3G75A

Crystal structure of staphylococcus aureus gyrase b co-complexed with 4-methyl-5-[3-(methylsulfanyl)-1h-pyrazol-5-yl]-2-thiophen-2-yl-1,3-thiazole inhibitor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
184
Chain Sequence
b'GLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Discovery of pyrazolthiazoles as novel and potent inhibitors of bacterial gyrase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
total genus 50
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3g75A00
1S14A 1YC1A 2WI7A 4XKKA 5BOCA 3RKZA 4CWQA 1ZWHA 4W7TA 1BXDA 2CG9A 2YECA 5IN9A 1UY8A 2WI1A 5J6AA 2AKPA 3U2KA 1TIDA 3GIGB 1BKNA 1TC0A 4CE3A 2HG1A 2WI3A 4BIUA 5D6QA 4XTJA 4JAVA 1Y4UA 4GEEA 3OWBA 3B25A 2VCJA 1ZW9A 4WUBA 2Q8HA 4V26A 5GGZA 2Q8FA 4HYMA 1I59A 4CE2A 2IORA 5CTYA 4ASGA 4ASAA 1YC4A 4HY1A 1ZXNA 4P7AA 3PEJA 1Y4SA 1ZXMA 4R1FA 2XABA 3HHUA 3HZ1A 1UYEA 2VCIA 2E0AA 3D36A 4KQVA 1TBWA 4NH7A 4LWHA 4GFNA 3EHHA 1YSZA 2K5BA 4L93A 4CE1A 3D2RA 1YT1A 2WERA 3JZ3A 2YGEA 1UY6A 4B7PA 1BGQA 2O1VA 4CWOA 4AWOA 4DUHA 4KSHA 1R62A 2QG2A 4GT8A 3A0ZA 4U7OA 3B28A 2YJWA 1Z5BA 4Q20A 1UYGA 2YEFA 2ZDYA 4PRVA 1UYFA 2XD6A 2YE7A 3GIGA 2EXLA 3MNRP 4LP0A 3HEKA 1I5DA 4XC0A 4XIQA 1UYKA 4YKQA 1UYIA 4AWPA 4DZYA 2O1UA 3TZ0A 4P8OA 3T1KA 4LWEA 1Z59A 4EMVA 4XD8A 2QFOA 1B63A 2YK2A 2YKJA 3LPSA 3CGYA 3O0IA 1AJ6A 4WUCA 3C0EA 4BQGA 2O1WA 5M4KA 2YJXA 3T10A 3TTZA 2XDKA 2WI6A 2YKIA 4XCLA 3Q5JA 2YI6A 2YK9A 3U2DA 3A0WA 2XDXA 1UYCA 3CGZA 4CWTA 2YE6A 3CRKA 3T2SA 1YS3A 4O0BA 1UYMA 2H8MA 3EHFA 2WEPA 3R4OA 2GQPA 3R91A 3VADA 2PNRA 4K4OA 4HXWA 4QPJA 4EFTA 2Q8IA 1AMWA 3VHAA 4O04A 4YKXA 4PL9A 5D7DA 5F5RA 4WUDA 1H7UA 2XJXA 3DGEA 4HY6A 1U0ZA 4I5SA 1A4HA 3OMUA 3O2FA 4EGHA 4URLA 2WI2A 3CWVA 2HCHA 2YE5A 3SL2A 1L0OA 2XX2A 3VHDA 4H7QA 1Y8NA 2FWYA 2IWUA 3H80A 1YT2A 4PRXA 3T0ZA 4MB9A 3K60A 2C2AA 3OWDA 3H4LA 2YEHA 3LNUA 1KIJA 2XCMA 3U67A 2XX5A 4LWGA 2YI7A 4FMTA 4CWFA 2UWDA 5FNFA 2VW5A 2YE9A 4XE2A 5BODA 2ZDXA 4XIPA 2YEIA 4EGIA 2CCTA 1AH8A 4BAEA 2BU7A 4JQLA 2FWZA 1MU5A 1PVGA 3QDDA 2Q2EB 2YI5A 3C11A 2CGFA 1B3QA 3HZ5A 4XKOA 3B24A 2IWSA 2Q8GA 1QYEA 1Z5CA 4NH9A 3CRLA 4I3HA 4L8ZA 1NHJA 2XJJA 4AWQA 2YE8A 4XDMA 1OSFA 3ZKBA 2YEAA 4KFGA 2ZKJA 1Y8PA 3A0RA 3FT5A 1I5BA 3K98A 1UY7A 2XX4A 3A0TA 2ESAA 4UROA 4U93A 3HYZA 3ZXOA 1B62A 2BYHA 5FNDA 3B27A 3INWA 4O07A 4E01A 4GQTA 4LWFA 4GGLA 2XHRA 3WHAA 3TZ4A 4HYPA 5M4PA 2YE4A 3QTFA 2QG0A 5L3JA 4O05A 3ZKDA 1TH8A 4KP4A 2CCSA 1AM1A 4MP7A 4ZVIA 5M4EA 3O6OA 2YGFA 4L90A 5CTWA 2WEQA 3EKOA 2IOPA 2YEGA 4JAUA 2H55A 1UYLA 2BT0A 1TC6A 2BU5A 1YETA 2WI5A 4CWRA 4L91A 3FT8A 1QZRA 5D7CA 4MP2A 2GFDA 3KE6A 4MPEA 2XK2A 3VHCA 5CTUA 4FCRA 3WQ9A 2XDUA 2BU8A 1ID0A 4FCQA 1UYDA 3ZXQA 1GKXA 4YKUA 1NHHA 2BSMA 3GIEA 2CCUA 2JKIA 1EA6A 2HKJA 4H81A 4XCJA 4MPNA 3A0XA 1QY8A 5F3KA 2YKEA 1AH6A 1YSRA 4V25A 4H85A 4JASA 3G7BA 2XHTA 2JJCA 3G75A 4ZKIA 5M4MA 1I58A 3R4PA 3Q5LA 3RLQA 4XIRA 4YKWA 4R3AA 3R92A 5J71A 3NMQA 2YGAA 3R4NA 2BZ5A 1MX0A 2FYPA 4BQJA 3EKRA 2YKBA 4MBCA 1TILA 1BYQA 1YT0A 3TZ5A 1THNA 4YKRA 4U7NA 2VWCA 3IEDA 1GJVA 4ASFA 5CF0A 3K97A 4EEHA 3B26A 2XDLA 5M4HA 3BMYA 2XDSA 4CWPA 2CH4A 5IDMA 3D0BA 2YE3A 4NH8A 5CTXA 3TUHA 2YEEA 4YKYA 3EHJA 4YKTA 2WI4A 4L94A 4R3MA 1KZNA 4URNA 5D6PA 2BTZA 4HZ5A 4LWIA 3RLRA 3ZM7A 3TZ2A 4BXIA 4KTNA 4X9LA 2QF6A 1YERA 5M4NA 2BREA 4BIZA 5IDJA 5C93A 3OPDA 4ASBA 1Z5AA 4E02A 4EM7A 1I5AA 2XHXA 4CWNA 3INXA 4FCPA 4PU9A 4FPPA 3OW6A 4E00A 1GKZA 4YKZA 2BU6A 4EFUA 4HXZA 2YKCA 4MPCA 2BRCA 2IOQA 3K99A 3R4MA 4LPBA 2FXSA 1US7A 1YESA 1I5CA 3FV5A 2YE2A 2YEJA 1JM6A 2IWXA 1Y8OA 1U2OA 3PEHA 4GCZA 3EHGA 5CPHA 1UYHA 1S16A 3BM9A 2YI0A 4XITA 1H7SA 4QPKA 2XJGA 3Q5KA 4KSGA 1NHIA 1UY9A 5D7RA 2BYIA 3GIFA 2YEDA 4O09A 4AS9A 4XKAA 3RLPA 3T0HA 1EI1A 5FNCA 4CWSA 5FWKA 4HZ0A 4EGKA 2BU2A 3HYYA 1YC3A 4B6CA 4MOTA 3G7EA 3A0YA 4URMA 2YEBA 2ZBKB
chains in the Genus database with same CATH superfamily
1S14A 1YC1A 2WI7A 4XKKA 5BOCA 3RKZA 4CWQA 1ZWHA 4W7TA 1BXDA 2CG9A 2YECA 5IN9A 1UY8A 2WI1A 5J6AA 2AKPA 3U2KA 1TIDA 3GIGB 1BKNA 1TC0A 4CE3A 2HG1A 2WI3A 4BIUA 5D6QA 1F51A 4XTJA 4JAVA 1Y4UA 4GEEA 3OWBA 3B25A 2VCJA 1ZW9A 4WUBA 2Q8HA 4V26A 5GGZA 2Q8FA 4HYMA 1I59A 4CE2A 2IORA 5CTYA 4ASGA 4ASAA 1YC4A 4HY1A 1ZXNA 4P7AA 3PEJA 1Y4SA 1ZXMA 4R1FA 2XABA 3HHUA 3HZ1A 1UYEA 2VCIA 2E0AA 3D36A 4KQVA 1TBWA 4NH7A 4LWHA 4GFNA 3EHHA 1YSZA 2K5BA 4L93A 4CE1A 3D2RA 1YT1A 2WERA 3JZ3A 2YGEA 1UY6A 4B7PA 1BGQA 2O1VA 4CWOA 4AWOA 4DUHA 4KSHA 1R62A 2QG2A 4GT8A 3A0ZA 4U7OA 3B28A 2YJWA 1Z5BA 4Q20A 1UYGA 2YEFA 2ZDYA 4PRVA 1UYFA 2XD6A 2YE7A 3GIGA 2EXLA 3MNRP 4LP0A 3HEKA 1I5DA 4XC0A 4XIQA 1UYKA 4YKQA 1UYIA 4AWPA 4DZYA 2O1UA 3TZ0A 4P8OA 3T1KA 2HHIA 4LWEA 1Z59A 4EMVA 4XD8A 2QFOA 1B63A 2YK2A 2FTKA 2YKJA 3LPSA 3CGYA 3O0IA 1AJ6A 4WUCA 3C0EA 4BQGA 2O1WA 5M4KA 2YJXA 3T10A 3TTZA 2XDKA 2WI6A 2YKIA 4XCLA 3Q5JA 2YI6A 2YK9A 3U2DA 3A0WA 2XDXA 1UYCA 3CGZA 4CWTA 2YE6A 3CRKA 3T2SA 1YS3A 4O0BA 1UYMA 2H8MA 3EHFA 2WEPA 3R4OA 2GQPA 3R91A 3VADA 2PNRA 4K4OA 4HXWA 4QPJA 4EFTA 2Q8IA 1AMWA 3VHAA 4O04A 3S5TA 4YKXA 4PL9A 5D7DA 5F5RA 2C1GA 4WUDA 1H7UA 2XJXA 3DGEA 4HY6A 1U0ZA 4I5SA 1A4HA 3OMUA 3O2FA 4EGHA 4URLA 2WI2A 3CWVA 2HCHA 2YE5A 3SL2A 1L0OA 2XX2A 3VHDA 4H7QA 1Y8NA 2FWYA 2IWUA 3H80A 1YT2A 4PRXA 3T0ZA 4MB9A 2C1IA 3K60A 2C2AA 3OWDA 3H4LA 2YEHA 3LNUA 1KIJA 2XCMA 3U67A 2XX5A 4LWGA 2YI7A 4FMTA 3CYGA 4CWFA 2UWDA 5FNFA 2VW5A 2YE9A 4XE2A 5BODA 2ZDXA 4XIPA 2YEIA 4EGIA 2CCTA 1AH8A 4BAEA 2BU7A 4JQLA 2FWZA 1MU5A 1PVGA 3QDDA 2Q2EB 2YI5A 3C11A 2CGFA 1B3QA 3HZ5A 4XKOA 3B24A 2IWSA 2Q8GA 1QYEA 1Z5CA 4NH9A 3CRLA 4I3HA 4L8ZA 1NHJA 2XJJA 4AWQA 2YE8A 4XDMA 1OSFA 3ZKBA 2YEAA 4KFGA 2ZKJA 1Y8PA 3A0RA 3FT5A 1I5BA 3K98A 1UY7A 2XX4A 3A0TA 2ESAA 4UROA 4U93A 3HYZA 3ZXOA 1B62A 2BYHA 5FNDA 3B27A 3INWA 4O07A 4E01A 4GQTA 4LWFA 4GGLA 2XHRA 3WHAA 3TZ4A 4HYPA 5M4PA 2YE4A 3QTFA 2QG0A 5L3JA 4O05A 3ZKDA 1TH8A 4KP4A 2CCSA 1AM1A 4MP7A 4ZVIA 5M4EA 3O6OA 2YGFA 4L90A 5CTWA 2WEQA 3EKOA 2IOPA 2YEGA 4JAUA 2H55A 1UYLA 2BT0A 1TC6A 2BU5A 1YETA 2WI5A 4CWRA 4L91A 3FT8A 1QZRA 5D7CA 4MP2A 2GFDA 3KE6A 4MPEA 2XK2A 5JENA 3VHCA 5CTUA 4FCRA 3WQ9A 2XDUA 2BU8A 1ID0A 4FCQA 1UYDA 3ZXQA 1GKXA 4YKUA 1NHHA 2BSMA 3GIEA 2CCUA 2JKIA 1EA6A 2HKJA 4H81A 4XCJA 4MPNA 3A0XA 1QY8A 3LMMA 5F3KA 2YKEA 1AH6A 1YSRA 4V25A 4H85A 4JASA 3G7BA 2XHTA 2JJCA 3G75A 4ZKIA 5M4MA 1I58A 3R4PA 3Q5LA 3RLQA 4XIRA 4YKWA 4R3AA 3R92A 5J71A 3NMQA 2YGAA 3R4NA 2BZ5A 1MX0A 2FYPA 4BQJA 3EKRA 2YKBA 4MBCA 1TILA 1BYQA 1YT0A 3TZ5A 1THNA 4YKRA 4U7NA 2VWCA 3IEDA 1GJVA 4ASFA 5CF0A 3K97A 4EEHA 3B26A 2XDLA 5M4HA 3BMYA 2XDSA 4CWPA 2CH4A 5IDMA 3D0BA 2YE3A 4NH8A 5CTXA 3TUHA 2YEEA 4YKYA 3EHJA 4YKTA 2WI4A 4L94A 4R3MA 1KZNA 4URNA 5D6PA 2BTZA 4HZ5A 4LWIA 3RLRA 3ZM7A 3TZ2A 4BXIA 4KTNA 4X9LA 2QF6A 1YERA 5M4NA 2BREA 4BIZA 5IDJA 5C93A 3OPDA 4ASBA 1IXMA 1Z5AA 4E02A 4EM7A 1I5AA 2XHXA 4CWNA 3INXA 4FCPA 4PU9A 4FPPA 3OW6A 4E00A 1GKZA 4YKZA 2BU6A 4EFUA 4HXZA 2YKCA 4MPCA 2BRCA 2IOQA 3K99A 3R4MA 4LPBA 2FXSA 1US7A 1YESA 1I5CA 3FV5A 2YE2A 2YEJA 1JM6A 2IWXA 1Y8OA 1U2OA 3PEHA 4GCZA 3EHGA 5CPHA 4E72A 1UYHA 1S16A 3BM9A 2YI0A 4XITA 1H7SA 4QPKA 2XJGA 3Q5KA 4KSGA 1NHIA 1UY9A 5D7RA 2BYIA 3GIFA 2YEDA 4O09A 4AS9A 4XKAA 3RLPA 3T0HA 1EI1A 5FNCA 4CWSA 5FWKA 4HZ0A 4EGKA 2BU2A 3HYYA 1YC3A 4B6CA 4MOTA 3G7EA 3A0YA 4URMA 2YEBA 2ZBKB
chains in the Genus database with same CATH topology
1S14A 1YC1A 2WI7A 4XKKA 5BOCA 3RKZA 4CWQA 1ZWHA 4W7TA 1BXDA 2CG9A 2YECA 5IN9A 1UY8A 2WI1A 5J6AA 2AKPA 3U2KA 1TIDA 3GIGB 1BKNA 1TC0A 4CE3A 2HG1A 2WI3A 4BIUA 5D6QA 4XTJA 4JAVA 1Y4UA 4GEEA 3OWBA 3B25A 2VCJA 1ZW9A 4WUBA 2Q8HA 4V26A 5GGZA 2Q8FA 4HYMA 1I59A 4CE2A 2IORA 5CTYA 4ASGA 4ASAA 1YC4A 4HY1A 1ZXNA 4P7AA 3PEJA 1Y4SA 1ZXMA 4R1FA 2XABA 3HHUA 3HZ1A 1UYEA 2VCIA 2E0AA 3D36A 4KQVA 1TBWA 4NH7A 4LWHA 4GFNA 3EHHA 1YSZA 2K5BA 4L93A 4CE1A 3D2RA 1YT1A 2WERA 3JZ3A 2YGEA 1UY6A 4B7PA 1BGQA 2O1VA 4CWOA 4AWOA 4DUHA 4KSHA 1R62A 2QG2A 4GT8A 3A0ZA 4U7OA 3B28A 2YJWA 1Z5BA 4Q20A 1UYGA 2YEFA 2ZDYA 4PRVA 1UYFA 2XD6A 2YE7A 3GIGA 2EXLA 3MNRP 4LP0A 3HEKA 1I5DA 4XC0A 4XIQA 1UYKA 4YKQA 1UYIA 4AWPA 4DZYA 2O1UA 3TZ0A 4P8OA 3T1KA 4LWEA 1Z59A 4EMVA 4XD8A 2QFOA 1B63A 2YK2A 2YKJA 3LPSA 3CGYA 3O0IA 1AJ6A 4WUCA 3C0EA 4BQGA 2O1WA 5M4KA 2YJXA 3T10A 3TTZA 2XDKA 2WI6A 2YKIA 4XCLA 3Q5JA 2YI6A 2YK9A 3U2DA 3A0WA 2XDXA 1UYCA 3CGZA 4CWTA 2YE6A 3CRKA 3T2SA 1YS3A 4O0BA 1UYMA 2H8MA 3EHFA 2WEPA 3R4OA 2GQPA 3R91A 3VADA 2PNRA 4K4OA 4HXWA 4QPJA 4EFTA 2Q8IA 1AMWA 3VHAA 4O04A 4YKXA 4PL9A 5D7DA 5F5RA 4WUDA 1H7UA 2XJXA 3DGEA 4HY6A 1U0ZA 4I5SA 1A4HA 3OMUA 3O2FA 4EGHA 4URLA 2WI2A 3CWVA 2HCHA 2YE5A 3SL2A 1L0OA 2XX2A 3VHDA 4H7QA 1Y8NA 2FWYA 2IWUA 3H80A 1YT2A 4PRXA 3T0ZA 4MB9A 3K60A 2C2AA 3OWDA 3H4LA 2YEHA 3LNUA 1KIJA 2XCMA 3U67A 2XX5A 4LWGA 2YI7A 4FMTA 4CWFA 2UWDA 5FNFA 2VW5A 2YE9A 4XE2A 5BODA 2ZDXA 4XIPA 2YEIA 4EGIA 2CCTA 1AH8A 4BAEA 2BU7A 4JQLA 2FWZA 1MU5A 1PVGA 3QDDA 2Q2EB 2YI5A 3C11A 2CGFA 1B3QA 3HZ5A 4XKOA 3B24A 2IWSA 2Q8GA 1QYEA 1Z5CA 4NH9A 3CRLA 4I3HA 4L8ZA 1NHJA 2XJJA 4AWQA 2YE8A 4XDMA 1OSFA 3ZKBA 2YEAA 4KFGA 2ZKJA 1Y8PA 3A0RA 3FT5A 1I5BA 3K98A 1UY7A 2XX4A 3A0TA 2ESAA 4UROA 4U93A 3HYZA 3ZXOA 1B62A 2BYHA 5FNDA 3B27A 3INWA 4O07A 4E01A 4GQTA 4LWFA 4GGLA 2XHRA 3WHAA 3TZ4A 4HYPA 5M4PA 2YE4A 3QTFA 2QG0A 5L3JA 4O05A 3ZKDA 1TH8A 4KP4A 2CCSA 1AM1A 4MP7A 4ZVIA 5M4EA 3O6OA 2YGFA 4L90A 5CTWA 2WEQA 3EKOA 2IOPA 2YEGA 4JAUA 2H55A 1UYLA 2BT0A 1TC6A 2BU5A 1YETA 2WI5A 4CWRA 4L91A 3FT8A 1QZRA 5D7CA 4MP2A 2GFDA 3KE6A 4MPEA 2XK2A 3VHCA 5CTUA 4FCRA 3WQ9A 2XDUA 2BU8A 1ID0A 4FCQA 1UYDA 3ZXQA 1GKXA 4YKUA 1NHHA 2BSMA 3GIEA 2CCUA 2JKIA 1EA6A 2HKJA 4H81A 4XCJA 4MPNA 3A0XA 1QY8A 5F3KA 2YKEA 1AH6A 1YSRA 4V25A 4H85A 4JASA 3G7BA 2XHTA 2JJCA 3G75A 4ZKIA 5M4MA 1I58A 3R4PA 3Q5LA 3RLQA 4XIRA 4YKWA 4R3AA 3R92A 5J71A 3NMQA 2YGAA 3R4NA 2BZ5A 1MX0A 2FYPA 4BQJA 3EKRA 2YKBA 4MBCA 1TILA 1BYQA 1YT0A 3TZ5A 1THNA 4YKRA 4U7NA 2VWCA 3IEDA 1GJVA 4ASFA 5CF0A 3K97A 4EEHA 3B26A 2XDLA 5M4HA 3BMYA 2XDSA 4CWPA 2CH4A 5IDMA 3D0BA 2YE3A 4NH8A 5CTXA 3TUHA 2YEEA 4YKYA 3EHJA 4YKTA 2WI4A 4L94A 4R3MA 1KZNA 4URNA 5D6PA 2BTZA 4HZ5A 4LWIA 3RLRA 3ZM7A 3TZ2A 4BXIA 4KTNA 4X9LA 2QF6A 1YERA 5M4NA 2BREA 4BIZA 5IDJA 5C93A 3OPDA 4ASBA 1Z5AA 4E02A 4EM7A 1I5AA 2XHXA 4CWNA 3INXA 4FCPA 4PU9A 4FPPA 3OW6A 4E00A 1GKZA 4YKZA 2BU6A 4EFUA 4HXZA 2YKCA 4MPCA 2BRCA 2IOQA 3K99A 3R4MA 4LPBA 2FXSA 1US7A 1YESA 1I5CA 3FV5A 2YE2A 2YEJA 1JM6A 2IWXA 1Y8OA 1U2OA 3PEHA 4GCZA 3EHGA 5CPHA 1UYHA 1S16A 3BM9A 2YI0A 4XITA 1H7SA 4QPKA 2XJGA 3Q5KA 4KSGA 1NHIA 1UY9A 5D7RA 2BYIA 3GIFA 2YEDA 4O09A 4AS9A 4XKAA 3RLPA 3T0HA 1EI1A 5FNCA 4CWSA 5FWKA 4HZ0A 4EGKA 2BU2A 3HYYA 1YC3A 4B6CA 4MOTA 3G7EA 3A0YA 4URMA 2YEBA 2ZBKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S14 A;  1YC1 A;  2WI7 A;  4XKK A;  5BOC A;  3RKZ A;  4CWQ A;  1ZWH A;  4W7T A;  1BXD A;  2CG9 A;  2YEC A;  5IN9 A;  1UY8 A;  2WI1 A;  5J6A A;  2AKP A;  3U2K A;  1TID A;  3GIG B;  1BKN A;  1TC0 A;  4CE3 A;  2HG1 A;  2WI3 A;  4BIU A;  5D6Q A;  4XTJ A;  4JAV A;  1Y4U A;  4GEE A;  3OWB A;  3B25 A;  2VCJ A;  1ZW9 A;  4WUB A;  2Q8H A;  4V26 A;  5GGZ A;  2Q8F A;  4HYM A;  1I59 A;  4CE2 A;  2IOR A;  5CTY A;  4ASG A;  4ASA A;  1YC4 A;  4HY1 A;  1ZXN A;  4P7A A;  3PEJ A;  1Y4S A;  1ZXM A;  4R1F A;  2XAB A;  3HHU A;  3HZ1 A;  1UYE A;  2VCI A;  2E0A A;  3D36 A;  4KQV A;  1TBW A;  4NH7 A;  4LWH A;  4GFN A;  3EHH A;  1YSZ A;  2K5B A;  4L93 A;  4CE1 A;  3D2R A;  1YT1 A;  2WER A;  3JZ3 A;  2YGE A;  1UY6 A;  4B7P A;  1BGQ A;  2O1V A;  4CWO A;  4AWO A;  4DUH A;  4KSH A;  1R62 A;  2QG2 A;  4GT8 A;  3A0Z A;  4U7O A;  3B28 A;  2YJW A;  1Z5B A;  4Q20 A;  1UYG A;  2YEF A;  2ZDY A;  4PRV A;  1UYF A;  2XD6 A;  2YE7 A;  3GIG A;  2EXL A;  3MNR P;  4LP0 A;  3HEK A;  1I5D A;  4XC0 A;  4XIQ A;  1UYK A;  4YKQ A;  1UYI A;  4AWP A;  4DZY A;  2O1U A;  3TZ0 A;  4P8O A;  3T1K A;  4LWE A;  1Z59 A;  4EMV A;  4XD8 A;  2QFO A;  1B63 A;  2YK2 A;  2YKJ A;  3LPS A;  3CGY A;  3O0I A;  1AJ6 A;  4WUC A;  3C0E A;  4BQG A;  2O1W A;  5M4K A;  2YJX A;  3T10 A;  3TTZ A;  2XDK A;  2WI6 A;  2YKI A;  4XCL A;  3Q5J A;  2YI6 A;  2YK9 A;  3U2D A;  3A0W A;  2XDX A;  1UYC A;  3CGZ A;  4CWT A;  2YE6 A;  3CRK A;  3T2S A;  1YS3 A;  4O0B A;  1UYM A;  2H8M A;  3EHF A;  2WEP A;  3R4O A;  2GQP A;  3R91 A;  3VAD A;  2PNR A;  4K4O A;  4HXW A;  4QPJ A;  4EFT A;  2Q8I A;  1AMW A;  3VHA A;  4O04 A;  4YKX A;  4PL9 A;  5D7D A;  5F5R A;  4WUD A;  1H7U A;  2XJX A;  3DGE A;  4HY6 A;  1U0Z A;  4I5S A;  1A4H A;  3OMU A;  3O2F A;  4EGH A;  4URL A;  2WI2 A;  3CWV A;  2HCH A;  2YE5 A;  3SL2 A;  1L0O A;  2XX2 A;  3VHD A;  4H7Q A;  1Y8N A;  2FWY A;  2IWU A;  3H80 A;  1YT2 A;  4PRX A;  3T0Z A;  4MB9 A;  3K60 A;  2C2A A;  3OWD A;  3H4L A;  2YEH A;  3LNU A;  1KIJ A;  2XCM A;  3U67 A;  2XX5 A;  4LWG A;  2YI7 A;  4FMT A;  4CWF A;  2UWD A;  5FNF A;  2VW5 A;  2YE9 A;  4XE2 A;  5BOD A;  2ZDX A;  4XIP A;  2YEI A;  4EGI A;  2CCT A;  1AH8 A;  4BAE A;  2BU7 A;  4JQL A;  2FWZ A;  1MU5 A;  1PVG A;  3QDD A;  2Q2E B;  2YI5 A;  3C11 A;  2CGF A;  1B3Q A;  3HZ5 A;  4XKO A;  3B24 A;  2IWS A;  2Q8G A;  1QYE A;  1Z5C A;  4NH9 A;  3CRL A;  4I3H A;  4L8Z A;  1NHJ A;  2XJJ A;  4AWQ A;  2YE8 A;  4XDM A;  1OSF A;  3ZKB A;  2YEA A;  4KFG A;  2ZKJ A;  1Y8P A;  3A0R A;  3FT5 A;  1I5B A;  3K98 A;  1UY7 A;  2XX4 A;  3A0T A;  2ESA A;  4URO A;  4U93 A;  3HYZ A;  3ZXO A;  1B62 A;  2BYH A;  5FND A;  3B27 A;  3INW A;  4O07 A;  4E01 A;  4GQT A;  4LWF A;  4GGL A;  2XHR A;  3WHA A;  3TZ4 A;  4HYP A;  5M4P A;  2YE4 A;  3QTF A;  2QG0 A;  5L3J A;  4O05 A;  3ZKD A;  1TH8 A;  4KP4 A;  2CCS A;  1AM1 A;  4MP7 A;  4ZVI A;  5M4E A;  3O6O A;  2YGF A;  4L90 A;  5CTW A;  2WEQ A;  3EKO A;  2IOP A;  2YEG A;  4JAU A;  2H55 A;  1UYL A;  2BT0 A;  1TC6 A;  2BU5 A;  1YET A;  2WI5 A;  4CWR A;  4L91 A;  3FT8 A;  1QZR A;  5D7C A;  4MP2 A;  2GFD A;  3KE6 A;  4MPE A;  2XK2 A;  3VHC A;  5CTU A;  4FCR A;  3WQ9 A;  2XDU A;  2BU8 A;  1ID0 A;  4FCQ A;  1UYD A;  3ZXQ A;  1GKX A;  4YKU A;  1NHH A;  2BSM A;  3GIE A;  2CCU A;  2JKI A;  1EA6 A;  2HKJ A;  4H81 A;  4XCJ A;  4MPN A;  3A0X A;  1QY8 A;  5F3K A;  2YKE A;  1AH6 A;  1YSR A;  4V25 A;  4H85 A;  4JAS A;  3G7B A;  2XHT A;  2JJC A;  3G75 A;  4ZKI A;  5M4M A;  1I58 A;  3R4P A;  3Q5L A;  3RLQ A;  4XIR A;  4YKW A;  4R3A A;  3R92 A;  5J71 A;  3NMQ A;  2YGA A;  3R4N A;  2BZ5 A;  1MX0 A;  2FYP A;  4BQJ A;  3EKR A;  2YKB A;  4MBC A;  1TIL A;  1BYQ A;  1YT0 A;  3TZ5 A;  1THN A;  4YKR A;  4U7N A;  2VWC A;  3IED A;  1GJV A;  4ASF A;  5CF0 A;  3K97 A;  4EEH A;  3B26 A;  2XDL A;  5M4H A;  3BMY A;  2XDS A;  4CWP A;  2CH4 A;  5IDM A;  3D0B A;  2YE3 A;  4NH8 A;  5CTX A;  3TUH A;  2YEE A;  4YKY A;  3EHJ A;  4YKT A;  2WI4 A;  4L94 A;  4R3M A;  1KZN A;  4URN A;  5D6P A;  2BTZ A;  4HZ5 A;  4LWI A;  3RLR A;  3ZM7 A;  3TZ2 A;  4BXI A;  4KTN A;  4X9L A;  2QF6 A;  1YER A;  5M4N A;  2BRE A;  4BIZ A;  5IDJ A;  5C93 A;  3OPD A;  4ASB A;  1Z5A A;  4E02 A;  4EM7 A;  1I5A A;  2XHX A;  4CWN A;  3INX A;  4FCP A;  4PU9 A;  4FPP A;  3OW6 A;  4E00 A;  1GKZ A;  4YKZ A;  2BU6 A;  4EFU A;  4HXZ A;  2YKC A;  4MPC A;  2BRC A;  2IOQ A;  3K99 A;  3R4M A;  4LPB A;  2FXS A;  1US7 A;  1YES A;  1I5C A;  3FV5 A;  2YE2 A;  2YEJ A;  1JM6 A;  2IWX A;  1Y8O A;  1U2O A;  3PEH A;  4GCZ A;  3EHG A;  5CPH A;  1UYH A;  1S16 A;  3BM9 A;  2YI0 A;  4XIT A;  1H7S A;  4QPK A;  2XJG A;  3Q5K A;  4KSG A;  1NHI A;  1UY9 A;  5D7R A;  2BYI A;  3GIF A;  2YED A;  4O09 A;  4AS9 A;  4XKA A;  3RLP A;  3T0H A;  1EI1 A;  5FNC A;  4CWS A;  5FWK A;  4HZ0 A;  4EGK A;  2BU2 A;  3HYY A;  1YC3 A;  4B6C A;  4MOT A;  3G7E A;  3A0Y A;  4URM A;  2YEB A;  2ZBK B; 
#chains in the Genus database with same CATH topology
 1S14 A;  1YC1 A;  2WI7 A;  4XKK A;  5BOC A;  3RKZ A;  4CWQ A;  1ZWH A;  4W7T A;  1BXD A;  2CG9 A;  2YEC A;  5IN9 A;  1UY8 A;  2WI1 A;  5J6A A;  2AKP A;  3U2K A;  1TID A;  3GIG B;  1BKN A;  1TC0 A;  4CE3 A;  2HG1 A;  2WI3 A;  4BIU A;  5D6Q A;  1F51 A;  4XTJ A;  4JAV A;  1Y4U A;  4GEE A;  3OWB A;  3B25 A;  2VCJ A;  1ZW9 A;  4WUB A;  2Q8H A;  4V26 A;  5GGZ A;  2Q8F A;  4HYM A;  1I59 A;  4CE2 A;  2IOR A;  5CTY A;  4ASG A;  4ASA A;  1YC4 A;  4HY1 A;  1ZXN A;  4P7A A;  3PEJ A;  1Y4S A;  1ZXM A;  4R1F A;  2XAB A;  3HHU A;  3HZ1 A;  1UYE A;  2VCI A;  2E0A A;  3D36 A;  4KQV A;  1TBW A;  4NH7 A;  4LWH A;  4GFN A;  3EHH A;  1YSZ A;  2K5B A;  4L93 A;  4CE1 A;  3D2R A;  1YT1 A;  2WER A;  3JZ3 A;  2YGE A;  1UY6 A;  4B7P A;  1BGQ A;  2O1V A;  4CWO A;  4AWO A;  4DUH A;  4KSH A;  1R62 A;  2QG2 A;  4GT8 A;  3A0Z A;  4U7O A;  3B28 A;  2YJW A;  1Z5B A;  4Q20 A;  1UYG A;  2YEF A;  2ZDY A;  4PRV A;  1UYF A;  2XD6 A;  2YE7 A;  3GIG A;  2EXL A;  3MNR P;  4LP0 A;  3HEK A;  1I5D A;  4XC0 A;  4XIQ A;  1UYK A;  4YKQ A;  1UYI A;  4AWP A;  4DZY A;  2O1U A;  3TZ0 A;  4P8O A;  3T1K A;  2HHI A;  4LWE A;  1Z59 A;  4EMV A;  4XD8 A;  2QFO A;  1B63 A;  2YK2 A;  2FTK A;  2YKJ A;  3LPS A;  3CGY A;  3O0I A;  1AJ6 A;  4WUC A;  3C0E A;  4BQG A;  2O1W A;  5M4K A;  2YJX A;  3T10 A;  3TTZ A;  2XDK A;  2WI6 A;  2YKI A;  4XCL A;  3Q5J A;  2YI6 A;  2YK9 A;  3U2D A;  3A0W A;  2XDX A;  1UYC A;  3CGZ A;  4CWT A;  2YE6 A;  3CRK A;  3T2S A;  1YS3 A;  4O0B A;  1UYM A;  2H8M A;  3EHF A;  2WEP A;  3R4O A;  2GQP A;  3R91 A;  3VAD A;  2PNR A;  4K4O A;  4HXW A;  4QPJ A;  4EFT A;  2Q8I A;  1AMW A;  3VHA A;  4O04 A;  3S5T A;  4YKX A;  4PL9 A;  5D7D A;  5F5R A;  2C1G A;  4WUD A;  1H7U A;  2XJX A;  3DGE A;  4HY6 A;  1U0Z A;  4I5S A;  1A4H A;  3OMU A;  3O2F A;  4EGH A;  4URL A;  2WI2 A;  3CWV A;  2HCH A;  2YE5 A;  3SL2 A;  1L0O A;  2XX2 A;  3VHD A;  4H7Q A;  1Y8N A;  2FWY A;  2IWU A;  3H80 A;  1YT2 A;  4PRX A;  3T0Z A;  4MB9 A;  2C1I A;  3K60 A;  2C2A A;  3OWD A;  3H4L A;  2YEH A;  3LNU A;  1KIJ A;  2XCM A;  3U67 A;  2XX5 A;  4LWG A;  2YI7 A;  4FMT A;  3CYG A;  4CWF A;  2UWD A;  5FNF A;  2VW5 A;  2YE9 A;  4XE2 A;  5BOD A;  2ZDX A;  4XIP A;  2YEI A;  4EGI A;  2CCT A;  1AH8 A;  4BAE A;  2BU7 A;  4JQL A;  2FWZ A;  1MU5 A;  1PVG A;  3QDD A;  2Q2E B;  2YI5 A;  3C11 A;  2CGF A;  1B3Q A;  3HZ5 A;  4XKO A;  3B24 A;  2IWS A;  2Q8G A;  1QYE A;  1Z5C A;  4NH9 A;  3CRL A;  4I3H A;  4L8Z A;  1NHJ A;  2XJJ A;  4AWQ A;  2YE8 A;  4XDM A;  1OSF A;  3ZKB A;  2YEA A;  4KFG A;  2ZKJ A;  1Y8P A;  3A0R A;  3FT5 A;  1I5B A;  3K98 A;  1UY7 A;  2XX4 A;  3A0T A;  2ESA A;  4URO A;  4U93 A;  3HYZ A;  3ZXO A;  1B62 A;  2BYH A;  5FND A;  3B27 A;  3INW A;  4O07 A;  4E01 A;  4GQT A;  4LWF A;  4GGL A;  2XHR A;  3WHA A;  3TZ4 A;  4HYP A;  5M4P A;  2YE4 A;  3QTF A;  2QG0 A;  5L3J A;  4O05 A;  3ZKD A;  1TH8 A;  4KP4 A;  2CCS A;  1AM1 A;  4MP7 A;  4ZVI A;  5M4E A;  3O6O A;  2YGF A;  4L90 A;  5CTW A;  2WEQ A;  3EKO A;  2IOP A;  2YEG A;  4JAU A;  2H55 A;  1UYL A;  2BT0 A;  1TC6 A;  2BU5 A;  1YET A;  2WI5 A;  4CWR A;  4L91 A;  3FT8 A;  1QZR A;  5D7C A;  4MP2 A;  2GFD A;  3KE6 A;  4MPE A;  2XK2 A;  5JEN A;  3VHC A;  5CTU A;  4FCR A;  3WQ9 A;  2XDU A;  2BU8 A;  1ID0 A;  4FCQ A;  1UYD A;  3ZXQ A;  1GKX A;  4YKU A;  1NHH A;  2BSM A;  3GIE A;  2CCU A;  2JKI A;  1EA6 A;  2HKJ A;  4H81 A;  4XCJ A;  4MPN A;  3A0X A;  1QY8 A;  3LMM A;  5F3K A;  2YKE A;  1AH6 A;  1YSR A;  4V25 A;  4H85 A;  4JAS A;  3G7B A;  2XHT A;  2JJC A;  3G75 A;  4ZKI A;  5M4M A;  1I58 A;  3R4P A;  3Q5L A;  3RLQ A;  4XIR A;  4YKW A;  4R3A A;  3R92 A;  5J71 A;  3NMQ A;  2YGA A;  3R4N A;  2BZ5 A;  1MX0 A;  2FYP A;  4BQJ A;  3EKR A;  2YKB A;  4MBC A;  1TIL A;  1BYQ A;  1YT0 A;  3TZ5 A;  1THN A;  4YKR A;  4U7N A;  2VWC A;  3IED A;  1GJV A;  4ASF A;  5CF0 A;  3K97 A;  4EEH A;  3B26 A;  2XDL A;  5M4H A;  3BMY A;  2XDS A;  4CWP A;  2CH4 A;  5IDM A;  3D0B A;  2YE3 A;  4NH8 A;  5CTX A;  3TUH A;  2YEE A;  4YKY A;  3EHJ A;  4YKT A;  2WI4 A;  4L94 A;  4R3M A;  1KZN A;  4URN A;  5D6P A;  2BTZ A;  4HZ5 A;  4LWI A;  3RLR A;  3ZM7 A;  3TZ2 A;  4BXI A;  4KTN A;  4X9L A;  2QF6 A;  1YER A;  5M4N A;  2BRE A;  4BIZ A;  5IDJ A;  5C93 A;  3OPD A;  4ASB A;  1IXM A;  1Z5A A;  4E02 A;  4EM7 A;  1I5A A;  2XHX A;  4CWN A;  3INX A;  4FCP A;  4PU9 A;  4FPP A;  3OW6 A;  4E00 A;  1GKZ A;  4YKZ A;  2BU6 A;  4EFU A;  4HXZ A;  2YKC A;  4MPC A;  2BRC A;  2IOQ A;  3K99 A;  3R4M A;  4LPB A;  2FXS A;  1US7 A;  1YES A;  1I5C A;  3FV5 A;  2YE2 A;  2YEJ A;  1JM6 A;  2IWX A;  1Y8O A;  1U2O A;  3PEH A;  4GCZ A;  3EHG A;  5CPH A;  4E72 A;  1UYH A;  1S16 A;  3BM9 A;  2YI0 A;  4XIT A;  1H7S A;  4QPK A;  2XJG A;  3Q5K A;  4KSG A;  1NHI A;  1UY9 A;  5D7R A;  2BYI A;  3GIF A;  2YED A;  4O09 A;  4AS9 A;  4XKA A;  3RLP A;  3T0H A;  1EI1 A;  5FNC A;  4CWS A;  5FWK A;  4HZ0 A;  4EGK A;  2BU2 A;  3HYY A;  1YC3 A;  4B6C A;  4MOT A;  3G7E A;  3A0Y A;  4URM A;  2YEB A;  2ZBK B; 
#chains in the Genus database with same CATH homology
 1S14 A;  1YC1 A;  2WI7 A;  4XKK A;  5BOC A;  3RKZ A;  4CWQ A;  1ZWH A;  4W7T A;  1BXD A;  2CG9 A;  2YEC A;  5IN9 A;  1UY8 A;  2WI1 A;  5J6A A;  2AKP A;  3U2K A;  1TID A;  3GIG B;  1BKN A;  1TC0 A;  4CE3 A;  2HG1 A;  2WI3 A;  4BIU A;  5D6Q A;  4XTJ A;  4JAV A;  1Y4U A;  4GEE A;  3OWB A;  3B25 A;  2VCJ A;  1ZW9 A;  4WUB A;  2Q8H A;  4V26 A;  5GGZ A;  2Q8F A;  4HYM A;  1I59 A;  4CE2 A;  2IOR A;  5CTY A;  4ASG A;  4ASA A;  1YC4 A;  4HY1 A;  1ZXN A;  4P7A A;  3PEJ A;  1Y4S A;  1ZXM A;  4R1F A;  2XAB A;  3HHU A;  3HZ1 A;  1UYE A;  2VCI A;  2E0A A;  3D36 A;  4KQV A;  1TBW A;  4NH7 A;  4LWH A;  4GFN A;  3EHH A;  1YSZ A;  2K5B A;  4L93 A;  4CE1 A;  3D2R A;  1YT1 A;  2WER A;  3JZ3 A;  2YGE A;  1UY6 A;  4B7P A;  1BGQ A;  2O1V A;  4CWO A;  4AWO A;  4DUH A;  4KSH A;  1R62 A;  2QG2 A;  4GT8 A;  3A0Z A;  4U7O A;  3B28 A;  2YJW A;  1Z5B A;  4Q20 A;  1UYG A;  2YEF A;  2ZDY A;  4PRV A;  1UYF A;  2XD6 A;  2YE7 A;  3GIG A;  2EXL A;  3MNR P;  4LP0 A;  3HEK A;  1I5D A;  4XC0 A;  4XIQ A;  1UYK A;  4YKQ A;  1UYI A;  4AWP A;  4DZY A;  2O1U A;  3TZ0 A;  4P8O A;  3T1K A;  4LWE A;  1Z59 A;  4EMV A;  4XD8 A;  2QFO A;  1B63 A;  2YK2 A;  2YKJ A;  3LPS A;  3CGY A;  3O0I A;  1AJ6 A;  4WUC A;  3C0E A;  4BQG A;  2O1W A;  5M4K A;  2YJX A;  3T10 A;  3TTZ A;  2XDK A;  2WI6 A;  2YKI A;  4XCL A;  3Q5J A;  2YI6 A;  2YK9 A;  3U2D A;  3A0W A;  2XDX A;  1UYC A;  3CGZ A;  4CWT A;  2YE6 A;  3CRK A;  3T2S A;  1YS3 A;  4O0B A;  1UYM A;  2H8M A;  3EHF A;  2WEP A;  3R4O A;  2GQP A;  3R91 A;  3VAD A;  2PNR A;  4K4O A;  4HXW A;  4QPJ A;  4EFT A;  2Q8I A;  1AMW A;  3VHA A;  4O04 A;  4YKX A;  4PL9 A;  5D7D A;  5F5R A;  4WUD A;  1H7U A;  2XJX A;  3DGE A;  4HY6 A;  1U0Z A;  4I5S A;  1A4H A;  3OMU A;  3O2F A;  4EGH A;  4URL A;  2WI2 A;  3CWV A;  2HCH A;  2YE5 A;  3SL2 A;  1L0O A;  2XX2 A;  3VHD A;  4H7Q A;  1Y8N A;  2FWY A;  2IWU A;  3H80 A;  1YT2 A;  4PRX A;  3T0Z A;  4MB9 A;  3K60 A;  2C2A A;  3OWD A;  3H4L A;  2YEH A;  3LNU A;  1KIJ A;  2XCM A;  3U67 A;  2XX5 A;  4LWG A;  2YI7 A;  4FMT A;  4CWF A;  2UWD A;  5FNF A;  2VW5 A;  2YE9 A;  4XE2 A;  5BOD A;  2ZDX A;  4XIP A;  2YEI A;  4EGI A;  2CCT A;  1AH8 A;  4BAE A;  2BU7 A;  4JQL A;  2FWZ A;  1MU5 A;  1PVG A;  3QDD A;  2Q2E B;  2YI5 A;  3C11 A;  2CGF A;  1B3Q A;  3HZ5 A;  4XKO A;  3B24 A;  2IWS A;  2Q8G A;  1QYE A;  1Z5C A;  4NH9 A;  3CRL A;  4I3H A;  4L8Z A;  1NHJ A;  2XJJ A;  4AWQ A;  2YE8 A;  4XDM A;  1OSF A;  3ZKB A;  2YEA A;  4KFG A;  2ZKJ A;  1Y8P A;  3A0R A;  3FT5 A;  1I5B A;  3K98 A;  1UY7 A;  2XX4 A;  3A0T A;  2ESA A;  4URO A;  4U93 A;  3HYZ A;  3ZXO A;  1B62 A;  2BYH A;  5FND A;  3B27 A;  3INW A;  4O07 A;  4E01 A;  4GQT A;  4LWF A;  4GGL A;  2XHR A;  3WHA A;  3TZ4 A;  4HYP A;  5M4P A;  2YE4 A;  3QTF A;  2QG0 A;  5L3J A;  4O05 A;  3ZKD A;  1TH8 A;  4KP4 A;  2CCS A;  1AM1 A;  4MP7 A;  4ZVI A;  5M4E A;  3O6O A;  2YGF A;  4L90 A;  5CTW A;  2WEQ A;  3EKO A;  2IOP A;  2YEG A;  4JAU A;  2H55 A;  1UYL A;  2BT0 A;  1TC6 A;  2BU5 A;  1YET A;  2WI5 A;  4CWR A;  4L91 A;  3FT8 A;  1QZR A;  5D7C A;  4MP2 A;  2GFD A;  3KE6 A;  4MPE A;  2XK2 A;  3VHC A;  5CTU A;  4FCR A;  3WQ9 A;  2XDU A;  2BU8 A;  1ID0 A;  4FCQ A;  1UYD A;  3ZXQ A;  1GKX A;  4YKU A;  1NHH A;  2BSM A;  3GIE A;  2CCU A;  2JKI A;  1EA6 A;  2HKJ A;  4H81 A;  4XCJ A;  4MPN A;  3A0X A;  1QY8 A;  5F3K A;  2YKE A;  1AH6 A;  1YSR A;  4V25 A;  4H85 A;  4JAS A;  3G7B A;  2XHT A;  2JJC A;  3G75 A;  4ZKI A;  5M4M A;  1I58 A;  3R4P A;  3Q5L A;  3RLQ A;  4XIR A;  4YKW A;  4R3A A;  3R92 A;  5J71 A;  3NMQ A;  2YGA A;  3R4N A;  2BZ5 A;  1MX0 A;  2FYP A;  4BQJ A;  3EKR A;  2YKB A;  4MBC A;  1TIL A;  1BYQ A;  1YT0 A;  3TZ5 A;  1THN A;  4YKR A;  4U7N A;  2VWC A;  3IED A;  1GJV A;  4ASF A;  5CF0 A;  3K97 A;  4EEH A;  3B26 A;  2XDL A;  5M4H A;  3BMY A;  2XDS A;  4CWP A;  2CH4 A;  5IDM A;  3D0B A;  2YE3 A;  4NH8 A;  5CTX A;  3TUH A;  2YEE A;  4YKY A;  3EHJ A;  4YKT A;  2WI4 A;  4L94 A;  4R3M A;  1KZN A;  4URN A;  5D6P A;  2BTZ A;  4HZ5 A;  4LWI A;  3RLR A;  3ZM7 A;  3TZ2 A;  4BXI A;  4KTN A;  4X9L A;  2QF6 A;  1YER A;  5M4N A;  2BRE A;  4BIZ A;  5IDJ A;  5C93 A;  3OPD A;  4ASB A;  1Z5A A;  4E02 A;  4EM7 A;  1I5A A;  2XHX A;  4CWN A;  3INX A;  4FCP A;  4PU9 A;  4FPP A;  3OW6 A;  4E00 A;  1GKZ A;  4YKZ A;  2BU6 A;  4EFU A;  4HXZ A;  2YKC A;  4MPC A;  2BRC A;  2IOQ A;  3K99 A;  3R4M A;  4LPB A;  2FXS A;  1US7 A;  1YES A;  1I5C A;  3FV5 A;  2YE2 A;  2YEJ A;  1JM6 A;  2IWX A;  1Y8O A;  1U2O A;  3PEH A;  4GCZ A;  3EHG A;  5CPH A;  1UYH A;  1S16 A;  3BM9 A;  2YI0 A;  4XIT A;  1H7S A;  4QPK A;  2XJG A;  3Q5K A;  4KSG A;  1NHI A;  1UY9 A;  5D7R A;  2BYI A;  3GIF A;  2YED A;  4O09 A;  4AS9 A;  4XKA A;  3RLP A;  3T0H A;  1EI1 A;  5FNC A;  4CWS A;  5FWK A;  4HZ0 A;  4EGK A;  2BU2 A;  3HYY A;  1YC3 A;  4B6C A;  4MOT A;  3G7E A;  3A0Y A;  4URM A;  2YEB A;  2ZBK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...