 4EGIA 1N33E 2V2VA 3CGYA 1AH8A 1H7UA 5IWAI 5FLXQ 4DV0I 4DV2E 1U0ZA 2EXLA 4EMDA 5M4KA 3TZ0A
chains in the Genus database with same CATH superfamily
4KHPI 1OJ4A 4E72A 4BIUA 4O04A 2GS8A 3D2RA 4XKOA 4X65I 5CTYA 4USKA 4LF6E 1UY6A 1ZWHA 2ZITA 3J7AM 4GCZA 4FWGA 2C37B 2PNMA 4GKJI 1Y8PA 3PYEA 2XDUA 2XJJA 4IS9A 5D6QA 4HXWA 4XD8A 3U67A 3H80A 4LWFA 2V34A 2YEBA 2O3ZA 3ZM7A 4CWPA 2YJXA 4DV4E 4MPEA 2UWDA 1S4EA 1IBKE 1GJVA 2QG0A 2HKEA 4LPFA 4DPXA 3H1CA 3K1JA 1US7A 5FNCA 2IESA 4JI4I 4JV5E 3INWA 2YEFA 4LFCI 4X64E 4U93A 2BYIA 4JI0I 3QTFA 2Q8GA 2HG1A 4DV5E 2PNLA 1UY8A 4EGKA 2YEDA 2O1TA 1R62A 1YH8A 5C0XF 2BU7A 1ZXMA 1UDQA 4DR5I 4OO1D 1HNZE 4YKYA 2CH4A 1XMOE 1TH8A 2CG9A 2X7IA 3T1YE 4L91A 1HNZI 3P3CA 4V25A 4XDMA 4XITA 4YKUA 4GQUA 2BV3A 4USMA 4LF5I 1QY8A 2BA1D 2BTZA 2WI6A 2CCUA 2VCJA 2PNZA 1FWLA 1Y5YA 4GKJE 3KE6A 2IOQA 2A2DA 4R3MA 2YKIA 3R4OA 1FI4A 2HHHI 3B25A 4B3SE 4URLA 3PEHA 5JENA 1YS3A 5A2QQ 3GIFA 2CVEA 3K60A 4K4OA 3PS1A 4DR6E 4UTGA 4L93A 4WUBA 4CE2A 3K98A 5A2QC 2BA1G 4ISAA 2F4VI 3JAMC 2YE6A 4EEHA 2VW5A 4DV6I 4ASGA 4R1FA 4OO1C 2VCIA 1XNRE 2GFDA 2WI5A 2WP8A 5DRPA 1TBWA 5LL6R 4X64I 5K36B 1KKHA 3P76A 3F0NA 5K36E 4DR4E 2HKJA 2AKPA 2IOPA 2WI4A 2YKEA 5ELWA 1N34I 4DUHA 1UYGA 2BSMA 2UUBE 4X9LA 3RLQA 2VF3A 4MU4A 5GMEA 1XMQE 1IBKI 1HNXI 4Z7CA 4AQYI 4DR5E 1GKZA 4URNA 2UUAE 3FT8A 2JEBA 4P7AA 3CRLA 2GO3A 4BA1A 5JEAA 1OYSA 4EMVA 2IWXA 2VWCA 5CTXA 1J5EI 2IWSA 4LFCE 1N32E 1XHKA 1H73A 1ZXNA 4OX9I 4EM7A 3HULA 4DV1I 4H81A 4KP4A 3B82A 2PO1B 4JI2I 4YY3E 4NXME 4GKKI 2H55A 4NH7A 4CWRA 3V5RA 3ZKDA 1IBLE 4U3BA 4JI5E 4DPTA 1UDNA 3V2UC 2XABA 2NN6C 1FJGI 3TUHA 2BZ5A 4QNKA 4OO1E 3QDDA 3B78A 1B3QA 4I3HA 4J3DA 3LPSA 4CWOA 5BR8I 4P52A 2PNZB 1U2RA 2CCTA 4DPUA 1MX0A 3ZZ0A 5IWAE 4DV2I 3HYYA 1N0UA 1KVKA 4YHHI 4IFDB 4L94A 2IORA 2YGFA 2PO0A 4JI6I 3PS3A 3OWDA 2F1DA 4DV6E 4MP2A 4X66E 3JZ3A 2C2AA 1P42A 3PYGA 3HEKA 4EFTA 4XIPA 4UROA 2BR2A 1N34E 4LF7I 4DR7E 2JJCA 2XDKA 2BU2A 2BR2B 4MOTA 2YEHA 4FPPA 1BYQA 3PRYA 4HY1A 4O0BA 4LFBE 2ZM6I 3TTZA 4BAEA 1YSRA 1RR9A 3B4TA 3JAMQ 2YE4A 2YKJA 4CE1A 1IBMI 1YERA 2YI7A 4XE2A 4BQJA 3PYFA 1I5BA 4OKGA 3WU6A 5BOCA 5JEAB 4QNJA 3PS2A 2OI2A 2C39B 1Y8OA 4XKKA 2XDLA 1U2OA 5C0XD 3R91A 1OSFA 5LMNI 3H4LA 3NMQA 1AMWA 4MYTA 4CWSA 4DR1I 4BQGA 4LPBA 4JI1I 4HXZA 2BM0A 2YECA 1YESA 3M85D 4X62I 2R3VA 4FW6A 4MU0A 5D7DA 4AIDA 4ZKIA 2YEJA 1YT0A 5JEAD 4DR3I 2NN6F 2YE3A 2Q8IA 1USUA 1N33I 4LOMA 3P06A 2XDXA 4GGLA 2NN6A 4LWIA 4LWHA 1R6LA 1UDOA 1B63A 2X36A 4DUZI 3B8HA 1OYRA 5K36A 4O09A 3QT6A 2YGEA 4XCJA 3Q6MA 3GCMA 2V2ZA 3T1HE 3CDIA 4MU3A 4JI6E 3J80Q 1HNWI 1UYLA 4FMTA 3BM9A 4CWNA 3MNRP 2Q8HA 1NZ0A 5DROA 4DR4I 4DV3I 4IFDA 1GKXA 2JEBB 3DGEA 1KIJA 2YK2A 2C38A 1UEKA 1ID0A 3A0YA 1Z59A 3G7EA 3IEDA 2FXSA 1UYFA 3RKZA 4R3AA 3M7NG 3ZZTA 3CDJA 3VADA 4B3RE 5IN9A 5M4HA 4X66I 3Q6NA 1JM6A 3EHHA 1N0VC 2UUCI 4WUCA 3K85A 2QF6A 1J5EE 1H7SA 4FN5A 3WU5A 5M4NA 1Z0CA 4HYMA 2YEGA 4LF9I 2E5LI 3RLRA 3Q1QA 2FTKA 2YI0A 2JE6A 2WI1A 5GMDA 4O05A 4JI1E 1FKAE 4FW7A 4LF8I 3T1YI 5IT9Q 3J81C 2UXCE 1ZW9A 2WERA 4YKXA 5FNDA 1RHYA 2NN6D 3T0ZA 3LMMA 4LWGA 1KTVA 3QT5A 3O0IA 4L90A 1HR0I 4CWTA 4Z7YA 1ZM3A 4HY6A 4HZ0A 2Z5CB 1HR0E 4FWDA 4LF9E 3HYZA 2BU8A 2CZ9A 4IFDD 4JI3I 4AQYE 3INXA 4URMA 1Y4UA 3U1KA 4ED4A 4KHPE 3U2DA 5C93A 4U7NA 2PO0B 4XIRA 2XJGA 1I5AA 2JT2A 1RREA 2A2CA 4ASBA 3C0EA 2UU9E 2NN6B 5IT9C 4K0KE 3OTOE 4B3TE 1H72C 5CTWA 5CF0A 2FYPA 1UYIA 3K17A 1I58A 1UY9A 1A4HA 3UHMA 1OYPA 2ZBKB 3WHAA 3U1YA 1XNQE 5J71A 1YETA 3A0ZA 2WP8B 4JYAE 1Y60A 1I94E 4DV1E 1TILA 3B26A 1UDSA 3J80C 4LCHA 1XMOI 3SL2A 3CRKA 2NPFA 4DV7I 1KZNA 5D6PA 4JI8I 2XD6A 4IFDC 1Z0EA 1PIEA 4RPFA 4DPYA 1IBLI 1PVGA 4LFBI 1HK7A 2C38B 5C0XB 1YHCA 2BT0A 3EKRA 4GEEA 1ELOA 4UT4A 4BA1B 2C39A 5C0XA 4JI0E 3M7ND 3HJCA 2XX4A 3J81Q 3LTOA 1Z0TA 5C0XC 4YKTA 4JQLA 2PO2B 4GT8A 3G75A 2V8PA 4AWOA 2YE5A 2NN6E 1USVA 2PO2A 1Z0BA 4DUZE 5CTUA 4MBCA 2VQEE 2J65A 3WU4A 4IZJA 3GIEA 2HCHA 4DPWA 3Q5KA 3R4MA 4LCGA 4IFDF 3S5TA 4B3MI 5FNFA 2Q2EB 4K0KI 4IZJB 3L7ZA 2JE6B 5F3KA 2YI6A 2QG2A 4B7PA 1YC4A 5JEAC 4LFAE 2YKBA 4AIMA 1MU5A 4DXLA 1UYKA 3D0BA 4GFNA 4P8OA 4HYPA 4DR6I 1YC1A 2BA0G 1FWKA 4MU1A 2VQFE 3ZZUA 1XMQI 5DRRA 3GLLA 3GMEA 3R4NA 1Z5AA 1S14A 4DU8A 2C37A 3WU3A 1YT1A 2JKIA 2HK3A 1UYMA 4JAVA 3Q5LA 1UY7A 4MP7A 4JI3E 4BA2B 2UXDE 2Z5CA 2E0AA 2YGAA 3PYDA 2ZM6E 4BA2A 4OO1F 3D36A 3OPDA 2HK2A 4E01A 1PKPA 2XX5A 5GGZA 1VI7A 2E1RA 1YT2A 3Q5JA 4AS9A 2UUCE 4LWEA 4XKAA 1E3HA 1IXMA 1UYDA 3PEJA 1NHJA 5M4MA 2ESAA 2Q8FA 3R92A 1MG7A 3CYGA 2FWZA 4PL9A 2UUBI 2WI2A 2GQ0A 3O2FA 1B62A 3GIGB 3DD6A 4U7OA 1TC6A 3KRNA 1UYHA 3FV5A 4YHHE 3GIGA 5M4EA 4MYUA 2O1WA 4DV5I 1Z5CA 2VQEI 3J7AG 4CWFA 4DU7A 2XJXA 3OTOI 2ZKJA 4DZYA 5EL9A 2WI3A 5DNLA 5EKWA 2V2QA 1Z0WA 4JI7E 2Z5BA 3B28A 4W7TA 2FWYA 4MPNA 4DUYI 3VHCA 5L3JA 1UYEA 3EKOA 5JEAE 1YSZA 4V26A 1S16A 2PNRA 2VESA 1ZM9A 4PU9A 2CCSA 1I94I 4DV4I 3A0XA 4L8ZA 3EHJA 2DEIA 3RLPA 3CGZA 3M85G 3OW6A 1THNA 5LMNE 3GONA 4JI5I 2CGEA 2K5BA 1EA6A 1N36E 4B3ME 3A0WA 3HHUA 4YY3I 4NXMI 3FT5A 2YI5A 1Y4SA 4WUDA 3P3GA 4LF5E 5IDMA 4LF6I 5IDJA 2GO4A 5DNXA 5C0XE 2CGFA 4DR3E 1BGQA 2XDSA 3T1HI 1HNWE 1QZRA 1I5CA 4DR2E 2XCMA 2ZDYA 3T0HA 3TZ2A 4AWQA 2BM1A 5K36F 2HHIA 3HZ5A 4LCFA 4O07A 1NHIA 4YKZA 4FW4A 4JYAI 4B3SI 3U2KA 3A0RA 3L7ZB 5LMUI 4XC0A 3VHAA 1TC0A 3T10A 5LMUE 2UU9I 2LJPA 2BYHA 1AM1A 2XHTA 4B3TI 2J7KA 4JI4E 3TZ5A 1AH6A 4EGHA 4FWHA 4B6CA 2ZDXA 4YKQA 3CWVA 5DRQA 3EHGA 1ZM2A 2BA0D 4FW9A 4NBQA 1HNXE 5D7RA 5FWKA 1Z0GA 4AWPA 4EFUA 2VQFI 2WNRA 4KQVA 4PRXA 4DV0E 1VISA 1XXEA 5JEAF 2E5LE 1L0OA 2WNRB 4JAUA 4JG4A 2BREA 4FW3A 4E00A 3OMUA 5FLXC 2HFSA 1WUUA 4GKKE 3T2SA 2AJ4A 4CE3A 1XNRI 4MPCA 4HACB 1BKNA 4M1KA 4XCLA 4AM3A 2WEPA 2DEJA 2O1UA 2R42A 4HACA 2YE8A 4QPKA 5M4PA 3T1KA 4B3RI 4OX9E 3HZ1A 4HZ5A 2PO1A 4IFDE 1IBME 3TZ4A 4DR2I 2QFOA 1Y8NA 5F5RA 3D4JA 1D6TA 4LF4E 4KFGA 3A0TA 1N36I 2BU6A 3ZXOA 3ZXQA 2AE8A 4ASAA 4BXIA 4OZEA 4H7QA 4JV5I 3QT7A 4QPJA 2O1VA 2IERA 4OO1B 4FW5A 4CWQA 4KSHA 4MQYA 5K36C 5BODA 2HHHE 3K99A 3ZKBA 2YEAA 2YJWA 3M6AA 2BRCA 1FJGE 2BU5A 1BXDA 1FNMA 3G7BA 1K47A 2C1GA 3O6OA 5CPHA 3B24A 4DV3E 2WI7A 1I5DA 2XX2A 4JASA 4LF4I 4IZJD 1AJ6A 3C11A 2YK9A 1DARA 1YC3A 1Y6ZA 3K97A 4E02A 1EI1A 2YE7A 4JI8E 3BMYA 2XEXA 4X62E 3EHFA 4Q20A 2YE2A 4JI7I 2YE9A 4ZVIA 1NHHA 3VHDA 2XHXA 4GQTA 3HKMA 4MDTA 4FCRA 4PRVA 5K36D 2YKCA 4MB9A 4LF7E 4DR7I 4XTJA 1TIDA 4NH8A 1F51A 2UXDI 4IZKA 2HFUA 1UYCA 4X65E 1H74A 1QYEA 3P3EA 2UXCI 2Z5BB 4IZKB 4DUYE 2WW4A 1N32I 4KTNA 3WQ9A 1A6FA 5J6AA 2YEIA 4BIZA 2EFGA 1XNQI 1Z5BA 3R4PA 5D7CA 2XK2A 4YKWA 1Z0VA 2H8MA 4FCQA 4KSGA 4XIQA 4JI2E 2UUAI 5BR8E 2C1IA 3QT8A 4ASFA 4LF8E 4NH9A 4DV7E 2XHRA 2JEAB 2GQPA 3B27A 2F4VE 4NXNI 2UXBE 3LNUA 3OWBA 4YKRA 2IWUA 2YEEA 2JEAA 4FCPA 4U3DA 1I59A 4NXNE 2UXBI 4H85A 4DR1E 4LFAI 4I5SA 1ZM4A 1E3PA 2WEQA 2Z5EA 4LP0A 4EGIA 1N33E 2V2VA 3CGYA 1AH8A 1H7UA 4OO1A 5IWAI 5FLXQ 4DV0I 4DV2E 1U0ZA 2EXLA 4EMDA 3NZKA 5M4KA 1R6MA 3TZ0A 4N3OA
chains in the Genus database with same CATH topology
4KHPI 1OJ4A 4BIUA 4O04A 2GS8A 3D2RA 4XKOA 4X65I 5CTYA 4USKA 4LF6E 1UY6A 1ZWHA 2ZITA 3J7AM 4GCZA 4FWGA 2PNMA 4GKJI 1Y8PA 2XJJA 3PYEA 2XDUA 5D6QA 4HXWA 4XD8A 3U67A 3H80A 4LWFA 2V34A 2YEBA 3ZM7A 4CWPA 2YJXA 4DV4E 4MPEA 2UWDA 1S4EA 1IBKE 1GJVA 2QG0A 2HKEA 4DPXA 3K1JA 1US7A 5FNCA 4JI4I 4JV5E 3INWA 2YEFA 4LFCI 4X64E 4U93A 2BYIA 4JI0I 3QTFA 2Q8GA 2HG1A 4DV5E 2PNLA 1UY8A 4EGKA 2YEDA 2O1TA 1R62A 2BU7A 1ZXMA 4DR5I 1HNZE 4YKYA 2CH4A 1XMOE 1TH8A 2CG9A 2X7IA 3T1YE 4L91A 1HNZI 4V25A 4XDMA 4XITA 4YKUA 2BV3A 4USMA 4LF5I 1QY8A 2BTZA 2WI6A 2CCUA 2VCJA 1FWLA 4GKJE 3KE6A 2IOQA 2A2DA 4R3MA 2YKIA 3R4OA 1FI4A 2HHHI 3PEHA 4B3SE 4URLA 1YS3A 5A2QQ 3GIFA 3K60A 4K4OA 4DR6E 4UTGA 4L93A 4WUBA 4CE2A 3K98A 5A2QC 2F4VI 3JAMC 2YE6A 4EEHA 2VW5A 4DV6I 4ASGA 4R1FA 2VCIA 2WI5A 1XNRE 2GFDA 1TBWA 5LL6R 4X64I 1KKHA 2WI4A 3F0NA 2AKPA 4DR4E 2HKJA 2YKEA 2IOPA 4DUHA 1N34I 1UYGA 2BSMA 2UUBE 4X9LA 3RLQA 2VF3A 5GMEA 1IBKI 1XMQE 1HNXI 4Z7CA 4AQYI 4DR5E 1GKZA 4URNA 2UUAE 3FT8A 4P7AA 3CRLA 4EMVA 2IWXA 2VWCA 5CTXA 1J5EI 2IWSA 4LFCE 1N32E 1XHKA 1H73A 1ZXNA 4OX9I 4EM7A 3HULA 4DV1I 4H81A 4KP4A 3B82A 4JI2I 4YY3E 4NXME 4GKKI 2H55A 4NH7A 4CWRA 3V5RA 3ZKDA 1IBLE 2XABA 4JI5E 4DPTA 3TUHA 3V2UC 1FJGI 2BZ5A 3QDDA 3B78A 1B3QA 4I3HA 3LPSA 4CWOA 5BR8I 4P52A 1U2RA 2CCTA 4DPUA 1MX0A 3ZZ0A 5IWAE 4DV2I 3HYYA 1N0UA 1KVKA 4YHHI 4L94A 2IORA 2YGFA 3OWDA 4JI6I 4DV6E 4MP2A 4X66E 3JZ3A 2C2AA 3PYGA 3HEKA 4EFTA 4XIPA 4UROA 1N34E 4LF7I 4DR7E 2JJCA 2XDKA 2BU2A 4MOTA 2YEHA 4FPPA 1BYQA 3PRYA 4HY1A 4O0BA 4LFBE 2ZM6I 3TTZA 4BAEA 1YSRA 1RR9A 3JAMQ 2YE4A 2YKJA 4CE1A 1IBMI 1YERA 2YI7A 4XE2A 4BQJA 3PYFA 1I5BA 3WU6A 5BOCA 2OI2A 1Y8OA 4XKKA 2XDLA 1U2OA 3R91A 1OSFA 5LMNI 3H4LA 3NMQA 1AMWA 4MYTA 4CWSA 4DR1I 4BQGA 4LPBA 4JI1I 4HXZA 2BM0A 2YECA 1YESA 4X62I 2R3VA 5D7DA 4ZKIA 2YEJA 1YT0A 4DR3I 2YE3A 2Q8IA 1USUA 1N33I 4GGLA 3P06A 2XDXA 4LWIA 4LWHA 1B63A 2X36A 4DUZI 3B8HA 4O09A 3QT6A 2YGEA 4XCJA 3Q6MA 1UYLA 2V2ZA 3T1HE 1HNWI 4JI6E 4FMTA 3J80Q 3BM9A 4CWNA 3MNRP 2Q8HA 1NZ0A 4DR4I 1GKXA 4DV3I 3DGEA 1KIJA 2YK2A 1UEKA 1ID0A 3A0YA 1Z59A 3G7EA 3IEDA 2FXSA 1UYFA 3RKZA 4R3AA 3ZZTA 3VADA 5IN9A 4B3RE 5M4HA 4X66I 3Q6NA 1JM6A 3EHHA 1N0VC 2UUCI 4WUCA 3K85A 2QF6A 1J5EE 1H7SA 4FN5A 3WU5A 5M4NA 1Z0CA 4HYMA 2YEGA 4LF9I 2E5LI 3RLRA 3Q1QA 2YI0A 2WI1A 5GMDA 4O05A 4JI1E 1FKAE 2WERA 4LF8I 3T1YI 5IT9Q 3J81C 2UXCE 1ZW9A 4YKXA 5FNDA 3T0ZA 4LWGA 1KTVA 3QT5A 3O0IA 4L90A 1HR0I 4CWTA 4Z7YA 1ZM3A 4HY6A 4HZ0A 2Z5CB 1HR0E 4FWDA 4LF9E 3HYZA 2BU8A 2CZ9A 4JI3I 4AQYE 3INXA 4URMA 1Y4UA 4KHPE 4ED4A 3U2DA 5C93A 4U7NA 4XIRA 2XJGA 1I5AA 1RREA 2A2CA 4ASBA 3C0EA 2UU9E 5IT9C 4K0KE 3OTOE 4B3TE 1H72C 5CTWA 5CF0A 2FYPA 1UYIA 3K17A 1I58A 1UY9A 1A4HA 3WHAA 2ZBKB 1XNQE 5J71A 1YETA 3A0ZA 4JYAE 1I94E 4DV1E 1TILA 3B26A 3J80C 1XMOI 3SL2A 3CRKA 2NPFA 4DV7I 1KZNA 5D6PA 4JI8I 2XD6A 1Z0EA 1PIEA 4RPFA 4DPYA 1IBLI 1PVGA 4LFBI 1HK7A 2BT0A 3EKRA 4GEEA 1ELOA 4UT4A 4JI0E 3HJCA 2XX4A 3J81Q 3LTOA 1Z0TA 4YKTA 4JQLA 4GT8A 3G75A 2V8PA 4AWOA 2YE5A 1USVA 1Z0BA 4DUZE 5CTUA 4MBCA 2VQEE 3WU4A 4IZJA 3GIEA 2HCHA 4DPWA 3Q5KA 3R4MA 4B3MI 5FNFA 2Q2EB 4K0KI 4IZJB 5F3KA 2YI6A 2QG2A 4B7PA 1YC4A 4LFAE 2YKBA 3D0BA 1MU5A 4DXLA 1UYKA 4GFNA 4P8OA 4HYPA 4DR6I 1YC1A 2VQFE 1FWKA 3R4NA 3ZZUA 1XMQI 1Z5AA 1S14A 4DU8A 1YT1A 3WU3A 4JAVA 2JKIA 2HK3A 1UYMA 4MP7A 3Q5LA 1UY7A 4JI3E 2UXDE 2Z5CA 2E0AA 2YGAA 3PYDA 2ZM6E 3D36A 3OPDA 2HK2A 4E01A 1PKPA 2XX5A 5GGZA 2E1RA 1YT2A 3Q5JA 4AS9A 2UUCE 4LWEA 4XKAA 1UYDA 3PEJA 1NHJA 5M4MA 2ESAA 2Q8FA 3R92A 1MG7A 2FWZA 4PL9A 2UUBI 2WI2A 2GQ0A 3O2FA 1B62A 3GIGB 4U7OA 1TC6A 1UYHA 3FV5A 4YHHE 3GIGA 5M4EA 4MYUA 2O1WA 4DV5I 1Z5CA 2VQEI 3J7AG 4CWFA 4DU7A 2XJXA 3OTOI 2ZKJA 4DZYA 2WI3A 2V2QA 1Z0WA 4JI7E 2Z5BA 3B28A 4W7TA 2FWYA 4MPNA 4DUYI 3VHCA 5L3JA 1UYEA 3EKOA 1YSZA 4V26A 1S16A 2PNRA 1ZM9A 4PU9A 2CCSA 1I94I 4DV4I 3A0XA 4L8ZA 3EHJA 2DEIA 3RLPA 3CGZA 3OW6A 1THNA 5LMNE 3GONA 4JI5I 2CGEA 2K5BA 1EA6A 1N36E 4B3ME 3A0WA 3HHUA 4YY3I 4NXMI 3FT5A 2YI5A 1Y4SA 4WUDA 4LF5E 5IDMA 5IDJA 4LF6I 2XDSA 2CGFA 4DR3E 1BGQA 3B25A 3T1HI 1HNWE 1QZRA 1I5CA 4DR2E 2XCMA 2ZDYA 3T0HA 3TZ2A 4AWQA 2BM1A 3HZ5A 4O07A 1NHIA 4YKZA 4JYAI 4B3SI 3U2KA 3A0RA 5LMUI 4XC0A 3VHAA 1TC0A 3T10A 5LMUE 2UU9I 2LJPA 2BYHA 1AM1A 2XHTA 4B3TI 2J7KA 4JI4E 3TZ5A 1AH6A 4EGHA 4FWHA 4B6CA 2ZDXA 4YKQA 3CWVA 3EHGA 1ZM2A 4AWPA 4FW9A 1HNXE 5D7RA 4EFUA 5FWKA 1Z0GA 2VQFI 4KQVA 4PRXA 4DV0E 1VISA 2E5LE 1L0OA 4JAUA 4JG4A 2BREA 4E00A 3OMUA 5FLXC 2HFSA 1WUUA 4GKKE 3T2SA 2AJ4A 4CE3A 1XNRI 4MPCA 4HACB 1BKNA 4M1KA 4XCLA 2WEPA 2DEJA 2O1UA 2R42A 4HACA 2YE8A 4QPKA 5M4PA 3T1KA 4B3RI 4OX9E 3HZ1A 4HZ5A 1IBME 3TZ4A 4DR2I 2QFOA 1Y8NA 5F5RA 3D4JA 1D6TA 4LF4E 4KFGA 3A0TA 1N36I 2BU6A 3ZXOA 3ZXQA 4ASAA 4BXIA 4H7QA 4JV5I 3QT7A 4QPJA 2O1VA 4CWQA 4KSHA 5BODA 2HHHE 3K99A 3ZKBA 2YEAA 2YJWA 3M6AA 2BRCA 1FJGE 2BU5A 1BXDA 1FNMA 3G7BA 1K47A 3O6OA 5CPHA 3B24A 4DV3E 2WI7A 1I5DA 2XX2A 4JASA 4LF4I 4IZJD 1AJ6A 3C11A 2YK9A 1DARA 1YC3A 1Y6ZA 3K97A 4E02A 1EI1A 2YE7A 4JI8E 3BMYA 2XEXA 4X62E 3EHFA 4Q20A 2YE2A 4JI7I 2YE9A 4ZVIA 1NHHA 3VHDA 2XHXA 4GQTA 4FCRA 4PRVA 2YKCA 4MB9A 4LF7E 4DR7I 4XTJA 1TIDA 4NH8A 2UXDI 4IZKA 2HFUA 1UYCA 4X65E 1H74A 1QYEA 2UXCI 2Z5BB 4IZKB 4DUYE 2WW4A 1N32I 4KTNA 3WQ9A 1A6FA 5J6AA 2YEIA 4BIZA 2EFGA 1XNQI 1Z5BA 3R4PA 5D7CA 2XK2A 4YKWA 1Z0VA 2H8MA 4FCQA 4KSGA 4XIQA 4JI2E 2UUAI 5BR8E 3QT8A 4ASFA 4LF8E 4NH9A 4DV7E 2XHRA 2GQPA 3B27A 2F4VE 4NXNI 2UXBE 3LNUA 3OWBA 4YKRA 2IWUA 2YEEA 4FCPA 1I59A 4NXNE 2UXBI 4H85A 4DR1E 4LFAI 4I5SA 1ZM4A 2WEQA 2Z5EA 4LP0A 4EGIA 1N33E 2V2VA 3CGYA 1AH8A 1H7UA 5IWAI 5FLXQ 4DV0I 4DV2E 1U0ZA 2EXLA 4EMDA 5M4KA 3TZ0A 4N3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP I;  1OJ4 A;  4BIU A;  4O04 A;  2GS8 A;  3D2R A;  4XKO A;  4X65 I;  5CTY A;  4USK A;  4LF6 E;  1UY6 A;  1ZWH A;  2ZIT A;  3J7A M;  4GCZ A;  4FWG A;  4GKJ I;  1Y8P A;  2XJJ A;  3PYE A;  2XDU A;  5D6Q A;  4HXW A;  4XD8 A;  3U67 A;  3H80 A;  4LWF A;  2V34 A;  2YEB A;  3ZM7 A;  4CWP A;  2YJX A;  4DV4 E;  4MPE A;  2UWD A;  1S4E A;  1IBK E;  1GJV A;  2QG0 A;  2HKE A;  4DPX A;  3K1J A;  1US7 A;  5FNC A;  4JI4 I;  4JV5 E;  3INW A;  2YEF A;  4LFC I;  4X64 E;  4U93 A;  2BYI A;  4JI0 I;  3QTF A;  2Q8G A;  2HG1 A;  4DV5 E;  1UY8 A;  4EGK A;  2YED A;  1R62 A;  2BU7 A;  1ZXM A;  4DR5 I;  1HNZ E;  4YKY A;  2CH4 A;  1XMO E;  1TH8 A;  3T1Y E;  2X7I A;  2CG9 A;  4L91 A;  1HNZ I;  4V25 A;  4XDM A;  4XIT A;  4YKU A;  2BV3 A;  4USM A;  4LF5 I;  1QY8 A;  2BTZ A;  2WI6 A;  2CCU A;  2VCJ A;  1FWL A;  4GKJ E;  3KE6 A;  2IOQ A;  2A2D A;  4R3M A;  2YKI A;  3R4O A;  1FI4 A;  2HHH I;  3PEH A;  4B3S E;  4URL A;  1YS3 A;  5A2Q Q;  3GIF A;  3K60 A;  4K4O A;  4DR6 E;  4UTG A;  4L93 A;  4WUB A;  4CE2 A;  3K98 A;  5A2Q C;  2F4V I;  3JAM C;  2YE6 A;  4EEH A;  2VW5 A;  4DV6 I;  4ASG A;  4R1F A;  2VCI A;  2WI5 A;  1XNR E;  2GFD A;  1TBW A;  5LL6 R;  4X64 I;  1KKH A;  2WI4 A;  3F0N A;  2AKP A;  4DR4 E;  2HKJ A;  2YKE A;  2IOP A;  4DUH A;  1N34 I;  1UYG A;  2BSM A;  2UUB E;  4X9L A;  3RLQ A;  2VF3 A;  5GME A;  1IBK I;  1XMQ E;  1HNX I;  4Z7C A;  4AQY I;  4DR5 E;  1GKZ A;  4URN A;  2UUA E;  3FT8 A;  4P7A A;  3CRL A;  4EMV A;  2IWX A;  2VWC A;  5CTX A;  1J5E I;  2IWS A;  4LFC E;  1N32 E;  1XHK A;  1H73 A;  1ZXN A;  4OX9 I;  4EM7 A;  3HUL A;  4DV1 I;  4H81 A;  4KP4 A;  3B82 A;  4JI2 I;  4YY3 E;  4NXM E;  4GKK I;  2H55 A;  4NH7 A;  4CWR A;  3V5R A;  3ZKD A;  1IBL E;  2XAB A;  4JI5 E;  4DPT A;  3TUH A;  3V2U C;  1FJG I;  2BZ5 A;  3QDD A;  3B78 A;  1B3Q A;  4I3H A;  3LPS A;  4CWO A;  5BR8 I;  4P52 A;  1U2R A;  2CCT A;  4DPU A;  1MX0 A;  3ZZ0 A;  5IWA E;  4DV2 I;  3HYY A;  1N0U A;  1KVK A;  4YHH I;  4L94 A;  2IOR A;  2YGF A;  3OWD A;  4JI6 I;  4DV6 E;  4MP2 A;  4X66 E;  3JZ3 A;  2C2A A;  3PYG A;  3HEK A;  4EFT A;  4XIP A;  4URO A;  1N34 E;  4LF7 I;  4DR7 E;  2JJC A;  2XDK A;  2BU2 A;  4MOT A;  2YEH A;  4FPP A;  1BYQ A;  4HY1 A;  4O0B A;  4LFB E;  2ZM6 I;  3TTZ A;  4BAE A;  1YSR A;  1RR9 A;  3JAM Q;  2YE4 A;  2YKJ A;  4CE1 A;  1IBM I;  1YER A;  2YI7 A;  4XE2 A;  4BQJ A;  3PYF A;  1I5B A;  3WU6 A;  5BOC A;  2OI2 A;  1Y8O A;  4XKK A;  2XDL A;  1U2O A;  3R91 A;  1OSF A;  5LMN I;  3H4L A;  3NMQ A;  1AMW A;  4MYT A;  4CWS A;  4DR1 I;  4BQG A;  4LPB A;  4JI1 I;  4HXZ A;  2BM0 A;  2YEC A;  1YES A;  4X62 I;  2R3V A;  5D7D A;  4ZKI A;  2YEJ A;  1YT0 A;  4DR3 I;  2YE3 A;  2Q8I A;  1N33 I;  4GGL A;  4LWI A;  2XDX A;  4LWH A;  1B63 A;  2X36 A;  4DUZ I;  3B8H A;  4O09 A;  3QT6 A;  2YGE A;  4XCJ A;  1UYL A;  2V2Z A;  3T1H E;  1HNW I;  4JI6 E;  4FMT A;  3J80 Q;  3BM9 A;  4CWN A;  3MNR P;  2Q8H A;  1NZ0 A;  4DR4 I;  1GKX A;  4DV3 I;  3DGE A;  1KIJ A;  2YK2 A;  1UEK A;  1ID0 A;  3A0Y A;  1Z59 A;  3G7E A;  3IED A;  2FXS A;  1UYF A;  3RKZ A;  4R3A A;  3ZZT A;  3VAD A;  5IN9 A;  4B3R E;  5M4H A;  4X66 I;  1JM6 A;  3EHH A;  1N0V C;  2UUC I;  4WUC A;  2QF6 A;  1J5E E;  1H7S A;  4FN5 A;  3WU5 A;  5M4N A;  1Z0C A;  4HYM A;  2YEG A;  4LF9 I;  2E5L I;  3RLR A;  3Q1Q A;  2YI0 A;  2WI1 A;  5GMD A;  4O05 A;  4JI1 E;  1FKA E;  2WER A;  4LF8 I;  3T1Y I;  5IT9 Q;  3J81 C;  2UXC E;  1ZW9 A;  4YKX A;  5FND A;  3T0Z A;  4LWG A;  1KTV A;  3QT5 A;  3O0I A;  4L90 A;  1HR0 I;  4CWT A;  4Z7Y A;  1ZM3 A;  4HY6 A;  4HZ0 A;  1HR0 E;  4FWD A;  4LF9 E;  3HYZ A;  2BU8 A;  2CZ9 A;  4JI3 I;  4AQY E;  3INX A;  4URM A;  4KHP E;  1Y4U A;  4ED4 A;  3U2D A;  5C93 A;  4U7N A;  4XIR A;  2XJG A;  1I5A A;  1RRE A;  2A2C A;  4ASB A;  3C0E A;  2UU9 E;  5IT9 C;  4K0K E;  3OTO E;  4B3T E;  1H72 C;  5CTW A;  5CF0 A;  2FYP A;  1UYI A;  3K17 A;  1I58 A;  1UY9 A;  1A4H A;  3WHA A;  2ZBK B;  1XNQ E;  5J71 A;  1YET A;  3A0Z A;  4JYA E;  1I94 E;  4DV1 E;  1TIL A;  3B26 A;  3J80 C;  1XMO I;  3SL2 A;  3CRK A;  2NPF A;  4DV7 I;  1KZN A;  5D6P A;  4JI8 I;  2XD6 A;  1Z0E A;  1PIE A;  4RPF A;  4DPY A;  1IBL I;  1PVG A;  4LFB I;  2BT0 A;  3EKR A;  4GEE A;  1ELO A;  4UT4 A;  4JI0 E;  2XX4 A;  3J81 Q;  3LTO A;  1Z0T A;  4YKT A;  4JQL A;  4GT8 A;  3G75 A;  2V8P A;  4AWO A;  2YE5 A;  1Z0B A;  4DUZ E;  5CTU A;  4MBC A;  2VQE E;  3WU4 A;  3GIE A;  2HCH A;  4DPW A;  3Q5K A;  3R4M A;  4B3M I;  5FNF A;  2Q2E B;  4K0K I;  5F3K A;  2YI6 A;  2QG2 A;  4B7P A;  1YC4 A;  4LFA E;  2YKB A;  3D0B A;  1MU5 A;  4DXL A;  1UYK A;  4GFN A;  4P8O A;  4HYP A;  4DR6 I;  1YC1 A;  2VQF E;  1FWK A;  3R4N A;  3ZZU A;  1XMQ I;  1Z5A A;  1S14 A;  4DU8 A;  1YT1 A;  3WU3 A;  4JAV A;  2JKI A;  2HK3 A;  1UYM A;  4MP7 A;  3Q5L A;  1UY7 A;  4JI3 E;  2UXD E;  2E0A A;  2YGA A;  3PYD A;  2ZM6 E;  3D36 A;  3OPD A;  2HK2 A;  4E01 A;  1PKP A;  2XX5 A;  5GGZ A;  2E1R A;  1YT2 A;  3Q5J A;  4AS9 A;  2UUC E;  4LWE A;  4XKA A;  1UYD A;  3PEJ A;  1NHJ A;  5M4M A;  2ESA A;  2Q8F A;  3R92 A;  1MG7 A;  2FWZ A;  4PL9 A;  2UUB I;  2WI2 A;  3O2F A;  1B62 A;  3GIG B;  4U7O A;  1TC6 A;  1UYH A;  3FV5 A;  4YHH E;  3GIG A;  5M4E A;  4MYU A;  2O1W A;  4DV5 I;  1Z5C A;  2VQE I;  3J7A G;  4CWF A;  4DU7 A;  2XJX A;  3OTO I;  2ZKJ A;  4DZY A;  2WI3 A;  2V2Q A;  1Z0W A;  4JI7 E;  3B28 A;  4W7T A;  2FWY A;  4MPN A;  4DUY I;  3VHC A;  5L3J A;  1UYE A;  3EKO A;  1YSZ A;  4V26 A;  1S16 A;  2PNR A;  1ZM9 A;  4PU9 A;  2CCS A;  1I94 I;  4DV4 I;  3A0X A;  4L8Z A;  3EHJ A;  2DEI A;  3RLP A;  3CGZ A;  3OW6 A;  1THN A;  5LMN E;  3GON A;  4JI5 I;  2K5B A;  3HHU A;  1EA6 A;  1N36 E;  4B3M E;  3A0W A;  4YY3 I;  4NXM I;  3FT5 A;  2YI5 A;  4LF5 E;  4WUD A;  1Y4S A;  5IDM A;  5IDJ A;  4LF6 I;  2XDS A;  2CGF A;  4DR3 E;  1BGQ A;  3B25 A;  3T1H I;  1HNW E;  1QZR A;  1I5C A;  4DR2 E;  2XCM A;  2ZDY A;  3T0H A;  3TZ2 A;  4AWQ A;  2BM1 A;  3HZ5 A;  4O07 A;  1NHI A;  4YKZ A;  4JYA I;  4B3S I;  3U2K A;  3A0R A;  5LMU I;  4XC0 A;  3VHA A;  1TC0 A;  3T10 A;  5LMU E;  2UU9 I;  2LJP A;  2BYH A;  1AM1 A;  2XHT A;  4B3T I;  2J7K A;  4JI4 E;  3TZ5 A;  1AH6 A;  4EGH A;  4FWH A;  4B6C A;  2ZDX A;  4YKQ A;  3CWV A;  3EHG A;  1ZM2 A;  4AWP A;  4FW9 A;  1HNX E;  5D7R A;  4EFU A;  5FWK A;  1Z0G A;  2VQF I;  4KQV A;  4PRX A;  4DV0 E;  1VIS A;  2E5L E;  1L0O A;  4JAU A;  4JG4 A;  2BRE A;  4E00 A;  3OMU A;  5FLX C;  2HFS A;  1WUU A;  4GKK E;  3T2S A;  2AJ4 A;  4CE3 A;  1XNR I;  4MPC A;  4HAC B;  1BKN A;  4M1K A;  4XCL A;  2WEP A;  2DEJ A;  2O1U A;  2R42 A;  4HAC A;  2YE8 A;  4QPK A;  5M4P A;  3T1K A;  4B3R I;  4OX9 E;  3HZ1 A;  4HZ5 A;  1IBM E;  3TZ4 A;  4DR2 I;  2QFO A;  1Y8N A;  5F5R A;  3D4J A;  1D6T A;  4LF4 E;  4KFG A;  3A0T A;  1N36 I;  2BU6 A;  3ZXO A;  3ZXQ A;  4ASA A;  4BXI A;  4H7Q A;  4JV5 I;  3QT7 A;  4QPJ A;  2O1V A;  4CWQ A;  4KSH A;  5BOD A;  2HHH E;  3K99 A;  3ZKB A;  2YEA A;  2YJW A;  3M6A A;  2BRC A;  1FJG E;  2BU5 A;  1BXD A;  1FNM A;  3G7B A;  1K47 A;  3O6O A;  5CPH A;  3B24 A;  4DV3 E;  2WI7 A;  1I5D A;  2XX2 A;  4JAS A;  4LF4 I;  1AJ6 A;  3C11 A;  2YK9 A;  1DAR A;  1YC3 A;  3K97 A;  4E02 A;  1EI1 A;  2YE7 A;  4JI8 E;  3BMY A;  2XEX A;  4X62 E;  3EHF A;  4Q20 A;  2YE2 A;  4JI7 I;  2YE9 A;  4ZVI A;  1NHH A;  3VHD A;  2XHX A;  4GQT A;  4FCR A;  4PRV A;  2YKC A;  4MB9 A;  4LF7 E;  4DR7 I;  4XTJ A;  1TID A;  4NH8 A;  2UXD I;  2HFU A;  1UYC A;  4X65 E;  1H74 A;  1QYE A;  2UXC I;  4DUY E;  2WW4 A;  1N32 I;  4KTN A;  3WQ9 A;  1A6F A;  5J6A A;  2YEI A;  4BIZ A;  2EFG A;  1XNQ I;  1Z5B A;  3R4P A;  5D7C A;  2XK2 A;  4YKW A;  1Z0V A;  2H8M A;  4FCQ A;  4KSG A;  4XIQ A;  4JI2 E;  2UUA I;  5BR8 E;  3QT8 A;  4ASF A;  4LF8 E;  4NH9 A;  4DV7 E;  2XHR A;  2GQP A;  3B27 A;  2F4V E;  4NXN I;  2UXB E;  3LNU A;  3OWB A;  4YKR A;  2IWU A;  2YEE A;  4FCP A;  1I59 A;  4NXN E;  2UXB I;  4H85 A;  4DR1 E;  4LFA I;  4I5S A;  1ZM4 A;  2WEQ A;  4LP0 A;  4EGI A;  1N33 E;  2V2V A;  3CGY A;  1AH8 A;  1H7U A;  5IWA I;  5FLX Q;  4DV0 I;  4DV2 E;  1U0Z A;  2EXL A;  4EMD A;  5M4K A;  3TZ0 A; 
#chains in the Genus database with same CATH topology
 4KHP I;  1OJ4 A;  4E72 A;  4BIU A;  4O04 A;  2GS8 A;  3D2R A;  4XKO A;  4X65 I;  5CTY A;  4USK A;  4LF6 E;  1UY6 A;  1ZWH A;  2ZIT A;  3J7A M;  4GCZ A;  4FWG A;  2C37 B;  2PNM A;  4GKJ I;  1Y8P A;  3PYE A;  2XDU A;  2XJJ A;  4IS9 A;  5D6Q A;  4HXW A;  4XD8 A;  3U67 A;  3H80 A;  4LWF A;  2V34 A;  2YEB A;  2O3Z A;  3ZM7 A;  4CWP A;  2YJX A;  4DV4 E;  4MPE A;  2UWD A;  1S4E A;  1IBK E;  1GJV A;  2QG0 A;  2HKE A;  4LPF A;  4DPX A;  3H1C A;  3K1J A;  1US7 A;  5FNC A;  2IES A;  4JI4 I;  4JV5 E;  3INW A;  2YEF A;  4LFC I;  4X64 E;  4U93 A;  2BYI A;  4JI0 I;  3QTF A;  2Q8G A;  2HG1 A;  4DV5 E;  2PNL A;  1UY8 A;  4EGK A;  2YED A;  2O1T A;  1R62 A;  1YH8 A;  5C0X F;  2BU7 A;  1ZXM A;  1UDQ A;  4DR5 I;  4OO1 D;  1HNZ E;  4YKY A;  2CH4 A;  1XMO E;  1TH8 A;  2CG9 A;  2X7I A;  3T1Y E;  4L91 A;  1HNZ I;  3P3C A;  4V25 A;  4XDM A;  4XIT A;  4YKU A;  4GQU A;  2BV3 A;  4USM A;  4LF5 I;  1QY8 A;  2BA1 D;  2BTZ A;  2WI6 A;  2CCU A;  2VCJ A;  2PNZ A;  1FWL A;  1Y5Y A;  4GKJ E;  3KE6 A;  2IOQ A;  2A2D A;  4R3M A;  2YKI A;  3R4O A;  1FI4 A;  2HHH I;  3B25 A;  4B3S E;  4URL A;  3PEH A;  5JEN A;  1YS3 A;  5A2Q Q;  3GIF A;  2CVE A;  3K60 A;  4K4O A;  3PS1 A;  4DR6 E;  4UTG A;  4L93 A;  4WUB A;  4CE2 A;  3K98 A;  5A2Q C;  2BA1 G;  4ISA A;  2F4V I;  3JAM C;  2YE6 A;  4EEH A;  2VW5 A;  4DV6 I;  4ASG A;  4R1F A;  4OO1 C;  2VCI A;  1XNR E;  2GFD A;  2WI5 A;  2WP8 A;  5DRP A;  1TBW A;  5LL6 R;  4X64 I;  5K36 B;  1KKH A;  3P76 A;  3F0N A;  5K36 E;  4DR4 E;  2HKJ A;  2AKP A;  2IOP A;  2WI4 A;  2YKE A;  5ELW A;  1N34 I;  4DUH A;  1UYG A;  2BSM A;  2UUB E;  4X9L A;  3RLQ A;  2VF3 A;  4MU4 A;  5GME A;  1XMQ E;  1IBK I;  1HNX I;  4Z7C A;  4AQY I;  4DR5 E;  1GKZ A;  4URN A;  2UUA E;  3FT8 A;  2JEB A;  4P7A A;  3CRL A;  2GO3 A;  4BA1 A;  5JEA A;  1OYS A;  4EMV A;  2IWX A;  2VWC A;  5CTX A;  1J5E I;  2IWS A;  4LFC E;  1N32 E;  1XHK A;  1H73 A;  1ZXN A;  4OX9 I;  4EM7 A;  3HUL A;  4DV1 I;  4H81 A;  4KP4 A;  3B82 A;  2PO1 B;  4JI2 I;  4YY3 E;  4NXM E;  4GKK I;  2H55 A;  4NH7 A;  4CWR A;  3V5R A;  3ZKD A;  1IBL E;  4U3B A;  4JI5 E;  4DPT A;  1UDN A;  3V2U C;  2XAB A;  2NN6 C;  1FJG I;  3TUH A;  2BZ5 A;  4QNK A;  4OO1 E;  3QDD A;  3B78 A;  1B3Q A;  4I3H A;  4J3D A;  3LPS A;  4CWO A;  5BR8 I;  4P52 A;  2PNZ B;  1U2R A;  2CCT A;  4DPU A;  1MX0 A;  3ZZ0 A;  5IWA E;  4DV2 I;  3HYY A;  1N0U A;  1KVK A;  4YHH I;  4IFD B;  4L94 A;  2IOR A;  2YGF A;  2PO0 A;  4JI6 I;  3PS3 A;  3OWD A;  2F1D A;  4DV6 E;  4MP2 A;  4X66 E;  3JZ3 A;  2C2A A;  1P42 A;  3PYG A;  3HEK A;  4EFT A;  4XIP A;  4URO A;  2BR2 A;  1N34 E;  4LF7 I;  4DR7 E;  2JJC A;  2XDK A;  2BU2 A;  2BR2 B;  4MOT A;  2YEH A;  4FPP A;  1BYQ A;  3PRY A;  4HY1 A;  4O0B A;  4LFB E;  2ZM6 I;  3TTZ A;  4BAE A;  1YSR A;  1RR9 A;  3B4T A;  3JAM Q;  2YE4 A;  2YKJ A;  4CE1 A;  1IBM I;  1YER A;  2YI7 A;  4XE2 A;  4BQJ A;  3PYF A;  1I5B A;  4OKG A;  3WU6 A;  5BOC A;  5JEA B;  4QNJ A;  3PS2 A;  2OI2 A;  2C39 B;  1Y8O A;  4XKK A;  2XDL A;  1U2O A;  5C0X D;  3R91 A;  1OSF A;  5LMN I;  3H4L A;  3NMQ A;  1AMW A;  4MYT A;  4CWS A;  4DR1 I;  4BQG A;  4LPB A;  4JI1 I;  4HXZ A;  2BM0 A;  2YEC A;  1YES A;  3M85 D;  4X62 I;  2R3V A;  4FW6 A;  4MU0 A;  5D7D A;  4AID A;  4ZKI A;  2YEJ A;  1YT0 A;  5JEA D;  4DR3 I;  2NN6 F;  2YE3 A;  2Q8I A;  1USU A;  1N33 I;  4LOM A;  3P06 A;  2XDX A;  4GGL A;  2NN6 A;  4LWI A;  4LWH A;  1R6L A;  1UDO A;  1B63 A;  2X36 A;  4DUZ I;  3B8H A;  1OYR A;  5K36 A;  4O09 A;  3QT6 A;  2YGE A;  4XCJ A;  3Q6M A;  3GCM A;  2V2Z A;  3T1H E;  3CDI A;  4MU3 A;  4JI6 E;  3J80 Q;  1HNW I;  1UYL A;  4FMT A;  3BM9 A;  4CWN A;  3MNR P;  2Q8H A;  1NZ0 A;  5DRO A;  4DR4 I;  4DV3 I;  4IFD A;  1GKX A;  2JEB B;  3DGE A;  1KIJ A;  2YK2 A;  2C38 A;  1UEK A;  1ID0 A;  3A0Y A;  1Z59 A;  3G7E A;  3IED A;  2FXS A;  1UYF A;  3RKZ A;  4R3A A;  3M7N G;  3ZZT A;  3CDJ A;  3VAD A;  4B3R E;  5IN9 A;  5M4H A;  4X66 I;  3Q6N A;  1JM6 A;  3EHH A;  1N0V C;  2UUC I;  4WUC A;  3K85 A;  2QF6 A;  1J5E E;  1H7S A;  4FN5 A;  3WU5 A;  5M4N A;  1Z0C A;  4HYM A;  2YEG A;  4LF9 I;  2E5L I;  3RLR A;  3Q1Q A;  2FTK A;  2YI0 A;  2JE6 A;  2WI1 A;  5GMD A;  4O05 A;  4JI1 E;  1FKA E;  4FW7 A;  4LF8 I;  3T1Y I;  5IT9 Q;  3J81 C;  2UXC E;  1ZW9 A;  2WER A;  4YKX A;  5FND A;  1RHY A;  2NN6 D;  3T0Z A;  3LMM A;  4LWG A;  1KTV A;  3QT5 A;  3O0I A;  4L90 A;  1HR0 I;  4CWT A;  4Z7Y A;  1ZM3 A;  4HY6 A;  4HZ0 A;  2Z5C B;  1HR0 E;  4FWD A;  4LF9 E;  3HYZ A;  2BU8 A;  2CZ9 A;  4IFD D;  4JI3 I;  4AQY E;  3INX A;  4URM A;  1Y4U A;  3U1K A;  4ED4 A;  4KHP E;  3U2D A;  5C93 A;  4U7N A;  2PO0 B;  4XIR A;  2XJG A;  1I5A A;  2JT2 A;  1RRE A;  2A2C A;  4ASB A;  3C0E A;  2UU9 E;  2NN6 B;  5IT9 C;  4K0K E;  3OTO E;  4B3T E;  1H72 C;  5CTW A;  5CF0 A;  2FYP A;  1UYI A;  3K17 A;  1I58 A;  1UY9 A;  1A4H A;  3UHM A;  1OYP A;  2ZBK B;  3WHA A;  3U1Y A;  1XNQ E;  5J71 A;  1YET A;  3A0Z A;  2WP8 B;  4JYA E;  1Y60 A;  1I94 E;  4DV1 E;  1TIL A;  3B26 A;  1UDS A;  3J80 C;  4LCH A;  1XMO I;  3SL2 A;  3CRK A;  2NPF A;  4DV7 I;  1KZN A;  5D6P A;  4JI8 I;  2XD6 A;  4IFD C;  1Z0E A;  1PIE A;  4RPF A;  4DPY A;  1IBL I;  1PVG A;  4LFB I;  1HK7 A;  2C38 B;  5C0X B;  1YHC A;  2BT0 A;  3EKR A;  4GEE A;  1ELO A;  4UT4 A;  4BA1 B;  2C39 A;  5C0X A;  4JI0 E;  3M7N D;  3HJC A;  2XX4 A;  3J81 Q;  3LTO A;  1Z0T A;  5C0X C;  4YKT A;  4JQL A;  2PO2 B;  4GT8 A;  3G75 A;  2V8P A;  4AWO A;  2YE5 A;  2NN6 E;  1USV A;  2PO2 A;  1Z0B A;  4DUZ E;  5CTU A;  4MBC A;  2VQE E;  2J65 A;  3WU4 A;  4IZJ A;  3GIE A;  2HCH A;  4DPW A;  3Q5K A;  3R4M A;  4LCG A;  4IFD F;  3S5T A;  4B3M I;  5FNF A;  2Q2E B;  4K0K I;  4IZJ B;  3L7Z A;  2JE6 B;  5F3K A;  2YI6 A;  2QG2 A;  4B7P A;  1YC4 A;  5JEA C;  4LFA E;  2YKB A;  4AIM A;  1MU5 A;  4DXL A;  1UYK A;  3D0B A;  4GFN A;  4P8O A;  4HYP A;  4DR6 I;  1YC1 A;  2BA0 G;  1FWK A;  4MU1 A;  2VQF E;  3ZZU A;  1XMQ I;  5DRR A;  3GLL A;  3GME A;  3R4N A;  1Z5A A;  1S14 A;  4DU8 A;  2C37 A;  3WU3 A;  1YT1 A;  2JKI A;  2HK3 A;  1UYM A;  4JAV A;  3Q5L A;  1UY7 A;  4MP7 A;  4JI3 E;  4BA2 B;  2UXD E;  2Z5C A;  2E0A A;  2YGA A;  3PYD A;  2ZM6 E;  4BA2 A;  4OO1 F;  3D36 A;  3OPD A;  2HK2 A;  4E01 A;  1PKP A;  2XX5 A;  5GGZ A;  1VI7 A;  2E1R A;  1YT2 A;  3Q5J A;  4AS9 A;  2UUC E;  4LWE A;  4XKA A;  1E3H A;  1IXM A;  1UYD A;  3PEJ A;  1NHJ A;  5M4M A;  2ESA A;  2Q8F A;  3R92 A;  1MG7 A;  3CYG A;  2FWZ A;  4PL9 A;  2UUB I;  2WI2 A;  2GQ0 A;  3O2F A;  1B62 A;  3GIG B;  3DD6 A;  4U7O A;  1TC6 A;  3KRN A;  1UYH A;  3FV5 A;  4YHH E;  3GIG A;  5M4E A;  4MYU A;  2O1W A;  4DV5 I;  1Z5C A;  2VQE I;  3J7A G;  4CWF A;  4DU7 A;  2XJX A;  3OTO I;  2ZKJ A;  4DZY A;  5EL9 A;  2WI3 A;  5DNL A;  5EKW A;  2V2Q A;  1Z0W A;  4JI7 E;  2Z5B A;  3B28 A;  4W7T A;  2FWY A;  4MPN A;  4DUY I;  3VHC A;  5L3J A;  1UYE A;  3EKO A;  5JEA E;  1YSZ A;  4V26 A;  1S16 A;  2PNR A;  2VES A;  1ZM9 A;  4PU9 A;  2CCS A;  1I94 I;  4DV4 I;  3A0X A;  4L8Z A;  3EHJ A;  2DEI A;  3RLP A;  3CGZ A;  3M85 G;  3OW6 A;  1THN A;  5LMN E;  3GON A;  4JI5 I;  2CGE A;  2K5B A;  1EA6 A;  1N36 E;  4B3M E;  3A0W A;  3HHU A;  4YY3 I;  4NXM I;  3FT5 A;  2YI5 A;  1Y4S A;  4WUD A;  3P3G A;  4LF5 E;  5IDM A;  4LF6 I;  5IDJ A;  2GO4 A;  5DNX A;  5C0X E;  2CGF A;  4DR3 E;  1BGQ A;  2XDS A;  3T1H I;  1HNW E;  1QZR A;  1I5C A;  4DR2 E;  2XCM A;  2ZDY A;  3T0H A;  3TZ2 A;  4AWQ A;  2BM1 A;  5K36 F;  2HHI A;  3HZ5 A;  4LCF A;  4O07 A;  1NHI A;  4YKZ A;  4FW4 A;  4JYA I;  4B3S I;  3U2K A;  3A0R A;  3L7Z B;  5LMU I;  4XC0 A;  3VHA A;  1TC0 A;  3T10 A;  5LMU E;  2UU9 I;  2LJP A;  2BYH A;  1AM1 A;  2XHT A;  4B3T I;  2J7K A;  4JI4 E;  3TZ5 A;  1AH6 A;  4EGH A;  4FWH A;  4B6C A;  2ZDX A;  4YKQ A;  3CWV A;  5DRQ A;  3EHG A;  1ZM2 A;  2BA0 D;  4FW9 A;  4NBQ A;  1HNX E;  5D7R A;  5FWK A;  1Z0G A;  4AWP A;  4EFU A;  2VQF I;  2WNR A;  4KQV A;  4PRX A;  4DV0 E;  1VIS A;  1XXE A;  5JEA F;  2E5L E;  1L0O A;  2WNR B;  4JAU A;  4JG4 A;  2BRE A;  4FW3 A;  4E00 A;  3OMU A;  5FLX C;  2HFS A;  1WUU A;  4GKK E;  3T2S A;  2AJ4 A;  4CE3 A;  1XNR I;  4MPC A;  4HAC B;  1BKN A;  4M1K A;  4XCL A;  4AM3 A;  2WEP A;  2DEJ A;  2O1U A;  2R42 A;  4HAC A;  2YE8 A;  4QPK A;  5M4P A;  3T1K A;  4B3R I;  4OX9 E;  3HZ1 A;  4HZ5 A;  2PO1 A;  4IFD E;  1IBM E;  3TZ4 A;  4DR2 I;  2QFO A;  1Y8N A;  5F5R A;  3D4J A;  1D6T A;  4LF4 E;  4KFG A;  3A0T A;  1N36 I;  2BU6 A;  3ZXO A;  3ZXQ A;  2AE8 A;  4ASA A;  4BXI A;  4OZE A;  4H7Q A;  4JV5 I;  3QT7 A;  4QPJ A;  2O1V A;  2IER A;  4OO1 B;  4FW5 A;  4CWQ A;  4KSH A;  4MQY A;  5K36 C;  5BOD A;  2HHH E;  3K99 A;  3ZKB A;  2YEA A;  2YJW A;  3M6A A;  2BRC A;  1FJG E;  2BU5 A;  1BXD A;  1FNM A;  3G7B A;  1K47 A;  2C1G A;  3O6O A;  5CPH A;  3B24 A;  4DV3 E;  2WI7 A;  1I5D A;  2XX2 A;  4JAS A;  4LF4 I;  4IZJ D;  1AJ6 A;  3C11 A;  2YK9 A;  1DAR A;  1YC3 A;  1Y6Z A;  3K97 A;  4E02 A;  1EI1 A;  2YE7 A;  4JI8 E;  3BMY A;  2XEX A;  4X62 E;  3EHF A;  4Q20 A;  2YE2 A;  4JI7 I;  2YE9 A;  4ZVI A;  1NHH A;  3VHD A;  2XHX A;  4GQT A;  3HKM A;  4MDT A;  4FCR A;  4PRV A;  5K36 D;  2YKC A;  4MB9 A;  4LF7 E;  4DR7 I;  4XTJ A;  1TID A;  4NH8 A;  1F51 A;  2UXD I;  4IZK A;  2HFU A;  1UYC A;  4X65 E;  1H74 A;  1QYE A;  3P3E A;  2UXC I;  2Z5B B;  4IZK B;  4DUY E;  2WW4 A;  1N32 I;  4KTN A;  3WQ9 A;  1A6F A;  5J6A A;  2YEI A;  4BIZ A;  2EFG A;  1XNQ I;  1Z5B A;  3R4P A;  5D7C A;  2XK2 A;  4YKW A;  1Z0V A;  2H8M A;  4FCQ A;  4KSG A;  4XIQ A;  4JI2 E;  2UUA I;  5BR8 E;  2C1I A;  3QT8 A;  4ASF A;  4LF8 E;  4NH9 A;  4DV7 E;  2XHR A;  2JEA B;  2GQP A;  3B27 A;  2F4V E;  4NXN I;  2UXB E;  3LNU A;  3OWB A;  4YKR A;  2IWU A;  2YEE A;  2JEA A;  4FCP A;  4U3D A;  1I59 A;  4NXN E;  2UXB I;  4H85 A;  4DR1 E;  4LFA I;  4I5S A;  1ZM4 A;  1E3P A;  2WEQ A;  2Z5E A;  4LP0 A;  4EGI A;  1N33 E;  2V2V A;  3CGY A;  1AH8 A;  1H7U A;  4OO1 A;  5IWA I;  5FLX Q;  4DV0 I;  4DV2 E;  1U0Z A;  2EXL A;  4EMD A;  3NZK A;  5M4K A;  1R6M A;  3TZ0 A;  4N3O A; 
#chains in the Genus database with same CATH homology
 4KHP I;  1OJ4 A;  4BIU A;  4O04 A;  2GS8 A;  3D2R A;  4XKO A;  4X65 I;  5CTY A;  4USK A;  4LF6 E;  1UY6 A;  1ZWH A;  2ZIT A;  3J7A M;  4GCZ A;  4FWG A;  2PNM A;  4GKJ I;  1Y8P A;  2XJJ A;  3PYE A;  2XDU A;  5D6Q A;  4HXW A;  4XD8 A;  3U67 A;  3H80 A;  4LWF A;  2V34 A;  2YEB A;  3ZM7 A;  4CWP A;  2YJX A;  4DV4 E;  4MPE A;  2UWD A;  1S4E A;  1IBK E;  1GJV A;  2QG0 A;  2HKE A;  4DPX A;  3K1J A;  1US7 A;  5FNC A;  4JI4 I;  4JV5 E;  3INW A;  2YEF A;  4LFC I;  4X64 E;  4U93 A;  2BYI A;  4JI0 I;  3QTF A;  2Q8G A;  2HG1 A;  4DV5 E;  2PNL A;  1UY8 A;  4EGK A;  2YED A;  2O1T A;  1R62 A;  2BU7 A;  1ZXM A;  4DR5 I;  1HNZ E;  4YKY A;  2CH4 A;  1XMO E;  1TH8 A;  2CG9 A;  2X7I A;  3T1Y E;  4L91 A;  1HNZ I;  4V25 A;  4XDM A;  4XIT A;  4YKU A;  2BV3 A;  4USM A;  4LF5 I;  1QY8 A;  2BTZ A;  2WI6 A;  2CCU A;  2VCJ A;  1FWL A;  4GKJ E;  3KE6 A;  2IOQ A;  2A2D A;  4R3M A;  2YKI A;  3R4O A;  1FI4 A;  2HHH I;  3PEH A;  4B3S E;  4URL A;  1YS3 A;  5A2Q Q;  3GIF A;  3K60 A;  4K4O A;  4DR6 E;  4UTG A;  4L93 A;  4WUB A;  4CE2 A;  3K98 A;  5A2Q C;  2F4V I;  3JAM C;  2YE6 A;  4EEH A;  2VW5 A;  4DV6 I;  4ASG A;  4R1F A;  2VCI A;  2WI5 A;  1XNR E;  2GFD A;  1TBW A;  5LL6 R;  4X64 I;  1KKH A;  2WI4 A;  3F0N A;  2AKP A;  4DR4 E;  2HKJ A;  2YKE A;  2IOP A;  4DUH A;  1N34 I;  1UYG A;  2BSM A;  2UUB E;  4X9L A;  3RLQ A;  2VF3 A;  5GME A;  1IBK I;  1XMQ E;  1HNX I;  4Z7C A;  4AQY I;  4DR5 E;  1GKZ A;  4URN A;  2UUA E;  3FT8 A;  4P7A A;  3CRL A;  4EMV A;  2IWX A;  2VWC A;  5CTX A;  1J5E I;  2IWS A;  4LFC E;  1N32 E;  1XHK A;  1H73 A;  1ZXN A;  4OX9 I;  4EM7 A;  3HUL A;  4DV1 I;  4H81 A;  4KP4 A;  3B82 A;  4JI2 I;  4YY3 E;  4NXM E;  4GKK I;  2H55 A;  4NH7 A;  4CWR A;  3V5R A;  3ZKD A;  1IBL E;  2XAB A;  4JI5 E;  4DPT A;  3TUH A;  3V2U C;  1FJG I;  2BZ5 A;  3QDD A;  3B78 A;  1B3Q A;  4I3H A;  3LPS A;  4CWO A;  5BR8 I;  4P52 A;  1U2R A;  2CCT A;  4DPU A;  1MX0 A;  3ZZ0 A;  5IWA E;  4DV2 I;  3HYY A;  1N0U A;  1KVK A;  4YHH I;  4L94 A;  2IOR A;  2YGF A;  3OWD A;  4JI6 I;  4DV6 E;  4MP2 A;  4X66 E;  3JZ3 A;  2C2A A;  3PYG A;  3HEK A;  4EFT A;  4XIP A;  4URO A;  1N34 E;  4LF7 I;  4DR7 E;  2JJC A;  2XDK A;  2BU2 A;  4MOT A;  2YEH A;  4FPP A;  1BYQ A;  3PRY A;  4HY1 A;  4O0B A;  4LFB E;  2ZM6 I;  3TTZ A;  4BAE A;  1YSR A;  1RR9 A;  3JAM Q;  2YE4 A;  2YKJ A;  4CE1 A;  1IBM I;  1YER A;  2YI7 A;  4XE2 A;  4BQJ A;  3PYF A;  1I5B A;  3WU6 A;  5BOC A;  2OI2 A;  1Y8O A;  4XKK A;  2XDL A;  1U2O A;  3R91 A;  1OSF A;  5LMN I;  3H4L A;  3NMQ A;  1AMW A;  4MYT A;  4CWS A;  4DR1 I;  4BQG A;  4LPB A;  4JI1 I;  4HXZ A;  2BM0 A;  2YEC A;  1YES A;  4X62 I;  2R3V A;  5D7D A;  4ZKI A;  2YEJ A;  1YT0 A;  4DR3 I;  2YE3 A;  2Q8I A;  1USU A;  1N33 I;  4GGL A;  3P06 A;  2XDX A;  4LWI A;  4LWH A;  1B63 A;  2X36 A;  4DUZ I;  3B8H A;  4O09 A;  3QT6 A;  2YGE A;  4XCJ A;  3Q6M A;  1UYL A;  2V2Z A;  3T1H E;  1HNW I;  4JI6 E;  4FMT A;  3J80 Q;  3BM9 A;  4CWN A;  3MNR P;  2Q8H A;  1NZ0 A;  4DR4 I;  1GKX A;  4DV3 I;  3DGE A;  1KIJ A;  2YK2 A;  1UEK A;  1ID0 A;  3A0Y A;  1Z59 A;  3G7E A;  3IED A;  2FXS A;  1UYF A;  3RKZ A;  4R3A A;  3ZZT A;  3VAD A;  5IN9 A;  4B3R E;  5M4H A;  4X66 I;  3Q6N A;  1JM6 A;  3EHH A;  1N0V C;  2UUC I;  4WUC A;  3K85 A;  2QF6 A;  1J5E E;  1H7S A;  4FN5 A;  3WU5 A;  5M4N A;  1Z0C A;  4HYM A;  2YEG A;  4LF9 I;  2E5L I;  3RLR A;  3Q1Q A;  2YI0 A;  2WI1 A;  5GMD A;  4O05 A;  4JI1 E;  1FKA E;  2WER A;  4LF8 I;  3T1Y I;  5IT9 Q;  3J81 C;  2UXC E;  1ZW9 A;  4YKX A;  5FND A;  3T0Z A;  4LWG A;  1KTV A;  3QT5 A;  3O0I A;  4L90 A;  1HR0 I;  4CWT A;  4Z7Y A;  1ZM3 A;  4HY6 A;  4HZ0 A;  2Z5C B;  1HR0 E;  4FWD A;  4LF9 E;  3HYZ A;  2BU8 A;  2CZ9 A;  4JI3 I;  4AQY E;  3INX A;  4URM A;  1Y4U A;  4KHP E;  4ED4 A;  3U2D A;  5C93 A;  4U7N A;  4XIR A;  2XJG A;  1I5A A;  1RRE A;  2A2C A;  4ASB A;  3C0E A;  2UU9 E;  5IT9 C;  4K0K E;  3OTO E;  4B3T E;  1H72 C;  5CTW A;  5CF0 A;  2FYP A;  1UYI A;  3K17 A;  1I58 A;  1UY9 A;  1A4H A;  3WHA A;  2ZBK B;  1XNQ E;  5J71 A;  1YET A;  3A0Z A;  4JYA E;  1I94 E;  4DV1 E;  1TIL A;  3B26 A;  3J80 C;  1XMO I;  3SL2 A;  3CRK A;  2NPF A;  4DV7 I;  1KZN A;  5D6P A;  4JI8 I;  2XD6 A;  1Z0E A;  1PIE A;  4RPF A;  4DPY A;  1IBL I;  1PVG A;  4LFB I;  1HK7 A;  2BT0 A;  3EKR A;  4GEE A;  1ELO A;  4UT4 A;  4JI0 E;  3HJC A;  2XX4 A;  3J81 Q;  3LTO A;  1Z0T A;  4YKT A;  4JQL A;  4GT8 A;  3G75 A;  2V8P A;  4AWO A;  2YE5 A;  1USV A;  1Z0B A;  4DUZ E;  5CTU A;  4MBC A;  2VQE E;  3WU4 A;  4IZJ A;  3GIE A;  2HCH A;  4DPW A;  3Q5K A;  3R4M A;  4B3M I;  5FNF A;  2Q2E B;  4K0K I;  4IZJ B;  5F3K A;  2YI6 A;  2QG2 A;  4B7P A;  1YC4 A;  4LFA E;  2YKB A;  3D0B A;  1MU5 A;  4DXL A;  1UYK A;  4GFN A;  4P8O A;  4HYP A;  4DR6 I;  1YC1 A;  2VQF E;  1FWK A;  3R4N A;  3ZZU A;  1XMQ I;  1Z5A A;  1S14 A;  4DU8 A;  1YT1 A;  3WU3 A;  4JAV A;  2JKI A;  2HK3 A;  1UYM A;  4MP7 A;  3Q5L A;  1UY7 A;  4JI3 E;  2UXD E;  2Z5C A;  2E0A A;  2YGA A;  3PYD A;  2ZM6 E;  3D36 A;  3OPD A;  2HK2 A;  4E01 A;  1PKP A;  2XX5 A;  5GGZ A;  2E1R A;  1YT2 A;  3Q5J A;  4AS9 A;  2UUC E;  4LWE A;  4XKA A;  1UYD A;  3PEJ A;  1NHJ A;  5M4M A;  2ESA A;  2Q8F A;  3R92 A;  1MG7 A;  2FWZ A;  4PL9 A;  2UUB I;  2WI2 A;  2GQ0 A;  3O2F A;  1B62 A;  3GIG B;  4U7O A;  1TC6 A;  1UYH A;  3FV5 A;  4YHH E;  3GIG A;  5M4E A;  4MYU A;  2O1W A;  4DV5 I;  1Z5C A;  2VQE I;  3J7A G;  4CWF A;  4DU7 A;  2XJX A;  3OTO I;  2ZKJ A;  4DZY A;  2WI3 A;  2V2Q A;  1Z0W A;  4JI7 E;  2Z5B A;  3B28 A;  4W7T A;  2FWY A;  4MPN A;  4DUY I;  3VHC A;  5L3J A;  1UYE A;  3EKO A;  1YSZ A;  4V26 A;  1S16 A;  2PNR A;  1ZM9 A;  4PU9 A;  2CCS A;  1I94 I;  4DV4 I;  3A0X A;  4L8Z A;  3EHJ A;  2DEI A;  3RLP A;  3CGZ A;  3OW6 A;  1THN A;  5LMN E;  3GON A;  4JI5 I;  2CGE A;  2K5B A;  1EA6 A;  1N36 E;  4B3M E;  3A0W A;  3HHU A;  4YY3 I;  4NXM I;  3FT5 A;  2YI5 A;  1Y4S A;  4WUD A;  4LF5 E;  5IDM A;  5IDJ A;  4LF6 I;  2XDS A;  2CGF A;  4DR3 E;  1BGQ A;  3B25 A;  3T1H I;  1HNW E;  1QZR A;  1I5C A;  4DR2 E;  2XCM A;  2ZDY A;  3T0H A;  3TZ2 A;  4AWQ A;  2BM1 A;  3HZ5 A;  4O07 A;  1NHI A;  4YKZ A;  4JYA I;  4B3S I;  3U2K A;  3A0R A;  5LMU I;  4XC0 A;  3VHA A;  1TC0 A;  3T10 A;  5LMU E;  2UU9 I;  2LJP A;  2BYH A;  1AM1 A;  2XHT A;  4B3T I;  2J7K A;  4JI4 E;  3TZ5 A;  1AH6 A;  4EGH A;  4FWH A;  4B6C A;  2ZDX A;  4YKQ A;  3CWV A;  3EHG A;  1ZM2 A;  4AWP A;  4FW9 A;  1HNX E;  5D7R A;  4EFU A;  5FWK A;  1Z0G A;  2VQF I;  4KQV A;  4PRX A;  4DV0 E;  1VIS A;  2E5L E;  1L0O A;  4JAU A;  4JG4 A;  2BRE A;  4E00 A;  3OMU A;  5FLX C;  2HFS A;  1WUU A;  4GKK E;  3T2S A;  2AJ4 A;  4CE3 A;  1XNR I;  4MPC A;  4HAC B;  1BKN A;  4M1K A;  4XCL A;  2WEP A;  2DEJ A;  2O1U A;  2R42 A;  4HAC A;  2YE8 A;  4QPK A;  5M4P A;  3T1K A;  4B3R I;  4OX9 E;  3HZ1 A;  4HZ5 A;  1IBM E;  3TZ4 A;  4DR2 I;  2QFO A;  1Y8N A;  5F5R A;  3D4J A;  1D6T A;  4LF4 E;  4KFG A;  3A0T A;  1N36 I;  2BU6 A;  3ZXO A;  3ZXQ A;  4ASA A;  4BXI A;  4H7Q A;  4JV5 I;  3QT7 A;  4QPJ A;  2O1V A;  4CWQ A;  4KSH A;  5BOD A;  2HHH E;  3K99 A;  3ZKB A;  2YEA A;  2YJW A;  3M6A A;  2BRC A;  1FJG E;  2BU5 A;  1BXD A;  1FNM A;  3G7B A;  1K47 A;  3O6O A;  5CPH A;  3B24 A;  4DV3 E;  2WI7 A;  1I5D A;  2XX2 A;  4JAS A;  4LF4 I;  4IZJ D;  1AJ6 A;  3C11 A;  2YK9 A;  1DAR A;  1YC3 A;  1Y6Z A;  3K97 A;  4E02 A;  1EI1 A;  2YE7 A;  4JI8 E;  3BMY A;  2XEX A;  4X62 E;  3EHF A;  4Q20 A;  2YE2 A;  4JI7 I;  2YE9 A;  4ZVI A;  1NHH A;  3VHD A;  2XHX A;  4GQT A;  4FCR A;  4PRV A;  2YKC A;  4MB9 A;  4LF7 E;  4DR7 I;  4XTJ A;  1TID A;  4NH8 A;  2UXD I;  4IZK A;  2HFU A;  1UYC A;  4X65 E;  1H74 A;  1QYE A;  2UXC I;  2Z5B B;  4IZK B;  4DUY E;  2WW4 A;  1N32 I;  4KTN A;  3WQ9 A;  1A6F A;  5J6A A;  2YEI A;  4BIZ A;  2EFG A;  1XNQ I;  1Z5B A;  3R4P A;  5D7C A;  2XK2 A;  4YKW A;  1Z0V A;  2H8M A;  4FCQ A;  4KSG A;  4XIQ A;  4JI2 E;  2UUA I;  5BR8 E;  3QT8 A;  4ASF A;  4LF8 E;  4NH9 A;  4DV7 E;  2XHR A;  2GQP A;  3B27 A;  2F4V E;  4NXN I;  2UXB E;  3LNU A;  3OWB A;  4YKR A;  2IWU A;  2YEE A;  4FCP A;  1I59 A;  4NXN E;  2UXB I;  4H85 A;  4DR1 E;  4LFA I;  4I5S A;  1ZM4 A;  2WEQ A;  2Z5E A;  4LP0 A;  4EGI A;  1N33 E;  2V2V A;  3CGY A;  1AH8 A;  1H7U A;  5IWA I;  5FLX Q;  4DV0 I;  4DV2 E;  1U0Z A;  2EXL A;  4EMD A;  5M4K A;  3TZ0 A;  4N3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...