4FPPA

Bacterial phosphotransferase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
205
structure length
205
Chain Sequence
PDFAAMLAARLCHDFISPASAIVSGLDLLEDPSAQDMRDDAMNLIASSARKLADLLQFTRVAFGASASAENFDSRELEKLAQGVFAHVRPTLDWQIEPQAMNKPSSRAVLNIAQIAASALPAGGVATVKGVAADGRFSIIADAKGPRARLRPEVLAGLKGEPLAEGLGGPWVQAAYLNALVRAAGGQIAVEIGEDRASIAAWVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords phosphotransferase
publication title Structural insights into ChpT, an essential dimeric histidine phosphotransferase regulating the cell cycle in Caulobacter crescentus.
pubmed doi rcsb
source organism Caulobacter crescentus
total genus 66
structure length 205
sequence length 205
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10090 HPTransfase Histidine phosphotransferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fppA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4fppA02
3P32A 5IN9A 3R4MA 4URLA 3QDDA 2YGEA 4U93A 2FWZA 1QY8A 2XD6A 1ZXNA 4AS9A 3T0ZA 2XX4A 3SL2A 4HZ5A 5GGZA 4BIZA 1JM6A 4HYMA 2GQPA 5M4MA 4JASA 3IEDA 2YEEA 4CWRA 4BAEA 2XDSA 5BOCA 2JJCA 4QPJA 1YESA 3GIGA 4PRVA 3A0WA 4L8ZA 3LNUA 4JYCA 4MP2A 1BXDA 3A0TA 2CCTA 2YGAA 3Q5JA 1UYMA 4XCJA 3TZ2A 2XX2A 2WI2A 1UYHA 2ZDXA 1JOYA 2YK9A 4WUBA 2IOPA 4MT8A 2ZKJA 4P7AA 4XC0A 4LWGA 3C0EA 4EGKA 2H55A 1B63A 2IWSA 3O2FA 3B24A 1BKNA 4MPNA 5IDMA 5CTUA 2XX5A 4YKYA 1Y8OA 2QF6A 5CTYA 5BODA 4XKAA 5M4NA 1U2OA 4XITA 2BSMA 3TZ0A 2VCJA 2YKCA 1ZXMA 3D0BA 4URNA 4MB9A 4DZYA 1Z5BA 2YKJA 3K97A 4ASBA 4JQLA 1YT0A 4JAUA 3T2SA 1UYDA 1Z59A 2YE3A 4YKZA 4V26A 3TZ5A 3K60A 1YSRA 1TC0A 4ASAA 2VW5A 4O0BA 4W7TA 2XJXA 1KIJA 3HYZA 1Y4SA 2IWUA 4HYPA 1H7UA 3FT8A 4U7NA 2Q8IA 5F5RA 4ZVIA 2XHRA 1IXMA 1UY6A 3TZ4A 3ZM7A 4ASGA 2XCMA 3CGZA 2BU7A 5FWKA 2YECA 4CWTA 2BT0A 3B28A 2EXLA 1I59A 4EM7A 1AMWA 2YI6A 3R92A 4O05A 1UY8A 4MPCA 3EHGA 4K4OA 1QYEA 2YEBA 2HCHA 4AWQA 4LWIA 5FNCA 1THNA 2XHXA 4WUCA 2CCUA 1B62A 4V25A 1Z5CA 1I5BA 2VCIA 2O1WA 4XTJA 1YC3A 2WI4A 1AJ6A 3A0YA 3EHHA 1L0OA 1UYCA 4L94A 4B7PA 2BYIA 3R4NA 2YJXA 5M4HA 2IWXA 5FNFA 3GIGB 2WI5A 4L93A 3ZXQA 3BMYA 4CWPA 4PU9A 4MBCA 5D7CA 2C2AA 1ZW9A 4L90A 3RKZA 4KSGA 4KTNA 3TTZA 4CE3A 1Y8NA 3KE6A 3ZXOA 1I5AA 2XDUA 4GFNA 2LFSA 1BGQA 3OPDA 2Q8GA 4KSHA 4JYBA 2CGFA 4CWSA 2QM8A 3ZKDA 2CCSA 3T1KA 5CTWA 3TUHA 2YEJA 4YKXA 3U67A 2ZBKB 3WHAA 4KP4A 2BTZA 3LPSA 3NMQA 4H7QA 2FTKA 5D7RA 1TC6A 3D36A 4XCLA 4EFUA 2WEPA 2VWCA 2YE9A 2AKPA 4GGLA 3VHAA 2GFDA 4MOTA 4XIPA 2YE4A 4HY6A 3ZRWA 3CGYA 3INWA 4HY1A 2XDXA 4XKKA 1GKXA 2XDLA 2UWDA 1AH6A 2FXSA 2YEIA 2WEQA 1EI1A 3HYYA 4CWOA 4AWOA 2XHTA 4NH8A 3ZRXA 2BZ5A 2HG1A 2P67A 1QZRA 3C11A 2YE8A 4BXIA 3RLQA 4E02A 3FV5A 4I5SA 3EKOA 4LC1A 2O1VA 4XD8A 2XK2A 2XABA 3A0ZA 3CRKA 1R62A 5FNDA 2YK2A 2WWWA 3QTFA 2HKJA 4X9LA 2IORA 3GIEA 4R3MA 3INXA 4WUDA 5D7DA 1ZWHA 3BM9A 4YKUA 2JKIA 2XJGA 3OWBA 5M4KA 3GIFA 4O04A 2YE6A 4XDMA 3T0HA 3HZ5A 4H85A 3VADA 1I58A 2BYHA 3EHFA 4H81A 4BQGA 4URMA 1TILA 1NHJA 4YKTA 4EGHA 5J71A 1YERA 1F51A 2H8MA 3DGEA 3OMUA 3ZKBA 3ZCCA 3K98A 1YC1A 4E00A 2BU8A 3EHJA 2YEAA 3Q5KA 4FPPA 2FYPA 1A4HA 2YGFA 1UYFA 3U2DA 4YKQA 4GQTA 4CWQA 5CF0A 4JAVA 2YI0A 3T10A 1UYLA 1TBWA 4LP0A 4FCRA 3B27A 4EGIA 2XDKA 4EMVA 3H4LA 3G75A 1KZNA 2PNRA 4XE2A 1U0ZA 2ZDYA 1AH8A 4U7OA 5M4PA 4B6CA 2YKEA 4FMTA 4QPKA 4XIRA 4CWNA 1S14A 2YKIA 4CE2A 1GKZA 1YT2A 2BU5A 1Y4UA 5B1NA 3R4PA 1OSFA 2LFRA 3ZRWB 2Q2EB 3ZRVA 1Y8PA 3RLRA 2QG0A 3O0IA 3U2KA 2BU6A 3MD0A 4PRXA 3O6OA 5C93A 4HXWA 2WI1A 3RLPA 4GT1A 4AWPA 3R91A 1US7A 1EA6A 4XKOA 4BQJA 3A0RA 1ID0A 4GEEA 3WQ9A 3CRLA 2YJWA 1S16A 1YT1A 1UY9A 4XIQA 4LWEA 3EKRA 3B25A 1NHIA 4O09A 4LPBA 4FCPA 3VHDA 2Q8HA 3OW6A 4O07A 1MX0A 4LWFA 2WERA 5B1OA 2YEFA 2BREA 4GT8A 2YE7A 2WI3A 2YEDA 2YEGA 1PVGA 5D6PA 3JZ3A 4ZKIA 5D6QA 3OWDA 1H7SA 1UYIA 1GJVA 1UY7A 4UROA 2QM7A 3R4OA 1I5DA 1YETA 2YKBA 5CPHA 4I3HA 4KFGA 1UYGA 3A0XA 3G7EA 2K5BA 2CG9A 3B26A 4FCQA 2CH4A 4CE1A 2IOQA 2WI7A 1TIDA 4HZ0A 2O1UA 1MU5A 2ESAA 3K99A 2Q8FA 4DUHA 1NHHA 4KQVA 5CTXA 3VHCA 2XJJA 2YI5A 4EEHA 2WI6A 1UYKA 4LWHA 2YE2A 4YKRA 1B3QA 1YC4A 3Q5LA 4NH7A 3CWVA 2BRCA 4E01A 3PEHA 4HXZA 2E0AA 2YEHA 4Q20A 5IDJA 2FWYA 4PL9A 5L3JA 3PEJA 1Z5AA 1BYQA 1UYEA 3FT5A 1AM1A 4MP7A 2QG2A 3G7BA 5M4EA 3H80A 3TK1A 3HHUA 3NXSA 2YI7A 3HZ1A 3MNRP 1YS3A 4YKWA 4ASFA 4CWFA 3HEKA 2YE5A 4R3AA 2BU2A 5F3KA 3D2RA 4P8OA 4NH9A 1YSZA 4GCZA 2QFOA 4L91A 4MTXA 4BIUA 4R1FA 4MPEA 5J6AA 4EFTA 1I5CA 1TH8A
chains in the Genus database with same CATH superfamily
2QJ1A 3P32A 4UFZA 3QG5A 1IXBA 4MVRA 1SRYA 2FWZA 4K8XA 1QY8A 3T0ZA 3W7SA 3EXAA 5GTHZ 5GGZA 1FXKC 3CYOA 2CTWA 2YEVA 2GQPA 4JASA 2JDIG 2YIBA 4NR1A 4GX1A 4UCTA 4BAEA 5BOCA 2YXHA 3RT3C 3T1HB 4QPJA 3GIGA 3K9SA 4JI5B 2QGNA 2UUCO 3K3WA 4JYCA 4MP2A 2Q0OC 4DUZO 1BXDA 3CCEV 3QO5A 2CCTA 4XCJA 1UYMA 1KKCA 5JVDB 2XX2A 2YSUB 4LP8A 5D5PA 4FM2A 4DV2O 3JCZA 4MW3A 4Q6GA 4FLUA 2YK9A 3LNNA 2A7WA 4P7AA 5JCOA 4XC0A 1GM7A 4O4LB 3C0EA 1YTFD 3CRMA 2K1EA 5JJEB 2JS5A 3O2FA 5EBMC 5CTUA 2IJIA 1PPJH 2UXCO 1I7FA 1U2OA 4YHHB 3TJTA 3AG2B 5H2FZ 4DV6B 4O2BB 5KA6A 1ZXMA 3G67A 2YKCA 4DV4O 4FZ1A 1QR9A 3B09A 4LF7O 3B8NA 3L9DA 2YKJA 3CHXA 2PF4E 1IBLB 4JQLA 1O9GA 4HNAA 1YT0A 2OT5A 4JAUA 1UYDA 2ITCC 1HNZB 2YDEA 1YSRA 3K60A 2PZSA 3AG1B 1XMOO 2Z0AA 4ABMA 2W6JG 3UM7A 1Y4SA 4TV8A 4YJ3A 2Y4TA 4DYLA 2YIAA 3SJCC 2RN9A 2UXBB 3FT8A 2XAHA 2Q8IA 1H2NA 4LF5B 5JENA 2XT9A 3BFRA 2GUZA 2ZXWC 2BTOA 3ZM7A 1SQFA 1N36O 3BRCA 1I59A 4EFEA 1AMWA 2YI6A 2EZOA 3LNMB 2V7QG 3FAVA 3OMNB 4K4OA 4X1KB 2ZE8A 1FJGB 2XTAA 4YY3O 2LGQA 5LXTB 2RNBA 4FLWA 2CCUA 1B62A 2X7RB 1M9NA 1HR0B 1XBLA 2WLLA 2VCIA 3QTCA 4W4LA 5LOVB 1F4NA 4XTJA 3K79A 1YC3A 1XNRO 4DRXA 5BXZA 5IYZB 3EHHA 1BQ0A 3OUSA 2QM4A 1VQ4V 1NR7A 2BYIA 3MAQA 5M4HA 4KFMA 3ZMZA 5HFMA 2LJ2A 4L93A 1D5AA 3ZHUA 5D7CA 4GZRB 1Y4MA 4IL6Z 3K08A 4KTNA 2IW5A 3U0ZA 4FFBA 1IBKO 2VRZA 4CE3A 2IH1C 2XDUA 5CA0A 4GFNA 3C3TA 4XDJA 1RSOB 4O2AB 5LGTA 4B3MB 1H8EG 2IM9A 2Q8GA 1YJWV 4JYBA 2BCCH 2CGFA 2DWDC 3JD4A 3LUTB 1AP6A 3Q4HB 2XASA 3TUHA 2UUBO 3E83A 4YKXA 5L3DA 3U67A 3OGIB 5LA6B 5IY5C 4LFBO 3JATB 4IYHA 2KQXA 3PN1A 2IU0A 2OWOA 2VWKA 5KAFZ 3D36A 4EEQA 2FL4A 2ZDIA 4NYKA 4DV7B 4PA6A 2D2CB 3HR0A 1G8MA 3SJQC 4MOTA 2DN9A 2ETNA 4HY6A 3HKBB 5C8YB 5EBWC 4HY1A 3PJSK 2W6IG 2LW1A 1TVKB 1M93A 3E35A 4WBNB 3K5OA 2UWDA 3IC7A 4UXNA 2BOBC 1K5SA 4DV6O 1N4CA 1EI1A 3HYYA 1HW7A 3VQYA 4B3SB 1W59A 2P22C 4QGPA 1VQ8V 1VF6A 5JVDA 2IJJA 3O65A 3G6EV 1IBLO 2JVDA 4NTYA 5IYBO 1GN3A 5JH7B 1HNZO 1WP8A 4GX2A 2EIJB 3OGCC 3K57A 3VQWA 4YIOA 4I5SA 2O1VA 3UCSC 1N34O 3A0ZA 3CRKA 1R62A 3CCMV 4G2KA 1CEZA 2P4VA 4TOIA 1A32A 4O2BA 3RYFB 3THOA 3QTFA 2HKJA 4KL1A 2AHZA 3CCRV 3SPIA 2AXTZ 2XAJA 3INXA 4PV1B 1SQGA 3E86A 3BM9A 4YKUA 2Q5ZA 3OTFA 3UQ8A 2JKIA 5M4KA 1J5EB 3GIFA 4O04A 1KP3A 4FK5C 1VQ7V 3CC4V 2WSSG 4PA4A 1VQPV 2OYQA 2C1GA 3T0HA 3E22B 2ZD9A 3EHFA 1P84F 2WA4A 4HZ3A 4RAIA 5B3SB 1TILA 1VP7A 1F51A 4LH7A 1TAEA 3AG7A 2N04A 3OMUA 4RUEA 5E79Z 1HR0O 1YC1A 4P2ZA 3W7XA 3OD4A 5IJ0B 3OFNG 4HBNA 1W2BU 3Q5KA 4JI3O 4FPPA 2FYPA 1FFTB 1OV9A 4O4HA 2NN4A 2R9IA 2DQ3A 3RVYA 4GQTA 2LQTA 1OCZB 2ZE6A 4GYCB 5EZYB 3CSXA 2JGUA 4MTFA 3T10A 1UYLA 4TT3G 2K9PA 1PD3A 4QE7A 3AK3A 4EGIA 2XDKA 1D2DA 1IBMB 4EMVA 3H4LA 2PNRA 1NKDA 5LXTA 4JI7B 4FMTA 2VQFO 4CWNA 1SZTA 3JSNA 4QE9A 5LOVA 1WPXA 4DR4B 3IFXA 1KP2A 1AILA 1BS3A 3D8CA 2Q2EB 5IYZA 1Y8PA 3RLRA 5BZBA 3MD0A 2LW7A 2ILMA 4DR3O 5FNVB 5LMUO 2WI1A 1OHHG 3WFVA 3RLPA 3LSQA 1JVMA 1US7A 3JD2A 4J41A 1ZSPA 1JPXA 1VF5B 2Y4UA 3A0RA 1ID0A 1JR9A 4FFKA 1XI1A 3CRLA 2YJWA 2ADPA 1YSCA 4TQFA 5CBGA 1KC8W 1RSOA 3HPLC 4LWEA 2EINC 1YVWA 3EKRA 2BTQB 1OCRC 4EFBA 4UCSA 3F7YC 5CBHA 3OW6A 4O07A 1N0NA 1LUWA 4O4IB 3VOUA 3Q4HA 3JAKB 5B1OA 3ABTA 1CXZB 3ETDA 2BREA 2YE7A 3BPZA 1QR8A 3SGIA 5LA6A 3JATA 4MVUA 4B3SO 1YCIA 3SJAC 3WG7C 3N2GB 4JI8B 2ARHA 2YS8A 4ZKIA 1G1XB 1H7SA 4WF9V 4DV5B 5KHGA 1TUBB 4AQYB 2CTRA 4DR7B 3B4SA 4JI1B 2HJDA 3STZC 2Q9LA 1YETA 2YKBA 5CPHA 4KFGA 3HKBA 3ETQA 3G6BA 2Q6AA 2K5BA 5C8YA 1U96A 2Y0IA 3G7EA 1WJZA 4GX0A 3ABLC 2ADQB 1TVKA 4U3JB 4WBNA 3ETEA 2F1MA 4XDLA 3H9VA 4X64O 4JI4B 3B40A 4QJFB 4DUHA 4KQVA 2UUAO 4K0KO 2XJJA 5CA3A 2WI6A 2CE4A 5IE9A 5EK0A 4NH7A 2BSKA 1F7YA 4JI2O 2E0AA 2JJ2G 1Y67A 5DECA 2F4VB 2ATKC 1Q7YW 1BYQA 3JARB 1UYEA 3FT5A 1SQPH 1G4YB 2YI8A 5JH7A 4BW5A 4TUYB 3TK1A 2YI7A 2VS0A 3MNRP 3WB0A 3LDEA 3FD9A 4YKWA 3AK2A 4R6ZA 2OCHA 4B3RB 3RYFA 3I55V 4GCZA 2NNUA 2QKSA 2ODMA 4MPEA 3JCUZ 2Z5UA 4DV1O 3R4MA 3AG4B 3QO8A 3S5TA 4URLA 1IZ3A 3SYPA 3X2QB 4DO2A 2YGEA 3I56V 1YJ9V 1IBMO 3E22A 1ZXNA 2XX4A 5IWAO 4JI7O 4BIZA 2CTQA 1QVGU 1S5LZ 2AHYA 1ROPA 1FAFA 1AJPA 5IJ0A 2YEEA 4CWRA 1DLBA 2QWPB 3H1LH 2R9RB 5LHHA 2EJ7A 2WA3A 2CTPA 1PV0A 1MZEA 2C1IA 3OMAB 4K35A 5EZYA 1JMKC 2QKAA 3E8GA 1KECA 3DTUB 1M5IA 2ZR2A 3TZ2A 4I9WA 1NS1A 1UYHA 2LGWA 1V55C 4X20B 4MT8A 1M56C 4LWGA 3FB7C 4HAMA 1FXKB 3OR6C 2IWSA 4UVBA 5H6RA 3LSSA 3EFFK 5IDMA 1L8DA 2ZNJA 1BCCH 1PL0A 2DYRC 4YKYA 3K0GA 1VARA 5BODA 3K5LA 2DJVA 4XKAA 3QF7A 3TZ0A 2VCJA 4LFAB 3ZIAG 2PI4A 3P3PA 3ZMSA 3G71V 5FNVA 5J2UA 4DR6O 4MB9A 4DZYA 1Z5BA 4J80A 3F5TA 5IYDO 1EN4A 4LFCB 4ASBA 2E5LO 3S3WA 5LYJB 3T2SA 4QNHB 1Z59A 2YE3A 1F4MA 3TZ5A 5AG2A 1R3IC 4AQYO 4DR7O 5GW7A 1V54C 4O0BA 2BTQA 5CB4B 3L75H 4HYPA 2HVJC 4OGQB 1M57B 1R3LC 4PJ0Z 4MS2A 3CCVV 4O4IA 1M4UA 3JAKA 4JI4O 5F5RA 1RPOA 1NBMG 3K5MA 3FYIB 4J42A 2XCMA 2BU7A 2ZT9B 2RQ6A 2YECA 3N2GA 4CWTA 3JASB 2BT0A 5LMNO 3IGAC 3B28A 3R65A 2W0XA 1I94B 1TUBA 5L3CA 4JF3A 4MPCA 1N33O 2PTMA 3EHGA 2HCHA 1AI7A 3E8BA 1BL8A 4AWQA 4LWIA 5FNCA 1THNA 2XHXA 4WUCA 4DV3B 4JI6B 4I4TB 1VQ9V 4FM0A 4B7EA 4WFBV 4DV0O 3OEHG 4LR3A 1VQKV 4U3JA 5JCOC 2O1WA 3ASNC 2KB1A 5E1AC 3ZBHA 4B3RO 2HJFC 5L3BA 1N32O 1AJ6A 4X89A 1L1FA 4L87A 1UYCA 5EBLC 2OCCB 2DWEC 4NXNB 3CJHB 2E76B 5KUMA 2XHBA 3R4NA 2QE7G 5FNFA 4JYAB 3ZXQA 1VQNV 3BMYA 4X1YB 1AR4A 4LF8B 1RM1B 1XOUA 5B1AC 3BA8A 1AR1B 2DMXA 4MVSA 3KE6A 3ZXOA 5TISZ 3H1KH 2WLJA 2LFSA 1BGQA 4GX5A 1OZ0A 1L0NH 3CC2V 2YXLA 5B66Z 4X62B 4WCEV 3QVNA 4UCVA 3T1KA 1K3EA 1XMQB 4DR5O 2ZBKB 1WA8B 4KP4A 2R9AA 3G80A 2BTZA 4UCRA 3NMQA 1H2KA 2W0FC 1Q82W 1DK1A 4C7UA 2MW2B 2VWCA 4PI0A 1US6A 5BR8B 2YE9A 3VHAA 2GFDA 2YE4A 2CH7B 3B8MA 3ASOC 2GTSA 3RGBA 4AHCA 1GKXA 1W0KG 4OPAA 1BHAA 3VBBA 2Y48A 1AH6A 4LWSB 4G27B 5IY5B 3KG2A 3JD1A 4BWAA 5KMGB 4LFCO 3ZHTA 4JZGA 2JGDB 4NXMO 1I5YA 4NH8A 1GRJA 1AROP 1QVFU 3N27A 4RUFA 4TQDA 1FXKA 3C11A 4JV5B 4K8ZA 2OTJV 4B3TB 4LC1A 4XD8A 2UXDB 2XK2A 2XABA 4GKJB 5LP6B 4MW8A 5ITZB 1DF4A 2WWWA 1FS0G 2B5UA 4UV8A 2Q73A 2IORA 3GIEA 1IURA 1Y6XA 4JI0B 1MZFA 1AI6A 3ZHSA 2CAZC 4U3FH 4UVCA 5LYJA 1Z2GA 2EILC 3W7UA 5FPRA 3A0HZ 3VQXA 2IJKA 1MMMA 4UVAA 3K9AA 4H81A 5CB4A 1NHJA 5EIBD 3D36C 2H8MA 1QBZA 4JI6O 3DGEA 3P30A 5L3FA 3ZCCA 3K98A 3R66A 4J9YB 4NKGB 4E00A 3EHJA 2PI5A 2PUSA 1VQOV 1UPGA 1OCOC 3CXHF 1K33A 3S3XA 1S5HC 3JASA 5JQGB 1E1RG 5FLXN 4JYYA 4I0XB 4FCRA 2P5OA 4H33A 4XE2A 1AH8A 1VF6C 4J7ZA 4WFGA 3SJBC 4B6CA 3GB7C 4I4TA 2Y69C 4XIRA 4WFEA 1S14A 1H2SB 2YKIA 4RQEA 4CE2A 1YT2A 3T1HO 5B1NA 3R4PA 2HKOA 1NR1A 2F95B 5HFLA 3L70H 4JI5O 1UJWB 4GKKB 2PYJA 3OW2U 3ZRWB 2QG0A 3U2KA 3CC7V 3H1IH 2BU6A 1XMQO 4LH6A 4YXWG 4DK1A 3TXQA 3ZS8C 4HXWA 2DOSA 3K0DA 3OEEG 3AG2C 4X1YA 4KHPB 2CK3G 4AWPA 3R91A 2VQEB 3OR7C 4YIPA 1I08A 1EA6A 2F23A 3ABUA 4FZ0A 4I7ZB 3ZN0A 1AP5A 1KQSU 1Y76B 2Q68A 1FD9A 4OX9B 2WPDG 3VHDA 2X0LA 2Q8HA 4DUYB 2EIMC 1AJNA 4YHHO 1MX0A 1DF5A 2WERA 1JJOA 4GT8A 2FB5A 2WI3A 4OPHA 1EZVH 1K4DC 1YI2V 2R70A 3L71H 5D6PA 4O4LA 2XAQA 5D6QA 2HEPA 1UYIA 4IT5A 2A3QA 2DE0X 3R4OA 1S77D 1PNMA 4I3HA 2UXBO 1UYGA 4L8JA 4JV5O 4FVMA 5IJ9B 2CH7A 3A0BZ 2CG9A 4LF5O 2QWOB 3DC5A 2CH4A 2CGOA 2IOQA 2WI7A 3JYCA 1TIDA 1QLEC 4FLTA 2ESAA 3K99A 4GKJO 1NHHA 5CTXA 4FLZA 1UYKA 4YKRA 4LWSA 3KKYA 1YC4A 2GBOA 2IBZH 2OIEA 3AG3B 1PP9H 4DW1A 3WG7B 3K5NA 5KMGA 1VQ5V 4DR2B 2JGDA 1NTZH 2GV9A 1FJGO 1QLNA 2QEXV 3QO7A 2QG2A 5M4EA 2RDCA 3H80A 3KCYA 2NLJC 5B1BB 3SPGA 1I5XA 4ZHQB 5KHKA 2QA4V 3CRAA 4ASFA 4CWFA 2BU2A 3MDSA 3ABLB 3ZEDA 2ZM6B 4A5UB 5J9PC 3ZMTA 5LP6A 3T1YB 3OTOB 5ITZA 1YSZA 1JFFB 3ICXA 2HG5C 2GTAA 2QFOA 4R1FA 4BIUA 2HP8A 5IYCO 1QCEA 3E8FA 4X1KA 1KUQA 1I5CA 5IN9A 1BSMA 1XDCA 4XBFA 1DTOA 3JALB 4U93A 3TGUH 4X66B 2XD6A 4AS9A 4HZ5A 4B3MO 2QWNB 2XOKG 2JK5C 1U97A 3JD3A 1QQCA 3MHSC 4NTWA 4PELA 2JJCA 1NT2B 3HKDB 3LSUA 3U11A 4P30A 4PRVA 3A0WA 4L8ZA 3LNUA 4UCUA 5JQGA 3A0TA 1HDJA 1VEWA 4KXRA 2GDSA 2YGAA 2JEXA 3FYEB 4I0XA 4TSFG 1YHQV 2WI2A 4DV7O 2VQEO 4N21A 3SYCA 2ZDXA 2JIZG 3LDCA 4O2AA 5H5NA 4OXSA 1FPOA 5EYPB 1XREA 2UU9B 3CCSV 4P9OA 1BKNA 5L3GA 2DYSC 2XX5A 1ZTEA 4DUYO 1Y8OA 5BMVB 4ZI7B 5CTYA 3STLC 1AJQA 5CA1B 4JTCB 5M4NA 2BSMA 3J81N 1IX9A 4CH3A 1YIJV 2BOCC 3BAAA 1VQLV 1PL4A 2B1GA 3OT7A 4PI2A 5FPOA 1V55B 2CGNA 4YKZA 2Q7GA 4ASAA 2B9ZA 2VW5A 4W7TA 1Y76A 4F6EA 3K06A 4LF9B 1KIJA 2QDOA 5KHHA 1H7UA 1Q6HA 3E8HA 2DYRB 3ZMVA 4U7NA 2HHHB 4CH4A 4ZVIA 3RYIB 1J95A 4ASGA 5FWKA 3SPJA 4F4LA 3OMIB 1J5EO 3JSLA 2Y0PA 3R92A 4PDRA 5H6QA 1OCZC 3HB3B 4O05A 4ICGA 4JZ2A 3H1HH 1K8AW 5CBFA 1Z5WA 2JJ1G 4NB5A 3G4SV 2DW4A 2WLNA 5IT9N 3ABKC 2A0LA 2EBOA 4V25A 4R7CA 1GM8A 5JJJB 3GVMA 1T5EA 2YIDA 2ZM6O 2WI4A 5A9GA 2P7TC 3OTOO 1WP7A 1R6KA 2HHIA 2P6JA 1L0OA 1PNLA 4L94A 2E74B 4I55B 2EULA 4X65B 1WNSA 1YZBA 3GIGB 4PU9A 1BE3H 2M6YA 1ZW9A 4L90A 3RKZA 4KSGA 1KYOF 4UB8Z 2EIKC 3TTZA 2KKWA 1Y8NA 1G6UA 4ASUG 1SKVA 4DR4O 2E75B 3CYGA 3ZX6A 4X9QA 4KSHA 3ASNB 4CWSA 1JFFA 3BHPA 2AW9A 2QM8A 3ZKDA 3TXSA 2CCSA 4JTAB 2YEJA 1GMGA 4X1IB 4CBCA 2WLMA 1VIBA 2UUCB 4H7QA 2FTKA 1ZL8B 3JALA 2X6CA 2RCVA 3RYHB 1KKDA 1TC6A 4H44B 2ZINA 5B1AB 4O4JB 1B6QA 3DXRB 1TA8A 2MK3A 1EM1A 2EX3A 4AI8A 4WFHA 4XIPA 3UKMA 4XDKA 3CGYA 1SA0B 2UU9O 1XQ8A 2CUGA 1URFA 1RFYA 3HKDA 4R8CA 2QTSA 2Z3YA 2CDYA 2YXYA 1VQMV 1JQ0A 2UXCB 3WB1A 2YEIA 3L73H 4JI8O 2WEQA 1ZWIC 1NVPB 4FIPC 4DV5O 3O9OA 4JI1O 4BIOA 2QTOA 3JAMN 3LMMA 1SQBH 3SDLA 2BZ5A 1GTOA 3E89A 4DXWA 1H2MA 5EYPA 2HG1A 1GK9A 4LF4B 2P67A 1QZRA 2YE8A 3CE2A 1M1KW 4LF9O 1XMOB 3FV5A 5LL6Y 4E02A 1GN6A 3ML0A 3EKOA 2Q8VA 3ZMUA 3OUFA 5BMVA 4ZI7A 4EB6B 2HHHO 1ENVA 5FNDA 2A9HA 2WLLB 5LHGA 2EZPA 5KX5B 4X9LA 1QU7A 2BE3A 2ZIMA 2YI9A 2F4VO 4UUJC 5D7DA 1H38A 4NVPA 1Z5VA 3W7TA 5F2VO 4CC5A 3ABMC 1H8HG 4PHZA 4XDMA 3AG4C 4WFAV 3VADA 5KA5A 3M99B 4MVQA 3CCLV 4URMA 3WB2A 4YKTA 1YERA 1WAZA 3ETGA 3ZKBA 1BQZA 2AZ2A 1B04A 5JWPA 3CRCA 2ZXWB 1MABG 3P3NA 2YEAA 1ZLZA 1A4HA 1O9HA 4DW0A 3RYIA 4QIWF 3AEIA 3U2DA 3K58A 2AZ0A 2H94A 4YKQA 1NTMH 3JARA 1N8RW 1XNRB 4CWQA 1S0VA 2YI0A 5KLVH 4TUYA 2QWRB 4P9PA 2EILB 1NH2B 3CRRA 3JAWB 1H2LA 4YJ2B 1KZNA 1U0ZA 3RW0A 4U7OA 4LNUB 4ZIBA 4MTGA 3N2KB 2KG7B 1IBKB 1LUVA 1S3JA 1OCCC 1Y4UA 1GN2A 1OSFA 5DEDA 3D3QA 4I50B 2B1IA 3M7MX 2PYLA 2ZNIA 1SQXH 3ZRVA 1OCOB 2PGGA 4UCOA 3O0IA 3VQVA 3J80N 1P4RA 4I55A 4PRXA 2UUBB 4K3AA 1KMIZ 3CD6V 3UO2A 4LFBB 1XNQB 1YDXA 2LO1A 1KD1W 2QKCA 1K92A 3WQ9A 1IVSA 1JJ2U 4B08A 1NVPD 1MA1A 4XIQA 2Y69B 1XHZA 5B5EZ 1YEWA 3B77A 2DQ0A 3B25A 1NHIA 4BW9A 4FCPA 4LWFA 3BA9A 4CZZA 4H13B 4LFAO 1M57C 1XHXA 3CCJV 1K73W 1R1BA 2YEFA 4X1IA 4MVMA 2UXNA 3TETA 2YEDA 4MVOA 1SQVH 4X20A 1ZL8A 1MG1A 2Q67A 5CMUA 1SZXA 3RYHA 4CS2A 4O4JA 1GJVA 3DXRA 5GONB 4UROA 2QSAA 2ZQMA 1I5DA 3GWOA 1EN5A 1RPRA 4LF4O 5L3EA 1P49A 1SA0A 1TUEB 3A0XA 1WLEA 1X4TA 3B26A 3A8TA 3MHHC 3FB8C 5FL7G 1SESA 2FYUH 4Z1MG 4MSWC 5EC2C 5EC1C 2XAGA 2EIMB 3FKSG 3RBZA 1GAXA 2YI5A 1Q6UA 5DM6V 1AB3A 2YE2A 1N34B 4LCUC 1NU1H 3CMAV 3CWVA 3GWKC 2F66C 4E01A 1I94O 2RJZA 3PEHA 2LP7A 4JPRA 4FJCC 4O4HB 3IC9A 4Q20A 5IDJA 2OCCC 3PEJA 1Z5AA 3T4ZA 3OM3B 1AM1A 4MP7A 4I9QA 4DV3O 5EIBC 3APOA 2ZDIC 3HHUA 3NXSA 2ZCEA 1FXHA 1RM1C 3HZ1A 1Y74B 3EHBB 1AI5A 2H3OA 1NH2D 5DN6G 4N23A 1Q86W 2ZIOA 1UFIA 4EB6A 1QLEB 1EFRG 4P8OA 4JGSA 3ZJZA 2PY5A 2YC0A 4NXNO 2XUMA 2N74A 4X8AA 1S76D 5KX5A 2P90A 4JI3B 1YITV 4JYAO 1VF7A 1HNXB 3EVKA 3K03A 1GO3F 2GHYA 1TH8A 4LF8O 3BCCH 4FLVA 3QDDA 3FB5C 1S72V 4J7JA 1Q81W 3OE7G 1COWG 5K1PA 3SL2A 1JCHA 1GKFA 1JM6A 4HYMA 3DSQA 5M4MA 2VQFB 3IEDA 4X62O 3CJHA 2XDSA 1M90W 1YESA 2A79B 5KHJA 3CEIA 4TWKA 1ZX3A 4IIJB 4UV9A 3Q5JA 3CCQV 1PNKA 4DR3B 2YUAA 4IYIA 3JAWA 5LMUB 4YJ2A 5BR8O 1XNQO 4J9ZB 1JOYA 3I5DA 4WUBA 2IOPA 4LNUA 2ZKJA 1NI8A 4RWUA 3AG1C 3N2KA 1Q3EA 2OTLV 4EGKA 3CCUV 2KG7A 1VMGA 1B63A 1ZAUA 2H55A 3B24A 1X59A 4MPNA 1HNWB 1S5JA 1NZ6A 4I50A 1WA8A 2QF6A 3BY6A 1NQTA 2JS3A 4XITA 2X6AA 3SYOA 1JA8A 3HKEB 3J7AU 5LBQA 3D0BA 4URNA 5LP6C 3CPWU 1XL6A 3K97A 1DGSA 3ZHVA 2BSKB 1YJNV 1XL4A 4V26A 2EINB 3RN4A 1TC0A 1AR5A 1OCRB 4B3TO 3BVOA 4E72A 1YF2A 2XJXA 3HYZA 2IWUA 1E1QG 2UXDO 1XEQA 2YICA 1SETA 2DYSB 4TV9B 4F6RB 4AILC 1BGYH 4G28B 2A06H 5LHIA 3CRQA 4W4KA 2F93B 2XHRA 5BY1A 1B06A 1IXMA 4X64B 5KAIZ 1KB9F 4JI0O 1Q8IA 1UY6A 3TZ4A 1SQQH 2UUAB 4K0KB 3CGZA 4WFFA 3SYQA 1GM9A 4J11A 2EXLA 2WLHA 4EM7A 3CXCU 3CB2A 4JI2B 3CWBH 3KZIZ 3OAAG 5GONA 1UY8A 4RO2A 3K59A 1FYJA 1QYEA 2YEBA 2M7WA 1V9PA 4Z1VA 3M8AA 2P06A 4IHJB 1TGOA 4FLXA 4CS3A 5LGNA 3F7VC 1Z5CA 1I5BA 3IAYA 2EJRA 3SPHA 3A0YA 1Y66A 4B7PA 3C3SA 1HNXO 3FFQA 3RWRD 2YJXA 2IWXA 1Q43A 2WI5A 4CWPA 4DV1B 4MBCA 5A2QN 1SF9A 2C2AA 1PKXA 3SYAA 5JJNB 5J2TB 3RYCB 3T4DA 1XUQA 2ZE5A 3RVZA 1I5AA 1Y74A 3ABKB 3OPDA 5IWAB 1WB7A 4GKKO 5K1XA 3U10A 3C90A 1QHTA 4H37A 4ZOLB 1LR1A 5CTWA 1FKAO 1R3JC 3A2FA 1HWYA 4Z2WA 2FMLA 3WHAA 1K7DA 4B7KA 4KHPO 2IU3A 4MVZA 3LPSA 1AVMA 1FFXB 2N05A 5D7RA 4CC6A 4PDLA 3UT5B 5J2UB 4XCLA 4X88A 4EFUA 2WEPA 2EIKB 4HYOA 2NR5A 2JEUA 2AKPA 4OX9O 4GGLA 1NTKH 2EIJC 2G38A 2OIGA 3HKCB 2R72A 1K34A 3ZRWA 4D7SA 3INWA 1CP9A 2ZR3A 1HNWO 4MTOA 1R6NA 2XDXA 4XKKA 1CPYA 3SPCA 2XDLA 3BEHA 3WU2Z 4RQFA 3CX5F 4IIJA 2FXSA 2L6LA 4CWOA 4GLXA 2Q7HA 4AWOA 5CN0A 4DR6B 2XHTA 1M56B 4GUNA 3AG3C 2HVKC 4LF6B 2WLIB 2WAMA 3ZRXA 4R50A 3RFRA 1QNMA 4BAYA 2E5LB 3H1JH 1K97A 4PDMA 2IJHA 5B3SC 4BXIA 3RLQA 1MSWD 2RMKB 1WB8A 4LBEC 5B1BC 4FLYA 1Q6IA 2E3CA 2D3OW 1D5NA 3UO3A 2ITDC 4DR1B 4JTDB 1LNQA 3HKEA 2ZKOA 4FM1A 2YK2A 2L35A 1SERA 3KCXA 4DR2O 1PM9A 4R3MA 4KUMA 2QWQB 4WUDA 3FB6C 3AK1A 1ZWHA 1V54B 3B2EE 1L0LH 1BT8A 2XJGA 1R73A 3OWBA 5LMNB 1I0HA 4NTXA 5IJ9A 2YE6A 3HZ5A 4H85A 4BR6A 1I58A 2IH3C 3ZN1A 3E2EA 2BYHA 1KU9A 1N33B 4BQGA 4CH5A 4EGHA 5J71A 3QNEA 2P4KA 2YEVB 4TV9A 4F6RA 3T1YO 1HP8A 4PDVA 4CS4A 2HFEC 4IGGA 2BU8A 4DV0B 1BMFG 1MSDA 2YGFA 1UYFA 3L74H 1K9MW 1N32B 1FXVA 2Q69A 1BZKA 2GSMB 3DC6A 5CF0A 4JAVA 4JAAA 4H0LB 1TBWA 4X66O 4LP0A 3B27A 3ABMB 1THZA 2F43G 4ZHQA 5LGUA 1VQ6V 3G75A 2ZDYA 5M4PA 1SS3A 3JD0A 2YKEA 4IHJA 2VWJA 1OJHA 4QPKA 4PA9A 4ZBMA 1IDSA 3IJ4A 2JRIA 3CS5A 1GKZA 2BU5A 2O57A 1F23A 1ZUQA 1RP3B 2LFRA 1EZJA 3CMEV 3ZHQA 1MNGA 4DUZB 2XNDG 4D7TA 3O6OA 5C93A 1NJIW 4DR5B 3LDDA 4GT1A 1EBOA 4DV2B 1GN4A 3BABA 4HNAB 1N0JA 3CP1A 4XKOA 4GEEA 5J2TA 4BQJA 3RYCA 1R6TA 1S16A 1YT1A 1UY9A 1SC5B 2WLKA 4O09A 4TV8B 4YJ3B 4LPBA 1OCCB 2QR4A 4ZOLA 2V4DA 4PD4F 4DV4B 2GUZB 2H8PC 5KUKA 3ZRSA 2ZE7A 2YEGA 1PVGA 4LF7B 3L72H 4DK0A 1FFXA 5GTIZ 1YTFB 2HR3A 4E4EA 2HLDG 4EKWA 3K04A 3JZ3A 2V1DA 3UT5A 3OWDA 3NR7A 4LF6O 1UY7A 2Q0AA 1WPBA 2QM7A 3FAVB 5KHIA 4D6TH 3HKCA 4NXMB 1ORQC 3H01A 3ASOB 1P7BA 5D5QA 5CA1A 3T1CA 5H9CA 4FCQA 4CE1A 1H2GA 4HZ0A 2O1UA 1MU5A 1EN6A 1MOFA 4E2LA 2Q8FA 3VHCA 1AI4A 1P7GA 4EEHA 4DR1O 4LWHA 4PA7A 3W7WA 1B3QA 4UB6Z 4DRXB 1N36B 3ZHRA 3Q5LA 2BRCA 2XAFA 3SR2C 2YIBD 1XILA 4HXZA 2YEHA 2WLIA 4PL9A 2FWYA 5L3JA 1R3KC 3X2QC 1GH6A 1Q90D 1KBHA 2FKXA 3G7BA 4J7KA 4YY3B 3FX7A 1BHBA 4FFBB 4CH6A 2KSDA 1E79G 3APQA 5CA0B 1YS3A 3T2MA 3HEKA 2YE5A 4R3AA 1JX9A 5F3KA 3F5WC 3D2RA 1W0JG 2X6BA 3D3IA 2Q7EA 1YXBA 1K5QA 4NH9A 4PA3A 3TCUA 2AGAA 4J10A 1Q5OA 4L91A 4X65O 4MTXA 2Q4PA 5J6AA 2UXXA 4EFTA 1K4CC 1WN7A
chains in the Genus database with same CATH topology
3P32A 4MVRA 1SRYA 2FWZA 1QY8A 3T0ZA 3W7SA 5GGZA 1FXKC 3CYOA 2YEVA 2GQPA 4JASA 2JDIG 4GX1A 4BAEA 5BOCA 4QPJA 3GIGA 3K3WA 4JYCA 4MP2A 1BXDA 3CCEV 3QO5A 2CCTA 4XCJA 1UYMA 2XX2A 2YSUB 4LP8A 3JCZA 4MW3A 2YK9A 4P7AA 4XC0A 1GM7A 3C0EA 1YTFD 2K1EA 3O2FA 5EBMC 5CTUA 2IJIA 1U2OA 3AG2B 5KA6A 1ZXMA 2YKCA 1QR9A 2YKJA 3B8NA 4JQLA 1YT0A 2OT5A 4JAUA 1UYDA 2ITCC 3K60A 1YSRA 3AG1B 2W6JG 3UM7A 1Y4SA 3FT8A 2XAHA 2Q8IA 2ZXWC 3ZM7A 1I59A 1AMWA 2YI6A 2EZOA 3LNMB 2V7QG 3OMNB 4K4OA 2CCUA 1B62A 2X7RB 1M9NA 2WLLA 2VCIA 1F4NA 4XTJA 3K79A 1YC3A 3EHHA 3OUSA 1VQ4V 1NR7A 2BYIA 5M4HA 4KFMA 3ZMZA 5HFMA 4L93A 5D7CA 1Y4MA 3K08A 4KTNA 2IW5A 4CE3A 2IH1C 2XDUA 4GFNA 4XDJA 5LGTA 1H8EG 2Q8GA 1YJWV 4JYBA 2CGFA 2DWDC 3JD4A 3LUTB 2XASA 3TUHA 3E83A 4YKXA 5L3DA 3U67A 5IY5C 2IU0A 3D36A 2ZDIA 4PA6A 1G8MA 3SJQC 4MOTA 4HY6A 5EBWC 4HY1A 3PJSK 2W6IG 3E35A 2UWDA 3IC7A 4UXNA 2BOBC 1K5SA 1EI1A 3HYYA 1VQ8V 2IJJA 3G6EV 5IYBO 4GX2A 2EIJB 3OGCC 4I5SA 2O1VA 3A0ZA 3CRKA 1R62A 3CCMV 4G2KA 1CEZA 3QTFA 2HKJA 2AHZA 3CCRV 3SPIA 3INXA 2XAJA 3E86A 3BM9A 4YKUA 2JKIA 5M4KA 3GIFA 4O04A 1KP3A 4FK5C 1VQ7V 3CC4V 2WSSG 4PA4A 1VQPV 3T0HA 2ZD9A 3EHFA 4HZ3A 4RAIA 5B3SB 1TILA 1F51A 3OMUA 4RUEA 1YC1A 4P2ZA 3W7XA 3OFNG 1W2BU 3Q5KA 4FPPA 2FYPA 1FFTB 2R9IA 2DQ3A 3RVYA 4GQTA 1OCZB 4MTFA 3T10A 1UYLA 4TT3G 1PD3A 4QE7A 4EGIA 2XDKA 4EMVA 3H4LA 2PNRA 1NKDA 4FMTA 4CWNA 1SZTA 4QE9A 1WPXA 3IFXA 1KP2A 2Q2EB 1Y8PA 3RLRA 5BZBA 3MD0A 2WI1A 1OHHG 3WFVA 3RLPA 3LSQA 1JVMA 1US7A 3JD2A 1JPXA 3A0RA 1ID0A 3CRLA 2YJWA 1YSCA 5CBGA 1KC8W 3HPLC 4LWEA 2EINC 3EKRA 1OCRC 3F7YC 5CBHA 3OW6A 4O07A 3VOUA 5B1OA 3ABTA 3ETDA 2BREA 2YE7A 1QR8A 4MVUA 3WG7C 4ZKIA 1H7SA 4WF9V 3STZC 1YETA 2YKBA 5CPHA 4KFGA 3G7EA 2K5BA 2Q6AA 4GX0A 3ABLC 3ETEA 4XDLA 4QJFB 4DUHA 4KQVA 2XJJA 5CA3A 2WI6A 5EK0A 4NH7A 2E0AA 2JJ2G 2ATKC 1Q7YW 1BYQA 1UYEA 3FT5A 1G4YB 4BW5A 3TK1A 2YI7A 3MNRP 3LDEA 4YKWA 4R6ZA 3I55V 4GCZA 2NNUA 2QKSA 4MPEA 2Z5UA 3R4MA 3AG4B 3QO8A 4URLA 3SYPA 3X2QB 4DO2A 2YGEA 3I56V 1YJ9V 1ZXNA 2XX4A 4BIZA 1QVGU 2AHYA 1ROPA 1AJPA 2YEEA 4CWRA 1DLBA 2R9RB 5LHHA 3OMAB 3E8GA 1KECA 3DTUB 2ZR2A 3TZ2A 4I9WA 1UYHA 1V55C 4MT8A 1M56C 4LWGA 3FB7C 4HAMA 1FXKB 3OR6C 2IWSA 4UVBA 5H6RA 3LSSA 3EFFK 5IDMA 2DYRC 1PL0A 4YKYA 3K0GA 5BODA 4XKAA 3TZ0A 2VCJA 3ZIAG 2PI4A 3ZMSA 3G71V 4MB9A 4DZYA 1Z5BA 5IYDO 4ASBA 3T2SA 4QNHB 1Z59A 2YE3A 1F4MA 3TZ5A 1R3IC 5GW7A 1V54C 4O0BA 4HYPA 2HVJC 1M57B 1R3LC 4MS2A 3CCVV 5F5RA 1RPOA 1NBMG 3FYIB 2XCMA 2BU7A 2YECA 4CWTA 2BT0A 3B28A 3IGAC 3R65A 5L3CA 4JF3A 4MPCA 3EHGA 2HCHA 1AI7A 3E8BA 1BL8A 4AWQA 4LWIA 5FNCA 1THNA 2XHXA 4WUCA 1VQ9V 4WFBV 3OEHG 1VQKV 2O1WA 3ASNC 2KB1A 5E1AC 2HJFC 5L3BA 1AJ6A 4X89A 1L1FA 4L87A 1UYCA 5EBLC 2OCCB 2DWEC 5KUMA 3R4NA 2QE7G 5FNFA 3ZXQA 1VQNV 3BMYA 1RM1B 5B1AC 1AR1B 4MVSA 3KE6A 3ZXOA 2WLJA 2LFSA 1BGQA 4GX5A 1OZ0A 3CC2V 4WCEV 3T1KA 1K3EA 2ZBKB 4KP4A 2BTZA 3NMQA 2W0FC 1Q82W 2VWCA 2YE9A 3VHAA 2GFDA 2YE4A 3B8MA 3ASOC 1GKXA 1W0KG 1BHAA 3VBBA 2Y48A 1AH6A 4G27B 5IY5B 3KG2A 3JD1A 1I5YA 4NH8A 1AROP 1QVFU 4RUFA 1FXKA 3C11A 2OTJV 4LC1A 4XD8A 2XK2A 2XABA 4MW8A 1DF4A 2WWWA 1FS0G 2B5UA 4UV8A 2IORA 3GIEA 1AI6A 4UVCA 2EILC 3W7UA 2IJKA 4UVAA 3K9AA 4H81A 1NHJA 2H8MA 1QBZA 3DGEA 3P30A 5L3FA 3ZCCA 3K98A 4J9YB 4E00A 3EHJA 2PI5A 1VQOV 1OCOC 1K33A 1S5HC 1E1RG 4FCRA 4H33A 4XE2A 1AH8A 4WFGA 4B6CA 3GB7C 2Y69C 4XIRA 4WFEA 1S14A 2YKIA 4RQEA 4CE2A 1YT2A 5B1NA 3R4PA 2HKOA 1NR1A 5HFLA 1UJWB 3OW2U 3ZRWB 2QG0A 3U2KA 3CC7V 2BU6A 4YXWG 4HXWA 3K0DA 3OEEG 3AG2C 2CK3G 4AWPA 3R91A 3OR7C 1EA6A 3ABUA 3ZN0A 1KQSU 2Q68A 2WPDG 3VHDA 2X0LA 2Q8HA 2EIMC 1AJNA 1MX0A 1DF5A 2WERA 4GT8A 2WI3A 1K4DC 1YI2V 5D6PA 2XAQA 5D6QA 1UYIA 3R4OA 1S77D 1PNMA 4I3HA 1UYGA 2CG9A 2CH4A 2IOQA 2WI7A 3JYCA 1TIDA 1QLEC 2ESAA 3K99A 1NHHA 5CTXA 4YKRA 1UYKA 1YC4A 3AG3B 3WG7B 1VQ5V 1QLNA 2QEXV 3QO7A 2QG2A 5M4EA 3H80A 2NLJC 5B1BB 3SPGA 1I5XA 2QA4V 4CWFA 4ASFA 2BU2A 3ABLB 5J9PC 3ZMTA 1YSZA 2HG5C 2QFOA 4R1FA 4BIUA 5IYCO 1QCEA 3E8FA 1I5CA 5IN9A 4XBFA 1DTOA 4U93A 2XD6A 4AS9A 4HZ5A 2XOKG 2JK5C 3JD3A 3MHSC 4PELA 2JJCA 4P30A 4PRVA 3A0WA 4L8ZA 3LNUA 3A0TA 2YGAA 2JEXA 3FYEB 4TSFG 1YHQV 2WI2A 4N21A 3SYCA 2ZDXA 2JIZG 3LDCA 4OXSA 3CCSV 4P9OA 1BKNA 5L3GA 2DYSC 2XX5A 1Y8OA 5CTYA 3STLC 1AJQA 4JTCB 5M4NA 2BSMA 1YIJV 2BOCC 1VQLV 2B1GA 1V55B 4YKZA 4ASAA 2VW5A 4W7TA 3K06A 1KIJA 1H7UA 3E8HA 2DYRB 3ZMVA 4U7NA 4ZVIA 1J95A 4ASGA 5FWKA 3SPJA 4F4LA 3OMIB 3R92A 4PDRA 5H6QA 1OCZC 3HB3B 4O05A 1K8AW 5CBFA 2JJ1G 3G4SV 2DW4A 2WLNA 3ABKC 2A0LA 2EBOA 4V25A 4R7CA 1GM8A 2WI4A 2P7TC 1R6KA 2P6JA 1L0OA 1PNLA 4L94A 3GIGB 4PU9A 1ZW9A 4L90A 3RKZA 4KSGA 2EIKC 3TTZA 1Y8NA 4ASUG 4KSHA 3ASNB 4CWSA 2QM8A 3ZKDA 2CCSA 4JTAB 2YEJA 1GMGA 4CBCA 2WLMA 4H7QA 2FTKA 2X6CA 1TC6A 1KKDA 5B1AB 1B6QA 2MK3A 4WFHA 4XIPA 3UKMA 4XDKA 3CGYA 4R8CA 2Z3YA 1VQMV 1JQ0A 2YEIA 2WEQA 1ZWIC 1NVPB 4FIPC 2QTOA 2BZ5A 1GTOA 3E89A 4DXWA 2HG1A 1GK9A 2P67A 1QZRA 2YE8A 1M1KW 4E02A 3FV5A 3EKOA 3ML0A 3ZMUA 3OUFA 1ENVA 5FNDA 2A9HA 2WLLB 5LHGA 2EZPA 4X9LA 4UUJC 5D7DA 1H38A 3W7TA 3ABMC 1H8HG 4XDMA 3AG4C 4WFAV 3VADA 5KA5A 3M99B 4MVQA 3CCLV 4URMA 4YKTA 1YERA 3ETGA 3ZKBA 2ZXWB 1MABG 2YEAA 1A4HA 4QIWF 3AEIA 3U2DA 4YKQA 2H94A 1N8RW 4CWQA 1S0VA 2YI0A 4P9PA 2EILB 1NH2B 1KZNA 1U0ZA 3RW0A 4U7OA 4MTGA 1S3JA 1OCCC 1Y4UA 1OSFA 2B1IA 3ZRVA 1OCOB 3O0IA 1P4RA 4PRXA 3CD6V 1KD1W 1K92A 3WQ9A 1JJ2U 1NVPD 4XIQA 2Y69B 3B77A 2DQ0A 3B25A 1NHIA 4FCPA 4LWFA 4CZZA 1M57C 3CCJV 1K73W 2YEFA 4MVMA 2UXNA 3TETA 2YEDA 4MVOA 1MG1A 2Q67A 5CMUA 1GJVA 4UROA 2ZQMA 1I5DA 3GWOA 1RPRA 5L3EA 1TUEB 3A0XA 1WLEA 3B26A 3FB8C 3MHHC 5FL7G 1SESA 4Z1MG 4MSWC 5EC2C 5EC1C 2XAGA 2EIMB 3FKSG 3RBZA 2YI5A 5DM6V 2YE2A 4LCUC 3CMAV 3CWVA 4E01A 3PEHA 2LP7A 4JPRA 4FJCC 4Q20A 5IDJA 2OCCC 3PEJA 1Z5AA 3T4ZA 3OM3B 1AM1A 4MP7A 2ZDIC 3HHUA 3NXSA 1FXHA 1RM1C 3HZ1A 3EHBB 1AI5A 1NH2D 5DN6G 4N23A 1Q86W 1QLEB 1EFRG 4P8OA 4JGSA 3ZJZA 1S76D 4X8AA 2P90A 1YITV 3K03A 1TH8A 2GHYA 1GO3F 3QDDA 3FB5C 1S72V 1Q81W 3OE7G 1COWG 3SL2A 1JCHA 1GKFA 1JM6A 4HYMA 5M4MA 3IEDA 2XDSA 1M90W 1YESA 2A79B 4TWKA 4UV9A 3Q5JA 3CCQV 1PNKA 4J9ZB 1JOYA 4WUBA 2IOPA 2ZKJA 3AG1C 2OTLV 4EGKA 3CCUV 2H55A 1B63A 3B24A 4MPNA 2QF6A 3BY6A 1NQTA 4XITA 2X6AA 3SYOA 5LBQA 3D0BA 4URNA 3CPWU 1XL6A 3K97A 1YJNV 1XL4A 4V26A 2EINB 1TC0A 1OCRB 2XJXA 3HYZA 2IWUA 1E1QG 1SETA 2DYSB 4G28B 5LHIA 2XHRA 1IXMA 1UY6A 3TZ4A 3CGZA 4WFFA 3SYQA 1GM9A 2EXLA 2WLHA 4EM7A 3CXCU 3OAAG 1UY8A 4RO2A 1QYEA 2YEBA 2M7WA 5LGNA 3F7VC 1Z5CA 1I5BA 2EJRA 3SPHA 3A0YA 1Y66A 4B7PA 2YJXA 2IWXA 2WI5A 4CWPA 4MBCA 2C2AA 1PKXA 3SYAA 3T4DA 3RVZA 1I5AA 3ABKB 3OPDA 4H37A 5CTWA 1R3JC 1HWYA 3WHAA 1K7DA 2IU3A 4MVZA 3LPSA 5D7RA 4PDLA 4XCLA 4X88A 4EFUA 2WEPA 2EIKB 4HYOA 2JEUA 2AKPA 4GGLA 2EIJC 1K34A 3ZRWA 3INWA 1CP9A 2ZR3A 4MTOA 1R6NA 2XDXA 4XKKA 1CPYA 3SPCA 2XDLA 3BEHA 4RQFA 2FXSA 4CWOA 4AWOA 5CN0A 2XHTA 1M56B 3AG3C 2HVKC 2WLIB 2WAMA 3ZRXA 4R50A 4BAYA 1K97A 4PDMA 2IJHA 5B3SC 4BXIA 3RLQA 1MSWD 4LBEC 5B1BC 2D3OW 2ITDC 4JTDB 1LNQA 2YK2A 1SERA 4R3MA 4KUMA 4WUDA 3FB6C 1ZWHA 1V54B 2XJGA 1R73A 3OWBA 2YE6A 3HZ5A 4H85A 1I58A 2IH3C 3ZN1A 3E2EA 2BYHA 4BQGA 4EGHA 5J71A 3QNEA 2YEVB 4PDVA 2HFEC 2BU8A 1BMFG 2YGFA 1UYFA 1K9MW 1FXVA 2Q69A 2GSMB 5CF0A 4JAVA 1TBWA 4LP0A 3B27A 3ABMB 1THZA 2F43G 5LGUA 1VQ6V 3G75A 2ZDYA 5M4PA 3JD0A 2YKEA 4QPKA 4PA9A 4ZBMA 1GKZA 2BU5A 1F23A 2LFRA 1EZJA 3CMEV 2XNDG 3O6OA 5C93A 1NJIW 3LDDA 4GT1A 1EBOA 3CP1A 4XKOA 4GEEA 4BQJA 1S16A 1YT1A 1UY9A 2WLKA 4O09A 4LPBA 1OCCB 2H8PC 5KUKA 3ZRSA 2YEGA 1PVGA 1YTFB 2HR3A 2HLDG 4EKWA 3K04A 3JZ3A 2V1DA 3OWDA 1UY7A 2QM7A 1ORQC 3H01A 3ASOB 1P7BA 3T1CA 5H9CA 4FCQA 4CE1A 1H2GA 4HZ0A 2O1UA 1MU5A 1MOFA 4E2LA 2Q8FA 3VHCA 1AI4A 4EEHA 4LWHA 4PA7A 3W7WA 1B3QA 3Q5LA 2BRCA 2XAFA 4HXZA 2YEHA 2WLIA 4PL9A 2FWYA 5L3JA 1R3KC 3X2QC 3G7BA 1BHBA 1E79G 1YS3A 3T2MA 3HEKA 2YE5A 4R3AA 5F3KA 1JX9A 3F5WC 3D2RA 2X6BA 1W0JG 3D3IA 1K5QA 4NH9A 4PA3A 3TCUA 4L91A 4MTXA 5J6AA 2UXXA 4EFTA 1K4CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P32 A;  5IN9 A;  3R4M A;  4URL A;  3QDD A;  2YGE A;  4U93 A;  2FWZ A;  1QY8 A;  2XD6 A;  1ZXN A;  4AS9 A;  3T0Z A;  2XX4 A;  3SL2 A;  4HZ5 A;  5GGZ A;  4BIZ A;  1JM6 A;  4HYM A;  2GQP A;  5M4M A;  4JAS A;  3IED A;  2YEE A;  4CWR A;  4BAE A;  2XDS A;  5BOC A;  2JJC A;  4QPJ A;  1YES A;  3GIG A;  4PRV A;  3A0W A;  4L8Z A;  3LNU A;  4JYC A;  4MP2 A;  1BXD A;  3A0T A;  2CCT A;  2YGA A;  3Q5J A;  1UYM A;  4XCJ A;  3TZ2 A;  2XX2 A;  2WI2 A;  1UYH A;  2ZDX A;  1JOY A;  2YK9 A;  4WUB A;  2IOP A;  4MT8 A;  2ZKJ A;  4P7A A;  4XC0 A;  4LWG A;  3C0E A;  4EGK A;  2H55 A;  1B63 A;  2IWS A;  3O2F A;  3B24 A;  1BKN A;  4MPN A;  5IDM A;  5CTU A;  2XX5 A;  4YKY A;  1Y8O A;  2QF6 A;  5CTY A;  5BOD A;  4XKA A;  5M4N A;  1U2O A;  4XIT A;  2BSM A;  3TZ0 A;  2VCJ A;  2YKC A;  1ZXM A;  3D0B A;  4URN A;  4MB9 A;  4DZY A;  1Z5B A;  2YKJ A;  3K97 A;  4ASB A;  4JQL A;  1YT0 A;  4JAU A;  3T2S A;  1UYD A;  1Z59 A;  2YE3 A;  4YKZ A;  4V26 A;  3TZ5 A;  3K60 A;  1YSR A;  1TC0 A;  4ASA A;  2VW5 A;  4O0B A;  4W7T A;  2XJX A;  1KIJ A;  3HYZ A;  1Y4S A;  2IWU A;  4HYP A;  1H7U A;  3FT8 A;  4U7N A;  2Q8I A;  5F5R A;  4ZVI A;  2XHR A;  1IXM A;  1UY6 A;  3TZ4 A;  3ZM7 A;  4ASG A;  2XCM A;  3CGZ A;  2BU7 A;  5FWK A;  2YEC A;  4CWT A;  2BT0 A;  3B28 A;  2EXL A;  1I59 A;  4EM7 A;  1AMW A;  2YI6 A;  3R92 A;  4O05 A;  1UY8 A;  4MPC A;  3EHG A;  4K4O A;  1QYE A;  2YEB A;  2HCH A;  4AWQ A;  4LWI A;  5FNC A;  1THN A;  2XHX A;  4WUC A;  2CCU A;  1B62 A;  4V25 A;  1Z5C A;  1I5B A;  2VCI A;  2O1W A;  4XTJ A;  1YC3 A;  2WI4 A;  1AJ6 A;  3A0Y A;  3EHH A;  1L0O A;  1UYC A;  4L94 A;  4B7P A;  2BYI A;  3R4N A;  2YJX A;  5M4H A;  2IWX A;  5FNF A;  3GIG B;  2WI5 A;  4L93 A;  3ZXQ A;  3BMY A;  4CWP A;  4PU9 A;  4MBC A;  5D7C A;  2C2A A;  1ZW9 A;  4L90 A;  3RKZ A;  4KSG A;  4KTN A;  3TTZ A;  4CE3 A;  1Y8N A;  3KE6 A;  3ZXO A;  1I5A A;  2XDU A;  4GFN A;  2LFS A;  1BGQ A;  3OPD A;  2Q8G A;  4KSH A;  4JYB A;  2CGF A;  4CWS A;  2QM8 A;  3ZKD A;  2CCS A;  3T1K A;  5CTW A;  3TUH A;  2YEJ A;  4YKX A;  3U67 A;  2ZBK B;  3WHA A;  4KP4 A;  2BTZ A;  3LPS A;  3NMQ A;  4H7Q A;  2FTK A;  5D7R A;  1TC6 A;  3D36 A;  4XCL A;  4EFU A;  2WEP A;  2VWC A;  2YE9 A;  2AKP A;  4GGL A;  3VHA A;  2GFD A;  4MOT A;  4XIP A;  2YE4 A;  4HY6 A;  3ZRW A;  3CGY A;  3INW A;  4HY1 A;  2XDX A;  4XKK A;  1GKX A;  2XDL A;  2UWD A;  1AH6 A;  2FXS A;  2YEI A;  2WEQ A;  1EI1 A;  3HYY A;  4CWO A;  4AWO A;  2XHT A;  4NH8 A;  3ZRX A;  2BZ5 A;  2HG1 A;  2P67 A;  1QZR A;  3C11 A;  2YE8 A;  4BXI A;  3RLQ A;  4E02 A;  3FV5 A;  4I5S A;  3EKO A;  4LC1 A;  2O1V A;  4XD8 A;  2XK2 A;  2XAB A;  3A0Z A;  3CRK A;  1R62 A;  5FND A;  2YK2 A;  2WWW A;  3QTF A;  2HKJ A;  4X9L A;  2IOR A;  3GIE A;  4R3M A;  3INX A;  4WUD A;  5D7D A;  1ZWH A;  3BM9 A;  4YKU A;  2JKI A;  2XJG A;  3OWB A;  5M4K A;  3GIF A;  4O04 A;  2YE6 A;  4XDM A;  3T0H A;  3HZ5 A;  4H85 A;  3VAD A;  1I58 A;  2BYH A;  3EHF A;  4H81 A;  4BQG A;  4URM A;  1TIL A;  1NHJ A;  4YKT A;  4EGH A;  5J71 A;  1YER A;  1F51 A;  2H8M A;  3DGE A;  3OMU A;  3ZKB A;  3ZCC A;  3K98 A;  1YC1 A;  4E00 A;  2BU8 A;  3EHJ A;  2YEA A;  3Q5K A;  4FPP A;  2FYP A;  1A4H A;  2YGF A;  1UYF A;  3U2D A;  4YKQ A;  4GQT A;  4CWQ A;  5CF0 A;  4JAV A;  2YI0 A;  3T10 A;  1UYL A;  1TBW A;  4LP0 A;  4FCR A;  3B27 A;  4EGI A;  2XDK A;  4EMV A;  3H4L A;  3G75 A;  1KZN A;  2PNR A;  4XE2 A;  1U0Z A;  2ZDY A;  1AH8 A;  4U7O A;  5M4P A;  4B6C A;  2YKE A;  4FMT A;  4QPK A;  4XIR A;  4CWN A;  1S14 A;  2YKI A;  4CE2 A;  1GKZ A;  1YT2 A;  2BU5 A;  1Y4U A;  5B1N A;  3R4P A;  1OSF A;  2LFR A;  3ZRW B;  2Q2E B;  3ZRV A;  1Y8P A;  3RLR A;  2QG0 A;  3O0I A;  3U2K A;  2BU6 A;  3MD0 A;  4PRX A;  3O6O A;  5C93 A;  4HXW A;  2WI1 A;  3RLP A;  4GT1 A;  4AWP A;  3R91 A;  1US7 A;  1EA6 A;  4XKO A;  4BQJ A;  3A0R A;  1ID0 A;  4GEE A;  3WQ9 A;  3CRL A;  2YJW A;  1S16 A;  1YT1 A;  1UY9 A;  4XIQ A;  4LWE A;  3EKR A;  3B25 A;  1NHI A;  4O09 A;  4LPB A;  4FCP A;  3VHD A;  2Q8H A;  3OW6 A;  4O07 A;  1MX0 A;  4LWF A;  2WER A;  5B1O A;  2YEF A;  2BRE A;  4GT8 A;  2YE7 A;  2WI3 A;  2YED A;  2YEG A;  1PVG A;  5D6P A;  3JZ3 A;  4ZKI A;  5D6Q A;  3OWD A;  1H7S A;  1UYI A;  1GJV A;  1UY7 A;  4URO A;  2QM7 A;  3R4O A;  1I5D A;  1YET A;  2YKB A;  5CPH A;  4I3H A;  4KFG A;  1UYG A;  3A0X A;  3G7E A;  2K5B A;  2CG9 A;  3B26 A;  4FCQ A;  2CH4 A;  4CE1 A;  2IOQ A;  2WI7 A;  1TID A;  4HZ0 A;  2O1U A;  1MU5 A;  2ESA A;  3K99 A;  2Q8F A;  4DUH A;  1NHH A;  4KQV A;  5CTX A;  3VHC A;  2XJJ A;  2YI5 A;  4EEH A;  2WI6 A;  1UYK A;  4LWH A;  2YE2 A;  4YKR A;  1B3Q A;  1YC4 A;  3Q5L A;  4NH7 A;  3CWV A;  2BRC A;  4E01 A;  3PEH A;  4HXZ A;  2E0A A;  2YEH A;  4Q20 A;  5IDJ A;  2FWY A;  4PL9 A;  5L3J A;  3PEJ A;  1Z5A A;  1BYQ A;  1UYE A;  3FT5 A;  1AM1 A;  4MP7 A;  2QG2 A;  3G7B A;  5M4E A;  3H80 A;  3TK1 A;  3HHU A;  3NXS A;  2YI7 A;  3HZ1 A;  3MNR P;  1YS3 A;  4YKW A;  4ASF A;  4CWF A;  3HEK A;  2YE5 A;  4R3A A;  2BU2 A;  5F3K A;  3D2R A;  4P8O A;  4NH9 A;  1YSZ A;  4GCZ A;  2QFO A;  4L91 A;  4MTX A;  4BIU A;  4R1F A;  4MPE A;  5J6A A;  4EFT A;  1I5C A;  1TH8 A; 
#chains in the Genus database with same CATH topology
 2QJ1 A;  3P32 A;  4UFZ A;  3QG5 A;  1IXB A;  4MVR A;  1SRY A;  2FWZ A;  4K8X A;  1QY8 A;  3T0Z A;  3W7S A;  3EXA A;  5GTH Z;  5GGZ A;  1FXK C;  3CYO A;  2CTW A;  2YEV A;  2GQP A;  4JAS A;  2JDI G;  2YIB A;  4NR1 A;  4GX1 A;  4UCT A;  4BAE A;  5BOC A;  2YXH A;  3RT3 C;  3T1H B;  4QPJ A;  3GIG A;  3K9S A;  4JI5 B;  2QGN A;  2UUC O;  3K3W A;  4JYC A;  4MP2 A;  2Q0O C;  4DUZ O;  1BXD A;  3CCE V;  3QO5 A;  2CCT A;  4XCJ A;  1UYM A;  1KKC A;  5JVD B;  2XX2 A;  2YSU B;  4LP8 A;  5D5P A;  4FM2 A;  4DV2 O;  3JCZ A;  4MW3 A;  4Q6G A;  4FLU A;  2YK9 A;  3LNN A;  2A7W A;  4P7A A;  5JCO A;  4XC0 A;  1GM7 A;  4O4L B;  3C0E A;  1YTF D;  3CRM A;  2K1E A;  5JJE B;  2JS5 A;  3O2F A;  5EBM C;  5CTU A;  2IJI A;  1PPJ H;  2UXC O;  1I7F A;  1U2O A;  4YHH B;  3TJT A;  3AG2 B;  5H2F Z;  4DV6 B;  4O2B B;  5KA6 A;  1ZXM A;  3G67 A;  2YKC A;  4DV4 O;  4FZ1 A;  1QR9 A;  3B09 A;  4LF7 O;  3B8N A;  3L9D A;  2YKJ A;  3CHX A;  2PF4 E;  1IBL B;  4JQL A;  1O9G A;  4HNA A;  1YT0 A;  2OT5 A;  4JAU A;  1UYD A;  2ITC C;  1HNZ B;  2YDE A;  1YSR A;  3K60 A;  2PZS A;  3AG1 B;  1XMO O;  2Z0A A;  4ABM A;  2W6J G;  3UM7 A;  1Y4S A;  4TV8 A;  4YJ3 A;  2Y4T A;  4DYL A;  2YIA A;  3SJC C;  2RN9 A;  2UXB B;  3FT8 A;  2XAH A;  2Q8I A;  1H2N A;  4LF5 B;  5JEN A;  2XT9 A;  3BFR A;  2GUZ A;  2ZXW C;  2BTO A;  3ZM7 A;  1SQF A;  1N36 O;  3BRC A;  1I59 A;  4EFE A;  1AMW A;  2YI6 A;  2EZO A;  3LNM B;  2V7Q G;  3FAV A;  3OMN B;  4K4O A;  4X1K B;  2ZE8 A;  1FJG B;  2XTA A;  4YY3 O;  2LGQ A;  5LXT B;  2RNB A;  4FLW A;  2CCU A;  1B62 A;  2X7R B;  1M9N A;  1HR0 B;  1XBL A;  2WLL A;  2VCI A;  3QTC A;  4W4L A;  5LOV B;  1F4N A;  4XTJ A;  3K79 A;  1YC3 A;  1XNR O;  4DRX A;  5BXZ A;  5IYZ B;  3EHH A;  1BQ0 A;  3OUS A;  2QM4 A;  1VQ4 V;  1NR7 A;  2BYI A;  3MAQ A;  5M4H A;  4KFM A;  3ZMZ A;  5HFM A;  2LJ2 A;  4L93 A;  1D5A A;  3ZHU A;  5D7C A;  4GZR B;  1Y4M A;  4IL6 Z;  3K08 A;  4KTN A;  2IW5 A;  3U0Z A;  4FFB A;  1IBK O;  2VRZ A;  4CE3 A;  2IH1 C;  2XDU A;  5CA0 A;  4GFN A;  3C3T A;  4XDJ A;  1RSO B;  4O2A B;  5LGT A;  4B3M B;  1H8E G;  2IM9 A;  2Q8G A;  1YJW V;  4JYB A;  2BCC H;  2CGF A;  2DWD C;  3JD4 A;  3LUT B;  1AP6 A;  3Q4H B;  2XAS A;  3TUH A;  2UUB O;  3E83 A;  4YKX A;  5L3D A;  3U67 A;  3OGI B;  5LA6 B;  5IY5 C;  4LFB O;  3JAT B;  4IYH A;  2KQX A;  3PN1 A;  2IU0 A;  2OWO A;  2VWK A;  5KAF Z;  3D36 A;  4EEQ A;  2FL4 A;  2ZDI A;  4NYK A;  4DV7 B;  4PA6 A;  2D2C B;  3HR0 A;  1G8M A;  3SJQ C;  4MOT A;  2DN9 A;  2ETN A;  4HY6 A;  3HKB B;  5C8Y B;  5EBW C;  4HY1 A;  3PJS K;  2W6I G;  2LW1 A;  1TVK B;  1M93 A;  3E35 A;  4WBN B;  3K5O A;  2UWD A;  3IC7 A;  4UXN A;  2BOB C;  1K5S A;  4DV6 O;  1N4C A;  1EI1 A;  3HYY A;  1HW7 A;  3VQY A;  4B3S B;  1W59 A;  2P22 C;  4QGP A;  1VQ8 V;  1VF6 A;  5JVD A;  2IJJ A;  3O65 A;  3G6E V;  1IBL O;  2JVD A;  4NTY A;  5IYB O;  1GN3 A;  5JH7 B;  1HNZ O;  1WP8 A;  4GX2 A;  2EIJ B;  3OGC C;  3K57 A;  3VQW A;  4YIO A;  4I5S A;  2O1V A;  3UCS C;  1N34 O;  3A0Z A;  3CRK A;  1R62 A;  3CCM V;  4G2K A;  1CEZ A;  2P4V A;  4TOI A;  1A32 A;  4O2B A;  3RYF B;  3THO A;  3QTF A;  2HKJ A;  4KL1 A;  2AHZ A;  3CCR V;  3SPI A;  2AXT Z;  2XAJ A;  3INX A;  4PV1 B;  1SQG A;  3E86 A;  3BM9 A;  4YKU A;  2Q5Z A;  3OTF A;  3UQ8 A;  2JKI A;  5M4K A;  1J5E B;  3GIF A;  4O04 A;  1KP3 A;  4FK5 C;  1VQ7 V;  3CC4 V;  2WSS G;  4PA4 A;  1VQP V;  2OYQ A;  2C1G A;  3T0H A;  3E22 B;  2ZD9 A;  3EHF A;  1P84 F;  2WA4 A;  4HZ3 A;  4RAI A;  5B3S B;  1TIL A;  1VP7 A;  1F51 A;  4LH7 A;  1TAE A;  3AG7 A;  2N04 A;  3OMU A;  4RUE A;  5E79 Z;  1HR0 O;  1YC1 A;  4P2Z A;  3W7X A;  3OD4 A;  5IJ0 B;  3OFN G;  4HBN A;  1W2B U;  3Q5K A;  4JI3 O;  4FPP A;  2FYP A;  1FFT B;  1OV9 A;  4O4H A;  2NN4 A;  2R9I A;  2DQ3 A;  3RVY A;  4GQT A;  2LQT A;  1OCZ B;  2ZE6 A;  4GYC B;  5EZY B;  3CSX A;  2JGU A;  4MTF A;  3T10 A;  1UYL A;  4TT3 G;  2K9P A;  1PD3 A;  4QE7 A;  3AK3 A;  4EGI A;  2XDK A;  1D2D A;  1IBM B;  4EMV A;  3H4L A;  2PNR A;  1NKD A;  5LXT A;  4JI7 B;  4FMT A;  2VQF O;  4CWN A;  1SZT A;  3JSN A;  4QE9 A;  5LOV A;  1WPX A;  4DR4 B;  3IFX A;  1KP2 A;  1AIL A;  1BS3 A;  3D8C A;  2Q2E B;  5IYZ A;  1Y8P A;  3RLR A;  5BZB A;  3MD0 A;  2LW7 A;  2ILM A;  4DR3 O;  5FNV B;  5LMU O;  2WI1 A;  1OHH G;  3WFV A;  3RLP A;  3LSQ A;  1JVM A;  1US7 A;  3JD2 A;  4J41 A;  1ZSP A;  1JPX A;  1VF5 B;  2Y4U A;  3A0R A;  1ID0 A;  1JR9 A;  4FFK A;  1XI1 A;  3CRL A;  2YJW A;  2ADP A;  1YSC A;  4TQF A;  5CBG A;  1KC8 W;  1RSO A;  3HPL C;  4LWE A;  2EIN C;  1YVW A;  3EKR A;  2BTQ B;  1OCR C;  4EFB A;  4UCS A;  3F7Y C;  5CBH A;  3OW6 A;  4O07 A;  1N0N A;  1LUW A;  4O4I B;  3VOU A;  3Q4H A;  3JAK B;  5B1O A;  3ABT A;  1CXZ B;  3ETD A;  2BRE A;  2YE7 A;  3BPZ A;  1QR8 A;  3SGI A;  5LA6 A;  3JAT A;  4MVU A;  4B3S O;  1YCI A;  3SJA C;  3WG7 C;  3N2G B;  4JI8 B;  2ARH A;  2YS8 A;  4ZKI A;  1G1X B;  1H7S A;  4WF9 V;  4DV5 B;  5KHG A;  1TUB B;  4AQY B;  2CTR A;  4DR7 B;  3B4S A;  4JI1 B;  2HJD A;  3STZ C;  2Q9L A;  1YET A;  2YKB A;  5CPH A;  4KFG A;  3HKB A;  3ETQ A;  3G6B A;  2Q6A A;  2K5B A;  5C8Y A;  1U96 A;  2Y0I A;  3G7E A;  1WJZ A;  4GX0 A;  3ABL C;  2ADQ B;  1TVK A;  4U3J B;  4WBN A;  3ETE A;  2F1M A;  4XDL A;  3H9V A;  4X64 O;  4JI4 B;  3B40 A;  4QJF B;  4DUH A;  4KQV A;  2UUA O;  4K0K O;  2XJJ A;  5CA3 A;  2WI6 A;  2CE4 A;  5IE9 A;  5EK0 A;  4NH7 A;  2BSK A;  1F7Y A;  4JI2 O;  2E0A A;  2JJ2 G;  1Y67 A;  5DEC A;  2F4V B;  2ATK C;  1Q7Y W;  1BYQ A;  3JAR B;  1UYE A;  3FT5 A;  1SQP H;  1G4Y B;  2YI8 A;  5JH7 A;  4BW5 A;  4TUY B;  3TK1 A;  2YI7 A;  2VS0 A;  3MNR P;  3WB0 A;  3LDE A;  3FD9 A;  4YKW A;  3AK2 A;  4R6Z A;  2OCH A;  4B3R B;  3RYF A;  3I55 V;  4GCZ A;  2NNU A;  2QKS A;  2ODM A;  4MPE A;  3JCU Z;  2Z5U A;  4DV1 O;  3R4M A;  3AG4 B;  3QO8 A;  3S5T A;  4URL A;  1IZ3 A;  3SYP A;  3X2Q B;  4DO2 A;  2YGE A;  3I56 V;  1YJ9 V;  1IBM O;  3E22 A;  1ZXN A;  2XX4 A;  5IWA O;  4JI7 O;  4BIZ A;  2CTQ A;  1QVG U;  1S5L Z;  2AHY A;  1ROP A;  1FAF A;  1AJP A;  5IJ0 A;  2YEE A;  4CWR A;  1DLB A;  2QWP B;  3H1L H;  2R9R B;  5LHH A;  2EJ7 A;  2WA3 A;  2CTP A;  1PV0 A;  1MZE A;  2C1I A;  3OMA B;  4K35 A;  5EZY A;  1JMK C;  2QKA A;  3E8G A;  1KEC A;  3DTU B;  1M5I A;  2ZR2 A;  3TZ2 A;  4I9W A;  1NS1 A;  1UYH A;  2LGW A;  1V55 C;  4X20 B;  4MT8 A;  1M56 C;  4LWG A;  3FB7 C;  4HAM A;  1FXK B;  3OR6 C;  2IWS A;  4UVB A;  5H6R A;  3LSS A;  3EFF K;  5IDM A;  1L8D A;  2ZNJ A;  1BCC H;  1PL0 A;  2DYR C;  4YKY A;  3K0G A;  1VAR A;  5BOD A;  3K5L A;  2DJV A;  4XKA A;  3QF7 A;  3TZ0 A;  2VCJ A;  4LFA B;  3ZIA G;  2PI4 A;  3P3P A;  3ZMS A;  3G71 V;  5FNV A;  5J2U A;  4DR6 O;  4MB9 A;  4DZY A;  1Z5B A;  4J80 A;  3F5T A;  5IYD O;  1EN4 A;  4LFC B;  4ASB A;  2E5L O;  3S3W A;  5LYJ B;  3T2S A;  4QNH B;  1Z59 A;  2YE3 A;  1F4M A;  3TZ5 A;  5AG2 A;  1R3I C;  4AQY O;  4DR7 O;  5GW7 A;  1V54 C;  4O0B A;  2BTQ A;  5CB4 B;  3L75 H;  4HYP A;  2HVJ C;  4OGQ B;  1M57 B;  1R3L C;  4PJ0 Z;  4MS2 A;  3CCV V;  4O4I A;  1M4U A;  3JAK A;  4JI4 O;  5F5R A;  1RPO A;  1NBM G;  3K5M A;  3FYI B;  4J42 A;  2XCM A;  2BU7 A;  2ZT9 B;  2RQ6 A;  2YEC A;  3N2G A;  4CWT A;  3JAS B;  2BT0 A;  5LMN O;  3IGA C;  3B28 A;  3R65 A;  2W0X A;  1I94 B;  1TUB A;  5L3C A;  4JF3 A;  4MPC A;  1N33 O;  2PTM A;  3EHG A;  2HCH A;  1AI7 A;  3E8B A;  1BL8 A;  4AWQ A;  4LWI A;  5FNC A;  1THN A;  2XHX A;  4WUC A;  4DV3 B;  4JI6 B;  4I4T B;  1VQ9 V;  4FM0 A;  4B7E A;  4WFB V;  4DV0 O;  3OEH G;  4LR3 A;  1VQK V;  4U3J A;  5JCO C;  2O1W A;  3ASN C;  2KB1 A;  5E1A C;  3ZBH A;  4B3R O;  2HJF C;  5L3B A;  1N32 O;  1AJ6 A;  4X89 A;  1L1F A;  4L87 A;  1UYC A;  5EBL C;  2OCC B;  2DWE C;  4NXN B;  3CJH B;  2E76 B;  5KUM A;  2XHB A;  3R4N A;  2QE7 G;  5FNF A;  4JYA B;  3ZXQ A;  1VQN V;  3BMY A;  4X1Y B;  1AR4 A;  4LF8 B;  1RM1 B;  1XOU A;  5B1A C;  3BA8 A;  1AR1 B;  2DMX A;  4MVS A;  3KE6 A;  3ZXO A;  5TIS Z;  3H1K H;  2WLJ A;  2LFS A;  1BGQ A;  4GX5 A;  1OZ0 A;  1L0N H;  3CC2 V;  2YXL A;  5B66 Z;  4X62 B;  4WCE V;  3QVN A;  4UCV A;  3T1K A;  1K3E A;  1XMQ B;  4DR5 O;  2ZBK B;  1WA8 B;  4KP4 A;  2R9A A;  3G80 A;  2BTZ A;  4UCR A;  3NMQ A;  1H2K A;  2W0F C;  1Q82 W;  1DK1 A;  4C7U A;  2MW2 B;  2VWC A;  4PI0 A;  1US6 A;  5BR8 B;  2YE9 A;  3VHA A;  2GFD A;  2YE4 A;  2CH7 B;  3B8M A;  3ASO C;  2GTS A;  3RGB A;  4AHC A;  1GKX A;  1W0K G;  4OPA A;  1BHA A;  3VBB A;  2Y48 A;  1AH6 A;  4LWS B;  4G27 B;  5IY5 B;  3KG2 A;  3JD1 A;  4BWA A;  5KMG B;  4LFC O;  3ZHT A;  4JZG A;  2JGD B;  4NXM O;  1I5Y A;  4NH8 A;  1GRJ A;  1ARO P;  1QVF U;  3N27 A;  4RUF A;  4TQD A;  1FXK A;  3C11 A;  4JV5 B;  4K8Z A;  2OTJ V;  4B3T B;  4LC1 A;  4XD8 A;  2UXD B;  2XK2 A;  2XAB A;  4GKJ B;  5LP6 B;  4MW8 A;  5ITZ B;  1DF4 A;  2WWW A;  1FS0 G;  2B5U A;  4UV8 A;  2Q73 A;  2IOR A;  3GIE A;  1IUR A;  1Y6X A;  4JI0 B;  1MZF A;  1AI6 A;  3ZHS A;  2CAZ C;  4U3F H;  4UVC A;  5LYJ A;  1Z2G A;  2EIL C;  3W7U A;  5FPR A;  3A0H Z;  3VQX A;  2IJK A;  1MMM A;  4UVA A;  3K9A A;  4H81 A;  5CB4 A;  1NHJ A;  5EIB D;  3D36 C;  2H8M A;  1QBZ A;  4JI6 O;  3DGE A;  3P30 A;  5L3F A;  3ZCC A;  3K98 A;  3R66 A;  4J9Y B;  4NKG B;  4E00 A;  3EHJ A;  2PI5 A;  2PUS A;  1VQO V;  1UPG A;  1OCO C;  3CXH F;  1K33 A;  3S3X A;  1S5H C;  3JAS A;  5JQG B;  1E1R G;  5FLX N;  4JYY A;  4I0X B;  4FCR A;  2P5O A;  4H33 A;  4XE2 A;  1AH8 A;  1VF6 C;  4J7Z A;  4WFG A;  3SJB C;  4B6C A;  3GB7 C;  4I4T A;  2Y69 C;  4XIR A;  4WFE A;  1S14 A;  1H2S B;  2YKI A;  4RQE A;  4CE2 A;  1YT2 A;  3T1H O;  5B1N A;  3R4P A;  2HKO A;  1NR1 A;  2F95 B;  5HFL A;  3L70 H;  4JI5 O;  1UJW B;  4GKK B;  2PYJ A;  3OW2 U;  3ZRW B;  2QG0 A;  3U2K A;  3CC7 V;  3H1I H;  2BU6 A;  1XMQ O;  4LH6 A;  4YXW G;  4DK1 A;  3TXQ A;  3ZS8 C;  4HXW A;  2DOS A;  3K0D A;  3OEE G;  3AG2 C;  4X1Y A;  4KHP B;  2CK3 G;  4AWP A;  3R91 A;  2VQE B;  3OR7 C;  4YIP A;  1I08 A;  1EA6 A;  2F23 A;  3ABU A;  4FZ0 A;  4I7Z B;  3ZN0 A;  1AP5 A;  1KQS U;  1Y76 B;  2Q68 A;  1FD9 A;  4OX9 B;  2WPD G;  3VHD A;  2X0L A;  2Q8H A;  4DUY B;  2EIM C;  1AJN A;  4YHH O;  1MX0 A;  1DF5 A;  2WER A;  1JJO A;  4GT8 A;  2FB5 A;  2WI3 A;  4OPH A;  1EZV H;  1K4D C;  1YI2 V;  2R70 A;  3L71 H;  5D6P A;  4O4L A;  2XAQ A;  5D6Q A;  2HEP A;  1UYI A;  4IT5 A;  2A3Q A;  2DE0 X;  3R4O A;  1S77 D;  1PNM A;  4I3H A;  2UXB O;  1UYG A;  4L8J A;  4JV5 O;  4FVM A;  5IJ9 B;  2CH7 A;  3A0B Z;  2CG9 A;  4LF5 O;  2QWO B;  3DC5 A;  2CH4 A;  2CGO A;  2IOQ A;  2WI7 A;  3JYC A;  1TID A;  1QLE C;  4FLT A;  2ESA A;  3K99 A;  4GKJ O;  1NHH A;  5CTX A;  4FLZ A;  1UYK A;  4YKR A;  4LWS A;  3KKY A;  1YC4 A;  2GBO A;  2IBZ H;  2OIE A;  3AG3 B;  1PP9 H;  4DW1 A;  3WG7 B;  3K5N A;  5KMG A;  1VQ5 V;  4DR2 B;  2JGD A;  1NTZ H;  2GV9 A;  1FJG O;  1QLN A;  2QEX V;  3QO7 A;  2QG2 A;  5M4E A;  2RDC A;  3H80 A;  3KCY A;  2NLJ C;  5B1B B;  3SPG A;  1I5X A;  4ZHQ B;  5KHK A;  2QA4 V;  3CRA A;  4ASF A;  4CWF A;  2BU2 A;  3MDS A;  3ABL B;  3ZED A;  2ZM6 B;  4A5U B;  5J9P C;  3ZMT A;  5LP6 A;  3T1Y B;  3OTO B;  5ITZ A;  1YSZ A;  1JFF B;  3ICX A;  2HG5 C;  2GTA A;  2QFO A;  4R1F A;  4BIU A;  2HP8 A;  5IYC O;  1QCE A;  3E8F A;  4X1K A;  1KUQ A;  1I5C A;  5IN9 A;  1BSM A;  1XDC A;  4XBF A;  1DTO A;  3JAL B;  4U93 A;  3TGU H;  4X66 B;  2XD6 A;  4AS9 A;  4HZ5 A;  4B3M O;  2QWN B;  2XOK G;  2JK5 C;  1U97 A;  3JD3 A;  1QQC A;  3MHS C;  4NTW A;  4PEL A;  2JJC A;  1NT2 B;  3HKD B;  3LSU A;  3U11 A;  4P30 A;  4PRV A;  3A0W A;  4L8Z A;  3LNU A;  4UCU A;  5JQG A;  3A0T A;  1HDJ A;  1VEW A;  4KXR A;  2GDS A;  2YGA A;  2JEX A;  3FYE B;  4I0X A;  4TSF G;  1YHQ V;  2WI2 A;  4DV7 O;  2VQE O;  4N21 A;  3SYC A;  2ZDX A;  2JIZ G;  3LDC A;  4O2A A;  5H5N A;  4OXS A;  1FPO A;  5EYP B;  1XRE A;  2UU9 B;  3CCS V;  4P9O A;  1BKN A;  5L3G A;  2DYS C;  2XX5 A;  1ZTE A;  4DUY O;  1Y8O A;  5BMV B;  4ZI7 B;  5CTY A;  3STL C;  1AJQ A;  5CA1 B;  4JTC B;  5M4N A;  2BSM A;  3J81 N;  1IX9 A;  4CH3 A;  1YIJ V;  2BOC C;  3BAA A;  1VQL V;  1PL4 A;  2B1G A;  3OT7 A;  4PI2 A;  5FPO A;  1V55 B;  2CGN A;  4YKZ A;  2Q7G A;  4ASA A;  2B9Z A;  2VW5 A;  4W7T A;  1Y76 A;  4F6E A;  3K06 A;  4LF9 B;  1KIJ A;  2QDO A;  5KHH A;  1H7U A;  1Q6H A;  3E8H A;  2DYR B;  3ZMV A;  4U7N A;  2HHH B;  4CH4 A;  4ZVI A;  3RYI B;  1J95 A;  4ASG A;  5FWK A;  3SPJ A;  4F4L A;  3OMI B;  1J5E O;  3JSL A;  2Y0P A;  3R92 A;  4PDR A;  5H6Q A;  1OCZ C;  3HB3 B;  4O05 A;  4ICG A;  4JZ2 A;  3H1H H;  1K8A W;  5CBF A;  1Z5W A;  2JJ1 G;  4NB5 A;  3G4S V;  2DW4 A;  2WLN A;  5IT9 N;  3ABK C;  2A0L A;  2EBO A;  4V25 A;  4R7C A;  1GM8 A;  5JJJ B;  3GVM A;  1T5E A;  2YID A;  2ZM6 O;  2WI4 A;  5A9G A;  2P7T C;  3OTO O;  1WP7 A;  1R6K A;  2HHI A;  2P6J A;  1L0O A;  1PNL A;  4L94 A;  2E74 B;  4I55 B;  2EUL A;  4X65 B;  1WNS A;  1YZB A;  3GIG B;  4PU9 A;  1BE3 H;  2M6Y A;  1ZW9 A;  4L90 A;  3RKZ A;  4KSG A;  1KYO F;  4UB8 Z;  2EIK C;  3TTZ A;  2KKW A;  1Y8N A;  1G6U A;  4ASU G;  1SKV A;  4DR4 O;  2E75 B;  3CYG A;  3ZX6 A;  4X9Q A;  4KSH A;  3ASN B;  4CWS A;  1JFF A;  3BHP A;  2AW9 A;  2QM8 A;  3ZKD A;  3TXS A;  2CCS A;  4JTA B;  2YEJ A;  1GMG A;  4X1I B;  4CBC A;  2WLM A;  1VIB A;  2UUC B;  4H7Q A;  2FTK A;  1ZL8 B;  3JAL A;  2X6C A;  2RCV A;  3RYH B;  1KKD A;  1TC6 A;  4H44 B;  2ZIN A;  5B1A B;  4O4J B;  1B6Q A;  3DXR B;  1TA8 A;  2MK3 A;  1EM1 A;  2EX3 A;  4AI8 A;  4WFH A;  4XIP A;  3UKM A;  4XDK A;  3CGY A;  1SA0 B;  2UU9 O;  1XQ8 A;  2CUG A;  1URF A;  1RFY A;  3HKD A;  4R8C A;  2QTS A;  2Z3Y A;  2CDY A;  2YXY A;  1VQM V;  1JQ0 A;  2UXC B;  3WB1 A;  2YEI A;  3L73 H;  4JI8 O;  2WEQ A;  1ZWI C;  1NVP B;  4FIP C;  4DV5 O;  3O9O A;  4JI1 O;  4BIO A;  2QTO A;  3JAM N;  3LMM A;  1SQB H;  3SDL A;  2BZ5 A;  1GTO A;  3E89 A;  4DXW A;  1H2M A;  5EYP A;  2HG1 A;  1GK9 A;  4LF4 B;  2P67 A;  1QZR A;  2YE8 A;  3CE2 A;  1M1K W;  4LF9 O;  1XMO B;  3FV5 A;  5LL6 Y;  4E02 A;  1GN6 A;  3ML0 A;  3EKO A;  2Q8V A;  3ZMU A;  3OUF A;  5BMV A;  4ZI7 A;  4EB6 B;  2HHH O;  1ENV A;  5FND A;  2A9H A;  2WLL B;  5LHG A;  2EZP A;  5KX5 B;  4X9L A;  1QU7 A;  2BE3 A;  2ZIM A;  2YI9 A;  2F4V O;  4UUJ C;  5D7D A;  1H38 A;  4NVP A;  1Z5V A;  3W7T A;  5F2V O;  4CC5 A;  3ABM C;  1H8H G;  4PHZ A;  4XDM A;  3AG4 C;  4WFA V;  3VAD A;  5KA5 A;  3M99 B;  4MVQ A;  3CCL V;  4URM A;  3WB2 A;  4YKT A;  1YER A;  1WAZ A;  3ETG A;  3ZKB A;  1BQZ A;  2AZ2 A;  1B04 A;  5JWP A;  3CRC A;  2ZXW B;  1MAB G;  3P3N A;  2YEA A;  1ZLZ A;  1A4H A;  1O9H A;  4DW0 A;  3RYI A;  4QIW F;  3AEI A;  3U2D A;  3K58 A;  2AZ0 A;  2H94 A;  4YKQ A;  1NTM H;  3JAR A;  1N8R W;  1XNR B;  4CWQ A;  1S0V A;  2YI0 A;  5KLV H;  4TUY A;  2QWR B;  4P9P A;  2EIL B;  1NH2 B;  3CRR A;  3JAW B;  1H2L A;  4YJ2 B;  1KZN A;  1U0Z A;  3RW0 A;  4U7O A;  4LNU B;  4ZIB A;  4MTG A;  3N2K B;  2KG7 B;  1IBK B;  1LUV A;  1S3J A;  1OCC C;  1Y4U A;  1GN2 A;  1OSF A;  5DED A;  3D3Q A;  4I50 B;  2B1I A;  3M7M X;  2PYL A;  2ZNI A;  1SQX H;  3ZRV A;  1OCO B;  2PGG A;  4UCO A;  3O0I A;  3VQV A;  3J80 N;  1P4R A;  4I55 A;  4PRX A;  2UUB B;  4K3A A;  1KMI Z;  3CD6 V;  3UO2 A;  4LFB B;  1XNQ B;  1YDX A;  2LO1 A;  1KD1 W;  2QKC A;  1K92 A;  3WQ9 A;  1IVS A;  1JJ2 U;  4B08 A;  1NVP D;  1MA1 A;  4XIQ A;  2Y69 B;  1XHZ A;  5B5E Z;  1YEW A;  3B77 A;  2DQ0 A;  3B25 A;  1NHI A;  4BW9 A;  4FCP A;  4LWF A;  3BA9 A;  4CZZ A;  4H13 B;  4LFA O;  1M57 C;  1XHX A;  3CCJ V;  1K73 W;  1R1B A;  2YEF A;  4X1I A;  4MVM A;  2UXN A;  3TET A;  2YED A;  4MVO A;  1SQV H;  4X20 A;  1ZL8 A;  1MG1 A;  2Q67 A;  5CMU A;  1SZX A;  3RYH A;  4CS2 A;  4O4J A;  1GJV A;  3DXR A;  5GON B;  4URO A;  2QSA A;  2ZQM A;  1I5D A;  3GWO A;  1EN5 A;  1RPR A;  4LF4 O;  5L3E A;  1P49 A;  1SA0 A;  1TUE B;  3A0X A;  1WLE A;  1X4T A;  3B26 A;  3A8T A;  3MHH C;  3FB8 C;  5FL7 G;  1SES A;  2FYU H;  4Z1M G;  4MSW C;  5EC2 C;  5EC1 C;  2XAG A;  2EIM B;  3FKS G;  3RBZ A;  1GAX A;  2YI5 A;  1Q6U A;  5DM6 V;  1AB3 A;  2YE2 A;  1N34 B;  4LCU C;  1NU1 H;  3CMA V;  3CWV A;  3GWK C;  2F66 C;  4E01 A;  1I94 O;  2RJZ A;  3PEH A;  2LP7 A;  4JPR A;  4FJC C;  4O4H B;  3IC9 A;  4Q20 A;  5IDJ A;  2OCC C;  3PEJ A;  1Z5A A;  3T4Z A;  3OM3 B;  1AM1 A;  4MP7 A;  4I9Q A;  4DV3 O;  5EIB C;  3APO A;  2ZDI C;  3HHU A;  3NXS A;  2ZCE A;  1FXH A;  1RM1 C;  3HZ1 A;  1Y74 B;  3EHB B;  1AI5 A;  2H3O A;  1NH2 D;  5DN6 G;  4N23 A;  1Q86 W;  2ZIO A;  1UFI A;  4EB6 A;  1QLE B;  1EFR G;  4P8O A;  4JGS A;  3ZJZ A;  2PY5 A;  2YC0 A;  4NXN O;  2XUM A;  2N74 A;  4X8A A;  1S76 D;  5KX5 A;  2P90 A;  4JI3 B;  1YIT V;  4JYA O;  1VF7 A;  1HNX B;  3EVK A;  3K03 A;  1GO3 F;  2GHY A;  1TH8 A;  4LF8 O;  3BCC H;  4FLV A;  3QDD A;  3FB5 C;  1S72 V;  4J7J A;  1Q81 W;  3OE7 G;  1COW G;  5K1P A;  3SL2 A;  1JCH A;  1GKF A;  1JM6 A;  4HYM A;  3DSQ A;  5M4M A;  2VQF B;  3IED A;  4X62 O;  3CJH A;  2XDS A;  1M90 W;  1YES A;  2A79 B;  5KHJ A;  3CEI A;  4TWK A;  1ZX3 A;  4IIJ B;  4UV9 A;  3Q5J A;  3CCQ V;  1PNK A;  4DR3 B;  2YUA A;  4IYI A;  3JAW A;  5LMU B;  4YJ2 A;  5BR8 O;  1XNQ O;  4J9Z B;  1JOY A;  3I5D A;  4WUB A;  2IOP A;  4LNU A;  2ZKJ A;  1NI8 A;  4RWU A;  3AG1 C;  3N2K A;  1Q3E A;  2OTL V;  4EGK A;  3CCU V;  2KG7 A;  1VMG A;  1B63 A;  1ZAU A;  2H55 A;  3B24 A;  1X59 A;  4MPN A;  1HNW B;  1S5J A;  1NZ6 A;  4I50 A;  1WA8 A;  2QF6 A;  3BY6 A;  1NQT A;  2JS3 A;  4XIT A;  2X6A A;  3SYO A;  1JA8 A;  3HKE B;  3J7A U;  5LBQ A;  3D0B A;  4URN A;  5LP6 C;  3CPW U;  1XL6 A;  3K97 A;  1DGS A;  3ZHV A;  2BSK B;  1YJN V;  1XL4 A;  4V26 A;  2EIN B;  3RN4 A;  1TC0 A;  1AR5 A;  1OCR B;  4B3T O;  3BVO A;  4E72 A;  1YF2 A;  2XJX A;  3HYZ A;  2IWU A;  1E1Q G;  2UXD O;  1XEQ A;  2YIC A;  1SET A;  2DYS B;  4TV9 B;  4F6R B;  4AIL C;  1BGY H;  4G28 B;  2A06 H;  5LHI A;  3CRQ A;  4W4K A;  2F93 B;  2XHR A;  5BY1 A;  1B06 A;  1IXM A;  4X64 B;  5KAI Z;  1KB9 F;  4JI0 O;  1Q8I A;  1UY6 A;  3TZ4 A;  1SQQ H;  2UUA B;  4K0K B;  3CGZ A;  4WFF A;  3SYQ A;  1GM9 A;  4J11 A;  2EXL A;  2WLH A;  4EM7 A;  3CXC U;  3CB2 A;  4JI2 B;  3CWB H;  3KZI Z;  3OAA G;  5GON A;  1UY8 A;  4RO2 A;  3K59 A;  1FYJ A;  1QYE A;  2YEB A;  2M7W A;  1V9P A;  4Z1V A;  3M8A A;  2P06 A;  4IHJ B;  1TGO A;  4FLX A;  4CS3 A;  5LGN A;  3F7V C;  1Z5C A;  1I5B A;  3IAY A;  2EJR A;  3SPH A;  3A0Y A;  1Y66 A;  4B7P A;  3C3S A;  1HNX O;  3FFQ A;  3RWR D;  2YJX A;  2IWX A;  1Q43 A;  2WI5 A;  4CWP A;  4DV1 B;  4MBC A;  5A2Q N;  1SF9 A;  2C2A A;  1PKX A;  3SYA A;  5JJN B;  5J2T B;  3RYC B;  3T4D A;  1XUQ A;  2ZE5 A;  3RVZ A;  1I5A A;  1Y74 A;  3ABK B;  3OPD A;  5IWA B;  1WB7 A;  4GKK O;  5K1X A;  3U10 A;  3C90 A;  1QHT A;  4H37 A;  4ZOL B;  1LR1 A;  5CTW A;  1FKA O;  1R3J C;  3A2F A;  1HWY A;  4Z2W A;  2FML A;  3WHA A;  1K7D A;  4B7K A;  4KHP O;  2IU3 A;  4MVZ A;  3LPS A;  1AVM A;  1FFX B;  2N05 A;  5D7R A;  4CC6 A;  4PDL A;  3UT5 B;  5J2U B;  4XCL A;  4X88 A;  4EFU A;  2WEP A;  2EIK B;  4HYO A;  2NR5 A;  2JEU A;  2AKP A;  4OX9 O;  4GGL A;  1NTK H;  2EIJ C;  2G38 A;  2OIG A;  3HKC B;  2R72 A;  1K34 A;  3ZRW A;  4D7S A;  3INW A;  1CP9 A;  2ZR3 A;  1HNW O;  4MTO A;  1R6N A;  2XDX A;  4XKK A;  1CPY A;  3SPC A;  2XDL A;  3BEH A;  3WU2 Z;  4RQF A;  3CX5 F;  4IIJ A;  2FXS A;  2L6L A;  4CWO A;  4GLX A;  2Q7H A;  4AWO A;  5CN0 A;  4DR6 B;  2XHT A;  1M56 B;  4GUN A;  3AG3 C;  2HVK C;  4LF6 B;  2WLI B;  2WAM A;  3ZRX A;  4R50 A;  3RFR A;  1QNM A;  4BAY A;  2E5L B;  3H1J H;  1K97 A;  4PDM A;  2IJH A;  5B3S C;  4BXI A;  3RLQ A;  1MSW D;  2RMK B;  1WB8 A;  4LBE C;  5B1B C;  4FLY A;  1Q6I A;  2E3C A;  2D3O W;  1D5N A;  3UO3 A;  2ITD C;  4DR1 B;  4JTD B;  1LNQ A;  3HKE A;  2ZKO A;  4FM1 A;  2YK2 A;  2L35 A;  1SER A;  3KCX A;  4DR2 O;  1PM9 A;  4R3M A;  4KUM A;  2QWQ B;  4WUD A;  3FB6 C;  3AK1 A;  1ZWH A;  1V54 B;  3B2E E;  1L0L H;  1BT8 A;  2XJG A;  1R73 A;  3OWB A;  5LMN B;  1I0H A;  4NTX A;  5IJ9 A;  2YE6 A;  3HZ5 A;  4H85 A;  4BR6 A;  1I58 A;  2IH3 C;  3ZN1 A;  3E2E A;  2BYH A;  1KU9 A;  1N33 B;  4BQG A;  4CH5 A;  4EGH A;  5J71 A;  3QNE A;  2P4K A;  2YEV B;  4TV9 A;  4F6R A;  3T1Y O;  1HP8 A;  4PDV A;  4CS4 A;  2HFE C;  4IGG A;  2BU8 A;  4DV0 B;  1BMF G;  1MSD A;  2YGF A;  1UYF A;  3L74 H;  1K9M W;  1N32 B;  1FXV A;  2Q69 A;  1BZK A;  2GSM B;  3DC6 A;  5CF0 A;  4JAV A;  4JAA A;  4H0L B;  1TBW A;  4X66 O;  4LP0 A;  3B27 A;  3ABM B;  1THZ A;  2F43 G;  4ZHQ A;  5LGU A;  1VQ6 V;  3G75 A;  2ZDY A;  5M4P A;  1SS3 A;  3JD0 A;  2YKE A;  4IHJ A;  2VWJ A;  1OJH A;  4QPK A;  4PA9 A;  4ZBM A;  1IDS A;  3IJ4 A;  2JRI A;  3CS5 A;  1GKZ A;  2BU5 A;  2O57 A;  1F23 A;  1ZUQ A;  1RP3 B;  2LFR A;  1EZJ A;  3CME V;  3ZHQ A;  1MNG A;  4DUZ B;  2XND G;  4D7T A;  3O6O A;  5C93 A;  1NJI W;  4DR5 B;  3LDD A;  4GT1 A;  1EBO A;  4DV2 B;  1GN4 A;  3BAB A;  4HNA B;  1N0J A;  3CP1 A;  4XKO A;  4GEE A;  5J2T A;  4BQJ A;  3RYC A;  1R6T A;  1S16 A;  1YT1 A;  1UY9 A;  1SC5 B;  2WLK A;  4O09 A;  4TV8 B;  4YJ3 B;  4LPB A;  1OCC B;  2QR4 A;  4ZOL A;  2V4D A;  4PD4 F;  4DV4 B;  2GUZ B;  2H8P C;  5KUK A;  3ZRS A;  2ZE7 A;  2YEG A;  1PVG A;  4LF7 B;  3L72 H;  4DK0 A;  1FFX A;  5GTI Z;  1YTF B;  2HR3 A;  4E4E A;  2HLD G;  4EKW A;  3K04 A;  3JZ3 A;  2V1D A;  3UT5 A;  3OWD A;  3NR7 A;  4LF6 O;  1UY7 A;  2Q0A A;  1WPB A;  2QM7 A;  3FAV B;  5KHI A;  4D6T H;  3HKC A;  4NXM B;  1ORQ C;  3H01 A;  3ASO B;  1P7B A;  5D5Q A;  5CA1 A;  3T1C A;  5H9C A;  4FCQ A;  4CE1 A;  1H2G A;  4HZ0 A;  2O1U A;  1MU5 A;  1EN6 A;  1MOF A;  4E2L A;  2Q8F A;  3VHC A;  1AI4 A;  1P7G A;  4EEH A;  4DR1 O;  4LWH A;  4PA7 A;  3W7W A;  1B3Q A;  4UB6 Z;  4DRX B;  1N36 B;  3ZHR A;  3Q5L A;  2BRC A;  2XAF A;  3SR2 C;  2YIB D;  1XIL A;  4HXZ A;  2YEH A;  2WLI A;  4PL9 A;  2FWY A;  5L3J A;  1R3K C;  3X2Q C;  1GH6 A;  1Q90 D;  1KBH A;  2FKX A;  3G7B A;  4J7K A;  4YY3 B;  3FX7 A;  1BHB A;  4FFB B;  4CH6 A;  2KSD A;  1E79 G;  3APQ A;  5CA0 B;  1YS3 A;  3T2M A;  3HEK A;  2YE5 A;  4R3A A;  1JX9 A;  5F3K A;  3F5W C;  3D2R A;  1W0J G;  2X6B A;  3D3I A;  2Q7E A;  1YXB A;  1K5Q A;  4NH9 A;  4PA3 A;  3TCU A;  2AGA A;  4J10 A;  1Q5O A;  4L91 A;  4X65 O;  4MTX A;  2Q4P A;  5J6A A;  2UXX A;  4EFT A;  1K4C C;  1WN7 A; 
#chains in the Genus database with same CATH homology
 3P32 A;  4MVR A;  1SRY A;  2FWZ A;  1QY8 A;  3T0Z A;  3W7S A;  5GGZ A;  1FXK C;  3CYO A;  2YEV A;  2GQP A;  4JAS A;  2JDI G;  4GX1 A;  4BAE A;  5BOC A;  4QPJ A;  3GIG A;  3K3W A;  4JYC A;  4MP2 A;  1BXD A;  3CCE V;  3QO5 A;  2CCT A;  4XCJ A;  1UYM A;  2XX2 A;  2YSU B;  4LP8 A;  3JCZ A;  4MW3 A;  2YK9 A;  4P7A A;  4XC0 A;  1GM7 A;  3C0E A;  1YTF D;  2K1E A;  3O2F A;  5EBM C;  5CTU A;  2IJI A;  1U2O A;  3AG2 B;  5KA6 A;  1ZXM A;  2YKC A;  1QR9 A;  2YKJ A;  3B8N A;  4JQL A;  1YT0 A;  2OT5 A;  4JAU A;  1UYD A;  2ITC C;  3K60 A;  1YSR A;  3AG1 B;  2W6J G;  3UM7 A;  1Y4S A;  3FT8 A;  2XAH A;  2Q8I A;  2ZXW C;  3ZM7 A;  1I59 A;  1AMW A;  2YI6 A;  2EZO A;  3LNM B;  2V7Q G;  3OMN B;  4K4O A;  2CCU A;  1B62 A;  2X7R B;  1M9N A;  2WLL A;  2VCI A;  1F4N A;  4XTJ A;  3K79 A;  1YC3 A;  3EHH A;  3OUS A;  1VQ4 V;  1NR7 A;  2BYI A;  5M4H A;  4KFM A;  3ZMZ A;  5HFM A;  4L93 A;  5D7C A;  1Y4M A;  3K08 A;  4KTN A;  2IW5 A;  4CE3 A;  2IH1 C;  2XDU A;  4GFN A;  4XDJ A;  5LGT A;  1H8E G;  2Q8G A;  1YJW V;  4JYB A;  2CGF A;  2DWD C;  3JD4 A;  3LUT B;  2XAS A;  3TUH A;  3E83 A;  4YKX A;  5L3D A;  3U67 A;  5IY5 C;  2IU0 A;  3D36 A;  2ZDI A;  4PA6 A;  1G8M A;  3SJQ C;  4MOT A;  4HY6 A;  5EBW C;  4HY1 A;  3PJS K;  2W6I G;  3E35 A;  2UWD A;  3IC7 A;  4UXN A;  2BOB C;  1K5S A;  1EI1 A;  3HYY A;  1VQ8 V;  2IJJ A;  3G6E V;  5IYB O;  4GX2 A;  2EIJ B;  3OGC C;  4I5S A;  2O1V A;  3A0Z A;  3CRK A;  1R62 A;  3CCM V;  4G2K A;  1CEZ A;  3QTF A;  2HKJ A;  2AHZ A;  3CCR V;  3SPI A;  3INX A;  2XAJ A;  3E86 A;  3BM9 A;  4YKU A;  2JKI A;  5M4K A;  3GIF A;  4O04 A;  1KP3 A;  4FK5 C;  1VQ7 V;  3CC4 V;  2WSS G;  4PA4 A;  1VQP V;  3T0H A;  2ZD9 A;  3EHF A;  4HZ3 A;  4RAI A;  5B3S B;  1TIL A;  1F51 A;  3OMU A;  4RUE A;  1YC1 A;  4P2Z A;  3W7X A;  3OFN G;  1W2B U;  3Q5K A;  4FPP A;  2FYP A;  1FFT B;  2R9I A;  2DQ3 A;  3RVY A;  4GQT A;  1OCZ B;  4MTF A;  3T10 A;  1UYL A;  4TT3 G;  1PD3 A;  4QE7 A;  4EGI A;  2XDK A;  4EMV A;  3H4L A;  2PNR A;  1NKD A;  4FMT A;  4CWN A;  1SZT A;  4QE9 A;  1WPX A;  3IFX A;  1KP2 A;  2Q2E B;  1Y8P A;  3RLR A;  5BZB A;  3MD0 A;  2WI1 A;  1OHH G;  3WFV A;  3RLP A;  3LSQ A;  1JVM A;  1US7 A;  3JD2 A;  1JPX A;  3A0R A;  1ID0 A;  3CRL A;  2YJW A;  1YSC A;  5CBG A;  1KC8 W;  3HPL C;  4LWE A;  2EIN C;  3EKR A;  1OCR C;  3F7Y C;  5CBH A;  3OW6 A;  4O07 A;  3VOU A;  5B1O A;  3ABT A;  3ETD A;  2BRE A;  2YE7 A;  1QR8 A;  4MVU A;  3WG7 C;  4ZKI A;  1H7S A;  4WF9 V;  3STZ C;  1YET A;  2YKB A;  5CPH A;  4KFG A;  3G7E A;  2K5B A;  2Q6A A;  4GX0 A;  3ABL C;  3ETE A;  4XDL A;  4QJF B;  4DUH A;  4KQV A;  2XJJ A;  5CA3 A;  2WI6 A;  5EK0 A;  4NH7 A;  2E0A A;  2JJ2 G;  2ATK C;  1Q7Y W;  1BYQ A;  1UYE A;  3FT5 A;  1G4Y B;  4BW5 A;  3TK1 A;  2YI7 A;  3MNR P;  3LDE A;  4YKW A;  4R6Z A;  3I55 V;  4GCZ A;  2NNU A;  2QKS A;  4MPE A;  2Z5U A;  3R4M A;  3AG4 B;  3QO8 A;  4URL A;  3SYP A;  3X2Q B;  4DO2 A;  2YGE A;  3I56 V;  1YJ9 V;  1ZXN A;  2XX4 A;  4BIZ A;  1QVG U;  2AHY A;  1ROP A;  1AJP A;  2YEE A;  4CWR A;  1DLB A;  2R9R B;  5LHH A;  3OMA B;  3E8G A;  1KEC A;  3DTU B;  2ZR2 A;  3TZ2 A;  4I9W A;  1UYH A;  1V55 C;  4MT8 A;  1M56 C;  4LWG A;  3FB7 C;  4HAM A;  1FXK B;  3OR6 C;  2IWS A;  4UVB A;  5H6R A;  3LSS A;  3EFF K;  5IDM A;  2DYR C;  1PL0 A;  4YKY A;  3K0G A;  5BOD A;  4XKA A;  3TZ0 A;  2VCJ A;  3ZIA G;  2PI4 A;  3ZMS A;  3G71 V;  4MB9 A;  4DZY A;  1Z5B A;  5IYD O;  4ASB A;  3T2S A;  4QNH B;  1Z59 A;  2YE3 A;  1F4M A;  3TZ5 A;  1R3I C;  5GW7 A;  1V54 C;  4O0B A;  4HYP A;  2HVJ C;  1M57 B;  1R3L C;  4MS2 A;  3CCV V;  5F5R A;  1RPO A;  1NBM G;  3FYI B;  2XCM A;  2BU7 A;  2YEC A;  4CWT A;  2BT0 A;  3B28 A;  3IGA C;  3R65 A;  5L3C A;  4JF3 A;  4MPC A;  3EHG A;  2HCH A;  1AI7 A;  3E8B A;  1BL8 A;  4AWQ A;  4LWI A;  5FNC A;  1THN A;  2XHX A;  4WUC A;  1VQ9 V;  4WFB V;  3OEH G;  1VQK V;  2O1W A;  3ASN C;  2KB1 A;  5E1A C;  2HJF C;  5L3B A;  1AJ6 A;  4X89 A;  1L1F A;  4L87 A;  1UYC A;  5EBL C;  2OCC B;  2DWE C;  5KUM A;  3R4N A;  2QE7 G;  5FNF A;  3ZXQ A;  1VQN V;  3BMY A;  1RM1 B;  5B1A C;  1AR1 B;  4MVS A;  3KE6 A;  3ZXO A;  2WLJ A;  2LFS A;  1BGQ A;  4GX5 A;  1OZ0 A;  3CC2 V;  4WCE V;  3T1K A;  1K3E A;  2ZBK B;  4KP4 A;  2BTZ A;  3NMQ A;  2W0F C;  1Q82 W;  2VWC A;  2YE9 A;  3VHA A;  2GFD A;  2YE4 A;  3B8M A;  3ASO C;  1GKX A;  1W0K G;  1BHA A;  3VBB A;  2Y48 A;  1AH6 A;  4G27 B;  5IY5 B;  3KG2 A;  3JD1 A;  1I5Y A;  4NH8 A;  1ARO P;  1QVF U;  4RUF A;  1FXK A;  3C11 A;  2OTJ V;  4LC1 A;  4XD8 A;  2XK2 A;  2XAB A;  4MW8 A;  1DF4 A;  2WWW A;  1FS0 G;  2B5U A;  4UV8 A;  2IOR A;  3GIE A;  1AI6 A;  4UVC A;  2EIL C;  3W7U A;  2IJK A;  4UVA A;  3K9A A;  4H81 A;  1NHJ A;  2H8M A;  1QBZ A;  3DGE A;  3P30 A;  5L3F A;  3ZCC A;  3K98 A;  4J9Y B;  4E00 A;  3EHJ A;  2PI5 A;  1VQO V;  1OCO C;  1K33 A;  1S5H C;  1E1R G;  4FCR A;  4H33 A;  4XE2 A;  1AH8 A;  4WFG A;  4B6C A;  3GB7 C;  2Y69 C;  4XIR A;  4WFE A;  1S14 A;  2YKI A;  4RQE A;  4CE2 A;  1YT2 A;  5B1N A;  3R4P A;  2HKO A;  1NR1 A;  5HFL A;  1UJW B;  3OW2 U;  3ZRW B;  2QG0 A;  3U2K A;  3CC7 V;  2BU6 A;  4YXW G;  4HXW A;  3K0D A;  3OEE G;  3AG2 C;  2CK3 G;  4AWP A;  3R91 A;  3OR7 C;  1EA6 A;  3ABU A;  3ZN0 A;  1KQS U;  2Q68 A;  2WPD G;  3VHD A;  2X0L A;  2Q8H A;  2EIM C;  1AJN A;  1MX0 A;  1DF5 A;  2WER A;  4GT8 A;  2WI3 A;  1K4D C;  1YI2 V;  5D6P A;  2XAQ A;  5D6Q A;  1UYI A;  3R4O A;  1S77 D;  1PNM A;  4I3H A;  1UYG A;  2CG9 A;  2CH4 A;  2IOQ A;  2WI7 A;  3JYC A;  1TID A;  1QLE C;  2ESA A;  3K99 A;  1NHH A;  5CTX A;  4YKR A;  1UYK A;  1YC4 A;  3AG3 B;  3WG7 B;  1VQ5 V;  1QLN A;  2QEX V;  3QO7 A;  2QG2 A;  5M4E A;  3H80 A;  2NLJ C;  5B1B B;  3SPG A;  1I5X A;  2QA4 V;  4CWF A;  4ASF A;  2BU2 A;  3ABL B;  5J9P C;  3ZMT A;  1YSZ A;  2HG5 C;  2QFO A;  4R1F A;  4BIU A;  5IYC O;  1QCE A;  3E8F A;  1I5C A;  5IN9 A;  4XBF A;  1DTO A;  4U93 A;  2XD6 A;  4AS9 A;  4HZ5 A;  2XOK G;  2JK5 C;  3JD3 A;  3MHS C;  4PEL A;  2JJC A;  4P30 A;  4PRV A;  3A0W A;  4L8Z A;  3LNU A;  3A0T A;  2YGA A;  2JEX A;  3FYE B;  4TSF G;  1YHQ V;  2WI2 A;  4N21 A;  3SYC A;  2ZDX A;  2JIZ G;  3LDC A;  4OXS A;  3CCS V;  4P9O A;  1BKN A;  5L3G A;  2DYS C;  2XX5 A;  1Y8O A;  5CTY A;  3STL C;  1AJQ A;  4JTC B;  5M4N A;  2BSM A;  1YIJ V;  2BOC C;  1VQL V;  2B1G A;  1V55 B;  4YKZ A;  4ASA A;  2VW5 A;  4W7T A;  3K06 A;  1KIJ A;  1H7U A;  3E8H A;  2DYR B;  3ZMV A;  4U7N A;  4ZVI A;  1J95 A;  4ASG A;  5FWK A;  3SPJ A;  4F4L A;  3OMI B;  3R92 A;  4PDR A;  5H6Q A;  1OCZ C;  3HB3 B;  4O05 A;  1K8A W;  5CBF A;  2JJ1 G;  3G4S V;  2DW4 A;  2WLN A;  3ABK C;  2A0L A;  2EBO A;  4V25 A;  4R7C A;  1GM8 A;  2WI4 A;  2P7T C;  1R6K A;  2P6J A;  1L0O A;  1PNL A;  4L94 A;  3GIG B;  4PU9 A;  1ZW9 A;  4L90 A;  3RKZ A;  4KSG A;  2EIK C;  3TTZ A;  1Y8N A;  4ASU G;  4KSH A;  3ASN B;  4CWS A;  2QM8 A;  3ZKD A;  2CCS A;  4JTA B;  2YEJ A;  1GMG A;  4CBC A;  2WLM A;  4H7Q A;  2FTK A;  2X6C A;  1TC6 A;  1KKD A;  5B1A B;  1B6Q A;  2MK3 A;  4WFH A;  4XIP A;  3UKM A;  4XDK A;  3CGY A;  4R8C A;  2Z3Y A;  1VQM V;  1JQ0 A;  2YEI A;  2WEQ A;  1ZWI C;  1NVP B;  4FIP C;  2QTO A;  2BZ5 A;  1GTO A;  3E89 A;  4DXW A;  2HG1 A;  1GK9 A;  2P67 A;  1QZR A;  2YE8 A;  1M1K W;  4E02 A;  3FV5 A;  3EKO A;  3ML0 A;  3ZMU A;  3OUF A;  1ENV A;  5FND A;  2A9H A;  2WLL B;  5LHG A;  2EZP A;  4X9L A;  4UUJ C;  5D7D A;  1H38 A;  3W7T A;  3ABM C;  1H8H G;  4XDM A;  3AG4 C;  4WFA V;  3VAD A;  5KA5 A;  3M99 B;  4MVQ A;  3CCL V;  4URM A;  4YKT A;  1YER A;  3ETG A;  3ZKB A;  2ZXW B;  1MAB G;  2YEA A;  1A4H A;  4QIW F;  3AEI A;  3U2D A;  4YKQ A;  2H94 A;  1N8R W;  4CWQ A;  1S0V A;  2YI0 A;  4P9P A;  2EIL B;  1NH2 B;  1KZN A;  1U0Z A;  3RW0 A;  4U7O A;  4MTG A;  1S3J A;  1OCC C;  1Y4U A;  1OSF A;  2B1I A;  3ZRV A;  1OCO B;  3O0I A;  1P4R A;  4PRX A;  3CD6 V;  1KD1 W;  1K92 A;  3WQ9 A;  1JJ2 U;  1NVP D;  4XIQ A;  2Y69 B;  3B77 A;  2DQ0 A;  3B25 A;  1NHI A;  4FCP A;  4LWF A;  4CZZ A;  1M57 C;  3CCJ V;  1K73 W;  2YEF A;  4MVM A;  2UXN A;  3TET A;  2YED A;  4MVO A;  1MG1 A;  2Q67 A;  5CMU A;  1GJV A;  4URO A;  2ZQM A;  1I5D A;  3GWO A;  1RPR A;  5L3E A;  1TUE B;  3A0X A;  1WLE A;  3B26 A;  3FB8 C;  3MHH C;  5FL7 G;  1SES A;  4Z1M G;  4MSW C;  5EC2 C;  5EC1 C;  2XAG A;  2EIM B;  3FKS G;  3RBZ A;  2YI5 A;  5DM6 V;  2YE2 A;  4LCU C;  3CMA V;  3CWV A;  4E01 A;  3PEH A;  2LP7 A;  4JPR A;  4FJC C;  4Q20 A;  5IDJ A;  2OCC C;  3PEJ A;  1Z5A A;  3T4Z A;  3OM3 B;  1AM1 A;  4MP7 A;  2ZDI C;  3HHU A;  3NXS A;  1FXH A;  1RM1 C;  3HZ1 A;  3EHB B;  1AI5 A;  1NH2 D;  5DN6 G;  4N23 A;  1Q86 W;  1QLE B;  1EFR G;  4P8O A;  4JGS A;  3ZJZ A;  1S76 D;  4X8A A;  2P90 A;  1YIT V;  3K03 A;  1TH8 A;  2GHY A;  1GO3 F;  3QDD A;  3FB5 C;  1S72 V;  1Q81 W;  3OE7 G;  1COW G;  3SL2 A;  1JCH A;  1GKF A;  1JM6 A;  4HYM A;  5M4M A;  3IED A;  2XDS A;  1M90 W;  1YES A;  2A79 B;  4TWK A;  4UV9 A;  3Q5J A;  3CCQ V;  1PNK A;  4J9Z B;  1JOY A;  4WUB A;  2IOP A;  2ZKJ A;  3AG1 C;  2OTL V;  4EGK A;  3CCU V;  2H55 A;  1B63 A;  3B24 A;  4MPN A;  2QF6 A;  3BY6 A;  1NQT A;  4XIT A;  2X6A A;  3SYO A;  5LBQ A;  3D0B A;  4URN A;  3CPW U;  1XL6 A;  3K97 A;  1YJN V;  1XL4 A;  4V26 A;  2EIN B;  1TC0 A;  1OCR B;  2XJX A;  3HYZ A;  2IWU A;  1E1Q G;  1SET A;  2DYS B;  4G28 B;  5LHI A;  2XHR A;  1IXM A;  1UY6 A;  3TZ4 A;  3CGZ A;  4WFF A;  3SYQ A;  1GM9 A;  2EXL A;  2WLH A;  4EM7 A;  3CXC U;  3OAA G;  1UY8 A;  4RO2 A;  1QYE A;  2YEB A;  2M7W A;  5LGN A;  3F7V C;  1Z5C A;  1I5B A;  2EJR A;  3SPH A;  3A0Y A;  1Y66 A;  4B7P A;  2YJX A;  2IWX A;  2WI5 A;  4CWP A;  4MBC A;  2C2A A;  1PKX A;  3SYA A;  3T4D A;  3RVZ A;  1I5A A;  3ABK B;  3OPD A;  4H37 A;  5CTW A;  1R3J C;  1HWY A;  3WHA A;  1K7D A;  2IU3 A;  4MVZ A;  3LPS A;  5D7R A;  4PDL A;  4XCL A;  4X88 A;  4EFU A;  2WEP A;  2EIK B;  4HYO A;  2JEU A;  2AKP A;  4GGL A;  2EIJ C;  1K34 A;  3ZRW A;  3INW A;  1CP9 A;  2ZR3 A;  4MTO A;  1R6N A;  2XDX A;  4XKK A;  1CPY A;  3SPC A;  2XDL A;  3BEH A;  4RQF A;  2FXS A;  4CWO A;  4AWO A;  5CN0 A;  2XHT A;  1M56 B;  3AG3 C;  2HVK C;  2WLI B;  2WAM A;  3ZRX A;  4R50 A;  4BAY A;  1K97 A;  4PDM A;  2IJH A;  5B3S C;  4BXI A;  3RLQ A;  1MSW D;  4LBE C;  5B1B C;  2D3O W;  2ITD C;  4JTD B;  1LNQ A;  2YK2 A;  1SER A;  4R3M A;  4KUM A;  4WUD A;  3FB6 C;  1ZWH A;  1V54 B;  2XJG A;  1R73 A;  3OWB A;  2YE6 A;  3HZ5 A;  4H85 A;  1I58 A;  2IH3 C;  3ZN1 A;  3E2E A;  2BYH A;  4BQG A;  4EGH A;  5J71 A;  3QNE A;  2YEV B;  4PDV A;  2HFE C;  2BU8 A;  1BMF G;  2YGF A;  1UYF A;  1K9M W;  1FXV A;  2Q69 A;  2GSM B;  5CF0 A;  4JAV A;  1TBW A;  4LP0 A;  3B27 A;  3ABM B;  1THZ A;  2F43 G;  5LGU A;  1VQ6 V;  3G75 A;  2ZDY A;  5M4P A;  3JD0 A;  2YKE A;  4QPK A;  4PA9 A;  4ZBM A;  1GKZ A;  2BU5 A;  1F23 A;  2LFR A;  1EZJ A;  3CME V;  2XND G;  3O6O A;  5C93 A;  1NJI W;  3LDD A;  4GT1 A;  1EBO A;  3CP1 A;  4XKO A;  4GEE A;  4BQJ A;  1S16 A;  1YT1 A;  1UY9 A;  2WLK A;  4O09 A;  4LPB A;  1OCC B;  2H8P C;  5KUK A;  3ZRS A;  2YEG A;  1PVG A;  1YTF B;  2HR3 A;  2HLD G;  4EKW A;  3K04 A;  3JZ3 A;  2V1D A;  3OWD A;  1UY7 A;  2QM7 A;  1ORQ C;  3H01 A;  3ASO B;  1P7B A;  3T1C A;  5H9C A;  4FCQ A;  4CE1 A;  1H2G A;  4HZ0 A;  2O1U A;  1MU5 A;  1MOF A;  4E2L A;  2Q8F A;  3VHC A;  1AI4 A;  4EEH A;  4LWH A;  4PA7 A;  3W7W A;  1B3Q A;  3Q5L A;  2BRC A;  2XAF A;  4HXZ A;  2YEH A;  2WLI A;  4PL9 A;  2FWY A;  5L3J A;  1R3K C;  3X2Q C;  3G7B A;  1BHB A;  1E79 G;  1YS3 A;  3T2M A;  3HEK A;  2YE5 A;  4R3A A;  5F3K A;  1JX9 A;  3F5W C;  3D2R A;  2X6B A;  1W0J G;  3D3I A;  1K5Q A;  4NH9 A;  4PA3 A;  3TCU A;  4L91 A;  4MTX A;  5J6A A;  2UXX A;  4EFT A;  1K4C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...