5CTXA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
publication title Fragment-based discovery of DNA gyrase inhibitors targeting the ATPase subunit of GyrB.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 65
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5ctxA00
1R62A 2YEHA 3FV5A 1B3QA 3CGZA 2AKPA 3OWDA 4H85A 3INWA 1UY9A 3A0ZA 4HYPA 2QG2A 4YKXA 3GIGA 3R91A 2YI7A 3K60A 2H55A 3A0XA 1BYQA 4O07A 4PRXA 2VW5A 2BTZA 1I5AA 2YEDA 2XABA 1UYFA 4KFGA 4AWQA 4PRVA 4O04A 5D7RA 4YKQA 3LNUA 4L8ZA 1Y8PA 1YC3A 3HZ1A 1GJVA 2YE4A 1QY8A 2WI7A 3SL2A 4AWOA 5IDJA 4BQJA 2YKEA 4DZYA 3KE6A 2GFDA 3VADA 3ZM7A 2WI1A 4FCQA 3EHJA 1BKNA 2HKJA 3FT8A 5CTUA 2YK2A 3TZ4A 4EGKA 2XDUA 3TZ2A 4R3MA 4H7QA 1YT1A 1AM1A 1KZNA 4EGIA 4O09A 2XJJA 4O0BA 1YT0A 4HYMA 4BAEA 4EMVA 2H8MA 2Q2EB 4BXIA 2YE3A 2YEFA 3GIFA 4LWIA 4FPPA 1QZRA 3TTZA 4EFTA 2JJCA 2WEQA 5FWKA 2BYIA 1YT2A 2IOPA 5FNDA 2WI6A 1QYEA 4HZ5A 4CWSA 3CWVA 1YETA 2IORA 4NH7A 4YKWA 4JQLA 2CCTA 1Y8NA 2YE7A 3MNRP 3Q5LA 4BIUA 4CWRA 1UYMA 5D6QA 5IN9A 2WERA 3QTFA 2WEPA 4E00A 4BQGA 4I3HA 4ASGA 4ASAA 4PL9A 5D7DA 5M4NA 3C11A 3ZKDA 4GQTA 5F3KA 5GGZA 2BSMA 2WI5A 2CG9A 4CWQA 5CPHA 4CWTA 1UYLA 4FMTA 4KSGA 3G7EA 3DGEA 1MU5A 2XHTA 3T10A 1US7A 3U2KA 3EHGA 2YKJA 3PEHA 2FWYA 3EHHA 3IEDA 1NHJA 4H81A 5FNCA 1BXDA 3JZ3A 4U7OA 2FXSA 2YGEA 4B6CA 2FYPA 2GQPA 2VWCA 4GFNA 4EM7A 2XX2A 4R3AA 1ZXMA 4MP7A 5M4EA 4K4OA 2XDKA 2YKCA 3A0RA 1NHIA 4HXWA 4WUBA 4CE3A 1THNA 4XTJA 2YEBA 1Z5AA 4KTNA 1UYHA 2YE9A 3K98A 2WI3A 3EHFA 1TBWA 5D6PA 4WUDA 3D0BA 3D36A 2HG1A 3H4LA 2IWSA 2QFOA 4YKRA 2YJWA 3K99A 3NMQA 2BU8A 4NH9A 4UROA 4EEHA 2C2AA 4HY1A 4KQVA 4XKKA 1NHHA 1UYEA 3OMUA 2PNRA 4JAUA 4ASFA 2ZDXA 4URLA 1ID0A 4MPNA 3GIEA 1AMWA 2E0AA 1TIDA 2YE5A 3B27A 3EKRA 1KIJA 3T0ZA 3U2DA 4EFUA 4XC0A 1I5DA 1L0OA 3ZXQA 3OWBA 3HYZA 4MPCA 1H7UA 5M4KA 3H80A 2ESAA 4XCLA 5CTWA 1Z5BA 4HZ0A 3G7BA 3TZ0A 4XCJA 2UWDA 4LWFA 1ZWHA 2YKBA 2YEEA 1YERA 3O6OA 4JAVA 1UY7A 4LPBA 2XDXA 1I5BA 3FT5A 5C93A 5CTYA 2VCIA 1H7SA 1UYDA 4L91A 2Q8FA 4CWFA 4HXZA 4LP0A 2CH4A 3CGYA 2YKIA 1GKZA 4XIPA 1UY6A 2BREA 1YESA 3T0HA 4CWOA 4E01A 4LWHA 2VCJA 4XD8A 2BYHA 1UY8A 2K5BA 4YKTA 2BU6A 2YEGA 3QDDA 2YEJA 2YEIA 3OW6A 3O2FA 3CRKA 1YS3A 3PEJA 1BGQA 1UYIA 3RLPA 5FNFA 2XHXA 2YE6A 4P7AA 3A0YA 1Z5CA 2JKIA 1Y4UA 4MPEA 1I5CA 1TC0A 2IWUA 4V26A 1AH8A 4XITA 4URNA 2CCSA 2XCMA 2WI2A 2XDLA 4HY6A 1S14A 2XJXA 4GT8A 2YE8A 3HHUA 1I59A 4MOTA 2EXLA 4GCZA 1AJ6A 3D2RA 4YKZA 5L3JA 2XHRA 2YGFA 1PVGA 4KSHA 4GEEA 1AH6A 2XJGA 4LWGA 3O0IA 3R4OA 4I5SA 2BU2A 5IDMA 2XX5A 2YI0A 1ZXNA 3TZ5A 1I58A 2ZBKB 3GIGB 4CE1A 4W7TA 1TC6A 1UYGA 2WI4A 2BT0A 5D7CA 1ZW9A 3G75A 1B63A 5BOCA 2XX4A 4MP2A 3VHDA 2YK9A 4XIRA 4NH8A 3HEKA 4XIQA 4L94A 1U0ZA 3C0EA 4E02A 4URMA 3RKZA 3VHAA 4AWPA 4V25A 1MX0A 3Q5JA 3INXA 5M4MA 4XKAA 2YGAA 3B28A 4EGHA 1OSFA 3RLRA 2HCHA 4QPKA 3ZKBA 2XD6A 2Q8HA 2YEAA 3OPDA 3RLQA 2CGFA 3R4PA 1JM6A 2O1VA 1Y8OA 4WUCA 1Z59A 3K97A 3HZ5A 5F5RA 3T2SA 2QG0A 2IOQA 4P8OA 2YJXA 3CRLA 4KP4A 4L90A 3WHAA 4R1FA 2IWXA 1U2OA 2BRCA 1UYCA 1EA6A 3A0TA 2BU5A 2BZ5A 3R92A 4LWEA 1Y4SA 5BODA 3HYYA 4AS9A 2ZDYA 3R4NA 4XKOA 4B7PA 4DUHA 4PU9A 2YI6A 3LPSA 1TH8A 4CWNA 4BIZA 4GGLA 2ZKJA 2QF6A 3ZXOA 1EI1A 3Q5KA 3WQ9A 3VHCA 4ASBA 1YSZA 1YC1A 4JASA 4U93A 2YE2A 5CF0A 2XDSA 4CE2A 4Q20A 3TUHA 3U67A 1S16A 1YSRA 5J71A 4YKYA 4CWPA 2BU7A 4U7NA 2Q8GA 4O05A 3B25A 3B24A 3BM9A 2FWZA 5J6AA 2YI5A 1YC4A 4ZKIA 3BMYA 2O1WA 1GKXA 1A4HA 4XE2A 1UYKA 3EKOA 2O1UA 4FCRA 4MBCA 5CTXA 4XDMA 2XK2A 4X9LA 3R4MA 4L93A 4MB9A 5M4HA 1TILA 3T1KA 4QPJA 1B62A 4ZVIA 4YKUA 2Q8IA 4FCPA 3B26A 2CCUA 3A0WA 2YECA 5M4PA
chains in the Genus database with same CATH superfamily
1R62A 2YEHA 3FV5A 1B3QA 3CGZA 2AKPA 3OWDA 4H85A 3INWA 1UY9A 3A0ZA 4HYPA 2QG2A 4YKXA 3GIGA 3R91A 2YI7A 3K60A 2H55A 3A0XA 1BYQA 4O07A 4PRXA 2VW5A 2BTZA 1I5AA 2YEDA 2XABA 1UYFA 4KFGA 4AWQA 4PRVA 4O04A 5D7RA 4YKQA 3LNUA 4L8ZA 1Y8PA 1YC3A 3HZ1A 1GJVA 2YE4A 1QY8A 2WI7A 3SL2A 4AWOA 5IDJA 4BQJA 2YKEA 4DZYA 3KE6A 2GFDA 3VADA 3ZM7A 2WI1A 4FCQA 2C1IA 3EHJA 1BKNA 2HKJA 3FT8A 5CTUA 2YK2A 3TZ4A 4EGKA 2XDUA 3TZ2A 4R3MA 4H7QA 1YT1A 1AM1A 1KZNA 4EGIA 4O09A 2XJJA 4O0BA 1YT0A 4HYMA 4BAEA 4EMVA 2H8MA 2Q2EB 4BXIA 2YE3A 2YEFA 3GIFA 4LWIA 4FPPA 1QZRA 3TTZA 4EFTA 2JJCA 2WEQA 5FWKA 2BYIA 1YT2A 2IOPA 5FNDA 2WI6A 1QYEA 4HZ5A 4CWSA 3CWVA 1YETA 2IORA 4NH7A 4YKWA 4JQLA 2CCTA 1Y8NA 2YE7A 3MNRP 3Q5LA 4BIUA 4CWRA 1UYMA 5D6QA 5IN9A 2WERA 3QTFA 2WEPA 4E00A 4BQGA 4I3HA 4ASGA 4ASAA 4PL9A 5D7DA 5M4NA 3C11A 3ZKDA 4GQTA 5F3KA 5GGZA 2BSMA 2WI5A 2CG9A 4CWQA 5CPHA 4CWTA 1UYLA 4FMTA 4KSGA 3G7EA 3DGEA 1MU5A 2XHTA 3T10A 1US7A 3U2KA 3EHGA 2YKJA 3PEHA 2FWYA 3EHHA 3IEDA 1NHJA 4H81A 5FNCA 1BXDA 3JZ3A 4U7OA 2FXSA 2YGEA 4B6CA 2FYPA 2GQPA 2VWCA 4GFNA 4EM7A 2XX2A 4R3AA 1ZXMA 4MP7A 5M4EA 4K4OA 2XDKA 2YKCA 3A0RA 1NHIA 4HXWA 4WUBA 4CE3A 1THNA 4XTJA 2YEBA 3S5TA 1Z5AA 4KTNA 1UYHA 2YE9A 3K98A 2WI3A 3EHFA 1TBWA 5D6PA 4WUDA 3D0BA 3D36A 2HG1A 3H4LA 2IWSA 2QFOA 4YKRA 2YJWA 3K99A 3NMQA 2BU8A 4NH9A 4UROA 4EEHA 2C2AA 4HY1A 4KQVA 4XKKA 1NHHA 1UYEA 3OMUA 2PNRA 4JAUA 4ASFA 2ZDXA 4URLA 1ID0A 4MPNA 3GIEA 1AMWA 2E0AA 1TIDA 2YE5A 3B27A 3EKRA 1KIJA 3T0ZA 3U2DA 4EFUA 4XC0A 1I5DA 1L0OA 3ZXQA 3OWBA 2FTKA 3LMMA 3HYZA 4MPCA 1H7UA 5M4KA 3H80A 2ESAA 4XCLA 5CTWA 1Z5BA 4HZ0A 3G7BA 3TZ0A 4XCJA 2UWDA 4LWFA 1ZWHA 2YKBA 2YEEA 1YERA 3O6OA 4JAVA 1UY7A 4LPBA 2XDXA 1I5BA 3FT5A 5C93A 5CTYA 2VCIA 1H7SA 1UYDA 4L91A 2Q8FA 4CWFA 4HXZA 4LP0A 2CH4A 3CGYA 2YKIA 1GKZA 4XIPA 1UY6A 2BREA 1YESA 3T0HA 4CWOA 4E01A 4LWHA 2VCJA 4XD8A 2BYHA 1UY8A 2K5BA 4YKTA 2BU6A 2YEGA 3QDDA 2YEJA 2YEIA 3OW6A 3O2FA 3CRKA 1YS3A 3PEJA 1BGQA 1UYIA 3RLPA 5FNFA 4E72A 2XHXA 2YE6A 4P7AA 3A0YA 1Z5CA 2JKIA 1Y4UA 4MPEA 1I5CA 1TC0A 2IWUA 4V26A 1AH8A 4XITA 4URNA 2CCSA 2XCMA 2WI2A 2XDLA 4HY6A 1S14A 2XJXA 4GT8A 2HHIA 2YE8A 1I59A 3HHUA 4MOTA 2EXLA 4GCZA 1AJ6A 3D2RA 4YKZA 5L3JA 2XHRA 2YGFA 1PVGA 4KSHA 4GEEA 1AH6A 2XJGA 4LWGA 3O0IA 3R4OA 4I5SA 2BU2A 5IDMA 2XX5A 2YI0A 1ZXNA 3TZ5A 1F51A 1I58A 2ZBKB 3GIGB 4CE1A 4W7TA 1TC6A 1UYGA 2WI4A 2BT0A 5D7CA 1ZW9A 3G75A 1B63A 5BOCA 2XX4A 4MP2A 3VHDA 2YK9A 4XIRA 4NH8A 3HEKA 4XIQA 4L94A 1U0ZA 3C0EA 4E02A 4URMA 3RKZA 3VHAA 4AWPA 4V25A 1MX0A 3Q5JA 3INXA 5M4MA 4XKAA 2YGAA 3B28A 4EGHA 1OSFA 3RLRA 2HCHA 4QPKA 3ZKBA 2XD6A 2Q8HA 2YEAA 3OPDA 3RLQA 2CGFA 3R4PA 1JM6A 2O1VA 1Y8OA 2C1GA 4WUCA 1Z59A 3K97A 3HZ5A 5F5RA 3T2SA 2QG0A 2IOQA 4P8OA 2YJXA 3CRLA 4KP4A 3CYGA 4L90A 3WHAA 4R1FA 2IWXA 1U2OA 2BRCA 1UYCA 1EA6A 3A0TA 2BU5A 2BZ5A 3R92A 4LWEA 1Y4SA 5BODA 3HYYA 4AS9A 2ZDYA 3R4NA 4XKOA 4B7PA 4DUHA 5JENA 4PU9A 2YI6A 3LPSA 1TH8A 4CWNA 4BIZA 4GGLA 2ZKJA 2QF6A 3ZXOA 1EI1A 3Q5KA 3WQ9A 3VHCA 4ASBA 1YSZA 1YC1A 4JASA 4U93A 2YE2A 5CF0A 2XDSA 4CE2A 4Q20A 3TUHA 3U67A 1S16A 1YSRA 5J71A 4YKYA 4CWPA 2BU7A 4U7NA 2Q8GA 4O05A 3B25A 3B24A 3BM9A 2FWZA 1IXMA 5J6AA 2YI5A 1YC4A 4ZKIA 3BMYA 2O1WA 1GKXA 1A4HA 4XE2A 1UYKA 3EKOA 2O1UA 4FCRA 4MBCA 5CTXA 4XDMA 2XK2A 4X9LA 3R4MA 4L93A 4MB9A 5M4HA 1TILA 3T1KA 4QPJA 1B62A 4ZVIA 4YKUA 2Q8IA 4FCPA 3B26A 2CCUA 3A0WA 2YECA 5M4PA
chains in the Genus database with same CATH topology
1R62A 2YEHA 3FV5A 1B3QA 3CGZA 2AKPA 3OWDA 4H85A 3INWA 1UY9A 3A0ZA 4HYPA 2QG2A 4YKXA 3GIGA 3R91A 2YI7A 3K60A 2H55A 3A0XA 1BYQA 4O07A 4PRXA 2VW5A 2BTZA 1I5AA 2YEDA 2XABA 1UYFA 4KFGA 4AWQA 4PRVA 4O04A 5D7RA 4YKQA 3LNUA 4L8ZA 1Y8PA 1YC3A 3HZ1A 1GJVA 2YE4A 1QY8A 2WI7A 3SL2A 4AWOA 5IDJA 4BQJA 2YKEA 4DZYA 3KE6A 2GFDA 3VADA 3ZM7A 2WI1A 4FCQA 3EHJA 1BKNA 2HKJA 3FT8A 5CTUA 2YK2A 3TZ4A 4EGKA 2XDUA 3TZ2A 4R3MA 4H7QA 1YT1A 1AM1A 1KZNA 4EGIA 4O09A 2XJJA 4O0BA 1YT0A 4HYMA 4BAEA 4EMVA 2H8MA 2Q2EB 4BXIA 2YE3A 2YEFA 3GIFA 4LWIA 4FPPA 1QZRA 3TTZA 4EFTA 2JJCA 2WEQA 5FWKA 2BYIA 1YT2A 2IOPA 5FNDA 2WI6A 1QYEA 4HZ5A 4CWSA 3CWVA 1YETA 2IORA 4NH7A 4YKWA 4JQLA 2CCTA 1Y8NA 2YE7A 3MNRP 3Q5LA 4BIUA 4CWRA 1UYMA 5D6QA 5IN9A 2WERA 3QTFA 2WEPA 4E00A 4BQGA 4I3HA 4ASGA 4ASAA 4PL9A 5D7DA 5M4NA 3C11A 3ZKDA 4GQTA 5F3KA 5GGZA 2BSMA 2WI5A 2CG9A 4CWQA 5CPHA 4CWTA 1UYLA 4FMTA 4KSGA 3G7EA 3DGEA 1MU5A 2XHTA 3T10A 1US7A 3U2KA 3EHGA 2YKJA 3PEHA 2FWYA 3EHHA 3IEDA 1NHJA 4H81A 5FNCA 1BXDA 3JZ3A 4U7OA 2FXSA 2YGEA 4B6CA 2FYPA 2GQPA 2VWCA 4GFNA 4EM7A 2XX2A 4R3AA 1ZXMA 4MP7A 5M4EA 4K4OA 2XDKA 2YKCA 3A0RA 1NHIA 4HXWA 4WUBA 4CE3A 1THNA 4XTJA 2YEBA 1Z5AA 4KTNA 1UYHA 2YE9A 3K98A 2WI3A 3EHFA 1TBWA 5D6PA 4WUDA 3D0BA 3D36A 2HG1A 3H4LA 2IWSA 2QFOA 4YKRA 2YJWA 3K99A 3NMQA 2BU8A 4NH9A 4UROA 4EEHA 2C2AA 4HY1A 4KQVA 4XKKA 1NHHA 1UYEA 3OMUA 2PNRA 4JAUA 4ASFA 2ZDXA 4URLA 1ID0A 4MPNA 3GIEA 1AMWA 2E0AA 1TIDA 2YE5A 3B27A 3EKRA 1KIJA 3T0ZA 3U2DA 4EFUA 4XC0A 1I5DA 1L0OA 3ZXQA 3OWBA 3HYZA 4MPCA 1H7UA 5M4KA 3H80A 2ESAA 4XCLA 5CTWA 1Z5BA 4HZ0A 3G7BA 3TZ0A 4XCJA 2UWDA 4LWFA 1ZWHA 2YKBA 2YEEA 1YERA 3O6OA 4JAVA 1UY7A 4LPBA 2XDXA 1I5BA 3FT5A 5C93A 5CTYA 2VCIA 1H7SA 1UYDA 4L91A 2Q8FA 4CWFA 4HXZA 4LP0A 2CH4A 3CGYA 2YKIA 1GKZA 4XIPA 1UY6A 2BREA 1YESA 3T0HA 4CWOA 4E01A 4LWHA 2VCJA 4XD8A 2BYHA 1UY8A 2K5BA 4YKTA 2BU6A 2YEGA 3QDDA 2YEJA 2YEIA 3OW6A 3O2FA 3CRKA 1YS3A 3PEJA 1BGQA 1UYIA 3RLPA 5FNFA 2XHXA 2YE6A 4P7AA 3A0YA 1Z5CA 2JKIA 1Y4UA 4MPEA 1I5CA 1TC0A 2IWUA 4V26A 1AH8A 4XITA 4URNA 2CCSA 2XCMA 2WI2A 2XDLA 4HY6A 1S14A 2XJXA 4GT8A 2YE8A 3HHUA 1I59A 4MOTA 2EXLA 4GCZA 1AJ6A 3D2RA 4YKZA 5L3JA 2XHRA 2YGFA 1PVGA 4KSHA 4GEEA 1AH6A 2XJGA 4LWGA 3O0IA 3R4OA 4I5SA 2BU2A 5IDMA 2XX5A 2YI0A 1ZXNA 3TZ5A 1I58A 2ZBKB 3GIGB 4CE1A 4W7TA 1TC6A 1UYGA 2WI4A 2BT0A 5D7CA 1ZW9A 3G75A 1B63A 5BOCA 2XX4A 4MP2A 3VHDA 2YK9A 4XIRA 4NH8A 3HEKA 4XIQA 4L94A 1U0ZA 3C0EA 4E02A 4URMA 3RKZA 3VHAA 4AWPA 4V25A 1MX0A 3Q5JA 3INXA 5M4MA 4XKAA 2YGAA 3B28A 4EGHA 1OSFA 3RLRA 2HCHA 4QPKA 3ZKBA 2XD6A 2Q8HA 2YEAA 3OPDA 3RLQA 2CGFA 3R4PA 1JM6A 2O1VA 1Y8OA 4WUCA 1Z59A 3K97A 3HZ5A 5F5RA 3T2SA 2QG0A 2IOQA 4P8OA 2YJXA 3CRLA 4KP4A 4L90A 3WHAA 4R1FA 2IWXA 1U2OA 2BRCA 1UYCA 1EA6A 3A0TA 2BU5A 2BZ5A 3R92A 4LWEA 1Y4SA 5BODA 3HYYA 4AS9A 2ZDYA 3R4NA 4XKOA 4B7PA 4DUHA 4PU9A 2YI6A 3LPSA 1TH8A 4CWNA 4BIZA 4GGLA 2ZKJA 2QF6A 3ZXOA 1EI1A 3Q5KA 3WQ9A 3VHCA 4ASBA 1YSZA 1YC1A 4JASA 4U93A 2YE2A 5CF0A 2XDSA 4CE2A 4Q20A 3TUHA 3U67A 1S16A 1YSRA 5J71A 4YKYA 4CWPA 2BU7A 4U7NA 2Q8GA 4O05A 3B25A 3B24A 3BM9A 2FWZA 5J6AA 2YI5A 1YC4A 4ZKIA 3BMYA 2O1WA 1GKXA 1A4HA 4XE2A 1UYKA 3EKOA 2O1UA 4FCRA 4MBCA 5CTXA 4XDMA 2XK2A 4X9LA 3R4MA 4L93A 4MB9A 5M4HA 1TILA 3T1KA 4QPJA 1B62A 4ZVIA 4YKUA 2Q8IA 4FCPA 3B26A 2CCUA 3A0WA 2YECA 5M4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R62 A;  2YEH A;  3FV5 A;  1B3Q A;  3CGZ A;  2AKP A;  3OWD A;  4H85 A;  3INW A;  1UY9 A;  3A0Z A;  4HYP A;  2QG2 A;  4YKX A;  3GIG A;  3R91 A;  2YI7 A;  3K60 A;  2H55 A;  3A0X A;  1BYQ A;  4O07 A;  4PRX A;  2VW5 A;  2BTZ A;  1I5A A;  2YED A;  2XAB A;  1UYF A;  4KFG A;  4AWQ A;  4PRV A;  4O04 A;  5D7R A;  4YKQ A;  3LNU A;  4L8Z A;  1Y8P A;  1YC3 A;  3HZ1 A;  1GJV A;  2YE4 A;  1QY8 A;  2WI7 A;  3SL2 A;  4AWO A;  5IDJ A;  4BQJ A;  2YKE A;  4DZY A;  3KE6 A;  2GFD A;  3VAD A;  3ZM7 A;  2WI1 A;  4FCQ A;  3EHJ A;  1BKN A;  2HKJ A;  3FT8 A;  5CTU A;  2YK2 A;  3TZ4 A;  4EGK A;  2XDU A;  3TZ2 A;  4R3M A;  4H7Q A;  1YT1 A;  1AM1 A;  1KZN A;  4EGI A;  4O09 A;  2XJJ A;  4O0B A;  1YT0 A;  4HYM A;  4BAE A;  4EMV A;  2H8M A;  2Q2E B;  4BXI A;  2YE3 A;  2YEF A;  3GIF A;  4LWI A;  4FPP A;  1QZR A;  3TTZ A;  4EFT A;  2JJC A;  2WEQ A;  5FWK A;  2BYI A;  1YT2 A;  2IOP A;  5FND A;  2WI6 A;  1QYE A;  4HZ5 A;  4CWS A;  3CWV A;  1YET A;  2IOR A;  4NH7 A;  4YKW A;  4JQL A;  2CCT A;  1Y8N A;  2YE7 A;  3MNR P;  3Q5L A;  4BIU A;  4CWR A;  1UYM A;  5D6Q A;  5IN9 A;  2WER A;  3QTF A;  2WEP A;  4E00 A;  4BQG A;  4I3H A;  4ASG A;  4ASA A;  4PL9 A;  5D7D A;  5M4N A;  3C11 A;  3ZKD A;  4GQT A;  5F3K A;  5GGZ A;  2BSM A;  2WI5 A;  2CG9 A;  4CWQ A;  5CPH A;  4CWT A;  1UYL A;  4FMT A;  4KSG A;  3G7E A;  3DGE A;  1MU5 A;  2XHT A;  3T10 A;  1US7 A;  3U2K A;  3EHG A;  2YKJ A;  3PEH A;  2FWY A;  3EHH A;  3IED A;  1NHJ A;  4H81 A;  5FNC A;  1BXD A;  3JZ3 A;  4U7O A;  2FXS A;  2YGE A;  4B6C A;  2FYP A;  2GQP A;  2VWC A;  4GFN A;  4EM7 A;  2XX2 A;  4R3A A;  1ZXM A;  4MP7 A;  5M4E A;  4K4O A;  2XDK A;  2YKC A;  3A0R A;  1NHI A;  4HXW A;  4WUB A;  4CE3 A;  1THN A;  4XTJ A;  2YEB A;  1Z5A A;  4KTN A;  1UYH A;  2YE9 A;  3K98 A;  2WI3 A;  3EHF A;  1TBW A;  5D6P A;  4WUD A;  3D0B A;  3D36 A;  2HG1 A;  3H4L A;  2IWS A;  2QFO A;  4YKR A;  2YJW A;  3K99 A;  3NMQ A;  2BU8 A;  4NH9 A;  4URO A;  4EEH A;  2C2A A;  4HY1 A;  4KQV A;  4XKK A;  1NHH A;  1UYE A;  3OMU A;  2PNR A;  4JAU A;  4ASF A;  2ZDX A;  4URL A;  1ID0 A;  4MPN A;  3GIE A;  1AMW A;  2E0A A;  1TID A;  2YE5 A;  3B27 A;  3EKR A;  1KIJ A;  3T0Z A;  3U2D A;  4EFU A;  4XC0 A;  1I5D A;  1L0O A;  3ZXQ A;  3OWB A;  3HYZ A;  4MPC A;  1H7U A;  5M4K A;  3H80 A;  2ESA A;  4XCL A;  5CTW A;  1Z5B A;  4HZ0 A;  3G7B A;  3TZ0 A;  4XCJ A;  2UWD A;  4LWF A;  1ZWH A;  2YKB A;  2YEE A;  1YER A;  3O6O A;  4JAV A;  1UY7 A;  4LPB A;  2XDX A;  1I5B A;  3FT5 A;  5C93 A;  5CTY A;  2VCI A;  1H7S A;  1UYD A;  4L91 A;  2Q8F A;  4CWF A;  4HXZ A;  4LP0 A;  2CH4 A;  3CGY A;  2YKI A;  1GKZ A;  4XIP A;  1UY6 A;  2BRE A;  1YES A;  3T0H A;  4CWO A;  4E01 A;  4LWH A;  2VCJ A;  4XD8 A;  2BYH A;  1UY8 A;  2K5B A;  4YKT A;  2BU6 A;  2YEG A;  3QDD A;  2YEJ A;  2YEI A;  3OW6 A;  3O2F A;  3CRK A;  1YS3 A;  3PEJ A;  1BGQ A;  1UYI A;  3RLP A;  5FNF A;  2XHX A;  2YE6 A;  4P7A A;  3A0Y A;  1Z5C A;  2JKI A;  1Y4U A;  4MPE A;  1I5C A;  1TC0 A;  2IWU A;  4V26 A;  1AH8 A;  4XIT A;  4URN A;  2CCS A;  2XCM A;  2WI2 A;  2XDL A;  4HY6 A;  1S14 A;  2XJX A;  4GT8 A;  2YE8 A;  3HHU A;  1I59 A;  4MOT A;  2EXL A;  4GCZ A;  1AJ6 A;  3D2R A;  4YKZ A;  5L3J A;  2XHR A;  2YGF A;  1PVG A;  4KSH A;  4GEE A;  1AH6 A;  2XJG A;  4LWG A;  3O0I A;  3R4O A;  4I5S A;  2BU2 A;  5IDM A;  2XX5 A;  2YI0 A;  1ZXN A;  3TZ5 A;  1I58 A;  2ZBK B;  3GIG B;  4CE1 A;  4W7T A;  1TC6 A;  1UYG A;  2WI4 A;  2BT0 A;  5D7C A;  1ZW9 A;  3G75 A;  1B63 A;  5BOC A;  2XX4 A;  4MP2 A;  3VHD A;  2YK9 A;  4XIR A;  4NH8 A;  3HEK A;  4XIQ A;  4L94 A;  1U0Z A;  3C0E A;  4E02 A;  4URM A;  3RKZ A;  3VHA A;  4AWP A;  4V25 A;  1MX0 A;  3Q5J A;  3INX A;  5M4M A;  4XKA A;  2YGA A;  3B28 A;  4EGH A;  1OSF A;  3RLR A;  2HCH A;  4QPK A;  3ZKB A;  2XD6 A;  2Q8H A;  2YEA A;  3OPD A;  3RLQ A;  2CGF A;  3R4P A;  1JM6 A;  2O1V A;  1Y8O A;  4WUC A;  1Z59 A;  3K97 A;  3HZ5 A;  5F5R A;  3T2S A;  2QG0 A;  2IOQ A;  4P8O A;  2YJX A;  3CRL A;  4KP4 A;  4L90 A;  3WHA A;  4R1F A;  2IWX A;  1U2O A;  2BRC A;  1UYC A;  1EA6 A;  3A0T A;  2BU5 A;  2BZ5 A;  3R92 A;  4LWE A;  1Y4S A;  5BOD A;  3HYY A;  4AS9 A;  2ZDY A;  3R4N A;  4XKO A;  4B7P A;  4DUH A;  4PU9 A;  2YI6 A;  3LPS A;  1TH8 A;  4CWN A;  4BIZ A;  4GGL A;  2ZKJ A;  2QF6 A;  3ZXO A;  1EI1 A;  3Q5K A;  3WQ9 A;  3VHC A;  4ASB A;  1YSZ A;  1YC1 A;  4JAS A;  4U93 A;  2YE2 A;  5CF0 A;  2XDS A;  4CE2 A;  4Q20 A;  3TUH A;  3U67 A;  1S16 A;  1YSR A;  5J71 A;  4YKY A;  4CWP A;  2BU7 A;  4U7N A;  2Q8G A;  4O05 A;  3B25 A;  3B24 A;  3BM9 A;  2FWZ A;  5J6A A;  2YI5 A;  1YC4 A;  4ZKI A;  3BMY A;  2O1W A;  1GKX A;  1A4H A;  4XE2 A;  1UYK A;  3EKO A;  2O1U A;  4FCR A;  4MBC A;  5CTX A;  4XDM A;  2XK2 A;  4X9L A;  3R4M A;  4L93 A;  4MB9 A;  5M4H A;  1TIL A;  3T1K A;  4QPJ A;  1B62 A;  4ZVI A;  4YKU A;  2Q8I A;  4FCP A;  3B26 A;  2CCU A;  3A0W A;  2YEC A;  5M4P A; 
#chains in the Genus database with same CATH topology
 1R62 A;  2YEH A;  3FV5 A;  1B3Q A;  3CGZ A;  2AKP A;  3OWD A;  4H85 A;  3INW A;  1UY9 A;  3A0Z A;  4HYP A;  2QG2 A;  4YKX A;  3GIG A;  3R91 A;  2YI7 A;  3K60 A;  2H55 A;  3A0X A;  1BYQ A;  4O07 A;  4PRX A;  2VW5 A;  2BTZ A;  1I5A A;  2YED A;  2XAB A;  1UYF A;  4KFG A;  4AWQ A;  4PRV A;  4O04 A;  5D7R A;  4YKQ A;  3LNU A;  4L8Z A;  1Y8P A;  1YC3 A;  3HZ1 A;  1GJV A;  2YE4 A;  1QY8 A;  2WI7 A;  3SL2 A;  4AWO A;  5IDJ A;  4BQJ A;  2YKE A;  4DZY A;  3KE6 A;  2GFD A;  3VAD A;  3ZM7 A;  2WI1 A;  4FCQ A;  2C1I A;  3EHJ A;  1BKN A;  2HKJ A;  3FT8 A;  5CTU A;  2YK2 A;  3TZ4 A;  4EGK A;  2XDU A;  3TZ2 A;  4R3M A;  4H7Q A;  1YT1 A;  1AM1 A;  1KZN A;  4EGI A;  4O09 A;  2XJJ A;  4O0B A;  1YT0 A;  4HYM A;  4BAE A;  4EMV A;  2H8M A;  2Q2E B;  4BXI A;  2YE3 A;  2YEF A;  3GIF A;  4LWI A;  4FPP A;  1QZR A;  3TTZ A;  4EFT A;  2JJC A;  2WEQ A;  5FWK A;  2BYI A;  1YT2 A;  2IOP A;  5FND A;  2WI6 A;  1QYE A;  4HZ5 A;  4CWS A;  3CWV A;  1YET A;  2IOR A;  4NH7 A;  4YKW A;  4JQL A;  2CCT A;  1Y8N A;  2YE7 A;  3MNR P;  3Q5L A;  4BIU A;  4CWR A;  1UYM A;  5D6Q A;  5IN9 A;  2WER A;  3QTF A;  2WEP A;  4E00 A;  4BQG A;  4I3H A;  4ASG A;  4ASA A;  4PL9 A;  5D7D A;  5M4N A;  3C11 A;  3ZKD A;  4GQT A;  5F3K A;  5GGZ A;  2BSM A;  2WI5 A;  2CG9 A;  4CWQ A;  5CPH A;  4CWT A;  1UYL A;  4FMT A;  4KSG A;  3G7E A;  3DGE A;  1MU5 A;  2XHT A;  3T10 A;  1US7 A;  3U2K A;  3EHG A;  2YKJ A;  3PEH A;  2FWY A;  3EHH A;  3IED A;  1NHJ A;  4H81 A;  5FNC A;  1BXD A;  3JZ3 A;  4U7O A;  2FXS A;  2YGE A;  4B6C A;  2FYP A;  2GQP A;  2VWC A;  4GFN A;  4EM7 A;  2XX2 A;  4R3A A;  1ZXM A;  4MP7 A;  5M4E A;  4K4O A;  2XDK A;  2YKC A;  3A0R A;  1NHI A;  4HXW A;  4WUB A;  4CE3 A;  1THN A;  4XTJ A;  2YEB A;  3S5T A;  1Z5A A;  4KTN A;  1UYH A;  2YE9 A;  3K98 A;  2WI3 A;  3EHF A;  1TBW A;  5D6P A;  4WUD A;  3D0B A;  3D36 A;  2HG1 A;  3H4L A;  2IWS A;  2QFO A;  4YKR A;  2YJW A;  3K99 A;  3NMQ A;  2BU8 A;  4NH9 A;  4URO A;  4EEH A;  2C2A A;  4HY1 A;  4KQV A;  4XKK A;  1NHH A;  1UYE A;  3OMU A;  2PNR A;  4JAU A;  4ASF A;  2ZDX A;  4URL A;  1ID0 A;  4MPN A;  3GIE A;  1AMW A;  2E0A A;  1TID A;  2YE5 A;  3B27 A;  3EKR A;  1KIJ A;  3T0Z A;  3U2D A;  4EFU A;  4XC0 A;  1I5D A;  1L0O A;  3ZXQ A;  3OWB A;  2FTK A;  3LMM A;  3HYZ A;  4MPC A;  1H7U A;  5M4K A;  3H80 A;  2ESA A;  4XCL A;  5CTW A;  1Z5B A;  4HZ0 A;  3G7B A;  3TZ0 A;  4XCJ A;  2UWD A;  4LWF A;  1ZWH A;  2YKB A;  2YEE A;  1YER A;  3O6O A;  4JAV A;  1UY7 A;  4LPB A;  2XDX A;  1I5B A;  3FT5 A;  5C93 A;  5CTY A;  2VCI A;  1H7S A;  1UYD A;  4L91 A;  2Q8F A;  4CWF A;  4HXZ A;  4LP0 A;  2CH4 A;  3CGY A;  2YKI A;  1GKZ A;  4XIP A;  1UY6 A;  2BRE A;  1YES A;  3T0H A;  4CWO A;  4E01 A;  4LWH A;  2VCJ A;  4XD8 A;  2BYH A;  1UY8 A;  2K5B A;  4YKT A;  2BU6 A;  2YEG A;  3QDD A;  2YEJ A;  2YEI A;  3OW6 A;  3O2F A;  3CRK A;  1YS3 A;  3PEJ A;  1BGQ A;  1UYI A;  3RLP A;  5FNF A;  4E72 A;  2XHX A;  2YE6 A;  4P7A A;  3A0Y A;  1Z5C A;  2JKI A;  1Y4U A;  4MPE A;  1I5C A;  1TC0 A;  2IWU A;  4V26 A;  1AH8 A;  4XIT A;  4URN A;  2CCS A;  2XCM A;  2WI2 A;  2XDL A;  4HY6 A;  1S14 A;  2XJX A;  4GT8 A;  2HHI A;  2YE8 A;  1I59 A;  3HHU A;  4MOT A;  2EXL A;  4GCZ A;  1AJ6 A;  3D2R A;  4YKZ A;  5L3J A;  2XHR A;  2YGF A;  1PVG A;  4KSH A;  4GEE A;  1AH6 A;  2XJG A;  4LWG A;  3O0I A;  3R4O A;  4I5S A;  2BU2 A;  5IDM A;  2XX5 A;  2YI0 A;  1ZXN A;  3TZ5 A;  1F51 A;  1I58 A;  2ZBK B;  3GIG B;  4CE1 A;  4W7T A;  1TC6 A;  1UYG A;  2WI4 A;  2BT0 A;  5D7C A;  1ZW9 A;  3G75 A;  1B63 A;  5BOC A;  2XX4 A;  4MP2 A;  3VHD A;  2YK9 A;  4XIR A;  4NH8 A;  3HEK A;  4XIQ A;  4L94 A;  1U0Z A;  3C0E A;  4E02 A;  4URM A;  3RKZ A;  3VHA A;  4AWP A;  4V25 A;  1MX0 A;  3Q5J A;  3INX A;  5M4M A;  4XKA A;  2YGA A;  3B28 A;  4EGH A;  1OSF A;  3RLR A;  2HCH A;  4QPK A;  3ZKB A;  2XD6 A;  2Q8H A;  2YEA A;  3OPD A;  3RLQ A;  2CGF A;  3R4P A;  1JM6 A;  2O1V A;  1Y8O A;  2C1G A;  4WUC A;  1Z59 A;  3K97 A;  3HZ5 A;  5F5R A;  3T2S A;  2QG0 A;  2IOQ A;  4P8O A;  2YJX A;  3CRL A;  4KP4 A;  3CYG A;  4L90 A;  3WHA A;  4R1F A;  2IWX A;  1U2O A;  2BRC A;  1UYC A;  1EA6 A;  3A0T A;  2BU5 A;  2BZ5 A;  3R92 A;  4LWE A;  1Y4S A;  5BOD A;  3HYY A;  4AS9 A;  2ZDY A;  3R4N A;  4XKO A;  4B7P A;  4DUH A;  5JEN A;  4PU9 A;  2YI6 A;  3LPS A;  1TH8 A;  4CWN A;  4BIZ A;  4GGL A;  2ZKJ A;  2QF6 A;  3ZXO A;  1EI1 A;  3Q5K A;  3WQ9 A;  3VHC A;  4ASB A;  1YSZ A;  1YC1 A;  4JAS A;  4U93 A;  2YE2 A;  5CF0 A;  2XDS A;  4CE2 A;  4Q20 A;  3TUH A;  3U67 A;  1S16 A;  1YSR A;  5J71 A;  4YKY A;  4CWP A;  2BU7 A;  4U7N A;  2Q8G A;  4O05 A;  3B25 A;  3B24 A;  3BM9 A;  2FWZ A;  1IXM A;  5J6A A;  2YI5 A;  1YC4 A;  4ZKI A;  3BMY A;  2O1W A;  1GKX A;  1A4H A;  4XE2 A;  1UYK A;  3EKO A;  2O1U A;  4FCR A;  4MBC A;  5CTX A;  4XDM A;  2XK2 A;  4X9L A;  3R4M A;  4L93 A;  4MB9 A;  5M4H A;  1TIL A;  3T1K A;  4QPJ A;  1B62 A;  4ZVI A;  4YKU A;  2Q8I A;  4FCP A;  3B26 A;  2CCU A;  3A0W A;  2YEC A;  5M4P A; 
#chains in the Genus database with same CATH homology
 1R62 A;  2YEH A;  3FV5 A;  1B3Q A;  3CGZ A;  2AKP A;  3OWD A;  4H85 A;  3INW A;  1UY9 A;  3A0Z A;  4HYP A;  2QG2 A;  4YKX A;  3GIG A;  3R91 A;  2YI7 A;  3K60 A;  2H55 A;  3A0X A;  1BYQ A;  4O07 A;  4PRX A;  2VW5 A;  2BTZ A;  1I5A A;  2YED A;  2XAB A;  1UYF A;  4KFG A;  4AWQ A;  4PRV A;  4O04 A;  5D7R A;  4YKQ A;  3LNU A;  4L8Z A;  1Y8P A;  1YC3 A;  3HZ1 A;  1GJV A;  2YE4 A;  1QY8 A;  2WI7 A;  3SL2 A;  4AWO A;  5IDJ A;  4BQJ A;  2YKE A;  4DZY A;  3KE6 A;  2GFD A;  3VAD A;  3ZM7 A;  2WI1 A;  4FCQ A;  3EHJ A;  1BKN A;  2HKJ A;  3FT8 A;  5CTU A;  2YK2 A;  3TZ4 A;  4EGK A;  2XDU A;  3TZ2 A;  4R3M A;  4H7Q A;  1YT1 A;  1AM1 A;  1KZN A;  4EGI A;  4O09 A;  2XJJ A;  4O0B A;  1YT0 A;  4HYM A;  4BAE A;  4EMV A;  2H8M A;  2Q2E B;  4BXI A;  2YE3 A;  2YEF A;  3GIF A;  4LWI A;  4FPP A;  1QZR A;  3TTZ A;  4EFT A;  2JJC A;  2WEQ A;  5FWK A;  2BYI A;  1YT2 A;  2IOP A;  5FND A;  2WI6 A;  1QYE A;  4HZ5 A;  4CWS A;  3CWV A;  1YET A;  2IOR A;  4NH7 A;  4YKW A;  4JQL A;  2CCT A;  1Y8N A;  2YE7 A;  3MNR P;  3Q5L A;  4BIU A;  4CWR A;  1UYM A;  5D6Q A;  5IN9 A;  2WER A;  3QTF A;  2WEP A;  4E00 A;  4BQG A;  4I3H A;  4ASG A;  4ASA A;  4PL9 A;  5D7D A;  5M4N A;  3C11 A;  3ZKD A;  4GQT A;  5F3K A;  5GGZ A;  2BSM A;  2WI5 A;  2CG9 A;  4CWQ A;  5CPH A;  4CWT A;  1UYL A;  4FMT A;  4KSG A;  3G7E A;  3DGE A;  1MU5 A;  2XHT A;  3T10 A;  1US7 A;  3U2K A;  3EHG A;  2YKJ A;  3PEH A;  2FWY A;  3EHH A;  3IED A;  1NHJ A;  4H81 A;  5FNC A;  1BXD A;  3JZ3 A;  4U7O A;  2FXS A;  2YGE A;  4B6C A;  2FYP A;  2GQP A;  2VWC A;  4GFN A;  4EM7 A;  2XX2 A;  4R3A A;  1ZXM A;  4MP7 A;  5M4E A;  4K4O A;  2XDK A;  2YKC A;  3A0R A;  1NHI A;  4HXW A;  4WUB A;  4CE3 A;  1THN A;  4XTJ A;  2YEB A;  1Z5A A;  4KTN A;  1UYH A;  2YE9 A;  3K98 A;  2WI3 A;  3EHF A;  1TBW A;  5D6P A;  4WUD A;  3D0B A;  3D36 A;  2HG1 A;  3H4L A;  2IWS A;  2QFO A;  4YKR A;  2YJW A;  3K99 A;  3NMQ A;  2BU8 A;  4NH9 A;  4URO A;  4EEH A;  2C2A A;  4HY1 A;  4KQV A;  4XKK A;  1NHH A;  1UYE A;  3OMU A;  2PNR A;  4JAU A;  4ASF A;  2ZDX A;  4URL A;  1ID0 A;  4MPN A;  3GIE A;  1AMW A;  2E0A A;  1TID A;  2YE5 A;  3B27 A;  3EKR A;  1KIJ A;  3T0Z A;  3U2D A;  4EFU A;  4XC0 A;  1I5D A;  1L0O A;  3ZXQ A;  3OWB A;  3HYZ A;  4MPC A;  1H7U A;  5M4K A;  3H80 A;  2ESA A;  4XCL A;  5CTW A;  1Z5B A;  4HZ0 A;  3G7B A;  3TZ0 A;  4XCJ A;  2UWD A;  4LWF A;  1ZWH A;  2YKB A;  2YEE A;  1YER A;  3O6O A;  4JAV A;  1UY7 A;  4LPB A;  2XDX A;  1I5B A;  3FT5 A;  5C93 A;  5CTY A;  2VCI A;  1H7S A;  1UYD A;  4L91 A;  2Q8F A;  4CWF A;  4HXZ A;  4LP0 A;  2CH4 A;  3CGY A;  2YKI A;  1GKZ A;  4XIP A;  1UY6 A;  2BRE A;  1YES A;  3T0H A;  4CWO A;  4E01 A;  4LWH A;  2VCJ A;  4XD8 A;  2BYH A;  1UY8 A;  2K5B A;  4YKT A;  2BU6 A;  2YEG A;  3QDD A;  2YEJ A;  2YEI A;  3OW6 A;  3O2F A;  3CRK A;  1YS3 A;  3PEJ A;  1BGQ A;  1UYI A;  3RLP A;  5FNF A;  2XHX A;  2YE6 A;  4P7A A;  3A0Y A;  1Z5C A;  2JKI A;  1Y4U A;  4MPE A;  1I5C A;  1TC0 A;  2IWU A;  4V26 A;  1AH8 A;  4XIT A;  4URN A;  2CCS A;  2XCM A;  2WI2 A;  2XDL A;  4HY6 A;  1S14 A;  2XJX A;  4GT8 A;  2YE8 A;  3HHU A;  1I59 A;  4MOT A;  2EXL A;  4GCZ A;  1AJ6 A;  3D2R A;  4YKZ A;  5L3J A;  2XHR A;  2YGF A;  1PVG A;  4KSH A;  4GEE A;  1AH6 A;  2XJG A;  4LWG A;  3O0I A;  3R4O A;  4I5S A;  2BU2 A;  5IDM A;  2XX5 A;  2YI0 A;  1ZXN A;  3TZ5 A;  1I58 A;  2ZBK B;  3GIG B;  4CE1 A;  4W7T A;  1TC6 A;  1UYG A;  2WI4 A;  2BT0 A;  5D7C A;  1ZW9 A;  3G75 A;  1B63 A;  5BOC A;  2XX4 A;  4MP2 A;  3VHD A;  2YK9 A;  4XIR A;  4NH8 A;  3HEK A;  4XIQ A;  4L94 A;  1U0Z A;  3C0E A;  4E02 A;  4URM A;  3RKZ A;  3VHA A;  4AWP A;  4V25 A;  1MX0 A;  3Q5J A;  3INX A;  5M4M A;  4XKA A;  2YGA A;  3B28 A;  4EGH A;  1OSF A;  3RLR A;  2HCH A;  4QPK A;  3ZKB A;  2XD6 A;  2Q8H A;  2YEA A;  3OPD A;  3RLQ A;  2CGF A;  3R4P A;  1JM6 A;  2O1V A;  1Y8O A;  4WUC A;  1Z59 A;  3K97 A;  3HZ5 A;  5F5R A;  3T2S A;  2QG0 A;  2IOQ A;  4P8O A;  2YJX A;  3CRL A;  4KP4 A;  4L90 A;  3WHA A;  4R1F A;  2IWX A;  1U2O A;  2BRC A;  1UYC A;  1EA6 A;  3A0T A;  2BU5 A;  2BZ5 A;  3R92 A;  4LWE A;  1Y4S A;  5BOD A;  3HYY A;  4AS9 A;  2ZDY A;  3R4N A;  4XKO A;  4B7P A;  4DUH A;  4PU9 A;  2YI6 A;  3LPS A;  1TH8 A;  4CWN A;  4BIZ A;  4GGL A;  2ZKJ A;  2QF6 A;  3ZXO A;  1EI1 A;  3Q5K A;  3WQ9 A;  3VHC A;  4ASB A;  1YSZ A;  1YC1 A;  4JAS A;  4U93 A;  2YE2 A;  5CF0 A;  2XDS A;  4CE2 A;  4Q20 A;  3TUH A;  3U67 A;  1S16 A;  1YSR A;  5J71 A;  4YKY A;  4CWP A;  2BU7 A;  4U7N A;  2Q8G A;  4O05 A;  3B25 A;  3B24 A;  3BM9 A;  2FWZ A;  5J6A A;  2YI5 A;  1YC4 A;  4ZKI A;  3BMY A;  2O1W A;  1GKX A;  1A4H A;  4XE2 A;  1UYK A;  3EKO A;  2O1U A;  4FCR A;  4MBC A;  5CTX A;  4XDM A;  2XK2 A;  4X9L A;  3R4M A;  4L93 A;  4MB9 A;  5M4H A;  1TIL A;  3T1K A;  4QPJ A;  1B62 A;  4ZVI A;  4YKU A;  2Q8I A;  4FCP A;  3B26 A;  2CCU A;  3A0W A;  2YEC A;  5M4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...