1BKNA

Crystal structure of an n-terminal 40kd fragment of e. coli dna mismatch repair protein mutl
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
312
structure length
272
Chain Sequence
VERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCGIKKDELALALAIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAWQAYAVTVKPAAHPVGTTLEVLDTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVSRLVHDFIYQGVLSVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUTL
publication title Crystal structure and ATPase activity of MutL: implications for DNA repair and mutagenesis.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Dna repair
total genus 75
structure length 272
sequence length 312
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain
A PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1bknA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1bknA01
4MYTA 2IWXA 1H7UA 4JI3I 4YKQA 4YKXA 4DV3I 1PIEA 4DR4I 4B7PA 1S16A 4LF7E 2E0AA 4X62E 1HNZE 5BR8E 2XX2A 3CGZA 4BAEA 3INXA 4AWQA 2Q8IA 2XHRA 2VQEI 2YI7A 4V26A 1Y4SA 3R91A 3Q1QA 5BOCA 4DV6E 5M4NA 4DPXA 3WU6A 4XKKA 4LFBI 3RLPA 2YKCA 5IT9Q 3RKZA 3T1YE 3GIGA 1UYFA 3CGYA 4DV4I 2ESAA 2WI2A 2UUCE 4XIRA 2YGFA 2UU9E 4LF4I 2A2DA 4DUZI 4FCPA 4B3ME 1FI4A 2IOPA 3EKOA 2HK3A 2YGAA 2UXBI 3B82A 4JAUA 4H7QA 4AQYI 1IBKI 4URMA 2BRCA 4MPEA 4YY3E 1Z0CA 3J7AM 2XABA 4ASBA 3K17A 1TC0A 2XDXA 1UY7A 4EM7A 1H72C 2DEIA 3OTOE 1KKHA 4NXMI 2C2AA 5CF0A 4JI5I 4CWQA 4GKJI 5IDJA 1XMQI 2HKJA 2HKEA 4JI0E 4FWHA 4DV5I 1AH8A 1QY8A 3B28A 3VHCA 1K47A 4DR1I 5J71A 2JJCA 2IOQA 2QFOA 3PYGA 4DR6E 4CE3A 4XDMA 1VISA 4LF9I 4XKOA 5LMNE 4O09A 3B8HA 1Z0VA 3D2RA 3TUHA 1U2OA 1HNWI 1WUUA 1YT2A 5C93A 4DR5I 3EHHA 2A2CA 3HZ5A 4PRXA 2WI6A 4U7OA 5M4KA 2GFDA 4XCJA 3PYEA 1Y8PA 1Z0TA 3HYYA 3T2SA 2WI1A 3ZXOA 3GIFA 1RR9A 2BYIA 1IBLI 2E5LI 3FT8A 3R4PA 3MNRP 4DPTA 1I94I 2BU7A 4YKUA 4LF5I 5CPHA 1N0UA 3DGEA 4XCLA 5IWAE 1AMWA 1UEKA 1BGQA 2H55A 1N36E 4EMDA 4R3AA 3RLQA 2YEAA 3ZXQA 3A0XA 4RPFA 2UUBI 2XEXA 2ZDYA 2BREA 3CRKA 1Z5AA 2UUAI 3O6OA 2YK2A 4EGHA 1GJVA 3B26A 3ZKDA 4CWTA 4DUHA 4DUYI 4QPJA 4JV5I 4DV1I 2YKEA 2BSMA 4BXIA 2AKPA 1YC1A 3K97A 1TBWA 1UYMA 2YI5A 3LTOA 1XNQI 4XC0A 4BIUA 3QT5A 1BYQA 2GS8A 3WU4A 4XD8A 4NXNI 1H7SA 4B3SI 1I5AA 4V25A 1YETA 1UYLA 5A2QC 2BM0A 1IBMI 1U2RA 4DR7I 3EHJA 1TIDA 2ZM6I 4PL9A 4B3RE 4R1FA 1ZXNA 1OSFA 3IEDA 5M4MA 4JYAI 1ELOA 1R62A 3K99A 4GGLA 2NPFA 4X65E 1XMOE 4AWOA 5FLXC 4JI6E 4KP4A 1FJGI 4GCZA 3J7AG 5F5RA 4B3TE 4JI4E 4HY6A 4FW9A 4JI1I 4HACB 3A0TA 2DEJA 1NHHA 4JI7E 1ZWHA 2YE3A 4GEEA 4ZVIA 2Q2EB 3ZKBA 2BTZA 3GIEA 2QG0A 3FT5A 3VADA 2EFGA 2V8PA 4LF7I 4LWEA 1FWLA 5M4HA 1KIJA 2HFUA 4BIZA 4UT4A 4FN5A 1XNRI 3T10A 2CCSA 4LP0A 4DV2E 2CGFA 1KTVA 4LF6I 2UWDA 2UXCI 1I5BA 4HYPA 4CE1A 3OWDA 4KTNA 4XIPA 5D7RA 1UY6A 4JI8I 2Q8FA 4JI3E 2PNRA 3GONA 4DV0I 2UU9I 4LWHA 4DV3E 4P8OA 5CTXA 2HFSA 3FV5A 4EMVA 1MX0A 4B3MI 4DR4E 2XCMA 3HYZA 2XK2A 4LPBA 3B27A 2WI4A 2F4VI 5A2QQ 2AJ4A 3A0YA 4O04A 4XKAA 4EGIA 2HCHA 3INWA 3OW6A 4M1KA 3C0EA 4QPKA 2VQEE 1N32I 5LMUI 2YGEA 4YKWA 2XHTA 3WQ9A 4AS9A 3ZZUA 5FLXQ 2YKBA 3T1HI 1UYHA 4LFBE 3A0ZA 1N0VC 4BQGA 1KVKA 3U2DA 4AWPA 4Q20A 2BV3A 2QG2A 4P52A 2FWYA 3C11A 4U7NA 4CWRA 4OX9I 3O2FA 4K0KI 4FPPA 4LF4E 4DUZE 3HEKA 2XD6A 4DU8A 3OMUA 4DPUA 4NH8A 4NH7A 3VHAA 4HACA 1EI1A 2UXBE 4AQYE 1IBKE 4WUCA 2YE7A 3U2KA 4MPCA 1I58A 2XJJA 1HR0E 2YKIA 5CTUA 2V2VA 3O0IA 4EFUA 1J5EE 2YI0A 2GQPA 4DZYA 4USKA 4NXME 3B25A 4JI5E 2CCUA 2JKIA 4GKJE 2XDLA 2YJWA 4X64E 2HHHE 4X66E 4L93A 4L91A 3A0RA 3V2UC 1XMQE 5D6PA 1ID0A 4XE2A 4H85A 2YJXA 1I5DA 2XJXA 4DV5E 4JI2I 2E1RA 3F0NA 5CTWA 2YE4A 1H73A 2YE8A 2X36A 4ASGA 1Z0GA 2BU6A 1N33I 4ZKIA 2XHXA 5IWAI 4LFAE 2VWCA 1N34I 2YE9A 3PYDA 2UXDE 2V2QA 1L0OA 2R42A 4DR5E 2HK2A 2VQFI 4HZ0A 2YEFA 5D7CA 4B6CA 4HY1A 3QT6A 1GKZA 4XITA 3ZZTA 3JAMC 2Q8GA 3Q5LA 4FWDA 1QZRA 3J80C 4KHPI 4LWIA 2FWZA 4EFTA 3D36A 1Z5BA 4FCQA 3H80A 3TZ4A 1AJ6A 4BQJA 4MOTA 3PYFA 1IBLE 1OJ4A 2E5LE 2WERA 4DPYA 4CE2A 1UYCA 4YHHI 1I94E 2J7KA 3G7BA 3KE6A 3K60A 4YKYA 2XX4A 4ASAA 4LF5E 2XDSA 4MB9A 3WU3A 4DV7E 4FCRA 4YKRA 1THNA 3D0BA 4DR2E 4LF8I 1ZM3A 3HULA 4FMTA 2UUBE 3VHDA 1YS3A 4MP2A 3CWVA 2FYPA 2CZ9A 4GKKE 2YE6A 3M6AA 2ZDXA 1TH8A 3PEHA 4MBCA 4DU7A 3R4NA 4H81A 4JV5E 2VCIA 4LFCI 2YEGA 4CWOA 4DXLA 3HHUA 4E00A 4DR3I 3D4JA 4B3TI 1XNQE 4W7TA 1HNXI 2ZKJA 2VCJA 1RREA 3U67A 1YERA 4WUBA 4B3SE 4KSHA 1IBME 4URNA 2YE2A 1ZW9A 4HZ5A 4X62I 1HNZI 2ZM6E 5BR8I 2BZ5A 5BODA 5IN9A 3JAMQ 4GQTA 3J80Q 1PVGA 4JYAE 2QF6A 2WI7A 1A4HA 2R3VA 4PRVA 1UY9A 4DV6I 2FXSA 3A0WA 1FJGE 4CWFA 1US7A 4L8ZA 4JI1E 3PEJA 4EEHA 3ZZ0A 3TZ0A 3T1YI 2IWUA 1AM1A 4O05A 2O1VA 2UUCI 4ED4A 4USMA 5L3JA 3OPDA 2O1WA 4U93A 2WW4A 4I5SA 4JQLA 3B24A 3T0HA 1Z0WA 1YESA 1XNRE 2YEEA 1Z59A 2EXLA 1YSRA 1NHIA 3K1JA 1PKPA 4YY3I 4CWSA 3TZ2A 4LF6E 4L90A 3LNUA 2UXCE 1S14A 4KFGA 1B63A 3LPSA 2YEHA 3B78A 4DPWA 4JI8E 1YSZA 4PU9A 3OTOI 2BYHA 4ASFA 4DV4E 2WEPA 1S4EA 5GGZA 4P7AA 4WUDA 4DV0E 4K4OA 4XIQA 3SL2A 3R4OA 3OWBA 2ZITA 1U0ZA 1A6FA 1NZ0A 1UYGA 4LWGA 2XDKA 4JI0I 2F4VE 2IORA 2YEIA 1EA6A 5GMDA 4NH9A 1D6TA 1QYEA 1UYDA 2V34A 1N32E 1DARA 5LMUE 4YKTA 4DR6I 2BU8A 3QT8A 1HR0I 5IDMA 3Q5KA 5LMNI 5FWKA 5F3KA 3T1HE 1KZNA 4URLA 3RLRA 1J5EI 5M4PA 4X9LA 5D6QA 4UTGA 4OX9E 3BM9A 4K0KE 4YKZA 1MU5A 2WI5A 4L94A 4X64I 2HHHI 4X66I 1B3QA 3EHFA 2X7IA 4GFNA 2XJGA 2CG9A 5FNDA 4DR1E 5D7DA 4CWPA 1NHJA 2BU2A 1UY8A 2XX5A 1Y8NA 3T1KA 4LF9E 5J6AA 2YECA 3R4MA 1FWKA 4LFAI 3TZ5A 4I3HA 1BKNA 1HNWE 2UXDI 1UYKA 4MP7A 1N36I 5CTYA 4KQVA 3R92A 1TC6A 4MYUA 3G7EA 4KSGA 3J81C 2YKJA 1FKAE 4JI2E 2V2ZA 1YT1A 4HXWA 2VW5A 2BM1A 4FWGA 2K5BA 3QTFA 1N33E 4EGKA 1UYEA 4LWFA 4CWNA 2WI3A 2VF3A 4DV7I 2CH4A 4E01A 1N34E 3ZM7A 4Z7YA 3V5RA 4DR2I 2VQFE 4HXZA 1ZM9A 5FNFA 1GKXA 1I59A 3EHGA 2UUAE 4B3RI 4GKKI 4KHPE 3QDDA 2XDUA 1JM6A 4XTJA 1TILA 2YI6A 3WU5A 3GIGB 2BU5A 2LJPA 3Q5JA 3QT7A 4DUYE 1ZM2A 2ZBKB 4X65I 4DV1E 1XMOI 1YC4A 2YEDA 4JI6I 4YHHE 2YK9A 1Y8OA 3NMQA 2HG1A 4Z7CA 4JI4I 5IT9C 1ZXMA 1UYIA 1MG7A 3H4LA 1Z5CA 2BT0A 1H74A 2YE5A 4JI7I 3HZ1A 2WEQA 4LF8E 4NXNE 3K98A 2IWSA 4JG4A 4O0BA 4DR7E 5M4EA 1ZM4A 2H8MA 1I5CA 3TTZA 5FNCA 1YT0A 2YEJA 4JAVA 4JASA 2Q8HA 4HYMA 1B62A 2YEBA 2OI2A 3CRLA 5LL6R 4DV2I 3G75A 1FNMA 3J81Q 3T0ZA 4O07A 3BMYA 4LFCE 5GMEA 3JZ3A 4GT8A 1Z0BA 4DR3E 1XHKA 1YC3A 3WHAA 1BXDA 1Z0EA 3EKRA 4MPNA 4UROA 4R3MA 1AH6A 2CCTA 2O1UA 1HNXE 4E02A 1Y4UA
chains in the Genus database with same CATH superfamily
4MYTA 2IWXA 1H7UA 4JI3I 4YKQA 4YKXA 4DV3I 1PIEA 2C38A 4DR4I 4B7PA 1S16A 4LF7E 2E0AA 4X62E 1HNZE 5BR8E 2XX2A 3CGZA 3P06A 3U1KA 4BAEA 3INXA 4AWQA 2Q8IA 3M7ND 2XHRA 2VQEI 2YI7A 4V26A 1Y4SA 3R91A 3Q1QA 4LCFA 5BOCA 4DV6E 5K36F 5M4NA 4DPXA 3WU6A 4XKKA 4LFBI 3RLPA 2YKCA 5IT9Q 3RKZA 4FW7A 3T1YE 3GIGA 1UYFA 3CGYA 4DV4I 2ESAA 2WI2A 2UUCE 4XIRA 2YGFA 2UU9E 4LF4I 2A2DA 4DUZI 4FCPA 4B3ME 1FI4A 2IOPA 3EKOA 2HK3A 5C0XC 2YGAA 2PNLA 2UXBI 3B82A 4JAUA 4H7QA 4AQYI 1IBKI 4URMA 2BRCA 4MPEA 4YY3E 1Z0CA 3J7AM 2XABA 4ASBA 3K17A 1TC0A 3S5TA 3HJCA 2XDXA 1UY7A 4EM7A 1H72C 2DEIA 3OTOE 2CGEA 1KKHA 4NXMI 2C2AA 5CF0A 4JI5I 5K36C 4CWQA 4GKJI 2NN6F 5IDJA 1XMQI 4OZEA 2HKJA 2HKEA 4JI0E 4FWHA 4DV5I 2IERA 4MDTA 3U1YA 1AH8A 1QY8A 3B28A 2VESA 3VHCA 1K47A 3DD6A 4DR1I 2JJCA 5J71A 1E3PA 2IOQA 2QFOA 4BA2B 3PYGA 4DR6E 4CE3A 4XDMA 1VISA 4LF9I 4AM3A 4XKOA 5LMNE 4O09A 3B8HA 1Z0VA 3D2RA 3TUHA 1U2OA 1HNWI 1WUUA 1YT2A 5CTXA 5C93A 4DR5I 3EHHA 2A2CA 3HZ5A 4PRXA 4IS9A 5DRQA 2WI6A 2GFDA 3P3EA 3PYEA 1Y8PA 4U7OA 4XCJA 1Z0TA 5M4KA 3CYGA 3HYYA 4E00A 3T2SA 2WI1A 3ZXOA 3GIFA 1RR9A 2BYIA 1IBLI 2E5LI 3FT8A 2NN6C 4AIMA 3R4PA 3MNRP 4DPTA 1I94I 2BU7A 2IESA 4YKUA 4LF5I 5CPHA 1N0UA 4ISAA 3DGEA 5IWAE 4XCLA 1AMWA 1UEKA 1BGQA 5EL9A 2H55A 1N36E 4EMDA 4R3AA 3M85G 2YEAA 3RLQA 3A0XA 4RPFA 3ZXQA 2UUBI 2XEXA 2ZDYA 2BA0D 2BREA 3CRKA 1Z5AA 4U3DA 2UUAI 5JENA 3O6OA 2YK2A 3K85A 4EGHA 1GJVA 3B26A 3ZKDA 4CWTA 4DUHA 2GO4A 4DUYI 4QPJA 4JV5I 4DV1I 2YKEA 2BSMA 4BXIA 2JEAB 3Q6MA 3PS2A 2AKPA 1YC1A 3K97A 5C0XB 1TBWA 1UYMA 2YI5A 3LTOA 1XNQI 4XC0A 4BIUA 3QT5A 1BYQA 2JE6B 2GS8A 4FW4A 3WU4A 4XD8A 4NXNI 1H7SA 4B3SI 1UDOA 1I5AA 2C1GA 4V25A 4BA2A 1YETA 2JEBB 5A2QC 2BM0A 1IBMI 1U2RA 4DR7I 1UYLA 3EHJA 3GMEA 1OYRA 2ZM6I 1TIDA 4PL9A 4B3RE 4R1FA 1ZXNA 2PO2B 5C0XD 1OSFA 3IEDA 5M4MA 4JYAI 1ELOA 1R62A 2WNRB 3K99A 4GGLA 3PS3A 2NPFA 5K36B 4X65E 1XMOE 4AWOA 5FLXC 4JI6E 4KP4A 1FJGI 2O1TA 3J7AG 4GCZA 4B3TE 5F5RA 4JI4E 4HY6A 4FW9A 4JI1I 4HACB 3A0TA 2DEJA 1Y60A 1NHHA 4JI7E 1ZWHA 4BA1B 2YE3A 4GEEA 4ZVIA 2Q2EB 3ZKBA 2BTZA 3GIEA 5K36D 2QG0A 3HKMA 3FT5A 3VADA 2EFGA 2V8PA 4LF7I 4LWEA 1FWLA 4J3DA 5M4HA 1KIJA 2HFUA 4BIZA 4UT4A 4FN5A 1XNRI 3T10A 3UHMA 4IZJB 2CCSA 4LP0A 4DV2E 2CGFA 1KTVA 4LF6I 2UWDA 2UXCI 1I5BA 4HYPA 4CE1A 3OWDA 4KTNA 4XIPA 5D7RA 1UY6A 4JI8I 2Q8FA 4JI3E 2PNRA 3GONA 4IZJD 4DV0I 2UU9I 4DV3E 4LWHA 2PNMA 2BA1D 2HFSA 3FV5A 1MX0A 4B3MI 4DR4E 2XCMA 2Z5CA 2JEAA 3HYZA 2XK2A 4LPBA 5C0XA 2WI4A 2F4VI 5A2QQ 1VI7A 2AJ4A 3A0YA 3B27A 4O04A 3KRNA 4XKAA 2HCHA 2JE6A 3INWA 3OW6A 4M1KA 3C0EA 4QPKA 2VQEE 4OO1B 1N32I 5LMUI 2GO3A 2YGEA 2JEBA 2XHTA 4YKWA 5DROA 3WQ9A 4AS9A 3ZZUA 5FLXQ 2YKBA 3T1HI 1UYHA 4LFBE 3A0ZA 1N0VC 4IFDB 2PO2A 1KVKA 3U2DA 4AWPA 4Q20A 4BQGA 2PNZB 2BV3A 2QG2A 4MU3A 4P52A 2FWYA 3C11A 2WNRA 4U7NA 4OX9I 3GLLA 4K0KI 3O2FA 5K36A 5JEAB 4FPPA 4CWRA 4EMVA 5C0XE 4LF4E 4DUZE 4OO1D 3HEKA 3LMMA 2XD6A 4DU8A 3OMUA 4DPUA 4NH8A 4NH7A 3VHAA 4HACA 2PO0B 1EI1A 2UXBE 4IFDD 4AQYE 1IBKE 4WUCA 2O3ZA 4BA1A 2YE7A 3U2KA 4MPCA 5JEAD 1I58A 2XJJA 1HR0E 2YKIA 5CTUA 4MU1A 2V2VA 3O0IA 4EFUA 1J5EE 4QNJA 3PRYA 2YI0A 4IZJA 2GQPA 4DZYA 4USKA 4NXME 3B25A 4JI5E 2CCUA 2JKIA 4GKJE 2XDLA 2YJWA 4X64E 5ELWA 4X66E 2HHHE 2YEDA 3A0RA 3V2UC 1XMQE 2C37B 4L93A 1ID0A 4L91A 4XE2A 4H85A 2YJXA 1Y5YA 1I5DA 2XJXA 4DV5E 4JI2I 1UDNA 4FW6A 4LOMA 2E1RA 3F0NA 5CTWA 2YE4A 1H73A 1R6LA 1YHCA 2YE8A 2X36A 4ASGA 1Z0GA 2BU6A 1N33I 4ZKIA 2XHXA 5IWAI 4LFAE 2AE8A 4LPFA 4OKGA 1N34I 2VWCA 2YE9A 3PYDA 2UXDE 2V2QA 1L0OA 2R42A 4OO1A 4DR5E 2HK2A 3Q6NA 2VQFI 2YEFA 4HZ0A 5D7CA 4B6CA 4HY1A 3QT6A 1GKZA 4XITA 3ZZTA 3JAMC 2Q8GA 3Q5LA 4FWDA 1QZRA 3J80C 4KHPI 1F51A 4LWIA 2FWZA 4IFDA 4EFTA 3D36A 1Z5BA 2PNZA 4FCQA 3H80A 3TZ4A 1AJ6A 4BQJA 4MOTA 3PYFA 1Y6ZA 1IBLE 1OJ4A 5JEAA 2E5LE 4DPYA 2WERA 4CE2A 1UYCA 4YHHI 1I94E 2J7KA 2Z5CB 4QNKA 3G7BA 3P3GA 3KE6A 3K60A 4YKYA 2XX4A 4ASAA 4LF5E 2XDSA 4MB9A 3WU3A 4DV7E 4FCRA 2PO0A 4OO1E 4YKRA 1THNA 3D0BA 4DR2E 4LF8I 1ZM3A 3HULA 3GCMA 4FMTA 2UUBE 3VHDA 1YS3A 4MP2A 3CWVA 4IFDE 2FYPA 2CZ9A 5DNLA 3P76A 4GKKE 2YE6A 2JT2A 3M6AA 2ZDXA 5JEAE 1TH8A 3PEHA 4MBCA 4DU7A 3R4NA 4H81A 5EKWA 3M85D 4JV5E 5DRRA 4LFCI 2HHIA 2F1DA 4DXLA 2VCIA 2YEGA 3HHUA 4CWOA 4DR3I 3D4JA 4B3TI 2C37A 4NBQA 1XNQE 4W7TA 1HNXI 2ZKJA 2VCJA 3M7NG 1RREA 3U67A 1YERA 4WUBA 4B3SE 4KSHA 5DNXA 1IBME 4URNA 2YE2A 1ZW9A 4HZ5A 4X62I 1HNZI 2ZM6E 5BR8I 2BZ5A 5BODA 5IN9A 3JAMQ 4EGIA 4GQTA 3J80Q 1PVGA 4JYAE 2QF6A 2WI7A 1A4HA 2R3VA 4PRVA 1UY9A 4DV6I 2FXSA 3A0WA 1FJGE 2FTKA 4CWFA 1US7A 2PO1B 4L8ZA 3CDIA 4JI1E 3PEJA 4EEHA 3ZZ0A 3TZ0A 5C0XF 3T1YI 2IWUA 1AM1A 4O05A 2J65A 2O1VA 2NN6B 2UUCI 3P3CA 4U3BA 4ED4A 4USMA 5L3JA 5D6PA 2C1IA 3OPDA 2O1WA 1RHYA 4U93A 2WW4A 4I5SA 4JQLA 3B24A 3T0HA 3L7ZB 1Z0WA 1YESA 1XNRE 2YEEA 1Z59A 2EXLA 1YSRA 4AIDA 1NHIA 2NN6D 1PKPA 3K1JA 4YY3I 4CWSA 1YH8A 3TZ2A 4LF6E 4L90A 3LNUA 2UXCE 1S14A 4KFGA 1B63A 3LPSA 2YEHA 3B78A 4DPWA 4JI8E 1YSZA 4PU9A 3OTOI 2BYHA 4ASFA 4DV4E 2WEPA 1S4EA 5GGZA 4P7AA 4WUDA 4DV0E 4K4OA 4XIQA 3SL2A 3R4OA 3OWBA 2ZITA 1U0ZA 1A6FA 1NZ0A 1UYGA 4LWGA 2XDKA 4JI0I 2F4VE 2IORA 2YEIA 1EA6A 5GMDA 4NH9A 1D6TA 1QYEA 1UYDA 2V34A 4GQUA 1N32E 1DARA 5LMUE 4YKTA 4DR6I 2BU8A 3QT8A 3CDJA 1HR0I 5IDMA 1XXEA 5LMNI 3Q5KA 5FWKA 5F3KA 3T1HE 1KZNA 4URLA 3RLRA 1J5EI 5M4PA 5K36E 4X9LA 5D6QA 4UTGA 4OX9E 2BR2B 4K0KE 1P42A 3BM9A 4YKZA 2WP8B 1MU5A 2WI5A 4L94A 4X64I 2HHHI 4X66I 1B3QA 3EHFA 1R6MA 2X7IA 4GFNA 2PO1A 2XJGA 2CG9A 3H1CA 5FNDA 1IXMA 4DR1E 2NN6A 5D7DA 4CWPA 1NHJA 2BU2A 1UY8A 2XX5A 1Y8NA 4N3OA 4OO1F 2BA0G 3T1KA 4LF9E 4LCGA 5J6AA 3L7ZA 2YECA 3R4MA 1FWKA 4LFAI 3TZ5A 4I3HA 1BKNA 1HNWE 2UXDI 4IFDF 1UYKA 4MP7A 1N36I 5CTYA 4MQYA 2C39B 4KQVA 5JEAF 4IZKB 3R92A 1TC6A 2Z5BB 4MYUA 3G7EA 2NN6E 4KSGA 3J81C 2YKJA 1FKAE 4JI2E 2V2ZA 1YT1A 4HXWA 2VW5A 3PS1A 4E72A 1HK7A 2C38B 2BM1A 1USVA 4FWGA 2K5BA 1E3HA 3QTFA 3B4TA 1N33E 4EGKA 1UYEA 4LWFA 4FW5A 4CWNA 2WI3A 1UDSA 2VF3A 4DV7I 2CH4A 4E01A 1N34E 2GQ0A 3ZM7A 4Z7YA 3V5RA 4DR2I 1OYPA 2VQFE 4HXZA 1ZM9A 4OO1C 5FNFA 1GKXA 1I59A 4MU4A 3EHGA 2UUAE 4B3RI 4GKKI 4KHPE 3QDDA 2XDUA 1JM6A 4XTJA 1TILA 3NZKA 2YI6A 3WU5A 3GIGB 4IFDC 2BU5A 2LJPA 3Q5JA 3QT7A 2BR2A 4DUYE 1ZM2A 2ZBKB 4X65I 2WP8A 4DV1E 1XMOI 5JEAC 4JI6I 4MU0A 4YHHE 1Y8OA 1YC4A 2HG1A 2YK9A 3NMQA 4Z7CA 4JI4I 5IT9C 1ZXMA 1UYIA 1MG7A 1UDQA 2Z5EA 4LCHA 3H4LA 1Z5CA 2BT0A 1H74A 2YE5A 4JI7I 3HZ1A 4P8OA 2WEQA 2CVEA 4LF8E 4NXNE 5DRPA 3K98A 2IWSA 4JG4A 1USUA 4O0BA 4FW3A 4DR7E 5M4EA 1ZM4A 2H8MA 1I5CA 3TTZA 5FNCA 1YT0A 2YEJA 4JAVA 4JASA 2Q8HA 4HYMA 1B62A 2YEBA 2OI2A 3CRLA 5LL6R 4DV2I 3G75A 1FNMA 3J81Q 1OYSA 3T0ZA 4O07A 3BMYA 4LFCE 5GMEA 3JZ3A 4GT8A 2BA1G 1Z0BA 4DR3E 2C39A 1XHKA 1YC3A 4IZKA 3WHAA 1BXDA 1Z0EA 2Z5BA 3EKRA 4MPNA 4UROA 4R3MA 2O1UA 1AH6A 2CCTA 1HNXE 4E02A 1Y4UA
chains in the Genus database with same CATH topology
4MYTA 2IWXA 1H7UA 4JI3I 4YKQA 4YKXA 4DV3I 1PIEA 4DR4I 4B7PA 1S16A 4LF7E 2E0AA 4X62E 1HNZE 5BR8E 2XX2A 3CGZA 3P06A 4BAEA 3INXA 4AWQA 2Q8IA 2XHRA 2VQEI 2YI7A 4V26A 1Y4SA 3R91A 3Q1QA 5BOCA 4DV6E 5M4NA 4DPXA 3WU6A 4XKKA 4LFBI 3RLPA 2YKCA 5IT9Q 3RKZA 3T1YE 3GIGA 1UYFA 3CGYA 4DV4I 2ESAA 2WI2A 2UUCE 4XIRA 2YGFA 2UU9E 4LF4I 2A2DA 4DUZI 4FCPA 4B3ME 1FI4A 2IOPA 3EKOA 2HK3A 2YGAA 2PNLA 2UXBI 3B82A 4JAUA 4H7QA 4AQYI 1IBKI 4URMA 2BRCA 4MPEA 4YY3E 1Z0CA 3J7AM 2XABA 4ASBA 3K17A 1TC0A 3HJCA 2XDXA 1UY7A 4EM7A 1H72C 2DEIA 3OTOE 2CGEA 1KKHA 4NXMI 2C2AA 5CF0A 4JI5I 4CWQA 4GKJI 5IDJA 1XMQI 2HKJA 2HKEA 4JI0E 4FWHA 4DV5I 1AH8A 1QY8A 3B28A 3VHCA 1K47A 4DR1I 5J71A 2JJCA 2IOQA 2QFOA 3PYGA 4DR6E 4CE3A 4XDMA 1VISA 4LF9I 4XKOA 5LMNE 4O09A 3B8HA 1Z0VA 3D2RA 3TUHA 1U2OA 1HNWI 1WUUA 1YT2A 5CTXA 5C93A 4DR5I 3EHHA 2A2CA 3HZ5A 4PRXA 2WI6A 4U7OA 5M4KA 2GFDA 4XCJA 3PYEA 1Y8PA 1Z0TA 3HYYA 3T2SA 2WI1A 3ZXOA 3GIFA 1RR9A 2BYIA 1IBLI 2E5LI 3FT8A 3R4PA 3MNRP 4DPTA 1I94I 2BU7A 4YKUA 4LF5I 5CPHA 1N0UA 3DGEA 4XCLA 5IWAE 1AMWA 1UEKA 1BGQA 2H55A 1N36E 4EMDA 4R3AA 3RLQA 2YEAA 3ZXQA 3A0XA 4RPFA 2UUBI 2XEXA 2ZDYA 2BREA 3CRKA 1Z5AA 2UUAI 3O6OA 2YK2A 3K85A 4EGHA 1GJVA 3B26A 3ZKDA 4CWTA 4DUHA 4DUYI 4QPJA 4JV5I 4DV1I 2YKEA 2BSMA 4BXIA 3Q6MA 2AKPA 1YC1A 3K97A 1TBWA 1UYMA 2YI5A 3LTOA 1XNQI 4XC0A 4BIUA 3QT5A 1BYQA 2GS8A 3WU4A 4XD8A 4NXNI 1H7SA 4B3SI 1I5AA 4V25A 1YETA 1UYLA 5A2QC 2BM0A 1IBMI 1U2RA 4DR7I 3EHJA 1TIDA 2ZM6I 4PL9A 4B3RE 4R1FA 1ZXNA 1OSFA 3IEDA 5M4MA 4JYAI 1ELOA 1R62A 3K99A 4GGLA 2NPFA 4X65E 1XMOE 4AWOA 5FLXC 4JI6E 4KP4A 1FJGI 2O1TA 3J7AG 4GCZA 4B3TE 5F5RA 4JI4E 4HY6A 4FW9A 4JI1I 4HACB 3A0TA 2DEJA 1NHHA 4JI7E 1ZWHA 2YE3A 4GEEA 4ZVIA 2Q2EB 3ZKBA 2BTZA 3GIEA 2QG0A 3FT5A 3VADA 2EFGA 2V8PA 4LF7I 4LWEA 1FWLA 5M4HA 1KIJA 2HFUA 4BIZA 4UT4A 4FN5A 1XNRI 3T10A 4IZJB 2CCSA 4LP0A 4DV2E 2CGFA 1KTVA 4LF6I 2UWDA 2UXCI 1I5BA 4HYPA 4CE1A 3OWDA 4KTNA 4XIPA 5D7RA 1UY6A 4JI8I 2Q8FA 4JI3E 2PNRA 3GONA 4IZJD 4DV0I 2UU9I 4DV3E 4LWHA 2PNMA 2HFSA 3FV5A 4P8OA 1MX0A 4B3MI 4DR4E 2XCMA 2Z5CA 3HYZA 2XK2A 4LPBA 3B27A 2WI4A 2F4VI 5A2QQ 2AJ4A 3A0YA 4O04A 4XKAA 4EGIA 2HCHA 3INWA 3OW6A 4M1KA 3C0EA 4QPKA 2VQEE 1N32I 5LMUI 2YGEA 4YKWA 2XHTA 3WQ9A 4AS9A 3ZZUA 5FLXQ 2YKBA 3T1HI 1UYHA 4LFBE 3A0ZA 1N0VC 4BQGA 1KVKA 3U2DA 4AWPA 4Q20A 2BV3A 2QG2A 4P52A 2FWYA 3C11A 4U7NA 4CWRA 4OX9I 3O2FA 4K0KI 4EMVA 4FPPA 4LF4E 4DUZE 3HEKA 2XD6A 4DU8A 3OMUA 4DPUA 4NH8A 4NH7A 3VHAA 4HACA 1EI1A 2UXBE 4AQYE 1IBKE 4WUCA 2YE7A 3U2KA 4MPCA 1I58A 2XJJA 1HR0E 2YKIA 5CTUA 2V2VA 3O0IA 4EFUA 1J5EE 3PRYA 2YI0A 4IZJA 2GQPA 4DZYA 4USKA 4NXME 3B25A 4JI5E 2CCUA 2JKIA 4GKJE 2XDLA 2YJWA 4X64E 2HHHE 4X66E 4L93A 4L91A 3A0RA 1XMQE 3V2UC 5D6PA 1ID0A 4XE2A 4H85A 2YJXA 1I5DA 2XJXA 4DV5E 4JI2I 2E1RA 3F0NA 5CTWA 2YE4A 1H73A 2YE8A 2X36A 4ASGA 1Z0GA 2BU6A 1N33I 4ZKIA 2XHXA 5IWAI 4LFAE 2VWCA 1N34I 2YE9A 3PYDA 2UXDE 2V2QA 1L0OA 2R42A 4DR5E 2HK2A 3Q6NA 2VQFI 2YEFA 4HZ0A 5D7CA 4B6CA 4HY1A 3QT6A 1GKZA 4XITA 3ZZTA 3JAMC 2Q8GA 3Q5LA 4FWDA 1QZRA 3J80C 4KHPI 4LWIA 2FWZA 4EFTA 3D36A 1Z5BA 4FCQA 3H80A 3TZ4A 1AJ6A 4BQJA 4MOTA 3PYFA 1Y6ZA 1IBLE 1OJ4A 2E5LE 2WERA 4DPYA 4CE2A 1UYCA 4YHHI 1I94E 2J7KA 2Z5CB 3G7BA 3KE6A 3K60A 4YKYA 2XX4A 4ASAA 4LF5E 2XDSA 4MB9A 3WU3A 4DV7E 4FCRA 4YKRA 1THNA 3D0BA 4DR2E 4LF8I 1ZM3A 3HULA 4FMTA 2UUBE 3VHDA 1YS3A 4MP2A 3CWVA 2FYPA 2CZ9A 4GKKE 2YE6A 3M6AA 2ZDXA 1TH8A 3PEHA 4MBCA 4DU7A 3R4NA 4H81A 4JV5E 2VCIA 4LFCI 2YEGA 4CWOA 4DXLA 3HHUA 4E00A 4DR3I 3D4JA 4B3TI 1XNQE 4W7TA 1HNXI 2ZKJA 2VCJA 1RREA 3U67A 1YERA 4WUBA 4B3SE 4KSHA 1IBME 4URNA 2YE2A 1ZW9A 4HZ5A 4X62I 1HNZI 2ZM6E 5BR8I 2BZ5A 5BODA 5IN9A 3JAMQ 4GQTA 3J80Q 1PVGA 4JYAE 2QF6A 2WI7A 1A4HA 2R3VA 4PRVA 1UY9A 4DV6I 2FXSA 3A0WA 1FJGE 4CWFA 1US7A 4L8ZA 4JI1E 3PEJA 4EEHA 3ZZ0A 3TZ0A 3T1YI 2IWUA 1AM1A 4O05A 2O1VA 2UUCI 4ED4A 4USMA 5L3JA 3OPDA 2O1WA 4U93A 2WW4A 4I5SA 4JQLA 3B24A 3T0HA 1Z0WA 1YESA 1XNRE 2YEEA 1Z59A 2EXLA 1YSRA 1NHIA 3K1JA 1PKPA 4YY3I 4CWSA 3TZ2A 4LF6E 4L90A 3LNUA 2UXCE 1S14A 4KFGA 1B63A 3LPSA 2YEHA 3B78A 4DPWA 4JI8E 1YSZA 4PU9A 3OTOI 2BYHA 4ASFA 4DV4E 2WEPA 1S4EA 5GGZA 4P7AA 4WUDA 4DV0E 4K4OA 4XIQA 3SL2A 3R4OA 3OWBA 2ZITA 1U0ZA 1A6FA 1NZ0A 1UYGA 4LWGA 2XDKA 4JI0I 2F4VE 2IORA 2YEIA 1EA6A 5GMDA 4NH9A 1D6TA 1QYEA 1UYDA 2V34A 1N32E 1DARA 5LMUE 4YKTA 4DR6I 2BU8A 3QT8A 1HR0I 5IDMA 3Q5KA 5LMNI 5FWKA 5F3KA 3T1HE 1KZNA 4URLA 3RLRA 1J5EI 5M4PA 4X9LA 5D6QA 4UTGA 4OX9E 3BM9A 4K0KE 4YKZA 1MU5A 2WI5A 4L94A 4X64I 2HHHI 4X66I 1B3QA 3EHFA 2X7IA 4GFNA 2XJGA 2CG9A 5FNDA 4DR1E 5D7DA 4CWPA 1NHJA 2BU2A 1UY8A 2XX5A 1Y8NA 4N3OA 3T1KA 4LF9E 5J6AA 2YECA 3R4MA 1FWKA 4LFAI 3TZ5A 4I3HA 1BKNA 1HNWE 2UXDI 1UYKA 4MP7A 1N36I 5CTYA 4KQVA 4IZKB 3R92A 1TC6A 2Z5BB 4MYUA 3G7EA 4KSGA 3J81C 2YKJA 1FKAE 4JI2E 2V2ZA 1YT1A 4HXWA 2VW5A 1HK7A 2BM1A 1USVA 4FWGA 2K5BA 3QTFA 1N33E 4EGKA 1UYEA 4LWFA 4CWNA 2WI3A 2VF3A 4DV7I 2CH4A 4E01A 1N34E 2GQ0A 3ZM7A 4Z7YA 3V5RA 4DR2I 2VQFE 4HXZA 1ZM9A 5FNFA 1GKXA 1I59A 3EHGA 2UUAE 4B3RI 4GKKI 4KHPE 3QDDA 2XDUA 1JM6A 4XTJA 1TILA 2YI6A 3WU5A 3GIGB 2BU5A 2LJPA 3Q5JA 3QT7A 4DUYE 1ZM2A 2ZBKB 4X65I 4DV1E 1XMOI 1YC4A 2YEDA 4JI6I 4YHHE 2YK9A 1Y8OA 3NMQA 2HG1A 4Z7CA 4JI4I 5IT9C 1ZXMA 1UYIA 1MG7A 2Z5EA 3H4LA 1Z5CA 2BT0A 1H74A 2YE5A 4JI7I 3HZ1A 2WEQA 4LF8E 4NXNE 3K98A 2IWSA 4JG4A 1USUA 4O0BA 4DR7E 5M4EA 1ZM4A 2H8MA 1I5CA 3TTZA 5FNCA 1YT0A 2YEJA 4JAVA 4JASA 2Q8HA 4HYMA 1B62A 2YEBA 2OI2A 3CRLA 5LL6R 4DV2I 3G75A 1FNMA 3J81Q 3T0ZA 4O07A 3BMYA 4LFCE 5GMEA 3JZ3A 4GT8A 1Z0BA 4DR3E 1XHKA 1YC3A 4IZKA 3WHAA 1BXDA 1Z0EA 2Z5BA 3EKRA 4MPNA 4UROA 4R3MA 2O1UA 1AH6A 2CCTA 1HNXE 4E02A 1Y4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MYT A;  2IWX A;  1H7U A;  4JI3 I;  4YKQ A;  4YKX A;  4DV3 I;  1PIE A;  4DR4 I;  4B7P A;  1S16 A;  4LF7 E;  2E0A A;  4X62 E;  1HNZ E;  5BR8 E;  2XX2 A;  3CGZ A;  4BAE A;  3INX A;  4AWQ A;  2Q8I A;  2XHR A;  2VQE I;  2YI7 A;  4V26 A;  1Y4S A;  3R91 A;  3Q1Q A;  5BOC A;  4DV6 E;  5M4N A;  4DPX A;  3WU6 A;  4XKK A;  4LFB I;  3RLP A;  2YKC A;  5IT9 Q;  3RKZ A;  3T1Y E;  3GIG A;  1UYF A;  3CGY A;  4DV4 I;  2ESA A;  2WI2 A;  2UUC E;  4XIR A;  2YGF A;  2UU9 E;  4LF4 I;  2A2D A;  4DUZ I;  4FCP A;  4B3M E;  1FI4 A;  2IOP A;  3EKO A;  2HK3 A;  2YGA A;  2UXB I;  3B82 A;  4JAU A;  4H7Q A;  4AQY I;  1IBK I;  4URM A;  2BRC A;  4MPE A;  4YY3 E;  1Z0C A;  3J7A M;  2XAB A;  4ASB A;  3K17 A;  1TC0 A;  2XDX A;  1UY7 A;  4EM7 A;  1H72 C;  2DEI A;  3OTO E;  1KKH A;  4NXM I;  2C2A A;  5CF0 A;  4JI5 I;  4CWQ A;  4GKJ I;  5IDJ A;  1XMQ I;  2HKJ A;  2HKE A;  4JI0 E;  4FWH A;  4DV5 I;  1AH8 A;  1QY8 A;  3B28 A;  3VHC A;  1K47 A;  4DR1 I;  5J71 A;  2JJC A;  2IOQ A;  2QFO A;  3PYG A;  4DR6 E;  4CE3 A;  4XDM A;  1VIS A;  4LF9 I;  4XKO A;  5LMN E;  4O09 A;  3B8H A;  1Z0V A;  3D2R A;  3TUH A;  1U2O A;  1HNW I;  1WUU A;  1YT2 A;  5C93 A;  4DR5 I;  3EHH A;  2A2C A;  3HZ5 A;  4PRX A;  2WI6 A;  4U7O A;  5M4K A;  2GFD A;  4XCJ A;  3PYE A;  1Y8P A;  1Z0T A;  3HYY A;  3T2S A;  2WI1 A;  3ZXO A;  3GIF A;  1RR9 A;  2BYI A;  1IBL I;  2E5L I;  3FT8 A;  3R4P A;  3MNR P;  4DPT A;  1I94 I;  2BU7 A;  4YKU A;  4LF5 I;  5CPH A;  1N0U A;  3DGE A;  4XCL A;  5IWA E;  1AMW A;  1UEK A;  1BGQ A;  2H55 A;  1N36 E;  4EMD A;  4R3A A;  3RLQ A;  2YEA A;  3ZXQ A;  3A0X A;  4RPF A;  2UUB I;  2XEX A;  2ZDY A;  2BRE A;  3CRK A;  1Z5A A;  2UUA I;  3O6O A;  2YK2 A;  4EGH A;  1GJV A;  3B26 A;  3ZKD A;  4CWT A;  4DUH A;  4DUY I;  4QPJ A;  4JV5 I;  4DV1 I;  2YKE A;  2BSM A;  4BXI A;  2AKP A;  1YC1 A;  3K97 A;  1TBW A;  1UYM A;  2YI5 A;  3LTO A;  1XNQ I;  4XC0 A;  4BIU A;  3QT5 A;  1BYQ A;  2GS8 A;  3WU4 A;  4XD8 A;  4NXN I;  1H7S A;  4B3S I;  1I5A A;  4V25 A;  1YET A;  1UYL A;  5A2Q C;  2BM0 A;  1IBM I;  1U2R A;  4DR7 I;  3EHJ A;  1TID A;  2ZM6 I;  4PL9 A;  4B3R E;  4R1F A;  1ZXN A;  1OSF A;  3IED A;  5M4M A;  4JYA I;  1ELO A;  1R62 A;  3K99 A;  4GGL A;  2NPF A;  4X65 E;  1XMO E;  4AWO A;  5FLX C;  4JI6 E;  4KP4 A;  1FJG I;  4GCZ A;  3J7A G;  5F5R A;  4B3T E;  4JI4 E;  4HY6 A;  4FW9 A;  4JI1 I;  4HAC B;  3A0T A;  2DEJ A;  1NHH A;  4JI7 E;  1ZWH A;  2YE3 A;  4GEE A;  4ZVI A;  2Q2E B;  3ZKB A;  2BTZ A;  3GIE A;  2QG0 A;  3FT5 A;  3VAD A;  2EFG A;  2V8P A;  4LF7 I;  4LWE A;  1FWL A;  5M4H A;  1KIJ A;  2HFU A;  4BIZ A;  4UT4 A;  4FN5 A;  1XNR I;  3T10 A;  2CCS A;  4LP0 A;  4DV2 E;  2CGF A;  1KTV A;  4LF6 I;  2UWD A;  2UXC I;  1I5B A;  4HYP A;  4CE1 A;  3OWD A;  4KTN A;  4XIP A;  5D7R A;  1UY6 A;  4JI8 I;  2Q8F A;  4JI3 E;  2PNR A;  3GON A;  4DV0 I;  2UU9 I;  4LWH A;  4DV3 E;  4P8O A;  5CTX A;  2HFS A;  3FV5 A;  4EMV A;  1MX0 A;  4B3M I;  4DR4 E;  2XCM A;  3HYZ A;  2XK2 A;  4LPB A;  3B27 A;  2WI4 A;  2F4V I;  5A2Q Q;  2AJ4 A;  3A0Y A;  4O04 A;  4XKA A;  4EGI A;  2HCH A;  3INW A;  3OW6 A;  4M1K A;  3C0E A;  4QPK A;  2VQE E;  1N32 I;  5LMU I;  2YGE A;  4YKW A;  2XHT A;  3WQ9 A;  4AS9 A;  3ZZU A;  5FLX Q;  2YKB A;  3T1H I;  1UYH A;  4LFB E;  3A0Z A;  1N0V C;  4BQG A;  1KVK A;  3U2D A;  4AWP A;  4Q20 A;  2BV3 A;  2QG2 A;  4P52 A;  2FWY A;  3C11 A;  4U7N A;  4CWR A;  4OX9 I;  3O2F A;  4K0K I;  4FPP A;  4LF4 E;  4DUZ E;  3HEK A;  2XD6 A;  4DU8 A;  3OMU A;  4DPU A;  4NH8 A;  4NH7 A;  3VHA A;  4HAC A;  1EI1 A;  2UXB E;  4AQY E;  1IBK E;  4WUC A;  2YE7 A;  3U2K A;  4MPC A;  1I58 A;  2XJJ A;  1HR0 E;  2YKI A;  5CTU A;  2V2V A;  3O0I A;  4EFU A;  1J5E E;  2YI0 A;  2GQP A;  4DZY A;  4USK A;  4NXM E;  3B25 A;  4JI5 E;  2CCU A;  2JKI A;  4GKJ E;  2XDL A;  2YJW A;  4X64 E;  2HHH E;  4X66 E;  4L93 A;  4L91 A;  3A0R A;  3V2U C;  1XMQ E;  5D6P A;  1ID0 A;  4XE2 A;  4H85 A;  2YJX A;  1I5D A;  2XJX A;  4DV5 E;  4JI2 I;  2E1R A;  3F0N A;  5CTW A;  2YE4 A;  1H73 A;  2YE8 A;  2X36 A;  4ASG A;  1Z0G A;  2BU6 A;  1N33 I;  4ZKI A;  2XHX A;  5IWA I;  4LFA E;  2VWC A;  1N34 I;  2YE9 A;  3PYD A;  2UXD E;  2V2Q A;  1L0O A;  2R42 A;  4DR5 E;  2HK2 A;  2VQF I;  4HZ0 A;  2YEF A;  5D7C A;  4B6C A;  4HY1 A;  3QT6 A;  1GKZ A;  4XIT A;  3ZZT A;  3JAM C;  2Q8G A;  3Q5L A;  4FWD A;  1QZR A;  3J80 C;  4KHP I;  4LWI A;  2FWZ A;  4EFT A;  3D36 A;  1Z5B A;  4FCQ A;  3H80 A;  3TZ4 A;  1AJ6 A;  4BQJ A;  4MOT A;  3PYF A;  1IBL E;  1OJ4 A;  2E5L E;  2WER A;  4DPY A;  4CE2 A;  1UYC A;  4YHH I;  1I94 E;  2J7K A;  3G7B A;  3KE6 A;  3K60 A;  4YKY A;  2XX4 A;  4ASA A;  4LF5 E;  2XDS A;  4MB9 A;  3WU3 A;  4DV7 E;  4FCR A;  4YKR A;  1THN A;  3D0B A;  4DR2 E;  4LF8 I;  1ZM3 A;  3HUL A;  4FMT A;  2UUB E;  3VHD A;  1YS3 A;  4MP2 A;  3CWV A;  2FYP A;  2CZ9 A;  4GKK E;  2YE6 A;  3M6A A;  2ZDX A;  1TH8 A;  3PEH A;  4MBC A;  4DU7 A;  3R4N A;  4H81 A;  4JV5 E;  2VCI A;  4LFC I;  2YEG A;  4CWO A;  4DXL A;  3HHU A;  4E00 A;  4DR3 I;  3D4J A;  4B3T I;  1XNQ E;  4W7T A;  1HNX I;  2ZKJ A;  2VCJ A;  1RRE A;  3U67 A;  1YER A;  4WUB A;  4B3S E;  4KSH A;  1IBM E;  4URN A;  2YE2 A;  1ZW9 A;  4HZ5 A;  4X62 I;  1HNZ I;  2ZM6 E;  5BR8 I;  2BZ5 A;  5BOD A;  5IN9 A;  3JAM Q;  4GQT A;  3J80 Q;  1PVG A;  4JYA E;  2QF6 A;  2WI7 A;  1A4H A;  2R3V A;  4PRV A;  1UY9 A;  4DV6 I;  2FXS A;  3A0W A;  1FJG E;  4CWF A;  1US7 A;  4L8Z A;  4JI1 E;  3PEJ A;  4EEH A;  3ZZ0 A;  3TZ0 A;  3T1Y I;  2IWU A;  1AM1 A;  4O05 A;  2O1V A;  2UUC I;  4ED4 A;  4USM A;  5L3J A;  3OPD A;  2O1W A;  4U93 A;  2WW4 A;  4I5S A;  4JQL A;  3B24 A;  3T0H A;  1Z0W A;  1YES A;  1XNR E;  2YEE A;  1Z59 A;  2EXL A;  1YSR A;  1NHI A;  3K1J A;  1PKP A;  4YY3 I;  4CWS A;  3TZ2 A;  4LF6 E;  4L90 A;  3LNU A;  2UXC E;  1S14 A;  4KFG A;  1B63 A;  3LPS A;  2YEH A;  3B78 A;  4DPW A;  4JI8 E;  1YSZ A;  4PU9 A;  3OTO I;  2BYH A;  4ASF A;  4DV4 E;  2WEP A;  1S4E A;  5GGZ A;  4P7A A;  4WUD A;  4DV0 E;  4K4O A;  4XIQ A;  3SL2 A;  3R4O A;  3OWB A;  2ZIT A;  1U0Z A;  1A6F A;  1NZ0 A;  1UYG A;  4LWG A;  2XDK A;  4JI0 I;  2F4V E;  2IOR A;  2YEI A;  1EA6 A;  5GMD A;  4NH9 A;  1D6T A;  1QYE A;  1UYD A;  2V34 A;  1N32 E;  1DAR A;  5LMU E;  4YKT A;  4DR6 I;  2BU8 A;  3QT8 A;  1HR0 I;  5IDM A;  3Q5K A;  5LMN I;  5FWK A;  5F3K A;  3T1H E;  1KZN A;  4URL A;  3RLR A;  1J5E I;  5M4P A;  4X9L A;  5D6Q A;  4UTG A;  4OX9 E;  3BM9 A;  4K0K E;  4YKZ A;  1MU5 A;  2WI5 A;  4L94 A;  4X64 I;  2HHH I;  4X66 I;  1B3Q A;  3EHF A;  2X7I A;  4GFN A;  2XJG A;  2CG9 A;  5FND A;  4DR1 E;  5D7D A;  4CWP A;  1NHJ A;  2BU2 A;  1UY8 A;  2XX5 A;  1Y8N A;  3T1K A;  4LF9 E;  5J6A A;  2YEC A;  3R4M A;  1FWK A;  4LFA I;  3TZ5 A;  4I3H A;  1BKN A;  1HNW E;  2UXD I;  1UYK A;  4MP7 A;  1N36 I;  5CTY A;  4KQV A;  3R92 A;  1TC6 A;  4MYU A;  3G7E A;  4KSG A;  3J81 C;  2YKJ A;  1FKA E;  4JI2 E;  2V2Z A;  1YT1 A;  4HXW A;  2VW5 A;  2BM1 A;  4FWG A;  2K5B A;  3QTF A;  1N33 E;  4EGK A;  1UYE A;  4LWF A;  4CWN A;  2WI3 A;  2VF3 A;  4DV7 I;  2CH4 A;  4E01 A;  1N34 E;  3ZM7 A;  4Z7Y A;  3V5R A;  4DR2 I;  2VQF E;  4HXZ A;  1ZM9 A;  5FNF A;  1GKX A;  1I59 A;  3EHG A;  2UUA E;  4B3R I;  4GKK I;  4KHP E;  3QDD A;  2XDU A;  1JM6 A;  4XTJ A;  1TIL A;  2YI6 A;  3WU5 A;  3GIG B;  2BU5 A;  2LJP A;  3Q5J A;  3QT7 A;  4DUY E;  1ZM2 A;  2ZBK B;  4X65 I;  4DV1 E;  1XMO I;  1YC4 A;  2YED A;  4JI6 I;  4YHH E;  2YK9 A;  1Y8O A;  3NMQ A;  2HG1 A;  4Z7C A;  4JI4 I;  5IT9 C;  1ZXM A;  1UYI A;  1MG7 A;  3H4L A;  1Z5C A;  2BT0 A;  1H74 A;  2YE5 A;  4JI7 I;  3HZ1 A;  2WEQ A;  4LF8 E;  4NXN E;  3K98 A;  2IWS A;  4JG4 A;  4O0B A;  4DR7 E;  5M4E A;  1ZM4 A;  2H8M A;  1I5C A;  3TTZ A;  5FNC A;  1YT0 A;  2YEJ A;  4JAV A;  4JAS A;  2Q8H A;  4HYM A;  1B62 A;  2YEB A;  2OI2 A;  3CRL A;  5LL6 R;  4DV2 I;  3G75 A;  1FNM A;  3J81 Q;  3T0Z A;  4O07 A;  3BMY A;  4LFC E;  5GME A;  3JZ3 A;  4GT8 A;  1Z0B A;  4DR3 E;  1XHK A;  1YC3 A;  3WHA A;  1BXD A;  1Z0E A;  3EKR A;  4MPN A;  4URO A;  4R3M A;  1AH6 A;  2CCT A;  2O1U A;  1HNX E;  4E02 A;  1Y4U A; 
#chains in the Genus database with same CATH topology
 4MYT A;  2IWX A;  1H7U A;  4JI3 I;  4YKQ A;  4YKX A;  4DV3 I;  1PIE A;  2C38 A;  4DR4 I;  4B7P A;  1S16 A;  4LF7 E;  2E0A A;  4X62 E;  1HNZ E;  5BR8 E;  2XX2 A;  3CGZ A;  3P06 A;  3U1K A;  4BAE A;  3INX A;  4AWQ A;  2Q8I A;  3M7N D;  2XHR A;  2VQE I;  2YI7 A;  4V26 A;  1Y4S A;  3R91 A;  3Q1Q A;  4LCF A;  5BOC A;  4DV6 E;  5K36 F;  5M4N A;  4DPX A;  3WU6 A;  4XKK A;  4LFB I;  3RLP A;  2YKC A;  5IT9 Q;  3RKZ A;  4FW7 A;  3T1Y E;  3GIG A;  1UYF A;  3CGY A;  4DV4 I;  2ESA A;  2WI2 A;  2UUC E;  4XIR A;  2YGF A;  2UU9 E;  4LF4 I;  2A2D A;  4DUZ I;  4FCP A;  4B3M E;  1FI4 A;  2IOP A;  3EKO A;  2HK3 A;  5C0X C;  2YGA A;  2PNL A;  2UXB I;  3B82 A;  4JAU A;  4H7Q A;  4AQY I;  1IBK I;  4URM A;  2BRC A;  4MPE A;  4YY3 E;  1Z0C A;  3J7A M;  2XAB A;  4ASB A;  3K17 A;  1TC0 A;  3S5T A;  3HJC A;  2XDX A;  1UY7 A;  4EM7 A;  1H72 C;  2DEI A;  3OTO E;  2CGE A;  1KKH A;  4NXM I;  2C2A A;  5CF0 A;  4JI5 I;  5K36 C;  4CWQ A;  4GKJ I;  2NN6 F;  5IDJ A;  1XMQ I;  4OZE A;  2HKJ A;  2HKE A;  4JI0 E;  4FWH A;  4DV5 I;  2IER A;  4MDT A;  3U1Y A;  1AH8 A;  1QY8 A;  3B28 A;  2VES A;  3VHC A;  1K47 A;  3DD6 A;  4DR1 I;  2JJC A;  5J71 A;  1E3P A;  2IOQ A;  2QFO A;  4BA2 B;  3PYG A;  4DR6 E;  4CE3 A;  4XDM A;  1VIS A;  4LF9 I;  4AM3 A;  4XKO A;  5LMN E;  4O09 A;  3B8H A;  1Z0V A;  3D2R A;  3TUH A;  1U2O A;  1HNW I;  1WUU A;  1YT2 A;  5CTX A;  5C93 A;  4DR5 I;  3EHH A;  2A2C A;  3HZ5 A;  4PRX A;  4IS9 A;  5DRQ A;  2WI6 A;  2GFD A;  3P3E A;  3PYE A;  1Y8P A;  4U7O A;  4XCJ A;  1Z0T A;  5M4K A;  3CYG A;  3HYY A;  4E00 A;  3T2S A;  2WI1 A;  3ZXO A;  3GIF A;  1RR9 A;  2BYI A;  1IBL I;  2E5L I;  3FT8 A;  2NN6 C;  4AIM A;  3R4P A;  3MNR P;  4DPT A;  1I94 I;  2BU7 A;  2IES A;  4YKU A;  4LF5 I;  5CPH A;  1N0U A;  4ISA A;  3DGE A;  5IWA E;  4XCL A;  1AMW A;  1UEK A;  1BGQ A;  5EL9 A;  2H55 A;  1N36 E;  4EMD A;  4R3A A;  3M85 G;  2YEA A;  3RLQ A;  3A0X A;  4RPF A;  3ZXQ A;  2UUB I;  2XEX A;  2ZDY A;  2BA0 D;  2BRE A;  3CRK A;  1Z5A A;  4U3D A;  2UUA I;  5JEN A;  3O6O A;  2YK2 A;  3K85 A;  4EGH A;  1GJV A;  3B26 A;  3ZKD A;  4CWT A;  4DUH A;  2GO4 A;  4DUY I;  4QPJ A;  4JV5 I;  4DV1 I;  2YKE A;  2BSM A;  4BXI A;  2JEA B;  3Q6M A;  3PS2 A;  2AKP A;  1YC1 A;  3K97 A;  5C0X B;  1TBW A;  1UYM A;  2YI5 A;  3LTO A;  1XNQ I;  4XC0 A;  4BIU A;  3QT5 A;  1BYQ A;  2JE6 B;  2GS8 A;  4FW4 A;  3WU4 A;  4XD8 A;  4NXN I;  1H7S A;  4B3S I;  1UDO A;  1I5A A;  2C1G A;  4V25 A;  4BA2 A;  1YET A;  2JEB B;  5A2Q C;  2BM0 A;  1IBM I;  1U2R A;  4DR7 I;  1UYL A;  3EHJ A;  3GME A;  1OYR A;  2ZM6 I;  1TID A;  4PL9 A;  4B3R E;  4R1F A;  1ZXN A;  2PO2 B;  5C0X D;  1OSF A;  3IED A;  5M4M A;  4JYA I;  1ELO A;  1R62 A;  2WNR B;  3K99 A;  4GGL A;  3PS3 A;  2NPF A;  5K36 B;  4X65 E;  1XMO E;  4AWO A;  5FLX C;  4JI6 E;  4KP4 A;  1FJG I;  2O1T A;  3J7A G;  4GCZ A;  4B3T E;  5F5R A;  4JI4 E;  4HY6 A;  4FW9 A;  4JI1 I;  4HAC B;  3A0T A;  2DEJ A;  1Y60 A;  1NHH A;  4JI7 E;  1ZWH A;  4BA1 B;  2YE3 A;  4GEE A;  4ZVI A;  2Q2E B;  3ZKB A;  2BTZ A;  3GIE A;  5K36 D;  2QG0 A;  3HKM A;  3FT5 A;  3VAD A;  2EFG A;  2V8P A;  4LF7 I;  4LWE A;  1FWL A;  4J3D A;  5M4H A;  1KIJ A;  2HFU A;  4BIZ A;  4UT4 A;  4FN5 A;  1XNR I;  3T10 A;  3UHM A;  4IZJ B;  2CCS A;  4LP0 A;  4DV2 E;  2CGF A;  1KTV A;  4LF6 I;  2UWD A;  2UXC I;  1I5B A;  4HYP A;  4CE1 A;  3OWD A;  4KTN A;  4XIP A;  5D7R A;  1UY6 A;  4JI8 I;  2Q8F A;  4JI3 E;  2PNR A;  3GON A;  4IZJ D;  4DV0 I;  2UU9 I;  4DV3 E;  4LWH A;  2PNM A;  2BA1 D;  2HFS A;  3FV5 A;  1MX0 A;  4B3M I;  4DR4 E;  2XCM A;  2Z5C A;  2JEA A;  3HYZ A;  2XK2 A;  4LPB A;  5C0X A;  2WI4 A;  2F4V I;  5A2Q Q;  1VI7 A;  2AJ4 A;  3A0Y A;  3B27 A;  4O04 A;  3KRN A;  4XKA A;  2HCH A;  2JE6 A;  3INW A;  3OW6 A;  4M1K A;  3C0E A;  4QPK A;  2VQE E;  4OO1 B;  1N32 I;  5LMU I;  2GO3 A;  2YGE A;  2JEB A;  2XHT A;  4YKW A;  5DRO A;  3WQ9 A;  4AS9 A;  3ZZU A;  5FLX Q;  2YKB A;  3T1H I;  1UYH A;  4LFB E;  3A0Z A;  1N0V C;  4IFD B;  2PO2 A;  1KVK A;  3U2D A;  4AWP A;  4Q20 A;  4BQG A;  2PNZ B;  2BV3 A;  2QG2 A;  4MU3 A;  4P52 A;  2FWY A;  3C11 A;  2WNR A;  4U7N A;  4OX9 I;  3GLL A;  4K0K I;  3O2F A;  5K36 A;  5JEA B;  4FPP A;  4CWR A;  4EMV A;  5C0X E;  4LF4 E;  4DUZ E;  4OO1 D;  3HEK A;  3LMM A;  2XD6 A;  4DU8 A;  3OMU A;  4DPU A;  4NH8 A;  4NH7 A;  3VHA A;  4HAC A;  2PO0 B;  1EI1 A;  2UXB E;  4IFD D;  4AQY E;  1IBK E;  4WUC A;  2O3Z A;  4BA1 A;  2YE7 A;  3U2K A;  4MPC A;  5JEA D;  1I58 A;  2XJJ A;  1HR0 E;  2YKI A;  5CTU A;  4MU1 A;  2V2V A;  3O0I A;  4EFU A;  1J5E E;  4QNJ A;  3PRY A;  2YI0 A;  4IZJ A;  2GQP A;  4DZY A;  4USK A;  4NXM E;  3B25 A;  4JI5 E;  2CCU A;  2JKI A;  4GKJ E;  2XDL A;  2YJW A;  4X64 E;  5ELW A;  4X66 E;  2HHH E;  2YED A;  3A0R A;  3V2U C;  1XMQ E;  2C37 B;  4L93 A;  1ID0 A;  4L91 A;  4XE2 A;  4H85 A;  2YJX A;  1Y5Y A;  1I5D A;  2XJX A;  4DV5 E;  4JI2 I;  1UDN A;  4FW6 A;  4LOM A;  2E1R A;  3F0N A;  5CTW A;  2YE4 A;  1H73 A;  1R6L A;  1YHC A;  2YE8 A;  2X36 A;  4ASG A;  1Z0G A;  2BU6 A;  1N33 I;  4ZKI A;  2XHX A;  5IWA I;  4LFA E;  2AE8 A;  4LPF A;  4OKG A;  1N34 I;  2VWC A;  2YE9 A;  3PYD A;  2UXD E;  2V2Q A;  1L0O A;  2R42 A;  4OO1 A;  4DR5 E;  2HK2 A;  3Q6N A;  2VQF I;  2YEF A;  4HZ0 A;  5D7C A;  4B6C A;  4HY1 A;  3QT6 A;  1GKZ A;  4XIT A;  3ZZT A;  3JAM C;  2Q8G A;  3Q5L A;  4FWD A;  1QZR A;  3J80 C;  4KHP I;  1F51 A;  4LWI A;  2FWZ A;  4IFD A;  4EFT A;  3D36 A;  1Z5B A;  2PNZ A;  4FCQ A;  3H80 A;  3TZ4 A;  1AJ6 A;  4BQJ A;  4MOT A;  3PYF A;  1Y6Z A;  1IBL E;  1OJ4 A;  5JEA A;  2E5L E;  4DPY A;  2WER A;  4CE2 A;  1UYC A;  4YHH I;  1I94 E;  2J7K A;  2Z5C B;  4QNK A;  3G7B A;  3P3G A;  3KE6 A;  3K60 A;  4YKY A;  2XX4 A;  4ASA A;  4LF5 E;  2XDS A;  4MB9 A;  3WU3 A;  4DV7 E;  4FCR A;  2PO0 A;  4OO1 E;  4YKR A;  1THN A;  3D0B A;  4DR2 E;  4LF8 I;  1ZM3 A;  3HUL A;  3GCM A;  4FMT A;  2UUB E;  3VHD A;  1YS3 A;  4MP2 A;  3CWV A;  4IFD E;  2FYP A;  2CZ9 A;  5DNL A;  3P76 A;  4GKK E;  2YE6 A;  2JT2 A;  3M6A A;  2ZDX A;  5JEA E;  1TH8 A;  3PEH A;  4MBC A;  4DU7 A;  3R4N A;  4H81 A;  5EKW A;  3M85 D;  4JV5 E;  5DRR A;  4LFC I;  2HHI A;  2F1D A;  4DXL A;  2VCI A;  2YEG A;  3HHU A;  4CWO A;  4DR3 I;  3D4J A;  4B3T I;  2C37 A;  4NBQ A;  1XNQ E;  4W7T A;  1HNX I;  2ZKJ A;  2VCJ A;  3M7N G;  1RRE A;  3U67 A;  1YER A;  4WUB A;  4B3S E;  4KSH A;  5DNX A;  1IBM E;  4URN A;  2YE2 A;  1ZW9 A;  4HZ5 A;  4X62 I;  1HNZ I;  2ZM6 E;  5BR8 I;  2BZ5 A;  5BOD A;  5IN9 A;  3JAM Q;  4EGI A;  4GQT A;  3J80 Q;  1PVG A;  4JYA E;  2QF6 A;  2WI7 A;  1A4H A;  2R3V A;  4PRV A;  1UY9 A;  4DV6 I;  2FXS A;  3A0W A;  1FJG E;  2FTK A;  4CWF A;  1US7 A;  2PO1 B;  4L8Z A;  3CDI A;  4JI1 E;  3PEJ A;  4EEH A;  3ZZ0 A;  3TZ0 A;  5C0X F;  3T1Y I;  2IWU A;  1AM1 A;  4O05 A;  2J65 A;  2O1V A;  2NN6 B;  2UUC I;  3P3C A;  4U3B A;  4ED4 A;  4USM A;  5L3J A;  5D6P A;  2C1I A;  3OPD A;  2O1W A;  1RHY A;  4U93 A;  2WW4 A;  4I5S A;  4JQL A;  3B24 A;  3T0H A;  3L7Z B;  1Z0W A;  1YES A;  1XNR E;  2YEE A;  1Z59 A;  2EXL A;  1YSR A;  4AID A;  1NHI A;  2NN6 D;  1PKP A;  3K1J A;  4YY3 I;  4CWS A;  1YH8 A;  3TZ2 A;  4LF6 E;  4L90 A;  3LNU A;  2UXC E;  1S14 A;  4KFG A;  1B63 A;  3LPS A;  2YEH A;  3B78 A;  4DPW A;  4JI8 E;  1YSZ A;  4PU9 A;  3OTO I;  2BYH A;  4ASF A;  4DV4 E;  2WEP A;  1S4E A;  5GGZ A;  4P7A A;  4WUD A;  4DV0 E;  4K4O A;  4XIQ A;  3SL2 A;  3R4O A;  3OWB A;  2ZIT A;  1U0Z A;  1A6F A;  1NZ0 A;  1UYG A;  4LWG A;  2XDK A;  4JI0 I;  2F4V E;  2IOR A;  2YEI A;  1EA6 A;  5GMD A;  4NH9 A;  1D6T A;  1QYE A;  1UYD A;  2V34 A;  4GQU A;  1N32 E;  1DAR A;  5LMU E;  4YKT A;  4DR6 I;  2BU8 A;  3QT8 A;  3CDJ A;  1HR0 I;  5IDM A;  1XXE A;  5LMN I;  3Q5K A;  5FWK A;  5F3K A;  3T1H E;  1KZN A;  4URL A;  3RLR A;  1J5E I;  5M4P A;  5K36 E;  4X9L A;  5D6Q A;  4UTG A;  4OX9 E;  2BR2 B;  4K0K E;  1P42 A;  3BM9 A;  4YKZ A;  2WP8 B;  1MU5 A;  2WI5 A;  4L94 A;  4X64 I;  2HHH I;  4X66 I;  1B3Q A;  3EHF A;  1R6M A;  2X7I A;  4GFN A;  2PO1 A;  2XJG A;  2CG9 A;  3H1C A;  5FND A;  1IXM A;  4DR1 E;  2NN6 A;  5D7D A;  4CWP A;  1NHJ A;  2BU2 A;  1UY8 A;  2XX5 A;  1Y8N A;  4N3O A;  4OO1 F;  2BA0 G;  3T1K A;  4LF9 E;  4LCG A;  5J6A A;  3L7Z A;  2YEC A;  3R4M A;  1FWK A;  4LFA I;  3TZ5 A;  4I3H A;  1BKN A;  1HNW E;  2UXD I;  4IFD F;  1UYK A;  4MP7 A;  1N36 I;  5CTY A;  4MQY A;  2C39 B;  4KQV A;  5JEA F;  4IZK B;  3R92 A;  1TC6 A;  2Z5B B;  4MYU A;  3G7E A;  2NN6 E;  4KSG A;  3J81 C;  2YKJ A;  1FKA E;  4JI2 E;  2V2Z A;  1YT1 A;  4HXW A;  2VW5 A;  3PS1 A;  4E72 A;  1HK7 A;  2C38 B;  2BM1 A;  1USV A;  4FWG A;  2K5B A;  1E3H A;  3QTF A;  3B4T A;  1N33 E;  4EGK A;  1UYE A;  4LWF A;  4FW5 A;  4CWN A;  2WI3 A;  1UDS A;  2VF3 A;  4DV7 I;  2CH4 A;  4E01 A;  1N34 E;  2GQ0 A;  3ZM7 A;  4Z7Y A;  3V5R A;  4DR2 I;  1OYP A;  2VQF E;  4HXZ A;  1ZM9 A;  4OO1 C;  5FNF A;  1GKX A;  1I59 A;  4MU4 A;  3EHG A;  2UUA E;  4B3R I;  4GKK I;  4KHP E;  3QDD A;  2XDU A;  1JM6 A;  4XTJ A;  1TIL A;  3NZK A;  2YI6 A;  3WU5 A;  3GIG B;  4IFD C;  2BU5 A;  2LJP A;  3Q5J A;  3QT7 A;  2BR2 A;  4DUY E;  1ZM2 A;  2ZBK B;  4X65 I;  2WP8 A;  4DV1 E;  1XMO I;  5JEA C;  4JI6 I;  4MU0 A;  4YHH E;  1Y8O A;  1YC4 A;  2HG1 A;  2YK9 A;  3NMQ A;  4Z7C A;  4JI4 I;  5IT9 C;  1ZXM A;  1UYI A;  1MG7 A;  1UDQ A;  2Z5E A;  4LCH A;  3H4L A;  1Z5C A;  2BT0 A;  1H74 A;  2YE5 A;  4JI7 I;  3HZ1 A;  4P8O A;  2WEQ A;  2CVE A;  4LF8 E;  4NXN E;  5DRP A;  3K98 A;  2IWS A;  4JG4 A;  1USU A;  4O0B A;  4FW3 A;  4DR7 E;  5M4E A;  1ZM4 A;  2H8M A;  1I5C A;  3TTZ A;  5FNC A;  1YT0 A;  2YEJ A;  4JAV A;  4JAS A;  2Q8H A;  4HYM A;  1B62 A;  2YEB A;  2OI2 A;  3CRL A;  5LL6 R;  4DV2 I;  3G75 A;  1FNM A;  3J81 Q;  1OYS A;  3T0Z A;  4O07 A;  3BMY A;  4LFC E;  5GME A;  3JZ3 A;  4GT8 A;  2BA1 G;  1Z0B A;  4DR3 E;  2C39 A;  1XHK A;  1YC3 A;  4IZK A;  3WHA A;  1BXD A;  1Z0E A;  2Z5B A;  3EKR A;  4MPN A;  4URO A;  4R3M A;  2O1U A;  1AH6 A;  2CCT A;  1HNX E;  4E02 A;  1Y4U A; 
#chains in the Genus database with same CATH homology
 4MYT A;  2IWX A;  1H7U A;  4JI3 I;  4YKQ A;  4YKX A;  4DV3 I;  1PIE A;  4DR4 I;  4B7P A;  1S16 A;  4LF7 E;  2E0A A;  4X62 E;  1HNZ E;  5BR8 E;  2XX2 A;  3CGZ A;  3P06 A;  4BAE A;  3INX A;  4AWQ A;  2Q8I A;  2XHR A;  2VQE I;  2YI7 A;  4V26 A;  1Y4S A;  3R91 A;  3Q1Q A;  5BOC A;  4DV6 E;  5M4N A;  4DPX A;  3WU6 A;  4XKK A;  4LFB I;  3RLP A;  2YKC A;  5IT9 Q;  3RKZ A;  3T1Y E;  3GIG A;  1UYF A;  3CGY A;  4DV4 I;  2ESA A;  2WI2 A;  2UUC E;  4XIR A;  2YGF A;  2UU9 E;  4LF4 I;  2A2D A;  4DUZ I;  4FCP A;  4B3M E;  1FI4 A;  2IOP A;  3EKO A;  2HK3 A;  2YGA A;  2PNL A;  2UXB I;  3B82 A;  4JAU A;  4H7Q A;  4AQY I;  1IBK I;  4URM A;  2BRC A;  4MPE A;  4YY3 E;  1Z0C A;  3J7A M;  2XAB A;  4ASB A;  3K17 A;  1TC0 A;  3HJC A;  2XDX A;  1UY7 A;  4EM7 A;  1H72 C;  2DEI A;  3OTO E;  2CGE A;  1KKH A;  4NXM I;  2C2A A;  5CF0 A;  4JI5 I;  4CWQ A;  4GKJ I;  5IDJ A;  1XMQ I;  2HKJ A;  2HKE A;  4JI0 E;  4FWH A;  4DV5 I;  1AH8 A;  1QY8 A;  3B28 A;  3VHC A;  1K47 A;  4DR1 I;  5J71 A;  2JJC A;  2IOQ A;  2QFO A;  3PYG A;  4DR6 E;  4CE3 A;  4XDM A;  1VIS A;  4LF9 I;  4XKO A;  5LMN E;  4O09 A;  3B8H A;  1Z0V A;  3D2R A;  3TUH A;  1U2O A;  1HNW I;  1WUU A;  1YT2 A;  5CTX A;  5C93 A;  4DR5 I;  3EHH A;  2A2C A;  3HZ5 A;  4PRX A;  2WI6 A;  4U7O A;  5M4K A;  2GFD A;  4XCJ A;  3PYE A;  1Y8P A;  1Z0T A;  3HYY A;  3T2S A;  2WI1 A;  3ZXO A;  3GIF A;  1RR9 A;  2BYI A;  1IBL I;  2E5L I;  3FT8 A;  3R4P A;  3MNR P;  4DPT A;  1I94 I;  2BU7 A;  4YKU A;  4LF5 I;  5CPH A;  1N0U A;  3DGE A;  4XCL A;  5IWA E;  1AMW A;  1UEK A;  1BGQ A;  2H55 A;  1N36 E;  4EMD A;  4R3A A;  3RLQ A;  2YEA A;  3ZXQ A;  3A0X A;  4RPF A;  2UUB I;  2XEX A;  2ZDY A;  2BRE A;  3CRK A;  1Z5A A;  2UUA I;  3O6O A;  2YK2 A;  3K85 A;  4EGH A;  1GJV A;  3B26 A;  3ZKD A;  4CWT A;  4DUH A;  4DUY I;  4QPJ A;  4JV5 I;  4DV1 I;  2YKE A;  2BSM A;  4BXI A;  3Q6M A;  2AKP A;  1YC1 A;  3K97 A;  1TBW A;  1UYM A;  2YI5 A;  3LTO A;  1XNQ I;  4XC0 A;  4BIU A;  3QT5 A;  1BYQ A;  2GS8 A;  3WU4 A;  4XD8 A;  4NXN I;  1H7S A;  4B3S I;  1I5A A;  4V25 A;  1YET A;  1UYL A;  5A2Q C;  2BM0 A;  1IBM I;  1U2R A;  4DR7 I;  3EHJ A;  1TID A;  2ZM6 I;  4PL9 A;  4B3R E;  4R1F A;  1ZXN A;  1OSF A;  3IED A;  5M4M A;  4JYA I;  1ELO A;  1R62 A;  3K99 A;  4GGL A;  2NPF A;  4X65 E;  1XMO E;  4AWO A;  5FLX C;  4JI6 E;  4KP4 A;  1FJG I;  2O1T A;  3J7A G;  4GCZ A;  4B3T E;  5F5R A;  4JI4 E;  4HY6 A;  4FW9 A;  4JI1 I;  4HAC B;  3A0T A;  2DEJ A;  1NHH A;  4JI7 E;  1ZWH A;  2YE3 A;  4GEE A;  4ZVI A;  2Q2E B;  3ZKB A;  2BTZ A;  3GIE A;  2QG0 A;  3FT5 A;  3VAD A;  2EFG A;  2V8P A;  4LF7 I;  4LWE A;  1FWL A;  5M4H A;  1KIJ A;  2HFU A;  4BIZ A;  4UT4 A;  4FN5 A;  1XNR I;  3T10 A;  4IZJ B;  2CCS A;  4LP0 A;  4DV2 E;  2CGF A;  1KTV A;  4LF6 I;  2UWD A;  2UXC I;  1I5B A;  4HYP A;  4CE1 A;  3OWD A;  4KTN A;  4XIP A;  5D7R A;  1UY6 A;  4JI8 I;  2Q8F A;  4JI3 E;  2PNR A;  3GON A;  4IZJ D;  4DV0 I;  2UU9 I;  4DV3 E;  4LWH A;  2PNM A;  2HFS A;  3FV5 A;  4P8O A;  1MX0 A;  4B3M I;  4DR4 E;  2XCM A;  2Z5C A;  3HYZ A;  2XK2 A;  4LPB A;  3B27 A;  2WI4 A;  2F4V I;  5A2Q Q;  2AJ4 A;  3A0Y A;  4O04 A;  4XKA A;  4EGI A;  2HCH A;  3INW A;  3OW6 A;  4M1K A;  3C0E A;  4QPK A;  2VQE E;  1N32 I;  5LMU I;  2YGE A;  4YKW A;  2XHT A;  3WQ9 A;  4AS9 A;  3ZZU A;  5FLX Q;  2YKB A;  3T1H I;  1UYH A;  4LFB E;  3A0Z A;  1N0V C;  4BQG A;  1KVK A;  3U2D A;  4AWP A;  4Q20 A;  2BV3 A;  2QG2 A;  4P52 A;  2FWY A;  3C11 A;  4U7N A;  4CWR A;  4OX9 I;  3O2F A;  4K0K I;  4EMV A;  4FPP A;  4LF4 E;  4DUZ E;  3HEK A;  2XD6 A;  4DU8 A;  3OMU A;  4DPU A;  4NH8 A;  4NH7 A;  3VHA A;  4HAC A;  1EI1 A;  2UXB E;  4AQY E;  1IBK E;  4WUC A;  2YE7 A;  3U2K A;  4MPC A;  1I58 A;  2XJJ A;  1HR0 E;  2YKI A;  5CTU A;  2V2V A;  3O0I A;  4EFU A;  1J5E E;  3PRY A;  2YI0 A;  4IZJ A;  2GQP A;  4DZY A;  4USK A;  4NXM E;  3B25 A;  4JI5 E;  2CCU A;  2JKI A;  4GKJ E;  2XDL A;  2YJW A;  4X64 E;  2HHH E;  4X66 E;  4L93 A;  4L91 A;  3A0R A;  1XMQ E;  3V2U C;  5D6P A;  1ID0 A;  4XE2 A;  4H85 A;  2YJX A;  1I5D A;  2XJX A;  4DV5 E;  4JI2 I;  2E1R A;  3F0N A;  5CTW A;  2YE4 A;  1H73 A;  2YE8 A;  2X36 A;  4ASG A;  1Z0G A;  2BU6 A;  1N33 I;  4ZKI A;  2XHX A;  5IWA I;  4LFA E;  2VWC A;  1N34 I;  2YE9 A;  3PYD A;  2UXD E;  2V2Q A;  1L0O A;  2R42 A;  4DR5 E;  2HK2 A;  3Q6N A;  2VQF I;  2YEF A;  4HZ0 A;  5D7C A;  4B6C A;  4HY1 A;  3QT6 A;  1GKZ A;  4XIT A;  3ZZT A;  3JAM C;  2Q8G A;  3Q5L A;  4FWD A;  1QZR A;  3J80 C;  4KHP I;  4LWI A;  2FWZ A;  4EFT A;  3D36 A;  1Z5B A;  4FCQ A;  3H80 A;  3TZ4 A;  1AJ6 A;  4BQJ A;  4MOT A;  3PYF A;  1Y6Z A;  1IBL E;  1OJ4 A;  2E5L E;  2WER A;  4DPY A;  4CE2 A;  1UYC A;  4YHH I;  1I94 E;  2J7K A;  2Z5C B;  3G7B A;  3KE6 A;  3K60 A;  4YKY A;  2XX4 A;  4ASA A;  4LF5 E;  2XDS A;  4MB9 A;  3WU3 A;  4DV7 E;  4FCR A;  4YKR A;  1THN A;  3D0B A;  4DR2 E;  4LF8 I;  1ZM3 A;  3HUL A;  4FMT A;  2UUB E;  3VHD A;  1YS3 A;  4MP2 A;  3CWV A;  2FYP A;  2CZ9 A;  4GKK E;  2YE6 A;  3M6A A;  2ZDX A;  1TH8 A;  3PEH A;  4MBC A;  4DU7 A;  3R4N A;  4H81 A;  4JV5 E;  2VCI A;  4LFC I;  2YEG A;  4CWO A;  4DXL A;  3HHU A;  4E00 A;  4DR3 I;  3D4J A;  4B3T I;  1XNQ E;  4W7T A;  1HNX I;  2ZKJ A;  2VCJ A;  1RRE A;  3U67 A;  1YER A;  4WUB A;  4B3S E;  4KSH A;  1IBM E;  4URN A;  2YE2 A;  1ZW9 A;  4HZ5 A;  4X62 I;  1HNZ I;  2ZM6 E;  5BR8 I;  2BZ5 A;  5BOD A;  5IN9 A;  3JAM Q;  4GQT A;  3J80 Q;  1PVG A;  4JYA E;  2QF6 A;  2WI7 A;  1A4H A;  2R3V A;  4PRV A;  1UY9 A;  4DV6 I;  2FXS A;  3A0W A;  1FJG E;  4CWF A;  1US7 A;  4L8Z A;  4JI1 E;  3PEJ A;  4EEH A;  3ZZ0 A;  3TZ0 A;  3T1Y I;  2IWU A;  1AM1 A;  4O05 A;  2O1V A;  2UUC I;  4ED4 A;  4USM A;  5L3J A;  3OPD A;  2O1W A;  4U93 A;  2WW4 A;  4I5S A;  4JQL A;  3B24 A;  3T0H A;  1Z0W A;  1YES A;  1XNR E;  2YEE A;  1Z59 A;  2EXL A;  1YSR A;  1NHI A;  3K1J A;  1PKP A;  4YY3 I;  4CWS A;  3TZ2 A;  4LF6 E;  4L90 A;  3LNU A;  2UXC E;  1S14 A;  4KFG A;  1B63 A;  3LPS A;  2YEH A;  3B78 A;  4DPW A;  4JI8 E;  1YSZ A;  4PU9 A;  3OTO I;  2BYH A;  4ASF A;  4DV4 E;  2WEP A;  1S4E A;  5GGZ A;  4P7A A;  4WUD A;  4DV0 E;  4K4O A;  4XIQ A;  3SL2 A;  3R4O A;  3OWB A;  2ZIT A;  1U0Z A;  1A6F A;  1NZ0 A;  1UYG A;  4LWG A;  2XDK A;  4JI0 I;  2F4V E;  2IOR A;  2YEI A;  1EA6 A;  5GMD A;  4NH9 A;  1D6T A;  1QYE A;  1UYD A;  2V34 A;  1N32 E;  1DAR A;  5LMU E;  4YKT A;  4DR6 I;  2BU8 A;  3QT8 A;  1HR0 I;  5IDM A;  3Q5K A;  5LMN I;  5FWK A;  5F3K A;  3T1H E;  1KZN A;  4URL A;  3RLR A;  1J5E I;  5M4P A;  4X9L A;  5D6Q A;  4UTG A;  4OX9 E;  3BM9 A;  4K0K E;  4YKZ A;  1MU5 A;  2WI5 A;  4L94 A;  4X64 I;  2HHH I;  4X66 I;  1B3Q A;  3EHF A;  2X7I A;  4GFN A;  2XJG A;  2CG9 A;  5FND A;  4DR1 E;  5D7D A;  4CWP A;  1NHJ A;  2BU2 A;  1UY8 A;  2XX5 A;  1Y8N A;  4N3O A;  3T1K A;  4LF9 E;  5J6A A;  2YEC A;  3R4M A;  1FWK A;  4LFA I;  3TZ5 A;  4I3H A;  1BKN A;  1HNW E;  2UXD I;  1UYK A;  4MP7 A;  1N36 I;  5CTY A;  4KQV A;  4IZK B;  3R92 A;  1TC6 A;  2Z5B B;  4MYU A;  3G7E A;  4KSG A;  3J81 C;  2YKJ A;  1FKA E;  4JI2 E;  2V2Z A;  1YT1 A;  4HXW A;  2VW5 A;  1HK7 A;  2BM1 A;  1USV A;  4FWG A;  2K5B A;  3QTF A;  1N33 E;  4EGK A;  1UYE A;  4LWF A;  4CWN A;  2WI3 A;  2VF3 A;  4DV7 I;  2CH4 A;  4E01 A;  1N34 E;  2GQ0 A;  3ZM7 A;  4Z7Y A;  3V5R A;  4DR2 I;  2VQF E;  4HXZ A;  1ZM9 A;  5FNF A;  1GKX A;  1I59 A;  3EHG A;  2UUA E;  4B3R I;  4GKK I;  4KHP E;  3QDD A;  2XDU A;  1JM6 A;  4XTJ A;  1TIL A;  2YI6 A;  3WU5 A;  3GIG B;  2BU5 A;  2LJP A;  3Q5J A;  3QT7 A;  4DUY E;  1ZM2 A;  2ZBK B;  4X65 I;  4DV1 E;  1XMO I;  1YC4 A;  2YED A;  4JI6 I;  4YHH E;  2YK9 A;  1Y8O A;  3NMQ A;  2HG1 A;  4Z7C A;  4JI4 I;  5IT9 C;  1ZXM A;  1UYI A;  1MG7 A;  2Z5E A;  3H4L A;  1Z5C A;  2BT0 A;  1H74 A;  2YE5 A;  4JI7 I;  3HZ1 A;  2WEQ A;  4LF8 E;  4NXN E;  3K98 A;  2IWS A;  4JG4 A;  1USU A;  4O0B A;  4DR7 E;  5M4E A;  1ZM4 A;  2H8M A;  1I5C A;  3TTZ A;  5FNC A;  1YT0 A;  2YEJ A;  4JAV A;  4JAS A;  2Q8H A;  4HYM A;  1B62 A;  2YEB A;  2OI2 A;  3CRL A;  5LL6 R;  4DV2 I;  3G75 A;  1FNM A;  3J81 Q;  3T0Z A;  4O07 A;  3BMY A;  4LFC E;  5GME A;  3JZ3 A;  4GT8 A;  1Z0B A;  4DR3 E;  1XHK A;  1YC3 A;  4IZK A;  3WHA A;  1BXD A;  1Z0E A;  2Z5B A;  3EKR A;  4MPN A;  4URO A;  4R3M A;  2O1U A;  1AH6 A;  2CCT A;  1HNX E;  4E02 A;  1Y4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...