4FPPA

Bacterial phosphotransferase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
205
structure length
205
Chain Sequence
PDFAAMLAARLCHDFISPASAIVSGLDLLEDPSAQDMRDDAMNLIASSARKLADLLQFTRVAFGASASAENFDSRELEKLAQGVFAHVRPTLDWQIEPQAMNKPSSRAVLNIAQIAASALPAGGVATVKGVAADGRFSIIADAKGPRARLRPEVLAGLKGEPLAEGLGGPWVQAAYLNALVRAAGGQIAVEIGEDRASIAAWVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphotransferase
publication title Structural insights into ChpT, an essential dimeric histidine phosphotransferase regulating the cell cycle in Caulobacter crescentus.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Transferase
total genus 66
structure length 205
sequence length 205
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10090 HPTransfase Histidine phosphotransferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fppA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4fppA02
1B62A 5M4MA 2XJJA 2ZDYA 4MPNA 5CTYA 2YI6A 4BQJA 1TC0A 3RKZA 1L0OA 2YGEA 1YETA 3TZ5A 2IOQA 2LFRA 2YK2A 4U7NA 2CCSA 5M4HA 3WHAA 4XC0A 4UROA 4BQGA 2O1WA 3HYZA 4L90A 1I5DA 5D6PA 1UYGA 1I58A 5IDMA 4EEHA 3H4LA 3R4PA 2CH4A 1UY7A 1UYMA 4E00A 3K98A 3R92A 5IN9A 4YKUA 4U93A 1UYHA 1UY8A 4NH7A 2Q8GA 4LC1A 3O6OA 1Y8OA 3MD0A 2XDXA 3B27A 3NMQA 4CWQA 3ZRXA 1I5CA 3DGEA 1EI1A 2BU5A 3TZ2A 4HXWA 5CTWA 4JYCA 1QZRA 2ZDXA 2ESAA 5FNDA 3ZXQA 4KP4A 1YC4A 3EHGA 4XKOA 1GKXA 3ZXOA 2QM8A 2YI5A 3D36A 3HZ1A 2YE5A 1YESA 4R3AA 1Y8PA 2YEIA 4ASBA 3Q5KA 3RLRA 3A0WA 4YKYA 1QY8A 3BM9A 2FXSA 3NXSA 4URMA 2O1UA 3A0YA 5C93A 5FNCA 4JYBA 5CPHA 2IWXA 4URNA 4H85A 1KIJA 1Z5BA 3A0XA 4NH8A 3GIFA 4YKRA 3TTZA 2Q8IA 2YI0A 1I5BA 2YECA 5F5RA 4QPJA 3P32A 4HZ0A 3INXA 3K97A 4L8ZA 3B26A 4EFTA 1YSRA 1TILA 5D7RA 4AWPA 2BU2A 2YKBA 4R1FA 3A0RA 4GEEA 4MP2A 4PRVA 3T10A 1Z5AA 1KZNA 5CTXA 3D2RA 1UYDA 3H80A 1S14A 3ZRWA 2YE4A 2XX2A 1UYCA 4BIZA 1YT2A 2YE3A 2XHTA 3CRKA 3R4OA 2EXLA 5GGZA 3EKOA 5B1NA 3GIGA 3VHCA 2XDUA 3K60A 4EGKA 1I5AA 4NH9A 2YKIA 4L91A 1ZXNA 2CG9A 2BTZA 4FCRA 3RLQA 2YE8A 2JJCA 3HEKA 4R3MA 1UYEA 4JAVA 4B6CA 4CWRA 4MOTA 2WI3A 3TUHA 2QFOA 4U7OA 2FWYA 1AH8A 2BREA 4PRXA 3CGZA 2JKIA 2YEHA 3CRLA 4XKKA 4EFUA 1BXDA 3TZ0A 4YKQA 3OPDA 1BYQA 2BU8A 4FPPA 4Q20A 3C0EA 4MBCA 4DZYA 4XCLA 3TK1A 2YE7A 4BXIA 3U2DA 1YSZA 5CF0A 2YJXA 1NHJA 5IDJA 5B1OA 3T1KA 3IEDA 4HXZA 4O05A 3OWBA 3EHHA 3T2SA 3G75A 4WUCA 4P8OA 1I59A 1NHIA 2BRCA 2YEFA 2HG1A 3T0HA 4CWPA 1YT0A 4GQTA 1BGQA 4XIPA 2YKCA 1OSFA 2YE6A 3OMUA 3ZRVA 4O09A 4BIUA 4KQVA 3B25A 1U0ZA 4O04A 1AMWA 4W7TA 2WI5A 4E02A 2H8MA 3O2FA 4XDMA 2AKPA 2WI6A 4B7PA 4MT8A 4KTNA 2IWUA 3A0TA 4XIQA 2YKJA 4LP0A 4CE1A 1TH8A 4WUDA 3FT8A 2VCJA 3RLPA 2HKJA 4FCPA 4PU9A 5D7DA 1JM6A 1MX0A 2Q8FA 2HCHA 2XDLA 4DUHA 2QG2A 5M4PA 2YEEA 1AH6A 3OWDA 3EHFA 2UWDA 2VCIA 1TBWA 2WI1A 3GIEA 2YEDA 4ZKIA 1TIDA 2YGFA 3O0IA 1Y4SA 4I3HA 2BYIA 2PNRA 1YERA 4JAUA 2XJGA 3QDDA 3VHDA 2XX5A 3KE6A 5L3JA 2YJWA 3WQ9A 4ASAA 4CWNA 4HYPA 1A4HA 1ID0A 4MPEA 1ZWHA 4GCZA 5FWKA 2YEGA 2XX4A 4HYMA 1US7A 2VW5A 2LFSA 3QTFA 1U2OA 4URLA 2BYHA 4FCQA 1AM1A 1PVGA 3C11A 4XCJA 4EGHA 2Q2EB 2O1VA 2YK9A 4V26A 2WI4A 5BOCA 4XKAA 2YEAA 1H7SA 1S16A 2YEJA 2YE9A 4XTJA 2QG0A 4KFGA 2QF6A 3TZ4A 4CWOA 4CE2A 2XCMA 3LNUA 2YI7A 1UYIA 3BMYA 1R62A 1IXMA 2BU6A 4XD8A 3PEHA 2CCUA 4WUBA 2XHXA 3U2KA 3JZ3A 4KSHA 5M4EA 2Q8HA 2CCTA 3FV5A 1UYLA 2FYPA 4HZ5A 2WERA 4O07A 1TC6A 3R4NA 4PL9A 1GJVA 3R4MA 4CWTA 4EGIA 1NHHA 2E0AA 5FNFA 4GGLA 4EMVA 2VWCA 3A0ZA 3Q5JA 2GFDA 2XD6A 2XJXA 2WEQA 4CE3A 5F3KA 2BZ5A 4LWHA 1F51A 3CGYA 2WI7A 1YC1A 2WWWA 4K4OA 4MTXA 4L94A 4JASA 2YKEA 4XE2A 4BAEA 4QPKA 1Z59A 4LWIA 2WEPA 1YS3A 4AWOA 4H7QA 1ZW9A 2ZKJA 1YC3A 2IWSA 1Y4UA 2BT0A 2K5BA 3CWVA 2YEBA 3ZKBA 4MPCA 1AJ6A 4YKXA 4CWSA 4L93A 4ZVIA 5D7CA 1UY6A 4YKTA 3SL2A 3EKRA 4YKZA 1GKZA 4LWEA 4LWFA 3D0BA 1UYFA 4GFNA 4P7AA 1YT1A 4LWGA 1B63A 3OW6A 1EA6A 4HY6A 4HY1A 3ZRWB 3INWA 4V25A 2CGFA 4FMTA 3PEJA 2WI2A 2YE2A 3GIGB 4ASFA 4EM7A 2XK2A 3R91A 3FT5A 2FTKA 1B3QA 4LPBA 5BODA 1Y8NA 4KSGA 4AS9A 2ZBKB 1JOYA 2XDSA 4H81A 3Q5LA 3HYYA 4JQLA 4XITA 2P67A 2IOPA 3T0ZA 3VADA 1QYEA 1UYKA 4E01A 2FWZA 3U67A 2QM7A 3LPSA 2BU7A 1ZXMA 1BKNA 3K99A 4O0BA 4AWQA 2GQPA 4I5SA 2XHRA 3ZKDA 5D6QA 4CWFA 3HHUA 3G7EA 4X9LA 2XABA 4YKWA 4GT1A 1MU5A 4MP7A 5J6AA 3ZCCA 1UY9A 2BSMA 4GT8A 3B28A 2C2AA 4MB9A 2H55A 3B24A 3G7BA 1THNA 3EHJA 1Z5CA 3VHAA 5M4KA 5M4NA 4ASGA 5J71A 2IORA 5CTUA 3MNRP 4XIRA 1H7UA 2YGAA 3ZM7A 3HZ5A 2XDKA
chains in the Genus database with same CATH superfamily
2GSMB 1B62A 5M4MA 1Q5OA 4TWKA 2ZDYA 2D3OW 5CTYA 2YI6A 1LNQA 3RVYA 4DR4B 1G4YB 3L73H 4GZRB 4X1IA 1L0OA 1YETA 1ZL8A 3D36C 1XMQO 2W0FC 4YXWG 4DR2B 2IOQA 2LFRA 2ZINA 3E8BA 2CCSA 2VS0A 2ZT9B 4CS2A 5KMGA 4MS2A 4BQGA 4PDLA 2MK3A 4L90A 2GDSA 1I58A 2XOKG 4AQYO 2OCCC 2WLLA 3CWBH 3R92A 5IN9A 3HKDA 4JI8B 1H2NA 3B8MA 3STZC 4WFEA 4YJ2A 3SPCA 3B27A 5EC2C 4NXNB 3THOA 5BR8B 3EVKA 1EI1A 2DJVA 3RYCB 2BU5A 2YXYA 3A2FA 3DXRA 1UPGA 1PKXA 4KP4A 2CH7A 5IYZB 3ZXOA 2ITCC 4B7EA 2YI5A 3HZ1A 4LH7A 4DR7B 2DYRB 2YE5A 2ZCEA 1K4DC 1YESA 2BCCH 1IBLB 3JD4A 2HP8A 1BT8A 4HYOA 3RLRA 1QY8A 3ABKB 3CMEV 4URMA 3M99B 4ZIBA 2O1UA 2VWKA 3BY6A 2NLJC 2B1IA 5LL6Y 5C8YA 1I7FA 2HHIA 4AI8A 4FLWA 1LUWA 1Z5BA 2ZNIA 4NH8A 1AILA 2Q8IA 2EILC 2YI0A 1GM7A 1F23A 2WLKA 3K58A 3P32A 4TSFG 4NXMO 4JI0O 4EB6B 4L8ZA 3B26A 5K1PA 4O4JA 4U3JB 2YKBA 4KUMA 3ETGA 3FB5C 1PV0A 4GEEA 1XNRO 3E8HA 2QWOB 4DXWA 2F4VB 4BWAA 3RGBA 4AHCA 1UYCA 2C1GA 1GN2A 1U96A 1YJNV 2GHYA 3TJTA 3CRKA 4X1YA 4GX0A 1NR1A 2QKAA 2XDUA 4FLTA 4X1IB 4YIOA 3E83A 4MTOA 1Q6UA 3JATA 4O4HA 2Q68A 2BTZA 2OTJV 2GBOA 2QKSA 3WG7C 1F4NA 4R7CA 5J2TA 2XNDG 2VQFB 5KX5B 2DYSB 1S76D 1FXVA 1XREA 1OCOC 2HKOA 4I4TA 4GKJO 2R9IA 4MW3A 2JKIA 3TGUH 2Z3YA 3AG4B 3HKDB 4IT5A 5A9GA 3LNMB 4DV2B 3D8CA 4DR5B 4LFBO 1M4UA 2W6JG 4FPPA 4YJ2B 1I94O 1PP9H 5JJJB 3U0ZA 1L0NH 4MSWC 2Q67A 4CBCA 2P4VA 1SQBH 2QJ1A 3RYIA 1YSZA 1XILA 5ITZB 2Q5ZA 1NHJA 2FYUH 5IDJA 4DR6B 2XAJA 3HKBB 2CH7B 3OWBA 3EHHA 3T2SA 3G75A 1VF6C 4DUZO 2ATKC 1GH6A 2ZIMA 3C3TA 1P49A 5KA5A 3AG7A 1N0JA 2RN9A 1UFIA 1WPXA 4DW0A 1K92A 4CWPA 4LF4O 3JCZA 3W7SA 2P4KA 4PA9A 1AR5A 4B7KA 3HKCA 3H1IH 1W0JG 1VQNV 3N2GA 2H3OA 1M1KW 4I9QA 4I0XB 1VARA 4P9OA 2KG7A 1R6KA 2HR3A 1NVPB 3B25A 4KQVA 1WB7A 4O04A 1YEWA 1AMWA 1AVMA 1PNLA 5CMUA 2WI5A 1AI7A 4FM2A 2H8MA 4HAMA 2JDIG 1FD9A 2BE3A 4B7PA 4J7KA 1Q81W 2IWUA 2YKJA 1XI1A 4CE1A 3CRMA 2EZOA 3FT8A 3ETDA 1ZLZA 3CP1A 1HW7A 1JM6A 2EIJC 4G27B 2YEEA 3BVOA 3U10A 1AH6A 4J7JA 4ICGA 3OWDA 4DRXB 2UWDA 2L35A 2Y69C 2WI1A 4MVZA 4UV8A 1NR7A 3GWKC 2XHBA 1XEQA 2YEDA 4ZKIA 1TIDA 2OIEA 2Z5UA 2YGFA 5EIBD 1N34B 1H2GA 3VQXA 3CC2V 4DUYO 4I3HA 1KU9A 2BYIA 1YERA 1AROP 3ICXA 2LP7A 1Q43A 2X6CA 3VBBA 2ZNJA 4DV4O 1A4HA 1QBZA 3AG3B 3OR6C 1YF2A 4GX2A 4J7ZA 4N21A 2VW5A 2QR4A 2ADPA 1ZAUA 2PY5A 1OCZB 2BYHA 4TV8B 1PVGA 2PI4A 4B3TB 4JI2B 3O9OA 2O1VA 3VQVA 5DM6V 4X66B 1VQOV 2WI4A 5B5EZ 1BQ0A 1AJNA 1HWYA 4IGGA 2HHHB 1R73A 5JVDA 2Q6AA 5IJ0B 4XTJA 1NI8A 1VQPV 1BCCH 4YHHB 4KFGA 5B66Z 1QVGU 4K3AA 2EINB 4DV1B 3LNUA 1LUVA 2IJKA 3GB7C 2YI7A 2DW4A 1Q86W 4XD8A 4TT3G 5LMUO 3PEHA 2CCUA 4WUBA 4RQEA 5BZBA 3JZ3A 4WCEV 3ASNC 1S5JA 2IU3A 5B1BC 1UYLA 2FYPA 2WERA 1D2DA 3N2GB 3R4MA 3MHHC 1JX9A 3LDEA 1EBOA 3OGIB 5EIBC 3A0ZA 5H5NA 2KG7B 2GFDA 3H1LH 2WEQA 1BHBA 2LO1A 3CXHF 4JTCB 1KP2A 5IJ9A 1N36B 1OCCC 2ZM6B 3IAYA 2AXTZ 3FX7A 2Q7HA 4RO2A 1H2KA 2OCCB 2YKEA 4XE2A 4R8CA 4PDRA 1IBMB 1ORQC 3CRQA 2BT0A 3BA8A 3BA9A 3ABLC 4YY3O 3ZKBA 1XL6A 5FNVB 2QWPB 1R3IC 4MPCA 4JTAB 1N4CA 5LHIA 3ETQA 2QA4V 1H8EG 4FVMA 3BRCA 1UY6A 1H2MA 1GKZA 1US6A 3ASOC 4JF3A 3ZEDA 2ZDIA 3CCRV 3D0BA 1UYFA 1JR9A 1YT1A 4ZHQA 4PHZA 2EZPA 4GYCB 5KAIZ 3ZRWB 2ZKOA 4DR4O 5KUMA 1N33O 1BZKA 1D5NA 1EM1A 1AJPA 4ASFA 5CBFA 1QLEB 2JEXA 2RQ6A 2ZIOA 3FT5A 2XASA 1JPXA 1B3QA 1FFXB 3FB6C 4MTGA 4LPBA 3MAQA 4ZOLB 1W59A 2A3QA 5LMNB 4K8XA 4WFHA 1NKDA 2XT9A 4KSGA 3H1JH 4AS9A 2XDSA 4H81A 3TXQA 4JQLA 1XHXA 3T0ZA 2IW5A 2P90A 5JJEB 1OV9A 1WB8A 3CCEV 1NVPD 2QM7A 2AZ2A 2UXXA 4B3RO 3CCSV 1FYJA 3BCCH 1BKNA 2BU7A 3JAMN 4I5SA 1QLNA 2XHRA 5D6QA 3ZKDA 4CH6A 2XABA 1QNMA 4GT1A 1MSWD 1NU1H 2O57A 4W4KA 4JI6O 1I5XA 4MP7A 3ABUA 3ZIAG 1UY9A 2D2CB 4DV7O 3B28A 1IBKB 3STLC 4Z1MG 3B24A 3G7BA 2F43G 3T1CA 4DR7O 1R1BA 2WAMA 3B2EE 3VHAA 2PYJA 5M4NA 4DO2A 5J71A 2BSKA 1XMOB 4XDJA 5DECA 1NH2D 4LFAB 4OXSA 3WG7B 2JGDA 2XJJA 1ZSPA 3FD9A 1TUBB 4DR1B 2DMXA 4BQJA 1TC0A 2QGNA 3RKZA 4R50A 3SJAC 2YGEA 3ZX6A 3TZ5A 4LF5B 1N32B 3HKEB 4IHJA 1OCOB 1RFYA 1GAXA 4J80A 4DV6B 4UROA 4P9PA 2ZE6A 3QVNA 2O1WA 1QR9A 3FYEB 1I5DA 3OW2U 5IDMA 3RN4A 4KHPB 3AK3A 4EKWA 3WB2A 1K33A 1VQ8V 2CH4A 1KB9F 2XAGA 4E00A 1SQFA 2WLHA 1BHAA 3APQA 1UYHA 4X20B 2F4VO 4NH7A 4ABMA 4ZHQB 1WLEA 2M7WA 2YXLA 5H2FZ 3NMQA 4CWQA 3ZRXA 1OJHA 1HR0B 4HXWA 1AR1B 1VQ7V 1QZRA 3JAWB 1SETA 2ESAA 2VQEO 5J2UA 1M57C 1YDXA 1NTMH 1R3JC 4LFCB 1RPRA 4OX9O 4UB8Z 2VQFO 2KQXA 3WU2Z 5CA3A 2FKXA 4R3AA 4MVUA 4Q6GA 1DF4A 3T1HB 4LF8O 3K03A 2ODMA 2ZQMA 4X65O 2VWJA 2GUZB 2XAQA 4X1KA 1FJGO 2WLIA 2FXSA 3BM9A 3NXSA 5L3FA 4NTYA 1I0HA 2ADQB 5CB4A 3UCSC 3G71V 3G67A 3A0YA 1QQCA 5FNCA 1TVKA 1MOFA 1URFA 3G4SV 3JARA 5CPHA 3JD1A 2JEUA 5KHKA 4H85A 4XBFA 1QR8A 2Q69A 3F7VC 3DTUB 3K9AA 5IYBO 1M56B 1I5BA 2YECA 3P30A 4QPJA 1K8AW 2UU9O 4HZ0A 1PL4A 4FLYA 1K7DA 3ABMC 2EIJB 1MMMA 1YSRA 4AWPA 4R1FA 1VQKV 4X89A 4EFBA 4B3MB 3ZMTA 1WAZA 3K06A 1Z5AA 2BSKB 3JAKB 2Y69B 5CTXA 3A0HZ 1H2SB 4MTFA 4JI3O 1P84F 2XX2A 4C7UA 3JCUZ 1JJOA 1EZJA 5GGZA 1SQVH 3K60A 4EGKA 2K9PA 4JI5B 1I5AA 2X6AA 3GVMA 2YKIA 1ZXNA 3OTFA 1FXKC 4IHJB 4B6CA 1JQ0A 4JGSA 4GX1A 3OD4A 3BPZA 2WI3A 2UXCB 1GRJA 2QFOA 4U7OA 1PPJH 2GTSA 2FWYA 1AH8A 2BREA 4PRXA 5IWAO 1JA8A 1CPYA 4TV9B 3CGZA 3RYHA 2YEHA 4F6EA 4XKKA 4EFUA 4GX5A 2LW7A 4YKQA 2BU8A 1M93A 3AK2A 3B4SA 2E5LB 4XCLA 3TK1A 3CRAA 1YXBA 2JJ1G 2Y4UA 3U2DA 2QWQB 1HNZB 2YJXA 1AI4A 2WLMA 5IY5C 2Q8VA 4JI7B 2F66C 1FXHA 1V54C 1SESA 3ASNB 4UVCA 1I59A 1GKFA 4KL1A 5B1BB 2Q7GA 2YEFA 1V9PA 3ZMZA 2HG1A 1YT0A 2AGAA 5JH7A 3K3WA 1LR1A 1Z2GA 4JZGA 3TETA 5JQGA 2DWDC 3OR7C 2WLJA 1YVWA 1UJWB 2UXBB 2YI8A 1OCCB 3CCUV 3OFNG 1NBMG 4JI2O 3T4ZA 1KUQA 1S5HC 4X64B 3RVZA 3ZRVA 2A0LA 5CBGA 3L9DA 3RT3C 2IM9A 1R6NA 1AP6A 4GUNA 2EIKC 4GKKB 3JALA 4YHHO 2QKCA 3ABLB 3VQYA 4IIJA 4OGQB 2B1GA 3O2FA 2AKPA 4MVSA 4MT8A 4DV1O 4JI1B 2FL4A 1SKVA 1RPOA 4LNUB 1Z5WA 3RLPA 3M8AA 1ENVA 2VCJA 3ASOB 2HKJA 2DQ0A 4PELA 4HBNA 5LYJA 3CE2A 1HNXB 3DSQA 2DOSA 3JASA 2Q8FA 3UT5B 2HCHA 4DUHA 4WFBV 1Q7YW 1Q90D 2QG2A 5M4PA 2QTSA 4YJ3A 2HJDA 5KLVH 1WJZA 3E22B 4NKGB 4QNHB 1BGYH 2RMKB 1Y4SA 5D5PA 3CRCA 4DYLA 3F7YC 5CN0A 2XJGA 4JAUA 3D3QA 1N36O 1J5EO 4PI2A 2Y0IA 4UUJC 3K08A 3C3SA 5H6QA 2YJWA 3WQ9A 3JD2A 4ASAA 3ZHQA 4CWNA 4HYPA 1ID0A 4MPEA 1ZL8B 1GO3F 4OPAA 4GCZA 5FWKA 2YEGA 4HYMA 4RUEA 2LFSA 1PD3A 5KMGB 3FB7C 5CA1A 3CPWU 4V26A 2YK9A 5KHGA 4MVMA 1MZFA 3E8GA 4DV3B 1DF5A 2YEAA 3WFVA 1S16A 1YJ9V 3KG2A 2WLLB 4BAYA 2CTWA 4X62O 2ZD9A 4TQDA 4HZ3A 4CZZA 2E75B 3TZ4A 1KECA 1M90W 3WB0A 4JI4O 2P7TC 4FFKA 1R6TA 3BMYA 2H8PC 4LP8A 1R62A 5GONA 2BU6A 5LP6A 1HNWB 4KFMA 1CP9A 2YS8A 4J11A 4MVQA 1XNQB 2XHXA 3U2KA 2AZ0A 3DXRB 2ZDIC 1K9MW 2UUAO 3L71H 2CTPA 4ZBMA 4CH4A 2CCTA 5LMNO 2WPDG 5FNFA 5JENA 4LF7O 1GJVA 4CWTA 1NHHA 2E0AA 1FXKA 3SGIA 1PNKA 4H44B 4CH3A 1S72V 5A2QN 1X59A 2LGWA 1N0NA 3PJSK 1F51A 3CGYA 4MW8A 4IIJB 4ASUG 3IJ4A 4FLXA 2WWWA 2YSUB 2OYQA 1YI2V 5EC1C 1GM9A 4XDKA 2YICA 1Z59A 1SZXA 3J81N 5C8YB 4H7QA 1VP7A 2K1EA 5IYDO 3CWVA 2YEBA 4H37A 2CTQA 4I55A 1XQ8A 3OE7G 4YJ3B 3MDSA 1CEZA 4YKTA 4LF6B 4O4JB 3SL2A 1XMOO 1BMFG 5L3DA 3PN1A 4U3FH 1M57B 4LFAO 2ZR3A 4HNAA 3E89A 4HY1A 1GM8A 5LGNA 4DR1O 1TAEA 2P22C 3QNEA 4FMTA 1WA8A 4UCVA 4X1YB 1B04A 1N32O 2WI2A 3PEJA 1NH2B 2R70A 5LOVA 3JATB 4O4HB 2KKWA 2YC0A 3ZN1A 1DGSA 4E2LA 5BODA 2R72A 5J2TB 3HPLC 5LBQA 4P30A 4KHPO 4IYHA 1L8DA 4I7ZB 1JOYA 3Q5LA 2IH1C 1VF5B 3FYIB 4I4TB 2P67A 2IOPA 4G28B 4AQYB 2YI9A 4B3SB 1V55B 1UYKA 4E01A 1KC8W 3ABMB 2FWZA 1YITV 4PA3A 3LPSA 2ZE7A 1R3LC 3K9SA 5KHHA 1YCIA 3K99A 1ZXMA 3L72H 4O0BA 4AWQA 1E1RG 1HR0O 4NYKA 1DLBA 2E76B 4O4LA 3SJQC 4O4IA 4WBNA 1MU5A 3RYIB 3U11A 5GTHZ 3ZCCA 2F93B 4GT8A 4J9YB 1YIJV 3JSNA 4XDLA 3ZMSA 1W0KG 5EK0A 2AHYA 3SJCC 4QE9A 4J10A 4JAAA 2L6LA 3T1HO 1FXKB 3MNRP 4XIRA 1H7UA 3ZM7A 4NVPA 3APOA 4RAIA 4F6RA 2YUAA 4BW5A 1WNSA 1VQ9V 3A0BZ 4CS4A 3HKCB 2YK2A 2PYLA 4CC6A 2JS3A 3E35A 3RFRA 5M4HA 3QTCA 5EBLC 3WHAA 1XHZA 1L0LH 1YTFD 5D6PA 2PI5A 1UYGA 3FFQA 4I55B 5L3BA 4LH6A 3UQ8A 4EEHA 2QEXV 2X0LA 5FLXN 1UYMA 4UB6Z 3ZHUA 4B3MO 2UXDO 4UCOA 4NXMB 1G6UA 4JI0B 5IY5B 4Z1VA 4U93A 5LHHA 1HP8A 1VQ4V 1UY8A 5JCOA 3JD0A 1V54B 3O6OA 4FLVA 1XNRB 1F7YA 2UUCO 3VQWA 2EX3A 1I5CA 1SF9A 1WA8B 3OMIB 3UM7A 4I9WA 4TUYA 5HFMA 3TZ2A 4JYCA 4K35A 2ZDXA 4JYAO 4EEQA 3FAVA 4DV0O 3EHGA 4XKOA 1GMGA 1H8HG 4FIPC 5L3CA 2JK5C 3CB2A 1Y8PA 4ASBA 1CXZB 3SPGA 4E72A 2YXHA 4ZI7A 4DR2O 2KB1A 3CC7V 2PGGA 2EIKB 1NTKH 1Q8IA 2YIBA 4GKJB 2RDCA 4PI0A 3BFRA 3EFFK 1VQLV 2P6JA 2E5LO 4RQFA 1YSCA 4WFGA 1G8MA 1KIJA 3A0XA 5FPOA 4JYYA 3GIFA 4YKRA 4LFBB 2LGQA 3SR2C 3SDLA 4X88A 4WFFA 5LGUA 4WBNB 2ITDC 3INXA 2EILB 3F5WC 4FZ0A 4W4LA 5JVDB 4JI8O 4EFTA 4MVRA 5D7RA 2BU2A 3A0RA 4MP2A 1D5AA 4PRVA 4G2KA 3T10A 3IC9A 3OGCC 1I08A 3D2RA 1UYDA 3H80A 4NXNO 3L70H 5BR8O 2YE4A 4BIZA 1YT2A 1YJWV 4F6RB 3R4OA 1F4MA 1WPBA 1R3KC 3GIGA 3VHCA 3JYCA 3KCYA 1K3EA 4NH9A 5K1XA 2CG9A 4FCRA 2YEVA 3F5TA 3RLQA 3CYGA 1TGOA 1IBLO 4UFZA 3OEHG 3SYQA 1UYEA 4JAVA 4NTWA 3SYAA 2Q7EA 4GKKO 4MOTA 3TUHA 1SQPH 2V1DA 4QGPA 3CD6V 5IJ9B 1COWG 1E79G 2PZSA 3ETEA 1VEWA 4NB5A 2EULA 3CRLA 1BXDA 2LW1A 1DK1A 3QO8A 2EJRA 3T2MA 3OPDA 4O2BA 3SPHA 2N05A 3ZRSA 3C0EA 4DZYA 4BXIA 2YE7A 1IDSA 2OWOA 2JVDA 4LWSA 4TUYB 2H94A 3SYCA 5F2VO 3OTOB 1H38A 4O05A 3FAVB 4GLXA 5H9CA 1AI6A 2PF4E 1BQZA 2BRCA 4FFBA 4CH5A 3K57A 3CMAV 1OCRC 4JV5B 2BOBC 3T0HA 1M9NA 1E1QG 1BGQA 4XIPA 1W2BU 2CTRA 1NTZH 2YE6A 3OMUA 1AI5A 2XAHA 3ZHSA 4DV4B 2IJIA 1RSOA 2V7QG 2B5UA 4O09A 1K5QA 4BIUA 4FJCC 4PA6A 4H33A 4CS3A 3H1HH 1EZVH 1YZBA 2OCHA 4E02A 4DV2O 1YHQV 2Q0OC 2Q9LA 1FS0G 4JZ2A 4DR5O 4XDMA 1FKAO 4EFEA 2WI6A 1IXBA 4KTNA 2ILMA 3CCMV 1ZWIC 3A0TA 4LP0A 2QWRB 2FMLA 1KD1W 3HB3B 2IBZH 1HNWO 4FLZA 4K0KB 4JTDB 4FCPA 4PU9A 2BOCC 3ZS8C 5D7DA 3LMMA 2HVJC 1MX0A 2XDLA 4DR6O 2UUBB 3RYCA 3J80N 4WF9V 2E74B 5LMUB 3EHFA 5KUKA 2DE0X 2VCIA 3WB1A 2YEVB 4NR1A 5IYZA 1JJ2U 4J41A 4CC5A 3B77A 1NJIW 3BEHA 1KBHA 5LP6C 1QVFU 1EFRG 4DR3B 4FM1A 2PNRA 4UCSA 3SYPA 1MABG 3QDDA 2JGDB 3VHDA 3AG1C 5L3JA 1JFFA 3AG3C 4QE7A 1EN6A 2N04A 2YDEA 3K5MA 3S3XA 1O9GA 1S0VA 3AEIA 2IU0A 1ZWHA 1BL8A 2HLDG 3DC6A 1SQGA 1US7A 3CCQV 1U2OA 3LDDA 4FCQA 3C11A 4XCJA 4EGHA 1MA1A 1B6QA 5BOCA 4XKAA 3S3WA 5B3SC 2YEJA 4LWSB 1QHTA 2YE9A 2LJ2A 2CE4A 2HEPA 2A79B 3P3NA 4U3JA 4LR3A 2QF6A 2ARHA 5EBMC 4I50A 1O9HA 4CE2A 3L75H 2XCMA 3LDCA 1XUQA 1X4TA 1BS3A 1VQMV 1SQXH 4L8JA 1SRYA 1Y76A 4UVAA 2PUSA 2CDYA 3SJBC 1N33B 4D7TA 2Q8HA 5EYPA 5J2UB 3J7AU 1N34O 1SA0A 1RSOB 3OMAB 2CUGA 4O07A 1TC6A 3R4NA 4PL9A 4D6TH 1SC5B 4GGLA 4EMVA 4DW1A 3Q5JA 5F3KA 5KX5A 4LWHA 3ZHRA 2BTQA 5KAFZ 4X1KB 2WLIB 3T1YB 4B3SO 3LNNA 2JS5A 4MTXA 5CB4B 4L94A 5KHJA 4LWIA 1TVKB 5DN6G 4B3TO 1YS3A 3JARB 2WEPA 4X66O 3ZMUA 1ZW9A 4UCRA 2ZKJA 1YC3A 5EBWC 2IWSA 1Y4UA 1Y67A 2K5BA 2RCVA 1GTOA 2HHHO 4B3RB 1Q3EA 4X8AA 1PM9A 1KYOF 4CWSA 3I55V 1SQQH 4QIWF 5ITZA 4ZVIA 2B9ZA 1AP5A 1JVMA 5D7CA 5BXZA 4JI6B 3CC4V 3HKBA 4YKZA 1KP3A 3CYOA 4DV7B 4LWFA 4TQFA 1OHHG 3QG5A 1JCHA 5CA0A 1B63A 3OW6A 1EA6A 2W0XA 1QU7A 4D7SA 3Q4HA 1JFFB 1QLEC 2CGFA 5GTIZ 3EHBB 4EM7A 2XK2A 3R91A 2KSDA 3W7TA 1XBLA 2EIMC 4J42A 3O65A 1FFTB 3FB8C 3TCUA 4I0XA 3AK1A 1GN3A 4LF9B 2ZM6O 4FZ1A 3RBZA 1JMKC 1GK9A 2ZBKB 4PDVA 2YIBD 3HYYA 3QO7A 3QF7A 4IYIA 1YTFB 1IBMO 3RYHB 5EZYA 3VADA 1QYEA 3U67A 3T4DA 2CGNA 2C1IA 4I50B 3G80A 2GQPA 2N74A 3G7EA 1VIBA 4YKWA 1Y76B 2F1MA 3L74H 2C2AA 4DRXA 5B1AC 5JCOC 2H55A 5EYPB 3ZHTA 3EHJA 1Z5CA 1J95A 1SA0B 3OAAG 1TA8A 2VQEB 3IGAC 2ZXWC 5IYCO 3IFXA 2JIZG 4OX9B 3H1KH 1IVSA 3CCLV 1XL4A 2XDKA 2EJ7A 3C90A 3K0GA 5JH7B 2BTQB 1KKDA 4MPNA 5JQGB 4LF8B 4X65B 2YIDA 4QJFB 1FJGB 1BSMA 1MSDA 3N27A 4U7NA 3K79A 2E3CA 2A06H 1Y74A 1THZA 4XC0A 4TV8A 3G6BA 1VQ6V 2WLNA 3HYZA 3OEEG 3QO5A 3JALB 4JPRA 5LGTA 3H4LA 5E79Z 4UVBA 5IJ0A 3R4PA 2AW9A 1UY7A 2UU9B 1IZ3A 3K98A 4YKUA 3OM3B 3E86A 1NT2B 2RJZA 5AG2A 3AG2C 2Q8GA 4LC1A 1OZ0A 1KKCA 3LSQA 5CA0B 2NR5A 1Y8OA 3MD0A 5LYJB 2XDXA 1Q6IA 3JASB 3UO3A 3Q4HB 1OCRB 1TUEB 4JI3B 3RW0A 3G6EV 2A9HA 1IBKO 3DGEA 3K04A 5CTWA 3I56V 3M7MX 4BR6A 5FNDA 3ZXQA 4MVOA 1RM1C 1YC4A 1GKXA 2QM8A 2W6IG 4R6ZA 4DV5B 3D36A 3P3PA 5BY1A 1FAFA 2YEIA 3Q5KA 1ZX3A 1SS3A 2XTAA 1S5LZ 1A32A 3B40A 3A0WA 4YKYA 4LF5O 1SZTA 4DV6O 1KQSU 5EZYB 5BMVA 1IX9A 5C93A 5IWAB 1Z5VA 2HVKC 4JYBA 1XMQB 2IJHA 2IWXA 1M56C 5CA1B 4URNA 2DN9A 3TTZA 2A7WA 4PJ0Z 5FNVA 3OTOO 5F5RA 3X2QC 3K97A 3K5NA 2JJ2G 5FL7G 3ZMVA 1TILA 3OUSA 1ZTEA 4JV5O 1S77D 3MHSC 1KZNA 1K97A 3BAAA 1S14A 5TISZ 3ZRWA 1VMGA 3I5DA 2YIAA 5GONB 3JSLA 2XHTA 2YE3A 5LP6B 2EXLA 3R65A 4O2AA 3EKOA 1PL0A 5B1NA 4LFCO 3AG1B 3OMNB 3RWRD 4L91A 2HFEC 2YE8A 1FFXA 2AHZA 4IL6Z 3VOUA 2F23A 2JJCA 3HEKA 4R3MA 1Y74B 4ZOLA 4CWRA 2HG5C 2QWNB 4F4LA 3CCVV 3N2KA 5LXTA 4UV9A 2Q0AA 1ROPA 4FK5C 4H0LB 5B3SB 3BHPA 2GV9A 1FPOA 3TZ0A 1WN7A 5D5QA 2VRZA 4K0KO 2JRIA 3ZJZA 5LA6A 1BYQA 3SYOA 4A5UB 4Q20A 2Y4TA 1I5YA 2UUBO 3EXAA 4MBCA 4NTXA 5CF0A 4KXRA 1P4RA 2R9AA 5B1OA 2OT5A 3T1KA 3IEDA 1VQ5V 4HXZA 3CRRA 4WUCA 4P8OA 3BABA 1NHIA 4DR3O 3NR7A 3CXCU 2ZE5A 4HNAB 1WP8A 2XAFA 4JI5O 4GQTA 3OT7A 1TUBA 3CHXA 1J5EB 2QSAA 3LUTB 2YKCA 1OSFA 5LOVB 2V4DA 5BMVB 2DYRC 3HKEA 1IURA 5E1AC 1K5SA 1RP3B 3LSSA 4PDMA 5JJNB 5IE9A 2UXCO 4UCUA 2RNBA 3S5TA 3E2EA 1AJQA 3ABKC 1U0ZA 5FPRA 4W7TA 1WP7A 4UCTA 3H9VA 3KCXA 2WA4A 1GN4A 1DTOA 4X20A 2PTMA 4X62B 2NN4A 4XIQA 2NNUA 5JWPA 1TH8A 4WUDA 3TXSA 4PA4A 1VF6A 4FLUA 3CX5F 1HNZO 4O4LB 1G1XB 4O4IB 3H01A 2BTOA 4JI7O 4JI4B 1I94B 3HR0A 4O2AB 2F95B 4YIPA 4AILC 3JAWA 2CGOA 1TBWA 3GIEA 2UUAB 4H13B 2DQ3A 2M6YA 2LQTA 3O0IA 3SPIA 3CJHA 4DUZB 5IT9N 1K73W 2EIMB 4LF7B 3T1YO 1SERA 4UXNA 3N2KB 5LXTB 2XX5A 3KE6A 1Y6XA 2GUZA 3K5OA 2DWEC 2MW2B 3W7XA 2Q4PA 1N8RW 2UXBO 2CAZC 3SPJA 4LF4B 3B8NA 4B08A 1H2LA 2IJJA 4X64O 2XX4A 3QTFA 4URLA 5LA6B 2QM4A 1AR4A 1AM1A 4BW9A 2UXNA 2DYSC 2Q2EB 5L3EA 3ABTA 1EN4A 1MNGA 1H7SA 3AG4C 4FM0A 2OTLV 1BE3H 4JI1O 3K0DA 3DC5A 3E8FA 2QTOA 1T5EA 2Q73A 4PA7A 2QG0A 2HJFC 2Z0AA 4TOIA 1HDJA 5B1AB 4K8ZA 1HNXO 3W7UA 3JAKA 5HFLA 3OUFA 3RYFA 4CWOA 3FKSG 2ZR2A 4PV1B 4BIOA 1P7GA 2X6BA 1UYIA 1IXMA 1U97A 2ZXWB 3A8TA 4DK1A 2XUMA 2WA3A 1PNMA 1XOUA 2CK3G 2QE7G 4KSHA 1B06A 4WFAV 5M4EA 1NS1A 4Z2WA 3FV5A 4P2ZA 4HZ5A 4EGIA 4LF9O 3R66A 4X9QA 2VWCA 2EBOA 5DEDA 2OIGA 2JGUA 2XD6A 2XJXA 1Y4MA 4CE3A 2WSSG 2BZ5A 4DUYB 1QCEA 4ZI7B 4OPHA 2WI7A 1YC1A 3UO2A 4TV9A 4K4OA 5H6RA 4JASA 3ML0A 4BAEA 4QPKA 2ZE8A 4AWOA 3KKYA 2FB5A 4DV3O 3AG2B 5KA6A 3IC7A 1AJ6A 4YKXA 3B09A 3CCJV 4L93A 5KHIA 2P5OA 3D3IA 3UKMA 3EKRA 4LWEA 2ETNA 4N23A 4GFNA 2QDOA 4P7AA 1K4CC 4LWGA 1RM1B 3CJHB 2P06A 1L1FA 4HY6A 3INWA 1XNQO 2R9RB 4V25A 5J9PC 1XDCA 1MZEA 2YE2A 3GIGB 5CBHA 3W7WA 2FTKA 4J9ZB 3CSXA 4LCUC 4RUFA 3JD3A 2GTAA 1Y8NA 1EN5A 5L3GA 3CS5A 3ZBHA 3CEIA 4DK0A 4RWUA 4PD4F 5GW7A 2X7RB 1V55C 4XITA 1P7BA 2IH3C 4L87A 1KMIZ 1M5IA 3X2QB 1OCZC 3K5LA 1AB3A 2UXDB 5LHGA 1S3JA 1Q6HA 4LNUA 1MG1A 4O2BB 3RYFB 4CWFA 1Y66A 2Y48A 3HHUA 4X9LA 2Y0PA 3UT5A 3KZIZ 2UUCB 2G38A 3LSUA 4LF6O 5J6AA 4YY3B 2BSMA 4EB6A 4E4EA 1NQTA 3GWOA 4DV5O 3E22A 4MB9A 1NZ6A 3ZN0A 4LBEC 1THNA 2EINC 5M4KA 4ASGA 4JYAB 4DV0B 4FFBB 1Q82W 2IORA 5CTUA 1K34A 1VF7A 2YGAA 1ZUQA 3ZHVA 1GN6A 3HZ5A 3K59A
chains in the Genus database with same CATH topology
2GSMB 1B62A 5M4MA 4TWKA 2ZDYA 2D3OW 5CTYA 2YI6A 1LNQA 3RVYA 1G4YB 1L0OA 1YETA 2W0FC 4YXWG 2IOQA 2LFRA 3E8BA 2CCSA 4MS2A 4BQGA 4PDLA 2MK3A 4L90A 1I58A 2XOKG 2OCCC 2WLLA 3R92A 5IN9A 3B8MA 3STZC 4WFEA 3SPCA 3B27A 5EC2C 1EI1A 2BU5A 1PKXA 4KP4A 3ZXOA 2ITCC 2YI5A 3HZ1A 2DYRB 2YE5A 1K4DC 1YESA 3JD4A 4HYOA 3RLRA 1QY8A 3ABKB 3CMEV 4URMA 3M99B 2O1UA 3BY6A 2NLJC 2B1IA 1Z5BA 4NH8A 2Q8IA 2EILC 2YI0A 1GM7A 1F23A 2WLKA 3P32A 4TSFG 4L8ZA 3B26A 2YKBA 4KUMA 3ETGA 3FB5C 4GEEA 3E8HA 4DXWA 1UYCA 1YJNV 2GHYA 3CRKA 4GX0A 1NR1A 2XDUA 3E83A 4MTOA 2BTZA 2Q68A 2OTJV 2QKSA 3WG7C 1F4NA 4R7CA 2XNDG 2DYSB 1S76D 1FXVA 2HKOA 1OCOC 2R9IA 4MW3A 2JKIA 2Z3YA 3AG4B 3LNMB 2W6JG 4FPPA 4MSWC 2Q67A 4CBCA 1YSZA 1NHJA 5IDJA 2XAJA 3OWBA 3EHHA 3T2SA 3G75A 2ATKC 5KA5A 1WPXA 4CWPA 1K92A 3JCZA 3W7SA 4PA9A 1W0JG 1VQNV 1M1KW 4P9OA 4KQVA 1R6KA 2HR3A 1NVPB 3B25A 4O04A 1AMWA 1PNLA 5CMUA 2WI5A 1AI7A 2H8MA 4HAMA 2JDIG 4B7PA 1Q81W 2IWUA 2YKJA 4CE1A 2EZOA 3FT8A 3ETDA 3CP1A 1JM6A 2EIJC 4G27B 2YEEA 1AH6A 3OWDA 2UWDA 2Y69C 2WI1A 4MVZA 4UV8A 1NR7A 2YEDA 4ZKIA 1TIDA 2Z5UA 2YGFA 1H2GA 3CC2V 4I3HA 2BYIA 1YERA 1AROP 2LP7A 2X6CA 3VBBA 1A4HA 1QBZA 3AG3B 3OR6C 4GX2A 4N21A 2VW5A 1OCZB 2BYHA 1PVGA 2PI4A 2O1VA 5DM6V 1VQOV 2WI4A 1AJNA 1HWYA 1R73A 2Q6AA 4XTJA 1VQPV 4KFGA 1QVGU 2EINB 3LNUA 2IJKA 3GB7C 2YI7A 2DW4A 1Q86W 4XD8A 4TT3G 3PEHA 2CCUA 4WUBA 4RQEA 5BZBA 3JZ3A 4WCEV 3ASNC 2IU3A 5B1BC 1UYLA 2FYPA 2WERA 3R4MA 3MHHC 1JX9A 3LDEA 1EBOA 3A0ZA 2GFDA 2WEQA 1BHBA 4JTCB 1KP2A 1OCCC 4RO2A 2OCCB 2YKEA 4XE2A 4R8CA 4PDRA 1ORQC 2BT0A 3ABLC 3ZKBA 1XL6A 1R3IC 4MPCA 4JTAB 5LHIA 2QA4V 1H8EG 1UY6A 1GKZA 3ASOC 4JF3A 3CCRV 2ZDIA 3D0BA 1UYFA 1YT1A 2EZPA 3ZRWB 5KUMA 4ASFA 1AJPA 5CBFA 1QLEB 2JEXA 3FT5A 2XASA 1JPXA 1B3QA 3FB6C 4MTGA 4LPBA 4WFHA 1NKDA 4KSGA 4AS9A 2XDSA 4H81A 4JQLA 3T0ZA 2IW5A 2P90A 3CCEV 1NVPD 2QM7A 2UXXA 3CCSV 2BU7A 1BKNA 4I5SA 1QLNA 2XHRA 5D6QA 3ZKDA 2XABA 4GT1A 1MSWD 1I5XA 4MP7A 3ABUA 3ZIAG 1UY9A 3B28A 3STLC 4Z1MG 3B24A 3G7BA 2F43G 3T1CA 2WAMA 3VHAA 5M4NA 4DO2A 5J71A 4XDJA 1NH2D 4OXSA 3WG7B 2XJJA 4BQJA 1TC0A 3RKZA 4R50A 2YGEA 3TZ5A 1OCOB 4UROA 4P9PA 2O1WA 1QR9A 3FYEB 1I5DA 3OW2U 5IDMA 4EKWA 2CH4A 1K33A 1VQ8V 2XAGA 4E00A 2WLHA 1BHAA 1UYHA 4NH7A 1WLEA 2M7WA 3NMQA 4CWQA 3ZRXA 4HXWA 1AR1B 1VQ7V 1QZRA 1SETA 2ESAA 1M57C 1R3JC 1RPRA 5CA3A 4R3AA 4MVUA 1DF4A 3K03A 2ZQMA 2XAQA 3BM9A 2WLIA 2FXSA 3NXSA 5L3FA 3G71V 3A0YA 5FNCA 3G4SV 1MOFA 5CPHA 3JD1A 2JEUA 4H85A 4XBFA 1QR8A 2Q69A 3F7VC 3DTUB 3K9AA 5IYBO 1M56B 1I5BA 2YECA 3P30A 4QPJA 1K8AW 4HZ0A 1K7DA 3ABMC 2EIJB 1YSRA 4AWPA 4R1FA 1VQKV 4X89A 3ZMTA 3K06A 1Z5AA 2Y69B 5CTXA 4MTFA 2XX2A 1EZJA 5GGZA 3K60A 4EGKA 1I5AA 2X6AA 2YKIA 1ZXNA 1FXKC 4B6CA 1JQ0A 4JGSA 4GX1A 2WI3A 2QFOA 4U7OA 2FWYA 1AH8A 2BREA 4PRXA 1CPYA 3CGZA 2YEHA 4XKKA 4EFUA 4GX5A 4YKQA 2BU8A 4XCLA 3TK1A 2JJ1G 3U2DA 2YJXA 1AI4A 2WLMA 5IY5C 1FXHA 1V54C 1SESA 3ASNB 4UVCA 1I59A 1GKFA 5B1BB 2YEFA 3ZMZA 2HG1A 1YT0A 3K3WA 3TETA 2DWDC 3OR7C 2WLJA 1UJWB 1OCCB 3CCUV 3OFNG 1NBMG 3T4ZA 1S5HC 3ZRVA 3RVZA 2A0LA 5CBGA 1R6NA 2EIKC 3ABLB 2B1GA 3O2FA 2AKPA 4MVSA 4MT8A 1RPOA 3RLPA 2VCJA 1ENVA 3ASOB 2HKJA 2DQ0A 4PELA 2Q8FA 2HCHA 4DUHA 4WFBV 1Q7YW 2QG2A 5M4PA 4QNHB 1Y4SA 3F7YC 5CN0A 2XJGA 4JAUA 4UUJC 3K08A 5H6QA 2YJWA 3WQ9A 3JD2A 4ASAA 4CWNA 4HYPA 1ID0A 4MPEA 1GO3F 4GCZA 5FWKA 2YEGA 4HYMA 4RUEA 2LFSA 1PD3A 3FB7C 3CPWU 4V26A 2YK9A 4MVMA 3E8GA 1DF5A 2YEAA 3WFVA 1S16A 1YJ9V 3KG2A 2WLLB 4BAYA 2ZD9A 4HZ3A 4CZZA 3TZ4A 1KECA 1M90W 2P7TC 3BMYA 2H8PC 4LP8A 1R62A 2BU6A 4KFMA 1CP9A 4MVQA 2XHXA 3U2KA 2ZDIC 1K9MW 4ZBMA 2CCTA 2WPDG 5FNFA 1GJVA 4CWTA 1NHHA 2E0AA 1FXKA 1PNKA 1S72V 3PJSK 1F51A 3CGYA 4MW8A 4ASUG 2WWWA 2YSUB 1YI2V 5EC1C 1GM9A 4XDKA 1Z59A 4H7QA 2K1EA 5IYDO 3CWVA 2YEBA 4H37A 3OE7G 1CEZA 4YKTA 3SL2A 1BMFG 5L3DA 1M57B 2ZR3A 3E89A 4HY1A 1GM8A 5LGNA 3QNEA 4FMTA 3PEJA 2WI2A 1NH2B 3ZN1A 4E2LA 5BODA 3HPLC 5LBQA 4P30A 1JOYA 3Q5LA 2IH1C 3FYIB 2P67A 2IOPA 4G28B 1V55B 1UYKA 4E01A 1KC8W 3ABMB 2FWZA 1YITV 4PA3A 3LPSA 1R3LC 4AWQA 1ZXMA 3K99A 4O0BA 1E1RG 1DLBA 3SJQC 1MU5A 3ZCCA 4GT8A 4J9YB 1YIJV 4XDLA 3ZMSA 1W0KG 5EK0A 2AHYA 4QE9A 1FXKB 3MNRP 4XIRA 1H7UA 3ZM7A 4RAIA 4BW5A 1VQ9V 2YK2A 3E35A 5M4HA 5EBLC 3WHAA 1YTFD 5D6PA 2PI5A 1UYGA 5L3BA 4EEHA 2QEXV 2X0LA 1UYMA 5IY5B 4U93A 5LHHA 1VQ4V 1UY8A 3JD0A 1V54B 3O6OA 1I5CA 3OMIB 3UM7A 4I9WA 3TZ2A 5HFMA 4JYCA 2ZDXA 3EHGA 4XKOA 1GMGA 1H8HG 4FIPC 5L3CA 2JK5C 1Y8PA 4ASBA 3SPGA 2KB1A 3CC7V 2EIKB 3EFFK 1VQLV 2P6JA 4RQFA 1YSCA 4WFGA 1G8MA 1KIJA 3A0XA 3GIFA 4YKRA 4X88A 4WFFA 5LGUA 2ITDC 3INXA 2EILB 3F5WC 4EFTA 4MVRA 5D7RA 2BU2A 3A0RA 4MP2A 4PRVA 4G2KA 3T10A 3OGCC 3D2RA 1UYDA 3H80A 2YE4A 4BIZA 1YT2A 1YJWV 3R4OA 1F4MA 1R3KC 3GIGA 3VHCA 3JYCA 1K3EA 4NH9A 2CG9A 4FCRA 2YEVA 3RLQA 3SYQA 3OEHG 1UYEA 4JAVA 3SYAA 4MOTA 3TUHA 2V1DA 3CD6V 1COWG 1E79G 3ETEA 3CRLA 1BXDA 3QO8A 2EJRA 3T2MA 3OPDA 3SPHA 3ZRSA 3C0EA 4DZYA 4BXIA 2YE7A 2H94A 3SYCA 1H38A 4O05A 5H9CA 1AI6A 2BRCA 3CMAV 1OCRC 2BOBC 3T0HA 1M9NA 1E1QG 1BGQA 4XIPA 1W2BU 2YE6A 3OMUA 1AI5A 2XAHA 2IJIA 2V7QG 2B5UA 4O09A 1K5QA 4BIUA 4FJCC 4PA6A 4H33A 4E02A 1YHQV 1FS0G 4XDMA 2WI6A 4KTNA 3CCMV 1ZWIC 3A0TA 4LP0A 1KD1W 3HB3B 4JTDB 4FCPA 4PU9A 2BOCC 5D7DA 2HVJC 1MX0A 2XDLA 4WF9V 3EHFA 5KUKA 2VCIA 2YEVB 1JJ2U 3B77A 1NJIW 3BEHA 1QVFU 1EFRG 2PNRA 3SYPA 1MABG 3QDDA 3VHDA 3AG1C 5L3JA 3AG3C 4QE7A 1S0VA 3AEIA 2IU0A 1ZWHA 1BL8A 2HLDG 1US7A 3CCQV 1U2OA 3LDDA 4FCQA 3C11A 4XCJA 4EGHA 1B6QA 5BOCA 4XKAA 5B3SC 2YEJA 2YE9A 2A79B 2QF6A 5EBMC 4CE2A 2XCMA 3LDCA 1VQMV 1SRYA 4UVAA 2Q8HA 3OMAB 4O07A 1TC6A 3R4NA 4PL9A 4GGLA 4EMVA 3Q5JA 5F3KA 4LWHA 2WLIB 4MTXA 4L94A 4LWIA 5DN6G 1YS3A 2WEPA 3ZMUA 1ZW9A 2ZKJA 1YC3A 5EBWC 2IWSA 1Y4UA 2K5BA 1GTOA 4X8AA 4CWSA 3I55V 4QIWF 4ZVIA 1JVMA 5D7CA 3CC4V 4YKZA 1KP3A 3CYOA 4LWFA 1OHHG 1JCHA 1B63A 3OW6A 1EA6A 1QLEC 2CGFA 3EHBB 4EM7A 2XK2A 3R91A 3W7TA 2EIMC 1FFTB 3FB8C 3TCUA 3RBZA 1GK9A 2ZBKB 4PDVA 3HYYA 3QO7A 1YTFB 3VADA 1QYEA 3U67A 3T4DA 2GQPA 3G7EA 4YKWA 2C2AA 5B1AC 2H55A 3EHJA 1Z5CA 1J95A 3OAAG 3IGAC 2ZXWC 5IYCO 3IFXA 2JIZG 3CCLV 2XDKA 1XL4A 3K0GA 1KKDA 4MPNA 4QJFB 4U7NA 3K79A 1THZA 4XC0A 1VQ6V 2WLNA 3HYZA 3OEEG 3QO5A 4JPRA 5LGTA 3H4LA 3R4PA 4UVBA 1UY7A 3K98A 4YKUA 3OM3B 3E86A 3AG2C 2Q8GA 4LC1A 1OZ0A 3LSQA 1Y8OA 3MD0A 2XDXA 1OCRB 1TUEB 3RW0A 3G6EV 2A9HA 3DGEA 3K04A 5CTWA 3I56V 5FNDA 3ZXQA 4MVOA 1RM1C 1YC4A 1GKXA 2QM8A 2W6IG 4R6ZA 3D36A 2YEIA 3Q5KA 3A0WA 4YKYA 1SZTA 1KQSU 5C93A 2HVKC 4JYBA 2IJHA 2IWXA 1M56C 4URNA 3TTZA 5F5RA 3X2QC 3K97A 2JJ2G 5FL7G 3ZMVA 1TILA 3OUSA 1S77D 3MHSC 1KZNA 1K97A 1S14A 3ZRWA 2YE3A 2XHTA 2EXLA 3R65A 3EKOA 1PL0A 5B1NA 3AG1B 3OMNB 4L91A 2HFEC 2YE8A 2AHZA 3VOUA 2JJCA 3HEKA 4R3MA 4CWRA 2HG5C 4F4LA 3CCVV 4UV9A 1ROPA 4FK5C 5B3SB 3TZ0A 3ZJZA 1BYQA 3SYOA 4Q20A 1I5YA 4MBCA 5CF0A 1P4RA 5B1OA 2OT5A 3T1KA 3IEDA 1VQ5V 4HXZA 4WUCA 4P8OA 1NHIA 3CXCU 2XAFA 4GQTA 3LUTB 2YKCA 1OSFA 2DYRC 5E1AC 1K5SA 3LSSA 4PDMA 3E2EA 1AJQA 3ABKC 1U0ZA 4W7TA 1DTOA 4XIQA 2NNUA 1TH8A 4WUDA 4PA4A 3H01A 1TBWA 3GIEA 2DQ3A 3O0IA 3SPIA 1K73W 2EIMB 1SERA 4UXNA 2XX5A 3KE6A 3W7XA 2DWEC 1N8RW 3SPJA 3B8NA 2IJJA 2XX4A 3QTFA 4URLA 1AM1A 2UXNA 2DYSC 2Q2EB 5L3EA 3ABTA 1H7SA 3AG4C 2OTLV 3K0DA 3E8FA 2QTOA 2QG0A 4PA7A 2HJFC 5B1AB 4CWOA 3W7UA 5HFLA 3OUFA 3FKSG 2ZR2A 2X6BA 1UYIA 1IXMA 2ZXWB 1PNMA 2CK3G 2QE7G 4KSHA 4WFAV 5M4EA 3FV5A 4P2ZA 4HZ5A 4EGIA 2VWCA 2EBOA 2XD6A 2XJXA 1Y4MA 4CE3A 2WSSG 2BZ5A 1QCEA 2WI7A 1YC1A 4K4OA 5H6RA 4JASA 3ML0A 4BAEA 4QPKA 4AWOA 3AG2B 5KA6A 3IC7A 1AJ6A 4YKXA 3CCJV 4L93A 3D3IA 3UKMA 3EKRA 4LWEA 4N23A 4GFNA 4P7AA 1K4CC 4LWGA 1RM1B 1L1FA 4HY6A 3INWA 2R9RB 4V25A 5J9PC 2YE2A 3GIGB 5CBHA 3W7WA 2FTKA 4J9ZB 4LCUC 4RUFA 3JD3A 1Y8NA 5L3GA 5GW7A 2X7RB 1V55C 4XITA 1P7BA 2IH3C 4L87A 3X2QB 1OCZC 5LHGA 1S3JA 1MG1A 4CWFA 1Y66A 2Y48A 3HHUA 4X9LA 5J6AA 2BSMA 1NQTA 3GWOA 4MB9A 3ZN0A 4LBEC 1THNA 2EINC 5M4KA 4ASGA 1Q82W 2IORA 5CTUA 1K34A 2YGAA 3HZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B62 A;  5M4M A;  2XJJ A;  2ZDY A;  4MPN A;  5CTY A;  2YI6 A;  4BQJ A;  1TC0 A;  3RKZ A;  1L0O A;  2YGE A;  1YET A;  3TZ5 A;  2IOQ A;  2LFR A;  2YK2 A;  4U7N A;  2CCS A;  5M4H A;  3WHA A;  4XC0 A;  4URO A;  4BQG A;  2O1W A;  3HYZ A;  4L90 A;  1I5D A;  5D6P A;  1UYG A;  1I58 A;  5IDM A;  4EEH A;  3H4L A;  3R4P A;  2CH4 A;  1UY7 A;  1UYM A;  4E00 A;  3K98 A;  3R92 A;  5IN9 A;  4YKU A;  4U93 A;  1UYH A;  1UY8 A;  4NH7 A;  2Q8G A;  4LC1 A;  3O6O A;  1Y8O A;  3MD0 A;  2XDX A;  3B27 A;  3NMQ A;  4CWQ A;  3ZRX A;  1I5C A;  3DGE A;  1EI1 A;  2BU5 A;  3TZ2 A;  4HXW A;  5CTW A;  4JYC A;  1QZR A;  2ZDX A;  2ESA A;  5FND A;  3ZXQ A;  4KP4 A;  1YC4 A;  3EHG A;  4XKO A;  1GKX A;  3ZXO A;  2QM8 A;  2YI5 A;  3D36 A;  3HZ1 A;  2YE5 A;  1YES A;  4R3A A;  1Y8P A;  2YEI A;  4ASB A;  3Q5K A;  3RLR A;  3A0W A;  4YKY A;  1QY8 A;  3BM9 A;  2FXS A;  3NXS A;  4URM A;  2O1U A;  3A0Y A;  5C93 A;  5FNC A;  4JYB A;  5CPH A;  2IWX A;  4URN A;  4H85 A;  1KIJ A;  1Z5B A;  3A0X A;  4NH8 A;  3GIF A;  4YKR A;  3TTZ A;  2Q8I A;  2YI0 A;  1I5B A;  2YEC A;  5F5R A;  4QPJ A;  3P32 A;  4HZ0 A;  3INX A;  3K97 A;  4L8Z A;  3B26 A;  4EFT A;  1YSR A;  1TIL A;  5D7R A;  4AWP A;  2BU2 A;  2YKB A;  4R1F A;  3A0R A;  4GEE A;  4MP2 A;  4PRV A;  3T10 A;  1Z5A A;  1KZN A;  5CTX A;  3D2R A;  1UYD A;  3H80 A;  1S14 A;  3ZRW A;  2YE4 A;  2XX2 A;  1UYC A;  4BIZ A;  1YT2 A;  2YE3 A;  2XHT A;  3CRK A;  3R4O A;  2EXL A;  5GGZ A;  3EKO A;  5B1N A;  3GIG A;  3VHC A;  2XDU A;  3K60 A;  4EGK A;  1I5A A;  4NH9 A;  2YKI A;  4L91 A;  1ZXN A;  2CG9 A;  2BTZ A;  4FCR A;  3RLQ A;  2YE8 A;  2JJC A;  3HEK A;  4R3M A;  1UYE A;  4JAV A;  4B6C A;  4CWR A;  4MOT A;  2WI3 A;  3TUH A;  2QFO A;  4U7O A;  2FWY A;  1AH8 A;  2BRE A;  4PRX A;  3CGZ A;  2JKI A;  2YEH A;  3CRL A;  4XKK A;  4EFU A;  1BXD A;  3TZ0 A;  4YKQ A;  3OPD A;  1BYQ A;  2BU8 A;  4FPP A;  4Q20 A;  3C0E A;  4MBC A;  4DZY A;  4XCL A;  3TK1 A;  2YE7 A;  4BXI A;  3U2D A;  1YSZ A;  5CF0 A;  2YJX A;  1NHJ A;  5IDJ A;  5B1O A;  3T1K A;  3IED A;  4HXZ A;  4O05 A;  3OWB A;  3EHH A;  3T2S A;  3G75 A;  4WUC A;  4P8O A;  1I59 A;  1NHI A;  2BRC A;  2YEF A;  2HG1 A;  3T0H A;  4CWP A;  1YT0 A;  4GQT A;  1BGQ A;  4XIP A;  2YKC A;  1OSF A;  2YE6 A;  3OMU A;  3ZRV A;  4O09 A;  4BIU A;  4KQV A;  3B25 A;  1U0Z A;  4O04 A;  1AMW A;  4W7T A;  2WI5 A;  4E02 A;  2H8M A;  3O2F A;  4XDM A;  2AKP A;  2WI6 A;  4B7P A;  4MT8 A;  4KTN A;  2IWU A;  3A0T A;  4XIQ A;  2YKJ A;  4LP0 A;  4CE1 A;  1TH8 A;  4WUD A;  3FT8 A;  2VCJ A;  3RLP A;  2HKJ A;  4FCP A;  4PU9 A;  5D7D A;  1JM6 A;  1MX0 A;  2Q8F A;  2HCH A;  2XDL A;  4DUH A;  2QG2 A;  5M4P A;  2YEE A;  1AH6 A;  3OWD A;  3EHF A;  2UWD A;  2VCI A;  1TBW A;  2WI1 A;  3GIE A;  2YED A;  4ZKI A;  1TID A;  2YGF A;  3O0I A;  1Y4S A;  4I3H A;  2BYI A;  2PNR A;  1YER A;  4JAU A;  2XJG A;  3QDD A;  3VHD A;  2XX5 A;  3KE6 A;  5L3J A;  2YJW A;  3WQ9 A;  4ASA A;  4CWN A;  4HYP A;  1A4H A;  1ID0 A;  4MPE A;  1ZWH A;  4GCZ A;  5FWK A;  2YEG A;  2XX4 A;  4HYM A;  1US7 A;  2VW5 A;  2LFS A;  3QTF A;  1U2O A;  4URL A;  2BYH A;  4FCQ A;  1AM1 A;  1PVG A;  3C11 A;  4XCJ A;  4EGH A;  2Q2E B;  2O1V A;  2YK9 A;  4V26 A;  2WI4 A;  5BOC A;  4XKA A;  2YEA A;  1H7S A;  1S16 A;  2YEJ A;  2YE9 A;  4XTJ A;  2QG0 A;  4KFG A;  2QF6 A;  3TZ4 A;  4CWO A;  4CE2 A;  2XCM A;  3LNU A;  2YI7 A;  1UYI A;  3BMY A;  1R62 A;  1IXM A;  2BU6 A;  4XD8 A;  3PEH A;  2CCU A;  4WUB A;  2XHX A;  3U2K A;  3JZ3 A;  4KSH A;  5M4E A;  2Q8H A;  2CCT A;  3FV5 A;  1UYL A;  2FYP A;  4HZ5 A;  2WER A;  4O07 A;  1TC6 A;  3R4N A;  4PL9 A;  1GJV A;  3R4M A;  4CWT A;  4EGI A;  1NHH A;  2E0A A;  5FNF A;  4GGL A;  4EMV A;  2VWC A;  3A0Z A;  3Q5J A;  2GFD A;  2XD6 A;  2XJX A;  2WEQ A;  4CE3 A;  5F3K A;  2BZ5 A;  4LWH A;  1F51 A;  3CGY A;  2WI7 A;  1YC1 A;  2WWW A;  4K4O A;  4MTX A;  4L94 A;  4JAS A;  2YKE A;  4XE2 A;  4BAE A;  4QPK A;  1Z59 A;  4LWI A;  2WEP A;  1YS3 A;  4AWO A;  4H7Q A;  1ZW9 A;  2ZKJ A;  1YC3 A;  2IWS A;  1Y4U A;  2BT0 A;  2K5B A;  3CWV A;  2YEB A;  3ZKB A;  4MPC A;  1AJ6 A;  4YKX A;  4CWS A;  4L93 A;  4ZVI A;  5D7C A;  1UY6 A;  4YKT A;  3SL2 A;  3EKR A;  4YKZ A;  1GKZ A;  4LWE A;  4LWF A;  3D0B A;  1UYF A;  4GFN A;  4P7A A;  1YT1 A;  4LWG A;  1B63 A;  3OW6 A;  1EA6 A;  4HY6 A;  4HY1 A;  3ZRW B;  3INW A;  4V25 A;  2CGF A;  4FMT A;  3PEJ A;  2WI2 A;  2YE2 A;  3GIG B;  4ASF A;  4EM7 A;  2XK2 A;  3R91 A;  3FT5 A;  2FTK A;  1B3Q A;  4LPB A;  5BOD A;  1Y8N A;  4KSG A;  4AS9 A;  2ZBK B;  1JOY A;  2XDS A;  4H81 A;  3Q5L A;  3HYY A;  4JQL A;  4XIT A;  2P67 A;  2IOP A;  3T0Z A;  3VAD A;  1QYE A;  1UYK A;  4E01 A;  2FWZ A;  3U67 A;  2QM7 A;  3LPS A;  2BU7 A;  1ZXM A;  1BKN A;  3K99 A;  4O0B A;  4AWQ A;  2GQP A;  4I5S A;  2XHR A;  3ZKD A;  5D6Q A;  4CWF A;  3HHU A;  3G7E A;  4X9L A;  2XAB A;  4YKW A;  4GT1 A;  1MU5 A;  4MP7 A;  5J6A A;  3ZCC A;  1UY9 A;  2BSM A;  4GT8 A;  3B28 A;  2C2A A;  4MB9 A;  2H55 A;  3B24 A;  3G7B A;  1THN A;  3EHJ A;  1Z5C A;  3VHA A;  5M4K A;  5M4N A;  4ASG A;  5J71 A;  2IOR A;  5CTU A;  3MNR P;  4XIR A;  1H7U A;  2YGA A;  3ZM7 A;  3HZ5 A;  2XDK A; 
#chains in the Genus database with same CATH topology
 2GSM B;  1B62 A;  5M4M A;  1Q5O A;  4TWK A;  2ZDY A;  2D3O W;  5CTY A;  2YI6 A;  1LNQ A;  3RVY A;  4DR4 B;  1G4Y B;  3L73 H;  4GZR B;  4X1I A;  1L0O A;  1YET A;  1ZL8 A;  3D36 C;  1XMQ O;  2W0F C;  4YXW G;  4DR2 B;  2IOQ A;  2LFR A;  2ZIN A;  3E8B A;  2CCS A;  2VS0 A;  2ZT9 B;  4CS2 A;  5KMG A;  4MS2 A;  4BQG A;  4PDL A;  2MK3 A;  4L90 A;  2GDS A;  1I58 A;  2XOK G;  4AQY O;  2OCC C;  2WLL A;  3CWB H;  3R92 A;  5IN9 A;  3HKD A;  4JI8 B;  1H2N A;  3B8M A;  3STZ C;  4WFE A;  4YJ2 A;  3SPC A;  3B27 A;  5EC2 C;  4NXN B;  3THO A;  5BR8 B;  3EVK A;  1EI1 A;  2DJV A;  3RYC B;  2BU5 A;  2YXY A;  3A2F A;  3DXR A;  1UPG A;  1PKX A;  4KP4 A;  2CH7 A;  5IYZ B;  3ZXO A;  2ITC C;  4B7E A;  2YI5 A;  3HZ1 A;  4LH7 A;  4DR7 B;  2DYR B;  2YE5 A;  2ZCE A;  1K4D C;  1YES A;  2BCC H;  1IBL B;  3JD4 A;  2HP8 A;  1BT8 A;  4HYO A;  3RLR A;  1QY8 A;  3ABK B;  3CME V;  4URM A;  3M99 B;  4ZIB A;  2O1U A;  2VWK A;  3BY6 A;  2NLJ C;  2B1I A;  5LL6 Y;  5C8Y A;  1I7F A;  2HHI A;  4AI8 A;  4FLW A;  1LUW A;  1Z5B A;  2ZNI A;  4NH8 A;  1AIL A;  2Q8I A;  2EIL C;  2YI0 A;  1GM7 A;  1F23 A;  2WLK A;  3K58 A;  3P32 A;  4TSF G;  4NXM O;  4JI0 O;  4EB6 B;  4L8Z A;  3B26 A;  5K1P A;  4O4J A;  4U3J B;  2YKB A;  4KUM A;  3ETG A;  3FB5 C;  1PV0 A;  4GEE A;  1XNR O;  3E8H A;  2QWO B;  4DXW A;  2F4V B;  4BWA A;  3RGB A;  4AHC A;  1UYC A;  2C1G A;  1GN2 A;  1U96 A;  1YJN V;  2GHY A;  3TJT A;  3CRK A;  4X1Y A;  4GX0 A;  1NR1 A;  2QKA A;  2XDU A;  4FLT A;  4X1I B;  4YIO A;  3E83 A;  4MTO A;  1Q6U A;  3JAT A;  4O4H A;  2Q68 A;  2BTZ A;  2OTJ V;  2GBO A;  2QKS A;  3WG7 C;  1F4N A;  4R7C A;  5J2T A;  2XND G;  2VQF B;  5KX5 B;  2DYS B;  1S76 D;  1FXV A;  1XRE A;  1OCO C;  2HKO A;  4I4T A;  4GKJ O;  2R9I A;  4MW3 A;  2JKI A;  3TGU H;  2Z3Y A;  3AG4 B;  3HKD B;  4IT5 A;  5A9G A;  3LNM B;  4DV2 B;  3D8C A;  4DR5 B;  4LFB O;  1M4U A;  2W6J G;  4FPP A;  4YJ2 B;  1I94 O;  1PP9 H;  5JJJ B;  3U0Z A;  1L0N H;  4MSW C;  2Q67 A;  4CBC A;  2P4V A;  1SQB H;  2QJ1 A;  3RYI A;  1YSZ A;  1XIL A;  5ITZ B;  2Q5Z A;  1NHJ A;  2FYU H;  5IDJ A;  4DR6 B;  2XAJ A;  3HKB B;  2CH7 B;  3OWB A;  3EHH A;  3T2S A;  3G75 A;  1VF6 C;  4DUZ O;  2ATK C;  1GH6 A;  2ZIM A;  3C3T A;  1P49 A;  5KA5 A;  3AG7 A;  1N0J A;  2RN9 A;  1UFI A;  1WPX A;  4DW0 A;  1K92 A;  4CWP A;  4LF4 O;  3JCZ A;  3W7S A;  2P4K A;  4PA9 A;  1AR5 A;  4B7K A;  3HKC A;  3H1I H;  1W0J G;  1VQN V;  3N2G A;  2H3O A;  1M1K W;  4I9Q A;  4I0X B;  1VAR A;  4P9O A;  2KG7 A;  1R6K A;  2HR3 A;  1NVP B;  3B25 A;  4KQV A;  1WB7 A;  4O04 A;  1YEW A;  1AMW A;  1AVM A;  1PNL A;  5CMU A;  2WI5 A;  1AI7 A;  4FM2 A;  2H8M A;  4HAM A;  2JDI G;  1FD9 A;  2BE3 A;  4B7P A;  4J7K A;  1Q81 W;  2IWU A;  2YKJ A;  1XI1 A;  4CE1 A;  3CRM A;  2EZO A;  3FT8 A;  3ETD A;  1ZLZ A;  3CP1 A;  1HW7 A;  1JM6 A;  2EIJ C;  4G27 B;  2YEE A;  3BVO A;  3U10 A;  1AH6 A;  4J7J A;  4ICG A;  3OWD A;  4DRX B;  2UWD A;  2L35 A;  2Y69 C;  2WI1 A;  4MVZ A;  4UV8 A;  1NR7 A;  3GWK C;  2XHB A;  1XEQ A;  2YED A;  4ZKI A;  1TID A;  2OIE A;  2Z5U A;  2YGF A;  5EIB D;  1N34 B;  1H2G A;  3VQX A;  3CC2 V;  4DUY O;  4I3H A;  1KU9 A;  2BYI A;  1YER A;  1ARO P;  3ICX A;  2LP7 A;  1Q43 A;  2X6C A;  3VBB A;  2ZNJ A;  4DV4 O;  1A4H A;  1QBZ A;  3AG3 B;  3OR6 C;  1YF2 A;  4GX2 A;  4J7Z A;  4N21 A;  2VW5 A;  2QR4 A;  2ADP A;  1ZAU A;  2PY5 A;  1OCZ B;  2BYH A;  4TV8 B;  1PVG A;  2PI4 A;  4B3T B;  4JI2 B;  3O9O A;  2O1V A;  3VQV A;  5DM6 V;  4X66 B;  1VQO V;  2WI4 A;  5B5E Z;  1BQ0 A;  1AJN A;  1HWY A;  4IGG A;  2HHH B;  1R73 A;  5JVD A;  2Q6A A;  5IJ0 B;  4XTJ A;  1NI8 A;  1VQP V;  1BCC H;  4YHH B;  4KFG A;  5B66 Z;  1QVG U;  4K3A A;  2EIN B;  4DV1 B;  3LNU A;  1LUV A;  2IJK A;  3GB7 C;  2YI7 A;  2DW4 A;  1Q86 W;  4XD8 A;  4TT3 G;  5LMU O;  3PEH A;  2CCU A;  4WUB A;  4RQE A;  5BZB A;  3JZ3 A;  4WCE V;  3ASN C;  1S5J A;  2IU3 A;  5B1B C;  1UYL A;  2FYP A;  2WER A;  1D2D A;  3N2G B;  3R4M A;  3MHH C;  1JX9 A;  3LDE A;  1EBO A;  3OGI B;  5EIB C;  3A0Z A;  5H5N A;  2KG7 B;  2GFD A;  3H1L H;  2WEQ A;  1BHB A;  2LO1 A;  3CXH F;  4JTC B;  1KP2 A;  5IJ9 A;  1N36 B;  1OCC C;  2ZM6 B;  3IAY A;  2AXT Z;  3FX7 A;  2Q7H A;  4RO2 A;  1H2K A;  2OCC B;  2YKE A;  4XE2 A;  4R8C A;  4PDR A;  1IBM B;  1ORQ C;  3CRQ A;  2BT0 A;  3BA8 A;  3BA9 A;  3ABL C;  4YY3 O;  3ZKB A;  1XL6 A;  5FNV B;  2QWP B;  1R3I C;  4MPC A;  4JTA B;  1N4C A;  5LHI A;  3ETQ A;  2QA4 V;  1H8E G;  4FVM A;  3BRC A;  1UY6 A;  1H2M A;  1GKZ A;  1US6 A;  3ASO C;  4JF3 A;  3ZED A;  2ZDI A;  3CCR V;  3D0B A;  1UYF A;  1JR9 A;  1YT1 A;  4ZHQ A;  4PHZ A;  2EZP A;  4GYC B;  5KAI Z;  3ZRW B;  2ZKO A;  4DR4 O;  5KUM A;  1N33 O;  1BZK A;  1D5N A;  1EM1 A;  1AJP A;  4ASF A;  5CBF A;  1QLE B;  2JEX A;  2RQ6 A;  2ZIO A;  3FT5 A;  2XAS A;  1JPX A;  1B3Q A;  1FFX B;  3FB6 C;  4MTG A;  4LPB A;  3MAQ A;  4ZOL B;  1W59 A;  2A3Q A;  5LMN B;  4K8X A;  4WFH A;  1NKD A;  2XT9 A;  4KSG A;  3H1J H;  4AS9 A;  2XDS A;  4H81 A;  3TXQ A;  4JQL A;  1XHX A;  3T0Z A;  2IW5 A;  2P90 A;  5JJE B;  1OV9 A;  1WB8 A;  3CCE V;  1NVP D;  2QM7 A;  2AZ2 A;  2UXX A;  4B3R O;  3CCS V;  1FYJ A;  3BCC H;  1BKN A;  2BU7 A;  3JAM N;  4I5S A;  1QLN A;  2XHR A;  5D6Q A;  3ZKD A;  4CH6 A;  2XAB A;  1QNM A;  4GT1 A;  1MSW D;  1NU1 H;  2O57 A;  4W4K A;  4JI6 O;  1I5X A;  4MP7 A;  3ABU A;  3ZIA G;  1UY9 A;  2D2C B;  4DV7 O;  3B28 A;  1IBK B;  3STL C;  4Z1M G;  3B24 A;  3G7B A;  2F43 G;  3T1C A;  4DR7 O;  1R1B A;  2WAM A;  3B2E E;  3VHA A;  2PYJ A;  5M4N A;  4DO2 A;  5J71 A;  2BSK A;  1XMO B;  4XDJ A;  5DEC A;  1NH2 D;  4LFA B;  4OXS A;  3WG7 B;  2JGD A;  2XJJ A;  1ZSP A;  3FD9 A;  1TUB B;  4DR1 B;  2DMX A;  4BQJ A;  1TC0 A;  2QGN A;  3RKZ A;  4R50 A;  3SJA C;  2YGE A;  3ZX6 A;  3TZ5 A;  4LF5 B;  1N32 B;  3HKE B;  4IHJ A;  1OCO B;  1RFY A;  1GAX A;  4J80 A;  4DV6 B;  4URO A;  4P9P A;  2ZE6 A;  3QVN A;  2O1W A;  1QR9 A;  3FYE B;  1I5D A;  3OW2 U;  5IDM A;  3RN4 A;  4KHP B;  3AK3 A;  4EKW A;  3WB2 A;  1K33 A;  1VQ8 V;  2CH4 A;  1KB9 F;  2XAG A;  4E00 A;  1SQF A;  2WLH A;  1BHA A;  3APQ A;  1UYH A;  4X20 B;  2F4V O;  4NH7 A;  4ABM A;  4ZHQ B;  1WLE A;  2M7W A;  2YXL A;  5H2F Z;  3NMQ A;  4CWQ A;  3ZRX A;  1OJH A;  1HR0 B;  4HXW A;  1AR1 B;  1VQ7 V;  1QZR A;  3JAW B;  1SET A;  2ESA A;  2VQE O;  5J2U A;  1M57 C;  1YDX A;  1NTM H;  1R3J C;  4LFC B;  1RPR A;  4OX9 O;  4UB8 Z;  2VQF O;  2KQX A;  3WU2 Z;  5CA3 A;  2FKX A;  4R3A A;  4MVU A;  4Q6G A;  1DF4 A;  3T1H B;  4LF8 O;  3K03 A;  2ODM A;  2ZQM A;  4X65 O;  2VWJ A;  2GUZ B;  2XAQ A;  4X1K A;  1FJG O;  2WLI A;  2FXS A;  3BM9 A;  3NXS A;  5L3F A;  4NTY A;  1I0H A;  2ADQ B;  5CB4 A;  3UCS C;  3G71 V;  3G67 A;  3A0Y A;  1QQC A;  5FNC A;  1TVK A;  1MOF A;  1URF A;  3G4S V;  3JAR A;  5CPH A;  3JD1 A;  2JEU A;  5KHK A;  4H85 A;  4XBF A;  1QR8 A;  2Q69 A;  3F7V C;  3DTU B;  3K9A A;  5IYB O;  1M56 B;  1I5B A;  2YEC A;  3P30 A;  4QPJ A;  1K8A W;  2UU9 O;  4HZ0 A;  1PL4 A;  4FLY A;  1K7D A;  3ABM C;  2EIJ B;  1MMM A;  1YSR A;  4AWP A;  4R1F A;  1VQK V;  4X89 A;  4EFB A;  4B3M B;  3ZMT A;  1WAZ A;  3K06 A;  1Z5A A;  2BSK B;  3JAK B;  2Y69 B;  5CTX A;  3A0H Z;  1H2S B;  4MTF A;  4JI3 O;  1P84 F;  2XX2 A;  4C7U A;  3JCU Z;  1JJO A;  1EZJ A;  5GGZ A;  1SQV H;  3K60 A;  4EGK A;  2K9P A;  4JI5 B;  1I5A A;  2X6A A;  3GVM A;  2YKI A;  1ZXN A;  3OTF A;  1FXK C;  4IHJ B;  4B6C A;  1JQ0 A;  4JGS A;  4GX1 A;  3OD4 A;  3BPZ A;  2WI3 A;  2UXC B;  1GRJ A;  2QFO A;  4U7O A;  1PPJ H;  2GTS A;  2FWY A;  1AH8 A;  2BRE A;  4PRX A;  5IWA O;  1JA8 A;  1CPY A;  4TV9 B;  3CGZ A;  3RYH A;  2YEH A;  4F6E A;  4XKK A;  4EFU A;  4GX5 A;  2LW7 A;  4YKQ A;  2BU8 A;  1M93 A;  3AK2 A;  3B4S A;  2E5L B;  4XCL A;  3TK1 A;  3CRA A;  1YXB A;  2JJ1 G;  2Y4U A;  3U2D A;  2QWQ B;  1HNZ B;  2YJX A;  1AI4 A;  2WLM A;  5IY5 C;  2Q8V A;  4JI7 B;  2F66 C;  1FXH A;  1V54 C;  1SES A;  3ASN B;  4UVC A;  1I59 A;  1GKF A;  4KL1 A;  5B1B B;  2Q7G A;  2YEF A;  1V9P A;  3ZMZ A;  2HG1 A;  1YT0 A;  2AGA A;  5JH7 A;  3K3W A;  1LR1 A;  1Z2G A;  4JZG A;  3TET A;  5JQG A;  2DWD C;  3OR7 C;  2WLJ A;  1YVW A;  1UJW B;  2UXB B;  2YI8 A;  1OCC B;  3CCU V;  3OFN G;  1NBM G;  4JI2 O;  3T4Z A;  1KUQ A;  1S5H C;  4X64 B;  3RVZ A;  3ZRV A;  2A0L A;  5CBG A;  3L9D A;  3RT3 C;  2IM9 A;  1R6N A;  1AP6 A;  4GUN A;  2EIK C;  4GKK B;  3JAL A;  4YHH O;  2QKC A;  3ABL B;  3VQY A;  4IIJ A;  4OGQ B;  2B1G A;  3O2F A;  2AKP A;  4MVS A;  4MT8 A;  4DV1 O;  4JI1 B;  2FL4 A;  1SKV A;  1RPO A;  4LNU B;  1Z5W A;  3RLP A;  3M8A A;  1ENV A;  2VCJ A;  3ASO B;  2HKJ A;  2DQ0 A;  4PEL A;  4HBN A;  5LYJ A;  3CE2 A;  1HNX B;  3DSQ A;  2DOS A;  3JAS A;  2Q8F A;  3UT5 B;  2HCH A;  4DUH A;  4WFB V;  1Q7Y W;  1Q90 D;  2QG2 A;  5M4P A;  2QTS A;  4YJ3 A;  2HJD A;  5KLV H;  1WJZ A;  3E22 B;  4NKG B;  4QNH B;  1BGY H;  2RMK B;  1Y4S A;  5D5P A;  3CRC A;  4DYL A;  3F7Y C;  5CN0 A;  2XJG A;  4JAU A;  3D3Q A;  1N36 O;  1J5E O;  4PI2 A;  2Y0I A;  4UUJ C;  3K08 A;  3C3S A;  5H6Q A;  2YJW A;  3WQ9 A;  3JD2 A;  4ASA A;  3ZHQ A;  4CWN A;  4HYP A;  1ID0 A;  4MPE A;  1ZL8 B;  1GO3 F;  4OPA A;  4GCZ A;  5FWK A;  2YEG A;  4HYM A;  4RUE A;  2LFS A;  1PD3 A;  5KMG B;  3FB7 C;  5CA1 A;  3CPW U;  4V26 A;  2YK9 A;  5KHG A;  4MVM A;  1MZF A;  3E8G A;  4DV3 B;  1DF5 A;  2YEA A;  3WFV A;  1S16 A;  1YJ9 V;  3KG2 A;  2WLL B;  4BAY A;  2CTW A;  4X62 O;  2ZD9 A;  4TQD A;  4HZ3 A;  4CZZ A;  2E75 B;  3TZ4 A;  1KEC A;  1M90 W;  3WB0 A;  4JI4 O;  2P7T C;  4FFK A;  1R6T A;  3BMY A;  2H8P C;  4LP8 A;  1R62 A;  5GON A;  2BU6 A;  5LP6 A;  1HNW B;  4KFM A;  1CP9 A;  2YS8 A;  4J11 A;  4MVQ A;  1XNQ B;  2XHX A;  3U2K A;  2AZ0 A;  3DXR B;  2ZDI C;  1K9M W;  2UUA O;  3L71 H;  2CTP A;  4ZBM A;  4CH4 A;  2CCT A;  5LMN O;  2WPD G;  5FNF A;  5JEN A;  4LF7 O;  1GJV A;  4CWT A;  1NHH A;  2E0A A;  1FXK A;  3SGI A;  1PNK A;  4H44 B;  4CH3 A;  1S72 V;  5A2Q N;  1X59 A;  2LGW A;  1N0N A;  3PJS K;  1F51 A;  3CGY A;  4MW8 A;  4IIJ B;  4ASU G;  3IJ4 A;  4FLX A;  2WWW A;  2YSU B;  2OYQ A;  1YI2 V;  5EC1 C;  1GM9 A;  4XDK A;  2YIC A;  1Z59 A;  1SZX A;  3J81 N;  5C8Y B;  4H7Q A;  1VP7 A;  2K1E A;  5IYD O;  3CWV A;  2YEB A;  4H37 A;  2CTQ A;  4I55 A;  1XQ8 A;  3OE7 G;  4YJ3 B;  3MDS A;  1CEZ A;  4YKT A;  4LF6 B;  4O4J B;  3SL2 A;  1XMO O;  1BMF G;  5L3D A;  3PN1 A;  4U3F H;  1M57 B;  4LFA O;  2ZR3 A;  4HNA A;  3E89 A;  4HY1 A;  1GM8 A;  5LGN A;  4DR1 O;  1TAE A;  2P22 C;  3QNE A;  4FMT A;  1WA8 A;  4UCV A;  4X1Y B;  1B04 A;  1N32 O;  2WI2 A;  3PEJ A;  1NH2 B;  2R70 A;  5LOV A;  3JAT B;  4O4H B;  2KKW A;  2YC0 A;  3ZN1 A;  1DGS A;  4E2L A;  5BOD A;  2R72 A;  5J2T B;  3HPL C;  5LBQ A;  4P30 A;  4KHP O;  4IYH A;  1L8D A;  4I7Z B;  1JOY A;  3Q5L A;  2IH1 C;  1VF5 B;  3FYI B;  4I4T B;  2P67 A;  2IOP A;  4G28 B;  4AQY B;  2YI9 A;  4B3S B;  1V55 B;  1UYK A;  4E01 A;  1KC8 W;  3ABM B;  2FWZ A;  1YIT V;  4PA3 A;  3LPS A;  2ZE7 A;  1R3L C;  3K9S A;  5KHH A;  1YCI A;  3K99 A;  1ZXM A;  3L72 H;  4O0B A;  4AWQ A;  1E1R G;  1HR0 O;  4NYK A;  1DLB A;  2E76 B;  4O4L A;  3SJQ C;  4O4I A;  4WBN A;  1MU5 A;  3RYI B;  3U11 A;  5GTH Z;  3ZCC A;  2F93 B;  4GT8 A;  4J9Y B;  1YIJ V;  3JSN A;  4XDL A;  3ZMS A;  1W0K G;  5EK0 A;  2AHY A;  3SJC C;  4QE9 A;  4J10 A;  4JAA A;  2L6L A;  3T1H O;  1FXK B;  3MNR P;  4XIR A;  1H7U A;  3ZM7 A;  4NVP A;  3APO A;  4RAI A;  4F6R A;  2YUA A;  4BW5 A;  1WNS A;  1VQ9 V;  3A0B Z;  4CS4 A;  3HKC B;  2YK2 A;  2PYL A;  4CC6 A;  2JS3 A;  3E35 A;  3RFR A;  5M4H A;  3QTC A;  5EBL C;  3WHA A;  1XHZ A;  1L0L H;  1YTF D;  5D6P A;  2PI5 A;  1UYG A;  3FFQ A;  4I55 B;  5L3B A;  4LH6 A;  3UQ8 A;  4EEH A;  2QEX V;  2X0L A;  5FLX N;  1UYM A;  4UB6 Z;  3ZHU A;  4B3M O;  2UXD O;  4UCO A;  4NXM B;  1G6U A;  4JI0 B;  5IY5 B;  4Z1V A;  4U93 A;  5LHH A;  1HP8 A;  1VQ4 V;  1UY8 A;  5JCO A;  3JD0 A;  1V54 B;  3O6O A;  4FLV A;  1XNR B;  1F7Y A;  2UUC O;  3VQW A;  2EX3 A;  1I5C A;  1SF9 A;  1WA8 B;  3OMI B;  3UM7 A;  4I9W A;  4TUY A;  5HFM A;  3TZ2 A;  4JYC A;  4K35 A;  2ZDX A;  4JYA O;  4EEQ A;  3FAV A;  4DV0 O;  3EHG A;  4XKO A;  1GMG A;  1H8H G;  4FIP C;  5L3C A;  2JK5 C;  3CB2 A;  1Y8P A;  4ASB A;  1CXZ B;  3SPG A;  4E72 A;  2YXH A;  4ZI7 A;  4DR2 O;  2KB1 A;  3CC7 V;  2PGG A;  2EIK B;  1NTK H;  1Q8I A;  2YIB A;  4GKJ B;  2RDC A;  4PI0 A;  3BFR A;  3EFF K;  1VQL V;  2P6J A;  2E5L O;  4RQF A;  1YSC A;  4WFG A;  1G8M A;  1KIJ A;  3A0X A;  5FPO A;  4JYY A;  3GIF A;  4YKR A;  4LFB B;  2LGQ A;  3SR2 C;  3SDL A;  4X88 A;  4WFF A;  5LGU A;  4WBN B;  2ITD C;  3INX A;  2EIL B;  3F5W C;  4FZ0 A;  4W4L A;  5JVD B;  4JI8 O;  4EFT A;  4MVR A;  5D7R A;  2BU2 A;  3A0R A;  4MP2 A;  1D5A A;  4PRV A;  4G2K A;  3T10 A;  3IC9 A;  3OGC C;  1I08 A;  3D2R A;  1UYD A;  3H80 A;  4NXN O;  3L70 H;  5BR8 O;  2YE4 A;  4BIZ A;  1YT2 A;  1YJW V;  4F6R B;  3R4O A;  1F4M A;  1WPB A;  1R3K C;  3GIG A;  3VHC A;  3JYC A;  3KCY A;  1K3E A;  4NH9 A;  5K1X A;  2CG9 A;  4FCR A;  2YEV A;  3F5T A;  3RLQ A;  3CYG A;  1TGO A;  1IBL O;  4UFZ A;  3OEH G;  3SYQ A;  1UYE A;  4JAV A;  4NTW A;  3SYA A;  2Q7E A;  4GKK O;  4MOT A;  3TUH A;  1SQP H;  2V1D A;  4QGP A;  3CD6 V;  5IJ9 B;  1COW G;  1E79 G;  2PZS A;  3ETE A;  1VEW A;  4NB5 A;  2EUL A;  3CRL A;  1BXD A;  2LW1 A;  1DK1 A;  3QO8 A;  2EJR A;  3T2M A;  3OPD A;  4O2B A;  3SPH A;  2N05 A;  3ZRS A;  3C0E A;  4DZY A;  4BXI A;  2YE7 A;  1IDS A;  2OWO A;  2JVD A;  4LWS A;  4TUY B;  2H94 A;  3SYC A;  5F2V O;  3OTO B;  1H38 A;  4O05 A;  3FAV B;  4GLX A;  5H9C A;  1AI6 A;  2PF4 E;  1BQZ A;  2BRC A;  4FFB A;  4CH5 A;  3K57 A;  3CMA V;  1OCR C;  4JV5 B;  2BOB C;  3T0H A;  1M9N A;  1E1Q G;  1BGQ A;  4XIP A;  1W2B U;  2CTR A;  1NTZ H;  2YE6 A;  3OMU A;  1AI5 A;  2XAH A;  3ZHS A;  4DV4 B;  2IJI A;  1RSO A;  2V7Q G;  2B5U A;  4O09 A;  1K5Q A;  4BIU A;  4FJC C;  4PA6 A;  4H33 A;  4CS3 A;  3H1H H;  1EZV H;  1YZB A;  2OCH A;  4E02 A;  4DV2 O;  1YHQ V;  2Q0O C;  2Q9L A;  1FS0 G;  4JZ2 A;  4DR5 O;  4XDM A;  1FKA O;  4EFE A;  2WI6 A;  1IXB A;  4KTN A;  2ILM A;  3CCM V;  1ZWI C;  3A0T A;  4LP0 A;  2QWR B;  2FML A;  1KD1 W;  3HB3 B;  2IBZ H;  1HNW O;  4FLZ A;  4K0K B;  4JTD B;  4FCP A;  4PU9 A;  2BOC C;  3ZS8 C;  5D7D A;  3LMM A;  2HVJ C;  1MX0 A;  2XDL A;  4DR6 O;  2UUB B;  3RYC A;  3J80 N;  4WF9 V;  2E74 B;  5LMU B;  3EHF A;  5KUK A;  2DE0 X;  2VCI A;  3WB1 A;  2YEV B;  4NR1 A;  5IYZ A;  1JJ2 U;  4J41 A;  4CC5 A;  3B77 A;  1NJI W;  3BEH A;  1KBH A;  5LP6 C;  1QVF U;  1EFR G;  4DR3 B;  4FM1 A;  2PNR A;  4UCS A;  3SYP A;  1MAB G;  3QDD A;  2JGD B;  3VHD A;  3AG1 C;  5L3J A;  1JFF A;  3AG3 C;  4QE7 A;  1EN6 A;  2N04 A;  2YDE A;  3K5M A;  3S3X A;  1O9G A;  1S0V A;  3AEI A;  2IU0 A;  1ZWH A;  1BL8 A;  2HLD G;  3DC6 A;  1SQG A;  1US7 A;  3CCQ V;  1U2O A;  3LDD A;  4FCQ A;  3C11 A;  4XCJ A;  4EGH A;  1MA1 A;  1B6Q A;  5BOC A;  4XKA A;  3S3W A;  5B3S C;  2YEJ A;  4LWS B;  1QHT A;  2YE9 A;  2LJ2 A;  2CE4 A;  2HEP A;  2A79 B;  3P3N A;  4U3J A;  4LR3 A;  2QF6 A;  2ARH A;  5EBM C;  4I50 A;  1O9H A;  4CE2 A;  3L75 H;  2XCM A;  3LDC A;  1XUQ A;  1X4T A;  1BS3 A;  1VQM V;  1SQX H;  4L8J A;  1SRY A;  1Y76 A;  4UVA A;  2PUS A;  2CDY A;  3SJB C;  1N33 B;  4D7T A;  2Q8H A;  5EYP A;  5J2U B;  3J7A U;  1N34 O;  1SA0 A;  1RSO B;  3OMA B;  2CUG A;  4O07 A;  1TC6 A;  3R4N A;  4PL9 A;  4D6T H;  1SC5 B;  4GGL A;  4EMV A;  4DW1 A;  3Q5J A;  5F3K A;  5KX5 A;  4LWH A;  3ZHR A;  2BTQ A;  5KAF Z;  4X1K B;  2WLI B;  3T1Y B;  4B3S O;  3LNN A;  2JS5 A;  4MTX A;  5CB4 B;  4L94 A;  5KHJ A;  4LWI A;  1TVK B;  5DN6 G;  4B3T O;  1YS3 A;  3JAR B;  2WEP A;  4X66 O;  3ZMU A;  1ZW9 A;  4UCR A;  2ZKJ A;  1YC3 A;  5EBW C;  2IWS A;  1Y4U A;  1Y67 A;  2K5B A;  2RCV A;  1GTO A;  2HHH O;  4B3R B;  1Q3E A;  4X8A A;  1PM9 A;  1KYO F;  4CWS A;  3I55 V;  1SQQ H;  4QIW F;  5ITZ A;  4ZVI A;  2B9Z A;  1AP5 A;  1JVM A;  5D7C A;  5BXZ A;  4JI6 B;  3CC4 V;  3HKB A;  4YKZ A;  1KP3 A;  3CYO A;  4DV7 B;  4LWF A;  4TQF A;  1OHH G;  3QG5 A;  1JCH A;  5CA0 A;  1B63 A;  3OW6 A;  1EA6 A;  2W0X A;  1QU7 A;  4D7S A;  3Q4H A;  1JFF B;  1QLE C;  2CGF A;  5GTI Z;  3EHB B;  4EM7 A;  2XK2 A;  3R91 A;  2KSD A;  3W7T A;  1XBL A;  2EIM C;  4J42 A;  3O65 A;  1FFT B;  3FB8 C;  3TCU A;  4I0X A;  3AK1 A;  1GN3 A;  4LF9 B;  2ZM6 O;  4FZ1 A;  3RBZ A;  1JMK C;  1GK9 A;  2ZBK B;  4PDV A;  2YIB D;  3HYY A;  3QO7 A;  3QF7 A;  4IYI A;  1YTF B;  1IBM O;  3RYH B;  5EZY A;  3VAD A;  1QYE A;  3U67 A;  3T4D A;  2CGN A;  2C1I A;  4I50 B;  3G80 A;  2GQP A;  2N74 A;  3G7E A;  1VIB A;  4YKW A;  1Y76 B;  2F1M A;  3L74 H;  2C2A A;  4DRX A;  5B1A C;  5JCO C;  2H55 A;  5EYP B;  3ZHT A;  3EHJ A;  1Z5C A;  1J95 A;  1SA0 B;  3OAA G;  1TA8 A;  2VQE B;  3IGA C;  2ZXW C;  5IYC O;  3IFX A;  2JIZ G;  4OX9 B;  3H1K H;  1IVS A;  3CCL V;  1XL4 A;  2XDK A;  2EJ7 A;  3C90 A;  3K0G A;  5JH7 B;  2BTQ B;  1KKD A;  4MPN A;  5JQG B;  4LF8 B;  4X65 B;  2YID A;  4QJF B;  1FJG B;  1BSM A;  1MSD A;  3N27 A;  4U7N A;  3K79 A;  2E3C A;  2A06 H;  1Y74 A;  1THZ A;  4XC0 A;  4TV8 A;  3G6B A;  1VQ6 V;  2WLN A;  3HYZ A;  3OEE G;  3QO5 A;  3JAL B;  4JPR A;  5LGT A;  3H4L A;  5E79 Z;  4UVB A;  5IJ0 A;  3R4P A;  2AW9 A;  1UY7 A;  2UU9 B;  1IZ3 A;  3K98 A;  4YKU A;  3OM3 B;  3E86 A;  1NT2 B;  2RJZ A;  5AG2 A;  3AG2 C;  2Q8G A;  4LC1 A;  1OZ0 A;  1KKC A;  3LSQ A;  5CA0 B;  2NR5 A;  1Y8O A;  3MD0 A;  5LYJ B;  2XDX A;  1Q6I A;  3JAS B;  3UO3 A;  3Q4H B;  1OCR B;  1TUE B;  4JI3 B;  3RW0 A;  3G6E V;  2A9H A;  1IBK O;  3DGE A;  3K04 A;  5CTW A;  3I56 V;  3M7M X;  4BR6 A;  5FND A;  3ZXQ A;  4MVO A;  1RM1 C;  1YC4 A;  1GKX A;  2QM8 A;  2W6I G;  4R6Z A;  4DV5 B;  3D36 A;  3P3P A;  5BY1 A;  1FAF A;  2YEI A;  3Q5K A;  1ZX3 A;  1SS3 A;  2XTA A;  1S5L Z;  1A32 A;  3B40 A;  3A0W A;  4YKY A;  4LF5 O;  1SZT A;  4DV6 O;  1KQS U;  5EZY B;  5BMV A;  1IX9 A;  5C93 A;  5IWA B;  1Z5V A;  2HVK C;  4JYB A;  1XMQ B;  2IJH A;  2IWX A;  1M56 C;  5CA1 B;  4URN A;  2DN9 A;  3TTZ A;  2A7W A;  4PJ0 Z;  5FNV A;  3OTO O;  5F5R A;  3X2Q C;  3K97 A;  3K5N A;  2JJ2 G;  5FL7 G;  3ZMV A;  1TIL A;  3OUS A;  1ZTE A;  4JV5 O;  1S77 D;  3MHS C;  1KZN A;  1K97 A;  3BAA A;  1S14 A;  5TIS Z;  3ZRW A;  1VMG A;  3I5D A;  2YIA A;  5GON B;  3JSL A;  2XHT A;  2YE3 A;  5LP6 B;  2EXL A;  3R65 A;  4O2A A;  3EKO A;  1PL0 A;  5B1N A;  4LFC O;  3AG1 B;  3OMN B;  3RWR D;  4L91 A;  2HFE C;  2YE8 A;  1FFX A;  2AHZ A;  4IL6 Z;  3VOU A;  2F23 A;  2JJC A;  3HEK A;  4R3M A;  1Y74 B;  4ZOL A;  4CWR A;  2HG5 C;  2QWN B;  4F4L A;  3CCV V;  3N2K A;  5LXT A;  4UV9 A;  2Q0A A;  1ROP A;  4FK5 C;  4H0L B;  5B3S B;  3BHP A;  2GV9 A;  1FPO A;  3TZ0 A;  1WN7 A;  5D5Q A;  2VRZ A;  4K0K O;  2JRI A;  3ZJZ A;  5LA6 A;  1BYQ A;  3SYO A;  4A5U B;  4Q20 A;  2Y4T A;  1I5Y A;  2UUB O;  3EXA A;  4MBC A;  4NTX A;  5CF0 A;  4KXR A;  1P4R A;  2R9A A;  5B1O A;  2OT5 A;  3T1K A;  3IED A;  1VQ5 V;  4HXZ A;  3CRR A;  4WUC A;  4P8O A;  3BAB A;  1NHI A;  4DR3 O;  3NR7 A;  3CXC U;  2ZE5 A;  4HNA B;  1WP8 A;  2XAF A;  4JI5 O;  4GQT A;  3OT7 A;  1TUB A;  3CHX A;  1J5E B;  2QSA A;  3LUT B;  2YKC A;  1OSF A;  5LOV B;  2V4D A;  5BMV B;  2DYR C;  3HKE A;  1IUR A;  5E1A C;  1K5S A;  1RP3 B;  3LSS A;  4PDM A;  5JJN B;  5IE9 A;  2UXC O;  4UCU A;  2RNB A;  3S5T A;  3E2E A;  1AJQ A;  3ABK C;  1U0Z A;  5FPR A;  4W7T A;  1WP7 A;  4UCT A;  3H9V A;  3KCX A;  2WA4 A;  1GN4 A;  1DTO A;  4X20 A;  2PTM A;  4X62 B;  2NN4 A;  4XIQ A;  2NNU A;  5JWP A;  1TH8 A;  4WUD A;  3TXS A;  4PA4 A;  1VF6 A;  4FLU A;  3CX5 F;  1HNZ O;  4O4L B;  1G1X B;  4O4I B;  3H01 A;  2BTO A;  4JI7 O;  4JI4 B;  1I94 B;  3HR0 A;  4O2A B;  2F95 B;  4YIP A;  4AIL C;  3JAW A;  2CGO A;  1TBW A;  3GIE A;  2UUA B;  4H13 B;  2DQ3 A;  2M6Y A;  2LQT A;  3O0I A;  3SPI A;  3CJH A;  4DUZ B;  5IT9 N;  1K73 W;  2EIM B;  4LF7 B;  3T1Y O;  1SER A;  4UXN A;  3N2K B;  5LXT B;  2XX5 A;  3KE6 A;  1Y6X A;  2GUZ A;  3K5O A;  2DWE C;  2MW2 B;  3W7X A;  2Q4P A;  1N8R W;  2UXB O;  2CAZ C;  3SPJ A;  4LF4 B;  3B8N A;  4B08 A;  1H2L A;  2IJJ A;  4X64 O;  2XX4 A;  3QTF A;  4URL A;  5LA6 B;  2QM4 A;  1AR4 A;  1AM1 A;  4BW9 A;  2UXN A;  2DYS C;  2Q2E B;  5L3E A;  3ABT A;  1EN4 A;  1MNG A;  1H7S A;  3AG4 C;  4FM0 A;  2OTL V;  1BE3 H;  4JI1 O;  3K0D A;  3DC5 A;  3E8F A;  2QTO A;  1T5E A;  2Q73 A;  4PA7 A;  2QG0 A;  2HJF C;  2Z0A A;  4TOI A;  1HDJ A;  5B1A B;  4K8Z A;  1HNX O;  3W7U A;  3JAK A;  5HFL A;  3OUF A;  3RYF A;  4CWO A;  3FKS G;  2ZR2 A;  4PV1 B;  4BIO A;  1P7G A;  2X6B A;  1UYI A;  1IXM A;  1U97 A;  2ZXW B;  3A8T A;  4DK1 A;  2XUM A;  2WA3 A;  1PNM A;  1XOU A;  2CK3 G;  2QE7 G;  4KSH A;  1B06 A;  4WFA V;  5M4E A;  1NS1 A;  4Z2W A;  3FV5 A;  4P2Z A;  4HZ5 A;  4EGI A;  4LF9 O;  3R66 A;  4X9Q A;  2VWC A;  2EBO A;  5DED A;  2OIG A;  2JGU A;  2XD6 A;  2XJX A;  1Y4M A;  4CE3 A;  2WSS G;  2BZ5 A;  4DUY B;  1QCE A;  4ZI7 B;  4OPH A;  2WI7 A;  1YC1 A;  3UO2 A;  4TV9 A;  4K4O A;  5H6R A;  4JAS A;  3ML0 A;  4BAE A;  4QPK A;  2ZE8 A;  4AWO A;  3KKY A;  2FB5 A;  4DV3 O;  3AG2 B;  5KA6 A;  3IC7 A;  1AJ6 A;  4YKX A;  3B09 A;  3CCJ V;  4L93 A;  5KHI A;  2P5O A;  3D3I A;  3UKM A;  3EKR A;  4LWE A;  2ETN A;  4N23 A;  4GFN A;  2QDO A;  4P7A A;  1K4C C;  4LWG A;  1RM1 B;  3CJH B;  2P06 A;  1L1F A;  4HY6 A;  3INW A;  1XNQ O;  2R9R B;  4V25 A;  5J9P C;  1XDC A;  1MZE A;  2YE2 A;  3GIG B;  5CBH A;  3W7W A;  2FTK A;  4J9Z B;  3CSX A;  4LCU C;  4RUF A;  3JD3 A;  2GTA A;  1Y8N A;  1EN5 A;  5L3G A;  3CS5 A;  3ZBH A;  3CEI A;  4DK0 A;  4RWU A;  4PD4 F;  5GW7 A;  2X7R B;  1V55 C;  4XIT A;  1P7B A;  2IH3 C;  4L87 A;  1KMI Z;  1M5I A;  3X2Q B;  1OCZ C;  3K5L A;  1AB3 A;  2UXD B;  5LHG A;  1S3J A;  1Q6H A;  4LNU A;  1MG1 A;  4O2B B;  3RYF B;  4CWF A;  1Y66 A;  2Y48 A;  3HHU A;  4X9L A;  2Y0P A;  3UT5 A;  3KZI Z;  2UUC B;  2G38 A;  3LSU A;  4LF6 O;  5J6A A;  4YY3 B;  2BSM A;  4EB6 A;  4E4E A;  1NQT A;  3GWO A;  4DV5 O;  3E22 A;  4MB9 A;  1NZ6 A;  3ZN0 A;  4LBE C;  1THN A;  2EIN C;  5M4K A;  4ASG A;  4JYA B;  4DV0 B;  4FFB B;  1Q82 W;  2IOR A;  5CTU A;  1K34 A;  1VF7 A;  2YGA A;  1ZUQ A;  3ZHV A;  1GN6 A;  3HZ5 A;  3K59 A; 
#chains in the Genus database with same CATH homology
 2GSM B;  1B62 A;  5M4M A;  4TWK A;  2ZDY A;  2D3O W;  5CTY A;  2YI6 A;  1LNQ A;  3RVY A;  1G4Y B;  1L0O A;  1YET A;  2W0F C;  4YXW G;  2IOQ A;  2LFR A;  3E8B A;  2CCS A;  4MS2 A;  4BQG A;  4PDL A;  2MK3 A;  4L90 A;  1I58 A;  2XOK G;  2OCC C;  2WLL A;  3R92 A;  5IN9 A;  3B8M A;  3STZ C;  4WFE A;  3SPC A;  3B27 A;  5EC2 C;  1EI1 A;  2BU5 A;  1PKX A;  4KP4 A;  3ZXO A;  2ITC C;  2YI5 A;  3HZ1 A;  2DYR B;  2YE5 A;  1K4D C;  1YES A;  3JD4 A;  4HYO A;  3RLR A;  1QY8 A;  3ABK B;  3CME V;  4URM A;  3M99 B;  2O1U A;  3BY6 A;  2NLJ C;  2B1I A;  1Z5B A;  4NH8 A;  2Q8I A;  2EIL C;  2YI0 A;  1GM7 A;  1F23 A;  2WLK A;  3P32 A;  4TSF G;  4L8Z A;  3B26 A;  2YKB A;  4KUM A;  3ETG A;  3FB5 C;  4GEE A;  3E8H A;  4DXW A;  1UYC A;  1YJN V;  2GHY A;  3CRK A;  4GX0 A;  1NR1 A;  2XDU A;  3E83 A;  4MTO A;  2BTZ A;  2Q68 A;  2OTJ V;  2QKS A;  3WG7 C;  1F4N A;  4R7C A;  2XND G;  2DYS B;  1S76 D;  1FXV A;  2HKO A;  1OCO C;  2R9I A;  4MW3 A;  2JKI A;  2Z3Y A;  3AG4 B;  3LNM B;  2W6J G;  4FPP A;  4MSW C;  2Q67 A;  4CBC A;  1YSZ A;  1NHJ A;  5IDJ A;  2XAJ A;  3OWB A;  3EHH A;  3T2S A;  3G75 A;  2ATK C;  5KA5 A;  1WPX A;  4CWP A;  1K92 A;  3JCZ A;  3W7S A;  4PA9 A;  1W0J G;  1VQN V;  1M1K W;  4P9O A;  4KQV A;  1R6K A;  2HR3 A;  1NVP B;  3B25 A;  4O04 A;  1AMW A;  1PNL A;  5CMU A;  2WI5 A;  1AI7 A;  2H8M A;  4HAM A;  2JDI G;  4B7P A;  1Q81 W;  2IWU A;  2YKJ A;  4CE1 A;  2EZO A;  3FT8 A;  3ETD A;  3CP1 A;  1JM6 A;  2EIJ C;  4G27 B;  2YEE A;  1AH6 A;  3OWD A;  2UWD A;  2Y69 C;  2WI1 A;  4MVZ A;  4UV8 A;  1NR7 A;  2YED A;  4ZKI A;  1TID A;  2Z5U A;  2YGF A;  1H2G A;  3CC2 V;  4I3H A;  2BYI A;  1YER A;  1ARO P;  2LP7 A;  2X6C A;  3VBB A;  1A4H A;  1QBZ A;  3AG3 B;  3OR6 C;  4GX2 A;  4N21 A;  2VW5 A;  1OCZ B;  2BYH A;  1PVG A;  2PI4 A;  2O1V A;  5DM6 V;  1VQO V;  2WI4 A;  1AJN A;  1HWY A;  1R73 A;  2Q6A A;  4XTJ A;  1VQP V;  4KFG A;  1QVG U;  2EIN B;  3LNU A;  2IJK A;  3GB7 C;  2YI7 A;  2DW4 A;  1Q86 W;  4XD8 A;  4TT3 G;  3PEH A;  2CCU A;  4WUB A;  4RQE A;  5BZB A;  3JZ3 A;  4WCE V;  3ASN C;  2IU3 A;  5B1B C;  1UYL A;  2FYP A;  2WER A;  3R4M A;  3MHH C;  1JX9 A;  3LDE A;  1EBO A;  3A0Z A;  2GFD A;  2WEQ A;  1BHB A;  4JTC B;  1KP2 A;  1OCC C;  4RO2 A;  2OCC B;  2YKE A;  4XE2 A;  4R8C A;  4PDR A;  1ORQ C;  2BT0 A;  3ABL C;  3ZKB A;  1XL6 A;  1R3I C;  4MPC A;  4JTA B;  5LHI A;  2QA4 V;  1H8E G;  1UY6 A;  1GKZ A;  3ASO C;  4JF3 A;  3CCR V;  2ZDI A;  3D0B A;  1UYF A;  1YT1 A;  2EZP A;  3ZRW B;  5KUM A;  4ASF A;  1AJP A;  5CBF A;  1QLE B;  2JEX A;  3FT5 A;  2XAS A;  1JPX A;  1B3Q A;  3FB6 C;  4MTG A;  4LPB A;  4WFH A;  1NKD A;  4KSG A;  4AS9 A;  2XDS A;  4H81 A;  4JQL A;  3T0Z A;  2IW5 A;  2P90 A;  3CCE V;  1NVP D;  2QM7 A;  2UXX A;  3CCS V;  2BU7 A;  1BKN A;  4I5S A;  1QLN A;  2XHR A;  5D6Q A;  3ZKD A;  2XAB A;  4GT1 A;  1MSW D;  1I5X A;  4MP7 A;  3ABU A;  3ZIA G;  1UY9 A;  3B28 A;  3STL C;  4Z1M G;  3B24 A;  3G7B A;  2F43 G;  3T1C A;  2WAM A;  3VHA A;  5M4N A;  4DO2 A;  5J71 A;  4XDJ A;  1NH2 D;  4OXS A;  3WG7 B;  2XJJ A;  4BQJ A;  1TC0 A;  3RKZ A;  4R50 A;  2YGE A;  3TZ5 A;  1OCO B;  4URO A;  4P9P A;  2O1W A;  1QR9 A;  3FYE B;  1I5D A;  3OW2 U;  5IDM A;  4EKW A;  2CH4 A;  1K33 A;  1VQ8 V;  2XAG A;  4E00 A;  2WLH A;  1BHA A;  1UYH A;  4NH7 A;  1WLE A;  2M7W A;  3NMQ A;  4CWQ A;  3ZRX A;  4HXW A;  1AR1 B;  1VQ7 V;  1QZR A;  1SET A;  2ESA A;  1M57 C;  1R3J C;  1RPR A;  5CA3 A;  4R3A A;  4MVU A;  1DF4 A;  3K03 A;  2ZQM A;  2XAQ A;  3BM9 A;  2WLI A;  2FXS A;  3NXS A;  5L3F A;  3G71 V;  3A0Y A;  5FNC A;  3G4S V;  1MOF A;  5CPH A;  3JD1 A;  2JEU A;  4H85 A;  4XBF A;  1QR8 A;  2Q69 A;  3F7V C;  3DTU B;  3K9A A;  5IYB O;  1M56 B;  1I5B A;  2YEC A;  3P30 A;  4QPJ A;  1K8A W;  4HZ0 A;  1K7D A;  3ABM C;  2EIJ B;  1YSR A;  4AWP A;  4R1F A;  1VQK V;  4X89 A;  3ZMT A;  3K06 A;  1Z5A A;  2Y69 B;  5CTX A;  4MTF A;  2XX2 A;  1EZJ A;  5GGZ A;  3K60 A;  4EGK A;  1I5A A;  2X6A A;  2YKI A;  1ZXN A;  1FXK C;  4B6C A;  1JQ0 A;  4JGS A;  4GX1 A;  2WI3 A;  2QFO A;  4U7O A;  2FWY A;  1AH8 A;  2BRE A;  4PRX A;  1CPY A;  3CGZ A;  2YEH A;  4XKK A;  4EFU A;  4GX5 A;  4YKQ A;  2BU8 A;  4XCL A;  3TK1 A;  2JJ1 G;  3U2D A;  2YJX A;  1AI4 A;  2WLM A;  5IY5 C;  1FXH A;  1V54 C;  1SES A;  3ASN B;  4UVC A;  1I59 A;  1GKF A;  5B1B B;  2YEF A;  3ZMZ A;  2HG1 A;  1YT0 A;  3K3W A;  3TET A;  2DWD C;  3OR7 C;  2WLJ A;  1UJW B;  1OCC B;  3CCU V;  3OFN G;  1NBM G;  3T4Z A;  1S5H C;  3ZRV A;  3RVZ A;  2A0L A;  5CBG A;  1R6N A;  2EIK C;  3ABL B;  2B1G A;  3O2F A;  2AKP A;  4MVS A;  4MT8 A;  1RPO A;  3RLP A;  2VCJ A;  1ENV A;  3ASO B;  2HKJ A;  2DQ0 A;  4PEL A;  2Q8F A;  2HCH A;  4DUH A;  4WFB V;  1Q7Y W;  2QG2 A;  5M4P A;  4QNH B;  1Y4S A;  3F7Y C;  5CN0 A;  2XJG A;  4JAU A;  4UUJ C;  3K08 A;  5H6Q A;  2YJW A;  3WQ9 A;  3JD2 A;  4ASA A;  4CWN A;  4HYP A;  1ID0 A;  4MPE A;  1GO3 F;  4GCZ A;  5FWK A;  2YEG A;  4HYM A;  4RUE A;  2LFS A;  1PD3 A;  3FB7 C;  3CPW U;  4V26 A;  2YK9 A;  4MVM A;  3E8G A;  1DF5 A;  2YEA A;  3WFV A;  1S16 A;  1YJ9 V;  3KG2 A;  2WLL B;  4BAY A;  2ZD9 A;  4HZ3 A;  4CZZ A;  3TZ4 A;  1KEC A;  1M90 W;  2P7T C;  3BMY A;  2H8P C;  4LP8 A;  1R62 A;  2BU6 A;  4KFM A;  1CP9 A;  4MVQ A;  2XHX A;  3U2K A;  2ZDI C;  1K9M W;  4ZBM A;  2CCT A;  2WPD G;  5FNF A;  1GJV A;  4CWT A;  1NHH A;  2E0A A;  1FXK A;  1PNK A;  1S72 V;  3PJS K;  1F51 A;  3CGY A;  4MW8 A;  4ASU G;  2WWW A;  2YSU B;  1YI2 V;  5EC1 C;  1GM9 A;  4XDK A;  1Z59 A;  4H7Q A;  2K1E A;  5IYD O;  3CWV A;  2YEB A;  4H37 A;  3OE7 G;  1CEZ A;  4YKT A;  3SL2 A;  1BMF G;  5L3D A;  1M57 B;  2ZR3 A;  3E89 A;  4HY1 A;  1GM8 A;  5LGN A;  3QNE A;  4FMT A;  3PEJ A;  2WI2 A;  1NH2 B;  3ZN1 A;  4E2L A;  5BOD A;  3HPL C;  5LBQ A;  4P30 A;  1JOY A;  3Q5L A;  2IH1 C;  3FYI B;  2P67 A;  2IOP A;  4G28 B;  1V55 B;  1UYK A;  4E01 A;  1KC8 W;  3ABM B;  2FWZ A;  1YIT V;  4PA3 A;  3LPS A;  1R3L C;  4AWQ A;  1ZXM A;  3K99 A;  4O0B A;  1E1R G;  1DLB A;  3SJQ C;  1MU5 A;  3ZCC A;  4GT8 A;  4J9Y B;  1YIJ V;  4XDL A;  3ZMS A;  1W0K G;  5EK0 A;  2AHY A;  4QE9 A;  1FXK B;  3MNR P;  4XIR A;  1H7U A;  3ZM7 A;  4RAI A;  4BW5 A;  1VQ9 V;  2YK2 A;  3E35 A;  5M4H A;  5EBL C;  3WHA A;  1YTF D;  5D6P A;  2PI5 A;  1UYG A;  5L3B A;  4EEH A;  2QEX V;  2X0L A;  1UYM A;  5IY5 B;  4U93 A;  5LHH A;  1VQ4 V;  1UY8 A;  3JD0 A;  1V54 B;  3O6O A;  1I5C A;  3OMI B;  3UM7 A;  4I9W A;  3TZ2 A;  5HFM A;  4JYC A;  2ZDX A;  3EHG A;  4XKO A;  1GMG A;  1H8H G;  4FIP C;  5L3C A;  2JK5 C;  1Y8P A;  4ASB A;  3SPG A;  2KB1 A;  3CC7 V;  2EIK B;  3EFF K;  1VQL V;  2P6J A;  4RQF A;  1YSC A;  4WFG A;  1G8M A;  1KIJ A;  3A0X A;  3GIF A;  4YKR A;  4X88 A;  4WFF A;  5LGU A;  2ITD C;  3INX A;  2EIL B;  3F5W C;  4EFT A;  4MVR A;  5D7R A;  2BU2 A;  3A0R A;  4MP2 A;  4PRV A;  4G2K A;  3T10 A;  3OGC C;  3D2R A;  1UYD A;  3H80 A;  2YE4 A;  4BIZ A;  1YT2 A;  1YJW V;  3R4O A;  1F4M A;  1R3K C;  3GIG A;  3VHC A;  3JYC A;  1K3E A;  4NH9 A;  2CG9 A;  4FCR A;  2YEV A;  3RLQ A;  3SYQ A;  3OEH G;  1UYE A;  4JAV A;  3SYA A;  4MOT A;  3TUH A;  2V1D A;  3CD6 V;  1COW G;  1E79 G;  3ETE A;  3CRL A;  1BXD A;  3QO8 A;  2EJR A;  3T2M A;  3OPD A;  3SPH A;  3ZRS A;  3C0E A;  4DZY A;  4BXI A;  2YE7 A;  2H94 A;  3SYC A;  1H38 A;  4O05 A;  5H9C A;  1AI6 A;  2BRC A;  3CMA V;  1OCR C;  2BOB C;  3T0H A;  1M9N A;  1E1Q G;  1BGQ A;  4XIP A;  1W2B U;  2YE6 A;  3OMU A;  1AI5 A;  2XAH A;  2IJI A;  2V7Q G;  2B5U A;  4O09 A;  1K5Q A;  4BIU A;  4FJC C;  4PA6 A;  4H33 A;  4E02 A;  1YHQ V;  1FS0 G;  4XDM A;  2WI6 A;  4KTN A;  3CCM V;  1ZWI C;  3A0T A;  4LP0 A;  1KD1 W;  3HB3 B;  4JTD B;  4FCP A;  4PU9 A;  2BOC C;  5D7D A;  2HVJ C;  1MX0 A;  2XDL A;  4WF9 V;  3EHF A;  5KUK A;  2VCI A;  2YEV B;  1JJ2 U;  3B77 A;  1NJI W;  3BEH A;  1QVF U;  1EFR G;  2PNR A;  3SYP A;  1MAB G;  3QDD A;  3VHD A;  3AG1 C;  5L3J A;  3AG3 C;  4QE7 A;  1S0V A;  3AEI A;  2IU0 A;  1ZWH A;  1BL8 A;  2HLD G;  1US7 A;  3CCQ V;  1U2O A;  3LDD A;  4FCQ A;  3C11 A;  4XCJ A;  4EGH A;  1B6Q A;  5BOC A;  4XKA A;  5B3S C;  2YEJ A;  2YE9 A;  2A79 B;  2QF6 A;  5EBM C;  4CE2 A;  2XCM A;  3LDC A;  1VQM V;  1SRY A;  4UVA A;  2Q8H A;  3OMA B;  4O07 A;  1TC6 A;  3R4N A;  4PL9 A;  4GGL A;  4EMV A;  3Q5J A;  5F3K A;  4LWH A;  2WLI B;  4MTX A;  4L94 A;  4LWI A;  5DN6 G;  1YS3 A;  2WEP A;  3ZMU A;  1ZW9 A;  2ZKJ A;  1YC3 A;  5EBW C;  2IWS A;  1Y4U A;  2K5B A;  1GTO A;  4X8A A;  4CWS A;  3I55 V;  4QIW F;  4ZVI A;  1JVM A;  5D7C A;  3CC4 V;  4YKZ A;  1KP3 A;  3CYO A;  4LWF A;  1OHH G;  1JCH A;  1B63 A;  3OW6 A;  1EA6 A;  1QLE C;  2CGF A;  3EHB B;  4EM7 A;  2XK2 A;  3R91 A;  3W7T A;  2EIM C;  1FFT B;  3FB8 C;  3TCU A;  3RBZ A;  1GK9 A;  2ZBK B;  4PDV A;  3HYY A;  3QO7 A;  1YTF B;  3VAD A;  1QYE A;  3U67 A;  3T4D A;  2GQP A;  3G7E A;  4YKW A;  2C2A A;  5B1A C;  2H55 A;  3EHJ A;  1Z5C A;  1J95 A;  3OAA G;  3IGA C;  2ZXW C;  5IYC O;  3IFX A;  2JIZ G;  3CCL V;  2XDK A;  1XL4 A;  3K0G A;  1KKD A;  4MPN A;  4QJF B;  4U7N A;  3K79 A;  1THZ A;  4XC0 A;  1VQ6 V;  2WLN A;  3HYZ A;  3OEE G;  3QO5 A;  4JPR A;  5LGT A;  3H4L A;  3R4P A;  4UVB A;  1UY7 A;  3K98 A;  4YKU A;  3OM3 B;  3E86 A;  3AG2 C;  2Q8G A;  4LC1 A;  1OZ0 A;  3LSQ A;  1Y8O A;  3MD0 A;  2XDX A;  1OCR B;  1TUE B;  3RW0 A;  3G6E V;  2A9H A;  3DGE A;  3K04 A;  5CTW A;  3I56 V;  5FND A;  3ZXQ A;  4MVO A;  1RM1 C;  1YC4 A;  1GKX A;  2QM8 A;  2W6I G;  4R6Z A;  3D36 A;  2YEI A;  3Q5K A;  3A0W A;  4YKY A;  1SZT A;  1KQS U;  5C93 A;  2HVK C;  4JYB A;  2IJH A;  2IWX A;  1M56 C;  4URN A;  3TTZ A;  5F5R A;  3X2Q C;  3K97 A;  2JJ2 G;  5FL7 G;  3ZMV A;  1TIL A;  3OUS A;  1S77 D;  3MHS C;  1KZN A;  1K97 A;  1S14 A;  3ZRW A;  2YE3 A;  2XHT A;  2EXL A;  3R65 A;  3EKO A;  1PL0 A;  5B1N A;  3AG1 B;  3OMN B;  4L91 A;  2HFE C;  2YE8 A;  2AHZ A;  3VOU A;  2JJC A;  3HEK A;  4R3M A;  4CWR A;  2HG5 C;  4F4L A;  3CCV V;  4UV9 A;  1ROP A;  4FK5 C;  5B3S B;  3TZ0 A;  3ZJZ A;  1BYQ A;  3SYO A;  4Q20 A;  1I5Y A;  4MBC A;  5CF0 A;  1P4R A;  5B1O A;  2OT5 A;  3T1K A;  3IED A;  1VQ5 V;  4HXZ A;  4WUC A;  4P8O A;  1NHI A;  3CXC U;  2XAF A;  4GQT A;  3LUT B;  2YKC A;  1OSF A;  2DYR C;  5E1A C;  1K5S A;  3LSS A;  4PDM A;  3E2E A;  1AJQ A;  3ABK C;  1U0Z A;  4W7T A;  1DTO A;  4XIQ A;  2NNU A;  1TH8 A;  4WUD A;  4PA4 A;  3H01 A;  1TBW A;  3GIE A;  2DQ3 A;  3O0I A;  3SPI A;  1K73 W;  2EIM B;  1SER A;  4UXN A;  2XX5 A;  3KE6 A;  3W7X A;  2DWE C;  1N8R W;  3SPJ A;  3B8N A;  2IJJ A;  2XX4 A;  3QTF A;  4URL A;  1AM1 A;  2UXN A;  2DYS C;  2Q2E B;  5L3E A;  3ABT A;  1H7S A;  3AG4 C;  2OTL V;  3K0D A;  3E8F A;  2QTO A;  2QG0 A;  4PA7 A;  2HJF C;  5B1A B;  4CWO A;  3W7U A;  5HFL A;  3OUF A;  3FKS G;  2ZR2 A;  2X6B A;  1UYI A;  1IXM A;  2ZXW B;  1PNM A;  2CK3 G;  2QE7 G;  4KSH A;  4WFA V;  5M4E A;  3FV5 A;  4P2Z A;  4HZ5 A;  4EGI A;  2VWC A;  2EBO A;  2XD6 A;  2XJX A;  1Y4M A;  4CE3 A;  2WSS G;  2BZ5 A;  1QCE A;  2WI7 A;  1YC1 A;  4K4O A;  5H6R A;  4JAS A;  3ML0 A;  4BAE A;  4QPK A;  4AWO A;  3AG2 B;  5KA6 A;  3IC7 A;  1AJ6 A;  4YKX A;  3CCJ V;  4L93 A;  3D3I A;  3UKM A;  3EKR A;  4LWE A;  4N23 A;  4GFN A;  4P7A A;  1K4C C;  4LWG A;  1RM1 B;  1L1F A;  4HY6 A;  3INW A;  2R9R B;  4V25 A;  5J9P C;  2YE2 A;  3GIG B;  5CBH A;  3W7W A;  2FTK A;  4J9Z B;  4LCU C;  4RUF A;  3JD3 A;  1Y8N A;  5L3G A;  5GW7 A;  2X7R B;  1V55 C;  4XIT A;  1P7B A;  2IH3 C;  4L87 A;  3X2Q B;  1OCZ C;  5LHG A;  1S3J A;  1MG1 A;  4CWF A;  1Y66 A;  2Y48 A;  3HHU A;  4X9L A;  5J6A A;  2BSM A;  1NQT A;  3GWO A;  4MB9 A;  3ZN0 A;  4LBE C;  1THN A;  2EIN C;  5M4K A;  4ASG A;  1Q82 W;  2IOR A;  5CTU A;  1K34 A;  2YGA A;  3HZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...