4FPPA

Bacterial phosphotransferase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
205
structure length
205
Chain Sequence
PDFAAMLAARLCHDFISPASAIVSGLDLLEDPSAQDMRDDAMNLIASSARKLADLLQFTRVAFGASASAENFDSRELEKLAQGVFAHVRPTLDWQIEPQAMNKPSSRAVLNIAQIAASALPAGGVATVKGVAADGRFSIIADAKGPRARLRPEVLAGLKGEPLAEGLGGPWVQAAYLNALVRAAGGQIAVEIGEDRASIAAWVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphotransferase
publication title Structural insights into ChpT, an essential dimeric histidine phosphotransferase regulating the cell cycle in Caulobacter crescentus.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Transferase
total genus 66
structure length 205
sequence length 205
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10090 HPTransfase Histidine phosphotransferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fppA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4fppA02
4JAUA 4BQJA 2BREA 1QZRA 1AH8A 1UY7A 4CWQA 2O1WA 1YERA 4LWFA 1JM6A 3HZ5A 3INWA 4YKWA 4XC0A 3D0BA 4AWOA 5CPHA 1AMWA 2CH4A 4I3HA 1YT1A 4LC1A 4YKZA 2YEGA 1BKNA 1B62A 3CGZA 2CCUA 2FWYA 4BIUA 1UYKA 3EKRA 2YJXA 1OSFA 3G75A 2QM8A 2YGEA 3JZ3A 3TZ0A 2XD6A 3RKZA 3T1KA 1UY6A 5F5RA 3LPSA 2XJGA 2WEPA 3Q5LA 4U7NA 2XJJA 4PL9A 1YT0A 4GGLA 2AKPA 5FNDA 1UYGA 5J6AA 3CGYA 2GQPA 1MX0A 1NHJA 5M4PA 1UYCA 5FNCA 1UYLA 4MB9A 3ZRXA 4PRXA 4V26A 3FT8A 4GT8A 1S14A 2BU2A 3OMUA 4CWOA 3GIGA 2Q8HA 2WI2A 2YE2A 1UYHA 4MT8A 3SL2A 4ASBA 2YK9A 2BU6A 4WUBA 1B63A 1I5AA 3HYZA 3B24A 3MD0A 1TC0A 3A0ZA 1NHIA 1TH8A 4E01A 4KFGA 1TILA 4YKQA 4CE2A 2YJWA 2XX2A 1B3QA 2P67A 4EEHA 3RLPA 1F51A 4FCQA 1L0OA 2VW5A 4EFTA 4GEEA 4GT1A 2XDXA 4JAVA 3R91A 3U67A 4CWNA 4YKRA 4WUDA 4L8ZA 2HG1A 3R92A 1H7SA 2YEHA 3NMQA 3VHCA 3R4NA 4URLA 3EHHA 4QPKA 2XHRA 4MPCA 3PEJA 4LP0A 3HYYA 4MOTA 2LFRA 3GIGB 1Y4UA 3K99A 3GIFA 2E0AA 2C2AA 5GGZA 4L91A 3A0XA 4H85A 5F3KA 3Q5KA 2FTKA 2Q8IA 5CF0A 3T10A 2WERA 1I59A 2IOQA 1EI1A 2BTZA 5CTWA 3P32A 1A4HA 4HY1A 5C93A 1THNA 3K97A 1GJVA 3VADA 3LNUA 1QYEA 1TIDA 2BYIA 3A0TA 1YSRA 3ZKBA 2YEAA 4JYCA 1YC4A 3EKOA 4XD8A 1U2OA 5CTXA 4ASFA 1I58A 1TC6A 1NHHA 4LWEA 3OWBA 3ZXQA 1UY9A 1ZXNA 4MTXA 1IXMA 4L93A 3IEDA 1KZNA 5B1OA 2XX5A 1S16A 3ZRWA 3B26A 2ESAA 5FWKA 4CWPA 3A0YA 4PRVA 4HZ0A 3OW6A 3R4OA 2XDUA 3O2FA 4YKUA 1YETA 4PU9A 1UYEA 2QG0A 2YE9A 5D7CA 4XIQA 1YSZA 1UYDA 2IWUA 2WI4A 3TZ2A 4KTNA 4FPPA 2FXSA 3FT5A 3A0RA 4JASA 1BGQA 1AH6A 2XDSA 4FMTA 1I5BA 2EXLA 3K98A 4P8OA 5IDJA 4EGHA 5IDMA 3K60A 3H4LA 3EHFA 1GKXA 4MP2A 1UYFA 4KSGA 4CWSA 2JJCA 2WWWA 4U93A 4YKXA 2BU8A 4Q20A 3HEKA 4NH7A 3VHDA 5BODA 2O1UA 3TTZA 1ZW9A 2K5BA 4XIPA 2YEDA 2XX4A 3VHAA 2YE4A 1Y4SA 2XHXA 3DGEA 3ZRWB 4HXWA 4V25A 4MPEA 4CWFA 3ZCCA 4O0BA 2IORA 3O0IA 4EGKA 4MPNA 4YKYA 3RLRA 2YI6A 2IWXA 5D6PA 3MNRP 4E00A 3TZ4A 4W7TA 3ZKDA 3PEHA 4EMVA 4X9LA 4HYMA 5D6QA 1Z5BA 1YC1A 2O1VA 3C11A 4R3AA 1YS3A 5B1NA 3CRLA 3WHAA 4LWHA 2QF6A 4U7OA 1GKZA 2QFOA 2BU5A 2YEBA 2YGAA 3Q5JA 4HXZA 3T0HA 1R62A 3C0EA 3T2SA 2YGFA 1H7UA 2BRCA 1Z5AA 4E02A 4I5SA 5M4EA 1YT2A 2QG2A 3A0WA 4GQTA 4XKOA 4XE2A 4AS9A 2XK2A 3EHGA 2ZDXA 4L94A 1U0ZA 3D2RA 2PNRA 4AWPA 4DZYA 5CTYA 4JQLA 3GIEA 2VCJA 3OPDA 3INXA 3T0ZA 4BIZA 4H7QA 4LWIA 4ZVIA 2YK2A 3BMYA 4HZ5A 2CCSA 2YKIA 2YEEA 4DUHA 2Q8GA 4XCJA 3NXSA 1I5CA 1KIJA 3ZRVA 4WUCA 2IOPA 2YE3A 2XDLA 3KE6A 2H55A 1Z59A 5D7RA 2HKJA 2ZDYA 4BAEA 4BQGA 2WI7A 3BM9A 5D7DA 3WQ9A 2YI0A 2YKCA 2ZBKB 4H81A 4K4OA 3TZ5A 2WI6A 3QTFA 2YECA 4CWTA 4EFUA 5M4HA 4ASGA 4MBCA 5M4KA 2H8MA 2QM7A 3H80A 3G7BA 3B27A 4R3MA 3HHUA 4KSHA 2YEIA 4O09A 1UYMA 4FCPA 4P7AA 4GCZA 4URNA 2YE7A 2FYPA 3ZM7A 4KP4A 4KQVA 1Z5CA 4YKTA 4HYPA 4NH8A 2LFSA 5M4MA 2YI7A 2YEJA 2YKJA 2CGFA 2Q8FA 2HCHA 2FWZA 2YEFA 1BXDA 2CG9A 3R4PA 3HZ1A 4O05A 2BZ5A 4NH9A 4URMA 1EA6A 1Y8PA 2XCMA 5L3JA 3R4MA 3B25A 1US7A 4XCLA 1ZWHA 4XKKA 1PVGA 2BT0A 1UY8A 1ID0A 2IWSA 3O6OA 4B6CA 5J71A 2XHTA 2ZKJA 2XJXA 2YKEA 1TBWA 2YE5A 1I5DA 2XDKA 2WI3A 4O07A 2BU7A 4HY6A 4O04A 4ASAA 1JOYA 4FCRA 1BYQA 4CE1A 3EHJA 1Y8OA 3TK1A 3RLQA 3FV5A 4GFNA 4L90A 5FNFA 5M4NA 4LPBA 4EGIA 1MU5A 2GFDA 5IN9A 2JKIA 2XABA 2YE6A 1AM1A 1YC3A 5CTUA 2YKBA 2VCIA 4MP7A 3CRKA 4LWGA 4EM7A 2UWDA 2Q2EB 3CWVA 2WI1A 2YE8A 1UYIA 4ZKIA 3B28A 4XKAA 4BXIA 3QDDA 4XTJA 1QY8A 3TUHA 4AWQA 4B7PA 2WI5A 5BOCA 4CWRA 3G7EA 3ZXOA 4QPJA 4XIRA 1AJ6A 2WEQA 4XDMA 4UROA 4XITA 4CE3A 3U2KA 4JYBA 2BYHA 3OWDA 2YI5A 1YESA 4R1FA 2VWCA 1Y8NA 3D36A 3U2DA 1ZXMA 2CCTA 2BSMA
chains in the Genus database with same CATH superfamily
3RN4A 1I08A 2BREA 1WP8A 4EB6A 4NXNB 4DUZO 3P3NA 4AQYO 4UV9A 4WFBV 1GM9A 1TUEB 2EIKC 3I55V 2O1WA 2YICA 4JI8B 4IIJB 1PV0A 2DMXA 4TV9B 5B3SC 4XC0A 1KECA 3IC7A 2E75B 3CCLV 3ASOC 1YXBA 3OR7C 2AHZA 4I3HA 4IYIA 4YKZA 2YEGA 1BKNA 1GH6A 2UUCB 4NTYA 1OV9A 4LF4B 2CCUA 2QE7G 2PI4A 3SPIA 1KYOF 1KP3A 2QM8A 3T4ZA 4ZI7B 2Q0AA 4KL1A 2OCHA 4UFZA 1X4TA 3L75H 3CCQV 4LF5B 1YT0A 1JJOA 2PI5A 1JMKC 2YIBA 1NTZH 1SS3A 4O4JA 1S5JA 3AG3B 3CCEV 1H2KA 5GONA 1UYGA 1XBLA 1HW7A 5J6AA 2DYSC 3X2QC 2Q7EA 5IJ9A 2ZE8A 2ZT9B 4JV5O 1UYCA 4ZOLA 3FT8A 1Q7YW 3AG1C 1AROP 3RYHB 1E79G 3BAAA 3S3WA 4CWOA 3CYOA 3QO7A 2Q8HA 2CK3G 4PI2A 4IHJB 2UXDO 5CBGA 1HWYA 4ASBA 1B63A 1I5AA 1I5XA 3ZJZA 4DR1O 5TISZ 1TH8A 4KFGA 5IYBO 1R3LC 4I4TA 5JWPA 4NR1A 4WFAV 4B3TB 2ZXWB 5F2VO 3CCMV 1RSOA 4LWSB 2H3OA 4J9ZB 4X8AA 3K9AA 1AILA 4JZ2A 4EEHA 4EFTA 2ZQMA 2VW5A 5L3DA 4GEEA 3S3XA 5IWAB 2XDXA 1K8AW 4YKRA 5JVDB 1QVFU 2QA4V 1DF4A 3R92A 4PI0A 3NMQA 3FB8C 5H2FZ 1OCZB 1BMFG 2RN9A 1M57B 3RW0A 1HR0O 1XL6A 3JSLA 2EIJC 1Y4UA 2JGUA 2YDEA 2C2AA 4ZHQB 3KCYA 3H9VA 1M90W 4LF9O 5LHGA 1ZSPA 3FB7C 4DR2B 5CBFA 5LGTA 3IGAC 4FM2A 3T10A 2WERA 5LMNO 4DUYO 3JATB 1QHTA 2ADQB 5IT9N 5LYJB 2AHYA 4RQEA 1Z2GA 4O2BB 1A4HA 4JI6B 3FB5C 5C93A 2GUZB 5L3GA 2DWEC 3K97A 3UT5A 3DTUB 4UCRA 3LNUA 1FD9A 2QGNA 4D7TA 4R8CA 5EYPB 1YSRA 3ZKBA 2YEAA 1W2BU 3TXQA 2VWKA 5CTXA 3P30A 1VQMV 1NHHA 2JIZG 5EZYB 1SQQH 4GUNA 2BTQB 2UXNA 1ZXNA 4MTXA 3AEIA 4LR3A 4GKKB 1KZNA 3ZMZA 2LO1A 1S16A 1KKCA 3UQ8A 2EILC 3CMAV 4CWPA 2IJJA 4CH6A 1N34B 4HZ0A 4DR5O 4B7KA 5D7CA 1GN2A 2IW5A 4I0XB 5AG2A 4LFBB 4XIQA 2MK3A 5EIBC 2WI4A 1PNKA 3HKDA 4KTNA 1Y4MA 3APOA 4EB6B 1FJGB 4JASA 1P49A 1AH6A 3JD4A 5BZBA 4BWAA 3K5LA 3TGUH 2EXLA 1YITV 3K98A 4PD4F 1R3KC 4IL6Z 5IDMA 1I0HA 3EVKA 4DO2A 3JALA 1KB9F 1NH2B 1V54C 3T1CA 5LGUA 1P84F 1K5QA 5KA5A 2WWWA 2QSAA 3ZHVA 3EXAA 4Q20A 2CUGA 3TJTA 3HEKA 1JA8A 4NH7A 4F6RA 3E22B 4X1IB 3T1HB 2O1UA 2K5BA 1GKFA 1SKVA 3S5TA 1NZ6A 2YEDA 2XX4A 4ZBMA 4NVPA 2YE4A 4BW9A 3J80N 1M9NA 3BHPA 3ABKB 3DGEA 1R6KA 4DV2O 4OX9O 4CWFA 3ZCCA 4O0BA 2IORA 5KX5A 1WPBA 3T2MA 1AR1B 4MS2A 1OCOB 2WLNA 5FLXN 1KQSU 4X65B 5D6PA 1Z5WA 4I50A 4O4JB 2CTRA 3PEHA 3STZC 1FPOA 4TSFG 2X7RB 5IJ9B 4O4HA 1QR8A 3CRLA 2HVKC 4W4KA 2ZNIA 1GKZA 2E5LO 3QNEA 5LGNA 3G71V 2QFOA 3QF7A 2BU5A 2YGAA 3T0HA 1A32A 4Z1MG 2JEUA 3D36C 1H7UA 1XOUA 1Z5AA 1IVSA 5M4EA 1YT2A 1N32O 3DSQA 1SC5B 1YJNV 3A0WA 4AS9A 4XE2A 3JD1A 2WLJA 3DXRA 3LDCA 1U0ZA 4DRXA 4HYOA 4AWPA 1T5EA 2VWJA 3GIEA 1VP7A 4BIOA 4MTOA 4I4TB 2VCJA 3OPDA 3T0ZA 2YXYA 2QWQB 3CE2A 3BMYA 2CCSA 4DUHA 4AQYB 2DJVA 3CEIA 5LXTA 3NXSA 3K57A 3CS5A 4J9YB 3ZRVA 3VQWA 4FJCC 4MTGA 2PF4E 2IOPA 4PA9A 3RYIB 2YE3A 1SQPH 3WU2Z 3UO3A 1B6QA 4UCOA 1YCIA 2VQFB 3CRRA 4ASUG 4NXNO 5LMUB 1Z59A 2HKJA 1Y74A 1AI5A 3RYFA 4JI8O 1PL0A 1E1QG 2PTMA 4BQGA 1H8EG 4MW3A 5CN0A 2ZNJA 3WQ9A 2RQ6A 1JQ0A 4CWTA 5M4HA 2YECA 2P06A 4DR6B 5M4KA 1NKDA 3JSNA 1GN6A 4LFAO 1NH2D 4O2AA 4KSHA 1DTOA 4UV8A 1EM1A 1HNXB 4URNA 2L35A 2OWOA 4Q6GA 2ZE5A 2C1GA 4YKTA 4OPHA 1CXZB 4LF5O 4R50A 2ZDIC 1G6UA 1RM1C 4TUYA 3UT5B 4JI3B 2YI7A 2YKJA 2CGFA 3VQVA 1BXDA 2CG9A 4TV8B 4O05A 2BZ5A 2ZE6A 4O4IA 1BZKA 2NNUA 1EA6A 4X64B 2XCMA 3R4MA 2RDCA 3JYCA 3ETGA 3B25A 2ATKC 5H6QA 1YVWA 3U10A 4XKKA 1JPXA 3K59A 5L3EA 2A0LA 3O6OA 1KP2A 5J71A 2GDSA 3G4SV 2CTWA 1XDCA 3H1JH 4O07A 4O04A 1NT2B 2M7WA 2A7WA 2IJIA 2M6YA 2H94A 4PV1B 3TK1A 1AB3A 3FV5A 3ZMVA 3NR7A 2WLIA 4L90A 5IYCO 1HDJA 5FNFA 2WPDG 4B3TO 4LPBA 4EGIA 1P4RA 4JTCB 2XAJA 3FX7A 1B04A 5EBLC 4P30A 2F23A 3JALB 4IIJA 4FLTA 5CTUA 4K35A 4HAMA 4TV9A 5L3BA 1HR0B 3IAYA 3EFFK 5IWAO 2OTJV 5KLVH 3DC6A 2Q2EB 2X0LA 3RGBA 1L1FA 4X66O 2YE8A 1UYIA 5CMUA 3SGIA 3VOUA 4DR3O 4B7PA 1THZA 2WI5A 4FLZA 4QPJA 2IBZH 4XIRA 3R65A 1QLEC 1Y76B 5LMNB 4DV4B 1PPJH 3QG5A 2WEQA 2FYUH 1VQKV 1SRYA 4ZI7A 5KX5B 2BYHA 3E8FA 5JJJB 3ZHRA 1JJ2U 3GWOA 4I50B 4DR2O 2VWCA 3ABMC 2QJ1A 4DV7B 2Z5UA 1PKXA 3A0HZ 1ZXMA 2Y69B 3TXSA 3M7MX 1SF9A 2BSMA 2X6CA 4UCVA 2XAFA 4O4HB 4YJ2B 1TUBA 2CGNA 4GX5A 4JI6O 1LUWA 3FAVB 5FNVB 3RWRD 2YXHA 2UUBO 2RNBA 4Z1VA 4LWFA 5JJEB 3JCUZ 4U3JA 3INWA 2P4VA 4CC6A 3JCZA 4MW8A 2JGDB 2HG5C 1AMWA 3ZHQA 3DXRB 1K3EA 4DRXB 1EFRG 1V9PA 3BFRA 4IHJA 1XNRB 1BQ0A 4PDVA 3EKRA 5HFLA 2D2CB 3G75A 1G1XB 1N34O 3RKZA 1R3JC 4Z2WA 3ZN1A 2CTQA 2EZPA 2XJGA 2DYRC 2L6LA 2WEPA 3RT3C 3Q5LA 5KHIA 4LFBO 4U7NA 3SYQA 4GYCB 2XJJA 4PL9A 1FS0G 1PNLA 4GGLA 5LP6C 4MVQA 2AKPA 3SYAA 4TQDA 1YZBA 2NLJC 2B1IA 3JD0A 1FJGO 4RQFA 2YIDA 1Y74B 4J41A 2VQEB 4P9OA 3RYFB 1MX0A 1NHJA 2ARHA 1NS1A 5JVDA 5CB4A 3ABUA 3CSXA 3FFQA 1VQNV 4MB9A 2Q67A 1BSMA 3SPHA 4CC5A 2JRIA 1VQ8V 4GX0A 1CP9A 4MVUA 4UXNA 4DV2B 3HKCA 2Y48A 2WSSG 2QDOA 1Q81W 3WG7B 3CMEV 2YK9A 3W7TA 1YSCA 2PUSA 2P4KA 1S3JA 3B24A 1R6TA 3A0ZA 4XBFA 1FXKC 1TILA 4CE2A 1K7DA 3OFNG 4B3MB 5LYJA 1KMIZ 1Q6UA 3SPGA 4O2BA 3G6BA 4TUYB 4X65O 3AG4B 2GUZA 2OTLV 3T1YB 2OIGA 2P67A 4WFHA 5KAIZ 1F51A 3E83A 2B1GA 2PGGA 1YJ9V 4FCQA 5EYPA 4IGGA 4JAVA 3R91A 4E2LA 3K5OA 4FZ0A 4L8ZA 5CA0B 2CH7B 5EZYA 2BTQA 4R7CA 3R4NA 2CE4A 1MSWD 2PYJA 1IBMB 3C90A 3GIGB 3ABTA 4LF8B 2F4VB 4PHZA 4UVBA 4L91A 3A0XA 2EIMC 1SA0A 2FTKA 2WLIB 3ZS8C 3JASA 4LNUA 3WFVA 1P7GA 1EI1A 3VQYA 1F7YA 4X62B 4X1YB 3CC7V 2YI9A 4FZ1A 3VADA 5KAFZ 2UXBO 1MG1A 2VQFO 3ZHUA 5LMUO 2XAQA 1W59A 1ORQC 1F23A 5B66Z 3A0TA 1YC4A 3EKOA 4XD8A 1S0VA 2PZSA 2Z0AA 4UVAA 4LFAB 3CPWU 3E22A 4X1IA 2Y4UA 1VARA 1YHQV 1XHZA 4L93A 2AZ2A 3IEDA 4DR6O 5B1OA 3BRCA 3A8TA 3LUTB 4TT3G 5FWKA 3B77A 3L71H 3CCRV 3OTOB 1WAZA 2BOCC 4B3RO 4LP8A 2R72A 2YE9A 3O65A 2Q0OC 1UYDA 3CJHA 3BY6A 1HNXO 3WB0A 1TUBB 2FXSA 3FT5A 1DLBA 3A0RA 4MVMA 5JCOC 2XHBA 2HKOA 4J7JA 4U3JB 1GN4A 4JI3O 5IDJA 4EGHA 1F4NA 1FYJA 3K60A 2CCTA 2QTOA 3EHFA 1GKXA 3SJBC 1UYFA 4X64O 2KG7A 4U93A 2XNDG 1H2MA 4DV6O 3VHDA 3F5WC 5BODA 3TTZA 4AI8A 1ZW9A 5JJNB 5FL7G 2EINB 5GW7A 3VHAA 2K9PA 1K4DC 3OW2U 3OGCC 4MPEA 2EIKB 4JZGA 3O0IA 4EGKA 1FFXB 1Y6XA 2YEVB 3ZMTA 4P9PA 4EKWA 4K8ZA 1AI6A 4E00A 5B3SB 3TZ4A 3LNNA 3RYIA 1ZL8A 4HYMA 4JI7B 2A3QA 5H9CA 3SR2C 3BVOA 5B1NA 5CA3A 4X66B 4LWHA 3D8CA 2W0XA 4U7OA 5CB4B 1HNZB 2YEBA 4DR3B 1H2GA 3C0EA 3HKCB 2Q4PA 2F43G 3RBZA 2XAHA 1BS3A 1IBLO 1IXBA 3APQA 2EULA 3K58A 2XK2A 4L94A 1GN3A 3FB6C 5ITZA 2F1MA 4DZYA 3UKMA 4JQLA 3L74H 4QIWF 2JS5A 1VF6A 4LH7A 4DV4O 3SPJA 4PDLA 1CPYA 2DYSB 2VS0A 4BIZA 5KUMA 2N04A 1VQLV 4BR6A 2YK2A 2YEEA 1K92A 1I5YA 5B1AC 2Q73A 4DV7O 2UUBB 3IFXA 1I5CA 3CXHF 4DK1A 3B40A 3AK3A 4JYYA 3E35A 1WN7A 2XDLA 2P90A 1YTFB 1TA8A 2RJZA 3ABKC 3EHBB 4TV8A 5A9GA 1BHAA 3ZX6A 1R73A 3CRQA 2XAGA 4J80A 2E74B 3UM7A 1SETA 1XUQA 2WLKA 3BM9A 5D7DA 2YI0A 2YKCA 3SJAC 1ZWIC 4EFUA 4GX2A 1YIJV 2H8MA 1XNRO 3H80A 2OT5A 3K08A 1OCRC 3G7BA 3ETEA 2QWOB 4UCUA 1SA0B 4FLVA 2ITCC 1ROPA 2KKWA 3BA8A 3JASB 4LNUB 4OPAA 3ZBHA 1ZLZA 2P22C 3ZMSA 1MZFA 5GTHZ 4O09A 4P7AA 1Q90D 2DW4A 4FIPC 4DV0O 3E2EA 3ABLC 2QKCA 1D5NA 1Z5CA 3E8GA 1K5SA 1S72V 4HYPA 3THOA 1N36B 2LFSA 2KSDA 2YEJA 1EN4A 2FWZA 2EIJB 5LOVA 2VQEO 1KC8W 5EBWC 4YIOA 3CRCA 3RVZA 2IH1C 1YDXA 3UO2A 4O4LA 4PA7A 2BT0A 3T4DA 4OXSA 2Q8VA 2IWSA 1Y76A 5C8YB 2XJXA 3OM3B 3LMMA 4H0LB 1RPRA 2XDKA 4HY6A 4ASAA 4LFCB 2AXTZ 3SPCA 2R9IA 5BR8B 3OD4A 5JENA 4YIPA 2X6AA 1JOYA 3E8BA 2ODMA 3W7UA 2WLMA 3CJHB 1H2LA 3K5MA 4GFNA 5E79Z 2Q9LA 4B3MO 1COWG 4WBNB 4YJ2A 4X89A 3CWBH 3W7SA 4MVRA 3HKBA 1XL4A 3FAVA 5FNVA 1EZVH 3T1YO 2A79B 5LHHA 2ZINA 5EK0A 2JKIA 3KZIZ 4LF6B 1VEWA 1NQTA 3C3TA 4U3FH 3CXCU 4UB8Z 2EILB 2ZKOA 4JI1B 1VF5B 3CB2A 2N05A 1Q43A 4MP7A 2QEXV 3PN1A 2JGDA 2KG7B 1HP8A 2OIEA 2UWDA 4XKAA 4ZKIA 3ZHTA 1YTFD 2HVJC 4AWQA 4CWRA 1Q8IA 1I7FA 4DV1B 1IBMO 5DEDA 4DW1A 1Q5OA 4LF8O 2F4VO 4CE3A 3JAKA 3G80A 1G8MA 2PY5A 4R1FA 1ZL8B 2UXBB 4X20B 1V54B 4G27B 1BT8A 2Q6AA 2OCCC 4NTWA 3QTCA 3LDEA 4X62O 4CWQA 4UUJC 1YERA 1AVMA 1JM6A 3HZ5A 1M93A 4YKWA 2FMLA 3QO8A 3D0BA 1AP6A 5CPHA 3K3WA 2CH4A 4E72A 1GMGA 4JI2O 5ITZB 1S76D 1YT1A 4B08A 4B3RB 2V1DA 5KHHA 1VQ9V 1FAFA 3CGZA 1N0NA 3U0ZA 2FWYA 4BIUA 2BSKA 5JH7B 1UYKA 4BAYA 1WA8A 1KBHA 3I5DA 2YJXA 1BL8A 1OSFA 3SDLA 2YGEA 3TZ0A 2B9ZA 3OTOO 1JX9A 1OCCB 1YEWA 2UXCB 1UY6A 4MSWC 1OHHG 5BY1A 3LPSA 3K9SA 3JARB 1K73W 4WCEV 2QR4A 2JK5C 1L0LH 4H13B 1K33A 1ENVA 2E76B 5FPRA 2YIAA 2GQPA 2RCVA 5M4PA 1D2DA 4DV6B 5CA1B 5FNCA 5CA0A 1UYLA 2CH7A 3B2EE 3ZRXA 4B3SB 2VRZA 1NTKH 1QU7A 1EBOA 2V4DA 2Y69C 2UXXA 3OMUA 3OUSA 1S5HC 3GIGA 3IJ4A 4DK0A 5B5EZ 3WB2A 1UYHA 4MT8A 3SL2A 4DR7B 1IZ3A 2BU6A 3AG2C 2F66C 2XUMA 1TC0A 3OE7G 4RO2A 4K3AA 3FYIB 5IJ0A 4E01A 1QVGU 2QWNB 3D3IA 1MZEA 3LSUA 3N2GB 5EIBD 2YJWA 1EN6A 4F4LA 2BE3A 1GTOA 1TVKA 2EZOA 4RUFA 1BGYH 4X1YA 1B3QA 5KMGB 4I7ZB 1AR4A 5LOVB 4JI7O 4FVMA 1IBLB 4GT1A 3U67A 4WUDA 1QLNA 1HNZO 3OEHG 1JR9A 2WA4A 4O4LB 1H7SA 2YEHA 2N74A 2E3CA 3VHCA 4URLA 5EC2C 4CS3A 2XHRA 1U97A 4MPCA 1MMMA 1QCEA 1MA1A 4LP0A 3HYYA 4WFEA 4JYAB 4YJ3A 4MOTA 2LFRA 3GIFA 1BHBA 1NJIW 2E0AA 3FKSG 3CYGA 1AI4A 3SJQC 1WP7A 5H5NA 5F3KA 2O57A 3Q5KA 2Q8IA 5CF0A 2XASA 1O9GA 3K0DA 1I59A 3HKBB 2BTZA 1AJPA 3TCUA 3P32A 1M4UA 3VQXA 2WA3A 4JI4B 1EZJA 3Q4HA 5IYDO 3SYOA 3CRMA 4JGSA 2NR5A 2BYIA 2OYQA 1PM9A 4BW5A 4JYCA 4E4EA 2H8PC 2ZCEA 1U2OA 4DW0A 1FXHA 1QNMA 4LWEA 4W4LA 4FLYA 3OGIB 3OWBA 3ZXQA 5J2UB 3RFRA 4WFFA 1J5EO 1IXMA 2JJ1G 3B26A 3ZIAG 2ESAA 4HBNA 4DV0B 2IM9A 3JAKB 4ICGA 3R4OA 1M56C 2XDUA 4YKUA 1J95A 3OAAG 4EEQA 1FFXA 4QJFB 2YEVA 4PU9A 4QE9A 2DQ0A 2PYLA 2HFEC 1NVPB 2IWUA 3TZ2A 3ZMUA 4I9WA 4LF7B 4MTFA 3OUFA 3ETQA 1UPGA 1ZX3A 4RUEA 1N36O 4X1KA 5IY5B 1VQPV 4P8OA 1SQGA 2X6BA 2LGQA 1V55C 1QLEB 3QVNA 4I55B 1Y67A 2Y4TA 4MP2A 4CWSA 2JJCA 5LL6Y 4RAIA 1URFA 3ABMB 2BSKB 3BEHA 1WA8B 4XIPA 2GTAA 1Q86W 1Y4SA 2Y0PA 2FKXA 3ZRWB 4FFBA 2F93B 4F6EA 4LFCO 5BR8O 5EC1C 1HNWB 5B1BB 4MPNA 3MHHC 2IWXA 1BE3H 5CBHA 4WFGA 1SERA 4EMVA 5A2QN 3OEEG 4RWUA 2CDYA 3HB3B 2O1VA 1VQ5V 1YS3A 2UU9B 1E1RG 3WHAA 4CH5A 4DYLA 2ITDC 1CEZA 4LF6O 1O9HA 5J2TB 2HHHB 3T2SA 2LGWA 4JI1O 4E02A 4GZRB 5H6RA 3AG3C 1SZTA 4GQTA 4XKOA 4TWKA 5KUKA 1PP9H 3EHGA 1MABG 5KHKA 3ML0A 4KFMA 2UUAO 1MNGA 2PNRA 3HKEA 4DV1O 4NXMO 5IJ0B 1Z5VA 4H37A 2LW7A 3INXA 3B8NA 3G6EV 3CX5F 4H7QA 4LWIA 4HZ5A 1TVKB 2Q8GA 4CS2A 2ZM6B 1KIJA 4JAAA 2EBOA 3LDDA 4EFBA 2DN9A 2P6JA 3ASNB 2H55A 1LR1A 3GVMA 3F7VC 1F4MA 4YY3B 4I9QA 4JI2B 4KUMA 3CC4V 1NR1A 1NVPD 1EN5A 4CH4A 2ZDYA 2ZXWC 4BAEA 2WI7A 2LQTA 3JAMN 1FXKB 1W0JG 4YJ3B 2ZBKB 4H81A 4K4OA 1FXVA 3QTFA 5C8YA 1BQZA 1FFTB 3B27A 3ZRSA 3HHUA 2YEIA 1OCZC 1UYMA 2CTPA 1M57C 4GCZA 2UXCO 3L70H 2YE7A 4WBNA 1QQCA 2FYPA 3ZHSA 3A2FA 4KP4A 4GKJB 1AJQA 3Q4HB 4D7SA 1W0KG 4PA3A 5D5QA 2Q8FA 2HCHA 1WPXA 4MVSA 3KCXA 2NN4A 3H1KH 3R4PA 3HZ1A 4NH9A 1VQOV 4LCUC 4NKGB 4URMA 1Y8PA 3UCSC 1XNQO 5J9PC 2EIMB 1US7A 4XCLA 1PVGA 1RPOA 1WB7A 4B3SO 1SQFA 1UY8A 3J7AU 5IYZB 4B6CA 2YC0A 1TBWA 2YE5A 1SQVH 4UB6Z 4FLUA 4J7KA 1GAXA 4DR7O 3MAQA 4AILC 4WF9V 4FCRA 3B09A 3EHJA 1B06A 3H1LH 3SYPA 3ASOB 4X20A 2P7TC 1NI8A 4YHHB 4X1KB 1US6A 1GRJA 2F95B 5D5PA 1MU5A 2GFDA 4JI5O 2QKAA 2XABA 1L0NH 2YE6A 1YC3A 1YJWV 3P3PA 2VCIA 1AJNA 3CRKA 4EM7A 3CWVA 2WI1A 3B28A 4BXIA 4JTAB 4XDJA 4XTJA 1QY8A 3TUHA 4FM1A 1KUQA 5JH7A 3ZXOA 4JYAO 3CCSV 3PJSK 1AJ6A 1D5AA 2GHYA 1N8RW 4FFBB 1KD1W 3X2QB 3STLC 4UROA 4XITA 3L73H 3OWDA 4PA4A 1N33O 2YI5A 1WB8A 3E8HA 4DV5B 4D6TH 4CZZA 3JARA 1ZTEA 3H01A 3D36A 3AG1B 1H2SB 2KQXA 4FFKA 4JI0B 4JAUA 2AGAA 4BQJA 3G67A 1QZRA 1AP5A 2FL4A 4N23A 5JQGB 4JI4O 1AH8A 1UY7A 1JFFB 2P5OA 4MVZA 5CA1A 1ZUQA 5LA6B 2IJHA 1OCOC 1FKAO 2V7QG 2WLLB 4LBEC 1J5EB 1DF5A 2Q7GA 4AWOA 2HJFC 3F7YC 4QE7A 4C7UA 1PNMA 3MHSC 4HNAA 4LC1A 1XQ8A 3HKEB 3N2KA 1XMOO 1B62A 4K0KB 1XMQO 3CCUV 1GM8A 2CGOA 1NR7A 3JZ3A 2ZIOA 2XD6A 2JVDA 3N2GA 3T1KA 2IJKA 5LBQA 5F5RA 4QGPA 1VMGA 1I94O 3ZEDA 3H1IH 4OGQB 3E89A 5KMGA 5DECA 4LF7O 4CH3A 5FNDA 1AR5A 2Q7HA 3K04A 3CGYA 3MDSA 3JD3A 4G28B 3CCVV 1H2NA 5GTIZ 2GBOA 5K1PA 2B5UA 1NU1H 2Q5ZA 4PRXA 4V26A 2LJ2A 4GT8A 1RP3B 1IBKO 2HR3A 1S14A 5DN6G 2BU2A 1TGOA 3JAWA 5B1AB 2WI2A 2YE2A 4XDLA 2R9AA 5DM6V 2ZDIA 1GM7A 2EJ7A 5EBMC 2WAMA 2JJ2G 4R6ZA 4WUBA 1GK9A 2MW2B 3HYZA 3MD0A 3ZN0A 1NHIA 2ZR3A 4DR4B 4QNHB 5LHIA 4YKQA 1JVMA 1HNWO 3BCCH 2HEPA 5KA6A 1WLEA 2WLHA 1IURA 3RYCA 2XX2A 2K1EA 5BMVA 4CBCA 1XI1A 3RLPA 4J42A 1VF6C 3AK1A 5GONB 4NYKA 1L0OA 1XHXA 2UU9O 3OR6C 1OCRB 4CWNA 1OCCC 2HG1A 2YUAA 2UUAB 1Q3EA 2HHHO 5E1AC 1N0JA 3GB7C 2C1IA 1R1BA 3FD9A 5J2UA 4GLXA 4QPKA 4NXMB 3EHHA 4ZOLB 3PEJA 5FPOA 3ABLB 2LW1A 4DXWA 3K99A 3R66A 1VIBA 2XTAA 2W6IG 3N27A 5GGZA 4P2ZA 4H85A 1SZXA 1TAEA 4G2KA 2GSMB 2IOQA 3E86A 3RVYA 5CTWA 4FLXA 2Y0IA 4JF3A 2JEXA 1BCCH 1RSOB 1XEQA 2ZM6O 4HY1A 4DUZB 4DV3O 3GWKC 1THNA 1GJVA 1SQBH 2IH3C 4KHPO 1QYEA 1TIDA 4I55A 4J11A 4YY3O 4A5UB 4IYHA 4ASFA 1Q6HA 2ETNA 4UVCA 4B7EA 4EFEA 1I58A 1TC6A 4KXRA 1UY9A 2R70A 4ABMA 2XX5A 3ZRWA 3I56V 4X9QA 2HLDG 5KHJA 3A0YA 4PRVA 3OW6A 3O2FA 1YETA 1Q6IA 1UJWB 2UUCO 2DQ3A 1UYEA 2QWPB 4LF4O 2QG0A 1YSZA 3ICXA 1Q82W 3W7WA 4FPPA 1L8DA 3M99B 4H44B 4PDRA 1WJZA 4GKJO 1BGQA 2XDSA 4FMTA 1I5BA 2YI8A 1XNQB 1G4YB 2CAZC 3KKYA 4FLWA 1WNSA 4JV5B 3AK2A 5J2TA 4ZIBA 4MVOA 3D3QA 1K34A 3H4LA 1N4CA 1RFYA 4N21A 4HNAB 1YI2V 1MOFA 4KSGA 4AHCA 2YIBD 3J81N 1P7BA 3N2KB 4YKXA 3VBBA 2BU8A 5KHGA 2BCCH 1GO3F 1PL4A 2UXDB 3H1HH 4X88A 5LP6A 1KKDA 3JD2A 3OTFA 2XHXA 2OCCB 4HZ3A 1NBMG 4DR1B 4HXWA 1SESA 2A06H 4V25A 4GX1A 1DK1A 3HPLC 3AG7A 1S77D 1R3IC 4YKYA 3RLRA 2W6JG 2YI6A 2QKSA 2G38A 1IX9A 1DGSA 3MNRP 3BA9A 4JI5B 4W7TA 3HKDB 3ZKDA 3C3SA 4X9LA 5D6QA 2JDIG 4YHHO 1Z5BA 1S5LZ 3A0BZ 1YC1A 3C11A 4R3AA 2YXLA 1H38A 1XREA 2QF6A 1H8HG 2FB5A 3LSQA 3Q5JA 4HXZA 1R62A 2EJRA 2YGFA 2BRCA 3FYEB 3F5TA 4JTDB 1FXKA 1XILA 4I5SA 3ETDA 3JAWB 2QG2A 5BXZA 1RM1B 2ZDXA 4F6RB 1N33B 3QO5A 2GTSA 3D2RA 4FM0A 4LF9B 5CTYA 5IY5C 3K06A 1PD3A 4FK5C 4NB5A 4DUYB 4NTXA 4ZVIA 2YKIA 5HFMA 3RYCB 4DV5O 4PELA 3W7XA 4XCJA 5BMVB 1YF2A 3WG7C 4UCSA 4WUCA 2ZE7A 3OMNB 1NTMH 4JI0O 3KE6A 2ZIMA 3OMIB 1VQ6V 4PA6A 5D7RA 3B4SA 2BOBC 2HJDA 3BPZA 1XMOB 4J10A 3AG2B 1JCHA 2EX3A 2HP8A 5B1BC 1XMQB 2AZ0A 2W0FC 3AG4C 2ZR2A 3K5NA 1ZAUA 3SJCC 3TZ5A 5K1XA 5IYZA 2WI6A 2JS3A 4ASGA 4MBCA 4CS4A 3RYHA 2QM7A 1OZ0A 3O9OA 4DR5B 1I94B 4K0KO 4R3MA 3U11A 4IT5A 2A9HA 2QTSA 1VF7A 3K03A 1SQXH 4GKKO 4FCPA 2GV9A 3CP1A 1K97A 1MSDA 4LH6A 3DC5A 1KU9A 3ZM7A 3CD6V 4KQVA 3M8AA 5LXTB 4NH8A 2DOSA 2IU3A 4LWSA 1Y66A 2Z3YA 5M4MA 5L3FA 3KG2A 2RMKB 1VQ4V 3OMAB 1IDSA 1IBKB 2YEFA 2KB1A 2QWRB 4UCTA 3B8MA 5L3JA 1X59A 3OT7A 2XOKG 3WB1A 1ZWHA 4YXWG 4TQFA 1ID0A 2XHTA 2ZKJA 5JCOA 2YKEA 1K9MW 2IU0A 1I5DA 2HHIA 2WI3A 3ASNC 4OX9B 2BU7A 4TOIA 4PDMA 3T1HO 2ZD9A 4JPRA 4O2AB 4ZHQA 1VQ7V 2XT9A 2YS8A 4CE1A 1BYQA 2Q68A 4DR4O 1Y8OA 3RLQA 3SYCA 2ILMA 1OJHA 3L72H 3BABA 1R6NA 4L87A 2QM4A 2BTOA 3JATA 3L9DA 5M4NA 1M1KW 2R9RB 5JQGA 1JFFA 1U96A 4J7ZA 4H33A 2E5LB 5IN9A 2AW9A 1QR9A 2ADPA 2DWDC 5LA6A 1AM1A 2WLLA 3CHXA 2YKBA 3K0GA 2D3OW 4LWGA 1N32B 2DYRB 1M56B 4K8XA 4O4IB 2Q69A 3CRAA 5L3CA 3K79A 3QDDA 5LP6B 1UFIA 4L8JA 5BOCA 3G7EA 3LSSA 4XDKA 5IE9A 1K4CC 2LP7A 1LUVA 3LNMB 3CCJV 4XDMA 3IC9A 3TETA 3U2KA 4JYBA 1AI7A 1LNQA 1QBZA 4DV3B 1YESA 1V55B 2YSUB 1Y8NA 4PJ0Z 3U2DA 3CC2V 4KHPB 3HR0A 4I0XA 2EINC 1M5IA 2DE0X
chains in the Genus database with same CATH topology
2BREA 4UV9A 4WFBV 1GM9A 1TUEB 2EIKC 3I55V 2O1WA 5B3SC 4XC0A 1KECA 3IC7A 3CCLV 3ASOC 3OR7C 2AHZA 4I3HA 4YKZA 2YEGA 1BKNA 2CCUA 2QE7G 2PI4A 3SPIA 1KP3A 2QM8A 3T4ZA 3CCQV 1YT0A 2PI5A 3AG3B 3CCEV 1UYGA 5J6AA 2DYSC 3X2QC 1UYCA 3FT8A 1Q7YW 3AG1C 1AROP 1E79G 4CWOA 3CYOA 3QO7A 2Q8HA 2CK3G 5CBGA 1HWYA 4ASBA 1B63A 1I5AA 1I5XA 3ZJZA 1TH8A 4KFGA 5IYBO 1R3LC 4WFAV 2ZXWB 3CCMV 4J9ZB 4X8AA 3K9AA 4EEHA 4EFTA 2ZQMA 2VW5A 5L3DA 4GEEA 2XDXA 1K8AW 4YKRA 1QVFU 2QA4V 1DF4A 3R92A 3NMQA 3FB8C 1OCZB 1BMFG 1M57B 3RW0A 1XL6A 2EIJC 1Y4UA 2C2AA 1M90W 5LHGA 3FB7C 5CBFA 5LGTA 3IGAC 3T10A 2WERA 2AHYA 4RQEA 1A4HA 3FB5C 5C93A 5L3GA 2DWEC 3K97A 3DTUB 3LNUA 4R8CA 1YSRA 3ZKBA 2YEAA 1W2BU 5CTXA 3P30A 1VQMV 1NHHA 2JIZG 2UXNA 1ZXNA 4MTXA 3AEIA 1KZNA 3ZMZA 1S16A 2EILC 3CMAV 4CWPA 2IJJA 4HZ0A 5D7CA 2IW5A 4XIQA 2MK3A 2WI4A 1PNKA 4KTNA 1Y4MA 4JASA 1AH6A 3JD4A 5BZBA 2EXLA 1YITV 3K98A 1R3KC 5IDMA 4DO2A 1NH2B 1V54C 3T1CA 5LGUA 1K5QA 5KA5A 2WWWA 4Q20A 3HEKA 4NH7A 2O1UA 2K5BA 1GKFA 2YEDA 2XX4A 4ZBMA 2YE4A 1M9NA 3ABKB 3DGEA 1R6KA 4CWFA 3ZCCA 4O0BA 2IORA 3T2MA 1AR1B 4MS2A 1OCOB 2WLNA 1KQSU 5D6PA 3PEHA 3STZC 4TSFG 2X7RB 1QR8A 3CRLA 2HVKC 1GKZA 3QNEA 5LGNA 3G71V 2QFOA 2BU5A 3T0HA 2YGAA 4Z1MG 2JEUA 1H7UA 1Z5AA 5M4EA 1YT2A 1YJNV 3A0WA 4AS9A 4XE2A 3JD1A 2WLJA 3LDCA 1U0ZA 4HYOA 4AWPA 3GIEA 4MTOA 2VCJA 3OPDA 3T0ZA 3BMYA 2CCSA 4DUHA 3NXSA 4J9YB 3ZRVA 4FJCC 4MTGA 2IOPA 4PA9A 2YE3A 1B6QA 4ASUG 1Z59A 2HKJA 1AI5A 1PL0A 1E1QG 4BQGA 1H8EG 4MW3A 5CN0A 3WQ9A 1JQ0A 4CWTA 5M4HA 2YECA 5M4KA 1NKDA 1NH2D 4KSHA 1DTOA 4UV8A 4URNA 4YKTA 4R50A 2ZDIC 1RM1C 2YI7A 2YKJA 2CGFA 1BXDA 2CG9A 4O05A 2BZ5A 2NNUA 1EA6A 2XCMA 3R4MA 3B25A 3JYCA 3ETGA 2ATKC 5H6QA 4XKKA 1JPXA 5L3EA 2A0LA 3O6OA 1KP2A 5J71A 3G4SV 4O07A 4O04A 2M7WA 2IJIA 2H94A 3TK1A 3FV5A 3ZMVA 2WLIA 4L90A 5IYCO 5FNFA 2WPDG 4LPBA 4EGIA 1P4RA 4JTCB 2XAJA 5EBLC 4P30A 5CTUA 4HAMA 5L3BA 3EFFK 2OTJV 2Q2EB 2X0LA 1L1FA 2YE8A 1UYIA 5CMUA 3VOUA 4B7PA 1THZA 2WI5A 4QPJA 4XIRA 3R65A 1QLEC 2WEQA 1VQKV 1SRYA 2BYHA 3E8FA 1JJ2U 3GWOA 2VWCA 3ABMC 2Z5UA 1PKXA 1ZXMA 2Y69B 2BSMA 2X6CA 2XAFA 4GX5A 4LWFA 3INWA 3JCZA 4MW8A 2HG5C 1AMWA 1K3EA 1EFRG 4PDVA 3EKRA 5HFLA 3G75A 3RKZA 1R3JC 3ZN1A 2EZPA 2XJGA 2DYRC 2WEPA 3Q5LA 4U7NA 3SYQA 2XJJA 4PL9A 1FS0G 1PNLA 4GGLA 4MVQA 2AKPA 3SYAA 2NLJC 2B1IA 3JD0A 4RQFA 4P9OA 1MX0A 1NHJA 3ABUA 1VQNV 4MB9A 2Q67A 3SPHA 1VQ8V 4GX0A 1CP9A 4MVUA 4UXNA 2Y48A 2WSSG 1Q81W 3WG7B 3CMEV 2YK9A 3W7TA 1YSCA 1S3JA 3B24A 3A0ZA 4XBFA 1FXKC 1TILA 4CE2A 1K7DA 3OFNG 3SPGA 3AG4B 2OTLV 4WFHA 2P67A 1F51A 3E83A 2B1GA 1YJ9V 4FCQA 4JAVA 3R91A 4E2LA 4L8ZA 4R7CA 3R4NA 1MSWD 3GIGB 3ABTA 4UVBA 4L91A 3A0XA 2EIMC 2FTKA 2WLIB 3WFVA 1EI1A 3CC7V 3VADA 1MG1A 3A0TA 2XAQA 1ORQC 1F23A 1YC4A 3EKOA 4XD8A 1S0VA 4UVAA 3CPWU 1YHQV 4L93A 3IEDA 5B1OA 3LUTB 4TT3G 5FWKA 3B77A 3CCRV 2BOCC 4LP8A 2YE9A 1UYDA 3BY6A 3FT5A 2FXSA 1DLBA 3A0RA 4MVMA 2HKOA 5IDJA 4EGHA 1F4NA 3K60A 2QTOA 3EHFA 1GKXA 1UYFA 4U93A 2XNDG 3VHDA 3F5WC 5BODA 3TTZA 1ZW9A 5FL7G 2EINB 5GW7A 3VHAA 1K4DC 3OW2U 3OGCC 4MPEA 2EIKB 3O0IA 4EGKA 2YEVB 3ZMTA 4P9PA 4EKWA 1AI6A 4E00A 5B3SB 3TZ4A 4HYMA 5H9CA 5B1NA 5CA3A 4LWHA 4U7OA 2YEBA 1H2GA 3C0EA 3RBZA 2F43G 2XAHA 2XK2A 4L94A 3FB6C 4DZYA 3UKMA 4JQLA 4QIWF 3SPJA 4PDLA 1CPYA 2DYSB 4BIZA 5KUMA 1VQLV 2YK2A 2YEEA 1K92A 1I5YA 5B1AC 3IFXA 1I5CA 3E35A 2XDLA 2P90A 1YTFB 3ABKC 3EHBB 1BHAA 1R73A 2XAGA 3UM7A 1SETA 2WLKA 3BM9A 5D7DA 2YI0A 2YKCA 1ZWIC 4EFUA 4GX2A 1YIJV 2H8MA 3H80A 2OT5A 3K08A 1OCRC 3G7BA 3ETEA 2ITCC 1ROPA 3ZMSA 4O09A 4P7AA 2DW4A 4FIPC 3E2EA 3ABLC 1Z5CA 3E8GA 1K5SA 1S72V 4HYPA 2LFSA 2YEJA 2FWZA 2EIJB 1KC8W 5EBWC 3RVZA 2IH1C 4PA7A 2BT0A 3T4DA 4OXSA 2IWSA 2XJXA 3OM3B 1RPRA 2XDKA 4HY6A 4ASAA 3SPCA 2R9IA 2X6AA 1JOYA 3E8BA 3W7UA 2WLMA 4GFNA 1COWG 4X89A 3W7SA 4MVRA 1XL4A 2A79B 5LHHA 5EK0A 2JKIA 1NQTA 3CXCU 2EILB 4MP7A 2QEXV 2UWDA 4XKAA 4ZKIA 1YTFD 2HVJC 4AWQA 4CWRA 4CE3A 1G8MA 4R1FA 1V54B 4G27B 2Q6AA 2OCCC 3LDEA 4CWQA 4UUJC 1YERA 1JM6A 3HZ5A 4YKWA 3QO8A 3D0BA 5CPHA 3K3WA 2CH4A 1GMGA 1S76D 1YT1A 2V1DA 1VQ9V 3CGZA 2FWYA 4BIUA 1UYKA 4BAYA 2YJXA 1BL8A 1OSFA 2YGEA 3TZ0A 1JX9A 1OCCB 1UY6A 4MSWC 1OHHG 3LPSA 1K73W 4WCEV 2JK5C 1K33A 1ENVA 2GQPA 5M4PA 5FNCA 1UYLA 3ZRXA 1EBOA 2Y69C 2UXXA 3OMUA 3OUSA 1S5HC 3GIGA 1UYHA 4MT8A 3SL2A 2BU6A 3AG2C 1TC0A 3OE7G 4RO2A 4E01A 3FYIB 1QVGU 3D3IA 2YJWA 4F4LA 1GTOA 2EZOA 4RUFA 1B3QA 4GT1A 3U67A 4WUDA 1QLNA 3OEHG 1H7SA 2YEHA 3VHCA 4URLA 5EC2C 2XHRA 4MPCA 1QCEA 4LP0A 3HYYA 4WFEA 4MOTA 2LFRA 3GIFA 1BHBA 1NJIW 2E0AA 3FKSG 1AI4A 3SJQC 5F3KA 3Q5KA 2Q8IA 5CF0A 2XASA 3K0DA 1I59A 2BTZA 1AJPA 3TCUA 3P32A 1EZJA 5IYDO 3SYOA 4JGSA 2BYIA 4BW5A 4JYCA 2H8PC 1U2OA 1FXHA 4LWEA 3OWBA 3ZXQA 4WFFA 1IXMA 2JJ1G 3B26A 3ZIAG 2ESAA 3R4OA 1M56C 2XDUA 4YKUA 1J95A 3OAAG 4QJFB 2YEVA 4PU9A 4QE9A 2DQ0A 2HFEC 1NVPB 2IWUA 3TZ2A 3ZMUA 4I9WA 4MTFA 3OUFA 4RUEA 5IY5B 1VQPV 4P8OA 2X6BA 1V55C 1QLEB 4MP2A 4CWSA 2JJCA 4RAIA 3ABMB 3BEHA 4XIPA 1Q86W 1Y4SA 3ZRWB 5EC1C 5B1BB 4MPNA 3MHHC 2IWXA 5CBHA 4WFGA 1SERA 4EMVA 3OEEG 3HB3B 2O1VA 1VQ5V 1YS3A 1E1RG 3WHAA 2ITDC 1CEZA 3T2SA 4E02A 5H6RA 3AG3C 1SZTA 4GQTA 4XKOA 4TWKA 5KUKA 3EHGA 1MABG 3ML0A 4KFMA 2PNRA 4H37A 3INXA 3B8NA 3G6EV 4H7QA 4LWIA 4HZ5A 2Q8GA 1KIJA 2EBOA 3LDDA 2P6JA 3ASNB 2H55A 3F7VC 1F4MA 4KUMA 3CC4V 1NR1A 1NVPD 2ZDYA 2ZXWC 4BAEA 2WI7A 1FXKB 1W0JG 2ZBKB 4H81A 4K4OA 1FXVA 3QTFA 1FFTB 3B27A 3ZRSA 3HHUA 2YEIA 1OCZC 1UYMA 1M57C 4GCZA 2YE7A 2FYPA 4KP4A 1AJQA 1W0KG 4PA3A 2Q8FA 2HCHA 1WPXA 4MVSA 3R4PA 3HZ1A 4NH9A 1VQOV 4LCUC 4URMA 1Y8PA 5J9PC 2EIMB 1US7A 4XCLA 1PVGA 1RPOA 1UY8A 4B6CA 1TBWA 2YE5A 4WF9V 4FCRA 3EHJA 3SYPA 3ASOB 2P7TC 1MU5A 2GFDA 2XABA 2YE6A 1YC3A 1YJWV 2VCIA 1AJNA 3CRKA 4EM7A 3CWVA 2WI1A 3B28A 4BXIA 4JTAB 4XDJA 4XTJA 1QY8A 3TUHA 3ZXOA 3CCSV 3PJSK 1AJ6A 2GHYA 1N8RW 1KD1W 3X2QB 3STLC 4UROA 4XITA 3OWDA 4PA4A 2YI5A 3E8HA 4CZZA 3H01A 3D36A 3AG1B 4JAUA 4BQJA 1QZRA 4N23A 1AH8A 1UY7A 4MVZA 2IJHA 1OCOC 2V7QG 2WLLB 4LBEC 1DF5A 4AWOA 2HJFC 3F7YC 4QE7A 1PNMA 3MHSC 4LC1A 1B62A 3CCUV 1GM8A 1NR7A 3JZ3A 2XD6A 3T1KA 2IJKA 5LBQA 5F5RA 3E89A 5FNDA 3K04A 3CGYA 3JD3A 4G28B 3CCVV 2B5UA 4PRXA 4V26A 4GT8A 2HR3A 1S14A 5DN6G 2BU2A 5B1AB 2WI2A 2YE2A 4XDLA 5DM6V 2ZDIA 1GM7A 5EBMC 2WAMA 2JJ2G 4R6ZA 4WUBA 1GK9A 3HYZA 3MD0A 3ZN0A 1NHIA 2ZR3A 4QNHB 5LHIA 4YKQA 1JVMA 5KA6A 1WLEA 2WLHA 2XX2A 2K1EA 4CBCA 3RLPA 1L0OA 3OR6C 1OCRB 4CWNA 1OCCC 2HG1A 5E1AC 3GB7C 3EHHA 4QPKA 3PEJA 3ABLB 4DXWA 3K99A 2W6IG 5GGZA 4P2ZA 4H85A 4G2KA 2GSMB 2IOQA 3E86A 3RVYA 5CTWA 4JF3A 2JEXA 4HY1A 1THNA 1GJVA 2IH3C 1QYEA 1TIDA 4ASFA 4UVCA 1I58A 1TC6A 1UY9A 2XX5A 3ZRWA 3I56V 2HLDG 3A0YA 4PRVA 3OW6A 3O2FA 1YETA 1UJWB 2DQ3A 1UYEA 2QG0A 1YSZA 1Q82W 3W7WA 4FPPA 3M99B 4PDRA 1BGQA 2XDSA 4FMTA 1I5BA 1G4YB 4MVOA 1K34A 3H4LA 4N21A 1YI2V 1MOFA 4KSGA 1P7BA 4YKXA 3VBBA 2BU8A 1GO3F 4X88A 1KKDA 3JD2A 2XHXA 2OCCB 4HZ3A 1NBMG 4HXWA 1SESA 4V25A 4GX1A 3HPLC 1S77D 3RLRA 1R3IC 4YKYA 2W6JG 2YI6A 2QKSA 3MNRP 4W7TA 3ZKDA 4X9LA 5D6QA 2JDIG 1Z5BA 1YC1A 3C11A 4R3AA 1H38A 2QF6A 1H8HG 3LSQA 3Q5JA 4HXZA 1R62A 2EJRA 2YGFA 2BRCA 3FYEB 4JTDB 1FXKA 4I5SA 3ETDA 2QG2A 1RM1B 2ZDXA 3QO5A 3D2RA 5CTYA 5IY5C 3K06A 1PD3A 4FK5C 4ZVIA 2YKIA 5HFMA 4PELA 3W7XA 4XCJA 3WG7C 4WUCA 3OMNB 3KE6A 3OMIB 1VQ6V 4PA6A 5D7RA 2BOBC 3AG2B 1JCHA 5B1BC 2W0FC 3AG4C 2ZR2A 3TZ5A 2WI6A 4ASGA 4MBCA 2QM7A 1OZ0A 4R3MA 2A9HA 3K03A 4FCPA 3CP1A 1K97A 3ZM7A 3CD6V 4KQVA 4NH8A 2IU3A 1Y66A 2Z3YA 5M4MA 5L3FA 3KG2A 1VQ4V 3OMAB 2YEFA 2KB1A 3B8MA 5L3JA 2XOKG 1ZWHA 4YXWG 1ID0A 2XHTA 2ZKJA 2YKEA 1K9MW 2IU0A 1I5DA 2WI3A 3ASNC 2BU7A 4PDMA 2ZD9A 4JPRA 1VQ7V 4CE1A 1BYQA 2Q68A 1Y8OA 3RLQA 3SYCA 1R6NA 4L87A 5M4NA 1M1KW 2R9RB 4H33A 5IN9A 1QR9A 2DWDC 1AM1A 2WLLA 2YKBA 3K0GA 2D3OW 4LWGA 2DYRB 1M56B 2Q69A 5L3CA 3K79A 3QDDA 5BOCA 3G7EA 3LSSA 4XDKA 1K4CC 2LP7A 3CCJV 3LNMB 4XDMA 3TETA 3U2KA 4JYBA 1AI7A 1LNQA 1QBZA 1YESA 1V55B 2YSUB 1Y8NA 3U2DA 3CC2V 2CCTA 2EINC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JAU A;  4BQJ A;  2BRE A;  1QZR A;  1AH8 A;  1UY7 A;  4CWQ A;  2O1W A;  1YER A;  4LWF A;  1JM6 A;  3HZ5 A;  3INW A;  4YKW A;  4XC0 A;  3D0B A;  4AWO A;  5CPH A;  1AMW A;  2CH4 A;  4I3H A;  1YT1 A;  4LC1 A;  4YKZ A;  2YEG A;  1BKN A;  1B62 A;  3CGZ A;  2CCU A;  2FWY A;  4BIU A;  1UYK A;  3EKR A;  2YJX A;  1OSF A;  3G75 A;  2QM8 A;  2YGE A;  3JZ3 A;  3TZ0 A;  2XD6 A;  3RKZ A;  3T1K A;  1UY6 A;  5F5R A;  3LPS A;  2XJG A;  2WEP A;  3Q5L A;  4U7N A;  2XJJ A;  4PL9 A;  1YT0 A;  4GGL A;  2AKP A;  5FND A;  1UYG A;  5J6A A;  3CGY A;  2GQP A;  1MX0 A;  1NHJ A;  5M4P A;  1UYC A;  5FNC A;  1UYL A;  4MB9 A;  3ZRX A;  4PRX A;  4V26 A;  3FT8 A;  4GT8 A;  1S14 A;  2BU2 A;  3OMU A;  4CWO A;  3GIG A;  2Q8H A;  2WI2 A;  2YE2 A;  1UYH A;  4MT8 A;  3SL2 A;  4ASB A;  2YK9 A;  2BU6 A;  4WUB A;  1B63 A;  1I5A A;  3HYZ A;  3B24 A;  3MD0 A;  1TC0 A;  3A0Z A;  1NHI A;  1TH8 A;  4E01 A;  4KFG A;  1TIL A;  4YKQ A;  4CE2 A;  2YJW A;  2XX2 A;  1B3Q A;  2P67 A;  4EEH A;  3RLP A;  1F51 A;  4FCQ A;  1L0O A;  2VW5 A;  4EFT A;  4GEE A;  4GT1 A;  2XDX A;  4JAV A;  3R91 A;  3U67 A;  4CWN A;  4YKR A;  4WUD A;  4L8Z A;  2HG1 A;  3R92 A;  1H7S A;  2YEH A;  3NMQ A;  3VHC A;  3R4N A;  4URL A;  3EHH A;  4QPK A;  2XHR A;  4MPC A;  3PEJ A;  4LP0 A;  3HYY A;  4MOT A;  2LFR A;  3GIG B;  1Y4U A;  3K99 A;  3GIF A;  2E0A A;  2C2A A;  5GGZ A;  4L91 A;  3A0X A;  4H85 A;  5F3K A;  3Q5K A;  2FTK A;  2Q8I A;  5CF0 A;  3T10 A;  2WER A;  1I59 A;  2IOQ A;  1EI1 A;  2BTZ A;  5CTW A;  3P32 A;  1A4H A;  4HY1 A;  5C93 A;  1THN A;  3K97 A;  1GJV A;  3VAD A;  3LNU A;  1QYE A;  1TID A;  2BYI A;  3A0T A;  1YSR A;  3ZKB A;  2YEA A;  4JYC A;  1YC4 A;  3EKO A;  4XD8 A;  1U2O A;  5CTX A;  4ASF A;  1I58 A;  1TC6 A;  1NHH A;  4LWE A;  3OWB A;  3ZXQ A;  1UY9 A;  1ZXN A;  4MTX A;  1IXM A;  4L93 A;  3IED A;  1KZN A;  5B1O A;  2XX5 A;  1S16 A;  3ZRW A;  3B26 A;  2ESA A;  5FWK A;  4CWP A;  3A0Y A;  4PRV A;  4HZ0 A;  3OW6 A;  3R4O A;  2XDU A;  3O2F A;  4YKU A;  1YET A;  4PU9 A;  1UYE A;  2QG0 A;  2YE9 A;  5D7C A;  4XIQ A;  1YSZ A;  1UYD A;  2IWU A;  2WI4 A;  3TZ2 A;  4KTN A;  4FPP A;  2FXS A;  3FT5 A;  3A0R A;  4JAS A;  1BGQ A;  1AH6 A;  2XDS A;  4FMT A;  1I5B A;  2EXL A;  3K98 A;  4P8O A;  5IDJ A;  4EGH A;  5IDM A;  3K60 A;  3H4L A;  3EHF A;  1GKX A;  4MP2 A;  1UYF A;  4KSG A;  4CWS A;  2JJC A;  2WWW A;  4U93 A;  4YKX A;  2BU8 A;  4Q20 A;  3HEK A;  4NH7 A;  3VHD A;  5BOD A;  2O1U A;  3TTZ A;  1ZW9 A;  2K5B A;  4XIP A;  2YED A;  2XX4 A;  3VHA A;  2YE4 A;  1Y4S A;  2XHX A;  3DGE A;  3ZRW B;  4HXW A;  4V25 A;  4MPE A;  4CWF A;  3ZCC A;  4O0B A;  2IOR A;  3O0I A;  4EGK A;  4MPN A;  4YKY A;  3RLR A;  2YI6 A;  2IWX A;  5D6P A;  3MNR P;  4E00 A;  3TZ4 A;  4W7T A;  3ZKD A;  3PEH A;  4EMV A;  4X9L A;  4HYM A;  5D6Q A;  1Z5B A;  1YC1 A;  2O1V A;  3C11 A;  4R3A A;  1YS3 A;  5B1N A;  3CRL A;  3WHA A;  4LWH A;  2QF6 A;  4U7O A;  1GKZ A;  2QFO A;  2BU5 A;  2YEB A;  2YGA A;  3Q5J A;  4HXZ A;  3T0H A;  1R62 A;  3C0E A;  3T2S A;  2YGF A;  1H7U A;  2BRC A;  1Z5A A;  4E02 A;  4I5S A;  5M4E A;  1YT2 A;  2QG2 A;  3A0W A;  4GQT A;  4XKO A;  4XE2 A;  4AS9 A;  2XK2 A;  3EHG A;  2ZDX A;  4L94 A;  1U0Z A;  3D2R A;  2PNR A;  4AWP A;  4DZY A;  5CTY A;  4JQL A;  3GIE A;  2VCJ A;  3OPD A;  3INX A;  3T0Z A;  4BIZ A;  4H7Q A;  4LWI A;  4ZVI A;  2YK2 A;  3BMY A;  4HZ5 A;  2CCS A;  2YKI A;  2YEE A;  4DUH A;  2Q8G A;  4XCJ A;  3NXS A;  1I5C A;  1KIJ A;  3ZRV A;  4WUC A;  2IOP A;  2YE3 A;  2XDL A;  3KE6 A;  2H55 A;  1Z59 A;  5D7R A;  2HKJ A;  2ZDY A;  4BAE A;  4BQG A;  2WI7 A;  3BM9 A;  5D7D A;  3WQ9 A;  2YI0 A;  2YKC A;  2ZBK B;  4H81 A;  4K4O A;  3TZ5 A;  2WI6 A;  3QTF A;  2YEC A;  4CWT A;  4EFU A;  5M4H A;  4ASG A;  4MBC A;  5M4K A;  2H8M A;  2QM7 A;  3H80 A;  3G7B A;  3B27 A;  4R3M A;  3HHU A;  4KSH A;  2YEI A;  4O09 A;  1UYM A;  4FCP A;  4P7A A;  4GCZ A;  4URN A;  2YE7 A;  2FYP A;  3ZM7 A;  4KP4 A;  4KQV A;  1Z5C A;  4YKT A;  4HYP A;  4NH8 A;  2LFS A;  5M4M A;  2YI7 A;  2YEJ A;  2YKJ A;  2CGF A;  2Q8F A;  2HCH A;  2FWZ A;  2YEF A;  1BXD A;  2CG9 A;  3R4P A;  3HZ1 A;  4O05 A;  2BZ5 A;  4NH9 A;  4URM A;  1EA6 A;  1Y8P A;  2XCM A;  5L3J A;  3R4M A;  3B25 A;  1US7 A;  4XCL A;  1ZWH A;  4XKK A;  1PVG A;  2BT0 A;  1UY8 A;  1ID0 A;  2IWS A;  3O6O A;  4B6C A;  5J71 A;  2XHT A;  2ZKJ A;  2XJX A;  2YKE A;  1TBW A;  2YE5 A;  1I5D A;  2XDK A;  2WI3 A;  4O07 A;  2BU7 A;  4HY6 A;  4O04 A;  4ASA A;  1JOY A;  4FCR A;  1BYQ A;  4CE1 A;  3EHJ A;  1Y8O A;  3TK1 A;  3RLQ A;  3FV5 A;  4GFN A;  4L90 A;  5FNF A;  5M4N A;  4LPB A;  4EGI A;  1MU5 A;  2GFD A;  5IN9 A;  2JKI A;  2XAB A;  2YE6 A;  1AM1 A;  1YC3 A;  5CTU A;  2YKB A;  2VCI A;  4MP7 A;  3CRK A;  4LWG A;  4EM7 A;  2UWD A;  2Q2E B;  3CWV A;  2WI1 A;  2YE8 A;  1UYI A;  4ZKI A;  3B28 A;  4XKA A;  4BXI A;  3QDD A;  4XTJ A;  1QY8 A;  3TUH A;  4AWQ A;  4B7P A;  2WI5 A;  5BOC A;  4CWR A;  3G7E A;  3ZXO A;  4QPJ A;  4XIR A;  1AJ6 A;  2WEQ A;  4XDM A;  4URO A;  4XIT A;  4CE3 A;  3U2K A;  4JYB A;  2BYH A;  3OWD A;  2YI5 A;  1YES A;  4R1F A;  2VWC A;  1Y8N A;  3D36 A;  3U2D A;  1ZXM A;  2CCT A;  2BSM A; 
#chains in the Genus database with same CATH topology
 3RN4 A;  1I08 A;  2BRE A;  1WP8 A;  4EB6 A;  4NXN B;  4DUZ O;  3P3N A;  4AQY O;  4UV9 A;  4WFB V;  1GM9 A;  1TUE B;  2EIK C;  3I55 V;  2O1W A;  2YIC A;  4JI8 B;  4IIJ B;  1PV0 A;  2DMX A;  4TV9 B;  5B3S C;  4XC0 A;  1KEC A;  3IC7 A;  2E75 B;  3CCL V;  3ASO C;  1YXB A;  3OR7 C;  2AHZ A;  4I3H A;  4IYI A;  4YKZ A;  2YEG A;  1BKN A;  1GH6 A;  2UUC B;  4NTY A;  1OV9 A;  4LF4 B;  2CCU A;  2QE7 G;  2PI4 A;  3SPI A;  1KYO F;  1KP3 A;  2QM8 A;  3T4Z A;  4ZI7 B;  2Q0A A;  4KL1 A;  2OCH A;  4UFZ A;  1X4T A;  3L75 H;  3CCQ V;  4LF5 B;  1YT0 A;  1JJO A;  2PI5 A;  1JMK C;  2YIB A;  1NTZ H;  1SS3 A;  4O4J A;  1S5J A;  3AG3 B;  3CCE V;  1H2K A;  5GON A;  1UYG A;  1XBL A;  1HW7 A;  5J6A A;  2DYS C;  3X2Q C;  2Q7E A;  5IJ9 A;  2ZE8 A;  2ZT9 B;  4JV5 O;  1UYC A;  4ZOL A;  3FT8 A;  1Q7Y W;  3AG1 C;  1ARO P;  3RYH B;  1E79 G;  3BAA A;  3S3W A;  4CWO A;  3CYO A;  3QO7 A;  2Q8H A;  2CK3 G;  4PI2 A;  4IHJ B;  2UXD O;  5CBG A;  1HWY A;  4ASB A;  1B63 A;  1I5A A;  1I5X A;  3ZJZ A;  4DR1 O;  5TIS Z;  1TH8 A;  4KFG A;  5IYB O;  1R3L C;  4I4T A;  5JWP A;  4NR1 A;  4WFA V;  4B3T B;  2ZXW B;  5F2V O;  3CCM V;  1RSO A;  4LWS B;  2H3O A;  4J9Z B;  4X8A A;  3K9A A;  1AIL A;  4JZ2 A;  4EEH A;  4EFT A;  2ZQM A;  2VW5 A;  5L3D A;  4GEE A;  3S3X A;  5IWA B;  2XDX A;  1K8A W;  4YKR A;  5JVD B;  1QVF U;  2QA4 V;  1DF4 A;  3R92 A;  4PI0 A;  3NMQ A;  3FB8 C;  5H2F Z;  1OCZ B;  1BMF G;  2RN9 A;  1M57 B;  3RW0 A;  1HR0 O;  1XL6 A;  3JSL A;  2EIJ C;  1Y4U A;  2JGU A;  2YDE A;  2C2A A;  4ZHQ B;  3KCY A;  3H9V A;  1M90 W;  4LF9 O;  5LHG A;  1ZSP A;  3FB7 C;  4DR2 B;  5CBF A;  5LGT A;  3IGA C;  4FM2 A;  3T10 A;  2WER A;  5LMN O;  4DUY O;  3JAT B;  1QHT A;  2ADQ B;  5IT9 N;  5LYJ B;  2AHY A;  4RQE A;  1Z2G A;  4O2B B;  1A4H A;  4JI6 B;  3FB5 C;  5C93 A;  2GUZ B;  5L3G A;  2DWE C;  3K97 A;  3UT5 A;  3DTU B;  4UCR A;  3LNU A;  1FD9 A;  2QGN A;  4D7T A;  4R8C A;  5EYP B;  1YSR A;  3ZKB A;  2YEA A;  1W2B U;  3TXQ A;  2VWK A;  5CTX A;  3P30 A;  1VQM V;  1NHH A;  2JIZ G;  5EZY B;  1SQQ H;  4GUN A;  2BTQ B;  2UXN A;  1ZXN A;  4MTX A;  3AEI A;  4LR3 A;  4GKK B;  1KZN A;  3ZMZ A;  2LO1 A;  1S16 A;  1KKC A;  3UQ8 A;  2EIL C;  3CMA V;  4CWP A;  2IJJ A;  4CH6 A;  1N34 B;  4HZ0 A;  4DR5 O;  4B7K A;  5D7C A;  1GN2 A;  2IW5 A;  4I0X B;  5AG2 A;  4LFB B;  4XIQ A;  2MK3 A;  5EIB C;  2WI4 A;  1PNK A;  3HKD A;  4KTN A;  1Y4M A;  3APO A;  4EB6 B;  1FJG B;  4JAS A;  1P49 A;  1AH6 A;  3JD4 A;  5BZB A;  4BWA A;  3K5L A;  3TGU H;  2EXL A;  1YIT V;  3K98 A;  4PD4 F;  1R3K C;  4IL6 Z;  5IDM A;  1I0H A;  3EVK A;  4DO2 A;  3JAL A;  1KB9 F;  1NH2 B;  1V54 C;  3T1C A;  5LGU A;  1P84 F;  1K5Q A;  5KA5 A;  2WWW A;  2QSA A;  3ZHV A;  3EXA A;  4Q20 A;  2CUG A;  3TJT A;  3HEK A;  1JA8 A;  4NH7 A;  4F6R A;  3E22 B;  4X1I B;  3T1H B;  2O1U A;  2K5B A;  1GKF A;  1SKV A;  3S5T A;  1NZ6 A;  2YED A;  2XX4 A;  4ZBM A;  4NVP A;  2YE4 A;  4BW9 A;  3J80 N;  1M9N A;  3BHP A;  3ABK B;  3DGE A;  1R6K A;  4DV2 O;  4OX9 O;  4CWF A;  3ZCC A;  4O0B A;  2IOR A;  5KX5 A;  1WPB A;  3T2M A;  1AR1 B;  4MS2 A;  1OCO B;  2WLN A;  5FLX N;  1KQS U;  4X65 B;  5D6P A;  1Z5W A;  4I50 A;  4O4J B;  2CTR A;  3PEH A;  3STZ C;  1FPO A;  4TSF G;  2X7R B;  5IJ9 B;  4O4H A;  1QR8 A;  3CRL A;  2HVK C;  4W4K A;  2ZNI A;  1GKZ A;  2E5L O;  3QNE A;  5LGN A;  3G71 V;  2QFO A;  3QF7 A;  2BU5 A;  2YGA A;  3T0H A;  1A32 A;  4Z1M G;  2JEU A;  3D36 C;  1H7U A;  1XOU A;  1Z5A A;  1IVS A;  5M4E A;  1YT2 A;  1N32 O;  3DSQ A;  1SC5 B;  1YJN V;  3A0W A;  4AS9 A;  4XE2 A;  3JD1 A;  2WLJ A;  3DXR A;  3LDC A;  1U0Z A;  4DRX A;  4HYO A;  4AWP A;  1T5E A;  2VWJ A;  3GIE A;  1VP7 A;  4BIO A;  4MTO A;  4I4T B;  2VCJ A;  3OPD A;  3T0Z A;  2YXY A;  2QWQ B;  3CE2 A;  3BMY A;  2CCS A;  4DUH A;  4AQY B;  2DJV A;  3CEI A;  5LXT A;  3NXS A;  3K57 A;  3CS5 A;  4J9Y B;  3ZRV A;  3VQW A;  4FJC C;  4MTG A;  2PF4 E;  2IOP A;  4PA9 A;  3RYI B;  2YE3 A;  1SQP H;  3WU2 Z;  3UO3 A;  1B6Q A;  4UCO A;  1YCI A;  2VQF B;  3CRR A;  4ASU G;  4NXN O;  5LMU B;  1Z59 A;  2HKJ A;  1Y74 A;  1AI5 A;  3RYF A;  4JI8 O;  1PL0 A;  1E1Q G;  2PTM A;  4BQG A;  1H8E G;  4MW3 A;  5CN0 A;  2ZNJ A;  3WQ9 A;  2RQ6 A;  1JQ0 A;  4CWT A;  5M4H A;  2YEC A;  2P06 A;  4DR6 B;  5M4K A;  1NKD A;  3JSN A;  1GN6 A;  4LFA O;  1NH2 D;  4O2A A;  4KSH A;  1DTO A;  4UV8 A;  1EM1 A;  1HNX B;  4URN A;  2L35 A;  2OWO A;  4Q6G A;  2ZE5 A;  2C1G A;  4YKT A;  4OPH A;  1CXZ B;  4LF5 O;  4R50 A;  2ZDI C;  1G6U A;  1RM1 C;  4TUY A;  3UT5 B;  4JI3 B;  2YI7 A;  2YKJ A;  2CGF A;  3VQV A;  1BXD A;  2CG9 A;  4TV8 B;  4O05 A;  2BZ5 A;  2ZE6 A;  4O4I A;  1BZK A;  2NNU A;  1EA6 A;  4X64 B;  2XCM A;  3R4M A;  2RDC A;  3JYC A;  3ETG A;  3B25 A;  2ATK C;  5H6Q A;  1YVW A;  3U10 A;  4XKK A;  1JPX A;  3K59 A;  5L3E A;  2A0L A;  3O6O A;  1KP2 A;  5J71 A;  2GDS A;  3G4S V;  2CTW A;  1XDC A;  3H1J H;  4O07 A;  4O04 A;  1NT2 B;  2M7W A;  2A7W A;  2IJI A;  2M6Y A;  2H94 A;  4PV1 B;  3TK1 A;  1AB3 A;  3FV5 A;  3ZMV A;  3NR7 A;  2WLI A;  4L90 A;  5IYC O;  1HDJ A;  5FNF A;  2WPD G;  4B3T O;  4LPB A;  4EGI A;  1P4R A;  4JTC B;  2XAJ A;  3FX7 A;  1B04 A;  5EBL C;  4P30 A;  2F23 A;  3JAL B;  4IIJ A;  4FLT A;  5CTU A;  4K35 A;  4HAM A;  4TV9 A;  5L3B A;  1HR0 B;  3IAY A;  3EFF K;  5IWA O;  2OTJ V;  5KLV H;  3DC6 A;  2Q2E B;  2X0L A;  3RGB A;  1L1F A;  4X66 O;  2YE8 A;  1UYI A;  5CMU A;  3SGI A;  3VOU A;  4DR3 O;  4B7P A;  1THZ A;  2WI5 A;  4FLZ A;  4QPJ A;  2IBZ H;  4XIR A;  3R65 A;  1QLE C;  1Y76 B;  5LMN B;  4DV4 B;  1PPJ H;  3QG5 A;  2WEQ A;  2FYU H;  1VQK V;  1SRY A;  4ZI7 A;  5KX5 B;  2BYH A;  3E8F A;  5JJJ B;  3ZHR A;  1JJ2 U;  3GWO A;  4I50 B;  4DR2 O;  2VWC A;  3ABM C;  2QJ1 A;  4DV7 B;  2Z5U A;  1PKX A;  3A0H Z;  1ZXM A;  2Y69 B;  3TXS A;  3M7M X;  1SF9 A;  2BSM A;  2X6C A;  4UCV A;  2XAF A;  4O4H B;  4YJ2 B;  1TUB A;  2CGN A;  4GX5 A;  4JI6 O;  1LUW A;  3FAV B;  5FNV B;  3RWR D;  2YXH A;  2UUB O;  2RNB A;  4Z1V A;  4LWF A;  5JJE B;  3JCU Z;  4U3J A;  3INW A;  2P4V A;  4CC6 A;  3JCZ A;  4MW8 A;  2JGD B;  2HG5 C;  1AMW A;  3ZHQ A;  3DXR B;  1K3E A;  4DRX B;  1EFR G;  1V9P A;  3BFR A;  4IHJ A;  1XNR B;  1BQ0 A;  4PDV A;  3EKR A;  5HFL A;  2D2C B;  3G75 A;  1G1X B;  1N34 O;  3RKZ A;  1R3J C;  4Z2W A;  3ZN1 A;  2CTQ A;  2EZP A;  2XJG A;  2DYR C;  2L6L A;  2WEP A;  3RT3 C;  3Q5L A;  5KHI A;  4LFB O;  4U7N A;  3SYQ A;  4GYC B;  2XJJ A;  4PL9 A;  1FS0 G;  1PNL A;  4GGL A;  5LP6 C;  4MVQ A;  2AKP A;  3SYA A;  4TQD A;  1YZB A;  2NLJ C;  2B1I A;  3JD0 A;  1FJG O;  4RQF A;  2YID A;  1Y74 B;  4J41 A;  2VQE B;  4P9O A;  3RYF B;  1MX0 A;  1NHJ A;  2ARH A;  1NS1 A;  5JVD A;  5CB4 A;  3ABU A;  3CSX A;  3FFQ A;  1VQN V;  4MB9 A;  2Q67 A;  1BSM A;  3SPH A;  4CC5 A;  2JRI A;  1VQ8 V;  4GX0 A;  1CP9 A;  4MVU A;  4UXN A;  4DV2 B;  3HKC A;  2Y48 A;  2WSS G;  2QDO A;  1Q81 W;  3WG7 B;  3CME V;  2YK9 A;  3W7T A;  1YSC A;  2PUS A;  2P4K A;  1S3J A;  3B24 A;  1R6T A;  3A0Z A;  4XBF A;  1FXK C;  1TIL A;  4CE2 A;  1K7D A;  3OFN G;  4B3M B;  5LYJ A;  1KMI Z;  1Q6U A;  3SPG A;  4O2B A;  3G6B A;  4TUY B;  4X65 O;  3AG4 B;  2GUZ A;  2OTL V;  3T1Y B;  2OIG A;  2P67 A;  4WFH A;  5KAI Z;  1F51 A;  3E83 A;  2B1G A;  2PGG A;  1YJ9 V;  4FCQ A;  5EYP A;  4IGG A;  4JAV A;  3R91 A;  4E2L A;  3K5O A;  4FZ0 A;  4L8Z A;  5CA0 B;  2CH7 B;  5EZY A;  2BTQ A;  4R7C A;  3R4N A;  2CE4 A;  1MSW D;  2PYJ A;  1IBM B;  3C90 A;  3GIG B;  3ABT A;  4LF8 B;  2F4V B;  4PHZ A;  4UVB A;  4L91 A;  3A0X A;  2EIM C;  1SA0 A;  2FTK A;  2WLI B;  3ZS8 C;  3JAS A;  4LNU A;  3WFV A;  1P7G A;  1EI1 A;  3VQY A;  1F7Y A;  4X62 B;  4X1Y B;  3CC7 V;  2YI9 A;  4FZ1 A;  3VAD A;  5KAF Z;  2UXB O;  1MG1 A;  2VQF O;  3ZHU A;  5LMU O;  2XAQ A;  1W59 A;  1ORQ C;  1F23 A;  5B66 Z;  3A0T A;  1YC4 A;  3EKO A;  4XD8 A;  1S0V A;  2PZS A;  2Z0A A;  4UVA A;  4LFA B;  3CPW U;  3E22 A;  4X1I A;  2Y4U A;  1VAR A;  1YHQ V;  1XHZ A;  4L93 A;  2AZ2 A;  3IED A;  4DR6 O;  5B1O A;  3BRC A;  3A8T A;  3LUT B;  4TT3 G;  5FWK A;  3B77 A;  3L71 H;  3CCR V;  3OTO B;  1WAZ A;  2BOC C;  4B3R O;  4LP8 A;  2R72 A;  2YE9 A;  3O65 A;  2Q0O C;  1UYD A;  3CJH A;  3BY6 A;  1HNX O;  3WB0 A;  1TUB B;  2FXS A;  3FT5 A;  1DLB A;  3A0R A;  4MVM A;  5JCO C;  2XHB A;  2HKO A;  4J7J A;  4U3J B;  1GN4 A;  4JI3 O;  5IDJ A;  4EGH A;  1F4N A;  1FYJ A;  3K60 A;  2CCT A;  2QTO A;  3EHF A;  1GKX A;  3SJB C;  1UYF A;  4X64 O;  2KG7 A;  4U93 A;  2XND G;  1H2M A;  4DV6 O;  3VHD A;  3F5W C;  5BOD A;  3TTZ A;  4AI8 A;  1ZW9 A;  5JJN B;  5FL7 G;  2EIN B;  5GW7 A;  3VHA A;  2K9P A;  1K4D C;  3OW2 U;  3OGC C;  4MPE A;  2EIK B;  4JZG A;  3O0I A;  4EGK A;  1FFX B;  1Y6X A;  2YEV B;  3ZMT A;  4P9P A;  4EKW A;  4K8Z A;  1AI6 A;  4E00 A;  5B3S B;  3TZ4 A;  3LNN A;  3RYI A;  1ZL8 A;  4HYM A;  4JI7 B;  2A3Q A;  5H9C A;  3SR2 C;  3BVO A;  5B1N A;  5CA3 A;  4X66 B;  4LWH A;  3D8C A;  2W0X A;  4U7O A;  5CB4 B;  1HNZ B;  2YEB A;  4DR3 B;  1H2G A;  3C0E A;  3HKC B;  2Q4P A;  2F43 G;  3RBZ A;  2XAH A;  1BS3 A;  1IBL O;  1IXB A;  3APQ A;  2EUL A;  3K58 A;  2XK2 A;  4L94 A;  1GN3 A;  3FB6 C;  5ITZ A;  2F1M A;  4DZY A;  3UKM A;  4JQL A;  3L74 H;  4QIW F;  2JS5 A;  1VF6 A;  4LH7 A;  4DV4 O;  3SPJ A;  4PDL A;  1CPY A;  2DYS B;  2VS0 A;  4BIZ A;  5KUM A;  2N04 A;  1VQL V;  4BR6 A;  2YK2 A;  2YEE A;  1K92 A;  1I5Y A;  5B1A C;  2Q73 A;  4DV7 O;  2UUB B;  3IFX A;  1I5C A;  3CXH F;  4DK1 A;  3B40 A;  3AK3 A;  4JYY A;  3E35 A;  1WN7 A;  2XDL A;  2P90 A;  1YTF B;  1TA8 A;  2RJZ A;  3ABK C;  3EHB B;  4TV8 A;  5A9G A;  1BHA A;  3ZX6 A;  1R73 A;  3CRQ A;  2XAG A;  4J80 A;  2E74 B;  3UM7 A;  1SET A;  1XUQ A;  2WLK A;  3BM9 A;  5D7D A;  2YI0 A;  2YKC A;  3SJA C;  1ZWI C;  4EFU A;  4GX2 A;  1YIJ V;  2H8M A;  1XNR O;  3H80 A;  2OT5 A;  3K08 A;  1OCR C;  3G7B A;  3ETE A;  2QWO B;  4UCU A;  1SA0 B;  4FLV A;  2ITC C;  1ROP A;  2KKW A;  3BA8 A;  3JAS B;  4LNU B;  4OPA A;  3ZBH A;  1ZLZ A;  2P22 C;  3ZMS A;  1MZF A;  5GTH Z;  4O09 A;  4P7A A;  1Q90 D;  2DW4 A;  4FIP C;  4DV0 O;  3E2E A;  3ABL C;  2QKC A;  1D5N A;  1Z5C A;  3E8G A;  1K5S A;  1S72 V;  4HYP A;  3THO A;  1N36 B;  2LFS A;  2KSD A;  2YEJ A;  1EN4 A;  2FWZ A;  2EIJ B;  5LOV A;  2VQE O;  1KC8 W;  5EBW C;  4YIO A;  3CRC A;  3RVZ A;  2IH1 C;  1YDX A;  3UO2 A;  4O4L A;  4PA7 A;  2BT0 A;  3T4D A;  4OXS A;  2Q8V A;  2IWS A;  1Y76 A;  5C8Y B;  2XJX A;  3OM3 B;  3LMM A;  4H0L B;  1RPR A;  2XDK A;  4HY6 A;  4ASA A;  4LFC B;  2AXT Z;  3SPC A;  2R9I A;  5BR8 B;  3OD4 A;  5JEN A;  4YIP A;  2X6A A;  1JOY A;  3E8B A;  2ODM A;  3W7U A;  2WLM A;  3CJH B;  1H2L A;  3K5M A;  4GFN A;  5E79 Z;  2Q9L A;  4B3M O;  1COW G;  4WBN B;  4YJ2 A;  4X89 A;  3CWB H;  3W7S A;  4MVR A;  3HKB A;  1XL4 A;  3FAV A;  5FNV A;  1EZV H;  3T1Y O;  2A79 B;  5LHH A;  2ZIN A;  5EK0 A;  2JKI A;  3KZI Z;  4LF6 B;  1VEW A;  1NQT A;  3C3T A;  4U3F H;  3CXC U;  4UB8 Z;  2EIL B;  2ZKO A;  4JI1 B;  1VF5 B;  3CB2 A;  2N05 A;  1Q43 A;  4MP7 A;  2QEX V;  3PN1 A;  2JGD A;  2KG7 B;  1HP8 A;  2OIE A;  2UWD A;  4XKA A;  4ZKI A;  3ZHT A;  1YTF D;  2HVJ C;  4AWQ A;  4CWR A;  1Q8I A;  1I7F A;  4DV1 B;  1IBM O;  5DED A;  4DW1 A;  1Q5O A;  4LF8 O;  2F4V O;  4CE3 A;  3JAK A;  3G80 A;  1G8M A;  2PY5 A;  4R1F A;  1ZL8 B;  2UXB B;  4X20 B;  1V54 B;  4G27 B;  1BT8 A;  2Q6A A;  2OCC C;  4NTW A;  3QTC A;  3LDE A;  4X62 O;  4CWQ A;  4UUJ C;  1YER A;  1AVM A;  1JM6 A;  3HZ5 A;  1M93 A;  4YKW A;  2FML A;  3QO8 A;  3D0B A;  1AP6 A;  5CPH A;  3K3W A;  2CH4 A;  4E72 A;  1GMG A;  4JI2 O;  5ITZ B;  1S76 D;  1YT1 A;  4B08 A;  4B3R B;  2V1D A;  5KHH A;  1VQ9 V;  1FAF A;  3CGZ A;  1N0N A;  3U0Z A;  2FWY A;  4BIU A;  2BSK A;  5JH7 B;  1UYK A;  4BAY A;  1WA8 A;  1KBH A;  3I5D A;  2YJX A;  1BL8 A;  1OSF A;  3SDL A;  2YGE A;  3TZ0 A;  2B9Z A;  3OTO O;  1JX9 A;  1OCC B;  1YEW A;  2UXC B;  1UY6 A;  4MSW C;  1OHH G;  5BY1 A;  3LPS A;  3K9S A;  3JAR B;  1K73 W;  4WCE V;  2QR4 A;  2JK5 C;  1L0L H;  4H13 B;  1K33 A;  1ENV A;  2E76 B;  5FPR A;  2YIA A;  2GQP A;  2RCV A;  5M4P A;  1D2D A;  4DV6 B;  5CA1 B;  5FNC A;  5CA0 A;  1UYL A;  2CH7 A;  3B2E E;  3ZRX A;  4B3S B;  2VRZ A;  1NTK H;  1QU7 A;  1EBO A;  2V4D A;  2Y69 C;  2UXX A;  3OMU A;  3OUS A;  1S5H C;  3GIG A;  3IJ4 A;  4DK0 A;  5B5E Z;  3WB2 A;  1UYH A;  4MT8 A;  3SL2 A;  4DR7 B;  1IZ3 A;  2BU6 A;  3AG2 C;  2F66 C;  2XUM A;  1TC0 A;  3OE7 G;  4RO2 A;  4K3A A;  3FYI B;  5IJ0 A;  4E01 A;  1QVG U;  2QWN B;  3D3I A;  1MZE A;  3LSU A;  3N2G B;  5EIB D;  2YJW A;  1EN6 A;  4F4L A;  2BE3 A;  1GTO A;  1TVK A;  2EZO A;  4RUF A;  1BGY H;  4X1Y A;  1B3Q A;  5KMG B;  4I7Z B;  1AR4 A;  5LOV B;  4JI7 O;  4FVM A;  1IBL B;  4GT1 A;  3U67 A;  4WUD A;  1QLN A;  1HNZ O;  3OEH G;  1JR9 A;  2WA4 A;  4O4L B;  1H7S A;  2YEH A;  2N74 A;  2E3C A;  3VHC A;  4URL A;  5EC2 C;  4CS3 A;  2XHR A;  1U97 A;  4MPC A;  1MMM A;  1QCE A;  1MA1 A;  4LP0 A;  3HYY A;  4WFE A;  4JYA B;  4YJ3 A;  4MOT A;  2LFR A;  3GIF A;  1BHB A;  1NJI W;  2E0A A;  3FKS G;  3CYG A;  1AI4 A;  3SJQ C;  1WP7 A;  5H5N A;  5F3K A;  2O57 A;  3Q5K A;  2Q8I A;  5CF0 A;  2XAS A;  1O9G A;  3K0D A;  1I59 A;  3HKB B;  2BTZ A;  1AJP A;  3TCU A;  3P32 A;  1M4U A;  3VQX A;  2WA3 A;  4JI4 B;  1EZJ A;  3Q4H A;  5IYD O;  3SYO A;  3CRM A;  4JGS A;  2NR5 A;  2BYI A;  2OYQ A;  1PM9 A;  4BW5 A;  4JYC A;  4E4E A;  2H8P C;  2ZCE A;  1U2O A;  4DW0 A;  1FXH A;  1QNM A;  4LWE A;  4W4L A;  4FLY A;  3OGI B;  3OWB A;  3ZXQ A;  5J2U B;  3RFR A;  4WFF A;  1J5E O;  1IXM A;  2JJ1 G;  3B26 A;  3ZIA G;  2ESA A;  4HBN A;  4DV0 B;  2IM9 A;  3JAK B;  4ICG A;  3R4O A;  1M56 C;  2XDU A;  4YKU A;  1J95 A;  3OAA G;  4EEQ A;  1FFX A;  4QJF B;  2YEV A;  4PU9 A;  4QE9 A;  2DQ0 A;  2PYL A;  2HFE C;  1NVP B;  2IWU A;  3TZ2 A;  3ZMU A;  4I9W A;  4LF7 B;  4MTF A;  3OUF A;  3ETQ A;  1UPG A;  1ZX3 A;  4RUE A;  1N36 O;  4X1K A;  5IY5 B;  1VQP V;  4P8O A;  1SQG A;  2X6B A;  2LGQ A;  1V55 C;  1QLE B;  3QVN A;  4I55 B;  1Y67 A;  2Y4T A;  4MP2 A;  4CWS A;  2JJC A;  5LL6 Y;  4RAI A;  1URF A;  3ABM B;  2BSK B;  3BEH A;  1WA8 B;  4XIP A;  2GTA A;  1Q86 W;  1Y4S A;  2Y0P A;  2FKX A;  3ZRW B;  4FFB A;  2F93 B;  4F6E A;  4LFC O;  5BR8 O;  5EC1 C;  1HNW B;  5B1B B;  4MPN A;  3MHH C;  2IWX A;  1BE3 H;  5CBH A;  4WFG A;  1SER A;  4EMV A;  5A2Q N;  3OEE G;  4RWU A;  2CDY A;  3HB3 B;  2O1V A;  1VQ5 V;  1YS3 A;  2UU9 B;  1E1R G;  3WHA A;  4CH5 A;  4DYL A;  2ITD C;  1CEZ A;  4LF6 O;  1O9H A;  5J2T B;  2HHH B;  3T2S A;  2LGW A;  4JI1 O;  4E02 A;  4GZR B;  5H6R A;  3AG3 C;  1SZT A;  4GQT A;  4XKO A;  4TWK A;  5KUK A;  1PP9 H;  3EHG A;  1MAB G;  5KHK A;  3ML0 A;  4KFM A;  2UUA O;  1MNG A;  2PNR A;  3HKE A;  4DV1 O;  4NXM O;  5IJ0 B;  1Z5V A;  4H37 A;  2LW7 A;  3INX A;  3B8N A;  3G6E V;  3CX5 F;  4H7Q A;  4LWI A;  4HZ5 A;  1TVK B;  2Q8G A;  4CS2 A;  2ZM6 B;  1KIJ A;  4JAA A;  2EBO A;  3LDD A;  4EFB A;  2DN9 A;  2P6J A;  3ASN B;  2H55 A;  1LR1 A;  3GVM A;  3F7V C;  1F4M A;  4YY3 B;  4I9Q A;  4JI2 B;  4KUM A;  3CC4 V;  1NR1 A;  1NVP D;  1EN5 A;  4CH4 A;  2ZDY A;  2ZXW C;  4BAE A;  2WI7 A;  2LQT A;  3JAM N;  1FXK B;  1W0J G;  4YJ3 B;  2ZBK B;  4H81 A;  4K4O A;  1FXV A;  3QTF A;  5C8Y A;  1BQZ A;  1FFT B;  3B27 A;  3ZRS A;  3HHU A;  2YEI A;  1OCZ C;  1UYM A;  2CTP A;  1M57 C;  4GCZ A;  2UXC O;  3L70 H;  2YE7 A;  4WBN A;  1QQC A;  2FYP A;  3ZHS A;  3A2F A;  4KP4 A;  4GKJ B;  1AJQ A;  3Q4H B;  4D7S A;  1W0K G;  4PA3 A;  5D5Q A;  2Q8F A;  2HCH A;  1WPX A;  4MVS A;  3KCX A;  2NN4 A;  3H1K H;  3R4P A;  3HZ1 A;  4NH9 A;  1VQO V;  4LCU C;  4NKG B;  4URM A;  1Y8P A;  3UCS C;  1XNQ O;  5J9P C;  2EIM B;  1US7 A;  4XCL A;  1PVG A;  1RPO A;  1WB7 A;  4B3S O;  1SQF A;  1UY8 A;  3J7A U;  5IYZ B;  4B6C A;  2YC0 A;  1TBW A;  2YE5 A;  1SQV H;  4UB6 Z;  4FLU A;  4J7K A;  1GAX A;  4DR7 O;  3MAQ A;  4AIL C;  4WF9 V;  4FCR A;  3B09 A;  3EHJ A;  1B06 A;  3H1L H;  3SYP A;  3ASO B;  4X20 A;  2P7T C;  1NI8 A;  4YHH B;  4X1K B;  1US6 A;  1GRJ A;  2F95 B;  5D5P A;  1MU5 A;  2GFD A;  4JI5 O;  2QKA A;  2XAB A;  1L0N H;  2YE6 A;  1YC3 A;  1YJW V;  3P3P A;  2VCI A;  1AJN A;  3CRK A;  4EM7 A;  3CWV A;  2WI1 A;  3B28 A;  4BXI A;  4JTA B;  4XDJ A;  4XTJ A;  1QY8 A;  3TUH A;  4FM1 A;  1KUQ A;  5JH7 A;  3ZXO A;  4JYA O;  3CCS V;  3PJS K;  1AJ6 A;  1D5A A;  2GHY A;  1N8R W;  4FFB B;  1KD1 W;  3X2Q B;  3STL C;  4URO A;  4XIT A;  3L73 H;  3OWD A;  4PA4 A;  1N33 O;  2YI5 A;  1WB8 A;  3E8H A;  4DV5 B;  4D6T H;  4CZZ A;  3JAR A;  1ZTE A;  3H01 A;  3D36 A;  3AG1 B;  1H2S B;  2KQX A;  4FFK A;  4JI0 B;  4JAU A;  2AGA A;  4BQJ A;  3G67 A;  1QZR A;  1AP5 A;  2FL4 A;  4N23 A;  5JQG B;  4JI4 O;  1AH8 A;  1UY7 A;  1JFF B;  2P5O A;  4MVZ A;  5CA1 A;  1ZUQ A;  5LA6 B;  2IJH A;  1OCO C;  1FKA O;  2V7Q G;  2WLL B;  4LBE C;  1J5E B;  1DF5 A;  2Q7G A;  4AWO A;  2HJF C;  3F7Y C;  4QE7 A;  4C7U A;  1PNM A;  3MHS C;  4HNA A;  4LC1 A;  1XQ8 A;  3HKE B;  3N2K A;  1XMO O;  1B62 A;  4K0K B;  1XMQ O;  3CCU V;  1GM8 A;  2CGO A;  1NR7 A;  3JZ3 A;  2ZIO A;  2XD6 A;  2JVD A;  3N2G A;  3T1K A;  2IJK A;  5LBQ A;  5F5R A;  4QGP A;  1VMG A;  1I94 O;  3ZED A;  3H1I H;  4OGQ B;  3E89 A;  5KMG A;  5DEC A;  4LF7 O;  4CH3 A;  5FND A;  1AR5 A;  2Q7H A;  3K04 A;  3CGY A;  3MDS A;  3JD3 A;  4G28 B;  3CCV V;  1H2N A;  5GTI Z;  2GBO A;  5K1P A;  2B5U A;  1NU1 H;  2Q5Z A;  4PRX A;  4V26 A;  2LJ2 A;  4GT8 A;  1RP3 B;  1IBK O;  2HR3 A;  1S14 A;  5DN6 G;  2BU2 A;  1TGO A;  3JAW A;  5B1A B;  2WI2 A;  2YE2 A;  4XDL A;  2R9A A;  5DM6 V;  2ZDI A;  1GM7 A;  2EJ7 A;  5EBM C;  2WAM A;  2JJ2 G;  4R6Z A;  4WUB A;  1GK9 A;  2MW2 B;  3HYZ A;  3MD0 A;  3ZN0 A;  1NHI A;  2ZR3 A;  4DR4 B;  4QNH B;  5LHI A;  4YKQ A;  1JVM A;  1HNW O;  3BCC H;  2HEP A;  5KA6 A;  1WLE A;  2WLH A;  1IUR A;  3RYC A;  2XX2 A;  2K1E A;  5BMV A;  4CBC A;  1XI1 A;  3RLP A;  4J42 A;  1VF6 C;  3AK1 A;  5GON B;  4NYK A;  1L0O A;  1XHX A;  2UU9 O;  3OR6 C;  1OCR B;  4CWN A;  1OCC C;  2HG1 A;  2YUA A;  2UUA B;  1Q3E A;  2HHH O;  5E1A C;  1N0J A;  3GB7 C;  2C1I A;  1R1B A;  3FD9 A;  5J2U A;  4GLX A;  4QPK A;  4NXM B;  3EHH A;  4ZOL B;  3PEJ A;  5FPO A;  3ABL B;  2LW1 A;  4DXW A;  3K99 A;  3R66 A;  1VIB A;  2XTA A;  2W6I G;  3N27 A;  5GGZ A;  4P2Z A;  4H85 A;  1SZX A;  1TAE A;  4G2K A;  2GSM B;  2IOQ A;  3E86 A;  3RVY A;  5CTW A;  4FLX A;  2Y0I A;  4JF3 A;  2JEX A;  1BCC H;  1RSO B;  1XEQ A;  2ZM6 O;  4HY1 A;  4DUZ B;  4DV3 O;  3GWK C;  1THN A;  1GJV A;  1SQB H;  2IH3 C;  4KHP O;  1QYE A;  1TID A;  4I55 A;  4J11 A;  4YY3 O;  4A5U B;  4IYH A;  4ASF A;  1Q6H A;  2ETN A;  4UVC A;  4B7E A;  4EFE A;  1I58 A;  1TC6 A;  4KXR A;  1UY9 A;  2R70 A;  4ABM A;  2XX5 A;  3ZRW A;  3I56 V;  4X9Q A;  2HLD G;  5KHJ A;  3A0Y A;  4PRV A;  3OW6 A;  3O2F A;  1YET A;  1Q6I A;  1UJW B;  2UUC O;  2DQ3 A;  1UYE A;  2QWP B;  4LF4 O;  2QG0 A;  1YSZ A;  3ICX A;  1Q82 W;  3W7W A;  4FPP A;  1L8D A;  3M99 B;  4H44 B;  4PDR A;  1WJZ A;  4GKJ O;  1BGQ A;  2XDS A;  4FMT A;  1I5B A;  2YI8 A;  1XNQ B;  1G4Y B;  2CAZ C;  3KKY A;  4FLW A;  1WNS A;  4JV5 B;  3AK2 A;  5J2T A;  4ZIB A;  4MVO A;  3D3Q A;  1K34 A;  3H4L A;  1N4C A;  1RFY A;  4N21 A;  4HNA B;  1YI2 V;  1MOF A;  4KSG A;  4AHC A;  2YIB D;  3J81 N;  1P7B A;  3N2K B;  4YKX A;  3VBB A;  2BU8 A;  5KHG A;  2BCC H;  1GO3 F;  1PL4 A;  2UXD B;  3H1H H;  4X88 A;  5LP6 A;  1KKD A;  3JD2 A;  3OTF A;  2XHX A;  2OCC B;  4HZ3 A;  1NBM G;  4DR1 B;  4HXW A;  1SES A;  2A06 H;  4V25 A;  4GX1 A;  1DK1 A;  3HPL C;  3AG7 A;  1S77 D;  1R3I C;  4YKY A;  3RLR A;  2W6J G;  2YI6 A;  2QKS A;  2G38 A;  1IX9 A;  1DGS A;  3MNR P;  3BA9 A;  4JI5 B;  4W7T A;  3HKD B;  3ZKD A;  3C3S A;  4X9L A;  5D6Q A;  2JDI G;  4YHH O;  1Z5B A;  1S5L Z;  3A0B Z;  1YC1 A;  3C11 A;  4R3A A;  2YXL A;  1H38 A;  1XRE A;  2QF6 A;  1H8H G;  2FB5 A;  3LSQ A;  3Q5J A;  4HXZ A;  1R62 A;  2EJR A;  2YGF A;  2BRC A;  3FYE B;  3F5T A;  4JTD B;  1FXK A;  1XIL A;  4I5S A;  3ETD A;  3JAW B;  2QG2 A;  5BXZ A;  1RM1 B;  2ZDX A;  4F6R B;  1N33 B;  3QO5 A;  2GTS A;  3D2R A;  4FM0 A;  4LF9 B;  5CTY A;  5IY5 C;  3K06 A;  1PD3 A;  4FK5 C;  4NB5 A;  4DUY B;  4NTX A;  4ZVI A;  2YKI A;  5HFM A;  3RYC B;  4DV5 O;  4PEL A;  3W7X A;  4XCJ A;  5BMV B;  1YF2 A;  3WG7 C;  4UCS A;  4WUC A;  2ZE7 A;  3OMN B;  1NTM H;  4JI0 O;  3KE6 A;  2ZIM A;  3OMI B;  1VQ6 V;  4PA6 A;  5D7R A;  3B4S A;  2BOB C;  2HJD A;  3BPZ A;  1XMO B;  4J10 A;  3AG2 B;  1JCH A;  2EX3 A;  2HP8 A;  5B1B C;  1XMQ B;  2AZ0 A;  2W0F C;  3AG4 C;  2ZR2 A;  3K5N A;  1ZAU A;  3SJC C;  3TZ5 A;  5K1X A;  5IYZ A;  2WI6 A;  2JS3 A;  4ASG A;  4MBC A;  4CS4 A;  3RYH A;  2QM7 A;  1OZ0 A;  3O9O A;  4DR5 B;  1I94 B;  4K0K O;  4R3M A;  3U11 A;  4IT5 A;  2A9H A;  2QTS A;  1VF7 A;  3K03 A;  1SQX H;  4GKK O;  4FCP A;  2GV9 A;  3CP1 A;  1K97 A;  1MSD A;  4LH6 A;  3DC5 A;  1KU9 A;  3ZM7 A;  3CD6 V;  4KQV A;  3M8A A;  5LXT B;  4NH8 A;  2DOS A;  2IU3 A;  4LWS A;  1Y66 A;  2Z3Y A;  5M4M A;  5L3F A;  3KG2 A;  2RMK B;  1VQ4 V;  3OMA B;  1IDS A;  1IBK B;  2YEF A;  2KB1 A;  2QWR B;  4UCT A;  3B8M A;  5L3J A;  1X59 A;  3OT7 A;  2XOK G;  3WB1 A;  1ZWH A;  4YXW G;  4TQF A;  1ID0 A;  2XHT A;  2ZKJ A;  5JCO A;  2YKE A;  1K9M W;  2IU0 A;  1I5D A;  2HHI A;  2WI3 A;  3ASN C;  4OX9 B;  2BU7 A;  4TOI A;  4PDM A;  3T1H O;  2ZD9 A;  4JPR A;  4O2A B;  4ZHQ A;  1VQ7 V;  2XT9 A;  2YS8 A;  4CE1 A;  1BYQ A;  2Q68 A;  4DR4 O;  1Y8O A;  3RLQ A;  3SYC A;  2ILM A;  1OJH A;  3L72 H;  3BAB A;  1R6N A;  4L87 A;  2QM4 A;  2BTO A;  3JAT A;  3L9D A;  5M4N A;  1M1K W;  2R9R B;  5JQG A;  1JFF A;  1U96 A;  4J7Z A;  4H33 A;  2E5L B;  5IN9 A;  2AW9 A;  1QR9 A;  2ADP A;  2DWD C;  5LA6 A;  1AM1 A;  2WLL A;  3CHX A;  2YKB A;  3K0G A;  2D3O W;  4LWG A;  1N32 B;  2DYR B;  1M56 B;  4K8X A;  4O4I B;  2Q69 A;  3CRA A;  5L3C A;  3K79 A;  3QDD A;  5LP6 B;  1UFI A;  4L8J A;  5BOC A;  3G7E A;  3LSS A;  4XDK A;  5IE9 A;  1K4C C;  2LP7 A;  1LUV A;  3LNM B;  3CCJ V;  4XDM A;  3IC9 A;  3TET A;  3U2K A;  4JYB A;  1AI7 A;  1LNQ A;  1QBZ A;  4DV3 B;  1YES A;  1V55 B;  2YSU B;  1Y8N A;  4PJ0 Z;  3U2D A;  3CC2 V;  4KHP B;  3HR0 A;  4I0X A;  2EIN C;  1M5I A;  2DE0 X; 
#chains in the Genus database with same CATH homology
 2BRE A;  4UV9 A;  4WFB V;  1GM9 A;  1TUE B;  2EIK C;  3I55 V;  2O1W A;  5B3S C;  4XC0 A;  1KEC A;  3IC7 A;  3CCL V;  3ASO C;  3OR7 C;  2AHZ A;  4I3H A;  4YKZ A;  2YEG A;  1BKN A;  2CCU A;  2QE7 G;  2PI4 A;  3SPI A;  1KP3 A;  2QM8 A;  3T4Z A;  3CCQ V;  1YT0 A;  2PI5 A;  3AG3 B;  3CCE V;  1UYG A;  5J6A A;  2DYS C;  3X2Q C;  1UYC A;  3FT8 A;  1Q7Y W;  3AG1 C;  1ARO P;  1E79 G;  4CWO A;  3CYO A;  3QO7 A;  2Q8H A;  2CK3 G;  5CBG A;  1HWY A;  4ASB A;  1B63 A;  1I5A A;  1I5X A;  3ZJZ A;  1TH8 A;  4KFG A;  5IYB O;  1R3L C;  4WFA V;  2ZXW B;  3CCM V;  4J9Z B;  4X8A A;  3K9A A;  4EEH A;  4EFT A;  2ZQM A;  2VW5 A;  5L3D A;  4GEE A;  2XDX A;  1K8A W;  4YKR A;  1QVF U;  2QA4 V;  1DF4 A;  3R92 A;  3NMQ A;  3FB8 C;  1OCZ B;  1BMF G;  1M57 B;  3RW0 A;  1XL6 A;  2EIJ C;  1Y4U A;  2C2A A;  1M90 W;  5LHG A;  3FB7 C;  5CBF A;  5LGT A;  3IGA C;  3T10 A;  2WER A;  2AHY A;  4RQE A;  1A4H A;  3FB5 C;  5C93 A;  5L3G A;  2DWE C;  3K97 A;  3DTU B;  3LNU A;  4R8C A;  1YSR A;  3ZKB A;  2YEA A;  1W2B U;  5CTX A;  3P30 A;  1VQM V;  1NHH A;  2JIZ G;  2UXN A;  1ZXN A;  4MTX A;  3AEI A;  1KZN A;  3ZMZ A;  1S16 A;  2EIL C;  3CMA V;  4CWP A;  2IJJ A;  4HZ0 A;  5D7C A;  2IW5 A;  4XIQ A;  2MK3 A;  2WI4 A;  1PNK A;  4KTN A;  1Y4M A;  4JAS A;  1AH6 A;  3JD4 A;  5BZB A;  2EXL A;  1YIT V;  3K98 A;  1R3K C;  5IDM A;  4DO2 A;  1NH2 B;  1V54 C;  3T1C A;  5LGU A;  1K5Q A;  5KA5 A;  2WWW A;  4Q20 A;  3HEK A;  4NH7 A;  2O1U A;  2K5B A;  1GKF A;  2YED A;  2XX4 A;  4ZBM A;  2YE4 A;  1M9N A;  3ABK B;  3DGE A;  1R6K A;  4CWF A;  3ZCC A;  4O0B A;  2IOR A;  3T2M A;  1AR1 B;  4MS2 A;  1OCO B;  2WLN A;  1KQS U;  5D6P A;  3PEH A;  3STZ C;  4TSF G;  2X7R B;  1QR8 A;  3CRL A;  2HVK C;  1GKZ A;  3QNE A;  5LGN A;  3G71 V;  2QFO A;  2BU5 A;  3T0H A;  2YGA A;  4Z1M G;  2JEU A;  1H7U A;  1Z5A A;  5M4E A;  1YT2 A;  1YJN V;  3A0W A;  4AS9 A;  4XE2 A;  3JD1 A;  2WLJ A;  3LDC A;  1U0Z A;  4HYO A;  4AWP A;  3GIE A;  4MTO A;  2VCJ A;  3OPD A;  3T0Z A;  3BMY A;  2CCS A;  4DUH A;  3NXS A;  4J9Y B;  3ZRV A;  4FJC C;  4MTG A;  2IOP A;  4PA9 A;  2YE3 A;  1B6Q A;  4ASU G;  1Z59 A;  2HKJ A;  1AI5 A;  1PL0 A;  1E1Q G;  4BQG A;  1H8E G;  4MW3 A;  5CN0 A;  3WQ9 A;  1JQ0 A;  4CWT A;  5M4H A;  2YEC A;  5M4K A;  1NKD A;  1NH2 D;  4KSH A;  1DTO A;  4UV8 A;  4URN A;  4YKT A;  4R50 A;  2ZDI C;  1RM1 C;  2YI7 A;  2YKJ A;  2CGF A;  1BXD A;  2CG9 A;  4O05 A;  2BZ5 A;  2NNU A;  1EA6 A;  2XCM A;  3R4M A;  3B25 A;  3JYC A;  3ETG A;  2ATK C;  5H6Q A;  4XKK A;  1JPX A;  5L3E A;  2A0L A;  3O6O A;  1KP2 A;  5J71 A;  3G4S V;  4O07 A;  4O04 A;  2M7W A;  2IJI A;  2H94 A;  3TK1 A;  3FV5 A;  3ZMV A;  2WLI A;  4L90 A;  5IYC O;  5FNF A;  2WPD G;  4LPB A;  4EGI A;  1P4R A;  4JTC B;  2XAJ A;  5EBL C;  4P30 A;  5CTU A;  4HAM A;  5L3B A;  3EFF K;  2OTJ V;  2Q2E B;  2X0L A;  1L1F A;  2YE8 A;  1UYI A;  5CMU A;  3VOU A;  4B7P A;  1THZ A;  2WI5 A;  4QPJ A;  4XIR A;  3R65 A;  1QLE C;  2WEQ A;  1VQK V;  1SRY A;  2BYH A;  3E8F A;  1JJ2 U;  3GWO A;  2VWC A;  3ABM C;  2Z5U A;  1PKX A;  1ZXM A;  2Y69 B;  2BSM A;  2X6C A;  2XAF A;  4GX5 A;  4LWF A;  3INW A;  3JCZ A;  4MW8 A;  2HG5 C;  1AMW A;  1K3E A;  1EFR G;  4PDV A;  3EKR A;  5HFL A;  3G75 A;  3RKZ A;  1R3J C;  3ZN1 A;  2EZP A;  2XJG A;  2DYR C;  2WEP A;  3Q5L A;  4U7N A;  3SYQ A;  2XJJ A;  4PL9 A;  1FS0 G;  1PNL A;  4GGL A;  4MVQ A;  2AKP A;  3SYA A;  2NLJ C;  2B1I A;  3JD0 A;  4RQF A;  4P9O A;  1MX0 A;  1NHJ A;  3ABU A;  1VQN V;  4MB9 A;  2Q67 A;  3SPH A;  1VQ8 V;  4GX0 A;  1CP9 A;  4MVU A;  4UXN A;  2Y48 A;  2WSS G;  1Q81 W;  3WG7 B;  3CME V;  2YK9 A;  3W7T A;  1YSC A;  1S3J A;  3B24 A;  3A0Z A;  4XBF A;  1FXK C;  1TIL A;  4CE2 A;  1K7D A;  3OFN G;  3SPG A;  3AG4 B;  2OTL V;  4WFH A;  2P67 A;  1F51 A;  3E83 A;  2B1G A;  1YJ9 V;  4FCQ A;  4JAV A;  3R91 A;  4E2L A;  4L8Z A;  4R7C A;  3R4N A;  1MSW D;  3GIG B;  3ABT A;  4UVB A;  4L91 A;  3A0X A;  2EIM C;  2FTK A;  2WLI B;  3WFV A;  1EI1 A;  3CC7 V;  3VAD A;  1MG1 A;  3A0T A;  2XAQ A;  1ORQ C;  1F23 A;  1YC4 A;  3EKO A;  4XD8 A;  1S0V A;  4UVA A;  3CPW U;  1YHQ V;  4L93 A;  3IED A;  5B1O A;  3LUT B;  4TT3 G;  5FWK A;  3B77 A;  3CCR V;  2BOC C;  4LP8 A;  2YE9 A;  1UYD A;  3BY6 A;  3FT5 A;  2FXS A;  1DLB A;  3A0R A;  4MVM A;  2HKO A;  5IDJ A;  4EGH A;  1F4N A;  3K60 A;  2QTO A;  3EHF A;  1GKX A;  1UYF A;  4U93 A;  2XND G;  3VHD A;  3F5W C;  5BOD A;  3TTZ A;  1ZW9 A;  5FL7 G;  2EIN B;  5GW7 A;  3VHA A;  1K4D C;  3OW2 U;  3OGC C;  4MPE A;  2EIK B;  3O0I A;  4EGK A;  2YEV B;  3ZMT A;  4P9P A;  4EKW A;  1AI6 A;  4E00 A;  5B3S B;  3TZ4 A;  4HYM A;  5H9C A;  5B1N A;  5CA3 A;  4LWH A;  4U7O A;  2YEB A;  1H2G A;  3C0E A;  3RBZ A;  2F43 G;  2XAH A;  2XK2 A;  4L94 A;  3FB6 C;  4DZY A;  3UKM A;  4JQL A;  4QIW F;  3SPJ A;  4PDL A;  1CPY A;  2DYS B;  4BIZ A;  5KUM A;  1VQL V;  2YK2 A;  2YEE A;  1K92 A;  1I5Y A;  5B1A C;  3IFX A;  1I5C A;  3E35 A;  2XDL A;  2P90 A;  1YTF B;  3ABK C;  3EHB B;  1BHA A;  1R73 A;  2XAG A;  3UM7 A;  1SET A;  2WLK A;  3BM9 A;  5D7D A;  2YI0 A;  2YKC A;  1ZWI C;  4EFU A;  4GX2 A;  1YIJ V;  2H8M A;  3H80 A;  2OT5 A;  3K08 A;  1OCR C;  3G7B A;  3ETE A;  2ITC C;  1ROP A;  3ZMS A;  4O09 A;  4P7A A;  2DW4 A;  4FIP C;  3E2E A;  3ABL C;  1Z5C A;  3E8G A;  1K5S A;  1S72 V;  4HYP A;  2LFS A;  2YEJ A;  2FWZ A;  2EIJ B;  1KC8 W;  5EBW C;  3RVZ A;  2IH1 C;  4PA7 A;  2BT0 A;  3T4D A;  4OXS A;  2IWS A;  2XJX A;  3OM3 B;  1RPR A;  2XDK A;  4HY6 A;  4ASA A;  3SPC A;  2R9I A;  2X6A A;  1JOY A;  3E8B A;  3W7U A;  2WLM A;  4GFN A;  1COW G;  4X89 A;  3W7S A;  4MVR A;  1XL4 A;  2A79 B;  5LHH A;  5EK0 A;  2JKI A;  1NQT A;  3CXC U;  2EIL B;  4MP7 A;  2QEX V;  2UWD A;  4XKA A;  4ZKI A;  1YTF D;  2HVJ C;  4AWQ A;  4CWR A;  4CE3 A;  1G8M A;  4R1F A;  1V54 B;  4G27 B;  2Q6A A;  2OCC C;  3LDE A;  4CWQ A;  4UUJ C;  1YER A;  1JM6 A;  3HZ5 A;  4YKW A;  3QO8 A;  3D0B A;  5CPH A;  3K3W A;  2CH4 A;  1GMG A;  1S76 D;  1YT1 A;  2V1D A;  1VQ9 V;  3CGZ A;  2FWY A;  4BIU A;  1UYK A;  4BAY A;  2YJX A;  1BL8 A;  1OSF A;  2YGE A;  3TZ0 A;  1JX9 A;  1OCC B;  1UY6 A;  4MSW C;  1OHH G;  3LPS A;  1K73 W;  4WCE V;  2JK5 C;  1K33 A;  1ENV A;  2GQP A;  5M4P A;  5FNC A;  1UYL A;  3ZRX A;  1EBO A;  2Y69 C;  2UXX A;  3OMU A;  3OUS A;  1S5H C;  3GIG A;  1UYH A;  4MT8 A;  3SL2 A;  2BU6 A;  3AG2 C;  1TC0 A;  3OE7 G;  4RO2 A;  4E01 A;  3FYI B;  1QVG U;  3D3I A;  2YJW A;  4F4L A;  1GTO A;  2EZO A;  4RUF A;  1B3Q A;  4GT1 A;  3U67 A;  4WUD A;  1QLN A;  3OEH G;  1H7S A;  2YEH A;  3VHC A;  4URL A;  5EC2 C;  2XHR A;  4MPC A;  1QCE A;  4LP0 A;  3HYY A;  4WFE A;  4MOT A;  2LFR A;  3GIF A;  1BHB A;  1NJI W;  2E0A A;  3FKS G;  1AI4 A;  3SJQ C;  5F3K A;  3Q5K A;  2Q8I A;  5CF0 A;  2XAS A;  3K0D A;  1I59 A;  2BTZ A;  1AJP A;  3TCU A;  3P32 A;  1EZJ A;  5IYD O;  3SYO A;  4JGS A;  2BYI A;  4BW5 A;  4JYC A;  2H8P C;  1U2O A;  1FXH A;  4LWE A;  3OWB A;  3ZXQ A;  4WFF A;  1IXM A;  2JJ1 G;  3B26 A;  3ZIA G;  2ESA A;  3R4O A;  1M56 C;  2XDU A;  4YKU A;  1J95 A;  3OAA G;  4QJF B;  2YEV A;  4PU9 A;  4QE9 A;  2DQ0 A;  2HFE C;  1NVP B;  2IWU A;  3TZ2 A;  3ZMU A;  4I9W A;  4MTF A;  3OUF A;  4RUE A;  5IY5 B;  1VQP V;  4P8O A;  2X6B A;  1V55 C;  1QLE B;  4MP2 A;  4CWS A;  2JJC A;  4RAI A;  3ABM B;  3BEH A;  4XIP A;  1Q86 W;  1Y4S A;  3ZRW B;  5EC1 C;  5B1B B;  4MPN A;  3MHH C;  2IWX A;  5CBH A;  4WFG A;  1SER A;  4EMV A;  3OEE G;  3HB3 B;  2O1V A;  1VQ5 V;  1YS3 A;  1E1R G;  3WHA A;  2ITD C;  1CEZ A;  3T2S A;  4E02 A;  5H6R A;  3AG3 C;  1SZT A;  4GQT A;  4XKO A;  4TWK A;  5KUK A;  3EHG A;  1MAB G;  3ML0 A;  4KFM A;  2PNR A;  4H37 A;  3INX A;  3B8N A;  3G6E V;  4H7Q A;  4LWI A;  4HZ5 A;  2Q8G A;  1KIJ A;  2EBO A;  3LDD A;  2P6J A;  3ASN B;  2H55 A;  3F7V C;  1F4M A;  4KUM A;  3CC4 V;  1NR1 A;  1NVP D;  2ZDY A;  2ZXW C;  4BAE A;  2WI7 A;  1FXK B;  1W0J G;  2ZBK B;  4H81 A;  4K4O A;  1FXV A;  3QTF A;  1FFT B;  3B27 A;  3ZRS A;  3HHU A;  2YEI A;  1OCZ C;  1UYM A;  1M57 C;  4GCZ A;  2YE7 A;  2FYP A;  4KP4 A;  1AJQ A;  1W0K G;  4PA3 A;  2Q8F A;  2HCH A;  1WPX A;  4MVS A;  3R4P A;  3HZ1 A;  4NH9 A;  1VQO V;  4LCU C;  4URM A;  1Y8P A;  5J9P C;  2EIM B;  1US7 A;  4XCL A;  1PVG A;  1RPO A;  1UY8 A;  4B6C A;  1TBW A;  2YE5 A;  4WF9 V;  4FCR A;  3EHJ A;  3SYP A;  3ASO B;  2P7T C;  1MU5 A;  2GFD A;  2XAB A;  2YE6 A;  1YC3 A;  1YJW V;  2VCI A;  1AJN A;  3CRK A;  4EM7 A;  3CWV A;  2WI1 A;  3B28 A;  4BXI A;  4JTA B;  4XDJ A;  4XTJ A;  1QY8 A;  3TUH A;  3ZXO A;  3CCS V;  3PJS K;  1AJ6 A;  2GHY A;  1N8R W;  1KD1 W;  3X2Q B;  3STL C;  4URO A;  4XIT A;  3OWD A;  4PA4 A;  2YI5 A;  3E8H A;  4CZZ A;  3H01 A;  3D36 A;  3AG1 B;  4JAU A;  4BQJ A;  1QZR A;  4N23 A;  1AH8 A;  1UY7 A;  4MVZ A;  2IJH A;  1OCO C;  2V7Q G;  2WLL B;  4LBE C;  1DF5 A;  4AWO A;  2HJF C;  3F7Y C;  4QE7 A;  1PNM A;  3MHS C;  4LC1 A;  1B62 A;  3CCU V;  1GM8 A;  1NR7 A;  3JZ3 A;  2XD6 A;  3T1K A;  2IJK A;  5LBQ A;  5F5R A;  3E89 A;  5FND A;  3K04 A;  3CGY A;  3JD3 A;  4G28 B;  3CCV V;  2B5U A;  4PRX A;  4V26 A;  4GT8 A;  2HR3 A;  1S14 A;  5DN6 G;  2BU2 A;  5B1A B;  2WI2 A;  2YE2 A;  4XDL A;  5DM6 V;  2ZDI A;  1GM7 A;  5EBM C;  2WAM A;  2JJ2 G;  4R6Z A;  4WUB A;  1GK9 A;  3HYZ A;  3MD0 A;  3ZN0 A;  1NHI A;  2ZR3 A;  4QNH B;  5LHI A;  4YKQ A;  1JVM A;  5KA6 A;  1WLE A;  2WLH A;  2XX2 A;  2K1E A;  4CBC A;  3RLP A;  1L0O A;  3OR6 C;  1OCR B;  4CWN A;  1OCC C;  2HG1 A;  5E1A C;  3GB7 C;  3EHH A;  4QPK A;  3PEJ A;  3ABL B;  4DXW A;  3K99 A;  2W6I G;  5GGZ A;  4P2Z A;  4H85 A;  4G2K A;  2GSM B;  2IOQ A;  3E86 A;  3RVY A;  5CTW A;  4JF3 A;  2JEX A;  4HY1 A;  1THN A;  1GJV A;  2IH3 C;  1QYE A;  1TID A;  4ASF A;  4UVC A;  1I58 A;  1TC6 A;  1UY9 A;  2XX5 A;  3ZRW A;  3I56 V;  2HLD G;  3A0Y A;  4PRV A;  3OW6 A;  3O2F A;  1YET A;  1UJW B;  2DQ3 A;  1UYE A;  2QG0 A;  1YSZ A;  1Q82 W;  3W7W A;  4FPP A;  3M99 B;  4PDR A;  1BGQ A;  2XDS A;  4FMT A;  1I5B A;  1G4Y B;  4MVO A;  1K34 A;  3H4L A;  4N21 A;  1YI2 V;  1MOF A;  4KSG A;  1P7B A;  4YKX A;  3VBB A;  2BU8 A;  1GO3 F;  4X88 A;  1KKD A;  3JD2 A;  2XHX A;  2OCC B;  4HZ3 A;  1NBM G;  4HXW A;  1SES A;  4V25 A;  4GX1 A;  3HPL C;  1S77 D;  3RLR A;  1R3I C;  4YKY A;  2W6J G;  2YI6 A;  2QKS A;  3MNR P;  4W7T A;  3ZKD A;  4X9L A;  5D6Q A;  2JDI G;  1Z5B A;  1YC1 A;  3C11 A;  4R3A A;  1H38 A;  2QF6 A;  1H8H G;  3LSQ A;  3Q5J A;  4HXZ A;  1R62 A;  2EJR A;  2YGF A;  2BRC A;  3FYE B;  4JTD B;  1FXK A;  4I5S A;  3ETD A;  2QG2 A;  1RM1 B;  2ZDX A;  3QO5 A;  3D2R A;  5CTY A;  5IY5 C;  3K06 A;  1PD3 A;  4FK5 C;  4ZVI A;  2YKI A;  5HFM A;  4PEL A;  3W7X A;  4XCJ A;  3WG7 C;  4WUC A;  3OMN B;  3KE6 A;  3OMI B;  1VQ6 V;  4PA6 A;  5D7R A;  2BOB C;  3AG2 B;  1JCH A;  5B1B C;  2W0F C;  3AG4 C;  2ZR2 A;  3TZ5 A;  2WI6 A;  4ASG A;  4MBC A;  2QM7 A;  1OZ0 A;  4R3M A;  2A9H A;  3K03 A;  4FCP A;  3CP1 A;  1K97 A;  3ZM7 A;  3CD6 V;  4KQV A;  4NH8 A;  2IU3 A;  1Y66 A;  2Z3Y A;  5M4M A;  5L3F A;  3KG2 A;  1VQ4 V;  3OMA B;  2YEF A;  2KB1 A;  3B8M A;  5L3J A;  2XOK G;  1ZWH A;  4YXW G;  1ID0 A;  2XHT A;  2ZKJ A;  2YKE A;  1K9M W;  2IU0 A;  1I5D A;  2WI3 A;  3ASN C;  2BU7 A;  4PDM A;  2ZD9 A;  4JPR A;  1VQ7 V;  4CE1 A;  1BYQ A;  2Q68 A;  1Y8O A;  3RLQ A;  3SYC A;  1R6N A;  4L87 A;  5M4N A;  1M1K W;  2R9R B;  4H33 A;  5IN9 A;  1QR9 A;  2DWD C;  1AM1 A;  2WLL A;  2YKB A;  3K0G A;  2D3O W;  4LWG A;  2DYR B;  1M56 B;  2Q69 A;  5L3C A;  3K79 A;  3QDD A;  5BOC A;  3G7E A;  3LSS A;  4XDK A;  1K4C C;  2LP7 A;  3CCJ V;  3LNM B;  4XDM A;  3TET A;  3U2K A;  4JYB A;  1AI7 A;  1LNQ A;  1QBZ A;  1YES A;  1V55 B;  2YSU B;  1Y8N A;  3U2D A;  3CC2 V;  2CCT A;  2EIN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...