1BKNA

Crystal structure of an n-terminal 40kd fragment of e. coli dna mismatch repair protein mutl
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
312
structure length
272
Chain Sequence
VERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCGIKKDELALALAIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAWQAYAVTVKPAAHPVGTTLEVLDTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVSRLVHDFIYQGVLSVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUTL
publication title Crystal structure and ATPase activity of MutL: implications for DNA repair and mutagenesis.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Dna repair
total genus 75
structure length 272
sequence length 312
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain
A PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1bknA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1bknA01
4GT8A 3OW6A 2BZ5A 2VCIA 3R4MA 3K99A 4I5SA 2CGFA 3MNRP 4MP2A 3PYDA 2Q2EB 1GJVA 4L8ZA 1N34I 1HNXI 4LWHA 5CTWA 2BU6A 5FWKA 4GKKI 4PU9A 4KSHA 3R4NA 4DV1E 2BU2A 2BYHA 3G7BA 4DPYA 4BQGA 2YI0A 2YKCA 2HCHA 4HY1A 2UXDI 4DR7E 1ZM9A 1GKXA 1I5CA 5GMEA 4KQVA 2WI5A 3DGEA 2YKIA 1FWKA 2YK9A 5IDMA 1Y4UA 5L3JA 4EMDA 1OSFA 2XD6A 4XD8A 2YGAA 4DV4I 4WUCA 1UYDA 3Q5KA 3D0BA 4JI5E 3G7EA 3EHGA 4DR6I 2IWUA 2UXCI 2YI6A 1Z0TA 3WU3A 4JV5E 2E1RA 4WUDA 1YERA 2ZM6E 2WI1A 4JI3I 2OI2A 1NHJA 3D2RA 3QTFA 1R62A 3T0ZA 4MPNA 1XMOI 4JI0I 3J81Q 4CWPA 4AQYI 3C11A 3VADA 2YJWA 2QF6A 4EGKA 3LNUA 3PYFA 4LF7I 3OMUA 1OJ4A 3A0XA 3OTOI 1TC6A 4YKYA 4JYAE 3ZXOA 1NHIA 4YKXA 3VHCA 1PKPA 3T1HI 3J7AG 2H55A 2IOPA 4LFCI 3J81C 4JI7E 4YKRA 2YEGA 3R91A 1HNWE 1I5BA 2XX5A 4K0KI 2XDKA 3R92A 2YEFA 1KVKA 2BYIA 2YE2A 2XDLA 4P52A 4DV3E 2YEHA 2QG2A 4B3TE 2IORA 2YE8A 2VCJA 1XNQE 1XNRE 2WERA 2XJJA 2XX4A 4U7NA 4DV6I 2EFGA 5D7CA 4LFBE 2Q8HA 4ED4A 3A0TA 1YETA 1UY6A 1ZM4A 2FYPA 2ZKJA 2WI4A 3HHUA 3QT6A 2XEXA 4DU8A 5LMUE 4NXMI 1UYKA 2VW5A 4L90A 2GFDA 5FNFA 2E5LI 3K97A 1UY7A 1Y4SA 2HKEA 4YKUA 4NH9A 4DR5I 4MB9A 4YKQA 4URNA 3EKOA 1KIJA 3ZZ0A 5LMNE 1RREA 2UUCI 4KHPI 1Y8NA 4JI2E 4CWRA 4DR4I 2BU7A 4JI4E 2ZDXA 4GQTA 1N33I 2UWDA 4DR2E 4NXNI 5BR8E 1YC3A 4X9LA 1H73A 1UYMA 4U93A 4YY3I 3FT8A 1BKNA 1GKZA 1ZWHA 2YEEA 2O1VA 4X66I 4ASAA 1KTVA 1RR9A 4X62E 5F3KA 1H72C 1MU5A 1S16A 2UUAE 4CE2A 3B82A 4MYUA 2CCTA 3A0YA 1UYHA 1IBME 1N36I 3CWVA 2YEBA 3H80A 4E02A 1ZM2A 4JI1E 3CRLA 4JQLA 2JKIA 2UU9I 1BXDA 4DR3I 2HHHI 3CGYA 4JI8I 2YEJA 4P7AA 4GFNA 5M4HA 3J80Q 1H7UA 1I5DA 1YT1A 2JJCA 2CZ9A 4DPUA 2YK2A 4V25A 4B7PA 2CCUA 2V8PA 2WW4A 4K4OA 1Y8OA 4CE1A 4Z7CA 2NPFA 1FJGE 1UY9A 1Z0EA 3Q1QA 1AMWA 2XCMA 3J80C 2WI2A 4DV7I 1YC4A 1HR0I 1QY8A 3HEKA 3K17A 1IBLI 4LF9E 1U2RA 1UYLA 3ZM7A 2V2VA 1N32I 4OX9E 4FN5A 4GGLA 1UY8A 1Z0BA 3B25A 1FWLA 3O6OA 4BIUA 1ZM3A 1I94E 1U2OA 1B3QA 2IOQA 4R1FA 2VF3A 2XHXA 4DV2I 4MOTA 3T10A 1J5EI 4MPCA 4V26A 4JG4A 3ZXQA 2YEIA 3B27A 4EFTA 2BV3A 4LFAI 5M4EA 2Q8FA 2UUBI 4R3AA 1Z59A 4AWQA 3GONA 3H4LA 3QT7A 3ZKBA 2X7IA 5M4PA 2VWCA 4XIPA 4B3SI 1N34E 1HNXE 4EGHA 4DUYI 1YC1A 4GKKE 3FV5A 1YESA 4LF6I 4JYAI 4FWGA 2O1UA 3K60A 1FKAE 3HULA 2IWXA 4GKJE 5D7DA 1XMQI 2BU5A 4XIRA 2YE7A 3EHFA 3HYYA 3O0IA 4USKA 4KP4A 4NH8A 4X64E 4LF4I 4DV3I 2IWSA 4PL9A 1Z0WA 4X65E 5CPHA 4YKTA 3V5RA 4CWTA 3CRKA 5J6AA 4JI6I 1U0ZA 3WU4A 1AM1A 4JASA 5BODA 3B8HA 1US7A 4DV4E 1EI1A 2VQEI 4LF5E 1UYIA 2CG9A 2YECA 3B28A 3C0EA 4CWQA 4BAEA 4LFBI 1AH6A 4LWEA 4DR6E 1B63A 2BTZA 2UXCE 2F4VI 1YT2A 4URMA 4HYMA 4B3MI 1A4HA 4UTGA 3BM9A 4PRXA 1IBKI 4ZVIA 4JI3E 2ZITA 1HNZI 3HYZA 3Q5JA 4R3MA 3A0ZA 5GGZA 2GQPA 4AQYE 4I3HA 4DPXA 4NH7A 1K47A 2V34A 5GMDA 4LF7E 1AH8A 5J71A 4AWOA 3GIGA 3OTOE 1VISA 2QFOA 4DUHA 1I5AA 3GIEA 3T1YI 3T1KA 3U2KA 1QZRA 3F0NA 3WQ9A 3T1HE 2QG0A 3VHAA 4LFCE 4XTJA 3V2UC 3B24A 3O2FA 4WUBA 3R4OA 4DUZI 2VQFE 2Q8IA 5M4MA 4K0KE 2YKBA 5C93A 4DV5I 5IWAI 1ZXMA 3HZ1A 1Z0GA 4YKZA 4QPJA 3PYEA 4YHHI 2YE4A 4HACA 3TZ2A 2DEJA 4HZ5A 4MBCA 5F5RA 4XCLA 2A2CA 3PEJA 2Q8GA 1S14A 1XHKA 4DV6E 4B3RI 1UYGA 1I59A 4O05A 5IT9Q 2WEPA 1Y8PA 2HKJA 3JAMQ 2WI6A 1YT0A 3OWDA 3GIFA 5IN9A 3M6AA 1Z5BA 4DPTA 4LF8E 2HK2A 1PVGA 3B78A 1ZXNA 4FMTA 4HZ0A 2XK2A 4DR5E 3GIGB 1Z0VA 2V2ZA 1THNA 2YE3A 4ASBA 1MX0A 4EGIA 2XABA 5IT9C 2XJXA 2XX2A 2YEAA 2UUCE 3JAMC 5FLXQ 4KHPE 2HFSA 2C2AA 4DV1I 4L94A 2WI7A 1N33E 2ZBKB 5D6PA 3NMQA 4NXNE 4FCQA 3U67A 4ZKIA 3K1JA 3WU5A 3JZ3A 4YY3E 1H74A 4DU7A 1QYEA 2YE9A 3T0HA 4DR7I 1N0VC 3WHAA 4L93A 4DR1E 1I94I 5FLXC 4X66E 4HACB 4FW9A 4M1KA 2BM1A 2PNRA 4QPKA 1KKHA 2YGEA 4EMVA 1H7SA 2YE5A 1KZNA 4ASGA 4EFUA 2XHRA 2UXBE 5BOCA 2AJ4A 1ZW9A 1N36E 5CF0A 3INWA 4HXWA 2AKPA 3LTOA 4JI5I 1UEKA 1D6TA 2UU9E 2ESAA 4DR3E 3RLRA 2HHHE 2DEIA 4DV0E 4JI8E 3PYGA 4JV5I 5M4KA 2YI7A 4XIQA 2HK3A 5CTYA 2ZM6I 3RLPA 3SL2A 3EKRA 3D36A 2BRCA 2E0AA 2BT0A 2FWYA 3R4PA 4GKJI 1B62A 4MPEA 2J7KA 4XCJA 1YSRA 4LP0A 5FNDA 4MP7A 4DXLA 4DV7E 4KTNA 4CWOA 1HR0E 1UYCA 3TTZA 1IBLE 4X64I 3Q5LA 4LPBA 4RPFA 4JAVA 1NHHA 4X65I 2WI3A 4BXIA 4DPWA 1N32E 4JI7I 1AJ6A 4UROA 4O09A 1HNWI 3KE6A 4FWHA 2YI5A 4GEEA 2R3VA 4LF5I 1NZ0A 2UXDE 4HYPA 1Z0CA 2O1WA 4O07A 1JM6A 2YE6A 4UT4A 3RLQA 5LL6R 4DZYA 1TIDA 4DV2E 2XDUA 4B3TI 4L91A 1J5EE 4JAUA 3B26A 4XDMA 4CWFA 1XNQI 1UYEA 3K98A 4LFAE 4HXZA 4XKAA 2UUBE 1XNRI 2X36A 4KSGA 1A6FA 3BMYA 4EEHA 2CCSA 4O0BA 2BU8A 3U2DA 4B3SE 2EXLA 1YSZA 3OPDA 3QT8A 4LWIA 5A2QQ 1S4EA 4DUYE 5D6QA 5LMUI 4FPPA 3EHHA 5FNCA 4LF6E 3TZ0A 4B6CA 4XKKA 2YJXA 1XMOE 2BSMA 4JI0E 5CTUA 4W7TA 4USMA 4AS9A 1XMQE 4XITA 1MG7A 1ID0A 2VQFI 5LMNI 5A2QC 4KFGA 1TC0A 1BYQA 2GS8A 3J7AM 4JI2I 3QDDA 2BREA 4JI4I 2CH4A 3TZ4A 2FWZA 4LF4E 3A0WA 2BM0A 2A2DA 1TBWA 1I58A 3TZ5A 4DR2I 5BR8I 4CWNA 5IDJA 1WUUA 2YEDA 1UYFA 4JI6E 1PIEA 1TH8A 1DARA 4LWFA 2VQEE 3IEDA 1YS3A 3PEHA 3A0RA 2V2QA 4X62I 2XDSA 4XC0A 5CTXA 2R42A 2UUAI 2F4VE 4XE2A 4B3ME 1IBMI 4GCZA 1BGQA 2XHTA 1Z5AA 3WU6A 1IBKE 4LF8I 1HNZE 4JI1I 3ZZTA 4H7QA 3VHDA 4H81A 3T2SA 4BQJA 4P8OA 3EHJA 5M4NA 4ASFA 3G75A 4U7OA 4NXME 4YKWA 4Z7YA 2FXSA 2H8MA 4CWSA 4FCRA 4URLA 4MYTA 1EA6A 3T1YE 2E5LE 3TUHA 3D4JA 3INXA 3OWBA 4E01A 2XJGA 2YKJA 4CE3A 2LJPA 4EM7A 2K5BA 4AWPA 4DUZE 1FJGI 4LWGA 4E00A 4PRVA 4DR1I 4XKOA 4DV5E 1FNMA 3RKZA 4H85A 4DR4E 3ZZUA 1FI4A 5IWAE 1Z5CA 4FCPA 4LF9I 3QT5A 2WEQA 2YGFA 2HFUA 4YHHE 2XDXA 4OX9I 5D7RA 1TILA 4FWDA 3FT5A 3ZKDA 2UXBI 2HG1A 4HY6A 1ELOA 3LPSA 1L0OA 2ZDYA 2YKEA 4B3RE 4DV0I 4Q20A 4O04A 1N0UA 3CGZA 3HZ5A 4BIZA
chains in the Genus database with same CATH superfamily
3NZKA 4GT8A 3OW6A 2BZ5A 2VCIA 3R4MA 3K99A 4I5SA 2CGFA 2PO1B 3MNRP 4MP2A 5C0XE 3PYDA 2Q2EB 4NBQA 2PNZB 1GJVA 4L8ZA 1Y5YA 2J65A 5K36F 1N34I 1HNXI 2C1IA 4LWHA 5CTWA 3Q6NA 2BA0G 2BU6A 5FWKA 4GKKI 4PU9A 5C0XA 4KSHA 3R4NA 4DV1E 2BU2A 2BYHA 3G7BA 4DPYA 4BQGA 2YI0A 2YKCA 2HCHA 4HY1A 2UXDI 4DR7E 1ZM9A 2C37A 1GKXA 5GMEA 4KQVA 1I5CA 2WI5A 3DGEA 2YKIA 1FWKA 2YK9A 5K36B 5IDMA 1Y4UA 5L3JA 4EMDA 1OSFA 3GCMA 2XD6A 4XD8A 2YGAA 4OO1C 3P3EA 4DV4I 3HKMA 4WUCA 1UYDA 5C0XF 2O3ZA 3Q5KA 3D0BA 4JI5E 3P06A 3G7EA 3EHGA 4DR6I 2IWUA 2UXCI 4AM3A 2YI6A 1Z0TA 3WU3A 4JV5E 2E1RA 4WUDA 1YERA 2ZM6E 2WI1A 4JI3I 2OI2A 1NHJA 3D2RA 3QTFA 1R62A 3T0ZA 4MPNA 1XMOI 4JI0I 3J81Q 2CVEA 4AQYI 3C11A 3VADA 4CWPA 4FW6A 2YJWA 5C0XB 2QF6A 4EGKA 3LNUA 3PYFA 4LF7I 3OMUA 1OJ4A 3A0XA 3OTOI 1TC6A 4YKYA 4JYAE 3ZXOA 1NHIA 4YKXA 3VHCA 1PKPA 3T1HI 2IOPA 3J7AG 2H55A 3M7NG 4LFCI 4OO1E 2C37B 3J81C 4JI7E 4YKRA 3GMEA 2YEGA 1HNWE 3R91A 1I5BA 2XX5A 4K0KI 2XDKA 3R92A 3U1KA 2YEFA 1KVKA 2BYIA 2YE2A 2XDLA 1YH8A 4P52A 4DV3E 2HHIA 2QG2A 2YEHA 2PNMA 4B3TE 2IORA 2YE8A 2VCJA 1XNQE 1XNRE 2WERA 2XJJA 2XX4A 4U7NA 4DV6I 2EFGA 5D7CA 4LFBE 2Q8HA 4ED4A 3A0TA 1YETA 5DRQA 3P76A 1UY6A 1ZM4A 2GO4A 2FYPA 2ZKJA 2WI4A 3HHUA 3QT6A 2XEXA 4DU8A 5LMUE 4NXMI 1UYKA 2VW5A 4L90A 4OO1F 2GFDA 5FNFA 1UDQA 2E5LI 3K97A 1UY7A 1USUA 1Y4SA 2HKEA 4YKUA 2PO2A 4DR5I 4NH9A 5JEAC 4MB9A 4YKQA 4URNA 4LOMA 3EKOA 1KIJA 4ISAA 3ZZ0A 5LMNE 1RREA 2UUCI 4KHPI 1Y8NA 4JI2E 4CWRA 4DR4I 2BU7A 4JI4E 2ZDXA 4GQTA 4IFDE 1N33I 2UWDA 2VESA 4NXNI 1OYRA 5BR8E 4DR2E 1YC3A 1H73A 4X9LA 1UYMA 4U3BA 4U93A 4YY3I 3M85D 3PS1A 3FT8A 1BKNA 1GKZA 1ZWHA 2YEEA 2O1VA 4X66I 4IFDA 4ASAA 1KTVA 3B4TA 1RR9A 1VI7A 4X62E 5F3KA 1H72C 1MU5A 2BA1D 1S16A 2UUAE 4QNJA 3H1CA 4CE2A 3B82A 4MYUA 2CCTA 3A0YA 1UYHA 1IBME 1N36I 3CWVA 2YEBA 3H80A 4E02A 1ZM2A 4JI1E 3CRLA 4JQLA 3S5TA 2JKIA 2PO0A 2NN6C 2UU9I 1BXDA 4N3OA 4DR3I 2HHHI 3CGYA 4JI8I 2YEJA 4P7AA 4GFNA 5M4HA 3J80Q 1H7UA 1I5DA 1YT1A 4IFDF 1YHCA 2PO2B 2JJCA 2CZ9A 4DPUA 2YK2A 4V25A 4B7PA 2CCUA 2V8PA 2WW4A 4LPFA 4K4OA 1Y8OA 4CE1A 1Y6ZA 2C38A 4Z7CA 2NPFA 1FJGE 1UY9A 1Z0EA 3Q1QA 1AMWA 1UDSA 2XCMA 3J80C 2WI2A 4IZJA 4DV7I 1YC4A 1HR0I 1RHYA 1QY8A 3K17A 3HEKA 1IBLI 4LF9E 4MU4A 1U2RA 1UYLA 3ZM7A 3KRNA 2V2VA 1N32I 4OX9E 4FN5A 4GGLA 4IFDB 2WNRA 1UY8A 1OYSA 1Z0BA 3B25A 4UROA 1FWLA 3O6OA 4BIUA 1IXMA 1ZM3A 1I94E 1U2OA 2IOQA 1B3QA 4R1FA 3PRYA 2VF3A 2XHXA 3M85G 4DV2I 4MOTA 3T10A 1J5EI 4MPCA 4V26A 4JG4A 3ZXQA 2YEIA 3B27A 4EFTA 2BV3A 4LFAI 2PO0B 5M4EA 2Q8FA 2UUBI 2BA1G 4R3AA 1Z59A 4AWQA 3GONA 3H4LA 3QT7A 2WP8A 3ZKBA 2X7IA 5M4PA 2VWCA 4XIPA 4B3SI 2BR2A 1N34E 1HNXE 4EGHA 4DUYI 1YC1A 4GKKE 3CYGA 3FV5A 1YESA 4LF6I 1Y60A 4JYAI 2O1UA 4FWGA 2C38B 3K60A 1FKAE 3HULA 5JENA 2IWXA 4GKJE 5JEAD 5D7DA 1XXEA 4IZJB 5DROA 1XMQI 2BU5A 4XIRA 2YE7A 3EHFA 4AIMA 3HYYA 3O0IA 4USKA 5K36D 4KP4A 2WNRB 4NH8A 4BA1A 4X64E 3K85A 4LF4I 4DV3I 5DNXA 2IWSA 1Z0WA 4X65E 4PL9A 4YKTA 5CPHA 3V5RA 3P3GA 4CWTA 3CRKA 5J6AA 4JI6I 1U0ZA 3WU4A 1AM1A 4JASA 5BODA 3B8HA 4IZKA 4DV4E 1EI1A 2CG9A 2VQEI 4LF5E 1US7A 1UYIA 2YECA 3B28A 1UDOA 3C0EA 4CWQA 4BAEA 4OO1A 4LFBI 1AH6A 4LWEA 4DR6E 1B63A 2BTZA 2UXCE 2F4VI 1YT2A 4URMA 4HYMA 4B3MI 1A4HA 2WP8B 4UTGA 2IERA 3BM9A 4PRXA 1IBKI 4ZVIA 4JI3E 2ZITA 1HNZI 2BR2B 2NN6D 3HYZA 3Q5JA 4R3MA 3A0ZA 5GGZA 2GQPA 1OYPA 4AQYE 4I3HA 4DPXA 4MU1A 4NH7A 1K47A 2V34A 1HK7A 5GMDA 2Z5BA 4LF7E 3L7ZA 1AH8A 5J71A 4AWOA 2AE8A 3GIGA 2F1DA 3OTOE 1VISA 2QFOA 4DUHA 1I5AA 3GIEA 3T1YI 3T1KA 3U2KA 1QZRA 3F0NA 3WQ9A 3T1HE 2QG0A 3VHAA 4QNKA 4LFCE 4XTJA 3V2UC 3B24A 3O2FA 2GO3A 4WUBA 3R4OA 4DUZI 4BA1B 2VQFE 2Q8IA 4K0KE 2YKBA 5C93A 5M4MA 4DV5I 5IWAI 1ZXMA 3HZ1A 1Z0GA 4OZEA 4YKZA 5K36C 4QPJA 3PYEA 4YHHI 4IZKB 2YE4A 4E00A 4IS9A 4HACA 3CDIA 4OO1B 2DEJA 4HZ5A 4MBCA 5F5RA 4XCLA 3TZ2A 2A2CA 3PEJA 2Q8GA 1S14A 1XHKA 4DV6E 4B3RI 1UYGA 1I59A 4O05A 5IT9Q 2WEPA 1Y8PA 2HKJA 3JAMQ 2WI6A 1YT0A 1R6LA 3OWDA 3GIFA 5IN9A 3M6AA 1R6MA 1Z5BA 4OKGA 2HK2A 4DPTA 4LF8E 1PVGA 3B78A 1ZXNA 5JEAE 1E3PA 2Z5BB 4FMTA 3L7ZB 4HZ0A 2XK2A 4DR5E 3GIGB 1Z0VA 2V2ZA 1THNA 2YE3A 4ASBA 1MX0A 4EGIA 5C0XC 2XABA 5IT9C 2XJXA 4MDTA 2XX2A 2YEAA 4MU3A 3JAMC 2UUCE 5FLXQ 5JEAA 4KHPE 1UDNA 5DRRA 2HFSA 2C2AA 4DV1I 4L94A 2WI7A 1N33E 2ZBKB 5D6PA 3NMQA 3Q6MA 4NXNE 4FCQA 2FTKA 3U67A 4ZKIA 2Z5EA 3K1JA 3WU5A 3JZ3A 4YY3E 3LMMA 1H74A 4DU7A 1QYEA 2YE9A 3T0HA 4DR7I 1N0VC 3WHAA 4L93A 4DR1E 1I94I 5FLXC 4X66E 4HACB 4FW9A 4M1KA 2BM1A 2PNRA 4QPKA 1KKHA 5EL9A 2YGEA 4EMVA 1H7SA 2YE5A 1KZNA 4ASGA 4EFUA 2XHRA 2UXBE 5BOCA 5JEAF 2AJ4A 1ZW9A 1N36E 2NN6E 5CF0A 3INWA 4HXWA 2AKPA 2JEAA 3LTOA 4JI5I 1UEKA 1D6TA 2UU9E 2ESAA 4DR3E 3RLRA 2HHHE 2DEIA 4DV0E 2NN6A 4JI8E 3PYGA 4JV5I 5M4KA 4U3DA 3M7ND 2YI7A 4XIQA 2HK3A 5CTYA 2ZM6I 3RLPA 3SL2A 3EKRA 3DD6A 3D36A 2Z5CA 3GLLA 2BRCA 2E0AA 2BT0A 2FWYA 3R4PA 4GKJI 1B62A 4MPEA 2CGEA 2J7KA 2JT2A 5JEAB 4XCJA 1YSRA 4LP0A 5FNDA 4MP7A 4DXLA 4MU0A 4DV7E 4KTNA 4CWOA 1HR0E 1UYCA 5DNLA 1IBLE 4X64I 3Q5LA 4LPBA 3TTZA 4RPFA 4JAVA 1NHHA 4X65I 2WI3A 4BXIA 4DPWA 1N32E 3CDJA 4JI7I 4IFDD 2NN6F 1AJ6A 4O09A 1HNWI 3KE6A 4FW3A 4FWHA 2YI5A 4GEEA 2R3VA 4LF5I 1NZ0A 2UXDE 4HYPA 1Z0CA 2O1WA 3PS3A 4O07A 1JM6A 2YE6A 4UT4A 3RLQA 5LL6R 2JE6A 4DZYA 1TIDA 4DV2E 2XDUA 4B3TI 4L91A 1J5EE 4JAUA 3B26A 4XDMA 4CWFA 2JEAB 1XNQI 1UYEA 3K98A 4LFAE 4HXZA 4XKAA 2UUBE 1XNRI 2X36A 4KSGA 1A6FA 3U1YA 3BMYA 4EEHA 2NN6B 2CCSA 4O0BA 2BU8A 4LCFA 4BA2A 4MQYA 4B3SE 2EXLA 1YSZA 2C1GA 3QT8A 3OPDA 4LWIA 5A2QQ 1S4EA 2Z5CB 4DUYE 5D6QA 5LMUI 1USVA 4FW4A 4LCGA 3EHHA 4FPPA 4LF6E 5FNCA 3TZ0A 3U2DA 4XKKA 4B6CA 2YJXA 1XMOE 2BSMA 4JI0E 4IZJD 5CTUA 5C0XD 4W7TA 4USMA 4AS9A 1XMQE 4XITA 1MG7A 1ID0A 2VQFI 5LMNI 4E72A 5A2QC 4KFGA 1TC0A 1BYQA 2GS8A 3PS2A 4JI2I 3J7AM 3QDDA 2BREA 4JI4I 2CH4A 3TZ4A 2FWZA 4LF4E 3A0WA 2IESA 2BM0A 2A2DA 4FW5A 1I58A 1TBWA 4DR2I 5BR8I 3TZ5A 4CWNA 5IDJA 1WUUA 5ELWA 2YEDA 1UYFA 4IFDC 4JI6E 1PIEA 1TH8A 1DARA 4LWFA 2JE6B 2C39A 2VQEE 3IEDA 1YS3A 3PEHA 3A0RA 2V2QA 4X62I 2XDSA 4XC0A 5CTXA 2R42A 2UUAI 3P3CA 2F4VE 1E3HA 4XE2A 4GQUA 2PNLA 4B3ME 1IBMI 4GCZA 1BGQA 2XHTA 1Z5AA 3WU6A 1IBKE 2JEBA 4LF8I 1HNZE 4JI1I 3ZZTA 4BA2B 2BA0D 4H7QA 3VHDA 4H81A 3T2SA 5EKWA 4BQJA 1F51A 4P8OA 3EHJA 5M4NA 4ASFA 2PO1A 3G75A 2PNZA 4U7OA 4NXME 4YKWA 4Z7YA 2FXSA 2H8MA 4CWSA 4FCRA 4URLA 4MYTA 1EA6A 3T1YE 2E5LE 4FW7A 3D4JA 3TUHA 3INXA 3OWBA 4E01A 2XJGA 4LCHA 2YKJA 4CE3A 2LJPA 4EM7A 2K5BA 4AWPA 4DUZE 1FJGI 2GQ0A 4LWGA 5K36E 4PRVA 4DR1I 4XKOA 4DV5E 1FNMA 3RKZA 4H85A 4DR4E 3ZZUA 1FI4A 5IWAE 1Z5CA 4FCPA 4LF9I 3QT5A 2WEQA 2YGFA 2HFUA 4YHHE 2XDXA 2C39B 5DRPA 4OX9I 5D7RA 4OO1D 4FWDA 1TILA 5K36A 3FT5A 4J3DA 3ZKDA 2UXBI 3HJCA 2HG1A 4HY6A 1ELOA 3LPSA 1L0OA 1P42A 3UHMA 2ZDYA 2YKEA 4B3RE 2JEBB 4DV0I 4Q20A 4O04A 1N0UA 2O1TA 3CGZA 3HZ5A 4BIZA 4AIDA
chains in the Genus database with same CATH topology
4GT8A 3OW6A 2BZ5A 2VCIA 3R4MA 3K99A 4I5SA 2CGFA 3MNRP 4MP2A 3PYDA 2Q2EB 1GJVA 4L8ZA 1N34I 1HNXI 4LWHA 5CTWA 3Q6NA 2BU6A 5FWKA 4GKKI 4PU9A 4KSHA 3R4NA 4DV1E 2BU2A 2BYHA 3G7BA 4DPYA 4BQGA 2YI0A 2YKCA 2HCHA 4HY1A 2UXDI 4DR7E 1ZM9A 1GKXA 1I5CA 5GMEA 4KQVA 2WI5A 3DGEA 2YKIA 1FWKA 2YK9A 5IDMA 1Y4UA 5L3JA 4EMDA 1OSFA 2XD6A 4XD8A 2YGAA 4DV4I 4WUCA 1UYDA 3Q5KA 3D0BA 4JI5E 3P06A 3G7EA 3EHGA 4DR6I 2IWUA 2UXCI 2YI6A 1Z0TA 3WU3A 4JV5E 2E1RA 4WUDA 1YERA 2ZM6E 2WI1A 4JI3I 2OI2A 1NHJA 3D2RA 3QTFA 1R62A 3T0ZA 4MPNA 1XMOI 4JI0I 3J81Q 4CWPA 4AQYI 3C11A 3VADA 2YJWA 2QF6A 4EGKA 3LNUA 3PYFA 4LF7I 3OMUA 1OJ4A 3A0XA 3OTOI 1TC6A 4YKYA 4JYAE 3ZXOA 1NHIA 4YKXA 3VHCA 1PKPA 3T1HI 2IOPA 3J7AG 2H55A 4LFCI 3J81C 4JI7E 4YKRA 2YEGA 3R91A 1HNWE 1I5BA 2XX5A 4K0KI 2XDKA 3R92A 2YEFA 1KVKA 2BYIA 2YE2A 2XDLA 4P52A 4DV3E 2YEHA 2QG2A 2PNMA 4B3TE 2IORA 2YE8A 2VCJA 1XNQE 1XNRE 2WERA 2XJJA 2XX4A 4U7NA 4DV6I 2EFGA 5D7CA 4LFBE 2Q8HA 4ED4A 3A0TA 1YETA 1UY6A 1ZM4A 2FYPA 2ZKJA 2WI4A 3HHUA 3QT6A 2XEXA 4DU8A 5LMUE 4NXMI 1UYKA 2VW5A 4L90A 2GFDA 5FNFA 2E5LI 3K97A 1UY7A 1USUA 1Y4SA 2HKEA 4YKUA 4NH9A 4DR5I 4MB9A 4YKQA 4URNA 3EKOA 1KIJA 3ZZ0A 5LMNE 1RREA 2UUCI 4KHPI 1Y8NA 4JI2E 4CWRA 4DR4I 2BU7A 4JI4E 2ZDXA 4GQTA 1N33I 2UWDA 4DR2E 4NXNI 5BR8E 1YC3A 4X9LA 1H73A 1UYMA 4U93A 4YY3I 3FT8A 1BKNA 1GKZA 1ZWHA 2YEEA 2O1VA 4X66I 4ASAA 1KTVA 1RR9A 4X62E 5F3KA 1H72C 1MU5A 1S16A 2UUAE 4CE2A 3B82A 4MYUA 2CCTA 3A0YA 1UYHA 1IBME 1N36I 3CWVA 2YEBA 3H80A 4E02A 1ZM2A 4JI1E 3CRLA 4JQLA 2JKIA 2UU9I 1BXDA 4N3OA 4DR3I 2HHHI 3CGYA 4JI8I 2YEJA 4P7AA 4GFNA 5M4HA 3J80Q 1H7UA 1I5DA 1YT1A 2JJCA 2CZ9A 4DPUA 2YK2A 4V25A 4B7PA 2CCUA 2V8PA 2WW4A 4K4OA 1Y8OA 4CE1A 1Y6ZA 4Z7CA 2NPFA 1FJGE 1UY9A 1Z0EA 3Q1QA 1AMWA 2XCMA 3J80C 2WI2A 4IZJA 4DV7I 1YC4A 1HR0I 1QY8A 3HEKA 3K17A 1IBLI 4LF9E 1U2RA 1UYLA 3ZM7A 2V2VA 1N32I 4OX9E 4FN5A 4GGLA 1UY8A 1Z0BA 3B25A 1FWLA 3O6OA 4BIUA 1ZM3A 1I94E 1U2OA 2IOQA 1B3QA 4R1FA 3PRYA 2VF3A 2XHXA 4DV2I 4MOTA 3T10A 1J5EI 4MPCA 4V26A 4JG4A 3ZXQA 2YEIA 3B27A 4EFTA 2BV3A 4LFAI 5M4EA 2Q8FA 2UUBI 4R3AA 1Z59A 4AWQA 3GONA 3H4LA 3QT7A 3ZKBA 2X7IA 5M4PA 2VWCA 4XIPA 4B3SI 1N34E 1HNXE 4EGHA 4DUYI 1YC1A 4GKKE 3FV5A 1YESA 4LF6I 4JYAI 2O1UA 4FWGA 3K60A 1FKAE 3HULA 2IWXA 4GKJE 5D7DA 4IZJB 1XMQI 2BU5A 4XIRA 2YE7A 3EHFA 3HYYA 3O0IA 4USKA 4KP4A 4NH8A 4X64E 3K85A 4LF4I 4DV3I 2IWSA 4PL9A 1Z0WA 4X65E 5CPHA 4YKTA 3V5RA 4CWTA 3CRKA 5J6AA 4JI6I 1U0ZA 3WU4A 1AM1A 4JASA 5BODA 3B8HA 4IZKA 4DV4E 1EI1A 2CG9A 2VQEI 4LF5E 1US7A 1UYIA 2YECA 3B28A 3C0EA 4CWQA 4BAEA 4LFBI 1AH6A 4LWEA 4DR6E 1B63A 2BTZA 2UXCE 2F4VI 1YT2A 4URMA 4HYMA 4B3MI 1A4HA 4UTGA 3BM9A 4PRXA 1IBKI 4ZVIA 4JI3E 2ZITA 1HNZI 3HYZA 3Q5JA 4R3MA 3A0ZA 5GGZA 2GQPA 4AQYE 4I3HA 4DPXA 4NH7A 1K47A 2V34A 1HK7A 2Z5BA 5GMDA 4LF7E 1AH8A 5J71A 4AWOA 3GIGA 3OTOE 1VISA 2QFOA 4DUHA 1I5AA 3GIEA 3T1YI 3T1KA 3U2KA 1QZRA 3F0NA 3WQ9A 3T1HE 2QG0A 3VHAA 4LFCE 4XTJA 3V2UC 3B24A 3O2FA 4WUBA 3R4OA 4DUZI 2VQFE 2Q8IA 5M4MA 4K0KE 2YKBA 5C93A 4DV5I 5IWAI 1ZXMA 3HZ1A 1Z0GA 4YKZA 4QPJA 3PYEA 4YHHI 4IZKB 2YE4A 4HACA 3TZ2A 2DEJA 4HZ5A 4MBCA 5F5RA 4XCLA 2A2CA 3PEJA 2Q8GA 1S14A 1XHKA 4DV6E 4B3RI 1UYGA 1I59A 4O05A 5IT9Q 2WEPA 1Y8PA 2HKJA 3JAMQ 2WI6A 1YT0A 3OWDA 3GIFA 5IN9A 3M6AA 1Z5BA 4DPTA 4LF8E 2HK2A 1PVGA 3B78A 1ZXNA 2Z5BB 4FMTA 4HZ0A 2XK2A 4DR5E 3GIGB 1Z0VA 2V2ZA 1THNA 2YE3A 4ASBA 1MX0A 4EGIA 2XABA 5IT9C 2XJXA 2XX2A 2YEAA 2UUCE 3JAMC 5FLXQ 4KHPE 2HFSA 2C2AA 4DV1I 4L94A 2WI7A 1N33E 2ZBKB 5D6PA 3NMQA 3Q6MA 4NXNE 4FCQA 3U67A 4ZKIA 2Z5EA 3K1JA 3WU5A 3JZ3A 4YY3E 1H74A 4DU7A 1QYEA 2YE9A 3T0HA 4DR7I 1N0VC 3WHAA 4L93A 4DR1E 1I94I 5FLXC 4X66E 4HACB 4FW9A 4M1KA 2BM1A 2PNRA 4QPKA 1KKHA 2YGEA 4EMVA 1H7SA 2YE5A 1KZNA 4ASGA 4EFUA 2XHRA 2UXBE 5BOCA 2AJ4A 1ZW9A 1N36E 5CF0A 3INWA 4HXWA 2AKPA 3LTOA 4JI5I 1UEKA 1D6TA 2UU9E 2ESAA 4DR3E 3RLRA 2HHHE 2DEIA 4DV0E 4JI8E 3PYGA 4JV5I 5M4KA 2YI7A 4XIQA 2HK3A 5CTYA 2ZM6I 3RLPA 3SL2A 3EKRA 3D36A 2Z5CA 2BRCA 2E0AA 2BT0A 2FWYA 3R4PA 4GKJI 1B62A 4MPEA 2CGEA 2J7KA 4XCJA 1YSRA 4LP0A 5FNDA 4MP7A 4DXLA 4DV7E 4KTNA 4CWOA 1HR0E 1UYCA 3TTZA 1IBLE 4X64I 3Q5LA 4LPBA 4RPFA 4JAVA 1NHHA 4X65I 2WI3A 4BXIA 4DPWA 1N32E 4JI7I 1AJ6A 4UROA 4O09A 1HNWI 3KE6A 4FWHA 2YI5A 4GEEA 2R3VA 4LF5I 1NZ0A 2UXDE 4HYPA 1Z0CA 2O1WA 4O07A 1JM6A 2YE6A 4UT4A 3RLQA 5LL6R 4DZYA 1TIDA 4DV2E 2XDUA 4B3TI 4L91A 1J5EE 4JAUA 3B26A 4XDMA 4CWFA 1XNQI 1UYEA 3K98A 4LFAE 4HXZA 4XKAA 2UUBE 1XNRI 2X36A 4KSGA 1A6FA 3BMYA 4EEHA 2CCSA 4O0BA 2BU8A 3U2DA 4B3SE 2EXLA 1YSZA 3OPDA 3QT8A 4LWIA 5A2QQ 1S4EA 2Z5CB 4DUYE 5D6QA 5LMUI 1USVA 3EHHA 4FPPA 5FNCA 4LF6E 3TZ0A 4B6CA 4XKKA 2YJXA 1XMOE 2BSMA 4JI0E 4IZJD 5CTUA 4W7TA 4USMA 4AS9A 1XMQE 4XITA 1MG7A 1ID0A 2VQFI 5LMNI 5A2QC 4KFGA 1TC0A 1BYQA 2GS8A 3J7AM 4JI2I 3QDDA 2BREA 4JI4I 2CH4A 3TZ4A 2FWZA 4LF4E 3A0WA 2BM0A 2A2DA 1TBWA 1I58A 3TZ5A 4DR2I 5BR8I 4CWNA 5IDJA 1WUUA 2YEDA 1UYFA 4JI6E 1PIEA 1TH8A 1DARA 4LWFA 2VQEE 3IEDA 1YS3A 3PEHA 3A0RA 2V2QA 4X62I 2XDSA 4XC0A 5CTXA 2R42A 2UUAI 2F4VE 4XE2A 2PNLA 4B3ME 1IBMI 4GCZA 1BGQA 2XHTA 1Z5AA 3WU6A 1IBKE 4LF8I 1HNZE 4JI1I 3ZZTA 4H7QA 3VHDA 4H81A 3T2SA 4BQJA 4P8OA 3EHJA 5M4NA 4ASFA 3G75A 4U7OA 4NXME 4YKWA 4Z7YA 2FXSA 2H8MA 4CWSA 4FCRA 4URLA 4MYTA 1EA6A 3T1YE 2E5LE 3TUHA 3D4JA 3INXA 3OWBA 4E01A 2XJGA 2YKJA 4CE3A 2LJPA 4EM7A 2K5BA 4AWPA 4DUZE 1FJGI 2GQ0A 4LWGA 4E00A 4PRVA 4DR1I 4XKOA 4DV5E 1FNMA 3RKZA 4H85A 4DR4E 3ZZUA 1FI4A 5IWAE 1Z5CA 4FCPA 4LF9I 3QT5A 2WEQA 2YGFA 2HFUA 4YHHE 2XDXA 4OX9I 5D7RA 1TILA 4FWDA 3FT5A 3ZKDA 2UXBI 2HG1A 3HJCA 4HY6A 1ELOA 3LPSA 1L0OA 2ZDYA 2YKEA 4B3RE 4DV0I 4Q20A 4O04A 1N0UA 2O1TA 3CGZA 3HZ5A 4BIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GT8 A;  3OW6 A;  2BZ5 A;  2VCI A;  3R4M A;  3K99 A;  4I5S A;  2CGF A;  3MNR P;  4MP2 A;  3PYD A;  2Q2E B;  1GJV A;  4L8Z A;  1N34 I;  1HNX I;  4LWH A;  5CTW A;  2BU6 A;  5FWK A;  4GKK I;  4PU9 A;  4KSH A;  3R4N A;  4DV1 E;  2BU2 A;  2BYH A;  3G7B A;  4DPY A;  4BQG A;  2YI0 A;  2YKC A;  2HCH A;  4HY1 A;  2UXD I;  4DR7 E;  1ZM9 A;  1GKX A;  1I5C A;  5GME A;  4KQV A;  2WI5 A;  3DGE A;  2YKI A;  1FWK A;  2YK9 A;  5IDM A;  1Y4U A;  5L3J A;  4EMD A;  1OSF A;  2XD6 A;  4XD8 A;  2YGA A;  4DV4 I;  4WUC A;  1UYD A;  3Q5K A;  3D0B A;  4JI5 E;  3G7E A;  3EHG A;  4DR6 I;  2IWU A;  2UXC I;  2YI6 A;  1Z0T A;  3WU3 A;  4JV5 E;  2E1R A;  4WUD A;  1YER A;  2ZM6 E;  2WI1 A;  4JI3 I;  2OI2 A;  1NHJ A;  3D2R A;  3QTF A;  1R62 A;  3T0Z A;  4MPN A;  1XMO I;  4JI0 I;  3J81 Q;  4CWP A;  4AQY I;  3C11 A;  3VAD A;  2YJW A;  2QF6 A;  4EGK A;  3LNU A;  3PYF A;  4LF7 I;  3OMU A;  1OJ4 A;  3A0X A;  3OTO I;  1TC6 A;  4YKY A;  4JYA E;  3ZXO A;  1NHI A;  4YKX A;  3VHC A;  1PKP A;  3T1H I;  3J7A G;  2H55 A;  2IOP A;  4LFC I;  3J81 C;  4JI7 E;  4YKR A;  2YEG A;  3R91 A;  1HNW E;  1I5B A;  2XX5 A;  4K0K I;  2XDK A;  3R92 A;  2YEF A;  1KVK A;  2BYI A;  2YE2 A;  2XDL A;  4P52 A;  4DV3 E;  2YEH A;  2QG2 A;  4B3T E;  2IOR A;  2YE8 A;  2VCJ A;  1XNQ E;  1XNR E;  2WER A;  2XJJ A;  2XX4 A;  4U7N A;  4DV6 I;  2EFG A;  5D7C A;  4LFB E;  2Q8H A;  4ED4 A;  3A0T A;  1YET A;  1UY6 A;  1ZM4 A;  2FYP A;  2ZKJ A;  2WI4 A;  3HHU A;  3QT6 A;  2XEX A;  4DU8 A;  5LMU E;  4NXM I;  1UYK A;  2VW5 A;  4L90 A;  2GFD A;  5FNF A;  2E5L I;  3K97 A;  1UY7 A;  1Y4S A;  2HKE A;  4YKU A;  4NH9 A;  4DR5 I;  4MB9 A;  4YKQ A;  4URN A;  3EKO A;  1KIJ A;  3ZZ0 A;  5LMN E;  1RRE A;  2UUC I;  4KHP I;  1Y8N A;  4JI2 E;  4CWR A;  4DR4 I;  2BU7 A;  4JI4 E;  2ZDX A;  4GQT A;  1N33 I;  2UWD A;  4DR2 E;  4NXN I;  5BR8 E;  1YC3 A;  4X9L A;  1H73 A;  1UYM A;  4U93 A;  4YY3 I;  3FT8 A;  1BKN A;  1GKZ A;  1ZWH A;  2YEE A;  2O1V A;  4X66 I;  4ASA A;  1KTV A;  1RR9 A;  4X62 E;  5F3K A;  1H72 C;  1MU5 A;  1S16 A;  2UUA E;  4CE2 A;  3B82 A;  4MYU A;  2CCT A;  3A0Y A;  1UYH A;  1IBM E;  1N36 I;  3CWV A;  2YEB A;  3H80 A;  4E02 A;  1ZM2 A;  4JI1 E;  3CRL A;  4JQL A;  2JKI A;  2UU9 I;  1BXD A;  4DR3 I;  2HHH I;  3CGY A;  4JI8 I;  2YEJ A;  4P7A A;  4GFN A;  5M4H A;  3J80 Q;  1H7U A;  1I5D A;  1YT1 A;  2JJC A;  2CZ9 A;  4DPU A;  2YK2 A;  4V25 A;  4B7P A;  2CCU A;  2V8P A;  2WW4 A;  4K4O A;  1Y8O A;  4CE1 A;  4Z7C A;  2NPF A;  1FJG E;  1UY9 A;  1Z0E A;  3Q1Q A;  1AMW A;  2XCM A;  3J80 C;  2WI2 A;  4DV7 I;  1YC4 A;  1HR0 I;  1QY8 A;  3HEK A;  3K17 A;  1IBL I;  4LF9 E;  1U2R A;  1UYL A;  3ZM7 A;  2V2V A;  1N32 I;  4OX9 E;  4FN5 A;  4GGL A;  1UY8 A;  1Z0B A;  3B25 A;  1FWL A;  3O6O A;  4BIU A;  1ZM3 A;  1I94 E;  1U2O A;  1B3Q A;  2IOQ A;  4R1F A;  2VF3 A;  2XHX A;  4DV2 I;  4MOT A;  3T10 A;  1J5E I;  4MPC A;  4V26 A;  4JG4 A;  3ZXQ A;  2YEI A;  3B27 A;  4EFT A;  2BV3 A;  4LFA I;  5M4E A;  2Q8F A;  2UUB I;  4R3A A;  1Z59 A;  4AWQ A;  3GON A;  3H4L A;  3QT7 A;  3ZKB A;  2X7I A;  5M4P A;  2VWC A;  4XIP A;  4B3S I;  1N34 E;  1HNX E;  4EGH A;  4DUY I;  1YC1 A;  4GKK E;  3FV5 A;  1YES A;  4LF6 I;  4JYA I;  4FWG A;  2O1U A;  3K60 A;  1FKA E;  3HUL A;  2IWX A;  4GKJ E;  5D7D A;  1XMQ I;  2BU5 A;  4XIR A;  2YE7 A;  3EHF A;  3HYY A;  3O0I A;  4USK A;  4KP4 A;  4NH8 A;  4X64 E;  4LF4 I;  4DV3 I;  2IWS A;  4PL9 A;  1Z0W A;  4X65 E;  5CPH A;  4YKT A;  3V5R A;  4CWT A;  3CRK A;  5J6A A;  4JI6 I;  1U0Z A;  3WU4 A;  1AM1 A;  4JAS A;  5BOD A;  3B8H A;  1US7 A;  4DV4 E;  1EI1 A;  2VQE I;  4LF5 E;  1UYI A;  2CG9 A;  2YEC A;  3B28 A;  3C0E A;  4CWQ A;  4BAE A;  4LFB I;  1AH6 A;  4LWE A;  4DR6 E;  1B63 A;  2BTZ A;  2UXC E;  2F4V I;  1YT2 A;  4URM A;  4HYM A;  4B3M I;  1A4H A;  4UTG A;  3BM9 A;  4PRX A;  1IBK I;  4ZVI A;  4JI3 E;  2ZIT A;  1HNZ I;  3HYZ A;  3Q5J A;  4R3M A;  3A0Z A;  5GGZ A;  2GQP A;  4AQY E;  4I3H A;  4DPX A;  4NH7 A;  1K47 A;  2V34 A;  5GMD A;  4LF7 E;  1AH8 A;  5J71 A;  4AWO A;  3GIG A;  3OTO E;  1VIS A;  2QFO A;  4DUH A;  1I5A A;  3GIE A;  3T1Y I;  3T1K A;  3U2K A;  1QZR A;  3F0N A;  3WQ9 A;  3T1H E;  2QG0 A;  3VHA A;  4LFC E;  4XTJ A;  3V2U C;  3B24 A;  3O2F A;  4WUB A;  3R4O A;  4DUZ I;  2VQF E;  2Q8I A;  5M4M A;  4K0K E;  2YKB A;  5C93 A;  4DV5 I;  5IWA I;  1ZXM A;  3HZ1 A;  1Z0G A;  4YKZ A;  4QPJ A;  3PYE A;  4YHH I;  2YE4 A;  4HAC A;  3TZ2 A;  2DEJ A;  4HZ5 A;  4MBC A;  5F5R A;  4XCL A;  2A2C A;  3PEJ A;  2Q8G A;  1S14 A;  1XHK A;  4DV6 E;  4B3R I;  1UYG A;  1I59 A;  4O05 A;  5IT9 Q;  2WEP A;  1Y8P A;  2HKJ A;  3JAM Q;  2WI6 A;  1YT0 A;  3OWD A;  3GIF A;  5IN9 A;  3M6A A;  1Z5B A;  4DPT A;  4LF8 E;  2HK2 A;  1PVG A;  3B78 A;  1ZXN A;  4FMT A;  4HZ0 A;  2XK2 A;  4DR5 E;  3GIG B;  1Z0V A;  2V2Z A;  1THN A;  2YE3 A;  4ASB A;  1MX0 A;  4EGI A;  2XAB A;  5IT9 C;  2XJX A;  2XX2 A;  2YEA A;  2UUC E;  3JAM C;  5FLX Q;  4KHP E;  2HFS A;  2C2A A;  4DV1 I;  4L94 A;  2WI7 A;  1N33 E;  2ZBK B;  5D6P A;  3NMQ A;  4NXN E;  4FCQ A;  3U67 A;  4ZKI A;  3K1J A;  3WU5 A;  3JZ3 A;  4YY3 E;  1H74 A;  4DU7 A;  1QYE A;  2YE9 A;  3T0H A;  4DR7 I;  1N0V C;  3WHA A;  4L93 A;  4DR1 E;  1I94 I;  5FLX C;  4X66 E;  4HAC B;  4FW9 A;  4M1K A;  2BM1 A;  2PNR A;  4QPK A;  1KKH A;  2YGE A;  4EMV A;  1H7S A;  2YE5 A;  1KZN A;  4ASG A;  4EFU A;  2XHR A;  2UXB E;  5BOC A;  2AJ4 A;  1ZW9 A;  1N36 E;  5CF0 A;  3INW A;  4HXW A;  2AKP A;  3LTO A;  4JI5 I;  1UEK A;  1D6T A;  2UU9 E;  2ESA A;  4DR3 E;  3RLR A;  2HHH E;  2DEI A;  4DV0 E;  4JI8 E;  3PYG A;  4JV5 I;  5M4K A;  2YI7 A;  4XIQ A;  2HK3 A;  5CTY A;  2ZM6 I;  3RLP A;  3SL2 A;  3EKR A;  3D36 A;  2BRC A;  2E0A A;  2BT0 A;  2FWY A;  3R4P A;  4GKJ I;  1B62 A;  4MPE A;  2J7K A;  4XCJ A;  1YSR A;  4LP0 A;  5FND A;  4MP7 A;  4DXL A;  4DV7 E;  4KTN A;  4CWO A;  1HR0 E;  1UYC A;  3TTZ A;  1IBL E;  4X64 I;  3Q5L A;  4LPB A;  4RPF A;  4JAV A;  1NHH A;  4X65 I;  2WI3 A;  4BXI A;  4DPW A;  1N32 E;  4JI7 I;  1AJ6 A;  4URO A;  4O09 A;  1HNW I;  3KE6 A;  4FWH A;  2YI5 A;  4GEE A;  2R3V A;  4LF5 I;  1NZ0 A;  2UXD E;  4HYP A;  1Z0C A;  2O1W A;  4O07 A;  1JM6 A;  2YE6 A;  4UT4 A;  3RLQ A;  5LL6 R;  4DZY A;  1TID A;  4DV2 E;  2XDU A;  4B3T I;  4L91 A;  1J5E E;  4JAU A;  3B26 A;  4XDM A;  4CWF A;  1XNQ I;  1UYE A;  3K98 A;  4LFA E;  4HXZ A;  4XKA A;  2UUB E;  1XNR I;  2X36 A;  4KSG A;  1A6F A;  3BMY A;  4EEH A;  2CCS A;  4O0B A;  2BU8 A;  3U2D A;  4B3S E;  2EXL A;  1YSZ A;  3OPD A;  3QT8 A;  4LWI A;  5A2Q Q;  1S4E A;  4DUY E;  5D6Q A;  5LMU I;  4FPP A;  3EHH A;  5FNC A;  4LF6 E;  3TZ0 A;  4B6C A;  4XKK A;  2YJX A;  1XMO E;  2BSM A;  4JI0 E;  5CTU A;  4W7T A;  4USM A;  4AS9 A;  1XMQ E;  4XIT A;  1MG7 A;  1ID0 A;  2VQF I;  5LMN I;  5A2Q C;  4KFG A;  1TC0 A;  1BYQ A;  2GS8 A;  3J7A M;  4JI2 I;  3QDD A;  2BRE A;  4JI4 I;  2CH4 A;  3TZ4 A;  2FWZ A;  4LF4 E;  3A0W A;  2BM0 A;  2A2D A;  1TBW A;  1I58 A;  3TZ5 A;  4DR2 I;  5BR8 I;  4CWN A;  5IDJ A;  1WUU A;  2YED A;  1UYF A;  4JI6 E;  1PIE A;  1TH8 A;  1DAR A;  4LWF A;  2VQE E;  3IED A;  1YS3 A;  3PEH A;  3A0R A;  2V2Q A;  4X62 I;  2XDS A;  4XC0 A;  5CTX A;  2R42 A;  2UUA I;  2F4V E;  4XE2 A;  4B3M E;  1IBM I;  4GCZ A;  1BGQ A;  2XHT A;  1Z5A A;  3WU6 A;  1IBK E;  4LF8 I;  1HNZ E;  4JI1 I;  3ZZT A;  4H7Q A;  3VHD A;  4H81 A;  3T2S A;  4BQJ A;  4P8O A;  3EHJ A;  5M4N A;  4ASF A;  3G75 A;  4U7O A;  4NXM E;  4YKW A;  4Z7Y A;  2FXS A;  2H8M A;  4CWS A;  4FCR A;  4URL A;  4MYT A;  1EA6 A;  3T1Y E;  2E5L E;  3TUH A;  3D4J A;  3INX A;  3OWB A;  4E01 A;  2XJG A;  2YKJ A;  4CE3 A;  2LJP A;  4EM7 A;  2K5B A;  4AWP A;  4DUZ E;  1FJG I;  4LWG A;  4E00 A;  4PRV A;  4DR1 I;  4XKO A;  4DV5 E;  1FNM A;  3RKZ A;  4H85 A;  4DR4 E;  3ZZU A;  1FI4 A;  5IWA E;  1Z5C A;  4FCP A;  4LF9 I;  3QT5 A;  2WEQ A;  2YGF A;  2HFU A;  4YHH E;  2XDX A;  4OX9 I;  5D7R A;  1TIL A;  4FWD A;  3FT5 A;  3ZKD A;  2UXB I;  2HG1 A;  4HY6 A;  1ELO A;  3LPS A;  1L0O A;  2ZDY A;  2YKE A;  4B3R E;  4DV0 I;  4Q20 A;  4O04 A;  1N0U A;  3CGZ A;  3HZ5 A;  4BIZ A; 
#chains in the Genus database with same CATH topology
 3NZK A;  4GT8 A;  3OW6 A;  2BZ5 A;  2VCI A;  3R4M A;  3K99 A;  4I5S A;  2CGF A;  2PO1 B;  3MNR P;  4MP2 A;  5C0X E;  3PYD A;  2Q2E B;  4NBQ A;  2PNZ B;  1GJV A;  4L8Z A;  1Y5Y A;  2J65 A;  5K36 F;  1N34 I;  1HNX I;  2C1I A;  4LWH A;  5CTW A;  3Q6N A;  2BA0 G;  2BU6 A;  5FWK A;  4GKK I;  4PU9 A;  5C0X A;  4KSH A;  3R4N A;  4DV1 E;  2BU2 A;  2BYH A;  3G7B A;  4DPY A;  4BQG A;  2YI0 A;  2YKC A;  2HCH A;  4HY1 A;  2UXD I;  4DR7 E;  1ZM9 A;  2C37 A;  1GKX A;  5GME A;  4KQV A;  1I5C A;  2WI5 A;  3DGE A;  2YKI A;  1FWK A;  2YK9 A;  5K36 B;  5IDM A;  1Y4U A;  5L3J A;  4EMD A;  1OSF A;  3GCM A;  2XD6 A;  4XD8 A;  2YGA A;  4OO1 C;  3P3E A;  4DV4 I;  3HKM A;  4WUC A;  1UYD A;  5C0X F;  2O3Z A;  3Q5K A;  3D0B A;  4JI5 E;  3P06 A;  3G7E A;  3EHG A;  4DR6 I;  2IWU A;  2UXC I;  4AM3 A;  2YI6 A;  1Z0T A;  3WU3 A;  4JV5 E;  2E1R A;  4WUD A;  1YER A;  2ZM6 E;  2WI1 A;  4JI3 I;  2OI2 A;  1NHJ A;  3D2R A;  3QTF A;  1R62 A;  3T0Z A;  4MPN A;  1XMO I;  4JI0 I;  3J81 Q;  2CVE A;  4AQY I;  3C11 A;  3VAD A;  4CWP A;  4FW6 A;  2YJW A;  5C0X B;  2QF6 A;  4EGK A;  3LNU A;  3PYF A;  4LF7 I;  3OMU A;  1OJ4 A;  3A0X A;  3OTO I;  1TC6 A;  4YKY A;  4JYA E;  3ZXO A;  1NHI A;  4YKX A;  3VHC A;  1PKP A;  3T1H I;  2IOP A;  3J7A G;  2H55 A;  3M7N G;  4LFC I;  4OO1 E;  2C37 B;  3J81 C;  4JI7 E;  4YKR A;  3GME A;  2YEG A;  1HNW E;  3R91 A;  1I5B A;  2XX5 A;  4K0K I;  2XDK A;  3R92 A;  3U1K A;  2YEF A;  1KVK A;  2BYI A;  2YE2 A;  2XDL A;  1YH8 A;  4P52 A;  4DV3 E;  2HHI A;  2QG2 A;  2YEH A;  2PNM A;  4B3T E;  2IOR A;  2YE8 A;  2VCJ A;  1XNQ E;  1XNR E;  2WER A;  2XJJ A;  2XX4 A;  4U7N A;  4DV6 I;  2EFG A;  5D7C A;  4LFB E;  2Q8H A;  4ED4 A;  3A0T A;  1YET A;  5DRQ A;  3P76 A;  1UY6 A;  1ZM4 A;  2GO4 A;  2FYP A;  2ZKJ A;  2WI4 A;  3HHU A;  3QT6 A;  2XEX A;  4DU8 A;  5LMU E;  4NXM I;  1UYK A;  2VW5 A;  4L90 A;  4OO1 F;  2GFD A;  5FNF A;  1UDQ A;  2E5L I;  3K97 A;  1UY7 A;  1USU A;  1Y4S A;  2HKE A;  4YKU A;  2PO2 A;  4DR5 I;  4NH9 A;  5JEA C;  4MB9 A;  4YKQ A;  4URN A;  4LOM A;  3EKO A;  1KIJ A;  4ISA A;  3ZZ0 A;  5LMN E;  1RRE A;  2UUC I;  4KHP I;  1Y8N A;  4JI2 E;  4CWR A;  4DR4 I;  2BU7 A;  4JI4 E;  2ZDX A;  4GQT A;  4IFD E;  1N33 I;  2UWD A;  2VES A;  4NXN I;  1OYR A;  5BR8 E;  4DR2 E;  1YC3 A;  1H73 A;  4X9L A;  1UYM A;  4U3B A;  4U93 A;  4YY3 I;  3M85 D;  3PS1 A;  3FT8 A;  1BKN A;  1GKZ A;  1ZWH A;  2YEE A;  2O1V A;  4X66 I;  4IFD A;  4ASA A;  1KTV A;  3B4T A;  1RR9 A;  1VI7 A;  4X62 E;  5F3K A;  1H72 C;  1MU5 A;  2BA1 D;  1S16 A;  2UUA E;  4QNJ A;  3H1C A;  4CE2 A;  3B82 A;  4MYU A;  2CCT A;  3A0Y A;  1UYH A;  1IBM E;  1N36 I;  3CWV A;  2YEB A;  3H80 A;  4E02 A;  1ZM2 A;  4JI1 E;  3CRL A;  4JQL A;  3S5T A;  2JKI A;  2PO0 A;  2NN6 C;  2UU9 I;  1BXD A;  4N3O A;  4DR3 I;  2HHH I;  3CGY A;  4JI8 I;  2YEJ A;  4P7A A;  4GFN A;  5M4H A;  3J80 Q;  1H7U A;  1I5D A;  1YT1 A;  4IFD F;  1YHC A;  2PO2 B;  2JJC A;  2CZ9 A;  4DPU A;  2YK2 A;  4V25 A;  4B7P A;  2CCU A;  2V8P A;  2WW4 A;  4LPF A;  4K4O A;  1Y8O A;  4CE1 A;  1Y6Z A;  2C38 A;  4Z7C A;  2NPF A;  1FJG E;  1UY9 A;  1Z0E A;  3Q1Q A;  1AMW A;  1UDS A;  2XCM A;  3J80 C;  2WI2 A;  4IZJ A;  4DV7 I;  1YC4 A;  1HR0 I;  1RHY A;  1QY8 A;  3K17 A;  3HEK A;  1IBL I;  4LF9 E;  4MU4 A;  1U2R A;  1UYL A;  3ZM7 A;  3KRN A;  2V2V A;  1N32 I;  4OX9 E;  4FN5 A;  4GGL A;  4IFD B;  2WNR A;  1UY8 A;  1OYS A;  1Z0B A;  3B25 A;  4URO A;  1FWL A;  3O6O A;  4BIU A;  1IXM A;  1ZM3 A;  1I94 E;  1U2O A;  2IOQ A;  1B3Q A;  4R1F A;  3PRY A;  2VF3 A;  2XHX A;  3M85 G;  4DV2 I;  4MOT A;  3T10 A;  1J5E I;  4MPC A;  4V26 A;  4JG4 A;  3ZXQ A;  2YEI A;  3B27 A;  4EFT A;  2BV3 A;  4LFA I;  2PO0 B;  5M4E A;  2Q8F A;  2UUB I;  2BA1 G;  4R3A A;  1Z59 A;  4AWQ A;  3GON A;  3H4L A;  3QT7 A;  2WP8 A;  3ZKB A;  2X7I A;  5M4P A;  2VWC A;  4XIP A;  4B3S I;  2BR2 A;  1N34 E;  1HNX E;  4EGH A;  4DUY I;  1YC1 A;  4GKK E;  3CYG A;  3FV5 A;  1YES A;  4LF6 I;  1Y60 A;  4JYA I;  2O1U A;  4FWG A;  2C38 B;  3K60 A;  1FKA E;  3HUL A;  5JEN A;  2IWX A;  4GKJ E;  5JEA D;  5D7D A;  1XXE A;  4IZJ B;  5DRO A;  1XMQ I;  2BU5 A;  4XIR A;  2YE7 A;  3EHF A;  4AIM A;  3HYY A;  3O0I A;  4USK A;  5K36 D;  4KP4 A;  2WNR B;  4NH8 A;  4BA1 A;  4X64 E;  3K85 A;  4LF4 I;  4DV3 I;  5DNX A;  2IWS A;  1Z0W A;  4X65 E;  4PL9 A;  4YKT A;  5CPH A;  3V5R A;  3P3G A;  4CWT A;  3CRK A;  5J6A A;  4JI6 I;  1U0Z A;  3WU4 A;  1AM1 A;  4JAS A;  5BOD A;  3B8H A;  4IZK A;  4DV4 E;  1EI1 A;  2CG9 A;  2VQE I;  4LF5 E;  1US7 A;  1UYI A;  2YEC A;  3B28 A;  1UDO A;  3C0E A;  4CWQ A;  4BAE A;  4OO1 A;  4LFB I;  1AH6 A;  4LWE A;  4DR6 E;  1B63 A;  2BTZ A;  2UXC E;  2F4V I;  1YT2 A;  4URM A;  4HYM A;  4B3M I;  1A4H A;  2WP8 B;  4UTG A;  2IER A;  3BM9 A;  4PRX A;  1IBK I;  4ZVI A;  4JI3 E;  2ZIT A;  1HNZ I;  2BR2 B;  2NN6 D;  3HYZ A;  3Q5J A;  4R3M A;  3A0Z A;  5GGZ A;  2GQP A;  1OYP A;  4AQY E;  4I3H A;  4DPX A;  4MU1 A;  4NH7 A;  1K47 A;  2V34 A;  1HK7 A;  5GMD A;  2Z5B A;  4LF7 E;  3L7Z A;  1AH8 A;  5J71 A;  4AWO A;  2AE8 A;  3GIG A;  2F1D A;  3OTO E;  1VIS A;  2QFO A;  4DUH A;  1I5A A;  3GIE A;  3T1Y I;  3T1K A;  3U2K A;  1QZR A;  3F0N A;  3WQ9 A;  3T1H E;  2QG0 A;  3VHA A;  4QNK A;  4LFC E;  4XTJ A;  3V2U C;  3B24 A;  3O2F A;  2GO3 A;  4WUB A;  3R4O A;  4DUZ I;  4BA1 B;  2VQF E;  2Q8I A;  4K0K E;  2YKB A;  5C93 A;  5M4M A;  4DV5 I;  5IWA I;  1ZXM A;  3HZ1 A;  1Z0G A;  4OZE A;  4YKZ A;  5K36 C;  4QPJ A;  3PYE A;  4YHH I;  4IZK B;  2YE4 A;  4E00 A;  4IS9 A;  4HAC A;  3CDI A;  4OO1 B;  2DEJ A;  4HZ5 A;  4MBC A;  5F5R A;  4XCL A;  3TZ2 A;  2A2C A;  3PEJ A;  2Q8G A;  1S14 A;  1XHK A;  4DV6 E;  4B3R I;  1UYG A;  1I59 A;  4O05 A;  5IT9 Q;  2WEP A;  1Y8P A;  2HKJ A;  3JAM Q;  2WI6 A;  1YT0 A;  1R6L A;  3OWD A;  3GIF A;  5IN9 A;  3M6A A;  1R6M A;  1Z5B A;  4OKG A;  2HK2 A;  4DPT A;  4LF8 E;  1PVG A;  3B78 A;  1ZXN A;  5JEA E;  1E3P A;  2Z5B B;  4FMT A;  3L7Z B;  4HZ0 A;  2XK2 A;  4DR5 E;  3GIG B;  1Z0V A;  2V2Z A;  1THN A;  2YE3 A;  4ASB A;  1MX0 A;  4EGI A;  5C0X C;  2XAB A;  5IT9 C;  2XJX A;  4MDT A;  2XX2 A;  2YEA A;  4MU3 A;  3JAM C;  2UUC E;  5FLX Q;  5JEA A;  4KHP E;  1UDN A;  5DRR A;  2HFS A;  2C2A A;  4DV1 I;  4L94 A;  2WI7 A;  1N33 E;  2ZBK B;  5D6P A;  3NMQ A;  3Q6M A;  4NXN E;  4FCQ A;  2FTK A;  3U67 A;  4ZKI A;  2Z5E A;  3K1J A;  3WU5 A;  3JZ3 A;  4YY3 E;  3LMM A;  1H74 A;  4DU7 A;  1QYE A;  2YE9 A;  3T0H A;  4DR7 I;  1N0V C;  3WHA A;  4L93 A;  4DR1 E;  1I94 I;  5FLX C;  4X66 E;  4HAC B;  4FW9 A;  4M1K A;  2BM1 A;  2PNR A;  4QPK A;  1KKH A;  5EL9 A;  2YGE A;  4EMV A;  1H7S A;  2YE5 A;  1KZN A;  4ASG A;  4EFU A;  2XHR A;  2UXB E;  5BOC A;  5JEA F;  2AJ4 A;  1ZW9 A;  1N36 E;  2NN6 E;  5CF0 A;  3INW A;  4HXW A;  2AKP A;  2JEA A;  3LTO A;  4JI5 I;  1UEK A;  1D6T A;  2UU9 E;  2ESA A;  4DR3 E;  3RLR A;  2HHH E;  2DEI A;  4DV0 E;  2NN6 A;  4JI8 E;  3PYG A;  4JV5 I;  5M4K A;  4U3D A;  3M7N D;  2YI7 A;  4XIQ A;  2HK3 A;  5CTY A;  2ZM6 I;  3RLP A;  3SL2 A;  3EKR A;  3DD6 A;  3D36 A;  2Z5C A;  3GLL A;  2BRC A;  2E0A A;  2BT0 A;  2FWY A;  3R4P A;  4GKJ I;  1B62 A;  4MPE A;  2CGE A;  2J7K A;  2JT2 A;  5JEA B;  4XCJ A;  1YSR A;  4LP0 A;  5FND A;  4MP7 A;  4DXL A;  4MU0 A;  4DV7 E;  4KTN A;  4CWO A;  1HR0 E;  1UYC A;  5DNL A;  1IBL E;  4X64 I;  3Q5L A;  4LPB A;  3TTZ A;  4RPF A;  4JAV A;  1NHH A;  4X65 I;  2WI3 A;  4BXI A;  4DPW A;  1N32 E;  3CDJ A;  4JI7 I;  4IFD D;  2NN6 F;  1AJ6 A;  4O09 A;  1HNW I;  3KE6 A;  4FW3 A;  4FWH A;  2YI5 A;  4GEE A;  2R3V A;  4LF5 I;  1NZ0 A;  2UXD E;  4HYP A;  1Z0C A;  2O1W A;  3PS3 A;  4O07 A;  1JM6 A;  2YE6 A;  4UT4 A;  3RLQ A;  5LL6 R;  2JE6 A;  4DZY A;  1TID A;  4DV2 E;  2XDU A;  4B3T I;  4L91 A;  1J5E E;  4JAU A;  3B26 A;  4XDM A;  4CWF A;  2JEA B;  1XNQ I;  1UYE A;  3K98 A;  4LFA E;  4HXZ A;  4XKA A;  2UUB E;  1XNR I;  2X36 A;  4KSG A;  1A6F A;  3U1Y A;  3BMY A;  4EEH A;  2NN6 B;  2CCS A;  4O0B A;  2BU8 A;  4LCF A;  4BA2 A;  4MQY A;  4B3S E;  2EXL A;  1YSZ A;  2C1G A;  3QT8 A;  3OPD A;  4LWI A;  5A2Q Q;  1S4E A;  2Z5C B;  4DUY E;  5D6Q A;  5LMU I;  1USV A;  4FW4 A;  4LCG A;  3EHH A;  4FPP A;  4LF6 E;  5FNC A;  3TZ0 A;  3U2D A;  4XKK A;  4B6C A;  2YJX A;  1XMO E;  2BSM A;  4JI0 E;  4IZJ D;  5CTU A;  5C0X D;  4W7T A;  4USM A;  4AS9 A;  1XMQ E;  4XIT A;  1MG7 A;  1ID0 A;  2VQF I;  5LMN I;  4E72 A;  5A2Q C;  4KFG A;  1TC0 A;  1BYQ A;  2GS8 A;  3PS2 A;  4JI2 I;  3J7A M;  3QDD A;  2BRE A;  4JI4 I;  2CH4 A;  3TZ4 A;  2FWZ A;  4LF4 E;  3A0W A;  2IES A;  2BM0 A;  2A2D A;  4FW5 A;  1I58 A;  1TBW A;  4DR2 I;  5BR8 I;  3TZ5 A;  4CWN A;  5IDJ A;  1WUU A;  5ELW A;  2YED A;  1UYF A;  4IFD C;  4JI6 E;  1PIE A;  1TH8 A;  1DAR A;  4LWF A;  2JE6 B;  2C39 A;  2VQE E;  3IED A;  1YS3 A;  3PEH A;  3A0R A;  2V2Q A;  4X62 I;  2XDS A;  4XC0 A;  5CTX A;  2R42 A;  2UUA I;  3P3C A;  2F4V E;  1E3H A;  4XE2 A;  4GQU A;  2PNL A;  4B3M E;  1IBM I;  4GCZ A;  1BGQ A;  2XHT A;  1Z5A A;  3WU6 A;  1IBK E;  2JEB A;  4LF8 I;  1HNZ E;  4JI1 I;  3ZZT A;  4BA2 B;  2BA0 D;  4H7Q A;  3VHD A;  4H81 A;  3T2S A;  5EKW A;  4BQJ A;  1F51 A;  4P8O A;  3EHJ A;  5M4N A;  4ASF A;  2PO1 A;  3G75 A;  2PNZ A;  4U7O A;  4NXM E;  4YKW A;  4Z7Y A;  2FXS A;  2H8M A;  4CWS A;  4FCR A;  4URL A;  4MYT A;  1EA6 A;  3T1Y E;  2E5L E;  4FW7 A;  3D4J A;  3TUH A;  3INX A;  3OWB A;  4E01 A;  2XJG A;  4LCH A;  2YKJ A;  4CE3 A;  2LJP A;  4EM7 A;  2K5B A;  4AWP A;  4DUZ E;  1FJG I;  2GQ0 A;  4LWG A;  5K36 E;  4PRV A;  4DR1 I;  4XKO A;  4DV5 E;  1FNM A;  3RKZ A;  4H85 A;  4DR4 E;  3ZZU A;  1FI4 A;  5IWA E;  1Z5C A;  4FCP A;  4LF9 I;  3QT5 A;  2WEQ A;  2YGF A;  2HFU A;  4YHH E;  2XDX A;  2C39 B;  5DRP A;  4OX9 I;  5D7R A;  4OO1 D;  4FWD A;  1TIL A;  5K36 A;  3FT5 A;  4J3D A;  3ZKD A;  2UXB I;  3HJC A;  2HG1 A;  4HY6 A;  1ELO A;  3LPS A;  1L0O A;  1P42 A;  3UHM A;  2ZDY A;  2YKE A;  4B3R E;  2JEB B;  4DV0 I;  4Q20 A;  4O04 A;  1N0U A;  2O1T A;  3CGZ A;  3HZ5 A;  4BIZ A;  4AID A; 
#chains in the Genus database with same CATH homology
 4GT8 A;  3OW6 A;  2BZ5 A;  2VCI A;  3R4M A;  3K99 A;  4I5S A;  2CGF A;  3MNR P;  4MP2 A;  3PYD A;  2Q2E B;  1GJV A;  4L8Z A;  1N34 I;  1HNX I;  4LWH A;  5CTW A;  3Q6N A;  2BU6 A;  5FWK A;  4GKK I;  4PU9 A;  4KSH A;  3R4N A;  4DV1 E;  2BU2 A;  2BYH A;  3G7B A;  4DPY A;  4BQG A;  2YI0 A;  2YKC A;  2HCH A;  4HY1 A;  2UXD I;  4DR7 E;  1ZM9 A;  1GKX A;  1I5C A;  5GME A;  4KQV A;  2WI5 A;  3DGE A;  2YKI A;  1FWK A;  2YK9 A;  5IDM A;  1Y4U A;  5L3J A;  4EMD A;  1OSF A;  2XD6 A;  4XD8 A;  2YGA A;  4DV4 I;  4WUC A;  1UYD A;  3Q5K A;  3D0B A;  4JI5 E;  3P06 A;  3G7E A;  3EHG A;  4DR6 I;  2IWU A;  2UXC I;  2YI6 A;  1Z0T A;  3WU3 A;  4JV5 E;  2E1R A;  4WUD A;  1YER A;  2ZM6 E;  2WI1 A;  4JI3 I;  2OI2 A;  1NHJ A;  3D2R A;  3QTF A;  1R62 A;  3T0Z A;  4MPN A;  1XMO I;  4JI0 I;  3J81 Q;  4CWP A;  4AQY I;  3C11 A;  3VAD A;  2YJW A;  2QF6 A;  4EGK A;  3LNU A;  3PYF A;  4LF7 I;  3OMU A;  1OJ4 A;  3A0X A;  3OTO I;  1TC6 A;  4YKY A;  4JYA E;  3ZXO A;  1NHI A;  4YKX A;  3VHC A;  1PKP A;  3T1H I;  2IOP A;  3J7A G;  2H55 A;  4LFC I;  3J81 C;  4JI7 E;  4YKR A;  2YEG A;  3R91 A;  1HNW E;  1I5B A;  2XX5 A;  4K0K I;  2XDK A;  3R92 A;  2YEF A;  1KVK A;  2BYI A;  2YE2 A;  2XDL A;  4P52 A;  4DV3 E;  2YEH A;  2QG2 A;  2PNM A;  4B3T E;  2IOR A;  2YE8 A;  2VCJ A;  1XNQ E;  1XNR E;  2WER A;  2XJJ A;  2XX4 A;  4U7N A;  4DV6 I;  2EFG A;  5D7C A;  4LFB E;  2Q8H A;  4ED4 A;  3A0T A;  1YET A;  1UY6 A;  1ZM4 A;  2FYP A;  2ZKJ A;  2WI4 A;  3HHU A;  3QT6 A;  2XEX A;  4DU8 A;  5LMU E;  4NXM I;  1UYK A;  2VW5 A;  4L90 A;  2GFD A;  5FNF A;  2E5L I;  3K97 A;  1UY7 A;  1USU A;  1Y4S A;  2HKE A;  4YKU A;  4NH9 A;  4DR5 I;  4MB9 A;  4YKQ A;  4URN A;  3EKO A;  1KIJ A;  3ZZ0 A;  5LMN E;  1RRE A;  2UUC I;  4KHP I;  1Y8N A;  4JI2 E;  4CWR A;  4DR4 I;  2BU7 A;  4JI4 E;  2ZDX A;  4GQT A;  1N33 I;  2UWD A;  4DR2 E;  4NXN I;  5BR8 E;  1YC3 A;  4X9L A;  1H73 A;  1UYM A;  4U93 A;  4YY3 I;  3FT8 A;  1BKN A;  1GKZ A;  1ZWH A;  2YEE A;  2O1V A;  4X66 I;  4ASA A;  1KTV A;  1RR9 A;  4X62 E;  5F3K A;  1H72 C;  1MU5 A;  1S16 A;  2UUA E;  4CE2 A;  3B82 A;  4MYU A;  2CCT A;  3A0Y A;  1UYH A;  1IBM E;  1N36 I;  3CWV A;  2YEB A;  3H80 A;  4E02 A;  1ZM2 A;  4JI1 E;  3CRL A;  4JQL A;  2JKI A;  2UU9 I;  1BXD A;  4N3O A;  4DR3 I;  2HHH I;  3CGY A;  4JI8 I;  2YEJ A;  4P7A A;  4GFN A;  5M4H A;  3J80 Q;  1H7U A;  1I5D A;  1YT1 A;  2JJC A;  2CZ9 A;  4DPU A;  2YK2 A;  4V25 A;  4B7P A;  2CCU A;  2V8P A;  2WW4 A;  4K4O A;  1Y8O A;  4CE1 A;  1Y6Z A;  4Z7C A;  2NPF A;  1FJG E;  1UY9 A;  1Z0E A;  3Q1Q A;  1AMW A;  2XCM A;  3J80 C;  2WI2 A;  4IZJ A;  4DV7 I;  1YC4 A;  1HR0 I;  1QY8 A;  3HEK A;  3K17 A;  1IBL I;  4LF9 E;  1U2R A;  1UYL A;  3ZM7 A;  2V2V A;  1N32 I;  4OX9 E;  4FN5 A;  4GGL A;  1UY8 A;  1Z0B A;  3B25 A;  1FWL A;  3O6O A;  4BIU A;  1ZM3 A;  1I94 E;  1U2O A;  2IOQ A;  1B3Q A;  4R1F A;  3PRY A;  2VF3 A;  2XHX A;  4DV2 I;  4MOT A;  3T10 A;  1J5E I;  4MPC A;  4V26 A;  4JG4 A;  3ZXQ A;  2YEI A;  3B27 A;  4EFT A;  2BV3 A;  4LFA I;  5M4E A;  2Q8F A;  2UUB I;  4R3A A;  1Z59 A;  4AWQ A;  3GON A;  3H4L A;  3QT7 A;  3ZKB A;  2X7I A;  5M4P A;  2VWC A;  4XIP A;  4B3S I;  1N34 E;  1HNX E;  4EGH A;  4DUY I;  1YC1 A;  4GKK E;  3FV5 A;  1YES A;  4LF6 I;  4JYA I;  2O1U A;  4FWG A;  3K60 A;  1FKA E;  3HUL A;  2IWX A;  4GKJ E;  5D7D A;  4IZJ B;  1XMQ I;  2BU5 A;  4XIR A;  2YE7 A;  3EHF A;  3HYY A;  3O0I A;  4USK A;  4KP4 A;  4NH8 A;  4X64 E;  3K85 A;  4LF4 I;  4DV3 I;  2IWS A;  4PL9 A;  1Z0W A;  4X65 E;  5CPH A;  4YKT A;  3V5R A;  4CWT A;  3CRK A;  5J6A A;  4JI6 I;  1U0Z A;  3WU4 A;  1AM1 A;  4JAS A;  5BOD A;  3B8H A;  4IZK A;  4DV4 E;  1EI1 A;  2CG9 A;  2VQE I;  4LF5 E;  1US7 A;  1UYI A;  2YEC A;  3B28 A;  3C0E A;  4CWQ A;  4BAE A;  4LFB I;  1AH6 A;  4LWE A;  4DR6 E;  1B63 A;  2BTZ A;  2UXC E;  2F4V I;  1YT2 A;  4URM A;  4HYM A;  4B3M I;  1A4H A;  4UTG A;  3BM9 A;  4PRX A;  1IBK I;  4ZVI A;  4JI3 E;  2ZIT A;  1HNZ I;  3HYZ A;  3Q5J A;  4R3M A;  3A0Z A;  5GGZ A;  2GQP A;  4AQY E;  4I3H A;  4DPX A;  4NH7 A;  1K47 A;  2V34 A;  1HK7 A;  2Z5B A;  5GMD A;  4LF7 E;  1AH8 A;  5J71 A;  4AWO A;  3GIG A;  3OTO E;  1VIS A;  2QFO A;  4DUH A;  1I5A A;  3GIE A;  3T1Y I;  3T1K A;  3U2K A;  1QZR A;  3F0N A;  3WQ9 A;  3T1H E;  2QG0 A;  3VHA A;  4LFC E;  4XTJ A;  3V2U C;  3B24 A;  3O2F A;  4WUB A;  3R4O A;  4DUZ I;  2VQF E;  2Q8I A;  5M4M A;  4K0K E;  2YKB A;  5C93 A;  4DV5 I;  5IWA I;  1ZXM A;  3HZ1 A;  1Z0G A;  4YKZ A;  4QPJ A;  3PYE A;  4YHH I;  4IZK B;  2YE4 A;  4HAC A;  3TZ2 A;  2DEJ A;  4HZ5 A;  4MBC A;  5F5R A;  4XCL A;  2A2C A;  3PEJ A;  2Q8G A;  1S14 A;  1XHK A;  4DV6 E;  4B3R I;  1UYG A;  1I59 A;  4O05 A;  5IT9 Q;  2WEP A;  1Y8P A;  2HKJ A;  3JAM Q;  2WI6 A;  1YT0 A;  3OWD A;  3GIF A;  5IN9 A;  3M6A A;  1Z5B A;  4DPT A;  4LF8 E;  2HK2 A;  1PVG A;  3B78 A;  1ZXN A;  2Z5B B;  4FMT A;  4HZ0 A;  2XK2 A;  4DR5 E;  3GIG B;  1Z0V A;  2V2Z A;  1THN A;  2YE3 A;  4ASB A;  1MX0 A;  4EGI A;  2XAB A;  5IT9 C;  2XJX A;  2XX2 A;  2YEA A;  2UUC E;  3JAM C;  5FLX Q;  4KHP E;  2HFS A;  2C2A A;  4DV1 I;  4L94 A;  2WI7 A;  1N33 E;  2ZBK B;  5D6P A;  3NMQ A;  3Q6M A;  4NXN E;  4FCQ A;  3U67 A;  4ZKI A;  2Z5E A;  3K1J A;  3WU5 A;  3JZ3 A;  4YY3 E;  1H74 A;  4DU7 A;  1QYE A;  2YE9 A;  3T0H A;  4DR7 I;  1N0V C;  3WHA A;  4L93 A;  4DR1 E;  1I94 I;  5FLX C;  4X66 E;  4HAC B;  4FW9 A;  4M1K A;  2BM1 A;  2PNR A;  4QPK A;  1KKH A;  2YGE A;  4EMV A;  1H7S A;  2YE5 A;  1KZN A;  4ASG A;  4EFU A;  2XHR A;  2UXB E;  5BOC A;  2AJ4 A;  1ZW9 A;  1N36 E;  5CF0 A;  3INW A;  4HXW A;  2AKP A;  3LTO A;  4JI5 I;  1UEK A;  1D6T A;  2UU9 E;  2ESA A;  4DR3 E;  3RLR A;  2HHH E;  2DEI A;  4DV0 E;  4JI8 E;  3PYG A;  4JV5 I;  5M4K A;  2YI7 A;  4XIQ A;  2HK3 A;  5CTY A;  2ZM6 I;  3RLP A;  3SL2 A;  3EKR A;  3D36 A;  2Z5C A;  2BRC A;  2E0A A;  2BT0 A;  2FWY A;  3R4P A;  4GKJ I;  1B62 A;  4MPE A;  2CGE A;  2J7K A;  4XCJ A;  1YSR A;  4LP0 A;  5FND A;  4MP7 A;  4DXL A;  4DV7 E;  4KTN A;  4CWO A;  1HR0 E;  1UYC A;  3TTZ A;  1IBL E;  4X64 I;  3Q5L A;  4LPB A;  4RPF A;  4JAV A;  1NHH A;  4X65 I;  2WI3 A;  4BXI A;  4DPW A;  1N32 E;  4JI7 I;  1AJ6 A;  4URO A;  4O09 A;  1HNW I;  3KE6 A;  4FWH A;  2YI5 A;  4GEE A;  2R3V A;  4LF5 I;  1NZ0 A;  2UXD E;  4HYP A;  1Z0C A;  2O1W A;  4O07 A;  1JM6 A;  2YE6 A;  4UT4 A;  3RLQ A;  5LL6 R;  4DZY A;  1TID A;  4DV2 E;  2XDU A;  4B3T I;  4L91 A;  1J5E E;  4JAU A;  3B26 A;  4XDM A;  4CWF A;  1XNQ I;  1UYE A;  3K98 A;  4LFA E;  4HXZ A;  4XKA A;  2UUB E;  1XNR I;  2X36 A;  4KSG A;  1A6F A;  3BMY A;  4EEH A;  2CCS A;  4O0B A;  2BU8 A;  3U2D A;  4B3S E;  2EXL A;  1YSZ A;  3OPD A;  3QT8 A;  4LWI A;  5A2Q Q;  1S4E A;  2Z5C B;  4DUY E;  5D6Q A;  5LMU I;  1USV A;  3EHH A;  4FPP A;  5FNC A;  4LF6 E;  3TZ0 A;  4B6C A;  4XKK A;  2YJX A;  1XMO E;  2BSM A;  4JI0 E;  4IZJ D;  5CTU A;  4W7T A;  4USM A;  4AS9 A;  1XMQ E;  4XIT A;  1MG7 A;  1ID0 A;  2VQF I;  5LMN I;  5A2Q C;  4KFG A;  1TC0 A;  1BYQ A;  2GS8 A;  3J7A M;  4JI2 I;  3QDD A;  2BRE A;  4JI4 I;  2CH4 A;  3TZ4 A;  2FWZ A;  4LF4 E;  3A0W A;  2BM0 A;  2A2D A;  1TBW A;  1I58 A;  3TZ5 A;  4DR2 I;  5BR8 I;  4CWN A;  5IDJ A;  1WUU A;  2YED A;  1UYF A;  4JI6 E;  1PIE A;  1TH8 A;  1DAR A;  4LWF A;  2VQE E;  3IED A;  1YS3 A;  3PEH A;  3A0R A;  2V2Q A;  4X62 I;  2XDS A;  4XC0 A;  5CTX A;  2R42 A;  2UUA I;  2F4V E;  4XE2 A;  2PNL A;  4B3M E;  1IBM I;  4GCZ A;  1BGQ A;  2XHT A;  1Z5A A;  3WU6 A;  1IBK E;  4LF8 I;  1HNZ E;  4JI1 I;  3ZZT A;  4H7Q A;  3VHD A;  4H81 A;  3T2S A;  4BQJ A;  4P8O A;  3EHJ A;  5M4N A;  4ASF A;  3G75 A;  4U7O A;  4NXM E;  4YKW A;  4Z7Y A;  2FXS A;  2H8M A;  4CWS A;  4FCR A;  4URL A;  4MYT A;  1EA6 A;  3T1Y E;  2E5L E;  3TUH A;  3D4J A;  3INX A;  3OWB A;  4E01 A;  2XJG A;  2YKJ A;  4CE3 A;  2LJP A;  4EM7 A;  2K5B A;  4AWP A;  4DUZ E;  1FJG I;  2GQ0 A;  4LWG A;  4E00 A;  4PRV A;  4DR1 I;  4XKO A;  4DV5 E;  1FNM A;  3RKZ A;  4H85 A;  4DR4 E;  3ZZU A;  1FI4 A;  5IWA E;  1Z5C A;  4FCP A;  4LF9 I;  3QT5 A;  2WEQ A;  2YGF A;  2HFU A;  4YHH E;  2XDX A;  4OX9 I;  5D7R A;  1TIL A;  4FWD A;  3FT5 A;  3ZKD A;  2UXB I;  2HG1 A;  3HJC A;  4HY6 A;  1ELO A;  3LPS A;  1L0O A;  2ZDY A;  2YKE A;  4B3R E;  4DV0 I;  4Q20 A;  4O04 A;  1N0U A;  2O1T A;  3CGZ A;  3HZ5 A;  4BIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...