4FPPA

Bacterial phosphotransferase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
205
structure length
205
Chain Sequence
PDFAAMLAARLCHDFISPASAIVSGLDLLEDPSAQDMRDDAMNLIASSARKLADLLQFTRVAFGASASAENFDSRELEKLAQGVFAHVRPTLDWQIEPQAMNKPSSRAVLNIAQIAASALPAGGVATVKGVAADGRFSIIADAKGPRARLRPEVLAGLKGEPLAEGLGGPWVQAAYLNALVRAAGGQIAVEIGEDRASIAAWVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into ChpT, an essential dimeric histidine phosphotransferase regulating the cell cycle in Caulobacter crescentus.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Transferase
molecule keywords phosphotransferase
total genus 66
structure length 205
sequence length 205
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10090 HPTransfase Histidine phosphotransferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fppA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4fppA02
1AH8A 1TC0A 3A0TA 1H7UA 4XIQA 3EHJA 1THNA 4GEEA 4XKAA 2O1VA 4ZKIA 1ZW9A 2XX4A 2YE6A 3A0WA 4GT1A 3ZRXA 2WI2A 3O2FA 5B1NA 3R91A 4XKKA 2CCTA 3A0RA 5B1OA 5M4HA 4BIZA 3OWDA 2XX2A 3T1KA 2YI5A 3ZRWB 3CWVA 4MPNA 3ZCCA 5D7DA 1I5BA 2LFSA 3TZ4A 2LFRA 1AMWA 4CWTA 4LWFA 2WI7A 2XHRA 2VW5A 4NH7A 3ZKDA 4URLA 3NMQA 2YEIA 1UYKA 4MPCA 4MOTA 4E02A 2EXLA 1QZRA 1Z5CA 4HZ5A 3MD0A 2BTZA 2WEPA 5CTXA 2YE7A 5GGZA 3EKOA 4CWSA 2GFDA 1NHIA 1QYEA 2YEAA 2WI6A 3HYYA 3VHDA 2YI0A 2XK2A 3O0IA 2AKPA 2YE3A 4MTXA 4CE3A 4L93A 1Y4SA 3WQ9A 4CWOA 3HHUA 2BREA 3K60A 1OSFA 4LWGA 2ZBKB 4I3HA 2BYIA 1S14A 3B25A 4ASGA 4EMVA 1IXMA 2XD6A 2XDSA 5F3KA 4LC1A 1EA6A 4JASA 3B26A 3K97A 4XDMA 3VHCA 1YSRA 2BRCA 2GQPA 4XC0A 4HY1A 3G7BA 3K98A 4X9LA 2YI6A 4WUBA 4O07A 4KSHA 1YC4A 2IWSA 2BU2A 1GKXA 3R92A 4HYPA 4YKZA 2FWZA 3CGYA 4YKUA 3KE6A 3G75A 1ZWHA 2Q2EB 4HXWA 4P7AA 4H81A 3SL2A 3B28A 2VCJA 1YT2A 2ZDXA 4WUCA 1TIDA 3HZ1A 3TK1A 4FCPA 3CRLA 4GQTA 2YEDA 4GGLA 2XDLA 2PNRA 2WERA 4DZYA 1B63A 1NHHA 1AJ6A 4FCQA 4XD8A 2QF6A 2YGAA 2O1UA 1AM1A 2BSMA 1I5AA 2IOPA 4MPEA 4HXZA 2CCSA 4H85A 4XTJA 3FT8A 4XKOA 4MP7A 2XJXA 5FNFA 4R3MA 2IWXA 3Q5JA 2YECA 4XIPA 4URNA 3ZRVA 2BU6A 4AS9A 4GCZA 3TZ5A 2YJXA 4JQLA 3BM9A 3O6OA 2FYPA 2XABA 5CF0A 4AWQA 4MBCA 4V25A 2YK2A 5CPHA 5M4PA 3ZRWA 3GIEA 1ID0A 4CWFA 4R3AA 1TC6A 5CTWA 2ZKJA 5FNDA 1GJVA 3TTZA 1YC3A 5CTUA 2IWUA 2YE9A 4EGKA 4BQGA 1UY9A 4BQJA 1I5CA 3D36A 1Z5AA 2YK9A 2QG0A 1S16A 1UYGA 3HYZA 3RLPA 4YKXA 2E0AA 3FV5A 2HG1A 3A0YA 4EGHA 1H7SA 3GIFA 5M4KA 4LWIA 3QTFA 4UROA 4WUDA 1YT0A 2IOQA 1R62A 3R4OA 3TUHA 5IN9A 3HZ5A 1ZXNA 2YKCA 3BMYA 4KP4A 4K4OA 4R1FA 3EHGA 1BGQA 1U2OA 4U7NA 4HZ0A 3ZXOA 4XCJA 1PVGA 2HCHA 4KFGA 1GKZA 2YKEA 4FPPA 2FWYA 1JOYA 2XDKA 4L8ZA 2YEEA 3MNRP 2Q8HA 2CGFA 2Q8IA 3OWBA 3R4MA 3B24A 4B6CA 5M4EA 3C0EA 3R4PA 3JZ3A 3C11A 1UYEA 4ASAA 4JYBA 2WI1A 4O05A 1YESA 5D7CA 5D6PA 4YKTA 3D2RA 4CWRA 5BODA 5FWKA 2BYHA 2YE4A 4P8OA 2BU8A 3D0BA 2Q8FA 4LWHA 3GIGA 2XHXA 4PRXA 2CCUA 2YKBA 2QG2A 4ZVIA 3R4NA 3TZ2A 2YEFA 1UYHA 2JJCA 4U7OA 1UYMA 2P67A 4LP0A 3FT5A 3CRKA 3T0ZA 2XDXA 2IORA 2YE8A 3T0HA 2H8MA 1BXDA 2BU5A 4YKQA 3EHHA 1UYFA 2C2AA 4YKRA 4BXIA 5D7RA 4KTNA 3TZ0A 4BIUA 4KSGA 3RKZA 5CTYA 4QPKA 2K5BA 4EFTA 1I5DA 4O0BA 3T2SA 3U67A 5J6AA 1TBWA 5F5RA 4ASFA 1UYLA 4I5SA 1YT1A 4E00A 4HYMA 5L3JA 4CWPA 1B3QA 5J71A 4YKWA 4XITA 1F51A 3ZKBA 4H7QA 3CGZA 4L91A 1QY8A 4CWQA 2WI3A 4LWEA 4NH9A 5IDJA 4YKYA 2FXSA 1KZNA 1Z5BA 1Z59A 1EI1A 2WI4A 3DGEA 3QDDA 4EGIA 2BU7A 1UYCA 2CH4A 3ZXQA 2YJWA 3OW6A 3INXA 2Q8GA 3A0XA 3U2DA 1BKNA 3K99A 3NXSA 4AWPA 2VCIA 2O1WA 4AWOA 2BZ5A 1KIJA 2BT0A 3VADA 2WI5A 4GFNA 1TILA 3OMUA 4XCLA 3LNUA 3HEKA 4L90A 3INWA 1ZXMA 1A4HA 4XIRA 4URMA 1TH8A 4O09A 5FNCA 1Y8PA 2XX5A 2ZDYA 5BOCA 2ESAA 2XDUA 4JYCA 3T10A 3Q5KA 2CG9A 2YEGA 3A0ZA 4EFUA 2YGFA 1NHJA 2JKIA 3U2KA 4HY6A 4GT8A 1UYDA 4KQVA 4U93A 4NH8A 4PL9A 1Y8OA 3VHAA 4MP2A 3ZM7A 4V26A 2YEHA 3PEHA 3EKRA 4LPBA 1Y8NA 4Q20A 4QPJA 2WEQA 5M4NA 1I59A 1B62A 1BYQA 3B27A 4PU9A 1UYIA 4FMTA 2YGEA 1US7A 3H4LA 4PRVA 1MX0A 3GIGB 3EHFA 3G7EA 4EM7A 2QM8A 2XJJA 2YE2A 2YKIA 4L94A 3RLRA 2FTKA 1U0ZA 5IDMA 3H80A 4CE1A 4W7TA 2H55A 3WHAA 2XJGA 2XHTA 4JAUA 2QM7A 1UY8A 1JM6A 2YI7A 3OPDA 3IEDA 1YETA 2YKJA 4EEHA 4MT8A 1YS3A 3Q5LA 4DUHA 4CWNA 2HKJA 1YERA 2VWCA 1AH6A 1MU5A 4JAVA 5C93A 1UY6A 5D6QA 3RLQA 4BAEA 2YE5A 1Y4UA 1YSZA 2UWDA 1UY7A 3P32A 1L0OA 4CE2A 5M4MA 4ASBA 1YC1A 2YEBA 4O04A 4XE2A 4E01A 4B7PA 2QFOA 2XCMA 2WWWA 2YEJA 4FCRA 4MB9A 3LPSA 1I58A 3PEJA
chains in the Genus database with same CATH superfamily
3G6BA 1H7UA 4XIQA 1RM1B 4EB6A 1N34O 4B3RO 1V55C 4GEEA 2KG7B 3BVOA 4ZKIA 3E8FA 2XX4A 3CSXA 5CB4B 1M1KW 3O2FA 5B1NA 2D2CB 4XDKA 4XKKA 3CCLV 2CCTA 1WNSA 3AG7A 3M7MX 5LOVB 1K3EA 4FZ0A 2XX2A 3D3IA 1Z2GA 4MPNA 1YXBA 5D7DA 2LFRA 1AMWA 1WPBA 2VW5A 3ABLB 4LH6A 4NH7A 3ZKDA 4K0KO 1BCCH 1R6TA 4PDMA 1FJGO 2A79B 4JI3O 5IJ0B 1Q90D 2B1IA 4PDVA 5DECA 4LFAO 1N36B 5CBGA 3UM7A 2WEPA 5CTXA 3EKOA 1U96A 4CWSA 2WLLB 2DN9A 3P3PA 1VP7A 3CRRA 2YEAA 1Q8IA 3VHDA 2LGQA 1ZUQA 3AG3B 1HNWO 4CE3A 1Y4SA 1LUWA 3CYOA 3SYAA 2EINB 3HHUA 2ZNIA 4H13B 3AG4B 2ZBKB 4GKKB 3ABKB 4I3HA 3B25A 1GN3A 1TUEB 5EC1C 1B6QA 4EMVA 3WG7B 1IXMA 2XDSA 2CH7B 2QE7G 2QDOA 2EULA 4LFBO 4JF3A 2L35A 3UO3A 2GTSA 1AI6A 5HFMA 3AG2C 3B26A 1H38A 4Z2WA 4JZGA 2JGDB 1N34B 4JI0O 1YSRA 5H9CA 3W7XA 4HY1A 3K98A 4ZIBA 4JTAB 1TVKB 3D3QA 2N74A 5LA6A 2P4VA 3R92A 1AJQA 5J2UA 4TT3G 4H33A 4TQFA 4EEQA 2FWZA 2V7QG 2X6CA 1BQ0A 3H01A 3CC4V 1JX9A 4UCUA 3UCSC 1UFIA 4ZOLA 4IIJB 4P7AA 3C3SA 2VCJA 4E4EA 4X1KB 4GQTA 5L3BA 1Y66A 1FPOA 2Y48A 3LDDA 1WAZA 1Y67A 2YEDA 2PNRA 1JQ0A 1JVMA 2WA3A 4DZYA 5H5NA 4O4HA 3HPLC 4J41A 1AJ6A 1WJZA 2QF6A 2YGAA 1MSDA 2IH1C 5EYPB 1E79G 1XOUA 2OCCB 1DK1A 4K8ZA 2JEXA 2CCSA 4YJ3A 2R9RB 1X4TA 3C90A 2ZT9B 5EIBC 2QJ1A 3JASA 4YIPA 4R3MA 2IWXA 2QSAA 2EIMC 1ROPA 2BU6A 5IWAB 2E5LO 1O9HA 2WPDG 3O6OA 2FYPA 1BSMA 4G27B 1SF9A 2E3CA 2L6LA 3TETA 2OCHA 4V25A 3GIEA 4OPAA 1HR0O 4J42A 4YJ3B 1V54B 2ITCC 1I94B 4X20A 2ZKJA 1TUBA 2DYSC 1HNXB 3IAYA 4EGKA 4DYLA 1VQLV 5JCOA 3FAVA 2YK9A 1Z5WA 1S16A 3JAKA 1UYGA 4FFKA 3HYZA 4YKXA 2E0AA 2H94A 3FV5A 3A0YA 4EGHA 4W4KA 5M4KA 1Q43A 4DV4B 4P2ZA 3T1HO 4L8JA 3R65A 5IYCO 1R6KA 4ZOLB 3WFVA 5J9PC 1YT0A 3SPCA 2Z0AA 5EK0A 5IN9A 5KMGA 3FX7A 2HJFC 2WLJA 1SA0A 4JI3B 2A0LA 4R1FA 3K59A 1U2OA 5IJ0A 3ZXOA 2NLJC 1PVGA 1SERA 2Q7EA 2ZE6A 4MSWC 1GKZA 4GX0A 2YKEA 1FAFA 1AJNA 4CS2A 2FWYA 4TUYA 1U97A 4NXNO 4JI2B 3ASOC 1WN7A 1YZBA 2QKCA 3CCRV 3TJTA 3OR6C 4RQEA 4GUNA 1HNZB 1K4CC 2WLLA 1QVGU 4HAMA 2W6IG 1FXKA 3R4PA 3K9AA 1OCCB 1JFFA 4ASAA 1KP2A 1AROP 4LF9B 4AQYO 1SQXH 3RYHA 5FWKA 1HR0B 2F23A 2Q8FA 1NBMG 4LWHA 4YY3O 1VARA 4PRXA 2CCUA 2YKBA 4FLTA 2QG2A 4WFFA 2EX3A 4ZVIA 5JJJB 3OMIB 3ZN0A 1RPRA 4LWSA 4GX1A 2JJCA 1GO3F 5K1PA 2ILMA 4G2KA 3CRKA 3T0ZA 1NQTA 4O2BB 4WFEA 4LFCO 1OV9A 3ZHVA 2Q0AA 5CB4A 2WLHA 1WP8A 1NT2B 2C2AA 4YKRA 2OCCC 1XUQA 2KB1A 2ZXWC 1G6UA 5LP6A 2UXBB 3CCQV 4DV6B 1NKDA 4LF7B 3UKMA 4KXRA 4IYIA 2K5BA 2YXHA 1I08A 4EFTA 3G67A 5J6AA 4MVZA 1RM1C 3SPIA 5JENA 5F5RA 5LYJA 4PV1B 1UYLA 2HFEC 1YT1A 4MVMA 4E00A 1XREA 2CGOA 4KHPO 2C1IA 3ZKBA 4LWEA 4NH9A 4UVAA 1KZNA 3ABTA 4BW5A 2CH4A 1WA8B 3K9SA 5KHIA 2Q8GA 4B3TO 3AEIA 3BFRA 2VCIA 1AR5A 1AB3A 4B08A 2BT0A 3VADA 4CS4A 2WI5A 3BAAA 3ABLC 4YIOA 4DV4O 3BHPA 5ITZA 4LF4B 1PNMA 1N8RW 4XCLA 4J9YB 1IXBA 2V4DA 1H2NA 2RJZA 3HKCB 3HEKA 3ABMB 2BTQA 1AVMA 4FLXA 5KUKA 4LF7O 4GLXA 4NYKA 1QLEB 4I4TA 5FNCA 2Y0IA 2XX5A 1PNLA 1P7GA 4WFHA 2LW1A 2ZDYA 4R7CA 3E22B 1B06A 1P84F 5IY5C 3CYGA 5BOCA 4HNAA 1R3LC 4MVRA 3CMAV 3WU2Z 1IVSA 3RYFA 2PZSA 2EJRA 3B8NA 1XNQO 4NXNB 1KP3A 2OTJV 1JJOA 4DV5B 1KD1W 5F2VO 4E2LA 3AG4C 1V55B 3HKEA 3ETGA 3RWRD 3ASOB 3VHAA 5LGTA 2YXLA 4V26A 4FM2A 2YEHA 1Y8NA 3K5LA 3RBZA 1A32A 5JVDA 5M4NA 1I59A 1B62A 1BYQA 3B27A 4XDLA 3SGIA 2ZD9A 3LNNA 5CA1A 2XAQA 1MX0A 1T5EA 3OGIB 1EFRG 4X1YA 2CE4A 4UCVA 3JAWB 4EM7A 2QM8A 2XJJA 3RYHB 1TGOA 1D5AA 2FTKA 4YHHO 5IDMA 2F95B 4TOIA 4A5UB 4DR6B 4UCSA 1PM9A 4DV0B 1UY8A 4NB5A 3IEDA 4P9OA 4MT8A 1PNKA 2BTOA 4MVUA 1QVFU 1YERA 1JMKC 3QG5A 3RLQA 3E22A 1L0OA 4BAYA 3OTOO 4B7PA 4DV7B 3JATA 2YEJA 1S5LZ 1US6A 1YDXA 3N2KB 4X65B 1SQFA 4O4IA 5GTHZ 2UU9B 5KAIZ 4X1IA 3LPSA 1AR4A 1SQVH 4PA6A 3ZHUA 5LGUA 2XHBA 1TC0A 3DSQA 2WSSG 3U11A 2JDIG 2P5OA 1EBOA 1XDCA 4C7UA 2A9HA 3EHJA 2XUMA 3E8GA 2O1VA 4DR3B 3AG2B 1I5XA 1ZW9A 4J10A 3QTCA 2XAHA 2HHHB 3K57A 2EIKB 2XT9A 1Q7YW 3CEIA 3W7TA 4I0XA 5M4HA 1R3JC 2HHIA 4BIZA 3OWDA 1YHQV 3ZS8C 5LMNB 2YI5A 3OR7C 3IGAC 3CWVA 3ZCCA 2MK3A 5EZYA 1MOFA 5ITZB 3F5TA 3JSLA 4F4LA 2DQ0A 2XHRA 1N33O 4BWAA 3G6EV 2GTAA 2P90A 5EYPA 4LNUB 4JI6B 5KA6A 2A3QA 3OMAB 2YI8A 3ML0A 4MPCA 4CZZA 4MOTA 3ICXA 1NTZH 4I0XB 1IBLB 1XMOO 2BTZA 4CC5A 1EN4A 2V1DA 4ABMA 4O2BA 3RYCA 1KC8W 3CCSV 1QYEA 5KUMA 1VQ4V 4LBEC 3O0IA 1YIJV 3FB7C 4U3FH 4MTXA 1COWG 4L93A 3LSUA 3WQ9A 4CWOA 2P22C 1BMFG 2EZOA 1S76D 1LR1A 2VRZA 3UO2A 4UUJC 4LWGA 3DTUB 5KHGA 3M99B 3K0DA 3I56V 1LNQA 1FKAO 4IHJB 2P6JA 3SYQA 1VQ5V 1HNZO 3ABUA 3KCXA 3VQVA 1VF5B 3JALB 3CCUV 3K97A 3ASNC 2ARHA 3CC2V 4G28B 4XDMA 2BRCA 5IWAO 3CHXA 4I9WA 1R73A 3X2QB 5IYBO 4AI8A 2YI6A 2IU3A 3CS5A 1P49A 2UUAO 3U0ZA 3SJBC 2DYSB 4YKZA 4J80A 3SJQC 4YKUA 3KE6A 1ZWHA 4FFBA 2Q2EB 3W7WA 2QWOB 5L3CA 2DOSA 3OTOB 4H81A 5KMGB 2R9AA 1YT2A 3KKYA 2EJ7A 1TAEA 4K35A 1TIDA 2P4KA 4B3SO 2E75B 4Z1MG 4YY3B 2OTLV 4DR2O 1PL4A 4B7EA 3HKDB 3L70H 3F7VC 3WB2A 2XDLA 2WERA 2DWEC 1B63A 1GN2A 4TUYB 1JR9A 4DV0O 1Q82W 2ADPA 4I50A 4FJCC 3K5OA 2BSMA 4JI8B 3NR7A 3THOA 1AJPA 2IOPA 4GKKO 1KU9A 4H85A 4UV8A 4MTFA 2K9PA 3PN1A 3OD4A 1MA1A 4XKOA 2XJXA 1MNGA 3GWOA 1GKFA 4PI0A 2Y0PA 4MTGA 2YECA 1QBZA 5LXTB 3ZRVA 4AS9A 4GCZA 3S3WA 5B1BC 1W0JG 3RVYA 3OT7A 4MBCA 4AWQA 1K8AW 3LSSA 1ZL8A 2YXYA 5CPHA 3ZRWA 1URFA 2Y69C 1GTOA 1OCCC 1ID0A 4PA3A 1IURA 1L0LH 3RFRA 3WB0A 4EB6B 1M57B 3JCZA 3OAAG 2YUAA 5FNDA 4TV9B 1FFXA 1OJHA 3JASB 3TTZA 3EXAA 5GTIZ 2IWUA 2OIEA 1I7FA 4BQJA 4JV5B 1Y74B 1Q81W 2QG0A 1S5JA 1K92A 3RLPA 2IBZH 5A2QN 3D8CA 4R8CA 1H7SA 4Q6GA 4O4HB 1G4YB 1SA0B 3E83A 2BTQB 3FAVB 4DR7B 3H9VA 4UROA 4J7ZA 3L71H 3IJ4A 5LYJB 4NXMB 1WB7A 2CK3G 2YIBD 4FVMA 2AGAA 2ZXWB 2ZKOA 2GUZA 1G1XB 4PA7A 1ZXNA 2QR4A 4DXWA 2D3OW 1BGQA 4U7NA 4UV9A 4IGGA 4MVSA 4HZ0A 3JCUZ 1J5EO 2ZM6O 2HCHA 4KFGA 4IHJA 3RYCB 4MVQA 2CDYA 4JI0B 3SJAC 4X64O 1AP5A 4FPPA 3QO7A 1ZL8B 2R9IA 2PY5A 5D5QA 4LF8O 1W0KG 4LP8A 3DC6A 4RUFA 3S5TA 4LFBB 4LF6B 3MNRP 1TUBB 4JYAO 3DC5A 3MHSC 3OMNB 1EZJA 3B24A 3SR2C 3C0EA 2JS3A 3SPGA 1R3IC 5LHIA 3C11A 2CTPA 3ZHTA 1UYEA 1YJ9V 3HB3B 1YESA 4GX5A 1GAXA 4GKJB 5C8YA 1YCIA 2AXTZ 5FPOA 1L1FA 3GIGA 1H2KA 3P3NA 1XI1A 2IJKA 3R4NA 4W4LA 3SYPA 1UYHA 5KHKA 4DK0A 1IBLO 3K58A 4AQYB 1UYMA 4CH3A 3RGBA 1K4DC 1KMIZ 1YI2V 1IBKO 5LBQA 4LP0A 1AI5A 3G4SV 1VF6A 3MDSA 2IORA 5IY5B 2YE8A 5CA0B 1NS1A 2FL4A 2EIJC 3CMEV 1IX9A 4O2AA 3EHHA 1CXZB 5DN6G 2BE3A 2H3OA 1UYFA 1Q86W 4FFBB 2QKAA 4BXIA 4UVBA 4KTNA 1M5IA 3DXRA 3TZ0A 3SDLA 4DW1A 2HEPA 4KSGA 2Q68A 1NZ6A 1L0NH 2YC0A 4NXMO 5CTYA 4KUMA 4FK5C 4RAIA 3U67A 3S3XA 4DV2O 2XOKG 4B3MO 1SESA 4LR3A 1YVWA 2LP7A 2JGUA 2HHHO 4HZ3A 4I5SA 3ZMTA 4HYMA 3CC7V 5L3JA 4CWPA 3BY6A 5B1BB 1B3QA 5J71A 4CH4A 1H8HG 2EBOA 4L91A 1QY8A 4CWQA 4X64B 2BOBC 1S5HC 3DGEA 3CXHF 1M56B 2BU7A 4WCEV 1D5NA 5JH7B 2ATKC 3I55V 1IBKB 3INXA 3T2MA 2VS0A 1BKNA 2QTSA 3IFXA 1S3JA 1KIJA 1CEZA 3SYOA 1SQPH 2CH7A 4JI5O 4L90A 3INWA 2YS8A 5GONB 2GV9A 4YXWG 1JFFB 4O09A 4K0KB 4JI1O 2ZE7A 1ENVA 2O57A 2YIDA 1ZTEA 5B1AC 4UVCA 1Y8PA 3JD1A 4DRXB 1GM9A 5GONA 1SQBH 4E72A 2ESAA 3VQWA 1NTKH 1FS0G 4I7ZB 2DW4A 4ZHQA 4JI7B 4O4LB 1VQMV 3A0ZA 4EFUA 2OIGA 4NTYA 3SYCA 4R6ZA 4X62O 5H6QA 3BPZA 4GT8A 2ZIOA 1QR8A 1UYDA 3ETDA 4KQVA 4U93A 4JTCB 1LUVA 4XDJA 5CA3A 2GHYA 4B3RB 3PEHA 4FZ1A 4LPBA 4F6RB 1WPXA 4QPJA 1FXKB 1K7DA 4PU9A 1AR1B 2F4VO 2YGEA 3M8AA 4K3AA 3J7AU 1F7YA 4U3JA 3SPHA 2YKIA 4L94A 4NTXA 1U0ZA 4QIWF 3H80A 4CE1A 3B40A 5BXZA 4W7TA 3WHAA 1DLBA 5J2UB 3PJSK 3FB5C 4J7JA 4X8AA 3ZMVA 4DV3O 2YKJA 2YI7A 2Y4TA 1YETA 4JZ2A 1YS3A 2ZDIC 3Q5LA 1H2LA 5JQGA 4DR2B 4D7TA 3GB7C 2OYQA 3JATB 5A9GA 4GYCB 2AZ0A 2W6JG 2UUBO 4BAEA 2WA4A 3RYIA 4TV8B 1YSZA 3OUSA 2QA4V 3CCVV 4DUZO 4ZI7B 2DWDC 4IT5A 3AG3C 3MAQA 2QFOA 4PDRA 4FCRA 2EINC 1BZKA 4FLWA 1OHHG 1VQNV 1DF4A 1OCRC 1Q6UA 2BSKA 3BA8A 1AH8A 3A0TA 4DR4O 5BMVA 1J5EB 2W0FC 1S77D 3AG1B 1THNA 1YJWV 5FNVB 3ASNB 2IJIA 3T1CA 3CRMA 3Q4HB 3ZRXA 1XHZA 2WI2A 3W7UA 2UUCB 4I9QA 2VQFO 3A0RA 4LCUC 4JI6O 2JK5C 1OZ0A 5JWPA 3T1KA 2UXCB 3ZRWB 1N32O 2UXDO 4RQFA 4YJ2A 4IYHA 4OX9O 2QWRB 1I5BA 1F4MA 4CWTA 2WI7A 3ZEDA 1K5QA 3ZHQA 4F6EA 4QNHB 1PPJH 3A0HZ 2YEIA 2A06H 2GUZB 1UYKA 4PA4A 2R70A 4WFGA 1QHTA 2CGNA 4E02A 5CN0A 1QQCA 1YITV 3MD0A 5LA6B 4NR1A 4N21A 4RUEA 4TQDA 5KX5A 3CCJV 2YE7A 5GGZA 5E79Z 1X59A 3OE7G 1NHIA 1BQZA 3HYYA 4OXSA 2XK2A 4PI2A 5LXTA 4X1KA 2KKWA 3QNEA 3STLC 3CRQA 4LH7A 4X66O 2FKXA 1HW7A 1AILA 1SKVA 3CE2A 5B66Z 1KKCA 3JD2A 2WLIA 4JI7O 1OSFA 3CD6V 1NVPD 4DK1A 5EIBD 5IYDO 4ASGA 3CB2A 2XD6A 1TA8A 3OUFA 3A8TA 4JASA 4I4TB 3A2FA 4JPRA 2IJJA 2GSMB 2WAMA 3CCMV 1MZEA 2G38A 3VHCA 2GQPA 2Y69B 2B9ZA 3G7BA 5FL7G 1H2GA 3C3TA 4WUBA 1M57C 3T1YB 3RT3C 4O07A 4KSHA 1YC4A 2IWSA 2BU2A 5IYZB 3RVZA 2JS5A 2ZINA 2HP8A 4IL6Z 2Q69A 4MS2A 3H1KH 3H1LH 5KAFZ 1NI8A 4HXWA 1K9MW 3T1HB 2VWKA 3E89A 3B28A 2XAJA 2ZDXA 1F23A 3HZ1A 4OPHA 3TK1A 2C1GA 3B09A 4FCPA 5B3SB 2QM4A 1IBMB 1SQGA 3LDCA 4HNAB 3FB6C 2CAZC 1IBMO 1NHHA 4DUZB 4WBNB 4DV1B 1KB9F 2O1UA 2JJ1G 4KL1A 1AM1A 4HYOA 2F66C 2RQ6A 3H1JH 4KFMA 2JIZG 3WB1A 1OCRB 4P9PA 2BSKB 1I5AA 1XEQA 4N23A 4XTJA 1M4UA 2E76B 1GH6A 1HNWB 2VQEB 3K04A 2MW2B 2QWQB 5EBLC 4UFZA 3JD4A 2BCCH 5FNFA 2AHYA 3OEHG 2E5LB 1WLEA 3TZ5A 2YJXA 4JQLA 3BM9A 4BIOA 4FLYA 2OT5A 5BR8B 4QGPA 3EHBB 3AK3A 1VQKV 5M4PA 2XAGA 3SPJA 3B2EE 1KKDA 1TC6A 5JH7A 4QE9A 2Q4PA 5CTUA 2Q9LA 2YE9A 1F4NA 2X6BA 4BQGA 1RFYA 2LGWA 1AI7A 3CRCA 1Z5AA 1MABG 3AK1A 1YEWA 4MW3A 2F93B 5LMUB 1XMQB 2B1GA 3I5DA 2HG1A 2UXDB 3GIFA 2X0LA 4DR1O 3QTFA 3HKBA 2ZM6B 3VQXA 5DM6V 3L9DA 4OGQB 5KHJA 2RDCA 1R62A 1TVKA 2YIAA 3R4OA 1BHBA 2HLDG 3TUHA 3O9OA 3KZIZ 3JSNA 4K4OA 3CCEV 3EHGA 4X1YB 4EFEA 2DJVA 1SS3A 2YI9A 4DUYO 4PJ0Z 4DR4B 1HWYA 1XNRO 1UJWB 5LP6B 1N32B 2OWOA 4BW9A 3OGCC 2W0XA 1DGSA 2EIMB 4I50B 4CC6A 5EBMC 5KX5B 3ETQA 5JJEB 2Q8HA 1K73W 1Q6IA 3OWBA 1P7BA 1RSOA 3R4MA 4B6CA 1I5YA 3JZ3A 1EN6A 5CA1B 1XHXA 1V54C 4NTWA 5D7CA 4YKTA 3T4DA 4ICGA 4CWRA 5BODA 5GW7A 3ZJZA 2VWJA 2BYHA 2YE4A 4O4IB 2XHXA 1E1RG 3K3WA 3DXRB 1ZSPA 1YTFD 1QLEC 4O2AB 4X88A 4FM1A 4LFAB 4U7OA 2P67A 4DUYB 4LF5O 5LL6Y 2XDXA 2EILC 1VF6C 3JARA 1BXDA 2PYJA 1NJIW 2BU5A 5HFLA 2UUBB 3ZHRA 1RPOA 4DR1B 3IC9A 2RNBA 4BIUA 3G71V 3RKZA 2JEUA 4D7SA 2N04A 4K8XA 1K34A 3T2SA 3KG2A 1GMGA 1TBWA 2QKSA 3TCUA 3K79A 3R66A 3JAWA 1QLNA 3ZIAG 1VQ8V 4DR5B 5E1AC 3T4ZA 2VQFB 1RP3B 3QVNA 5CBFA 4YKWA 3RYIB 3MHHC 4XITA 1F51A 4H7QA 3QF7A 2WI3A 4ZI7A 4YKYA 1WB8A 1JA8A 1NU1H 2FXSA 1Z5BA 4H37A 3RN4A 1EI1A 3QDDA 3JD0A 3FD9A 1UYCA 1R1BA 4LF5B 3ZXQA 2YJWA 5L3GA 4F6RA 2ODMA 1I94O 3FYIB 2O1WA 1GM7A 3GVMA 2AHZA 1TILA 3OMUA 3CRAA 2PGGA 2PTMA 3RYFB 4CH5A 4MTOA 2PUSA 4LNUA 1S72V 4U3JB 4XIRA 4URMA 3JARB 1NR1A 1R3KC 1VQOV 3F5WC 3BRCA 2NNUA 1KECA 5KA5A 1O9GA 5BZBA 3CP1A 4DR7O 4JAAA 2XDUA 3T10A 4WFBV 3Q5KA 4CBCA 2CG9A 1SETA 1P4RA 3QO5A 5LMUO 3BA9A 2YGFA 1NH2D 4AILC 2JKIA 1Y74A 4LF8B 4HY6A 1CP9A 3AG1C 4UCRA 2Q8VA 2JRIA 4PL9A 2NN4A 4DV6O 4O4LA 2ZE5A 2M6YA 4Q20A 2WEQA 2EIKC 4GZRB 3UT5A 4FMTA 4QJFB 3LUTB 1Q5OA 3T1YO 4PRVA 3ETEA 3LMMA 5JCOC 1VMGA 1EM1A 3G7EA 2R72A 2UUAB 2JGDA 4KHPB 4P30A 2YE2A 3FB8C 4CS3A 3QO8A 4OX9B 1OCOB 2WLIB 1Q3EA 1K33A 1FFXB 2XHTA 2XJGA 4JAUA 1JM6A 1EZVH 3OPDA 2IU0A 4DRXA 4DUHA 1XNQB 4RWUA 4GKJO 4CWNA 3BEHA 3BABA 1D2DA 4JI8O 4BR6A 1PD3A 3EVKA 2GBOA 3ABMC 1AH6A 1MU5A 3ZHSA 3N2KA 1CPYA 5C93A 2PI5A 1UY6A 3SJCC 3ZMUA 3HKDA 2YEBA 4O04A 4UXNA 1Y76B 4XE2A 2PF4E 1ZX3A 1XNRB 2CTWA 2WWWA 2CUGA 5L3DA 2WLKA 2YIBA 4I55A 4JI2O 2JJ2G 2DYRB 1PV0A 1I58A 1V9PA 1Y4MA 3HKEB 1SC5B 3L72H 4XKAA 2M7WA 2XTAA 1G8MA 2YE6A 3A0WA 2UXNA 4LF9O 4DR5O 4GT1A 4JYAB 3R91A 2Q5ZA 2Q0OC 1M90W 3X2QC 5B1OA 2Q7HA 1ZLZA 1Q6HA 3E2EA 3JALA 1VIBA 3K06A 3ZRSA 1MZFA 3CJHB 5H6RA 4JGSA 1L8DA 3AK2A 5BMVB 1ZWIC 2LFSA 5JQGB 3EFFK 3TZ4A 1SQQH 4LWFA 3UT5B 4J9ZB 2RMKB 4URLA 1IZ3A 3LNMB 2QGNA 3NMQA 3W7SA 4CH6A 4X65O 4PELA 4X9QA 1QNMA 2Z3YA 2EXLA 1QZRA 2Q73A 1AP6A 1K97A 5B5EZ 4X20B 1HNXO 3RW0A 2ZIMA 1Z5CA 4HZ5A 1MMMA 3G80A 5AG2A 5B3SC 3B77A 1GRJA 4PD4F 1WA8A 1FYJA 5EC2C 2GFDA 1VQPV 2WI6A 4ZBMA 4X62B 2UU9O 4EKWA 2YI0A 4NKGB 2AKPA 2LW7A 2YE3A 1BS3A 2IM9A 2KG7A 2BREA 4FLZA 3K60A 3Q4HA 4RO2A 2YEVA 3FFQA 2Q67A 2BYIA 1QR9A 4TSFG 1S14A 4XBFA 4WBNA 5F3KA 2H8PC 4LC1A 2ADQB 2QWPB 3U10A 1EA6A 1R6NA 3A0BZ 3ZN1A 1MG1A 3TXQA 1VEWA 4H44B 4XC0A 4X9LA 5BY1A 2Y4UA 2WLMA 2JVDA 4FLUA 3K5MA 1UPGA 1N0JA 1GKXA 4HYPA 2HKOA 3CGYA 2RCVA 1XILA 1XL6A 3G75A 1W2BU 1Y76A 3ZMSA 3KCYA 3SL2A 4TV9A 1VQ9V 5KLVH 4WUCA 2IW5A 3F7YC 1N33B 3CRLA 1XMQO 3CJHA 2ZQMA 4GGLA 4DV5O 2EILB 1GN6A 4FCQA 4JI5B 4PDLA 4XD8A 2UXBO 1NH2B 4PA9A 3ZBHA 5FPRA 1QCEA 3IC7A 2HR3A 4MPEA 4HXZA 4HBNA 4J7KA 3N2GA 3FT8A 1SZXA 3ABKC 5LP6C 4MP7A 5J2TA 4LF6O 3E8HA 1FFTB 1JCHA 2NR5A 3J81N 3Q5JA 5LHGA 4XIPA 1I0HA 4URNA 4TWKA 2Q7GA 1SZTA 2FB5A 5K1XA 2FYUH 2K1EA 3HKCA 4L87A 2XABA 5CF0A 2WLNA 2VQEO 2YK2A 1PP9H 4B3TB 5KHHA 4CWFA 3J80N 1OCZB 4R3AA 2GDSA 2CTQA 5LMNO 2ZDIA 5CTWA 1DTOA 3ZX6A 1GJVA 1YC3A 2XASA 3H1IH 4JV5O 2HJDA 2AW9A 5IT9N 1UY9A 3TGUH 1I5CA 2EZPA 3D36A 2P06A 4EFBA 1FD9A 3HR0A 4JI4O 5L3EA 4FIPC 3OFNG 4D6TH 2AZ2A 2LJ2A 2DMXA 4LF4O 1W59A 2DE0X 1BE3H 4LWIA 2HG5C 2HVKC 2FMLA 5JVDB 3L74H 2HVJC 2LQTA 2A7WA 1BGYH 2YEVB 4WUDA 4NVPA 4FLVA 1GK9A 2ITDC 2X7RB 2IOQA 2ZR2A 4DV7O 1YSCA 4R50A 1B04A 1KYOF 3HZ5A 2YKCA 4O4JA 4KP4A 4LFCB 3JD3A 1ORQC 2F4VB 3BMYA 3JAKB 2IH3C 2DQ3A 4XCJA 3TXSA 1ZAUA 4UB8Z 2B5UA 2E74B 1HP8A 3JYCA 3CXCU 4DW0A 1NVPB 1JOYA 3B4SA 1YTFB 2XDKA 4L8ZA 2YEEA 2CGFA 2Q8IA 4JTDB 2PYLA 4JI4B 4X89A 4YHHB 5M4EA 1WP7A 2QWNB 2PI4A 4JYBA 2WI1A 4O05A 1BL8A 1H2MA 1M93A 5D6PA 3VBBA 3E35A 3D2RA 4DV3B 3OM3B 1H8EG 2QEXV 1OCOC 5H2FZ 3OW2U 2BU8A 3D0BA 4P8OA 2N05A 4DO2A 2YICA 2RN9A 2ZR3A 5TISZ 1XL4A 5L3FA 1YJNV 1RSOB 3TZ2A 2XAFA 2YEFA 5B1AB 3FT5A 1H2SB 1FXHA 1GN4A 1N4CA 3T0HA 5LHHA 2H8MA 3FYEB 4PHZA 1N0NA 2ETNA 4YKQA 4LWSB 4B7KA 5IYZA 2YSUB 2KSDA 5D7RA 3ZMZA 5IE9A 5EZYB 3O65A 4ZHQB 5LGNA 3VOUA 1KUQA 3BCCH 3K03A 4QPKA 1S0VA 3CX5F 2YDEA 1JPXA 3CPWU 1I5DA 4O0BA 3H1HH 4DV2B 4B3MB 2F43G 4ASFA 4UCTA 3HKBB 1FXKC 2BOCC 4WFAV 2UUCO 1THZA 1DF5A 4QE7A 3LDEA 3CGZA 4FM0A 5DEDA 2XNDG 5IDJA 1OCZC 1Z59A 2WI4A 3GWKC 4EGIA 4GX2A 5BR8O 3K0GA 5FNVA 2QTOA 4UCOA 3OW6A 3N27A 1E1QG 3A0XA 3U2DA 3K99A 3NXSA 4X1IB 4AWPA 4AWOA 2UXXA 3APQA 2BZ5A 1FJGB 5JJNB 4GFNA 5J2TB 5EBWC 2Q6AA 5FLXN 1BT8A 2UXCO 3N2GB 3LNUA 1XMOB 4H0LB 1ZXMA 1A4HA 4UB6Z 1K5SA 2ZCEA 1YF2A 1TH8A 1SRYA 2KQXA 2ZNJA 3FKSG 4JI1B 1MSWD 1NTMH 3E86A 4TV8A 5LOVA 4DV1O 1PL0A 2EIJB 4JYCA 4WF9V 1KBHA 2Z5UA 3L73H 4YJ2B 2YEGA 3JAMN 2DYRC 5CMUA 5C8YB 3D36C 1NHJA 1EN5A 1QU7A 3U2KA 2IJHA 3P30A 4NH8A 5CA0A 3WG7C 3K08A 1Y8OA 3CWBH 4MP2A 3ZM7A 1AI4A 5IJ9A 3EKRA 4DR3O 2P7TC 1Z5VA 1NR7A 1Y6XA 4J11A 4IIJA 1UYIA 1VQ6V 3K5NA 1US7A 5CBHA 3VQYA 3H4LA 4ASUG 1PKXA 3GIGB 3EHFA 4AHCA 3OTFA 4O4JB 1M56C 5D5PA 1BHAA 3RLRA 1FXVA 3E8BA 3B8MA 2H55A 1VQ7V 3APOA 3OEEG 3UQ8A 2QM7A 4I55B 4EEHA 4B3SB 1JJ2U 4MW8A 3L75H 2HKJA 2VWCA 2X6AA 2LO1A 2F1MA 4JAVA 5D6QA 2CTRA 1M9NA 2YE5A 1Y4UA 1IDSA 4MVOA 2UWDA 4DR6O 3P32A 1N36O 4Z1VA 4X66B 1UY7A 4ASBA 4CE2A 5M4MA 4JYYA 1XQ8A 1YC1A 4E01A 2XCMA 1KQSU 1GM8A 1XBLA 3LSQA 1J95A 1VF7A 4MB9A 5IJ9B 3STZC 1HDJA 2ZE8A 3PEJA
chains in the Genus database with same CATH topology
1DF4A 1OCRC 1AH8A 5LGUA 1Y4MA 1TC0A 3A0TA 1H7UA 2WSSG 4XIQA 2JDIG 1RM1B 2W0FC 1EBOA 1V55C 2A9HA 1S77D 3EHJA 3AG1B 1THNA 4GEEA 4XKAA 3E8GA 1YJWV 2O1VA 4ZKIA 3AG2B 3E8FA 1I5XA 1ZW9A 2XX4A 2M7WA 1G8MA 3ASNB 2YE6A 2IJIA 2UXNA 3A0WA 3T1CA 1M1KW 4GT1A 2XAHA 3ZRXA 2WI2A 3O2FA 5B1NA 3R91A 3W7UA 4XDKA 4XKKA 3CCLV 2EIKB 2CCTA 1Q7YW 3A0RA 4LCUC 3W7TA 1M90W 3X2QC 5B1OA 2JK5C 5M4HA 1R3JC 1K3EA 3E2EA 1OZ0A 4BIZA 3OWDA 1YHQV 2XX2A 3T1KA 2YI5A 3K06A 3D3IA 3OR7C 3ZRWB 3IGAC 3ZRSA 4RQFA 3CWVA 4MPNA 3ZCCA 5H6RA 4JGSA 2MK3A 5D7DA 1I5BA 1ZWIC 1MOFA 2LFSA 1F4MA 3EFFK 2LFRA 4F4LA 1AMWA 3TZ4A 4LWFA 2WI7A 4CWTA 2DQ0A 2XHRA 4J9ZB 2VW5A 3ABLB 1K5QA 4NH7A 3ZKDA 4URLA 3LNMB 3G6EV 3NMQA 2P90A 4QNHB 5KA6A 3W7SA 2YEIA 3OMAB 4PDMA 1UYKA 4PELA 4PA4A 3ML0A 4WFGA 4MPCA 2Z3YA 2A79B 4CZZA 4MOTA 2EXLA 4E02A 5CN0A 1QZRA 1K97A 3RW0A 1Z5CA 4HZ5A 2B1IA 4PDVA 1YITV 5B3SC 3B77A 3MD0A 5CBGA 2BTZA 3UM7A 2V1DA 4N21A 4RUEA 2WEPA 3CCJV 5CTXA 2YE7A 5GGZA 3EKOA 5EC2C 1KC8W 3OE7G 3CCSV 2WLLB 2GFDA 4CWSA 1NHIA 1QYEA 2YEAA 1VQPV 5KUMA 2WI6A 1VQ4V 4OXSA 4ZBMA 3HYYA 4LBEC 3VHDA 4EKWA 2YI0A 2XK2A 1YIJV 2AKPA 3O0IA 3FB7C 3AG3B 2YE3A 4MTXA 4CE3A 1COWG 3QNEA 3STLC 4L93A 1Y4SA 3WQ9A 4CWOA 3CYOA 3SYAA 2EINB 3HHUA 1BMFG 2EZOA 2BREA 3K60A 1S76D 3JD2A 2WLIA 4RO2A 4UUJC 1OSFA 3CD6V 4LWGA 3AG4B 3DTUB 2YEVA 1NVPD 2ZBKB 2Q67A 3ABKB 2BYIA 4I3HA 1QR9A 5IYDO 4TSFG 1S14A 3B25A 4ASGA 1TUEB 3M99B 5EC1C 4XBFA 1B6QA 4EMVA 3K0DA 3WG7B 1IXMA 3I56V 2XD6A 1LNQA 2XDSA 5F3KA 2H8PC 4LC1A 2QE7G 3OUFA 2P6JA 3SYQA 1VQ5V 1EA6A 4JF3A 3ABUA 4JASA 1AI6A 3CCUV 4JPRA 3AG2C 5HFMA 1R6NA 3B26A 2IJJA 3K97A 1H38A 3ASNC 2GSMB 3CC2V 2WAMA 3ZN1A 3CCMV 1MG1A 4G28B 4XDMA 3VHCA 1YSRA 2BRCA 2GQPA 5H9CA 4XC0A 2Y69B 3W7XA 4HY1A 3G7BA 3K98A 4X9LA 4I9WA 1R73A 4JTAB 3X2QB 5IYBO 5FL7G 1H2GA 2YI6A 2WLMA 4WUBA 1M57C 2IU3A 4O07A 4KSHA 1YC4A 2DYSB 2IWSA 2BU2A 1GKXA 3R92A 4HYPA 1AJQA 2HKOA 4TT3G 4H33A 3RVZA 4YKZA 4MS2A 2Q69A 2FWZA 3CGYA 2V7QG 2X6CA 3SJQC 4YKUA 1XL6A 3KE6A 3H01A 1ZWHA 1W2BU 3CC4V 1JX9A 2Q2EB 3G75A 3W7WA 4HXWA 5L3CA 3ZMSA 1K9MW 4H81A 4P7AA 3SL2A 3E89A 3B28A 1VQ9V 2XAJA 1YT2A 2VCJA 2ZDXA 4WUCA 2IW5A 1TIDA 1F23A 3HZ1A 3F7YC 3TK1A 4FCPA 5B3SB 4Z1MG 3CRLA 4GQTA 5L3BA 2OTLV 2ZQMA 1Y66A 2Y48A 3LDDA 2YEDA 4GGLA 3F7VC 2XDLA 3LDCA 1JQ0A 1JVMA 3FB6C 2PNRA 2WERA 2DWEC 2EILB 1B63A 4DZYA 1NHHA 3HPLC 1AJ6A 4FCQA 4XD8A 4PDLA 2QF6A 2YGAA 2O1UA 1Q82W 2JJ1G 1NH2B 4PA9A 4FJCC 1AM1A 2BSMA 4HYOA 2IH1C 1E79G 1QCEA 4KFMA 2JIZG 3IC7A 3QDDA 1OCRB 2OCCB 4P9PA 1AJPA 1I5AA 2HR3A 2JEXA 2IOPA 4HXZA 4MPEA 4N23A 2CCSA 4UV8A 4MTFA 4H85A 4XTJA 2R9RB 3FT8A 3ABKC 4XKOA 3K04A 5EBLC 4MP7A 3JD4A 3E8HA 2XJXA 1FFTB 3GWOA 1JCHA 5FNFA 1GKFA 4R3MA 2AHYA 4MTGA 2IWXA 3Q5JA 5LHGA 2YECA 3OEHG 4XIPA 1QBZA 2EIMC 4URNA 4TWKA 1ROPA 3ZRVA 1WLEA 4GCZA 2BU6A 4AS9A 1SZTA 3TZ5A 2YJXA 4JQLA 2K1EA 2WPDG 3BM9A 3O6OA 4L87A 5B1BC 1W0JG 3RVYA 2OT5A 2FYPA 4G27B 2XABA 5CF0A 3TETA 4AWQA 3EHBB 4MBCA 1K8AW 4V25A 1VQKV 2WLNA 3LSSA 2YK2A 5CPHA 5M4PA 3ZRWA 3GIEA 2XAGA 3SPJA 2Y69C 1GTOA 1OCCC 1ID0A 4CWFA 1OCZB 4PA3A 4R3AA 1V54B 2ITCC 1KKDA 1TC6A 2ZDIA 5CTWA 1M57B 3JCZA 1DTOA 3OAAG 4QE9A 1GJVA 2ZKJA 1YC3A 5FNDA 3TTZA 2DYSC 5CTUA 2XASA 2IWUA 2YE9A 1F4NA 2X6BA 4EGKA 4BQGA 1VQLV 1UY9A 4BQJA 1I5CA 2EZPA 1AI7A 3D36A 1Z5AA 1Q81W 2YK9A 1MABG 2QG0A 1S16A 1UYGA 4MW3A 5L3EA 4FIPC 3HYZA 1K92A 3OFNG 3RLPA 4YKXA 2E0AA 2B1GA 5FWKA 2H94A 3FV5A 2HG1A 3A0YA 4EGHA 4R8CA 1H7SA 3GIFA 5M4KA 4LWIA 2X0LA 2HG5C 1G4YB 2HVKC 3E83A 4P2ZA 2HVJC 5IYCO 3R65A 3QTFA 4UROA 1R6KA 5DM6V 2YEVB 4WUDA 3WFVA 1YT0A 5J9PC 1GK9A 2ITDC 2X7RB 3SPCA 2CK3G 1R62A 2IOQA 2ZR2A 1YSCA 4R50A 3R4OA 1BHBA 2HLDG 2ZXWB 5EK0A 5IN9A 3TUHA 3HZ5A 4PA7A 1ZXNA 2D3OW 4DXWA 3JD3A 4KP4A 2HJFC 1ORQC 2WLJA 2YKCA 3BMYA 2A0LA 4K4OA 4R1FA 2IH3C 3CCEV 1BGQA 1U2OA 3EHGA 4U7NA 4UV9A 2DQ3A 4MVSA 4HZ0A 3ZXOA 4XCJA 2NLJC 1PVGA 2B5UA 1SERA 1HWYA 2HCHA 4KFGA 4MSWC 3JYCA 4GX0A 4MVQA 3CXCU 1GKZA 2YKEA 1UJWB 1AJNA 4FPPA 3QO7A 1NVPB 2FWYA 2R9IA 3OGCC 3ASOC 1W0KG 4LP8A 4RUFA 1JOYA 1YTFB 3CCRV 2EIMB 2XDKA 4L8ZA 2YEEA 5EBMC 3OR6C 3MNRP 4RQEA 2CGFA 2Q8HA 1K73W 2Q8IA 3MHSC 4JTDB 1K4CC 2WLLA 1EZJA 1P7BA 3OMNB 3OWBA 3R4MA 4X89A 1QVGU 4HAMA 2W6IG 3B24A 4B6CA 1FXKA 5M4EA 1I5YA 3C0EA 3R4PA 3JZ3A 3SPGA 1R3IC 3K9AA 5LHIA 2PI4A 3C11A 1OCCB 1UYEA 4ASAA 4JYBA 1KP2A 2WI1A 1YJ9V 4O05A 1V54C 1AROP 1BL8A 3HB3B 1YESA 4GX5A 3VBBA 5D7CA 4YKTA 5D6PA 3E35A 3T4DA 3D2RA 4CWRA 5BODA 5GW7A 3ZJZA 3OM3B 1H8EG 1I58A 2QEXV 2BYHA 2YE4A 1OCOC 1L1FA 3OW2U 2BU8A 3D0BA 4P8OA 2Q8FA 1NBMG 4LWHA 3GIGA 4DO2A 2XHXA 1E1RG 4PRXA 3K3WA 2CCUA 2ZR3A 2YKBA 1XL4A 2IJKA 2QG2A 5L3FA 4WFFA 1YJNV 4ZVIA 3R4NA 3OMIB 1QLEC 3SYPA 3ZN0A 1RPRA 1YTFD 4X88A 3TZ2A 2XAFA 2YEFA 4GX1A 1UYHA 2JJCA 1GO3F 4U7OA 5B1AB 1UYMA 2P67A 1K4DC 4LP0A 1YI2V 4G2KA 5LBQA 3CRKA 1AI5A 1NQTA 2EILC 1FXHA 3G4SV 2XDXA 3T0ZA 2IORA 2YE8A 5IY5B 3T0HA 5LHHA 2H8MA 3FYEB 4WFEA 1BXDA 2EIJC 3CMEV 1NJIW 2BU5A 4YKQA 2WLHA 5HFLA 3EHHA 1UYFA 5DN6G 2C2AA 4YKRA 1Q86W 2YSUB 1RPOA 2OCCC 4BXIA 5D7RA 2KB1A 4UVBA 2ZXWC 3ZMZA 4KTNA 3TZ0A 4BIUA 3CCQV 3G71V 1NKDA 4KSGA 5LGNA 2Q68A 3VOUA 3RKZA 2JEUA 3UKMA 3K03A 4QPKA 1K34A 5CTYA 4KUMA 2K5BA 4EFTA 4FK5C 1S0VA 1JPXA 3CPWU 1I5DA 4RAIA 4O0BA 3T2SA 5J6AA 2XOKG 3KG2A 4MVZA 1GMGA 3SPIA 1SESA 2QKSA 3TCUA 1RM1C 3K79A 1TBWA 5F5RA 2LP7A 1QLNA 3ZIAG 2F43G 4HZ3A 1VQ8V 4ASFA 1UYLA 2HFEC 4I5SA 1YT1A 4MVMA 3ZMTA 5E1AC 3T4ZA 3CC7V 1FXKC 2BOCC 4HYMA 4E00A 4WFAV 3BY6A 5L3JA 3U67A 1THZA 4CWPA 5B1BB 1B3QA 1DF5A 5J71A 5CBFA 4YKWA 1H8HG 3MHHC 4QE7A 4XITA 1F51A 2EBOA 3ZKBA 4H7QA 3LDEA 3CGZA 1QY8A 4L91A 2WI3A 4LWEA 4CWQA 4NH9A 2XNDG 5IDJA 2FXSA 4YKYA 4UVAA 1KZNA 1Z5BA 1OCZC 2BOBC 4H37A 1S5HC 3DGEA 3ABTA 1EI1A 1Z59A 1M56B 2WI4A 4GX2A 3JD0A 4BW5A 1UYCA 2BU7A 2CH4A 4WCEV 3K0GA 2QTOA 2ATKC 3ZXQA 3I55V 5L3GA 2YJWA 3INXA 3T2MA 3OW6A 1E1QG 3A0XA 2Q8GA 3U2DA 1BKNA 3K99A 3AEIA 3FYIB 3NXSA 3IFXA 2VCIA 4AWPA 2O1WA 4AWOA 1S3JA 2UXXA 2BZ5A 1GM7A 1KIJA 2AHZA 2BT0A 3VADA 1CEZA 2WI5A 3ABLC 1TILA 3OMUA 4GFNA 4XCLA 1PNMA 2Q6AA 5EBWC 3SYOA 4J9YB 1N8RW 3LNUA 4MTOA 1S72V 3HEKA 4L90A 3INWA 1ZXMA 3ABMB 1A4HA 1K5SA 4XIRA 5KUKA 4URMA 1TH8A 1QLEB 1NR1A 4YXWG 1R3KC 1SRYA 1VQOV 4O09A 5FNCA 1ENVA 3F5WC 5B1AC 2NNUA 3FKSG 1KECA 4UVCA 5KA5A 1Y8PA 2XX5A 1PNLA 4WFHA 3JD1A 1MSWD 2ZDYA 4R7CA 5BZBA 3E86A 5IY5C 3CP1A 1PL0A 1GM9A 5BOCA 1R3LC 2ESAA 2EIJB 4MVRA 4JYCA 1FS0G 2XDUA 4WF9V 3T10A 3CMAV 4WFBV 3Q5KA 2DW4A 2Z5UA 4CBCA 2CG9A 1SETA 2EJRA 3B8NA 1VQMV 2YEGA 3A0ZA 4EFUA 1P4RA 2DYRC 3QO5A 5CMUA 2YGFA 3SYCA 1KP3A 4R6ZA 1NH2D 2OTJV 1NHJA 2JKIA 5H6QA 1KD1W 4E2LA 3U2KA 4HY6A 4GT8A 2IJHA 3AG4C 1V55B 1CP9A 3AG1C 1QR8A 3P30A 3ETDA 1UYDA 4KQVA 4NH8A 4JTCB 4XDJA 5CA3A 4PL9A 4U93A 3ETGA 3WG7C 3K08A 3ASOB 1Y8OA 2GHYA 3VHAA 5LGTA 4MP2A 3ZM7A 4V26A 2YEHA 1AI4A 3PEHA 3EKRA 4LPBA 2P7TC 1Y8NA 1WPXA 4Q20A 3RBZA 1NR7A 4QPJA 2WEQA 1K7DA 1FXKB 2EIKC 1B62A 1I59A 5M4NA 1BYQA 3B27A 1AR1B 4PU9A 1UYIA 4FMTA 4XDLA 1VQ6V 4QJFB 2ZD9A 2YGEA 1US7A 5CBHA 3H4LA 3LUTB 4ASUG 4PRVA 2XAQA 1MX0A 1PKXA 3ETEA 1EFRG 3GIGB 3EHFA 3G7EA 3SPHA 4EEHA 4EM7A 2QM8A 4P30A 2XJJA 3FB8C 2YE2A 1M56C 1BHAA 2YKIA 4L94A 3RLRA 2FTKA 1U0ZA 5IDMA 4QIWF 1FXVA 3E8BA 3QO8A 3H80A 4CE1A 3B8MA 2H55A 4W7TA 1VQ7V 1DLBA 1OCOB 3WHAA 2WLIB 3PJSK 3OEEG 3FB5C 4X8AA 3ZMVA 1K33A 2XJGA 2XHTA 4JAUA 2QM7A 1UY8A 1JM6A 2YI7A 2YKJA 3IEDA 4P9OA 2IU0A 1YETA 4MT8A 1PNKA 2ZDIC 1YS3A 3OPDA 1JJ2U 3Q5LA 4MW8A 4DUHA 4CWNA 3BEHA 3GB7C 2HKJA 4MVUA 1PD3A 1QVFU 1YERA 2VWCA 2X6AA 3ABMC 1AH6A 1MU5A 4JAVA 2W6JG 1CPYA 5C93A 2PI5A 1UY6A 5D6QA 3RLQA 4BAEA 1M9NA 2YE5A 1Y4UA 4MVOA 1YSZA 2UWDA 3OUSA 2QA4V 3P32A 3CCVV 1L0OA 4BAYA 1UY7A 3ZMUA 4ASBA 4CE2A 5M4MA 1YC1A 2YEBA 2DWDC 4UXNA 4O04A 4XE2A 4E01A 4B7PA 3AG3C 2QFOA 2XCMA 1KQSU 1GM8A 4PDRA 2WWWA 2YEJA 3LSQA 1J95A 5L3DA 3FT5A 4FCRA 4EGIA 2EINC 2WLKA 4MB9A 1OHHG 2JJ2G 3LPSA 3STZC 1VQNV 2DYRB 4PA6A 3PEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AH8 A;  1TC0 A;  3A0T A;  1H7U A;  4XIQ A;  3EHJ A;  1THN A;  4GEE A;  4XKA A;  2O1V A;  4ZKI A;  1ZW9 A;  2XX4 A;  2YE6 A;  3A0W A;  4GT1 A;  3ZRX A;  2WI2 A;  3O2F A;  5B1N A;  3R91 A;  4XKK A;  2CCT A;  3A0R A;  5B1O A;  5M4H A;  4BIZ A;  3OWD A;  2XX2 A;  3T1K A;  2YI5 A;  3ZRW B;  3CWV A;  4MPN A;  3ZCC A;  5D7D A;  1I5B A;  2LFS A;  3TZ4 A;  2LFR A;  1AMW A;  4CWT A;  4LWF A;  2WI7 A;  2XHR A;  2VW5 A;  4NH7 A;  3ZKD A;  4URL A;  3NMQ A;  2YEI A;  1UYK A;  4MPC A;  4MOT A;  4E02 A;  2EXL A;  1QZR A;  1Z5C A;  4HZ5 A;  3MD0 A;  2BTZ A;  2WEP A;  5CTX A;  2YE7 A;  5GGZ A;  3EKO A;  4CWS A;  2GFD A;  1NHI A;  1QYE A;  2YEA A;  2WI6 A;  3HYY A;  3VHD A;  2YI0 A;  2XK2 A;  3O0I A;  2AKP A;  2YE3 A;  4MTX A;  4CE3 A;  4L93 A;  1Y4S A;  3WQ9 A;  4CWO A;  3HHU A;  2BRE A;  3K60 A;  1OSF A;  4LWG A;  2ZBK B;  4I3H A;  2BYI A;  1S14 A;  3B25 A;  4ASG A;  4EMV A;  1IXM A;  2XD6 A;  2XDS A;  5F3K A;  4LC1 A;  1EA6 A;  4JAS A;  3B26 A;  3K97 A;  4XDM A;  3VHC A;  1YSR A;  2BRC A;  2GQP A;  4XC0 A;  4HY1 A;  3G7B A;  3K98 A;  4X9L A;  2YI6 A;  4WUB A;  4O07 A;  4KSH A;  1YC4 A;  2IWS A;  2BU2 A;  1GKX A;  3R92 A;  4HYP A;  4YKZ A;  2FWZ A;  3CGY A;  4YKU A;  3KE6 A;  3G75 A;  1ZWH A;  2Q2E B;  4HXW A;  4P7A A;  4H81 A;  3SL2 A;  3B28 A;  2VCJ A;  1YT2 A;  2ZDX A;  4WUC A;  1TID A;  3HZ1 A;  3TK1 A;  4FCP A;  3CRL A;  4GQT A;  2YED A;  4GGL A;  2XDL A;  2PNR A;  2WER A;  4DZY A;  1B63 A;  1NHH A;  1AJ6 A;  4FCQ A;  4XD8 A;  2QF6 A;  2YGA A;  2O1U A;  1AM1 A;  2BSM A;  1I5A A;  2IOP A;  4MPE A;  4HXZ A;  2CCS A;  4H85 A;  4XTJ A;  3FT8 A;  4XKO A;  4MP7 A;  2XJX A;  5FNF A;  4R3M A;  2IWX A;  3Q5J A;  2YEC A;  4XIP A;  4URN A;  3ZRV A;  2BU6 A;  4AS9 A;  4GCZ A;  3TZ5 A;  2YJX A;  4JQL A;  3BM9 A;  3O6O A;  2FYP A;  2XAB A;  5CF0 A;  4AWQ A;  4MBC A;  4V25 A;  2YK2 A;  5CPH A;  5M4P A;  3ZRW A;  3GIE A;  1ID0 A;  4CWF A;  4R3A A;  1TC6 A;  5CTW A;  2ZKJ A;  5FND A;  1GJV A;  3TTZ A;  1YC3 A;  5CTU A;  2IWU A;  2YE9 A;  4EGK A;  4BQG A;  1UY9 A;  4BQJ A;  1I5C A;  3D36 A;  1Z5A A;  2YK9 A;  2QG0 A;  1S16 A;  1UYG A;  3HYZ A;  3RLP A;  4YKX A;  2E0A A;  3FV5 A;  2HG1 A;  3A0Y A;  4EGH A;  1H7S A;  3GIF A;  5M4K A;  4LWI A;  3QTF A;  4URO A;  4WUD A;  1YT0 A;  2IOQ A;  1R62 A;  3R4O A;  3TUH A;  5IN9 A;  3HZ5 A;  1ZXN A;  2YKC A;  3BMY A;  4KP4 A;  4K4O A;  4R1F A;  3EHG A;  1BGQ A;  1U2O A;  4U7N A;  4HZ0 A;  3ZXO A;  4XCJ A;  1PVG A;  2HCH A;  4KFG A;  1GKZ A;  2YKE A;  4FPP A;  2FWY A;  1JOY A;  2XDK A;  4L8Z A;  2YEE A;  3MNR P;  2Q8H A;  2CGF A;  2Q8I A;  3OWB A;  3R4M A;  3B24 A;  4B6C A;  5M4E A;  3C0E A;  3R4P A;  3JZ3 A;  3C11 A;  1UYE A;  4ASA A;  4JYB A;  2WI1 A;  4O05 A;  1YES A;  5D7C A;  5D6P A;  4YKT A;  3D2R A;  4CWR A;  5BOD A;  5FWK A;  2BYH A;  2YE4 A;  4P8O A;  2BU8 A;  3D0B A;  2Q8F A;  4LWH A;  3GIG A;  2XHX A;  4PRX A;  2CCU A;  2YKB A;  2QG2 A;  4ZVI A;  3R4N A;  3TZ2 A;  2YEF A;  1UYH A;  2JJC A;  4U7O A;  1UYM A;  2P67 A;  4LP0 A;  3FT5 A;  3CRK A;  3T0Z A;  2XDX A;  2IOR A;  2YE8 A;  3T0H A;  2H8M A;  1BXD A;  2BU5 A;  4YKQ A;  3EHH A;  1UYF A;  2C2A A;  4YKR A;  4BXI A;  5D7R A;  4KTN A;  3TZ0 A;  4BIU A;  4KSG A;  3RKZ A;  5CTY A;  4QPK A;  2K5B A;  4EFT A;  1I5D A;  4O0B A;  3T2S A;  3U67 A;  5J6A A;  1TBW A;  5F5R A;  4ASF A;  1UYL A;  4I5S A;  1YT1 A;  4E00 A;  4HYM A;  5L3J A;  4CWP A;  1B3Q A;  5J71 A;  4YKW A;  4XIT A;  1F51 A;  3ZKB A;  4H7Q A;  3CGZ A;  4L91 A;  1QY8 A;  4CWQ A;  2WI3 A;  4LWE A;  4NH9 A;  5IDJ A;  4YKY A;  2FXS A;  1KZN A;  1Z5B A;  1Z59 A;  1EI1 A;  2WI4 A;  3DGE A;  3QDD A;  4EGI A;  2BU7 A;  1UYC A;  2CH4 A;  3ZXQ A;  2YJW A;  3OW6 A;  3INX A;  2Q8G A;  3A0X A;  3U2D A;  1BKN A;  3K99 A;  3NXS A;  4AWP A;  2VCI A;  2O1W A;  4AWO A;  2BZ5 A;  1KIJ A;  2BT0 A;  3VAD A;  2WI5 A;  4GFN A;  1TIL A;  3OMU A;  4XCL A;  3LNU A;  3HEK A;  4L90 A;  3INW A;  1ZXM A;  1A4H A;  4XIR A;  4URM A;  1TH8 A;  4O09 A;  5FNC A;  1Y8P A;  2XX5 A;  2ZDY A;  5BOC A;  2ESA A;  2XDU A;  4JYC A;  3T10 A;  3Q5K A;  2CG9 A;  2YEG A;  3A0Z A;  4EFU A;  2YGF A;  1NHJ A;  2JKI A;  3U2K A;  4HY6 A;  4GT8 A;  1UYD A;  4KQV A;  4U93 A;  4NH8 A;  4PL9 A;  1Y8O A;  3VHA A;  4MP2 A;  3ZM7 A;  4V26 A;  2YEH A;  3PEH A;  3EKR A;  4LPB A;  1Y8N A;  4Q20 A;  4QPJ A;  2WEQ A;  5M4N A;  1I59 A;  1B62 A;  1BYQ A;  3B27 A;  4PU9 A;  1UYI A;  4FMT A;  2YGE A;  1US7 A;  3H4L A;  4PRV A;  1MX0 A;  3GIG B;  3EHF A;  3G7E A;  4EM7 A;  2QM8 A;  2XJJ A;  2YE2 A;  2YKI A;  4L94 A;  3RLR A;  2FTK A;  1U0Z A;  5IDM A;  3H80 A;  4CE1 A;  4W7T A;  2H55 A;  3WHA A;  2XJG A;  2XHT A;  4JAU A;  2QM7 A;  1UY8 A;  1JM6 A;  2YI7 A;  3OPD A;  3IED A;  1YET A;  2YKJ A;  4EEH A;  4MT8 A;  1YS3 A;  3Q5L A;  4DUH A;  4CWN A;  2HKJ A;  1YER A;  2VWC A;  1AH6 A;  1MU5 A;  4JAV A;  5C93 A;  1UY6 A;  5D6Q A;  3RLQ A;  4BAE A;  2YE5 A;  1Y4U A;  1YSZ A;  2UWD A;  1UY7 A;  3P32 A;  1L0O A;  4CE2 A;  5M4M A;  4ASB A;  1YC1 A;  2YEB A;  4O04 A;  4XE2 A;  4E01 A;  4B7P A;  2QFO A;  2XCM A;  2WWW A;  2YEJ A;  4FCR A;  4MB9 A;  3LPS A;  1I58 A;  3PEJ A; 
#chains in the Genus database with same CATH topology
 3G6B A;  1H7U A;  4XIQ A;  1RM1 B;  4EB6 A;  1N34 O;  4B3R O;  1V55 C;  4GEE A;  2KG7 B;  3BVO A;  4ZKI A;  3E8F A;  2XX4 A;  3CSX A;  5CB4 B;  1M1K W;  3O2F A;  5B1N A;  2D2C B;  4XDK A;  4XKK A;  3CCL V;  2CCT A;  1WNS A;  3AG7 A;  3M7M X;  5LOV B;  1K3E A;  4FZ0 A;  2XX2 A;  3D3I A;  1Z2G A;  4MPN A;  1YXB A;  5D7D A;  2LFR A;  1AMW A;  1WPB A;  2VW5 A;  3ABL B;  4LH6 A;  4NH7 A;  3ZKD A;  4K0K O;  1BCC H;  1R6T A;  4PDM A;  1FJG O;  2A79 B;  4JI3 O;  5IJ0 B;  1Q90 D;  2B1I A;  4PDV A;  5DEC A;  4LFA O;  1N36 B;  5CBG A;  3UM7 A;  2WEP A;  5CTX A;  3EKO A;  1U96 A;  4CWS A;  2WLL B;  2DN9 A;  3P3P A;  1VP7 A;  3CRR A;  2YEA A;  1Q8I A;  3VHD A;  2LGQ A;  1ZUQ A;  3AG3 B;  1HNW O;  4CE3 A;  1Y4S A;  1LUW A;  3CYO A;  3SYA A;  2EIN B;  3HHU A;  2ZNI A;  4H13 B;  3AG4 B;  2ZBK B;  4GKK B;  3ABK B;  4I3H A;  3B25 A;  1GN3 A;  1TUE B;  5EC1 C;  1B6Q A;  4EMV A;  3WG7 B;  1IXM A;  2XDS A;  2CH7 B;  2QE7 G;  2QDO A;  2EUL A;  4LFB O;  4JF3 A;  2L35 A;  3UO3 A;  2GTS A;  1AI6 A;  5HFM A;  3AG2 C;  3B26 A;  1H38 A;  4Z2W A;  4JZG A;  2JGD B;  1N34 B;  4JI0 O;  1YSR A;  5H9C A;  3W7X A;  4HY1 A;  3K98 A;  4ZIB A;  4JTA B;  1TVK B;  3D3Q A;  2N74 A;  5LA6 A;  2P4V A;  3R92 A;  1AJQ A;  5J2U A;  4TT3 G;  4H33 A;  4TQF A;  4EEQ A;  2FWZ A;  2V7Q G;  2X6C A;  1BQ0 A;  3H01 A;  3CC4 V;  1JX9 A;  4UCU A;  3UCS C;  1UFI A;  4ZOL A;  4IIJ B;  4P7A A;  3C3S A;  2VCJ A;  4E4E A;  4X1K B;  4GQT A;  5L3B A;  1Y66 A;  1FPO A;  2Y48 A;  3LDD A;  1WAZ A;  1Y67 A;  2YED A;  2PNR A;  1JQ0 A;  1JVM A;  2WA3 A;  4DZY A;  5H5N A;  4O4H A;  3HPL C;  4J41 A;  1AJ6 A;  1WJZ A;  2QF6 A;  2YGA A;  1MSD A;  2IH1 C;  5EYP B;  1E79 G;  1XOU A;  2OCC B;  1DK1 A;  4K8Z A;  2JEX A;  2CCS A;  4YJ3 A;  2R9R B;  1X4T A;  3C90 A;  2ZT9 B;  5EIB C;  2QJ1 A;  3JAS A;  4YIP A;  4R3M A;  2IWX A;  2QSA A;  2EIM C;  1ROP A;  2BU6 A;  5IWA B;  2E5L O;  1O9H A;  2WPD G;  3O6O A;  2FYP A;  1BSM A;  4G27 B;  1SF9 A;  2E3C A;  2L6L A;  3TET A;  2OCH A;  4V25 A;  3GIE A;  4OPA A;  1HR0 O;  4J42 A;  4YJ3 B;  1V54 B;  2ITC C;  1I94 B;  4X20 A;  2ZKJ A;  1TUB A;  2DYS C;  1HNX B;  3IAY A;  4EGK A;  4DYL A;  1VQL V;  5JCO A;  3FAV A;  2YK9 A;  1Z5W A;  1S16 A;  3JAK A;  1UYG A;  4FFK A;  3HYZ A;  4YKX A;  2E0A A;  2H94 A;  3FV5 A;  3A0Y A;  4EGH A;  4W4K A;  5M4K A;  1Q43 A;  4DV4 B;  4P2Z A;  3T1H O;  4L8J A;  3R65 A;  5IYC O;  1R6K A;  4ZOL B;  3WFV A;  5J9P C;  1YT0 A;  3SPC A;  2Z0A A;  5EK0 A;  5IN9 A;  5KMG A;  3FX7 A;  2HJF C;  2WLJ A;  1SA0 A;  4JI3 B;  2A0L A;  4R1F A;  3K59 A;  1U2O A;  5IJ0 A;  3ZXO A;  2NLJ C;  1PVG A;  1SER A;  2Q7E A;  2ZE6 A;  4MSW C;  1GKZ A;  4GX0 A;  2YKE A;  1FAF A;  1AJN A;  4CS2 A;  2FWY A;  4TUY A;  1U97 A;  4NXN O;  4JI2 B;  3ASO C;  1WN7 A;  1YZB A;  2QKC A;  3CCR V;  3TJT A;  3OR6 C;  4RQE A;  4GUN A;  1HNZ B;  1K4C C;  2WLL A;  1QVG U;  4HAM A;  2W6I G;  1FXK A;  3R4P A;  3K9A A;  1OCC B;  1JFF A;  4ASA A;  1KP2 A;  1ARO P;  4LF9 B;  4AQY O;  1SQX H;  3RYH A;  5FWK A;  1HR0 B;  2F23 A;  2Q8F A;  1NBM G;  4LWH A;  4YY3 O;  1VAR A;  4PRX A;  2CCU A;  2YKB A;  4FLT A;  2QG2 A;  4WFF A;  2EX3 A;  4ZVI A;  5JJJ B;  3OMI B;  3ZN0 A;  1RPR A;  4LWS A;  4GX1 A;  2JJC A;  1GO3 F;  5K1P A;  2ILM A;  4G2K A;  3CRK A;  3T0Z A;  1NQT A;  4O2B B;  4WFE A;  4LFC O;  1OV9 A;  3ZHV A;  2Q0A A;  5CB4 A;  2WLH A;  1WP8 A;  1NT2 B;  2C2A A;  4YKR A;  2OCC C;  1XUQ A;  2KB1 A;  2ZXW C;  1G6U A;  5LP6 A;  2UXB B;  3CCQ V;  4DV6 B;  1NKD A;  4LF7 B;  3UKM A;  4KXR A;  4IYI A;  2K5B A;  2YXH A;  1I08 A;  4EFT A;  3G67 A;  5J6A A;  4MVZ A;  1RM1 C;  3SPI A;  5JEN A;  5F5R A;  5LYJ A;  4PV1 B;  1UYL A;  2HFE C;  1YT1 A;  4MVM A;  4E00 A;  1XRE A;  2CGO A;  4KHP O;  2C1I A;  3ZKB A;  4LWE A;  4NH9 A;  4UVA A;  1KZN A;  3ABT A;  4BW5 A;  2CH4 A;  1WA8 B;  3K9S A;  5KHI A;  2Q8G A;  4B3T O;  3AEI A;  3BFR A;  2VCI A;  1AR5 A;  1AB3 A;  4B08 A;  2BT0 A;  3VAD A;  4CS4 A;  2WI5 A;  3BAA A;  3ABL C;  4YIO A;  4DV4 O;  3BHP A;  5ITZ A;  4LF4 B;  1PNM A;  1N8R W;  4XCL A;  4J9Y B;  1IXB A;  2V4D A;  1H2N A;  2RJZ A;  3HKC B;  3HEK A;  3ABM B;  2BTQ A;  1AVM A;  4FLX A;  5KUK A;  4LF7 O;  4GLX A;  4NYK A;  1QLE B;  4I4T A;  5FNC A;  2Y0I A;  2XX5 A;  1PNL A;  1P7G A;  4WFH A;  2LW1 A;  2ZDY A;  4R7C A;  3E22 B;  1B06 A;  1P84 F;  5IY5 C;  3CYG A;  5BOC A;  4HNA A;  1R3L C;  4MVR A;  3CMA V;  3WU2 Z;  1IVS A;  3RYF A;  2PZS A;  2EJR A;  3B8N A;  1XNQ O;  4NXN B;  1KP3 A;  2OTJ V;  1JJO A;  4DV5 B;  1KD1 W;  5F2V O;  4E2L A;  3AG4 C;  1V55 B;  3HKE A;  3ETG A;  3RWR D;  3ASO B;  3VHA A;  5LGT A;  2YXL A;  4V26 A;  4FM2 A;  2YEH A;  1Y8N A;  3K5L A;  3RBZ A;  1A32 A;  5JVD A;  5M4N A;  1I59 A;  1B62 A;  1BYQ A;  3B27 A;  4XDL A;  3SGI A;  2ZD9 A;  3LNN A;  5CA1 A;  2XAQ A;  1MX0 A;  1T5E A;  3OGI B;  1EFR G;  4X1Y A;  2CE4 A;  4UCV A;  3JAW B;  4EM7 A;  2QM8 A;  2XJJ A;  3RYH B;  1TGO A;  1D5A A;  2FTK A;  4YHH O;  5IDM A;  2F95 B;  4TOI A;  4A5U B;  4DR6 B;  4UCS A;  1PM9 A;  4DV0 B;  1UY8 A;  4NB5 A;  3IED A;  4P9O A;  4MT8 A;  1PNK A;  2BTO A;  4MVU A;  1QVF U;  1YER A;  1JMK C;  3QG5 A;  3RLQ A;  3E22 A;  1L0O A;  4BAY A;  3OTO O;  4B7P A;  4DV7 B;  3JAT A;  2YEJ A;  1S5L Z;  1US6 A;  1YDX A;  3N2K B;  4X65 B;  1SQF A;  4O4I A;  5GTH Z;  2UU9 B;  5KAI Z;  4X1I A;  3LPS A;  1AR4 A;  1SQV H;  4PA6 A;  3ZHU A;  5LGU A;  2XHB A;  1TC0 A;  3DSQ A;  2WSS G;  3U11 A;  2JDI G;  2P5O A;  1EBO A;  1XDC A;  4C7U A;  2A9H A;  3EHJ A;  2XUM A;  3E8G A;  2O1V A;  4DR3 B;  3AG2 B;  1I5X A;  1ZW9 A;  4J10 A;  3QTC A;  2XAH A;  2HHH B;  3K57 A;  2EIK B;  2XT9 A;  1Q7Y W;  3CEI A;  3W7T A;  4I0X A;  5M4H A;  1R3J C;  2HHI A;  4BIZ A;  3OWD A;  1YHQ V;  3ZS8 C;  5LMN B;  2YI5 A;  3OR7 C;  3IGA C;  3CWV A;  3ZCC A;  2MK3 A;  5EZY A;  1MOF A;  5ITZ B;  3F5T A;  3JSL A;  4F4L A;  2DQ0 A;  2XHR A;  1N33 O;  4BWA A;  3G6E V;  2GTA A;  2P90 A;  5EYP A;  4LNU B;  4JI6 B;  5KA6 A;  2A3Q A;  3OMA B;  2YI8 A;  3ML0 A;  4MPC A;  4CZZ A;  4MOT A;  3ICX A;  1NTZ H;  4I0X B;  1IBL B;  1XMO O;  2BTZ A;  4CC5 A;  1EN4 A;  2V1D A;  4ABM A;  4O2B A;  3RYC A;  1KC8 W;  3CCS V;  1QYE A;  5KUM A;  1VQ4 V;  4LBE C;  3O0I A;  1YIJ V;  3FB7 C;  4U3F H;  4MTX A;  1COW G;  4L93 A;  3LSU A;  3WQ9 A;  4CWO A;  2P22 C;  1BMF G;  2EZO A;  1S76 D;  1LR1 A;  2VRZ A;  3UO2 A;  4UUJ C;  4LWG A;  3DTU B;  5KHG A;  3M99 B;  3K0D A;  3I56 V;  1LNQ A;  1FKA O;  4IHJ B;  2P6J A;  3SYQ A;  1VQ5 V;  1HNZ O;  3ABU A;  3KCX A;  3VQV A;  1VF5 B;  3JAL B;  3CCU V;  3K97 A;  3ASN C;  2ARH A;  3CC2 V;  4G28 B;  4XDM A;  2BRC A;  5IWA O;  3CHX A;  4I9W A;  1R73 A;  3X2Q B;  5IYB O;  4AI8 A;  2YI6 A;  2IU3 A;  3CS5 A;  1P49 A;  2UUA O;  3U0Z A;  3SJB C;  2DYS B;  4YKZ A;  4J80 A;  3SJQ C;  4YKU A;  3KE6 A;  1ZWH A;  4FFB A;  2Q2E B;  3W7W A;  2QWO B;  5L3C A;  2DOS A;  3OTO B;  4H81 A;  5KMG B;  2R9A A;  1YT2 A;  3KKY A;  2EJ7 A;  1TAE A;  4K35 A;  1TID A;  2P4K A;  4B3S O;  2E75 B;  4Z1M G;  4YY3 B;  2OTL V;  4DR2 O;  1PL4 A;  4B7E A;  3HKD B;  3L70 H;  3F7V C;  3WB2 A;  2XDL A;  2WER A;  2DWE C;  1B63 A;  1GN2 A;  4TUY B;  1JR9 A;  4DV0 O;  1Q82 W;  2ADP A;  4I50 A;  4FJC C;  3K5O A;  2BSM A;  4JI8 B;  3NR7 A;  3THO A;  1AJP A;  2IOP A;  4GKK O;  1KU9 A;  4H85 A;  4UV8 A;  4MTF A;  2K9P A;  3PN1 A;  3OD4 A;  1MA1 A;  4XKO A;  2XJX A;  1MNG A;  3GWO A;  1GKF A;  4PI0 A;  2Y0P A;  4MTG A;  2YEC A;  1QBZ A;  5LXT B;  3ZRV A;  4AS9 A;  4GCZ A;  3S3W A;  5B1B C;  1W0J G;  3RVY A;  3OT7 A;  4MBC A;  4AWQ A;  1K8A W;  3LSS A;  1ZL8 A;  2YXY A;  5CPH A;  3ZRW A;  1URF A;  2Y69 C;  1GTO A;  1OCC C;  1ID0 A;  4PA3 A;  1IUR A;  1L0L H;  3RFR A;  3WB0 A;  4EB6 B;  1M57 B;  3JCZ A;  3OAA G;  2YUA A;  5FND A;  4TV9 B;  1FFX A;  1OJH A;  3JAS B;  3TTZ A;  3EXA A;  5GTI Z;  2IWU A;  2OIE A;  1I7F A;  4BQJ A;  4JV5 B;  1Y74 B;  1Q81 W;  2QG0 A;  1S5J A;  1K92 A;  3RLP A;  2IBZ H;  5A2Q N;  3D8C A;  4R8C A;  1H7S A;  4Q6G A;  4O4H B;  1G4Y B;  1SA0 B;  3E83 A;  2BTQ B;  3FAV B;  4DR7 B;  3H9V A;  4URO A;  4J7Z A;  3L71 H;  3IJ4 A;  5LYJ B;  4NXM B;  1WB7 A;  2CK3 G;  2YIB D;  4FVM A;  2AGA A;  2ZXW B;  2ZKO A;  2GUZ A;  1G1X B;  4PA7 A;  1ZXN A;  2QR4 A;  4DXW A;  2D3O W;  1BGQ A;  4U7N A;  4UV9 A;  4IGG A;  4MVS A;  4HZ0 A;  3JCU Z;  1J5E O;  2ZM6 O;  2HCH A;  4KFG A;  4IHJ A;  3RYC B;  4MVQ A;  2CDY A;  4JI0 B;  3SJA C;  4X64 O;  1AP5 A;  4FPP A;  3QO7 A;  1ZL8 B;  2R9I A;  2PY5 A;  5D5Q A;  4LF8 O;  1W0K G;  4LP8 A;  3DC6 A;  4RUF A;  3S5T A;  4LFB B;  4LF6 B;  3MNR P;  1TUB B;  4JYA O;  3DC5 A;  3MHS C;  3OMN B;  1EZJ A;  3B24 A;  3SR2 C;  3C0E A;  2JS3 A;  3SPG A;  1R3I C;  5LHI A;  3C11 A;  2CTP A;  3ZHT A;  1UYE A;  1YJ9 V;  3HB3 B;  1YES A;  4GX5 A;  1GAX A;  4GKJ B;  5C8Y A;  1YCI A;  2AXT Z;  5FPO A;  1L1F A;  3GIG A;  1H2K A;  3P3N A;  1XI1 A;  2IJK A;  3R4N A;  4W4L A;  3SYP A;  1UYH A;  5KHK A;  4DK0 A;  1IBL O;  3K58 A;  4AQY B;  1UYM A;  4CH3 A;  3RGB A;  1K4D C;  1KMI Z;  1YI2 V;  1IBK O;  5LBQ A;  4LP0 A;  1AI5 A;  3G4S V;  1VF6 A;  3MDS A;  2IOR A;  5IY5 B;  2YE8 A;  5CA0 B;  1NS1 A;  2FL4 A;  2EIJ C;  3CME V;  1IX9 A;  4O2A A;  3EHH A;  1CXZ B;  5DN6 G;  2BE3 A;  2H3O A;  1UYF A;  1Q86 W;  4FFB B;  2QKA A;  4BXI A;  4UVB A;  4KTN A;  1M5I A;  3DXR A;  3TZ0 A;  3SDL A;  4DW1 A;  2HEP A;  4KSG A;  2Q68 A;  1NZ6 A;  1L0N H;  2YC0 A;  4NXM O;  5CTY A;  4KUM A;  4FK5 C;  4RAI A;  3U67 A;  3S3X A;  4DV2 O;  2XOK G;  4B3M O;  1SES A;  4LR3 A;  1YVW A;  2LP7 A;  2JGU A;  2HHH O;  4HZ3 A;  4I5S A;  3ZMT A;  4HYM A;  3CC7 V;  5L3J A;  4CWP A;  3BY6 A;  5B1B B;  1B3Q A;  5J71 A;  4CH4 A;  1H8H G;  2EBO A;  4L91 A;  1QY8 A;  4CWQ A;  4X64 B;  2BOB C;  1S5H C;  3DGE A;  3CXH F;  1M56 B;  2BU7 A;  4WCE V;  1D5N A;  5JH7 B;  2ATK C;  3I55 V;  1IBK B;  3INX A;  3T2M A;  2VS0 A;  1BKN A;  2QTS A;  3IFX A;  1S3J A;  1KIJ A;  1CEZ A;  3SYO A;  1SQP H;  2CH7 A;  4JI5 O;  4L90 A;  3INW A;  2YS8 A;  5GON B;  2GV9 A;  4YXW G;  1JFF B;  4O09 A;  4K0K B;  4JI1 O;  2ZE7 A;  1ENV A;  2O57 A;  2YID A;  1ZTE A;  5B1A C;  4UVC A;  1Y8P A;  3JD1 A;  4DRX B;  1GM9 A;  5GON A;  1SQB H;  4E72 A;  2ESA A;  3VQW A;  1NTK H;  1FS0 G;  4I7Z B;  2DW4 A;  4ZHQ A;  4JI7 B;  4O4L B;  1VQM V;  3A0Z A;  4EFU A;  2OIG A;  4NTY A;  3SYC A;  4R6Z A;  4X62 O;  5H6Q A;  3BPZ A;  4GT8 A;  2ZIO A;  1QR8 A;  1UYD A;  3ETD A;  4KQV A;  4U93 A;  4JTC B;  1LUV A;  4XDJ A;  5CA3 A;  2GHY A;  4B3R B;  3PEH A;  4FZ1 A;  4LPB A;  4F6R B;  1WPX A;  4QPJ A;  1FXK B;  1K7D A;  4PU9 A;  1AR1 B;  2F4V O;  2YGE A;  3M8A A;  4K3A A;  3J7A U;  1F7Y A;  4U3J A;  3SPH A;  2YKI A;  4L94 A;  4NTX A;  1U0Z A;  4QIW F;  3H80 A;  4CE1 A;  3B40 A;  5BXZ A;  4W7T A;  3WHA A;  1DLB A;  5J2U B;  3PJS K;  3FB5 C;  4J7J A;  4X8A A;  3ZMV A;  4DV3 O;  2YKJ A;  2YI7 A;  2Y4T A;  1YET A;  4JZ2 A;  1YS3 A;  2ZDI C;  3Q5L A;  1H2L A;  5JQG A;  4DR2 B;  4D7T A;  3GB7 C;  2OYQ A;  3JAT B;  5A9G A;  4GYC B;  2AZ0 A;  2W6J G;  2UUB O;  4BAE A;  2WA4 A;  3RYI A;  4TV8 B;  1YSZ A;  3OUS A;  2QA4 V;  3CCV V;  4DUZ O;  4ZI7 B;  2DWD C;  4IT5 A;  3AG3 C;  3MAQ A;  2QFO A;  4PDR A;  4FCR A;  2EIN C;  1BZK A;  4FLW A;  1OHH G;  1VQN V;  1DF4 A;  1OCR C;  1Q6U A;  2BSK A;  3BA8 A;  1AH8 A;  3A0T A;  4DR4 O;  5BMV A;  1J5E B;  2W0F C;  1S77 D;  3AG1 B;  1THN A;  1YJW V;  5FNV B;  3ASN B;  2IJI A;  3T1C A;  3CRM A;  3Q4H B;  3ZRX A;  1XHZ A;  2WI2 A;  3W7U A;  2UUC B;  4I9Q A;  2VQF O;  3A0R A;  4LCU C;  4JI6 O;  2JK5 C;  1OZ0 A;  5JWP A;  3T1K A;  2UXC B;  3ZRW B;  1N32 O;  2UXD O;  4RQF A;  4YJ2 A;  4IYH A;  4OX9 O;  2QWR B;  1I5B A;  1F4M A;  4CWT A;  2WI7 A;  3ZED A;  1K5Q A;  3ZHQ A;  4F6E A;  4QNH B;  1PPJ H;  3A0H Z;  2YEI A;  2A06 H;  2GUZ B;  1UYK A;  4PA4 A;  2R70 A;  4WFG A;  1QHT A;  2CGN A;  4E02 A;  5CN0 A;  1QQC A;  1YIT V;  3MD0 A;  5LA6 B;  4NR1 A;  4N21 A;  4RUE A;  4TQD A;  5KX5 A;  3CCJ V;  2YE7 A;  5GGZ A;  5E79 Z;  1X59 A;  3OE7 G;  1NHI A;  1BQZ A;  3HYY A;  4OXS A;  2XK2 A;  4PI2 A;  5LXT A;  4X1K A;  2KKW A;  3QNE A;  3STL C;  3CRQ A;  4LH7 A;  4X66 O;  2FKX A;  1HW7 A;  1AIL A;  1SKV A;  3CE2 A;  5B66 Z;  1KKC A;  3JD2 A;  2WLI A;  4JI7 O;  1OSF A;  3CD6 V;  1NVP D;  4DK1 A;  5EIB D;  5IYD O;  4ASG A;  3CB2 A;  2XD6 A;  1TA8 A;  3OUF A;  3A8T A;  4JAS A;  4I4T B;  3A2F A;  4JPR A;  2IJJ A;  2GSM B;  2WAM A;  3CCM V;  1MZE A;  2G38 A;  3VHC A;  2GQP A;  2Y69 B;  2B9Z A;  3G7B A;  5FL7 G;  1H2G A;  3C3T A;  4WUB A;  1M57 C;  3T1Y B;  3RT3 C;  4O07 A;  4KSH A;  1YC4 A;  2IWS A;  2BU2 A;  5IYZ B;  3RVZ A;  2JS5 A;  2ZIN A;  2HP8 A;  4IL6 Z;  2Q69 A;  4MS2 A;  3H1K H;  3H1L H;  5KAF Z;  1NI8 A;  4HXW A;  1K9M W;  3T1H B;  2VWK A;  3E89 A;  3B28 A;  2XAJ A;  2ZDX A;  1F23 A;  3HZ1 A;  4OPH A;  3TK1 A;  2C1G A;  3B09 A;  4FCP A;  5B3S B;  2QM4 A;  1IBM B;  1SQG A;  3LDC A;  4HNA B;  3FB6 C;  2CAZ C;  1IBM O;  1NHH A;  4DUZ B;  4WBN B;  4DV1 B;  1KB9 F;  2O1U A;  2JJ1 G;  4KL1 A;  1AM1 A;  4HYO A;  2F66 C;  2RQ6 A;  3H1J H;  4KFM A;  2JIZ G;  3WB1 A;  1OCR B;  4P9P A;  2BSK B;  1I5A A;  1XEQ A;  4N23 A;  4XTJ A;  1M4U A;  2E76 B;  1GH6 A;  1HNW B;  2VQE B;  3K04 A;  2MW2 B;  2QWQ B;  5EBL C;  4UFZ A;  3JD4 A;  2BCC H;  5FNF A;  2AHY A;  3OEH G;  2E5L B;  1WLE A;  3TZ5 A;  2YJX A;  4JQL A;  3BM9 A;  4BIO A;  4FLY A;  2OT5 A;  5BR8 B;  4QGP A;  3EHB B;  3AK3 A;  1VQK V;  5M4P A;  2XAG A;  3SPJ A;  3B2E E;  1KKD A;  1TC6 A;  5JH7 A;  4QE9 A;  2Q4P A;  5CTU A;  2Q9L A;  2YE9 A;  1F4N A;  2X6B A;  4BQG A;  1RFY A;  2LGW A;  1AI7 A;  3CRC A;  1Z5A A;  1MAB G;  3AK1 A;  1YEW A;  4MW3 A;  2F93 B;  5LMU B;  1XMQ B;  2B1G A;  3I5D A;  2HG1 A;  2UXD B;  3GIF A;  2X0L A;  4DR1 O;  3QTF A;  3HKB A;  2ZM6 B;  3VQX A;  5DM6 V;  3L9D A;  4OGQ B;  5KHJ A;  2RDC A;  1R62 A;  1TVK A;  2YIA A;  3R4O A;  1BHB A;  2HLD G;  3TUH A;  3O9O A;  3KZI Z;  3JSN A;  4K4O A;  3CCE V;  3EHG A;  4X1Y B;  4EFE A;  2DJV A;  1SS3 A;  2YI9 A;  4DUY O;  4PJ0 Z;  4DR4 B;  1HWY A;  1XNR O;  1UJW B;  5LP6 B;  1N32 B;  2OWO A;  4BW9 A;  3OGC C;  2W0X A;  1DGS A;  2EIM B;  4I50 B;  4CC6 A;  5EBM C;  5KX5 B;  3ETQ A;  5JJE B;  2Q8H A;  1K73 W;  1Q6I A;  3OWB A;  1P7B A;  1RSO A;  3R4M A;  4B6C A;  1I5Y A;  3JZ3 A;  1EN6 A;  5CA1 B;  1XHX A;  1V54 C;  4NTW A;  5D7C A;  4YKT A;  3T4D A;  4ICG A;  4CWR A;  5BOD A;  5GW7 A;  3ZJZ A;  2VWJ A;  2BYH A;  2YE4 A;  4O4I B;  2XHX A;  1E1R G;  3K3W A;  3DXR B;  1ZSP A;  1YTF D;  1QLE C;  4O2A B;  4X88 A;  4FM1 A;  4LFA B;  4U7O A;  2P67 A;  4DUY B;  4LF5 O;  5LL6 Y;  2XDX A;  2EIL C;  1VF6 C;  3JAR A;  1BXD A;  2PYJ A;  1NJI W;  2BU5 A;  5HFL A;  2UUB B;  3ZHR A;  1RPO A;  4DR1 B;  3IC9 A;  2RNB A;  4BIU A;  3G71 V;  3RKZ A;  2JEU A;  4D7S A;  2N04 A;  4K8X A;  1K34 A;  3T2S A;  3KG2 A;  1GMG A;  1TBW A;  2QKS A;  3TCU A;  3K79 A;  3R66 A;  3JAW A;  1QLN A;  3ZIA G;  1VQ8 V;  4DR5 B;  5E1A C;  3T4Z A;  2VQF B;  1RP3 B;  3QVN A;  5CBF A;  4YKW A;  3RYI B;  3MHH C;  4XIT A;  1F51 A;  4H7Q A;  3QF7 A;  2WI3 A;  4ZI7 A;  4YKY A;  1WB8 A;  1JA8 A;  1NU1 H;  2FXS A;  1Z5B A;  4H37 A;  3RN4 A;  1EI1 A;  3QDD A;  3JD0 A;  3FD9 A;  1UYC A;  1R1B A;  4LF5 B;  3ZXQ A;  2YJW A;  5L3G A;  4F6R A;  2ODM A;  1I94 O;  3FYI B;  2O1W A;  1GM7 A;  3GVM A;  2AHZ A;  1TIL A;  3OMU A;  3CRA A;  2PGG A;  2PTM A;  3RYF B;  4CH5 A;  4MTO A;  2PUS A;  4LNU A;  1S72 V;  4U3J B;  4XIR A;  4URM A;  3JAR B;  1NR1 A;  1R3K C;  1VQO V;  3F5W C;  3BRC A;  2NNU A;  1KEC A;  5KA5 A;  1O9G A;  5BZB A;  3CP1 A;  4DR7 O;  4JAA A;  2XDU A;  3T10 A;  4WFB V;  3Q5K A;  4CBC A;  2CG9 A;  1SET A;  1P4R A;  3QO5 A;  5LMU O;  3BA9 A;  2YGF A;  1NH2 D;  4AIL C;  2JKI A;  1Y74 A;  4LF8 B;  4HY6 A;  1CP9 A;  3AG1 C;  4UCR A;  2Q8V A;  2JRI A;  4PL9 A;  2NN4 A;  4DV6 O;  4O4L A;  2ZE5 A;  2M6Y A;  4Q20 A;  2WEQ A;  2EIK C;  4GZR B;  3UT5 A;  4FMT A;  4QJF B;  3LUT B;  1Q5O A;  3T1Y O;  4PRV A;  3ETE A;  3LMM A;  5JCO C;  1VMG A;  1EM1 A;  3G7E A;  2R72 A;  2UUA B;  2JGD A;  4KHP B;  4P30 A;  2YE2 A;  3FB8 C;  4CS3 A;  3QO8 A;  4OX9 B;  1OCO B;  2WLI B;  1Q3E A;  1K33 A;  1FFX B;  2XHT A;  2XJG A;  4JAU A;  1JM6 A;  1EZV H;  3OPD A;  2IU0 A;  4DRX A;  4DUH A;  1XNQ B;  4RWU A;  4GKJ O;  4CWN A;  3BEH A;  3BAB A;  1D2D A;  4JI8 O;  4BR6 A;  1PD3 A;  3EVK A;  2GBO A;  3ABM C;  1AH6 A;  1MU5 A;  3ZHS A;  3N2K A;  1CPY A;  5C93 A;  2PI5 A;  1UY6 A;  3SJC C;  3ZMU A;  3HKD A;  2YEB A;  4O04 A;  4UXN A;  1Y76 B;  4XE2 A;  2PF4 E;  1ZX3 A;  1XNR B;  2CTW A;  2WWW A;  2CUG A;  5L3D A;  2WLK A;  2YIB A;  4I55 A;  4JI2 O;  2JJ2 G;  2DYR B;  1PV0 A;  1I58 A;  1V9P A;  1Y4M A;  3HKE B;  1SC5 B;  3L72 H;  4XKA A;  2M7W A;  2XTA A;  1G8M A;  2YE6 A;  3A0W A;  2UXN A;  4LF9 O;  4DR5 O;  4GT1 A;  4JYA B;  3R91 A;  2Q5Z A;  2Q0O C;  1M90 W;  3X2Q C;  5B1O A;  2Q7H A;  1ZLZ A;  1Q6H A;  3E2E A;  3JAL A;  1VIB A;  3K06 A;  3ZRS A;  1MZF A;  3CJH B;  5H6R A;  4JGS A;  1L8D A;  3AK2 A;  5BMV B;  1ZWI C;  2LFS A;  5JQG B;  3EFF K;  3TZ4 A;  1SQQ H;  4LWF A;  3UT5 B;  4J9Z B;  2RMK B;  4URL A;  1IZ3 A;  3LNM B;  2QGN A;  3NMQ A;  3W7S A;  4CH6 A;  4X65 O;  4PEL A;  4X9Q A;  1QNM A;  2Z3Y A;  2EXL A;  1QZR A;  2Q73 A;  1AP6 A;  1K97 A;  5B5E Z;  4X20 B;  1HNX O;  3RW0 A;  2ZIM A;  1Z5C A;  4HZ5 A;  1MMM A;  3G80 A;  5AG2 A;  5B3S C;  3B77 A;  1GRJ A;  4PD4 F;  1WA8 A;  1FYJ A;  5EC2 C;  2GFD A;  1VQP V;  2WI6 A;  4ZBM A;  4X62 B;  2UU9 O;  4EKW A;  2YI0 A;  4NKG B;  2AKP A;  2LW7 A;  2YE3 A;  1BS3 A;  2IM9 A;  2KG7 A;  2BRE A;  4FLZ A;  3K60 A;  3Q4H A;  4RO2 A;  2YEV A;  3FFQ A;  2Q67 A;  2BYI A;  1QR9 A;  4TSF G;  1S14 A;  4XBF A;  4WBN A;  5F3K A;  2H8P C;  4LC1 A;  2ADQ B;  2QWP B;  3U10 A;  1EA6 A;  1R6N A;  3A0B Z;  3ZN1 A;  1MG1 A;  3TXQ A;  1VEW A;  4H44 B;  4XC0 A;  4X9L A;  5BY1 A;  2Y4U A;  2WLM A;  2JVD A;  4FLU A;  3K5M A;  1UPG A;  1N0J A;  1GKX A;  4HYP A;  2HKO A;  3CGY A;  2RCV A;  1XIL A;  1XL6 A;  3G75 A;  1W2B U;  1Y76 A;  3ZMS A;  3KCY A;  3SL2 A;  4TV9 A;  1VQ9 V;  5KLV H;  4WUC A;  2IW5 A;  3F7Y C;  1N33 B;  3CRL A;  1XMQ O;  3CJH A;  2ZQM A;  4GGL A;  4DV5 O;  2EIL B;  1GN6 A;  4FCQ A;  4JI5 B;  4PDL A;  4XD8 A;  2UXB O;  1NH2 B;  4PA9 A;  3ZBH A;  5FPR A;  1QCE A;  3IC7 A;  2HR3 A;  4MPE A;  4HXZ A;  4HBN A;  4J7K A;  3N2G A;  3FT8 A;  1SZX A;  3ABK C;  5LP6 C;  4MP7 A;  5J2T A;  4LF6 O;  3E8H A;  1FFT B;  1JCH A;  2NR5 A;  3J81 N;  3Q5J A;  5LHG A;  4XIP A;  1I0H A;  4URN A;  4TWK A;  2Q7G A;  1SZT A;  2FB5 A;  5K1X A;  2FYU H;  2K1E A;  3HKC A;  4L87 A;  2XAB A;  5CF0 A;  2WLN A;  2VQE O;  2YK2 A;  1PP9 H;  4B3T B;  5KHH A;  4CWF A;  3J80 N;  1OCZ B;  4R3A A;  2GDS A;  2CTQ A;  5LMN O;  2ZDI A;  5CTW A;  1DTO A;  3ZX6 A;  1GJV A;  1YC3 A;  2XAS A;  3H1I H;  4JV5 O;  2HJD A;  2AW9 A;  5IT9 N;  1UY9 A;  3TGU H;  1I5C A;  2EZP A;  3D36 A;  2P06 A;  4EFB A;  1FD9 A;  3HR0 A;  4JI4 O;  5L3E A;  4FIP C;  3OFN G;  4D6T H;  2AZ2 A;  2LJ2 A;  2DMX A;  4LF4 O;  1W59 A;  2DE0 X;  1BE3 H;  4LWI A;  2HG5 C;  2HVK C;  2FML A;  5JVD B;  3L74 H;  2HVJ C;  2LQT A;  2A7W A;  1BGY H;  2YEV B;  4WUD A;  4NVP A;  4FLV A;  1GK9 A;  2ITD C;  2X7R B;  2IOQ A;  2ZR2 A;  4DV7 O;  1YSC A;  4R50 A;  1B04 A;  1KYO F;  3HZ5 A;  2YKC A;  4O4J A;  4KP4 A;  4LFC B;  3JD3 A;  1ORQ C;  2F4V B;  3BMY A;  3JAK B;  2IH3 C;  2DQ3 A;  4XCJ A;  3TXS A;  1ZAU A;  4UB8 Z;  2B5U A;  2E74 B;  1HP8 A;  3JYC A;  3CXC U;  4DW0 A;  1NVP B;  1JOY A;  3B4S A;  1YTF B;  2XDK A;  4L8Z A;  2YEE A;  2CGF A;  2Q8I A;  4JTD B;  2PYL A;  4JI4 B;  4X89 A;  4YHH B;  5M4E A;  1WP7 A;  2QWN B;  2PI4 A;  4JYB A;  2WI1 A;  4O05 A;  1BL8 A;  1H2M A;  1M93 A;  5D6P A;  3VBB A;  3E35 A;  3D2R A;  4DV3 B;  3OM3 B;  1H8E G;  2QEX V;  1OCO C;  5H2F Z;  3OW2 U;  2BU8 A;  3D0B A;  4P8O A;  2N05 A;  4DO2 A;  2YIC A;  2RN9 A;  2ZR3 A;  5TIS Z;  1XL4 A;  5L3F A;  1YJN V;  1RSO B;  3TZ2 A;  2XAF A;  2YEF A;  5B1A B;  3FT5 A;  1H2S B;  1FXH A;  1GN4 A;  1N4C A;  3T0H A;  5LHH A;  2H8M A;  3FYE B;  4PHZ A;  1N0N A;  2ETN A;  4YKQ A;  4LWS B;  4B7K A;  5IYZ A;  2YSU B;  2KSD A;  5D7R A;  3ZMZ A;  5IE9 A;  5EZY B;  3O65 A;  4ZHQ B;  5LGN A;  3VOU A;  1KUQ A;  3BCC H;  3K03 A;  4QPK A;  1S0V A;  3CX5 F;  2YDE A;  1JPX A;  3CPW U;  1I5D A;  4O0B A;  3H1H H;  4DV2 B;  4B3M B;  2F43 G;  4ASF A;  4UCT A;  3HKB B;  1FXK C;  2BOC C;  4WFA V;  2UUC O;  1THZ A;  1DF5 A;  4QE7 A;  3LDE A;  3CGZ A;  4FM0 A;  5DED A;  2XND G;  5IDJ A;  1OCZ C;  1Z59 A;  2WI4 A;  3GWK C;  4EGI A;  4GX2 A;  5BR8 O;  3K0G A;  5FNV A;  2QTO A;  4UCO A;  3OW6 A;  3N27 A;  1E1Q G;  3A0X A;  3U2D A;  3K99 A;  3NXS A;  4X1I B;  4AWP A;  4AWO A;  2UXX A;  3APQ A;  2BZ5 A;  1FJG B;  5JJN B;  4GFN A;  5J2T B;  5EBW C;  2Q6A A;  5FLX N;  1BT8 A;  2UXC O;  3N2G B;  3LNU A;  1XMO B;  4H0L B;  1ZXM A;  1A4H A;  4UB6 Z;  1K5S A;  2ZCE A;  1YF2 A;  1TH8 A;  1SRY A;  2KQX A;  2ZNJ A;  3FKS G;  4JI1 B;  1MSW D;  1NTM H;  3E86 A;  4TV8 A;  5LOV A;  4DV1 O;  1PL0 A;  2EIJ B;  4JYC A;  4WF9 V;  1KBH A;  2Z5U A;  3L73 H;  4YJ2 B;  2YEG A;  3JAM N;  2DYR C;  5CMU A;  5C8Y B;  3D36 C;  1NHJ A;  1EN5 A;  1QU7 A;  3U2K A;  2IJH A;  3P30 A;  4NH8 A;  5CA0 A;  3WG7 C;  3K08 A;  1Y8O A;  3CWB H;  4MP2 A;  3ZM7 A;  1AI4 A;  5IJ9 A;  3EKR A;  4DR3 O;  2P7T C;  1Z5V A;  1NR7 A;  1Y6X A;  4J11 A;  4IIJ A;  1UYI A;  1VQ6 V;  3K5N A;  1US7 A;  5CBH A;  3VQY A;  3H4L A;  4ASU G;  1PKX A;  3GIG B;  3EHF A;  4AHC A;  3OTF A;  4O4J B;  1M56 C;  5D5P A;  1BHA A;  3RLR A;  1FXV A;  3E8B A;  3B8M A;  2H55 A;  1VQ7 V;  3APO A;  3OEE G;  3UQ8 A;  2QM7 A;  4I55 B;  4EEH A;  4B3S B;  1JJ2 U;  4MW8 A;  3L75 H;  2HKJ A;  2VWC A;  2X6A A;  2LO1 A;  2F1M A;  4JAV A;  5D6Q A;  2CTR A;  1M9N A;  2YE5 A;  1Y4U A;  1IDS A;  4MVO A;  2UWD A;  4DR6 O;  3P32 A;  1N36 O;  4Z1V A;  4X66 B;  1UY7 A;  4ASB A;  4CE2 A;  5M4M A;  4JYY A;  1XQ8 A;  1YC1 A;  4E01 A;  2XCM A;  1KQS U;  1GM8 A;  1XBL A;  3LSQ A;  1J95 A;  1VF7 A;  4MB9 A;  5IJ9 B;  3STZ C;  1HDJ A;  2ZE8 A;  3PEJ A; 
#chains in the Genus database with same CATH homology
 1DF4 A;  1OCR C;  1AH8 A;  5LGU A;  1Y4M A;  1TC0 A;  3A0T A;  1H7U A;  2WSS G;  4XIQ A;  2JDI G;  1RM1 B;  2W0F C;  1EBO A;  1V55 C;  2A9H A;  1S77 D;  3EHJ A;  3AG1 B;  1THN A;  4GEE A;  4XKA A;  3E8G A;  1YJW V;  2O1V A;  4ZKI A;  3AG2 B;  3E8F A;  1I5X A;  1ZW9 A;  2XX4 A;  2M7W A;  1G8M A;  3ASN B;  2YE6 A;  2IJI A;  2UXN A;  3A0W A;  3T1C A;  1M1K W;  4GT1 A;  2XAH A;  3ZRX A;  2WI2 A;  3O2F A;  5B1N A;  3R91 A;  3W7U A;  4XDK A;  4XKK A;  3CCL V;  2EIK B;  2CCT A;  1Q7Y W;  3A0R A;  4LCU C;  3W7T A;  1M90 W;  3X2Q C;  5B1O A;  2JK5 C;  5M4H A;  1R3J C;  1K3E A;  3E2E A;  1OZ0 A;  4BIZ A;  3OWD A;  1YHQ V;  2XX2 A;  3T1K A;  2YI5 A;  3K06 A;  3D3I A;  3OR7 C;  3ZRW B;  3IGA C;  3ZRS A;  4RQF A;  3CWV A;  4MPN A;  3ZCC A;  5H6R A;  4JGS A;  2MK3 A;  5D7D A;  1I5B A;  1ZWI C;  1MOF A;  2LFS A;  1F4M A;  3EFF K;  2LFR A;  4F4L A;  1AMW A;  3TZ4 A;  4LWF A;  2WI7 A;  4CWT A;  2DQ0 A;  2XHR A;  4J9Z B;  2VW5 A;  3ABL B;  1K5Q A;  4NH7 A;  3ZKD A;  4URL A;  3LNM B;  3G6E V;  3NMQ A;  2P90 A;  4QNH B;  5KA6 A;  3W7S A;  2YEI A;  3OMA B;  4PDM A;  1UYK A;  4PEL A;  4PA4 A;  3ML0 A;  4WFG A;  4MPC A;  2Z3Y A;  2A79 B;  4CZZ A;  4MOT A;  2EXL A;  4E02 A;  5CN0 A;  1QZR A;  1K97 A;  3RW0 A;  1Z5C A;  4HZ5 A;  2B1I A;  4PDV A;  1YIT V;  5B3S C;  3B77 A;  3MD0 A;  5CBG A;  2BTZ A;  3UM7 A;  2V1D A;  4N21 A;  4RUE A;  2WEP A;  3CCJ V;  5CTX A;  2YE7 A;  5GGZ A;  3EKO A;  5EC2 C;  1KC8 W;  3OE7 G;  3CCS V;  2WLL B;  2GFD A;  4CWS A;  1NHI A;  1QYE A;  2YEA A;  1VQP V;  5KUM A;  2WI6 A;  1VQ4 V;  4OXS A;  4ZBM A;  3HYY A;  4LBE C;  3VHD A;  4EKW A;  2YI0 A;  2XK2 A;  1YIJ V;  2AKP A;  3O0I A;  3FB7 C;  3AG3 B;  2YE3 A;  4MTX A;  4CE3 A;  1COW G;  3QNE A;  3STL C;  4L93 A;  1Y4S A;  3WQ9 A;  4CWO A;  3CYO A;  3SYA A;  2EIN B;  3HHU A;  1BMF G;  2EZO A;  2BRE A;  3K60 A;  1S76 D;  3JD2 A;  2WLI A;  4RO2 A;  4UUJ C;  1OSF A;  3CD6 V;  4LWG A;  3AG4 B;  3DTU B;  2YEV A;  1NVP D;  2ZBK B;  2Q67 A;  3ABK B;  2BYI A;  4I3H A;  1QR9 A;  5IYD O;  4TSF G;  1S14 A;  3B25 A;  4ASG A;  1TUE B;  3M99 B;  5EC1 C;  4XBF A;  1B6Q A;  4EMV A;  3K0D A;  3WG7 B;  1IXM A;  3I56 V;  2XD6 A;  1LNQ A;  2XDS A;  5F3K A;  2H8P C;  4LC1 A;  2QE7 G;  3OUF A;  2P6J A;  3SYQ A;  1VQ5 V;  1EA6 A;  4JF3 A;  3ABU A;  4JAS A;  1AI6 A;  3CCU V;  4JPR A;  3AG2 C;  5HFM A;  1R6N A;  3B26 A;  2IJJ A;  3K97 A;  1H38 A;  3ASN C;  2GSM B;  3CC2 V;  2WAM A;  3ZN1 A;  3CCM V;  1MG1 A;  4G28 B;  4XDM A;  3VHC A;  1YSR A;  2BRC A;  2GQP A;  5H9C A;  4XC0 A;  2Y69 B;  3W7X A;  4HY1 A;  3G7B A;  3K98 A;  4X9L A;  4I9W A;  1R73 A;  4JTA B;  3X2Q B;  5IYB O;  5FL7 G;  1H2G A;  2YI6 A;  2WLM A;  4WUB A;  1M57 C;  2IU3 A;  4O07 A;  4KSH A;  1YC4 A;  2DYS B;  2IWS A;  2BU2 A;  1GKX A;  3R92 A;  4HYP A;  1AJQ A;  2HKO A;  4TT3 G;  4H33 A;  3RVZ A;  4YKZ A;  4MS2 A;  2Q69 A;  2FWZ A;  3CGY A;  2V7Q G;  2X6C A;  3SJQ C;  4YKU A;  1XL6 A;  3KE6 A;  3H01 A;  1ZWH A;  1W2B U;  3CC4 V;  1JX9 A;  2Q2E B;  3G75 A;  3W7W A;  4HXW A;  5L3C A;  3ZMS A;  1K9M W;  4H81 A;  4P7A A;  3SL2 A;  3E89 A;  3B28 A;  1VQ9 V;  2XAJ A;  1YT2 A;  2VCJ A;  2ZDX A;  4WUC A;  2IW5 A;  1TID A;  1F23 A;  3HZ1 A;  3F7Y C;  3TK1 A;  4FCP A;  5B3S B;  4Z1M G;  3CRL A;  4GQT A;  5L3B A;  2OTL V;  2ZQM A;  1Y66 A;  2Y48 A;  3LDD A;  2YED A;  4GGL A;  3F7V C;  2XDL A;  3LDC A;  1JQ0 A;  1JVM A;  3FB6 C;  2PNR A;  2WER A;  2DWE C;  2EIL B;  1B63 A;  4DZY A;  1NHH A;  3HPL C;  1AJ6 A;  4FCQ A;  4XD8 A;  4PDL A;  2QF6 A;  2YGA A;  2O1U A;  1Q82 W;  2JJ1 G;  1NH2 B;  4PA9 A;  4FJC C;  1AM1 A;  2BSM A;  4HYO A;  2IH1 C;  1E79 G;  1QCE A;  4KFM A;  2JIZ G;  3IC7 A;  3QDD A;  1OCR B;  2OCC B;  4P9P A;  1AJP A;  1I5A A;  2HR3 A;  2JEX A;  2IOP A;  4HXZ A;  4MPE A;  4N23 A;  2CCS A;  4UV8 A;  4MTF A;  4H85 A;  4XTJ A;  2R9R B;  3FT8 A;  3ABK C;  4XKO A;  3K04 A;  5EBL C;  4MP7 A;  3JD4 A;  3E8H A;  2XJX A;  1FFT B;  3GWO A;  1JCH A;  5FNF A;  1GKF A;  4R3M A;  2AHY A;  4MTG A;  2IWX A;  3Q5J A;  5LHG A;  2YEC A;  3OEH G;  4XIP A;  1QBZ A;  2EIM C;  4URN A;  4TWK A;  1ROP A;  3ZRV A;  1WLE A;  4GCZ A;  2BU6 A;  4AS9 A;  1SZT A;  3TZ5 A;  2YJX A;  4JQL A;  2K1E A;  2WPD G;  3BM9 A;  3O6O A;  4L87 A;  5B1B C;  1W0J G;  3RVY A;  2OT5 A;  2FYP A;  4G27 B;  2XAB A;  5CF0 A;  3TET A;  4AWQ A;  3EHB B;  4MBC A;  1K8A W;  4V25 A;  1VQK V;  2WLN A;  3LSS A;  2YK2 A;  5CPH A;  5M4P A;  3ZRW A;  3GIE A;  2XAG A;  3SPJ A;  2Y69 C;  1GTO A;  1OCC C;  1ID0 A;  4CWF A;  1OCZ B;  4PA3 A;  4R3A A;  1V54 B;  2ITC C;  1KKD A;  1TC6 A;  2ZDI A;  5CTW A;  1M57 B;  3JCZ A;  1DTO A;  3OAA G;  4QE9 A;  1GJV A;  2ZKJ A;  1YC3 A;  5FND A;  3TTZ A;  2DYS C;  5CTU A;  2XAS A;  2IWU A;  2YE9 A;  1F4N A;  2X6B A;  4EGK A;  4BQG A;  1VQL V;  1UY9 A;  4BQJ A;  1I5C A;  2EZP A;  1AI7 A;  3D36 A;  1Z5A A;  1Q81 W;  2YK9 A;  1MAB G;  2QG0 A;  1S16 A;  1UYG A;  4MW3 A;  5L3E A;  4FIP C;  3HYZ A;  1K92 A;  3OFN G;  3RLP A;  4YKX A;  2E0A A;  2B1G A;  5FWK A;  2H94 A;  3FV5 A;  2HG1 A;  3A0Y A;  4EGH A;  4R8C A;  1H7S A;  3GIF A;  5M4K A;  4LWI A;  2X0L A;  2HG5 C;  1G4Y B;  2HVK C;  3E83 A;  4P2Z A;  2HVJ C;  5IYC O;  3R65 A;  3QTF A;  4URO A;  1R6K A;  5DM6 V;  2YEV B;  4WUD A;  3WFV A;  1YT0 A;  5J9P C;  1GK9 A;  2ITD C;  2X7R B;  3SPC A;  2CK3 G;  1R62 A;  2IOQ A;  2ZR2 A;  1YSC A;  4R50 A;  3R4O A;  1BHB A;  2HLD G;  2ZXW B;  5EK0 A;  5IN9 A;  3TUH A;  3HZ5 A;  4PA7 A;  1ZXN A;  2D3O W;  4DXW A;  3JD3 A;  4KP4 A;  2HJF C;  1ORQ C;  2WLJ A;  2YKC A;  3BMY A;  2A0L A;  4K4O A;  4R1F A;  2IH3 C;  3CCE V;  1BGQ A;  1U2O A;  3EHG A;  4U7N A;  4UV9 A;  2DQ3 A;  4MVS A;  4HZ0 A;  3ZXO A;  4XCJ A;  2NLJ C;  1PVG A;  2B5U A;  1SER A;  1HWY A;  2HCH A;  4KFG A;  4MSW C;  3JYC A;  4GX0 A;  4MVQ A;  3CXC U;  1GKZ A;  2YKE A;  1UJW B;  1AJN A;  4FPP A;  3QO7 A;  1NVP B;  2FWY A;  2R9I A;  3OGC C;  3ASO C;  1W0K G;  4LP8 A;  4RUF A;  1JOY A;  1YTF B;  3CCR V;  2EIM B;  2XDK A;  4L8Z A;  2YEE A;  5EBM C;  3OR6 C;  3MNR P;  4RQE A;  2CGF A;  2Q8H A;  1K73 W;  2Q8I A;  3MHS C;  4JTD B;  1K4C C;  2WLL A;  1EZJ A;  1P7B A;  3OMN B;  3OWB A;  3R4M A;  4X89 A;  1QVG U;  4HAM A;  2W6I G;  3B24 A;  4B6C A;  1FXK A;  5M4E A;  1I5Y A;  3C0E A;  3R4P A;  3JZ3 A;  3SPG A;  1R3I C;  3K9A A;  5LHI A;  2PI4 A;  3C11 A;  1OCC B;  1UYE A;  4ASA A;  4JYB A;  1KP2 A;  2WI1 A;  1YJ9 V;  4O05 A;  1V54 C;  1ARO P;  1BL8 A;  3HB3 B;  1YES A;  4GX5 A;  3VBB A;  5D7C A;  4YKT A;  5D6P A;  3E35 A;  3T4D A;  3D2R A;  4CWR A;  5BOD A;  5GW7 A;  3ZJZ A;  3OM3 B;  1H8E G;  1I58 A;  2QEX V;  2BYH A;  2YE4 A;  1OCO C;  1L1F A;  3OW2 U;  2BU8 A;  3D0B A;  4P8O A;  2Q8F A;  1NBM G;  4LWH A;  3GIG A;  4DO2 A;  2XHX A;  1E1R G;  4PRX A;  3K3W A;  2CCU A;  2ZR3 A;  2YKB A;  1XL4 A;  2IJK A;  2QG2 A;  5L3F A;  4WFF A;  1YJN V;  4ZVI A;  3R4N A;  3OMI B;  1QLE C;  3SYP A;  3ZN0 A;  1RPR A;  1YTF D;  4X88 A;  3TZ2 A;  2XAF A;  2YEF A;  4GX1 A;  1UYH A;  2JJC A;  1GO3 F;  4U7O A;  5B1A B;  1UYM A;  2P67 A;  1K4D C;  4LP0 A;  1YI2 V;  4G2K A;  5LBQ A;  3CRK A;  1AI5 A;  1NQT A;  2EIL C;  1FXH A;  3G4S V;  2XDX A;  3T0Z A;  2IOR A;  2YE8 A;  5IY5 B;  3T0H A;  5LHH A;  2H8M A;  3FYE B;  4WFE A;  1BXD A;  2EIJ C;  3CME V;  1NJI W;  2BU5 A;  4YKQ A;  2WLH A;  5HFL A;  3EHH A;  1UYF A;  5DN6 G;  2C2A A;  4YKR A;  1Q86 W;  2YSU B;  1RPO A;  2OCC C;  4BXI A;  5D7R A;  2KB1 A;  4UVB A;  2ZXW C;  3ZMZ A;  4KTN A;  3TZ0 A;  4BIU A;  3CCQ V;  3G71 V;  1NKD A;  4KSG A;  5LGN A;  2Q68 A;  3VOU A;  3RKZ A;  2JEU A;  3UKM A;  3K03 A;  4QPK A;  1K34 A;  5CTY A;  4KUM A;  2K5B A;  4EFT A;  4FK5 C;  1S0V A;  1JPX A;  3CPW U;  1I5D A;  4RAI A;  4O0B A;  3T2S A;  5J6A A;  2XOK G;  3KG2 A;  4MVZ A;  1GMG A;  3SPI A;  1SES A;  2QKS A;  3TCU A;  1RM1 C;  3K79 A;  1TBW A;  5F5R A;  2LP7 A;  1QLN A;  3ZIA G;  2F43 G;  4HZ3 A;  1VQ8 V;  4ASF A;  1UYL A;  2HFE C;  4I5S A;  1YT1 A;  4MVM A;  3ZMT A;  5E1A C;  3T4Z A;  3CC7 V;  1FXK C;  2BOC C;  4HYM A;  4E00 A;  4WFA V;  3BY6 A;  5L3J A;  3U67 A;  1THZ A;  4CWP A;  5B1B B;  1B3Q A;  1DF5 A;  5J71 A;  5CBF A;  4YKW A;  1H8H G;  3MHH C;  4QE7 A;  4XIT A;  1F51 A;  2EBO A;  3ZKB A;  4H7Q A;  3LDE A;  3CGZ A;  1QY8 A;  4L91 A;  2WI3 A;  4LWE A;  4CWQ A;  4NH9 A;  2XND G;  5IDJ A;  2FXS A;  4YKY A;  4UVA A;  1KZN A;  1Z5B A;  1OCZ C;  2BOB C;  4H37 A;  1S5H C;  3DGE A;  3ABT A;  1EI1 A;  1Z59 A;  1M56 B;  2WI4 A;  4GX2 A;  3JD0 A;  4BW5 A;  1UYC A;  2BU7 A;  2CH4 A;  4WCE V;  3K0G A;  2QTO A;  2ATK C;  3ZXQ A;  3I55 V;  5L3G A;  2YJW A;  3INX A;  3T2M A;  3OW6 A;  1E1Q G;  3A0X A;  2Q8G A;  3U2D A;  1BKN A;  3K99 A;  3AEI A;  3FYI B;  3NXS A;  3IFX A;  2VCI A;  4AWP A;  2O1W A;  4AWO A;  1S3J A;  2UXX A;  2BZ5 A;  1GM7 A;  1KIJ A;  2AHZ A;  2BT0 A;  3VAD A;  1CEZ A;  2WI5 A;  3ABL C;  1TIL A;  3OMU A;  4GFN A;  4XCL A;  1PNM A;  2Q6A A;  5EBW C;  3SYO A;  4J9Y B;  1N8R W;  3LNU A;  4MTO A;  1S72 V;  3HEK A;  4L90 A;  3INW A;  1ZXM A;  3ABM B;  1A4H A;  1K5S A;  4XIR A;  5KUK A;  4URM A;  1TH8 A;  1QLE B;  1NR1 A;  4YXW G;  1R3K C;  1SRY A;  1VQO V;  4O09 A;  5FNC A;  1ENV A;  3F5W C;  5B1A C;  2NNU A;  3FKS G;  1KEC A;  4UVC A;  5KA5 A;  1Y8P A;  2XX5 A;  1PNL A;  4WFH A;  3JD1 A;  1MSW D;  2ZDY A;  4R7C A;  5BZB A;  3E86 A;  5IY5 C;  3CP1 A;  1PL0 A;  1GM9 A;  5BOC A;  1R3L C;  2ESA A;  2EIJ B;  4MVR A;  4JYC A;  1FS0 G;  2XDU A;  4WF9 V;  3T10 A;  3CMA V;  4WFB V;  3Q5K A;  2DW4 A;  2Z5U A;  4CBC A;  2CG9 A;  1SET A;  2EJR A;  3B8N A;  1VQM V;  2YEG A;  3A0Z A;  4EFU A;  1P4R A;  2DYR C;  3QO5 A;  5CMU A;  2YGF A;  3SYC A;  1KP3 A;  4R6Z A;  1NH2 D;  2OTJ V;  1NHJ A;  2JKI A;  5H6Q A;  1KD1 W;  4E2L A;  3U2K A;  4HY6 A;  4GT8 A;  2IJH A;  3AG4 C;  1V55 B;  1CP9 A;  3AG1 C;  1QR8 A;  3P30 A;  3ETD A;  1UYD A;  4KQV A;  4NH8 A;  4JTC B;  4XDJ A;  5CA3 A;  4PL9 A;  4U93 A;  3ETG A;  3WG7 C;  3K08 A;  3ASO B;  1Y8O A;  2GHY A;  3VHA A;  5LGT A;  4MP2 A;  3ZM7 A;  4V26 A;  2YEH A;  1AI4 A;  3PEH A;  3EKR A;  4LPB A;  2P7T C;  1Y8N A;  1WPX A;  4Q20 A;  3RBZ A;  1NR7 A;  4QPJ A;  2WEQ A;  1K7D A;  1FXK B;  2EIK C;  1B62 A;  1I59 A;  5M4N A;  1BYQ A;  3B27 A;  1AR1 B;  4PU9 A;  1UYI A;  4FMT A;  4XDL A;  1VQ6 V;  4QJF B;  2ZD9 A;  2YGE A;  1US7 A;  5CBH A;  3H4L A;  3LUT B;  4ASU G;  4PRV A;  2XAQ A;  1MX0 A;  1PKX A;  3ETE A;  1EFR G;  3GIG B;  3EHF A;  3G7E A;  3SPH A;  4EEH A;  4EM7 A;  2QM8 A;  4P30 A;  2XJJ A;  3FB8 C;  2YE2 A;  1M56 C;  1BHA A;  2YKI A;  4L94 A;  3RLR A;  2FTK A;  1U0Z A;  5IDM A;  4QIW F;  1FXV A;  3E8B A;  3QO8 A;  3H80 A;  4CE1 A;  3B8M A;  2H55 A;  4W7T A;  1VQ7 V;  1DLB A;  1OCO B;  3WHA A;  2WLI B;  3PJS K;  3OEE G;  3FB5 C;  4X8A A;  3ZMV A;  1K33 A;  2XJG A;  2XHT A;  4JAU A;  2QM7 A;  1UY8 A;  1JM6 A;  2YI7 A;  2YKJ A;  3IED A;  4P9O A;  2IU0 A;  1YET A;  4MT8 A;  1PNK A;  2ZDI C;  1YS3 A;  3OPD A;  1JJ2 U;  3Q5L A;  4MW8 A;  4DUH A;  4CWN A;  3BEH A;  3GB7 C;  2HKJ A;  4MVU A;  1PD3 A;  1QVF U;  1YER A;  2VWC A;  2X6A A;  3ABM C;  1AH6 A;  1MU5 A;  4JAV A;  2W6J G;  1CPY A;  5C93 A;  2PI5 A;  1UY6 A;  5D6Q A;  3RLQ A;  4BAE A;  1M9N A;  2YE5 A;  1Y4U A;  4MVO A;  1YSZ A;  2UWD A;  3OUS A;  2QA4 V;  3P32 A;  3CCV V;  1L0O A;  4BAY A;  1UY7 A;  3ZMU A;  4ASB A;  4CE2 A;  5M4M A;  1YC1 A;  2YEB A;  2DWD C;  4UXN A;  4O04 A;  4XE2 A;  4E01 A;  4B7P A;  3AG3 C;  2QFO A;  2XCM A;  1KQS U;  1GM8 A;  4PDR A;  2WWW A;  2YEJ A;  3LSQ A;  1J95 A;  5L3D A;  3FT5 A;  4FCR A;  4EGI A;  2EIN C;  2WLK A;  4MB9 A;  1OHH G;  2JJ2 G;  3LPS A;  3STZ C;  1VQN V;  2DYR B;  4PA6 A;  3PEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...