5IDJA

Bifunctional histidine kinase ccka (domains dhp-ca) in complex with adp/mg2+
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
242
structure length
242
Chain Sequence
LSQAQKMQAIGQLAGGVAHDFNNLLTAIQLRLDQLLHRHPVGDPSYEGLNEIRQTGVRAADLVRKLLAFSRKQTVQREVLDLGELISEFEVLLRRLLREDVKLITDYGRDLPQVRADKSQLETAVMNLAVNARDAVRAAKGGGVVRIRTARLTRDEAIQLGFPAADGDTAFIEVSDDGPGIPPDVMGKIFDPFFTTKPVGEGTGLGLATVYGIVKQSDGWIHVHSRPNEGAAFRIFLPVYEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic di-GMP mediates a histidine kinase/phosphatase switch by noncovalent domain cross-linking.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase
molecule keywords Cell cycle histidine kinase CckA
total genus 63
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5idjA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5idjA02
3HYYA 4L94A 4MTXA 3TZ5A 1ZXMA 4LWGA 4BQJA 1Z59A 2H8MA 4O07A 3A0YA 5F5RA 4GT1A 1YT0A 2YE6A 4R1FA 4URMA 1Y8NA 1YS3A 1BKNA 1BYQA 2BZ5A 4K4OA 4MP7A 2GQPA 4XTJA 2YI0A 4H81A 4JAUA 3U67A 5L3JA 5M4EA 2XABA 2WI7A 3RLPA 3TUHA 4AWQA 4WUCA 3QDDA 1UYLA 4FCPA 2BU7A 2YKBA 4ASBA 2YI7A 5D7RA 1UY7A 2FYPA 2WI1A 2YGFA 4NH9A 2XX5A 4ASFA 1YERA 2K5BA 5FNDA 1L0OA 2ESAA 4XIQA 4L93A 4XCJA 4URLA 4BQGA 2CCTA 2XDXA 2BYIA 3GIEA 3K60A 4L8ZA 4BIUA 3A0ZA 3RLQA 1I5AA 2IOQA 1TILA 3FT8A 2XK2A 3T10A 2YE7A 5M4PA 4XC0A 4MT8A 4FCRA 4XIRA 4U93A 4V25A 3SL2A 3R4MA 1AJ6A 3R91A 2YE4A 4LWIA 1NHIA 2YE3A 3MNRP 2FTKA 2VW5A 4CWPA 1I5CA 4PL9A 4CE3A 3OW6A 4JQLA 2Q8IA 1YC3A 4ASGA 1S16A 4I5SA 2WI2A 4JASA 4YKZA 3EHFA 3EHGA 4AWPA 4L90A 5D7DA 2O1WA 2XX4A 2WWWA 4V26A 2XHRA 2ZDXA 3CGZA 3HYZA 4WUBA 4PRXA 4YKTA 3A0RA 1YETA 4DZYA 1UYHA 3B27A 3EKOA 1B63A 3ZRXA 1UYKA 5CTXA 3O0IA 2YE5A 5CTUA 2EXLA 3K98A 2QF6A 3ZM7A 4CWOA 1Y8OA 2HG1A 2YKIA 1A4HA 3C11A 4XE2A 4URNA 1JM6A 5D7CA 4E02A 3JZ3A 1B62A 4KFGA 1TC6A 2IWUA 2BU2A 1AM1A 2IWSA 2XDKA 1US7A 4MOTA 1I58A 1B3QA 1H7UA 4HYPA 1BGQA 3O6OA 3FV5A 1KZNA 3EHHA 1AH6A 4UROA 4MBCA 4P8OA 4LWEA 2YE8A 3H4LA 3RKZA 4ZKIA 4KP4A 1UYCA 4KSGA 4HY6A 2BSMA 2O1UA 1QY8A 2WEPA 1UYDA 3HZ5A 2YEEA 5BOCA 5M4KA 2XX2A 5CTWA 4KSHA 3QTFA 5FNFA 4B6CA 1EA6A 4MPCA 2QG2A 4GQTA 4CE1A 1S14A 3T0HA 3R4PA 2BREA 2YJWA 4O05A 3OMUA 1THNA 1YT1A 4YKWA 5C93A 2Q8GA 1TC0A 2VCIA 4EFTA 1MX0A 5CPHA 2FWZA 5B1OA 4EMVA 1GKZA 3U2DA 4MP2A 2YEGA 1UYFA 1UY6A 3Q5LA 3NMQA 4YKYA 1TH8A 4EFUA 2YKJA 3ZXOA 3ZRWB 1UY8A 4ZVIA 2QM7A 4FCQA 4O09A 4DUHA 2CH4A 4GT8A 4XDMA 1U2OA 4LWHA 4PRVA 2BU8A 4XITA 2UWDA 3TTZA 1JOYA 4XIPA 2JKIA 2LFRA 1QZRA 3GIGA 2WI6A 3T0ZA 2YEDA 3C0EA 3ZRVA 4GEEA 1H7SA 5IDMA 5M4MA 5GGZA 4CWNA 4BXIA 2GFDA 3BMYA 2YGEA 2FWYA 1UYMA 5IDJA 4O04A 3HHUA 2VCJA 4LPBA 2XJJA 3P32A 2BU6A 4CWFA 3CWVA 4XD8A 3H80A 4R3MA 4KQVA 1GKXA 4CE2A 3A0XA 2YE2A 5M4HA 2YKEA 3OPDA 5IN9A 3GIGB 3LPSA 2WI3A 3CRKA 3INXA 3HEKA 2YKCA 2XDSA 3B28A 4WUDA 2BT0A 2QG0A 2H55A 2CCSA 5D6PA 3TK1A 3B26A 3VHCA 4GCZA 2QM8A 2Q2EB 3ZRWA 2VWCA 4XKAA 1YSZA 2YGAA 3K97A 4I3HA 4BAEA 2O1VA 3ZXQA 4U7NA 4HXWA 1EI1A 2CCUA 3IEDA 1UYEA 3R4NA 2YK2A 1KIJA 3DGEA 2E0AA 1YC4A 4NH7A 1F51A 1NHHA 4HZ5A 3A0WA 3O2FA 3WQ9A 4EGKA 5M4NA 2AKPA 1Z5AA 2YI5A 4E00A 4LP0A 4JYBA 3WHAA 1QYEA 2BTZA 4R3AA 3D36A 3OWBA 2XDUA 4YKRA 2YECA 3A0TA 3T1KA 3GIFA 4MB9A 3ZKBA 3MD0A 2BRCA 1Z5CA 2YEIA 2IOPA 4BIZA 5B1NA 2YI6A 3TZ0A 4JAVA 2CGFA 2YEJA 3G75A 4HYMA 1UYIA 2YEBA 1ZWHA 2WEQA 1ZXNA 1BXDA 4XKOA 4CWSA 3Q5KA 2C2AA 4EGHA 5J71A 3BM9A 3PEJA 2YEHA 3T2SA 1NHJA 2HKJA 3TZ4A 4CWQA 1Y4SA 1YC1A 2XCMA 5CF0A 2XHXA 4CWRA 4PU9A 3D2RA 1GJVA 3EKRA 5J6AA 2XD6A 4LWFA 4W7TA 4HY1A 2XJGA 3OWDA 2YEFA 4QPKA 2Q8HA 1I5DA 1OSFA 4X9LA 1Y8PA 2FXSA 2YEAA 2QFOA 3EHJA 4L91A 3K99A 1Y4UA 3LNUA 3R92A 4QPJA 2WERA 3HZ1A 4B7PA 4O0BA 4FPPA 3CRLA 4YKQA 2ZKJA 3TZ2A 4H85A 3D0BA 3ZKDA 3PEHA 4E01A 2JJCA 2XDLA 4ASAA 3INWA 3G7EA 4MPEA 2YJXA 1U0ZA 3ZCCA 1UY9A 2ZDYA 1YESA 4AWOA 3B24A 4KTNA 3G7BA 4FMTA 1I5BA 2HCHA 3B25A 1YT2A 2YE9A 1ZW9A 3U2KA 2BU5A 4P7AA 5BODA 2BYHA 4GGLA 2P67A 4NH8A 3VADA 2CG9A 3CGYA 4YKXA 4LC1A 4XCLA 3FT5A 5CTYA 2WI5A 4HZ0A 4CWTA 1IXMA 1UYGA 5D6QA 3KE6A 4EEHA 4JYCA 1ID0A 1TIDA 2IWXA 5F3KA 4U7OA 4AS9A 2Q8FA 4EM7A 3R4OA 2YK9A 5FWKA 3RLRA 4Q20A 4YKUA 1Z5BA 2LFSA 1TBWA 4EGIA 3NXSA 2ZBKB 3VHDA 1MU5A 1R62A 1AH8A 4XKKA 1I59A 3Q5JA 2XHTA 4MPNA 2IORA 2XJXA 4GFNA 1AMWA 4HXZA 1PVGA 2PNRA 4H7QA 5FNCA 3VHAA 2WI4A 1YSRA
chains in the Genus database with same CATH superfamily
3ZMSA 3IFXA 3MAQA 2LW7A 5B5EZ 3TZ5A 4DV7O 2D3OW 4LFAB 5F5RA 1AILA 3ZX6A 5IWAO 1VQ8V 5EK0A 1XQ8A 1Y8NA 3AG4B 4OGQB 1XMOB 1YS3A 4K4OA 1QR8A 4JTCB 1NR7A 2LGWA 2QA4V 5DN6G 1I0HA 4BAYA 1K5SA 2ZDIC 5GTIZ 4ZHQA 2BCCH 4JYAB 2WI7A 3KZIZ 3FX7A 4H37A 3TUHA 1OCRC 4WUCA 1ENVA 2UUCO 3QDDA 4FCPA 4TV8A 5ITZB 2BU7A 2N74A 5IJ9B 1VF7A 3IC7A 1YI2V 1VF5B 5FNDA 4I0XA 5J9PC 4URLA 4BQGA 3FKSG 1PPJH 1DGSA 1VQ7V 3IGAC 1R6NA 2AZ2A 3BRCA 5JQGB 4H0LB 1R3LC 3T10A 5A2QN 4X64B 4MTOA 1OCZC 4MT8A 3H1KH 2WSSG 4U93A 2FL4A 4H33A 1AJ6A 4DV1O 1K9MW 3MNRP 1H2KA 5AG2A 3G80A 1I5CA 4PL9A 1XI1A 3OW6A 3OTOO 3P30A 4JQLA 1SQVH 2Q8IA 1OV9A 3UM7A 4ASGA 4ICGA 4BW5A 1S16A 2VRZA 4JGSA 1XHZA 4DR1B 3SGIA 1Y74B 4O2BA 1YJ9V 2OTJV 5D7DA 3CCJV 4I9WA 3HKCA 2ZDXA 3HYZA 4WUBA 1E79G 2W0FC 4EEQA 3AG1B 1YETA 2QKCA 3M99B 2K9PA 3JARB 4I4TA 3E22A 3ZRXA 2DYSC 2YS8A 1J5EO 2DJVA 1UYKA 3O0IA 3B2EE 4JI1B 3SYQA 3ZRSA 5KA6A 1MA1A 4CWOA 1Y8OA 2HG1A 1ZSPA 4DR7O 5LP6C 1A4HA 4XE2A 3WB0A 1SRYA 4X1YA 4O2BB 1JM6A 2IW5A 4E02A 2ZR3A 3K08A 1Q82W 1TC6A 4IT5A 3OEHG 1M57C 1JR9A 1O9GA 4YJ3B 5BMVB 1K3EA 4UCUA 1BGQA 3HKBA 2F66C 4P8OA 2ZINA 3RKZA 4LWSB 3EFFK 1XNRB 2XAJA 4KSGA 3D36C 4B7EA 4B3MO 2O1UA 1K73W 3JAWB 4WFAV 1QY8A 1K97A 1ZLZA 4R50A 1W0KG 3FB5C 4CH5A 5M4KA 4X9QA 4O4IB 4DR6O 3QTFA 1AI5A 2GTSA 4CZZA 1NTZH 4MPCA 4ZI7A 1TUBA 3JCZA 1THNA 5F2VO 3K5NA 5LOVB 1YCIA 4L8JA 2OT5A 3H1JH 3ABLB 3E89A 3U10A 4O4HB 4UXNA 1NU1H 5BR8O 2VCIA 1I08A 4DV6O 4E72A 5B3SC 5D5QA 2X0LA 3R66A 2YI9A 5B1OA 2DWEC 1D5AA 1NBMG 3FYEB 3W7XA 2ZCEA 3K0DA 5L3GA 4MP2A 4YY3O 4YKYA 3CC4V 4F6RB 2YKJA 1H2MA 4ZVIA 3CB2A 3RW0A 2QM7A 3J80N 2FYUH 3ZHVA 1M1KW 2CH4A 3G4SV 1Q81W 1L1FA 1NI8A 4LWHA 4PRVA 2UWDA 3SR2C 2Z0AA 2LGQA 2GUZB 2JKIA 3CCVV 1SQBH 5FNVA 2EILB 2LFRA 3E2EA 3OUSA 3GIGA 4DR5O 4F6RA 2ZDIA 3K58A 3T0ZA 3C0EA 1N36O 2DOSA 1UJWB 1H7SA 1KQSU 2ZD9A 4OX9O 4DUZB 4BXIA 5JJEB 3L71H 1UYMA 2E74B 1ROPA 3B4SA 3BY6A 1YZBA 5KHHA 3L72H 3P32A 2EINB 3H80A 4R3MA 4FM1A 4KQVA 1H38A 4DUYB 1NH2B 2YEVA 4JTDB 4YIPA 4D7TA 5EC1C 4LBEC 1QVGU 2YDEA 3C3SA 4MVOA 4OXSA 3GIGB 1OJHA 1YITV 4WBNA 5GW7A 3INXA 1Y66A 3CCQV 3B28A 2CE4A 2QG0A 2H55A 4Z1MG 1IVSA 2LW1A 3TK1A 4NVPA 4GCZA 3OT7A 2QM8A 2Q2EB 3CCSV 3ZRWA 2FB5A 1AROP 2LJ2A 1K7DA 1ZWIC 3ZXQA 4X62O 1HNWB 1AI7A 4FLYA 4OPAA 3R4NA 3OTOB 1KP2A 2YK2A 3BA8A 3ASOC 1KIJA 2X7RB 3DGEA 4JZ2A 3CE2A 1YC4A 4NH7A 1F51A 1NJIW 3O2FA 3E8GA 3IJ4A 1L0LH 1SC5B 2R9RB 4XBFA 4E00A 5L3DA 1VEWA 2XTAA 5B66Z 1JJOA 4RUFA 3ZN0A 4DK1A 2CAZC 3SDLA 3OWBA 1YVWA 2XDUA 1V55C 3A0TA 3T1KA 3B8MA 2Z5UA 1I7FA 2UXXA 1J5EB 4F6EA 4PA9A 2YEIA 4XDKA 4IGGA 4F4LA 1HWYA 2CGFA 4GKKO 3APOA 2YEJA 4HZ3A 3ZN1A 5DECA 1BXDA 3G71V 5JCOA 3Q5KA 4CWSA 4DV7B 1HR0B 2WLLA 5J71A 5K1XA 2NLJC 1NHJA 5LYJB 4CWQA 1DTOA 5L3CA 1YC1A 1BT8A 5EC2C 4MW3A 2XHXA 4O2AA 3RYFA 3UO2A 4DR2B 3LMMA 1IX9A 2JRIA 3D2RA 2DE0X 1HNXB 4B3RB 5LGNA 2XD6A 3CCEV 2KSDA 4W7TA 4GX5A 2XASA 3LUTB 4JAAA 2WLLB 4X9LA 1GM7A 2V1DA 1Y8PA 2JJ2G 3EHJA 4JI4B 1KKDA 1Y4UA 5JWPA 1XDCA 2OIEA 5LYJA 3ASNB 1XMQB 2WERA 3HZ1A 4B7PA 3CRLA 4IIJB 4UCRA 2A79B 4O2AB 1FXHA 3RYFB 4H85A 3PEHA 4W4LA 2XDLA 3ASNC 3E35A 2YJXA 3W7UA 1U0ZA 2CH7A 1YESA 3B24A 3H1LH 2E3CA 4MW8A 2EIKB 2YE9A 1FPOA 1J95A 5GONA 5KX5B 5BODA 2P67A 3A0HZ 1VMGA 1ORQC 5FPRA 1XL6A 2HJFC 1ZTEA 2CG9A 2PGGA 4YKXA 4LC1A 3FT5A 3FB8C 4HZ0A 4CWTA 1IXMA 4K8ZA 3W7TA 4FK5C 4EEHA 1M5IA 2JS5A 5IYBO 5F3KA 2EX3A 4U7OA 5J2TA 4O4LA 4EM7A 1PNKA 3R4OA 2YK9A 5EBMC 3RLRA 3RYCA 4YKUA 1SA0A 4JYYA 1K92A 4LCUC 3RYHB 5CA1A 1Z5BA 1GN2A 1TBWA 4PDVA 4LFBO 4EKWA 2ZBKB 5DEDA 4JI5B 3VHDA 2QGNA 5JENA 4UB6Z 3ABKB 4DUZO 4OX9B 3VQYA 3GWKC 1R6KA 1I59A 2AZ0A 2IORA 4LFCO 3E83A 4LP8A 2PNRA 4CH6A 3ZS8C 4I9QA 5KMGB 2GBOA 4ABMA 3Q4HA 4GX0A 1YSRA 3CRQA 4FM0A 1B04A 1R3KC 5H5NA 4LWGA 5JJJB 5LP6A 1Z59A 2H8MA 4PELA 2JGUA 4O07A 3A0YA 1NVPB 5A9GA 1YT0A 2PYJA 2YE6A 1FJGB 4J9YB 4URMA 1BYQA 3K5OA 4IHJB 4J11A 3RGBA 4PV1B 2KG7A 2GQPA 1Y74A 2E76B 2GSMB 4JAUA 2ITDC 3K5MA 2QWOB 3KCXA 3U67A 1BQZA 5L3JA 2HEPA 5IE9A 4J7ZA 2UXDB 1AJNA 4DR6B 3RLPA 3TXQA 4GLXA 2ZE8A 4FIPC 4AILC 4LF5O 3JARA 3H01A 4I4TB 2YKBA 2OWOA 1UY7A 2FYPA 1FD9A 1N34B 2Q69A 3K57A 1NS1A 1YERA 1L0OA 4XIQA 4L93A 4XCJA 4IHJA 2XDXA 3UT5A 2BYIA 3GIEA 4DV6B 1P84F 3K60A 4UCSA 4N23A 5JH7B 4DV5B 3RLQA 2BSKA 3K79A 3I55V 4G28B 3WB2A 1TILA 2XK2A 5M4PA 2ITCC 2YIBA 1AP6A 3HKBB 4K3AA 4XIRA 1VQKV 1Q86W 2ZNJA 2PY5A 2WAMA 4JI0O 3VOUA 3EHBB 1KBHA 1M93A 4GUNA 3WG7B 3UT5B 4CE3A 1WA8A 3B40A 2VQEO 1GN4A 3CRAA 4DYLA 1YC3A 2GV9A 2FMLA 1IZ3A 3L9DA 1IXBA 4I5SA 2CTWA 2HHIA 2ZE7A 2WI2A 4X1KA 3AG7A 3U11A 4DR5B 4WFFA 1W0JG 2V7QG 1EN6A 3CXHF 4MVRA 4L90A 4FZ1A 2PUSA 4MVZA 4ZHQB 3GVMA 2KKWA 3CGZA 2CTQA 3RYIA 4YKTA 4X64O 3A0RA 4OPHA 2BTQB 4TSFG 5IJ9A 5J2UB 1P49A 4JI4O 3DXRB 5CTUA 1GMGA 4FZ0A 4JI7O 2QF6A 1Z2GA 3DSQA 2AXTZ 1A32A 5LL6Y 4URNA 3E8FA 2CGOA 5LGTA 1Q5OA 1QVFU 2XAQA 1B62A 4J7JA 1AM1A 1D2DA 2JGDA 2HVJC 3O6OA 1KZNA 1AH6A 4UROA 1CPYA 3ETQA 3OGCC 1YJNV 4MBCA 4ZKIA 5BY1A 2F1MA 3IC9A 4HNAB 3QF7A 2ODMA 1EM1A 4NTYA 2WEPA 2GTAA 1F7YA 3HKDA 2Y4TA 1ZAUA 5BOCA 1WB7A 3JAKA 5CTWA 1BL8A 1QLNA 4DV0O 2ZIMA 4B6CA 4JI1O 2XT9A 5JVDA 4B08A 1S14A 3T0HA 1QBZA 2Q9LA 3E8BA 3HKCB 4YKWA 1E1QG 3CS5A 1NT2B 2UUAO 5D5PA 1F4NA 4EFTA 3AG2B 1OZ0A 2FWZA 2YXLA 1TGOA 4I7ZB 3JAKB 4O4JA 2YIAA 2IJHA 3QNEA 3AG1C 4J9ZB 3U2DA 2YEGA 5LXTB 2DYSB 1TH8A 1HR0O 4EFUA 4GZRB 4CH4A 1KYOF 4FCQA 1M4UA 1SS3A 4JI8O 3T4DA 2B1GA 3OTFA 4UV9A 1IBLB 2BOBC 4X20B 1U2OA 3R65A 2JDIG 2BU8A 3OMIB 1JOYA 4B3SO 1SQGA 2ETNA 5LBQA 4LF6O 5H6RA 4NTXA 4O4IA 2YEDA 2GDSA 3ETEA 4GEEA 4G27B 2OTLV 1XREA 4X8AA 4RAIA 4RWUA 2YI8A 3OFNG 2VCJA 1KB9F 2PF4E 4IYIA 1TUBB 1F4MA 1VQ5V 2Z3YA 4CC6A 1K34A 4FJCC 1SETA 1M57B 5LOVA 4BIOA 5BZBA 1YEWA 5KLVH 2EJRA 3A0XA 1IBKB 2UXCO 5IN9A 3U0ZA 4RQEA 5H6QA 1R3IC 5B1AC 4DV4O 2YICA 4FLXA 4PHZA 3K3WA 1W2BU 1JVMA 3RBZA 3ZMTA 3CD6V 2YKCA 2XDSA 2C1GA 4J41A 5KA5A 3B26A 2NR5A 3GWOA 4UV8A 5CB4B 3JSLA 4RO2A 4I3HA 3SYOA 5KAIZ 2UXNA 4BAEA 3BPZA 2O1VA 1YF2A 4K35A 1EI1A 1N36B 3K06A 1WAZA 1VQLV 2L6LA 3BVOA 5CA0B 4YJ2A 4X66O 1JA8A 4EGKA 5M4NA 5IYZB 5CBHA 4JI6O 4I50B 2YI5A 2MK3A 4JYBA 3E86A 4LH6A 3N2GB 4ZBMA 4R3AA 5EYPB 3D36A 2YECA 4DRXB 2A06H 3GIFA 4X65O 3ZKBA 2JVDA 3QTCA 2DYRC 4Z2WA 2BRCA 1Z5CA 1VIBA 4LFCB 3SJAC 2PYLA 4K8XA 2IU0A 1GM9A 2XAFA 4HYOA 5GONB 4B3TO 4R7CA 3PEJA 4FM2A 1RSOA 2HLDG 2N05A 1V54C 1MZFA 2A9HA 2HKJA 5K1PA 1Y4SA 2P6JA 3L73H 4CWRA 5LMUB 1KU9A 2OIGA 3FAVB 1EN5A 3S5TA 1L0NH 5IYCO 3LDCA 1X4TA 4RUEA 4K0KO 2IJIA 3WFVA 3RYCB 4LWFA 3DC6A 4HY1A 2XJGA 2Q8HA 2XUMA 2EIMC 1I5DA 1OSFA 1MG1A 2P7TC 5KAFZ 3W7SA 1DLBA 2MW2B 1H2SB 1VQ9V 3LNUA 1BCCH 1XUQA 3R92A 3SPGA 1XNQO 5L3EA 4LF4O 3ZMVA 4O0BA 2UUCB 4CBCA 4FPPA 1K4CC 3N2KB 1N33O 4GKJB 1KP3A 3TZ2A 2QEXV 4JTAB 4QE9A 2P4VA 5KMGA 2Q6AA 3DTUB 1AR1B 1SZXA 3KKYA 4BR6A 3QVNA 3INWA 3G7EA 4MPEA 5JJNB 5LP6B 4LF9O 3JALA 1UY9A 2ZDYA 3O9OA 1FXKB 4FMTA 2HCHA 4FLTA 3B25A 1HNXO 4X1IB 4Z1VA 4B3RO 1ZW9A 5EIBD 4P2ZA 5KUKA 4P7AA 1COWG 4GGLA 3SJQC 1AI4A 2P90A 3ICXA 3CGYA 4YIOA 3BEHA 1TVKB 4JI8B 5L3BA 2QWQB 4DV1B 4NXNB 3H9VA 2WI5A 4RQFA 3ABMB 4X89A 1ID0A 1TIDA 1HNZO 1G4YB 2QJ1A 3SYCA 1JMKC 1FXKA 1V55B 3N27A 4MVUA 1B06A 1MZEA 4MTGA 5FWKA 1MSDA 1RPRA 3NXSA 4AHCA 3ETGA 5JH7A 1Q3EA 3ZBHA 1GH6A 5KUMA 4MVSA 3CRCA 5B1BC 3Q5JA 2XHTA 5FLXN 1Y4MA 4UCOA 4LF8O 3SPCA 1PVGA 4H7QA 1M56C 2UXBO 5LMNB 4EFBA 2HFEC 4NKGB 3VHAA 2WI4A 3HYYA 1FYJA 4L94A 4U3JB 2RJZA 3CJHA 3OW2U 4TV8B 3RT3C 5ITZA 1S5JA 2CH7B 5HFLA 3H1IH 5GTHZ 4R1FA 2QDOA 1TUEB 4UB8Z 1BKNA 2BZ5A 4MP7A 1AB3A 2YI0A 1JFFB 1K8AW 3HR0A 2QTOA 3JASB 4DV0B 1MOFA 4CH3A 2ZQMA 2BTQA 3CRRA 4DO2A 3MDSA 2EILC 2EZOA 3AK1A 5J2TB 4O4LB 3F5TA 4JI3O 3TETA 4DR4B 2WI1A 2XX5A 4ASFA 2HHHB 2K5BA 3JAMN 2ESAA 1SZTA 1RM1B 1US6A 1SA0B 2CCTA 2QKSA 4L8ZA 1NZ6A 1XL4A 3K9AA 4BIUA 3A0ZA 4XDLA 5IJ0A 2IOQA 1AR5A 2XNDG 3OM3B 4B7KA 4CS4A 5BR8B 3RVYA 3C90A 1S76D 3JCUZ 1LUWA 4NYKA 3ABKC 2ZIOA 4V25A 3CHXA 3SL2A 3SPIA 2UU9O 4YHHB 3R4MA 3R91A 3OUFA 4LWIA 4HNAA 1NHIA 2FTKA 4CWPA 1Q7YW 3QO8A 4QNHB 2WA3A 2Q68A 1MNGA 4PD4F 1I94O 4LF5B 1NKDA 1FAFA 2X6CA 4H13B 4UCTA 1EZVH 4UVCA 4B3SB 1P4RA 4JASA 5LMUO 4NXMB 3EHFA 3SJCC 1WP8A 4IL6Z 2CDYA 1X59A 5KHKA 3J7AU 2H3OA 4LF6B 1Q90D 2O1WA 2WWWA 2Y48A 2A7WA 3O65A 3ZJZA 2XHRA 3SYPA 3CC2V 4PRXA 1UYHA 3B27A 3EKOA 1GK9A 1B63A 3CPWU 4MTFA 1I5XA 3X2QC 1R73A 1T5EA 3OR7C 3CEIA 2QE7G 4JI0B 5LXTA 2YKIA 3C11A 3B8NA 2W6JG 1P7GA 4XDJA 2E5LB 1B6QA 3CXCU 1BMFG 3X2QB 3JZ3A 1HW7A 2B5UA 3BHPA 3ASOB 2IWUA 3LSUA 2XDKA 1US7A 4MOTA 4TT3G 1I58A 1BS3A 1WPXA 5LA6B 4LF9B 1KC8W 3EHHA 4TUYA 2ZT9B 3FFQA 2G38A 3E22B 4LWEA 2YE8A 1UYCA 2WA4A 5BXZA 4HY6A 2JEUA 3HPLC 1MMMA 2RCVA 4O4HA 2ZM6O 1UYDA 4J10A 5IT9N 3HZ5A 4TV9B 4FLZA 1DF4A 2P5OA 1BQ0A 3K9SA 1ZX3A 4D7SA 2VQFO 4BWAA 2CTRA 3THOA 3LSQA 4X66B 4LR3A 3WG7C 2DMXA 4JI7B 1Z5VA 4JI6B 3TGUH 1E1RG 3ZMZA 5CBGA 2F23A 4LNUA 3R4PA 3I56V 4KFMA 1YTFD 2BREA 2YJWA 1YT1A 1FS0G 1CP9A 2ZR2A 3OR6C 4P30A 1BHBA 1XEQA 3UQ8A 4QGPA 1BHAA 4JV5O 2YXYA 5J2UA 1XHXA 1DF5A 4EMVA 1L8DA 2ZKOA 1HDJA 1GKZA 3ABMC 1M90W 5C8YB 1UYFA 3ZHUA 1UY6A 3Q5LA 3NMQA 5LMNO 2EBOA 3H1HH 4B3TB 2Q67A 1QNMA 2ZE5A 2HP8A 2RN9A 2VWKA 1YHQV 4GKKB 2DQ0A 2F43G 4DUHA 4GT8A 4XDMA 3BA9A 2ZE6A 2Q7HA 1SKVA 1R3JC 1PV0A 2WLJA 1JQ0A 1OCCC 2H94A 3FB7C 4XITA 2QSAA 2IJJA 2YEVB 4CC5A 5IYZA 3T1CA 4MVQA 1FKAO 1M56B 1QZRA 3M8AA 1OCOC 3N2GA 4EFEA 4DR2O 4JI2B 1AR4A 3RWRD 2ADQB 5IDMA 5GGZA 5E1AC 2GFDA 1XNQB 2YGEA 2FWYA 5JVDB 5IDJA 3CC7V 3HHUA 2LQTA 5IYDO 3S3WA 4LPBA 4GKJO 1N8RW 4CWFA 2EIKC 1N32B 1W59A 3AK2A 1GKXA 4CE2A 1VF6C 2YE2A 2BOCC 5H2FZ 1XMQO 1N0JA 2JS3A 3OPDA 1K4DC 1N0NA 3LPSA 2WI3A 2JJ1G 1RSOB 2PI5A 1IURA 2CTPA 1F23A 2Y69B 2CCSA 5D6PA 3T2MA 1WNSA 2W6IG 1S0VA 4DK0A 1S5HC 2XOKG 4P9OA 3CP1A 4YHHO 4XKAA 4N21A 2YGAA 4KHPB 3K97A 2R9AA 2M6YA 3FYIB 4HXWA 3T1YB 2Q4PA 3IEDA 3OGIB 1UYEA 5EZYA 4X20A 3L75H 3I5DA 4WBNB 1NHHA 4W4KA 3WQ9A 3F7VC 5LHHA 5CN0A 2XAGA 4FVMA 5DM6V 1NVPD 4PDLA 5L3FA 1Q6HA 4ZOLA 4LP0A 2UXCB 3WHAA 3VBBA 2A0LA 2XAHA 4YKRA 1YIJV 2HJDA 4DV3B 4J42A 1H8HG 4FLUA 4YY3B 4FFBB 3EVKA 4DR3B 2DQ3A 1GO3F 1QQCA 5B1NA 1BZKA 3CCUV 3RN4A 2YI6A 3TZ0A 3G75A 1OHHG 4QE7A 1U96A 2JIZG 2YEBA 5EBWC 1ZXNA 2Q73A 3ML0A 4XKOA 1VQ6V 2E5LO 2QWNB 2OCCC 4ZOLB 3LNMB 2C2AA 4EGHA 3MHSC 3VQXA 3CYGA 3BM9A 2VS0A 1O9HA 3T2SA 2IM9A 4TWKA 3TZ4A 3QO5A 4MS2A 2WLKA 1S3JA 1QCEA 4FFBA 3AG3B 3VQWA 2ARHA 5CB4A 4I55B 5CF0A 1GM8A 1WLEA 4WF9V 2PZSA 4JPRA 3KCYA 2OYQA 1Y67A 2YEFA 4LF7O 2LO1A 1SQPH 1WJZA 1YDXA 2V4DA 1XOUA 1LUVA 3MHHC 3UCSC 2R9IA 4DR4O 2YEAA 4ASUG 4L91A 2K1EA 2HKOA 4QPJA 4H44B 3LNNA 2X6AA 4YKQA 4I55A 3F7YC 1TA8A 1H2NA 4MVMA 4DRXA 3CMEV 4E01A 2JJCA 2F4VB 1PP9H 4JV5B 1YXBA 4ASAA 4CS2A 3CJHB 1R6TA 3AG4C 3T1HO 1PKXA 1AJQA 4KTNA 1I5BA 4X62B 1HNWO 4L87A 3EXAA 2QWPB 2WLNA 3PN1A 2BU5A 2RDCA 5CA1B 5H9CA 3JD0A 2BYHA 4IIJA 1VARA 4NH8A 3F5WC 3VADA 1ZL8A 1JFFA 3K0GA 4PA6A 1QLEB 2YXHA 4XCLA 3L74H 5CTYA 5CMUA 3L70H 4AQYB 5KHIA 5D6QA 2UUBO 4LF4B 4CS3A 2R72A 2IWXA 1NH2D 2VQEB 4AS9A 4AI8A 4C7UA 2DN9A 2DYRB 2D2CB 2RQ6A 2LFSA 5KX5A 2F93B 2WLMA 2IBZH 5JQGA 4JYAO 5IJ0B 4PI2A 1VQMV 1MU5A 1R62A 1AH8A 1GKFA 1MABG 1QHTA 4UFZA 2Q7EA 4XKKA 2N04A 1Q6UA 4MPNA 2KG7B 1AVMA 1BSMA 3CRMA 4A5UB 1OCCB 2XHBA 2L35A 3ETDA 1GN6A 4GYCB 3SJBC 2E75B 3WB1A 1Q6IA 2B9ZA 1Z5WA 4J80A 1ZUQA 4MTXA 2YC0A 4J7KA 3NR7A 3RYHA 1ZXMA 2IH1C 4BQJA 3JALB 2LP7A 4GT1A 1HNZB 3JD1A 4X1IA 3ZMUA 2H8PC 2CUGA 2ZM6B 2WLHA 1R1BA 4JZGA 4XTJA 4H81A 1H2GA 1VF6A 3CMAV 3JATB 4MSWC 5M4EA 5E79Z 2XABA 5JCOC 3Q4HB 4AWQA 2W0XA 1LNQA 1UYLA 4JF3A 4R6ZA 1PL0A 2Q0OC 4ASBA 4LF8B 2M7WA 4NR1A 2YI7A 3UO3A 2YGFA 4NH9A 2UXBB 5D7RA 5EBLC 2WLIA 2P22C 3OD4A 4Q6GA 4WFBV 1WA8B 1H8EG 4X1YB 3TJTA 4ZIBA 1K5QA 5FPOA 3OMAB 2R70A 1FXKC 4DV3O 2ILMA 3JATA 3HKEA 1I5AA 1BGYH 3FT8A 4U3FH 2YE7A 1GAXA 4YJ3A 2Q0AA 5BMVA 4XC0A 1P7BA 2UUAB 1AI6A 4FCRA 1JX9A 2NNUA 4LWSA 2EIJC 5B1BB 2YE4A 2WLIB 3S3XA 2YE3A 3JAWA 2VW5A 1GTOA 4DR7B 1KD1W 1IBMB 2AHZA 3G6BA 3STLC 1K33A 2EIJB 3HKEB 1AP5A 4KL1A 1JJ2U 5IY5C 4YKZA 2HHHO 4PA7A 3ABLC 3EHGA 3APQA 4AWPA 1WPBA 5HFMA 2XX4A 4FFKA 4V26A 3OAAG 4P9PA 2ZXWC 3JASA 5B1AB 1VP7A 4UVBA 1NR1A 2BTOA 3G67A 4DZYA 4NTWA 4DW0A 3ABTA 4DXWA 2OCHA 1KUQA 1XBLA 1V9PA 5CTXA 5KHJA 2YE5A 2UU9B 2EXLA 2ZXWB 3K98A 3D3IA 5CA3A 4I0XB 1LR1A 3AG3C 1NTKH 3ZM7A 4FLVA 4X1KB 3HKDB 1G1XB 3P3PA 5D7CA 2EINC 2B1IA 4UCVA 4KFGA 1I94B 2BU2A 2IWSA 2PTMA 4NB5A 1RPOA 1B3QA 3JD2A 4BW9A 1H7UA 2CK3G 4HYPA 2QKAA 1M9NA 3RYIB 1IBKO 3FV5A 1VQNV 1NTMH 4NXMO 2Y69C 1JCHA 2ADPA 4LFAO 4DV4B 1PNMA 3VQVA 3H4LA 3B09A 2RNBA 4KP4A 3UKMA 2BSMA 3DXRA 5IWAB 2NN4A 1V54B 2DW4A 3CCMV 1XMOO 2YEEA 1PL4A 1G8MA 2WPDG 2XX2A 4TQFA 4KSHA 1GN3A 4AQYO 3B77A 5FNFA 1YSCA 2UUBB 2Y4UA 4D6TH 1EA6A 3J81N 1SQQH 2JGDB 2QG2A 4GQTA 4CE1A 1WP7A 1UPGA 4E4EA 4DV5O 4O05A 1SESA 3K04A 3OMUA 1SQFA 4PA3A 3CYOA 4TQDA 1THZA 5C93A 4FLWA 1CEZA 2Q8GA 4DR3O 3TXSA 2ATKC 1TC0A 1MX0A 5CPHA 2AW9A 1G6UA 1KECA 2YSUB 2OCCB 3ZXOA 3ZRWB 1UY8A 2O57A 3BCCH 1S72V 4O09A 2EIMB 2VQFB 2HG5C 5EZYB 1XILA 3D8CA 5LA6A 1JPXA 4WFEA 4TUYB 5EIBC 4IYHA 1EN4A 3AEIA 3ZHSA 4O4JB 4DV2O 4KXRA 1SQXH 3TTZA 4XIPA 1U97A 2GHYA 3HB3B 3E8HA 1FFTB 4TV9A 4LF7B 2WI6A 1YJWV 3ZRVA 5M4MA 2QM4A 4CWNA 3D3QA 4K0KB 3BMYA 4ZI7B 4O04A 4LNUB 2XJJA 1EZJA 3ZEDA 2BU6A 3FD9A 3RFRA 3CWVA 4XD8A 1IDSA 3SYAA 1URFA 2P4KA 4WFHA 3TCUA 5M4HA 2YKEA 3BFRA 3K03A 3CX5F 2Q8VA 3LDEA 2ZNIA 4PDMA 1N33B 3T1HB 3CRKA 4YJ2B 1UFIA 3HEKA 1S77D 2EULA 5C8YA 2BT0A 4WUDA 2HR3A 3VHCA 5TISZ 2EZPA 1RP3B 5LHGA 2VWCA 5EYPA 1YSZA 4YXWG 1XNRO 4WCEV 4JI2O 4U7NA 3JSNA 2CCUA 1QLEC 3A8TA 3K59A 1IBMO 2CGNA 2F95B 2E0AA 1WB8A 1OCRB 3RVZA 1FFXB 1N32O 4HZ5A 3A0WA 4QIWF 2AKPA 1FXVA 4NXNO 1Z5AA 5KHGA 2GUZA 3WU2Z 2JEXA 5FNVB 3JD4A 3AK3A 4WFGA 4UUJC 4QJFB 1QYEA 2BTZA 1PM9A 1VQOV 2BE3A 2C1IA 4EB6A 3T4ZA 4MB9A 3ABUA 5LGUA 1BE3H 3SPJA 1OCOB 3MD0A 1QU7A 3JYCA 3QO7A 3FAVA 3BAAA 4TOIA 1EFRG 4BIZA 2IOPA 1OCZB 1D5NA 5CBFA 4JAVA 5CA0A 1FFXA 1Q8IA 4LH7A 4KHPO 4HYMA 3M7MX 1UYIA 1S5LZ 1ZWHA 3K5LA 2WEQA 1RFYA 3T1YO 4UVAA 3P3NA 4X88A 4I50A 3CCRV 1MSWD 1IBLO 4HBNA 5FL7G 1ZL8B 3LDDA 1GRJA 2YEHA 2QWRB 4EB6B 1TAEA 2XCMA 2Y0IA 1I5YA 3N2KA 1KMIZ 2AGAA 4PU9A 4PI0A 4DR1O 1RM1C 3OMNB 4PA4A 1SF9A 1GJVA 2RMKB 3EKRA 2YUAA 5J6AA 1DK1A 3DC5A 5LHIA 3OEEG 3GB7C 3OWDA 4QPKA 3ZHRA 4DW1A 1Y76B 4R8CA 4GX1A 2FXSA 2QFOA 3K99A 3CSXA 2VWJA 1WN7A 2Y0PA 1N4CA 2PI4A 2DWDC 3AG2C 3CCLV 1H2LA 3CWBH 3FB6C 2ZKJA 2FKXA 3D0BA 1TVKA 4JI3B 3PJSK 4PDRA 4DUYO 3C3TA 3ZKDA 3IAYA 2HVKC 1EBOA 2IU3A 4LFBB 4KUMA 3OE7G 2Q7GA 2QR4A 4JI5O 2KQXA 1Y76A 3ZCCA 4AWOA 4GX2A 3G7BA 2KB1A 3ZIAG 4G2KA 3QG5A 2A3QA 1YT2A 4E2LA 3U2KA 4B3MB 3ZHTA 3SPHA 2AHYA 1VQPV 2IH3C 2Q5ZA 3BABA 5B3SB 1PNLA 2X6BA 1HP8A 4HAMA 3A0BZ 1CXZB 3A2FA 1SERA 1UYGA 1Y6XA 5IY5B 3ZHQA 3KE6A 4JYCA 4DV2B 3W7WA 2IJKA 2Q8FA 1FJGO 2JK5C 4X65B 1AJPA 4U3JA 4Q20A 2YIBD 2F4VO 4EGIA 2UXDO 1NQTA 3KG2A 2BSKB 1VQ4V 2YIDA 2P06A 3LSSA 1KKCA 1QR9A 4PJ0Z 3JD3A 2XJXA 4GFNA 2EJ7A 1AMWA 4HXZA 1PD3A 1N34O 3STZC 5FNCA 3G6EV 2QTSA 1Q43A 1YTFB
chains in the Genus database with same CATH topology
3HYYA 3K98A 3ZMSA 3IFXA 4L94A 4MTXA 1R3KC 3TZ5A 3OW2U 1ZXMA 4LWGA 2IH1C 2D3OW 4BQJA 1Z59A 2H8MA 4PELA 2LP7A 4O07A 3A0YA 1NVPB 5F5RA 4GT1A 5HFLA 1YT0A 3JD1A 2YE6A 4R1FA 1VQ8V 4J9YB 3ZMUA 1TUEB 2H8PC 5EK0A 1Y8NA 1YS3A 3AG4B 2WLHA 1BKNA 1BYQA 2BZ5A 4K4OA 4MP7A 1QR8A 2GQPA 4XTJA 4JTCB 1NR7A 2QA4V 2YI0A 4H81A 1H2GA 2GSMB 4JAUA 2ITDC 3CMAV 3U67A 5DN6G 4BAYA 5L3JA 1K8AW 1K5SA 1AJNA 2ZDIC 4MSWC 5M4EA 2XABA 2QTOA 2WI7A 3RLPA 1MOFA 4H37A 3TUHA 1OCRC 4AWQA 4WUCA 1ENVA 2ZQMA 4FIPC 3QDDA 1LNQA 1UYLA 4FCPA 4JF3A 4DO2A 4R6ZA 1PL0A 2BU7A 2EILC 3H01A 2YKBA 4ASBA 3IC7A 2M7WA 2EZOA 1YI2V 2YI7A 5D7RA 3TETA 1UY7A 2FYPA 2WI1A 5EBLC 2Q69A 2WLIA 2XX5A 2YGFA 4NH9A 4ASFA 1YERA 2K5BA 5FNDA 1L0OA 2ESAA 1SZTA 5J9PC 1RM1B 4XIQA 4L93A 4XCJA 4URLA 4BQGA 2CCTA 2XDXA 3FKSG 4WFBV 2QKSA 1VQ7V 2BYIA 3GIEA 3IGAC 1R6NA 3K60A 1H8EG 4L8ZA 1XL4A 3K9AA 4BIUA 3A0ZA 1K5QA 4N23A 3OMAB 4XDLA 3RLQA 1FXKC 1R3LC 3K79A 1I5AA 2IOQA 3I55V 4G28B 2XNDG 1TILA 2XK2A 3FT8A 2YE7A 3T10A 5M4PA 4XC0A 2ITCC 1OCZC 3OM3B 1P7BA 4MTOA 4MT8A 1AI6A 3RVYA 4FCRA 4XIRA 2WSSG 1S76D 1VQKV 4U93A 1JX9A 3ABKC 4V25A 1Q86W 2NNUA 3SL2A 4H33A 2WAMA 3SPIA 3R4MA 2EIJC 1AJ6A 3OUFA 5B1BB 2YE4A 3R91A 4LWIA 1K9MW 1NHIA 2WLIB 2YE3A 3MNRP 3VOUA 3WQ9A 3EHBB 2FTKA 2VW5A 1GTOA 4CWPA 1Q7YW 3QO8A 1I5CA 4QNHB 3WG7B 3OW6A 4PL9A 4CE3A 1KD1W 3P30A 4JQLA 2AHZA 2Q8IA 2Q68A 3STLC 1NKDA 1YC3A 3UM7A 1K33A 2X6CA 2EIJB 4ASGA 4BW5A 1S16A 1JJ2U 4I5SA 4JGSA 5IY5C 4UVCA 1P4RA 2WI2A 4JASA 4YKZA 3EHFA 4PA7A 3ABLC 3EHGA 4WFFA 1W0JG 2V7QG 1YJ9V 4MVRA 2OTJV 4AWPA 5HFMA 4L90A 2O1WA 5D7DA 3CCJV 2XX4A 2WWWA 2Y48A 4I9WA 4MVZA 4V26A 3OAAG 4P9PA 2ZXWC 3ZJZA 2XHRA 2ZDXA 3CGZA 3HYZA 5B1AB 4WUBA 3SYPA 3CC2V 4UVBA 4PRXA 1E79G 2W0FC 1NR1A 4YKTA 3A0RA 3AG1B 1YETA 4DZYA 1UYHA 3B27A 3EKOA 1GK9A 4TSFG 3ABTA 3M99B 4DXWA 3CPWU 3ZRXA 1B63A 2DYSC 4MTFA 1I5XA 1UYKA 3X2QC 5CTXA 1R73A 3O0IA 3OR7C 2YE5A 5CTUA 1GMGA 3SYQA 2ZXWB 3ZRSA 5KA6A 3D3IA 5CA3A 2EXLA 2QE7G 2QF6A 3AG3C 3ZM7A 4CWOA 1Y8OA 2HG1A 2YKIA 1A4HA 3C11A 3B8NA 4XE2A 2W6JG 4URNA 1SRYA 4XDJA 3E8FA 1B6QA 1JM6A 2IW5A 5LGTA 5D7CA 4E02A 2EINC 2B1IA 3CXCU 2ZR3A 1BMFG 3X2QB 3K08A 1Q82W 1QVFU 2B5UA 2XAQA 1B62A 3ASOB 3OEHG 1M57C 1TC6A 2BU2A 1AM1A 2IWSA 2IWUA 2XDKA 1US7A 4MOTA 1RPOA 1K3EA 3JD2A 4TT3G 1B3QA 2CK3G 1BGQA 1H7UA 1I58A 1M9NA 4HYPA 1WPXA 2HVJC 3O6OA 3FV5A 1VQNV 1KZNA 1KC8W 2Y69C 1JCHA 3EHHA 1AH6A 4UROA 1CPYA 3OGCC 1YJNV 4MBCA 4P8OA 1PNMA 2YE8A 3H4LA 4LWEA 3RKZA 3UKMA 4ZKIA 4KP4A 3EFFK 1UYCA 2XAJA 4HY6A 2BSMA 4KSGA 2O1UA 1K73W 2JEUA 1V54B 2DW4A 1K97A 3HPLC 4WFAV 1QY8A 4R50A 3CCMV 1UYDA 2WEPA 1W0KG 3HZ5A 2YEEA 3FB5C 5BOCA 1DF4A 1G8MA 2WPDG 5M4KA 2XX2A 5CTWA 4KSHA 1BL8A 3QTFA 3LSQA 1AI5A 1QLNA 3B77A 5FNFA 1YSCA 3WG7C 4B6CA 4CZZA 1EA6A 1E1RG 4MPCA 3ZMZA 5CBGA 2QG2A 4GQTA 4CE1A 1S14A 3T0HA 3JCZA 3I56V 3R4PA 1QBZA 4KFMA 1SESA 1YTFD 3K04A 2BREA 2YJWA 4O05A 3OMUA 3E8BA 1THNA 1YT1A 4YKWA 1E1QG 1FS0G 4PA3A 1CP9A 2OT5A 2ZR2A 3CYOA 3OR6C 3ABLB 1THZA 3E89A 4P30A 4UXNA 5C93A 1BHBA 1CEZA 2Q8GA 1BHAA 1F4NA 2ATKC 1TC0A 2VCIA 4EFTA 5B3SC 1MX0A 3AG2B 1OZ0A 5CPHA 2X0LA 2FWZA 1DF5A 5B1OA 4EMVA 2DWEC 2IJHA 1NBMG 1GKZA 3ABMC 1KECA 3AG1C 3FYEB 3QNEA 4J9ZB 3W7XA 3K0DA 5L3GA 1M90W 1UYFA 2YEGA 4MP2A 3U2DA 2YSUB 1UY6A 2DYSB 3Q5LA 3NMQA 4YKYA 1TH8A 2EBOA 3CC4V 4EFUA 2YKJA 2Q67A 2OCCB 3ZXOA 3ZRWB 1UY8A 4ZVIA 3RW0A 2QM7A 1YHQV 1S72V 4FCQA 4O09A 2DQ0A 2EIMB 2F43G 1M1KW 4DUHA 3T4DA 2CH4A 2HG5C 2B1GA 3G4SV 1Q81W 4GT8A 1JPXA 4UV9A 1L1FA 4XDMA 1R3JC 4WFEA 2BOBC 1U2OA 2WLJA 1JQ0A 3R65A 4LWHA 2JDIG 1OCCC 4PRVA 3AEIA 2H94A 3FB7C 2BU8A 4XITA 2IJJA 3OMIB 2UWDA 3TTZA 1JOYA 4XIPA 2YEVB 2GHYA 3HB3B 4MVQA 3T1CA 3E8HA 1FFTB 2JKIA 3CCVV 2EILB 2LFRA 5LBQA 1M56B 3E2EA 1QZRA 3OUSA 3GIGA 2WI6A 2ZDIA 5H6RA 1OCOC 3T0ZA 1YJWV 2YEDA 3C0EA 3ZRVA 3ETEA 1UJWB 1H7SA 4G27B 1KQSU 2OTLV 4GEEA 5IDMA 2ZD9A 5GGZA 5M4MA 5E1AC 4CWNA 4BXIA 4X8AA 4RAIA 2GFDA 3BMYA 2YGEA 2FWYA 3OFNG 1UYMA 5IDJA 1ROPA 3CC7V 3BY6A 5IYDO 2VCJA 3HHUA 4O04A 4LPBA 1VQ5V 1F4MA 3P32A 1EZJA 1N8RW 2BU6A 2EIKC 2XJJA 3CWVA 2EINB 2Z3YA 3H80A 4R3MA 4XD8A 4CWFA 3SYAA 4KQVA 1H38A 1K34A 4FJCC 1SETA 1M57B 4WFHA 1GKXA 4CE2A 5BZBA 1NH2B 3TCUA 2YEVA 4JTDB 2EJRA 3A0XA 2YE2A 5M4HA 2YKEA 2BOCC 5EC1C 3K03A 4LBEC 1QVGU 4MVOA 4OXSA 3OPDA 3LDEA 1K4DC 5IN9A 4PDMA 4RQEA 5H6QA 2WI3A 1R3IC 5B1AC 1YITV 5GW7A 3CRKA 2JJ1G 3GIGB 3LPSA 3INXA 3K3WA 3HEKA 1W2BU 1S77D 1Y66A 1JVMA 3RBZA 3ZMTA 2PI5A 3CD6V 2YKCA 3CCQV 1F23A 2XDSA 3B28A 2BT0A 2QG0A 4WUDA 2H55A 2Y69B 4Z1MG 2HR3A 5KA5A 2CCSA 3T2MA 5D6PA 3TK1A 3B26A 3VHCA 2EZPA 2W6IG 3GWOA 1S0VA 4GCZA 4UV8A 2QM8A 1S5HC 2Q2EB 3CCSV 2XOKG 4P9OA 3CP1A 3ZRWA 5LHGA 1YSZA 2VWCA 4XKAA 4N21A 2YGAA 3K97A 4RO2A 1AROP 4I3HA 4YXWG 3SYOA 4WCEV 1K7DA 1ZWIC 2UXNA 4BAEA 2O1VA 3FYIB 4U7NA 4HXWA 3ZXQA 1AI7A 1EI1A 2CCUA 3IEDA 1QLEC 1UYEA 3K06A 3R4NA 1KP2A 2YK2A 3ASOC 1KIJA 2X7RB 3DGEA 2E0AA 1VQLV 1YC4A 4NH7A 1OCRB 1F51A 1NJIW 1NHHA 3RVZA 4HZ5A 3A0WA 3O2FA 3E8GA 3F7VC 4QIWF 5LHHA 5CN0A 5CBHA 1FXVA 2XAGA 1Z5AA 5DM6V 1NVPD 2AKPA 2R9RB 4PDLA 5L3FA 2JEXA 4XBFA 2YI5A 4E00A 5L3DA 4LP0A 2MK3A 3JD4A 4JYBA 4WFGA 4RUFA 3WHAA 3E86A 4UUJC 4QJFB 4ZBMA 1QYEA 3ZN0A 2BTZA 3D36A 4R3AA 1VQOV 3VBBA 3OWBA 2A0LA 2XDUA 2XAHA 4YKRA 1YIJV 1V55C 2YECA 3A0TA 3T1KA 1H8HG 3T4ZA 3GIFA 4MB9A 3ZKBA 3B8MA 2Z5UA 2DYRC 3ABUA 5LGUA 3SPJA 1OCOB 3MD0A 2BRCA 1Z5CA 2UXXA 2DQ3A 3JYCA 1GO3F 4PA9A 3QO7A 2YEIA 2IOPA 1EFRG 4XDKA 5B1NA 1OCZB 4BIZA 5CBFA 4F4LA 1HWYA 3CCUV 4JAVA 2CGFA 2YEJA 2YI6A 3TZ0A 3G75A 1OHHG 2IU0A 4HYMA 4QE7A 2JIZG 1GM9A 4HZ3A 1UYIA 2YEBA 3ZN1A 2XAFA 4HYOA 5EBWC 1ZWHA 1ZXNA 2WEQA 1BXDA 3ML0A 4XKOA 1VQ6V 4UVAA 2OCCC 4X88A 3G71V 3CCRV 3LNMB 2C2AA 1MSWD 3Q5KA 4CWSA 4EGHA 3MHSC 3JZ3A 2WLLA 4R7CA 3BM9A 5J71A 3PEJA 5FL7G 3LDDA 2HLDG 1V54C 2YEHA 2NLJC 2A9HA 3T2SA 1NHJA 4TWKA 2HKJA 3TZ4A 1YTFB 4CWQA 3QO5A 1DTOA 2WLKA 4MS2A 1Y4SA 5L3CA 1YC1A 2XCMA 1S3JA 2P6JA 1I5YA 1QCEA 4MW3A 3AG3B 5EC2C 2XHXA 4CWRA 5CF0A 5M4NA 4PU9A 4KFGA 1RM1C 3D2RA 3OMNB 4PA4A 1GM8A 1WLEA 1GJVA 4WF9V 3EKRA 5LGNA 5IYCO 3LDCA 5J6AA 4JPRA 4RUEA 2XD6A 3CCEV 2IJIA 3WFVA 5LHIA 3OEEG 4LWFA 4W7TA 3GB7C 4GX5A 2XJGA 2YEFA 3OWDA 4QPKA 4HY1A 2Q8HA 2EIMC 2XASA 3LUTB 1I5DA 1OSFA 1MG1A 2P7TC 2WLLB 4X9LA 1GM7A 2V1DA 3W7SA 4GX1A 1DLBA 2JJ2G 3MHHC 4R8CA 1Y8PA 2FXSA 2R9IA 2QFOA 2YEAA 4ASUG 3EHJA 1VQ9V 3K99A 1KKDA 4L91A 1Y4UA 3LNUA 2K1EA 2HKOA 3SPGA 4QPJA 3R92A 3ASNB 2PI4A 2WERA 5L3EA 2DWDC 3AG2C 3ZMVA 3HZ1A 4O0BA 3CCLV 4B7PA 4CBCA 4FPPA 3CRLA 1K4CC 2X6AA 4YKQA 4URMA 2A79B 3F7YC 3FB6C 1KP3A 2ZKJA 1FXHA 3TZ2A 2QEXV 4JTAB 4QE9A 4H85A 3D0BA 4MVMA 3PJSK 2Q6AA 4PDRA 3PEHA 3DTUB 3CMEV 3ZKDA 4E01A 2JJCA 1AR1B 2XDLA 2HVKC 1EBOA 3ASNC 2IU3A 4ASAA 3E35A 4KUMA 3OE7G 3AG4C 3INWA 3G7EA 4MPEA 2YJXA 3W7UA 3ZCCA 1U0ZA 1UY9A 2ZDYA 1YESA 4AWOA 1PKXA 1FXKB 1AJQA 4GX2A 3B24A 2KB1A 3G7BA 4FMTA 3ZIAG 1I5BA 4G2KA 4KTNA 2HCHA 4L87A 3B25A 4MW8A 1YT2A 2EIKB 2YE9A 2WLNA 4E2LA 1ZW9A 1J95A 3U2KA 4P2ZA 2BU5A 4EGKA 5KUKA 3SPHA 2AHYA 1COWG 4P7AA 5H9CA 3JD0A 3SJQC 2BYHA 2P67A 4GGLA 1VQPV 5BODA 1AI4A 1ORQC 2IH3C 3F5WC 2P90A 1XL6A 2HJFC 4NH8A 3VADA 5B3SB 1PNLA 2CG9A 3BEHA 2X6BA 3CGYA 3K0GA 4HAMA 1QLEB 4LC1A 4PA6A 4XCLA 4YKXA 5L3BA 3FT5A 3FB8C 5CTYA 2WI5A 5CMUA 1SERA 4HZ0A 4RQFA 1IXMA 1UYGA 4CWTA 3ABMB 5D6QA 3W7TA 4FK5C 5IY5B 3KE6A 4EEHA 4X89A 4JYCA 1ID0A 1TIDA 5IYBO 2IWXA 5F3KA 1NH2D 1G4YB 3W7WA 2IJKA 4U7OA 4AS9A 2Q8FA 3SYCA 1FXKA 4EM7A 1PNKA 1V55B 2JK5C 4MVUA 2YK9A 3R4OA 5EBMC 5FWKA 4MTGA 3RLRA 1AJPA 1RPRA 4Q20A 2DYRB 4LCUC 1Z5BA 1K92A 2LFSA 4YKUA 1TBWA 4PDVA 4EGIA 2WLMA 4EKWA 3NXSA 2ZBKB 1NQTA 3ETGA 3VHDA 3KG2A 3ABKB 1VQ4V 5KUMA 1VQMV 1MU5A 1R62A 4MVSA 1GKFA 1AH8A 1MABG 3LSSA 5B1BC 4XKKA 1QR9A 1R6KA 1I59A 2XHTA 3Q5JA 3JD3A 4MPNA 2IORA 2XJXA 1Y4MA 4GFNA 1OCCB 1AMWA 3E83A 4LP8A 3SPCA 4HXZA 1PVGA 3ETDA 1M56C 2PNRA 1PD3A 4H7QA 3STZC 5FNCA 2HFEC 3G6EV 3VHAA 2WI4A 4GX0A 1YSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HYY A;  4L94 A;  4MTX A;  3TZ5 A;  1ZXM A;  4LWG A;  4BQJ A;  1Z59 A;  2H8M A;  4O07 A;  3A0Y A;  5F5R A;  4GT1 A;  1YT0 A;  2YE6 A;  4R1F A;  4URM A;  1Y8N A;  1YS3 A;  1BKN A;  1BYQ A;  2BZ5 A;  4K4O A;  4MP7 A;  2GQP A;  4XTJ A;  2YI0 A;  4H81 A;  4JAU A;  3U67 A;  5L3J A;  5M4E A;  2XAB A;  2WI7 A;  3RLP A;  3TUH A;  4AWQ A;  4WUC A;  3QDD A;  1UYL A;  4FCP A;  2BU7 A;  2YKB A;  4ASB A;  2YI7 A;  5D7R A;  1UY7 A;  2FYP A;  2WI1 A;  2YGF A;  4NH9 A;  2XX5 A;  4ASF A;  1YER A;  2K5B A;  5FND A;  1L0O A;  2ESA A;  4XIQ A;  4L93 A;  4XCJ A;  4URL A;  4BQG A;  2CCT A;  2XDX A;  2BYI A;  3GIE A;  3K60 A;  4L8Z A;  4BIU A;  3A0Z A;  3RLQ A;  1I5A A;  2IOQ A;  1TIL A;  3FT8 A;  2XK2 A;  3T10 A;  2YE7 A;  5M4P A;  4XC0 A;  4MT8 A;  4FCR A;  4XIR A;  4U93 A;  4V25 A;  3SL2 A;  3R4M A;  1AJ6 A;  3R91 A;  2YE4 A;  4LWI A;  1NHI A;  2YE3 A;  3MNR P;  2FTK A;  2VW5 A;  4CWP A;  1I5C A;  4PL9 A;  4CE3 A;  3OW6 A;  4JQL A;  2Q8I A;  1YC3 A;  4ASG A;  1S16 A;  4I5S A;  2WI2 A;  4JAS A;  4YKZ A;  3EHF A;  3EHG A;  4AWP A;  4L90 A;  5D7D A;  2O1W A;  2XX4 A;  2WWW A;  4V26 A;  2XHR A;  2ZDX A;  3CGZ A;  3HYZ A;  4WUB A;  4PRX A;  4YKT A;  3A0R A;  1YET A;  4DZY A;  1UYH A;  3B27 A;  3EKO A;  1B63 A;  3ZRX A;  1UYK A;  5CTX A;  3O0I A;  2YE5 A;  5CTU A;  2EXL A;  3K98 A;  2QF6 A;  3ZM7 A;  4CWO A;  1Y8O A;  2HG1 A;  2YKI A;  1A4H A;  3C11 A;  4XE2 A;  4URN A;  1JM6 A;  5D7C A;  4E02 A;  3JZ3 A;  1B62 A;  4KFG A;  1TC6 A;  2IWU A;  2BU2 A;  1AM1 A;  2IWS A;  2XDK A;  1US7 A;  4MOT A;  1I58 A;  1B3Q A;  1H7U A;  4HYP A;  1BGQ A;  3O6O A;  3FV5 A;  1KZN A;  3EHH A;  1AH6 A;  4URO A;  4MBC A;  4P8O A;  4LWE A;  2YE8 A;  3H4L A;  3RKZ A;  4ZKI A;  4KP4 A;  1UYC A;  4KSG A;  4HY6 A;  2BSM A;  2O1U A;  1QY8 A;  2WEP A;  1UYD A;  3HZ5 A;  2YEE A;  5BOC A;  5M4K A;  2XX2 A;  5CTW A;  4KSH A;  3QTF A;  5FNF A;  4B6C A;  1EA6 A;  4MPC A;  2QG2 A;  4GQT A;  4CE1 A;  1S14 A;  3T0H A;  3R4P A;  2BRE A;  2YJW A;  4O05 A;  3OMU A;  1THN A;  1YT1 A;  4YKW A;  5C93 A;  2Q8G A;  1TC0 A;  2VCI A;  4EFT A;  1MX0 A;  5CPH A;  2FWZ A;  5B1O A;  4EMV A;  1GKZ A;  3U2D A;  4MP2 A;  2YEG A;  1UYF A;  1UY6 A;  3Q5L A;  3NMQ A;  4YKY A;  1TH8 A;  4EFU A;  2YKJ A;  3ZXO A;  3ZRW B;  1UY8 A;  4ZVI A;  2QM7 A;  4FCQ A;  4O09 A;  4DUH A;  2CH4 A;  4GT8 A;  4XDM A;  1U2O A;  4LWH A;  4PRV A;  2BU8 A;  4XIT A;  2UWD A;  3TTZ A;  1JOY A;  4XIP A;  2JKI A;  2LFR A;  1QZR A;  3GIG A;  2WI6 A;  3T0Z A;  2YED A;  3C0E A;  3ZRV A;  4GEE A;  1H7S A;  5IDM A;  5M4M A;  5GGZ A;  4CWN A;  4BXI A;  2GFD A;  3BMY A;  2YGE A;  2FWY A;  1UYM A;  5IDJ A;  4O04 A;  3HHU A;  2VCJ A;  4LPB A;  2XJJ A;  3P32 A;  2BU6 A;  4CWF A;  3CWV A;  4XD8 A;  3H80 A;  4R3M A;  4KQV A;  1GKX A;  4CE2 A;  3A0X A;  2YE2 A;  5M4H A;  2YKE A;  3OPD A;  5IN9 A;  3GIG B;  3LPS A;  2WI3 A;  3CRK A;  3INX A;  3HEK A;  2YKC A;  2XDS A;  3B28 A;  4WUD A;  2BT0 A;  2QG0 A;  2H55 A;  2CCS A;  5D6P A;  3TK1 A;  3B26 A;  3VHC A;  4GCZ A;  2QM8 A;  2Q2E B;  3ZRW A;  2VWC A;  4XKA A;  1YSZ A;  2YGA A;  3K97 A;  4I3H A;  4BAE A;  2O1V A;  3ZXQ A;  4U7N A;  4HXW A;  1EI1 A;  2CCU A;  3IED A;  1UYE A;  3R4N A;  2YK2 A;  1KIJ A;  3DGE A;  2E0A A;  1YC4 A;  4NH7 A;  1F51 A;  1NHH A;  4HZ5 A;  3A0W A;  3O2F A;  3WQ9 A;  4EGK A;  5M4N A;  2AKP A;  1Z5A A;  2YI5 A;  4E00 A;  4LP0 A;  4JYB A;  3WHA A;  1QYE A;  2BTZ A;  4R3A A;  3D36 A;  3OWB A;  2XDU A;  4YKR A;  2YEC A;  3A0T A;  3T1K A;  3GIF A;  4MB9 A;  3ZKB A;  3MD0 A;  2BRC A;  1Z5C A;  2YEI A;  2IOP A;  4BIZ A;  5B1N A;  2YI6 A;  3TZ0 A;  4JAV A;  2CGF A;  2YEJ A;  3G75 A;  4HYM A;  1UYI A;  2YEB A;  1ZWH A;  2WEQ A;  1ZXN A;  1BXD A;  4XKO A;  4CWS A;  3Q5K A;  2C2A A;  4EGH A;  5J71 A;  3BM9 A;  3PEJ A;  2YEH A;  3T2S A;  1NHJ A;  2HKJ A;  3TZ4 A;  4CWQ A;  1Y4S A;  1YC1 A;  2XCM A;  5CF0 A;  2XHX A;  4CWR A;  4PU9 A;  3D2R A;  1GJV A;  3EKR A;  5J6A A;  2XD6 A;  4LWF A;  4W7T A;  4HY1 A;  2XJG A;  3OWD A;  2YEF A;  4QPK A;  2Q8H A;  1I5D A;  1OSF A;  4X9L A;  1Y8P A;  2FXS A;  2YEA A;  2QFO A;  3EHJ A;  4L91 A;  3K99 A;  1Y4U A;  3LNU A;  3R92 A;  4QPJ A;  2WER A;  3HZ1 A;  4B7P A;  4O0B A;  4FPP A;  3CRL A;  4YKQ A;  2ZKJ A;  3TZ2 A;  4H85 A;  3D0B A;  3ZKD A;  3PEH A;  4E01 A;  2JJC A;  2XDL A;  4ASA A;  3INW A;  3G7E A;  4MPE A;  2YJX A;  1U0Z A;  3ZCC A;  1UY9 A;  2ZDY A;  1YES A;  4AWO A;  3B24 A;  4KTN A;  3G7B A;  4FMT A;  1I5B A;  2HCH A;  3B25 A;  1YT2 A;  2YE9 A;  1ZW9 A;  3U2K A;  2BU5 A;  4P7A A;  5BOD A;  2BYH A;  4GGL A;  2P67 A;  4NH8 A;  3VAD A;  2CG9 A;  3CGY A;  4YKX A;  4LC1 A;  4XCL A;  3FT5 A;  5CTY A;  2WI5 A;  4HZ0 A;  4CWT A;  1IXM A;  1UYG A;  5D6Q A;  3KE6 A;  4EEH A;  4JYC A;  1ID0 A;  1TID A;  2IWX A;  5F3K A;  4U7O A;  4AS9 A;  2Q8F A;  4EM7 A;  3R4O A;  2YK9 A;  5FWK A;  3RLR A;  4Q20 A;  4YKU A;  1Z5B A;  2LFS A;  1TBW A;  4EGI A;  3NXS A;  2ZBK B;  3VHD A;  1MU5 A;  1R62 A;  1AH8 A;  4XKK A;  1I59 A;  3Q5J A;  2XHT A;  4MPN A;  2IOR A;  2XJX A;  4GFN A;  1AMW A;  4HXZ A;  1PVG A;  2PNR A;  4H7Q A;  5FNC A;  3VHA A;  2WI4 A;  1YSR A; 
#chains in the Genus database with same CATH topology
 3ZMS A;  3IFX A;  3MAQ A;  2LW7 A;  5B5E Z;  3TZ5 A;  4DV7 O;  2D3O W;  4LFA B;  5F5R A;  1AIL A;  3ZX6 A;  5IWA O;  1VQ8 V;  5EK0 A;  1XQ8 A;  1Y8N A;  3AG4 B;  4OGQ B;  1XMO B;  1YS3 A;  4K4O A;  1QR8 A;  4JTC B;  1NR7 A;  2LGW A;  2QA4 V;  5DN6 G;  1I0H A;  4BAY A;  1K5S A;  2ZDI C;  5GTI Z;  4ZHQ A;  2BCC H;  4JYA B;  2WI7 A;  3KZI Z;  3FX7 A;  4H37 A;  3TUH A;  1OCR C;  4WUC A;  1ENV A;  2UUC O;  3QDD A;  4FCP A;  4TV8 A;  5ITZ B;  2BU7 A;  2N74 A;  5IJ9 B;  1VF7 A;  3IC7 A;  1YI2 V;  1VF5 B;  5FND A;  4I0X A;  5J9P C;  4URL A;  4BQG A;  3FKS G;  1PPJ H;  1DGS A;  1VQ7 V;  3IGA C;  1R6N A;  2AZ2 A;  3BRC A;  5JQG B;  4H0L B;  1R3L C;  3T10 A;  5A2Q N;  4X64 B;  4MTO A;  1OCZ C;  4MT8 A;  3H1K H;  2WSS G;  4U93 A;  2FL4 A;  4H33 A;  1AJ6 A;  4DV1 O;  1K9M W;  3MNR P;  1H2K A;  5AG2 A;  3G80 A;  1I5C A;  4PL9 A;  1XI1 A;  3OW6 A;  3OTO O;  3P30 A;  4JQL A;  1SQV H;  2Q8I A;  1OV9 A;  3UM7 A;  4ASG A;  4ICG A;  4BW5 A;  1S16 A;  2VRZ A;  4JGS A;  1XHZ A;  4DR1 B;  3SGI A;  1Y74 B;  4O2B A;  1YJ9 V;  2OTJ V;  5D7D A;  3CCJ V;  4I9W A;  3HKC A;  2ZDX A;  3HYZ A;  4WUB A;  1E79 G;  2W0F C;  4EEQ A;  3AG1 B;  1YET A;  2QKC A;  3M99 B;  2K9P A;  3JAR B;  4I4T A;  3E22 A;  3ZRX A;  2DYS C;  2YS8 A;  1J5E O;  2DJV A;  1UYK A;  3O0I A;  3B2E E;  4JI1 B;  3SYQ A;  3ZRS A;  5KA6 A;  1MA1 A;  4CWO A;  1Y8O A;  2HG1 A;  1ZSP A;  4DR7 O;  5LP6 C;  1A4H A;  4XE2 A;  3WB0 A;  1SRY A;  4X1Y A;  4O2B B;  1JM6 A;  2IW5 A;  4E02 A;  2ZR3 A;  3K08 A;  1Q82 W;  1TC6 A;  4IT5 A;  3OEH G;  1M57 C;  1JR9 A;  1O9G A;  4YJ3 B;  5BMV B;  1K3E A;  4UCU A;  1BGQ A;  3HKB A;  2F66 C;  4P8O A;  2ZIN A;  3RKZ A;  4LWS B;  3EFF K;  1XNR B;  2XAJ A;  4KSG A;  3D36 C;  4B7E A;  4B3M O;  2O1U A;  1K73 W;  3JAW B;  4WFA V;  1QY8 A;  1K97 A;  1ZLZ A;  4R50 A;  1W0K G;  3FB5 C;  4CH5 A;  5M4K A;  4X9Q A;  4O4I B;  4DR6 O;  3QTF A;  1AI5 A;  2GTS A;  4CZZ A;  1NTZ H;  4MPC A;  4ZI7 A;  1TUB A;  3JCZ A;  1THN A;  5F2V O;  3K5N A;  5LOV B;  1YCI A;  4L8J A;  2OT5 A;  3H1J H;  3ABL B;  3E89 A;  3U10 A;  4O4H B;  4UXN A;  1NU1 H;  5BR8 O;  2VCI A;  1I08 A;  4DV6 O;  4E72 A;  5B3S C;  5D5Q A;  2X0L A;  3R66 A;  2YI9 A;  5B1O A;  2DWE C;  1D5A A;  1NBM G;  3FYE B;  3W7X A;  2ZCE A;  3K0D A;  5L3G A;  4MP2 A;  4YY3 O;  4YKY A;  3CC4 V;  4F6R B;  2YKJ A;  1H2M A;  4ZVI A;  3CB2 A;  3RW0 A;  2QM7 A;  3J80 N;  2FYU H;  3ZHV A;  1M1K W;  2CH4 A;  3G4S V;  1Q81 W;  1L1F A;  1NI8 A;  4LWH A;  4PRV A;  2UWD A;  3SR2 C;  2Z0A A;  2LGQ A;  2GUZ B;  2JKI A;  3CCV V;  1SQB H;  5FNV A;  2EIL B;  2LFR A;  3E2E A;  3OUS A;  3GIG A;  4DR5 O;  4F6R A;  2ZDI A;  3K58 A;  3T0Z A;  3C0E A;  1N36 O;  2DOS A;  1UJW B;  1H7S A;  1KQS U;  2ZD9 A;  4OX9 O;  4DUZ B;  4BXI A;  5JJE B;  3L71 H;  1UYM A;  2E74 B;  1ROP A;  3B4S A;  3BY6 A;  1YZB A;  5KHH A;  3L72 H;  3P32 A;  2EIN B;  3H80 A;  4R3M A;  4FM1 A;  4KQV A;  1H38 A;  4DUY B;  1NH2 B;  2YEV A;  4JTD B;  4YIP A;  4D7T A;  5EC1 C;  4LBE C;  1QVG U;  2YDE A;  3C3S A;  4MVO A;  4OXS A;  3GIG B;  1OJH A;  1YIT V;  4WBN A;  5GW7 A;  3INX A;  1Y66 A;  3CCQ V;  3B28 A;  2CE4 A;  2QG0 A;  2H55 A;  4Z1M G;  1IVS A;  2LW1 A;  3TK1 A;  4NVP A;  4GCZ A;  3OT7 A;  2QM8 A;  2Q2E B;  3CCS V;  3ZRW A;  2FB5 A;  1ARO P;  2LJ2 A;  1K7D A;  1ZWI C;  3ZXQ A;  4X62 O;  1HNW B;  1AI7 A;  4FLY A;  4OPA A;  3R4N A;  3OTO B;  1KP2 A;  2YK2 A;  3BA8 A;  3ASO C;  1KIJ A;  2X7R B;  3DGE A;  4JZ2 A;  3CE2 A;  1YC4 A;  4NH7 A;  1F51 A;  1NJI W;  3O2F A;  3E8G A;  3IJ4 A;  1L0L H;  1SC5 B;  2R9R B;  4XBF A;  4E00 A;  5L3D A;  1VEW A;  2XTA A;  5B66 Z;  1JJO A;  4RUF A;  3ZN0 A;  4DK1 A;  2CAZ C;  3SDL A;  3OWB A;  1YVW A;  2XDU A;  1V55 C;  3A0T A;  3T1K A;  3B8M A;  2Z5U A;  1I7F A;  2UXX A;  1J5E B;  4F6E A;  4PA9 A;  2YEI A;  4XDK A;  4IGG A;  4F4L A;  1HWY A;  2CGF A;  4GKK O;  3APO A;  2YEJ A;  4HZ3 A;  3ZN1 A;  5DEC A;  1BXD A;  3G71 V;  5JCO A;  3Q5K A;  4CWS A;  4DV7 B;  1HR0 B;  2WLL A;  5J71 A;  5K1X A;  2NLJ C;  1NHJ A;  5LYJ B;  4CWQ A;  1DTO A;  5L3C A;  1YC1 A;  1BT8 A;  5EC2 C;  4MW3 A;  2XHX A;  4O2A A;  3RYF A;  3UO2 A;  4DR2 B;  3LMM A;  1IX9 A;  2JRI A;  3D2R A;  2DE0 X;  1HNX B;  4B3R B;  5LGN A;  2XD6 A;  3CCE V;  2KSD A;  4W7T A;  4GX5 A;  2XAS A;  3LUT B;  4JAA A;  2WLL B;  4X9L A;  1GM7 A;  2V1D A;  1Y8P A;  2JJ2 G;  3EHJ A;  4JI4 B;  1KKD A;  1Y4U A;  5JWP A;  1XDC A;  2OIE A;  5LYJ A;  3ASN B;  1XMQ B;  2WER A;  3HZ1 A;  4B7P A;  3CRL A;  4IIJ B;  4UCR A;  2A79 B;  4O2A B;  1FXH A;  3RYF B;  4H85 A;  3PEH A;  4W4L A;  2XDL A;  3ASN C;  3E35 A;  2YJX A;  3W7U A;  1U0Z A;  2CH7 A;  1YES A;  3B24 A;  3H1L H;  2E3C A;  4MW8 A;  2EIK B;  2YE9 A;  1FPO A;  1J95 A;  5GON A;  5KX5 B;  5BOD A;  2P67 A;  3A0H Z;  1VMG A;  1ORQ C;  5FPR A;  1XL6 A;  2HJF C;  1ZTE A;  2CG9 A;  2PGG A;  4YKX A;  4LC1 A;  3FT5 A;  3FB8 C;  4HZ0 A;  4CWT A;  1IXM A;  4K8Z A;  3W7T A;  4FK5 C;  4EEH A;  1M5I A;  2JS5 A;  5IYB O;  5F3K A;  2EX3 A;  4U7O A;  5J2T A;  4O4L A;  4EM7 A;  1PNK A;  3R4O A;  2YK9 A;  5EBM C;  3RLR A;  3RYC A;  4YKU A;  1SA0 A;  4JYY A;  1K92 A;  4LCU C;  3RYH B;  5CA1 A;  1Z5B A;  1GN2 A;  1TBW A;  4PDV A;  4LFB O;  4EKW A;  2ZBK B;  5DED A;  4JI5 B;  3VHD A;  2QGN A;  5JEN A;  4UB6 Z;  3ABK B;  4DUZ O;  4OX9 B;  3VQY A;  3GWK C;  1R6K A;  1I59 A;  2AZ0 A;  2IOR A;  4LFC O;  3E83 A;  4LP8 A;  2PNR A;  4CH6 A;  3ZS8 C;  4I9Q A;  5KMG B;  2GBO A;  4ABM A;  3Q4H A;  4GX0 A;  1YSR A;  3CRQ A;  4FM0 A;  1B04 A;  1R3K C;  5H5N A;  4LWG A;  5JJJ B;  5LP6 A;  1Z59 A;  2H8M A;  4PEL A;  2JGU A;  4O07 A;  3A0Y A;  1NVP B;  5A9G A;  1YT0 A;  2PYJ A;  2YE6 A;  1FJG B;  4J9Y B;  4URM A;  1BYQ A;  3K5O A;  4IHJ B;  4J11 A;  3RGB A;  4PV1 B;  2KG7 A;  2GQP A;  1Y74 A;  2E76 B;  2GSM B;  4JAU A;  2ITD C;  3K5M A;  2QWO B;  3KCX A;  3U67 A;  1BQZ A;  5L3J A;  2HEP A;  5IE9 A;  4J7Z A;  2UXD B;  1AJN A;  4DR6 B;  3RLP A;  3TXQ A;  4GLX A;  2ZE8 A;  4FIP C;  4AIL C;  4LF5 O;  3JAR A;  3H01 A;  4I4T B;  2YKB A;  2OWO A;  1UY7 A;  2FYP A;  1FD9 A;  1N34 B;  2Q69 A;  3K57 A;  1NS1 A;  1YER A;  1L0O A;  4XIQ A;  4L93 A;  4XCJ A;  4IHJ A;  2XDX A;  3UT5 A;  2BYI A;  3GIE A;  4DV6 B;  1P84 F;  3K60 A;  4UCS A;  4N23 A;  5JH7 B;  4DV5 B;  3RLQ A;  2BSK A;  3K79 A;  3I55 V;  4G28 B;  3WB2 A;  1TIL A;  2XK2 A;  5M4P A;  2ITC C;  2YIB A;  1AP6 A;  3HKB B;  4K3A A;  4XIR A;  1VQK V;  1Q86 W;  2ZNJ A;  2PY5 A;  2WAM A;  4JI0 O;  3VOU A;  3EHB B;  1KBH A;  1M93 A;  4GUN A;  3WG7 B;  3UT5 B;  4CE3 A;  1WA8 A;  3B40 A;  2VQE O;  1GN4 A;  3CRA A;  4DYL A;  1YC3 A;  2GV9 A;  2FML A;  1IZ3 A;  3L9D A;  1IXB A;  4I5S A;  2CTW A;  2HHI A;  2ZE7 A;  2WI2 A;  4X1K A;  3AG7 A;  3U11 A;  4DR5 B;  4WFF A;  1W0J G;  2V7Q G;  1EN6 A;  3CXH F;  4MVR A;  4L90 A;  4FZ1 A;  2PUS A;  4MVZ A;  4ZHQ B;  3GVM A;  2KKW A;  3CGZ A;  2CTQ A;  3RYI A;  4YKT A;  4X64 O;  3A0R A;  4OPH A;  2BTQ B;  4TSF G;  5IJ9 A;  5J2U B;  1P49 A;  4JI4 O;  3DXR B;  5CTU A;  1GMG A;  4FZ0 A;  4JI7 O;  2QF6 A;  1Z2G A;  3DSQ A;  2AXT Z;  1A32 A;  5LL6 Y;  4URN A;  3E8F A;  2CGO A;  5LGT A;  1Q5O A;  1QVF U;  2XAQ A;  1B62 A;  4J7J A;  1AM1 A;  1D2D A;  2JGD A;  2HVJ C;  3O6O A;  1KZN A;  1AH6 A;  4URO A;  1CPY A;  3ETQ A;  3OGC C;  1YJN V;  4MBC A;  4ZKI A;  5BY1 A;  2F1M A;  3IC9 A;  4HNA B;  3QF7 A;  2ODM A;  1EM1 A;  4NTY A;  2WEP A;  2GTA A;  1F7Y A;  3HKD A;  2Y4T A;  1ZAU A;  5BOC A;  1WB7 A;  3JAK A;  5CTW A;  1BL8 A;  1QLN A;  4DV0 O;  2ZIM A;  4B6C A;  4JI1 O;  2XT9 A;  5JVD A;  4B08 A;  1S14 A;  3T0H A;  1QBZ A;  2Q9L A;  3E8B A;  3HKC B;  4YKW A;  1E1Q G;  3CS5 A;  1NT2 B;  2UUA O;  5D5P A;  1F4N A;  4EFT A;  3AG2 B;  1OZ0 A;  2FWZ A;  2YXL A;  1TGO A;  4I7Z B;  3JAK B;  4O4J A;  2YIA A;  2IJH A;  3QNE A;  3AG1 C;  4J9Z B;  3U2D A;  2YEG A;  5LXT B;  2DYS B;  1TH8 A;  1HR0 O;  4EFU A;  4GZR B;  4CH4 A;  1KYO F;  4FCQ A;  1M4U A;  1SS3 A;  4JI8 O;  3T4D A;  2B1G A;  3OTF A;  4UV9 A;  1IBL B;  2BOB C;  4X20 B;  1U2O A;  3R65 A;  2JDI G;  2BU8 A;  3OMI B;  1JOY A;  4B3S O;  1SQG A;  2ETN A;  5LBQ A;  4LF6 O;  5H6R A;  4NTX A;  4O4I A;  2YED A;  2GDS A;  3ETE A;  4GEE A;  4G27 B;  2OTL V;  1XRE A;  4X8A A;  4RAI A;  4RWU A;  2YI8 A;  3OFN G;  2VCJ A;  1KB9 F;  2PF4 E;  4IYI A;  1TUB B;  1F4M A;  1VQ5 V;  2Z3Y A;  4CC6 A;  1K34 A;  4FJC C;  1SET A;  1M57 B;  5LOV A;  4BIO A;  5BZB A;  1YEW A;  5KLV H;  2EJR A;  3A0X A;  1IBK B;  2UXC O;  5IN9 A;  3U0Z A;  4RQE A;  5H6Q A;  1R3I C;  5B1A C;  4DV4 O;  2YIC A;  4FLX A;  4PHZ A;  3K3W A;  1W2B U;  1JVM A;  3RBZ A;  3ZMT A;  3CD6 V;  2YKC A;  2XDS A;  2C1G A;  4J41 A;  5KA5 A;  3B26 A;  2NR5 A;  3GWO A;  4UV8 A;  5CB4 B;  3JSL A;  4RO2 A;  4I3H A;  3SYO A;  5KAI Z;  2UXN A;  4BAE A;  3BPZ A;  2O1V A;  1YF2 A;  4K35 A;  1EI1 A;  1N36 B;  3K06 A;  1WAZ A;  1VQL V;  2L6L A;  3BVO A;  5CA0 B;  4YJ2 A;  4X66 O;  1JA8 A;  4EGK A;  5M4N A;  5IYZ B;  5CBH A;  4JI6 O;  4I50 B;  2YI5 A;  2MK3 A;  4JYB A;  3E86 A;  4LH6 A;  3N2G B;  4ZBM A;  4R3A A;  5EYP B;  3D36 A;  2YEC A;  4DRX B;  2A06 H;  3GIF A;  4X65 O;  3ZKB A;  2JVD A;  3QTC A;  2DYR C;  4Z2W A;  2BRC A;  1Z5C A;  1VIB A;  4LFC B;  3SJA C;  2PYL A;  4K8X A;  2IU0 A;  1GM9 A;  2XAF A;  4HYO A;  5GON B;  4B3T O;  4R7C A;  3PEJ A;  4FM2 A;  1RSO A;  2HLD G;  2N05 A;  1V54 C;  1MZF A;  2A9H A;  2HKJ A;  5K1P A;  1Y4S A;  2P6J A;  3L73 H;  4CWR A;  5LMU B;  1KU9 A;  2OIG A;  3FAV B;  1EN5 A;  3S5T A;  1L0N H;  5IYC O;  3LDC A;  1X4T A;  4RUE A;  4K0K O;  2IJI A;  3WFV A;  3RYC B;  4LWF A;  3DC6 A;  4HY1 A;  2XJG A;  2Q8H A;  2XUM A;  2EIM C;  1I5D A;  1OSF A;  1MG1 A;  2P7T C;  5KAF Z;  3W7S A;  1DLB A;  2MW2 B;  1H2S B;  1VQ9 V;  3LNU A;  1BCC H;  1XUQ A;  3R92 A;  3SPG A;  1XNQ O;  5L3E A;  4LF4 O;  3ZMV A;  4O0B A;  2UUC B;  4CBC A;  4FPP A;  1K4C C;  3N2K B;  1N33 O;  4GKJ B;  1KP3 A;  3TZ2 A;  2QEX V;  4JTA B;  4QE9 A;  2P4V A;  5KMG A;  2Q6A A;  3DTU B;  1AR1 B;  1SZX A;  3KKY A;  4BR6 A;  3QVN A;  3INW A;  3G7E A;  4MPE A;  5JJN B;  5LP6 B;  4LF9 O;  3JAL A;  1UY9 A;  2ZDY A;  3O9O A;  1FXK B;  4FMT A;  2HCH A;  4FLT A;  3B25 A;  1HNX O;  4X1I B;  4Z1V A;  4B3R O;  1ZW9 A;  5EIB D;  4P2Z A;  5KUK A;  4P7A A;  1COW G;  4GGL A;  3SJQ C;  1AI4 A;  2P90 A;  3ICX A;  3CGY A;  4YIO A;  3BEH A;  1TVK B;  4JI8 B;  5L3B A;  2QWQ B;  4DV1 B;  4NXN B;  3H9V A;  2WI5 A;  4RQF A;  3ABM B;  4X89 A;  1ID0 A;  1TID A;  1HNZ O;  1G4Y B;  2QJ1 A;  3SYC A;  1JMK C;  1FXK A;  1V55 B;  3N27 A;  4MVU A;  1B06 A;  1MZE A;  4MTG A;  5FWK A;  1MSD A;  1RPR A;  3NXS A;  4AHC A;  3ETG A;  5JH7 A;  1Q3E A;  3ZBH A;  1GH6 A;  5KUM A;  4MVS A;  3CRC A;  5B1B C;  3Q5J A;  2XHT A;  5FLX N;  1Y4M A;  4UCO A;  4LF8 O;  3SPC A;  1PVG A;  4H7Q A;  1M56 C;  2UXB O;  5LMN B;  4EFB A;  2HFE C;  4NKG B;  3VHA A;  2WI4 A;  3HYY A;  1FYJ A;  4L94 A;  4U3J B;  2RJZ A;  3CJH A;  3OW2 U;  4TV8 B;  3RT3 C;  5ITZ A;  1S5J A;  2CH7 B;  5HFL A;  3H1I H;  5GTH Z;  4R1F A;  2QDO A;  1TUE B;  4UB8 Z;  1BKN A;  2BZ5 A;  4MP7 A;  1AB3 A;  2YI0 A;  1JFF B;  1K8A W;  3HR0 A;  2QTO A;  3JAS B;  4DV0 B;  1MOF A;  4CH3 A;  2ZQM A;  2BTQ A;  3CRR A;  4DO2 A;  3MDS A;  2EIL C;  2EZO A;  3AK1 A;  5J2T B;  4O4L B;  3F5T A;  4JI3 O;  3TET A;  4DR4 B;  2WI1 A;  2XX5 A;  4ASF A;  2HHH B;  2K5B A;  3JAM N;  2ESA A;  1SZT A;  1RM1 B;  1US6 A;  1SA0 B;  2CCT A;  2QKS A;  4L8Z A;  1NZ6 A;  1XL4 A;  3K9A A;  4BIU A;  3A0Z A;  4XDL A;  5IJ0 A;  2IOQ A;  1AR5 A;  2XND G;  3OM3 B;  4B7K A;  4CS4 A;  5BR8 B;  3RVY A;  3C90 A;  1S76 D;  3JCU Z;  1LUW A;  4NYK A;  3ABK C;  2ZIO A;  4V25 A;  3CHX A;  3SL2 A;  3SPI A;  2UU9 O;  4YHH B;  3R4M A;  3R91 A;  3OUF A;  4LWI A;  4HNA A;  1NHI A;  2FTK A;  4CWP A;  1Q7Y W;  3QO8 A;  4QNH B;  2WA3 A;  2Q68 A;  1MNG A;  4PD4 F;  1I94 O;  4LF5 B;  1NKD A;  1FAF A;  2X6C A;  4H13 B;  4UCT A;  1EZV H;  4UVC A;  4B3S B;  1P4R A;  4JAS A;  5LMU O;  4NXM B;  3EHF A;  3SJC C;  1WP8 A;  4IL6 Z;  2CDY A;  1X59 A;  5KHK A;  3J7A U;  2H3O A;  4LF6 B;  1Q90 D;  2O1W A;  2WWW A;  2Y48 A;  2A7W A;  3O65 A;  3ZJZ A;  2XHR A;  3SYP A;  3CC2 V;  4PRX A;  1UYH A;  3B27 A;  3EKO A;  1GK9 A;  1B63 A;  3CPW U;  4MTF A;  1I5X A;  3X2Q C;  1R73 A;  1T5E A;  3OR7 C;  3CEI A;  2QE7 G;  4JI0 B;  5LXT A;  2YKI A;  3C11 A;  3B8N A;  2W6J G;  1P7G A;  4XDJ A;  2E5L B;  1B6Q A;  3CXC U;  1BMF G;  3X2Q B;  3JZ3 A;  1HW7 A;  2B5U A;  3BHP A;  3ASO B;  2IWU A;  3LSU A;  2XDK A;  1US7 A;  4MOT A;  4TT3 G;  1I58 A;  1BS3 A;  1WPX A;  5LA6 B;  4LF9 B;  1KC8 W;  3EHH A;  4TUY A;  2ZT9 B;  3FFQ A;  2G38 A;  3E22 B;  4LWE A;  2YE8 A;  1UYC A;  2WA4 A;  5BXZ A;  4HY6 A;  2JEU A;  3HPL C;  1MMM A;  2RCV A;  4O4H A;  2ZM6 O;  1UYD A;  4J10 A;  5IT9 N;  3HZ5 A;  4TV9 B;  4FLZ A;  1DF4 A;  2P5O A;  1BQ0 A;  3K9S A;  1ZX3 A;  4D7S A;  2VQF O;  4BWA A;  2CTR A;  3THO A;  3LSQ A;  4X66 B;  4LR3 A;  3WG7 C;  2DMX A;  4JI7 B;  1Z5V A;  4JI6 B;  3TGU H;  1E1R G;  3ZMZ A;  5CBG A;  2F23 A;  4LNU A;  3R4P A;  3I56 V;  4KFM A;  1YTF D;  2BRE A;  2YJW A;  1YT1 A;  1FS0 G;  1CP9 A;  2ZR2 A;  3OR6 C;  4P30 A;  1BHB A;  1XEQ A;  3UQ8 A;  4QGP A;  1BHA A;  4JV5 O;  2YXY A;  5J2U A;  1XHX A;  1DF5 A;  4EMV A;  1L8D A;  2ZKO A;  1HDJ A;  1GKZ A;  3ABM C;  1M90 W;  5C8Y B;  1UYF A;  3ZHU A;  1UY6 A;  3Q5L A;  3NMQ A;  5LMN O;  2EBO A;  3H1H H;  4B3T B;  2Q67 A;  1QNM A;  2ZE5 A;  2HP8 A;  2RN9 A;  2VWK A;  1YHQ V;  4GKK B;  2DQ0 A;  2F43 G;  4DUH A;  4GT8 A;  4XDM A;  3BA9 A;  2ZE6 A;  2Q7H A;  1SKV A;  1R3J C;  1PV0 A;  2WLJ A;  1JQ0 A;  1OCC C;  2H94 A;  3FB7 C;  4XIT A;  2QSA A;  2IJJ A;  2YEV B;  4CC5 A;  5IYZ A;  3T1C A;  4MVQ A;  1FKA O;  1M56 B;  1QZR A;  3M8A A;  1OCO C;  3N2G A;  4EFE A;  4DR2 O;  4JI2 B;  1AR4 A;  3RWR D;  2ADQ B;  5IDM A;  5GGZ A;  5E1A C;  2GFD A;  1XNQ B;  2YGE A;  2FWY A;  5JVD B;  5IDJ A;  3CC7 V;  3HHU A;  2LQT A;  5IYD O;  3S3W A;  4LPB A;  4GKJ O;  1N8R W;  4CWF A;  2EIK C;  1N32 B;  1W59 A;  3AK2 A;  1GKX A;  4CE2 A;  1VF6 C;  2YE2 A;  2BOC C;  5H2F Z;  1XMQ O;  1N0J A;  2JS3 A;  3OPD A;  1K4D C;  1N0N A;  3LPS A;  2WI3 A;  2JJ1 G;  1RSO B;  2PI5 A;  1IUR A;  2CTP A;  1F23 A;  2Y69 B;  2CCS A;  5D6P A;  3T2M A;  1WNS A;  2W6I G;  1S0V A;  4DK0 A;  1S5H C;  2XOK G;  4P9O A;  3CP1 A;  4YHH O;  4XKA A;  4N21 A;  2YGA A;  4KHP B;  3K97 A;  2R9A A;  2M6Y A;  3FYI B;  4HXW A;  3T1Y B;  2Q4P A;  3IED A;  3OGI B;  1UYE A;  5EZY A;  4X20 A;  3L75 H;  3I5D A;  4WBN B;  1NHH A;  4W4K A;  3WQ9 A;  3F7V C;  5LHH A;  5CN0 A;  2XAG A;  4FVM A;  5DM6 V;  1NVP D;  4PDL A;  5L3F A;  1Q6H A;  4ZOL A;  4LP0 A;  2UXC B;  3WHA A;  3VBB A;  2A0L A;  2XAH A;  4YKR A;  1YIJ V;  2HJD A;  4DV3 B;  4J42 A;  1H8H G;  4FLU A;  4YY3 B;  4FFB B;  3EVK A;  4DR3 B;  2DQ3 A;  1GO3 F;  1QQC A;  5B1N A;  1BZK A;  3CCU V;  3RN4 A;  2YI6 A;  3TZ0 A;  3G75 A;  1OHH G;  4QE7 A;  1U96 A;  2JIZ G;  2YEB A;  5EBW C;  1ZXN A;  2Q73 A;  3ML0 A;  4XKO A;  1VQ6 V;  2E5L O;  2QWN B;  2OCC C;  4ZOL B;  3LNM B;  2C2A A;  4EGH A;  3MHS C;  3VQX A;  3CYG A;  3BM9 A;  2VS0 A;  1O9H A;  3T2S A;  2IM9 A;  4TWK A;  3TZ4 A;  3QO5 A;  4MS2 A;  2WLK A;  1S3J A;  1QCE A;  4FFB A;  3AG3 B;  3VQW A;  2ARH A;  5CB4 A;  4I55 B;  5CF0 A;  1GM8 A;  1WLE A;  4WF9 V;  2PZS A;  4JPR A;  3KCY A;  2OYQ A;  1Y67 A;  2YEF A;  4LF7 O;  2LO1 A;  1SQP H;  1WJZ A;  1YDX A;  2V4D A;  1XOU A;  1LUV A;  3MHH C;  3UCS C;  2R9I A;  4DR4 O;  2YEA A;  4ASU G;  4L91 A;  2K1E A;  2HKO A;  4QPJ A;  4H44 B;  3LNN A;  2X6A A;  4YKQ A;  4I55 A;  3F7Y C;  1TA8 A;  1H2N A;  4MVM A;  4DRX A;  3CME V;  4E01 A;  2JJC A;  2F4V B;  1PP9 H;  4JV5 B;  1YXB A;  4ASA A;  4CS2 A;  3CJH B;  1R6T A;  3AG4 C;  3T1H O;  1PKX A;  1AJQ A;  4KTN A;  1I5B A;  4X62 B;  1HNW O;  4L87 A;  3EXA A;  2QWP B;  2WLN A;  3PN1 A;  2BU5 A;  2RDC A;  5CA1 B;  5H9C A;  3JD0 A;  2BYH A;  4IIJ A;  1VAR A;  4NH8 A;  3F5W C;  3VAD A;  1ZL8 A;  1JFF A;  3K0G A;  4PA6 A;  1QLE B;  2YXH A;  4XCL A;  3L74 H;  5CTY A;  5CMU A;  3L70 H;  4AQY B;  5KHI A;  5D6Q A;  2UUB O;  4LF4 B;  4CS3 A;  2R72 A;  2IWX A;  1NH2 D;  2VQE B;  4AS9 A;  4AI8 A;  4C7U A;  2DN9 A;  2DYR B;  2D2C B;  2RQ6 A;  2LFS A;  5KX5 A;  2F93 B;  2WLM A;  2IBZ H;  5JQG A;  4JYA O;  5IJ0 B;  4PI2 A;  1VQM V;  1MU5 A;  1R62 A;  1AH8 A;  1GKF A;  1MAB G;  1QHT A;  4UFZ A;  2Q7E A;  4XKK A;  2N04 A;  1Q6U A;  4MPN A;  2KG7 B;  1AVM A;  1BSM A;  3CRM A;  4A5U B;  1OCC B;  2XHB A;  2L35 A;  3ETD A;  1GN6 A;  4GYC B;  3SJB C;  2E75 B;  3WB1 A;  1Q6I A;  2B9Z A;  1Z5W A;  4J80 A;  1ZUQ A;  4MTX A;  2YC0 A;  4J7K A;  3NR7 A;  3RYH A;  1ZXM A;  2IH1 C;  4BQJ A;  3JAL B;  2LP7 A;  4GT1 A;  1HNZ B;  3JD1 A;  4X1I A;  3ZMU A;  2H8P C;  2CUG A;  2ZM6 B;  2WLH A;  1R1B A;  4JZG A;  4XTJ A;  4H81 A;  1H2G A;  1VF6 A;  3CMA V;  3JAT B;  4MSW C;  5M4E A;  5E79 Z;  2XAB A;  5JCO C;  3Q4H B;  4AWQ A;  2W0X A;  1LNQ A;  1UYL A;  4JF3 A;  4R6Z A;  1PL0 A;  2Q0O C;  4ASB A;  4LF8 B;  2M7W A;  4NR1 A;  2YI7 A;  3UO3 A;  2YGF A;  4NH9 A;  2UXB B;  5D7R A;  5EBL C;  2WLI A;  2P22 C;  3OD4 A;  4Q6G A;  4WFB V;  1WA8 B;  1H8E G;  4X1Y B;  3TJT A;  4ZIB A;  1K5Q A;  5FPO A;  3OMA B;  2R70 A;  1FXK C;  4DV3 O;  2ILM A;  3JAT A;  3HKE A;  1I5A A;  1BGY H;  3FT8 A;  4U3F H;  2YE7 A;  1GAX A;  4YJ3 A;  2Q0A A;  5BMV A;  4XC0 A;  1P7B A;  2UUA B;  1AI6 A;  4FCR A;  1JX9 A;  2NNU A;  4LWS A;  2EIJ C;  5B1B B;  2YE4 A;  2WLI B;  3S3X A;  2YE3 A;  3JAW A;  2VW5 A;  1GTO A;  4DR7 B;  1KD1 W;  1IBM B;  2AHZ A;  3G6B A;  3STL C;  1K33 A;  2EIJ B;  3HKE B;  1AP5 A;  4KL1 A;  1JJ2 U;  5IY5 C;  4YKZ A;  2HHH O;  4PA7 A;  3ABL C;  3EHG A;  3APQ A;  4AWP A;  1WPB A;  5HFM A;  2XX4 A;  4FFK A;  4V26 A;  3OAA G;  4P9P A;  2ZXW C;  3JAS A;  5B1A B;  1VP7 A;  4UVB A;  1NR1 A;  2BTO A;  3G67 A;  4DZY A;  4NTW A;  4DW0 A;  3ABT A;  4DXW A;  2OCH A;  1KUQ A;  1XBL A;  1V9P A;  5CTX A;  5KHJ A;  2YE5 A;  2UU9 B;  2EXL A;  2ZXW B;  3K98 A;  3D3I A;  5CA3 A;  4I0X B;  1LR1 A;  3AG3 C;  1NTK H;  3ZM7 A;  4FLV A;  4X1K B;  3HKD B;  1G1X B;  3P3P A;  5D7C A;  2EIN C;  2B1I A;  4UCV A;  4KFG A;  1I94 B;  2BU2 A;  2IWS A;  2PTM A;  4NB5 A;  1RPO A;  1B3Q A;  3JD2 A;  4BW9 A;  1H7U A;  2CK3 G;  4HYP A;  2QKA A;  1M9N A;  3RYI B;  1IBK O;  3FV5 A;  1VQN V;  1NTM H;  4NXM O;  2Y69 C;  1JCH A;  2ADP A;  4LFA O;  4DV4 B;  1PNM A;  3VQV A;  3H4L A;  3B09 A;  2RNB A;  4KP4 A;  3UKM A;  2BSM A;  3DXR A;  5IWA B;  2NN4 A;  1V54 B;  2DW4 A;  3CCM V;  1XMO O;  2YEE A;  1PL4 A;  1G8M A;  2WPD G;  2XX2 A;  4TQF A;  4KSH A;  1GN3 A;  4AQY O;  3B77 A;  5FNF A;  1YSC A;  2UUB B;  2Y4U A;  4D6T H;  1EA6 A;  3J81 N;  1SQQ H;  2JGD B;  2QG2 A;  4GQT A;  4CE1 A;  1WP7 A;  1UPG A;  4E4E A;  4DV5 O;  4O05 A;  1SES A;  3K04 A;  3OMU A;  1SQF A;  4PA3 A;  3CYO A;  4TQD A;  1THZ A;  5C93 A;  4FLW A;  1CEZ A;  2Q8G A;  4DR3 O;  3TXS A;  2ATK C;  1TC0 A;  1MX0 A;  5CPH A;  2AW9 A;  1G6U A;  1KEC A;  2YSU B;  2OCC B;  3ZXO A;  3ZRW B;  1UY8 A;  2O57 A;  3BCC H;  1S72 V;  4O09 A;  2EIM B;  2VQF B;  2HG5 C;  5EZY B;  1XIL A;  3D8C A;  5LA6 A;  1JPX A;  4WFE A;  4TUY B;  5EIB C;  4IYH A;  1EN4 A;  3AEI A;  3ZHS A;  4O4J B;  4DV2 O;  4KXR A;  1SQX H;  3TTZ A;  4XIP A;  1U97 A;  2GHY A;  3HB3 B;  3E8H A;  1FFT B;  4TV9 A;  4LF7 B;  2WI6 A;  1YJW V;  3ZRV A;  5M4M A;  2QM4 A;  4CWN A;  3D3Q A;  4K0K B;  3BMY A;  4ZI7 B;  4O04 A;  4LNU B;  2XJJ A;  1EZJ A;  3ZED A;  2BU6 A;  3FD9 A;  3RFR A;  3CWV A;  4XD8 A;  1IDS A;  3SYA A;  1URF A;  2P4K A;  4WFH A;  3TCU A;  5M4H A;  2YKE A;  3BFR A;  3K03 A;  3CX5 F;  2Q8V A;  3LDE A;  2ZNI A;  4PDM A;  1N33 B;  3T1H B;  3CRK A;  4YJ2 B;  1UFI A;  3HEK A;  1S77 D;  2EUL A;  5C8Y A;  2BT0 A;  4WUD A;  2HR3 A;  3VHC A;  5TIS Z;  2EZP A;  1RP3 B;  5LHG A;  2VWC A;  5EYP A;  1YSZ A;  4YXW G;  1XNR O;  4WCE V;  4JI2 O;  4U7N A;  3JSN A;  2CCU A;  1QLE C;  3A8T A;  3K59 A;  1IBM O;  2CGN A;  2F95 B;  2E0A A;  1WB8 A;  1OCR B;  3RVZ A;  1FFX B;  1N32 O;  4HZ5 A;  3A0W A;  4QIW F;  2AKP A;  1FXV A;  4NXN O;  1Z5A A;  5KHG A;  2GUZ A;  3WU2 Z;  2JEX A;  5FNV B;  3JD4 A;  3AK3 A;  4WFG A;  4UUJ C;  4QJF B;  1QYE A;  2BTZ A;  1PM9 A;  1VQO V;  2BE3 A;  2C1I A;  4EB6 A;  3T4Z A;  4MB9 A;  3ABU A;  5LGU A;  1BE3 H;  3SPJ A;  1OCO B;  3MD0 A;  1QU7 A;  3JYC A;  3QO7 A;  3FAV A;  3BAA A;  4TOI A;  1EFR G;  4BIZ A;  2IOP A;  1OCZ B;  1D5N A;  5CBF A;  4JAV A;  5CA0 A;  1FFX A;  1Q8I A;  4LH7 A;  4KHP O;  4HYM A;  3M7M X;  1UYI A;  1S5L Z;  1ZWH A;  3K5L A;  2WEQ A;  1RFY A;  3T1Y O;  4UVA A;  3P3N A;  4X88 A;  4I50 A;  3CCR V;  1MSW D;  1IBL O;  4HBN A;  5FL7 G;  1ZL8 B;  3LDD A;  1GRJ A;  2YEH A;  2QWR B;  4EB6 B;  1TAE A;  2XCM A;  2Y0I A;  1I5Y A;  3N2K A;  1KMI Z;  2AGA A;  4PU9 A;  4PI0 A;  4DR1 O;  1RM1 C;  3OMN B;  4PA4 A;  1SF9 A;  1GJV A;  2RMK B;  3EKR A;  2YUA A;  5J6A A;  1DK1 A;  3DC5 A;  5LHI A;  3OEE G;  3GB7 C;  3OWD A;  4QPK A;  3ZHR A;  4DW1 A;  1Y76 B;  4R8C A;  4GX1 A;  2FXS A;  2QFO A;  3K99 A;  3CSX A;  2VWJ A;  1WN7 A;  2Y0P A;  1N4C A;  2PI4 A;  2DWD C;  3AG2 C;  3CCL V;  1H2L A;  3CWB H;  3FB6 C;  2ZKJ A;  2FKX A;  3D0B A;  1TVK A;  4JI3 B;  3PJS K;  4PDR A;  4DUY O;  3C3T A;  3ZKD A;  3IAY A;  2HVK C;  1EBO A;  2IU3 A;  4LFB B;  4KUM A;  3OE7 G;  2Q7G A;  2QR4 A;  4JI5 O;  2KQX A;  1Y76 A;  3ZCC A;  4AWO A;  4GX2 A;  3G7B A;  2KB1 A;  3ZIA G;  4G2K A;  3QG5 A;  2A3Q A;  1YT2 A;  4E2L A;  3U2K A;  4B3M B;  3ZHT A;  3SPH A;  2AHY A;  1VQP V;  2IH3 C;  2Q5Z A;  3BAB A;  5B3S B;  1PNL A;  2X6B A;  1HP8 A;  4HAM A;  3A0B Z;  1CXZ B;  3A2F A;  1SER A;  1UYG A;  1Y6X A;  5IY5 B;  3ZHQ A;  3KE6 A;  4JYC A;  4DV2 B;  3W7W A;  2IJK A;  2Q8F A;  1FJG O;  2JK5 C;  4X65 B;  1AJP A;  4U3J A;  4Q20 A;  2YIB D;  2F4V O;  4EGI A;  2UXD O;  1NQT A;  3KG2 A;  2BSK B;  1VQ4 V;  2YID A;  2P06 A;  3LSS A;  1KKC A;  1QR9 A;  4PJ0 Z;  3JD3 A;  2XJX A;  4GFN A;  2EJ7 A;  1AMW A;  4HXZ A;  1PD3 A;  1N34 O;  3STZ C;  5FNC A;  3G6E V;  2QTS A;  1Q43 A;  1YTF B; 
#chains in the Genus database with same CATH homology
 3HYY A;  3K98 A;  3ZMS A;  3IFX A;  4L94 A;  4MTX A;  1R3K C;  3TZ5 A;  3OW2 U;  1ZXM A;  4LWG A;  2IH1 C;  2D3O W;  4BQJ A;  1Z59 A;  2H8M A;  4PEL A;  2LP7 A;  4O07 A;  3A0Y A;  1NVP B;  5F5R A;  4GT1 A;  5HFL A;  1YT0 A;  3JD1 A;  2YE6 A;  4R1F A;  1VQ8 V;  4J9Y B;  3ZMU A;  1TUE B;  2H8P C;  5EK0 A;  1Y8N A;  1YS3 A;  3AG4 B;  2WLH A;  1BKN A;  1BYQ A;  2BZ5 A;  4K4O A;  4MP7 A;  1QR8 A;  2GQP A;  4XTJ A;  4JTC B;  1NR7 A;  2QA4 V;  2YI0 A;  4H81 A;  1H2G A;  2GSM B;  4JAU A;  2ITD C;  3CMA V;  3U67 A;  5DN6 G;  4BAY A;  5L3J A;  1K8A W;  1K5S A;  1AJN A;  2ZDI C;  4MSW C;  5M4E A;  2XAB A;  2QTO A;  2WI7 A;  3RLP A;  1MOF A;  4H37 A;  3TUH A;  1OCR C;  4AWQ A;  4WUC A;  1ENV A;  2ZQM A;  4FIP C;  3QDD A;  1LNQ A;  1UYL A;  4FCP A;  4JF3 A;  4DO2 A;  4R6Z A;  1PL0 A;  2BU7 A;  2EIL C;  3H01 A;  2YKB A;  4ASB A;  3IC7 A;  2M7W A;  2EZO A;  1YI2 V;  2YI7 A;  5D7R A;  3TET A;  1UY7 A;  2FYP A;  2WI1 A;  5EBL C;  2Q69 A;  2WLI A;  2XX5 A;  2YGF A;  4NH9 A;  4ASF A;  1YER A;  2K5B A;  5FND A;  1L0O A;  2ESA A;  1SZT A;  5J9P C;  1RM1 B;  4XIQ A;  4L93 A;  4XCJ A;  4URL A;  4BQG A;  2CCT A;  2XDX A;  3FKS G;  4WFB V;  2QKS A;  1VQ7 V;  2BYI A;  3GIE A;  3IGA C;  1R6N A;  3K60 A;  1H8E G;  4L8Z A;  1XL4 A;  3K9A A;  4BIU A;  3A0Z A;  1K5Q A;  4N23 A;  3OMA B;  4XDL A;  3RLQ A;  1FXK C;  1R3L C;  3K79 A;  1I5A A;  2IOQ A;  3I55 V;  4G28 B;  2XND G;  1TIL A;  2XK2 A;  3FT8 A;  2YE7 A;  3T10 A;  5M4P A;  4XC0 A;  2ITC C;  1OCZ C;  3OM3 B;  1P7B A;  4MTO A;  4MT8 A;  1AI6 A;  3RVY A;  4FCR A;  4XIR A;  2WSS G;  1S76 D;  1VQK V;  4U93 A;  1JX9 A;  3ABK C;  4V25 A;  1Q86 W;  2NNU A;  3SL2 A;  4H33 A;  2WAM A;  3SPI A;  3R4M A;  2EIJ C;  1AJ6 A;  3OUF A;  5B1B B;  2YE4 A;  3R91 A;  4LWI A;  1K9M W;  1NHI A;  2WLI B;  2YE3 A;  3MNR P;  3VOU A;  3WQ9 A;  3EHB B;  2FTK A;  2VW5 A;  1GTO A;  4CWP A;  1Q7Y W;  3QO8 A;  1I5C A;  4QNH B;  3WG7 B;  3OW6 A;  4PL9 A;  4CE3 A;  1KD1 W;  3P30 A;  4JQL A;  2AHZ A;  2Q8I A;  2Q68 A;  3STL C;  1NKD A;  1YC3 A;  3UM7 A;  1K33 A;  2X6C A;  2EIJ B;  4ASG A;  4BW5 A;  1S16 A;  1JJ2 U;  4I5S A;  4JGS A;  5IY5 C;  4UVC A;  1P4R A;  2WI2 A;  4JAS A;  4YKZ A;  3EHF A;  4PA7 A;  3ABL C;  3EHG A;  4WFF A;  1W0J G;  2V7Q G;  1YJ9 V;  4MVR A;  2OTJ V;  4AWP A;  5HFM A;  4L90 A;  2O1W A;  5D7D A;  3CCJ V;  2XX4 A;  2WWW A;  2Y48 A;  4I9W A;  4MVZ A;  4V26 A;  3OAA G;  4P9P A;  2ZXW C;  3ZJZ A;  2XHR A;  2ZDX A;  3CGZ A;  3HYZ A;  5B1A B;  4WUB A;  3SYP A;  3CC2 V;  4UVB A;  4PRX A;  1E79 G;  2W0F C;  1NR1 A;  4YKT A;  3A0R A;  3AG1 B;  1YET A;  4DZY A;  1UYH A;  3B27 A;  3EKO A;  1GK9 A;  4TSF G;  3ABT A;  3M99 B;  4DXW A;  3CPW U;  3ZRX A;  1B63 A;  2DYS C;  4MTF A;  1I5X A;  1UYK A;  3X2Q C;  5CTX A;  1R73 A;  3O0I A;  3OR7 C;  2YE5 A;  5CTU A;  1GMG A;  3SYQ A;  2ZXW B;  3ZRS A;  5KA6 A;  3D3I A;  5CA3 A;  2EXL A;  2QE7 G;  2QF6 A;  3AG3 C;  3ZM7 A;  4CWO A;  1Y8O A;  2HG1 A;  2YKI A;  1A4H A;  3C11 A;  3B8N A;  4XE2 A;  2W6J G;  4URN A;  1SRY A;  4XDJ A;  3E8F A;  1B6Q A;  1JM6 A;  2IW5 A;  5LGT A;  5D7C A;  4E02 A;  2EIN C;  2B1I A;  3CXC U;  2ZR3 A;  1BMF G;  3X2Q B;  3K08 A;  1Q82 W;  1QVF U;  2B5U A;  2XAQ A;  1B62 A;  3ASO B;  3OEH G;  1M57 C;  1TC6 A;  2BU2 A;  1AM1 A;  2IWS A;  2IWU A;  2XDK A;  1US7 A;  4MOT A;  1RPO A;  1K3E A;  3JD2 A;  4TT3 G;  1B3Q A;  2CK3 G;  1BGQ A;  1H7U A;  1I58 A;  1M9N A;  4HYP A;  1WPX A;  2HVJ C;  3O6O A;  3FV5 A;  1VQN V;  1KZN A;  1KC8 W;  2Y69 C;  1JCH A;  3EHH A;  1AH6 A;  4URO A;  1CPY A;  3OGC C;  1YJN V;  4MBC A;  4P8O A;  1PNM A;  2YE8 A;  3H4L A;  4LWE A;  3RKZ A;  3UKM A;  4ZKI A;  4KP4 A;  3EFF K;  1UYC A;  2XAJ A;  4HY6 A;  2BSM A;  4KSG A;  2O1U A;  1K73 W;  2JEU A;  1V54 B;  2DW4 A;  1K97 A;  3HPL C;  4WFA V;  1QY8 A;  4R50 A;  3CCM V;  1UYD A;  2WEP A;  1W0K G;  3HZ5 A;  2YEE A;  3FB5 C;  5BOC A;  1DF4 A;  1G8M A;  2WPD G;  5M4K A;  2XX2 A;  5CTW A;  4KSH A;  1BL8 A;  3QTF A;  3LSQ A;  1AI5 A;  1QLN A;  3B77 A;  5FNF A;  1YSC A;  3WG7 C;  4B6C A;  4CZZ A;  1EA6 A;  1E1R G;  4MPC A;  3ZMZ A;  5CBG A;  2QG2 A;  4GQT A;  4CE1 A;  1S14 A;  3T0H A;  3JCZ A;  3I56 V;  3R4P A;  1QBZ A;  4KFM A;  1SES A;  1YTF D;  3K04 A;  2BRE A;  2YJW A;  4O05 A;  3OMU A;  3E8B A;  1THN A;  1YT1 A;  4YKW A;  1E1Q G;  1FS0 G;  4PA3 A;  1CP9 A;  2OT5 A;  2ZR2 A;  3CYO A;  3OR6 C;  3ABL B;  1THZ A;  3E89 A;  4P30 A;  4UXN A;  5C93 A;  1BHB A;  1CEZ A;  2Q8G A;  1BHA A;  1F4N A;  2ATK C;  1TC0 A;  2VCI A;  4EFT A;  5B3S C;  1MX0 A;  3AG2 B;  1OZ0 A;  5CPH A;  2X0L A;  2FWZ A;  1DF5 A;  5B1O A;  4EMV A;  2DWE C;  2IJH A;  1NBM G;  1GKZ A;  3ABM C;  1KEC A;  3AG1 C;  3FYE B;  3QNE A;  4J9Z B;  3W7X A;  3K0D A;  5L3G A;  1M90 W;  1UYF A;  2YEG A;  4MP2 A;  3U2D A;  2YSU B;  1UY6 A;  2DYS B;  3Q5L A;  3NMQ A;  4YKY A;  1TH8 A;  2EBO A;  3CC4 V;  4EFU A;  2YKJ A;  2Q67 A;  2OCC B;  3ZXO A;  3ZRW B;  1UY8 A;  4ZVI A;  3RW0 A;  2QM7 A;  1YHQ V;  1S72 V;  4FCQ A;  4O09 A;  2DQ0 A;  2EIM B;  2F43 G;  1M1K W;  4DUH A;  3T4D A;  2CH4 A;  2HG5 C;  2B1G A;  3G4S V;  1Q81 W;  4GT8 A;  1JPX A;  4UV9 A;  1L1F A;  4XDM A;  1R3J C;  4WFE A;  2BOB C;  1U2O A;  2WLJ A;  1JQ0 A;  3R65 A;  4LWH A;  2JDI G;  1OCC C;  4PRV A;  3AEI A;  2H94 A;  3FB7 C;  2BU8 A;  4XIT A;  2IJJ A;  3OMI B;  2UWD A;  3TTZ A;  1JOY A;  4XIP A;  2YEV B;  2GHY A;  3HB3 B;  4MVQ A;  3T1C A;  3E8H A;  1FFT B;  2JKI A;  3CCV V;  2EIL B;  2LFR A;  5LBQ A;  1M56 B;  3E2E A;  1QZR A;  3OUS A;  3GIG A;  2WI6 A;  2ZDI A;  5H6R A;  1OCO C;  3T0Z A;  1YJW V;  2YED A;  3C0E A;  3ZRV A;  3ETE A;  1UJW B;  1H7S A;  4G27 B;  1KQS U;  2OTL V;  4GEE A;  5IDM A;  2ZD9 A;  5GGZ A;  5M4M A;  5E1A C;  4CWN A;  4BXI A;  4X8A A;  4RAI A;  2GFD A;  3BMY A;  2YGE A;  2FWY A;  3OFN G;  1UYM A;  5IDJ A;  1ROP A;  3CC7 V;  3BY6 A;  5IYD O;  2VCJ A;  3HHU A;  4O04 A;  4LPB A;  1VQ5 V;  1F4M A;  3P32 A;  1EZJ A;  1N8R W;  2BU6 A;  2EIK C;  2XJJ A;  3CWV A;  2EIN B;  2Z3Y A;  3H80 A;  4R3M A;  4XD8 A;  4CWF A;  3SYA A;  4KQV A;  1H38 A;  1K34 A;  4FJC C;  1SET A;  1M57 B;  4WFH A;  1GKX A;  4CE2 A;  5BZB A;  1NH2 B;  3TCU A;  2YEV A;  4JTD B;  2EJR A;  3A0X A;  2YE2 A;  5M4H A;  2YKE A;  2BOC C;  5EC1 C;  3K03 A;  4LBE C;  1QVG U;  4MVO A;  4OXS A;  3OPD A;  3LDE A;  1K4D C;  5IN9 A;  4PDM A;  4RQE A;  5H6Q A;  2WI3 A;  1R3I C;  5B1A C;  1YIT V;  5GW7 A;  3CRK A;  2JJ1 G;  3GIG B;  3LPS A;  3INX A;  3K3W A;  3HEK A;  1W2B U;  1S77 D;  1Y66 A;  1JVM A;  3RBZ A;  3ZMT A;  2PI5 A;  3CD6 V;  2YKC A;  3CCQ V;  1F23 A;  2XDS A;  3B28 A;  2BT0 A;  2QG0 A;  4WUD A;  2H55 A;  2Y69 B;  4Z1M G;  2HR3 A;  5KA5 A;  2CCS A;  3T2M A;  5D6P A;  3TK1 A;  3B26 A;  3VHC A;  2EZP A;  2W6I G;  3GWO A;  1S0V A;  4GCZ A;  4UV8 A;  2QM8 A;  1S5H C;  2Q2E B;  3CCS V;  2XOK G;  4P9O A;  3CP1 A;  3ZRW A;  5LHG A;  1YSZ A;  2VWC A;  4XKA A;  4N21 A;  2YGA A;  3K97 A;  4RO2 A;  1ARO P;  4I3H A;  4YXW G;  3SYO A;  4WCE V;  1K7D A;  1ZWI C;  2UXN A;  4BAE A;  2O1V A;  3FYI B;  4U7N A;  4HXW A;  3ZXQ A;  1AI7 A;  1EI1 A;  2CCU A;  3IED A;  1QLE C;  1UYE A;  3K06 A;  3R4N A;  1KP2 A;  2YK2 A;  3ASO C;  1KIJ A;  2X7R B;  3DGE A;  2E0A A;  1VQL V;  1YC4 A;  4NH7 A;  1OCR B;  1F51 A;  1NJI W;  1NHH A;  3RVZ A;  4HZ5 A;  3A0W A;  3O2F A;  3E8G A;  3F7V C;  4QIW F;  5LHH A;  5CN0 A;  5CBH A;  1FXV A;  2XAG A;  1Z5A A;  5DM6 V;  1NVP D;  2AKP A;  2R9R B;  4PDL A;  5L3F A;  2JEX A;  4XBF A;  2YI5 A;  4E00 A;  5L3D A;  4LP0 A;  2MK3 A;  3JD4 A;  4JYB A;  4WFG A;  4RUF A;  3WHA A;  3E86 A;  4UUJ C;  4QJF B;  4ZBM A;  1QYE A;  3ZN0 A;  2BTZ A;  3D36 A;  4R3A A;  1VQO V;  3VBB A;  3OWB A;  2A0L A;  2XDU A;  2XAH A;  4YKR A;  1YIJ V;  1V55 C;  2YEC A;  3A0T A;  3T1K A;  1H8H G;  3T4Z A;  3GIF A;  4MB9 A;  3ZKB A;  3B8M A;  2Z5U A;  2DYR C;  3ABU A;  5LGU A;  3SPJ A;  1OCO B;  3MD0 A;  2BRC A;  1Z5C A;  2UXX A;  2DQ3 A;  3JYC A;  1GO3 F;  4PA9 A;  3QO7 A;  2YEI A;  2IOP A;  1EFR G;  4XDK A;  5B1N A;  1OCZ B;  4BIZ A;  5CBF A;  4F4L A;  1HWY A;  3CCU V;  4JAV A;  2CGF A;  2YEJ A;  2YI6 A;  3TZ0 A;  3G75 A;  1OHH G;  2IU0 A;  4HYM A;  4QE7 A;  2JIZ G;  1GM9 A;  4HZ3 A;  1UYI A;  2YEB A;  3ZN1 A;  2XAF A;  4HYO A;  5EBW C;  1ZWH A;  1ZXN A;  2WEQ A;  1BXD A;  3ML0 A;  4XKO A;  1VQ6 V;  4UVA A;  2OCC C;  4X88 A;  3G71 V;  3CCR V;  3LNM B;  2C2A A;  1MSW D;  3Q5K A;  4CWS A;  4EGH A;  3MHS C;  3JZ3 A;  2WLL A;  4R7C A;  3BM9 A;  5J71 A;  3PEJ A;  5FL7 G;  3LDD A;  2HLD G;  1V54 C;  2YEH A;  2NLJ C;  2A9H A;  3T2S A;  1NHJ A;  4TWK A;  2HKJ A;  3TZ4 A;  1YTF B;  4CWQ A;  3QO5 A;  1DTO A;  2WLK A;  4MS2 A;  1Y4S A;  5L3C A;  1YC1 A;  2XCM A;  1S3J A;  2P6J A;  1I5Y A;  1QCE A;  4MW3 A;  3AG3 B;  5EC2 C;  2XHX A;  4CWR A;  5CF0 A;  5M4N A;  4PU9 A;  4KFG A;  1RM1 C;  3D2R A;  3OMN B;  4PA4 A;  1GM8 A;  1WLE A;  1GJV A;  4WF9 V;  3EKR A;  5LGN A;  5IYC O;  3LDC A;  5J6A A;  4JPR A;  4RUE A;  2XD6 A;  3CCE V;  2IJI A;  3WFV A;  5LHI A;  3OEE G;  4LWF A;  4W7T A;  3GB7 C;  4GX5 A;  2XJG A;  2YEF A;  3OWD A;  4QPK A;  4HY1 A;  2Q8H A;  2EIM C;  2XAS A;  3LUT B;  1I5D A;  1OSF A;  1MG1 A;  2P7T C;  2WLL B;  4X9L A;  1GM7 A;  2V1D A;  3W7S A;  4GX1 A;  1DLB A;  2JJ2 G;  3MHH C;  4R8C A;  1Y8P A;  2FXS A;  2R9I A;  2QFO A;  2YEA A;  4ASU G;  3EHJ A;  1VQ9 V;  3K99 A;  1KKD A;  4L91 A;  1Y4U A;  3LNU A;  2K1E A;  2HKO A;  3SPG A;  4QPJ A;  3R92 A;  3ASN B;  2PI4 A;  2WER A;  5L3E A;  2DWD C;  3AG2 C;  3ZMV A;  3HZ1 A;  4O0B A;  3CCL V;  4B7P A;  4CBC A;  4FPP A;  3CRL A;  1K4C C;  2X6A A;  4YKQ A;  4URM A;  2A79 B;  3F7Y C;  3FB6 C;  1KP3 A;  2ZKJ A;  1FXH A;  3TZ2 A;  2QEX V;  4JTA B;  4QE9 A;  4H85 A;  3D0B A;  4MVM A;  3PJS K;  2Q6A A;  4PDR A;  3PEH A;  3DTU B;  3CME V;  3ZKD A;  4E01 A;  2JJC A;  1AR1 B;  2XDL A;  2HVK C;  1EBO A;  3ASN C;  2IU3 A;  4ASA A;  3E35 A;  4KUM A;  3OE7 G;  3AG4 C;  3INW A;  3G7E A;  4MPE A;  2YJX A;  3W7U A;  3ZCC A;  1U0Z A;  1UY9 A;  2ZDY A;  1YES A;  4AWO A;  1PKX A;  1FXK B;  1AJQ A;  4GX2 A;  3B24 A;  2KB1 A;  3G7B A;  4FMT A;  3ZIA G;  1I5B A;  4G2K A;  4KTN A;  2HCH A;  4L87 A;  3B25 A;  4MW8 A;  1YT2 A;  2EIK B;  2YE9 A;  2WLN A;  4E2L A;  1ZW9 A;  1J95 A;  3U2K A;  4P2Z A;  2BU5 A;  4EGK A;  5KUK A;  3SPH A;  2AHY A;  1COW G;  4P7A A;  5H9C A;  3JD0 A;  3SJQ C;  2BYH A;  2P67 A;  4GGL A;  1VQP V;  5BOD A;  1AI4 A;  1ORQ C;  2IH3 C;  3F5W C;  2P90 A;  1XL6 A;  2HJF C;  4NH8 A;  3VAD A;  5B3S B;  1PNL A;  2CG9 A;  3BEH A;  2X6B A;  3CGY A;  3K0G A;  4HAM A;  1QLE B;  4LC1 A;  4PA6 A;  4XCL A;  4YKX A;  5L3B A;  3FT5 A;  3FB8 C;  5CTY A;  2WI5 A;  5CMU A;  1SER A;  4HZ0 A;  4RQF A;  1IXM A;  1UYG A;  4CWT A;  3ABM B;  5D6Q A;  3W7T A;  4FK5 C;  5IY5 B;  3KE6 A;  4EEH A;  4X89 A;  4JYC A;  1ID0 A;  1TID A;  5IYB O;  2IWX A;  5F3K A;  1NH2 D;  1G4Y B;  3W7W A;  2IJK A;  4U7O A;  4AS9 A;  2Q8F A;  3SYC A;  1FXK A;  4EM7 A;  1PNK A;  1V55 B;  2JK5 C;  4MVU A;  2YK9 A;  3R4O A;  5EBM C;  5FWK A;  4MTG A;  3RLR A;  1AJP A;  1RPR A;  4Q20 A;  2DYR B;  4LCU C;  1Z5B A;  1K92 A;  2LFS A;  4YKU A;  1TBW A;  4PDV A;  4EGI A;  2WLM A;  4EKW A;  3NXS A;  2ZBK B;  1NQT A;  3ETG A;  3VHD A;  3KG2 A;  3ABK B;  1VQ4 V;  5KUM A;  1VQM V;  1MU5 A;  1R62 A;  4MVS A;  1GKF A;  1AH8 A;  1MAB G;  3LSS A;  5B1B C;  4XKK A;  1QR9 A;  1R6K A;  1I59 A;  2XHT A;  3Q5J A;  3JD3 A;  4MPN A;  2IOR A;  2XJX A;  1Y4M A;  4GFN A;  1OCC B;  1AMW A;  3E83 A;  4LP8 A;  3SPC A;  4HXZ A;  1PVG A;  3ETD A;  1M56 C;  2PNR A;  1PD3 A;  4H7Q A;  3STZ C;  5FNC A;  2HFE C;  3G6E V;  3VHA A;  2WI4 A;  4GX0 A;  1YSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...