3G75A

Crystal structure of staphylococcus aureus gyrase b co-complexed with 4-methyl-5-[3-(methylsulfanyl)-1h-pyrazol-5-yl]-2-thiophen-2-yl-1,3-thiazole inhibitor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
184
Chain Sequence
GLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of pyrazolthiazoles as novel and potent inhibitors of bacterial gyrase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 50
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3g75A00
5M4KA 4CWQA 2JJCA 5BOCA 2CCUA 3INXA 2QFOA 4AWOA 3CGZA 4CWNA 3QTFA 2XJJA 3EHHA 3TZ0A 4WUDA 2ESAA 4LWFA 4XKKA 3T2SA 4YKRA 2YEGA 3VHCA 4XIRA 3PEJA 3HEKA 4L90A 2Q2EB 5FWKA 3LNUA 4FMTA 1GJVA 2YEEA 4GCZA 4EFUA 2YEIA 3ZXOA 1NHIA 2BU8A 2YE4A 4GQTA 4X9LA 1YERA 5CTYA 3U2DA 3G7BA 3CRKA 4HXWA 2YKCA 2XDSA 3TTZA 5IN9A 4YKQA 2GQPA 1B3QA 4H85A 5L3JA 5FNCA 4XITA 3T0HA 4QPJA 1BXDA 4ASBA 2QG2A 1Z5CA 3EKOA 1NHHA 4LWGA 2WI3A 2BTZA 1TILA 3GIFA 1UYEA 4H7QA 1MU5A 3EKRA 4XD8A 4V25A 2WI7A 2QG0A 1PVGA 4XDMA 2BREA 3JZ3A 2BYIA 4E01A 1KIJA 3B26A 5M4HA 2GFDA 2WI4A 4I5SA 3O2FA 3A0YA 2YI6A 4BQGA 2YE6A 2VCJA 3OWBA 3ZKDA 1Z59A 1AH6A 2FYPA 2XDKA 1ZXMA 1YC1A 2YK9A 4XC0A 5M4EA 4KFGA 1GKXA 2YE8A 5D6PA 1UYCA 5J71A 4MB9A 2YEFA 3WHAA 1YS3A 4GGLA 3FT8A 4CWRA 3HHUA 4MPCA 1TH8A 1S16A 4LWIA 4WUBA 4ZVIA 3TZ4A 3G7EA 4KP4A 3T1KA 1QY8A 2K5BA 4XKAA 3TZ5A 4XE2A 5CTWA 1U0ZA 2FWZA 1YETA 3D2RA 4URLA 4UROA 4E02A 2YECA 3GIGB 2XABA 2BU6A 3R4OA 4EGHA 4HY6A 2BU7A 2XHXA 5IDMA 5M4NA 1UYHA 3VHDA 4YKYA 3R91A 2XDUA 4URMA 1Y8NA 2IOPA 4DZYA 4MP2A 3A0XA 2XJGA 2YGEA 2ZDYA 4U7NA 3R4NA 5D6QA 1UYKA 3K99A 3K98A 2O1VA 1Y8PA 2VWCA 2BZ5A 3O6OA 3B27A 2XX5A 2YI0A 4EMVA 1YSZA 1US7A 2YE3A 4PRXA 1BYQA 1S14A 4XCLA 4KSHA 1YESA 4CWSA 2WI6A 2BT0A 4LP0A 4YKTA 1UY8A 5FNFA 2YK2A 2PNRA 4ASFA 1YT1A 1ZWHA 1I5BA 1QZRA 3T0ZA 2O1WA 4AWPA 1ZW9A 3VADA 2YKJA 3OW6A 4NH7A 1TC0A 1AMWA 4CE3A 3K60A 5M4PA 1UYFA 3Q5KA 4LPBA 2YEBA 4L94A 4GFNA 4HYMA 1Z5AA 1TIDA 4LWHA 3ZKBA 3R4PA 4NH9A 2YE7A 4CE2A 2IWXA 3EHGA 4HZ5A 3RLRA 2XDLA 4XTJA 1OSFA 1B63A 3K97A 4BAEA 4GEEA 3Q5LA 4EFTA 4JAUA 3SL2A 5CTUA 3DGEA 1ZXNA 4I3HA 4W7TA 2H55A 1AH8A 4ASGA 1UY6A 3U67A 2WEPA 4O05A 3H4LA 3BMYA 1B62A 4E00A 2VCIA 3INWA 4R1FA 2XDXA 4O09A 4K4OA 2YI5A 4XIPA 1BGQA 3QDDA 4NH8A 2VW5A 1UYLA 4R3MA 4WUCA 3GIGA 3A0ZA 3A0TA 3RLPA 2YKIA 4EEHA 4MOTA 2YEJA 5CPHA 4L8ZA 4L91A 5F5RA 2XHTA 2WI2A 4MPNA 2ZDXA 3EHFA 5M4MA 4DUHA 2XHRA 1L0OA 1R62A 2YI7A 4O0BA 1U2OA 2E0AA 4EGIA 2YEDA 3R92A 3RLQA 3G75A 4B7PA 2XK2A 2BYHA 3B24A 2Q8IA 3O0IA 3LPSA 4CWFA 3B25A 4FCQA 3TUHA 2YE9A 4AWQA 2CGFA 1Y8OA 4R3AA 3GIEA 3ZM7A 1JM6A 5D7RA 4B6CA 1YC3A 4URNA 2O1UA 3C11A 2XCMA 2Q8GA 4P7AA 4MPEA 5D7DA 4FCRA 1UY9A 5J6AA 2YKBA 4BIZA 4CE1A 1KZNA 2XX4A 4EGKA 2CCTA 2BU2A 1Y4SA 2CH4A 2YGAA 4ASAA 2H8MA 4O07A 4MP7A 3T10A 3VHAA 4P8OA 4CWTA 3RKZA 2CCSA 2WI1A 4CWOA 4V26A 4U93A 1UYIA 4XKOA 4YKWA 2FWYA 3D36A 3ZXQA 1GKZA 4JQLA 2HG1A 4JASA 4L93A 4O04A 4PRVA 3OMUA 4HYPA 1THNA 1TBWA 4FPPA 2XD6A 1I5AA 2HKJA 2YKEA 3CWVA 2YE5A 3IEDA 1BKNA 2CG9A 2YGFA 1A4HA 2YEHA 1MX0A 3C0EA 4FCPA 2XX2A 2WEQA 5F3KA 3TZ2A 1I58A 2AKPA 3D0BA 5BODA 2IOQA 2IWSA 4EM7A 2C2AA 4BQJA 2YE2A 1I5CA 2BRCA 2HCHA 3U2KA 3HZ1A 5CTXA 2WI5A 4BXIA 4BIUA 2WERA 5FNDA 4PU9A 2ZBKB 3WQ9A 4JAVA 5C93A 3HYZA 1YT0A 4KTNA 2FXSA 3EHJA 3KE6A 2XJXA 3HZ5A 4GT8A 1AM1A 3H80A 2BU5A 1AJ6A 1H7UA 2JKIA 1TC6A 2YEAA 2IWUA 3OPDA 3A0RA 2UWDA 2YJXA 3A0WA 4AS9A 2BSMA 1UYDA 1Z5BA 4YKXA 4YKZA 2Q8HA 1UY7A 3CGYA 4HXZA 1EA6A 2EXLA 1UYMA 4Q20A 3HYYA 1YC4A 1UYGA 3FV5A 5D7CA 4XIQA 1ID0A 1NHJA 4PL9A 3FT5A 4HY1A 4KQVA 1Y4UA 2Q8FA 5GGZA 4QPKA 3MNRP 4ZKIA 2ZKJA 3OWDA 3NMQA 4LWEA 1YT2A 2QF6A 4YKUA 1YSRA 1QYEA 3Q5JA 1I5DA 5IDJA 4KSGA 1I59A 4U7OA 4H81A 3B28A 4XCJA 1H7SA 3CRLA 3BM9A 4HZ0A 4MBCA 5CF0A 2IORA 3PEHA 4CWPA 2YJWA 3R4MA 1EI1A
chains in the Genus database with same CATH superfamily
5M4KA 4CWQA 2JJCA 5BOCA 2CCUA 3INXA 2QFOA 4AWOA 3CGZA 4CWNA 3QTFA 2XJJA 3EHHA 3TZ0A 4WUDA 2ESAA 4LWFA 4XKKA 3T2SA 4YKRA 2YEGA 3VHCA 4XIRA 3PEJA 3HEKA 4L90A 2Q2EB 5FWKA 3LNUA 4FMTA 1GJVA 2YEEA 4GCZA 4EFUA 5JENA 2YEIA 3ZXOA 1NHIA 2BU8A 2YE4A 4GQTA 4X9LA 1YERA 5CTYA 3U2DA 3G7BA 3CRKA 4HXWA 2YKCA 2XDSA 3TTZA 5IN9A 4YKQA 2GQPA 1B3QA 4H85A 5L3JA 5FNCA 4XITA 3T0HA 4QPJA 1BXDA 4ASBA 2QG2A 1Z5CA 3EKOA 1NHHA 4LWGA 2WI3A 2BTZA 1TILA 3GIFA 1UYEA 4H7QA 1MU5A 3EKRA 4XD8A 4V25A 2WI7A 2QG0A 1PVGA 4XDMA 2BREA 3JZ3A 2BYIA 4E01A 1KIJA 3B26A 5M4HA 2GFDA 2WI4A 4I5SA 3O2FA 1F51A 3A0YA 2YI6A 4BQGA 2YE6A 2VCJA 3OWBA 3ZKDA 1Z59A 1AH6A 2FYPA 2XDKA 1ZXMA 1YC1A 2YK9A 4XC0A 5M4EA 4KFGA 1GKXA 2C1IA 2YE8A 3CYGA 5D6PA 1UYCA 5J71A 4MB9A 2YEFA 3WHAA 1YS3A 4GGLA 3FT8A 4CWRA 3HHUA 4MPCA 1TH8A 1S16A 4LWIA 4WUBA 4ZVIA 3TZ4A 3G7EA 4KP4A 3T1KA 1QY8A 2K5BA 4XKAA 3TZ5A 4XE2A 5CTWA 1U0ZA 2FWZA 1YETA 3D2RA 4URLA 4UROA 4E02A 2YECA 3GIGB 2XABA 2BU6A 3R4OA 4EGHA 4HY6A 2BU7A 2XHXA 5IDMA 5M4NA 1UYHA 3VHDA 4YKYA 3R91A 2XDUA 4URMA 1Y8NA 2IOPA 4DZYA 4MP2A 3A0XA 2XJGA 2YGEA 2ZDYA 4U7NA 3R4NA 5D6QA 1UYKA 3K99A 3K98A 2O1VA 1Y8PA 2VWCA 2BZ5A 3O6OA 3B27A 2XX5A 2YI0A 4EMVA 1YSZA 1US7A 2YE3A 4PRXA 1BYQA 1S14A 2FTKA 4XCLA 4KSHA 1YESA 4CWSA 2WI6A 2BT0A 4LP0A 4YKTA 1UY8A 5FNFA 2YK2A 2PNRA 4ASFA 1YT1A 1ZWHA 1I5BA 1QZRA 3T0ZA 2O1WA 4AWPA 1ZW9A 3VADA 2YKJA 3OW6A 4NH7A 1TC0A 1AMWA 4CE3A 3K60A 5M4PA 1UYFA 3Q5KA 4LPBA 2YEBA 4L94A 4GFNA 4HYMA 1Z5AA 1TIDA 4LWHA 3ZKBA 3R4PA 4NH9A 2YE7A 4CE2A 2IWXA 3EHGA 4HZ5A 3RLRA 2XDLA 4XTJA 1OSFA 1B63A 3K97A 4BAEA 4GEEA 3Q5LA 4EFTA 4JAUA 3SL2A 5CTUA 3DGEA 1ZXNA 4I3HA 4W7TA 2H55A 1AH8A 4ASGA 1UY6A 3U67A 2WEPA 4O05A 3H4LA 3BMYA 1B62A 4E00A 2VCIA 3INWA 4R1FA 2XDXA 4O09A 4K4OA 2HHIA 2YI5A 4XIPA 1BGQA 3QDDA 4NH8A 2VW5A 1UYLA 4R3MA 4WUCA 3GIGA 3A0ZA 3A0TA 3RLPA 2YKIA 4EEHA 4MOTA 2YEJA 5CPHA 4L8ZA 4L91A 5F5RA 2XHTA 2WI2A 4MPNA 2ZDXA 3EHFA 5M4MA 4DUHA 2XHRA 1L0OA 1R62A 2YI7A 4O0BA 1U2OA 2E0AA 4EGIA 2YEDA 3R92A 3RLQA 3G75A 4B7PA 2XK2A 2BYHA 3B24A 2Q8IA 3O0IA 3LPSA 4CWFA 3B25A 1IXMA 4FCQA 3TUHA 2YE9A 4AWQA 2CGFA 1Y8OA 4R3AA 3GIEA 3ZM7A 1JM6A 5D7RA 4B6CA 1YC3A 4URNA 2O1UA 3C11A 2XCMA 2Q8GA 4P7AA 4MPEA 5D7DA 4FCRA 1UY9A 5J6AA 2YKBA 4BIZA 4CE1A 1KZNA 2XX4A 4EGKA 2CCTA 2BU2A 1Y4SA 2CH4A 2YGAA 4ASAA 2H8MA 4O07A 4MP7A 3T10A 3VHAA 4P8OA 4CWTA 3RKZA 2CCSA 2WI1A 4CWOA 4V26A 4U93A 1UYIA 4XKOA 4YKWA 2FWYA 3D36A 3ZXQA 1GKZA 4JQLA 3S5TA 2HG1A 4JASA 4L93A 4O04A 4PRVA 3OMUA 4HYPA 1THNA 1TBWA 4FPPA 2XD6A 1I5AA 2HKJA 2YKEA 3CWVA 2YE5A 3IEDA 1BKNA 2CG9A 2YGFA 1A4HA 2YEHA 2C1GA 1MX0A 3C0EA 4FCPA 2XX2A 2WEQA 5F3KA 3TZ2A 1I58A 2AKPA 3D0BA 5BODA 2IOQA 2IWSA 4EM7A 2C2AA 4BQJA 2YE2A 1I5CA 2BRCA 2HCHA 3U2KA 3HZ1A 5CTXA 2WI5A 4BXIA 4BIUA 2WERA 5FNDA 4PU9A 2ZBKB 3WQ9A 4JAVA 5C93A 3HYZA 1YT0A 4KTNA 2FXSA 3EHJA 3KE6A 2XJXA 3HZ5A 4GT8A 1AM1A 3H80A 2BU5A 1AJ6A 1H7UA 2JKIA 1TC6A 2YEAA 2IWUA 3OPDA 3A0RA 2UWDA 2YJXA 3A0WA 4AS9A 2BSMA 1UYDA 1Z5BA 4YKXA 4YKZA 2Q8HA 1UY7A 3CGYA 4HXZA 1EA6A 2EXLA 1UYMA 4Q20A 3HYYA 1YC4A 1UYGA 3FV5A 5D7CA 4XIQA 1ID0A 1NHJA 4PL9A 3FT5A 4HY1A 4KQVA 1Y4UA 2Q8FA 5GGZA 4QPKA 3MNRP 4ZKIA 2ZKJA 3OWDA 3NMQA 4LWEA 1YT2A 2QF6A 4YKUA 1YSRA 1QYEA 3Q5JA 1I5DA 5IDJA 4KSGA 1I59A 4U7OA 4H81A 3B28A 4XCJA 1H7SA 3CRLA 3BM9A 4HZ0A 4MBCA 4E72A 3PEHA 2IORA 5CF0A 4CWPA 2YJWA 3R4MA 3LMMA 1EI1A
chains in the Genus database with same CATH topology
5M4KA 4CWQA 2JJCA 5BOCA 2CCUA 3INXA 2QFOA 4AWOA 3CGZA 4CWNA 3QTFA 2XJJA 3EHHA 3TZ0A 4WUDA 2ESAA 4LWFA 4XKKA 3T2SA 4YKRA 2YEGA 3VHCA 4XIRA 3PEJA 3HEKA 4L90A 2Q2EB 5FWKA 3LNUA 4FMTA 1GJVA 2YEEA 4GCZA 4EFUA 2YEIA 3ZXOA 1NHIA 2BU8A 2YE4A 4GQTA 4X9LA 1YERA 5CTYA 3U2DA 3G7BA 3CRKA 4HXWA 2YKCA 2XDSA 3TTZA 5IN9A 4YKQA 2GQPA 1B3QA 4H85A 5L3JA 5FNCA 4XITA 3T0HA 4QPJA 1BXDA 4ASBA 2QG2A 1Z5CA 3EKOA 1NHHA 4LWGA 2WI3A 2BTZA 1TILA 3GIFA 1UYEA 4H7QA 1MU5A 3EKRA 4XD8A 4V25A 2WI7A 2QG0A 1PVGA 4XDMA 2BREA 3JZ3A 2BYIA 4E01A 1KIJA 3B26A 5M4HA 2GFDA 2WI4A 4I5SA 3O2FA 3A0YA 2YI6A 4BQGA 2YE6A 2VCJA 3OWBA 3ZKDA 1Z59A 1AH6A 2FYPA 2XDKA 1ZXMA 1YC1A 2YK9A 4XC0A 5M4EA 4KFGA 1GKXA 2YE8A 5D6PA 1UYCA 5J71A 4MB9A 2YEFA 3WHAA 1YS3A 4GGLA 3FT8A 4CWRA 3HHUA 4MPCA 1TH8A 1S16A 4LWIA 4WUBA 4ZVIA 3TZ4A 3G7EA 4KP4A 3T1KA 1QY8A 2K5BA 4XKAA 3TZ5A 4XE2A 5CTWA 1U0ZA 2FWZA 1YETA 3D2RA 4URLA 4UROA 4E02A 2YECA 3GIGB 2XABA 2BU6A 3R4OA 4EGHA 4HY6A 2BU7A 2XHXA 5IDMA 5M4NA 1UYHA 3VHDA 4YKYA 3R91A 2XDUA 4URMA 1Y8NA 2IOPA 4DZYA 4MP2A 3A0XA 2XJGA 2YGEA 2ZDYA 4U7NA 3R4NA 5D6QA 1UYKA 3K99A 3K98A 2O1VA 1Y8PA 2VWCA 2BZ5A 3O6OA 3B27A 2XX5A 2YI0A 4EMVA 1YSZA 1US7A 2YE3A 4PRXA 1BYQA 1S14A 4XCLA 4KSHA 1YESA 4CWSA 2WI6A 2BT0A 4LP0A 4YKTA 1UY8A 5FNFA 2YK2A 2PNRA 4ASFA 1YT1A 1ZWHA 1I5BA 1QZRA 3T0ZA 2O1WA 4AWPA 1ZW9A 3VADA 2YKJA 3OW6A 4NH7A 1TC0A 1AMWA 4CE3A 3K60A 5M4PA 1UYFA 3Q5KA 4LPBA 2YEBA 4L94A 4GFNA 4HYMA 1Z5AA 1TIDA 4LWHA 3ZKBA 3R4PA 4NH9A 2YE7A 4CE2A 2IWXA 3EHGA 4HZ5A 3RLRA 2XDLA 4XTJA 1OSFA 1B63A 3K97A 4BAEA 4GEEA 3Q5LA 4EFTA 4JAUA 3SL2A 5CTUA 3DGEA 1ZXNA 4I3HA 4W7TA 2H55A 1AH8A 4ASGA 1UY6A 3U67A 2WEPA 4O05A 3H4LA 3BMYA 1B62A 4E00A 2VCIA 3INWA 4R1FA 2XDXA 4O09A 4K4OA 2YI5A 4XIPA 1BGQA 3QDDA 4NH8A 2VW5A 1UYLA 4R3MA 4WUCA 3GIGA 3A0ZA 3A0TA 3RLPA 2YKIA 4EEHA 4MOTA 2YEJA 5CPHA 4L8ZA 4L91A 5F5RA 2XHTA 2WI2A 4MPNA 2ZDXA 3EHFA 5M4MA 4DUHA 2XHRA 1L0OA 1R62A 2YI7A 4O0BA 1U2OA 2E0AA 4EGIA 2YEDA 3R92A 3RLQA 3G75A 4B7PA 2XK2A 2BYHA 3B24A 2Q8IA 3O0IA 3LPSA 4CWFA 3B25A 4FCQA 3TUHA 2YE9A 4AWQA 2CGFA 1Y8OA 4R3AA 3GIEA 3ZM7A 1JM6A 5D7RA 4B6CA 1YC3A 4URNA 2O1UA 3C11A 2XCMA 2Q8GA 4P7AA 4MPEA 5D7DA 4FCRA 1UY9A 5J6AA 2YKBA 4BIZA 4CE1A 1KZNA 2XX4A 4EGKA 2CCTA 2BU2A 1Y4SA 2CH4A 2YGAA 4ASAA 2H8MA 4O07A 4MP7A 3T10A 3VHAA 4P8OA 4CWTA 3RKZA 2CCSA 2WI1A 4CWOA 4V26A 4U93A 1UYIA 4XKOA 4YKWA 2FWYA 3D36A 3ZXQA 1GKZA 4JQLA 2HG1A 4JASA 4L93A 4O04A 4PRVA 3OMUA 4HYPA 1THNA 1TBWA 4FPPA 2XD6A 1I5AA 2HKJA 2YKEA 3CWVA 2YE5A 3IEDA 1BKNA 2CG9A 2YGFA 1A4HA 2YEHA 1MX0A 3C0EA 4FCPA 2XX2A 2WEQA 5F3KA 3TZ2A 1I58A 2AKPA 3D0BA 5BODA 2IOQA 2IWSA 4EM7A 2C2AA 4BQJA 2YE2A 1I5CA 2BRCA 2HCHA 3U2KA 3HZ1A 5CTXA 2WI5A 4BXIA 4BIUA 2WERA 5FNDA 4PU9A 2ZBKB 3WQ9A 4JAVA 5C93A 3HYZA 1YT0A 4KTNA 2FXSA 3EHJA 3KE6A 2XJXA 3HZ5A 4GT8A 1AM1A 3H80A 2BU5A 1AJ6A 1H7UA 2JKIA 1TC6A 2YEAA 2IWUA 3OPDA 3A0RA 2UWDA 2YJXA 3A0WA 4AS9A 2BSMA 1UYDA 1Z5BA 4YKXA 4YKZA 2Q8HA 1UY7A 3CGYA 4HXZA 1EA6A 2EXLA 1UYMA 4Q20A 3HYYA 1YC4A 1UYGA 3FV5A 5D7CA 4XIQA 1ID0A 1NHJA 4PL9A 3FT5A 4HY1A 4KQVA 1Y4UA 2Q8FA 5GGZA 4QPKA 3MNRP 4ZKIA 2ZKJA 3OWDA 3NMQA 4LWEA 1YT2A 2QF6A 4YKUA 1YSRA 1QYEA 3Q5JA 1I5DA 5IDJA 4KSGA 1I59A 4U7OA 4H81A 3B28A 4XCJA 1H7SA 3CRLA 3BM9A 4HZ0A 4MBCA 5CF0A 2IORA 3PEHA 4CWPA 2YJWA 3R4MA 1EI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M4K A;  4CWQ A;  2JJC A;  5BOC A;  2CCU A;  3INX A;  2QFO A;  4AWO A;  3CGZ A;  4CWN A;  3QTF A;  2XJJ A;  3EHH A;  3TZ0 A;  4WUD A;  2ESA A;  4LWF A;  4XKK A;  3T2S A;  4YKR A;  2YEG A;  3VHC A;  4XIR A;  3PEJ A;  3HEK A;  4L90 A;  2Q2E B;  5FWK A;  3LNU A;  4FMT A;  1GJV A;  2YEE A;  4GCZ A;  4EFU A;  2YEI A;  3ZXO A;  1NHI A;  2BU8 A;  2YE4 A;  4GQT A;  4X9L A;  1YER A;  5CTY A;  3U2D A;  3G7B A;  3CRK A;  4HXW A;  2YKC A;  2XDS A;  3TTZ A;  5IN9 A;  4YKQ A;  2GQP A;  1B3Q A;  4H85 A;  5L3J A;  5FNC A;  4XIT A;  3T0H A;  4QPJ A;  1BXD A;  4ASB A;  2QG2 A;  1Z5C A;  3EKO A;  1NHH A;  4LWG A;  2WI3 A;  2BTZ A;  1TIL A;  3GIF A;  1UYE A;  4H7Q A;  1MU5 A;  3EKR A;  4XD8 A;  4V25 A;  2WI7 A;  2QG0 A;  1PVG A;  4XDM A;  2BRE A;  3JZ3 A;  2BYI A;  4E01 A;  1KIJ A;  3B26 A;  5M4H A;  2GFD A;  2WI4 A;  4I5S A;  3O2F A;  3A0Y A;  2YI6 A;  4BQG A;  2YE6 A;  2VCJ A;  3OWB A;  3ZKD A;  1Z59 A;  1AH6 A;  2FYP A;  2XDK A;  1ZXM A;  1YC1 A;  2YK9 A;  4XC0 A;  5M4E A;  4KFG A;  1GKX A;  2YE8 A;  5D6P A;  1UYC A;  5J71 A;  4MB9 A;  2YEF A;  3WHA A;  1YS3 A;  4GGL A;  3FT8 A;  4CWR A;  3HHU A;  4MPC A;  1TH8 A;  1S16 A;  4LWI A;  4WUB A;  4ZVI A;  3TZ4 A;  3G7E A;  4KP4 A;  3T1K A;  1QY8 A;  2K5B A;  4XKA A;  3TZ5 A;  4XE2 A;  5CTW A;  1U0Z A;  2FWZ A;  1YET A;  3D2R A;  4URL A;  4URO A;  4E02 A;  2YEC A;  3GIG B;  2XAB A;  2BU6 A;  3R4O A;  4EGH A;  4HY6 A;  2BU7 A;  2XHX A;  5IDM A;  5M4N A;  1UYH A;  3VHD A;  4YKY A;  3R91 A;  2XDU A;  4URM A;  1Y8N A;  2IOP A;  4DZY A;  4MP2 A;  3A0X A;  2XJG A;  2YGE A;  2ZDY A;  4U7N A;  3R4N A;  5D6Q A;  1UYK A;  3K99 A;  3K98 A;  2O1V A;  1Y8P A;  2VWC A;  2BZ5 A;  3O6O A;  3B27 A;  2XX5 A;  2YI0 A;  4EMV A;  1YSZ A;  1US7 A;  2YE3 A;  4PRX A;  1BYQ A;  1S14 A;  4XCL A;  4KSH A;  1YES A;  4CWS A;  2WI6 A;  2BT0 A;  4LP0 A;  4YKT A;  1UY8 A;  5FNF A;  2YK2 A;  2PNR A;  4ASF A;  1YT1 A;  1ZWH A;  1I5B A;  1QZR A;  3T0Z A;  2O1W A;  4AWP A;  1ZW9 A;  3VAD A;  2YKJ A;  3OW6 A;  4NH7 A;  1TC0 A;  1AMW A;  4CE3 A;  3K60 A;  5M4P A;  1UYF A;  3Q5K A;  4LPB A;  2YEB A;  4L94 A;  4GFN A;  4HYM A;  1Z5A A;  1TID A;  4LWH A;  3ZKB A;  3R4P A;  4NH9 A;  2YE7 A;  4CE2 A;  2IWX A;  3EHG A;  4HZ5 A;  3RLR A;  2XDL A;  4XTJ A;  1OSF A;  1B63 A;  3K97 A;  4BAE A;  4GEE A;  3Q5L A;  4EFT A;  4JAU A;  3SL2 A;  5CTU A;  3DGE A;  1ZXN A;  4I3H A;  4W7T A;  2H55 A;  1AH8 A;  4ASG A;  1UY6 A;  3U67 A;  2WEP A;  4O05 A;  3H4L A;  3BMY A;  1B62 A;  4E00 A;  2VCI A;  3INW A;  4R1F A;  2XDX A;  4O09 A;  4K4O A;  2YI5 A;  4XIP A;  1BGQ A;  3QDD A;  4NH8 A;  2VW5 A;  1UYL A;  4R3M A;  4WUC A;  3GIG A;  3A0Z A;  3A0T A;  3RLP A;  2YKI A;  4EEH A;  4MOT A;  2YEJ A;  5CPH A;  4L8Z A;  4L91 A;  5F5R A;  2XHT A;  2WI2 A;  4MPN A;  2ZDX A;  3EHF A;  5M4M A;  4DUH A;  2XHR A;  1L0O A;  1R62 A;  2YI7 A;  4O0B A;  1U2O A;  2E0A A;  4EGI A;  2YED A;  3R92 A;  3RLQ A;  3G75 A;  4B7P A;  2XK2 A;  2BYH A;  3B24 A;  2Q8I A;  3O0I A;  3LPS A;  4CWF A;  3B25 A;  4FCQ A;  3TUH A;  2YE9 A;  4AWQ A;  2CGF A;  1Y8O A;  4R3A A;  3GIE A;  3ZM7 A;  1JM6 A;  5D7R A;  4B6C A;  1YC3 A;  4URN A;  2O1U A;  3C11 A;  2XCM A;  2Q8G A;  4P7A A;  4MPE A;  5D7D A;  4FCR A;  1UY9 A;  5J6A A;  2YKB A;  4BIZ A;  4CE1 A;  1KZN A;  2XX4 A;  4EGK A;  2CCT A;  2BU2 A;  1Y4S A;  2CH4 A;  2YGA A;  4ASA A;  2H8M A;  4O07 A;  4MP7 A;  3T10 A;  3VHA A;  4P8O A;  4CWT A;  3RKZ A;  2CCS A;  2WI1 A;  4CWO A;  4V26 A;  4U93 A;  1UYI A;  4XKO A;  4YKW A;  2FWY A;  3D36 A;  3ZXQ A;  1GKZ A;  4JQL A;  2HG1 A;  4JAS A;  4L93 A;  4O04 A;  4PRV A;  3OMU A;  4HYP A;  1THN A;  1TBW A;  4FPP A;  2XD6 A;  1I5A A;  2HKJ A;  2YKE A;  3CWV A;  2YE5 A;  3IED A;  1BKN A;  2CG9 A;  2YGF A;  1A4H A;  2YEH A;  1MX0 A;  3C0E A;  4FCP A;  2XX2 A;  2WEQ A;  5F3K A;  3TZ2 A;  1I58 A;  2AKP A;  3D0B A;  5BOD A;  2IOQ A;  2IWS A;  4EM7 A;  2C2A A;  4BQJ A;  2YE2 A;  1I5C A;  2BRC A;  2HCH A;  3U2K A;  3HZ1 A;  5CTX A;  2WI5 A;  4BXI A;  4BIU A;  2WER A;  5FND A;  4PU9 A;  2ZBK B;  3WQ9 A;  4JAV A;  5C93 A;  3HYZ A;  1YT0 A;  4KTN A;  2FXS A;  3EHJ A;  3KE6 A;  2XJX A;  3HZ5 A;  4GT8 A;  1AM1 A;  3H80 A;  2BU5 A;  1AJ6 A;  1H7U A;  2JKI A;  1TC6 A;  2YEA A;  2IWU A;  3OPD A;  3A0R A;  2UWD A;  2YJX A;  3A0W A;  4AS9 A;  2BSM A;  1UYD A;  1Z5B A;  4YKX A;  4YKZ A;  2Q8H A;  1UY7 A;  3CGY A;  4HXZ A;  1EA6 A;  2EXL A;  1UYM A;  4Q20 A;  3HYY A;  1YC4 A;  1UYG A;  3FV5 A;  5D7C A;  4XIQ A;  1ID0 A;  1NHJ A;  4PL9 A;  3FT5 A;  4HY1 A;  4KQV A;  1Y4U A;  2Q8F A;  5GGZ A;  4QPK A;  3MNR P;  4ZKI A;  2ZKJ A;  3OWD A;  3NMQ A;  4LWE A;  1YT2 A;  2QF6 A;  4YKU A;  1YSR A;  1QYE A;  3Q5J A;  1I5D A;  5IDJ A;  4KSG A;  1I59 A;  4U7O A;  4H81 A;  3B28 A;  4XCJ A;  1H7S A;  3CRL A;  3BM9 A;  4HZ0 A;  4MBC A;  5CF0 A;  2IOR A;  3PEH A;  4CWP A;  2YJW A;  3R4M A;  1EI1 A; 
#chains in the Genus database with same CATH topology
 5M4K A;  4CWQ A;  2JJC A;  5BOC A;  2CCU A;  3INX A;  2QFO A;  4AWO A;  3CGZ A;  4CWN A;  3QTF A;  2XJJ A;  3EHH A;  3TZ0 A;  4WUD A;  2ESA A;  4LWF A;  4XKK A;  3T2S A;  4YKR A;  2YEG A;  3VHC A;  4XIR A;  3PEJ A;  3HEK A;  4L90 A;  2Q2E B;  5FWK A;  3LNU A;  4FMT A;  1GJV A;  2YEE A;  4GCZ A;  4EFU A;  5JEN A;  2YEI A;  3ZXO A;  1NHI A;  2BU8 A;  2YE4 A;  4GQT A;  4X9L A;  1YER A;  5CTY A;  3U2D A;  3G7B A;  3CRK A;  4HXW A;  2YKC A;  2XDS A;  3TTZ A;  5IN9 A;  4YKQ A;  2GQP A;  1B3Q A;  4H85 A;  5L3J A;  5FNC A;  4XIT A;  3T0H A;  4QPJ A;  1BXD A;  4ASB A;  2QG2 A;  1Z5C A;  3EKO A;  1NHH A;  4LWG A;  2WI3 A;  2BTZ A;  1TIL A;  3GIF A;  1UYE A;  4H7Q A;  1MU5 A;  3EKR A;  4XD8 A;  4V25 A;  2WI7 A;  2QG0 A;  1PVG A;  4XDM A;  2BRE A;  3JZ3 A;  2BYI A;  4E01 A;  1KIJ A;  3B26 A;  5M4H A;  2GFD A;  2WI4 A;  4I5S A;  3O2F A;  1F51 A;  3A0Y A;  2YI6 A;  4BQG A;  2YE6 A;  2VCJ A;  3OWB A;  3ZKD A;  1Z59 A;  1AH6 A;  2FYP A;  2XDK A;  1ZXM A;  1YC1 A;  2YK9 A;  4XC0 A;  5M4E A;  4KFG A;  1GKX A;  2C1I A;  2YE8 A;  3CYG A;  5D6P A;  1UYC A;  5J71 A;  4MB9 A;  2YEF A;  3WHA A;  1YS3 A;  4GGL A;  3FT8 A;  4CWR A;  3HHU A;  4MPC A;  1TH8 A;  1S16 A;  4LWI A;  4WUB A;  4ZVI A;  3TZ4 A;  3G7E A;  4KP4 A;  3T1K A;  1QY8 A;  2K5B A;  4XKA A;  3TZ5 A;  4XE2 A;  5CTW A;  1U0Z A;  2FWZ A;  1YET A;  3D2R A;  4URL A;  4URO A;  4E02 A;  2YEC A;  3GIG B;  2XAB A;  2BU6 A;  3R4O A;  4EGH A;  4HY6 A;  2BU7 A;  2XHX A;  5IDM A;  5M4N A;  1UYH A;  3VHD A;  4YKY A;  3R91 A;  2XDU A;  4URM A;  1Y8N A;  2IOP A;  4DZY A;  4MP2 A;  3A0X A;  2XJG A;  2YGE A;  2ZDY A;  4U7N A;  3R4N A;  5D6Q A;  1UYK A;  3K99 A;  3K98 A;  2O1V A;  1Y8P A;  2VWC A;  2BZ5 A;  3O6O A;  3B27 A;  2XX5 A;  2YI0 A;  4EMV A;  1YSZ A;  1US7 A;  2YE3 A;  4PRX A;  1BYQ A;  1S14 A;  2FTK A;  4XCL A;  4KSH A;  1YES A;  4CWS A;  2WI6 A;  2BT0 A;  4LP0 A;  4YKT A;  1UY8 A;  5FNF A;  2YK2 A;  2PNR A;  4ASF A;  1YT1 A;  1ZWH A;  1I5B A;  1QZR A;  3T0Z A;  2O1W A;  4AWP A;  1ZW9 A;  3VAD A;  2YKJ A;  3OW6 A;  4NH7 A;  1TC0 A;  1AMW A;  4CE3 A;  3K60 A;  5M4P A;  1UYF A;  3Q5K A;  4LPB A;  2YEB A;  4L94 A;  4GFN A;  4HYM A;  1Z5A A;  1TID A;  4LWH A;  3ZKB A;  3R4P A;  4NH9 A;  2YE7 A;  4CE2 A;  2IWX A;  3EHG A;  4HZ5 A;  3RLR A;  2XDL A;  4XTJ A;  1OSF A;  1B63 A;  3K97 A;  4BAE A;  4GEE A;  3Q5L A;  4EFT A;  4JAU A;  3SL2 A;  5CTU A;  3DGE A;  1ZXN A;  4I3H A;  4W7T A;  2H55 A;  1AH8 A;  4ASG A;  1UY6 A;  3U67 A;  2WEP A;  4O05 A;  3H4L A;  3BMY A;  1B62 A;  4E00 A;  2VCI A;  3INW A;  4R1F A;  2XDX A;  4O09 A;  4K4O A;  2HHI A;  2YI5 A;  4XIP A;  1BGQ A;  3QDD A;  4NH8 A;  2VW5 A;  1UYL A;  4R3M A;  4WUC A;  3GIG A;  3A0Z A;  3A0T A;  3RLP A;  2YKI A;  4EEH A;  4MOT A;  2YEJ A;  5CPH A;  4L8Z A;  4L91 A;  5F5R A;  2XHT A;  2WI2 A;  4MPN A;  2ZDX A;  3EHF A;  5M4M A;  4DUH A;  2XHR A;  1L0O A;  1R62 A;  2YI7 A;  4O0B A;  1U2O A;  2E0A A;  4EGI A;  2YED A;  3R92 A;  3RLQ A;  3G75 A;  4B7P A;  2XK2 A;  2BYH A;  3B24 A;  2Q8I A;  3O0I A;  3LPS A;  4CWF A;  3B25 A;  1IXM A;  4FCQ A;  3TUH A;  2YE9 A;  4AWQ A;  2CGF A;  1Y8O A;  4R3A A;  3GIE A;  3ZM7 A;  1JM6 A;  5D7R A;  4B6C A;  1YC3 A;  4URN A;  2O1U A;  3C11 A;  2XCM A;  2Q8G A;  4P7A A;  4MPE A;  5D7D A;  4FCR A;  1UY9 A;  5J6A A;  2YKB A;  4BIZ A;  4CE1 A;  1KZN A;  2XX4 A;  4EGK A;  2CCT A;  2BU2 A;  1Y4S A;  2CH4 A;  2YGA A;  4ASA A;  2H8M A;  4O07 A;  4MP7 A;  3T10 A;  3VHA A;  4P8O A;  4CWT A;  3RKZ A;  2CCS A;  2WI1 A;  4CWO A;  4V26 A;  4U93 A;  1UYI A;  4XKO A;  4YKW A;  2FWY A;  3D36 A;  3ZXQ A;  1GKZ A;  4JQL A;  3S5T A;  2HG1 A;  4JAS A;  4L93 A;  4O04 A;  4PRV A;  3OMU A;  4HYP A;  1THN A;  1TBW A;  4FPP A;  2XD6 A;  1I5A A;  2HKJ A;  2YKE A;  3CWV A;  2YE5 A;  3IED A;  1BKN A;  2CG9 A;  2YGF A;  1A4H A;  2YEH A;  2C1G A;  1MX0 A;  3C0E A;  4FCP A;  2XX2 A;  2WEQ A;  5F3K A;  3TZ2 A;  1I58 A;  2AKP A;  3D0B A;  5BOD A;  2IOQ A;  2IWS A;  4EM7 A;  2C2A A;  4BQJ A;  2YE2 A;  1I5C A;  2BRC A;  2HCH A;  3U2K A;  3HZ1 A;  5CTX A;  2WI5 A;  4BXI A;  4BIU A;  2WER A;  5FND A;  4PU9 A;  2ZBK B;  3WQ9 A;  4JAV A;  5C93 A;  3HYZ A;  1YT0 A;  4KTN A;  2FXS A;  3EHJ A;  3KE6 A;  2XJX A;  3HZ5 A;  4GT8 A;  1AM1 A;  3H80 A;  2BU5 A;  1AJ6 A;  1H7U A;  2JKI A;  1TC6 A;  2YEA A;  2IWU A;  3OPD A;  3A0R A;  2UWD A;  2YJX A;  3A0W A;  4AS9 A;  2BSM A;  1UYD A;  1Z5B A;  4YKX A;  4YKZ A;  2Q8H A;  1UY7 A;  3CGY A;  4HXZ A;  1EA6 A;  2EXL A;  1UYM A;  4Q20 A;  3HYY A;  1YC4 A;  1UYG A;  3FV5 A;  5D7C A;  4XIQ A;  1ID0 A;  1NHJ A;  4PL9 A;  3FT5 A;  4HY1 A;  4KQV A;  1Y4U A;  2Q8F A;  5GGZ A;  4QPK A;  3MNR P;  4ZKI A;  2ZKJ A;  3OWD A;  3NMQ A;  4LWE A;  1YT2 A;  2QF6 A;  4YKU A;  1YSR A;  1QYE A;  3Q5J A;  1I5D A;  5IDJ A;  4KSG A;  1I59 A;  4U7O A;  4H81 A;  3B28 A;  4XCJ A;  1H7S A;  3CRL A;  3BM9 A;  4HZ0 A;  4MBC A;  4E72 A;  3PEH A;  2IOR A;  5CF0 A;  4CWP A;  2YJW A;  3R4M A;  3LMM A;  1EI1 A; 
#chains in the Genus database with same CATH homology
 5M4K A;  4CWQ A;  2JJC A;  5BOC A;  2CCU A;  3INX A;  2QFO A;  4AWO A;  3CGZ A;  4CWN A;  3QTF A;  2XJJ A;  3EHH A;  3TZ0 A;  4WUD A;  2ESA A;  4LWF A;  4XKK A;  3T2S A;  4YKR A;  2YEG A;  3VHC A;  4XIR A;  3PEJ A;  3HEK A;  4L90 A;  2Q2E B;  5FWK A;  3LNU A;  4FMT A;  1GJV A;  2YEE A;  4GCZ A;  4EFU A;  2YEI A;  3ZXO A;  1NHI A;  2BU8 A;  2YE4 A;  4GQT A;  4X9L A;  1YER A;  5CTY A;  3U2D A;  3G7B A;  3CRK A;  4HXW A;  2YKC A;  2XDS A;  3TTZ A;  5IN9 A;  4YKQ A;  2GQP A;  1B3Q A;  4H85 A;  5L3J A;  5FNC A;  4XIT A;  3T0H A;  4QPJ A;  1BXD A;  4ASB A;  2QG2 A;  1Z5C A;  3EKO A;  1NHH A;  4LWG A;  2WI3 A;  2BTZ A;  1TIL A;  3GIF A;  1UYE A;  4H7Q A;  1MU5 A;  3EKR A;  4XD8 A;  4V25 A;  2WI7 A;  2QG0 A;  1PVG A;  4XDM A;  2BRE A;  3JZ3 A;  2BYI A;  4E01 A;  1KIJ A;  3B26 A;  5M4H A;  2GFD A;  2WI4 A;  4I5S A;  3O2F A;  3A0Y A;  2YI6 A;  4BQG A;  2YE6 A;  2VCJ A;  3OWB A;  3ZKD A;  1Z59 A;  1AH6 A;  2FYP A;  2XDK A;  1ZXM A;  1YC1 A;  2YK9 A;  4XC0 A;  5M4E A;  4KFG A;  1GKX A;  2YE8 A;  5D6P A;  1UYC A;  5J71 A;  4MB9 A;  2YEF A;  3WHA A;  1YS3 A;  4GGL A;  3FT8 A;  4CWR A;  3HHU A;  4MPC A;  1TH8 A;  1S16 A;  4LWI A;  4WUB A;  4ZVI A;  3TZ4 A;  3G7E A;  4KP4 A;  3T1K A;  1QY8 A;  2K5B A;  4XKA A;  3TZ5 A;  4XE2 A;  5CTW A;  1U0Z A;  2FWZ A;  1YET A;  3D2R A;  4URL A;  4URO A;  4E02 A;  2YEC A;  3GIG B;  2XAB A;  2BU6 A;  3R4O A;  4EGH A;  4HY6 A;  2BU7 A;  2XHX A;  5IDM A;  5M4N A;  1UYH A;  3VHD A;  4YKY A;  3R91 A;  2XDU A;  4URM A;  1Y8N A;  2IOP A;  4DZY A;  4MP2 A;  3A0X A;  2XJG A;  2YGE A;  2ZDY A;  4U7N A;  3R4N A;  5D6Q A;  1UYK A;  3K99 A;  3K98 A;  2O1V A;  1Y8P A;  2VWC A;  2BZ5 A;  3O6O A;  3B27 A;  2XX5 A;  2YI0 A;  4EMV A;  1YSZ A;  1US7 A;  2YE3 A;  4PRX A;  1BYQ A;  1S14 A;  4XCL A;  4KSH A;  1YES A;  4CWS A;  2WI6 A;  2BT0 A;  4LP0 A;  4YKT A;  1UY8 A;  5FNF A;  2YK2 A;  2PNR A;  4ASF A;  1YT1 A;  1ZWH A;  1I5B A;  1QZR A;  3T0Z A;  2O1W A;  4AWP A;  1ZW9 A;  3VAD A;  2YKJ A;  3OW6 A;  4NH7 A;  1TC0 A;  1AMW A;  4CE3 A;  3K60 A;  5M4P A;  1UYF A;  3Q5K A;  4LPB A;  2YEB A;  4L94 A;  4GFN A;  4HYM A;  1Z5A A;  1TID A;  4LWH A;  3ZKB A;  3R4P A;  4NH9 A;  2YE7 A;  4CE2 A;  2IWX A;  3EHG A;  4HZ5 A;  3RLR A;  2XDL A;  4XTJ A;  1OSF A;  1B63 A;  3K97 A;  4BAE A;  4GEE A;  3Q5L A;  4EFT A;  4JAU A;  3SL2 A;  5CTU A;  3DGE A;  1ZXN A;  4I3H A;  4W7T A;  2H55 A;  1AH8 A;  4ASG A;  1UY6 A;  3U67 A;  2WEP A;  4O05 A;  3H4L A;  3BMY A;  1B62 A;  4E00 A;  2VCI A;  3INW A;  4R1F A;  2XDX A;  4O09 A;  4K4O A;  2YI5 A;  4XIP A;  1BGQ A;  3QDD A;  4NH8 A;  2VW5 A;  1UYL A;  4R3M A;  4WUC A;  3GIG A;  3A0Z A;  3A0T A;  3RLP A;  2YKI A;  4EEH A;  4MOT A;  2YEJ A;  5CPH A;  4L8Z A;  4L91 A;  5F5R A;  2XHT A;  2WI2 A;  4MPN A;  2ZDX A;  3EHF A;  5M4M A;  4DUH A;  2XHR A;  1L0O A;  1R62 A;  2YI7 A;  4O0B A;  1U2O A;  2E0A A;  4EGI A;  2YED A;  3R92 A;  3RLQ A;  3G75 A;  4B7P A;  2XK2 A;  2BYH A;  3B24 A;  2Q8I A;  3O0I A;  3LPS A;  4CWF A;  3B25 A;  4FCQ A;  3TUH A;  2YE9 A;  4AWQ A;  2CGF A;  1Y8O A;  4R3A A;  3GIE A;  3ZM7 A;  1JM6 A;  5D7R A;  4B6C A;  1YC3 A;  4URN A;  2O1U A;  3C11 A;  2XCM A;  2Q8G A;  4P7A A;  4MPE A;  5D7D A;  4FCR A;  1UY9 A;  5J6A A;  2YKB A;  4BIZ A;  4CE1 A;  1KZN A;  2XX4 A;  4EGK A;  2CCT A;  2BU2 A;  1Y4S A;  2CH4 A;  2YGA A;  4ASA A;  2H8M A;  4O07 A;  4MP7 A;  3T10 A;  3VHA A;  4P8O A;  4CWT A;  3RKZ A;  2CCS A;  2WI1 A;  4CWO A;  4V26 A;  4U93 A;  1UYI A;  4XKO A;  4YKW A;  2FWY A;  3D36 A;  3ZXQ A;  1GKZ A;  4JQL A;  2HG1 A;  4JAS A;  4L93 A;  4O04 A;  4PRV A;  3OMU A;  4HYP A;  1THN A;  1TBW A;  4FPP A;  2XD6 A;  1I5A A;  2HKJ A;  2YKE A;  3CWV A;  2YE5 A;  3IED A;  1BKN A;  2CG9 A;  2YGF A;  1A4H A;  2YEH A;  1MX0 A;  3C0E A;  4FCP A;  2XX2 A;  2WEQ A;  5F3K A;  3TZ2 A;  1I58 A;  2AKP A;  3D0B A;  5BOD A;  2IOQ A;  2IWS A;  4EM7 A;  2C2A A;  4BQJ A;  2YE2 A;  1I5C A;  2BRC A;  2HCH A;  3U2K A;  3HZ1 A;  5CTX A;  2WI5 A;  4BXI A;  4BIU A;  2WER A;  5FND A;  4PU9 A;  2ZBK B;  3WQ9 A;  4JAV A;  5C93 A;  3HYZ A;  1YT0 A;  4KTN A;  2FXS A;  3EHJ A;  3KE6 A;  2XJX A;  3HZ5 A;  4GT8 A;  1AM1 A;  3H80 A;  2BU5 A;  1AJ6 A;  1H7U A;  2JKI A;  1TC6 A;  2YEA A;  2IWU A;  3OPD A;  3A0R A;  2UWD A;  2YJX A;  3A0W A;  4AS9 A;  2BSM A;  1UYD A;  1Z5B A;  4YKX A;  4YKZ A;  2Q8H A;  1UY7 A;  3CGY A;  4HXZ A;  1EA6 A;  2EXL A;  1UYM A;  4Q20 A;  3HYY A;  1YC4 A;  1UYG A;  3FV5 A;  5D7C A;  4XIQ A;  1ID0 A;  1NHJ A;  4PL9 A;  3FT5 A;  4HY1 A;  4KQV A;  1Y4U A;  2Q8F A;  5GGZ A;  4QPK A;  3MNR P;  4ZKI A;  2ZKJ A;  3OWD A;  3NMQ A;  4LWE A;  1YT2 A;  2QF6 A;  4YKU A;  1YSR A;  1QYE A;  3Q5J A;  1I5D A;  5IDJ A;  4KSG A;  1I59 A;  4U7O A;  4H81 A;  3B28 A;  4XCJ A;  1H7S A;  3CRL A;  3BM9 A;  4HZ0 A;  4MBC A;  5CF0 A;  2IOR A;  3PEH A;  4CWP A;  2YJW A;  3R4M A;  1EI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...