3G75A

Crystal structure of staphylococcus aureus gyrase b co-complexed with 4-methyl-5-[3-(methylsulfanyl)-1h-pyrazol-5-yl]-2-thiophen-2-yl-1,3-thiazole inhibitor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
184
Chain Sequence
GLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Discovery of pyrazolthiazoles as novel and potent inhibitors of bacterial gyrase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
total genus 50
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3g75A00
1QY8A 2VWCA 4YKQA 2FYPA 4L94A 1Y4SA 3Q5JA 1UY8A 4MBCA 4H7QA 4AWQA 4FCRA 2Q8IA 1I58A 1A4HA 1TC0A 3H4LA 2BSMA 4WUBA 3A0WA 1AH6A 1UYFA 3OMUA 1US7A 4O0BA 1YETA 4V26A 1Z5BA 4KFGA 4XD8A 2BU7A 1NHHA 5J71A 2YE6A 4JASA 3JZ3A 4URNA 4QPKA 1UYEA 2WI5A 4LPBA 1KIJA 2IWSA 3IEDA 4O05A 2XK2A 1AM1A 3C11A 3O0IA 1I59A 4PL9A 4R3AA 2ZDYA 2XJJA 4ZVIA 4U7OA 4EEHA 2BYHA 2YKIA 4PRVA 4YKUA 2XD6A 4YKRA 4GGLA 4R3MA 3PEJA 2XDXA 2Q2EB 5FNCA 2IWXA 5J6AA 2BU5A 2ZDXA 2YI7A 1BYQA 3LNUA 4H85A 4L90A 4B6CA 3FV5A 3R91A 5D7RA 5FNFA 4GFNA 4NH8A 4XKAA 2XDUA 4CWSA 5M4MA 3A0YA 4KP4A 2XX4A 4LWEA 1UYMA 2WI1A 4CWRA 1U0ZA 1Z59A 4CWNA 4XCLA 3R4MA 3RLQA 1UY6A 4CE1A 3B26A 3OWBA 3RKZA 1S16A 1YSRA 1EI1A 5F3KA 2GQPA 4LWIA 4CWPA 3VHDA 4KQVA 4O07A 5D6QA 3HYYA 1I5BA 4CWTA 3B28A 2H8MA 3DGEA 2XABA 2QG0A 4DZYA 1AH8A 4MPEA 4O09A 4FCQA 3CRKA 4HXWA 2VW5A 3VADA 1Z5CA 1UY7A 3B24A 2IOPA 3A0ZA 1YC3A 2ESAA 3GIGB 4JAUA 1R62A 2XJGA 2EXLA 4B7PA 2XX5A 4X9LA 4GCZA 2VCIA 3WHAA 2HCHA 2IWUA 1GJVA 2Q8HA 1YT0A 2Q8GA 4BAEA 5C93A 2YE3A 1H7SA 3HYZA 2YEAA 1S14A 2C2AA 4XIQA 2XDKA 2WI3A 5D6PA 2YEFA 3Q5LA 4AWPA 3TTZA 3A0XA 2FWYA 2YK2A 2HKJA 2CCSA 1Y8OA 1L0OA 2BRCA 1QZRA 2HG1A 1NHIA 3R4OA 5CTXA 1ZW9A 4HY6A 1UYHA 4XC0A 4LP0A 5D7CA 1TIDA 1YC1A 2YKBA 2YGAA 2XHXA 1UYGA 3TZ2A 3LPSA 2H55A 2BU6A 4NH7A 3FT5A 4HY1A 4R1FA 3ZKDA 4MPCA 4XIPA 3OW6A 2YEBA 2CH4A 4I3HA 2XDLA 2WERA 4LWHA 3OWDA 5M4KA 2WI2A 1UY9A 4HZ5A 1NHJA 1UYCA 4GQTA 2BYIA 2XJXA 3GIEA 3D2RA 4GEEA 5CTWA 1I5AA 2FWZA 3T10A 5M4PA 3K99A 3QTFA 1YC4A 4XITA 1YS3A 3SL2A 5CPHA 2GFDA 2WI7A 2YJWA 2PNRA 4NH9A 1UYDA 2BU2A 4XDMA 3TZ5A 4MOTA 1GKZA 4LWFA 3K98A 4O04A 4XIRA 3EHGA 2XHTA 4KTNA 2QFOA 2YE5A 1Y8NA 5M4EA 1TILA 4XCJA 4E01A 2YEIA 4EM7A 4FCPA 1TC6A 3A0RA 4EGKA 2YKJA 2YECA 1U2OA 2E0AA 2YK9A 4MP2A 3RLPA 3GIFA 3R4NA 4HXZA 4MP7A 1MU5A 3ZM7A 1B62A 5FWKA 4AWOA 1EA6A 4FMTA 3ZXOA 4YKZA 3GIGA 3U67A 3HEKA 2O1WA 2QF6A 3K60A 4CWOA 1KZNA 4WUCA 4ASAA 4K4OA 4CWQA 1BXDA 3EHFA 4CE2A 5M4NA 4EFUA 4Q20A 3CGZA 1YSZA 2XX2A 2YE2A 3KE6A 4U7NA 3B25A 3TUHA 2ZKJA 5F5RA 2VCJA 2K5BA 2YEDA 4JQLA 4E00A 4YKXA 4V25A 5IDJA 2YE4A 2YI0A 3R92A 4DUHA 5FNDA 4MB9A 3T2SA 1YT1A 1YESA 3CWVA 3VHAA 2YI6A 2BTZA 4BIZA 5M4HA 3G7EA 1TBWA 2YE9A 2FXSA 4HYMA 1ID0A 3T0HA 1GKXA 2YEEA 5D7DA 3VHCA 2AKPA 2WEPA 1TH8A 1MX0A 2WEQA 3B27A 1Z5AA 4P7AA 2Q8FA 4H81A 4GT8A 3R4PA 3EHJA 3D36A 4P8OA 3OPDA 4BIUA 1Y4UA 1AMWA 3A0TA 4UROA 3Q5KA 5IN9A 2JJCA 1ZXNA 4ZKIA 3TZ0A 4KSGA 2BZ5A 4WUDA 3ZXQA 3BM9A 4I5SA 3BMYA 2CG9A 4URMA 3T0ZA 4KSHA 3INWA 2BREA 3ZKBA 4ASBA 1THNA 3INXA 3O6OA 2UWDA 2YE8A 4XKOA 4W7TA 4YKYA 3K97A 2YKCA 1JM6A 1I5DA 4BQGA 3HZ1A 2CGFA 3PEHA 3EHHA 3U2KA 4L91A 3C0EA 4CWFA 5BODA 1AJ6A 2YE7A 2WI6A 2IORA 3T1KA 1ZXMA 3RLRA 3U2DA 2CCUA 3EKOA 4YKTA 4AS9A 2CCTA 5CF0A 2WI4A 1OSFA 3G7BA 3D0BA 2BU8A 2XCMA 1UYLA 2BT0A 4PU9A 4HYPA 4URLA 3HZ5A 4LWGA 5GGZA 1B3QA 2YGFA 4E02A 4PRXA 1ZWHA 3CGYA 4ASGA 1YT2A 4CE3A 3MNRP 4YKWA 2XHRA 5BOCA 4EFTA 3NMQA 5CTUA 2YEHA 5CTYA 4QPJA 4ASFA 5IDMA 1B63A 3O2FA 2YGEA 3EKRA 2ZBKB 4BQJA 4XE2A 4MPNA 2YEJA 2YEGA 3WQ9A 4JAVA 4EGIA 4U93A 4BXIA 2IOQA 3CRLA 4L93A 4FPPA 4XKKA 4XTJA 4EGHA 1PVGA 2XDSA 2YJXA 3TZ4A 3H80A 2O1UA 2YKEA 1BKNA 4L8ZA 1QYEA 4EMVA 1BGQA 3QDDA 3G75A 1Y8PA 2JKIA 1H7UA 2YI5A 1YERA 5L3JA 2QG2A 1I5CA 1UYKA 2O1VA 3HHUA 4HZ0A 1UYIA 3FT8A
chains in the Genus database with same CATH superfamily
1QY8A 2VWCA 4YKQA 2FYPA 4L94A 1Y4SA 3Q5JA 1UY8A 4MBCA 4H7QA 4AWQA 4FCRA 2Q8IA 1I58A 1A4HA 1TC0A 3H4LA 2BSMA 4WUBA 3A0WA 1AH6A 1UYFA 3OMUA 1US7A 4O0BA 1YETA 4V26A 1Z5BA 4KFGA 4XD8A 2BU7A 1NHHA 5J71A 2YE6A 4JASA 3JZ3A 4URNA 4QPKA 1UYEA 2WI5A 4LPBA 1KIJA 2IWSA 3IEDA 4O05A 2XK2A 1AM1A 3C11A 3LMMA 3O0IA 1I59A 4PL9A 3S5TA 4R3AA 5JENA 2ZDYA 2XJJA 4ZVIA 4U7OA 4EEHA 2BYHA 2YKIA 4PRVA 4YKUA 2XD6A 4YKRA 4GGLA 4R3MA 3PEJA 2XDXA 2HHIA 2Q2EB 5FNCA 2IWXA 5J6AA 2BU5A 2ZDXA 2YI7A 1BYQA 3LNUA 4H85A 4L90A 4B6CA 3FV5A 3R91A 5D7RA 5FNFA 4GFNA 4NH8A 4XKAA 2XDUA 4CWSA 5M4MA 3A0YA 4KP4A 2XX4A 4LWEA 1UYMA 2WI1A 4CWRA 1U0ZA 1Z59A 4CWNA 4XCLA 3R4MA 3RLQA 1UY6A 4CE1A 3B26A 3OWBA 3RKZA 1S16A 1YSRA 1EI1A 5F3KA 2GQPA 4LWIA 4CWPA 3VHDA 4KQVA 4O07A 5D6QA 3HYYA 1I5BA 4CWTA 3B28A 2H8MA 3DGEA 2XABA 2QG0A 4DZYA 1AH8A 4MPEA 4O09A 4FCQA 3CRKA 2FTKA 4HXWA 2VW5A 3VADA 1Z5CA 1UY7A 3B24A 2IOPA 3A0ZA 1YC3A 2ESAA 3GIGB 4JAUA 1R62A 2XJGA 2EXLA 4B7PA 2XX5A 4X9LA 4GCZA 2VCIA 3WHAA 2HCHA 2IWUA 1GJVA 2Q8HA 1YT0A 2Q8GA 4BAEA 5C93A 2YE3A 1H7SA 3HYZA 2YEAA 1S14A 2C2AA 4XIQA 2XDKA 2WI3A 5D6PA 3CYGA 2YEFA 3Q5LA 4AWPA 3TTZA 3A0XA 2FWYA 2YK2A 2HKJA 2CCSA 1Y8OA 1L0OA 2BRCA 1QZRA 2HG1A 1NHIA 3R4OA 5CTXA 1ZW9A 4HY6A 1UYHA 4XC0A 4LP0A 5D7CA 1TIDA 1YC1A 2YKBA 2YGAA 2XHXA 1UYGA 3TZ2A 3LPSA 2H55A 2BU6A 4NH7A 3FT5A 4HY1A 4R1FA 3ZKDA 4MPCA 4XIPA 3OW6A 2YEBA 1IXMA 2CH4A 4I3HA 2XDLA 2WERA 4LWHA 3OWDA 5M4KA 2WI2A 1UY9A 4HZ5A 1NHJA 1UYCA 4GQTA 2BYIA 2XJXA 3GIEA 3D2RA 4GEEA 5CTWA 1I5AA 2FWZA 3T10A 5M4PA 3K99A 3QTFA 1YC4A 4XITA 1YS3A 3SL2A 5CPHA 2GFDA 2WI7A 2YJWA 2PNRA 4NH9A 1UYDA 2BU2A 4XDMA 3TZ5A 4MOTA 1GKZA 4LWFA 3K98A 4O04A 4XIRA 2C1IA 3EHGA 2XHTA 4KTNA 2QFOA 2YE5A 1Y8NA 5M4EA 1TILA 4XCJA 4E01A 2YEIA 4EM7A 4FCPA 1TC6A 3A0RA 4EGKA 2YKJA 2YECA 1U2OA 2E0AA 2YK9A 4MP2A 3RLPA 3GIFA 3R4NA 4HXZA 4MP7A 4E72A 1MU5A 3ZM7A 1B62A 5FWKA 4AWOA 1EA6A 4FMTA 3ZXOA 4YKZA 3GIGA 3U67A 3HEKA 2O1WA 2QF6A 3K60A 4CWOA 1KZNA 4WUCA 4ASAA 4K4OA 4CWQA 1BXDA 3EHFA 4CE2A 5M4NA 4EFUA 4Q20A 3CGZA 1YSZA 2XX2A 2YE2A 3KE6A 4U7NA 3B25A 3TUHA 2ZKJA 5F5RA 2VCJA 2K5BA 2YEDA 4JQLA 4E00A 4YKXA 4V25A 5IDJA 2YE4A 2YI0A 3R92A 4DUHA 5FNDA 4MB9A 3T2SA 1YT1A 1YESA 3CWVA 3VHAA 2YI6A 2BTZA 4BIZA 5M4HA 3G7EA 1TBWA 2YE9A 2FXSA 4HYMA 1F51A 1ID0A 3T0HA 1GKXA 2YEEA 5D7DA 3VHCA 2AKPA 2WEPA 1TH8A 1MX0A 2WEQA 3B27A 1Z5AA 4P7AA 2Q8FA 4H81A 4GT8A 3R4PA 3EHJA 3D36A 4P8OA 3OPDA 4BIUA 1Y4UA 1AMWA 3A0TA 4UROA 3Q5KA 5IN9A 2JJCA 1ZXNA 4ZKIA 3TZ0A 4KSGA 2BZ5A 4WUDA 3ZXQA 3BM9A 4I5SA 3BMYA 2CG9A 4URMA 3T0ZA 4KSHA 3INWA 2BREA 3ZKBA 4ASBA 1THNA 3INXA 3O6OA 2UWDA 2YE8A 4XKOA 4W7TA 4YKYA 3K97A 2YKCA 1JM6A 1I5DA 4BQGA 3HZ1A 2CGFA 3PEHA 3EHHA 3U2KA 4L91A 3C0EA 4CWFA 5BODA 1AJ6A 2YE7A 2WI6A 2IORA 3T1KA 1ZXMA 3RLRA 3U2DA 2CCUA 3EKOA 4YKTA 4AS9A 2CCTA 5CF0A 2WI4A 1OSFA 3G7BA 3D0BA 2BU8A 2XCMA 1UYLA 2BT0A 4PU9A 4HYPA 4URLA 3HZ5A 4LWGA 5GGZA 1B3QA 2YGFA 4E02A 4PRXA 1ZWHA 3CGYA 4ASGA 1YT2A 4CE3A 3MNRP 4YKWA 2XHRA 5BOCA 4EFTA 3NMQA 5CTUA 2YEHA 5CTYA 4QPJA 4ASFA 5IDMA 1B63A 3O2FA 2YGEA 3EKRA 2ZBKB 4BQJA 4XE2A 4MPNA 2YEJA 2YEGA 3WQ9A 4JAVA 4EGIA 4U93A 4BXIA 2IOQA 3CRLA 4L93A 4FPPA 4XKKA 4XTJA 4EGHA 1PVGA 2XDSA 2YJXA 3TZ4A 3H80A 2O1UA 2YKEA 1BKNA 4L8ZA 1QYEA 4EMVA 1BGQA 3QDDA 2C1GA 3G75A 1Y8PA 2JKIA 1H7UA 2YI5A 1YERA 5L3JA 2QG2A 1I5CA 1UYKA 2O1VA 3HHUA 4HZ0A 1UYIA 3FT8A
chains in the Genus database with same CATH topology
1QY8A 2VWCA 4YKQA 2FYPA 4L94A 1Y4SA 3Q5JA 1UY8A 4MBCA 4H7QA 4AWQA 4FCRA 2Q8IA 1I58A 1A4HA 1TC0A 3H4LA 2BSMA 4WUBA 3A0WA 1AH6A 1UYFA 3OMUA 1US7A 4O0BA 1YETA 4V26A 1Z5BA 4KFGA 4XD8A 2BU7A 1NHHA 5J71A 2YE6A 4JASA 3JZ3A 4URNA 4QPKA 1UYEA 2WI5A 4LPBA 1KIJA 2IWSA 3IEDA 4O05A 2XK2A 1AM1A 3C11A 3O0IA 1I59A 4PL9A 4R3AA 2ZDYA 2XJJA 4ZVIA 4U7OA 4EEHA 2BYHA 2YKIA 4PRVA 4YKUA 2XD6A 4YKRA 4GGLA 4R3MA 3PEJA 2XDXA 2Q2EB 5FNCA 2IWXA 5J6AA 2BU5A 2ZDXA 2YI7A 1BYQA 3LNUA 4H85A 4L90A 4B6CA 3FV5A 3R91A 5D7RA 5FNFA 4GFNA 4NH8A 4XKAA 2XDUA 4CWSA 5M4MA 3A0YA 4KP4A 2XX4A 4LWEA 1UYMA 2WI1A 4CWRA 1U0ZA 1Z59A 4CWNA 4XCLA 3R4MA 3RLQA 1UY6A 4CE1A 3B26A 3OWBA 3RKZA 1S16A 1YSRA 1EI1A 5F3KA 2GQPA 4LWIA 4CWPA 3VHDA 4KQVA 4O07A 5D6QA 3HYYA 1I5BA 4CWTA 3B28A 2H8MA 3DGEA 2XABA 2QG0A 4DZYA 1AH8A 4MPEA 4O09A 4FCQA 3CRKA 4HXWA 2VW5A 3VADA 1Z5CA 1UY7A 3B24A 2IOPA 3A0ZA 1YC3A 2ESAA 3GIGB 4JAUA 1R62A 2XJGA 2EXLA 4B7PA 2XX5A 4X9LA 4GCZA 2VCIA 3WHAA 2HCHA 2IWUA 1GJVA 2Q8HA 1YT0A 2Q8GA 4BAEA 5C93A 2YE3A 1H7SA 3HYZA 2YEAA 1S14A 2C2AA 4XIQA 2XDKA 2WI3A 5D6PA 2YEFA 3Q5LA 4AWPA 3TTZA 3A0XA 2FWYA 2YK2A 2HKJA 2CCSA 1Y8OA 1L0OA 2BRCA 1QZRA 2HG1A 1NHIA 3R4OA 5CTXA 1ZW9A 4HY6A 1UYHA 4XC0A 4LP0A 5D7CA 1TIDA 1YC1A 2YKBA 2YGAA 2XHXA 1UYGA 3TZ2A 3LPSA 2H55A 2BU6A 4NH7A 3FT5A 4HY1A 4R1FA 3ZKDA 4MPCA 4XIPA 3OW6A 2YEBA 2CH4A 4I3HA 2XDLA 2WERA 4LWHA 3OWDA 5M4KA 2WI2A 1UY9A 4HZ5A 1NHJA 1UYCA 4GQTA 2BYIA 2XJXA 3GIEA 3D2RA 4GEEA 5CTWA 1I5AA 2FWZA 3T10A 5M4PA 3K99A 3QTFA 1YC4A 4XITA 1YS3A 3SL2A 5CPHA 2GFDA 2WI7A 2YJWA 2PNRA 4NH9A 1UYDA 2BU2A 4XDMA 3TZ5A 4MOTA 1GKZA 4LWFA 3K98A 4O04A 4XIRA 3EHGA 2XHTA 4KTNA 2QFOA 2YE5A 1Y8NA 5M4EA 1TILA 4XCJA 4E01A 2YEIA 4EM7A 4FCPA 1TC6A 3A0RA 4EGKA 2YKJA 2YECA 1U2OA 2E0AA 2YK9A 4MP2A 3RLPA 3GIFA 3R4NA 4HXZA 4MP7A 1MU5A 3ZM7A 1B62A 5FWKA 4AWOA 1EA6A 4FMTA 3ZXOA 4YKZA 3GIGA 3U67A 3HEKA 2O1WA 2QF6A 3K60A 4CWOA 1KZNA 4WUCA 4ASAA 4K4OA 4CWQA 1BXDA 3EHFA 4CE2A 5M4NA 4EFUA 4Q20A 3CGZA 1YSZA 2XX2A 2YE2A 3KE6A 4U7NA 3B25A 3TUHA 2ZKJA 5F5RA 2VCJA 2K5BA 2YEDA 4JQLA 4E00A 4YKXA 4V25A 5IDJA 2YE4A 2YI0A 3R92A 4DUHA 5FNDA 4MB9A 3T2SA 1YT1A 1YESA 3CWVA 3VHAA 2YI6A 2BTZA 4BIZA 5M4HA 3G7EA 1TBWA 2YE9A 2FXSA 4HYMA 1ID0A 3T0HA 1GKXA 2YEEA 5D7DA 3VHCA 2AKPA 2WEPA 1TH8A 1MX0A 2WEQA 3B27A 1Z5AA 4P7AA 2Q8FA 4H81A 4GT8A 3R4PA 3EHJA 3D36A 4P8OA 3OPDA 4BIUA 1Y4UA 1AMWA 3A0TA 4UROA 3Q5KA 5IN9A 2JJCA 1ZXNA 4ZKIA 3TZ0A 4KSGA 2BZ5A 4WUDA 3ZXQA 3BM9A 4I5SA 3BMYA 2CG9A 4URMA 3T0ZA 4KSHA 3INWA 2BREA 3ZKBA 4ASBA 1THNA 3INXA 3O6OA 2UWDA 2YE8A 4XKOA 4W7TA 4YKYA 3K97A 2YKCA 1JM6A 1I5DA 4BQGA 3HZ1A 2CGFA 3PEHA 3EHHA 3U2KA 4L91A 3C0EA 4CWFA 5BODA 1AJ6A 2YE7A 2WI6A 2IORA 3T1KA 1ZXMA 3RLRA 3U2DA 2CCUA 3EKOA 4YKTA 4AS9A 2CCTA 5CF0A 2WI4A 1OSFA 3G7BA 3D0BA 2BU8A 2XCMA 1UYLA 2BT0A 4PU9A 4HYPA 4URLA 3HZ5A 4LWGA 5GGZA 1B3QA 2YGFA 4E02A 4PRXA 1ZWHA 3CGYA 4ASGA 1YT2A 4CE3A 3MNRP 4YKWA 2XHRA 5BOCA 4EFTA 3NMQA 5CTUA 2YEHA 5CTYA 4QPJA 4ASFA 5IDMA 1B63A 3O2FA 2YGEA 3EKRA 2ZBKB 4BQJA 4XE2A 4MPNA 2YEJA 2YEGA 3WQ9A 4JAVA 4EGIA 4U93A 4BXIA 2IOQA 3CRLA 4L93A 4FPPA 4XKKA 4XTJA 4EGHA 1PVGA 2XDSA 2YJXA 3TZ4A 3H80A 2O1UA 2YKEA 1BKNA 4L8ZA 1QYEA 4EMVA 1BGQA 3QDDA 3G75A 1Y8PA 2JKIA 1H7UA 2YI5A 1YERA 5L3JA 2QG2A 1I5CA 1UYKA 2O1VA 3HHUA 4HZ0A 1UYIA 3FT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QY8 A;  2VWC A;  4YKQ A;  2FYP A;  4L94 A;  1Y4S A;  3Q5J A;  1UY8 A;  4MBC A;  4H7Q A;  4AWQ A;  4FCR A;  2Q8I A;  1I58 A;  1A4H A;  1TC0 A;  3H4L A;  2BSM A;  4WUB A;  3A0W A;  1AH6 A;  1UYF A;  3OMU A;  1US7 A;  4O0B A;  1YET A;  4V26 A;  1Z5B A;  4KFG A;  4XD8 A;  2BU7 A;  1NHH A;  5J71 A;  2YE6 A;  4JAS A;  3JZ3 A;  4URN A;  4QPK A;  1UYE A;  2WI5 A;  4LPB A;  1KIJ A;  2IWS A;  3IED A;  4O05 A;  2XK2 A;  1AM1 A;  3C11 A;  3O0I A;  1I59 A;  4PL9 A;  4R3A A;  2ZDY A;  2XJJ A;  4ZVI A;  4U7O A;  4EEH A;  2BYH A;  2YKI A;  4PRV A;  4YKU A;  2XD6 A;  4YKR A;  4GGL A;  4R3M A;  3PEJ A;  2XDX A;  2Q2E B;  5FNC A;  2IWX A;  5J6A A;  2BU5 A;  2ZDX A;  2YI7 A;  1BYQ A;  3LNU A;  4H85 A;  4L90 A;  4B6C A;  3FV5 A;  3R91 A;  5D7R A;  5FNF A;  4GFN A;  4NH8 A;  4XKA A;  2XDU A;  4CWS A;  5M4M A;  3A0Y A;  4KP4 A;  2XX4 A;  4LWE A;  1UYM A;  2WI1 A;  4CWR A;  1U0Z A;  1Z59 A;  4CWN A;  4XCL A;  3R4M A;  3RLQ A;  1UY6 A;  4CE1 A;  3B26 A;  3OWB A;  3RKZ A;  1S16 A;  1YSR A;  1EI1 A;  5F3K A;  2GQP A;  4LWI A;  4CWP A;  3VHD A;  4KQV A;  4O07 A;  5D6Q A;  3HYY A;  1I5B A;  4CWT A;  3B28 A;  2H8M A;  3DGE A;  2XAB A;  2QG0 A;  4DZY A;  1AH8 A;  4MPE A;  4O09 A;  4FCQ A;  3CRK A;  4HXW A;  2VW5 A;  3VAD A;  1Z5C A;  1UY7 A;  3B24 A;  2IOP A;  3A0Z A;  1YC3 A;  2ESA A;  3GIG B;  4JAU A;  1R62 A;  2XJG A;  2EXL A;  4B7P A;  2XX5 A;  4X9L A;  4GCZ A;  2VCI A;  3WHA A;  2HCH A;  2IWU A;  1GJV A;  2Q8H A;  1YT0 A;  2Q8G A;  4BAE A;  5C93 A;  2YE3 A;  1H7S A;  3HYZ A;  2YEA A;  1S14 A;  2C2A A;  4XIQ A;  2XDK A;  2WI3 A;  5D6P A;  2YEF A;  3Q5L A;  4AWP A;  3TTZ A;  3A0X A;  2FWY A;  2YK2 A;  2HKJ A;  2CCS A;  1Y8O A;  1L0O A;  2BRC A;  1QZR A;  2HG1 A;  1NHI A;  3R4O A;  5CTX A;  1ZW9 A;  4HY6 A;  1UYH A;  4XC0 A;  4LP0 A;  5D7C A;  1TID A;  1YC1 A;  2YKB A;  2YGA A;  2XHX A;  1UYG A;  3TZ2 A;  3LPS A;  2H55 A;  2BU6 A;  4NH7 A;  3FT5 A;  4HY1 A;  4R1F A;  3ZKD A;  4MPC A;  4XIP A;  3OW6 A;  2YEB A;  2CH4 A;  4I3H A;  2XDL A;  2WER A;  4LWH A;  3OWD A;  5M4K A;  2WI2 A;  1UY9 A;  4HZ5 A;  1NHJ A;  1UYC A;  4GQT A;  2BYI A;  2XJX A;  3GIE A;  3D2R A;  4GEE A;  5CTW A;  1I5A A;  2FWZ A;  3T10 A;  5M4P A;  3K99 A;  3QTF A;  1YC4 A;  4XIT A;  1YS3 A;  3SL2 A;  5CPH A;  2GFD A;  2WI7 A;  2YJW A;  2PNR A;  4NH9 A;  1UYD A;  2BU2 A;  4XDM A;  3TZ5 A;  4MOT A;  1GKZ A;  4LWF A;  3K98 A;  4O04 A;  4XIR A;  3EHG A;  2XHT A;  4KTN A;  2QFO A;  2YE5 A;  1Y8N A;  5M4E A;  1TIL A;  4XCJ A;  4E01 A;  2YEI A;  4EM7 A;  4FCP A;  1TC6 A;  3A0R A;  4EGK A;  2YKJ A;  2YEC A;  1U2O A;  2E0A A;  2YK9 A;  4MP2 A;  3RLP A;  3GIF A;  3R4N A;  4HXZ A;  4MP7 A;  1MU5 A;  3ZM7 A;  1B62 A;  5FWK A;  4AWO A;  1EA6 A;  4FMT A;  3ZXO A;  4YKZ A;  3GIG A;  3U67 A;  3HEK A;  2O1W A;  2QF6 A;  3K60 A;  4CWO A;  1KZN A;  4WUC A;  4ASA A;  4K4O A;  4CWQ A;  1BXD A;  3EHF A;  4CE2 A;  5M4N A;  4EFU A;  4Q20 A;  3CGZ A;  1YSZ A;  2XX2 A;  2YE2 A;  3KE6 A;  4U7N A;  3B25 A;  3TUH A;  2ZKJ A;  5F5R A;  2VCJ A;  2K5B A;  2YED A;  4JQL A;  4E00 A;  4YKX A;  4V25 A;  5IDJ A;  2YE4 A;  2YI0 A;  3R92 A;  4DUH A;  5FND A;  4MB9 A;  3T2S A;  1YT1 A;  1YES A;  3CWV A;  3VHA A;  2YI6 A;  2BTZ A;  4BIZ A;  5M4H A;  3G7E A;  1TBW A;  2YE9 A;  2FXS A;  4HYM A;  1ID0 A;  3T0H A;  1GKX A;  2YEE A;  5D7D A;  3VHC A;  2AKP A;  2WEP A;  1TH8 A;  1MX0 A;  2WEQ A;  3B27 A;  1Z5A A;  4P7A A;  2Q8F A;  4H81 A;  4GT8 A;  3R4P A;  3EHJ A;  3D36 A;  4P8O A;  3OPD A;  4BIU A;  1Y4U A;  1AMW A;  3A0T A;  4URO A;  3Q5K A;  5IN9 A;  2JJC A;  1ZXN A;  4ZKI A;  3TZ0 A;  4KSG A;  2BZ5 A;  4WUD A;  3ZXQ A;  3BM9 A;  4I5S A;  3BMY A;  2CG9 A;  4URM A;  3T0Z A;  4KSH A;  3INW A;  2BRE A;  3ZKB A;  4ASB A;  1THN A;  3INX A;  3O6O A;  2UWD A;  2YE8 A;  4XKO A;  4W7T A;  4YKY A;  3K97 A;  2YKC A;  1JM6 A;  1I5D A;  4BQG A;  3HZ1 A;  2CGF A;  3PEH A;  3EHH A;  3U2K A;  4L91 A;  3C0E A;  4CWF A;  5BOD A;  1AJ6 A;  2YE7 A;  2WI6 A;  2IOR A;  3T1K A;  1ZXM A;  3RLR A;  3U2D A;  2CCU A;  3EKO A;  4YKT A;  4AS9 A;  2CCT A;  5CF0 A;  2WI4 A;  1OSF A;  3G7B A;  3D0B A;  2BU8 A;  2XCM A;  1UYL A;  2BT0 A;  4PU9 A;  4HYP A;  4URL A;  3HZ5 A;  4LWG A;  5GGZ A;  1B3Q A;  2YGF A;  4E02 A;  4PRX A;  1ZWH A;  3CGY A;  4ASG A;  1YT2 A;  4CE3 A;  3MNR P;  4YKW A;  2XHR A;  5BOC A;  4EFT A;  3NMQ A;  5CTU A;  2YEH A;  5CTY A;  4QPJ A;  4ASF A;  5IDM A;  1B63 A;  3O2F A;  2YGE A;  3EKR A;  2ZBK B;  4BQJ A;  4XE2 A;  4MPN A;  2YEJ A;  2YEG A;  3WQ9 A;  4JAV A;  4EGI A;  4U93 A;  4BXI A;  2IOQ A;  3CRL A;  4L93 A;  4FPP A;  4XKK A;  4XTJ A;  4EGH A;  1PVG A;  2XDS A;  2YJX A;  3TZ4 A;  3H80 A;  2O1U A;  2YKE A;  1BKN A;  4L8Z A;  1QYE A;  4EMV A;  1BGQ A;  3QDD A;  3G75 A;  1Y8P A;  2JKI A;  1H7U A;  2YI5 A;  1YER A;  5L3J A;  2QG2 A;  1I5C A;  1UYK A;  2O1V A;  3HHU A;  4HZ0 A;  1UYI A;  3FT8 A; 
#chains in the Genus database with same CATH topology
 1QY8 A;  2VWC A;  4YKQ A;  2FYP A;  4L94 A;  1Y4S A;  3Q5J A;  1UY8 A;  4MBC A;  4H7Q A;  4AWQ A;  4FCR A;  2Q8I A;  1I58 A;  1A4H A;  1TC0 A;  3H4L A;  2BSM A;  4WUB A;  3A0W A;  1AH6 A;  1UYF A;  3OMU A;  1US7 A;  4O0B A;  1YET A;  4V26 A;  1Z5B A;  4KFG A;  4XD8 A;  2BU7 A;  1NHH A;  5J71 A;  2YE6 A;  4JAS A;  3JZ3 A;  4URN A;  4QPK A;  1UYE A;  2WI5 A;  4LPB A;  1KIJ A;  2IWS A;  3IED A;  4O05 A;  2XK2 A;  1AM1 A;  3C11 A;  3LMM A;  3O0I A;  1I59 A;  4PL9 A;  3S5T A;  4R3A A;  5JEN A;  2ZDY A;  2XJJ A;  4ZVI A;  4U7O A;  4EEH A;  2BYH A;  2YKI A;  4PRV A;  4YKU A;  2XD6 A;  4YKR A;  4GGL A;  4R3M A;  3PEJ A;  2XDX A;  2HHI A;  2Q2E B;  5FNC A;  2IWX A;  5J6A A;  2BU5 A;  2ZDX A;  2YI7 A;  1BYQ A;  3LNU A;  4H85 A;  4L90 A;  4B6C A;  3FV5 A;  3R91 A;  5D7R A;  5FNF A;  4GFN A;  4NH8 A;  4XKA A;  2XDU A;  4CWS A;  5M4M A;  3A0Y A;  4KP4 A;  2XX4 A;  4LWE A;  1UYM A;  2WI1 A;  4CWR A;  1U0Z A;  1Z59 A;  4CWN A;  4XCL A;  3R4M A;  3RLQ A;  1UY6 A;  4CE1 A;  3B26 A;  3OWB A;  3RKZ A;  1S16 A;  1YSR A;  1EI1 A;  5F3K A;  2GQP A;  4LWI A;  4CWP A;  3VHD A;  4KQV A;  4O07 A;  5D6Q A;  3HYY A;  1I5B A;  4CWT A;  3B28 A;  2H8M A;  3DGE A;  2XAB A;  2QG0 A;  4DZY A;  1AH8 A;  4MPE A;  4O09 A;  4FCQ A;  3CRK A;  2FTK A;  4HXW A;  2VW5 A;  3VAD A;  1Z5C A;  1UY7 A;  3B24 A;  2IOP A;  3A0Z A;  1YC3 A;  2ESA A;  3GIG B;  4JAU A;  1R62 A;  2XJG A;  2EXL A;  4B7P A;  2XX5 A;  4X9L A;  4GCZ A;  2VCI A;  3WHA A;  2HCH A;  2IWU A;  1GJV A;  2Q8H A;  1YT0 A;  2Q8G A;  4BAE A;  5C93 A;  2YE3 A;  1H7S A;  3HYZ A;  2YEA A;  1S14 A;  2C2A A;  4XIQ A;  2XDK A;  2WI3 A;  5D6P A;  3CYG A;  2YEF A;  3Q5L A;  4AWP A;  3TTZ A;  3A0X A;  2FWY A;  2YK2 A;  2HKJ A;  2CCS A;  1Y8O A;  1L0O A;  2BRC A;  1QZR A;  2HG1 A;  1NHI A;  3R4O A;  5CTX A;  1ZW9 A;  4HY6 A;  1UYH A;  4XC0 A;  4LP0 A;  5D7C A;  1TID A;  1YC1 A;  2YKB A;  2YGA A;  2XHX A;  1UYG A;  3TZ2 A;  3LPS A;  2H55 A;  2BU6 A;  4NH7 A;  3FT5 A;  4HY1 A;  4R1F A;  3ZKD A;  4MPC A;  4XIP A;  3OW6 A;  2YEB A;  1IXM A;  2CH4 A;  4I3H A;  2XDL A;  2WER A;  4LWH A;  3OWD A;  5M4K A;  2WI2 A;  1UY9 A;  4HZ5 A;  1NHJ A;  1UYC A;  4GQT A;  2BYI A;  2XJX A;  3GIE A;  3D2R A;  4GEE A;  5CTW A;  1I5A A;  2FWZ A;  3T10 A;  5M4P A;  3K99 A;  3QTF A;  1YC4 A;  4XIT A;  1YS3 A;  3SL2 A;  5CPH A;  2GFD A;  2WI7 A;  2YJW A;  2PNR A;  4NH9 A;  1UYD A;  2BU2 A;  4XDM A;  3TZ5 A;  4MOT A;  1GKZ A;  4LWF A;  3K98 A;  4O04 A;  4XIR A;  2C1I A;  3EHG A;  2XHT A;  4KTN A;  2QFO A;  2YE5 A;  1Y8N A;  5M4E A;  1TIL A;  4XCJ A;  4E01 A;  2YEI A;  4EM7 A;  4FCP A;  1TC6 A;  3A0R A;  4EGK A;  2YKJ A;  2YEC A;  1U2O A;  2E0A A;  2YK9 A;  4MP2 A;  3RLP A;  3GIF A;  3R4N A;  4HXZ A;  4MP7 A;  4E72 A;  1MU5 A;  3ZM7 A;  1B62 A;  5FWK A;  4AWO A;  1EA6 A;  4FMT A;  3ZXO A;  4YKZ A;  3GIG A;  3U67 A;  3HEK A;  2O1W A;  2QF6 A;  3K60 A;  4CWO A;  1KZN A;  4WUC A;  4ASA A;  4K4O A;  4CWQ A;  1BXD A;  3EHF A;  4CE2 A;  5M4N A;  4EFU A;  4Q20 A;  3CGZ A;  1YSZ A;  2XX2 A;  2YE2 A;  3KE6 A;  4U7N A;  3B25 A;  3TUH A;  2ZKJ A;  5F5R A;  2VCJ A;  2K5B A;  2YED A;  4JQL A;  4E00 A;  4YKX A;  4V25 A;  5IDJ A;  2YE4 A;  2YI0 A;  3R92 A;  4DUH A;  5FND A;  4MB9 A;  3T2S A;  1YT1 A;  1YES A;  3CWV A;  3VHA A;  2YI6 A;  2BTZ A;  4BIZ A;  5M4H A;  3G7E A;  1TBW A;  2YE9 A;  2FXS A;  4HYM A;  1F51 A;  1ID0 A;  3T0H A;  1GKX A;  2YEE A;  5D7D A;  3VHC A;  2AKP A;  2WEP A;  1TH8 A;  1MX0 A;  2WEQ A;  3B27 A;  1Z5A A;  4P7A A;  2Q8F A;  4H81 A;  4GT8 A;  3R4P A;  3EHJ A;  3D36 A;  4P8O A;  3OPD A;  4BIU A;  1Y4U A;  1AMW A;  3A0T A;  4URO A;  3Q5K A;  5IN9 A;  2JJC A;  1ZXN A;  4ZKI A;  3TZ0 A;  4KSG A;  2BZ5 A;  4WUD A;  3ZXQ A;  3BM9 A;  4I5S A;  3BMY A;  2CG9 A;  4URM A;  3T0Z A;  4KSH A;  3INW A;  2BRE A;  3ZKB A;  4ASB A;  1THN A;  3INX A;  3O6O A;  2UWD A;  2YE8 A;  4XKO A;  4W7T A;  4YKY A;  3K97 A;  2YKC A;  1JM6 A;  1I5D A;  4BQG A;  3HZ1 A;  2CGF A;  3PEH A;  3EHH A;  3U2K A;  4L91 A;  3C0E A;  4CWF A;  5BOD A;  1AJ6 A;  2YE7 A;  2WI6 A;  2IOR A;  3T1K A;  1ZXM A;  3RLR A;  3U2D A;  2CCU A;  3EKO A;  4YKT A;  4AS9 A;  2CCT A;  5CF0 A;  2WI4 A;  1OSF A;  3G7B A;  3D0B A;  2BU8 A;  2XCM A;  1UYL A;  2BT0 A;  4PU9 A;  4HYP A;  4URL A;  3HZ5 A;  4LWG A;  5GGZ A;  1B3Q A;  2YGF A;  4E02 A;  4PRX A;  1ZWH A;  3CGY A;  4ASG A;  1YT2 A;  4CE3 A;  3MNR P;  4YKW A;  2XHR A;  5BOC A;  4EFT A;  3NMQ A;  5CTU A;  2YEH A;  5CTY A;  4QPJ A;  4ASF A;  5IDM A;  1B63 A;  3O2F A;  2YGE A;  3EKR A;  2ZBK B;  4BQJ A;  4XE2 A;  4MPN A;  2YEJ A;  2YEG A;  3WQ9 A;  4JAV A;  4EGI A;  4U93 A;  4BXI A;  2IOQ A;  3CRL A;  4L93 A;  4FPP A;  4XKK A;  4XTJ A;  4EGH A;  1PVG A;  2XDS A;  2YJX A;  3TZ4 A;  3H80 A;  2O1U A;  2YKE A;  1BKN A;  4L8Z A;  1QYE A;  4EMV A;  1BGQ A;  3QDD A;  2C1G A;  3G75 A;  1Y8P A;  2JKI A;  1H7U A;  2YI5 A;  1YER A;  5L3J A;  2QG2 A;  1I5C A;  1UYK A;  2O1V A;  3HHU A;  4HZ0 A;  1UYI A;  3FT8 A; 
#chains in the Genus database with same CATH homology
 1QY8 A;  2VWC A;  4YKQ A;  2FYP A;  4L94 A;  1Y4S A;  3Q5J A;  1UY8 A;  4MBC A;  4H7Q A;  4AWQ A;  4FCR A;  2Q8I A;  1I58 A;  1A4H A;  1TC0 A;  3H4L A;  2BSM A;  4WUB A;  3A0W A;  1AH6 A;  1UYF A;  3OMU A;  1US7 A;  4O0B A;  1YET A;  4V26 A;  1Z5B A;  4KFG A;  4XD8 A;  2BU7 A;  1NHH A;  5J71 A;  2YE6 A;  4JAS A;  3JZ3 A;  4URN A;  4QPK A;  1UYE A;  2WI5 A;  4LPB A;  1KIJ A;  2IWS A;  3IED A;  4O05 A;  2XK2 A;  1AM1 A;  3C11 A;  3O0I A;  1I59 A;  4PL9 A;  4R3A A;  2ZDY A;  2XJJ A;  4ZVI A;  4U7O A;  4EEH A;  2BYH A;  2YKI A;  4PRV A;  4YKU A;  2XD6 A;  4YKR A;  4GGL A;  4R3M A;  3PEJ A;  2XDX A;  2Q2E B;  5FNC A;  2IWX A;  5J6A A;  2BU5 A;  2ZDX A;  2YI7 A;  1BYQ A;  3LNU A;  4H85 A;  4L90 A;  4B6C A;  3FV5 A;  3R91 A;  5D7R A;  5FNF A;  4GFN A;  4NH8 A;  4XKA A;  2XDU A;  4CWS A;  5M4M A;  3A0Y A;  4KP4 A;  2XX4 A;  4LWE A;  1UYM A;  2WI1 A;  4CWR A;  1U0Z A;  1Z59 A;  4CWN A;  4XCL A;  3R4M A;  3RLQ A;  1UY6 A;  4CE1 A;  3B26 A;  3OWB A;  3RKZ A;  1S16 A;  1YSR A;  1EI1 A;  5F3K A;  2GQP A;  4LWI A;  4CWP A;  3VHD A;  4KQV A;  4O07 A;  5D6Q A;  3HYY A;  1I5B A;  4CWT A;  3B28 A;  2H8M A;  3DGE A;  2XAB A;  2QG0 A;  4DZY A;  1AH8 A;  4MPE A;  4O09 A;  4FCQ A;  3CRK A;  4HXW A;  2VW5 A;  3VAD A;  1Z5C A;  1UY7 A;  3B24 A;  2IOP A;  3A0Z A;  1YC3 A;  2ESA A;  3GIG B;  4JAU A;  1R62 A;  2XJG A;  2EXL A;  4B7P A;  2XX5 A;  4X9L A;  4GCZ A;  2VCI A;  3WHA A;  2HCH A;  2IWU A;  1GJV A;  2Q8H A;  1YT0 A;  2Q8G A;  4BAE A;  5C93 A;  2YE3 A;  1H7S A;  3HYZ A;  2YEA A;  1S14 A;  2C2A A;  4XIQ A;  2XDK A;  2WI3 A;  5D6P A;  2YEF A;  3Q5L A;  4AWP A;  3TTZ A;  3A0X A;  2FWY A;  2YK2 A;  2HKJ A;  2CCS A;  1Y8O A;  1L0O A;  2BRC A;  1QZR A;  2HG1 A;  1NHI A;  3R4O A;  5CTX A;  1ZW9 A;  4HY6 A;  1UYH A;  4XC0 A;  4LP0 A;  5D7C A;  1TID A;  1YC1 A;  2YKB A;  2YGA A;  2XHX A;  1UYG A;  3TZ2 A;  3LPS A;  2H55 A;  2BU6 A;  4NH7 A;  3FT5 A;  4HY1 A;  4R1F A;  3ZKD A;  4MPC A;  4XIP A;  3OW6 A;  2YEB A;  2CH4 A;  4I3H A;  2XDL A;  2WER A;  4LWH A;  3OWD A;  5M4K A;  2WI2 A;  1UY9 A;  4HZ5 A;  1NHJ A;  1UYC A;  4GQT A;  2BYI A;  2XJX A;  3GIE A;  3D2R A;  4GEE A;  5CTW A;  1I5A A;  2FWZ A;  3T10 A;  5M4P A;  3K99 A;  3QTF A;  1YC4 A;  4XIT A;  1YS3 A;  3SL2 A;  5CPH A;  2GFD A;  2WI7 A;  2YJW A;  2PNR A;  4NH9 A;  1UYD A;  2BU2 A;  4XDM A;  3TZ5 A;  4MOT A;  1GKZ A;  4LWF A;  3K98 A;  4O04 A;  4XIR A;  3EHG A;  2XHT A;  4KTN A;  2QFO A;  2YE5 A;  1Y8N A;  5M4E A;  1TIL A;  4XCJ A;  4E01 A;  2YEI A;  4EM7 A;  4FCP A;  1TC6 A;  3A0R A;  4EGK A;  2YKJ A;  2YEC A;  1U2O A;  2E0A A;  2YK9 A;  4MP2 A;  3RLP A;  3GIF A;  3R4N A;  4HXZ A;  4MP7 A;  1MU5 A;  3ZM7 A;  1B62 A;  5FWK A;  4AWO A;  1EA6 A;  4FMT A;  3ZXO A;  4YKZ A;  3GIG A;  3U67 A;  3HEK A;  2O1W A;  2QF6 A;  3K60 A;  4CWO A;  1KZN A;  4WUC A;  4ASA A;  4K4O A;  4CWQ A;  1BXD A;  3EHF A;  4CE2 A;  5M4N A;  4EFU A;  4Q20 A;  3CGZ A;  1YSZ A;  2XX2 A;  2YE2 A;  3KE6 A;  4U7N A;  3B25 A;  3TUH A;  2ZKJ A;  5F5R A;  2VCJ A;  2K5B A;  2YED A;  4JQL A;  4E00 A;  4YKX A;  4V25 A;  5IDJ A;  2YE4 A;  2YI0 A;  3R92 A;  4DUH A;  5FND A;  4MB9 A;  3T2S A;  1YT1 A;  1YES A;  3CWV A;  3VHA A;  2YI6 A;  2BTZ A;  4BIZ A;  5M4H A;  3G7E A;  1TBW A;  2YE9 A;  2FXS A;  4HYM A;  1ID0 A;  3T0H A;  1GKX A;  2YEE A;  5D7D A;  3VHC A;  2AKP A;  2WEP A;  1TH8 A;  1MX0 A;  2WEQ A;  3B27 A;  1Z5A A;  4P7A A;  2Q8F A;  4H81 A;  4GT8 A;  3R4P A;  3EHJ A;  3D36 A;  4P8O A;  3OPD A;  4BIU A;  1Y4U A;  1AMW A;  3A0T A;  4URO A;  3Q5K A;  5IN9 A;  2JJC A;  1ZXN A;  4ZKI A;  3TZ0 A;  4KSG A;  2BZ5 A;  4WUD A;  3ZXQ A;  3BM9 A;  4I5S A;  3BMY A;  2CG9 A;  4URM A;  3T0Z A;  4KSH A;  3INW A;  2BRE A;  3ZKB A;  4ASB A;  1THN A;  3INX A;  3O6O A;  2UWD A;  2YE8 A;  4XKO A;  4W7T A;  4YKY A;  3K97 A;  2YKC A;  1JM6 A;  1I5D A;  4BQG A;  3HZ1 A;  2CGF A;  3PEH A;  3EHH A;  3U2K A;  4L91 A;  3C0E A;  4CWF A;  5BOD A;  1AJ6 A;  2YE7 A;  2WI6 A;  2IOR A;  3T1K A;  1ZXM A;  3RLR A;  3U2D A;  2CCU A;  3EKO A;  4YKT A;  4AS9 A;  2CCT A;  5CF0 A;  2WI4 A;  1OSF A;  3G7B A;  3D0B A;  2BU8 A;  2XCM A;  1UYL A;  2BT0 A;  4PU9 A;  4HYP A;  4URL A;  3HZ5 A;  4LWG A;  5GGZ A;  1B3Q A;  2YGF A;  4E02 A;  4PRX A;  1ZWH A;  3CGY A;  4ASG A;  1YT2 A;  4CE3 A;  3MNR P;  4YKW A;  2XHR A;  5BOC A;  4EFT A;  3NMQ A;  5CTU A;  2YEH A;  5CTY A;  4QPJ A;  4ASF A;  5IDM A;  1B63 A;  3O2F A;  2YGE A;  3EKR A;  2ZBK B;  4BQJ A;  4XE2 A;  4MPN A;  2YEJ A;  2YEG A;  3WQ9 A;  4JAV A;  4EGI A;  4U93 A;  4BXI A;  2IOQ A;  3CRL A;  4L93 A;  4FPP A;  4XKK A;  4XTJ A;  4EGH A;  1PVG A;  2XDS A;  2YJX A;  3TZ4 A;  3H80 A;  2O1U A;  2YKE A;  1BKN A;  4L8Z A;  1QYE A;  4EMV A;  1BGQ A;  3QDD A;  3G75 A;  1Y8P A;  2JKI A;  1H7U A;  2YI5 A;  1YER A;  5L3J A;  2QG2 A;  1I5C A;  1UYK A;  2O1V A;  3HHU A;  4HZ0 A;  1UYI A;  3FT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...