3G75A

Crystal structure of staphylococcus aureus gyrase b co-complexed with 4-methyl-5-[3-(methylsulfanyl)-1h-pyrazol-5-yl]-2-thiophen-2-yl-1,3-thiazole inhibitor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
184
Chain Sequence
GLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
publication title Discovery of pyrazolthiazoles as novel and potent inhibitors of bacterial gyrase.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 50
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3g75A00
2VCIA 1UYKA 3KE6A 4PL9A 4GCZA 2CCSA 4HYPA 3TUHA 2YKEA 2XJJA 2BU2A 2HCHA 4DZYA 2YEAA 3CRKA 2XJXA 4MPEA 4XIRA 3B27A 2WEPA 3CGYA 3RLRA 3VHAA 2O1WA 2ZDYA 5GGZA 3WHAA 2GFDA 1YC1A 5CPHA 3TZ2A 2FWZA 3HZ1A 2BU6A 1Y4UA 1UYEA 3O6OA 3TZ5A 3INWA 4XE2A 4BQJA 4BIZA 2Q8FA 4BQGA 1OSFA 3H80A 4H85A 2YEJA 2BYHA 2FWYA 3D0BA 4FPPA 3R91A 1YS3A 3K99A 2YE5A 4WUCA 5M4NA 1U0ZA 3ZKDA 3BM9A 4P8OA 3OMUA 4XDMA 2BYIA 2O1UA 4XC0A 4HXZA 1S16A 3VHDA 3OW6A 2HKJA 4KSHA 2YGFA 4BXIA 1ZW9A 4KFGA 1QYEA 2FXSA 2WEQA 2CCTA 4CE2A 1UYDA 1YSRA 2H8MA 5F5RA 2YI0A 2VCJA 2WI2A 4EM7A 4W7TA 3ZXQA 4R3MA 3LPSA 4H81A 2IWSA 2CCUA 4MP2A 2YJXA 1Z5AA 4ASBA 1B63A 4XITA 3ZXOA 2YI7A 4O09A 1YC3A 4E00A 4JQLA 1Y8OA 1THNA 5IDMA 3PEHA 1YETA 3EHFA 4AWOA 4GQTA 3FV5A 4KQVA 4LWFA 1UYMA 4EGKA 2YI6A 3A0RA 3Q5JA 3O2FA 2YEBA 4I5SA 4YKUA 2XDXA 2ESAA 4LP0A 4CWOA 4URMA 2IOPA 1KZNA 3FT5A 4U7OA 4PU9A 1U2OA 4HZ5A 4EGHA 4E02A 4PRVA 2QG2A 3R4MA 4MBCA 2WERA 2WI3A 4QPJA 4AWQA 1TH8A 3IEDA 5F3KA 2XHRA 3EKRA 3CRLA 4FCPA 2YE9A 3OWBA 2BRCA 1I5CA 4URNA 4KP4A 2YE4A 3A0YA 1Z5CA 3B25A 1BYQA 2YKCA 4XKOA 2YE8A 1ZXMA 4CWSA 2XD6A 2YECA 1BKNA 1EI1A 2Q8GA 1YERA 4LWHA 2BTZA 5BODA 3B24A 5IN9A 3BMYA 4V26A 1US7A 3JZ3A 4GEEA 2YEHA 2BU5A 1S14A 4ZVIA 1QY8A 2BREA 2IWUA 5IDJA 1TILA 3TZ4A 4EFUA 4YKXA 3RKZA 2BU7A 1TBWA 1UYFA 3A0XA 3HYYA 3K98A 3HEKA 2VW5A 4MP7A 1I5AA 5FNCA 4O07A 1Z59A 5CTXA 3EHJA 2EXLA 2H55A 1H7UA 2YEFA 2YE2A 1AH8A 4HXWA 5FNFA 4NH7A 3QTFA 3NMQA 4MB9A 4E01A 4FCQA 4XKKA 4EEHA 3A0TA 2XJGA 1GJVA 2JJCA 4WUDA 4YKQA 1AM1A 2JKIA 1YT0A 3C11A 3VADA 1BGQA 3T10A 3T0HA 2YJWA 1GKZA 3HZ5A 4X9LA 5M4PA 3INXA 4L90A 4AS9A 1QZRA 5M4MA 3GIGA 1B62A 4LWEA 4UROA 5FNDA 1I5BA 2XHXA 2UWDA 1UYIA 2PNRA 4R3AA 3D36A 1A4HA 4H7QA 5M4KA 1Y8NA 1NHJA 2XHTA 4U93A 2YKBA 2XDLA 3VHCA 3OPDA 1I58A 2Q2EB 2XDKA 4EMVA 2XX2A 1PVGA 2YK2A 2CGFA 3ZKBA 1R62A 4O05A 3RLPA 2HG1A 2Q8HA 4DUHA 1I5DA 4L8ZA 4LPBA 3Q5LA 2O1VA 1ZWHA 4GT8A 2XDSA 5M4EA 4ZKIA 4CWNA 4EFTA 4EGIA 3T0ZA 2ZDXA 4YKRA 5C93A 3EKOA 4XTJA 3O0IA 2ZBKB 4I3HA 1YC4A 1KIJA 4KTNA 3R4OA 2CH4A 4CWRA 5M4HA 3FT8A 3U2DA 4L94A 4JAVA 4O04A 3OWDA 4XIQA 5CTYA 2E0AA 1Y8PA 2QFOA 3G75A 1B3QA 4CE1A 4XD8A 2BT0A 3MNRP 2FYPA 4CWTA 1YESA 5D7RA 3HYZA 3GIGB 1Z5BA 4L91A 3A0WA 1L0OA 4YKWA 2XCMA 4JAUA 4NH8A 4R1FA 3B28A 3HHUA 4NH9A 3K97A 4FCRA 2WI6A 1NHIA 3WQ9A 2WI5A 4LWGA 4YKZA 1TC0A 4MPNA 1H7SA 2YEEA 4XKAA 2K5BA 2YK9A 1UYCA 4KSGA 3ZM7A 4HZ0A 2YEIA 2VWCA 4ASFA 3TZ0A 2XX5A 4XCJA 5CF0A 5D6PA 1TC6A 4PRXA 2YE3A 4GFNA 2CG9A 3GIFA 3C0EA 1GKXA 2IWXA 4K4OA 3LNUA 1NHHA 1ZXNA 2WI1A 4URLA 3SL2A 4AWPA 4B7PA 5L3JA 1UY7A 4ASGA 3R92A 5D7DA 4BIUA 4YKYA 1TIDA 4CWFA 2XDUA 4O0BA 2XK2A 4XCLA 4HY1A 3B26A 3R4NA 5BOCA 2YGEA 4U7NA 2YEDA 5CTWA 4CE3A 1YSZA 3CWVA 1YT2A 2YI5A 4MPCA 2QG0A 4V25A 2IORA 1Y4SA 4B6CA 1BXDA 1ID0A 4WUBA 2YKJA 1UYGA 2BSMA 2YEGA 3T1KA 4P7AA 3EHGA 3CGZA 4LWIA 2YKIA 1AMWA 1MX0A 2GQPA 3PEJA 2YE7A 2IOQA 4XIPA 2AKPA 1UYLA 2ZKJA 3RLQA 4HY6A 2Q8IA 5CTUA 4JASA 1UY6A 4BAEA 1YT1A 4MOTA 2BU8A 3R4PA 1EA6A 4L93A 4QPKA 5J71A 4Q20A 3TTZA 3DGEA 1AH6A 3QDDA 3A0ZA 5FWKA 4CWPA 4FMTA 4GGLA 3G7EA 3K60A 2C2AA 2XABA 4HYMA 2XX4A 1AJ6A 1I59A 1UY8A 3Q5KA 2YGAA 5J6AA 2BZ5A 3GIEA 2QF6A 3EHHA 4CWQA 3U67A 1UY9A 5D7CA 1JM6A 3D2RA 1UYHA 3U2KA 4ASAA 3H4LA 2WI4A 2YE6A 4YKTA 1MU5A 2WI7A 3G7BA 5D6QA 3T2SA
chains in the Genus database with same CATH superfamily
2VCIA 1UYKA 3KE6A 4PL9A 4GCZA 5JENA 2CCSA 4HYPA 3TUHA 2YKEA 2XJJA 2BU2A 2HCHA 4DZYA 2YEAA 3CRKA 2XJXA 4MPEA 4XIRA 3B27A 2WEPA 3CGYA 3RLRA 3VHAA 2O1WA 2ZDYA 5GGZA 3WHAA 2GFDA 1YC1A 5CPHA 3TZ2A 2FWZA 3HZ1A 2BU6A 1Y4UA 1UYEA 3O6OA 3TZ5A 3INWA 4E72A 4XE2A 4BQJA 4BIZA 2Q8FA 4BQGA 1OSFA 3H80A 4H85A 2YEJA 2BYHA 2FWYA 3D0BA 4FPPA 3R91A 1YS3A 3K99A 2YE5A 4WUCA 5M4NA 1U0ZA 3ZKDA 3BM9A 4P8OA 3OMUA 4XDMA 2BYIA 2O1UA 4XC0A 4HXZA 1S16A 3VHDA 3OW6A 2HKJA 4KSHA 2YGFA 4BXIA 1ZW9A 4KFGA 1QYEA 2FXSA 2WEQA 2CCTA 4CE2A 1UYDA 1YSRA 2H8MA 5F5RA 2YI0A 2VCJA 2WI2A 4EM7A 4W7TA 3ZXQA 4R3MA 3LPSA 4H81A 2IWSA 2CCUA 4MP2A 2YJXA 1Z5AA 4ASBA 1B63A 4XITA 3ZXOA 2YI7A 4O09A 1YC3A 4E00A 4JQLA 1Y8OA 1THNA 5IDMA 3PEHA 1YETA 3EHFA 4AWOA 4GQTA 3FV5A 4KQVA 4LWFA 1UYMA 4EGKA 2YI6A 3A0RA 3Q5JA 3O2FA 2YEBA 4I5SA 4YKUA 2XDXA 2ESAA 4LP0A 4CWOA 4URMA 2IOPA 1KZNA 3FT5A 4U7OA 4PU9A 1U2OA 4HZ5A 4EGHA 4E02A 4PRVA 2QG2A 3R4MA 4MBCA 2WERA 2WI3A 4QPJA 4AWQA 1TH8A 3IEDA 5F3KA 2XHRA 3EKRA 3CRLA 4FCPA 2YE9A 3OWBA 2BRCA 1I5CA 4URNA 4KP4A 2YE4A 3A0YA 1Z5CA 3B25A 1BYQA 2YKCA 4XKOA 2YE8A 1ZXMA 4CWSA 2XD6A 2YECA 1BKNA 1EI1A 2Q8GA 1YERA 4LWHA 2BTZA 5BODA 3B24A 5IN9A 3BMYA 4V26A 1US7A 3JZ3A 4GEEA 2YEHA 2BU5A 1S14A 4ZVIA 1QY8A 2BREA 2IWUA 3CYGA 5IDJA 1TILA 3TZ4A 4EFUA 4YKXA 3RKZA 2BU7A 1TBWA 1UYFA 3A0XA 3HYYA 3K98A 3HEKA 2VW5A 4MP7A 1I5AA 5FNCA 4O07A 1Z59A 5CTXA 3EHJA 2EXLA 2H55A 1H7UA 2YEFA 2YE2A 1AH8A 4HXWA 5FNFA 4NH7A 3QTFA 3NMQA 4MB9A 4E01A 4FCQA 4XKKA 4EEHA 3A0TA 2XJGA 1GJVA 2JJCA 4WUDA 4YKQA 1AM1A 2JKIA 1YT0A 3C11A 3VADA 1BGQA 3T10A 3T0HA 2YJWA 1GKZA 3HZ5A 4X9LA 5M4PA 3INXA 4L90A 4AS9A 1QZRA 5M4MA 3GIGA 1B62A 4LWEA 4UROA 5FNDA 1I5BA 2XHXA 2UWDA 1UYIA 2PNRA 4R3AA 3D36A 1A4HA 4H7QA 5M4KA 1Y8NA 3LMMA 1NHJA 2XHTA 4U93A 2YKBA 2XDLA 3VHCA 3OPDA 1I58A 2Q2EB 2XDKA 4EMVA 2XX2A 1PVGA 2YK2A 2CGFA 3ZKBA 1R62A 4O05A 3RLPA 2HG1A 2Q8HA 4DUHA 1I5DA 4L8ZA 4LPBA 2HHIA 3Q5LA 2O1VA 1ZWHA 4GT8A 2XDSA 5M4EA 4ZKIA 4CWNA 4EFTA 4EGIA 3T0ZA 2ZDXA 4YKRA 5C93A 3EKOA 4XTJA 3O0IA 2ZBKB 4I3HA 1YC4A 1KIJA 1IXMA 4KTNA 3R4OA 2CH4A 4CWRA 5M4HA 3FT8A 3U2DA 4L94A 4JAVA 4O04A 3OWDA 4XIQA 5CTYA 2E0AA 1Y8PA 2QFOA 3G75A 1B3QA 4CE1A 4XD8A 2BT0A 3MNRP 2FYPA 4CWTA 1YESA 2C1IA 5D7RA 3HYZA 3GIGB 1Z5BA 2FTKA 4L91A 3A0WA 1L0OA 4YKWA 2XCMA 4JAUA 4NH8A 4R1FA 3B28A 3HHUA 4NH9A 3K97A 4FCRA 2WI6A 1NHIA 3WQ9A 2WI5A 4LWGA 4YKZA 1TC0A 4MPNA 1H7SA 2YEEA 4XKAA 2K5BA 2YK9A 1UYCA 4KSGA 3ZM7A 4HZ0A 2YEIA 2VWCA 4ASFA 3TZ0A 2XX5A 4XCJA 5CF0A 5D6PA 1TC6A 4PRXA 2YE3A 4GFNA 2CG9A 3GIFA 3C0EA 1GKXA 2IWXA 4K4OA 3LNUA 1NHHA 1ZXNA 2WI1A 4URLA 3SL2A 4AWPA 4B7PA 5L3JA 1UY7A 4ASGA 3R92A 5D7DA 4BIUA 4YKYA 1TIDA 2C1GA 4CWFA 2XDUA 4O0BA 2XK2A 4XCLA 4HY1A 3B26A 3R4NA 5BOCA 2YGEA 4U7NA 2YEDA 5CTWA 4CE3A 1YSZA 3CWVA 1YT2A 2YI5A 4MPCA 2QG0A 4V25A 2IORA 1Y4SA 4B6CA 1BXDA 1ID0A 4WUBA 2YKJA 1UYGA 2BSMA 2YEGA 3T1KA 4P7AA 3EHGA 3S5TA 3CGZA 4LWIA 2YKIA 1AMWA 1MX0A 2GQPA 3PEJA 2YE7A 2IOQA 4XIPA 2AKPA 1UYLA 2ZKJA 1F51A 3RLQA 4HY6A 2Q8IA 5CTUA 4JASA 1UY6A 4BAEA 1YT1A 4MOTA 2BU8A 3R4PA 1EA6A 4L93A 4QPKA 5J71A 4Q20A 3TTZA 3DGEA 1AH6A 3QDDA 3A0ZA 5FWKA 4CWPA 4FMTA 4GGLA 3G7EA 3K60A 2C2AA 2XABA 4HYMA 2XX4A 1AJ6A 1I59A 1UY8A 3Q5KA 2YGAA 5J6AA 2BZ5A 3GIEA 2QF6A 3EHHA 4CWQA 3U67A 1UY9A 5D7CA 1JM6A 3D2RA 1UYHA 3U2KA 4ASAA 3H4LA 2WI4A 2YE6A 4YKTA 1MU5A 2WI7A 3G7BA 5D6QA 3T2SA
chains in the Genus database with same CATH topology
2VCIA 1UYKA 3KE6A 4PL9A 4GCZA 2CCSA 4HYPA 3TUHA 2YKEA 2XJJA 2BU2A 2HCHA 4DZYA 2YEAA 3CRKA 2XJXA 4MPEA 4XIRA 3B27A 2WEPA 3CGYA 3RLRA 3VHAA 2O1WA 2ZDYA 5GGZA 3WHAA 2GFDA 1YC1A 5CPHA 3TZ2A 2FWZA 3HZ1A 2BU6A 1Y4UA 1UYEA 3O6OA 3TZ5A 3INWA 4XE2A 4BQJA 4BIZA 2Q8FA 4BQGA 1OSFA 3H80A 4H85A 2YEJA 2BYHA 2FWYA 3D0BA 4FPPA 3R91A 1YS3A 3K99A 2YE5A 4WUCA 5M4NA 1U0ZA 3ZKDA 3BM9A 4P8OA 3OMUA 4XDMA 2BYIA 2O1UA 4XC0A 4HXZA 1S16A 3VHDA 3OW6A 2HKJA 4KSHA 2YGFA 4BXIA 1ZW9A 4KFGA 1QYEA 2FXSA 2WEQA 2CCTA 4CE2A 1UYDA 1YSRA 2H8MA 5F5RA 2YI0A 2VCJA 2WI2A 4EM7A 4W7TA 3ZXQA 4R3MA 3LPSA 4H81A 2IWSA 2CCUA 4MP2A 2YJXA 1Z5AA 4ASBA 1B63A 4XITA 3ZXOA 2YI7A 4O09A 1YC3A 4E00A 4JQLA 1Y8OA 1THNA 5IDMA 3PEHA 1YETA 3EHFA 4AWOA 4GQTA 3FV5A 4KQVA 4LWFA 1UYMA 4EGKA 2YI6A 3A0RA 3Q5JA 3O2FA 2YEBA 4I5SA 4YKUA 2XDXA 2ESAA 4LP0A 4CWOA 4URMA 2IOPA 1KZNA 3FT5A 4U7OA 4PU9A 1U2OA 4HZ5A 4EGHA 4E02A 4PRVA 2QG2A 3R4MA 4MBCA 2WERA 2WI3A 4QPJA 4AWQA 1TH8A 3IEDA 5F3KA 2XHRA 3EKRA 3CRLA 4FCPA 2YE9A 3OWBA 2BRCA 1I5CA 4URNA 4KP4A 2YE4A 3A0YA 1Z5CA 3B25A 1BYQA 2YKCA 4XKOA 2YE8A 1ZXMA 4CWSA 2XD6A 2YECA 1BKNA 1EI1A 2Q8GA 1YERA 4LWHA 2BTZA 5BODA 3B24A 5IN9A 3BMYA 4V26A 1US7A 3JZ3A 4GEEA 2YEHA 2BU5A 1S14A 4ZVIA 1QY8A 2BREA 2IWUA 5IDJA 1TILA 3TZ4A 4EFUA 4YKXA 3RKZA 2BU7A 1TBWA 1UYFA 3A0XA 3HYYA 3K98A 3HEKA 2VW5A 4MP7A 1I5AA 5FNCA 4O07A 1Z59A 5CTXA 3EHJA 2EXLA 2H55A 1H7UA 2YEFA 2YE2A 1AH8A 4HXWA 5FNFA 4NH7A 3QTFA 3NMQA 4MB9A 4E01A 4FCQA 4XKKA 4EEHA 3A0TA 2XJGA 1GJVA 2JJCA 4WUDA 4YKQA 1AM1A 2JKIA 1YT0A 3C11A 3VADA 1BGQA 3T10A 3T0HA 2YJWA 1GKZA 3HZ5A 4X9LA 5M4PA 3INXA 4L90A 4AS9A 1QZRA 5M4MA 3GIGA 1B62A 4LWEA 4UROA 5FNDA 1I5BA 2XHXA 2UWDA 1UYIA 2PNRA 4R3AA 3D36A 1A4HA 4H7QA 5M4KA 1Y8NA 1NHJA 2XHTA 4U93A 2YKBA 2XDLA 3VHCA 3OPDA 1I58A 2Q2EB 2XDKA 4EMVA 2XX2A 1PVGA 2YK2A 2CGFA 3ZKBA 1R62A 4O05A 3RLPA 2HG1A 2Q8HA 4DUHA 1I5DA 4L8ZA 4LPBA 3Q5LA 2O1VA 1ZWHA 4GT8A 2XDSA 5M4EA 4ZKIA 4CWNA 4EFTA 4EGIA 3T0ZA 2ZDXA 4YKRA 5C93A 3EKOA 4XTJA 3O0IA 2ZBKB 4I3HA 1YC4A 1KIJA 4KTNA 3R4OA 2CH4A 4CWRA 5M4HA 3FT8A 3U2DA 4L94A 4JAVA 4O04A 3OWDA 4XIQA 5CTYA 2E0AA 1Y8PA 2QFOA 3G75A 1B3QA 4CE1A 4XD8A 2BT0A 3MNRP 2FYPA 4CWTA 1YESA 5D7RA 3HYZA 3GIGB 1Z5BA 4L91A 3A0WA 1L0OA 4YKWA 2XCMA 4JAUA 4NH8A 4R1FA 3B28A 3HHUA 4NH9A 3K97A 4FCRA 2WI6A 1NHIA 3WQ9A 2WI5A 4LWGA 4YKZA 1TC0A 4MPNA 1H7SA 2YEEA 4XKAA 2K5BA 2YK9A 1UYCA 4KSGA 3ZM7A 4HZ0A 2YEIA 2VWCA 4ASFA 3TZ0A 2XX5A 4XCJA 5CF0A 5D6PA 1TC6A 4PRXA 2YE3A 4GFNA 2CG9A 3GIFA 3C0EA 1GKXA 2IWXA 4K4OA 3LNUA 1NHHA 1ZXNA 2WI1A 4URLA 3SL2A 4AWPA 4B7PA 5L3JA 1UY7A 4ASGA 3R92A 5D7DA 4BIUA 4YKYA 1TIDA 4CWFA 2XDUA 4O0BA 2XK2A 4XCLA 4HY1A 3B26A 3R4NA 5BOCA 2YGEA 4U7NA 2YEDA 5CTWA 4CE3A 1YSZA 3CWVA 1YT2A 2YI5A 4MPCA 2QG0A 4V25A 2IORA 1Y4SA 4B6CA 1BXDA 1ID0A 4WUBA 2YKJA 1UYGA 2BSMA 2YEGA 3T1KA 4P7AA 3EHGA 3CGZA 4LWIA 2YKIA 1AMWA 1MX0A 2GQPA 3PEJA 2YE7A 2IOQA 4XIPA 2AKPA 1UYLA 2ZKJA 3RLQA 4HY6A 2Q8IA 5CTUA 4JASA 1UY6A 4BAEA 1YT1A 4MOTA 2BU8A 3R4PA 1EA6A 4L93A 4QPKA 5J71A 4Q20A 3TTZA 3DGEA 1AH6A 3QDDA 3A0ZA 5FWKA 4CWPA 4FMTA 4GGLA 3G7EA 3K60A 2C2AA 2XABA 4HYMA 2XX4A 1AJ6A 1I59A 1UY8A 3Q5KA 2YGAA 5J6AA 2BZ5A 3GIEA 2QF6A 3EHHA 4CWQA 3U67A 1UY9A 5D7CA 1JM6A 3D2RA 1UYHA 3U2KA 4ASAA 3H4LA 2WI4A 2YE6A 4YKTA 1MU5A 2WI7A 3G7BA 5D6QA 3T2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCI A;  1UYK A;  3KE6 A;  4PL9 A;  4GCZ A;  2CCS A;  4HYP A;  3TUH A;  2YKE A;  2XJJ A;  2BU2 A;  2HCH A;  4DZY A;  2YEA A;  3CRK A;  2XJX A;  4MPE A;  4XIR A;  3B27 A;  2WEP A;  3CGY A;  3RLR A;  3VHA A;  2O1W A;  2ZDY A;  5GGZ A;  3WHA A;  2GFD A;  1YC1 A;  5CPH A;  3TZ2 A;  2FWZ A;  3HZ1 A;  2BU6 A;  1Y4U A;  1UYE A;  3O6O A;  3TZ5 A;  3INW A;  4XE2 A;  4BQJ A;  4BIZ A;  2Q8F A;  4BQG A;  1OSF A;  3H80 A;  4H85 A;  2YEJ A;  2BYH A;  2FWY A;  3D0B A;  4FPP A;  3R91 A;  1YS3 A;  3K99 A;  2YE5 A;  4WUC A;  5M4N A;  1U0Z A;  3ZKD A;  3BM9 A;  4P8O A;  3OMU A;  4XDM A;  2BYI A;  2O1U A;  4XC0 A;  4HXZ A;  1S16 A;  3VHD A;  3OW6 A;  2HKJ A;  4KSH A;  2YGF A;  4BXI A;  1ZW9 A;  4KFG A;  1QYE A;  2FXS A;  2WEQ A;  2CCT A;  4CE2 A;  1UYD A;  1YSR A;  2H8M A;  5F5R A;  2YI0 A;  2VCJ A;  2WI2 A;  4EM7 A;  4W7T A;  3ZXQ A;  4R3M A;  3LPS A;  4H81 A;  2IWS A;  2CCU A;  4MP2 A;  2YJX A;  1Z5A A;  4ASB A;  1B63 A;  4XIT A;  3ZXO A;  2YI7 A;  4O09 A;  1YC3 A;  4E00 A;  4JQL A;  1Y8O A;  1THN A;  5IDM A;  3PEH A;  1YET A;  3EHF A;  4AWO A;  4GQT A;  3FV5 A;  4KQV A;  4LWF A;  1UYM A;  4EGK A;  2YI6 A;  3A0R A;  3Q5J A;  3O2F A;  2YEB A;  4I5S A;  4YKU A;  2XDX A;  2ESA A;  4LP0 A;  4CWO A;  4URM A;  2IOP A;  1KZN A;  3FT5 A;  4U7O A;  4PU9 A;  1U2O A;  4HZ5 A;  4EGH A;  4E02 A;  4PRV A;  2QG2 A;  3R4M A;  4MBC A;  2WER A;  2WI3 A;  4QPJ A;  4AWQ A;  1TH8 A;  3IED A;  5F3K A;  2XHR A;  3EKR A;  3CRL A;  4FCP A;  2YE9 A;  3OWB A;  2BRC A;  1I5C A;  4URN A;  4KP4 A;  2YE4 A;  3A0Y A;  1Z5C A;  3B25 A;  1BYQ A;  2YKC A;  4XKO A;  2YE8 A;  1ZXM A;  4CWS A;  2XD6 A;  2YEC A;  1BKN A;  1EI1 A;  2Q8G A;  1YER A;  4LWH A;  2BTZ A;  5BOD A;  3B24 A;  5IN9 A;  3BMY A;  4V26 A;  1US7 A;  3JZ3 A;  4GEE A;  2YEH A;  2BU5 A;  1S14 A;  4ZVI A;  1QY8 A;  2BRE A;  2IWU A;  5IDJ A;  1TIL A;  3TZ4 A;  4EFU A;  4YKX A;  3RKZ A;  2BU7 A;  1TBW A;  1UYF A;  3A0X A;  3HYY A;  3K98 A;  3HEK A;  2VW5 A;  4MP7 A;  1I5A A;  5FNC A;  4O07 A;  1Z59 A;  5CTX A;  3EHJ A;  2EXL A;  2H55 A;  1H7U A;  2YEF A;  2YE2 A;  1AH8 A;  4HXW A;  5FNF A;  4NH7 A;  3QTF A;  3NMQ A;  4MB9 A;  4E01 A;  4FCQ A;  4XKK A;  4EEH A;  3A0T A;  2XJG A;  1GJV A;  2JJC A;  4WUD A;  4YKQ A;  1AM1 A;  2JKI A;  1YT0 A;  3C11 A;  3VAD A;  1BGQ A;  3T10 A;  3T0H A;  2YJW A;  1GKZ A;  3HZ5 A;  4X9L A;  5M4P A;  3INX A;  4L90 A;  4AS9 A;  1QZR A;  5M4M A;  3GIG A;  1B62 A;  4LWE A;  4URO A;  5FND A;  1I5B A;  2XHX A;  2UWD A;  1UYI A;  2PNR A;  4R3A A;  3D36 A;  1A4H A;  4H7Q A;  5M4K A;  1Y8N A;  1NHJ A;  2XHT A;  4U93 A;  2YKB A;  2XDL A;  3VHC A;  3OPD A;  1I58 A;  2Q2E B;  2XDK A;  4EMV A;  2XX2 A;  1PVG A;  2YK2 A;  2CGF A;  3ZKB A;  1R62 A;  4O05 A;  3RLP A;  2HG1 A;  2Q8H A;  4DUH A;  1I5D A;  4L8Z A;  4LPB A;  3Q5L A;  2O1V A;  1ZWH A;  4GT8 A;  2XDS A;  5M4E A;  4ZKI A;  4CWN A;  4EFT A;  4EGI A;  3T0Z A;  2ZDX A;  4YKR A;  5C93 A;  3EKO A;  4XTJ A;  3O0I A;  2ZBK B;  4I3H A;  1YC4 A;  1KIJ A;  4KTN A;  3R4O A;  2CH4 A;  4CWR A;  5M4H A;  3FT8 A;  3U2D A;  4L94 A;  4JAV A;  4O04 A;  3OWD A;  4XIQ A;  5CTY A;  2E0A A;  1Y8P A;  2QFO A;  3G75 A;  1B3Q A;  4CE1 A;  4XD8 A;  2BT0 A;  3MNR P;  2FYP A;  4CWT A;  1YES A;  5D7R A;  3HYZ A;  3GIG B;  1Z5B A;  4L91 A;  3A0W A;  1L0O A;  4YKW A;  2XCM A;  4JAU A;  4NH8 A;  4R1F A;  3B28 A;  3HHU A;  4NH9 A;  3K97 A;  4FCR A;  2WI6 A;  1NHI A;  3WQ9 A;  2WI5 A;  4LWG A;  4YKZ A;  1TC0 A;  4MPN A;  1H7S A;  2YEE A;  4XKA A;  2K5B A;  2YK9 A;  1UYC A;  4KSG A;  3ZM7 A;  4HZ0 A;  2YEI A;  2VWC A;  4ASF A;  3TZ0 A;  2XX5 A;  4XCJ A;  5CF0 A;  5D6P A;  1TC6 A;  4PRX A;  2YE3 A;  4GFN A;  2CG9 A;  3GIF A;  3C0E A;  1GKX A;  2IWX A;  4K4O A;  3LNU A;  1NHH A;  1ZXN A;  2WI1 A;  4URL A;  3SL2 A;  4AWP A;  4B7P A;  5L3J A;  1UY7 A;  4ASG A;  3R92 A;  5D7D A;  4BIU A;  4YKY A;  1TID A;  4CWF A;  2XDU A;  4O0B A;  2XK2 A;  4XCL A;  4HY1 A;  3B26 A;  3R4N A;  5BOC A;  2YGE A;  4U7N A;  2YED A;  5CTW A;  4CE3 A;  1YSZ A;  3CWV A;  1YT2 A;  2YI5 A;  4MPC A;  2QG0 A;  4V25 A;  2IOR A;  1Y4S A;  4B6C A;  1BXD A;  1ID0 A;  4WUB A;  2YKJ A;  1UYG A;  2BSM A;  2YEG A;  3T1K A;  4P7A A;  3EHG A;  3CGZ A;  4LWI A;  2YKI A;  1AMW A;  1MX0 A;  2GQP A;  3PEJ A;  2YE7 A;  2IOQ A;  4XIP A;  2AKP A;  1UYL A;  2ZKJ A;  3RLQ A;  4HY6 A;  2Q8I A;  5CTU A;  4JAS A;  1UY6 A;  4BAE A;  1YT1 A;  4MOT A;  2BU8 A;  3R4P A;  1EA6 A;  4L93 A;  4QPK A;  5J71 A;  4Q20 A;  3TTZ A;  3DGE A;  1AH6 A;  3QDD A;  3A0Z A;  5FWK A;  4CWP A;  4FMT A;  4GGL A;  3G7E A;  3K60 A;  2C2A A;  2XAB A;  4HYM A;  2XX4 A;  1AJ6 A;  1I59 A;  1UY8 A;  3Q5K A;  2YGA A;  5J6A A;  2BZ5 A;  3GIE A;  2QF6 A;  3EHH A;  4CWQ A;  3U67 A;  1UY9 A;  5D7C A;  1JM6 A;  3D2R A;  1UYH A;  3U2K A;  4ASA A;  3H4L A;  2WI4 A;  2YE6 A;  4YKT A;  1MU5 A;  2WI7 A;  3G7B A;  5D6Q A;  3T2S A; 
#chains in the Genus database with same CATH topology
 2VCI A;  1UYK A;  3KE6 A;  4PL9 A;  4GCZ A;  5JEN A;  2CCS A;  4HYP A;  3TUH A;  2YKE A;  2XJJ A;  2BU2 A;  2HCH A;  4DZY A;  2YEA A;  3CRK A;  2XJX A;  4MPE A;  4XIR A;  3B27 A;  2WEP A;  3CGY A;  3RLR A;  3VHA A;  2O1W A;  2ZDY A;  5GGZ A;  3WHA A;  2GFD A;  1YC1 A;  5CPH A;  3TZ2 A;  2FWZ A;  3HZ1 A;  2BU6 A;  1Y4U A;  1UYE A;  3O6O A;  3TZ5 A;  3INW A;  4E72 A;  4XE2 A;  4BQJ A;  4BIZ A;  2Q8F A;  4BQG A;  1OSF A;  3H80 A;  4H85 A;  2YEJ A;  2BYH A;  2FWY A;  3D0B A;  4FPP A;  3R91 A;  1YS3 A;  3K99 A;  2YE5 A;  4WUC A;  5M4N A;  1U0Z A;  3ZKD A;  3BM9 A;  4P8O A;  3OMU A;  4XDM A;  2BYI A;  2O1U A;  4XC0 A;  4HXZ A;  1S16 A;  3VHD A;  3OW6 A;  2HKJ A;  4KSH A;  2YGF A;  4BXI A;  1ZW9 A;  4KFG A;  1QYE A;  2FXS A;  2WEQ A;  2CCT A;  4CE2 A;  1UYD A;  1YSR A;  2H8M A;  5F5R A;  2YI0 A;  2VCJ A;  2WI2 A;  4EM7 A;  4W7T A;  3ZXQ A;  4R3M A;  3LPS A;  4H81 A;  2IWS A;  2CCU A;  4MP2 A;  2YJX A;  1Z5A A;  4ASB A;  1B63 A;  4XIT A;  3ZXO A;  2YI7 A;  4O09 A;  1YC3 A;  4E00 A;  4JQL A;  1Y8O A;  1THN A;  5IDM A;  3PEH A;  1YET A;  3EHF A;  4AWO A;  4GQT A;  3FV5 A;  4KQV A;  4LWF A;  1UYM A;  4EGK A;  2YI6 A;  3A0R A;  3Q5J A;  3O2F A;  2YEB A;  4I5S A;  4YKU A;  2XDX A;  2ESA A;  4LP0 A;  4CWO A;  4URM A;  2IOP A;  1KZN A;  3FT5 A;  4U7O A;  4PU9 A;  1U2O A;  4HZ5 A;  4EGH A;  4E02 A;  4PRV A;  2QG2 A;  3R4M A;  4MBC A;  2WER A;  2WI3 A;  4QPJ A;  4AWQ A;  1TH8 A;  3IED A;  5F3K A;  2XHR A;  3EKR A;  3CRL A;  4FCP A;  2YE9 A;  3OWB A;  2BRC A;  1I5C A;  4URN A;  4KP4 A;  2YE4 A;  3A0Y A;  1Z5C A;  3B25 A;  1BYQ A;  2YKC A;  4XKO A;  2YE8 A;  1ZXM A;  4CWS A;  2XD6 A;  2YEC A;  1BKN A;  1EI1 A;  2Q8G A;  1YER A;  4LWH A;  2BTZ A;  5BOD A;  3B24 A;  5IN9 A;  3BMY A;  4V26 A;  1US7 A;  3JZ3 A;  4GEE A;  2YEH A;  2BU5 A;  1S14 A;  4ZVI A;  1QY8 A;  2BRE A;  2IWU A;  3CYG A;  5IDJ A;  1TIL A;  3TZ4 A;  4EFU A;  4YKX A;  3RKZ A;  2BU7 A;  1TBW A;  1UYF A;  3A0X A;  3HYY A;  3K98 A;  3HEK A;  2VW5 A;  4MP7 A;  1I5A A;  5FNC A;  4O07 A;  1Z59 A;  5CTX A;  3EHJ A;  2EXL A;  2H55 A;  1H7U A;  2YEF A;  2YE2 A;  1AH8 A;  4HXW A;  5FNF A;  4NH7 A;  3QTF A;  3NMQ A;  4MB9 A;  4E01 A;  4FCQ A;  4XKK A;  4EEH A;  3A0T A;  2XJG A;  1GJV A;  2JJC A;  4WUD A;  4YKQ A;  1AM1 A;  2JKI A;  1YT0 A;  3C11 A;  3VAD A;  1BGQ A;  3T10 A;  3T0H A;  2YJW A;  1GKZ A;  3HZ5 A;  4X9L A;  5M4P A;  3INX A;  4L90 A;  4AS9 A;  1QZR A;  5M4M A;  3GIG A;  1B62 A;  4LWE A;  4URO A;  5FND A;  1I5B A;  2XHX A;  2UWD A;  1UYI A;  2PNR A;  4R3A A;  3D36 A;  1A4H A;  4H7Q A;  5M4K A;  1Y8N A;  3LMM A;  1NHJ A;  2XHT A;  4U93 A;  2YKB A;  2XDL A;  3VHC A;  3OPD A;  1I58 A;  2Q2E B;  2XDK A;  4EMV A;  2XX2 A;  1PVG A;  2YK2 A;  2CGF A;  3ZKB A;  1R62 A;  4O05 A;  3RLP A;  2HG1 A;  2Q8H A;  4DUH A;  1I5D A;  4L8Z A;  4LPB A;  2HHI A;  3Q5L A;  2O1V A;  1ZWH A;  4GT8 A;  2XDS A;  5M4E A;  4ZKI A;  4CWN A;  4EFT A;  4EGI A;  3T0Z A;  2ZDX A;  4YKR A;  5C93 A;  3EKO A;  4XTJ A;  3O0I A;  2ZBK B;  4I3H A;  1YC4 A;  1KIJ A;  1IXM A;  4KTN A;  3R4O A;  2CH4 A;  4CWR A;  5M4H A;  3FT8 A;  3U2D A;  4L94 A;  4JAV A;  4O04 A;  3OWD A;  4XIQ A;  5CTY A;  2E0A A;  1Y8P A;  2QFO A;  3G75 A;  1B3Q A;  4CE1 A;  4XD8 A;  2BT0 A;  3MNR P;  2FYP A;  4CWT A;  1YES A;  2C1I A;  5D7R A;  3HYZ A;  3GIG B;  1Z5B A;  2FTK A;  4L91 A;  3A0W A;  1L0O A;  4YKW A;  2XCM A;  4JAU A;  4NH8 A;  4R1F A;  3B28 A;  3HHU A;  4NH9 A;  3K97 A;  4FCR A;  2WI6 A;  1NHI A;  3WQ9 A;  2WI5 A;  4LWG A;  4YKZ A;  1TC0 A;  4MPN A;  1H7S A;  2YEE A;  4XKA A;  2K5B A;  2YK9 A;  1UYC A;  4KSG A;  3ZM7 A;  4HZ0 A;  2YEI A;  2VWC A;  4ASF A;  3TZ0 A;  2XX5 A;  4XCJ A;  5CF0 A;  5D6P A;  1TC6 A;  4PRX A;  2YE3 A;  4GFN A;  2CG9 A;  3GIF A;  3C0E A;  1GKX A;  2IWX A;  4K4O A;  3LNU A;  1NHH A;  1ZXN A;  2WI1 A;  4URL A;  3SL2 A;  4AWP A;  4B7P A;  5L3J A;  1UY7 A;  4ASG A;  3R92 A;  5D7D A;  4BIU A;  4YKY A;  1TID A;  2C1G A;  4CWF A;  2XDU A;  4O0B A;  2XK2 A;  4XCL A;  4HY1 A;  3B26 A;  3R4N A;  5BOC A;  2YGE A;  4U7N A;  2YED A;  5CTW A;  4CE3 A;  1YSZ A;  3CWV A;  1YT2 A;  2YI5 A;  4MPC A;  2QG0 A;  4V25 A;  2IOR A;  1Y4S A;  4B6C A;  1BXD A;  1ID0 A;  4WUB A;  2YKJ A;  1UYG A;  2BSM A;  2YEG A;  3T1K A;  4P7A A;  3EHG A;  3S5T A;  3CGZ A;  4LWI A;  2YKI A;  1AMW A;  1MX0 A;  2GQP A;  3PEJ A;  2YE7 A;  2IOQ A;  4XIP A;  2AKP A;  1UYL A;  2ZKJ A;  1F51 A;  3RLQ A;  4HY6 A;  2Q8I A;  5CTU A;  4JAS A;  1UY6 A;  4BAE A;  1YT1 A;  4MOT A;  2BU8 A;  3R4P A;  1EA6 A;  4L93 A;  4QPK A;  5J71 A;  4Q20 A;  3TTZ A;  3DGE A;  1AH6 A;  3QDD A;  3A0Z A;  5FWK A;  4CWP A;  4FMT A;  4GGL A;  3G7E A;  3K60 A;  2C2A A;  2XAB A;  4HYM A;  2XX4 A;  1AJ6 A;  1I59 A;  1UY8 A;  3Q5K A;  2YGA A;  5J6A A;  2BZ5 A;  3GIE A;  2QF6 A;  3EHH A;  4CWQ A;  3U67 A;  1UY9 A;  5D7C A;  1JM6 A;  3D2R A;  1UYH A;  3U2K A;  4ASA A;  3H4L A;  2WI4 A;  2YE6 A;  4YKT A;  1MU5 A;  2WI7 A;  3G7B A;  5D6Q A;  3T2S A; 
#chains in the Genus database with same CATH homology
 2VCI A;  1UYK A;  3KE6 A;  4PL9 A;  4GCZ A;  2CCS A;  4HYP A;  3TUH A;  2YKE A;  2XJJ A;  2BU2 A;  2HCH A;  4DZY A;  2YEA A;  3CRK A;  2XJX A;  4MPE A;  4XIR A;  3B27 A;  2WEP A;  3CGY A;  3RLR A;  3VHA A;  2O1W A;  2ZDY A;  5GGZ A;  3WHA A;  2GFD A;  1YC1 A;  5CPH A;  3TZ2 A;  2FWZ A;  3HZ1 A;  2BU6 A;  1Y4U A;  1UYE A;  3O6O A;  3TZ5 A;  3INW A;  4XE2 A;  4BQJ A;  4BIZ A;  2Q8F A;  4BQG A;  1OSF A;  3H80 A;  4H85 A;  2YEJ A;  2BYH A;  2FWY A;  3D0B A;  4FPP A;  3R91 A;  1YS3 A;  3K99 A;  2YE5 A;  4WUC A;  5M4N A;  1U0Z A;  3ZKD A;  3BM9 A;  4P8O A;  3OMU A;  4XDM A;  2BYI A;  2O1U A;  4XC0 A;  4HXZ A;  1S16 A;  3VHD A;  3OW6 A;  2HKJ A;  4KSH A;  2YGF A;  4BXI A;  1ZW9 A;  4KFG A;  1QYE A;  2FXS A;  2WEQ A;  2CCT A;  4CE2 A;  1UYD A;  1YSR A;  2H8M A;  5F5R A;  2YI0 A;  2VCJ A;  2WI2 A;  4EM7 A;  4W7T A;  3ZXQ A;  4R3M A;  3LPS A;  4H81 A;  2IWS A;  2CCU A;  4MP2 A;  2YJX A;  1Z5A A;  4ASB A;  1B63 A;  4XIT A;  3ZXO A;  2YI7 A;  4O09 A;  1YC3 A;  4E00 A;  4JQL A;  1Y8O A;  1THN A;  5IDM A;  3PEH A;  1YET A;  3EHF A;  4AWO A;  4GQT A;  3FV5 A;  4KQV A;  4LWF A;  1UYM A;  4EGK A;  2YI6 A;  3A0R A;  3Q5J A;  3O2F A;  2YEB A;  4I5S A;  4YKU A;  2XDX A;  2ESA A;  4LP0 A;  4CWO A;  4URM A;  2IOP A;  1KZN A;  3FT5 A;  4U7O A;  4PU9 A;  1U2O A;  4HZ5 A;  4EGH A;  4E02 A;  4PRV A;  2QG2 A;  3R4M A;  4MBC A;  2WER A;  2WI3 A;  4QPJ A;  4AWQ A;  1TH8 A;  3IED A;  5F3K A;  2XHR A;  3EKR A;  3CRL A;  4FCP A;  2YE9 A;  3OWB A;  2BRC A;  1I5C A;  4URN A;  4KP4 A;  2YE4 A;  3A0Y A;  1Z5C A;  3B25 A;  1BYQ A;  2YKC A;  4XKO A;  2YE8 A;  1ZXM A;  4CWS A;  2XD6 A;  2YEC A;  1BKN A;  1EI1 A;  2Q8G A;  1YER A;  4LWH A;  2BTZ A;  5BOD A;  3B24 A;  5IN9 A;  3BMY A;  4V26 A;  1US7 A;  3JZ3 A;  4GEE A;  2YEH A;  2BU5 A;  1S14 A;  4ZVI A;  1QY8 A;  2BRE A;  2IWU A;  5IDJ A;  1TIL A;  3TZ4 A;  4EFU A;  4YKX A;  3RKZ A;  2BU7 A;  1TBW A;  1UYF A;  3A0X A;  3HYY A;  3K98 A;  3HEK A;  2VW5 A;  4MP7 A;  1I5A A;  5FNC A;  4O07 A;  1Z59 A;  5CTX A;  3EHJ A;  2EXL A;  2H55 A;  1H7U A;  2YEF A;  2YE2 A;  1AH8 A;  4HXW A;  5FNF A;  4NH7 A;  3QTF A;  3NMQ A;  4MB9 A;  4E01 A;  4FCQ A;  4XKK A;  4EEH A;  3A0T A;  2XJG A;  1GJV A;  2JJC A;  4WUD A;  4YKQ A;  1AM1 A;  2JKI A;  1YT0 A;  3C11 A;  3VAD A;  1BGQ A;  3T10 A;  3T0H A;  2YJW A;  1GKZ A;  3HZ5 A;  4X9L A;  5M4P A;  3INX A;  4L90 A;  4AS9 A;  1QZR A;  5M4M A;  3GIG A;  1B62 A;  4LWE A;  4URO A;  5FND A;  1I5B A;  2XHX A;  2UWD A;  1UYI A;  2PNR A;  4R3A A;  3D36 A;  1A4H A;  4H7Q A;  5M4K A;  1Y8N A;  1NHJ A;  2XHT A;  4U93 A;  2YKB A;  2XDL A;  3VHC A;  3OPD A;  1I58 A;  2Q2E B;  2XDK A;  4EMV A;  2XX2 A;  1PVG A;  2YK2 A;  2CGF A;  3ZKB A;  1R62 A;  4O05 A;  3RLP A;  2HG1 A;  2Q8H A;  4DUH A;  1I5D A;  4L8Z A;  4LPB A;  3Q5L A;  2O1V A;  1ZWH A;  4GT8 A;  2XDS A;  5M4E A;  4ZKI A;  4CWN A;  4EFT A;  4EGI A;  3T0Z A;  2ZDX A;  4YKR A;  5C93 A;  3EKO A;  4XTJ A;  3O0I A;  2ZBK B;  4I3H A;  1YC4 A;  1KIJ A;  4KTN A;  3R4O A;  2CH4 A;  4CWR A;  5M4H A;  3FT8 A;  3U2D A;  4L94 A;  4JAV A;  4O04 A;  3OWD A;  4XIQ A;  5CTY A;  2E0A A;  1Y8P A;  2QFO A;  3G75 A;  1B3Q A;  4CE1 A;  4XD8 A;  2BT0 A;  3MNR P;  2FYP A;  4CWT A;  1YES A;  5D7R A;  3HYZ A;  3GIG B;  1Z5B A;  4L91 A;  3A0W A;  1L0O A;  4YKW A;  2XCM A;  4JAU A;  4NH8 A;  4R1F A;  3B28 A;  3HHU A;  4NH9 A;  3K97 A;  4FCR A;  2WI6 A;  1NHI A;  3WQ9 A;  2WI5 A;  4LWG A;  4YKZ A;  1TC0 A;  4MPN A;  1H7S A;  2YEE A;  4XKA A;  2K5B A;  2YK9 A;  1UYC A;  4KSG A;  3ZM7 A;  4HZ0 A;  2YEI A;  2VWC A;  4ASF A;  3TZ0 A;  2XX5 A;  4XCJ A;  5CF0 A;  5D6P A;  1TC6 A;  4PRX A;  2YE3 A;  4GFN A;  2CG9 A;  3GIF A;  3C0E A;  1GKX A;  2IWX A;  4K4O A;  3LNU A;  1NHH A;  1ZXN A;  2WI1 A;  4URL A;  3SL2 A;  4AWP A;  4B7P A;  5L3J A;  1UY7 A;  4ASG A;  3R92 A;  5D7D A;  4BIU A;  4YKY A;  1TID A;  4CWF A;  2XDU A;  4O0B A;  2XK2 A;  4XCL A;  4HY1 A;  3B26 A;  3R4N A;  5BOC A;  2YGE A;  4U7N A;  2YED A;  5CTW A;  4CE3 A;  1YSZ A;  3CWV A;  1YT2 A;  2YI5 A;  4MPC A;  2QG0 A;  4V25 A;  2IOR A;  1Y4S A;  4B6C A;  1BXD A;  1ID0 A;  4WUB A;  2YKJ A;  1UYG A;  2BSM A;  2YEG A;  3T1K A;  4P7A A;  3EHG A;  3CGZ A;  4LWI A;  2YKI A;  1AMW A;  1MX0 A;  2GQP A;  3PEJ A;  2YE7 A;  2IOQ A;  4XIP A;  2AKP A;  1UYL A;  2ZKJ A;  3RLQ A;  4HY6 A;  2Q8I A;  5CTU A;  4JAS A;  1UY6 A;  4BAE A;  1YT1 A;  4MOT A;  2BU8 A;  3R4P A;  1EA6 A;  4L93 A;  4QPK A;  5J71 A;  4Q20 A;  3TTZ A;  3DGE A;  1AH6 A;  3QDD A;  3A0Z A;  5FWK A;  4CWP A;  4FMT A;  4GGL A;  3G7E A;  3K60 A;  2C2A A;  2XAB A;  4HYM A;  2XX4 A;  1AJ6 A;  1I59 A;  1UY8 A;  3Q5K A;  2YGA A;  5J6A A;  2BZ5 A;  3GIE A;  2QF6 A;  3EHH A;  4CWQ A;  3U67 A;  1UY9 A;  5D7C A;  1JM6 A;  3D2R A;  1UYH A;  3U2K A;  4ASA A;  3H4L A;  2WI4 A;  2YE6 A;  4YKT A;  1MU5 A;  2WI7 A;  3G7B A;  5D6Q A;  3T2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...