5CTXA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based discovery of DNA gyrase inhibitors targeting the ATPase subunit of GyrB.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 65
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5ctxA00
3B26A 5CTWA 4BQGA 4NH7A 1QZRA 3ZM7A 1Y8PA 2HG1A 1MX0A 1I5BA 4HYPA 4O07A 3GIEA 3R4MA 4E02A 4BIUA 1PVGA 2BTZA 4ASGA 4EGKA 1KZNA 3B28A 3FV5A 4XC0A 2BREA 2WERA 1Y4SA 4ZKIA 4BIZA 4QPKA 2YJXA 2XDUA 1R62A 4YKYA 4L93A 1YT0A 5F5RA 1TC0A 4ZVIA 3OWBA 3VHDA 1ZXMA 5IN9A 3GIGA 2IOPA 2CG9A 2Q2EB 3HHUA 1TC6A 2BU2A 5BODA 3PEJA 1Y8NA 4YKXA 5CF0A 2BU8A 3T2SA 2HKJA 2QG0A 1BYQA 2ESAA 3JZ3A 3IEDA 1JM6A 1UYMA 4XD8A 1UY6A 4KP4A 2XHXA 2Q8IA 4CWRA 3VADA 1UYFA 5C93A 3B24A 3B25A 4XIRA 4CE2A 2UWDA 4V25A 4ASBA 2WI5A 2YEHA 2IWSA 2YE2A 2YEJA 3ZKDA 3DGEA 2CCUA 2XJJA 2YI0A 3C0EA 3BM9A 3Q5JA 1YC1A 2FYPA 3A0TA 3RKZA 4I3HA 1YC3A 4URLA 4KSGA 4O05A 3U67A 4V26A 1I58A 5D7CA 3R4PA 1BKNA 1H7UA 4CE3A 5M4KA 5CTYA 4E00A 4DZYA 2H8MA 3A0WA 3OPDA 2YJWA 1ZWHA 1B62A 1YSZA 2O1VA 2WI7A 4HZ5A 5F3KA 1TH8A 1YESA 4YKQA 2WI2A 1S16A 2CCSA 4MP2A 4KFGA 1I59A 2WI1A 2WI6A 4ASAA 1Z5BA 2QFOA 5M4NA 2XABA 1KIJA 2FXSA 2XJGA 1UYGA 2QG2A 3QDDA 4JAUA 4K4OA 1MU5A 3HEKA 2FWYA 3T0HA 3VHCA 1UYLA 2JKIA 1U2OA 4I5SA 4PRVA 2YEFA 4BAEA 3OW6A 3CRLA 4H85A 4YKRA 2BRCA 2IORA 5M4HA 2JJCA 3KE6A 4XKKA 4XCLA 3G7BA 4XKOA 3H80A 3INWA 3VHAA 1NHHA 4B6CA 4HXZA 1AH6A 4CWSA 2WEQA 1AH8A 2XX5A 3U2KA 5CTXA 4HY1A 5J71A 1YS3A 1Z5AA 4GCZA 4WUBA 3T0ZA 2K5BA 1TIDA 2HCHA 3B27A 5D7DA 3R4OA 5M4PA 4BQJA 2WI4A 5FNCA 4H7QA 4ASFA 2XDLA 2Q8FA 1AMWA 4X9LA 4CWTA 3FT8A 1S14A 1U0ZA 4FMTA 1THNA 2H55A 5GGZA 2ZDXA 4CWFA 2IWUA 2VWCA 3WHAA 4L8ZA 4GFNA 3RLQA 4PL9A 4HY6A 2GFDA 5BOCA 2BU6A 1UY9A 4LWGA 2YI5A 1UY8A 4JASA 4H81A 3INXA 3G7EA 3ZXQA 4CWNA 2E0AA 3O6OA 2EXLA 4KTNA 4AWQA 3CWVA 4EFUA 4LWHA 3GIGB 3WQ9A 4LWEA 1AJ6A 1GJVA 2YECA 1GKZA 1YSRA 1TBWA 4XCJA 4L90A 2VCIA 3Q5KA 2YE4A 2YE8A 5IDJA 4YKZA 4LPBA 1UYCA 1Y4UA 2CCTA 4GQTA 4MOTA 5CTUA 2CGFA 4R1FA 4MB9A 4AWOA 4JQLA 2C2AA 3TUHA 3PEHA 2YK9A 4MPCA 3A0YA 4EGHA 3EHFA 2YI6A 1AM1A 2XX2A 3R91A 1OSFA 4URMA 4U93A 4FCQA 1UY7A 1A4HA 1US7A 4XDMA 1I5CA 2YE9A 3CGZA 2XJXA 2YKIA 4MBCA 5D6QA 4EGIA 2XHTA 2YKCA 1QYEA 4DUHA 3K98A 4E01A 3EKOA 3EHJA 4FCRA 2WI3A 5IDMA 4EEHA 4LWFA 2YK2A 2YEDA 3ZXOA 2ZDYA 3TZ2A 4O09A 2AKPA 2BSMA 3HYZA 2ZBKB 4CWQA 4U7OA 2XD6A 2YEEA 2PNRA 1YETA 1NHIA 2BT0A 4MP7A 3MNRP 1YT1A 1ZXNA 1L0OA 3R4NA 3A0ZA 3EKRA 3TZ4A 2YEAA 1EA6A 1Z5CA 3CRKA 4BXIA 5FWKA 1I5DA 2ZKJA 3RLRA 3K60A 1YT2A 2YKEA 2YI7A 4CWOA 2O1WA 4HYMA 4L91A 4WUCA 3HZ5A 1UYIA 1QY8A 1UYHA 2XDSA 1Y8OA 4P7AA 3BMYA 4FCPA 2IWXA 4PU9A 4YKTA 4QPJA 3SL2A 3FT5A 2BYHA 1ZW9A 2YEGA 3NMQA 3T10A 1B3QA 2YE7A 4KQVA 3TZ0A 1H7SA 3OMUA 2YE3A 5D6PA 5CPHA 4LP0A 5D7RA 3D36A 2FWZA 4KSHA 3EHHA 4HXWA 4AWPA 4CE1A 1ID0A 2YKBA 1B63A 4XTJA 2YKJA 4AS9A 4U7NA 1TILA 2XCMA 2CH4A 4NH8A 2YE6A 4P8OA 4LWIA 4MPNA 2VW5A 3LNUA 2YGAA 3O0IA 4CWPA 3TTZA 4XITA 4L94A 3H4LA 2GQPA 4EFTA 3ZKBA 4HZ0A 1EI1A 3CGYA 2O1UA 4R3AA 4Q20A 4XKAA 1I5AA 4GT8A 4EM7A 5FNDA 1UYKA 2YGFA 4UROA 2Q8HA 1GKXA 3T1KA 1YC4A 4JAVA 2YE5A 4FPPA 4GGLA 1Z59A 3HYYA 3TZ5A 3EHGA 3K99A 3OWDA 2XDXA 5FNFA 5M4MA 2XDKA 1UYDA 1BGQA 2YEBA 4PRXA 4GEEA 4EMVA 3RLPA 5J6AA 2BU7A 2IOQA 3QTFA 3HZ1A 4O0BA 3Q5LA 2BYIA 3GIFA 4R3MA 4XE2A 3K97A 3O2FA 5M4EA 3A0RA 4NH9A 2YGEA 4O04A 2VCJA 2XHRA 2Q8GA 3U2DA 3LPSA 3G75A 2QF6A 1NHJA 1YERA 4WUDA 2BU5A 2YEIA 4YKUA 3D0BA 2XK2A 3A0XA 3D2RA 4W7TA 4XIQA 3C11A 5L3JA 4MPEA 3R92A 1BXDA 4YKWA 4XIPA 1UYEA 4B7PA 4URNA 2WEPA 2XX4A 2BZ5A
chains in the Genus database with same CATH superfamily
3B26A 5CTWA 4BQGA 4NH7A 1QZRA 3ZM7A 1Y8PA 2HG1A 1MX0A 1I5BA 4HYPA 4O07A 3GIEA 3R4MA 4E02A 4BIUA 1PVGA 2BTZA 4ASGA 4EGKA 1KZNA 3B28A 3FV5A 4XC0A 2BREA 2WERA 1Y4SA 4ZKIA 4BIZA 4QPKA 2YJXA 2XDUA 1R62A 4YKYA 4L93A 1YT0A 5F5RA 1TC0A 4ZVIA 3OWBA 3VHDA 1ZXMA 5IN9A 3GIGA 2IOPA 2CG9A 2Q2EB 3HHUA 1TC6A 2BU2A 5BODA 3PEJA 1Y8NA 4YKXA 5CF0A 2BU8A 3T2SA 2C1GA 2HKJA 2QG0A 1BYQA 2ESAA 3JZ3A 3IEDA 1JM6A 1UYMA 4XD8A 1UY6A 4KP4A 2XHXA 2Q8IA 4CWRA 3VADA 1UYFA 5C93A 3B24A 3B25A 4XIRA 4CE2A 2UWDA 4V25A 4ASBA 2WI5A 2YEHA 2IWSA 2YE2A 2YEJA 3ZKDA 3DGEA 2CCUA 2XJJA 2YI0A 3C0EA 3BM9A 3Q5JA 1YC1A 2FYPA 3A0TA 3RKZA 4I3HA 1YC3A 4URLA 4KSGA 4O05A 3U67A 4V26A 1I58A 5D7CA 3R4PA 1BKNA 1H7UA 4CE3A 5M4KA 5CTYA 4E00A 4DZYA 2H8MA 3A0WA 3OPDA 2YJWA 1ZWHA 1B62A 1YSZA 2O1VA 2WI7A 4HZ5A 5F3KA 1F51A 1TH8A 1YESA 4YKQA 2WI2A 1S16A 2CCSA 4MP2A 4KFGA 1I59A 2WI1A 2WI6A 4ASAA 1Z5BA 2QFOA 5M4NA 2XABA 2C1IA 1KIJA 2FXSA 2XJGA 1UYGA 2QG2A 3QDDA 4JAUA 4K4OA 1MU5A 3HEKA 2FWYA 3T0HA 3VHCA 1UYLA 2JKIA 1U2OA 4I5SA 4PRVA 2YEFA 4BAEA 3OW6A 3CRLA 4H85A 4YKRA 2BRCA 2IORA 5M4HA 2JJCA 3KE6A 4XKKA 4XCLA 3G7BA 4XKOA 3H80A 3INWA 3VHAA 1NHHA 4B6CA 4HXZA 1AH6A 4CWSA 2WEQA 1AH8A 2XX5A 3U2KA 5CTXA 4HY1A 5J71A 1YS3A 1Z5AA 4GCZA 4WUBA 3T0ZA 2K5BA 1TIDA 2HCHA 3B27A 5D7DA 3R4OA 5M4PA 4BQJA 2WI4A 5FNCA 4H7QA 4ASFA 2XDLA 2Q8FA 1AMWA 4X9LA 4CWTA 3FT8A 1S14A 1U0ZA 4FMTA 1THNA 2H55A 5GGZA 2ZDXA 4CWFA 2IWUA 2FTKA 2VWCA 3WHAA 4L8ZA 4GFNA 3RLQA 4PL9A 4HY6A 2GFDA 5BOCA 2BU6A 1UY9A 4LWGA 4E72A 2YI5A 1UY8A 4JASA 4H81A 3INXA 3G7EA 3ZXQA 4CWNA 2E0AA 3O6OA 2EXLA 4KTNA 4AWQA 3CWVA 4EFUA 4LWHA 3GIGB 3WQ9A 4LWEA 1AJ6A 1GJVA 2YECA 1GKZA 1YSRA 1TBWA 4XCJA 4L90A 2VCIA 3Q5KA 2YE4A 2YE8A 5IDJA 4YKZA 4LPBA 1UYCA 1Y4UA 2CCTA 4GQTA 4MOTA 5CTUA 2CGFA 4R1FA 4MB9A 4AWOA 4JQLA 2C2AA 3TUHA 3PEHA 2YK9A 4MPCA 3A0YA 4EGHA 3EHFA 2YI6A 1AM1A 2XX2A 3R91A 1OSFA 4URMA 4U93A 4FCQA 1UY7A 1A4HA 1US7A 4XDMA 1I5CA 2YE9A 3CGZA 2XJXA 2YKIA 4MBCA 5D6QA 4EGIA 2XHTA 2YKCA 1QYEA 4DUHA 3K98A 4E01A 3EKOA 3EHJA 4FCRA 2WI3A 5IDMA 4EEHA 4LWFA 2YK2A 2YEDA 3ZXOA 2ZDYA 3TZ2A 4O09A 2AKPA 2BSMA 3HYZA 2ZBKB 4CWQA 4U7OA 2XD6A 2YEEA 2PNRA 1YETA 1NHIA 2BT0A 4MP7A 3MNRP 1YT1A 1ZXNA 1L0OA 3R4NA 3A0ZA 3EKRA 3TZ4A 2YEAA 1EA6A 1Z5CA 3CRKA 4BXIA 5FWKA 1I5DA 2ZKJA 3RLRA 3K60A 1YT2A 2YKEA 2YI7A 4CWOA 2O1WA 4HYMA 4L91A 4WUCA 3HZ5A 1UYIA 1QY8A 1UYHA 2XDSA 1Y8OA 4P7AA 3BMYA 4FCPA 2IWXA 4PU9A 4YKTA 4QPJA 3SL2A 3FT5A 2BYHA 1ZW9A 2YEGA 3NMQA 3T10A 1B3QA 4KQVA 2YE7A 3TZ0A 3CYGA 1H7SA 3OMUA 2YE3A 5D6PA 5CPHA 4LP0A 5D7RA 3D36A 2FWZA 4KSHA 3EHHA 4HXWA 4AWPA 4CE1A 1ID0A 2YKBA 1B63A 4XTJA 2YKJA 4AS9A 4U7NA 1TILA 2XCMA 1IXMA 2CH4A 4NH8A 2YE6A 4P8OA 4LWIA 5JENA 4MPNA 2VW5A 3LNUA 2YGAA 3O0IA 4CWPA 3TTZA 4XITA 4L94A 3H4LA 2GQPA 4EFTA 3ZKBA 4HZ0A 2HHIA 1EI1A 3CGYA 2O1UA 4R3AA 4Q20A 4XKAA 1I5AA 4GT8A 4EM7A 5FNDA 1UYKA 2YGFA 4UROA 2Q8HA 1GKXA 3T1KA 1YC4A 4JAVA 3S5TA 2YE5A 4FPPA 4GGLA 1Z59A 3HYYA 3TZ5A 3EHGA 3K99A 3LMMA 3OWDA 2XDXA 5FNFA 5M4MA 2XDKA 1UYDA 1BGQA 2YEBA 4PRXA 4GEEA 4EMVA 3RLPA 5J6AA 2BU7A 2IOQA 3QTFA 3HZ1A 4O0BA 3Q5LA 2BYIA 3GIFA 4R3MA 4XE2A 3K97A 3O2FA 5M4EA 3A0RA 4NH9A 2YGEA 4O04A 2VCJA 2XHRA 2Q8GA 3U2DA 3LPSA 3G75A 2QF6A 1NHJA 1YERA 4WUDA 2BU5A 2YEIA 4YKUA 3D0BA 2XK2A 3A0XA 3D2RA 4W7TA 4XIQA 3C11A 5L3JA 4MPEA 3R92A 1BXDA 4YKWA 4XIPA 1UYEA 4B7PA 4URNA 2WEPA 2XX4A 2BZ5A
chains in the Genus database with same CATH topology
3B26A 5CTWA 4BQGA 4NH7A 1QZRA 3ZM7A 1Y8PA 2HG1A 1MX0A 1I5BA 4HYPA 4O07A 3GIEA 3R4MA 4E02A 4BIUA 1PVGA 2BTZA 4ASGA 4EGKA 1KZNA 3B28A 3FV5A 4XC0A 2BREA 2WERA 1Y4SA 4ZKIA 4BIZA 4QPKA 2YJXA 2XDUA 1R62A 4YKYA 4L93A 1YT0A 5F5RA 1TC0A 4ZVIA 3OWBA 3VHDA 1ZXMA 5IN9A 3GIGA 2IOPA 2CG9A 2Q2EB 3HHUA 1TC6A 2BU2A 5BODA 3PEJA 1Y8NA 4YKXA 5CF0A 2BU8A 3T2SA 2HKJA 2QG0A 1BYQA 2ESAA 3JZ3A 3IEDA 1JM6A 1UYMA 4XD8A 1UY6A 4KP4A 2XHXA 2Q8IA 4CWRA 3VADA 1UYFA 5C93A 3B24A 3B25A 4XIRA 4CE2A 2UWDA 4V25A 4ASBA 2WI5A 2YEHA 2IWSA 2YE2A 2YEJA 3ZKDA 3DGEA 2CCUA 2XJJA 2YI0A 3C0EA 3BM9A 3Q5JA 1YC1A 2FYPA 3A0TA 3RKZA 4I3HA 1YC3A 4URLA 4KSGA 4O05A 3U67A 4V26A 1I58A 5D7CA 3R4PA 1BKNA 1H7UA 4CE3A 5M4KA 5CTYA 4E00A 4DZYA 2H8MA 3A0WA 3OPDA 2YJWA 1ZWHA 1B62A 1YSZA 2O1VA 2WI7A 4HZ5A 5F3KA 1TH8A 1YESA 4YKQA 2WI2A 1S16A 2CCSA 4MP2A 4KFGA 1I59A 2WI1A 2WI6A 4ASAA 1Z5BA 2QFOA 5M4NA 2XABA 1KIJA 2FXSA 2XJGA 1UYGA 2QG2A 3QDDA 4JAUA 4K4OA 1MU5A 3HEKA 2FWYA 3T0HA 3VHCA 1UYLA 2JKIA 1U2OA 4I5SA 4PRVA 2YEFA 4BAEA 3OW6A 3CRLA 4H85A 4YKRA 2BRCA 2IORA 5M4HA 2JJCA 3KE6A 4XKKA 4XCLA 3G7BA 4XKOA 3H80A 3INWA 3VHAA 1NHHA 4B6CA 4HXZA 1AH6A 4CWSA 2WEQA 1AH8A 2XX5A 3U2KA 5CTXA 4HY1A 5J71A 1YS3A 1Z5AA 4GCZA 4WUBA 3T0ZA 2K5BA 1TIDA 2HCHA 3B27A 5D7DA 3R4OA 5M4PA 4BQJA 2WI4A 5FNCA 4H7QA 4ASFA 2XDLA 2Q8FA 1AMWA 4X9LA 4CWTA 3FT8A 1S14A 1U0ZA 4FMTA 1THNA 2H55A 5GGZA 2ZDXA 4CWFA 2IWUA 2VWCA 3WHAA 4L8ZA 4GFNA 3RLQA 4PL9A 4HY6A 2GFDA 5BOCA 2BU6A 1UY9A 4LWGA 2YI5A 1UY8A 4JASA 4H81A 3INXA 3G7EA 3ZXQA 4CWNA 2E0AA 3O6OA 2EXLA 4KTNA 4AWQA 3CWVA 4EFUA 4LWHA 3GIGB 3WQ9A 4LWEA 1AJ6A 1GJVA 2YECA 1GKZA 1YSRA 1TBWA 4XCJA 4L90A 2VCIA 3Q5KA 2YE4A 2YE8A 5IDJA 4YKZA 4LPBA 1UYCA 1Y4UA 2CCTA 4GQTA 4MOTA 5CTUA 2CGFA 4R1FA 4MB9A 4AWOA 4JQLA 2C2AA 3TUHA 3PEHA 2YK9A 4MPCA 3A0YA 4EGHA 3EHFA 2YI6A 1AM1A 2XX2A 3R91A 1OSFA 4URMA 4U93A 4FCQA 1UY7A 1A4HA 1US7A 4XDMA 1I5CA 2YE9A 3CGZA 2XJXA 2YKIA 4MBCA 5D6QA 4EGIA 2XHTA 2YKCA 1QYEA 4DUHA 3K98A 4E01A 3EKOA 3EHJA 4FCRA 2WI3A 5IDMA 4EEHA 4LWFA 2YK2A 2YEDA 3ZXOA 2ZDYA 3TZ2A 4O09A 2AKPA 2BSMA 3HYZA 2ZBKB 4CWQA 4U7OA 2XD6A 2YEEA 2PNRA 1YETA 1NHIA 2BT0A 4MP7A 3MNRP 1YT1A 1ZXNA 1L0OA 3R4NA 3A0ZA 3EKRA 3TZ4A 2YEAA 1EA6A 1Z5CA 3CRKA 4BXIA 5FWKA 1I5DA 2ZKJA 3RLRA 3K60A 1YT2A 2YKEA 2YI7A 4CWOA 2O1WA 4HYMA 4L91A 4WUCA 3HZ5A 1UYIA 1QY8A 1UYHA 2XDSA 1Y8OA 4P7AA 3BMYA 4FCPA 2IWXA 4PU9A 4YKTA 4QPJA 3SL2A 3FT5A 2BYHA 1ZW9A 2YEGA 3NMQA 3T10A 1B3QA 2YE7A 4KQVA 3TZ0A 1H7SA 3OMUA 2YE3A 5D6PA 5CPHA 4LP0A 5D7RA 3D36A 2FWZA 4KSHA 3EHHA 4HXWA 4AWPA 4CE1A 1ID0A 2YKBA 1B63A 4XTJA 2YKJA 4AS9A 4U7NA 1TILA 2XCMA 2CH4A 4NH8A 2YE6A 4P8OA 4LWIA 4MPNA 2VW5A 3LNUA 2YGAA 3O0IA 4CWPA 3TTZA 4XITA 4L94A 3H4LA 2GQPA 4EFTA 3ZKBA 4HZ0A 1EI1A 3CGYA 2O1UA 4R3AA 4Q20A 4XKAA 1I5AA 4GT8A 4EM7A 5FNDA 1UYKA 2YGFA 4UROA 2Q8HA 1GKXA 3T1KA 1YC4A 4JAVA 2YE5A 4FPPA 4GGLA 1Z59A 3HYYA 3TZ5A 3EHGA 3K99A 3OWDA 2XDXA 5FNFA 5M4MA 2XDKA 1UYDA 1BGQA 2YEBA 4PRXA 4GEEA 4EMVA 3RLPA 5J6AA 2BU7A 2IOQA 3QTFA 3HZ1A 4O0BA 3Q5LA 2BYIA 3GIFA 4R3MA 4XE2A 3K97A 3O2FA 5M4EA 3A0RA 4NH9A 2YGEA 4O04A 2VCJA 2XHRA 2Q8GA 3U2DA 3LPSA 3G75A 2QF6A 1NHJA 1YERA 4WUDA 2BU5A 2YEIA 4YKUA 3D0BA 2XK2A 3A0XA 3D2RA 4W7TA 4XIQA 3C11A 5L3JA 4MPEA 3R92A 1BXDA 4YKWA 4XIPA 1UYEA 4B7PA 4URNA 2WEPA 2XX4A 2BZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B26 A;  5CTW A;  4BQG A;  4NH7 A;  1QZR A;  3ZM7 A;  1Y8P A;  2HG1 A;  1MX0 A;  1I5B A;  4HYP A;  4O07 A;  3GIE A;  3R4M A;  4E02 A;  4BIU A;  1PVG A;  2BTZ A;  4ASG A;  4EGK A;  1KZN A;  3B28 A;  3FV5 A;  4XC0 A;  2BRE A;  2WER A;  1Y4S A;  4ZKI A;  4BIZ A;  4QPK A;  2YJX A;  2XDU A;  1R62 A;  4YKY A;  4L93 A;  1YT0 A;  5F5R A;  1TC0 A;  4ZVI A;  3OWB A;  3VHD A;  1ZXM A;  5IN9 A;  3GIG A;  2IOP A;  2CG9 A;  2Q2E B;  3HHU A;  1TC6 A;  2BU2 A;  5BOD A;  3PEJ A;  1Y8N A;  4YKX A;  5CF0 A;  2BU8 A;  3T2S A;  2HKJ A;  2QG0 A;  1BYQ A;  2ESA A;  3JZ3 A;  3IED A;  1JM6 A;  1UYM A;  4XD8 A;  1UY6 A;  4KP4 A;  2XHX A;  2Q8I A;  4CWR A;  3VAD A;  1UYF A;  5C93 A;  3B24 A;  3B25 A;  4XIR A;  4CE2 A;  2UWD A;  4V25 A;  4ASB A;  2WI5 A;  2YEH A;  2IWS A;  2YE2 A;  2YEJ A;  3ZKD A;  3DGE A;  2CCU A;  2XJJ A;  2YI0 A;  3C0E A;  3BM9 A;  3Q5J A;  1YC1 A;  2FYP A;  3A0T A;  3RKZ A;  4I3H A;  1YC3 A;  4URL A;  4KSG A;  4O05 A;  3U67 A;  4V26 A;  1I58 A;  5D7C A;  3R4P A;  1BKN A;  1H7U A;  4CE3 A;  5M4K A;  5CTY A;  4E00 A;  4DZY A;  2H8M A;  3A0W A;  3OPD A;  2YJW A;  1ZWH A;  1B62 A;  1YSZ A;  2O1V A;  2WI7 A;  4HZ5 A;  5F3K A;  1TH8 A;  1YES A;  4YKQ A;  2WI2 A;  1S16 A;  2CCS A;  4MP2 A;  4KFG A;  1I59 A;  2WI1 A;  2WI6 A;  4ASA A;  1Z5B A;  2QFO A;  5M4N A;  2XAB A;  1KIJ A;  2FXS A;  2XJG A;  1UYG A;  2QG2 A;  3QDD A;  4JAU A;  4K4O A;  1MU5 A;  3HEK A;  2FWY A;  3T0H A;  3VHC A;  1UYL A;  2JKI A;  1U2O A;  4I5S A;  4PRV A;  2YEF A;  4BAE A;  3OW6 A;  3CRL A;  4H85 A;  4YKR A;  2BRC A;  2IOR A;  5M4H A;  2JJC A;  3KE6 A;  4XKK A;  4XCL A;  3G7B A;  4XKO A;  3H80 A;  3INW A;  3VHA A;  1NHH A;  4B6C A;  4HXZ A;  1AH6 A;  4CWS A;  2WEQ A;  1AH8 A;  2XX5 A;  3U2K A;  5CTX A;  4HY1 A;  5J71 A;  1YS3 A;  1Z5A A;  4GCZ A;  4WUB A;  3T0Z A;  2K5B A;  1TID A;  2HCH A;  3B27 A;  5D7D A;  3R4O A;  5M4P A;  4BQJ A;  2WI4 A;  5FNC A;  4H7Q A;  4ASF A;  2XDL A;  2Q8F A;  1AMW A;  4X9L A;  4CWT A;  3FT8 A;  1S14 A;  1U0Z A;  4FMT A;  1THN A;  2H55 A;  5GGZ A;  2ZDX A;  4CWF A;  2IWU A;  2VWC A;  3WHA A;  4L8Z A;  4GFN A;  3RLQ A;  4PL9 A;  4HY6 A;  2GFD A;  5BOC A;  2BU6 A;  1UY9 A;  4LWG A;  2YI5 A;  1UY8 A;  4JAS A;  4H81 A;  3INX A;  3G7E A;  3ZXQ A;  4CWN A;  2E0A A;  3O6O A;  2EXL A;  4KTN A;  4AWQ A;  3CWV A;  4EFU A;  4LWH A;  3GIG B;  3WQ9 A;  4LWE A;  1AJ6 A;  1GJV A;  2YEC A;  1GKZ A;  1YSR A;  1TBW A;  4XCJ A;  4L90 A;  2VCI A;  3Q5K A;  2YE4 A;  2YE8 A;  5IDJ A;  4YKZ A;  4LPB A;  1UYC A;  1Y4U A;  2CCT A;  4GQT A;  4MOT A;  5CTU A;  2CGF A;  4R1F A;  4MB9 A;  4AWO A;  4JQL A;  2C2A A;  3TUH A;  3PEH A;  2YK9 A;  4MPC A;  3A0Y A;  4EGH A;  3EHF A;  2YI6 A;  1AM1 A;  2XX2 A;  3R91 A;  1OSF A;  4URM A;  4U93 A;  4FCQ A;  1UY7 A;  1A4H A;  1US7 A;  4XDM A;  1I5C A;  2YE9 A;  3CGZ A;  2XJX A;  2YKI A;  4MBC A;  5D6Q A;  4EGI A;  2XHT A;  2YKC A;  1QYE A;  4DUH A;  3K98 A;  4E01 A;  3EKO A;  3EHJ A;  4FCR A;  2WI3 A;  5IDM A;  4EEH A;  4LWF A;  2YK2 A;  2YED A;  3ZXO A;  2ZDY A;  3TZ2 A;  4O09 A;  2AKP A;  2BSM A;  3HYZ A;  2ZBK B;  4CWQ A;  4U7O A;  2XD6 A;  2YEE A;  2PNR A;  1YET A;  1NHI A;  2BT0 A;  4MP7 A;  3MNR P;  1YT1 A;  1ZXN A;  1L0O A;  3R4N A;  3A0Z A;  3EKR A;  3TZ4 A;  2YEA A;  1EA6 A;  1Z5C A;  3CRK A;  4BXI A;  5FWK A;  1I5D A;  2ZKJ A;  3RLR A;  3K60 A;  1YT2 A;  2YKE A;  2YI7 A;  4CWO A;  2O1W A;  4HYM A;  4L91 A;  4WUC A;  3HZ5 A;  1UYI A;  1QY8 A;  1UYH A;  2XDS A;  1Y8O A;  4P7A A;  3BMY A;  4FCP A;  2IWX A;  4PU9 A;  4YKT A;  4QPJ A;  3SL2 A;  3FT5 A;  2BYH A;  1ZW9 A;  2YEG A;  3NMQ A;  3T10 A;  1B3Q A;  2YE7 A;  4KQV A;  3TZ0 A;  1H7S A;  3OMU A;  2YE3 A;  5D6P A;  5CPH A;  4LP0 A;  5D7R A;  3D36 A;  2FWZ A;  4KSH A;  3EHH A;  4HXW A;  4AWP A;  4CE1 A;  1ID0 A;  2YKB A;  1B63 A;  4XTJ A;  2YKJ A;  4AS9 A;  4U7N A;  1TIL A;  2XCM A;  2CH4 A;  4NH8 A;  2YE6 A;  4P8O A;  4LWI A;  4MPN A;  2VW5 A;  3LNU A;  2YGA A;  3O0I A;  4CWP A;  3TTZ A;  4XIT A;  4L94 A;  3H4L A;  2GQP A;  4EFT A;  3ZKB A;  4HZ0 A;  1EI1 A;  3CGY A;  2O1U A;  4R3A A;  4Q20 A;  4XKA A;  1I5A A;  4GT8 A;  4EM7 A;  5FND A;  1UYK A;  2YGF A;  4URO A;  2Q8H A;  1GKX A;  3T1K A;  1YC4 A;  4JAV A;  2YE5 A;  4FPP A;  4GGL A;  1Z59 A;  3HYY A;  3TZ5 A;  3EHG A;  3K99 A;  3OWD A;  2XDX A;  5FNF A;  5M4M A;  2XDK A;  1UYD A;  1BGQ A;  2YEB A;  4PRX A;  4GEE A;  4EMV A;  3RLP A;  5J6A A;  2BU7 A;  2IOQ A;  3QTF A;  3HZ1 A;  4O0B A;  3Q5L A;  2BYI A;  3GIF A;  4R3M A;  4XE2 A;  3K97 A;  3O2F A;  5M4E A;  3A0R A;  4NH9 A;  2YGE A;  4O04 A;  2VCJ A;  2XHR A;  2Q8G A;  3U2D A;  3LPS A;  3G75 A;  2QF6 A;  1NHJ A;  1YER A;  4WUD A;  2BU5 A;  2YEI A;  4YKU A;  3D0B A;  2XK2 A;  3A0X A;  3D2R A;  4W7T A;  4XIQ A;  3C11 A;  5L3J A;  4MPE A;  3R92 A;  1BXD A;  4YKW A;  4XIP A;  1UYE A;  4B7P A;  4URN A;  2WEP A;  2XX4 A;  2BZ5 A; 
#chains in the Genus database with same CATH topology
 3B26 A;  5CTW A;  4BQG A;  4NH7 A;  1QZR A;  3ZM7 A;  1Y8P A;  2HG1 A;  1MX0 A;  1I5B A;  4HYP A;  4O07 A;  3GIE A;  3R4M A;  4E02 A;  4BIU A;  1PVG A;  2BTZ A;  4ASG A;  4EGK A;  1KZN A;  3B28 A;  3FV5 A;  4XC0 A;  2BRE A;  2WER A;  1Y4S A;  4ZKI A;  4BIZ A;  4QPK A;  2YJX A;  2XDU A;  1R62 A;  4YKY A;  4L93 A;  1YT0 A;  5F5R A;  1TC0 A;  4ZVI A;  3OWB A;  3VHD A;  1ZXM A;  5IN9 A;  3GIG A;  2IOP A;  2CG9 A;  2Q2E B;  3HHU A;  1TC6 A;  2BU2 A;  5BOD A;  3PEJ A;  1Y8N A;  4YKX A;  5CF0 A;  2BU8 A;  3T2S A;  2C1G A;  2HKJ A;  2QG0 A;  1BYQ A;  2ESA A;  3JZ3 A;  3IED A;  1JM6 A;  1UYM A;  4XD8 A;  1UY6 A;  4KP4 A;  2XHX A;  2Q8I A;  4CWR A;  3VAD A;  1UYF A;  5C93 A;  3B24 A;  3B25 A;  4XIR A;  4CE2 A;  2UWD A;  4V25 A;  4ASB A;  2WI5 A;  2YEH A;  2IWS A;  2YE2 A;  2YEJ A;  3ZKD A;  3DGE A;  2CCU A;  2XJJ A;  2YI0 A;  3C0E A;  3BM9 A;  3Q5J A;  1YC1 A;  2FYP A;  3A0T A;  3RKZ A;  4I3H A;  1YC3 A;  4URL A;  4KSG A;  4O05 A;  3U67 A;  4V26 A;  1I58 A;  5D7C A;  3R4P A;  1BKN A;  1H7U A;  4CE3 A;  5M4K A;  5CTY A;  4E00 A;  4DZY A;  2H8M A;  3A0W A;  3OPD A;  2YJW A;  1ZWH A;  1B62 A;  1YSZ A;  2O1V A;  2WI7 A;  4HZ5 A;  5F3K A;  1F51 A;  1TH8 A;  1YES A;  4YKQ A;  2WI2 A;  1S16 A;  2CCS A;  4MP2 A;  4KFG A;  1I59 A;  2WI1 A;  2WI6 A;  4ASA A;  1Z5B A;  2QFO A;  5M4N A;  2XAB A;  2C1I A;  1KIJ A;  2FXS A;  2XJG A;  1UYG A;  2QG2 A;  3QDD A;  4JAU A;  4K4O A;  1MU5 A;  3HEK A;  2FWY A;  3T0H A;  3VHC A;  1UYL A;  2JKI A;  1U2O A;  4I5S A;  4PRV A;  2YEF A;  4BAE A;  3OW6 A;  3CRL A;  4H85 A;  4YKR A;  2BRC A;  2IOR A;  5M4H A;  2JJC A;  3KE6 A;  4XKK A;  4XCL A;  3G7B A;  4XKO A;  3H80 A;  3INW A;  3VHA A;  1NHH A;  4B6C A;  4HXZ A;  1AH6 A;  4CWS A;  2WEQ A;  1AH8 A;  2XX5 A;  3U2K A;  5CTX A;  4HY1 A;  5J71 A;  1YS3 A;  1Z5A A;  4GCZ A;  4WUB A;  3T0Z A;  2K5B A;  1TID A;  2HCH A;  3B27 A;  5D7D A;  3R4O A;  5M4P A;  4BQJ A;  2WI4 A;  5FNC A;  4H7Q A;  4ASF A;  2XDL A;  2Q8F A;  1AMW A;  4X9L A;  4CWT A;  3FT8 A;  1S14 A;  1U0Z A;  4FMT A;  1THN A;  2H55 A;  5GGZ A;  2ZDX A;  4CWF A;  2IWU A;  2FTK A;  2VWC A;  3WHA A;  4L8Z A;  4GFN A;  3RLQ A;  4PL9 A;  4HY6 A;  2GFD A;  5BOC A;  2BU6 A;  1UY9 A;  4LWG A;  4E72 A;  2YI5 A;  1UY8 A;  4JAS A;  4H81 A;  3INX A;  3G7E A;  3ZXQ A;  4CWN A;  2E0A A;  3O6O A;  2EXL A;  4KTN A;  4AWQ A;  3CWV A;  4EFU A;  4LWH A;  3GIG B;  3WQ9 A;  4LWE A;  1AJ6 A;  1GJV A;  2YEC A;  1GKZ A;  1YSR A;  1TBW A;  4XCJ A;  4L90 A;  2VCI A;  3Q5K A;  2YE4 A;  2YE8 A;  5IDJ A;  4YKZ A;  4LPB A;  1UYC A;  1Y4U A;  2CCT A;  4GQT A;  4MOT A;  5CTU A;  2CGF A;  4R1F A;  4MB9 A;  4AWO A;  4JQL A;  2C2A A;  3TUH A;  3PEH A;  2YK9 A;  4MPC A;  3A0Y A;  4EGH A;  3EHF A;  2YI6 A;  1AM1 A;  2XX2 A;  3R91 A;  1OSF A;  4URM A;  4U93 A;  4FCQ A;  1UY7 A;  1A4H A;  1US7 A;  4XDM A;  1I5C A;  2YE9 A;  3CGZ A;  2XJX A;  2YKI A;  4MBC A;  5D6Q A;  4EGI A;  2XHT A;  2YKC A;  1QYE A;  4DUH A;  3K98 A;  4E01 A;  3EKO A;  3EHJ A;  4FCR A;  2WI3 A;  5IDM A;  4EEH A;  4LWF A;  2YK2 A;  2YED A;  3ZXO A;  2ZDY A;  3TZ2 A;  4O09 A;  2AKP A;  2BSM A;  3HYZ A;  2ZBK B;  4CWQ A;  4U7O A;  2XD6 A;  2YEE A;  2PNR A;  1YET A;  1NHI A;  2BT0 A;  4MP7 A;  3MNR P;  1YT1 A;  1ZXN A;  1L0O A;  3R4N A;  3A0Z A;  3EKR A;  3TZ4 A;  2YEA A;  1EA6 A;  1Z5C A;  3CRK A;  4BXI A;  5FWK A;  1I5D A;  2ZKJ A;  3RLR A;  3K60 A;  1YT2 A;  2YKE A;  2YI7 A;  4CWO A;  2O1W A;  4HYM A;  4L91 A;  4WUC A;  3HZ5 A;  1UYI A;  1QY8 A;  1UYH A;  2XDS A;  1Y8O A;  4P7A A;  3BMY A;  4FCP A;  2IWX A;  4PU9 A;  4YKT A;  4QPJ A;  3SL2 A;  3FT5 A;  2BYH A;  1ZW9 A;  2YEG A;  3NMQ A;  3T10 A;  1B3Q A;  4KQV A;  2YE7 A;  3TZ0 A;  3CYG A;  1H7S A;  3OMU A;  2YE3 A;  5D6P A;  5CPH A;  4LP0 A;  5D7R A;  3D36 A;  2FWZ A;  4KSH A;  3EHH A;  4HXW A;  4AWP A;  4CE1 A;  1ID0 A;  2YKB A;  1B63 A;  4XTJ A;  2YKJ A;  4AS9 A;  4U7N A;  1TIL A;  2XCM A;  1IXM A;  2CH4 A;  4NH8 A;  2YE6 A;  4P8O A;  4LWI A;  5JEN A;  4MPN A;  2VW5 A;  3LNU A;  2YGA A;  3O0I A;  4CWP A;  3TTZ A;  4XIT A;  4L94 A;  3H4L A;  2GQP A;  4EFT A;  3ZKB A;  4HZ0 A;  2HHI A;  1EI1 A;  3CGY A;  2O1U A;  4R3A A;  4Q20 A;  4XKA A;  1I5A A;  4GT8 A;  4EM7 A;  5FND A;  1UYK A;  2YGF A;  4URO A;  2Q8H A;  1GKX A;  3T1K A;  1YC4 A;  4JAV A;  3S5T A;  2YE5 A;  4FPP A;  4GGL A;  1Z59 A;  3HYY A;  3TZ5 A;  3EHG A;  3K99 A;  3LMM A;  3OWD A;  2XDX A;  5FNF A;  5M4M A;  2XDK A;  1UYD A;  1BGQ A;  2YEB A;  4PRX A;  4GEE A;  4EMV A;  3RLP A;  5J6A A;  2BU7 A;  2IOQ A;  3QTF A;  3HZ1 A;  4O0B A;  3Q5L A;  2BYI A;  3GIF A;  4R3M A;  4XE2 A;  3K97 A;  3O2F A;  5M4E A;  3A0R A;  4NH9 A;  2YGE A;  4O04 A;  2VCJ A;  2XHR A;  2Q8G A;  3U2D A;  3LPS A;  3G75 A;  2QF6 A;  1NHJ A;  1YER A;  4WUD A;  2BU5 A;  2YEI A;  4YKU A;  3D0B A;  2XK2 A;  3A0X A;  3D2R A;  4W7T A;  4XIQ A;  3C11 A;  5L3J A;  4MPE A;  3R92 A;  1BXD A;  4YKW A;  4XIP A;  1UYE A;  4B7P A;  4URN A;  2WEP A;  2XX4 A;  2BZ5 A; 
#chains in the Genus database with same CATH homology
 3B26 A;  5CTW A;  4BQG A;  4NH7 A;  1QZR A;  3ZM7 A;  1Y8P A;  2HG1 A;  1MX0 A;  1I5B A;  4HYP A;  4O07 A;  3GIE A;  3R4M A;  4E02 A;  4BIU A;  1PVG A;  2BTZ A;  4ASG A;  4EGK A;  1KZN A;  3B28 A;  3FV5 A;  4XC0 A;  2BRE A;  2WER A;  1Y4S A;  4ZKI A;  4BIZ A;  4QPK A;  2YJX A;  2XDU A;  1R62 A;  4YKY A;  4L93 A;  1YT0 A;  5F5R A;  1TC0 A;  4ZVI A;  3OWB A;  3VHD A;  1ZXM A;  5IN9 A;  3GIG A;  2IOP A;  2CG9 A;  2Q2E B;  3HHU A;  1TC6 A;  2BU2 A;  5BOD A;  3PEJ A;  1Y8N A;  4YKX A;  5CF0 A;  2BU8 A;  3T2S A;  2HKJ A;  2QG0 A;  1BYQ A;  2ESA A;  3JZ3 A;  3IED A;  1JM6 A;  1UYM A;  4XD8 A;  1UY6 A;  4KP4 A;  2XHX A;  2Q8I A;  4CWR A;  3VAD A;  1UYF A;  5C93 A;  3B24 A;  3B25 A;  4XIR A;  4CE2 A;  2UWD A;  4V25 A;  4ASB A;  2WI5 A;  2YEH A;  2IWS A;  2YE2 A;  2YEJ A;  3ZKD A;  3DGE A;  2CCU A;  2XJJ A;  2YI0 A;  3C0E A;  3BM9 A;  3Q5J A;  1YC1 A;  2FYP A;  3A0T A;  3RKZ A;  4I3H A;  1YC3 A;  4URL A;  4KSG A;  4O05 A;  3U67 A;  4V26 A;  1I58 A;  5D7C A;  3R4P A;  1BKN A;  1H7U A;  4CE3 A;  5M4K A;  5CTY A;  4E00 A;  4DZY A;  2H8M A;  3A0W A;  3OPD A;  2YJW A;  1ZWH A;  1B62 A;  1YSZ A;  2O1V A;  2WI7 A;  4HZ5 A;  5F3K A;  1TH8 A;  1YES A;  4YKQ A;  2WI2 A;  1S16 A;  2CCS A;  4MP2 A;  4KFG A;  1I59 A;  2WI1 A;  2WI6 A;  4ASA A;  1Z5B A;  2QFO A;  5M4N A;  2XAB A;  1KIJ A;  2FXS A;  2XJG A;  1UYG A;  2QG2 A;  3QDD A;  4JAU A;  4K4O A;  1MU5 A;  3HEK A;  2FWY A;  3T0H A;  3VHC A;  1UYL A;  2JKI A;  1U2O A;  4I5S A;  4PRV A;  2YEF A;  4BAE A;  3OW6 A;  3CRL A;  4H85 A;  4YKR A;  2BRC A;  2IOR A;  5M4H A;  2JJC A;  3KE6 A;  4XKK A;  4XCL A;  3G7B A;  4XKO A;  3H80 A;  3INW A;  3VHA A;  1NHH A;  4B6C A;  4HXZ A;  1AH6 A;  4CWS A;  2WEQ A;  1AH8 A;  2XX5 A;  3U2K A;  5CTX A;  4HY1 A;  5J71 A;  1YS3 A;  1Z5A A;  4GCZ A;  4WUB A;  3T0Z A;  2K5B A;  1TID A;  2HCH A;  3B27 A;  5D7D A;  3R4O A;  5M4P A;  4BQJ A;  2WI4 A;  5FNC A;  4H7Q A;  4ASF A;  2XDL A;  2Q8F A;  1AMW A;  4X9L A;  4CWT A;  3FT8 A;  1S14 A;  1U0Z A;  4FMT A;  1THN A;  2H55 A;  5GGZ A;  2ZDX A;  4CWF A;  2IWU A;  2VWC A;  3WHA A;  4L8Z A;  4GFN A;  3RLQ A;  4PL9 A;  4HY6 A;  2GFD A;  5BOC A;  2BU6 A;  1UY9 A;  4LWG A;  2YI5 A;  1UY8 A;  4JAS A;  4H81 A;  3INX A;  3G7E A;  3ZXQ A;  4CWN A;  2E0A A;  3O6O A;  2EXL A;  4KTN A;  4AWQ A;  3CWV A;  4EFU A;  4LWH A;  3GIG B;  3WQ9 A;  4LWE A;  1AJ6 A;  1GJV A;  2YEC A;  1GKZ A;  1YSR A;  1TBW A;  4XCJ A;  4L90 A;  2VCI A;  3Q5K A;  2YE4 A;  2YE8 A;  5IDJ A;  4YKZ A;  4LPB A;  1UYC A;  1Y4U A;  2CCT A;  4GQT A;  4MOT A;  5CTU A;  2CGF A;  4R1F A;  4MB9 A;  4AWO A;  4JQL A;  2C2A A;  3TUH A;  3PEH A;  2YK9 A;  4MPC A;  3A0Y A;  4EGH A;  3EHF A;  2YI6 A;  1AM1 A;  2XX2 A;  3R91 A;  1OSF A;  4URM A;  4U93 A;  4FCQ A;  1UY7 A;  1A4H A;  1US7 A;  4XDM A;  1I5C A;  2YE9 A;  3CGZ A;  2XJX A;  2YKI A;  4MBC A;  5D6Q A;  4EGI A;  2XHT A;  2YKC A;  1QYE A;  4DUH A;  3K98 A;  4E01 A;  3EKO A;  3EHJ A;  4FCR A;  2WI3 A;  5IDM A;  4EEH A;  4LWF A;  2YK2 A;  2YED A;  3ZXO A;  2ZDY A;  3TZ2 A;  4O09 A;  2AKP A;  2BSM A;  3HYZ A;  2ZBK B;  4CWQ A;  4U7O A;  2XD6 A;  2YEE A;  2PNR A;  1YET A;  1NHI A;  2BT0 A;  4MP7 A;  3MNR P;  1YT1 A;  1ZXN A;  1L0O A;  3R4N A;  3A0Z A;  3EKR A;  3TZ4 A;  2YEA A;  1EA6 A;  1Z5C A;  3CRK A;  4BXI A;  5FWK A;  1I5D A;  2ZKJ A;  3RLR A;  3K60 A;  1YT2 A;  2YKE A;  2YI7 A;  4CWO A;  2O1W A;  4HYM A;  4L91 A;  4WUC A;  3HZ5 A;  1UYI A;  1QY8 A;  1UYH A;  2XDS A;  1Y8O A;  4P7A A;  3BMY A;  4FCP A;  2IWX A;  4PU9 A;  4YKT A;  4QPJ A;  3SL2 A;  3FT5 A;  2BYH A;  1ZW9 A;  2YEG A;  3NMQ A;  3T10 A;  1B3Q A;  2YE7 A;  4KQV A;  3TZ0 A;  1H7S A;  3OMU A;  2YE3 A;  5D6P A;  5CPH A;  4LP0 A;  5D7R A;  3D36 A;  2FWZ A;  4KSH A;  3EHH A;  4HXW A;  4AWP A;  4CE1 A;  1ID0 A;  2YKB A;  1B63 A;  4XTJ A;  2YKJ A;  4AS9 A;  4U7N A;  1TIL A;  2XCM A;  2CH4 A;  4NH8 A;  2YE6 A;  4P8O A;  4LWI A;  4MPN A;  2VW5 A;  3LNU A;  2YGA A;  3O0I A;  4CWP A;  3TTZ A;  4XIT A;  4L94 A;  3H4L A;  2GQP A;  4EFT A;  3ZKB A;  4HZ0 A;  1EI1 A;  3CGY A;  2O1U A;  4R3A A;  4Q20 A;  4XKA A;  1I5A A;  4GT8 A;  4EM7 A;  5FND A;  1UYK A;  2YGF A;  4URO A;  2Q8H A;  1GKX A;  3T1K A;  1YC4 A;  4JAV A;  2YE5 A;  4FPP A;  4GGL A;  1Z59 A;  3HYY A;  3TZ5 A;  3EHG A;  3K99 A;  3OWD A;  2XDX A;  5FNF A;  5M4M A;  2XDK A;  1UYD A;  1BGQ A;  2YEB A;  4PRX A;  4GEE A;  4EMV A;  3RLP A;  5J6A A;  2BU7 A;  2IOQ A;  3QTF A;  3HZ1 A;  4O0B A;  3Q5L A;  2BYI A;  3GIF A;  4R3M A;  4XE2 A;  3K97 A;  3O2F A;  5M4E A;  3A0R A;  4NH9 A;  2YGE A;  4O04 A;  2VCJ A;  2XHR A;  2Q8G A;  3U2D A;  3LPS A;  3G75 A;  2QF6 A;  1NHJ A;  1YER A;  4WUD A;  2BU5 A;  2YEI A;  4YKU A;  3D0B A;  2XK2 A;  3A0X A;  3D2R A;  4W7T A;  4XIQ A;  3C11 A;  5L3J A;  4MPE A;  3R92 A;  1BXD A;  4YKW A;  4XIP A;  1UYE A;  4B7P A;  4URN A;  2WEP A;  2XX4 A;  2BZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...