4FPPA

Bacterial phosphotransferase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
205
structure length
205
Chain Sequence
PDFAAMLAARLCHDFISPASAIVSGLDLLEDPSAQDMRDDAMNLIASSARKLADLLQFTRVAFGASASAENFDSRELEKLAQGVFAHVRPTLDWQIEPQAMNKPSSRAVLNIAQIAASALPAGGVATVKGVAADGRFSIIADAKGPRARLRPEVLAGLKGEPLAEGLGGPWVQAAYLNALVRAAGGQIAVEIGEDRASIAAWVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into ChpT, an essential dimeric histidine phosphotransferase regulating the cell cycle in Caulobacter crescentus.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Transferase
molecule keywords phosphotransferase
total genus 66
structure length 205
sequence length 205
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10090 HPTransfase Histidine phosphotransferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fppA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4fppA02
4MPEA 2YGAA 1THNA 4PU9A 2BU6A 5CTXA 5IDMA 3R91A 1Y4UA 2ESAA 3R4OA 2HKJA 1Y8PA 4E02A 2YI5A 2YK2A 4MT8A 4FCPA 3SL2A 3GIGA 2Q8FA 2FTKA 1Y4SA 4R3AA 2YEHA 2BU8A 3K99A 3O2FA 2BSMA 4U93A 3BMYA 4W7TA 2FYPA 4QPKA 1AM1A 2XK2A 3U2DA 3INXA 2YKIA 1JOYA 3ZKDA 4XCLA 2XHTA 5FNDA 4EEHA 4EGKA 2XJJA 4LC1A 2GFDA 4Q20A 1YC3A 4I5SA 2YEEA 4GT1A 1JM6A 2JKIA 2WI2A 2YEIA 2YJWA 3KE6A 5L3JA 4BQGA 5M4MA 2XX4A 1BXDA 3ZRWA 4AWOA 4L94A 4H81A 4YKQA 1YSZA 2QFOA 1QZRA 2YE6A 3R4PA 3VADA 2BU2A 1NHJA 3T0HA 1Z5CA 2YEDA 4URLA 4XCJA 4YKTA 2YKJA 4DUHA 1L0OA 1UYMA 2ZDXA 2XABA 2Q2EB 4O0BA 1TC6A 2UWDA 2YGEA 4CWNA 3CRLA 4XIPA 3VHAA 1NHHA 4EMVA 5F3KA 4JYCA 5M4PA 4MPNA 4CE2A 3Q5JA 1YC1A 2CG9A 1BGQA 1R62A 2YE3A 3C11A 4E00A 1BKNA 4FCRA 4HZ5A 4PRVA 4R1FA 3RLPA 2QG0A 2WI7A 4KSHA 1IXMA 2XDLA 2QF6A 3OPDA 1OSFA 4LWGA 5CF0A 4U7NA 3EKRA 4BAEA 2PNRA 3FT5A 5M4KA 3NXSA 2HCHA 4LWHA 4E01A 5CPHA 3WQ9A 2QG2A 2CH4A 3NMQA 3LPSA 5J71A 1ZW9A 3U67A 3GIFA 4FMTA 2ZKJA 3RLQA 1UYHA 2BYIA 2BU7A 3VHCA 2VCIA 1MX0A 4JQLA 3HYYA 4P8OA 3A0YA 4LWEA 4EM7A 2YECA 3H4LA 1GJVA 2CCTA 2YE4A 3K97A 4V25A 1Y8NA 1YSRA 3CRKA 2EXLA 4K4OA 3TUHA 3C0EA 2YE5A 3A0RA 4ZKIA 1S14A 4GEEA 1EA6A 3TZ4A 4AWPA 4O07A 4CWTA 1I5BA 2YE9A 3FV5A 1GKXA 1H7SA 2H55A 4XD8A 3CWVA 4AS9A 4KQVA 4MTXA 3QDDA 2QM7A 1UY6A 2Q8IA 3A0XA 5IDJA 4H7QA 4U7OA 3IEDA 1YT0A 2FWYA 2YEBA 4XKOA 2VCJA 3ZXOA 3VHDA 2ZDYA 4B6CA 2CCUA 3R4NA 4O05A 2WI1A 2YE2A 4PL9A 2YE8A 4HZ0A 3PEHA 2YKEA 4MPCA 5D7DA 3QTFA 4ASAA 4XDMA 2JJCA 3RLRA 4EFTA 4MB9A 4H85A 1ZWHA 2WERA 4CWQA 2YI6A 4L93A 2YKBA 1Y8OA 3ZRWB 1H7UA 4CE1A 4GFNA 4WUBA 4YKXA 5D6PA 4O09A 4XTJA 3P32A 2QM8A 5FNFA 5D7RA 4NH9A 2HG1A 4ASGA 3A0TA 3CGYA 3OMUA 4EGIA 3BM9A 4CWPA 4CWFA 4HY6A 3GIGB 1I5CA 4KSGA 5BODA 2WEQA 2YEJA 2O1WA 1GKZA 4CWRA 4LPBA 3Q5KA 4L90A 2XDUA 3CGZA 4YKUA 2LFRA 1QYEA 1AJ6A 5J6AA 4JYBA 2C2AA 2BZ5A 3FT8A 4EFUA 1B3QA 4WUCA 4CE3A 2YI7A 2YJXA 4BIZA 4GQTA 1AMWA 3ZRVA 3HEKA 1KIJA 3K98A 1Z5BA 3H80A 4GCZA 4NH8A 3LNUA 4HY1A 1PVGA 4YKWA 5F5RA 4LWFA 4XE2A 4X9LA 5CTUA 2CGFA 3G7BA 5M4HA 1U2OA 5D6QA 1ZXMA 3OW6A 4HYMA 2BU5A 2VWCA 2YE7A 3D2RA 2XHRA 3EHFA 3MNRP 3ZKBA 2WEPA 1AH6A 3HZ1A 3MD0A 2BT0A 2IWUA 2P67A 1A4HA 3ZRXA 1EI1A 1YS3A 1I5DA 1UYLA 2XDSA 3D0BA 4BQJA 4YKYA 4NH7A 3O0IA 4YKRA 1BYQA 1AH8A 2IOPA 1Z59A 1ID0A 3A0WA 1S16A 1I59A 5FNCA 4LP0A 4L8ZA 4AWQA 3T10A 1UYDA 4YKZA 2YI0A 4JAUA 4UROA 3HZ5A 5B1NA 4B7PA 1I58A 5B1OA 1Z5AA 3T1KA 1KZNA 3O6OA 1I5AA 3B28A 4DZYA 1NHIA 5M4EA 1YT2A 2YK9A 5GGZA 4MP7A 2XDXA 2IWXA 3PEJA 2WI6A 3Q5LA 1B63A 3TZ2A 3ZXQA 4XIRA 3TK1A 2XHXA 4HXZA 3U2KA 1U0ZA 3K60A 4BXIA 2YEAA 4KFGA 2WI5A 2CCSA 4GT8A 4P7AA 3WHAA 2FWZA 1YT1A 4QPJA 4EGHA 3OWDA 2E0AA 2VW5A 2XJGA 4R3MA 3G7EA 1YERA 4URNA 3DGEA 1US7A 2ZBKB 4JAVA 4KTNA 3R92A 4CWSA 1YC4A 4FPPA 2IORA 4ASFA 2WWWA 2XD6A 4HYPA 1UYGA 2FXSA 2WI3A 2BTZA 3HHUA 5FWKA 1UYEA 2XJXA 2WI4A 3ZM7A 3RKZA 1UYKA 3B27A 1TC0A 3G75A 1UY9A 2GQPA 2O1VA 1TH8A 1TBWA 3JZ3A 3TZ5A 2IWSA 2XCMA 4JASA 2XX2A 3B25A 3EHHA 2H8MA 2XX5A 3B24A 4PRXA 5D7CA 4MP2A 3INWA 1UYCA 2XDKA 3D36A 2Q8GA 4XITA 1ZXNA 2YEFA 2YEGA 1UYFA 4MOTA 3TTZA 3EHJA 4BIUA 5M4NA 4I3HA 4XIQA 4L91A 2BRCA 4HXWA 1B62A 3A0ZA 2Q8HA 2O1UA 4URMA 4XKAA 4ASBA 4CWOA 2BREA 3EHGA 1YESA 5CTWA 5C93A 3T2SA 1YETA 3TZ0A 4XC0A 3EKOA 1QY8A 5BOCA 1TILA 2K5BA 2AKPA 5CTYA 2YKCA 2IOQA 4ZVIA 3HYZA 4LWIA 3ZCCA 5IN9A 1UY7A 2YGFA 1UY8A 3B26A 1F51A 3GIEA 3OWBA 2BYHA 1MU5A 4WUDA 1UYIA 3R4MA 2LFSA 4GGLA 4O04A 4KP4A 4FCQA 4V26A 4XKKA 3T0ZA 1TIDA 4MBCA
chains in the Genus database with same CATH superfamily
4LFAO 2QWPB 5EIBD 3BABA 1AJQA 1CEZA 5L3DA 2A7WA 4UB8Z 2JJ1G 3JAKB 3B8MA 4UCRA 2EINB 4EKWA 1QCEA 2N74A 1TUBA 1OHHG 2YK2A 4FCPA 5CB4A 1JVMA 4TQDA 1Y4SA 5HFLA 4U3FH 1SQBH 1HNWB 3LNNA 2OTJV 4QPKA 1R6KA 1W2BU 1YJNV 1QVGU 3U2DA 1JOYA 4JI1O 4X8AA 5FNDA 1OV9A 1OJHA 2QM4A 4I0XA 3N2KA 3HKEA 4DV5O 4DK0A 5GTIZ 3DXRA 4JI0O 4I5SA 2YEEA 4DR6O 4GT1A 1K33A 5GONB 1SQVH 2UUBO 5L3JA 4FVMA 1GN2A 4GKKB 3ZRWA 3F5TA 4L94A 4O2AA 1E1RG 5B3SB 4PA6A 4FLYA 2EULA 2QFOA 2Q8VA 1NR1A 1SF9A 4HBNA 4KHPO 4QE9A 4JV5B 3OM3B 2BOBC 1WA8B 1UYMA 2XABA 2Q2EB 2X6CA 3ZN1A 2CUGA 1FXKC 4TQFA 2O57A 2MK3A 5JWPA 1CXZB 4NKGB 3TJTA 1NHHA 5LGUA 1N32B 3EFFK 4MPNA 4CE2A 2Q7EA 3SJCC 3C3SA 1K7DA 2OIGA 3FYEB 5KLVH 3E8BA 2YE3A 4MVUA 4B3TB 1S3JA 3L73H 3C11A 3G4SV 4E00A 3STZC 4HZ5A 1QNMA 3RLPA 1QVFU 4U3JB 4ZHQB 4NXMO 3K04A 3JD2A 2XDLA 5KHIA 1QLNA 1Y74A 2QF6A 1OSFA 2X6BA 4NTXA 2PNRA 2HLDG 3NXSA 4ZI7A 4E01A 1NI8A 4YY3B 1BT8A 2HHIA 3WQ9A 1EN5A 3OE7G 5L3BA 4GYCB 3W7SA 5J71A 1ZW9A 3CC2V 2QWQB 2EIJC 1YJWV 1XDCA 4DXWA 4FLWA 4BIOA 2BU7A 2YS8A 1R6TA 4TV9B 3U10A 3GB7C 1MX0A 1QBZA 4TUYB 2ETNA 1TVKA 3L71H 4RQFA 1RPOA 1XHXA 4G2KA 4JZGA 3A0YA 4K8ZA 4LWEA 2OT5A 3H4LA 4TWKA 3K97A 1Y8NA 5KHHA 4CH5A 3H1IH 2LW7A 2YE5A 2YIAA 3K5MA 4ZKIA 1Q6HA 4GEEA 4YJ3A 3ABLB 1NTMH 1QR9A 4EB6A 3X2QB 4H13B 3S5TA 2UXXA 4CWTA 5LA6B 1I5BA 2GUZB 2YSUB 3HKBA 4IIJB 1DF5A 1H7SA 4NXMB 3E86A 2DWDC 1VQ6V 4XD8A 1FXVA 3H9VA 4MTXA 3H1HH 3BEHA 3QG5A 1H2KA 2QM7A 4X1YA 4PA4A 5JCOC 2WSSG 3IEDA 2PI4A 1YT0A 1S5JA 3SPCA 3ZXOA 4LFBB 3CJHA 4A5UB 5IT9N 3DSQA 2YE8A 2CGOA 4UV8A 4MPCA 1HNXB 4YJ2B 2CAZC 1Q6UA 1RP3B 1SETA 1EN6A 3QO7A 1JA8A 1R6NA 4JV5O 2WERA 4CWQA 1N4CA 4D7SA 3JAMN 4MVSA 2W6IG 1L0NH 3ZX6A 2Y4UA 1H7UA 1VIBA 3OUSA 2CE4A 1S5HC 4JI8B 3TGUH 4X1IA 4JI0B 2YIBD 3AG4B 4NH9A 3BVOA 3ZMZA 1EZVH 1XREA 1KP2A 5LMUB 4JI1B 2CTQA 4CWPA 2ZE6A 4UCVA 4H44B 1WP7A 2HFEC 2Y0PA 1TVKB 4LF4O 2YEVA 4WFEA 1I5CA 4CWFA 5DM6V 3B8NA 1Q6IA 1GKZA 4P30A 4LPBA 1O9GA 2PF4E 4JI2O 3T1HO 3CB2A 2ZCEA 3VQYA 3CGZA 1S77D 5LGNA 1NTKH 3UQ8A 5J2TB 1I94O 1QYEA 4WBNA 2HP8A 4DV7O 4JPRA 1LUVA 1R3KC 4I9WA 2DYSB 2JGDA 1Z5VA 4JYBA 2IU0A 2Y69B 3K9AA 3J81N 1E79G 3FT8A 5L3CA 2UUCO 3K58A 1VQLV 2QKAA 3KKYA 2Q0OC 5IWAO 2R9AA 4FM2A 2XAJA 3AG3C 4QNHB 3BAAA 4CH3A 1DGSA 4UFZA 3K98A 1Z5BA 1D2DA 4E2LA 4GCZA 4NH8A 2HHHO 4LF5O 4HNAA 4HY1A 1SZXA 2ZIOA 5KUMA 5LXTA 1ZSPA 3I56V 5F5RA 2EIKC 3DTUB 1TIDA 1WN7A 1R3IC 4XDKA 1AI6A 4OPAA 5B1BC 1PP9H 2AW9A 1LNQA 2KB1A 5M4HA 1N34O 2ZDIA 3WB0A 1IURA 1U2OA 4N21A 1ZXMA 3K08A 4DR4O 2VWCA 2YE7A 5CA3A 1MABG 1MMMA 1M90W 2Q0AA 3ZRSA 1YI2V 4B3SB 4KHPB 1EI1A 3HB3B 3D0BA 4YIOA 1NJIW 3HKEB 1XBLA 4JYYA 4Z1MG 3SYOA 2JEXA 2UUBB 1BYQA 2LJ2A 1MZEA 3MHSC 4R7CA 1AH8A 4CH6A 3CYGA 4J9ZB 2QWOB 2F4VB 3T10A 1VQ7V 3K03A 3M99B 4XDLA 3HZ5A 2RDCA 3ABTA 1KZNA 3O6OA 5LP6A 2LGWA 3CXCU 2UXDB 1U97A 2AHZA 1VQ8V 5GGZA 4PDLA 3A8TA 4LWSA 4MP7A 2XDXA 4BR6A 5KA6A 2WI6A 3JD4A 3Q5LA 3CPWU 2ATKC 2N04A 1NQTA 1WP8A 3ZMUA 4X65O 2BCCH 3RWRD 4DUYO 2BSKA 2QSAA 4I50A 2YEAA 1X4TA 2CCSA 1Q86W 2Q6AA 4GT8A 3WHAA 2YXYA 1V54C 4AHCA 3OMIB 5KHKA 4GKJO 4EGHA 3OWDA 4UVCA 2IJIA 3QO8A 3CC4V 4X9QA 1XL4A 3N2GA 4R3MA 2EIKB 3CCLV 5EYPA 4U3JA 3IFXA 3JAKA 3K79A 2FMLA 2WWWA 3JAWB 4F6RB 2FXSA 1KBHA 3CX5F 2F95B 3OR7C 3L9DA 1SQGA 1UYKA 2JEUA 2XHBA 1Q90D 1EZJA 1HWYA 4DR1B 2WLLA 1UY9A 4FZ0A 1D5NA 4GX0A 4X20A 4JI7O 2IWSA 3CD6V 4YJ3B 4EB6B 3B25A 2FB5A 3OTOB 1B04A 1COWG 1L8DA 5CBHA 5EBLC 4NB5A 3INWA 3D36A 2Q8GA 1V55C 2WLNA 3L72H 4UVAA 2XOKG 1UYFA 2BTQB 4E72A 1GM7A 3H01A 1BCCH 4BIUA 4I3HA 4CS4A 4DR4B 4OX9O 2P22C 3AK1A 1P4RA 4NXNO 3LSQA 4XKAA 4BW5A 4ASBA 3WG7C 5H6RA 4X1KB 1NT2B 4DR5O 5CTWA 4O4JA 2DYRC 3OTFA 4XC0A 2QTOA 2P06A 2HJFC 1R1BA 4K8XA 2VWKA 3SJAC 4E4EA 2JGDB 3RYIA 1K4DC 1KYOF 3ZCCA 1UY7A 5IWAB 2EIJB 2BYHA 3OUFA 4WUDA 1FJGB 4RUEA 5DECA 4B3MO 3IGAC 3R4MA 5KMGB 4KP4A 4WFFA 2F43G 1ZAUA 2XAHA 1NH2D 2YGAA 4PU9A 1K5QA 1BZKA 1WPXA 1KKCA 5CTXA 2BTOA 4X88A 2EZPA 2ITCC 2E5LO 2P7TC 3W7UA 3N27A 4MSWC 3CEIA 2YI5A 4WFAV 3GIGA 1W59A 4DR7O 1MNGA 1NS1A 4R3AA 2ZNJA 3K99A 2BSMA 3BMYA 4W7TA 1P84F 5GW7A 3CC7V 1CPYA 4CH4A 3R65A 5LOVB 2PZSA 3CYOA 4HYOA 3INXA 1H2MA 1M93A 4XCLA 4PDVA 1AI5A 2ZT9B 4J7ZA 4MVOA 1H8HG 4QJFB 1AR4A 4O4IA 1RSOA 2L6LA 4Q20A 1HR0O 1YC3A 3FX7A 1OCRC 2YDEA 5A9GA 2YUAA 1VF5B 2XX4A 4FFKA 2H8PC 4YKQA 1YSZA 1AB3A 1IX9A 4C7UA 1NHJA 2GUZA 2YEDA 4URLA 4XCJA 4YKTA 1R3LC 1AJPA 4IHJA 4K0KB 5IJ9B 4DR3B 2ZDXA 3FAVA 1WJZA 1PM9A 3UO3A 1AILA 2RQ6A 3HKCB 3TXSA 4UV9A 1TC6A 2EIMB 3T1CA 3WB2A 4X65B 2BOCC 4LF9O 3CRLA 1T5EA 1ORQC 4GX5A 4R6ZA 5DN6G 1NH2B 5M4PA 4JI6B 3Q5JA 1NVPD 2CG9A 4Z1VA 2V1DA 4LF8B 1K34A 1R62A 4TUYA 1ZLZA 4PI0A 1BKNA 4FCRA 4B08A 4PRVA 3CCSV 5JCOA 2NR5A 5TISZ 3ZHQA 2IH1C 5IY5C 3FT5A 4DUZO 2QG2A 2GTSA 3OR6C 4LF6B 3ETGA 4X1IB 3M7MX 4O2BB 3GIFA 4FMTA 3RLQA 1R73A 3D3QA 1UYHA 1N0NA 4IT5A 4LFCO 4G28B 2RMKB 1R3JC 1DF4A 2VCIA 4FJCC 4JAAA 5ITZA 4JTAB 2Q7HA 2E5LB 2OTLV 3JASA 2Q68A 3RYFA 4R8CA 3T1YB 3OGCC 1GJVA 2CCTA 4AI8A 5JJNB 4L8JA 2PYLA 2EX3A 5LP6B 1KQSU 3C0EA 1GO3F 2A3QA 3F7VC 4NTWA 2ZXWC 4ASUG 1YTFB 3CMAV 3ZHVA 1BHAA 3TZ4A 2MW2B 1F23A 4NVPA 2UXCB 2HHHB 2YE9A 4MVRA 4X64B 1OZ0A 3FV5A 2QTSA 2UXCO 1W0KG 3E22B 2EINC 2XTAA 5EBWC 3UO2A 4Q6GA 2HJDA 4H7QA 1GN3A 3IC7A 1AP6A 4XKOA 2VCJA 1K92A 5GONA 3T1YO 2Q9LA 5L3GA 2CCUA 1FFXB 1KUQA 2YE2A 1QHTA 4PL9A 2IJHA 2QDOA 3PEHA 2YKEA 5KMGA 5D7DA 4YXWG 5KA5A 4ZOLB 2F23A 2NLJC 2GBOA 1ENVA 5B1AB 3RBZA 5IJ0B 4JI2B 4DUZB 3RLRA 3JYCA 1JMKC 4H85A 1ZWHA 1EBOA 3RVYA 3FB5C 4DR1O 3LDDA 4BW9A 1Y8OA 2KG7A 4CE1A 4MVQA 1QLEC 4I55A 4YKXA 1YITV 5D6PA 4O09A 2VRZA 1RFYA 2QM8A 2PUSA 4O4JB 2Q73A 2HG1A 2OCHA 2JS5A 5JJEB 4RAIA 1VQ5V 4G27B 4JTDB 3CHXA 5JENA 2CH7B 2YI8A 1JJ2U 3RT3C 1PL4A 5CMUA 2YXLA 1J5EB 2E3CA 3Q5KA 5IYZA 4K0KO 4LNUB 4YKUA 2IBZH 1VF6C 1K4CC 3G6BA 2Y0IA 2WLIA 5J6AA 1XMQB 1MSDA 3T4ZA 1K9MW 3TXQA 2CK3G 4R50A 1J5EO 4YIPA 1ROPA 4WUCA 4GLXA 4TV9A 4J10A 1N36B 2YI7A 1ZTEA 2YJXA 1BS3A 5AG2A 2KQXA 2XNDG 4CC6A 4ZI7B 3W7TA 1VMGA 3ZHRA 1PL0A 2YIDA 3JSLA 4LP8A 1XNQO 3JAWA 4F6RA 2Q5ZA 1EM1A 1S0VA 2W6JG 3H1JH 2CGFA 3G7BA 3SPHA 4I4TA 2YI9A 1H2LA 5D6QA 3OW6A 4HYMA 2X6AA 2EBOA 3T2MA 3D2RA 4FLVA 3OEEG 3MNRP 4QGPA 3EXAA 1Y4MA 3PN1A 2Z5UA 4MTGA 4QIWF 3MD0A 3LSSA 2IWUA 1XL6A 1IBMO 1UYLA 3SYCA 1Q82W 4O4LB 3FD9A 2CTPA 3O0IA 3SJBC 4O4IB 3TETA 4KXRA 1U96A 5IYZB 5FPRA 4LF5B 1N34B 2HVJC 2OCCC 5J2TA 3BA8A 4ICGA 1I59A 3VBBA 2PI5A 2XT9A 5D5QA 4AWQA 1UYDA 4UROA 1AROP 2A79B 4PA9A 4DYLA 5CA1A 1I58A 1Z5AA 3T1KA 3ZN0A 3E35A 1AR1B 4DZYA 5M4EA 1Y76A 1YT2A 3RYCB 3LMMA 5IJ9A 2YK9A 4MTOA 3RN4A 1I5XA 3EVKA 5CA0A 3FFQA 3SGIA 1BGYH 5H2FZ 1S5LZ 4XIRA 1EN4A 5KAFZ 4WF9V 1DK1A 1B06A 1IBMB 4HXZA 5FL7G 5CN0A 4OX9B 4KFGA 1WLEA 2WI5A 2FWZA 1YT1A 4QPJA 3UM7A 2E0AA 3AG2B 2XJGA 2NN4A 2ZIMA 1FD9A 5LYJA 1N0JA 4PD4F 4J41A 1B6QA 3HPLC 3OFNG 1H8EG 3T1HB 3IJ4A 1YC4A 4JI7B 5E79Z 4DK1A 3B4SA 4HYPA 2WI3A 2ZD9A 2WI4A 3ZM7A 4LH6A 4F6EA 2E76B 3G75A 1H2SB 3E8FA 2GQPA 1AVMA 3ZHSA 2JK5C 4FFBA 1AI7A 1TH8A 1H2NA 1TBWA 1ZX3A 1BQ0A 3TZ5A 1YVWA 4K3AA 3B24A 4PRXA 5D7CA 4PJ0Z 1K73W 4X66O 4RUFA 4DV0O 2QR4A 5CBGA 1VF7A 2R72A 2CTRA 4O4HB 1YIJV 4PDMA 3AK2A 4JI3O 1K8AW 2BRCA 4HXWA 1B62A 3A0ZA 5BMVB 2Y69C 1QQCA 4X89A 2QE7G 4ABMA 4B3RO 4DV0B 3TZ0A 4ZBMA 4LFAB 1QY8A 3EKOA 1PNMA 1Y76B 2LW1A 1WNSA 2YKCA 3D36C 2ZE5A 4TV8A 5JH7A 5IN9A 1M56C 3K0GA 3B26A 3OWBA 4J42A 3SDLA 1HR0B 3I55V 2VS0A 3E89A 1X59A 3B77A 1FFTB 1UYIA 3SYQA 1MG1A 2AHYA 1GH6A 1Y67A 3G67A 1VEWA 5CB4B 4V26A 2M7WA 1RPRA 5BR8O 2CDYA 4MTFA 1UPGA 1THNA 1M57B 1QU7A 2ITDC 3B09A 2BU6A 4CC5A 2RJZA 3TCUA 3R91A 1Y4UA 1KD1W 2JS3A 1Q5OA 3R4OA 2HKJA 3K9SA 3E8HA 1Y8PA 3ZHUA 2KSDA 4E02A 3SL2A 3ABKC 1EFRG 1DTOA 2FTKA 4NTYA 3JSNA 1XQ8A 4P2ZA 3O2FA 1NZ6A 3B2EE 1IVSA 3DXRB 2DJVA 1VQKV 1I08A 1AM1A 2V4DA 4X64O 2XK2A 2YKIA 2OWOA 4DRXB 1GRJA 1GAXA 2XHTA 4EFBA 1JFFA 4EGKA 4JZ2A 2LQTA 2XJJA 2RNBA 3SJQC 5EYPB 5LHGA 1JCHA 4AQYO 2A06H 1TGOA 5IYCO 1L1FA 2DN9A 1VARA 2YEIA 1M57C 1GK9A 3KE6A 1N32O 2A9HA 2UUCB 2IW5A 4H81A 5JVDB 1F7YA 3CP1A 3GWKC 2BU2A 1CP9A 3L75H 4LFCB 2YKJA 1NU1H 3SPGA 4DUHA 1WB8A 1QR8A 1L0OA 2HG5C 1YCIA 1UFIA 2P6JA 2XAQA 4NXNB 4O0BA 3G6EV 3BPZA 1QLEB 5KUKA 1M1KW 3CMEV 3E83A 3CCUV 2WLMA 3CCVV 2UWDA 2YGEA 4XIPA 3VHAA 1NKDA 3K3WA 5HFMA 4EMVA 5F3KA 2EZOA 4JYCA 4OGQB 1AI4A 5LMUO 4W4KA 1YC1A 2A0LA 1BGQA 1BHBA 1KMIZ 1WPBA 2WA3A 3JCUZ 3ABKB 2GTAA 1P7GA 1ZL8B 2IU3A 4JYAO 2B1IA 3KCXA 2QWNB 2WI7A 4LF8O 2GHYA 4KSHA 1IXMA 1SKVA 3FYIB 3OPDA 4DV5B 5CF0A 4U7NA 4BAEA 2ZR2A 5LMNB 5M4KA 3UT5A 4P9PA 2HCHA 3FB8C 3DC6A 4JI6O 3LPSA 1GKFA 1FAFA 4X1KA 2ZKJA 4PDRA 1IZ3A 4MS2A 5EC2C 3E22A 4LFBO 4LF9B 1XMQO 1M56B 2ZDIC 3ETEA 4TOIA 5EZYA 1DLBA 4HAMA 2EJRA 4JQLA 4P8OA 1H38A 4PV1B 4EM7A 1RM1B 4V25A 2AZ2A 2HEPA 1YSRA 2HVKC 3RYHB 2DQ0A 2EXLA 4K4OA 3RVZA 1HDJA 3K59A 2C1GA 4PI2A 4X66B 3A0RA 3L70H 3D8CA 2PY5A 1S14A 1P49A 4DV4O 1KECA 2VQEO 1EA6A 2P90A 3JD3A 4X1YB 4O07A 3RFRA 2IJKA 4FLTA 3BY6A 2H55A 3BA9A 3CWVA 1URFA 2ZR3A 1XMOB 3ICXA 3QDDA 1FYJA 1UY6A 1TUBB 2Q8IA 3ETQA 3A0XA 2WLKA 5IDJA 4DR2O 3B40A 4DV6B 5C8YA 2R9RB 2FWYA 5JQGB 2BE3A 2YEBA 3GVMA 4D6TH 3R4NA 2WI1A 4KUMA 2UXNA 4HZ0A 2JGUA 4HZ3A 2G38A 3QF7A 3QTFA 3KZIZ 4XDMA 1G6UA 4DR2B 1K3EA 2JJCA 3F7YC 4DV2B 5FPOA 2ZM6B 2OCCB 4EFTA 2LGQA 1ZUQA 2BTQA 4FFBB 1M9NA 1NVPB 4N23A 1NR7A 4J9YB 1AR5A 3WB1A 2Z0AA 2JJ2G 1XHZA 4WFBV 3ETDA 4L93A 2Q69A 1FPOA 1NBMG 2RN9A 3ZRWB 3HKDB 2EIMC 2YEVB 4GFNA 2HKOA 4WUBA 1JJOA 1AJNA 4XTJA 4B3TO 1G1XB 3P32A 1OCZB 4PHZA 1K97A 1IBLB 3ZMTA 4ASGA 4QE7A 2XUMA 2ILMA 2R9IA 3CGYA 3OMUA 3ASOC 3BM9A 4EGIA 3AG4C 3LDEA 3OGIB 1SERA 4B7EA 4HY6A 2WLIB 1VQ9V 4KSGA 3L74H 2YEJA 2O1WA 4ZHQA 1I94B 4CWRA 3K5NA 4LBEC 1OCRB 2PGGA 3J7AU 4X20B 3BHPA 3M8AA 4TSFG 1OCCB 2LFRA 3RGBA 1MZFA 3ZIAG 1AJ6A 2UXBO 2C2AA 4GKKO 4H33A 4UCUA 2ZINA 4IGGA 3ML0A 5LMNO 1KB9F 4CE3A 4OXSA 3THOA 4GQTA 5LP6C 3ZRVA 3HEKA 5F2VO 2JVDA 2NNUA 1JQ0A 4DR6B 4JI8O 5DEDA 3LNUA 4YKWA 1SESA 2QWRB 4H37A 3STLC 4XE2A 4UUJC 4X9LA 4BWAA 3BRCA 2B5UA 1N36O 1I7FA 5LA6A 1Q7YW 4JI4O 2W0XA 3P3NA 1M5IA 3H1LH 1G8MA 2CGNA 5IYBO 2XHRA 5K1PA 1D5AA 1M4UA 5GTHZ 5LXTB 4J11A 3JD1A 1VQ4V 4J7KA 3VQXA 3HZ1A 2BT0A 2P67A 5IY5B 1A4HA 4FZ1A 3ZRXA 2GDSA 3CS5A 1YS3A 4FM1A 1VP7A 5EK0A 1I5DA 2XDSA 4BQJA 4NYKA 1US6A 4YKRA 4O4HA 3SR2C 1LR1A 4DUYB 1Z59A 1ID0A 2D2CB 5L3EA 4L8ZA 4YKZA 2YI0A 2IJJA 5B1NA 3SYPA 5KHGA 1TA8A 2W0FC 4J7JA 5B1OA 4YHHO 5EBMC 1BSMA 1I5AA 3B28A 2ADPA 5A2QN 1NHIA 3ASNC 4CS3A 1AP5A 1FXKB 1JX9A 3OEHG 5E1AC 3O9OA 2AGAA 2WA4A 2F4VO 3ZXQA 4RO2A 3ZS8C 3WU2Z 3OAAG 3F5WC 5H9CA 4UB6Z 1IBKO 2XHXA 1RSOB 1U0ZA 4BXIA 3JALB 1VQMV 4P7AA 4XBFA 2Q7GA 4LWSB 4DR7B 1PNLA 3JARA 3Q4HA 1Q43A 1SA0B 2ARHA 4B7KA 2EILC 1YERA 3IC9A 1OCOC 3G7EA 4B3SO 1Q3EA 3DGEA 1YJ9V 3S3WA 1US7A 2ZBKB 3N2KB 4JAVA 2L35A 4CWSA 1XMOO 2ZQMA 2IORA 4ASFA 3FKSG 3QTCA 3LDCA 4GUNA 3G71V 5LBQA 2VQFB 2XD6A 4LCUC 4LF7B 2X0LA 2BTZA 3HKCA 1HP8A 3HHUA 5FWKA 1UYEA 2XJXA 3AG1C 3ZMSA 3ZEDA 3RKZA 4B3MB 2VQEB 2UU9O 1FJGO 3DC5A 2XAGA 2O1VA 3OD4A 4WCEV 1VQNV 1XOUA 2H8MA 2M6YA 1S76D 2JDIG 1UYCA 3CRRA 2XAFA 2WLLB 1ZXNA 4MW3A 2YEFA 2YEGA 5EIBC 4MOTA 4UCTA 5EC1C 3RYHA 4EEQA 2EJ7A 1N8RW 4XIQA 5K1XA 4DV3B 4GX1A 2D3OW 2R70A 1L0LH 2Q8HA 4ZIBA 2O1UA 4URMA 5JQGA 2BREA 4JTCB 4OPHA 3ZHTA 3SPJA 2RCVA 2DE0X 2K5BA 3E2EA 1SRYA 3K5LA 2AKPA 2IOQA 4KL1A 5J9PC 2EILB 2YC0A 4ZVIA 2WPDG 2B1GA 4LWIA 5IJ0A 4H0LB 3CCJV 3GIEA 3JALA 1XNQB 3A0BZ 3NR7A 1MU5A 1BL8A 1F4NA 4W4LA 2LFSA 3JATB 1ZL8A 4O04A 2UXBB 4FCQA 4TT3G 3JD0A 2DMXA 1S72V 4MBCA 1P7BA 4MPEA 5IDMA 3ABMB 3MAQA 2ESAA 1JR9A 2YIBA 2AZ0A 5CA0B 2DYRB 1XI1A 4MT8A 1E1QG 3U0ZA 2Q8FA 3HKDA 2H94A 2YEHA 2BU8A 2LP7A 2IH3C 4U93A 2FYPA 2QJ1A 3K5OA 5H6QA 4IYIA 4IYHA 1IBLO 3N2GB 3ZKDA 2UU9B 3CE2A 4UCSA 4EEHA 1I5YA 4LC1A 2GSMB 3MHHC 2GFDA 2C1IA 2V7QG 2BSKB 1Z5WA 4LF7O 3CRQA 1KP3A 1JM6A 2JKIA 2WI2A 3QO5A 1YF2A 1HNZO 3E8GA 2Z3YA 2YJWA 3BFRA 4DV1O 4BQGA 5M4MA 2JIZG 1WB7A 1BXDA 2IM9A 4AWOA 2K1EA 3K0DA 1V54B 4ZOLA 4Z2WA 2JRIA 4DV2O 1QZRA 3CXHF 2YE6A 3R4PA 3VADA 2Y4TA 1Z5CA 5B5EZ 3T0HA 1Y6XA 2ZE8A 2QA4V 1FXHA 2AXTZ 1KC8W 3APQA 5J2UA 1V9PA 2Q4PA 4IL6Z 5FNVB 3ABUA 5KX5B 2QEXV 5BR8B 4PA3A 4X62O 4CWNA 3A2FA 1Y66A 1IBKB 1YDXA 3JARB 3Q4HB 3UT5B 1GN4A 2CH7A 4R1FA 2QG0A 1O9HA 1BE3H 2WLHA 4LWGA 3EKRA 4B3RB 4GX2A 3CCQV 3R66A 2YICA 4LWHA 5CPHA 3UCSC 2CH4A 1XEQA 3NMQA 3CRAA 3U67A 4JI3B 3HR0A 2CTWA 2BYIA 3AG7A 3JCZA 1G4YB 5B1BB 3VHCA 1YHQV 4DV7B 3D3IA 3HYYA 4LH7A 4CS2A 3ABLC 4FLXA 4I0XB 4AILC 2YECA 5L3FA 2YE4A 5FLXN 3CRKA 1FFXA 4JI4B 5J2UB 3TUHA 3WG7B 2H3OA 5IYDO 5FNVA 1GN6A 5KX5A 4LF4B 1ZWIC 3OTOO 3OT7A 1YTFD 3T4DA 4AWPA 3JASB 2PTMA 1UJWB 4UXNA 4RQEA 3OMNB 1GKXA 4PELA 1WA8A 1KU9A 4DW1A 4AS9A 1V55B 4KQVA 3IAYA 4DRXA 1VQOV 5D5PA 1SA0A 1XNRB 5ITZB 2QGNA 3KCYA 4U7OA 5LGTA 3CCRV 2P4KA 1SQPH 2ZE7A 4PA7A 3K06A 3VHDA 2ZDYA 4B6CA 3RYCA 4O05A 5CBFA 3J80N 3FB6C 4DV3O 4ASAA 2UUAO 1JFFB 1TUEB 3AEIA 3I5DA 2DYSC 4MB9A 1SZTA 4EFEA 1PD3A 4IHJB 1GM8A 4CBCA 4LNUA 4HNAB 3AK3A 1RM1C 5KAIZ 4JGSA 2YI6A 1GTOA 3KG2A 4AQYB 2LO1A 3OMAB 2YKBA 2X7RB 4I7ZB 5JJJB 1MSWD 2FL4A 2QKCA 2ZKOA 1N33O 3G80A 3APOA 5FNFA 5D7RA 3U11A 3CJHB 2N05A 4FK5C 3A0TA 3BCCH 2B9ZA 1PKXA 2ZM6O 5BZBA 3GIGB 5BODA 2WEQA 4DO2A 1XILA 4WFGA 4L90A 1Q81W 2XDUA 2FYUH 4X62B 4FIPC 4LF6O 1JPXA 3AG3B 2BZ5A 4EFUA 1B3QA 4F4LA 3X2QC 3AG1B 3C3TA 5EZYB 1YZBA 3LSUA 1PNKA 4BIZA 4YY3O 1NTZH 1THZA 1AMWA 3JATA 2KKWA 1Z2GA 1YEWA 3A0HZ 2PYJA 1KIJA 3H80A 2VWJA 4I50B 4YHHB 3ABMC 3FB7C 4JI5O 1PVGA 3CCMV 1OCOB 1FS0G 2E74B 4LWFA 3ZJZA 5CTUA 4TV8B 5JH7B 1HW7A 4DV4B 3RYIB 4WBNB 1MA1A 5BXZA 5BY1A 1SQFA 4NR1A 2OYQA 3VQVA 2DWEC 4O4LA 2BU5A 1Y74B 3EHFA 2ADQB 2F1MA 4DR3O 3ZKBA 2WEPA 4RWUA 1F4MA 4BAYA 1AH6A 2UUAB 4I9QA 3ASNB 2P4VA 3OW2U 5JVDA 1BQZA 1XNRO 3UKMA 5CA1B 4YKYA 1K5SA 4NH7A 1XUQA 5KHJA 3EHBB 3CCEV 2IOPA 4GZRB 3A0WA 1S16A 5FNCA 4LP0A 2E75B 3SYAA 4WFHA 2XASA 4JAUA 3VOUA 4B7PA 5C8YB 5IE9A 1MOFA 5LOVA 3LNMB 4P9OA 2Y48A 1SQQH 4JYAB 2DW4A 2IWXA 3PEJA 3ZMVA 1B63A 3TZ2A 3TK1A 2KG7B 4DW0A 3VQWA 1LUWA 3U2KA 2Q67A 1IXBA 3K60A 4FLUA 2DQ3A 3HKBB 4IIJA 1HNWO 3K57A 3CSXA 1SS3A 1VF6A 4XDJA 1GM9A 1H2GA 1I0HA 2VW5A 1HNXO 5B66Z 1FKAO 4K35A 4URNA 4CZZA 2ZNIA 4KTNA 4GKJB 4MW8A 5LL6Y 3R92A 2F66C 1SQXH 2WAMA 2DOSA 4FPPA 3ZBHA 1IDSA 3WFVA 1PPJH 5B1AC 1UYGA 1YSCA 1BMFG 5LYJB 1PV0A 5LHHA 2UXDO 3B27A 1WAZA 3GWOA 1TC0A 4JI5B 2P5OA 2HR3A 2GV9A 3C90A 3JZ3A 1Q8IA 4D7TA 3CRCA 1OCCC 4DR5B 2YXHA 1VQPV 4JASA 3FAVB 3RW0A 5LHIA 2XCMA 2XX2A 3EHHA 2XX5A 2F93B 4YJ2A 2OIEA 4MP2A 3O65A 2XDKA 2VQFO 4XITA 2K9PA 3TTZA 3EHJA 1KKDA 5M4NA 1FXKA 4MVZA 1GMGA 1A32A 3MDSA 1YXBA 4FLZA 4L91A 2ZXWB 4O2AB 4I4TB 2ODMA 4MVMA 4I55B 1J95A 2QKSA 4CWOA 3S3XA 3EHGA 4O2BA 1YESA 5C93A 3T2SA 1HNZB 4FM0A 1YETA 5H5NA 4DV6O 3W7XA 3LUTB 2WLJA 5BOCA 4L87A 1TILA 1N33B 3P30A 5CTYA 4LR3A 4DV1B 4UVBA 3AG2C 3SPIA 3HYZA 3RYFB 2YGFA 1UY8A 1F51A 4KFMA 1SC5B 2FKXA 3ASOB 3PJSK 3CRMA 4J80A 4JF3A 1W0JG 3QVNA 3W7WA 3CWBH 5B3SC 4GGLA 1OCZC 4UCOA 3H1KH 4XKKA 3T0ZA 1TAEA 3QNEA 5BMVA 3P3PA
chains in the Genus database with same CATH topology
4MPEA 2YGAA 4MTFA 1K5QA 1THNA 1M57B 4PU9A 1WPXA 1AJQA 2ITDC 5L3DA 1CEZA 2BU6A 5CTXA 5IDMA 4X88A 2JJ1G 3TCUA 2EZPA 3ABMB 3B8MA 1Y4UA 1KD1W 2ESAA 3R91A 2ITCC 3R4OA 2EINB 4EKWA 2P7TC 2HKJA 1QCEA 3W7UA 1Y8PA 3E8HA 4MSWC 2DYRB 4E02A 1OHHG 2YI5A 4WFAV 4MT8A 1E1QG 3ABKC 2YK2A 3GIGA 1EFRG 1DTOA 4FCPA 2Q8FA 2FTKA 1JVMA 4P2ZA 2H94A 1Y4SA 4R3AA 2YEHA 2BU8A 3K99A 2LP7A 2BSMA 2IH3C 5HFLA 3O2FA 3BMYA 4U93A 4W7TA 5GW7A 2FYPA 3CC7V 1CPYA 2OTJV 3R65A 4QPKA 1R6KA 5H6QA 1VQKV 1W2BU 3CYOA 1AM1A 4HYOA 1YJNV 1QVGU 2XK2A 3U2DA 3INXA 2YKIA 1JOYA 3ZKDA 4XCLA 4PDVA 1AI5A 2XHTA 4X8AA 5FNDA 4EEHA 4EGKA 4MVOA 1I5YA 2XJJA 1H8HG 3SJQC 4LC1A 5LHGA 2GSMB 4QJFB 1JCHA 3MHHC 2GFDA 2V7QG 4Q20A 1YC3A 4I5SA 5IYCO 2YEEA 1L1FA 1OCRC 1K33A 1KP3A 4GT1A 1JM6A 2JKIA 2WI2A 3QO5A 2YEIA 3E8GA 1M57C 1GK9A 2Z3YA 2YJWA 3KE6A 2A9HA 5L3JA 4BQGA 5M4MA 2IW5A 2JIZG 2XX4A 1BXDA 3ZRWA 4AWOA 2K1EA 3K0DA 1V54B 1E1RG 2H8PC 5B3SB 4H81A 4L94A 4PA6A 1YSZA 2QFOA 4YKQA 3CP1A 1QZRA 2YE6A 3R4PA 3VADA 1NR1A 2BU2A 1NHJA 3T0HA 1Z5CA 4QE9A 2YEDA 1CP9A 4URLA 4XCJA 2QA4V 4YKTA 3OM3B 1R3LC 2YKJA 1FXHA 1AJPA 2BOBC 3SPGA 4DUHA 1QR8A 1KC8W 1L0OA 2HG5C 1UYMA 2ZDXA 2XABA 2P6JA 2Q2EB 2X6CA 2XAQA 4O0BA 3ZN1A 3ABUA 1FXKC 3G6EV 1QLEB 4UV9A 2QEXV 2EIMB 3T1CA 5KUKA 3CMEV 1M1KW 1TC6A 3E83A 3CCUV 2WLMA 4PA3A 2BOCC 3CCVV 2UWDA 2MK3A 2YGEA 4CWNA 3CRLA 1ORQC 4GX5A 4XIPA 3VHAA 1NKDA 1NHHA 5LGUA 3K3WA 4R6ZA 5DN6G 5HFMA 5F3KA 3EFFK 4EMVA 1Y66A 2EZOA 4JYCA 4MP7A 1AI4A 1NH2B 5M4PA 4MPNA 4CE2A 3Q5JA 1NVPD 1YC1A 2CG9A 2V1DA 1K7DA 3FYEB 2A0LA 1BGQA 1K34A 1BHBA 1R62A 2YE3A 3E8BA 4MVUA 1S3JA 3C11A 3ABKB 3G4SV 4E00A 1BKNA 4FCRA 3STZC 2IU3A 4HZ5A 4PRVA 4R1FA 3RLPA 2QG0A 2YI0A 2B1IA 1QVFU 2WI7A 2WLHA 3K04A 2GHYA 3JD2A 1IXMA 2XDLA 4KSHA 1QLNA 3FYIB 2QF6A 3OPDA 3CCSV 2X6BA 1OSFA 4LWGA 5CF0A 4U7NA 3EKRA 4GX2A 4BAEA 2PNRA 2HLDG 2ZR2A 2IH1C 5IY5C 3FT5A 5M4KA 3CCQV 3NXSA 4P9PA 2HCHA 4LWHA 4E01A 5CPHA 3WQ9A 3FB8C 3OE7G 5L3BA 2QG2A 3OR6C 2CH4A 3NMQA 3W7SA 3LPSA 3ETGA 1GKFA 1ZW9A 5J71A 3U67A 3CC2V 3GIFA 4FMTA 2ZKJA 3RLQA 4PDRA 1R73A 1UYHA 2EIJC 4MS2A 1YJWV 5EC2C 2BYIA 4DXWA 3JCZA 4MBCA 1G4YB 4G28B 5B1BB 1M56B 2ZDIC 2BU7A 3VHCA 3ETEA 1R3JC 1DF4A 1YHQV 2VCIA 1DLBA 3GB7C 1QBZA 3D3IA 4HAMA 4RQFA 4FJCC 2EJRA 1MX0A 1RPOA 4G2KA 4JQLA 4JTAB 3HYYA 4P8OA 3ABLC 3A0YA 1H38A 2OTLV 4LWEA 4EM7A 2YECA 2Q68A 2OT5A 1RM1B 4R8CA 4TWKA 3OGCC 5L3FA 1GJVA 2CCTA 2YE4A 3H4LA 3K97A 4V25A 1Y8NA 1YSRA 2HVKC 4UROA 3CRKA 2DQ0A 2EXLA 4K4OA 3RVZA 1KQSU 3C0EA 4CE1A 2YE5A 3TUHA 3WG7B 1GO3F 3A0RA 5IYDO 3F7VC 4ZKIA 1S14A 1ZWIC 4GEEA 3ABLB 1QR9A 1KECA 2ZXWC 4ASUG 3X2QB 1YTFD 1EA6A 1S72V 2P90A 3CMAV 1YTFB 3JD3A 1BHAA 3T4DA 3TZ4A 4O07A 4AWPA 2UXXA 4CWTA 1F23A 2IJKA 1I5BA 1UJWB 4UXNA 2YE9A 4MVRA 2YSUB 4RQEA 1OZ0A 1DF5A 3BY6A 3OMNB 1GKXA 4PELA 1H7SA 2H55A 3FV5A 3E86A 1W0KG 2DWDC 1VQ6V 3CWVA 4XD8A 1FXVA 1V55B 4KQVA 4AS9A 2ZR3A 4MTXA 3QDDA 1VQOV 2EINC 3BEHA 2QM7A 1UY6A 5EBWC 4ASBA 2Q8IA 3A0XA 2WLKA 5IDJA 4H7QA 4PA4A 4U7OA 2WSSG 3IC7A 5LGTA 3CCRV 2PI4A 1YT0A 2R9RB 2FWYA 3IEDA 3SPCA 2YEBA 4XKOA 2VCJA 1K92A 3ZXOA 4PA7A 3K06A 3VHDA 2ZDYA 4B6CA 5L3GA 2CCUA 3R4NA 4O05A 2WI1A 5CBFA 4KUMA 2YE2A 4PL9A 2UXNA 2YE8A 2IJHA 4HZ0A 3FB6C 3PEHA 4HZ3A 4UV8A 2YKEA 4MPCA 5D7DA 4YXWG 5KA5A 3QTFA 4ASAA 4XDMA 2NLJC 2JJCA 1K3EA 1ENVA 3F7YC 1SETA 1TUEB 3AEIA 5B1AB 2OCCB 3RBZA 3RLRA 2DYSC 3QO7A 4MB9A 4EFTA 1SZTA 3JYCA 1PD3A 4H85A 1R6NA 1ZWHA 1GM8A 4CBCA 2WERA 4CWQA 1EBOA 1M9NA 1NVPB 4N23A 3RVYA 1RM1C 3FB5C 1NR7A 4MVSA 4JGSA 4J9YB 3LDDA 2YI6A 2JJ2G 1GTOA 2W6IG 3KG2A 4WFBV 3ETDA 4L93A 2YKBA 2Q69A 1NBMG 3OMAB 2X7RB 3ZRWB 1MSWD 1H7UA 2EIMC 2YEVB 4MVQA 1Y8OA 1QLEC 2HKOA 4GFNA 1YITV 4WUBA 4O09A 3OUSA 1AJNA 4XTJA 4YKXA 5D6PA 1S5HC 3P32A 1OCZB 2QM8A 5FNFA 5D7RA 3AG4B 1K97A 4NH9A 2HG1A 3ZMZA 1KP2A 3ZMTA 4ASGA 4FK5C 3A0TA 4QE7A 3CGYA 2R9IA 4RAIA 1VQ5V 4G27B 1PKXA 3ASOC 4JTDB 3BM9A 3OMUA 4EGIA 4CWPA 3AG4C 5BZBA 3LDEA 2HFEC 1SERA 4CWFA 4HY6A 2YEVA 4WFEA 2WLIB 1VQ9V 1I5CA 5DM6V 2WEQA 3B8NA 1JJ2U 3GIGB 4KSGA 2YEJA 2O1WA 1GKZA 4CWRA 5CMUA 4DO2A 4P30A 4LPBA 4WFGA 4LBEC 3Q5KA 4L90A 1OCRB 1Q81W 2XDUA 3CGZA 4YKUA 1S77D 4TSFG 5LGNA 4FIPC 1OCCB 2LFRA 1K4CC 1QYEA 1JPXA 4JPRA 3ZIAG 2WLIA 1AJ6A 1R3KC 4I9WA 5J6AA 2DYSB 4JYBA 2IU0A 2Y69B 3AG3B 3K9AA 2C2AA 3T4ZA 1K9MW 4H33A 2BZ5A 2CK3G 1E79G 3FT8A 4R50A 4EFUA 3ML0A 5L3CA 1B3QA 4F4LA 1VQLV 1ROPA 4WUCA 4CE3A 3X2QC 3AG1B 4OXSA 2YI7A 1PNKA 2YJXA 4BIZA 2XNDG 2XAJA 3AG3C 4QNHB 4GQTA 1THZA 3W7TA 1AMWA 3ZRVA 3HEKA 1PL0A 1KIJA 2NNUA 3K98A 1JQ0A 1Z5BA 3H80A 4LP8A 4E2LA 4GCZA 4NH8A 3ABMC 3FB7C 3LNUA 1PVGA 3CCMV 4HY1A 5KUMA 1OCOB 4YKWA 1FS0G 1SESA 3I56V 1S0VA 2EIKC 3DTUB 1TIDA 5F5RA 4LWFA 2W6JG 1R3IC 3QNEA 4H37A 4XDKA 3STLC 3ZJZA 4UUJC 4X9LA 4XE2A 5CTUA 1AI6A 5B1BC 2CGFA 3G7BA 3SPHA 1LNQA 2B5UA 2KB1A 5M4HA 2ZDIA 1Q7YW 4N21A 1U2OA 5D6QA 1ZXMA 3OW6A 2DWEC 4HYMA 2X6AA 2BU5A 2EBOA 3K08A 3T2MA 1G8MA 5CA3A 5IYBO 2VWCA 1MABG 2XHRA 2YE7A 3D2RA 3EHFA 3OEEG 3MNRP 3ZKBA 3JD1A 1VQ4V 1Y4MA 2WEPA 1F4MA 4BAYA 1M90W 2Z5UA 4MTGA 3ZRSA 1AH6A 4QIWF 3MD0A 3LSSA 1YI2V 2P67A 5IY5B 2BT0A 2IWUA 3HZ1A 3ZXQA 1XL6A 3ASNB 3ZRXA 1A4HA 1EI1A 3OW2U 1YS3A 5EK0A 1I5DA 3HB3B 1UYLA 3SYCA 2XDSA 1Q82W 3D0BA 4BQJA 3UKMA 4YKYA 1K5SA 1NJIW 4NH7A 3O0IA 4YKRA 3TETA 4Z1MG 3SYOA 2JEXA 3EHBB 3CCEV 1BYQA 3MHSC 4R7CA 1AH8A 2IOPA 1Z59A 1ID0A 2HVJC 2OCCC 4J9ZB 3A0WA 5L3EA 1S16A 1I59A 5FNCA 4LP0A 3VBBA 2PI5A 4L8ZA 3SYAA 3T10A 1VQ7V 1UYDA 3K03A 2XASA 1AROP 3M99B 4JAUA 4WFHA 4XDLA 2IJJA 3VOUA 2A79B 4PA9A 3HZ5A 5B1NA 3SYPA 4B7PA 3ABTA 1I58A 2W0FC 5B1OA 1Z5AA 3T1KA 3ZN0A 3E35A 1KZNA 3O6OA 5EBMC 1MOFA 3LNMB 4P9OA 1AR1B 2Y48A 1I5AA 3B28A 4DZYA 1NHIA 5M4EA 3CXCU 1YT2A 2AHZA 2DW4A 3ASNC 1VQ8V 2YK9A 4PDLA 5GGZA 1FXKB 4MTOA 1I5XA 1JX9A 3OEHG 5E1AC 2XDXA 5KA6A 2IWXA 3PEJA 2WI6A 3JD4A 3ZMVA 3Q5LA 4RO2A 2ATKC 3CPWU 1B63A 4XIRA 3TK1A 3OAAG 3F5WC 1NQTA 5H9CA 3TZ2A 3ZMUA 4WF9V 2XHXA 4HXZA 5FL7G 3U2KA 1U0ZA 2Q67A 3K60A 5CN0A 4BXIA 2YEAA 2DQ3A 1VQMV 4KFGA 1WLEA 2CCSA 1Q86W 2Q6AA 2WI5A 4GT8A 4P7AA 2FWZA 3WHAA 4XBFA 1YT1A 4QPJA 1V54C 3UM7A 4XDJA 3OMIB 4EGHA 1GM9A 1H2GA 4UVCA 2E0AA 3OWDA 2IJIA 1PNLA 3QO8A 3CC4V 2VW5A 1XL4A 3AG2B 2XJGA 4R3MA 2EIKB 3G7EA 2EILC 1YERA 1OCOC 3CCLV 4URNA 3DGEA 1YJ9V 4CZZA 1B6QA 1US7A 2ZBKB 3HPLC 4JAVA 3OFNG 4KTNA 4AWQA 1H8EG 4MW8A 3R92A 4CWSA 1YC4A 2WAMA 3IFXA 4FPPA 3K79A 3WFVA 2ZQMA 2IORA 4ASFA 3FKSG 2WWWA 3LDCA 3G71V 5LBQA 5B1AC 2XD6A 4HYPA 4LCUC 1YSCA 1BMFG 2X0LA 1UYGA 2FXSA 2BTZA 2WI3A 5BODA 3HHUA 5FWKA 2ZD9A 1UYEA 2WI4A 3OR7C 2XJXA 3AG1C 3ZMSA 3ZM7A 3RKZA 4YKZA 1UYKA 5LHHA 3B27A 2JEUA 3GWOA 1TC0A 3G75A 1EZJA 3E8FA 1HWYA 3SL2A 2WLLA 1UY9A 2GQPA 2XAGA 2HR3A 2JK5C 2O1VA 1AI7A 4GX0A 1TH8A 4WCEV 1VQNV 1TBWA 3JZ3A 3TZ5A 2IWSA 1OCCC 1VQPV 3CD6V 2XCMA 4JASA 3RW0A 5LHIA 2XX2A 3B25A 2H8MA 3EHHA 2XX5A 3B24A 1COWG 4PRXA 5CBHA 5D7CA 5EBLC 1K73W 1S76D 3INWA 2JDIG 1UYCA 4MP2A 2XDKA 4RUFA 3D36A 2Q8GA 2XAFA 1V55C 2WLNA 4XITA 2WLLB 5CBGA 1ZXNA 4MW3A 4UVAA 2YEFA 2YEGA 2XOKG 1UYFA 4MOTA 1GM7A 5EC1C 1YIJV 3H01A 3EHJA 3TTZA 4PDMA 4BIUA 1KKDA 5M4NA 4I3HA 1FXKA 1K8AW 4MVZA 1GMGA 1N8RW 4XIQA 4L91A 2BRCA 2ZXWB 1P4RA 2D3OW 4GX1A 4HXWA 1B62A 3A0ZA 3LSQA 4MVMA 2Q8HA 2O1UA 1J95A 4BW5A 2Y69C 2QKSA 3WG7C 4URMA 5H6RA 2BREA 4XKAA 3EHGA 1YESA 4CWOA 4X89A 4JTCB 5CTWA 5C93A 2QE7G 2DYRC 3T2SA 1YETA 3TZ0A 4XC0A 4ZBMA 3EKOA 1QY8A 2QTOA 1PNMA 3W7XA 3SPJA 3LUTB 2WLJA 5BOCA 4L87A 1TILA 2K5BA 2HJFC 3E2EA 1SRYA 3P30A 2AKPA 2YKCA 5CTYA 2IOQA 5J9PC 2EILB 4ZVIA 2WPDG 4UVBA 2B1GA 3AG2C 3SPIA 1K4DC 3HYZA 4LWIA 1M56C 3ZCCA 1UY7A 3K0GA 2YGFA 1UY8A 5IN9A 3B26A 1F51A 3CCJV 3GIEA 3OWBA 4KFMA 2EIJB 2BYHA 3OUFA 3I55V 3ASOB 1MU5A 4WUDA 4RUEA 3PJSK 3E89A 1BL8A 3IGAC 3B77A 1FFTB 4JF3A 1UYIA 1F4NA 3SYQA 1MG1A 3R4MA 1W0JG 2AHYA 3W7WA 2LFSA 5B3SC 4GGLA 1OCZC 4O04A 4KP4A 4FCQA 4WFFA 2M7WA 2F43G 3JD0A 4TT3G 1RPRA 4V26A 4XKKA 3T0ZA 1P7BA 1NH2D 2XAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MPE A;  2YGA A;  1THN A;  4PU9 A;  2BU6 A;  5CTX A;  5IDM A;  3R91 A;  1Y4U A;  2ESA A;  3R4O A;  2HKJ A;  1Y8P A;  4E02 A;  2YI5 A;  2YK2 A;  4MT8 A;  4FCP A;  3SL2 A;  3GIG A;  2Q8F A;  2FTK A;  1Y4S A;  4R3A A;  2YEH A;  2BU8 A;  3K99 A;  3O2F A;  2BSM A;  4U93 A;  3BMY A;  4W7T A;  2FYP A;  4QPK A;  1AM1 A;  2XK2 A;  3U2D A;  3INX A;  2YKI A;  1JOY A;  3ZKD A;  4XCL A;  2XHT A;  5FND A;  4EEH A;  4EGK A;  2XJJ A;  4LC1 A;  2GFD A;  4Q20 A;  1YC3 A;  4I5S A;  2YEE A;  4GT1 A;  1JM6 A;  2JKI A;  2WI2 A;  2YEI A;  2YJW A;  3KE6 A;  5L3J A;  4BQG A;  5M4M A;  2XX4 A;  1BXD A;  3ZRW A;  4AWO A;  4L94 A;  4H81 A;  4YKQ A;  1YSZ A;  2QFO A;  1QZR A;  2YE6 A;  3R4P A;  3VAD A;  2BU2 A;  1NHJ A;  3T0H A;  1Z5C A;  2YED A;  4URL A;  4XCJ A;  4YKT A;  2YKJ A;  4DUH A;  1L0O A;  1UYM A;  2ZDX A;  2XAB A;  2Q2E B;  4O0B A;  1TC6 A;  2UWD A;  2YGE A;  4CWN A;  3CRL A;  4XIP A;  3VHA A;  1NHH A;  4EMV A;  5F3K A;  4JYC A;  5M4P A;  4MPN A;  4CE2 A;  3Q5J A;  1YC1 A;  2CG9 A;  1BGQ A;  1R62 A;  2YE3 A;  3C11 A;  4E00 A;  1BKN A;  4FCR A;  4HZ5 A;  4PRV A;  4R1F A;  3RLP A;  2QG0 A;  2WI7 A;  4KSH A;  1IXM A;  2XDL A;  2QF6 A;  3OPD A;  1OSF A;  4LWG A;  5CF0 A;  4U7N A;  3EKR A;  4BAE A;  2PNR A;  3FT5 A;  5M4K A;  3NXS A;  2HCH A;  4LWH A;  4E01 A;  5CPH A;  3WQ9 A;  2QG2 A;  2CH4 A;  3NMQ A;  3LPS A;  5J71 A;  1ZW9 A;  3U67 A;  3GIF A;  4FMT A;  2ZKJ A;  3RLQ A;  1UYH A;  2BYI A;  2BU7 A;  3VHC A;  2VCI A;  1MX0 A;  4JQL A;  3HYY A;  4P8O A;  3A0Y A;  4LWE A;  4EM7 A;  2YEC A;  3H4L A;  1GJV A;  2CCT A;  2YE4 A;  3K97 A;  4V25 A;  1Y8N A;  1YSR A;  3CRK A;  2EXL A;  4K4O A;  3TUH A;  3C0E A;  2YE5 A;  3A0R A;  4ZKI A;  1S14 A;  4GEE A;  1EA6 A;  3TZ4 A;  4AWP A;  4O07 A;  4CWT A;  1I5B A;  2YE9 A;  3FV5 A;  1GKX A;  1H7S A;  2H55 A;  4XD8 A;  3CWV A;  4AS9 A;  4KQV A;  4MTX A;  3QDD A;  2QM7 A;  1UY6 A;  2Q8I A;  3A0X A;  5IDJ A;  4H7Q A;  4U7O A;  3IED A;  1YT0 A;  2FWY A;  2YEB A;  4XKO A;  2VCJ A;  3ZXO A;  3VHD A;  2ZDY A;  4B6C A;  2CCU A;  3R4N A;  4O05 A;  2WI1 A;  2YE2 A;  4PL9 A;  2YE8 A;  4HZ0 A;  3PEH A;  2YKE A;  4MPC A;  5D7D A;  3QTF A;  4ASA A;  4XDM A;  2JJC A;  3RLR A;  4EFT A;  4MB9 A;  4H85 A;  1ZWH A;  2WER A;  4CWQ A;  2YI6 A;  4L93 A;  2YKB A;  1Y8O A;  3ZRW B;  1H7U A;  4CE1 A;  4GFN A;  4WUB A;  4YKX A;  5D6P A;  4O09 A;  4XTJ A;  3P32 A;  2QM8 A;  5FNF A;  5D7R A;  4NH9 A;  2HG1 A;  4ASG A;  3A0T A;  3CGY A;  3OMU A;  4EGI A;  3BM9 A;  4CWP A;  4CWF A;  4HY6 A;  3GIG B;  1I5C A;  4KSG A;  5BOD A;  2WEQ A;  2YEJ A;  2O1W A;  1GKZ A;  4CWR A;  4LPB A;  3Q5K A;  4L90 A;  2XDU A;  3CGZ A;  4YKU A;  2LFR A;  1QYE A;  1AJ6 A;  5J6A A;  4JYB A;  2C2A A;  2BZ5 A;  3FT8 A;  4EFU A;  1B3Q A;  4WUC A;  4CE3 A;  2YI7 A;  2YJX A;  4BIZ A;  4GQT A;  1AMW A;  3ZRV A;  3HEK A;  1KIJ A;  3K98 A;  1Z5B A;  3H80 A;  4GCZ A;  4NH8 A;  3LNU A;  4HY1 A;  1PVG A;  4YKW A;  5F5R A;  4LWF A;  4XE2 A;  4X9L A;  5CTU A;  2CGF A;  3G7B A;  5M4H A;  1U2O A;  5D6Q A;  1ZXM A;  3OW6 A;  4HYM A;  2BU5 A;  2VWC A;  2YE7 A;  3D2R A;  2XHR A;  3EHF A;  3MNR P;  3ZKB A;  2WEP A;  1AH6 A;  3HZ1 A;  3MD0 A;  2BT0 A;  2IWU A;  2P67 A;  1A4H A;  3ZRX A;  1EI1 A;  1YS3 A;  1I5D A;  1UYL A;  2XDS A;  3D0B A;  4BQJ A;  4YKY A;  4NH7 A;  3O0I A;  4YKR A;  1BYQ A;  1AH8 A;  2IOP A;  1Z59 A;  1ID0 A;  3A0W A;  1S16 A;  1I59 A;  5FNC A;  4LP0 A;  4L8Z A;  4AWQ A;  3T10 A;  1UYD A;  4YKZ A;  2YI0 A;  4JAU A;  4URO A;  3HZ5 A;  5B1N A;  4B7P A;  1I58 A;  5B1O A;  1Z5A A;  3T1K A;  1KZN A;  3O6O A;  1I5A A;  3B28 A;  4DZY A;  1NHI A;  5M4E A;  1YT2 A;  2YK9 A;  5GGZ A;  4MP7 A;  2XDX A;  2IWX A;  3PEJ A;  2WI6 A;  3Q5L A;  1B63 A;  3TZ2 A;  3ZXQ A;  4XIR A;  3TK1 A;  2XHX A;  4HXZ A;  3U2K A;  1U0Z A;  3K60 A;  4BXI A;  2YEA A;  4KFG A;  2WI5 A;  2CCS A;  4GT8 A;  4P7A A;  3WHA A;  2FWZ A;  1YT1 A;  4QPJ A;  4EGH A;  3OWD A;  2E0A A;  2VW5 A;  2XJG A;  4R3M A;  3G7E A;  1YER A;  4URN A;  3DGE A;  1US7 A;  2ZBK B;  4JAV A;  4KTN A;  3R92 A;  4CWS A;  1YC4 A;  4FPP A;  2IOR A;  4ASF A;  2WWW A;  2XD6 A;  4HYP A;  1UYG A;  2FXS A;  2WI3 A;  2BTZ A;  3HHU A;  5FWK A;  1UYE A;  2XJX A;  2WI4 A;  3ZM7 A;  3RKZ A;  1UYK A;  3B27 A;  1TC0 A;  3G75 A;  1UY9 A;  2GQP A;  2O1V A;  1TH8 A;  1TBW A;  3JZ3 A;  3TZ5 A;  2IWS A;  2XCM A;  4JAS A;  2XX2 A;  3B25 A;  3EHH A;  2H8M A;  2XX5 A;  3B24 A;  4PRX A;  5D7C A;  4MP2 A;  3INW A;  1UYC A;  2XDK A;  3D36 A;  2Q8G A;  4XIT A;  1ZXN A;  2YEF A;  2YEG A;  1UYF A;  4MOT A;  3TTZ A;  3EHJ A;  4BIU A;  5M4N A;  4I3H A;  4XIQ A;  4L91 A;  2BRC A;  4HXW A;  1B62 A;  3A0Z A;  2Q8H A;  2O1U A;  4URM A;  4XKA A;  4ASB A;  4CWO A;  2BRE A;  3EHG A;  1YES A;  5CTW A;  5C93 A;  3T2S A;  1YET A;  3TZ0 A;  4XC0 A;  3EKO A;  1QY8 A;  5BOC A;  1TIL A;  2K5B A;  2AKP A;  5CTY A;  2YKC A;  2IOQ A;  4ZVI A;  3HYZ A;  4LWI A;  3ZCC A;  5IN9 A;  1UY7 A;  2YGF A;  1UY8 A;  3B26 A;  1F51 A;  3GIE A;  3OWB A;  2BYH A;  1MU5 A;  4WUD A;  1UYI A;  3R4M A;  2LFS A;  4GGL A;  4O04 A;  4KP4 A;  4FCQ A;  4V26 A;  4XKK A;  3T0Z A;  1TID A;  4MBC A; 
#chains in the Genus database with same CATH topology
 4LFA O;  2QWP B;  5EIB D;  3BAB A;  1AJQ A;  1CEZ A;  5L3D A;  2A7W A;  4UB8 Z;  2JJ1 G;  3JAK B;  3B8M A;  4UCR A;  2EIN B;  4EKW A;  1QCE A;  2N74 A;  1TUB A;  1OHH G;  2YK2 A;  4FCP A;  5CB4 A;  1JVM A;  4TQD A;  1Y4S A;  5HFL A;  4U3F H;  1SQB H;  1HNW B;  3LNN A;  2OTJ V;  4QPK A;  1R6K A;  1W2B U;  1YJN V;  1QVG U;  3U2D A;  1JOY A;  4JI1 O;  4X8A A;  5FND A;  1OV9 A;  1OJH A;  2QM4 A;  4I0X A;  3N2K A;  3HKE A;  4DV5 O;  4DK0 A;  5GTI Z;  3DXR A;  4JI0 O;  4I5S A;  2YEE A;  4DR6 O;  4GT1 A;  1K33 A;  5GON B;  1SQV H;  2UUB O;  5L3J A;  4FVM A;  1GN2 A;  4GKK B;  3ZRW A;  3F5T A;  4L94 A;  4O2A A;  1E1R G;  5B3S B;  4PA6 A;  4FLY A;  2EUL A;  2QFO A;  2Q8V A;  1NR1 A;  1SF9 A;  4HBN A;  4KHP O;  4QE9 A;  4JV5 B;  3OM3 B;  2BOB C;  1WA8 B;  1UYM A;  2XAB A;  2Q2E B;  2X6C A;  3ZN1 A;  2CUG A;  1FXK C;  4TQF A;  2O57 A;  2MK3 A;  5JWP A;  1CXZ B;  4NKG B;  3TJT A;  1NHH A;  5LGU A;  1N32 B;  3EFF K;  4MPN A;  4CE2 A;  2Q7E A;  3SJC C;  3C3S A;  1K7D A;  2OIG A;  3FYE B;  5KLV H;  3E8B A;  2YE3 A;  4MVU A;  4B3T B;  1S3J A;  3L73 H;  3C11 A;  3G4S V;  4E00 A;  3STZ C;  4HZ5 A;  1QNM A;  3RLP A;  1QVF U;  4U3J B;  4ZHQ B;  4NXM O;  3K04 A;  3JD2 A;  2XDL A;  5KHI A;  1QLN A;  1Y74 A;  2QF6 A;  1OSF A;  2X6B A;  4NTX A;  2PNR A;  2HLD G;  3NXS A;  4ZI7 A;  4E01 A;  1NI8 A;  4YY3 B;  1BT8 A;  2HHI A;  3WQ9 A;  1EN5 A;  3OE7 G;  5L3B A;  4GYC B;  3W7S A;  5J71 A;  1ZW9 A;  3CC2 V;  2QWQ B;  2EIJ C;  1YJW V;  1XDC A;  4DXW A;  4FLW A;  4BIO A;  2BU7 A;  2YS8 A;  1R6T A;  4TV9 B;  3U10 A;  3GB7 C;  1MX0 A;  1QBZ A;  4TUY B;  2ETN A;  1TVK A;  3L71 H;  4RQF A;  1RPO A;  1XHX A;  4G2K A;  4JZG A;  3A0Y A;  4K8Z A;  4LWE A;  2OT5 A;  3H4L A;  4TWK A;  3K97 A;  1Y8N A;  5KHH A;  4CH5 A;  3H1I H;  2LW7 A;  2YE5 A;  2YIA A;  3K5M A;  4ZKI A;  1Q6H A;  4GEE A;  4YJ3 A;  3ABL B;  1NTM H;  1QR9 A;  4EB6 A;  3X2Q B;  4H13 B;  3S5T A;  2UXX A;  4CWT A;  5LA6 B;  1I5B A;  2GUZ B;  2YSU B;  3HKB A;  4IIJ B;  1DF5 A;  1H7S A;  4NXM B;  3E86 A;  2DWD C;  1VQ6 V;  4XD8 A;  1FXV A;  3H9V A;  4MTX A;  3H1H H;  3BEH A;  3QG5 A;  1H2K A;  2QM7 A;  4X1Y A;  4PA4 A;  5JCO C;  2WSS G;  3IED A;  2PI4 A;  1YT0 A;  1S5J A;  3SPC A;  3ZXO A;  4LFB B;  3CJH A;  4A5U B;  5IT9 N;  3DSQ A;  2YE8 A;  2CGO A;  4UV8 A;  4MPC A;  1HNX B;  4YJ2 B;  2CAZ C;  1Q6U A;  1RP3 B;  1SET A;  1EN6 A;  3QO7 A;  1JA8 A;  1R6N A;  4JV5 O;  2WER A;  4CWQ A;  1N4C A;  4D7S A;  3JAM N;  4MVS A;  2W6I G;  1L0N H;  3ZX6 A;  2Y4U A;  1H7U A;  1VIB A;  3OUS A;  2CE4 A;  1S5H C;  4JI8 B;  3TGU H;  4X1I A;  4JI0 B;  2YIB D;  3AG4 B;  4NH9 A;  3BVO A;  3ZMZ A;  1EZV H;  1XRE A;  1KP2 A;  5LMU B;  4JI1 B;  2CTQ A;  4CWP A;  2ZE6 A;  4UCV A;  4H44 B;  1WP7 A;  2HFE C;  2Y0P A;  1TVK B;  4LF4 O;  2YEV A;  4WFE A;  1I5C A;  4CWF A;  5DM6 V;  3B8N A;  1Q6I A;  1GKZ A;  4P30 A;  4LPB A;  1O9G A;  2PF4 E;  4JI2 O;  3T1H O;  3CB2 A;  2ZCE A;  3VQY A;  3CGZ A;  1S77 D;  5LGN A;  1NTK H;  3UQ8 A;  5J2T B;  1I94 O;  1QYE A;  4WBN A;  2HP8 A;  4DV7 O;  4JPR A;  1LUV A;  1R3K C;  4I9W A;  2DYS B;  2JGD A;  1Z5V A;  4JYB A;  2IU0 A;  2Y69 B;  3K9A A;  3J81 N;  1E79 G;  3FT8 A;  5L3C A;  2UUC O;  3K58 A;  1VQL V;  2QKA A;  3KKY A;  2Q0O C;  5IWA O;  2R9A A;  4FM2 A;  2XAJ A;  3AG3 C;  4QNH B;  3BAA A;  4CH3 A;  1DGS A;  4UFZ A;  3K98 A;  1Z5B A;  1D2D A;  4E2L A;  4GCZ A;  4NH8 A;  2HHH O;  4LF5 O;  4HNA A;  4HY1 A;  1SZX A;  2ZIO A;  5KUM A;  5LXT A;  1ZSP A;  3I56 V;  5F5R A;  2EIK C;  3DTU B;  1TID A;  1WN7 A;  1R3I C;  4XDK A;  1AI6 A;  4OPA A;  5B1B C;  1PP9 H;  2AW9 A;  1LNQ A;  2KB1 A;  5M4H A;  1N34 O;  2ZDI A;  3WB0 A;  1IUR A;  1U2O A;  4N21 A;  1ZXM A;  3K08 A;  4DR4 O;  2VWC A;  2YE7 A;  5CA3 A;  1MAB G;  1MMM A;  1M90 W;  2Q0A A;  3ZRS A;  1YI2 V;  4B3S B;  4KHP B;  1EI1 A;  3HB3 B;  3D0B A;  4YIO A;  1NJI W;  3HKE B;  1XBL A;  4JYY A;  4Z1M G;  3SYO A;  2JEX A;  2UUB B;  1BYQ A;  2LJ2 A;  1MZE A;  3MHS C;  4R7C A;  1AH8 A;  4CH6 A;  3CYG A;  4J9Z B;  2QWO B;  2F4V B;  3T10 A;  1VQ7 V;  3K03 A;  3M99 B;  4XDL A;  3HZ5 A;  2RDC A;  3ABT A;  1KZN A;  3O6O A;  5LP6 A;  2LGW A;  3CXC U;  2UXD B;  1U97 A;  2AHZ A;  1VQ8 V;  5GGZ A;  4PDL A;  3A8T A;  4LWS A;  4MP7 A;  2XDX A;  4BR6 A;  5KA6 A;  2WI6 A;  3JD4 A;  3Q5L A;  3CPW U;  2ATK C;  2N04 A;  1NQT A;  1WP8 A;  3ZMU A;  4X65 O;  2BCC H;  3RWR D;  4DUY O;  2BSK A;  2QSA A;  4I50 A;  2YEA A;  1X4T A;  2CCS A;  1Q86 W;  2Q6A A;  4GT8 A;  3WHA A;  2YXY A;  1V54 C;  4AHC A;  3OMI B;  5KHK A;  4GKJ O;  4EGH A;  3OWD A;  4UVC A;  2IJI A;  3QO8 A;  3CC4 V;  4X9Q A;  1XL4 A;  3N2G A;  4R3M A;  2EIK B;  3CCL V;  5EYP A;  4U3J A;  3IFX A;  3JAK A;  3K79 A;  2FML A;  2WWW A;  3JAW B;  4F6R B;  2FXS A;  1KBH A;  3CX5 F;  2F95 B;  3OR7 C;  3L9D A;  1SQG A;  1UYK A;  2JEU A;  2XHB A;  1Q90 D;  1EZJ A;  1HWY A;  4DR1 B;  2WLL A;  1UY9 A;  4FZ0 A;  1D5N A;  4GX0 A;  4X20 A;  4JI7 O;  2IWS A;  3CD6 V;  4YJ3 B;  4EB6 B;  3B25 A;  2FB5 A;  3OTO B;  1B04 A;  1COW G;  1L8D A;  5CBH A;  5EBL C;  4NB5 A;  3INW A;  3D36 A;  2Q8G A;  1V55 C;  2WLN A;  3L72 H;  4UVA A;  2XOK G;  1UYF A;  2BTQ B;  4E72 A;  1GM7 A;  3H01 A;  1BCC H;  4BIU A;  4I3H A;  4CS4 A;  4DR4 B;  4OX9 O;  2P22 C;  3AK1 A;  1P4R A;  4NXN O;  3LSQ A;  4XKA A;  4BW5 A;  4ASB A;  3WG7 C;  5H6R A;  4X1K B;  1NT2 B;  4DR5 O;  5CTW A;  4O4J A;  2DYR C;  3OTF A;  4XC0 A;  2QTO A;  2P06 A;  2HJF C;  1R1B A;  4K8X A;  2VWK A;  3SJA C;  4E4E A;  2JGD B;  3RYI A;  1K4D C;  1KYO F;  3ZCC A;  1UY7 A;  5IWA B;  2EIJ B;  2BYH A;  3OUF A;  4WUD A;  1FJG B;  4RUE A;  5DEC A;  4B3M O;  3IGA C;  3R4M A;  5KMG B;  4KP4 A;  4WFF A;  2F43 G;  1ZAU A;  2XAH A;  1NH2 D;  2YGA A;  4PU9 A;  1K5Q A;  1BZK A;  1WPX A;  1KKC A;  5CTX A;  2BTO A;  4X88 A;  2EZP A;  2ITC C;  2E5L O;  2P7T C;  3W7U A;  3N27 A;  4MSW C;  3CEI A;  2YI5 A;  4WFA V;  3GIG A;  1W59 A;  4DR7 O;  1MNG A;  1NS1 A;  4R3A A;  2ZNJ A;  3K99 A;  2BSM A;  3BMY A;  4W7T A;  1P84 F;  5GW7 A;  3CC7 V;  1CPY A;  4CH4 A;  3R65 A;  5LOV B;  2PZS A;  3CYO A;  4HYO A;  3INX A;  1H2M A;  1M93 A;  4XCL A;  4PDV A;  1AI5 A;  2ZT9 B;  4J7Z A;  4MVO A;  1H8H G;  4QJF B;  1AR4 A;  4O4I A;  1RSO A;  2L6L A;  4Q20 A;  1HR0 O;  1YC3 A;  3FX7 A;  1OCR C;  2YDE A;  5A9G A;  2YUA A;  1VF5 B;  2XX4 A;  4FFK A;  2H8P C;  4YKQ A;  1YSZ A;  1AB3 A;  1IX9 A;  4C7U A;  1NHJ A;  2GUZ A;  2YED A;  4URL A;  4XCJ A;  4YKT A;  1R3L C;  1AJP A;  4IHJ A;  4K0K B;  5IJ9 B;  4DR3 B;  2ZDX A;  3FAV A;  1WJZ A;  1PM9 A;  3UO3 A;  1AIL A;  2RQ6 A;  3HKC B;  3TXS A;  4UV9 A;  1TC6 A;  2EIM B;  3T1C A;  3WB2 A;  4X65 B;  2BOC C;  4LF9 O;  3CRL A;  1T5E A;  1ORQ C;  4GX5 A;  4R6Z A;  5DN6 G;  1NH2 B;  5M4P A;  4JI6 B;  3Q5J A;  1NVP D;  2CG9 A;  4Z1V A;  2V1D A;  4LF8 B;  1K34 A;  1R62 A;  4TUY A;  1ZLZ A;  4PI0 A;  1BKN A;  4FCR A;  4B08 A;  4PRV A;  3CCS V;  5JCO A;  2NR5 A;  5TIS Z;  3ZHQ A;  2IH1 C;  5IY5 C;  3FT5 A;  4DUZ O;  2QG2 A;  2GTS A;  3OR6 C;  4LF6 B;  3ETG A;  4X1I B;  3M7M X;  4O2B B;  3GIF A;  4FMT A;  3RLQ A;  1R73 A;  3D3Q A;  1UYH A;  1N0N A;  4IT5 A;  4LFC O;  4G28 B;  2RMK B;  1R3J C;  1DF4 A;  2VCI A;  4FJC C;  4JAA A;  5ITZ A;  4JTA B;  2Q7H A;  2E5L B;  2OTL V;  3JAS A;  2Q68 A;  3RYF A;  4R8C A;  3T1Y B;  3OGC C;  1GJV A;  2CCT A;  4AI8 A;  5JJN B;  4L8J A;  2PYL A;  2EX3 A;  5LP6 B;  1KQS U;  3C0E A;  1GO3 F;  2A3Q A;  3F7V C;  4NTW A;  2ZXW C;  4ASU G;  1YTF B;  3CMA V;  3ZHV A;  1BHA A;  3TZ4 A;  2MW2 B;  1F23 A;  4NVP A;  2UXC B;  2HHH B;  2YE9 A;  4MVR A;  4X64 B;  1OZ0 A;  3FV5 A;  2QTS A;  2UXC O;  1W0K G;  3E22 B;  2EIN C;  2XTA A;  5EBW C;  3UO2 A;  4Q6G A;  2HJD A;  4H7Q A;  1GN3 A;  3IC7 A;  1AP6 A;  4XKO A;  2VCJ A;  1K92 A;  5GON A;  3T1Y O;  2Q9L A;  5L3G A;  2CCU A;  1FFX B;  1KUQ A;  2YE2 A;  1QHT A;  4PL9 A;  2IJH A;  2QDO A;  3PEH A;  2YKE A;  5KMG A;  5D7D A;  4YXW G;  5KA5 A;  4ZOL B;  2F23 A;  2NLJ C;  2GBO A;  1ENV A;  5B1A B;  3RBZ A;  5IJ0 B;  4JI2 B;  4DUZ B;  3RLR A;  3JYC A;  1JMK C;  4H85 A;  1ZWH A;  1EBO A;  3RVY A;  3FB5 C;  4DR1 O;  3LDD A;  4BW9 A;  1Y8O A;  2KG7 A;  4CE1 A;  4MVQ A;  1QLE C;  4I55 A;  4YKX A;  1YIT V;  5D6P A;  4O09 A;  2VRZ A;  1RFY A;  2QM8 A;  2PUS A;  4O4J B;  2Q73 A;  2HG1 A;  2OCH A;  2JS5 A;  5JJE B;  4RAI A;  1VQ5 V;  4G27 B;  4JTD B;  3CHX A;  5JEN A;  2CH7 B;  2YI8 A;  1JJ2 U;  3RT3 C;  1PL4 A;  5CMU A;  2YXL A;  1J5E B;  2E3C A;  3Q5K A;  5IYZ A;  4K0K O;  4LNU B;  4YKU A;  2IBZ H;  1VF6 C;  1K4C C;  3G6B A;  2Y0I A;  2WLI A;  5J6A A;  1XMQ B;  1MSD A;  3T4Z A;  1K9M W;  3TXQ A;  2CK3 G;  4R50 A;  1J5E O;  4YIP A;  1ROP A;  4WUC A;  4GLX A;  4TV9 A;  4J10 A;  1N36 B;  2YI7 A;  1ZTE A;  2YJX A;  1BS3 A;  5AG2 A;  2KQX A;  2XND G;  4CC6 A;  4ZI7 B;  3W7T A;  1VMG A;  3ZHR A;  1PL0 A;  2YID A;  3JSL A;  4LP8 A;  1XNQ O;  3JAW A;  4F6R A;  2Q5Z A;  1EM1 A;  1S0V A;  2W6J G;  3H1J H;  2CGF A;  3G7B A;  3SPH A;  4I4T A;  2YI9 A;  1H2L A;  5D6Q A;  3OW6 A;  4HYM A;  2X6A A;  2EBO A;  3T2M A;  3D2R A;  4FLV A;  3OEE G;  3MNR P;  4QGP A;  3EXA A;  1Y4M A;  3PN1 A;  2Z5U A;  4MTG A;  4QIW F;  3MD0 A;  3LSS A;  2IWU A;  1XL6 A;  1IBM O;  1UYL A;  3SYC A;  1Q82 W;  4O4L B;  3FD9 A;  2CTP A;  3O0I A;  3SJB C;  4O4I B;  3TET A;  4KXR A;  1U96 A;  5IYZ B;  5FPR A;  4LF5 B;  1N34 B;  2HVJ C;  2OCC C;  5J2T A;  3BA8 A;  4ICG A;  1I59 A;  3VBB A;  2PI5 A;  2XT9 A;  5D5Q A;  4AWQ A;  1UYD A;  4URO A;  1ARO P;  2A79 B;  4PA9 A;  4DYL A;  5CA1 A;  1I58 A;  1Z5A A;  3T1K A;  3ZN0 A;  3E35 A;  1AR1 B;  4DZY A;  5M4E A;  1Y76 A;  1YT2 A;  3RYC B;  3LMM A;  5IJ9 A;  2YK9 A;  4MTO A;  3RN4 A;  1I5X A;  3EVK A;  5CA0 A;  3FFQ A;  3SGI A;  1BGY H;  5H2F Z;  1S5L Z;  4XIR A;  1EN4 A;  5KAF Z;  4WF9 V;  1DK1 A;  1B06 A;  1IBM B;  4HXZ A;  5FL7 G;  5CN0 A;  4OX9 B;  4KFG A;  1WLE A;  2WI5 A;  2FWZ A;  1YT1 A;  4QPJ A;  3UM7 A;  2E0A A;  3AG2 B;  2XJG A;  2NN4 A;  2ZIM A;  1FD9 A;  5LYJ A;  1N0J A;  4PD4 F;  4J41 A;  1B6Q A;  3HPL C;  3OFN G;  1H8E G;  3T1H B;  3IJ4 A;  1YC4 A;  4JI7 B;  5E79 Z;  4DK1 A;  3B4S A;  4HYP A;  2WI3 A;  2ZD9 A;  2WI4 A;  3ZM7 A;  4LH6 A;  4F6E A;  2E76 B;  3G75 A;  1H2S B;  3E8F A;  2GQP A;  1AVM A;  3ZHS A;  2JK5 C;  4FFB A;  1AI7 A;  1TH8 A;  1H2N A;  1TBW A;  1ZX3 A;  1BQ0 A;  3TZ5 A;  1YVW A;  4K3A A;  3B24 A;  4PRX A;  5D7C A;  4PJ0 Z;  1K73 W;  4X66 O;  4RUF A;  4DV0 O;  2QR4 A;  5CBG A;  1VF7 A;  2R72 A;  2CTR A;  4O4H B;  1YIJ V;  4PDM A;  3AK2 A;  4JI3 O;  1K8A W;  2BRC A;  4HXW A;  1B62 A;  3A0Z A;  5BMV B;  2Y69 C;  1QQC A;  4X89 A;  2QE7 G;  4ABM A;  4B3R O;  4DV0 B;  3TZ0 A;  4ZBM A;  4LFA B;  1QY8 A;  3EKO A;  1PNM A;  1Y76 B;  2LW1 A;  1WNS A;  2YKC A;  3D36 C;  2ZE5 A;  4TV8 A;  5JH7 A;  5IN9 A;  1M56 C;  3K0G A;  3B26 A;  3OWB A;  4J42 A;  3SDL A;  1HR0 B;  3I55 V;  2VS0 A;  3E89 A;  1X59 A;  3B77 A;  1FFT B;  1UYI A;  3SYQ A;  1MG1 A;  2AHY A;  1GH6 A;  1Y67 A;  3G67 A;  1VEW A;  5CB4 B;  4V26 A;  2M7W A;  1RPR A;  5BR8 O;  2CDY A;  4MTF A;  1UPG A;  1THN A;  1M57 B;  1QU7 A;  2ITD C;  3B09 A;  2BU6 A;  4CC5 A;  2RJZ A;  3TCU A;  3R91 A;  1Y4U A;  1KD1 W;  2JS3 A;  1Q5O A;  3R4O A;  2HKJ A;  3K9S A;  3E8H A;  1Y8P A;  3ZHU A;  2KSD A;  4E02 A;  3SL2 A;  3ABK C;  1EFR G;  1DTO A;  2FTK A;  4NTY A;  3JSN A;  1XQ8 A;  4P2Z A;  3O2F A;  1NZ6 A;  3B2E E;  1IVS A;  3DXR B;  2DJV A;  1VQK V;  1I08 A;  1AM1 A;  2V4D A;  4X64 O;  2XK2 A;  2YKI A;  2OWO A;  4DRX B;  1GRJ A;  1GAX A;  2XHT A;  4EFB A;  1JFF A;  4EGK A;  4JZ2 A;  2LQT A;  2XJJ A;  2RNB A;  3SJQ C;  5EYP B;  5LHG A;  1JCH A;  4AQY O;  2A06 H;  1TGO A;  5IYC O;  1L1F A;  2DN9 A;  1VAR A;  2YEI A;  1M57 C;  1GK9 A;  3KE6 A;  1N32 O;  2A9H A;  2UUC B;  2IW5 A;  4H81 A;  5JVD B;  1F7Y A;  3CP1 A;  3GWK C;  2BU2 A;  1CP9 A;  3L75 H;  4LFC B;  2YKJ A;  1NU1 H;  3SPG A;  4DUH A;  1WB8 A;  1QR8 A;  1L0O A;  2HG5 C;  1YCI A;  1UFI A;  2P6J A;  2XAQ A;  4NXN B;  4O0B A;  3G6E V;  3BPZ A;  1QLE B;  5KUK A;  1M1K W;  3CME V;  3E83 A;  3CCU V;  2WLM A;  3CCV V;  2UWD A;  2YGE A;  4XIP A;  3VHA A;  1NKD A;  3K3W A;  5HFM A;  4EMV A;  5F3K A;  2EZO A;  4JYC A;  4OGQ B;  1AI4 A;  5LMU O;  4W4K A;  1YC1 A;  2A0L A;  1BGQ A;  1BHB A;  1KMI Z;  1WPB A;  2WA3 A;  3JCU Z;  3ABK B;  2GTA A;  1P7G A;  1ZL8 B;  2IU3 A;  4JYA O;  2B1I A;  3KCX A;  2QWN B;  2WI7 A;  4LF8 O;  2GHY A;  4KSH A;  1IXM A;  1SKV A;  3FYI B;  3OPD A;  4DV5 B;  5CF0 A;  4U7N A;  4BAE A;  2ZR2 A;  5LMN B;  5M4K A;  3UT5 A;  4P9P A;  2HCH A;  3FB8 C;  3DC6 A;  4JI6 O;  3LPS A;  1GKF A;  1FAF A;  4X1K A;  2ZKJ A;  4PDR A;  1IZ3 A;  4MS2 A;  5EC2 C;  3E22 A;  4LFB O;  4LF9 B;  1XMQ O;  1M56 B;  2ZDI C;  3ETE A;  4TOI A;  5EZY A;  1DLB A;  4HAM A;  2EJR A;  4JQL A;  4P8O A;  1H38 A;  4PV1 B;  4EM7 A;  1RM1 B;  4V25 A;  2AZ2 A;  2HEP A;  1YSR A;  2HVK C;  3RYH B;  2DQ0 A;  2EXL A;  4K4O A;  3RVZ A;  1HDJ A;  3K59 A;  2C1G A;  4PI2 A;  4X66 B;  3A0R A;  3L70 H;  3D8C A;  2PY5 A;  1S14 A;  1P49 A;  4DV4 O;  1KEC A;  2VQE O;  1EA6 A;  2P90 A;  3JD3 A;  4X1Y B;  4O07 A;  3RFR A;  2IJK A;  4FLT A;  3BY6 A;  2H55 A;  3BA9 A;  3CWV A;  1URF A;  2ZR3 A;  1XMO B;  3ICX A;  3QDD A;  1FYJ A;  1UY6 A;  1TUB B;  2Q8I A;  3ETQ A;  3A0X A;  2WLK A;  5IDJ A;  4DR2 O;  3B40 A;  4DV6 B;  5C8Y A;  2R9R B;  2FWY A;  5JQG B;  2BE3 A;  2YEB A;  3GVM A;  4D6T H;  3R4N A;  2WI1 A;  4KUM A;  2UXN A;  4HZ0 A;  2JGU A;  4HZ3 A;  2G38 A;  3QF7 A;  3QTF A;  3KZI Z;  4XDM A;  1G6U A;  4DR2 B;  1K3E A;  2JJC A;  3F7Y C;  4DV2 B;  5FPO A;  2ZM6 B;  2OCC B;  4EFT A;  2LGQ A;  1ZUQ A;  2BTQ A;  4FFB B;  1M9N A;  1NVP B;  4N23 A;  1NR7 A;  4J9Y B;  1AR5 A;  3WB1 A;  2Z0A A;  2JJ2 G;  1XHZ A;  4WFB V;  3ETD A;  4L93 A;  2Q69 A;  1FPO A;  1NBM G;  2RN9 A;  3ZRW B;  3HKD B;  2EIM C;  2YEV B;  4GFN A;  2HKO A;  4WUB A;  1JJO A;  1AJN A;  4XTJ A;  4B3T O;  1G1X B;  3P32 A;  1OCZ B;  4PHZ A;  1K97 A;  1IBL B;  3ZMT A;  4ASG A;  4QE7 A;  2XUM A;  2ILM A;  2R9I A;  3CGY A;  3OMU A;  3ASO C;  3BM9 A;  4EGI A;  3AG4 C;  3LDE A;  3OGI B;  1SER A;  4B7E A;  4HY6 A;  2WLI B;  1VQ9 V;  4KSG A;  3L74 H;  2YEJ A;  2O1W A;  4ZHQ A;  1I94 B;  4CWR A;  3K5N A;  4LBE C;  1OCR B;  2PGG A;  3J7A U;  4X20 B;  3BHP A;  3M8A A;  4TSF G;  1OCC B;  2LFR A;  3RGB A;  1MZF A;  3ZIA G;  1AJ6 A;  2UXB O;  2C2A A;  4GKK O;  4H33 A;  4UCU A;  2ZIN A;  4IGG A;  3ML0 A;  5LMN O;  1KB9 F;  4CE3 A;  4OXS A;  3THO A;  4GQT A;  5LP6 C;  3ZRV A;  3HEK A;  5F2V O;  2JVD A;  2NNU A;  1JQ0 A;  4DR6 B;  4JI8 O;  5DED A;  3LNU A;  4YKW A;  1SES A;  2QWR B;  4H37 A;  3STL C;  4XE2 A;  4UUJ C;  4X9L A;  4BWA A;  3BRC A;  2B5U A;  1N36 O;  1I7F A;  5LA6 A;  1Q7Y W;  4JI4 O;  2W0X A;  3P3N A;  1M5I A;  3H1L H;  1G8M A;  2CGN A;  5IYB O;  2XHR A;  5K1P A;  1D5A A;  1M4U A;  5GTH Z;  5LXT B;  4J11 A;  3JD1 A;  1VQ4 V;  4J7K A;  3VQX A;  3HZ1 A;  2BT0 A;  2P67 A;  5IY5 B;  1A4H A;  4FZ1 A;  3ZRX A;  2GDS A;  3CS5 A;  1YS3 A;  4FM1 A;  1VP7 A;  5EK0 A;  1I5D A;  2XDS A;  4BQJ A;  4NYK A;  1US6 A;  4YKR A;  4O4H A;  3SR2 C;  1LR1 A;  4DUY B;  1Z59 A;  1ID0 A;  2D2C B;  5L3E A;  4L8Z A;  4YKZ A;  2YI0 A;  2IJJ A;  5B1N A;  3SYP A;  5KHG A;  1TA8 A;  2W0F C;  4J7J A;  5B1O A;  4YHH O;  5EBM C;  1BSM A;  1I5A A;  3B28 A;  2ADP A;  5A2Q N;  1NHI A;  3ASN C;  4CS3 A;  1AP5 A;  1FXK B;  1JX9 A;  3OEH G;  5E1A C;  3O9O A;  2AGA A;  2WA4 A;  2F4V O;  3ZXQ A;  4RO2 A;  3ZS8 C;  3WU2 Z;  3OAA G;  3F5W C;  5H9C A;  4UB6 Z;  1IBK O;  2XHX A;  1RSO B;  1U0Z A;  4BXI A;  3JAL B;  1VQM V;  4P7A A;  4XBF A;  2Q7G A;  4LWS B;  4DR7 B;  1PNL A;  3JAR A;  3Q4H A;  1Q43 A;  1SA0 B;  2ARH A;  4B7K A;  2EIL C;  1YER A;  3IC9 A;  1OCO C;  3G7E A;  4B3S O;  1Q3E A;  3DGE A;  1YJ9 V;  3S3W A;  1US7 A;  2ZBK B;  3N2K B;  4JAV A;  2L35 A;  4CWS A;  1XMO O;  2ZQM A;  2IOR A;  4ASF A;  3FKS G;  3QTC A;  3LDC A;  4GUN A;  3G71 V;  5LBQ A;  2VQF B;  2XD6 A;  4LCU C;  4LF7 B;  2X0L A;  2BTZ A;  3HKC A;  1HP8 A;  3HHU A;  5FWK A;  1UYE A;  2XJX A;  3AG1 C;  3ZMS A;  3ZED A;  3RKZ A;  4B3M B;  2VQE B;  2UU9 O;  1FJG O;  3DC5 A;  2XAG A;  2O1V A;  3OD4 A;  4WCE V;  1VQN V;  1XOU A;  2H8M A;  2M6Y A;  1S76 D;  2JDI G;  1UYC A;  3CRR A;  2XAF A;  2WLL B;  1ZXN A;  4MW3 A;  2YEF A;  2YEG A;  5EIB C;  4MOT A;  4UCT A;  5EC1 C;  3RYH A;  4EEQ A;  2EJ7 A;  1N8R W;  4XIQ A;  5K1X A;  4DV3 B;  4GX1 A;  2D3O W;  2R70 A;  1L0L H;  2Q8H A;  4ZIB A;  2O1U A;  4URM A;  5JQG A;  2BRE A;  4JTC B;  4OPH A;  3ZHT A;  3SPJ A;  2RCV A;  2DE0 X;  2K5B A;  3E2E A;  1SRY A;  3K5L A;  2AKP A;  2IOQ A;  4KL1 A;  5J9P C;  2EIL B;  2YC0 A;  4ZVI A;  2WPD G;  2B1G A;  4LWI A;  5IJ0 A;  4H0L B;  3CCJ V;  3GIE A;  3JAL A;  1XNQ B;  3A0B Z;  3NR7 A;  1MU5 A;  1BL8 A;  1F4N A;  4W4L A;  2LFS A;  3JAT B;  1ZL8 A;  4O04 A;  2UXB B;  4FCQ A;  4TT3 G;  3JD0 A;  2DMX A;  1S72 V;  4MBC A;  1P7B A;  4MPE A;  5IDM A;  3ABM B;  3MAQ A;  2ESA A;  1JR9 A;  2YIB A;  2AZ0 A;  5CA0 B;  2DYR B;  1XI1 A;  4MT8 A;  1E1Q G;  3U0Z A;  2Q8F A;  3HKD A;  2H94 A;  2YEH A;  2BU8 A;  2LP7 A;  2IH3 C;  4U93 A;  2FYP A;  2QJ1 A;  3K5O A;  5H6Q A;  4IYI A;  4IYH A;  1IBL O;  3N2G B;  3ZKD A;  2UU9 B;  3CE2 A;  4UCS A;  4EEH A;  1I5Y A;  4LC1 A;  2GSM B;  3MHH C;  2GFD A;  2C1I A;  2V7Q G;  2BSK B;  1Z5W A;  4LF7 O;  3CRQ A;  1KP3 A;  1JM6 A;  2JKI A;  2WI2 A;  3QO5 A;  1YF2 A;  1HNZ O;  3E8G A;  2Z3Y A;  2YJW A;  3BFR A;  4DV1 O;  4BQG A;  5M4M A;  2JIZ G;  1WB7 A;  1BXD A;  2IM9 A;  4AWO A;  2K1E A;  3K0D A;  1V54 B;  4ZOL A;  4Z2W A;  2JRI A;  4DV2 O;  1QZR A;  3CXH F;  2YE6 A;  3R4P A;  3VAD A;  2Y4T A;  1Z5C A;  5B5E Z;  3T0H A;  1Y6X A;  2ZE8 A;  2QA4 V;  1FXH A;  2AXT Z;  1KC8 W;  3APQ A;  5J2U A;  1V9P A;  2Q4P A;  4IL6 Z;  5FNV B;  3ABU A;  5KX5 B;  2QEX V;  5BR8 B;  4PA3 A;  4X62 O;  4CWN A;  3A2F A;  1Y66 A;  1IBK B;  1YDX A;  3JAR B;  3Q4H B;  3UT5 B;  1GN4 A;  2CH7 A;  4R1F A;  2QG0 A;  1O9H A;  1BE3 H;  2WLH A;  4LWG A;  3EKR A;  4B3R B;  4GX2 A;  3CCQ V;  3R66 A;  2YIC A;  4LWH A;  5CPH A;  3UCS C;  2CH4 A;  1XEQ A;  3NMQ A;  3CRA A;  3U67 A;  4JI3 B;  3HR0 A;  2CTW A;  2BYI A;  3AG7 A;  3JCZ A;  1G4Y B;  5B1B B;  3VHC A;  1YHQ V;  4DV7 B;  3D3I A;  3HYY A;  4LH7 A;  4CS2 A;  3ABL C;  4FLX A;  4I0X B;  4AIL C;  2YEC A;  5L3F A;  2YE4 A;  5FLX N;  3CRK A;  1FFX A;  4JI4 B;  5J2U B;  3TUH A;  3WG7 B;  2H3O A;  5IYD O;  5FNV A;  1GN6 A;  5KX5 A;  4LF4 B;  1ZWI C;  3OTO O;  3OT7 A;  1YTF D;  3T4D A;  4AWP A;  3JAS B;  2PTM A;  1UJW B;  4UXN A;  4RQE A;  3OMN B;  1GKX A;  4PEL A;  1WA8 A;  1KU9 A;  4DW1 A;  4AS9 A;  1V55 B;  4KQV A;  3IAY A;  4DRX A;  1VQO V;  5D5P A;  1SA0 A;  1XNR B;  5ITZ B;  2QGN A;  3KCY A;  4U7O A;  5LGT A;  3CCR V;  2P4K A;  1SQP H;  2ZE7 A;  4PA7 A;  3K06 A;  3VHD A;  2ZDY A;  4B6C A;  3RYC A;  4O05 A;  5CBF A;  3J80 N;  3FB6 C;  4DV3 O;  4ASA A;  2UUA O;  1JFF B;  1TUE B;  3AEI A;  3I5D A;  2DYS C;  4MB9 A;  1SZT A;  4EFE A;  1PD3 A;  4IHJ B;  1GM8 A;  4CBC A;  4LNU A;  4HNA B;  3AK3 A;  1RM1 C;  5KAI Z;  4JGS A;  2YI6 A;  1GTO A;  3KG2 A;  4AQY B;  2LO1 A;  3OMA B;  2YKB A;  2X7R B;  4I7Z B;  5JJJ B;  1MSW D;  2FL4 A;  2QKC A;  2ZKO A;  1N33 O;  3G80 A;  3APO A;  5FNF A;  5D7R A;  3U11 A;  3CJH B;  2N05 A;  4FK5 C;  3A0T A;  3BCC H;  2B9Z A;  1PKX A;  2ZM6 O;  5BZB A;  3GIG B;  5BOD A;  2WEQ A;  4DO2 A;  1XIL A;  4WFG A;  4L90 A;  1Q81 W;  2XDU A;  2FYU H;  4X62 B;  4FIP C;  4LF6 O;  1JPX A;  3AG3 B;  2BZ5 A;  4EFU A;  1B3Q A;  4F4L A;  3X2Q C;  3AG1 B;  3C3T A;  5EZY B;  1YZB A;  3LSU A;  1PNK A;  4BIZ A;  4YY3 O;  1NTZ H;  1THZ A;  1AMW A;  3JAT A;  2KKW A;  1Z2G A;  1YEW A;  3A0H Z;  2PYJ A;  1KIJ A;  3H80 A;  2VWJ A;  4I50 B;  4YHH B;  3ABM C;  3FB7 C;  4JI5 O;  1PVG A;  3CCM V;  1OCO B;  1FS0 G;  2E74 B;  4LWF A;  3ZJZ A;  5CTU A;  4TV8 B;  5JH7 B;  1HW7 A;  4DV4 B;  3RYI B;  4WBN B;  1MA1 A;  5BXZ A;  5BY1 A;  1SQF A;  4NR1 A;  2OYQ A;  3VQV A;  2DWE C;  4O4L A;  2BU5 A;  1Y74 B;  3EHF A;  2ADQ B;  2F1M A;  4DR3 O;  3ZKB A;  2WEP A;  4RWU A;  1F4M A;  4BAY A;  1AH6 A;  2UUA B;  4I9Q A;  3ASN B;  2P4V A;  3OW2 U;  5JVD A;  1BQZ A;  1XNR O;  3UKM A;  5CA1 B;  4YKY A;  1K5S A;  4NH7 A;  1XUQ A;  5KHJ A;  3EHB B;  3CCE V;  2IOP A;  4GZR B;  3A0W A;  1S16 A;  5FNC A;  4LP0 A;  2E75 B;  3SYA A;  4WFH A;  2XAS A;  4JAU A;  3VOU A;  4B7P A;  5C8Y B;  5IE9 A;  1MOF A;  5LOV A;  3LNM B;  4P9O A;  2Y48 A;  1SQQ H;  4JYA B;  2DW4 A;  2IWX A;  3PEJ A;  3ZMV A;  1B63 A;  3TZ2 A;  3TK1 A;  2KG7 B;  4DW0 A;  3VQW A;  1LUW A;  3U2K A;  2Q67 A;  1IXB A;  3K60 A;  4FLU A;  2DQ3 A;  3HKB B;  4IIJ A;  1HNW O;  3K57 A;  3CSX A;  1SS3 A;  1VF6 A;  4XDJ A;  1GM9 A;  1H2G A;  1I0H A;  2VW5 A;  1HNX O;  5B66 Z;  1FKA O;  4K35 A;  4URN A;  4CZZ A;  2ZNI A;  4KTN A;  4GKJ B;  4MW8 A;  5LL6 Y;  3R92 A;  2F66 C;  1SQX H;  2WAM A;  2DOS A;  4FPP A;  3ZBH A;  1IDS A;  3WFV A;  1PPJ H;  5B1A C;  1UYG A;  1YSC A;  1BMF G;  5LYJ B;  1PV0 A;  5LHH A;  2UXD O;  3B27 A;  1WAZ A;  3GWO A;  1TC0 A;  4JI5 B;  2P5O A;  2HR3 A;  2GV9 A;  3C90 A;  3JZ3 A;  1Q8I A;  4D7T A;  3CRC A;  1OCC C;  4DR5 B;  2YXH A;  1VQP V;  4JAS A;  3FAV B;  3RW0 A;  5LHI A;  2XCM A;  2XX2 A;  3EHH A;  2XX5 A;  2F93 B;  4YJ2 A;  2OIE A;  4MP2 A;  3O65 A;  2XDK A;  2VQF O;  4XIT A;  2K9P A;  3TTZ A;  3EHJ A;  1KKD A;  5M4N A;  1FXK A;  4MVZ A;  1GMG A;  1A32 A;  3MDS A;  1YXB A;  4FLZ A;  4L91 A;  2ZXW B;  4O2A B;  4I4T B;  2ODM A;  4MVM A;  4I55 B;  1J95 A;  2QKS A;  4CWO A;  3S3X A;  3EHG A;  4O2B A;  1YES A;  5C93 A;  3T2S A;  1HNZ B;  4FM0 A;  1YET A;  5H5N A;  4DV6 O;  3W7X A;  3LUT B;  2WLJ A;  5BOC A;  4L87 A;  1TIL A;  1N33 B;  3P30 A;  5CTY A;  4LR3 A;  4DV1 B;  4UVB A;  3AG2 C;  3SPI A;  3HYZ A;  3RYF B;  2YGF A;  1UY8 A;  1F51 A;  4KFM A;  1SC5 B;  2FKX A;  3ASO B;  3PJS K;  3CRM A;  4J80 A;  4JF3 A;  1W0J G;  3QVN A;  3W7W A;  3CWB H;  5B3S C;  4GGL A;  1OCZ C;  4UCO A;  3H1K H;  4XKK A;  3T0Z A;  1TAE A;  3QNE A;  5BMV A;  3P3P A; 
#chains in the Genus database with same CATH homology
 4MPE A;  2YGA A;  4MTF A;  1K5Q A;  1THN A;  1M57 B;  4PU9 A;  1WPX A;  1AJQ A;  2ITD C;  5L3D A;  1CEZ A;  2BU6 A;  5CTX A;  5IDM A;  4X88 A;  2JJ1 G;  3TCU A;  2EZP A;  3ABM B;  3B8M A;  1Y4U A;  1KD1 W;  2ESA A;  3R91 A;  2ITC C;  3R4O A;  2EIN B;  4EKW A;  2P7T C;  2HKJ A;  1QCE A;  3W7U A;  1Y8P A;  3E8H A;  4MSW C;  2DYR B;  4E02 A;  1OHH G;  2YI5 A;  4WFA V;  4MT8 A;  1E1Q G;  3ABK C;  2YK2 A;  3GIG A;  1EFR G;  1DTO A;  4FCP A;  2Q8F A;  2FTK A;  1JVM A;  4P2Z A;  2H94 A;  1Y4S A;  4R3A A;  2YEH A;  2BU8 A;  3K99 A;  2LP7 A;  2BSM A;  2IH3 C;  5HFL A;  3O2F A;  3BMY A;  4U93 A;  4W7T A;  5GW7 A;  2FYP A;  3CC7 V;  1CPY A;  2OTJ V;  3R65 A;  4QPK A;  1R6K A;  5H6Q A;  1VQK V;  1W2B U;  3CYO A;  1AM1 A;  4HYO A;  1YJN V;  1QVG U;  2XK2 A;  3U2D A;  3INX A;  2YKI A;  1JOY A;  3ZKD A;  4XCL A;  4PDV A;  1AI5 A;  2XHT A;  4X8A A;  5FND A;  4EEH A;  4EGK A;  4MVO A;  1I5Y A;  2XJJ A;  1H8H G;  3SJQ C;  4LC1 A;  5LHG A;  2GSM B;  4QJF B;  1JCH A;  3MHH C;  2GFD A;  2V7Q G;  4Q20 A;  1YC3 A;  4I5S A;  5IYC O;  2YEE A;  1L1F A;  1OCR C;  1K33 A;  1KP3 A;  4GT1 A;  1JM6 A;  2JKI A;  2WI2 A;  3QO5 A;  2YEI A;  3E8G A;  1M57 C;  1GK9 A;  2Z3Y A;  2YJW A;  3KE6 A;  2A9H A;  5L3J A;  4BQG A;  5M4M A;  2IW5 A;  2JIZ G;  2XX4 A;  1BXD A;  3ZRW A;  4AWO A;  2K1E A;  3K0D A;  1V54 B;  1E1R G;  2H8P C;  5B3S B;  4H81 A;  4L94 A;  4PA6 A;  1YSZ A;  2QFO A;  4YKQ A;  3CP1 A;  1QZR A;  2YE6 A;  3R4P A;  3VAD A;  1NR1 A;  2BU2 A;  1NHJ A;  3T0H A;  1Z5C A;  4QE9 A;  2YED A;  1CP9 A;  4URL A;  4XCJ A;  2QA4 V;  4YKT A;  3OM3 B;  1R3L C;  2YKJ A;  1FXH A;  1AJP A;  2BOB C;  3SPG A;  4DUH A;  1QR8 A;  1KC8 W;  1L0O A;  2HG5 C;  1UYM A;  2ZDX A;  2XAB A;  2P6J A;  2Q2E B;  2X6C A;  2XAQ A;  4O0B A;  3ZN1 A;  3ABU A;  1FXK C;  3G6E V;  1QLE B;  4UV9 A;  2QEX V;  2EIM B;  3T1C A;  5KUK A;  3CME V;  1M1K W;  1TC6 A;  3E83 A;  3CCU V;  2WLM A;  4PA3 A;  2BOC C;  3CCV V;  2UWD A;  2MK3 A;  2YGE A;  4CWN A;  3CRL A;  1ORQ C;  4GX5 A;  4XIP A;  3VHA A;  1NKD A;  1NHH A;  5LGU A;  3K3W A;  4R6Z A;  5DN6 G;  5HFM A;  5F3K A;  3EFF K;  4EMV A;  1Y66 A;  2EZO A;  4JYC A;  4MP7 A;  1AI4 A;  1NH2 B;  5M4P A;  4MPN A;  4CE2 A;  3Q5J A;  1NVP D;  1YC1 A;  2CG9 A;  2V1D A;  1K7D A;  3FYE B;  2A0L A;  1BGQ A;  1K34 A;  1BHB A;  1R62 A;  2YE3 A;  3E8B A;  4MVU A;  1S3J A;  3C11 A;  3ABK B;  3G4S V;  4E00 A;  1BKN A;  4FCR A;  3STZ C;  2IU3 A;  4HZ5 A;  4PRV A;  4R1F A;  3RLP A;  2QG0 A;  2YI0 A;  2B1I A;  1QVF U;  2WI7 A;  2WLH A;  3K04 A;  2GHY A;  3JD2 A;  1IXM A;  2XDL A;  4KSH A;  1QLN A;  3FYI B;  2QF6 A;  3OPD A;  3CCS V;  2X6B A;  1OSF A;  4LWG A;  5CF0 A;  4U7N A;  3EKR A;  4GX2 A;  4BAE A;  2PNR A;  2HLD G;  2ZR2 A;  2IH1 C;  5IY5 C;  3FT5 A;  5M4K A;  3CCQ V;  3NXS A;  4P9P A;  2HCH A;  4LWH A;  4E01 A;  5CPH A;  3WQ9 A;  3FB8 C;  3OE7 G;  5L3B A;  2QG2 A;  3OR6 C;  2CH4 A;  3NMQ A;  3W7S A;  3LPS A;  3ETG A;  1GKF A;  1ZW9 A;  5J71 A;  3U67 A;  3CC2 V;  3GIF A;  4FMT A;  2ZKJ A;  3RLQ A;  4PDR A;  1R73 A;  1UYH A;  2EIJ C;  4MS2 A;  1YJW V;  5EC2 C;  2BYI A;  4DXW A;  3JCZ A;  4MBC A;  1G4Y B;  4G28 B;  5B1B B;  1M56 B;  2ZDI C;  2BU7 A;  3VHC A;  3ETE A;  1R3J C;  1DF4 A;  1YHQ V;  2VCI A;  1DLB A;  3GB7 C;  1QBZ A;  3D3I A;  4HAM A;  4RQF A;  4FJC C;  2EJR A;  1MX0 A;  1RPO A;  4G2K A;  4JQL A;  4JTA B;  3HYY A;  4P8O A;  3ABL C;  3A0Y A;  1H38 A;  2OTL V;  4LWE A;  4EM7 A;  2YEC A;  2Q68 A;  2OT5 A;  1RM1 B;  4R8C A;  4TWK A;  3OGC C;  5L3F A;  1GJV A;  2CCT A;  2YE4 A;  3H4L A;  3K97 A;  4V25 A;  1Y8N A;  1YSR A;  2HVK C;  4URO A;  3CRK A;  2DQ0 A;  2EXL A;  4K4O A;  3RVZ A;  1KQS U;  3C0E A;  4CE1 A;  2YE5 A;  3TUH A;  3WG7 B;  1GO3 F;  3A0R A;  5IYD O;  3F7V C;  4ZKI A;  1S14 A;  1ZWI C;  4GEE A;  3ABL B;  1QR9 A;  1KEC A;  2ZXW C;  4ASU G;  3X2Q B;  1YTF D;  1EA6 A;  1S72 V;  2P90 A;  3CMA V;  1YTF B;  3JD3 A;  1BHA A;  3T4D A;  3TZ4 A;  4O07 A;  4AWP A;  2UXX A;  4CWT A;  1F23 A;  2IJK A;  1I5B A;  1UJW B;  4UXN A;  2YE9 A;  4MVR A;  2YSU B;  4RQE A;  1OZ0 A;  1DF5 A;  3BY6 A;  3OMN B;  1GKX A;  4PEL A;  1H7S A;  2H55 A;  3FV5 A;  3E86 A;  1W0K G;  2DWD C;  1VQ6 V;  3CWV A;  4XD8 A;  1FXV A;  1V55 B;  4KQV A;  4AS9 A;  2ZR3 A;  4MTX A;  3QDD A;  1VQO V;  2EIN C;  3BEH A;  2QM7 A;  1UY6 A;  5EBW C;  4ASB A;  2Q8I A;  3A0X A;  2WLK A;  5IDJ A;  4H7Q A;  4PA4 A;  4U7O A;  2WSS G;  3IC7 A;  5LGT A;  3CCR V;  2PI4 A;  1YT0 A;  2R9R B;  2FWY A;  3IED A;  3SPC A;  2YEB A;  4XKO A;  2VCJ A;  1K92 A;  3ZXO A;  4PA7 A;  3K06 A;  3VHD A;  2ZDY A;  4B6C A;  5L3G A;  2CCU A;  3R4N A;  4O05 A;  2WI1 A;  5CBF A;  4KUM A;  2YE2 A;  4PL9 A;  2UXN A;  2YE8 A;  2IJH A;  4HZ0 A;  3FB6 C;  3PEH A;  4HZ3 A;  4UV8 A;  2YKE A;  4MPC A;  5D7D A;  4YXW G;  5KA5 A;  3QTF A;  4ASA A;  4XDM A;  2NLJ C;  2JJC A;  1K3E A;  1ENV A;  3F7Y C;  1SET A;  1TUE B;  3AEI A;  5B1A B;  2OCC B;  3RBZ A;  3RLR A;  2DYS C;  3QO7 A;  4MB9 A;  4EFT A;  1SZT A;  3JYC A;  1PD3 A;  4H85 A;  1R6N A;  1ZWH A;  1GM8 A;  4CBC A;  2WER A;  4CWQ A;  1EBO A;  1M9N A;  1NVP B;  4N23 A;  3RVY A;  1RM1 C;  3FB5 C;  1NR7 A;  4MVS A;  4JGS A;  4J9Y B;  3LDD A;  2YI6 A;  2JJ2 G;  1GTO A;  2W6I G;  3KG2 A;  4WFB V;  3ETD A;  4L93 A;  2YKB A;  2Q69 A;  1NBM G;  3OMA B;  2X7R B;  3ZRW B;  1MSW D;  1H7U A;  2EIM C;  2YEV B;  4MVQ A;  1Y8O A;  1QLE C;  2HKO A;  4GFN A;  1YIT V;  4WUB A;  4O09 A;  3OUS A;  1AJN A;  4XTJ A;  4YKX A;  5D6P A;  1S5H C;  3P32 A;  1OCZ B;  2QM8 A;  5FNF A;  5D7R A;  3AG4 B;  1K97 A;  4NH9 A;  2HG1 A;  3ZMZ A;  1KP2 A;  3ZMT A;  4ASG A;  4FK5 C;  3A0T A;  4QE7 A;  3CGY A;  2R9I A;  4RAI A;  1VQ5 V;  4G27 B;  1PKX A;  3ASO C;  4JTD B;  3BM9 A;  3OMU A;  4EGI A;  4CWP A;  3AG4 C;  5BZB A;  3LDE A;  2HFE C;  1SER A;  4CWF A;  4HY6 A;  2YEV A;  4WFE A;  2WLI B;  1VQ9 V;  1I5C A;  5DM6 V;  2WEQ A;  3B8N A;  1JJ2 U;  3GIG B;  4KSG A;  2YEJ A;  2O1W A;  1GKZ A;  4CWR A;  5CMU A;  4DO2 A;  4P30 A;  4LPB A;  4WFG A;  4LBE C;  3Q5K A;  4L90 A;  1OCR B;  1Q81 W;  2XDU A;  3CGZ A;  4YKU A;  1S77 D;  4TSF G;  5LGN A;  4FIP C;  1OCC B;  2LFR A;  1K4C C;  1QYE A;  1JPX A;  4JPR A;  3ZIA G;  2WLI A;  1AJ6 A;  1R3K C;  4I9W A;  5J6A A;  2DYS B;  4JYB A;  2IU0 A;  2Y69 B;  3AG3 B;  3K9A A;  2C2A A;  3T4Z A;  1K9M W;  4H33 A;  2BZ5 A;  2CK3 G;  1E79 G;  3FT8 A;  4R50 A;  4EFU A;  3ML0 A;  5L3C A;  1B3Q A;  4F4L A;  1VQL V;  1ROP A;  4WUC A;  4CE3 A;  3X2Q C;  3AG1 B;  4OXS A;  2YI7 A;  1PNK A;  2YJX A;  4BIZ A;  2XND G;  2XAJ A;  3AG3 C;  4QNH B;  4GQT A;  1THZ A;  3W7T A;  1AMW A;  3ZRV A;  3HEK A;  1PL0 A;  1KIJ A;  2NNU A;  3K98 A;  1JQ0 A;  1Z5B A;  3H80 A;  4LP8 A;  4E2L A;  4GCZ A;  4NH8 A;  3ABM C;  3FB7 C;  3LNU A;  1PVG A;  3CCM V;  4HY1 A;  5KUM A;  1OCO B;  4YKW A;  1FS0 G;  1SES A;  3I56 V;  1S0V A;  2EIK C;  3DTU B;  1TID A;  5F5R A;  4LWF A;  2W6J G;  1R3I C;  3QNE A;  4H37 A;  4XDK A;  3STL C;  3ZJZ A;  4UUJ C;  4X9L A;  4XE2 A;  5CTU A;  1AI6 A;  5B1B C;  2CGF A;  3G7B A;  3SPH A;  1LNQ A;  2B5U A;  2KB1 A;  5M4H A;  2ZDI A;  1Q7Y W;  4N21 A;  1U2O A;  5D6Q A;  1ZXM A;  3OW6 A;  2DWE C;  4HYM A;  2X6A A;  2BU5 A;  2EBO A;  3K08 A;  3T2M A;  1G8M A;  5CA3 A;  5IYB O;  2VWC A;  1MAB G;  2XHR A;  2YE7 A;  3D2R A;  3EHF A;  3OEE G;  3MNR P;  3ZKB A;  3JD1 A;  1VQ4 V;  1Y4M A;  2WEP A;  1F4M A;  4BAY A;  1M90 W;  2Z5U A;  4MTG A;  3ZRS A;  1AH6 A;  4QIW F;  3MD0 A;  3LSS A;  1YI2 V;  2P67 A;  5IY5 B;  2BT0 A;  2IWU A;  3HZ1 A;  3ZXQ A;  1XL6 A;  3ASN B;  3ZRX A;  1A4H A;  1EI1 A;  3OW2 U;  1YS3 A;  5EK0 A;  1I5D A;  3HB3 B;  1UYL A;  3SYC A;  2XDS A;  1Q82 W;  3D0B A;  4BQJ A;  3UKM A;  4YKY A;  1K5S A;  1NJI W;  4NH7 A;  3O0I A;  4YKR A;  3TET A;  4Z1M G;  3SYO A;  2JEX A;  3EHB B;  3CCE V;  1BYQ A;  3MHS C;  4R7C A;  1AH8 A;  2IOP A;  1Z59 A;  1ID0 A;  2HVJ C;  2OCC C;  4J9Z B;  3A0W A;  5L3E A;  1S16 A;  1I59 A;  5FNC A;  4LP0 A;  3VBB A;  2PI5 A;  4L8Z A;  3SYA A;  3T10 A;  1VQ7 V;  1UYD A;  3K03 A;  2XAS A;  1ARO P;  3M99 B;  4JAU A;  4WFH A;  4XDL A;  2IJJ A;  3VOU A;  2A79 B;  4PA9 A;  3HZ5 A;  5B1N A;  3SYP A;  4B7P A;  3ABT A;  1I58 A;  2W0F C;  5B1O A;  1Z5A A;  3T1K A;  3ZN0 A;  3E35 A;  1KZN A;  3O6O A;  5EBM C;  1MOF A;  3LNM B;  4P9O A;  1AR1 B;  2Y48 A;  1I5A A;  3B28 A;  4DZY A;  1NHI A;  5M4E A;  3CXC U;  1YT2 A;  2AHZ A;  2DW4 A;  3ASN C;  1VQ8 V;  2YK9 A;  4PDL A;  5GGZ A;  1FXK B;  4MTO A;  1I5X A;  1JX9 A;  3OEH G;  5E1A C;  2XDX A;  5KA6 A;  2IWX A;  3PEJ A;  2WI6 A;  3JD4 A;  3ZMV A;  3Q5L A;  4RO2 A;  2ATK C;  3CPW U;  1B63 A;  4XIR A;  3TK1 A;  3OAA G;  3F5W C;  1NQT A;  5H9C A;  3TZ2 A;  3ZMU A;  4WF9 V;  2XHX A;  4HXZ A;  5FL7 G;  3U2K A;  1U0Z A;  2Q67 A;  3K60 A;  5CN0 A;  4BXI A;  2YEA A;  2DQ3 A;  1VQM V;  4KFG A;  1WLE A;  2CCS A;  1Q86 W;  2Q6A A;  2WI5 A;  4GT8 A;  4P7A A;  2FWZ A;  3WHA A;  4XBF A;  1YT1 A;  4QPJ A;  1V54 C;  3UM7 A;  4XDJ A;  3OMI B;  4EGH A;  1GM9 A;  1H2G A;  4UVC A;  2E0A A;  3OWD A;  2IJI A;  1PNL A;  3QO8 A;  3CC4 V;  2VW5 A;  1XL4 A;  3AG2 B;  2XJG A;  4R3M A;  2EIK B;  3G7E A;  2EIL C;  1YER A;  1OCO C;  3CCL V;  4URN A;  3DGE A;  1YJ9 V;  4CZZ A;  1B6Q A;  1US7 A;  2ZBK B;  3HPL C;  4JAV A;  3OFN G;  4KTN A;  4AWQ A;  1H8E G;  4MW8 A;  3R92 A;  4CWS A;  1YC4 A;  2WAM A;  3IFX A;  4FPP A;  3K79 A;  3WFV A;  2ZQM A;  2IOR A;  4ASF A;  3FKS G;  2WWW A;  3LDC A;  3G71 V;  5LBQ A;  5B1A C;  2XD6 A;  4HYP A;  4LCU C;  1YSC A;  1BMF G;  2X0L A;  1UYG A;  2FXS A;  2BTZ A;  2WI3 A;  5BOD A;  3HHU A;  5FWK A;  2ZD9 A;  1UYE A;  2WI4 A;  3OR7 C;  2XJX A;  3AG1 C;  3ZMS A;  3ZM7 A;  3RKZ A;  4YKZ A;  1UYK A;  5LHH A;  3B27 A;  2JEU A;  3GWO A;  1TC0 A;  3G75 A;  1EZJ A;  3E8F A;  1HWY A;  3SL2 A;  2WLL A;  1UY9 A;  2GQP A;  2XAG A;  2HR3 A;  2JK5 C;  2O1V A;  1AI7 A;  4GX0 A;  1TH8 A;  4WCE V;  1VQN V;  1TBW A;  3JZ3 A;  3TZ5 A;  2IWS A;  1OCC C;  1VQP V;  3CD6 V;  2XCM A;  4JAS A;  3RW0 A;  5LHI A;  2XX2 A;  3B25 A;  2H8M A;  3EHH A;  2XX5 A;  3B24 A;  1COW G;  4PRX A;  5CBH A;  5D7C A;  5EBL C;  1K73 W;  1S76 D;  3INW A;  2JDI G;  1UYC A;  4MP2 A;  2XDK A;  4RUF A;  3D36 A;  2Q8G A;  2XAF A;  1V55 C;  2WLN A;  4XIT A;  2WLL B;  5CBG A;  1ZXN A;  4MW3 A;  4UVA A;  2YEF A;  2YEG A;  2XOK G;  1UYF A;  4MOT A;  1GM7 A;  5EC1 C;  1YIJ V;  3H01 A;  3EHJ A;  3TTZ A;  4PDM A;  4BIU A;  1KKD A;  5M4N A;  4I3H A;  1FXK A;  1K8A W;  4MVZ A;  1GMG A;  1N8R W;  4XIQ A;  4L91 A;  2BRC A;  2ZXW B;  1P4R A;  2D3O W;  4GX1 A;  4HXW A;  1B62 A;  3A0Z A;  3LSQ A;  4MVM A;  2Q8H A;  2O1U A;  1J95 A;  4BW5 A;  2Y69 C;  2QKS A;  3WG7 C;  4URM A;  5H6R A;  2BRE A;  4XKA A;  3EHG A;  1YES A;  4CWO A;  4X89 A;  4JTC B;  5CTW A;  5C93 A;  2QE7 G;  2DYR C;  3T2S A;  1YET A;  3TZ0 A;  4XC0 A;  4ZBM A;  3EKO A;  1QY8 A;  2QTO A;  1PNM A;  3W7X A;  3SPJ A;  3LUT B;  2WLJ A;  5BOC A;  4L87 A;  1TIL A;  2K5B A;  2HJF C;  3E2E A;  1SRY A;  3P30 A;  2AKP A;  2YKC A;  5CTY A;  2IOQ A;  5J9P C;  2EIL B;  4ZVI A;  2WPD G;  4UVB A;  2B1G A;  3AG2 C;  3SPI A;  1K4D C;  3HYZ A;  4LWI A;  1M56 C;  3ZCC A;  1UY7 A;  3K0G A;  2YGF A;  1UY8 A;  5IN9 A;  3B26 A;  1F51 A;  3CCJ V;  3GIE A;  3OWB A;  4KFM A;  2EIJ B;  2BYH A;  3OUF A;  3I55 V;  3ASO B;  1MU5 A;  4WUD A;  4RUE A;  3PJS K;  3E89 A;  1BL8 A;  3IGA C;  3B77 A;  1FFT B;  4JF3 A;  1UYI A;  1F4N A;  3SYQ A;  1MG1 A;  3R4M A;  1W0J G;  2AHY A;  3W7W A;  2LFS A;  5B3S C;  4GGL A;  1OCZ C;  4O04 A;  4KP4 A;  4FCQ A;  4WFF A;  2M7W A;  2F43 G;  3JD0 A;  4TT3 G;  1RPR A;  4V26 A;  4XKK A;  3T0Z A;  1P7B A;  1NH2 D;  2XAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...