4FPPA

Bacterial phosphotransferase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
205
structure length
205
Chain Sequence
b'PDFAAMLAARLCHDFISPASAIVSGLDLLEDPSAQDMRDDAMNLIASSARKLADLLQFTRVAFGASASAENFDSRELEKLAQGVFAHVRPTLDWQIEPQAMNKPSSRAVLNIAQIAASALPAGGVATVKGVAADGRFSIIADAKGPRARLRPEVLAGLKGEPLAEGLGGPWVQAAYLNALVRAAGGQIAVEIGEDRASIAAWVPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphotransferase
publication title Structural insights into ChpT, an essential dimeric histidine phosphotransferase regulating the cell cycle in Caulobacter crescentus.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Transferase
total genus 66
structure length 205
sequence length 205
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10090 HPTransfase Histidine phosphotransferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fppA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4fppA02
1YSZA 3H4LA 3KE6A 2LFSA 3D2RA 4U93A 1ZWHA 5M4HA 1TBWA 1JOYA 3U2KA 4FPPA 1Y8OA 1YESA 1GKZA 4EGKA 3HEKA 4R1FA 1UYIA 2HKJA 3QTFA 2YEDA 4MBCA 1B63A 2GFDA 2YE8A 3B27A 4O09A 4E02A 4LPBA 5M4EA 2BTZA 4XIPA 1BXDA 2XJJA 2BRCA 2C2AA 4E00A 2FWZA 2YKJA 4FMTA 2YEHA 1YC1A 4FCRA 2E0AA 4MOTA 4XIRA 4CWSA 4XKKA 4GEEA 5M4NA 4MTXA 1BGQA 2XX4A 1YC4A 3HHUA 4LC1A 4JASA 5C93A 4KSHA 4CWNA 4R3MA 2BU2A 3ZRVA 1PVGA 3WHAA 4XDMA 1B62A 4B6CA 4ASBA 3GIGA 1TC6A 3T10A 4O0BA 4XCJA 4MB9A 4YKXA 2WI6A 2K5BA 2BU5A 2YKIA 4P8OA 4XD8A 4XC0A 4YKTA 3Q5JA 1I59A 4LWGA 3OW6A 4CE2A 4URNA 4XITA 2XABA 2YI6A 4H85A 3VHAA 1U0ZA 3INXA 5CPHA 3WQ9A 2O1WA 1S14A 3R92A 4CWFA 4MPNA 4XIQA 4CWQA 4YKRA 4EGIA 4JQLA 1UYMA 4URLA 2Q8FA 5FNFA 3ZKDA 4U7NA 2PNRA 1YS3A 1US7A 3CWVA 3ZRWB 2ZDXA 4E01A 2WI5A 4CWRA 4YKUA 3D36A 5F5RA 3T0ZA 1MX0A 1UY9A 4XE2A 2XDUA 2IWSA 1YERA 1ZXMA 2YE9A 4PRXA 2BU7A 3OWDA 4MP7A 4EEHA 1YC3A 3DGEA 3T2SA 4KSGA 1F51A 1EA6A 2YGFA 3TZ4A 5IDJA 3A0TA 4MPEA 4JAVA 4ASFA 4FCQA 4HXWA 2CGFA 4B7PA 1AM1A 4AS9A 2YJWA 2YI7A 3VADA 3G7EA 2LFRA 1AJ6A 3A0RA 2CCTA 2YK2A 3K99A 3U67A 4GFNA 2YEFA 3OMUA 5FNCA 3EHGA 3R4OA 2YEAA 5FNDA 3A0XA 3FT5A 5M4KA 3T1KA 3NXSA 1ZXNA 1UY8A 3R4PA 4L90A 1BKNA 4XKAA 3B26A 1QZRA 2BU6A 5D6PA 3GIEA 1U2OA 2QF6A 1I5AA 3RLRA 4QPJA 1OSFA 2ZKJA 4HY1A 4NH9A 2XDKA 4XCLA 4MT8A 3SL2A 3TTZA 1Z5CA 1UY7A 2ESAA 5M4PA 1I5DA 2XX2A 2Q8HA 4BIUA 3CRKA 3ZXQA 3EHHA 1KIJA 3MD0A 1QY8A 2XK2A 2XJGA 4GGLA 2VWCA 4CWPA 1Z59A 4CE3A 4Q20A 2FTKA 1UYLA 2XCMA 1THNA 4BAEA 5D7DA 5CF0A 2Q2EB 1YSRA 3LPSA 2VCIA 2AKPA 3NMQA 2JJCA 4MP2A 3ZRWA 2IOPA 2XX5A 2YI0A 2HCHA 4URMA 3C11A 2XDLA 2BYHA 2YKBA 4KQVA 4MPCA 3BM9A 1QYEA 4EFTA 1AMWA 5GGZA 2YE7A 2YGEA 3RLQA 1NHHA 4BQGA 3H80A 2H8MA 4NH8A 4ASAA 2YI5A 2EXLA 2YGAA 2XHRA 3K98A 2VCJA 4BXIA 3RKZA 2GQPA 3U2DA 4EGHA 1B3QA 3PEHA 3IEDA 4R3AA 4K4OA 5IN9A 4DZYA 3FV5A 3T0HA 5BODA 1TIDA 2YE6A 3A0YA 3HZ1A 1TILA 4BIZA 4WUDA 5F3KA 5D7CA 2XDXA 4L93A 1I5CA 3TZ2A 4KTNA 1Z5BA 2QG2A 4AWOA 3A0WA 3GIFA 3JZ3A 4KFGA 2O1VA 4LWHA 1AH6A 5CTWA 1GKXA 4W7TA 3D0BA 4AWPA 3CGZA 5D7RA 1KZNA 2CG9A 2YKEA 3Q5LA 3C0EA 2O1UA 2UWDA 5B1NA 4X9LA 1Y8PA 2YEGA 4V26A 3EKRA 1R62A 2WI7A 3ZKBA 2IWUA 1MU5A 1NHIA 2YKCA 5J71A 2CH4A 3R91A 2WI2A 1NHJA 1I58A 4HYPA 5L3JA 4JYCA 3EHFA 3K60A 2YEJA 4EM7A 2FXSA 2WERA 4CWTA 5D6QA 4FCPA 2XD6A 2XJXA 2Q8GA 2CCUA 1UYFA 5CTYA 3HYYA 2WI3A 3R4MA 4LWEA 4JAUA 1AH8A 2BREA 4HY6A 1YETA 5CTXA 3PEJA 2YK9A 1YT1A 4AWQA 1L0OA 5CTUA 2BYIA 4U7OA 1ID0A 3B24A 3OWBA 1IXMA 3B25A 2YE4A 1H7SA 2ZBKB 4P7AA 4XTJA 4O04A 2P67A 1EI1A 3TK1A 3O6OA 5BOCA 1S16A 1I5BA 2YJXA 3R4NA 4LP0A 4I5SA 2QFOA 3HYZA 3FT8A 2YEIA 2QG0A 2WI1A 4QPKA 1UYGA 1Y4SA 1UYCA 1UYHA 4NH7A 3MNRP 3RLPA 2H55A 3G75A 4WUCA 4HZ0A 4ZVIA 4YKYA 3EHJA 5FWKA 2BU8A 4ASGA 4WUBA 4PL9A 2YEBA 3TZ0A 2HG1A 4GT1A 3HZ5A 4HYMA 4YKZA 4O05A 4ZKIA 4PU9A 3VHCA 4YKWA 4EMVA 4KP4A 2BT0A 1Y4UA 3ZXOA 4GCZA 4HXZA 1Y8NA 4YKQA 2YE3A 5IDMA 3TUHA 1YT2A 3ZCCA 3INWA 2Q8IA 1ZW9A 4HZ5A 4CWOA 3CGYA 4L94A 1YT0A 3G7BA 1TH8A 4GQTA 5M4MA 3CRLA 3GIGB 2FWYA 4L8ZA 1Z5AA 4LWIA 2YE5A 3P32A 2BSMA 2IORA 3BMYA 4O07A 1GJVA 2YE2A 2XHTA 4L91A 2XDSA 4XKOA 4CE1A 2WEQA 3ZM7A 3Q5KA 3ZRXA 3VHDA 2WI4A 2YECA 4H81A 1BYQA 4LWFA 1A4HA 3OPDA 2QM7A 3O0IA 4EFUA 2QM8A 2ZDYA 1UYDA 3A0ZA 3B28A 2XHXA 1H7UA 5J6AA 3K97A 2BZ5A 2IOQA 2CCSA 2YEEA 4JYBA 3EKOA 4PRVA 3O2FA 2VW5A 4DUHA 1UY6A 4GT8A 2FYPA 4H7QA 2JKIA 1UYEA 4V25A 1JM6A 3QDDA 3LNUA 3TZ5A 5B1OA 4I3HA 4UROA 1TC0A 2IWXA 1UYKA 2WWWA 4BQJA 2WEPA
chains in the Genus database with same CATH superfamily
3HKEB 1YSZA 4U93A 1ZL8B 3E83A 4LP8A 1V54B 5IWAB 1YESA 1GKZA 1JR9A 3JYCA 4B08A 1TUEB 4NXMO 4QNHB 1N34B 2HKJA 3QTFA 4MBCA 4TSFG 3B27A 2ZM6B 4LPBA 2WPDG 3OR6C 4GKKO 4UCVA 4PA7A 1A32A 3I56V 2C2AA 2YKJA 1YC1A 4CH6A 2DYRC 3K5NA 2OIGA 1VEWA 4XIRA 5EBWC 3SJAC 2ZE7A 1BGQA 5JENA 2D2CB 4DV6O 3GWKC 1YC4A 2ZXWB 4B3TO 3C3TA 1N32O 2Y48A 4FLYA 4I0XA 3CMAV 4DXWA 1VP7A 2HHIA 5JQGB 4IIJB 1PVGA 5JJJB 1OCRB 1Q6HA 3WHAA 1B62A 2MW2B 2UXDB 3GIGA 3FB8C 1XBLA 5EZYB 3T10A 2H94A 4PDRA 3T4DA 1GTOA 2IBZH 4O2BA 4GLXA 2X6BA 4YJ2B 1HNWO 1OV9A 3VOUA 3AG4B 4LF8O 1JX9A 3CRRA 1K97A 3FD9A 4J41A 3O9OA 4YKTA 3RYHB 1I59A 3SPGA 4JI7O 4UVCA 4JGSA 2UUCO 4HBNA 1PV0A 3RT3C 1NJIW 1AR1B 1VQKV 1IXBA 2QEXV 4UXNA 3VQXA 4QIWF 1ZUQA 4MTOA 5CPHA 3IFXA 1S14A 3R92A 4XIQA 3H1JH 4YHHO 1IBMB 3DSQA 4YKRA 4P30A 2Q8FA 4J42A 1HNXB 1I7FA 3ICXA 3JAKA 3ZKDA 3E8GA 2CTQA 1YS3A 3CWVA 1XREA 3ZRWB 4JYYA 4E01A 2N74A 4ICGA 4LH7A 2A79B 2B9ZA 1KKCA 3D36A 1H2GA 4H33A 1BT8A 5L3GA 2Q9LA 4WBNA 5KMGB 5F5RA 1S5LZ 1MX0A 1UY9A 4XE2A 2XDUA 2YUAA 3DXRB 4OPHA 4JI8O 3AG1C 5FL7G 2YE9A 1QR8A 1M1KW 1AI7A 2BU7A 4MP7A 2ETNA 4EEHA 2NLJC 4OX9B 3DGEA 4MVQA 3CMEV 3T2SA 3TXQA 5BR8O 3JD1A 4HZ3A 3JATA 4MPEA 5LGTA 1FXKA 2ARHA 1Y76A 2B1IA 2YI9A 1V55B 4U3JB 5KX5A 4DV2O 2CK3G 1FAFA 1S0VA 3B09A 3VADA 1XNRO 3B8MA 3CXCU 5E1AC 2XAQA 1N36B 1Q3EA 5H5NA 2YEFA 5FNCA 4UCTA 5LXTB 4X66B 4NR1A 4ZHQA 2YEAA 3CJHA 3M7MX 1MSWD 5LP6A 4BW9A 1SERA 1BZKA 1OCCC 5M4KA 1TVKA 2OCCC 2ZD9A 4JI0B 1F7YA 3R4PA 4L90A 3B26A 4GKJB 1Y4MA 3CRQA 5FPOA 5IYCO 2EINB 3ASNC 2QF6A 1I5AA 4GUNA 3RLRA 1OSFA 3ABLC 4HY1A 2XDKA 3SL2A 3GWOA 4G28B 3UT5A 1I5DA 4DR5O 2LJ2A 3ZXQA 4X1IB 4E4EA 2BCCH 2YXHA 5KUMA 2XK2A 5IT9N 2A7WA 4CWPA 1TA8A 2W6JG 4DV5B 2VWJA 4K8XA 4Q20A 1GO3F 3OD4A 4DRXB 5L3EA 1THNA 5D7DA 2X6AA 5CF0A 2DMXA 4MVSA 1ZLZA 3BPZA 2Q0OC 5HFMA 4WFEA 1H2LA 2QWQB 5A2QN 5JVDB 3E2EA 2PTMA 1VF7A 2CUGA 3KCXA 5AG2A 3C11A 2XDLA 1FKAO 2Y0PA 2GUZB 2YKBA 4KQVA 1SETA 1UFIA 3HPLC 4MVUA 1PPJH 2K9PA 2DW4A 3B2EE 3OEHG 1S77D 1AMWA 3RLQA 4BQGA 2WLKA 2EIJC 4X1YB 4NH8A 4ASAA 1QU7A 3RVZA 1IVSA 1KP2A 4YIPA 4EGHA 4R3AA 4K4OA 5IN9A 3A0HZ 4DZYA 2Z3YA 2EZPA 4IHJA 3CCQV 3A0YA 3HZ1A 5F3KA 2XDXA 4H0LB 1O9GA 4KTNA 4J9YB 3E86A 2HP8A 1VMGA 3G67A 3GIFA 2DYSC 1SQGA 2O1VA 1IBKO 4WFAV 3D0BA 4AWPA 3RW0A 3WB0A 1QVGU 1FXVA 3ABUA 1KZNA 2LW1A 5CBHA 3Q5LA 2QWPB 1XMOB 4JI2O 2QKCA 1OJHA 4UV8A 4FLXA 5EC2C 3CCSV 5B1NA 4X9LA 3HKDA 2WLMA 3E8HA 2YEGA 3EKRA 3LDDA 5GTIZ 4DR7B 1RM1B 3Q4HA 4LF7O 1NHIA 2R9AA 5IJ9B 5EBMC 3P30A 1NHJA 4DR2B 1T5EA 1IURA 3EHFA 3FYEB 4DV3B 1BMFG 2Q8VA 1VQ5V 4EM7A 3B8NA 4N23A 2WLJA 1XOUA 1NR1A 4WFHA 1YEWA 3JD3A 2O57A 1QLEC 3UKMA 4OPAA 2Q7HA 1WB7A 2JGDA 1M56C 1YDXA 4TV9B 2WI3A 4LWEA 2YEVB 1WAZA 2EZOA 4NKGB 1ZTEA 4HY6A 3L70H 4J9ZB 5B1BB 1VF6A 3OM3B 4X20B 1H38A 1YT1A 1FXKC 1AI4A 2RDCA 4I55A 3F7YC 2BYIA 2A9HA 4U7OA 2P06A 1ID0A 1IXMA 3B25A 2YE4A 5H2FZ 5C8YA 4UCRA 1EI1A 4O4LB 2JJ2G 2QE7G 1BQZA 1N4CA 5EC1C 1S16A 1I5BA 2YJXA 4LP0A 2QFOA 3SR2C 2YEIA 5LP6C 1JA8A 1M9NA 1GH6A 2E75B 3ABKB 5HFLA 1UYGA 4FFBA 2Y69B 4O4HB 4X64O 1SRYA 4YJ3A 2H55A 4ZBMA 2QM4A 4O4JB 2E5LO 4WUCA 3ZHSA 3T1HO 1PNMA 1QQCA 5IYDO 3RYIA 4ASGA 4WUBA 1GKFA 4PL9A 4U3FH 2YEBA 3TZ0A 1OCZB 1U97A 2HG1A 3KZIZ 3U10A 4JI4O 4HAMA 2QSAA 4YKZA 3QVNA 4JZ2A 4KFMA 4O05A 4NB5A 4EMVA 2PYJA 2BT0A 2AW9A 4IYIA 3FB5C 3A2FA 1M57B 5IDMA 3TUHA 1YT2A 3H9VA 2Q8IA 5FLXN 4L94A 2ZR2A 3HKCA 3CRLA 2YDEA 2BOCC 2JDIG 3CCJV 3P32A 2BSMA 1XHZA 1GJVA 3GVMA 2OCHA 3FKSG 4XKOA 5LGNA 2WA4A 4TQFA 4JI1O 2Q68A 3S5TA 2YIAA 4H44B 2HVJC 3LSSA 4F6RB 4FLZA 5CMUA 2ZT9B 3K5LA 1IBLO 1IDSA 1LR1A 2VQFB 1THZA 4AQYB 2Q7GA 2XHXA 5J6AA 1RP3B 3BAAA 2XAHA 3H1HH 3OUFA 4DUYB 2IOQA 1G6UA 4JTCB 1I5XA 2QKAA 4DUHA 4E2LA 5D5QA 1L0LH 4GT8A 4WCEV 1UYEA 1JM6A 3BVOA 3ETEA 2AZ0A 3LNUA 4MW8A 5B1OA 1FFXB 3N27A 1DLBA 4DV4O 3JARA 4JYAB 5B1AB 3D2RA 2WLIB 5IYZB 4DW0A 1ZWHA 4GYCB 3O65A 1JOYA 5M4HA 3U2KA 1Y8OA 5JH7A 2V7QG 4EGKA 5FNVA 3QF7A 3HEKA 1UYIA 2P5OA 3R66A 4DR6B 2YEDA 4J7ZA 1HNZO 2GFDA 4JPRA 2X7RB 5M4EA 2BTZA 3CP1A 4UCUA 4O4IA 3N2GB 3OW2U 2BRCA 4PD4F 4E00A 1BE3H 2EBOA 4MS2A 3OMIB 4PJ0Z 4QE7A 2WAMA 5B66Z 1AJQA 2Q7EA 3UCSC 3WG7C 1WA8B 3BEHA 1GRJA 4GEEA 4MTXA 1B6QA 4RAIA 4JI6B 2DYRB 1S5HC 3KKYA 3HHUA 2RJZA 1FJGO 1P7BA 4R7CA 2QR4A 4XBFA 1J95A 4FM2A 2CE4A 4R3MA 3FAVA 1VQOV 4UV9A 2BU2A 1KP3A 3KG2A 1LNQA 4LFCB 3E8BA 4XDMA 1VF6C 1IX9A 1F23A 4XCJA 4MB9A 2VWKA 5B3SC 5LHHA 1Y6XA 2F23A 2UUBB 2WI6A 2DQ3A 2EIMB 3S3XA 2EIKC 5LBQA 2BU5A 4P8OA 4XD8A 4XDLA 4I50A 2ZINA 2CTWA 3Q5JA 1BGYH 2ZCEA 2IJIA 3VQWA 4CS3A 1WB8A 4ZI7B 2XABA 2YI6A 1UJWB 4H85A 1GM7A 5JJEB 2M6YA 1XI1A 3E22B 4DR1O 3SGIA 3CWBH 1EZJA 4DK1A 4F4LA 1Q8IA 1Y66A 1WP7A 1VQ4V 2GBOA 2H3OA 4BIOA 2UU9O 5LMUB 1J5EO 2ZDIC 2ZDXA 3EHBB 4CS4A 1TUBA 1XDCA 2IU3A 2QKSA 4IGGA 4CWRA 1R3KC 1K5QA 3QTCA 1NTMH 5J2TB 4MW3A 1KBHA 4ABMA 1PL4A 1Q6UA 1EBOA 3DC5A 2LW7A 3HKEA 3J81N 3ZHTA 1WN7A 2CH7B 2QTOA 2IWSA 1YERA 1ZL8A 1Q5OA 5DM6V 3E8FA 2ZNIA 4UFZA 3JAMN 4NXMB 3OWDA 1PP9H 1YC3A 4NTYA 5GONB 4GKKB 3OGIB 3AG1B 2JRIA 3MDSA 1F51A 4BAYA 2CAZC 4JI3O 2UUAO 4ZOLB 4LFBB 2YIBD 3HKBA 1BS3A 1LUVA 1DF4A 3ASOC 4B7PA 1AM1A 5TISZ 2X6CA 4AS9A 3K5MA 4Z2WA 1YJNV 3G7EA 3A0RA 2JGUA 2YK2A 2EILC 3SJBC 5DEDA 2WLNA 3CCRV 4DV6B 3U67A 4GFNA 4B3TB 1N32B 4DK0A 3OMUA 1R3JC 1VARA 5FNDA 4FFKA 2QDOA 5LOVB 3T1KA 4LFAB 2Z5UA 1TAEA 3SYQA 5JQGA 5IY5B 4X89A 2DWEC 3H1IH 5L3BA 3K0DA 1OCCB 4NYKA 4LFBO 1YVWA 5EZYA 1GK9A 1HNWB 4JAAA 4LF8B 1V9PA 3AG2B 4B3RO 4XCLA 4YJ2A 1NQTA 4JI7B 2UUCB 2Q8HA 2L6LA 4BIUA 3ABLB 4X8AA 4LF5B 3RYHA 1JPXA 3MD0A 2N04A 1QCEA 2VWCA 4PA3A 1EN5A 3ZN1A 4YHHB 4CE3A 4LFAO 3CRCA 2FTKA 2E76B 3JAWB 4BAEA 2ITDC 4IT5A 1NS1A 2M7WA 3LPSA 1RPOA 1M5IA 4MP2A 1XEQA 3ZRWA 2GSMB 1K5SA 2HCHA 4URMA 1H2SB 2HEPA 3RVYA 4LF5O 3T1YO 3BM9A 4W4LA 5KMGA 4JI8B 5GGZA 4RUFA 4GX1A 2YGEA 1E79G 3DXRA 3ZHVA 1IZ3A 4Q6GA 2H8MA 1K34A 2YGAA 2R9IA 5BR8B 3K04A 2VCJA 1VQ7V 4BXIA 1WJZA 2GQPA 3IEDA 1Y74B 3JSNA 2ILMA 4DV2B 1P4RA 3G4SV 3ABMC 3FV5A 3T0HA 1WNSA 1TIDA 3K03A 4U3JA 1XNRB 1VQPV 1Q86W 1TILA 4WUDA 2H8PC 4MTFA 5A9GA 4O2BB 4L93A 2KG7B 3ZMUA 4KHPO 5H9CA 1I5CA 3TZ2A 3FB6C 1NZ6A 2QG2A 4AWOA 3JZ3A 4KFGA 5LXTA 3SJCC 4LWHA 1GKXA 5J9PC 2CG9A 4CH4A 4TV8B 1AP5A 3EFFK 3CSXA 3SYCA 4FVMA 1RPRA 5B5EZ 1M4UA 2B1GA 4D6TH 5KA5A 2WI7A 3ZKBA 3L74H 3L9DA 3BY6A 3T4ZA 1YI2V 1MU5A 5J2UB 3U11A 3IJ4A 1Q7YW 4DR5B 2IH1C 1I58A 5L3JA 3K60A 2WLLB 3RYFA 4EB6B 4HYOA 4X1IA 2YEJA 4K8ZA 2FXSA 4ZIBA 1RFYA 2WERA 4CWTA 2PI4A 1V54C 4FZ0A 2XD6A 4L8JA 1CP9A 3HYYA 4DRXA 4JAUA 1QLEB 1XNQO 1AH8A 2IJKA 1YETA 2DN9A 5CTXA 5JJNB 5LHGA 3IC7A 2YK9A 1YSCA 4GZRB 5JVDA 3FYIB 4PI0A 2IU0A 2P22C 2XAJA 3QO8A 1FFTB 3B24A 2N05A 1GN2A 3HB3B 2OTLV 1Y76B 4P7AA 2GUZA 1SKVA 5LGUA 2P67A 1MSDA 1BHBA 2QGNA 4IYHA 4TT3G 4I5SA 2ZXWC 2YXLA 3LNNA 1Q43A 3CRMA 3K5OA 5BZBA 2WI1A 4NH7A 4J7JA 1OCRC 5LP6B 3JASB 1TVKB 3RLPA 2R9RB 1YTFD 3R65A 3LDEA 3VBBA 1U96A 2F43G 3SJQC 4HZ0A 5LYJB 4NTWA 5L3DA 2Q6AA 5KLVH 5FWKA 1NVPB 2PZSA 1XHXA 4DR3O 1ZWIC 4X62O 3HZ5A 1IBKB 3BA8A 3I55V 3BCCH 4CZZA 5EK0A 4YKWA 2AZ2A 3G80A 3EVKA 2RMKB 3ZXOA 4WFBV 2UXCO 4JI2B 5BMVB 1Y8NA 4HXZA 2ADQB 1AVMA 3ZCCA 1G1XB 1H2NA 3H01A 1JFFB 4HZ5A 3CGYA 3JCZA 4DV7O 4EEQA 4Z1VA 4MSWC 4X9QA 2ODMA 3WB1A 2CTPA 3CS5A 4MVMA 1KC8W 1AILA 4LF7B 2YE5A 2Q69A 3BMYA 3B77A 2YE2A 4L91A 4L87A 5IJ9A 3ZRXA 2Y4UA 1JCHA 3RFRA 3QG5A 1AI5A 1NI8A 3JD4A 3ETDA 4IL6Z 4LWSB 4C7UA 3OTFA 5BXZA 4TV9A 4XDKA 1NH2D 2F4VO 3ZRSA 1EM1A 4FK5C 3CE2A 2BZ5A 2YEVA 3CC2V 5CA3A 4XDJA 3EKOA 3UQ8A 3AEIA 4X20A 4RQEA 3VQVA 4J11A 1V55C 2DOSA 3D36C 3OFNG 4V25A 2ZE5A 2PYLA 1N33O 3WFVA 3CXHF 3EXAA 4TUYB 1TC0A 4IHJB 5KHIA 2WWWA 2DWDC 4O4LA 2YS8A 2ZE8A 1K4DC 1Y67A 2LFSA 4PA4A 3OE7G 3FX7A 4FPPA 4PDMA 3T2MA 3ETQA 3BABA 2HHHO 1H2KA 5LA6B 4X64B 4K0KO 4YY3O 3APQA 3K08A 2E5LB 2A3QA 4CC6A 4O4HA 4O09A 4E02A 1NU1H 4O4JA 3T1HB 2EINC 4K3AA 1BXDA 2W0XA 2XJJA 3OGCC 3QNEA 1PNLA 3UO3A 3RWRD 5KHHA 4JI4B 4FCRA 4CH3A 2BTQB 1NR7A 4DR4O 1XL4A 1K8AW 4MOTA 1E1QG 4CWSA 1EN4A 4DW1A 5M4NA 2XX4A 1JVMA 1E1RG 4R6ZA 1P49A 3DTUB 3WG7B 4O2AB 4LC1A 4JASA 3SDLA 5C93A 4KSHA 4CWNA 4JF3A 1AJPA 3ZS8C 2XT9A 2HFEC 1Z5WA 1HR0O 4B6CA 3RYCB 3AG7A 1TC6A 3LMMA 2UXBO 3L73H 3M99B 1ZSPA 4JI1B 2BE3A 3LSUA 4YKXA 2FMLA 2K5BA 4XC0A 3U0ZA 3W7XA 1IBLB 1KMIZ 4DYLA 2BSKA 4F6RA 4LWGA 4DO2A 4CE2A 4URNA 4HNAB 3INXA 1WP8A 2O1WA 1K3EA 1M90W 4CWFA 4MPNA 3K9AA 5IJ0B 3CRAA 4MVOA 3PN1A 1MA1A 4EGIA 3X2QB 1UYMA 2BTOA 1KUQA 2QJ1A 5FNFA 1PNKA 2CGNA 4BWAA 3AG3B 1US7A 2XASA 4YJ3B 1DF5A 1WLEA 2OTJV 1NT2B 2KSDA 4DV4B 1W0JG 1MNGA 1FFXA 2RNBA 1R1BA 1GN3A 2C1GA 2GV9A 3RYIB 3T0ZA 3LNMB 2A0LA 4J10A 5IYZA 1XMQO 3RBZA 1EFRG 4PRXA 4N21A 2ZKOA 2Q67A 1FD9A 1HNZB 4DV1O 1WPXA 1M93A 3F5TA 5JCOA 3UM7A 1CEZA 1NKDA 2JJ1G 4KSGA 2AHYA 2YGFA 3WB2A 4I4TB 3UO2A 5IDJA 1I08A 1RM1C 4YXWG 4JAVA 4ASFA 4FCQA 2CGFA 3N2GA 1OCOB 1ORQC 3IGAC 1GN4A 2YJWA 2YI7A 2LFRA 5IE9A 2F93B 1SQFA 2HLDG 3CCVV 4JV5O 2CCTA 1GM8A 2PI5A 1N8RW 1WA8A 4UUJC 1YITV 2R72A 5CBFA 3CCUV 1FJGB 3EHGA 2F95B 4B3MO 1EN6A 2OT5A 2VQEO 2BOBC 5KAIZ 4UCOA 2FL4A 3C90A 1ZXNA 2KB1A 3ZHQA 5B1BC 4XKAA 1X4TA 1CPYA 1QZRA 4BR6A 2BU6A 5D6PA 3JCUZ 2ZKJA 4NH9A 2K1EA 4MT8A 3LDCA 3BRCA 3TTZA 1L8DA 1Z5CA 3CEIA 2PF4E 2ESAA 3ZMZA 1NTZH 2AGAA 4K35A 2XX2A 3K9SA 3HR0A 3MHSC 3GB7C 4B7KA 3ML0A 1QY8A 4GGLA 4DUZO 1VQ6V 4DR1B 4LF6O 4ZI7A 1Z59A 2ITCC 3ABKC 2RN9A 1AJNA 3E22A 2YICA 1UYLA 2UU9B 1YSRA 3W7SA 2YXYA 1J5EB 2ADPA 1YCIA 3KCYA 2G38A 2CDYA 2ZE6A 4CC5A 2VCIA 2AKPA 4P9PA 5CA0B 2JJCA 3NMQA 4X1KB 2Q0AA 2IOPA 2XX5A 2YI0A 2B5UA 5EYPB 3OMAB 1OCZC 5J2TA 4B3SO 1I0HA 1K33A 5CA1B 1QYEA 4EFTA 2LGQA 1QLNA 2CH7A 1H8EG 1SA0B 3CYGA 1M57C 2YI5A 2EXLA 3K98A 5F2VO 5GONA 3RKZA 4JI3B 2UUAB 4NXNO 1B3QA 3PEHA 4LF4O 2X0LA 3W7TA 3BA9A 2Y0IA 4ZOLA 5BODA 4LF9O 4BIZA 1KYOF 5D7CA 4FLTA 4WFGA 4KUMA 3FB7C 1I94O 1HW7A 1Z5BA 3VQYA 1RSOB 2E3CA 4A5UB 4EKWA 1Z5VA 3A0WA 1P7GA 2OWOA 2KQXA 4DV0O 1AH6A 4FLVA 4D7SA 5CTWA 4UB8Z 4X65O 4W7TA 4LBEC 3JALB 2RQ6A 1XL6A 3A8TA 5LOVA 5LMNO 3CGZA 2ZNJA 3ZX6A 5D7RA 1KU9A 1PM9A 1D5NA 4JI5O 3N2KB 2IJJA 2UWDA 4B3RB 5K1XA 2VRZA 2MK3A 1KECA 1K73W 1R62A 1US6A 2NR5A 1G4YB 1B06A 3OTOO 1KKDA 2CH4A 3R91A 5IYBO 1D2DA 4HYPA 3K06A 2LGWA 4JYCA 1Q6IA 5B1AC 5D6QA 4FCPA 1SQQH 3P3PA 2Q8GA 4IIJA 1OHHG 5CB4B 4LNUB 2V1DA 4NTXA 5CTYA 1GN6A 2OCCB 5JCOC 3JAWA 5KHGA 4W4KA 3PEJA 4JTAB 4MVZA 3F5WC 1MMMA 3T1CA 2OIEA 1W0KG 4ASUG 1YXBA 2XAGA 1L0OA 3SYAA 3ASNB 2LO1A 1F4MA 3T1YB 2QWOB 1SZXA 3OWBA 2Z0AA 3B4SA 3HKBB 2XUMA 1DTOA 1LUWA 1H7SA 2ZBKB 3JSLA 2F1MA 1QNMA 1ZAUA 5ITZB 3CHXA 2JEXA 1VQLV 5BOCA 3DC6A 3PJSK 1N0NA 1Q81W 2JIZG 4PA6A 4QPKA 1Y4SA 1NTKH 5IWAO 1K9MW 1UYHA 3MNRP 3QO7A 1Y74A 3G75A 1N34O 5FPRA 2ZM6O 2UXXA 4YKYA 4KHPB 2HKOA 2EIMC 2KG7A 4UVBA 4R50A 4UCSA 5EBLC 3APOA 2EX3A 2FB5A 2ZR3A 4PU9A 4EFEA 3CD6V 1FYJA 4KP4A 5EIBC 1Y4UA 2EIJB 4I0XB 1W59A 2GTAA 4TV8A 4CS2A 4CWOA 3G7BA 4QGPA 1TH8A 1S76D 1AROP 3GIGB 2FWYA 1Z5AA 2ZQMA 5H6QA 1X59A 4LH6A 4PELA 1XUQA 2IORA 3W7WA 2CGOA 1R73A 3AK3A 4I9WA 2UXDO 5J2UA 2Q5ZA 1JJ2U 1VQ8V 3K58A 2XDSA 4CE1A 3CX5F 3Q5KA 3VHDA 4RUEA 1K7DA 1O9HA 2WI4A 2WLLA 2YECA 1B04A 2P4VA 1A4HA 4EB6A 4NVPA 3D8CA 2DYSB 3JD0A 4EFUA 1YF2A 2EJRA 2QM8A 3K0GA 2ZDYA 2XNDG 1UYDA 3A0ZA 2IH3C 1XNQB 3CPWU 2NNUA 2XTAA 2FYUH 2HJDA 4OGQB 2YEEA 4JYBA 4TQDA 1MABG 4PRVA 3LSQA 3O2FA 3P3NA 1N0JA 2R70A 1IBMO 3JAKB 2HJFC 4B7EA 1PD3A 2L35A 3STZC 4AILC 2FYPA 2JKIA 1HNXO 3SYPA 2WLHA 3ZMSA 2RCVA 3TZ5A 2ZIOA 4LCUC 1CXZB 4FZ1A 3AK1A 2V4DA 2IWXA 1Q82W 4WBNB 3TGUH 2WEPA 3H4LA 3KE6A 2DQ0A 1TBWA 3H1KH 4PHZA 3AK2A 1M56B 3C3SA 4R1FA 1YTFB 1SQPH 5IY5C 4G2KA 1B63A 2YE8A 3JASA 4OX9O 2QWRB 4GX2A 3TXSA 3JATB 3NR7A 2LP7A 4I7ZB 4XIPA 1FXKB 1GAXA 5KX5B 3AG2C 5LYJA 1HP8A 1R6TA 4DR3B 2FWZA 4FMTA 4X62B 2YEHA 1QHTA 1F4NA 2E0AA 3ZJZA 1JQ0A 4XKKA 4X1YA 3RN4A 3MAQA 1FS0G 1MOFA 5GW7A 4KXRA 3LUTB 4ZHQB 1N36O 2UXCB 3CJHB 4GX0A 2HVKC 3RYFB 4X88A 3ZHRA 2AHZA 1K4CC 1MG1A 4X66O 4DV7B 5BMVA 4UVAA 1BL8A 1YZBA 3J7AU 3FFQA 1JFFA 2EULA 3ZRVA 1COWG 3L72H 4ASBA 5D5PA 1VQNV 4JI0O 3AG4C 3E89A 4O0BA 4GKJO 2IJHA 4PV1B 5KAFZ 4RO2A 1SF9A 3UT5B 2YKIA 1GM9A 3BHPA 5KA6A 1FPOA 3OW6A 1SESA 4JZGA 1NH2B 5H6RA 3CCLV 4QE9A 4XITA 2F4VB 4LWSA 3VHAA 3L71H 1U0ZA 4RQFA 1YJ9V 3WQ9A 2GTSA 4MVRA 4DV5O 5JWPA 4CWQA 4JQLA 1KB9F 4URLA 3ZHUA 2IW5A 3G6BA 3OR7C 4U7NA 1N33B 2PNRA 1JJOA 2WI5A 3D3QA 4YKUA 2DE0X 4TUYA 3SPCA 2OYQA 2LQTA 1R3IC 3TCUA 1ZXMA 2HHHB 4JTDB 4K0KB 4YY3B 2VS0A 1NVPD 2W6IG 4AI8A 5KUKA 3M8AA 5LA6A 4FJCC 2XAFA 1K92A 1EA6A 1KD1W 4FLWA 3TZ4A 3A0TA 4J7KA 4HXWA 1W2BU 4TOIA 3ZN0A 4DR4B 1L1FA 5KHKA 1AJ6A 1WPBA 2BTQA 3K99A 4PDLA 4PA9A 2W0FC 1EZVH 3R4OA 1Q90D 1SQBH 4O2AA 1HWYA 4H37A 3A0XA 3FT5A 3ZBHA 1URFA 2WA3A 3NXSA 2NN4A 3G71V 1HR0B 1UY8A 1BCCH 1ROPA 1BKNA 2UXBB 4OXSA 1XMOO 3HKDB 3RYCA 3GIEA 2HR3A 1U2OA 1D5AA 1DK1A 1QVFU 3Q4HB 4QPJA 1VIBA 4J80A 4DR7O 1TGOA 2P4KA 4QJFB 1UY7A 2P90A 5M4PA 3CRKA 4FLUA 4DR2O 3ZIAG 1KIJA 3EHHA 1QBZA 4DV3O 1H8HG 2XJGA 4HNAA 3SPHA 2QA4V 2JGDB 4FM0A 1S72V 5IJ0A 2XCMA 2Q2EB 4GX5A 1VQ9V 4YIOA 2Q4PA 4I55B 3QO5A 4UB6Z 3K59A 5B3SB 4MTGA 3S3WA 4LR3A 3H1LH 3RGBA 2BYHA 4MPCA 2ZDIA 2EIKB 3BFRA 5C8YB 1R6NA 1XMQB 5GTHZ 5CN0A 1QR9A 1SQVH 2YE7A 3STLC 1NHHA 2YC0A 4DV1B 3H80A 3CCMV 2IM9A 1PL0A 5L3FA 3G6EV 2XHRA 1G8MA 3K57A 4FFBB 4CH5A 3JD2A 3U2DA 1NBMG 4AHCA 4I4TA 5DECA 1AR4A 1AB3A 5BY1A 2YE6A 4JV5B 1FXHA 1P84F 2C1IA 3ETGA 4RWUA 2WLIA 3F7VC 4B3MB 2A06H 2VQEB 1H2MA 1KQSU 2BSKB 2WSSG 1YHQV 3OAAG 2YKEA 1YJWV 2JS3A 3HKCB 2XHBA 3C0EA 2O1UA 1Y8PA 4V26A 1XILA 4CBCA 2IWUA 4F6EA 1R6KA 3ASOB 2F66C 3CC7V 2YKCA 5J71A 2WI2A 3SYOA 3ZEDA 1I5YA 3WU2Z 2EILB 3SPJA 4DUZB 4LF6B 2YIDA 3CYOA 3I5DA 2XJXA 1MZFA 1UYFA 3J80N 1OZ0A 2CCUA 2VQFO 3R4MA 3K3WA 4AQYO 1R3LC 2BREA 3SPIA 4TWKA 4DUYO 2Q73A 2QTSA 4AWQA 5CTUA 1VQMV 5CA0A 4X1KA 3TETA 1PKXA 3OT7A 5EYPA 4B3SB 2JS5A 1GMGA 1YIJV 4XTJA 2E74B 2AXTZ 4O04A 2EJ7A 5L3CA 5K1PA 3TK1A 5CA1A 3JARB 1BQ0A 5LL6Y 3O6OA 3W7UA 1XQ8A 4D7TA 3R4NA 3HYZA 2XOKG 3ZMVA 3CC4V 3FT8A 1SA0A 2Y69C 3D3IA 4JYAO 5JH7B 1ENVA 1L0NH 5FNVB 4NXNB 2JEUA 2QG0A 2KKWA 4E72A 4LF4B 1UYCA 3K79A 2YIBA 2PY5A 1MZEA 2Y4TA 4LF9B 1UPGA 4DR6O 4P9OA 3TJTA 4O4IB 4ZVIA 1BHAA 3CB2A 2D3OW 1I94B 1AP6A 3EHJA 2BU8A 4BW5A 4I9QA 5LHIA 4GT1A 1AR5A 4DV0B 4HYMA 4Z1MG 1RSOA 2P6JA 5KHJA 4X65B 4P2ZA 4ZKIA 3VHCA 1JMKC 3OMNB 5LMNB 1DGSA 2DJVA 4GCZA 4JI6O 2PUSA 3JALA 4YKQA 2YE3A 2ATKC 3INWA 3FAVB 4JI5B 1ZW9A 4R8CA 1AI6A 1YT0A 4GQTA 3E35A 3X2QC 5M4MA 2JVDA 2JK5C 3N2KA 4EFBA 4LWIA 4L8ZA 3OTOB 1S5JA 4LFCO 2PGGA 3AG3C 1Z2GA 1SQXH 4KL1A 5E79Z 2P7TC 2YI8A 3ABMB 4O07A 2YSUB 3MHHC 3OUSA 2XHTA 3OEEG 2UXNA 1SC5B 2WEQA 3ZM7A 3IC9A 3THOA 1S3JA 2GHYA 4I50B 1BYQA 2UUBO 4H81A 4LWFA 3OPDA 2ZIMA 2QM7A 3O0IA 4PDVA 4WF9V 3L75H 1SS3A 5DN6G 5CB4A 1ZX3A 1BSMA 4LNUA 1H7UA 3B28A 3K97A 3IAYA 4WFFA 4H13B 1VF5B 5EIBD 2QWNB 4FM1A 2CCSA 1SZTA 2FKXA 3B40A 2VW5A 2CTRA 1UY6A 5CBGA 3ABTA 1OCOC 3CCEV 4H7QA 1TUBB 5LMUO 3QDDA 4FIPC 3ZMTA 4I3HA 4UROA 1HDJA 2HG5C 4PI2A 1UYKA 3A0BZ 4BQJA 2GDSA 4G27B 5ITZA
chains in the Genus database with same CATH topology
1YSZA 4U93A 3E83A 4LP8A 1V54B 1YESA 1GKZA 3JYCA 1TUEB 4QNHB 2HKJA 3QTFA 4MBCA 4TSFG 3B27A 4LPBA 2WPDG 3OR6C 4PA7A 3I56V 2C2AA 2YKJA 1YC1A 2DYRC 4XIRA 5EBWC 1BGQA 1YC4A 2ZXWB 2Y48A 3CMAV 4DXWA 1PVGA 1OCRB 3WHAA 1B62A 3GIGA 3FB8C 3T10A 2H94A 4PDRA 3T4DA 1GTOA 2X6BA 3VOUA 3AG4B 1JX9A 1K97A 4YKTA 1I59A 3SPGA 4UVCA 4JGSA 1NJIW 1AR1B 1VQKV 2QEXV 4UXNA 4QIWF 4MTOA 5CPHA 3IFXA 1S14A 3R92A 4XIQA 4YKRA 4P30A 2Q8FA 3ZKDA 3E8GA 1YS3A 3CWVA 3ZRWB 4E01A 2A79B 3D36A 1H2GA 4H33A 5L3GA 5F5RA 1MX0A 1UY9A 4XE2A 2XDUA 3AG1C 5FL7G 2YE9A 1QR8A 1M1KW 1AI7A 2BU7A 4MP7A 4EEHA 2NLJC 3DGEA 4MVQA 3CMEV 3T2SA 3JD1A 4HZ3A 4MPEA 5LGTA 1FXKA 2B1IA 1V55B 2CK3G 1S0VA 3VADA 3B8MA 3CXCU 5E1AC 2XAQA 2YEFA 5FNCA 2YEAA 1MSWD 1SERA 1OCCC 5M4KA 2OCCC 2ZD9A 3R4PA 4L90A 3B26A 1Y4MA 5IYCO 2EINB 3ASNC 2QF6A 1I5AA 3RLRA 1OSFA 3ABLC 4HY1A 2XDKA 3SL2A 3GWOA 4G28B 1I5DA 3ZXQA 5KUMA 2XK2A 4CWPA 2W6JG 4Q20A 1GO3F 5L3EA 1THNA 5D7DA 2X6AA 5CF0A 4MVSA 5HFMA 4WFEA 3E2EA 3C11A 2XDLA 2YKBA 4KQVA 1SETA 3HPLC 4MVUA 2DW4A 3OEHG 1S77D 1AMWA 3RLQA 4BQGA 2WLKA 2EIJC 4NH8A 4ASAA 3RVZA 1KP2A 4EGHA 4R3AA 4K4OA 5IN9A 4DZYA 2Z3YA 2EZPA 3CCQV 3A0YA 3HZ1A 5F3KA 2XDXA 4KTNA 4J9YB 3E86A 3GIFA 2DYSC 2O1VA 4WFAV 3D0BA 4AWPA 3RW0A 1QVGU 1FXVA 3ABUA 1KZNA 5CBHA 3Q5LA 4UV8A 5EC2C 3CCSV 5B1NA 4X9LA 2YEGA 2WLMA 3EKRA 3E8HA 3LDDA 1RM1B 1NHIA 5EBMC 3P30A 1NHJA 3EHFA 3FYEB 1BMFG 1VQ5V 4EM7A 3B8NA 4N23A 2WLJA 1NR1A 4WFHA 3JD3A 3UKMA 1QLEC 1M56C 2WI3A 4LWEA 2YEVB 2EZOA 4HY6A 4J9ZB 5B1BB 3OM3B 1H38A 1YT1A 1FXKC 1AI4A 3F7YC 2BYIA 2A9HA 4U7OA 1ID0A 1IXMA 3B25A 2YE4A 1EI1A 2JJ2G 2QE7G 5EC1C 1S16A 1I5BA 2YJXA 4LP0A 2QFOA 2YEIA 1M9NA 3ABKB 5HFLA 1UYGA 2Y69B 1SRYA 2H55A 4ZBMA 4WUCA 1PNMA 5IYDO 4ASGA 4WUBA 1GKFA 4PL9A 2YEBA 3TZ0A 1OCZB 2HG1A 4HAMA 4YKZA 4KFMA 4O05A 4EMVA 2BT0A 3FB5C 1M57B 5IDMA 3TUHA 1YT2A 2Q8IA 4L94A 2ZR2A 3CRLA 2BOCC 2JDIG 3CCJV 3P32A 2BSMA 1GJVA 3FKSG 4XKOA 5LGNA 2Q68A 2HVJC 3LSSA 5CMUA 1THZA 2XHXA 5J6AA 2XAHA 3OUFA 2IOQA 4JTCB 1I5XA 4DUHA 4E2LA 4GT8A 4WCEV 1UYEA 1JM6A 3ETEA 3LNUA 4MW8A 5B1OA 1DLBA 5B1AB 3D2RA 2WLIB 1ZWHA 5M4HA 1JOYA 3U2KA 1Y8OA 4EGKA 2V7QG 3HEKA 1UYIA 2YEDA 2GFDA 4JPRA 2X7RB 5M4EA 2BTZA 3CP1A 3OW2U 2BRCA 4E00A 2EBOA 4MS2A 3OMIB 4QE7A 2WAMA 1AJQA 3WG7C 3BEHA 4GEEA 4MTXA 1B6QA 4RAIA 2DYRB 1S5HC 3HHUA 1P7BA 4R7CA 4XBFA 1J95A 4R3MA 1VQOV 4UV9A 2BU2A 1KP3A 3KG2A 1LNQA 3E8BA 4XDMA 1F23A 4XCJA 4MB9A 5B3SC 5LHHA 2WI6A 2DQ3A 2EIMB 2BU5A 2EIKC 5LBQA 4P8OA 4XD8A 4XDLA 3Q5JA 2IJIA 2XABA 2YI6A 1UJWB 4H85A 1GM7A 1EZJA 4F4LA 1Y66A 1VQ4V 2ZDIC 2ZDXA 3EHBB 2IU3A 2QKSA 4CWRA 1R3KC 1K5QA 4MW3A 1EBOA 2IWSA 2QTOA 1YERA 5DM6V 3E8FA 3OWDA 1YC3A 3AG1B 1F51A 4BAYA 1DF4A 3ASOC 4B7PA 1AM1A 2X6CA 4AS9A 1YJNV 3G7EA 3A0RA 2YK2A 2EILC 2WLNA 3CCRV 3U67A 4GFNA 3OMUA 1R3JC 5FNDA 3T1KA 2Z5UA 3SYQA 5IY5B 4X89A 2DWEC 5L3BA 3K0DA 1OCCB 1GK9A 3AG2B 4XCLA 1NQTA 2Q8HA 4BIUA 3ABLB 4X8AA 1JPXA 3MD0A 1QCEA 2VWCA 4PA3A 3ZN1A 4CE3A 2FTKA 4BAEA 2ITDC 2M7WA 3LPSA 1RPOA 4MP2A 3ZRWA 2GSMB 1K5SA 2HCHA 4URMA 3RVYA 3BM9A 5GGZA 4RUFA 4GX1A 2YGEA 1E79G 2H8MA 1K34A 2YGAA 2R9IA 3K04A 2VCJA 1VQ7V 4BXIA 2GQPA 3IEDA 1P4RA 3G4SV 3ABMC 3FV5A 3T0HA 1TIDA 3K03A 1VQPV 1Q86W 1TILA 4WUDA 2H8PC 4MTFA 4L93A 3ZMUA 1I5CA 5H9CA 3TZ2A 3FB6C 2QG2A 4AWOA 3JZ3A 4KFGA 4LWHA 1GKXA 5J9PC 2CG9A 3EFFK 3SYCA 1RPRA 2B1GA 5KA5A 2WI7A 3ZKBA 3BY6A 3T4ZA 1YI2V 1MU5A 1Q7YW 2IH1C 1I58A 5L3JA 3K60A 2WLLB 4HYOA 2YEJA 2FXSA 2WERA 4CWTA 2PI4A 1V54C 2XD6A 1CP9A 3HYYA 4JAUA 1QLEB 1AH8A 2IJKA 1YETA 5CTXA 5LHGA 3IC7A 2YK9A 1YSCA 3FYIB 2IU0A 2XAJA 3QO8A 1FFTB 3B24A 3HB3B 2OTLV 4P7AA 5LGUA 2P67A 1BHBA 4TT3G 4I5SA 2ZXWC 5BZBA 2WI1A 4NH7A 1OCRC 3RLPA 2R9RB 1YTFD 3R65A 3LDEA 3VBBA 2F43G 3SJQC 4HZ0A 5L3DA 2Q6AA 5FWKA 1NVPB 1ZWIC 3HZ5A 3I55V 4CZZA 5EK0A 4YKWA 3ZXOA 4WFBV 4HXZA 1Y8NA 3ZCCA 3H01A 4HZ5A 3CGYA 3JCZA 4MSWC 1KC8W 4MVMA 2YE5A 2Q69A 3BMYA 3B77A 2YE2A 4L91A 4L87A 3ZRXA 1JCHA 1AI5A 3JD4A 3ETDA 4XDKA 1NH2D 3ZRSA 4FK5C 2BZ5A 2YEVA 3CC2V 5CA3A 4XDJA 3EKOA 3AEIA 4RQEA 1V55C 3OFNG 4V25A 3WFVA 1TC0A 2WWWA 2DWDC 1K4DC 2LFSA 4PA4A 3OE7G 4FPPA 4PDMA 3T2MA 3K08A 4O09A 4E02A 2EINC 1BXDA 2XJJA 3OGCC 3QNEA 1PNLA 4FCRA 1NR7A 1XL4A 1K8AW 4MOTA 1E1QG 4CWSA 5M4NA 2XX4A 1JVMA 1E1RG 4R6ZA 3DTUB 3WG7B 4LC1A 4JASA 5C93A 4KSHA 4CWNA 4JF3A 1AJPA 4B6CA 2HFEC 1TC6A 3M99B 4YKXA 2K5BA 4XC0A 3W7XA 4LWGA 4DO2A 4CE2A 4URNA 3INXA 2O1WA 1K3EA 1M90W 4CWFA 4MPNA 3K9AA 4MVOA 4EGIA 3X2QB 1UYMA 5FNFA 1PNKA 3AG3B 1US7A 2XASA 1DF5A 1WLEA 2OTJV 1W0JG 3T0ZA 3LNMB 2A0LA 3RBZA 1EFRG 4PRXA 4N21A 2Q67A 1WPXA 3UM7A 1CEZA 1NKDA 2JJ1G 4KSGA 2AHYA 2YGFA 5IDJA 1RM1C 4YXWG 4JAVA 4ASFA 4FCQA 2CGFA 1OCOB 1ORQC 3IGAC 2YJWA 2YI7A 2LFRA 2HLDG 3CCVV 2CCTA 1GM8A 2PI5A 1N8RW 4UUJC 1YITV 5CBFA 3CCUV 3EHGA 2OT5A 2BOBC 1ZXNA 2KB1A 5B1BC 4XKAA 1CPYA 1QZRA 2BU6A 5D6PA 2ZKJA 4NH9A 2K1EA 4MT8A 3LDCA 3TTZA 1Z5CA 2ESAA 3ZMZA 2XX2A 3MHSC 3GB7C 3ML0A 1QY8A 4GGLA 1VQ6V 1Z59A 2ITCC 3ABKC 1AJNA 1UYLA 1YSRA 3W7SA 2VCIA 2AKPA 4P9PA 3NMQA 2JJCA 2IOPA 2XX5A 2YI0A 2B5UA 3OMAB 1OCZC 1K33A 1QYEA 4EFTA 1QLNA 1H8EG 1M57C 2YI5A 2EXLA 3K98A 3RKZA 1B3QA 3PEHA 2X0LA 3W7TA 5BODA 4BIZA 5D7CA 4WFGA 4KUMA 3FB7C 1Z5BA 4EKWA 3A0WA 1AH6A 5CTWA 4W7TA 4LBEC 1XL6A 3CGZA 5D7RA 2IJJA 2UWDA 2MK3A 1KECA 1K73W 1R62A 1G4YB 1KKDA 2CH4A 3R91A 5IYBO 4HYPA 3K06A 4JYCA 5B1AC 5D6QA 4FCPA 2Q8GA 1OHHG 2V1DA 5CTYA 2OCCB 3PEJA 4JTAB 4MVZA 3F5WC 3T1CA 1W0KG 4ASUG 2XAGA 1L0OA 3SYAA 3ASNB 1F4MA 3OWBA 1DTOA 1H7SA 2ZBKB 2JEXA 1VQLV 5BOCA 3PJSK 1Q81W 2JIZG 4PA6A 4QPKA 1Y4SA 1K9MW 1UYHA 3MNRP 3QO7A 3G75A 2UXXA 4YKYA 2HKOA 2EIMC 4UVBA 4R50A 5EBLC 2ZR3A 4PU9A 3CD6V 4KP4A 1Y4UA 2EIJB 4CWOA 3G7BA 1TH8A 1S76D 1AROP 3GIGB 2FWYA 1Z5AA 2ZQMA 5H6QA 4PELA 2IORA 3W7WA 1R73A 4I9WA 1JJ2U 1VQ8V 2XDSA 4CE1A 3Q5KA 3VHDA 4RUEA 1K7DA 2WI4A 2WLLA 2YECA 1A4HA 2DYSB 3JD0A 4EFUA 2EJRA 2QM8A 3K0GA 2ZDYA 2XNDG 1UYDA 3A0ZA 2IH3C 3CPWU 2NNUA 2YEEA 4JYBA 1MABG 4PRVA 3LSQA 3O2FA 2HJFC 1PD3A 3STZC 2FYPA 2JKIA 3SYPA 2WLHA 3ZMSA 3TZ5A 4LCUC 2IWXA 1Q82W 2WEPA 3H4LA 3KE6A 2DQ0A 1TBWA 1M56B 4R1FA 1YTFB 5IY5C 4G2KA 1B63A 2YE8A 4GX2A 2LP7A 4XIPA 1FXKB 3AG2C 2FWZA 4FMTA 2YEHA 1F4NA 2E0AA 3ZJZA 1JQ0A 4XKKA 1FS0G 1MOFA 5GW7A 3LUTB 4GX0A 2HVKC 4X88A 2AHZA 1K4CC 1MG1A 4UVAA 1BL8A 3ZRVA 1COWG 4ASBA 1VQNV 3AG4C 3E89A 4O0BA 2IJHA 4RO2A 2YKIA 1GM9A 5KA6A 3OW6A 1SESA 1NH2B 5H6RA 3CCLV 4QE9A 4XITA 3VHAA 1U0ZA 4RQFA 1YJ9V 3WQ9A 4MVRA 4CWQA 4JQLA 4URLA 2IW5A 3OR7C 4U7NA 2PNRA 2WI5A 4YKUA 3SPCA 1R3IC 3TCUA 1ZXMA 4JTDB 1NVPD 2W6IG 5KUKA 4FJCC 2XAFA 1K92A 1EA6A 1KD1W 3TZ4A 3A0TA 4HXWA 1W2BU 3ZN0A 1L1FA 1AJ6A 3K99A 4PDLA 4PA9A 2W0FC 3R4OA 1HWYA 4H37A 3A0XA 3FT5A 3NXSA 3G71V 1UY8A 1ROPA 1BKNA 4OXSA 3GIEA 2HR3A 1U2OA 1QVFU 4QPJA 4QJFB 1UY7A 2P90A 5M4PA 3CRKA 3EHHA 3ZIAG 1KIJA 1QBZA 1H8HG 2XJGA 3SPHA 2QA4V 1S72V 2XCMA 2Q2EB 4GX5A 1VQ9V 3QO5A 5B3SB 4MTGA 2BYHA 4MPCA 2ZDIA 2EIKB 1R6NA 5CN0A 1QR9A 2YE7A 3STLC 1NHHA 3H80A 3CCMV 1PL0A 5L3FA 3G6EV 2XHRA 1G8MA 3JD2A 3U2DA 1NBMG 2YE6A 1FXHA 3ETGA 2WLIA 3F7VC 1KQSU 2WSSG 1YHQV 3OAAG 2YKEA 1YJWV 3C0EA 2O1UA 1Y8PA 4V26A 4CBCA 2IWUA 1R6KA 3ASOB 3CC7V 2YKCA 5J71A 2WI2A 3SYOA 1I5YA 2EILB 3SPJA 3CYOA 2XJXA 2CCUA 1UYFA 1OZ0A 3R4MA 3K3WA 1R3LC 2BREA 3SPIA 4TWKA 4AWQA 5CTUA 1VQMV 3TETA 1PKXA 1GMGA 1YIJV 4XTJA 4O04A 5L3CA 3TK1A 3O6OA 3W7UA 3R4NA 3HYZA 2XOKG 3ZMVA 3CC4V 3FT8A 3D3IA 2Y69C 1ENVA 2JEUA 2QG0A 1UYCA 3K79A 4P9OA 4ZVIA 1BHAA 2D3OW 3EHJA 2BU8A 4BW5A 5LHIA 4GT1A 4HYMA 4Z1MG 2P6JA 4P2ZA 4ZKIA 3VHCA 3OMNB 4GCZA 4YKQA 2YE3A 2ATKC 3INWA 1ZW9A 4R8CA 1AI6A 1YT0A 4GQTA 3E35A 3X2QC 5M4MA 2JK5C 4LWIA 4L8ZA 3AG3C 3ABMB 2P7TC 4O07A 2YSUB 3MHHC 3OUSA 2XHTA 3OEEG 2UXNA 2WEQA 3ZM7A 1S3JA 2GHYA 1BYQA 4H81A 4LWFA 3OPDA 2QM7A 3O0IA 4PDVA 4WF9V 5DN6G 3B28A 1H7UA 3K97A 4WFFA 2CCSA 1SZTA 2VW5A 1UY6A 5CBGA 3ABTA 1OCOC 3CCEV 4H7QA 3QDDA 4FIPC 3ZMTA 4I3HA 4UROA 2HG5C 1UYKA 4BQJA 4G27B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YSZ A;  3H4L A;  3KE6 A;  2LFS A;  3D2R A;  4U93 A;  1ZWH A;  5M4H A;  1TBW A;  1JOY A;  3U2K A;  4FPP A;  1Y8O A;  1YES A;  1GKZ A;  4EGK A;  3HEK A;  4R1F A;  1UYI A;  2HKJ A;  3QTF A;  2YED A;  4MBC A;  1B63 A;  2GFD A;  2YE8 A;  3B27 A;  4O09 A;  4E02 A;  4LPB A;  5M4E A;  2BTZ A;  4XIP A;  1BXD A;  2XJJ A;  2BRC A;  2C2A A;  4E00 A;  2FWZ A;  2YKJ A;  4FMT A;  2YEH A;  1YC1 A;  4FCR A;  2E0A A;  4MOT A;  4XIR A;  4CWS A;  4XKK A;  4GEE A;  5M4N A;  4MTX A;  1BGQ A;  2XX4 A;  1YC4 A;  3HHU A;  4LC1 A;  4JAS A;  5C93 A;  4KSH A;  4CWN A;  4R3M A;  2BU2 A;  3ZRV A;  1PVG A;  3WHA A;  4XDM A;  1B62 A;  4B6C A;  4ASB A;  3GIG A;  1TC6 A;  3T10 A;  4O0B A;  4XCJ A;  4MB9 A;  4YKX A;  2WI6 A;  2K5B A;  2BU5 A;  2YKI A;  4P8O A;  4XD8 A;  4XC0 A;  4YKT A;  3Q5J A;  1I59 A;  4LWG A;  3OW6 A;  4CE2 A;  4URN A;  4XIT A;  2XAB A;  2YI6 A;  4H85 A;  3VHA A;  1U0Z A;  3INX A;  5CPH A;  3WQ9 A;  2O1W A;  1S14 A;  3R92 A;  4CWF A;  4MPN A;  4XIQ A;  4CWQ A;  4YKR A;  4EGI A;  4JQL A;  1UYM A;  4URL A;  2Q8F A;  5FNF A;  3ZKD A;  4U7N A;  2PNR A;  1YS3 A;  1US7 A;  3CWV A;  3ZRW B;  2ZDX A;  4E01 A;  2WI5 A;  4CWR A;  4YKU A;  3D36 A;  5F5R A;  3T0Z A;  1MX0 A;  1UY9 A;  4XE2 A;  2XDU A;  2IWS A;  1YER A;  1ZXM A;  2YE9 A;  4PRX A;  2BU7 A;  3OWD A;  4MP7 A;  4EEH A;  1YC3 A;  3DGE A;  3T2S A;  4KSG A;  1F51 A;  1EA6 A;  2YGF A;  3TZ4 A;  5IDJ A;  3A0T A;  4MPE A;  4JAV A;  4ASF A;  4FCQ A;  4HXW A;  2CGF A;  4B7P A;  1AM1 A;  4AS9 A;  2YJW A;  2YI7 A;  3VAD A;  3G7E A;  2LFR A;  1AJ6 A;  3A0R A;  2CCT A;  2YK2 A;  3K99 A;  3U67 A;  4GFN A;  2YEF A;  3OMU A;  5FNC A;  3EHG A;  3R4O A;  2YEA A;  5FND A;  3A0X A;  3FT5 A;  5M4K A;  3T1K A;  3NXS A;  1ZXN A;  1UY8 A;  3R4P A;  4L90 A;  1BKN A;  4XKA A;  3B26 A;  1QZR A;  2BU6 A;  5D6P A;  3GIE A;  1U2O A;  2QF6 A;  1I5A A;  3RLR A;  4QPJ A;  1OSF A;  2ZKJ A;  4HY1 A;  4NH9 A;  2XDK A;  4XCL A;  4MT8 A;  3SL2 A;  3TTZ A;  1Z5C A;  1UY7 A;  2ESA A;  5M4P A;  1I5D A;  2XX2 A;  2Q8H A;  4BIU A;  3CRK A;  3ZXQ A;  3EHH A;  1KIJ A;  3MD0 A;  1QY8 A;  2XK2 A;  2XJG A;  4GGL A;  2VWC A;  4CWP A;  1Z59 A;  4CE3 A;  4Q20 A;  2FTK A;  1UYL A;  2XCM A;  1THN A;  4BAE A;  5D7D A;  5CF0 A;  2Q2E B;  1YSR A;  3LPS A;  2VCI A;  2AKP A;  3NMQ A;  2JJC A;  4MP2 A;  3ZRW A;  2IOP A;  2XX5 A;  2YI0 A;  2HCH A;  4URM A;  3C11 A;  2XDL A;  2BYH A;  2YKB A;  4KQV A;  4MPC A;  3BM9 A;  1QYE A;  4EFT A;  1AMW A;  5GGZ A;  2YE7 A;  2YGE A;  3RLQ A;  1NHH A;  4BQG A;  3H80 A;  2H8M A;  4NH8 A;  4ASA A;  2YI5 A;  2EXL A;  2YGA A;  2XHR A;  3K98 A;  2VCJ A;  4BXI A;  3RKZ A;  2GQP A;  3U2D A;  4EGH A;  1B3Q A;  3PEH A;  3IED A;  4R3A A;  4K4O A;  5IN9 A;  4DZY A;  3FV5 A;  3T0H A;  5BOD A;  1TID A;  2YE6 A;  3A0Y A;  3HZ1 A;  1TIL A;  4BIZ A;  4WUD A;  5F3K A;  5D7C A;  2XDX A;  4L93 A;  1I5C A;  3TZ2 A;  4KTN A;  1Z5B A;  2QG2 A;  4AWO A;  3A0W A;  3GIF A;  3JZ3 A;  4KFG A;  2O1V A;  4LWH A;  1AH6 A;  5CTW A;  1GKX A;  4W7T A;  3D0B A;  4AWP A;  3CGZ A;  5D7R A;  1KZN A;  2CG9 A;  2YKE A;  3Q5L A;  3C0E A;  2O1U A;  2UWD A;  5B1N A;  4X9L A;  1Y8P A;  2YEG A;  4V26 A;  3EKR A;  1R62 A;  2WI7 A;  3ZKB A;  2IWU A;  1MU5 A;  1NHI A;  2YKC A;  5J71 A;  2CH4 A;  3R91 A;  2WI2 A;  1NHJ A;  1I58 A;  4HYP A;  5L3J A;  4JYC A;  3EHF A;  3K60 A;  2YEJ A;  4EM7 A;  2FXS A;  2WER A;  4CWT A;  5D6Q A;  4FCP A;  2XD6 A;  2XJX A;  2Q8G A;  2CCU A;  1UYF A;  5CTY A;  3HYY A;  2WI3 A;  3R4M A;  4LWE A;  4JAU A;  1AH8 A;  2BRE A;  4HY6 A;  1YET A;  5CTX A;  3PEJ A;  2YK9 A;  1YT1 A;  4AWQ A;  1L0O A;  5CTU A;  2BYI A;  4U7O A;  1ID0 A;  3B24 A;  3OWB A;  1IXM A;  3B25 A;  2YE4 A;  1H7S A;  2ZBK B;  4P7A A;  4XTJ A;  4O04 A;  2P67 A;  1EI1 A;  3TK1 A;  3O6O A;  5BOC A;  1S16 A;  1I5B A;  2YJX A;  3R4N A;  4LP0 A;  4I5S A;  2QFO A;  3HYZ A;  3FT8 A;  2YEI A;  2QG0 A;  2WI1 A;  4QPK A;  1UYG A;  1Y4S A;  1UYC A;  1UYH A;  4NH7 A;  3MNR P;  3RLP A;  2H55 A;  3G75 A;  4WUC A;  4HZ0 A;  4ZVI A;  4YKY A;  3EHJ A;  5FWK A;  2BU8 A;  4ASG A;  4WUB A;  4PL9 A;  2YEB A;  3TZ0 A;  2HG1 A;  4GT1 A;  3HZ5 A;  4HYM A;  4YKZ A;  4O05 A;  4ZKI A;  4PU9 A;  3VHC A;  4YKW A;  4EMV A;  4KP4 A;  2BT0 A;  1Y4U A;  3ZXO A;  4GCZ A;  4HXZ A;  1Y8N A;  4YKQ A;  2YE3 A;  5IDM A;  3TUH A;  1YT2 A;  3ZCC A;  3INW A;  2Q8I A;  1ZW9 A;  4HZ5 A;  4CWO A;  3CGY A;  4L94 A;  1YT0 A;  3G7B A;  1TH8 A;  4GQT A;  5M4M A;  3CRL A;  3GIG B;  2FWY A;  4L8Z A;  1Z5A A;  4LWI A;  2YE5 A;  3P32 A;  2BSM A;  2IOR A;  3BMY A;  4O07 A;  1GJV A;  2YE2 A;  2XHT A;  4L91 A;  2XDS A;  4XKO A;  4CE1 A;  2WEQ A;  3ZM7 A;  3Q5K A;  3ZRX A;  3VHD A;  2WI4 A;  2YEC A;  4H81 A;  1BYQ A;  4LWF A;  1A4H A;  3OPD A;  2QM7 A;  3O0I A;  4EFU A;  2QM8 A;  2ZDY A;  1UYD A;  3A0Z A;  3B28 A;  2XHX A;  1H7U A;  5J6A A;  3K97 A;  2BZ5 A;  2IOQ A;  2CCS A;  2YEE A;  4JYB A;  3EKO A;  4PRV A;  3O2F A;  2VW5 A;  4DUH A;  1UY6 A;  4GT8 A;  2FYP A;  4H7Q A;  2JKI A;  1UYE A;  4V25 A;  1JM6 A;  3QDD A;  3LNU A;  3TZ5 A;  5B1O A;  4I3H A;  4URO A;  1TC0 A;  2IWX A;  1UYK A;  2WWW A;  4BQJ A;  2WEP A; 
#chains in the Genus database with same CATH topology
 3HKE B;  1YSZ A;  4U93 A;  1ZL8 B;  3E83 A;  4LP8 A;  1V54 B;  5IWA B;  1YES A;  1GKZ A;  1JR9 A;  3JYC A;  4B08 A;  1TUE B;  4NXM O;  4QNH B;  1N34 B;  2HKJ A;  3QTF A;  4MBC A;  4TSF G;  3B27 A;  2ZM6 B;  4LPB A;  2WPD G;  3OR6 C;  4GKK O;  4UCV A;  4PA7 A;  1A32 A;  3I56 V;  2C2A A;  2YKJ A;  1YC1 A;  4CH6 A;  2DYR C;  3K5N A;  2OIG A;  1VEW A;  4XIR A;  5EBW C;  3SJA C;  2ZE7 A;  1BGQ A;  5JEN A;  2D2C B;  4DV6 O;  3GWK C;  1YC4 A;  2ZXW B;  4B3T O;  3C3T A;  1N32 O;  2Y48 A;  4FLY A;  4I0X A;  3CMA V;  4DXW A;  1VP7 A;  2HHI A;  5JQG B;  4IIJ B;  1PVG A;  5JJJ B;  1OCR B;  1Q6H A;  3WHA A;  1B62 A;  2MW2 B;  2UXD B;  3GIG A;  3FB8 C;  1XBL A;  5EZY B;  3T10 A;  2H94 A;  4PDR A;  3T4D A;  1GTO A;  2IBZ H;  4O2B A;  4GLX A;  2X6B A;  4YJ2 B;  1HNW O;  1OV9 A;  3VOU A;  3AG4 B;  4LF8 O;  1JX9 A;  3CRR A;  1K97 A;  3FD9 A;  4J41 A;  3O9O A;  4YKT A;  3RYH B;  1I59 A;  3SPG A;  4JI7 O;  4UVC A;  4JGS A;  2UUC O;  4HBN A;  1PV0 A;  3RT3 C;  1NJI W;  1AR1 B;  1VQK V;  1IXB A;  2QEX V;  4UXN A;  3VQX A;  4QIW F;  1ZUQ A;  4MTO A;  5CPH A;  3IFX A;  1S14 A;  3R92 A;  4XIQ A;  3H1J H;  4YHH O;  1IBM B;  3DSQ A;  4YKR A;  4P30 A;  2Q8F A;  4J42 A;  1HNX B;  1I7F A;  3ICX A;  3JAK A;  3ZKD A;  3E8G A;  2CTQ A;  1YS3 A;  3CWV A;  1XRE A;  3ZRW B;  4JYY A;  4E01 A;  2N74 A;  4ICG A;  4LH7 A;  2A79 B;  2B9Z A;  1KKC A;  3D36 A;  1H2G A;  4H33 A;  1BT8 A;  5L3G A;  2Q9L A;  4WBN A;  5KMG B;  5F5R A;  1S5L Z;  1MX0 A;  1UY9 A;  4XE2 A;  2XDU A;  2YUA A;  3DXR B;  4OPH A;  4JI8 O;  3AG1 C;  5FL7 G;  2YE9 A;  1QR8 A;  1M1K W;  1AI7 A;  2BU7 A;  4MP7 A;  2ETN A;  4EEH A;  2NLJ C;  4OX9 B;  3DGE A;  4MVQ A;  3CME V;  3T2S A;  3TXQ A;  5BR8 O;  3JD1 A;  4HZ3 A;  3JAT A;  4MPE A;  5LGT A;  1FXK A;  2ARH A;  1Y76 A;  2B1I A;  2YI9 A;  1V55 B;  4U3J B;  5KX5 A;  4DV2 O;  2CK3 G;  1FAF A;  1S0V A;  3B09 A;  3VAD A;  1XNR O;  3B8M A;  3CXC U;  5E1A C;  2XAQ A;  1N36 B;  1Q3E A;  5H5N A;  2YEF A;  5FNC A;  4UCT A;  5LXT B;  4X66 B;  4NR1 A;  4ZHQ A;  2YEA A;  3CJH A;  3M7M X;  1MSW D;  5LP6 A;  4BW9 A;  1SER A;  1BZK A;  1OCC C;  5M4K A;  1TVK A;  2OCC C;  2ZD9 A;  4JI0 B;  1F7Y A;  3R4P A;  4L90 A;  3B26 A;  4GKJ B;  1Y4M A;  3CRQ A;  5FPO A;  5IYC O;  2EIN B;  3ASN C;  2QF6 A;  1I5A A;  4GUN A;  3RLR A;  1OSF A;  3ABL C;  4HY1 A;  2XDK A;  3SL2 A;  3GWO A;  4G28 B;  3UT5 A;  1I5D A;  4DR5 O;  2LJ2 A;  3ZXQ A;  4X1I B;  4E4E A;  2BCC H;  2YXH A;  5KUM A;  2XK2 A;  5IT9 N;  2A7W A;  4CWP A;  1TA8 A;  2W6J G;  4DV5 B;  2VWJ A;  4K8X A;  4Q20 A;  1GO3 F;  3OD4 A;  4DRX B;  5L3E A;  1THN A;  5D7D A;  2X6A A;  5CF0 A;  2DMX A;  4MVS A;  1ZLZ A;  3BPZ A;  2Q0O C;  5HFM A;  4WFE A;  1H2L A;  2QWQ B;  5A2Q N;  5JVD B;  3E2E A;  2PTM A;  1VF7 A;  2CUG A;  3KCX A;  5AG2 A;  3C11 A;  2XDL A;  1FKA O;  2Y0P A;  2GUZ B;  2YKB A;  4KQV A;  1SET A;  1UFI A;  3HPL C;  4MVU A;  1PPJ H;  2K9P A;  2DW4 A;  3B2E E;  3OEH G;  1S77 D;  1AMW A;  3RLQ A;  4BQG A;  2WLK A;  2EIJ C;  4X1Y B;  4NH8 A;  4ASA A;  1QU7 A;  3RVZ A;  1IVS A;  1KP2 A;  4YIP A;  4EGH A;  4R3A A;  4K4O A;  5IN9 A;  3A0H Z;  4DZY A;  2Z3Y A;  2EZP A;  4IHJ A;  3CCQ V;  3A0Y A;  3HZ1 A;  5F3K A;  2XDX A;  4H0L B;  1O9G A;  4KTN A;  4J9Y B;  3E86 A;  2HP8 A;  1VMG A;  3G67 A;  3GIF A;  2DYS C;  1SQG A;  2O1V A;  1IBK O;  4WFA V;  3D0B A;  4AWP A;  3RW0 A;  3WB0 A;  1QVG U;  1FXV A;  3ABU A;  1KZN A;  2LW1 A;  5CBH A;  3Q5L A;  2QWP B;  1XMO B;  4JI2 O;  2QKC A;  1OJH A;  4UV8 A;  4FLX A;  5EC2 C;  3CCS V;  5B1N A;  4X9L A;  3HKD A;  2WLM A;  3E8H A;  2YEG A;  3EKR A;  3LDD A;  5GTI Z;  4DR7 B;  1RM1 B;  3Q4H A;  4LF7 O;  1NHI A;  2R9A A;  5IJ9 B;  5EBM C;  3P30 A;  1NHJ A;  4DR2 B;  1T5E A;  1IUR A;  3EHF A;  3FYE B;  4DV3 B;  1BMF G;  2Q8V A;  1VQ5 V;  4EM7 A;  3B8N A;  4N23 A;  2WLJ A;  1XOU A;  1NR1 A;  4WFH A;  1YEW A;  3JD3 A;  2O57 A;  1QLE C;  3UKM A;  4OPA A;  2Q7H A;  1WB7 A;  2JGD A;  1M56 C;  1YDX A;  4TV9 B;  2WI3 A;  4LWE A;  2YEV B;  1WAZ A;  2EZO A;  4NKG B;  1ZTE A;  4HY6 A;  3L70 H;  4J9Z B;  5B1B B;  1VF6 A;  3OM3 B;  4X20 B;  1H38 A;  1YT1 A;  1FXK C;  1AI4 A;  2RDC A;  4I55 A;  3F7Y C;  2BYI A;  2A9H A;  4U7O A;  2P06 A;  1ID0 A;  1IXM A;  3B25 A;  2YE4 A;  5H2F Z;  5C8Y A;  4UCR A;  1EI1 A;  4O4L B;  2JJ2 G;  2QE7 G;  1BQZ A;  1N4C A;  5EC1 C;  1S16 A;  1I5B A;  2YJX A;  4LP0 A;  2QFO A;  3SR2 C;  2YEI A;  5LP6 C;  1JA8 A;  1M9N A;  1GH6 A;  2E75 B;  3ABK B;  5HFL A;  1UYG A;  4FFB A;  2Y69 B;  4O4H B;  4X64 O;  1SRY A;  4YJ3 A;  2H55 A;  4ZBM A;  2QM4 A;  4O4J B;  2E5L O;  4WUC A;  3ZHS A;  3T1H O;  1PNM A;  1QQC A;  5IYD O;  3RYI A;  4ASG A;  4WUB A;  1GKF A;  4PL9 A;  4U3F H;  2YEB A;  3TZ0 A;  1OCZ B;  1U97 A;  2HG1 A;  3KZI Z;  3U10 A;  4JI4 O;  4HAM A;  2QSA A;  4YKZ A;  3QVN A;  4JZ2 A;  4KFM A;  4O05 A;  4NB5 A;  4EMV A;  2PYJ A;  2BT0 A;  2AW9 A;  4IYI A;  3FB5 C;  3A2F A;  1M57 B;  5IDM A;  3TUH A;  1YT2 A;  3H9V A;  2Q8I A;  5FLX N;  4L94 A;  2ZR2 A;  3HKC A;  3CRL A;  2YDE A;  2BOC C;  2JDI G;  3CCJ V;  3P32 A;  2BSM A;  1XHZ A;  1GJV A;  3GVM A;  2OCH A;  3FKS G;  4XKO A;  5LGN A;  2WA4 A;  4TQF A;  4JI1 O;  2Q68 A;  3S5T A;  2YIA A;  4H44 B;  2HVJ C;  3LSS A;  4F6R B;  4FLZ A;  5CMU A;  2ZT9 B;  3K5L A;  1IBL O;  1IDS A;  1LR1 A;  2VQF B;  1THZ A;  4AQY B;  2Q7G A;  2XHX A;  5J6A A;  1RP3 B;  3BAA A;  2XAH A;  3H1H H;  3OUF A;  4DUY B;  2IOQ A;  1G6U A;  4JTC B;  1I5X A;  2QKA A;  4DUH A;  4E2L A;  5D5Q A;  1L0L H;  4GT8 A;  4WCE V;  1UYE A;  1JM6 A;  3BVO A;  3ETE A;  2AZ0 A;  3LNU A;  4MW8 A;  5B1O A;  1FFX B;  3N27 A;  1DLB A;  4DV4 O;  3JAR A;  4JYA B;  5B1A B;  3D2R A;  2WLI B;  5IYZ B;  4DW0 A;  1ZWH A;  4GYC B;  3O65 A;  1JOY A;  5M4H A;  3U2K A;  1Y8O A;  5JH7 A;  2V7Q G;  4EGK A;  5FNV A;  3QF7 A;  3HEK A;  1UYI A;  2P5O A;  3R66 A;  4DR6 B;  2YED A;  4J7Z A;  1HNZ O;  2GFD A;  4JPR A;  2X7R B;  5M4E A;  2BTZ A;  3CP1 A;  4UCU A;  4O4I A;  3N2G B;  3OW2 U;  2BRC A;  4PD4 F;  4E00 A;  1BE3 H;  2EBO A;  4MS2 A;  3OMI B;  4PJ0 Z;  4QE7 A;  2WAM A;  5B66 Z;  1AJQ A;  2Q7E A;  3UCS C;  3WG7 C;  1WA8 B;  3BEH A;  1GRJ A;  4GEE A;  4MTX A;  1B6Q A;  4RAI A;  4JI6 B;  2DYR B;  1S5H C;  3KKY A;  3HHU A;  2RJZ A;  1FJG O;  1P7B A;  4R7C A;  2QR4 A;  4XBF A;  1J95 A;  4FM2 A;  2CE4 A;  4R3M A;  3FAV A;  1VQO V;  4UV9 A;  2BU2 A;  1KP3 A;  3KG2 A;  1LNQ A;  4LFC B;  3E8B A;  4XDM A;  1VF6 C;  1IX9 A;  1F23 A;  4XCJ A;  4MB9 A;  2VWK A;  5B3S C;  5LHH A;  1Y6X A;  2F23 A;  2UUB B;  2WI6 A;  2DQ3 A;  2EIM B;  3S3X A;  2EIK C;  5LBQ A;  2BU5 A;  4P8O A;  4XD8 A;  4XDL A;  4I50 A;  2ZIN A;  2CTW A;  3Q5J A;  1BGY H;  2ZCE A;  2IJI A;  3VQW A;  4CS3 A;  1WB8 A;  4ZI7 B;  2XAB A;  2YI6 A;  1UJW B;  4H85 A;  1GM7 A;  5JJE B;  2M6Y A;  1XI1 A;  3E22 B;  4DR1 O;  3SGI A;  3CWB H;  1EZJ A;  4DK1 A;  4F4L A;  1Q8I A;  1Y66 A;  1WP7 A;  1VQ4 V;  2GBO A;  2H3O A;  4BIO A;  2UU9 O;  5LMU B;  1J5E O;  2ZDI C;  2ZDX A;  3EHB B;  4CS4 A;  1TUB A;  1XDC A;  2IU3 A;  2QKS A;  4IGG A;  4CWR A;  1R3K C;  1K5Q A;  3QTC A;  1NTM H;  5J2T B;  4MW3 A;  1KBH A;  4ABM A;  1PL4 A;  1Q6U A;  1EBO A;  3DC5 A;  2LW7 A;  3HKE A;  3J81 N;  3ZHT A;  1WN7 A;  2CH7 B;  2QTO A;  2IWS A;  1YER A;  1ZL8 A;  1Q5O A;  5DM6 V;  3E8F A;  2ZNI A;  4UFZ A;  3JAM N;  4NXM B;  3OWD A;  1PP9 H;  1YC3 A;  4NTY A;  5GON B;  4GKK B;  3OGI B;  3AG1 B;  2JRI A;  3MDS A;  1F51 A;  4BAY A;  2CAZ C;  4JI3 O;  2UUA O;  4ZOL B;  4LFB B;  2YIB D;  3HKB A;  1BS3 A;  1LUV A;  1DF4 A;  3ASO C;  4B7P A;  1AM1 A;  5TIS Z;  2X6C A;  4AS9 A;  3K5M A;  4Z2W A;  1YJN V;  3G7E A;  3A0R A;  2JGU A;  2YK2 A;  2EIL C;  3SJB C;  5DED A;  2WLN A;  3CCR V;  4DV6 B;  3U67 A;  4GFN A;  4B3T B;  1N32 B;  4DK0 A;  3OMU A;  1R3J C;  1VAR A;  5FND A;  4FFK A;  2QDO A;  5LOV B;  3T1K A;  4LFA B;  2Z5U A;  1TAE A;  3SYQ A;  5JQG A;  5IY5 B;  4X89 A;  2DWE C;  3H1I H;  5L3B A;  3K0D A;  1OCC B;  4NYK A;  4LFB O;  1YVW A;  5EZY A;  1GK9 A;  1HNW B;  4JAA A;  4LF8 B;  1V9P A;  3AG2 B;  4B3R O;  4XCL A;  4YJ2 A;  1NQT A;  4JI7 B;  2UUC B;  2Q8H A;  2L6L A;  4BIU A;  3ABL B;  4X8A A;  4LF5 B;  3RYH A;  1JPX A;  3MD0 A;  2N04 A;  1QCE A;  2VWC A;  4PA3 A;  1EN5 A;  3ZN1 A;  4YHH B;  4CE3 A;  4LFA O;  3CRC A;  2FTK A;  2E76 B;  3JAW B;  4BAE A;  2ITD C;  4IT5 A;  1NS1 A;  2M7W A;  3LPS A;  1RPO A;  1M5I A;  4MP2 A;  1XEQ A;  3ZRW A;  2GSM B;  1K5S A;  2HCH A;  4URM A;  1H2S B;  2HEP A;  3RVY A;  4LF5 O;  3T1Y O;  3BM9 A;  4W4L A;  5KMG A;  4JI8 B;  5GGZ A;  4RUF A;  4GX1 A;  2YGE A;  1E79 G;  3DXR A;  3ZHV A;  1IZ3 A;  4Q6G A;  2H8M A;  1K34 A;  2YGA A;  2R9I A;  5BR8 B;  3K04 A;  2VCJ A;  1VQ7 V;  4BXI A;  1WJZ A;  2GQP A;  3IED A;  1Y74 B;  3JSN A;  2ILM A;  4DV2 B;  1P4R A;  3G4S V;  3ABM C;  3FV5 A;  3T0H A;  1WNS A;  1TID A;  3K03 A;  4U3J A;  1XNR B;  1VQP V;  1Q86 W;  1TIL A;  4WUD A;  2H8P C;  4MTF A;  5A9G A;  4O2B B;  4L93 A;  2KG7 B;  3ZMU A;  4KHP O;  5H9C A;  1I5C A;  3TZ2 A;  3FB6 C;  1NZ6 A;  2QG2 A;  4AWO A;  3JZ3 A;  4KFG A;  5LXT A;  3SJC C;  4LWH A;  1GKX A;  5J9P C;  2CG9 A;  4CH4 A;  4TV8 B;  1AP5 A;  3EFF K;  3CSX A;  3SYC A;  4FVM A;  1RPR A;  5B5E Z;  1M4U A;  2B1G A;  4D6T H;  5KA5 A;  2WI7 A;  3ZKB A;  3L74 H;  3L9D A;  3BY6 A;  3T4Z A;  1YI2 V;  1MU5 A;  5J2U B;  3U11 A;  3IJ4 A;  1Q7Y W;  4DR5 B;  2IH1 C;  1I58 A;  5L3J A;  3K60 A;  2WLL B;  3RYF A;  4EB6 B;  4HYO A;  4X1I A;  2YEJ A;  4K8Z A;  2FXS A;  4ZIB A;  1RFY A;  2WER A;  4CWT A;  2PI4 A;  1V54 C;  4FZ0 A;  2XD6 A;  4L8J A;  1CP9 A;  3HYY A;  4DRX A;  4JAU A;  1QLE B;  1XNQ O;  1AH8 A;  2IJK A;  1YET A;  2DN9 A;  5CTX A;  5JJN B;  5LHG A;  3IC7 A;  2YK9 A;  1YSC A;  4GZR B;  5JVD A;  3FYI B;  4PI0 A;  2IU0 A;  2P22 C;  2XAJ A;  3QO8 A;  1FFT B;  3B24 A;  2N05 A;  1GN2 A;  3HB3 B;  2OTL V;  1Y76 B;  4P7A A;  2GUZ A;  1SKV A;  5LGU A;  2P67 A;  1MSD A;  1BHB A;  2QGN A;  4IYH A;  4TT3 G;  4I5S A;  2ZXW C;  2YXL A;  3LNN A;  1Q43 A;  3CRM A;  3K5O A;  5BZB A;  2WI1 A;  4NH7 A;  4J7J A;  1OCR C;  5LP6 B;  3JAS B;  1TVK B;  3RLP A;  2R9R B;  1YTF D;  3R65 A;  3LDE A;  3VBB A;  1U96 A;  2F43 G;  3SJQ C;  4HZ0 A;  5LYJ B;  4NTW A;  5L3D A;  2Q6A A;  5KLV H;  5FWK A;  1NVP B;  2PZS A;  1XHX A;  4DR3 O;  1ZWI C;  4X62 O;  3HZ5 A;  1IBK B;  3BA8 A;  3I55 V;  3BCC H;  4CZZ A;  5EK0 A;  4YKW A;  2AZ2 A;  3G80 A;  3EVK A;  2RMK B;  3ZXO A;  4WFB V;  2UXC O;  4JI2 B;  5BMV B;  1Y8N A;  4HXZ A;  2ADQ B;  1AVM A;  3ZCC A;  1G1X B;  1H2N A;  3H01 A;  1JFF B;  4HZ5 A;  3CGY A;  3JCZ A;  4DV7 O;  4EEQ A;  4Z1V A;  4MSW C;  4X9Q A;  2ODM A;  3WB1 A;  2CTP A;  3CS5 A;  4MVM A;  1KC8 W;  1AIL A;  4LF7 B;  2YE5 A;  2Q69 A;  3BMY A;  3B77 A;  2YE2 A;  4L91 A;  4L87 A;  5IJ9 A;  3ZRX A;  2Y4U A;  1JCH A;  3RFR A;  3QG5 A;  1AI5 A;  1NI8 A;  3JD4 A;  3ETD A;  4IL6 Z;  4LWS B;  4C7U A;  3OTF A;  5BXZ A;  4TV9 A;  4XDK A;  1NH2 D;  2F4V O;  3ZRS A;  1EM1 A;  4FK5 C;  3CE2 A;  2BZ5 A;  2YEV A;  3CC2 V;  5CA3 A;  4XDJ A;  3EKO A;  3UQ8 A;  3AEI A;  4X20 A;  4RQE A;  3VQV A;  4J11 A;  1V55 C;  2DOS A;  3D36 C;  3OFN G;  4V25 A;  2ZE5 A;  2PYL A;  1N33 O;  3WFV A;  3CXH F;  3EXA A;  4TUY B;  1TC0 A;  4IHJ B;  5KHI A;  2WWW A;  2DWD C;  4O4L A;  2YS8 A;  2ZE8 A;  1K4D C;  1Y67 A;  2LFS A;  4PA4 A;  3OE7 G;  3FX7 A;  4FPP A;  4PDM A;  3T2M A;  3ETQ A;  3BAB A;  2HHH O;  1H2K A;  5LA6 B;  4X64 B;  4K0K O;  4YY3 O;  3APQ A;  3K08 A;  2E5L B;  2A3Q A;  4CC6 A;  4O4H A;  4O09 A;  4E02 A;  1NU1 H;  4O4J A;  3T1H B;  2EIN C;  4K3A A;  1BXD A;  2W0X A;  2XJJ A;  3OGC C;  3QNE A;  1PNL A;  3UO3 A;  3RWR D;  5KHH A;  4JI4 B;  4FCR A;  4CH3 A;  2BTQ B;  1NR7 A;  4DR4 O;  1XL4 A;  1K8A W;  4MOT A;  1E1Q G;  4CWS A;  1EN4 A;  4DW1 A;  5M4N A;  2XX4 A;  1JVM A;  1E1R G;  4R6Z A;  1P49 A;  3DTU B;  3WG7 B;  4O2A B;  4LC1 A;  4JAS A;  3SDL A;  5C93 A;  4KSH A;  4CWN A;  4JF3 A;  1AJP A;  3ZS8 C;  2XT9 A;  2HFE C;  1Z5W A;  1HR0 O;  4B6C A;  3RYC B;  3AG7 A;  1TC6 A;  3LMM A;  2UXB O;  3L73 H;  3M99 B;  1ZSP A;  4JI1 B;  2BE3 A;  3LSU A;  4YKX A;  2FML A;  2K5B A;  4XC0 A;  3U0Z A;  3W7X A;  1IBL B;  1KMI Z;  4DYL A;  2BSK A;  4F6R A;  4LWG A;  4DO2 A;  4CE2 A;  4URN A;  4HNA B;  3INX A;  1WP8 A;  2O1W A;  1K3E A;  1M90 W;  4CWF A;  4MPN A;  3K9A A;  5IJ0 B;  3CRA A;  4MVO A;  3PN1 A;  1MA1 A;  4EGI A;  3X2Q B;  1UYM A;  2BTO A;  1KUQ A;  2QJ1 A;  5FNF A;  1PNK A;  2CGN A;  4BWA A;  3AG3 B;  1US7 A;  2XAS A;  4YJ3 B;  1DF5 A;  1WLE A;  2OTJ V;  1NT2 B;  2KSD A;  4DV4 B;  1W0J G;  1MNG A;  1FFX A;  2RNB A;  1R1B A;  1GN3 A;  2C1G A;  2GV9 A;  3RYI B;  3T0Z A;  3LNM B;  2A0L A;  4J10 A;  5IYZ A;  1XMQ O;  3RBZ A;  1EFR G;  4PRX A;  4N21 A;  2ZKO A;  2Q67 A;  1FD9 A;  1HNZ B;  4DV1 O;  1WPX A;  1M93 A;  3F5T A;  5JCO A;  3UM7 A;  1CEZ A;  1NKD A;  2JJ1 G;  4KSG A;  2AHY A;  2YGF A;  3WB2 A;  4I4T B;  3UO2 A;  5IDJ A;  1I08 A;  1RM1 C;  4YXW G;  4JAV A;  4ASF A;  4FCQ A;  2CGF A;  3N2G A;  1OCO B;  1ORQ C;  3IGA C;  1GN4 A;  2YJW A;  2YI7 A;  2LFR A;  5IE9 A;  2F93 B;  1SQF A;  2HLD G;  3CCV V;  4JV5 O;  2CCT A;  1GM8 A;  2PI5 A;  1N8R W;  1WA8 A;  4UUJ C;  1YIT V;  2R72 A;  5CBF A;  3CCU V;  1FJG B;  3EHG A;  2F95 B;  4B3M O;  1EN6 A;  2OT5 A;  2VQE O;  2BOB C;  5KAI Z;  4UCO A;  2FL4 A;  3C90 A;  1ZXN A;  2KB1 A;  3ZHQ A;  5B1B C;  4XKA A;  1X4T A;  1CPY A;  1QZR A;  4BR6 A;  2BU6 A;  5D6P A;  3JCU Z;  2ZKJ A;  4NH9 A;  2K1E A;  4MT8 A;  3LDC A;  3BRC A;  3TTZ A;  1L8D A;  1Z5C A;  3CEI A;  2PF4 E;  2ESA A;  3ZMZ A;  1NTZ H;  2AGA A;  4K35 A;  2XX2 A;  3K9S A;  3HR0 A;  3MHS C;  3GB7 C;  4B7K A;  3ML0 A;  1QY8 A;  4GGL A;  4DUZ O;  1VQ6 V;  4DR1 B;  4LF6 O;  4ZI7 A;  1Z59 A;  2ITC C;  3ABK C;  2RN9 A;  1AJN A;  3E22 A;  2YIC A;  1UYL A;  2UU9 B;  1YSR A;  3W7S A;  2YXY A;  1J5E B;  2ADP A;  1YCI A;  3KCY A;  2G38 A;  2CDY A;  2ZE6 A;  4CC5 A;  2VCI A;  2AKP A;  4P9P A;  5CA0 B;  2JJC A;  3NMQ A;  4X1K B;  2Q0A A;  2IOP A;  2XX5 A;  2YI0 A;  2B5U A;  5EYP B;  3OMA B;  1OCZ C;  5J2T A;  4B3S O;  1I0H A;  1K33 A;  5CA1 B;  1QYE A;  4EFT A;  2LGQ A;  1QLN A;  2CH7 A;  1H8E G;  1SA0 B;  3CYG A;  1M57 C;  2YI5 A;  2EXL A;  3K98 A;  5F2V O;  5GON A;  3RKZ A;  4JI3 B;  2UUA B;  4NXN O;  1B3Q A;  3PEH A;  4LF4 O;  2X0L A;  3W7T A;  3BA9 A;  2Y0I A;  4ZOL A;  5BOD A;  4LF9 O;  4BIZ A;  1KYO F;  5D7C A;  4FLT A;  4WFG A;  4KUM A;  3FB7 C;  1I94 O;  1HW7 A;  1Z5B A;  3VQY A;  1RSO B;  2E3C A;  4A5U B;  4EKW A;  1Z5V A;  3A0W A;  1P7G A;  2OWO A;  2KQX A;  4DV0 O;  1AH6 A;  4FLV A;  4D7S A;  5CTW A;  4UB8 Z;  4X65 O;  4W7T A;  4LBE C;  3JAL B;  2RQ6 A;  1XL6 A;  3A8T A;  5LOV A;  5LMN O;  3CGZ A;  2ZNJ A;  3ZX6 A;  5D7R A;  1KU9 A;  1PM9 A;  1D5N A;  4JI5 O;  3N2K B;  2IJJ A;  2UWD A;  4B3R B;  5K1X A;  2VRZ A;  2MK3 A;  1KEC A;  1K73 W;  1R62 A;  1US6 A;  2NR5 A;  1G4Y B;  1B06 A;  3OTO O;  1KKD A;  2CH4 A;  3R91 A;  5IYB O;  1D2D A;  4HYP A;  3K06 A;  2LGW A;  4JYC A;  1Q6I A;  5B1A C;  5D6Q A;  4FCP A;  1SQQ H;  3P3P A;  2Q8G A;  4IIJ A;  1OHH G;  5CB4 B;  4LNU B;  2V1D A;  4NTX A;  5CTY A;  1GN6 A;  2OCC B;  5JCO C;  3JAW A;  5KHG A;  4W4K A;  3PEJ A;  4JTA B;  4MVZ A;  3F5W C;  1MMM A;  3T1C A;  2OIE A;  1W0K G;  4ASU G;  1YXB A;  2XAG A;  1L0O A;  3SYA A;  3ASN B;  2LO1 A;  1F4M A;  3T1Y B;  2QWO B;  1SZX A;  3OWB A;  2Z0A A;  3B4S A;  3HKB B;  2XUM A;  1DTO A;  1LUW A;  1H7S A;  2ZBK B;  3JSL A;  2F1M A;  1QNM A;  1ZAU A;  5ITZ B;  3CHX A;  2JEX A;  1VQL V;  5BOC A;  3DC6 A;  3PJS K;  1N0N A;  1Q81 W;  2JIZ G;  4PA6 A;  4QPK A;  1Y4S A;  1NTK H;  5IWA O;  1K9M W;  1UYH A;  3MNR P;  3QO7 A;  1Y74 A;  3G75 A;  1N34 O;  5FPR A;  2ZM6 O;  2UXX A;  4YKY A;  4KHP B;  2HKO A;  2EIM C;  2KG7 A;  4UVB A;  4R50 A;  4UCS A;  5EBL C;  3APO A;  2EX3 A;  2FB5 A;  2ZR3 A;  4PU9 A;  4EFE A;  3CD6 V;  1FYJ A;  4KP4 A;  5EIB C;  1Y4U A;  2EIJ B;  4I0X B;  1W59 A;  2GTA A;  4TV8 A;  4CS2 A;  4CWO A;  3G7B A;  4QGP A;  1TH8 A;  1S76 D;  1ARO P;  3GIG B;  2FWY A;  1Z5A A;  2ZQM A;  5H6Q A;  1X59 A;  4LH6 A;  4PEL A;  1XUQ A;  2IOR A;  3W7W A;  2CGO A;  1R73 A;  3AK3 A;  4I9W A;  2UXD O;  5J2U A;  2Q5Z A;  1JJ2 U;  1VQ8 V;  3K58 A;  2XDS A;  4CE1 A;  3CX5 F;  3Q5K A;  3VHD A;  4RUE A;  1K7D A;  1O9H A;  2WI4 A;  2WLL A;  2YEC A;  1B04 A;  2P4V A;  1A4H A;  4EB6 A;  4NVP A;  3D8C A;  2DYS B;  3JD0 A;  4EFU A;  1YF2 A;  2EJR A;  2QM8 A;  3K0G A;  2ZDY A;  2XND G;  1UYD A;  3A0Z A;  2IH3 C;  1XNQ B;  3CPW U;  2NNU A;  2XTA A;  2FYU H;  2HJD A;  4OGQ B;  2YEE A;  4JYB A;  4TQD A;  1MAB G;  4PRV A;  3LSQ A;  3O2F A;  3P3N A;  1N0J A;  2R70 A;  1IBM O;  3JAK B;  2HJF C;  4B7E A;  1PD3 A;  2L35 A;  3STZ C;  4AIL C;  2FYP A;  2JKI A;  1HNX O;  3SYP A;  2WLH A;  3ZMS A;  2RCV A;  3TZ5 A;  2ZIO A;  4LCU C;  1CXZ B;  4FZ1 A;  3AK1 A;  2V4D A;  2IWX A;  1Q82 W;  4WBN B;  3TGU H;  2WEP A;  3H4L A;  3KE6 A;  2DQ0 A;  1TBW A;  3H1K H;  4PHZ A;  3AK2 A;  1M56 B;  3C3S A;  4R1F A;  1YTF B;  1SQP H;  5IY5 C;  4G2K A;  1B63 A;  2YE8 A;  3JAS A;  4OX9 O;  2QWR B;  4GX2 A;  3TXS A;  3JAT B;  3NR7 A;  2LP7 A;  4I7Z B;  4XIP A;  1FXK B;  1GAX A;  5KX5 B;  3AG2 C;  5LYJ A;  1HP8 A;  1R6T A;  4DR3 B;  2FWZ A;  4FMT A;  4X62 B;  2YEH A;  1QHT A;  1F4N A;  2E0A A;  3ZJZ A;  1JQ0 A;  4XKK A;  4X1Y A;  3RN4 A;  3MAQ A;  1FS0 G;  1MOF A;  5GW7 A;  4KXR A;  3LUT B;  4ZHQ B;  1N36 O;  2UXC B;  3CJH B;  4GX0 A;  2HVK C;  3RYF B;  4X88 A;  3ZHR A;  2AHZ A;  1K4C C;  1MG1 A;  4X66 O;  4DV7 B;  5BMV A;  4UVA A;  1BL8 A;  1YZB A;  3J7A U;  3FFQ A;  1JFF A;  2EUL A;  3ZRV A;  1COW G;  3L72 H;  4ASB A;  5D5P A;  1VQN V;  4JI0 O;  3AG4 C;  3E89 A;  4O0B A;  4GKJ O;  2IJH A;  4PV1 B;  5KAF Z;  4RO2 A;  1SF9 A;  3UT5 B;  2YKI A;  1GM9 A;  3BHP A;  5KA6 A;  1FPO A;  3OW6 A;  1SES A;  4JZG A;  1NH2 B;  5H6R A;  3CCL V;  4QE9 A;  4XIT A;  2F4V B;  4LWS A;  3VHA A;  3L71 H;  1U0Z A;  4RQF A;  1YJ9 V;  3WQ9 A;  2GTS A;  4MVR A;  4DV5 O;  5JWP A;  4CWQ A;  4JQL A;  1KB9 F;  4URL A;  3ZHU A;  2IW5 A;  3G6B A;  3OR7 C;  4U7N A;  1N33 B;  2PNR A;  1JJO A;  2WI5 A;  3D3Q A;  4YKU A;  2DE0 X;  4TUY A;  3SPC A;  2OYQ A;  2LQT A;  1R3I C;  3TCU A;  1ZXM A;  2HHH B;  4JTD B;  4K0K B;  4YY3 B;  2VS0 A;  1NVP D;  2W6I G;  4AI8 A;  5KUK A;  3M8A A;  5LA6 A;  4FJC C;  2XAF A;  1K92 A;  1EA6 A;  1KD1 W;  4FLW A;  3TZ4 A;  3A0T A;  4J7K A;  4HXW A;  1W2B U;  4TOI A;  3ZN0 A;  4DR4 B;  1L1F A;  5KHK A;  1AJ6 A;  1WPB A;  2BTQ A;  3K99 A;  4PDL A;  4PA9 A;  2W0F C;  1EZV H;  3R4O A;  1Q90 D;  1SQB H;  4O2A A;  1HWY A;  4H37 A;  3A0X A;  3FT5 A;  3ZBH A;  1URF A;  2WA3 A;  3NXS A;  2NN4 A;  3G71 V;  1HR0 B;  1UY8 A;  1BCC H;  1ROP A;  1BKN A;  2UXB B;  4OXS A;  1XMO O;  3HKD B;  3RYC A;  3GIE A;  2HR3 A;  1U2O A;  1D5A A;  1DK1 A;  1QVF U;  3Q4H B;  4QPJ A;  1VIB A;  4J80 A;  4DR7 O;  1TGO A;  2P4K A;  4QJF B;  1UY7 A;  2P90 A;  5M4P A;  3CRK A;  4FLU A;  4DR2 O;  3ZIA G;  1KIJ A;  3EHH A;  1QBZ A;  4DV3 O;  1H8H G;  2XJG A;  4HNA A;  3SPH A;  2QA4 V;  2JGD B;  4FM0 A;  1S72 V;  5IJ0 A;  2XCM A;  2Q2E B;  4GX5 A;  1VQ9 V;  4YIO A;  2Q4P A;  4I55 B;  3QO5 A;  4UB6 Z;  3K59 A;  5B3S B;  4MTG A;  3S3W A;  4LR3 A;  3H1L H;  3RGB A;  2BYH A;  4MPC A;  2ZDI A;  2EIK B;  3BFR A;  5C8Y B;  1R6N A;  1XMQ B;  5GTH Z;  5CN0 A;  1QR9 A;  1SQV H;  2YE7 A;  3STL C;  1NHH A;  2YC0 A;  4DV1 B;  3H80 A;  3CCM V;  2IM9 A;  1PL0 A;  5L3F A;  3G6E V;  2XHR A;  1G8M A;  3K57 A;  4FFB B;  4CH5 A;  3JD2 A;  3U2D A;  1NBM G;  4AHC A;  4I4T A;  5DEC A;  1AR4 A;  1AB3 A;  5BY1 A;  2YE6 A;  4JV5 B;  1FXH A;  1P84 F;  2C1I A;  3ETG A;  4RWU A;  2WLI A;  3F7V C;  4B3M B;  2A06 H;  2VQE B;  1H2M A;  1KQS U;  2BSK B;  2WSS G;  1YHQ V;  3OAA G;  2YKE A;  1YJW V;  2JS3 A;  3HKC B;  2XHB A;  3C0E A;  2O1U A;  1Y8P A;  4V26 A;  1XIL A;  4CBC A;  2IWU A;  4F6E A;  1R6K A;  3ASO B;  2F66 C;  3CC7 V;  2YKC A;  5J71 A;  2WI2 A;  3SYO A;  3ZED A;  1I5Y A;  3WU2 Z;  2EIL B;  3SPJ A;  4DUZ B;  4LF6 B;  2YID A;  3CYO A;  3I5D A;  2XJX A;  1MZF A;  1UYF A;  3J80 N;  1OZ0 A;  2CCU A;  2VQF O;  3R4M A;  3K3W A;  4AQY O;  1R3L C;  2BRE A;  3SPI A;  4TWK A;  4DUY O;  2Q73 A;  2QTS A;  4AWQ A;  5CTU A;  1VQM V;  5CA0 A;  4X1K A;  3TET A;  1PKX A;  3OT7 A;  5EYP A;  4B3S B;  2JS5 A;  1GMG A;  1YIJ V;  4XTJ A;  2E74 B;  2AXT Z;  4O04 A;  2EJ7 A;  5L3C A;  5K1P A;  3TK1 A;  5CA1 A;  3JAR B;  1BQ0 A;  5LL6 Y;  3O6O A;  3W7U A;  1XQ8 A;  4D7T A;  3R4N A;  3HYZ A;  2XOK G;  3ZMV A;  3CC4 V;  3FT8 A;  1SA0 A;  2Y69 C;  3D3I A;  4JYA O;  5JH7 B;  1ENV A;  1L0N H;  5FNV B;  4NXN B;  2JEU A;  2QG0 A;  2KKW A;  4E72 A;  4LF4 B;  1UYC A;  3K79 A;  2YIB A;  2PY5 A;  1MZE A;  2Y4T A;  4LF9 B;  1UPG A;  4DR6 O;  4P9O A;  3TJT A;  4O4I B;  4ZVI A;  1BHA A;  3CB2 A;  2D3O W;  1I94 B;  1AP6 A;  3EHJ A;  2BU8 A;  4BW5 A;  4I9Q A;  5LHI A;  4GT1 A;  1AR5 A;  4DV0 B;  4HYM A;  4Z1M G;  1RSO A;  2P6J A;  5KHJ A;  4X65 B;  4P2Z A;  4ZKI A;  3VHC A;  1JMK C;  3OMN B;  5LMN B;  1DGS A;  2DJV A;  4GCZ A;  4JI6 O;  2PUS A;  3JAL A;  4YKQ A;  2YE3 A;  2ATK C;  3INW A;  3FAV B;  4JI5 B;  1ZW9 A;  4R8C A;  1AI6 A;  1YT0 A;  4GQT A;  3E35 A;  3X2Q C;  5M4M A;  2JVD A;  2JK5 C;  3N2K A;  4EFB A;  4LWI A;  4L8Z A;  3OTO B;  1S5J A;  4LFC O;  2PGG A;  3AG3 C;  1Z2G A;  1SQX H;  4KL1 A;  5E79 Z;  2P7T C;  2YI8 A;  3ABM B;  4O07 A;  2YSU B;  3MHH C;  3OUS A;  2XHT A;  3OEE G;  2UXN A;  1SC5 B;  2WEQ A;  3ZM7 A;  3IC9 A;  3THO A;  1S3J A;  2GHY A;  4I50 B;  1BYQ A;  2UUB O;  4H81 A;  4LWF A;  3OPD A;  2ZIM A;  2QM7 A;  3O0I A;  4PDV A;  4WF9 V;  3L75 H;  1SS3 A;  5DN6 G;  5CB4 A;  1ZX3 A;  1BSM A;  4LNU A;  1H7U A;  3B28 A;  3K97 A;  3IAY A;  4WFF A;  4H13 B;  1VF5 B;  5EIB D;  2QWN B;  4FM1 A;  2CCS A;  1SZT A;  2FKX A;  3B40 A;  2VW5 A;  2CTR A;  1UY6 A;  5CBG A;  3ABT A;  1OCO C;  3CCE V;  4H7Q A;  1TUB B;  5LMU O;  3QDD A;  4FIP C;  3ZMT A;  4I3H A;  4URO A;  1HDJ A;  2HG5 C;  4PI2 A;  1UYK A;  3A0B Z;  4BQJ A;  2GDS A;  4G27 B;  5ITZ A; 
#chains in the Genus database with same CATH homology
 1YSZ A;  4U93 A;  3E83 A;  4LP8 A;  1V54 B;  1YES A;  1GKZ A;  3JYC A;  1TUE B;  4QNH B;  2HKJ A;  3QTF A;  4MBC A;  4TSF G;  3B27 A;  4LPB A;  2WPD G;  3OR6 C;  4PA7 A;  3I56 V;  2C2A A;  2YKJ A;  1YC1 A;  2DYR C;  4XIR A;  5EBW C;  1BGQ A;  1YC4 A;  2ZXW B;  2Y48 A;  3CMA V;  4DXW A;  1PVG A;  1OCR B;  3WHA A;  1B62 A;  3GIG A;  3FB8 C;  3T10 A;  2H94 A;  4PDR A;  3T4D A;  1GTO A;  2X6B A;  3VOU A;  3AG4 B;  1JX9 A;  1K97 A;  4YKT A;  1I59 A;  3SPG A;  4UVC A;  4JGS A;  1NJI W;  1AR1 B;  1VQK V;  2QEX V;  4UXN A;  4QIW F;  4MTO A;  5CPH A;  3IFX A;  1S14 A;  3R92 A;  4XIQ A;  4YKR A;  4P30 A;  2Q8F A;  3ZKD A;  3E8G A;  1YS3 A;  3CWV A;  3ZRW B;  4E01 A;  2A79 B;  3D36 A;  1H2G A;  4H33 A;  5L3G A;  5F5R A;  1MX0 A;  1UY9 A;  4XE2 A;  2XDU A;  3AG1 C;  5FL7 G;  2YE9 A;  1QR8 A;  1M1K W;  1AI7 A;  2BU7 A;  4MP7 A;  4EEH A;  2NLJ C;  3DGE A;  4MVQ A;  3CME V;  3T2S A;  3JD1 A;  4HZ3 A;  4MPE A;  5LGT A;  1FXK A;  2B1I A;  1V55 B;  2CK3 G;  1S0V A;  3VAD A;  3B8M A;  3CXC U;  5E1A C;  2XAQ A;  2YEF A;  5FNC A;  2YEA A;  1MSW D;  1SER A;  1OCC C;  5M4K A;  2OCC C;  2ZD9 A;  3R4P A;  4L90 A;  3B26 A;  1Y4M A;  5IYC O;  2EIN B;  3ASN C;  2QF6 A;  1I5A A;  3RLR A;  1OSF A;  3ABL C;  4HY1 A;  2XDK A;  3SL2 A;  3GWO A;  4G28 B;  1I5D A;  3ZXQ A;  5KUM A;  2XK2 A;  4CWP A;  2W6J G;  4Q20 A;  1GO3 F;  5L3E A;  1THN A;  5D7D A;  2X6A A;  5CF0 A;  4MVS A;  5HFM A;  4WFE A;  3E2E A;  3C11 A;  2XDL A;  2YKB A;  4KQV A;  1SET A;  3HPL C;  4MVU A;  2DW4 A;  3OEH G;  1S77 D;  1AMW A;  3RLQ A;  4BQG A;  2WLK A;  2EIJ C;  4NH8 A;  4ASA A;  3RVZ A;  1KP2 A;  4EGH A;  4R3A A;  4K4O A;  5IN9 A;  4DZY A;  2Z3Y A;  2EZP A;  3CCQ V;  3A0Y A;  3HZ1 A;  5F3K A;  2XDX A;  4KTN A;  4J9Y B;  3E86 A;  3GIF A;  2DYS C;  2O1V A;  4WFA V;  3D0B A;  4AWP A;  3RW0 A;  1QVG U;  1FXV A;  3ABU A;  1KZN A;  5CBH A;  3Q5L A;  4UV8 A;  5EC2 C;  3CCS V;  5B1N A;  4X9L A;  2YEG A;  2WLM A;  3EKR A;  3E8H A;  3LDD A;  1RM1 B;  1NHI A;  5EBM C;  3P30 A;  1NHJ A;  3EHF A;  3FYE B;  1BMF G;  1VQ5 V;  4EM7 A;  3B8N A;  4N23 A;  2WLJ A;  1NR1 A;  4WFH A;  3JD3 A;  3UKM A;  1QLE C;  1M56 C;  2WI3 A;  4LWE A;  2YEV B;  2EZO A;  4HY6 A;  4J9Z B;  5B1B B;  3OM3 B;  1H38 A;  1YT1 A;  1FXK C;  1AI4 A;  3F7Y C;  2BYI A;  2A9H A;  4U7O A;  1ID0 A;  1IXM A;  3B25 A;  2YE4 A;  1EI1 A;  2JJ2 G;  2QE7 G;  5EC1 C;  1S16 A;  1I5B A;  2YJX A;  4LP0 A;  2QFO A;  2YEI A;  1M9N A;  3ABK B;  5HFL A;  1UYG A;  2Y69 B;  1SRY A;  2H55 A;  4ZBM A;  4WUC A;  1PNM A;  5IYD O;  4ASG A;  4WUB A;  1GKF A;  4PL9 A;  2YEB A;  3TZ0 A;  1OCZ B;  2HG1 A;  4HAM A;  4YKZ A;  4KFM A;  4O05 A;  4EMV A;  2BT0 A;  3FB5 C;  1M57 B;  5IDM A;  3TUH A;  1YT2 A;  2Q8I A;  4L94 A;  2ZR2 A;  3CRL A;  2BOC C;  2JDI G;  3CCJ V;  3P32 A;  2BSM A;  1GJV A;  3FKS G;  4XKO A;  5LGN A;  2Q68 A;  2HVJ C;  3LSS A;  5CMU A;  1THZ A;  2XHX A;  5J6A A;  2XAH A;  3OUF A;  2IOQ A;  4JTC B;  1I5X A;  4DUH A;  4E2L A;  4GT8 A;  4WCE V;  1UYE A;  1JM6 A;  3ETE A;  3LNU A;  4MW8 A;  5B1O A;  1DLB A;  5B1A B;  3D2R A;  2WLI B;  1ZWH A;  5M4H A;  1JOY A;  3U2K A;  1Y8O A;  4EGK A;  2V7Q G;  3HEK A;  1UYI A;  2YED A;  2GFD A;  4JPR A;  2X7R B;  5M4E A;  2BTZ A;  3CP1 A;  3OW2 U;  2BRC A;  4E00 A;  2EBO A;  4MS2 A;  3OMI B;  4QE7 A;  2WAM A;  1AJQ A;  3WG7 C;  3BEH A;  4GEE A;  4MTX A;  1B6Q A;  4RAI A;  2DYR B;  1S5H C;  3HHU A;  1P7B A;  4R7C A;  4XBF A;  1J95 A;  4R3M A;  1VQO V;  4UV9 A;  2BU2 A;  1KP3 A;  3KG2 A;  1LNQ A;  3E8B A;  4XDM A;  1F23 A;  4XCJ A;  4MB9 A;  5B3S C;  5LHH A;  2WI6 A;  2DQ3 A;  2EIM B;  2BU5 A;  2EIK C;  5LBQ A;  4P8O A;  4XD8 A;  4XDL A;  3Q5J A;  2IJI A;  2XAB A;  2YI6 A;  1UJW B;  4H85 A;  1GM7 A;  1EZJ A;  4F4L A;  1Y66 A;  1VQ4 V;  2ZDI C;  2ZDX A;  3EHB B;  2IU3 A;  2QKS A;  4CWR A;  1R3K C;  1K5Q A;  4MW3 A;  1EBO A;  2IWS A;  2QTO A;  1YER A;  5DM6 V;  3E8F A;  3OWD A;  1YC3 A;  3AG1 B;  1F51 A;  4BAY A;  1DF4 A;  3ASO C;  4B7P A;  1AM1 A;  2X6C A;  4AS9 A;  1YJN V;  3G7E A;  3A0R A;  2YK2 A;  2EIL C;  2WLN A;  3CCR V;  3U67 A;  4GFN A;  3OMU A;  1R3J C;  5FND A;  3T1K A;  2Z5U A;  3SYQ A;  5IY5 B;  4X89 A;  2DWE C;  5L3B A;  3K0D A;  1OCC B;  1GK9 A;  3AG2 B;  4XCL A;  1NQT A;  2Q8H A;  4BIU A;  3ABL B;  4X8A A;  1JPX A;  3MD0 A;  1QCE A;  2VWC A;  4PA3 A;  3ZN1 A;  4CE3 A;  2FTK A;  4BAE A;  2ITD C;  2M7W A;  3LPS A;  1RPO A;  4MP2 A;  3ZRW A;  2GSM B;  1K5S A;  2HCH A;  4URM A;  3RVY A;  3BM9 A;  5GGZ A;  4RUF A;  4GX1 A;  2YGE A;  1E79 G;  2H8M A;  1K34 A;  2YGA A;  2R9I A;  3K04 A;  2VCJ A;  1VQ7 V;  4BXI A;  2GQP A;  3IED A;  1P4R A;  3G4S V;  3ABM C;  3FV5 A;  3T0H A;  1TID A;  3K03 A;  1VQP V;  1Q86 W;  1TIL A;  4WUD A;  2H8P C;  4MTF A;  4L93 A;  3ZMU A;  1I5C A;  5H9C A;  3TZ2 A;  3FB6 C;  2QG2 A;  4AWO A;  3JZ3 A;  4KFG A;  4LWH A;  1GKX A;  5J9P C;  2CG9 A;  3EFF K;  3SYC A;  1RPR A;  2B1G A;  5KA5 A;  2WI7 A;  3ZKB A;  3BY6 A;  3T4Z A;  1YI2 V;  1MU5 A;  1Q7Y W;  2IH1 C;  1I58 A;  5L3J A;  3K60 A;  2WLL B;  4HYO A;  2YEJ A;  2FXS A;  2WER A;  4CWT A;  2PI4 A;  1V54 C;  2XD6 A;  1CP9 A;  3HYY A;  4JAU A;  1QLE B;  1AH8 A;  2IJK A;  1YET A;  5CTX A;  5LHG A;  3IC7 A;  2YK9 A;  1YSC A;  3FYI B;  2IU0 A;  2XAJ A;  3QO8 A;  1FFT B;  3B24 A;  3HB3 B;  2OTL V;  4P7A A;  5LGU A;  2P67 A;  1BHB A;  4TT3 G;  4I5S A;  2ZXW C;  5BZB A;  2WI1 A;  4NH7 A;  1OCR C;  3RLP A;  2R9R B;  1YTF D;  3R65 A;  3LDE A;  3VBB A;  2F43 G;  3SJQ C;  4HZ0 A;  5L3D A;  2Q6A A;  5FWK A;  1NVP B;  1ZWI C;  3HZ5 A;  3I55 V;  4CZZ A;  5EK0 A;  4YKW A;  3ZXO A;  4WFB V;  4HXZ A;  1Y8N A;  3ZCC A;  3H01 A;  4HZ5 A;  3CGY A;  3JCZ A;  4MSW C;  1KC8 W;  4MVM A;  2YE5 A;  2Q69 A;  3BMY A;  3B77 A;  2YE2 A;  4L91 A;  4L87 A;  3ZRX A;  1JCH A;  1AI5 A;  3JD4 A;  3ETD A;  4XDK A;  1NH2 D;  3ZRS A;  4FK5 C;  2BZ5 A;  2YEV A;  3CC2 V;  5CA3 A;  4XDJ A;  3EKO A;  3AEI A;  4RQE A;  1V55 C;  3OFN G;  4V25 A;  3WFV A;  1TC0 A;  2WWW A;  2DWD C;  1K4D C;  2LFS A;  4PA4 A;  3OE7 G;  4FPP A;  4PDM A;  3T2M A;  3K08 A;  4O09 A;  4E02 A;  2EIN C;  1BXD A;  2XJJ A;  3OGC C;  3QNE A;  1PNL A;  4FCR A;  1NR7 A;  1XL4 A;  1K8A W;  4MOT A;  1E1Q G;  4CWS A;  5M4N A;  2XX4 A;  1JVM A;  1E1R G;  4R6Z A;  3DTU B;  3WG7 B;  4LC1 A;  4JAS A;  5C93 A;  4KSH A;  4CWN A;  4JF3 A;  1AJP A;  4B6C A;  2HFE C;  1TC6 A;  3M99 B;  4YKX A;  2K5B A;  4XC0 A;  3W7X A;  4LWG A;  4DO2 A;  4CE2 A;  4URN A;  3INX A;  2O1W A;  1K3E A;  1M90 W;  4CWF A;  4MPN A;  3K9A A;  4MVO A;  4EGI A;  3X2Q B;  1UYM A;  5FNF A;  1PNK A;  3AG3 B;  1US7 A;  2XAS A;  1DF5 A;  1WLE A;  2OTJ V;  1W0J G;  3T0Z A;  3LNM B;  2A0L A;  3RBZ A;  1EFR G;  4PRX A;  4N21 A;  2Q67 A;  1WPX A;  3UM7 A;  1CEZ A;  1NKD A;  2JJ1 G;  4KSG A;  2AHY A;  2YGF A;  5IDJ A;  1RM1 C;  4YXW G;  4JAV A;  4ASF A;  4FCQ A;  2CGF A;  1OCO B;  1ORQ C;  3IGA C;  2YJW A;  2YI7 A;  2LFR A;  2HLD G;  3CCV V;  2CCT A;  1GM8 A;  2PI5 A;  1N8R W;  4UUJ C;  1YIT V;  5CBF A;  3CCU V;  3EHG A;  2OT5 A;  2BOB C;  1ZXN A;  2KB1 A;  5B1B C;  4XKA A;  1CPY A;  1QZR A;  2BU6 A;  5D6P A;  2ZKJ A;  4NH9 A;  2K1E A;  4MT8 A;  3LDC A;  3TTZ A;  1Z5C A;  2ESA A;  3ZMZ A;  2XX2 A;  3MHS C;  3GB7 C;  3ML0 A;  1QY8 A;  4GGL A;  1VQ6 V;  1Z59 A;  2ITC C;  3ABK C;  1AJN A;  1UYL A;  1YSR A;  3W7S A;  2VCI A;  2AKP A;  4P9P A;  3NMQ A;  2JJC A;  2IOP A;  2XX5 A;  2YI0 A;  2B5U A;  3OMA B;  1OCZ C;  1K33 A;  1QYE A;  4EFT A;  1QLN A;  1H8E G;  1M57 C;  2YI5 A;  2EXL A;  3K98 A;  3RKZ A;  1B3Q A;  3PEH A;  2X0L A;  3W7T A;  5BOD A;  4BIZ A;  5D7C A;  4WFG A;  4KUM A;  3FB7 C;  1Z5B A;  4EKW A;  3A0W A;  1AH6 A;  5CTW A;  4W7T A;  4LBE C;  1XL6 A;  3CGZ A;  5D7R A;  2IJJ A;  2UWD A;  2MK3 A;  1KEC A;  1K73 W;  1R62 A;  1G4Y B;  1KKD A;  2CH4 A;  3R91 A;  5IYB O;  4HYP A;  3K06 A;  4JYC A;  5B1A C;  5D6Q A;  4FCP A;  2Q8G A;  1OHH G;  2V1D A;  5CTY A;  2OCC B;  3PEJ A;  4JTA B;  4MVZ A;  3F5W C;  3T1C A;  1W0K G;  4ASU G;  2XAG A;  1L0O A;  3SYA A;  3ASN B;  1F4M A;  3OWB A;  1DTO A;  1H7S A;  2ZBK B;  2JEX A;  1VQL V;  5BOC A;  3PJS K;  1Q81 W;  2JIZ G;  4PA6 A;  4QPK A;  1Y4S A;  1K9M W;  1UYH A;  3MNR P;  3QO7 A;  3G75 A;  2UXX A;  4YKY A;  2HKO A;  2EIM C;  4UVB A;  4R50 A;  5EBL C;  2ZR3 A;  4PU9 A;  3CD6 V;  4KP4 A;  1Y4U A;  2EIJ B;  4CWO A;  3G7B A;  1TH8 A;  1S76 D;  1ARO P;  3GIG B;  2FWY A;  1Z5A A;  2ZQM A;  5H6Q A;  4PEL A;  2IOR A;  3W7W A;  1R73 A;  4I9W A;  1JJ2 U;  1VQ8 V;  2XDS A;  4CE1 A;  3Q5K A;  3VHD A;  4RUE A;  1K7D A;  2WI4 A;  2WLL A;  2YEC A;  1A4H A;  2DYS B;  3JD0 A;  4EFU A;  2EJR A;  2QM8 A;  3K0G A;  2ZDY A;  2XND G;  1UYD A;  3A0Z A;  2IH3 C;  3CPW U;  2NNU A;  2YEE A;  4JYB A;  1MAB G;  4PRV A;  3LSQ A;  3O2F A;  2HJF C;  1PD3 A;  3STZ C;  2FYP A;  2JKI A;  3SYP A;  2WLH A;  3ZMS A;  3TZ5 A;  4LCU C;  2IWX A;  1Q82 W;  2WEP A;  3H4L A;  3KE6 A;  2DQ0 A;  1TBW A;  1M56 B;  4R1F A;  1YTF B;  5IY5 C;  4G2K A;  1B63 A;  2YE8 A;  4GX2 A;  2LP7 A;  4XIP A;  1FXK B;  3AG2 C;  2FWZ A;  4FMT A;  2YEH A;  1F4N A;  2E0A A;  3ZJZ A;  1JQ0 A;  4XKK A;  1FS0 G;  1MOF A;  5GW7 A;  3LUT B;  4GX0 A;  2HVK C;  4X88 A;  2AHZ A;  1K4C C;  1MG1 A;  4UVA A;  1BL8 A;  3ZRV A;  1COW G;  4ASB A;  1VQN V;  3AG4 C;  3E89 A;  4O0B A;  2IJH A;  4RO2 A;  2YKI A;  1GM9 A;  5KA6 A;  3OW6 A;  1SES A;  1NH2 B;  5H6R A;  3CCL V;  4QE9 A;  4XIT A;  3VHA A;  1U0Z A;  4RQF A;  1YJ9 V;  3WQ9 A;  4MVR A;  4CWQ A;  4JQL A;  4URL A;  2IW5 A;  3OR7 C;  4U7N A;  2PNR A;  2WI5 A;  4YKU A;  3SPC A;  1R3I C;  3TCU A;  1ZXM A;  4JTD B;  1NVP D;  2W6I G;  5KUK A;  4FJC C;  2XAF A;  1K92 A;  1EA6 A;  1KD1 W;  3TZ4 A;  3A0T A;  4HXW A;  1W2B U;  3ZN0 A;  1L1F A;  1AJ6 A;  3K99 A;  4PDL A;  4PA9 A;  2W0F C;  3R4O A;  1HWY A;  4H37 A;  3A0X A;  3FT5 A;  3NXS A;  3G71 V;  1UY8 A;  1ROP A;  1BKN A;  4OXS A;  3GIE A;  2HR3 A;  1U2O A;  1QVF U;  4QPJ A;  4QJF B;  1UY7 A;  2P90 A;  5M4P A;  3CRK A;  3EHH A;  3ZIA G;  1KIJ A;  1QBZ A;  1H8H G;  2XJG A;  3SPH A;  2QA4 V;  1S72 V;  2XCM A;  2Q2E B;  4GX5 A;  1VQ9 V;  3QO5 A;  5B3S B;  4MTG A;  2BYH A;  4MPC A;  2ZDI A;  2EIK B;  1R6N A;  5CN0 A;  1QR9 A;  2YE7 A;  3STL C;  1NHH A;  3H80 A;  3CCM V;  1PL0 A;  5L3F A;  3G6E V;  2XHR A;  1G8M A;  3JD2 A;  3U2D A;  1NBM G;  2YE6 A;  1FXH A;  3ETG A;  2WLI A;  3F7V C;  1KQS U;  2WSS G;  1YHQ V;  3OAA G;  2YKE A;  1YJW V;  3C0E A;  2O1U A;  1Y8P A;  4V26 A;  4CBC A;  2IWU A;  1R6K A;  3ASO B;  3CC7 V;  2YKC A;  5J71 A;  2WI2 A;  3SYO A;  1I5Y A;  2EIL B;  3SPJ A;  3CYO A;  2XJX A;  2CCU A;  1UYF A;  1OZ0 A;  3R4M A;  3K3W A;  1R3L C;  2BRE A;  3SPI A;  4TWK A;  4AWQ A;  5CTU A;  1VQM V;  3TET A;  1PKX A;  1GMG A;  1YIJ V;  4XTJ A;  4O04 A;  5L3C A;  3TK1 A;  3O6O A;  3W7U A;  3R4N A;  3HYZ A;  2XOK G;  3ZMV A;  3CC4 V;  3FT8 A;  3D3I A;  2Y69 C;  1ENV A;  2JEU A;  2QG0 A;  1UYC A;  3K79 A;  4P9O A;  4ZVI A;  1BHA A;  2D3O W;  3EHJ A;  2BU8 A;  4BW5 A;  5LHI A;  4GT1 A;  4HYM A;  4Z1M G;  2P6J A;  4P2Z A;  4ZKI A;  3VHC A;  3OMN B;  4GCZ A;  4YKQ A;  2YE3 A;  2ATK C;  3INW A;  1ZW9 A;  4R8C A;  1AI6 A;  1YT0 A;  4GQT A;  3E35 A;  3X2Q C;  5M4M A;  2JK5 C;  4LWI A;  4L8Z A;  3AG3 C;  3ABM B;  2P7T C;  4O07 A;  2YSU B;  3MHH C;  3OUS A;  2XHT A;  3OEE G;  2UXN A;  2WEQ A;  3ZM7 A;  1S3J A;  2GHY A;  1BYQ A;  4H81 A;  4LWF A;  3OPD A;  2QM7 A;  3O0I A;  4PDV A;  4WF9 V;  5DN6 G;  3B28 A;  1H7U A;  3K97 A;  4WFF A;  2CCS A;  1SZT A;  2VW5 A;  1UY6 A;  5CBG A;  3ABT A;  1OCO C;  3CCE V;  4H7Q A;  3QDD A;  4FIP C;  3ZMT A;  4I3H A;  4URO A;  2HG5 C;  1UYK A;  4BQJ A;  4G27 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...