5CTXA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Fragment-based discovery of DNA gyrase inhibitors targeting the ATPase subunit of GyrB.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
total genus 65
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5ctxA00
3MNRP 5BOCA 1UY9A 1UYCA 4O07A 4U93A 3LNUA 4L90A 5M4NA 1UYMA 1Z59A 4HXWA 3T0HA 4CWSA 3EHJA 1ZW9A 5M4KA 5CTXA 3HZ1A 2O1UA 5D7CA 4GFNA 4XIPA 3U2KA 3D36A 2Q8HA 3LPSA 4XCJA 4E02A 1YC1A 1GKZA 3A0TA 1ZWHA 3T0ZA 4NH9A 4KSGA 3GIGA 4L94A 3RKZA 1Y8NA 5L3JA 3C11A 1YT0A 1I5CA 3CRKA 1KZNA 2QG0A 1AM1A 1UYLA 2FWYA 3R4OA 3T2SA 2YEAA 3HYYA 2YE4A 2ESAA 3CGZA 3ZKDA 3D2RA 2YE9A 3OWDA 4XKAA 1UYFA 1Z5CA 2YE7A 3EHGA 4DZYA 4XKKA 2WI3A 2E0AA 3GIEA 2YKBA 3DGEA 3GIGB 1MU5A 3CGYA 5J6AA 4CWPA 2XHRA 4HY1A 4XE2A 2VW5A 2YK2A 1R62A 4BQGA 2XHTA 2YEDA 2IORA 4CWRA 4URLA 1UY6A 2WI1A 4L93A 2H55A 2XJGA 4H85A 4U7NA 5F5RA 3H4LA 4E00A 5CPHA 4HZ0A 3R4PA 4AWPA 2XJXA 4X9LA 4CE2A 4KP4A 1UY8A 2BYIA 3IEDA 4YKRA 5IDJA 4W7TA 2YGEA 2FXSA 4XD8A 3WQ9A 2Q8IA 3HZ5A 2BRCA 2YE6A 4B7PA 2C2AA 3D0BA 4I5SA 4WUBA 2XHXA 4QPJA 4WUCA 5CF0A 4BIUA 2JKIA 3EKRA 3HHUA 1OSFA 3ZXQA 1US7A 3U2DA 2YI0A 4XIRA 1B3QA 5GGZA 3R92A 4CWFA 2BZ5A 2BU5A 4FCRA 4BAEA 3U67A 1L0OA 2BT0A 2YJXA 2CH4A 2BTZA 4JAVA 4BQJA 3Q5KA 2YK9A 3B25A 3EHHA 5J71A 4MPCA 1TC0A 5CTYA 3A0XA 4L91A 3K97A 4CWQA 5FNFA 5FNCA 1GJVA 2UWDA 4XTJA 3A0ZA 1ID0A 2QG2A 3PEJA 4LWGA 2HG1A 4EEHA 1TC6A 1I5DA 4MOTA 4URNA 2VCJA 2YGAA 5IN9A 2YECA 2YE5A 4YKTA 1Y8PA 2YKCA 2HKJA 3HEKA 2YJWA 2BU8A 5D7RA 4EGHA 1BGQA 5F3KA 2YEIA 2BYHA 4XCLA 2GFDA 3KE6A 5D6QA 4JQLA 4NH7A 4XDMA 2AKPA 4AWOA 2IWSA 4GCZA 5M4PA 2BU2A 3ZM7A 3TUHA 2XDXA 4FPPA 1Z5AA 2YKIA 4XITA 5IDMA 1QYEA 3INXA 4NH8A 2YEFA 1UYHA 1YSZA 4CWOA 5C93A 4JAUA 1BXDA 4P7AA 4O04A 2VCIA 1UYDA 5BODA 4GGLA 2WI6A 2ZDYA 4H7QA 2IOPA 1S16A 2FYPA 4KQVA 4R1FA 4PRVA 2Q8FA 4YKZA 4I3HA 1TILA 3TZ2A 1YERA 2YE2A 1U0ZA 3C0EA 5M4EA 1AMWA 3OW6A 4LWEA 3FT5A 1U2OA 4WUDA 4U7OA 4CE1A 1EI1A 1YSRA 2YKJA 3B24A 4EM7A 2VWCA 1EA6A 4HYPA 1Y8OA 1Y4UA 4BIZA 3FV5A 1A4HA 3JZ3A 1GKXA 3T1KA 2WI7A 1H7UA 1TBWA 5CTUA 4O09A 2YE8A 3VHDA 3R4MA 1UYKA 5M4MA 1BYQA 1AH8A 1JM6A 4CWNA 4ZVIA 2Q2EB 1AH6A 3G7EA 2YKEA 3R91A 1ZXMA 3EKOA 2ZDXA 2QF6A 3K99A 3BM9A 2YI5A 2ZKJA 1YC3A 2XX4A 4GT8A 3VHCA 3A0WA 3SL2A 2BREA 4HZ5A 1NHHA 2CCSA 4MP2A 1UY7A 1TIDA 4EGIA 1PVGA 2BU7A 1BKNA 4PRXA 3TZ0A 2H8MA 1YESA 3TZ4A 3K60A 4UROA 2EXLA 2YE3A 2O1VA 4PL9A 2CG9A 3Q5LA 2WEPA 2WI2A 4EGKA 2YEBA 2GQPA 1QY8A 4ASGA 4LWHA 2WEQA 2XDLA 2JJCA 3T10A 1I5BA 1I5AA 3HYZA 2CCUA 1Y4SA 4R3AA 3R4NA 2QFOA 2XX2A 3VHAA 2XCMA 2IOQA 4LPBA 2XABA 3FT8A 1THNA 4H81A 2WI4A 4JASA 4GEEA 2IWXA 4V26A 4KTNA 4HYMA 2IWUA 2XX5A 4MPEA 3O6OA 2ZBKB 3QTFA 1QZRA 3VADA 2YEGA 1YC4A 2XJJA 3RLRA 1B62A 3Q5JA 4YKUA 4HY6A 2CGFA 3TTZA 1NHJA 4O0BA 4B6CA 3OWBA 3CRLA 3CWVA 2XD6A 4XKOA 1ZXNA 1AJ6A 2XDUA 2BU6A 4XC0A 4K4OA 3B27A 4MP7A 4YKWA 4MB9A 2XDSA 4P8OA 1UYEA 1YT1A 2YGFA 3O2FA 4ASBA 2WERA 3B28A 4EFUA 1YETA 1I58A 4MPNA 3A0YA 3PEHA 2O1WA 4BXIA 5D7DA 3ZKBA 4AS9A 4FCQA 4GQTA 5CTWA 2XK2A 3OMUA 3B26A 2HCHA 4FCPA 3QDDA 4V25A 3G7BA 4QPKA 2XDKA 4MBCA 4ZKIA 2WI5A 4CE3A 4R3MA 3K98A 1Z5BA 2YI6A 4YKYA 3A0RA 4YKXA 1NHIA 4Q20A 3RLPA 5M4HA 4LWFA 4PU9A 4CWTA 4LWIA 2CCTA 4O05A 3TZ5A 2YEJA 3WHAA 3NMQA 4YKQA 4AWQA 1TH8A 4FMTA 3EHFA 1KIJA 4E01A 3GIFA 4ASAA 2BSMA 3ZXOA 4L8ZA 4URMA 3G75A 1YS3A 4ASFA 1UYGA 4KSHA 2PNRA 2K5BA 2YEEA 4EFTA 1UYIA 1MX0A 1YT2A 4EMVA 4XIQA 3BMYA 2YEHA 5FNDA 2Q8GA 3O0IA 5D6PA 5FWKA 1B63A 1I59A 3H80A 4LP0A 3OPDA 2YI7A 4HXZA 3INWA 1H7SA 3RLQA 4KFGA 4DUHA 1S14A 2FWZA
chains in the Genus database with same CATH superfamily
3MNRP 5BOCA 1UY9A 1UYCA 4O07A 4U93A 3LNUA 3LMMA 4L90A 5M4NA 1UYMA 1Z59A 4HXWA 3T0HA 4CWSA 3EHJA 1ZW9A 5M4KA 5CTXA 3HZ1A 2O1UA 5D7CA 4GFNA 4XIPA 3U2KA 3D36A 2Q8HA 3LPSA 4XCJA 4E02A 1YC1A 1GKZA 3A0TA 1ZWHA 3T0ZA 4NH9A 4KSGA 3GIGA 4L94A 3RKZA 1Y8NA 5L3JA 3C11A 1YT0A 1I5CA 3CRKA 4E72A 1KZNA 2QG0A 1AM1A 1UYLA 2FWYA 3R4OA 3T2SA 2YEAA 3HYYA 2YE4A 2ESAA 3CGZA 3ZKDA 3D2RA 2YE9A 3OWDA 4XKAA 1UYFA 1Z5CA 2YE7A 3EHGA 4DZYA 4XKKA 2WI3A 2E0AA 3GIEA 2YKBA 3DGEA 3GIGB 1MU5A 3CGYA 5J6AA 4CWPA 2XHRA 4HY1A 4XE2A 2VW5A 2YK2A 1R62A 4BQGA 2XHTA 2YEDA 2IORA 4CWRA 4URLA 1UY6A 2WI1A 4L93A 2H55A 2XJGA 4H85A 4U7NA 5F5RA 3H4LA 4E00A 5CPHA 4HZ0A 3R4PA 4AWPA 2XJXA 4X9LA 4CE2A 4KP4A 1UY8A 2BYIA 3IEDA 4YKRA 5IDJA 4W7TA 2YGEA 2FXSA 4XD8A 3WQ9A 2Q8IA 3HZ5A 2BRCA 2YE6A 4B7PA 2C2AA 3D0BA 4I5SA 4WUBA 2XHXA 4QPJA 4WUCA 5CF0A 4BIUA 2JKIA 3EKRA 3HHUA 1OSFA 3ZXQA 1US7A 3U2DA 2YI0A 4XIRA 1B3QA 5GGZA 3R92A 4CWFA 2BZ5A 2BU5A 4FCRA 4BAEA 3U67A 1L0OA 2BT0A 2YJXA 2CH4A 2BTZA 4JAVA 4BQJA 2FTKA 3Q5KA 2YK9A 3B25A 3EHHA 5J71A 4MPCA 1TC0A 5CTYA 3A0XA 4L91A 3K97A 3CYGA 4CWQA 5FNFA 5FNCA 1GJVA 2UWDA 4XTJA 3A0ZA 1ID0A 2QG2A 3PEJA 4LWGA 3S5TA 2HG1A 4EEHA 1TC6A 1I5DA 4MOTA 4URNA 2VCJA 2YGAA 5IN9A 2YECA 2YE5A 4YKTA 1Y8PA 2YKCA 2HKJA 3HEKA 2YJWA 2BU8A 1F51A 5D7RA 4EGHA 1BGQA 5F3KA 2YEIA 2BYHA 4XCLA 2GFDA 3KE6A 5D6QA 4JQLA 4NH7A 4XDMA 2AKPA 4AWOA 2IWSA 4GCZA 5M4PA 2BU2A 3ZM7A 3TUHA 2XDXA 4FPPA 1Z5AA 2YKIA 4XITA 5IDMA 1QYEA 3INXA 4NH8A 2YEFA 1UYHA 1YSZA 4CWOA 5C93A 4JAUA 1BXDA 4P7AA 4O04A 2VCIA 1UYDA 5BODA 4GGLA 2WI6A 2ZDYA 4H7QA 2IOPA 1S16A 2FYPA 4KQVA 4R1FA 4PRVA 2Q8FA 4YKZA 4I3HA 1TILA 3TZ2A 1YERA 2YE2A 1U0ZA 3C0EA 5M4EA 1AMWA 3OW6A 4LWEA 3FT5A 1U2OA 4WUDA 4U7OA 4CE1A 1EI1A 1YSRA 2YKJA 3B24A 4EM7A 2VWCA 1EA6A 4HYPA 1Y8OA 1Y4UA 4BIZA 3FV5A 2HHIA 1A4HA 3JZ3A 1GKXA 3T1KA 2WI7A 1H7UA 1TBWA 5CTUA 4O09A 2YE8A 3VHDA 3R4MA 1UYKA 5M4MA 1BYQA 1JM6A 1AH8A 4CWNA 4ZVIA 5JENA 2Q2EB 1AH6A 3G7EA 2YKEA 3R91A 1ZXMA 3EKOA 2ZDXA 2QF6A 3K99A 1IXMA 3BM9A 2YI5A 2ZKJA 1YC3A 2XX4A 4GT8A 3VHCA 3A0WA 3SL2A 2BREA 4HZ5A 1NHHA 2CCSA 4MP2A 1UY7A 1TIDA 4EGIA 1PVGA 2BU7A 1BKNA 4PRXA 3TZ0A 2H8MA 1YESA 3TZ4A 3K60A 4UROA 2EXLA 2YE3A 2O1VA 4PL9A 2CG9A 3Q5LA 2WEPA 2WI2A 4EGKA 2YEBA 2GQPA 2C1IA 1QY8A 4ASGA 4LWHA 2WEQA 2XDLA 2JJCA 3T10A 1I5BA 1I5AA 3HYZA 2CCUA 1Y4SA 4R3AA 3R4NA 2QFOA 2XX2A 3VHAA 2XCMA 2IOQA 4LPBA 2XABA 3FT8A 1THNA 4H81A 2WI4A 4JASA 4GEEA 2IWXA 4V26A 4KTNA 4HYMA 2IWUA 2XX5A 4MPEA 3O6OA 2ZBKB 3QTFA 1QZRA 3VADA 2YEGA 1YC4A 2XJJA 3RLRA 1B62A 3Q5JA 4YKUA 2C1GA 4HY6A 2CGFA 3TTZA 1NHJA 4O0BA 4B6CA 3OWBA 3CRLA 3CWVA 2XD6A 4XKOA 1ZXNA 1AJ6A 2XDUA 2BU6A 4XC0A 4K4OA 3B27A 4MP7A 4YKWA 4MB9A 2XDSA 4P8OA 1UYEA 1YT1A 2YGFA 3O2FA 4ASBA 2WERA 3B28A 4EFUA 1YETA 1I58A 4MPNA 3A0YA 3PEHA 2O1WA 4BXIA 5D7DA 3ZKBA 4AS9A 4FCQA 4GQTA 5CTWA 2XK2A 3OMUA 3B26A 2HCHA 4FCPA 3QDDA 4V25A 3G7BA 4QPKA 2XDKA 4MBCA 4ZKIA 2WI5A 4CE3A 4R3MA 3K98A 1Z5BA 2YI6A 4YKYA 3A0RA 4YKXA 1NHIA 4Q20A 3RLPA 5M4HA 4LWFA 4PU9A 4CWTA 4LWIA 2CCTA 4O05A 3TZ5A 2YEJA 3WHAA 3NMQA 4YKQA 4AWQA 1TH8A 4FMTA 3EHFA 1KIJA 4E01A 3GIFA 4ASAA 2BSMA 3ZXOA 4L8ZA 4URMA 3G75A 1YS3A 4ASFA 1UYGA 4KSHA 2PNRA 2K5BA 2YEEA 4EFTA 1UYIA 1MX0A 1YT2A 4EMVA 4XIQA 3BMYA 2YEHA 5FNDA 2Q8GA 3O0IA 5D6PA 5FWKA 1B63A 1I59A 3H80A 4LP0A 3OPDA 2YI7A 4HXZA 3INWA 1H7SA 3RLQA 4KFGA 4DUHA 1S14A 2FWZA
chains in the Genus database with same CATH topology
3MNRP 5BOCA 1UY9A 1UYCA 4O07A 4U93A 3LNUA 4L90A 5M4NA 1UYMA 1Z59A 4HXWA 3T0HA 4CWSA 3EHJA 1ZW9A 5M4KA 5CTXA 3HZ1A 2O1UA 5D7CA 4GFNA 4XIPA 3U2KA 3D36A 2Q8HA 3LPSA 4XCJA 4E02A 1YC1A 1GKZA 3A0TA 1ZWHA 3T0ZA 4NH9A 4KSGA 3GIGA 4L94A 3RKZA 1Y8NA 5L3JA 3C11A 1YT0A 1I5CA 3CRKA 1KZNA 2QG0A 1AM1A 1UYLA 2FWYA 3R4OA 3T2SA 2YEAA 3HYYA 2YE4A 2ESAA 3CGZA 3ZKDA 3D2RA 2YE9A 3OWDA 4XKAA 1UYFA 1Z5CA 2YE7A 3EHGA 4DZYA 4XKKA 2WI3A 2E0AA 3GIEA 2YKBA 3DGEA 3GIGB 1MU5A 3CGYA 5J6AA 4CWPA 2XHRA 4HY1A 4XE2A 2VW5A 2YK2A 1R62A 4BQGA 2XHTA 2YEDA 2IORA 4CWRA 4URLA 1UY6A 2WI1A 4L93A 2H55A 2XJGA 4H85A 4U7NA 5F5RA 3H4LA 4E00A 5CPHA 4HZ0A 3R4PA 4AWPA 2XJXA 4X9LA 4CE2A 4KP4A 1UY8A 2BYIA 3IEDA 4YKRA 5IDJA 4W7TA 2YGEA 2FXSA 4XD8A 3WQ9A 2Q8IA 3HZ5A 2BRCA 2YE6A 4B7PA 2C2AA 3D0BA 4I5SA 4WUBA 2XHXA 4QPJA 4WUCA 5CF0A 4BIUA 2JKIA 3EKRA 3HHUA 1OSFA 3ZXQA 1US7A 3U2DA 2YI0A 4XIRA 1B3QA 5GGZA 3R92A 4CWFA 2BZ5A 2BU5A 4FCRA 4BAEA 3U67A 1L0OA 2BT0A 2YJXA 2CH4A 2BTZA 4JAVA 4BQJA 3Q5KA 2YK9A 3B25A 3EHHA 5J71A 4MPCA 1TC0A 5CTYA 3A0XA 4L91A 3K97A 4CWQA 5FNFA 5FNCA 1GJVA 2UWDA 4XTJA 3A0ZA 1ID0A 2QG2A 3PEJA 4LWGA 2HG1A 4EEHA 1TC6A 1I5DA 4MOTA 4URNA 2VCJA 2YGAA 5IN9A 2YECA 2YE5A 4YKTA 1Y8PA 2YKCA 2HKJA 3HEKA 2YJWA 2BU8A 5D7RA 4EGHA 1BGQA 5F3KA 2YEIA 2BYHA 4XCLA 2GFDA 3KE6A 5D6QA 4JQLA 4NH7A 4XDMA 2AKPA 4AWOA 2IWSA 4GCZA 5M4PA 2BU2A 3ZM7A 3TUHA 2XDXA 4FPPA 1Z5AA 2YKIA 4XITA 5IDMA 1QYEA 3INXA 4NH8A 2YEFA 1UYHA 1YSZA 4CWOA 5C93A 4JAUA 1BXDA 4P7AA 4O04A 2VCIA 1UYDA 5BODA 4GGLA 2WI6A 2ZDYA 4H7QA 2IOPA 1S16A 2FYPA 4KQVA 4R1FA 4PRVA 2Q8FA 4YKZA 4I3HA 1TILA 3TZ2A 1YERA 2YE2A 1U0ZA 3C0EA 5M4EA 1AMWA 3OW6A 4LWEA 3FT5A 1U2OA 4WUDA 4U7OA 4CE1A 1EI1A 1YSRA 2YKJA 3B24A 4EM7A 2VWCA 1EA6A 4HYPA 1Y8OA 1Y4UA 4BIZA 3FV5A 1A4HA 3JZ3A 1GKXA 3T1KA 2WI7A 1H7UA 1TBWA 5CTUA 4O09A 2YE8A 3VHDA 3R4MA 1UYKA 5M4MA 1BYQA 1AH8A 1JM6A 4CWNA 4ZVIA 2Q2EB 1AH6A 3G7EA 2YKEA 3R91A 1ZXMA 3EKOA 2ZDXA 2QF6A 3K99A 3BM9A 2YI5A 2ZKJA 1YC3A 2XX4A 4GT8A 3VHCA 3A0WA 3SL2A 2BREA 4HZ5A 1NHHA 2CCSA 4MP2A 1UY7A 1TIDA 4EGIA 1PVGA 2BU7A 1BKNA 4PRXA 3TZ0A 2H8MA 1YESA 3TZ4A 3K60A 4UROA 2EXLA 2YE3A 2O1VA 4PL9A 2CG9A 3Q5LA 2WEPA 2WI2A 4EGKA 2YEBA 2GQPA 1QY8A 4ASGA 4LWHA 2WEQA 2XDLA 2JJCA 3T10A 1I5BA 1I5AA 3HYZA 2CCUA 1Y4SA 4R3AA 3R4NA 2QFOA 2XX2A 3VHAA 2XCMA 2IOQA 4LPBA 2XABA 3FT8A 1THNA 4H81A 2WI4A 4JASA 4GEEA 2IWXA 4V26A 4KTNA 4HYMA 2IWUA 2XX5A 4MPEA 3O6OA 2ZBKB 3QTFA 1QZRA 3VADA 2YEGA 1YC4A 2XJJA 3RLRA 1B62A 3Q5JA 4YKUA 4HY6A 2CGFA 3TTZA 1NHJA 4O0BA 4B6CA 3OWBA 3CRLA 3CWVA 2XD6A 4XKOA 1ZXNA 1AJ6A 2XDUA 2BU6A 4XC0A 4K4OA 3B27A 4MP7A 4YKWA 4MB9A 2XDSA 4P8OA 1UYEA 1YT1A 2YGFA 3O2FA 4ASBA 2WERA 3B28A 4EFUA 1YETA 1I58A 4MPNA 3A0YA 3PEHA 2O1WA 4BXIA 5D7DA 3ZKBA 4AS9A 4FCQA 4GQTA 5CTWA 2XK2A 3OMUA 3B26A 2HCHA 4FCPA 3QDDA 4V25A 3G7BA 4QPKA 2XDKA 4MBCA 4ZKIA 2WI5A 4CE3A 4R3MA 3K98A 1Z5BA 2YI6A 4YKYA 3A0RA 4YKXA 1NHIA 4Q20A 3RLPA 5M4HA 4LWFA 4PU9A 4CWTA 4LWIA 2CCTA 4O05A 3TZ5A 2YEJA 3WHAA 3NMQA 4YKQA 4AWQA 1TH8A 4FMTA 3EHFA 1KIJA 4E01A 3GIFA 4ASAA 2BSMA 3ZXOA 4L8ZA 4URMA 3G75A 1YS3A 4ASFA 1UYGA 4KSHA 2PNRA 2K5BA 2YEEA 4EFTA 1UYIA 1MX0A 1YT2A 4EMVA 4XIQA 3BMYA 2YEHA 5FNDA 2Q8GA 3O0IA 5D6PA 5FWKA 1B63A 1I59A 3H80A 4LP0A 3OPDA 2YI7A 4HXZA 3INWA 1H7SA 3RLQA 4KFGA 4DUHA 1S14A 2FWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MNR P;  5BOC A;  1UY9 A;  1UYC A;  4O07 A;  4U93 A;  3LNU A;  4L90 A;  5M4N A;  1UYM A;  1Z59 A;  4HXW A;  3T0H A;  4CWS A;  3EHJ A;  1ZW9 A;  5M4K A;  5CTX A;  3HZ1 A;  2O1U A;  5D7C A;  4GFN A;  4XIP A;  3U2K A;  3D36 A;  2Q8H A;  3LPS A;  4XCJ A;  4E02 A;  1YC1 A;  1GKZ A;  3A0T A;  1ZWH A;  3T0Z A;  4NH9 A;  4KSG A;  3GIG A;  4L94 A;  3RKZ A;  1Y8N A;  5L3J A;  3C11 A;  1YT0 A;  1I5C A;  3CRK A;  1KZN A;  2QG0 A;  1AM1 A;  1UYL A;  2FWY A;  3R4O A;  3T2S A;  2YEA A;  3HYY A;  2YE4 A;  2ESA A;  3CGZ A;  3ZKD A;  3D2R A;  2YE9 A;  3OWD A;  4XKA A;  1UYF A;  1Z5C A;  2YE7 A;  3EHG A;  4DZY A;  4XKK A;  2WI3 A;  2E0A A;  3GIE A;  2YKB A;  3DGE A;  3GIG B;  1MU5 A;  3CGY A;  5J6A A;  4CWP A;  2XHR A;  4HY1 A;  4XE2 A;  2VW5 A;  2YK2 A;  1R62 A;  4BQG A;  2XHT A;  2YED A;  2IOR A;  4CWR A;  4URL A;  1UY6 A;  2WI1 A;  4L93 A;  2H55 A;  2XJG A;  4H85 A;  4U7N A;  5F5R A;  3H4L A;  4E00 A;  5CPH A;  4HZ0 A;  3R4P A;  4AWP A;  2XJX A;  4X9L A;  4CE2 A;  4KP4 A;  1UY8 A;  2BYI A;  3IED A;  4YKR A;  5IDJ A;  4W7T A;  2YGE A;  2FXS A;  4XD8 A;  3WQ9 A;  2Q8I A;  3HZ5 A;  2BRC A;  2YE6 A;  4B7P A;  2C2A A;  3D0B A;  4I5S A;  4WUB A;  2XHX A;  4QPJ A;  4WUC A;  5CF0 A;  4BIU A;  2JKI A;  3EKR A;  3HHU A;  1OSF A;  3ZXQ A;  1US7 A;  3U2D A;  2YI0 A;  4XIR A;  1B3Q A;  5GGZ A;  3R92 A;  4CWF A;  2BZ5 A;  2BU5 A;  4FCR A;  4BAE A;  3U67 A;  1L0O A;  2BT0 A;  2YJX A;  2CH4 A;  2BTZ A;  4JAV A;  4BQJ A;  3Q5K A;  2YK9 A;  3B25 A;  3EHH A;  5J71 A;  4MPC A;  1TC0 A;  5CTY A;  3A0X A;  4L91 A;  3K97 A;  4CWQ A;  5FNF A;  5FNC A;  1GJV A;  2UWD A;  4XTJ A;  3A0Z A;  1ID0 A;  2QG2 A;  3PEJ A;  4LWG A;  2HG1 A;  4EEH A;  1TC6 A;  1I5D A;  4MOT A;  4URN A;  2VCJ A;  2YGA A;  5IN9 A;  2YEC A;  2YE5 A;  4YKT A;  1Y8P A;  2YKC A;  2HKJ A;  3HEK A;  2YJW A;  2BU8 A;  5D7R A;  4EGH A;  1BGQ A;  5F3K A;  2YEI A;  2BYH A;  4XCL A;  2GFD A;  3KE6 A;  5D6Q A;  4JQL A;  4NH7 A;  4XDM A;  2AKP A;  4AWO A;  2IWS A;  4GCZ A;  5M4P A;  2BU2 A;  3ZM7 A;  3TUH A;  2XDX A;  4FPP A;  1Z5A A;  2YKI A;  4XIT A;  5IDM A;  1QYE A;  3INX A;  4NH8 A;  2YEF A;  1UYH A;  1YSZ A;  4CWO A;  5C93 A;  4JAU A;  1BXD A;  4P7A A;  4O04 A;  2VCI A;  1UYD A;  5BOD A;  4GGL A;  2WI6 A;  2ZDY A;  4H7Q A;  2IOP A;  1S16 A;  2FYP A;  4KQV A;  4R1F A;  4PRV A;  2Q8F A;  4YKZ A;  4I3H A;  1TIL A;  3TZ2 A;  1YER A;  2YE2 A;  1U0Z A;  3C0E A;  5M4E A;  1AMW A;  3OW6 A;  4LWE A;  3FT5 A;  1U2O A;  4WUD A;  4U7O A;  4CE1 A;  1EI1 A;  1YSR A;  2YKJ A;  3B24 A;  4EM7 A;  2VWC A;  1EA6 A;  4HYP A;  1Y8O A;  1Y4U A;  4BIZ A;  3FV5 A;  1A4H A;  3JZ3 A;  1GKX A;  3T1K A;  2WI7 A;  1H7U A;  1TBW A;  5CTU A;  4O09 A;  2YE8 A;  3VHD A;  3R4M A;  1UYK A;  5M4M A;  1BYQ A;  1AH8 A;  1JM6 A;  4CWN A;  4ZVI A;  2Q2E B;  1AH6 A;  3G7E A;  2YKE A;  3R91 A;  1ZXM A;  3EKO A;  2ZDX A;  2QF6 A;  3K99 A;  3BM9 A;  2YI5 A;  2ZKJ A;  1YC3 A;  2XX4 A;  4GT8 A;  3VHC A;  3A0W A;  3SL2 A;  2BRE A;  4HZ5 A;  1NHH A;  2CCS A;  4MP2 A;  1UY7 A;  1TID A;  4EGI A;  1PVG A;  2BU7 A;  1BKN A;  4PRX A;  3TZ0 A;  2H8M A;  1YES A;  3TZ4 A;  3K60 A;  4URO A;  2EXL A;  2YE3 A;  2O1V A;  4PL9 A;  2CG9 A;  3Q5L A;  2WEP A;  2WI2 A;  4EGK A;  2YEB A;  2GQP A;  1QY8 A;  4ASG A;  4LWH A;  2WEQ A;  2XDL A;  2JJC A;  3T10 A;  1I5B A;  1I5A A;  3HYZ A;  2CCU A;  1Y4S A;  4R3A A;  3R4N A;  2QFO A;  2XX2 A;  3VHA A;  2XCM A;  2IOQ A;  4LPB A;  2XAB A;  3FT8 A;  1THN A;  4H81 A;  2WI4 A;  4JAS A;  4GEE A;  2IWX A;  4V26 A;  4KTN A;  4HYM A;  2IWU A;  2XX5 A;  4MPE A;  3O6O A;  2ZBK B;  3QTF A;  1QZR A;  3VAD A;  2YEG A;  1YC4 A;  2XJJ A;  3RLR A;  1B62 A;  3Q5J A;  4YKU A;  4HY6 A;  2CGF A;  3TTZ A;  1NHJ A;  4O0B A;  4B6C A;  3OWB A;  3CRL A;  3CWV A;  2XD6 A;  4XKO A;  1ZXN A;  1AJ6 A;  2XDU A;  2BU6 A;  4XC0 A;  4K4O A;  3B27 A;  4MP7 A;  4YKW A;  4MB9 A;  2XDS A;  4P8O A;  1UYE A;  1YT1 A;  2YGF A;  3O2F A;  4ASB A;  2WER A;  3B28 A;  4EFU A;  1YET A;  1I58 A;  4MPN A;  3A0Y A;  3PEH A;  2O1W A;  4BXI A;  5D7D A;  3ZKB A;  4AS9 A;  4FCQ A;  4GQT A;  5CTW A;  2XK2 A;  3OMU A;  3B26 A;  2HCH A;  4FCP A;  3QDD A;  4V25 A;  3G7B A;  4QPK A;  2XDK A;  4MBC A;  4ZKI A;  2WI5 A;  4CE3 A;  4R3M A;  3K98 A;  1Z5B A;  2YI6 A;  4YKY A;  3A0R A;  4YKX A;  1NHI A;  4Q20 A;  3RLP A;  5M4H A;  4LWF A;  4PU9 A;  4CWT A;  4LWI A;  2CCT A;  4O05 A;  3TZ5 A;  2YEJ A;  3WHA A;  3NMQ A;  4YKQ A;  4AWQ A;  1TH8 A;  4FMT A;  3EHF A;  1KIJ A;  4E01 A;  3GIF A;  4ASA A;  2BSM A;  3ZXO A;  4L8Z A;  4URM A;  3G75 A;  1YS3 A;  4ASF A;  1UYG A;  4KSH A;  2PNR A;  2K5B A;  2YEE A;  4EFT A;  1UYI A;  1MX0 A;  1YT2 A;  4EMV A;  4XIQ A;  3BMY A;  2YEH A;  5FND A;  2Q8G A;  3O0I A;  5D6P A;  5FWK A;  1B63 A;  1I59 A;  3H80 A;  4LP0 A;  3OPD A;  2YI7 A;  4HXZ A;  3INW A;  1H7S A;  3RLQ A;  4KFG A;  4DUH A;  1S14 A;  2FWZ A; 
#chains in the Genus database with same CATH topology
 3MNR P;  5BOC A;  1UY9 A;  1UYC A;  4O07 A;  4U93 A;  3LNU A;  3LMM A;  4L90 A;  5M4N A;  1UYM A;  1Z59 A;  4HXW A;  3T0H A;  4CWS A;  3EHJ A;  1ZW9 A;  5M4K A;  5CTX A;  3HZ1 A;  2O1U A;  5D7C A;  4GFN A;  4XIP A;  3U2K A;  3D36 A;  2Q8H A;  3LPS A;  4XCJ A;  4E02 A;  1YC1 A;  1GKZ A;  3A0T A;  1ZWH A;  3T0Z A;  4NH9 A;  4KSG A;  3GIG A;  4L94 A;  3RKZ A;  1Y8N A;  5L3J A;  3C11 A;  1YT0 A;  1I5C A;  3CRK A;  4E72 A;  1KZN A;  2QG0 A;  1AM1 A;  1UYL A;  2FWY A;  3R4O A;  3T2S A;  2YEA A;  3HYY A;  2YE4 A;  2ESA A;  3CGZ A;  3ZKD A;  3D2R A;  2YE9 A;  3OWD A;  4XKA A;  1UYF A;  1Z5C A;  2YE7 A;  3EHG A;  4DZY A;  4XKK A;  2WI3 A;  2E0A A;  3GIE A;  2YKB A;  3DGE A;  3GIG B;  1MU5 A;  3CGY A;  5J6A A;  4CWP A;  2XHR A;  4HY1 A;  4XE2 A;  2VW5 A;  2YK2 A;  1R62 A;  4BQG A;  2XHT A;  2YED A;  2IOR A;  4CWR A;  4URL A;  1UY6 A;  2WI1 A;  4L93 A;  2H55 A;  2XJG A;  4H85 A;  4U7N A;  5F5R A;  3H4L A;  4E00 A;  5CPH A;  4HZ0 A;  3R4P A;  4AWP A;  2XJX A;  4X9L A;  4CE2 A;  4KP4 A;  1UY8 A;  2BYI A;  3IED A;  4YKR A;  5IDJ A;  4W7T A;  2YGE A;  2FXS A;  4XD8 A;  3WQ9 A;  2Q8I A;  3HZ5 A;  2BRC A;  2YE6 A;  4B7P A;  2C2A A;  3D0B A;  4I5S A;  4WUB A;  2XHX A;  4QPJ A;  4WUC A;  5CF0 A;  4BIU A;  2JKI A;  3EKR A;  3HHU A;  1OSF A;  3ZXQ A;  1US7 A;  3U2D A;  2YI0 A;  4XIR A;  1B3Q A;  5GGZ A;  3R92 A;  4CWF A;  2BZ5 A;  2BU5 A;  4FCR A;  4BAE A;  3U67 A;  1L0O A;  2BT0 A;  2YJX A;  2CH4 A;  2BTZ A;  4JAV A;  4BQJ A;  2FTK A;  3Q5K A;  2YK9 A;  3B25 A;  3EHH A;  5J71 A;  4MPC A;  1TC0 A;  5CTY A;  3A0X A;  4L91 A;  3K97 A;  3CYG A;  4CWQ A;  5FNF A;  5FNC A;  1GJV A;  2UWD A;  4XTJ A;  3A0Z A;  1ID0 A;  2QG2 A;  3PEJ A;  4LWG A;  3S5T A;  2HG1 A;  4EEH A;  1TC6 A;  1I5D A;  4MOT A;  4URN A;  2VCJ A;  2YGA A;  5IN9 A;  2YEC A;  2YE5 A;  4YKT A;  1Y8P A;  2YKC A;  2HKJ A;  3HEK A;  2YJW A;  2BU8 A;  1F51 A;  5D7R A;  4EGH A;  1BGQ A;  5F3K A;  2YEI A;  2BYH A;  4XCL A;  2GFD A;  3KE6 A;  5D6Q A;  4JQL A;  4NH7 A;  4XDM A;  2AKP A;  4AWO A;  2IWS A;  4GCZ A;  5M4P A;  2BU2 A;  3ZM7 A;  3TUH A;  2XDX A;  4FPP A;  1Z5A A;  2YKI A;  4XIT A;  5IDM A;  1QYE A;  3INX A;  4NH8 A;  2YEF A;  1UYH A;  1YSZ A;  4CWO A;  5C93 A;  4JAU A;  1BXD A;  4P7A A;  4O04 A;  2VCI A;  1UYD A;  5BOD A;  4GGL A;  2WI6 A;  2ZDY A;  4H7Q A;  2IOP A;  1S16 A;  2FYP A;  4KQV A;  4R1F A;  4PRV A;  2Q8F A;  4YKZ A;  4I3H A;  1TIL A;  3TZ2 A;  1YER A;  2YE2 A;  1U0Z A;  3C0E A;  5M4E A;  1AMW A;  3OW6 A;  4LWE A;  3FT5 A;  1U2O A;  4WUD A;  4U7O A;  4CE1 A;  1EI1 A;  1YSR A;  2YKJ A;  3B24 A;  4EM7 A;  2VWC A;  1EA6 A;  4HYP A;  1Y8O A;  1Y4U A;  4BIZ A;  3FV5 A;  2HHI A;  1A4H A;  3JZ3 A;  1GKX A;  3T1K A;  2WI7 A;  1H7U A;  1TBW A;  5CTU A;  4O09 A;  2YE8 A;  3VHD A;  3R4M A;  1UYK A;  5M4M A;  1BYQ A;  1JM6 A;  1AH8 A;  4CWN A;  4ZVI A;  5JEN A;  2Q2E B;  1AH6 A;  3G7E A;  2YKE A;  3R91 A;  1ZXM A;  3EKO A;  2ZDX A;  2QF6 A;  3K99 A;  1IXM A;  3BM9 A;  2YI5 A;  2ZKJ A;  1YC3 A;  2XX4 A;  4GT8 A;  3VHC A;  3A0W A;  3SL2 A;  2BRE A;  4HZ5 A;  1NHH A;  2CCS A;  4MP2 A;  1UY7 A;  1TID A;  4EGI A;  1PVG A;  2BU7 A;  1BKN A;  4PRX A;  3TZ0 A;  2H8M A;  1YES A;  3TZ4 A;  3K60 A;  4URO A;  2EXL A;  2YE3 A;  2O1V A;  4PL9 A;  2CG9 A;  3Q5L A;  2WEP A;  2WI2 A;  4EGK A;  2YEB A;  2GQP A;  2C1I A;  1QY8 A;  4ASG A;  4LWH A;  2WEQ A;  2XDL A;  2JJC A;  3T10 A;  1I5B A;  1I5A A;  3HYZ A;  2CCU A;  1Y4S A;  4R3A A;  3R4N A;  2QFO A;  2XX2 A;  3VHA A;  2XCM A;  2IOQ A;  4LPB A;  2XAB A;  3FT8 A;  1THN A;  4H81 A;  2WI4 A;  4JAS A;  4GEE A;  2IWX A;  4V26 A;  4KTN A;  4HYM A;  2IWU A;  2XX5 A;  4MPE A;  3O6O A;  2ZBK B;  3QTF A;  1QZR A;  3VAD A;  2YEG A;  1YC4 A;  2XJJ A;  3RLR A;  1B62 A;  3Q5J A;  4YKU A;  2C1G A;  4HY6 A;  2CGF A;  3TTZ A;  1NHJ A;  4O0B A;  4B6C A;  3OWB A;  3CRL A;  3CWV A;  2XD6 A;  4XKO A;  1ZXN A;  1AJ6 A;  2XDU A;  2BU6 A;  4XC0 A;  4K4O A;  3B27 A;  4MP7 A;  4YKW A;  4MB9 A;  2XDS A;  4P8O A;  1UYE A;  1YT1 A;  2YGF A;  3O2F A;  4ASB A;  2WER A;  3B28 A;  4EFU A;  1YET A;  1I58 A;  4MPN A;  3A0Y A;  3PEH A;  2O1W A;  4BXI A;  5D7D A;  3ZKB A;  4AS9 A;  4FCQ A;  4GQT A;  5CTW A;  2XK2 A;  3OMU A;  3B26 A;  2HCH A;  4FCP A;  3QDD A;  4V25 A;  3G7B A;  4QPK A;  2XDK A;  4MBC A;  4ZKI A;  2WI5 A;  4CE3 A;  4R3M A;  3K98 A;  1Z5B A;  2YI6 A;  4YKY A;  3A0R A;  4YKX A;  1NHI A;  4Q20 A;  3RLP A;  5M4H A;  4LWF A;  4PU9 A;  4CWT A;  4LWI A;  2CCT A;  4O05 A;  3TZ5 A;  2YEJ A;  3WHA A;  3NMQ A;  4YKQ A;  4AWQ A;  1TH8 A;  4FMT A;  3EHF A;  1KIJ A;  4E01 A;  3GIF A;  4ASA A;  2BSM A;  3ZXO A;  4L8Z A;  4URM A;  3G75 A;  1YS3 A;  4ASF A;  1UYG A;  4KSH A;  2PNR A;  2K5B A;  2YEE A;  4EFT A;  1UYI A;  1MX0 A;  1YT2 A;  4EMV A;  4XIQ A;  3BMY A;  2YEH A;  5FND A;  2Q8G A;  3O0I A;  5D6P A;  5FWK A;  1B63 A;  1I59 A;  3H80 A;  4LP0 A;  3OPD A;  2YI7 A;  4HXZ A;  3INW A;  1H7S A;  3RLQ A;  4KFG A;  4DUH A;  1S14 A;  2FWZ A; 
#chains in the Genus database with same CATH homology
 3MNR P;  5BOC A;  1UY9 A;  1UYC A;  4O07 A;  4U93 A;  3LNU A;  4L90 A;  5M4N A;  1UYM A;  1Z59 A;  4HXW A;  3T0H A;  4CWS A;  3EHJ A;  1ZW9 A;  5M4K A;  5CTX A;  3HZ1 A;  2O1U A;  5D7C A;  4GFN A;  4XIP A;  3U2K A;  3D36 A;  2Q8H A;  3LPS A;  4XCJ A;  4E02 A;  1YC1 A;  1GKZ A;  3A0T A;  1ZWH A;  3T0Z A;  4NH9 A;  4KSG A;  3GIG A;  4L94 A;  3RKZ A;  1Y8N A;  5L3J A;  3C11 A;  1YT0 A;  1I5C A;  3CRK A;  1KZN A;  2QG0 A;  1AM1 A;  1UYL A;  2FWY A;  3R4O A;  3T2S A;  2YEA A;  3HYY A;  2YE4 A;  2ESA A;  3CGZ A;  3ZKD A;  3D2R A;  2YE9 A;  3OWD A;  4XKA A;  1UYF A;  1Z5C A;  2YE7 A;  3EHG A;  4DZY A;  4XKK A;  2WI3 A;  2E0A A;  3GIE A;  2YKB A;  3DGE A;  3GIG B;  1MU5 A;  3CGY A;  5J6A A;  4CWP A;  2XHR A;  4HY1 A;  4XE2 A;  2VW5 A;  2YK2 A;  1R62 A;  4BQG A;  2XHT A;  2YED A;  2IOR A;  4CWR A;  4URL A;  1UY6 A;  2WI1 A;  4L93 A;  2H55 A;  2XJG A;  4H85 A;  4U7N A;  5F5R A;  3H4L A;  4E00 A;  5CPH A;  4HZ0 A;  3R4P A;  4AWP A;  2XJX A;  4X9L A;  4CE2 A;  4KP4 A;  1UY8 A;  2BYI A;  3IED A;  4YKR A;  5IDJ A;  4W7T A;  2YGE A;  2FXS A;  4XD8 A;  3WQ9 A;  2Q8I A;  3HZ5 A;  2BRC A;  2YE6 A;  4B7P A;  2C2A A;  3D0B A;  4I5S A;  4WUB A;  2XHX A;  4QPJ A;  4WUC A;  5CF0 A;  4BIU A;  2JKI A;  3EKR A;  3HHU A;  1OSF A;  3ZXQ A;  1US7 A;  3U2D A;  2YI0 A;  4XIR A;  1B3Q A;  5GGZ A;  3R92 A;  4CWF A;  2BZ5 A;  2BU5 A;  4FCR A;  4BAE A;  3U67 A;  1L0O A;  2BT0 A;  2YJX A;  2CH4 A;  2BTZ A;  4JAV A;  4BQJ A;  3Q5K A;  2YK9 A;  3B25 A;  3EHH A;  5J71 A;  4MPC A;  1TC0 A;  5CTY A;  3A0X A;  4L91 A;  3K97 A;  4CWQ A;  5FNF A;  5FNC A;  1GJV A;  2UWD A;  4XTJ A;  3A0Z A;  1ID0 A;  2QG2 A;  3PEJ A;  4LWG A;  2HG1 A;  4EEH A;  1TC6 A;  1I5D A;  4MOT A;  4URN A;  2VCJ A;  2YGA A;  5IN9 A;  2YEC A;  2YE5 A;  4YKT A;  1Y8P A;  2YKC A;  2HKJ A;  3HEK A;  2YJW A;  2BU8 A;  5D7R A;  4EGH A;  1BGQ A;  5F3K A;  2YEI A;  2BYH A;  4XCL A;  2GFD A;  3KE6 A;  5D6Q A;  4JQL A;  4NH7 A;  4XDM A;  2AKP A;  4AWO A;  2IWS A;  4GCZ A;  5M4P A;  2BU2 A;  3ZM7 A;  3TUH A;  2XDX A;  4FPP A;  1Z5A A;  2YKI A;  4XIT A;  5IDM A;  1QYE A;  3INX A;  4NH8 A;  2YEF A;  1UYH A;  1YSZ A;  4CWO A;  5C93 A;  4JAU A;  1BXD A;  4P7A A;  4O04 A;  2VCI A;  1UYD A;  5BOD A;  4GGL A;  2WI6 A;  2ZDY A;  4H7Q A;  2IOP A;  1S16 A;  2FYP A;  4KQV A;  4R1F A;  4PRV A;  2Q8F A;  4YKZ A;  4I3H A;  1TIL A;  3TZ2 A;  1YER A;  2YE2 A;  1U0Z A;  3C0E A;  5M4E A;  1AMW A;  3OW6 A;  4LWE A;  3FT5 A;  1U2O A;  4WUD A;  4U7O A;  4CE1 A;  1EI1 A;  1YSR A;  2YKJ A;  3B24 A;  4EM7 A;  2VWC A;  1EA6 A;  4HYP A;  1Y8O A;  1Y4U A;  4BIZ A;  3FV5 A;  1A4H A;  3JZ3 A;  1GKX A;  3T1K A;  2WI7 A;  1H7U A;  1TBW A;  5CTU A;  4O09 A;  2YE8 A;  3VHD A;  3R4M A;  1UYK A;  5M4M A;  1BYQ A;  1AH8 A;  1JM6 A;  4CWN A;  4ZVI A;  2Q2E B;  1AH6 A;  3G7E A;  2YKE A;  3R91 A;  1ZXM A;  3EKO A;  2ZDX A;  2QF6 A;  3K99 A;  3BM9 A;  2YI5 A;  2ZKJ A;  1YC3 A;  2XX4 A;  4GT8 A;  3VHC A;  3A0W A;  3SL2 A;  2BRE A;  4HZ5 A;  1NHH A;  2CCS A;  4MP2 A;  1UY7 A;  1TID A;  4EGI A;  1PVG A;  2BU7 A;  1BKN A;  4PRX A;  3TZ0 A;  2H8M A;  1YES A;  3TZ4 A;  3K60 A;  4URO A;  2EXL A;  2YE3 A;  2O1V A;  4PL9 A;  2CG9 A;  3Q5L A;  2WEP A;  2WI2 A;  4EGK A;  2YEB A;  2GQP A;  1QY8 A;  4ASG A;  4LWH A;  2WEQ A;  2XDL A;  2JJC A;  3T10 A;  1I5B A;  1I5A A;  3HYZ A;  2CCU A;  1Y4S A;  4R3A A;  3R4N A;  2QFO A;  2XX2 A;  3VHA A;  2XCM A;  2IOQ A;  4LPB A;  2XAB A;  3FT8 A;  1THN A;  4H81 A;  2WI4 A;  4JAS A;  4GEE A;  2IWX A;  4V26 A;  4KTN A;  4HYM A;  2IWU A;  2XX5 A;  4MPE A;  3O6O A;  2ZBK B;  3QTF A;  1QZR A;  3VAD A;  2YEG A;  1YC4 A;  2XJJ A;  3RLR A;  1B62 A;  3Q5J A;  4YKU A;  4HY6 A;  2CGF A;  3TTZ A;  1NHJ A;  4O0B A;  4B6C A;  3OWB A;  3CRL A;  3CWV A;  2XD6 A;  4XKO A;  1ZXN A;  1AJ6 A;  2XDU A;  2BU6 A;  4XC0 A;  4K4O A;  3B27 A;  4MP7 A;  4YKW A;  4MB9 A;  2XDS A;  4P8O A;  1UYE A;  1YT1 A;  2YGF A;  3O2F A;  4ASB A;  2WER A;  3B28 A;  4EFU A;  1YET A;  1I58 A;  4MPN A;  3A0Y A;  3PEH A;  2O1W A;  4BXI A;  5D7D A;  3ZKB A;  4AS9 A;  4FCQ A;  4GQT A;  5CTW A;  2XK2 A;  3OMU A;  3B26 A;  2HCH A;  4FCP A;  3QDD A;  4V25 A;  3G7B A;  4QPK A;  2XDK A;  4MBC A;  4ZKI A;  2WI5 A;  4CE3 A;  4R3M A;  3K98 A;  1Z5B A;  2YI6 A;  4YKY A;  3A0R A;  4YKX A;  1NHI A;  4Q20 A;  3RLP A;  5M4H A;  4LWF A;  4PU9 A;  4CWT A;  4LWI A;  2CCT A;  4O05 A;  3TZ5 A;  2YEJ A;  3WHA A;  3NMQ A;  4YKQ A;  4AWQ A;  1TH8 A;  4FMT A;  3EHF A;  1KIJ A;  4E01 A;  3GIF A;  4ASA A;  2BSM A;  3ZXO A;  4L8Z A;  4URM A;  3G75 A;  1YS3 A;  4ASF A;  1UYG A;  4KSH A;  2PNR A;  2K5B A;  2YEE A;  4EFT A;  1UYI A;  1MX0 A;  1YT2 A;  4EMV A;  4XIQ A;  3BMY A;  2YEH A;  5FND A;  2Q8G A;  3O0I A;  5D6P A;  5FWK A;  1B63 A;  1I59 A;  3H80 A;  4LP0 A;  3OPD A;  2YI7 A;  4HXZ A;  3INW A;  1H7S A;  3RLQ A;  4KFG A;  4DUH A;  1S14 A;  2FWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...