5IDJA

Bifunctional histidine kinase ccka (domains dhp-ca) in complex with adp/mg2+
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
242
structure length
242
Chain Sequence
LSQAQKMQAIGQLAGGVAHDFNNLLTAIQLRLDQLLHRHPVGDPSYEGLNEIRQTGVRAADLVRKLLAFSRKQTVQREVLDLGELISEFEVLLRRLLREDVKLITDYGRDLPQVRADKSQLETAVMNLAVNARDAVRAAKGGGVVRIRTARLTRDEAIQLGFPAADGDTAFIEVSDDGPGIPPDVMGKIFDPFFTTKPVGEGTGLGLATVYGIVKQSDGWIHVHSRPNEGAAFRIFLPVYEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Cell cycle histidine kinase CckA
publication title Cyclic di-GMP mediates a histidine kinase/phosphatase switch by noncovalent domain cross-linking.
pubmed doi rcsb
source organism Caulobacter vibrioides
total genus 63
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5idjA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5idjA02
4DZYA 2VCJA 3VHCA 2QM8A 1YC1A 2WERA 4YKTA 3INWA 4MPEA 2BU5A 2YEDA 3EHFA 5F5RA 3SL2A 3OWDA 2UWDA 4EFTA 4KFGA 5J71A 3D36A 2ZKJA 1B3QA 2BU2A 1Y4UA 4O09A 1AH8A 1UYCA 3TZ2A 3HZ1A 2WI1A 1Z5CA 2YE2A 4UROA 4CWPA 2YGAA 3U67A 1YETA 4WUCA 2YEEA 2XJXA 2LFSA 5D6QA 1UYIA 4HXWA 4CE3A 2WEPA 2FWZA 4E01A 4E00A 5B1OA 2PNRA 3LNUA 1F51A 4ZKIA 2H8MA 1YT1A 4YKWA 1UY9A 3BMYA 2Q8HA 4GT8A 2C2AA 1ZWHA 2K5BA 3K97A 1JM6A 4O0BA 3EKOA 4HY1A 1NHIA 3HYYA 5J6AA 3BM9A 4MP7A 2YEBA 3G75A 1KIJA 3R4MA 3HHUA 4YKRA 2WI2A 2CH4A 4DUHA 4WUDA 3TZ4A 3VADA 4LWEA 3G7EA 2FWYA 2BU7A 2YI0A 1ID0A 2XDSA 4LWIA 4H85A 3P32A 2YKIA 4YKUA 4E02A 4L94A 2O1VA 1ZW9A 2YK9A 2WI5A 2CCTA 4KSHA 2EXLA 2YE8A 2GQPA 5BOCA 3TTZA 4W7TA 5F3KA 4KSGA 1UY8A 4GCZA 3T10A 4QPKA 3ZCCA 2YGFA 3TZ5A 4GEEA 3FT5A 1TC6A 3Q5JA 1MU5A 3RLRA 2XHRA 2IWUA 4R3MA 3R4OA 1YSRA 4NH7A 4HY6A 4B7PA 1I58A 3RLPA 2AKPA 1ZXNA 4H7QA 4LWHA 4URLA 4XC0A 5D7CA 1UYGA 4HYMA 2BYIA 2ESAA 2Q2EB 2O1UA 2YKJA 3QDDA 4XKKA 3K98A 2YK2A 5D7RA 4FPPA 1EA6A 4ASFA 4XCJA 4JASA 2QF6A 5FWKA 3FT8A 2WI6A 4GGLA 3TZ0A 5C93A 4EFUA 2YE7A 4L93A 1GKXA 2JJCA 2XCMA 2HKJA 4BXIA 2XD6A 4XKAA 3GIFA 4AWPA 3PEJA 4U93A 5B1NA 4KP4A 3JZ3A 4JAVA 4BQGA 3EHGA 2XDKA 2YE5A 1BKNA 4NH8A 3A0WA 2YGEA 3KE6A 2YJXA 2CCUA 3G7BA 2YE4A 1ZXMA 2XDUA 1B62A 4WUBA 1TH8A 1TIDA 2BTZA 3R4NA 1US7A 4I5SA 4URNA 1YC4A 2IWSA 1EI1A 1UYDA 3B25A 2CCSA 2XHTA 3CGYA 4R1FA 4V25A 3HZ5A 3R91A 3ZRWA 1YERA 5M4KA 2CG9A 3Q5KA 3D0BA 4JYBA 2IORA 2LFRA 4I3HA 2XDLA 3ZKDA 3NMQA 1Z5BA 4U7NA 2YE9A 2CGFA 4O07A 5M4PA 2ZDXA 4KTNA 3ZKBA 3FV5A 3NXSA 1NHJA 2XX4A 1THNA 3ZXQA 4XTJA 4CWQA 3B26A 4YKZA 2YKEA 4BAEA 4X9LA 4MBCA 5GGZA 3T2SA 4CE1A 1I5CA 4HZ0A 4FMTA 5CTYA 2BU6A 2QFOA 4LPBA 3A0ZA 2O1WA 1YSZA 2YEAA 4XIRA 4LC1A 1R62A 4CWNA 3O2FA 4NH9A 3H80A 2ZBKB 4HZ5A 5M4NA 2WI4A 4ASGA 2XX5A 4CWTA 3WQ9A 4GQTA 4HXZA 4ZVIA 3EHJA 4HYPA 2QG2A 2YE6A 2Q8IA 4MT8A 3OW6A 1UYMA 2IOPA 1QY8A 3RKZA 3A0XA 4L8ZA 1UYKA 3RLQA 4MPNA 4XKOA 4FCRA 3ZXOA 3ZRXA 3VHDA 3ZM7A 3VHAA 4BIZA 4CWRA 3TUHA 5CF0A 2VW5A 3K99A 4LWGA 4KQVA 1TC0A 2YI6A 1U2OA 2WI7A 5M4EA 4P8OA 4GFNA 4MP2A 2Q8FA 5FNDA 3A0RA 3ZRVA 1PVGA 2XJGA 4XD8A 1JOYA 1BXDA 2ZDYA 1AM1A 4V26A 1AH6A 2WEQA 4QPJA 4YKYA 4YKXA 3B27A 4XITA 4XIPA 2XDXA 3T0HA 4LP0A 1UYHA 2YI5A 2YEJA 3OWBA 4LWFA 3EHHA 1Y8NA 1Z5AA 4FCPA 4PRVA 3DGEA 4ASAA 3CRLA 2XK2A 4O04A 2P67A 4JYCA 1I5BA 2WWWA 4BIUA 4ASBA 1UY7A 1GJVA 4R3AA 5CTXA 1UYEA 2WI3A 5CPHA 2YKBA 1Z59A 1YESA 2XABA 3WHAA 2BSMA 5IDMA 3R4PA 1YT0A 4CWFA 2YEGA 3R92A 1TBWA 1B63A 1AMWA 2BU8A 4AWQA 3H4LA 1NHHA 2BT0A 5D6PA 5CTWA 2FXSA 4EMVA 4AS9A 1KZNA 2Q8GA 1YS3A 3MNRP 2H55A 2YEHA 3A0YA 4EGKA 1H7SA 1I59A 1A4HA 1S14A 3C0EA 4FCQA 4Q20A 1H7UA 1AJ6A 4XE2A 3PEHA 2FYPA 5L3JA 1L0OA 3CGZA 4CWOA 1BGQA 3IEDA 3O0IA 2BREA 3C11A 2XJJA 1UYLA 4XCLA 5M4HA 4BQJA 3T0ZA 5CTUA 1U0ZA 4EM7A 4XIQA 3GIGB 2XX2A 3OPDA 3HYZA 4B6CA 5D7DA 1YT2A 3O6OA 2FTKA 3B24A 4PL9A 5BODA 2YEIA 2IWXA 1TILA 1S16A 2HG1A 4AWOA 4MOTA 4K4OA 3CRKA 4H81A 3EKRA 2YJWA 4GT1A 4O05A 5FNCA 4XDMA 2YKCA 1UY6A 1Y8OA 3QTFA 3T1KA 3TK1A 3B28A 1MX0A 1QYEA 5IN9A 2YE3A 2VWCA 2QM7A 1I5DA 1Y8PA 4PRXA 2VCIA 2BZ5A 2YI7A 3D2RA 5FNFA 4MPCA 4L91A 4CE2A 3LPSA 3GIGA 4YKQA 4P7AA 2YEFA 3CWVA 4JQLA 4CWSA 1I5AA 1UYFA 4U7OA 4MTXA 2IOQA 4URMA 1Y4SA 1GKZA 3OMUA 1OSFA 3K60A 2JKIA 2QG0A 3Q5LA 5IDJA 3INXA 4EGHA 4L90A 2BYHA 1YC3A 3A0TA 4PU9A 2XHXA 3U2DA 3HEKA 4EEHA 5M4MA 4JAUA 3U2KA 1BYQA 2BRCA 2GFDA 3ZRWB 1QZRA 2YECA 2E0AA 4MB9A 4EGIA 1IXMA 3GIEA 3MD0A 2HCHA
chains in the Genus database with same CATH superfamily
2K1EA 1SRYA 3CCSV 1N33B 3UO2A 2XTAA 1YC1A 4YKTA 2KG7A 1S3JA 5JVDB 4HYOA 1F4NA 1KD1W 3FB8C 5KUKA 4EFTA 2X6BA 1HWYA 1WN7A 4FFKA 2ZKJA 3OW2U 1B3QA 5IJ0A 4OX9O 2ZQMA 3MHSC 4UXNA 2VWKA 1B04A 4PA7A 4JI2O 5EYPB 5LYJA 4XBFA 4YIPA 4I9QA 2XJXA 2LFSA 1UYIA 2WEPA 2FWZA 2GV9A 4GLXA 2PNRA 4ZKIA 2O57A 2Q68A 3OUSA 5BR8B 2OTLV 3BMYA 2Q8HA 1P4RA 4GT8A 2JIZG 4O0BA 3RYCB 1JM6A 3EKOA 4P9PA 1NHIA 4N21A 3HYYA 3BM9A 2YI9A 3SYPA 4MP7A 1ZL8B 1N0JA 3TZ4A 4KUMA 2JK5C 2ZDIC 2UUBO 4YKUA 4L94A 4E2LA 1O9HA 3AG2B 4PA4A 3OGCC 4KSHA 3I56V 3ABKC 2QDOA 4B7KA 1P7BA 1K33A 1JFFB 2VWJA 1YZBA 3RYCA 2YGFA 1W0KG 5H9CA 4Z1MG 3CCRV 1JR9A 2N74A 1ZL8A 3F5WC 2MK3A 4U3JB 3OMNB 1MU5A 3RLRA 3H9VA 3IFXA 4HNAA 4NH7A 1ZSPA 1Q6IA 1XMOO 2BSKB 1CEZA 4B7PA 2YEVB 4J80A 5CA0A 1DGSA 1ZXNA 3B4SA 4CS3A 3CCQV 4H7QA 3T1HB 4LWHA 2LW1A 4PI2A 4CH3A 1Y66A 3SYAA 5LP6B 4HYMA 5IYCO 3QF7A 2O1UA 2Q67A 2ARHA 2YKJA 3K98A 2QKSA 5JJEB 1WB8A 3O65A 1KBHA 2QF6A 1SQBH 3APQA 3C90A 3JASB 5JJNB 1VQOV 3SYOA 4JV5B 1IX9A 4GGLA 5IYZA 1Z5WA 5C93A 1GKXA 2JJCA 3HR0A 4JZ2A 4LF4B 5TISZ 1K5QA 3GIFA 3PEJA 4R6ZA 1KC8W 1I08A 2QSAA 3SDLA 3JZ3A 2BSKA 2YIAA 2XDKA 1BKNA 4NH8A 3A0WA 2RJZA 4X66B 2YJXA 1M56C 2YE4A 4GYCB 1B62A 3ETGA 2ZE7A 3B8MA 3ZHRA 2GUZA 3J81N 3LDDA 1Q3EA 5JQGB 2F1MA 4DR5B 2ZXWB 3P3NA 3A2FA 1US7A 3SYCA 1H8EG 3JASA 2IWSA 4K35A 1UYDA 2XHTA 1PV0A 1K73W 3R91A 1VARA 4P2ZA 4YJ2B 2ZM6B 2DN9A 3N2GB 1TUBB 3D0BA 1EFRG 3ZMZA 4FJCC 5EBMC 1QLEC 1VMGA 3LNNA 1Z5BA 3JARB 1IVSA 5IWAO 2CGFA 5JENA 4LF5O 1K7DA 1V54C 1XDCA 4B3RB 1AILA 2XT9A 4ZOLA 5JQGA 4LFAO 3B26A 4ZI7B 4EFEA 4YKZA 1KECA 4O4HA 2WPDG 5GGZA 4LF6B 4CE1A 4JI8O 4WF9V 4DV0O 1MABG 2BU6A 3A0HZ 1GKFA 2QFOA 4YJ2A 1ZLZA 4XIRA 3N2GA 3OT7A 1TUBA 4JYYA 4I4TB 4CWNA 3O2FA 1SKVA 3H80A 1JJ2U 5M4NA 2UUCB 3JARA 4BAYA 2HHHO 1YJNV 2ITDC 1MNGA 4X9QA 4CWTA 2XNDG 3CPWU 2HJFC 4KL1A 5D5QA 3SGIA 1Q7YW 1VP7A 3KCYA 1QR8A 2P06A 1Q43A 4MT8A 3OW6A 2F93B 3KZIZ 4J11A 1NI8A 3OGIB 1OCRC 2OCCB 4ZBMA 2JJ1G 4FZ1A 4J7KA 3RKZA 1Z2GA 4L8ZA 3RLQA 3OAAG 5IY5B 4MPNA 3AG1C 4FCRA 3ZRXA 4N23A 3P3PA 1U97A 3ZM7A 5H6RA 2ZCEA 1M93A 1V55B 4FM2A 4LWGA 4I4TA 1MSWD 1TC0A 4DR4O 1U2OA 3Q4HB 4X88A 5JJJB 3W7XA 3A0RA 1M57C 5EC2C 1SA0A 4LF9B 4J42A 2XJGA 2BOCC 2XAQA 4IIJA 3JD4A 2WEQA 4LF7O 4QPJA 3CYGA 4YKYA 3ZHUA 1WAZA 3CB2A 5IYBO 3T0HA 1CXZB 1UYHA 2YEJA 2HFEC 2EINB 3WB0A 2PF4E 1Y8NA 5CA1B 4PRVA 4PA3A 3CCLV 1QLNA 1GMGA 2HVJC 2QJ1A 4OGQB 4JI6O 1GN6A 1THZA 4G27B 1I5BA 2WWWA 1JJOA 1VF6A 4DUYB 1N34O 3JSLA 3TJTA 2KQXA 3ASOC 4JI2B 4NXMO 3Q4HA 3RBZA 2EIMC 2YSUB 5CTXA 2X0LA 3ZMUA 1UYEA 2CAZC 5JWPA 4ZHQA 3AG4B 1X4TA 4DK0A 2BSMA 5IDMA 4O2BB 4GKKO 2VQEO 1PNMA 2BU8A 1OCCC 2ZE8A 3UKMA 3C3TA 5CTWA 4DV6O 4JI7O 2WLIA 2FXSA 2DQ0A 4AS9A 2IU3A 3CSXA 2UUBB 2P6JA 3T1CA 3K5MA 2YEHA 2W6IG 1FXKB 1HNZO 1YTFD 4PV1B 4A5UB 2JVDA 4DV5O 4Q6GA 1R6KA 1HR0O 3JD0A 1H7UA 3SJAC 2Q4PA 1L0OA 3CGZA 1XNQB 4CWOA 1OZ0A 3IEDA 2E5LO 4FLYA 1RSOA 2X6CA 4ASUG 3T1YO 3S5TA 4K0KB 3GWKC 2OIGA 1LNQA 1VQNV 2LGWA 4JF3A 5E79Z 3CWBH 2A3QA 1XNRO 1AP5A 1OCOC 1U0ZA 1XMOB 2Y69B 2FB5A 1AJPA 3GIGB 2QWNB 4K3AA 3B2EE 2UXBO 4UV9A 1BCCH 4DV2O 3VOUA 3CXHF 2YEIA 2IWXA 3JATB 1VQ9V 3STZC 3VQVA 1B06A 5LA6B 3R66A 5KA6A 4K4OA 3CRKA 4GT1A 4O05A 5FNCA 2OCHA 5L3EA 4TQFA 5KA5A 5GW7A 1XBLA 3E22A 1K92A 2V1DA 3L72H 3T1KA 1GTOA 3K9AA 3K03A 5CMUA 1QYEA 3R65A 1IZ3A 1SQPH 2UXCB 2YE3A 1SZTA 4PRXA 2L6LA 4J41A 4X20B 4MPCA 4GX2A 3GIGA 2CTWA 1GN4A 5B1AC 5LMUO 1VIBA 4JQLA 4CWSA 4NVPA 1EZJA 2HG5C 1K3EA 3GB7C 2QTSA 4O4IA 3LSUA 2IOQA 1Y4SA 3LDCA 3JATA 2WLKA 1NS1A 3RVZA 5LBQA 1NKDA 1L1FA 1VF7A 1KP3A 3DSQA 1G1XB 3CS5A 4NXNO 2BOBC 4L90A 5LGNA 4TV8B 3QVNA 1PKXA 3ZHTA 5M4MA 5KMGA 3JCZA 3RYFB 4TWKA 1BYQA 5EC1C 3CHXA 2GFDA 3UO3A 4O4JB 4CH5A 2IU0A 4H0LB 4DR7O 4X20A 4EGIA 3B40A 1L8DA 3GIEA 1SQGA 1I7FA 5IWAB 4O2AB 3ZHQA 2VCJA 2VQFO 4KXRA 3VHCA 2QM8A 1S77D 1KMIZ 1EN5A 1R1BA 5IJ9A 3INWA 4MPEA 2QWPB 5FNVB 2GSMB 4JAAA 2YEDA 2E76B 3EHFA 5F5RA 3CCEV 4LFAB 3SL2A 2IJIA 3OWDA 2CTRA 2IW5A 2UWDA 2JEXA 4TUYB 5J71A 1I94O 4X1YB 2CTQA 2ZINA 4O09A 2CH7B 4DV0B 4X62B 1COWG 2JGDA 4QNHB 2WI1A 2RMKB 5KHGA 1DK1A 2YE2A 4FFBA 4UROA 4PDMA 4CWPA 3MHHC 4O4JA 5EIBD 2YEEA 2WLLA 3ZEDA 2UXDB 3RYHB 3K04A 1I5XA 5DM6V 2DYRB 4HXWA 5J2UB 3CMEV 1H2NA 3LNUA 1KP2A 1BZKA 4G28B 1YSCA 4KFMA 2K5BA 3G71V 3E8HA 2DYSC 2RQ6A 2QTOA 3EXAA 1NT2B 3FYIB 4TUYA 2YEBA 2A7WA 1WNSA 1YEWA 2Q9LA 4CZZA 4MS2A 4MW8A 2Q0AA 5FL7G 4FIPC 2B1IA 3FD9A 3S3XA 1FXHA 3JAKB 1MOFA 1IBKO 1XUQA 1FD9A 3M7MX 4DW1A 1NTZH 5LHHA 4LWIA 3KKYA 3AG3C 4DR4B 3H01A 1RPRA 4YJ3B 3RYHA 4WFHA 3B77A 5K1XA 4CC6A 3O9OA 4MSWC 4QIWF 1Y4MA 3W7UA 2ZIOA 2BTOA 2ZNJA 4TQDA 2EZOA 4WBNB 3EVKA 1UY8A 4LF7B 4GCZA 4MVSA 3T10A 4QPKA 3ZCCA 2UUAO 3MDSA 4FLVA 5LOVB 3TZ5A 4DV3B 5F2VO 1RM1C 1VF6C 4PA9A 3LNMB 4NB5A 1G4YB 5LXTB 2CDYA 4MVMA 1MZFA 2XHRA 5FLXN 5KAIZ 3JAKA 4JI6B 1EBOA 1I58A 4EEQA 4JGSA 4URLA 4FLWA 4YJ3A 1H2SB 4Z1VA 4NXMB 2BYIA 2ESAA 2FYUH 3QDDA 4XKKA 2YK2A 1YIJV 1N8RW 4DV4O 4JASA 1AI5A 3FT8A 2E74B 4NKGB 3UM7A 4DR6O 5LOVA 2XCMA 2F23A 2HKJA 2VS0A 1S72V 2XD6A 4BXIA 2NNUA 5B1NA 2VQEB 3IC9A 1RFYA 4J7ZA 2WLMA 1Y76B 4GX0A 3CMAV 5L3DA 2L35A 4O4LA 3QO5A 4JI7B 3HKDB 2YGEA 4H37A 1P7GA 5EBWC 2XDUA 2KB1A 4WUBA 4LFCO 4UFZA 1TIDA 2BTZA 2EIJC 4XDJA 3JD2A 2A06H 1ZX3A 2V4DA 5EBLC 4I5SA 1HR0B 1R6TA 3BVOA 4PDVA 2YC0A 2CCSA 3L73H 3PN1A 3K0DA 3OR7C 2XAGA 3K06A 2E5LB 3ZRWA 1R3JC 4R8CA 1YERA 5M4KA 2CG9A 3ETDA 3EHBB 3Q5KA 2XDLA 1Q6HA 3FX7A 4LWSB 3ZKDA 4E4EA 2ODMA 1VQMV 4TV9B 3NMQA 4U7NA 4H13B 4GKJB 1XNRB 4I7ZB 3BPZA 3HKDA 3CJHB 5EZYB 3ABLC 5JVDA 2PTMA 2XX4A 4PHZA 4XTJA 4UVAA 2D3OW 2F95B 2UXBB 1AI7A 1TGOA 1ROPA 1KYOF 1R3LC 4DV1O 1FFXB 2R9IA 2EJRA 1Q81W 1EM1A 3E83A 4UCUA 2OIEA 4HZ0A 4FMTA 2AHZA 3ABMC 3OTOO 1AVMA 5EYPA 3A0ZA 4CS4A 1NTMH 1R62A 1GRJA 1JMKC 2QWOB 1QU7A 4LWSA 2ZBKB 4HZ5A 3SJBC 3CCJV 2WI4A 3N27A 1P84F 4LR3A 4PA6A 1ORQC 4DV7B 4AHCA 5A2QN 4GQTA 4HXZA 4ZVIA 1XMQO 5LMUB 2QG2A 2Q8IA 4YY3O 4DR1O 4X1IB 3JD1A 1GO3F 3OM3B 4BW5A 3K3WA 3K5LA 1FFXA 1BHBA 3ZXOA 5B3SC 4PJ0Z 1OCOB 5B66Z 4FVMA 2AZ2A 3BEHA 2EILC 2Z0AA 3K99A 4KQVA 2A0LA 2AW9A 2E3CA 2IM9A 5M4EA 2WI7A 4P8OA 2ZE6A 5LHGA 4GFNA 3N2KB 2Q8FA 5FNDA 3UCSC 4DR7B 3AK3A 1JFFA 1PVGA 1BXDA 3ZHVA 5KX5B 4B3SO 1AM1A 2KKWA 3T2MA 4U3JA 4X1IA 1NH2B 3B27A 4YKXA 2G38A 2WA4A 4LP0A 4QE7A 5H2FZ 4DRXB 2XAFA 1H2LA 2YI5A 2ADPA 3IGAC 3EHHA 5H6QA 3H1KH 4DYLA 1Z5AA 4MVRA 1I94B 3SPCA 3CRLA 4ASAA 2YEVA 2VRZA 3KG2A 2XK2A 4O04A 2IH1C 2PUSA 1K97A 5CBHA 3BA9A 5LP6A 4BIUA 1XL4A 1JVMA 1GJVA 3N2KA 3UQ8A 1AR4A 1K5SA 4DUZO 3RYIB 3ZN1A 4RO2A 1YESA 5KX5A 1IBMB 3K79A 3WHAA 2EIKB 1F7YA 4CWFA 5HFMA 4DRXA 3ASNC 3G6EV 1FPOA 1Q5OA 4UCSA 1L0NH 4W4LA 4KHPO 2Q8VA 5D6PA 4QJFB 4WFEA 4EMVA 1KZNA 4PI0A 1VQ5V 1IBKB 3MNRP 2H55A 2P4KA 4EGKA 2ZD9A 4YXWG 1US6A 1I59A 3RYIA 4D6TH 2V7QG 3HKEB 3OD4A 4MVOA 5JCOC 3ICXA 1QR9A 5E1AC 2RN9A 1AJ6A 1QVFU 1MMMA 1GH6A 4JYAO 4JI5B 4AQYB 2FYPA 1IURA 4RAIA 5L3JA 4I50B 2X6AA 1F4MA 3O0IA 1WPXA 1IXBA 2F4VB 3DXRB 2X7RB 1MA1A 3BFRA 5M4HA 2BTQB 2WLJA 5CTUA 3E8FA 2JS5A 4EM7A 3I5DA 3D8CA 3OPDA 4MTFA 3OUFA 4B6CA 3BA8A 4U3FH 5D7DA 3QG5A 3O6OA 2FTKA 3OR6C 4ZI7A 3EFFK 4PL9A 2Y4TA 1TILA 1R6NA 1K34A 1BHAA 2HG1A 4AWOA 3WG7C 4MOTA 4DV4B 1BGYH 1PM9A 2PI4A 4H81A 3EKRA 2YJWA 2N05A 3AG7A 4LBEC 3X2QC 4RUEA 2YKCA 4XDLA 1Y8OA 4WCEV 2CK3G 4MW3A 1XI1A 4LF8B 4LH6A 1N4CA 3ZJZA 2HHIA 2QM7A 1I5DA 1Y8PA 2BTQA 1B6QA 1AJNA 3UT5B 3HPLC 2EBOA 1BSMA 4L87A 5IYDO 5ITZB 2HLDG 3CWVA 1XQ8A 5CN0A 1UYFA 1TAEA 4U7OA 3CC4V 4MTXA 3AEIA 3C3SA 1WP7A 3OMUA 4JI3O 1OSFA 4F6EA 4OX9B 1RP3B 2A9HA 4FM1A 2B5UA 4EGHA 3WFVA 4EKWA 2AZ0A 4JI0O 1YC3A 4PU9A 1BS3A 3HEKA 2Q7EA 4JAUA 4JTDB 5K1PA 3SJCC 4UUJC 3F7VC 2QA4V 3WB1A 2OWOA 2YXHA 4R7CA 3M8AA 3AK2A 5CB4B 1KUQA 5CA1A 5EIBC 4KFGA 4RUFA 2EX3A 4DV1B 4GX5A 2BU2A 1Y4UA 1KU9A 1CPYA 1YXBA 3OTOB 1Z5CA 2PYJA 2UXNA 4J10A 3VBBA 2YGAA 1R3KC 2R72A 4WUCA 1SQFA 3OMAB 4CE3A 3BRCA 1Y67A 4X89A 4E01A 4ICGA 5B1OA 2WAMA 3CCUV 1YT1A 1N33O 5L3GA 4WFGA 3SPIA 1E1QG 4YKWA 1XMQB 1UY9A 4O2BA 2C2AA 1ZWHA 4ABMA 1GK9A 3ZIAG 3CRMA 3R4MA 2WI2A 4X8AA 3AG2C 4DUHA 4EFBA 4R50A 3G7EA 2FWYA 3L74H 3K58A 2LQTA 1NVPB 3FB6C 2ZR2A 1FXKA 1SERA 2ILMA 4H85A 3P32A 4E02A 1GAXA 1SQVH 5HFLA 1XOUA 1M5IA 4PD4F 3CX5F 4AI8A 2YK9A 2QWRB 1OCZC 1Q86W 3JAMN 2WI5A 2CE4A 3JALB 2DWEC 2EXLA 1P49A 3LUTB 3RGBA 2GQPA 5BOCA 3TTZA 4W7TA 5F3KA 5LMNO 4B3SB 2EULA 4KSGA 1D5AA 4XDKA 2Q5ZA 4X1KB 1QBZA 3DC6A 2QKCA 4LNUB 4GEEA 1WP8A 3HKBB 5LP6C 2LGQA 3FT5A 1NR1A 1TC6A 3Q5JA 3ABKB 4X64O 3B8NA 3R4OA 1TVKB 1YSRA 3NR7A 3FAVB 3RLPA 2AKPA 1YJWV 1FJGO 4XC0A 1UYGA 1N36O 2P5OA 2Q2EB 3HKCB 2ZDIA 5LA6A 1VQPV 3JAWB 5D7RA 1T5EA 1JQ0A 1EA6A 4XCJA 4DR2O 4CH6A 4X1KA 2EILB 2ZE5A 3TZ0A 5JH7B 1DF4A 1QHTA 4L93A 3TCUA 1AR1B 3ZRSA 2NN4A 4XKAA 2QWQB 1J5EO 1HNWO 4KP4A 1TVKA 2ZXWC 4JAVA 1YCIA 4BQGA 3EHGA 1SQQH 4LF5B 1YHQV 3KE6A 3DTUB 3T1HO 5KHJA 2WSSG 2WA3A 3CEIA 1TH8A 3L71H 4FLZA 3JAWA 2R9AA 2YI8A 5FPOA 3R4NA 4URNA 4JI8B 4K8XA 3ABTA 5DN6G 2GHYA 4JV5O 4TV8A 1M56B 4R1FA 4RWUA 4NYKA 3HZ5A 4V25A 2MW2B 3ABUA 3RYFA 2YIBA 4IHJB 1NR7A 3K9SA 4DW0A 3CP1A 3S3WA 2M6YA 5LGUA 3E8BA 2LFRA 4I3HA 1VQ7V 1V9PA 3SYQA 4O2AA 2PGGA 3CCMV 1YITV 2HHHB 4GUNA 2YE9A 3TETA 4O07A 5M4PA 3ML0A 1EN6A 1YF2A 3ZKBA 5FNVA 1SZXA 4X66O 1THNA 5IT9N 2WLHA 4PDRA 4UCRA 1QLEB 2YKEA 4X1YA 4BAEA 4DR5O 1Q82W 4X9LA 2PY5A 2P22C 2CH7A 2XHBA 1V54B 5CTYA 1YVWA 2QR4A 2YUAA 4LFBO 1Z5VA 1NQTA 2YEAA 2ZM6O 4TOIA 1LUVA 3RN4A 3JCUZ 2DW4A 3F5TA 2OCCC 3D3QA 5J2UA 5KUMA 4TSFG 4ASGA 2ZNIA 4H33A 5IY5C 3ZMVA 3RVYA 4HYPA 2YE6A 4FLTA 1PPJH 1V55C 1FS0G 3ZS8C 1UYMA 3KCXA 4X65O 3W7TA 3A0XA 2HR3A 4JI3B 2Y48A 2QGNA 4NTXA 1WLEA 3BHPA 1E79G 4CWRA 1BQ0A 3TUHA 5CF0A 2VW5A 4P9OA 1R73A 1TUEB 1OCRB 4HAMA 1N34B 2XASA 2YXYA 2AGAA 1J95A 5BZBA 4MP2A 3AG1B 2EINC 1HNXO 5C8YB 4WBNA 4V26A 5BY1A 1AH6A 5CBGA 1Q90D 3OFNG 1JCHA 1WJZA 2AXTZ 1PD3A 2XOKG 2XDXA 4XIPA 4FK5C 1ZUQA 2KG7B 3L9DA 5LXTA 4HBNA 3OWBA 4GKKB 1M57B 4LWFA 2NLJC 2Q69A 2Y0IA 4B3MO 4FCPA 3DGEA 5IJ0B 5AG2A 3AG4C 4DV6B 4JYCA 3ZMSA 3P30A 3ZN0A 1S5LZ 4ASBA 3CYOA 1O9GA 4WFBV 2HVKC 2Q7GA 5LYJB 1HNZB 2WI3A 4DV5B 5DEDA 5CPHA 1Z59A 4LF9O 4WFFA 1YT0A 5H5NA 3ASOB 5L3FA 2YEGA 3R92A 2EIMB 4B3TO 2CGOA 3T1YB 4B08A 1FXKC 2ETNA 3J7AU 1Y76A 1B63A 1FYJA 1MZEA 4AWQA 1ZTEA 1TA8A 2QE7G 2PI5A 1G8MA 1NHHA 1OV9A 4MVUA 3SJQC 4DUYO 4B7EA 2ATKC 1YS3A 4FLXA 3A0YA 4DV2B 5B1BC 4IL6Z 3RT3C 3T4DA 1QNMA 4IT5A 1OCCB 1KKCA 4FCQA 3WU2Z 1RPOA 1Y6XA 4UVBA 2DJVA 3OMIB 4W4KA 5LMNB 2Y69C 2AHYA 3H1HH 2RDCA 2IBZH 2XUMA 1F23A 1LR1A 4TV9A 1YI2V 1UYLA 4X64B 4XCLA 2P7TC 1BMFG 2ZKOA 3CJHA 3T0ZA 4HNAB 1NTKH 5EZYA 4WFAV 2XX2A 3HYZA 5CA0B 3G4SV 2ZR3A 1YT2A 3BABA 3U10A 1FJGB 2H8PC 5BODA 4K8ZA 1N36B 3FB7C 3THOA 2IJJA 5A9GA 1QCEA 2ZT9B 4DR2B 4NXNB 1XNQO 2B9ZA 5LHIA 4BWAA 1S5HC 5IYZB 3ETEA 1UY6A 4PELA 1D2DA 3GWOA 3B28A 5FPRA 4K0KO 1OCZB 4JI1O 1I5YA 4JPRA 2NR5A 2VWCA 1Q8IA 1J5EB 1HNWB 5GTIZ 3OEEG 2VCIA 4IGGA 2C1IA 3E35A 3E86A 3QO7A 2W6JG 3RW0A 4CE2A 3LPSA 3FFQA 2IH3C 2VQFB 4YKQA 4P7AA 1XREA 3TGUH 1M4UA 2RNBA 1I5AA 1PP9H 4UCTA 1AJQA 4YHHO 4YIOA 2QEXV 2GUZB 3K60A 5LGTA 3Q5LA 5B1AB 1GM9A 3FYEB 1QQCA 4MVZA 2M7WA 3SR2C 1N32O 3A0TA 3U2DA 4EEHA 3U2KA 3I55V 2ZIMA 1SS3A 2UXCO 1QZRA 2XAJA 3A0BZ 3J80N 1GM8A 3CRCA 1NJIW 2YECA 1K4DC 3H1LH 3E89A 1IXMA 3WB2A 1IBLO 3HB3B 3MD0A 4UCOA 3D3IA 2W0XA 4DZYA 3G67A 2HJDA 4J9YB 1KKDA 2WERA 3CC2V 2BU5A 1JPXA 4ZOLB 3D36A 4LCUC 3RWRD 2EJ7A 2DYRC 4O4HB 1M1KW 3GVMA 1AH8A 1UYCA 2UXXA 4C7UA 3T4ZA 3HZ1A 3TZ2A 3IAYA 4LFBB 4UV8A 4HZ3A 1JX9A 1G6UA 3K59A 3U67A 2DQ3A 1VF5B 1YETA 4EB6B 5KHIA 4LH7A 3SPGA 5D6QA 3CE2A 3ZMTA 3VQWA 1WPBA 5KHHA 2BE3A 2YDEA 4E00A 1F51A 2H8MA 1BL8A 1SESA 5KAFZ 5L3BA 3K97A 2UUAB 4HY1A 5J6AA 1KQSU 1HDJA 2DMXA 4DR3O 3G75A 1KIJA 4X65B 1WA8B 5IE9A 3HHUA 4YKRA 5J9PC 2CH4A 4JTCB 4WUDA 3VADA 4LWEA 4PDLA 3W7WA 5GONB 2QM4A 2BU7A 2YI0A 1ID0A 4X62O 2XDSA 2JEUA 1NVPD 2JDIG 4J9ZB 2DYSB 1BE3H 4JZGA 3BAAA 3HKEA 3K5OA 2YKIA 3A8TA 4EB6A 2C1GA 4QE9A 2O1VA 1ZW9A 1W2BU 2UXDO 1SQXH 1SETA 2CCTA 1UFIA 1HNXB 2YE8A 1ENVA 1SA0B 4I50A 2P4VA 1GN3A 4IIJB 2Q0OC 4DR6B 3AG3B 4DO2A 1JA8A 1PNKA 3DXRA 1WA8A 4JI4O 1R3IC 1BT8A 4G2KA 4TT3G 4B3MB 5GONA 1Y74B 1AI4A 1YJ9V 1SC5B 3LDEA 2IWUA 4R3MA 1D5NA 4HY6A 2LJ2A 5J2TB 3SPHA 1IDSA 3QO8A 5DECA 1RM1B 1QVGU 4LFCB 5D7CA 2N04A 2W0FC 2D2CB 1CP9A 2DWDC 3JD3A 4FPPA 4ASFA 4ZHQB 5FWKA 2WI6A 5EK0A 4D7SA 4EFUA 2XAHA 3ETQA 2YE7A 4BR6A 3LMMA 2GTSA 4GZRB 1VEWA 1URFA 4DV3O 4B3TB 1W0JG 2YIBD 4AWPA 4U93A 2Q7HA 2DOSA 3UT5A 1Y74A 3SPJA 2H94A 1DLBA 1FFTB 5J2TA 4CC5A 2E75B 4OPHA 2LW7A 2YE5A 1X59A 1WB7A 1L0LH 4BIOA 5ITZA 2CCUA 3G7BA 2WLIB 1ZXMA 1VQKV 1ZAUA 3ZX6A 1S5JA 3TXQA 3H1JH 4F6RB 2JGUA 2ITCC 1XILA 1XL6A 1YC4A 1EI1A 1N0NA 3B25A 4I0XB 3DC5A 3CGYA 4Z2WA 4MTOA 4JTAB 2UU9O 2EIJB 3AK1A 3JSNA 4JYBA 2IORA 1AB3A 2GBOA 1RSOB 2Q73A 4CBCA 2KSDA 3IC7A 1UJWB 2ZDXA 3QTCA 4KTNA 3FV5A 3NXSA 4UCVA 4J7JA 1NHJA 2Z5UA 3ZXQA 5CB4A 4YY3B 1EN4A 4DR1B 4CWQA 1U96A 4F6RA 1AP6A 4MBCA 3T2SA 3CC7V 4MTGA 1PL4A 4I0XA 4NTWA 1I5CA 3BCCH 3ABLB 1GM7A 4LPBA 2O1WA 2QKAA 1YSZA 3LSSA 1PL0A 4LC1A 5B1BB 1MG1A 3E22B 3K0GA 4GX1A 1AI6A 4NH9A 3BY6A 4JI1B 2F43G 2CGNA 4NTYA 2XX5A 3WQ9A 5BR8O 5D5PA 4GKJO 2Y4UA 2K9PA 3ABMB 1H8HG 3ZHSA 1LUWA 3EHJA 1XHZA 1VQ8V 2OTJV 1EZVH 4MVQA 2IOPA 1QY8A 4YHHB 4O4IB 3E2EA 1UYKA 4DXWA 4XKOA 2LP7A 2HKOA 3VHDA 4E72A 3H1IH 3VHAA 2JRIA 4BIZA 3STLC 1N32B 4IYHA 2IJKA 2YI6A 5KMGB 1A32A 4D7TA 2Z3YA 3JALA 4DUZB 2JJ2G 3L75H 5B3SB 4DV7O 3TXSA 3ZRVA 5LL6Y 4XD8A 1VQLV 1JOYA 2ZDYA 1IBLB 5B5EZ 3D36C 1H2KA 2YICA 2A79B 4I55B 4UB8Z 5CA3A 3CD6V 3OE7G 2WLNA 4LNUA 3E8GA 4XITA 3HKBA 5IJ9B 2HEPA 3G6BA 4UB6Z 1NZ6A 1I0HA 2PZSA 3JYCA 4AILC 3FAVA 4KHPB 1XHXA 1DF5A 3CRRA 1NBMG 1KB9F 2P67A 3L70H 1H38A 5CBFA 2EIKC 3QNEA 1W59A 2JGDB 3W7SA 3HKCA 1UY7A 4FFBB 5GTHZ 1E1RG 4R3AA 4I9WA 3G80A 3ZBHA 2WLLB 2YKBA 4NR1A 4I55A 2XABA 1VQ6V 4JYAB 5JH7A 1M90W 3R4PA 3K57A 1K4CC 4LF4O 2FMLA 1TBWA 2FL4A 1YDXA 3OTFA 3VQYA 2DE0X 4DR3B 2YIDA 1AMWA 3H4LA 2R70A 1GN2A 2BT0A 5BXZA 3APOA 1FAFA 2Q8GA 2JS3A 3ASNB 4UVCA 4L8JA 2GDSA 3U0ZA 1H7SA 1PNLA 1MSDA 1UPGA 3F7YC 1YTFB 1A4HA 1VQ4V 1S14A 4FLUA 2FKXA 3VQXA 3C0EA 3CRQA 1M9NA 4Q20A 3U11A 3CXCU 1IBMO 3PEHA 4XE2A 1K8AW 3FKSG 5L3CA 3CRAA 5KLVH 4IHJA 1BGQA 1H2GA 2BREA 3C11A 4ZIBA 4RQFA 1FKAO 5BMVB 4JI4B 2XJJA 2CTPA 4IYIA 4OPAA 1BQZA 2B1GA 4BQJA 1NU1H 4XIQA 2RCVA 4B3RO 2CUGA 2R9RB 3LSQA 2PYLA 2Q6AA 3B24A 4P30A 4OXSA 1K9MW 1OJHA 1Q6UA 2Y0PA 3PJSK 1S0VA 1S16A 4LF6O 4QGPA 2IJHA 3CCVV 1OHHG 3K5NA 4JI5O 3B09A 2ADQB 4AQYO 4CH4A 4H44B 4XDMA 4JI0B 4FZ0A 5JCOA 2EZPA 5BMVA 3QTFA 3TK1A 5KHKA 2YS8A 1MX0A 2HP8A 5IN9A 2UUCO 2F4VO 3WG7B 2YXLA 3OEHG 2GTAA 2BZ5A 2BCCH 2YI7A 3D2RA 5FNFA 4L91A 2P90A 3X2QB 2YEFA 4O4LB 1ZWIC 1NH2D 1HP8A 1FXVA 3M99B 4URMA 4F4LA 4LP8A 3MAQA 1GKZA 2F66C 2LO1A 3IJ4A 2JKIA 2QG0A 1H2MA 5IDJA 3INXA 1SF9A 1DTOA 3K08A 2H3OA 4BW9A 1S76D 2BYHA 2OT5A 3FB5C 4DK1A 2XHXA 1XEQA 4CS2A 4FM0A 1AR5A 4LF8O 2UU9B 1AROP 2BRCA 2OYQA 3ZRWB 5C8YA 4RQEA 1HW7A 3RFRA 2E0AA 4MB9A 2HCHA
chains in the Genus database with same CATH topology
2K1EA 1SRYA 3CCSV 1YC1A 4YKTA 1S3JA 4HYOA 1F4NA 1KD1W 3FB8C 5KUKA 4EFTA 2X6BA 1HWYA 2ZKJA 3OW2U 1B3QA 2ZQMA 3MHSC 4UXNA 4PA7A 4XBFA 2XJXA 2LFSA 1UYIA 2WEPA 2FWZA 2PNRA 4ZKIA 2Q68A 3OUSA 2OTLV 3BMYA 2Q8HA 1P4RA 4GT8A 2JIZG 4O0BA 1JM6A 3EKOA 4P9PA 1NHIA 4N21A 3HYYA 3BM9A 3SYPA 4MP7A 3TZ4A 4KUMA 2JK5C 2ZDIC 4YKUA 4L94A 4E2LA 3AG2B 4PA4A 3OGCC 4KSHA 3I56V 3ABKC 1P7BA 1K33A 2YGFA 1W0KG 5H9CA 4Z1MG 3CCRV 3F5WC 2MK3A 3OMNB 1MU5A 3RLRA 3IFXA 4NH7A 1CEZA 4B7PA 2YEVB 1ZXNA 3CCQV 4H7QA 4LWHA 1Y66A 3SYAA 4HYMA 5IYCO 2O1UA 2Q67A 2YKJA 3K98A 2QKSA 2QF6A 1VQOV 3SYOA 4GGLA 5C93A 1GKXA 2JJCA 1K5QA 3GIFA 3PEJA 4R6ZA 1KC8W 3JZ3A 2XDKA 1BKNA 4NH8A 3A0WA 2YJXA 1M56C 2YE4A 1B62A 3ETGA 3B8MA 3LDDA 2ZXWB 1US7A 3SYCA 1H8EG 2IWSA 1UYDA 2XHTA 1K73W 3R91A 4P2ZA 3D0BA 1EFRG 3ZMZA 4FJCC 5EBMC 1QLEC 1Z5BA 2CGFA 1K7DA 1V54C 3B26A 4YKZA 1KECA 2WPDG 5GGZA 4CE1A 4WF9V 1MABG 2BU6A 1GKFA 2QFOA 4XIRA 4CWNA 3O2FA 3H80A 1JJ2U 5M4NA 4BAYA 1YJNV 2ITDC 4CWTA 2XNDG 3CPWU 2HJFC 1Q7YW 1QR8A 4MT8A 3OW6A 1OCRC 2OCCB 4ZBMA 2JJ1G 3RKZA 4L8ZA 3RLQA 3OAAG 5IY5B 4MPNA 3AG1C 4FCRA 3ZRXA 4N23A 3ZM7A 5H6RA 1V55B 4LWGA 1MSWD 1TC0A 1U2OA 4X88A 3W7XA 3A0RA 1M57C 5EC2C 2XJGA 2BOCC 2XAQA 3JD4A 2WEQA 4QPJA 4YKYA 5IYBO 3T0HA 1UYHA 2YEJA 2HFEC 2EINB 1Y8NA 4PRVA 4PA3A 3CCLV 1QLNA 1GMGA 2HVJC 1THZA 4G27B 1I5BA 2WWWA 3ASOC 3RBZA 2EIMC 2YSUB 5CTXA 2X0LA 3ZMUA 1UYEA 3AG4B 2BSMA 5IDMA 1PNMA 2BU8A 1OCCC 3UKMA 5CTWA 2WLIA 2FXSA 2DQ0A 4AS9A 2IU3A 2P6JA 3T1CA 2YEHA 2W6IG 1FXKB 1YTFD 1R6KA 3JD0A 1H7UA 1L0OA 3CGZA 4CWOA 1OZ0A 3IEDA 2X6CA 4ASUG 1LNQA 1VQNV 4JF3A 1OCOC 1U0ZA 2Y69B 1AJPA 3GIGB 4UV9A 3VOUA 2YEIA 2IWXA 1VQ9V 3STZC 5KA6A 4K4OA 3CRKA 4GT1A 4O05A 5FNCA 5L3EA 5KA5A 5GW7A 1K92A 2V1DA 3T1KA 1GTOA 3K9AA 3K03A 5CMUA 1QYEA 3R65A 2YE3A 1SZTA 4PRXA 4MPCA 4GX2A 3GIGA 5B1AC 4JQLA 4CWSA 1EZJA 2HG5C 1K3EA 3GB7C 2IOQA 1Y4SA 3LDCA 2WLKA 3RVZA 5LBQA 1NKDA 1L1FA 1KP3A 2BOBC 4L90A 5LGNA 1PKXA 5M4MA 3JCZA 4TWKA 1BYQA 5EC1C 2GFDA 2IU0A 4EGIA 3GIEA 2VCJA 3VHCA 2QM8A 1S77D 3INWA 4MPEA 2GSMB 2YEDA 3EHFA 5F5RA 3CCEV 3SL2A 2IJIA 3OWDA 2IW5A 2UWDA 2JEXA 5J71A 4O09A 1COWG 4QNHB 2WI1A 2YE2A 4UROA 4PDMA 4CWPA 3MHHC 2YEEA 2WLLA 3K04A 1I5XA 5DM6V 2DYRB 4HXWA 3CMEV 3LNUA 1KP2A 4G28B 1YSCA 4KFMA 2K5BA 3G71V 3E8HA 2DYSC 2QTOA 3FYIB 2YEBA 4CZZA 4MS2A 4MW8A 5FL7G 4FIPC 2B1IA 1FXHA 1MOFA 4LWIA 5LHHA 3AG3C 3H01A 1RPRA 4WFHA 3B77A 4MSWC 4QIWF 1Y4MA 3W7UA 2EZOA 1UY8A 4GCZA 4MVSA 3T10A 4QPKA 3ZCCA 3TZ5A 1RM1C 4PA9A 3LNMB 1G4YB 4MVMA 2XHRA 1EBOA 1I58A 4JGSA 4URLA 2BYIA 2ESAA 3QDDA 4XKKA 2YK2A 1YIJV 1N8RW 4JASA 1AI5A 3FT8A 3UM7A 2XCMA 2HKJA 1S72V 4BXIA 2XD6A 2NNUA 5B1NA 2WLMA 4GX0A 3CMAV 5L3DA 3QO5A 2YGEA 4H37A 5EBWC 2XDUA 2KB1A 4WUBA 1TIDA 2BTZA 2EIJC 4XDJA 3JD2A 5EBLC 4I5SA 4PDVA 2CCSA 3K0DA 3OR7C 2XAGA 3K06A 3ZRWA 1R3JC 4R8CA 1YERA 5M4KA 2CG9A 3Q5KA 3ETDA 3EHBB 2XDLA 3ZKDA 1VQMV 3NMQA 4U7NA 3ABLC 2XX4A 4XTJA 4UVAA 2D3OW 1AI7A 1ROPA 1R3LC 2R9IA 2EJRA 1Q81W 3E83A 4HZ0A 4FMTA 2AHZA 3ABMC 3A0ZA 1R62A 2ZBKB 4HZ5A 3CCJV 2WI4A 4PA6A 1ORQC 4GQTA 4HXZA 4ZVIA 2QG2A 2Q8IA 3JD1A 1GO3F 3OM3B 4BW5A 3K3WA 1BHBA 3ZXOA 5B3SC 1OCOB 3BEHA 2EILC 3K99A 4KQVA 2A0LA 5M4EA 2WI7A 4P8OA 5LHGA 4GFNA 2Q8FA 5FNDA 1PVGA 1BXDA 1AM1A 3T2MA 1NH2B 3B27A 4YKXA 4LP0A 4QE7A 2YI5A 2XAFA 3IGAC 3EHHA 5H6QA 1Z5AA 4MVRA 3SPCA 3CRLA 4ASAA 2YEVA 3KG2A 2XK2A 4O04A 2IH1C 1K97A 5CBHA 4BIUA 1XL4A 1JVMA 1GJVA 1K5SA 3ZN1A 4RO2A 1YESA 3K79A 3WHAA 2EIKB 4CWFA 5HFMA 3ASNC 3G6EV 5D6PA 4QJFB 4WFEA 4EMVA 1KZNA 1VQ5V 3MNRP 2H55A 4EGKA 2ZD9A 4YXWG 1I59A 2V7QG 4MVOA 1QR9A 5E1AC 1AJ6A 1QVFU 2FYPA 5L3JA 4RAIA 2X6AA 1F4MA 3O0IA 1WPXA 2X7RB 5M4HA 2WLJA 5CTUA 3E8FA 4EM7A 3OPDA 4MTFA 3OUFA 4B6CA 5D7DA 3O6OA 2FTKA 3OR6C 3EFFK 4PL9A 1TILA 1R6NA 1K34A 1BHAA 2HG1A 4AWOA 3WG7C 4MOTA 2PI4A 4H81A 3EKRA 2YJWA 4LBEC 3X2QC 4RUEA 2YKCA 4XDLA 1Y8OA 4WCEV 2CK3G 4MW3A 3ZJZA 2QM7A 1I5DA 1Y8PA 1B6QA 1AJNA 3HPLC 2EBOA 4L87A 5IYDO 3CWVA 2HLDG 5CN0A 1UYFA 4U7OA 3CC4V 4MTXA 3AEIA 3OMUA 1OSFA 2A9HA 2B5UA 4EGHA 3WFVA 4EKWA 1YC3A 4PU9A 3HEKA 4JAUA 4JTDB 4UUJC 3F7VC 2QA4V 4R7CA 4KFGA 4RUFA 4GX5A 2BU2A 1Y4UA 1CPYA 1Z5CA 2UXNA 3VBBA 2YGAA 1R3KC 4WUCA 3OMAB 4CE3A 4X89A 4E01A 5B1OA 2WAMA 3CCUV 1YT1A 5L3GA 4WFGA 3SPIA 1E1QG 4YKWA 1UY9A 2C2AA 1ZWHA 1GK9A 3ZIAG 3R4MA 2WI2A 4X8AA 3AG2C 4DUHA 4R50A 3G7EA 2FWYA 1NVPB 3FB6C 2ZR2A 1FXKA 1SERA 4H85A 3P32A 4E02A 5HFLA 2YK9A 1OCZC 1Q86W 2WI5A 2DWEC 2EXLA 3LUTB 2GQPA 5BOCA 3TTZA 4W7TA 5F3KA 4KSGA 4XDKA 1QBZA 4GEEA 3FT5A 1NR1A 1TC6A 3Q5JA 3ABKB 3B8NA 3R4OA 1YSRA 3RLPA 2AKPA 1YJWV 4XC0A 1UYGA 2Q2EB 2ZDIA 1VQPV 5D7RA 1JQ0A 1EA6A 4XCJA 2EILB 3TZ0A 1DF4A 4L93A 3TCUA 1AR1B 3ZRSA 4XKAA 4KP4A 4JAVA 2ZXWC 4BQGA 3EHGA 1YHQV 3KE6A 3DTUB 2WSSG 1TH8A 3R4NA 4URNA 3ABTA 5DN6G 2GHYA 1M56B 4R1FA 4V25A 3HZ5A 3ABUA 1NR7A 3CP1A 5LGUA 3E8BA 2LFRA 4I3HA 1VQ7V 3SYQA 3CCMV 1YITV 2YE9A 3TETA 4O07A 5M4PA 3ML0A 3ZKBA 1THNA 2WLHA 4PDRA 1QLEB 2YKEA 4BAEA 4X9LA 1Q82W 1V54B 5CTYA 1NQTA 2YEAA 2DW4A 2OCCC 5KUMA 4TSFG 4ASGA 4H33A 5IY5C 3ZMVA 3RVYA 4HYPA 2YE6A 1V55C 1FS0G 1UYMA 3W7TA 3A0XA 2HR3A 2Y48A 1WLEA 4CWRA 1E79G 3TUHA 5CF0A 2VW5A 4P9OA 1R73A 1TUEB 1OCRB 4HAMA 2XASA 1J95A 5BZBA 4MP2A 3AG1B 2EINC 4V26A 1AH6A 5CBGA 3OFNG 1JCHA 1PD3A 2XOKG 2XDXA 4XIPA 4FK5C 3OWBA 1M57B 4LWFA 2NLJC 2Q69A 4FCPA 3DGEA 3AG4C 4JYCA 3ZMSA 3P30A 3ZN0A 4ASBA 3CYOA 4WFBV 2HVKC 2WI3A 5CPHA 1Z59A 4WFFA 1YT0A 3ASOB 5L3FA 2YEGA 3R92A 2EIMB 1FXKC 1B63A 4AWQA 2QE7G 2PI5A 1G8MA 1NHHA 4MVUA 3SJQC 2ATKC 1YS3A 3A0YA 5B1BC 3T4DA 1OCCB 4FCQA 1RPOA 4UVBA 3OMIB 2Y69C 2AHYA 1F23A 1YI2V 1UYLA 4XCLA 2P7TC 1BMFG 3T0ZA 4WFAV 2XX2A 3HYZA 3G4SV 2ZR3A 1YT2A 2H8PC 5BODA 3FB7C 2IJJA 1QCEA 5LHIA 1S5HC 3ETEA 1UY6A 4PELA 3GWOA 3B28A 1OCZB 1I5YA 4JPRA 2VWCA 3OEEG 2VCIA 3E35A 3E86A 3QO7A 2W6JG 3RW0A 4CE2A 3LPSA 2IH3C 4YKQA 4P7AA 1I5AA 1AJQA 2QEXV 3K60A 5LGTA 3Q5LA 5B1AB 1GM9A 3FYEB 4MVZA 2M7WA 3A0TA 3U2DA 4EEHA 3U2KA 3I55V 1QZRA 2XAJA 1GM8A 1NJIW 2YECA 1K4DC 3E89A 1IXMA 3HB3B 3MD0A 3D3IA 4DZYA 4J9YB 1KKDA 2WERA 3CC2V 2BU5A 1JPXA 3D36A 4LCUC 2DYRC 1M1KW 1AH8A 1UYCA 2UXXA 3TZ2A 3T4ZA 3HZ1A 4UV8A 4HZ3A 1JX9A 3U67A 2DQ3A 1YETA 5D6QA 3SPGA 3ZMTA 4E00A 1F51A 2H8MA 1BL8A 1SESA 5L3BA 3K97A 4HY1A 5J6AA 1KQSU 3G75A 1KIJA 4YKRA 3HHUA 5J9PC 2CH4A 4JTCB 4WUDA 3VADA 4LWEA 4PDLA 3W7WA 2BU7A 2YI0A 1ID0A 2XDSA 2JEUA 1NVPD 2JDIG 4J9ZB 2DYSB 2YKIA 2O1VA 4QE9A 1ZW9A 1W2BU 1SETA 2CCTA 2YE8A 1ENVA 3AG3B 4DO2A 1PNKA 1R3IC 4G2KA 4TT3G 1AI4A 1YJ9V 2IWUA 3LDEA 4R3MA 4HY6A 3SPHA 3QO8A 1RM1B 1QVGU 5D7CA 2W0FC 1CP9A 2DWDC 3JD3A 4FPPA 4ASFA 5FWKA 2WI6A 5EK0A 4EFUA 2XAHA 2YE7A 1W0JG 4AWPA 4U93A 3SPJA 2H94A 1DLBA 1FFTB 2YE5A 2CCUA 3G7BA 2WLIB 1ZXMA 1VQKV 2ITCC 1XL6A 1YC4A 1EI1A 3B25A 3CGYA 4MTOA 4JTAB 2EIJB 4JYBA 2IORA 4CBCA 3IC7A 1UJWB 2ZDXA 4KTNA 3FV5A 3NXSA 1NHJA 2Z5UA 3ZXQA 4CWQA 4MBCA 3T2SA 3CC7V 4MTGA 1I5CA 3ABLB 1GM7A 4LPBA 2O1WA 1YSZA 3LSSA 1PL0A 4LC1A 5B1BB 1MG1A 3K0GA 4GX1A 1AI6A 4NH9A 3BY6A 2F43G 2XX5A 3WQ9A 3ABMB 1H8HG 3EHJA 1VQ8V 2OTJV 4MVQA 2IOPA 1QY8A 3E2EA 1UYKA 4DXWA 4XKOA 2LP7A 2HKOA 3VHDA 3VHAA 4BIZA 3STLC 2IJKA 2YI6A 2Z3YA 2JJ2G 5B3SB 3ZRVA 4XD8A 1VQLV 1JOYA 2ZDYA 2A79B 5CA3A 3CD6V 3OE7G 2WLNA 3E8GA 4XITA 3JYCA 1DF5A 1NBMG 1H38A 2P67A 5CBFA 2EIKC 3QNEA 3W7SA 1UY7A 1E1RG 4R3AA 4I9WA 2WLLB 2YKBA 2XABA 1VQ6V 1M90W 3R4PA 1K4CC 1TBWA 1AMWA 3H4LA 2BT0A 2Q8GA 3ASNB 4UVCA 1H7SA 1PNLA 3F7YC 1YTFB 1A4HA 1VQ4V 1S14A 3C0EA 4Q20A 1M9NA 3CXCU 4XE2A 3PEHA 1K8AW 3FKSG 5L3CA 1BGQA 1H2GA 2BREA 3C11A 4RQFA 2XJJA 2B1GA 4BQJA 4XIQA 2R9RB 3LSQA 2Q6AA 3B24A 4P30A 4OXSA 1K9MW 3PJSK 1S0VA 1S16A 2IJHA 3CCVV 1OHHG 4XDMA 3QTFA 2EZPA 3TK1A 1MX0A 5IN9A 3WG7B 3OEHG 5FNFA 2BZ5A 2YI7A 3D2RA 4L91A 2P90A 3X2QB 2YEFA 1ZWIC 1NH2D 1FXVA 3M99B 4URMA 4F4LA 4LP8A 1GKZA 2JKIA 2QG0A 5IDJA 3INXA 1DTOA 3K08A 1S76D 2BYHA 2OT5A 3FB5C 2XHXA 1AROP 2BRCA 3ZRWB 4RQEA 2E0AA 4MB9A 2HCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DZY A;  2VCJ A;  3VHC A;  2QM8 A;  1YC1 A;  2WER A;  4YKT A;  3INW A;  4MPE A;  2BU5 A;  2YED A;  3EHF A;  5F5R A;  3SL2 A;  3OWD A;  2UWD A;  4EFT A;  4KFG A;  5J71 A;  3D36 A;  2ZKJ A;  1B3Q A;  2BU2 A;  1Y4U A;  4O09 A;  1AH8 A;  1UYC A;  3TZ2 A;  3HZ1 A;  2WI1 A;  1Z5C A;  2YE2 A;  4URO A;  4CWP A;  2YGA A;  3U67 A;  1YET A;  4WUC A;  2YEE A;  2XJX A;  2LFS A;  5D6Q A;  1UYI A;  4HXW A;  4CE3 A;  2WEP A;  2FWZ A;  4E01 A;  4E00 A;  5B1O A;  2PNR A;  3LNU A;  1F51 A;  4ZKI A;  2H8M A;  1YT1 A;  4YKW A;  1UY9 A;  3BMY A;  2Q8H A;  4GT8 A;  2C2A A;  1ZWH A;  2K5B A;  3K97 A;  1JM6 A;  4O0B A;  3EKO A;  4HY1 A;  1NHI A;  3HYY A;  5J6A A;  3BM9 A;  4MP7 A;  2YEB A;  3G75 A;  1KIJ A;  3R4M A;  3HHU A;  4YKR A;  2WI2 A;  2CH4 A;  4DUH A;  4WUD A;  3TZ4 A;  3VAD A;  4LWE A;  3G7E A;  2FWY A;  2BU7 A;  2YI0 A;  1ID0 A;  2XDS A;  4LWI A;  4H85 A;  3P32 A;  2YKI A;  4YKU A;  4E02 A;  4L94 A;  2O1V A;  1ZW9 A;  2YK9 A;  2WI5 A;  2CCT A;  4KSH A;  2EXL A;  2YE8 A;  2GQP A;  5BOC A;  3TTZ A;  4W7T A;  5F3K A;  4KSG A;  1UY8 A;  4GCZ A;  3T10 A;  4QPK A;  3ZCC A;  2YGF A;  3TZ5 A;  4GEE A;  3FT5 A;  1TC6 A;  3Q5J A;  1MU5 A;  3RLR A;  2XHR A;  2IWU A;  4R3M A;  3R4O A;  1YSR A;  4NH7 A;  4HY6 A;  4B7P A;  1I58 A;  3RLP A;  2AKP A;  1ZXN A;  4H7Q A;  4LWH A;  4URL A;  4XC0 A;  5D7C A;  1UYG A;  4HYM A;  2BYI A;  2ESA A;  2Q2E B;  2O1U A;  2YKJ A;  3QDD A;  4XKK A;  3K98 A;  2YK2 A;  5D7R A;  4FPP A;  1EA6 A;  4ASF A;  4XCJ A;  4JAS A;  2QF6 A;  5FWK A;  3FT8 A;  2WI6 A;  4GGL A;  3TZ0 A;  5C93 A;  4EFU A;  2YE7 A;  4L93 A;  1GKX A;  2JJC A;  2XCM A;  2HKJ A;  4BXI A;  2XD6 A;  4XKA A;  3GIF A;  4AWP A;  3PEJ A;  4U93 A;  5B1N A;  4KP4 A;  3JZ3 A;  4JAV A;  4BQG A;  3EHG A;  2XDK A;  2YE5 A;  1BKN A;  4NH8 A;  3A0W A;  2YGE A;  3KE6 A;  2YJX A;  2CCU A;  3G7B A;  2YE4 A;  1ZXM A;  2XDU A;  1B62 A;  4WUB A;  1TH8 A;  1TID A;  2BTZ A;  3R4N A;  1US7 A;  4I5S A;  4URN A;  1YC4 A;  2IWS A;  1EI1 A;  1UYD A;  3B25 A;  2CCS A;  2XHT A;  3CGY A;  4R1F A;  4V25 A;  3HZ5 A;  3R91 A;  3ZRW A;  1YER A;  5M4K A;  2CG9 A;  3Q5K A;  3D0B A;  4JYB A;  2IOR A;  2LFR A;  4I3H A;  2XDL A;  3ZKD A;  3NMQ A;  1Z5B A;  4U7N A;  2YE9 A;  2CGF A;  4O07 A;  5M4P A;  2ZDX A;  4KTN A;  3ZKB A;  3FV5 A;  3NXS A;  1NHJ A;  2XX4 A;  1THN A;  3ZXQ A;  4XTJ A;  4CWQ A;  3B26 A;  4YKZ A;  2YKE A;  4BAE A;  4X9L A;  4MBC A;  5GGZ A;  3T2S A;  4CE1 A;  1I5C A;  4HZ0 A;  4FMT A;  5CTY A;  2BU6 A;  2QFO A;  4LPB A;  3A0Z A;  2O1W A;  1YSZ A;  2YEA A;  4XIR A;  4LC1 A;  1R62 A;  4CWN A;  3O2F A;  4NH9 A;  3H80 A;  2ZBK B;  4HZ5 A;  5M4N A;  2WI4 A;  4ASG A;  2XX5 A;  4CWT A;  3WQ9 A;  4GQT A;  4HXZ A;  4ZVI A;  3EHJ A;  4HYP A;  2QG2 A;  2YE6 A;  2Q8I A;  4MT8 A;  3OW6 A;  1UYM A;  2IOP A;  1QY8 A;  3RKZ A;  3A0X A;  4L8Z A;  1UYK A;  3RLQ A;  4MPN A;  4XKO A;  4FCR A;  3ZXO A;  3ZRX A;  3VHD A;  3ZM7 A;  3VHA A;  4BIZ A;  4CWR A;  3TUH A;  5CF0 A;  2VW5 A;  3K99 A;  4LWG A;  4KQV A;  1TC0 A;  2YI6 A;  1U2O A;  2WI7 A;  5M4E A;  4P8O A;  4GFN A;  4MP2 A;  2Q8F A;  5FND A;  3A0R A;  3ZRV A;  1PVG A;  2XJG A;  4XD8 A;  1JOY A;  1BXD A;  2ZDY A;  1AM1 A;  4V26 A;  1AH6 A;  2WEQ A;  4QPJ A;  4YKY A;  4YKX A;  3B27 A;  4XIT A;  4XIP A;  2XDX A;  3T0H A;  4LP0 A;  1UYH A;  2YI5 A;  2YEJ A;  3OWB A;  4LWF A;  3EHH A;  1Y8N A;  1Z5A A;  4FCP A;  4PRV A;  3DGE A;  4ASA A;  3CRL A;  2XK2 A;  4O04 A;  2P67 A;  4JYC A;  1I5B A;  2WWW A;  4BIU A;  4ASB A;  1UY7 A;  1GJV A;  4R3A A;  5CTX A;  1UYE A;  2WI3 A;  5CPH A;  2YKB A;  1Z59 A;  1YES A;  2XAB A;  3WHA A;  2BSM A;  5IDM A;  3R4P A;  1YT0 A;  4CWF A;  2YEG A;  3R92 A;  1TBW A;  1B63 A;  1AMW A;  2BU8 A;  4AWQ A;  3H4L A;  1NHH A;  2BT0 A;  5D6P A;  5CTW A;  2FXS A;  4EMV A;  4AS9 A;  1KZN A;  2Q8G A;  1YS3 A;  3MNR P;  2H55 A;  2YEH A;  3A0Y A;  4EGK A;  1H7S A;  1I59 A;  1A4H A;  1S14 A;  3C0E A;  4FCQ A;  4Q20 A;  1H7U A;  1AJ6 A;  4XE2 A;  3PEH A;  2FYP A;  5L3J A;  1L0O A;  3CGZ A;  4CWO A;  1BGQ A;  3IED A;  3O0I A;  2BRE A;  3C11 A;  2XJJ A;  1UYL A;  4XCL A;  5M4H A;  4BQJ A;  3T0Z A;  5CTU A;  1U0Z A;  4EM7 A;  4XIQ A;  3GIG B;  2XX2 A;  3OPD A;  3HYZ A;  4B6C A;  5D7D A;  1YT2 A;  3O6O A;  2FTK A;  3B24 A;  4PL9 A;  5BOD A;  2YEI A;  2IWX A;  1TIL A;  1S16 A;  2HG1 A;  4AWO A;  4MOT A;  4K4O A;  3CRK A;  4H81 A;  3EKR A;  2YJW A;  4GT1 A;  4O05 A;  5FNC A;  4XDM A;  2YKC A;  1UY6 A;  1Y8O A;  3QTF A;  3T1K A;  3TK1 A;  3B28 A;  1MX0 A;  1QYE A;  5IN9 A;  2YE3 A;  2VWC A;  2QM7 A;  1I5D A;  1Y8P A;  4PRX A;  2VCI A;  2BZ5 A;  2YI7 A;  3D2R A;  5FNF A;  4MPC A;  4L91 A;  4CE2 A;  3LPS A;  3GIG A;  4YKQ A;  4P7A A;  2YEF A;  3CWV A;  4JQL A;  4CWS A;  1I5A A;  1UYF A;  4U7O A;  4MTX A;  2IOQ A;  4URM A;  1Y4S A;  1GKZ A;  3OMU A;  1OSF A;  3K60 A;  2JKI A;  2QG0 A;  3Q5L A;  5IDJ A;  3INX A;  4EGH A;  4L90 A;  2BYH A;  1YC3 A;  3A0T A;  4PU9 A;  2XHX A;  3U2D A;  3HEK A;  4EEH A;  5M4M A;  4JAU A;  3U2K A;  1BYQ A;  2BRC A;  2GFD A;  3ZRW B;  1QZR A;  2YEC A;  2E0A A;  4MB9 A;  4EGI A;  1IXM A;  3GIE A;  3MD0 A;  2HCH A; 
#chains in the Genus database with same CATH topology
 2K1E A;  1SRY A;  3CCS V;  1N33 B;  3UO2 A;  2XTA A;  1YC1 A;  4YKT A;  2KG7 A;  1S3J A;  5JVD B;  4HYO A;  1F4N A;  1KD1 W;  3FB8 C;  5KUK A;  4EFT A;  2X6B A;  1HWY A;  1WN7 A;  4FFK A;  2ZKJ A;  3OW2 U;  1B3Q A;  5IJ0 A;  4OX9 O;  2ZQM A;  3MHS C;  4UXN A;  2VWK A;  1B04 A;  4PA7 A;  4JI2 O;  5EYP B;  5LYJ A;  4XBF A;  4YIP A;  4I9Q A;  2XJX A;  2LFS A;  1UYI A;  2WEP A;  2FWZ A;  2GV9 A;  4GLX A;  2PNR A;  4ZKI A;  2O57 A;  2Q68 A;  3OUS A;  5BR8 B;  2OTL V;  3BMY A;  2Q8H A;  1P4R A;  4GT8 A;  2JIZ G;  4O0B A;  3RYC B;  1JM6 A;  3EKO A;  4P9P A;  1NHI A;  4N21 A;  3HYY A;  3BM9 A;  2YI9 A;  3SYP A;  4MP7 A;  1ZL8 B;  1N0J A;  3TZ4 A;  4KUM A;  2JK5 C;  2ZDI C;  2UUB O;  4YKU A;  4L94 A;  4E2L A;  1O9H A;  3AG2 B;  4PA4 A;  3OGC C;  4KSH A;  3I56 V;  3ABK C;  2QDO A;  4B7K A;  1P7B A;  1K33 A;  1JFF B;  2VWJ A;  1YZB A;  3RYC A;  2YGF A;  1W0K G;  5H9C A;  4Z1M G;  3CCR V;  1JR9 A;  2N74 A;  1ZL8 A;  3F5W C;  2MK3 A;  4U3J B;  3OMN B;  1MU5 A;  3RLR A;  3H9V A;  3IFX A;  4HNA A;  4NH7 A;  1ZSP A;  1Q6I A;  1XMO O;  2BSK B;  1CEZ A;  4B7P A;  2YEV B;  4J80 A;  5CA0 A;  1DGS A;  1ZXN A;  3B4S A;  4CS3 A;  3CCQ V;  4H7Q A;  3T1H B;  4LWH A;  2LW1 A;  4PI2 A;  4CH3 A;  1Y66 A;  3SYA A;  5LP6 B;  4HYM A;  5IYC O;  3QF7 A;  2O1U A;  2Q67 A;  2ARH A;  2YKJ A;  3K98 A;  2QKS A;  5JJE B;  1WB8 A;  3O65 A;  1KBH A;  2QF6 A;  1SQB H;  3APQ A;  3C90 A;  3JAS B;  5JJN B;  1VQO V;  3SYO A;  4JV5 B;  1IX9 A;  4GGL A;  5IYZ A;  1Z5W A;  5C93 A;  1GKX A;  2JJC A;  3HR0 A;  4JZ2 A;  4LF4 B;  5TIS Z;  1K5Q A;  3GIF A;  3PEJ A;  4R6Z A;  1KC8 W;  1I08 A;  2QSA A;  3SDL A;  3JZ3 A;  2BSK A;  2YIA A;  2XDK A;  1BKN A;  4NH8 A;  3A0W A;  2RJZ A;  4X66 B;  2YJX A;  1M56 C;  2YE4 A;  4GYC B;  1B62 A;  3ETG A;  2ZE7 A;  3B8M A;  3ZHR A;  2GUZ A;  3J81 N;  3LDD A;  1Q3E A;  5JQG B;  2F1M A;  4DR5 B;  2ZXW B;  3P3N A;  3A2F A;  1US7 A;  3SYC A;  1H8E G;  3JAS A;  2IWS A;  4K35 A;  1UYD A;  2XHT A;  1PV0 A;  1K73 W;  3R91 A;  1VAR A;  4P2Z A;  4YJ2 B;  2ZM6 B;  2DN9 A;  3N2G B;  1TUB B;  3D0B A;  1EFR G;  3ZMZ A;  4FJC C;  5EBM C;  1QLE C;  1VMG A;  3LNN A;  1Z5B A;  3JAR B;  1IVS A;  5IWA O;  2CGF A;  5JEN A;  4LF5 O;  1K7D A;  1V54 C;  1XDC A;  4B3R B;  1AIL A;  2XT9 A;  4ZOL A;  5JQG A;  4LFA O;  3B26 A;  4ZI7 B;  4EFE A;  4YKZ A;  1KEC A;  4O4H A;  2WPD G;  5GGZ A;  4LF6 B;  4CE1 A;  4JI8 O;  4WF9 V;  4DV0 O;  1MAB G;  2BU6 A;  3A0H Z;  1GKF A;  2QFO A;  4YJ2 A;  1ZLZ A;  4XIR A;  3N2G A;  3OT7 A;  1TUB A;  4JYY A;  4I4T B;  4CWN A;  3O2F A;  1SKV A;  3H80 A;  1JJ2 U;  5M4N A;  2UUC B;  3JAR A;  4BAY A;  2HHH O;  1YJN V;  2ITD C;  1MNG A;  4X9Q A;  4CWT A;  2XND G;  3CPW U;  2HJF C;  4KL1 A;  5D5Q A;  3SGI A;  1Q7Y W;  1VP7 A;  3KCY A;  1QR8 A;  2P06 A;  1Q43 A;  4MT8 A;  3OW6 A;  2F93 B;  3KZI Z;  4J11 A;  1NI8 A;  3OGI B;  1OCR C;  2OCC B;  4ZBM A;  2JJ1 G;  4FZ1 A;  4J7K A;  3RKZ A;  1Z2G A;  4L8Z A;  3RLQ A;  3OAA G;  5IY5 B;  4MPN A;  3AG1 C;  4FCR A;  3ZRX A;  4N23 A;  3P3P A;  1U97 A;  3ZM7 A;  5H6R A;  2ZCE A;  1M93 A;  1V55 B;  4FM2 A;  4LWG A;  4I4T A;  1MSW D;  1TC0 A;  4DR4 O;  1U2O A;  3Q4H B;  4X88 A;  5JJJ B;  3W7X A;  3A0R A;  1M57 C;  5EC2 C;  1SA0 A;  4LF9 B;  4J42 A;  2XJG A;  2BOC C;  2XAQ A;  4IIJ A;  3JD4 A;  2WEQ A;  4LF7 O;  4QPJ A;  3CYG A;  4YKY A;  3ZHU A;  1WAZ A;  3CB2 A;  5IYB O;  3T0H A;  1CXZ B;  1UYH A;  2YEJ A;  2HFE C;  2EIN B;  3WB0 A;  2PF4 E;  1Y8N A;  5CA1 B;  4PRV A;  4PA3 A;  3CCL V;  1QLN A;  1GMG A;  2HVJ C;  2QJ1 A;  4OGQ B;  4JI6 O;  1GN6 A;  1THZ A;  4G27 B;  1I5B A;  2WWW A;  1JJO A;  1VF6 A;  4DUY B;  1N34 O;  3JSL A;  3TJT A;  2KQX A;  3ASO C;  4JI2 B;  4NXM O;  3Q4H A;  3RBZ A;  2EIM C;  2YSU B;  5CTX A;  2X0L A;  3ZMU A;  1UYE A;  2CAZ C;  5JWP A;  4ZHQ A;  3AG4 B;  1X4T A;  4DK0 A;  2BSM A;  5IDM A;  4O2B B;  4GKK O;  2VQE O;  1PNM A;  2BU8 A;  1OCC C;  2ZE8 A;  3UKM A;  3C3T A;  5CTW A;  4DV6 O;  4JI7 O;  2WLI A;  2FXS A;  2DQ0 A;  4AS9 A;  2IU3 A;  3CSX A;  2UUB B;  2P6J A;  3T1C A;  3K5M A;  2YEH A;  2W6I G;  1FXK B;  1HNZ O;  1YTF D;  4PV1 B;  4A5U B;  2JVD A;  4DV5 O;  4Q6G A;  1R6K A;  1HR0 O;  3JD0 A;  1H7U A;  3SJA C;  2Q4P A;  1L0O A;  3CGZ A;  1XNQ B;  4CWO A;  1OZ0 A;  3IED A;  2E5L O;  4FLY A;  1RSO A;  2X6C A;  4ASU G;  3T1Y O;  3S5T A;  4K0K B;  3GWK C;  2OIG A;  1LNQ A;  1VQN V;  2LGW A;  4JF3 A;  5E79 Z;  3CWB H;  2A3Q A;  1XNR O;  1AP5 A;  1OCO C;  1U0Z A;  1XMO B;  2Y69 B;  2FB5 A;  1AJP A;  3GIG B;  2QWN B;  4K3A A;  3B2E E;  2UXB O;  4UV9 A;  1BCC H;  4DV2 O;  3VOU A;  3CXH F;  2YEI A;  2IWX A;  3JAT B;  1VQ9 V;  3STZ C;  3VQV A;  1B06 A;  5LA6 B;  3R66 A;  5KA6 A;  4K4O A;  3CRK A;  4GT1 A;  4O05 A;  5FNC A;  2OCH A;  5L3E A;  4TQF A;  5KA5 A;  5GW7 A;  1XBL A;  3E22 A;  1K92 A;  2V1D A;  3L72 H;  3T1K A;  1GTO A;  3K9A A;  3K03 A;  5CMU A;  1QYE A;  3R65 A;  1IZ3 A;  1SQP H;  2UXC B;  2YE3 A;  1SZT A;  4PRX A;  2L6L A;  4J41 A;  4X20 B;  4MPC A;  4GX2 A;  3GIG A;  2CTW A;  1GN4 A;  5B1A C;  5LMU O;  1VIB A;  4JQL A;  4CWS A;  4NVP A;  1EZJ A;  2HG5 C;  1K3E A;  3GB7 C;  2QTS A;  4O4I A;  3LSU A;  2IOQ A;  1Y4S A;  3LDC A;  3JAT A;  2WLK A;  1NS1 A;  3RVZ A;  5LBQ A;  1NKD A;  1L1F A;  1VF7 A;  1KP3 A;  3DSQ A;  1G1X B;  3CS5 A;  4NXN O;  2BOB C;  4L90 A;  5LGN A;  4TV8 B;  3QVN A;  1PKX A;  3ZHT A;  5M4M A;  5KMG A;  3JCZ A;  3RYF B;  4TWK A;  1BYQ A;  5EC1 C;  3CHX A;  2GFD A;  3UO3 A;  4O4J B;  4CH5 A;  2IU0 A;  4H0L B;  4DR7 O;  4X20 A;  4EGI A;  3B40 A;  1L8D A;  3GIE A;  1SQG A;  1I7F A;  5IWA B;  4O2A B;  3ZHQ A;  2VCJ A;  2VQF O;  4KXR A;  3VHC A;  2QM8 A;  1S77 D;  1KMI Z;  1EN5 A;  1R1B A;  5IJ9 A;  3INW A;  4MPE A;  2QWP B;  5FNV B;  2GSM B;  4JAA A;  2YED A;  2E76 B;  3EHF A;  5F5R A;  3CCE V;  4LFA B;  3SL2 A;  2IJI A;  3OWD A;  2CTR A;  2IW5 A;  2UWD A;  2JEX A;  4TUY B;  5J71 A;  1I94 O;  4X1Y B;  2CTQ A;  2ZIN A;  4O09 A;  2CH7 B;  4DV0 B;  4X62 B;  1COW G;  2JGD A;  4QNH B;  2WI1 A;  2RMK B;  5KHG A;  1DK1 A;  2YE2 A;  4FFB A;  4URO A;  4PDM A;  4CWP A;  3MHH C;  4O4J A;  5EIB D;  2YEE A;  2WLL A;  3ZED A;  2UXD B;  3RYH B;  3K04 A;  1I5X A;  5DM6 V;  2DYR B;  4HXW A;  5J2U B;  3CME V;  1H2N A;  3LNU A;  1KP2 A;  1BZK A;  4G28 B;  1YSC A;  4KFM A;  2K5B A;  3G71 V;  3E8H A;  2DYS C;  2RQ6 A;  2QTO A;  3EXA A;  1NT2 B;  3FYI B;  4TUY A;  2YEB A;  2A7W A;  1WNS A;  1YEW A;  2Q9L A;  4CZZ A;  4MS2 A;  4MW8 A;  2Q0A A;  5FL7 G;  4FIP C;  2B1I A;  3FD9 A;  3S3X A;  1FXH A;  3JAK B;  1MOF A;  1IBK O;  1XUQ A;  1FD9 A;  3M7M X;  4DW1 A;  1NTZ H;  5LHH A;  4LWI A;  3KKY A;  3AG3 C;  4DR4 B;  3H01 A;  1RPR A;  4YJ3 B;  3RYH A;  4WFH A;  3B77 A;  5K1X A;  4CC6 A;  3O9O A;  4MSW C;  4QIW F;  1Y4M A;  3W7U A;  2ZIO A;  2BTO A;  2ZNJ A;  4TQD A;  2EZO A;  4WBN B;  3EVK A;  1UY8 A;  4LF7 B;  4GCZ A;  4MVS A;  3T10 A;  4QPK A;  3ZCC A;  2UUA O;  3MDS A;  4FLV A;  5LOV B;  3TZ5 A;  4DV3 B;  5F2V O;  1RM1 C;  1VF6 C;  4PA9 A;  3LNM B;  4NB5 A;  1G4Y B;  5LXT B;  2CDY A;  4MVM A;  1MZF A;  2XHR A;  5FLX N;  5KAI Z;  3JAK A;  4JI6 B;  1EBO A;  1I58 A;  4EEQ A;  4JGS A;  4URL A;  4FLW A;  4YJ3 A;  1H2S B;  4Z1V A;  4NXM B;  2BYI A;  2ESA A;  2FYU H;  3QDD A;  4XKK A;  2YK2 A;  1YIJ V;  1N8R W;  4DV4 O;  4JAS A;  1AI5 A;  3FT8 A;  2E74 B;  4NKG B;  3UM7 A;  4DR6 O;  5LOV A;  2XCM A;  2F23 A;  2HKJ A;  2VS0 A;  1S72 V;  2XD6 A;  4BXI A;  2NNU A;  5B1N A;  2VQE B;  3IC9 A;  1RFY A;  4J7Z A;  2WLM A;  1Y76 B;  4GX0 A;  3CMA V;  5L3D A;  2L35 A;  4O4L A;  3QO5 A;  4JI7 B;  3HKD B;  2YGE A;  4H37 A;  1P7G A;  5EBW C;  2XDU A;  2KB1 A;  4WUB A;  4LFC O;  4UFZ A;  1TID A;  2BTZ A;  2EIJ C;  4XDJ A;  3JD2 A;  2A06 H;  1ZX3 A;  2V4D A;  5EBL C;  4I5S A;  1HR0 B;  1R6T A;  3BVO A;  4PDV A;  2YC0 A;  2CCS A;  3L73 H;  3PN1 A;  3K0D A;  3OR7 C;  2XAG A;  3K06 A;  2E5L B;  3ZRW A;  1R3J C;  4R8C A;  1YER A;  5M4K A;  2CG9 A;  3ETD A;  3EHB B;  3Q5K A;  2XDL A;  1Q6H A;  3FX7 A;  4LWS B;  3ZKD A;  4E4E A;  2ODM A;  1VQM V;  4TV9 B;  3NMQ A;  4U7N A;  4H13 B;  4GKJ B;  1XNR B;  4I7Z B;  3BPZ A;  3HKD A;  3CJH B;  5EZY B;  3ABL C;  5JVD A;  2PTM A;  2XX4 A;  4PHZ A;  4XTJ A;  4UVA A;  2D3O W;  2F95 B;  2UXB B;  1AI7 A;  1TGO A;  1ROP A;  1KYO F;  1R3L C;  4DV1 O;  1FFX B;  2R9I A;  2EJR A;  1Q81 W;  1EM1 A;  3E83 A;  4UCU A;  2OIE A;  4HZ0 A;  4FMT A;  2AHZ A;  3ABM C;  3OTO O;  1AVM A;  5EYP A;  3A0Z A;  4CS4 A;  1NTM H;  1R62 A;  1GRJ A;  1JMK C;  2QWO B;  1QU7 A;  4LWS A;  2ZBK B;  4HZ5 A;  3SJB C;  3CCJ V;  2WI4 A;  3N27 A;  1P84 F;  4LR3 A;  4PA6 A;  1ORQ C;  4DV7 B;  4AHC A;  5A2Q N;  4GQT A;  4HXZ A;  4ZVI A;  1XMQ O;  5LMU B;  2QG2 A;  2Q8I A;  4YY3 O;  4DR1 O;  4X1I B;  3JD1 A;  1GO3 F;  3OM3 B;  4BW5 A;  3K3W A;  3K5L A;  1FFX A;  1BHB A;  3ZXO A;  5B3S C;  4PJ0 Z;  1OCO B;  5B66 Z;  4FVM A;  2AZ2 A;  3BEH A;  2EIL C;  2Z0A A;  3K99 A;  4KQV A;  2A0L A;  2AW9 A;  2E3C A;  2IM9 A;  5M4E A;  2WI7 A;  4P8O A;  2ZE6 A;  5LHG A;  4GFN A;  3N2K B;  2Q8F A;  5FND A;  3UCS C;  4DR7 B;  3AK3 A;  1JFF A;  1PVG A;  1BXD A;  3ZHV A;  5KX5 B;  4B3S O;  1AM1 A;  2KKW A;  3T2M A;  4U3J A;  4X1I A;  1NH2 B;  3B27 A;  4YKX A;  2G38 A;  2WA4 A;  4LP0 A;  4QE7 A;  5H2F Z;  4DRX B;  2XAF A;  1H2L A;  2YI5 A;  2ADP A;  3IGA C;  3EHH A;  5H6Q A;  3H1K H;  4DYL A;  1Z5A A;  4MVR A;  1I94 B;  3SPC A;  3CRL A;  4ASA A;  2YEV A;  2VRZ A;  3KG2 A;  2XK2 A;  4O04 A;  2IH1 C;  2PUS A;  1K97 A;  5CBH A;  3BA9 A;  5LP6 A;  4BIU A;  1XL4 A;  1JVM A;  1GJV A;  3N2K A;  3UQ8 A;  1AR4 A;  1K5S A;  4DUZ O;  3RYI B;  3ZN1 A;  4RO2 A;  1YES A;  5KX5 A;  1IBM B;  3K79 A;  3WHA A;  2EIK B;  1F7Y A;  4CWF A;  5HFM A;  4DRX A;  3ASN C;  3G6E V;  1FPO A;  1Q5O A;  4UCS A;  1L0N H;  4W4L A;  4KHP O;  2Q8V A;  5D6P A;  4QJF B;  4WFE A;  4EMV A;  1KZN A;  4PI0 A;  1VQ5 V;  1IBK B;  3MNR P;  2H55 A;  2P4K A;  4EGK A;  2ZD9 A;  4YXW G;  1US6 A;  1I59 A;  3RYI A;  4D6T H;  2V7Q G;  3HKE B;  3OD4 A;  4MVO A;  5JCO C;  3ICX A;  1QR9 A;  5E1A C;  2RN9 A;  1AJ6 A;  1QVF U;  1MMM A;  1GH6 A;  4JYA O;  4JI5 B;  4AQY B;  2FYP A;  1IUR A;  4RAI A;  5L3J A;  4I50 B;  2X6A A;  1F4M A;  3O0I A;  1WPX A;  1IXB A;  2F4V B;  3DXR B;  2X7R B;  1MA1 A;  3BFR A;  5M4H A;  2BTQ B;  2WLJ A;  5CTU A;  3E8F A;  2JS5 A;  4EM7 A;  3I5D A;  3D8C A;  3OPD A;  4MTF A;  3OUF A;  4B6C A;  3BA8 A;  4U3F H;  5D7D A;  3QG5 A;  3O6O A;  2FTK A;  3OR6 C;  4ZI7 A;  3EFF K;  4PL9 A;  2Y4T A;  1TIL A;  1R6N A;  1K34 A;  1BHA A;  2HG1 A;  4AWO A;  3WG7 C;  4MOT A;  4DV4 B;  1BGY H;  1PM9 A;  2PI4 A;  4H81 A;  3EKR A;  2YJW A;  2N05 A;  3AG7 A;  4LBE C;  3X2Q C;  4RUE A;  2YKC A;  4XDL A;  1Y8O A;  4WCE V;  2CK3 G;  4MW3 A;  1XI1 A;  4LF8 B;  4LH6 A;  1N4C A;  3ZJZ A;  2HHI A;  2QM7 A;  1I5D A;  1Y8P A;  2BTQ A;  1B6Q A;  1AJN A;  3UT5 B;  3HPL C;  2EBO A;  1BSM A;  4L87 A;  5IYD O;  5ITZ B;  2HLD G;  3CWV A;  1XQ8 A;  5CN0 A;  1UYF A;  1TAE A;  4U7O A;  3CC4 V;  4MTX A;  3AEI A;  3C3S A;  1WP7 A;  3OMU A;  4JI3 O;  1OSF A;  4F6E A;  4OX9 B;  1RP3 B;  2A9H A;  4FM1 A;  2B5U A;  4EGH A;  3WFV A;  4EKW A;  2AZ0 A;  4JI0 O;  1YC3 A;  4PU9 A;  1BS3 A;  3HEK A;  2Q7E A;  4JAU A;  4JTD B;  5K1P A;  3SJC C;  4UUJ C;  3F7V C;  2QA4 V;  3WB1 A;  2OWO A;  2YXH A;  4R7C A;  3M8A A;  3AK2 A;  5CB4 B;  1KUQ A;  5CA1 A;  5EIB C;  4KFG A;  4RUF A;  2EX3 A;  4DV1 B;  4GX5 A;  2BU2 A;  1Y4U A;  1KU9 A;  1CPY A;  1YXB A;  3OTO B;  1Z5C A;  2PYJ A;  2UXN A;  4J10 A;  3VBB A;  2YGA A;  1R3K C;  2R72 A;  4WUC A;  1SQF A;  3OMA B;  4CE3 A;  3BRC A;  1Y67 A;  4X89 A;  4E01 A;  4ICG A;  5B1O A;  2WAM A;  3CCU V;  1YT1 A;  1N33 O;  5L3G A;  4WFG A;  3SPI A;  1E1Q G;  4YKW A;  1XMQ B;  1UY9 A;  4O2B A;  2C2A A;  1ZWH A;  4ABM A;  1GK9 A;  3ZIA G;  3CRM A;  3R4M A;  2WI2 A;  4X8A A;  3AG2 C;  4DUH A;  4EFB A;  4R50 A;  3G7E A;  2FWY A;  3L74 H;  3K58 A;  2LQT A;  1NVP B;  3FB6 C;  2ZR2 A;  1FXK A;  1SER A;  2ILM A;  4H85 A;  3P32 A;  4E02 A;  1GAX A;  1SQV H;  5HFL A;  1XOU A;  1M5I A;  4PD4 F;  3CX5 F;  4AI8 A;  2YK9 A;  2QWR B;  1OCZ C;  1Q86 W;  3JAM N;  2WI5 A;  2CE4 A;  3JAL B;  2DWE C;  2EXL A;  1P49 A;  3LUT B;  3RGB A;  2GQP A;  5BOC A;  3TTZ A;  4W7T A;  5F3K A;  5LMN O;  4B3S B;  2EUL A;  4KSG A;  1D5A A;  4XDK A;  2Q5Z A;  4X1K B;  1QBZ A;  3DC6 A;  2QKC A;  4LNU B;  4GEE A;  1WP8 A;  3HKB B;  5LP6 C;  2LGQ A;  3FT5 A;  1NR1 A;  1TC6 A;  3Q5J A;  3ABK B;  4X64 O;  3B8N A;  3R4O A;  1TVK B;  1YSR A;  3NR7 A;  3FAV B;  3RLP A;  2AKP A;  1YJW V;  1FJG O;  4XC0 A;  1UYG A;  1N36 O;  2P5O A;  2Q2E B;  3HKC B;  2ZDI A;  5LA6 A;  1VQP V;  3JAW B;  5D7R A;  1T5E A;  1JQ0 A;  1EA6 A;  4XCJ A;  4DR2 O;  4CH6 A;  4X1K A;  2EIL B;  2ZE5 A;  3TZ0 A;  5JH7 B;  1DF4 A;  1QHT A;  4L93 A;  3TCU A;  1AR1 B;  3ZRS A;  2NN4 A;  4XKA A;  2QWQ B;  1J5E O;  1HNW O;  4KP4 A;  1TVK A;  2ZXW C;  4JAV A;  1YCI A;  4BQG A;  3EHG A;  1SQQ H;  4LF5 B;  1YHQ V;  3KE6 A;  3DTU B;  3T1H O;  5KHJ A;  2WSS G;  2WA3 A;  3CEI A;  1TH8 A;  3L71 H;  4FLZ A;  3JAW A;  2R9A A;  2YI8 A;  5FPO A;  3R4N A;  4URN A;  4JI8 B;  4K8X A;  3ABT A;  5DN6 G;  2GHY A;  4JV5 O;  4TV8 A;  1M56 B;  4R1F A;  4RWU A;  4NYK A;  3HZ5 A;  4V25 A;  2MW2 B;  3ABU A;  3RYF A;  2YIB A;  4IHJ B;  1NR7 A;  3K9S A;  4DW0 A;  3CP1 A;  3S3W A;  2M6Y A;  5LGU A;  3E8B A;  2LFR A;  4I3H A;  1VQ7 V;  1V9P A;  3SYQ A;  4O2A A;  2PGG A;  3CCM V;  1YIT V;  2HHH B;  4GUN A;  2YE9 A;  3TET A;  4O07 A;  5M4P A;  3ML0 A;  1EN6 A;  1YF2 A;  3ZKB A;  5FNV A;  1SZX A;  4X66 O;  1THN A;  5IT9 N;  2WLH A;  4PDR A;  4UCR A;  1QLE B;  2YKE A;  4X1Y A;  4BAE A;  4DR5 O;  1Q82 W;  4X9L A;  2PY5 A;  2P22 C;  2CH7 A;  2XHB A;  1V54 B;  5CTY A;  1YVW A;  2QR4 A;  2YUA A;  4LFB O;  1Z5V A;  1NQT A;  2YEA A;  2ZM6 O;  4TOI A;  1LUV A;  3RN4 A;  3JCU Z;  2DW4 A;  3F5T A;  2OCC C;  3D3Q A;  5J2U A;  5KUM A;  4TSF G;  4ASG A;  2ZNI A;  4H33 A;  5IY5 C;  3ZMV A;  3RVY A;  4HYP A;  2YE6 A;  4FLT A;  1PPJ H;  1V55 C;  1FS0 G;  3ZS8 C;  1UYM A;  3KCX A;  4X65 O;  3W7T A;  3A0X A;  2HR3 A;  4JI3 B;  2Y48 A;  2QGN A;  4NTX A;  1WLE A;  3BHP A;  1E79 G;  4CWR A;  1BQ0 A;  3TUH A;  5CF0 A;  2VW5 A;  4P9O A;  1R73 A;  1TUE B;  1OCR B;  4HAM A;  1N34 B;  2XAS A;  2YXY A;  2AGA A;  1J95 A;  5BZB A;  4MP2 A;  3AG1 B;  2EIN C;  1HNX O;  5C8Y B;  4WBN A;  4V26 A;  5BY1 A;  1AH6 A;  5CBG A;  1Q90 D;  3OFN G;  1JCH A;  1WJZ A;  2AXT Z;  1PD3 A;  2XOK G;  2XDX A;  4XIP A;  4FK5 C;  1ZUQ A;  2KG7 B;  3L9D A;  5LXT A;  4HBN A;  3OWB A;  4GKK B;  1M57 B;  4LWF A;  2NLJ C;  2Q69 A;  2Y0I A;  4B3M O;  4FCP A;  3DGE A;  5IJ0 B;  5AG2 A;  3AG4 C;  4DV6 B;  4JYC A;  3ZMS A;  3P30 A;  3ZN0 A;  1S5L Z;  4ASB A;  3CYO A;  1O9G A;  4WFB V;  2HVK C;  2Q7G A;  5LYJ B;  1HNZ B;  2WI3 A;  4DV5 B;  5DED A;  5CPH A;  1Z59 A;  4LF9 O;  4WFF A;  1YT0 A;  5H5N A;  3ASO B;  5L3F A;  2YEG A;  3R92 A;  2EIM B;  4B3T O;  2CGO A;  3T1Y B;  4B08 A;  1FXK C;  2ETN A;  3J7A U;  1Y76 A;  1B63 A;  1FYJ A;  1MZE A;  4AWQ A;  1ZTE A;  1TA8 A;  2QE7 G;  2PI5 A;  1G8M A;  1NHH A;  1OV9 A;  4MVU A;  3SJQ C;  4DUY O;  4B7E A;  2ATK C;  1YS3 A;  4FLX A;  3A0Y A;  4DV2 B;  5B1B C;  4IL6 Z;  3RT3 C;  3T4D A;  1QNM A;  4IT5 A;  1OCC B;  1KKC A;  4FCQ A;  3WU2 Z;  1RPO A;  1Y6X A;  4UVB A;  2DJV A;  3OMI B;  4W4K A;  5LMN B;  2Y69 C;  2AHY A;  3H1H H;  2RDC A;  2IBZ H;  2XUM A;  1F23 A;  1LR1 A;  4TV9 A;  1YI2 V;  1UYL A;  4X64 B;  4XCL A;  2P7T C;  1BMF G;  2ZKO A;  3CJH A;  3T0Z A;  4HNA B;  1NTK H;  5EZY A;  4WFA V;  2XX2 A;  3HYZ A;  5CA0 B;  3G4S V;  2ZR3 A;  1YT2 A;  3BAB A;  3U10 A;  1FJG B;  2H8P C;  5BOD A;  4K8Z A;  1N36 B;  3FB7 C;  3THO A;  2IJJ A;  5A9G A;  1QCE A;  2ZT9 B;  4DR2 B;  4NXN B;  1XNQ O;  2B9Z A;  5LHI A;  4BWA A;  1S5H C;  5IYZ B;  3ETE A;  1UY6 A;  4PEL A;  1D2D A;  3GWO A;  3B28 A;  5FPR A;  4K0K O;  1OCZ B;  4JI1 O;  1I5Y A;  4JPR A;  2NR5 A;  2VWC A;  1Q8I A;  1J5E B;  1HNW B;  5GTI Z;  3OEE G;  2VCI A;  4IGG A;  2C1I A;  3E35 A;  3E86 A;  3QO7 A;  2W6J G;  3RW0 A;  4CE2 A;  3LPS A;  3FFQ A;  2IH3 C;  2VQF B;  4YKQ A;  4P7A A;  1XRE A;  3TGU H;  1M4U A;  2RNB A;  1I5A A;  1PP9 H;  4UCT A;  1AJQ A;  4YHH O;  4YIO A;  2QEX V;  2GUZ B;  3K60 A;  5LGT A;  3Q5L A;  5B1A B;  1GM9 A;  3FYE B;  1QQC A;  4MVZ A;  2M7W A;  3SR2 C;  1N32 O;  3A0T A;  3U2D A;  4EEH A;  3U2K A;  3I55 V;  2ZIM A;  1SS3 A;  2UXC O;  1QZR A;  2XAJ A;  3A0B Z;  3J80 N;  1GM8 A;  3CRC A;  1NJI W;  2YEC A;  1K4D C;  3H1L H;  3E89 A;  1IXM A;  3WB2 A;  1IBL O;  3HB3 B;  3MD0 A;  4UCO A;  3D3I A;  2W0X A;  4DZY A;  3G67 A;  2HJD A;  4J9Y B;  1KKD A;  2WER A;  3CC2 V;  2BU5 A;  1JPX A;  4ZOL B;  3D36 A;  4LCU C;  3RWR D;  2EJ7 A;  2DYR C;  4O4H B;  1M1K W;  3GVM A;  1AH8 A;  1UYC A;  2UXX A;  4C7U A;  3T4Z A;  3HZ1 A;  3TZ2 A;  3IAY A;  4LFB B;  4UV8 A;  4HZ3 A;  1JX9 A;  1G6U A;  3K59 A;  3U67 A;  2DQ3 A;  1VF5 B;  1YET A;  4EB6 B;  5KHI A;  4LH7 A;  3SPG A;  5D6Q A;  3CE2 A;  3ZMT A;  3VQW A;  1WPB A;  5KHH A;  2BE3 A;  2YDE A;  4E00 A;  1F51 A;  2H8M A;  1BL8 A;  1SES A;  5KAF Z;  5L3B A;  3K97 A;  2UUA B;  4HY1 A;  5J6A A;  1KQS U;  1HDJ A;  2DMX A;  4DR3 O;  3G75 A;  1KIJ A;  4X65 B;  1WA8 B;  5IE9 A;  3HHU A;  4YKR A;  5J9P C;  2CH4 A;  4JTC B;  4WUD A;  3VAD A;  4LWE A;  4PDL A;  3W7W A;  5GON B;  2QM4 A;  2BU7 A;  2YI0 A;  1ID0 A;  4X62 O;  2XDS A;  2JEU A;  1NVP D;  2JDI G;  4J9Z B;  2DYS B;  1BE3 H;  4JZG A;  3BAA A;  3HKE A;  3K5O A;  2YKI A;  3A8T A;  4EB6 A;  2C1G A;  4QE9 A;  2O1V A;  1ZW9 A;  1W2B U;  2UXD O;  1SQX H;  1SET A;  2CCT A;  1UFI A;  1HNX B;  2YE8 A;  1ENV A;  1SA0 B;  4I50 A;  2P4V A;  1GN3 A;  4IIJ B;  2Q0O C;  4DR6 B;  3AG3 B;  4DO2 A;  1JA8 A;  1PNK A;  3DXR A;  1WA8 A;  4JI4 O;  1R3I C;  1BT8 A;  4G2K A;  4TT3 G;  4B3M B;  5GON A;  1Y74 B;  1AI4 A;  1YJ9 V;  1SC5 B;  3LDE A;  2IWU A;  4R3M A;  1D5N A;  4HY6 A;  2LJ2 A;  5J2T B;  3SPH A;  1IDS A;  3QO8 A;  5DEC A;  1RM1 B;  1QVG U;  4LFC B;  5D7C A;  2N04 A;  2W0F C;  2D2C B;  1CP9 A;  2DWD C;  3JD3 A;  4FPP A;  4ASF A;  4ZHQ B;  5FWK A;  2WI6 A;  5EK0 A;  4D7S A;  4EFU A;  2XAH A;  3ETQ A;  2YE7 A;  4BR6 A;  3LMM A;  2GTS A;  4GZR B;  1VEW A;  1URF A;  4DV3 O;  4B3T B;  1W0J G;  2YIB D;  4AWP A;  4U93 A;  2Q7H A;  2DOS A;  3UT5 A;  1Y74 A;  3SPJ A;  2H94 A;  1DLB A;  1FFT B;  5J2T A;  4CC5 A;  2E75 B;  4OPH A;  2LW7 A;  2YE5 A;  1X59 A;  1WB7 A;  1L0L H;  4BIO A;  5ITZ A;  2CCU A;  3G7B A;  2WLI B;  1ZXM A;  1VQK V;  1ZAU A;  3ZX6 A;  1S5J A;  3TXQ A;  3H1J H;  4F6R B;  2JGU A;  2ITC C;  1XIL A;  1XL6 A;  1YC4 A;  1EI1 A;  1N0N A;  3B25 A;  4I0X B;  3DC5 A;  3CGY A;  4Z2W A;  4MTO A;  4JTA B;  2UU9 O;  2EIJ B;  3AK1 A;  3JSN A;  4JYB A;  2IOR A;  1AB3 A;  2GBO A;  1RSO B;  2Q73 A;  4CBC A;  2KSD A;  3IC7 A;  1UJW B;  2ZDX A;  3QTC A;  4KTN A;  3FV5 A;  3NXS A;  4UCV A;  4J7J A;  1NHJ A;  2Z5U A;  3ZXQ A;  5CB4 A;  4YY3 B;  1EN4 A;  4DR1 B;  4CWQ A;  1U96 A;  4F6R A;  1AP6 A;  4MBC A;  3T2S A;  3CC7 V;  4MTG A;  1PL4 A;  4I0X A;  4NTW A;  1I5C A;  3BCC H;  3ABL B;  1GM7 A;  4LPB A;  2O1W A;  2QKA A;  1YSZ A;  3LSS A;  1PL0 A;  4LC1 A;  5B1B B;  1MG1 A;  3E22 B;  3K0G A;  4GX1 A;  1AI6 A;  4NH9 A;  3BY6 A;  4JI1 B;  2F43 G;  2CGN A;  4NTY A;  2XX5 A;  3WQ9 A;  5BR8 O;  5D5P A;  4GKJ O;  2Y4U A;  2K9P A;  3ABM B;  1H8H G;  3ZHS A;  1LUW A;  3EHJ A;  1XHZ A;  1VQ8 V;  2OTJ V;  1EZV H;  4MVQ A;  2IOP A;  1QY8 A;  4YHH B;  4O4I B;  3E2E A;  1UYK A;  4DXW A;  4XKO A;  2LP7 A;  2HKO A;  3VHD A;  4E72 A;  3H1I H;  3VHA A;  2JRI A;  4BIZ A;  3STL C;  1N32 B;  4IYH A;  2IJK A;  2YI6 A;  5KMG B;  1A32 A;  4D7T A;  2Z3Y A;  3JAL A;  4DUZ B;  2JJ2 G;  3L75 H;  5B3S B;  4DV7 O;  3TXS A;  3ZRV A;  5LL6 Y;  4XD8 A;  1VQL V;  1JOY A;  2ZDY A;  1IBL B;  5B5E Z;  3D36 C;  1H2K A;  2YIC A;  2A79 B;  4I55 B;  4UB8 Z;  5CA3 A;  3CD6 V;  3OE7 G;  2WLN A;  4LNU A;  3E8G A;  4XIT A;  3HKB A;  5IJ9 B;  2HEP A;  3G6B A;  4UB6 Z;  1NZ6 A;  1I0H A;  2PZS A;  3JYC A;  4AIL C;  3FAV A;  4KHP B;  1XHX A;  1DF5 A;  3CRR A;  1NBM G;  1KB9 F;  2P67 A;  3L70 H;  1H38 A;  5CBF A;  2EIK C;  3QNE A;  1W59 A;  2JGD B;  3W7S A;  3HKC A;  1UY7 A;  4FFB B;  5GTH Z;  1E1R G;  4R3A A;  4I9W A;  3G80 A;  3ZBH A;  2WLL B;  2YKB A;  4NR1 A;  4I55 A;  2XAB A;  1VQ6 V;  4JYA B;  5JH7 A;  1M90 W;  3R4P A;  3K57 A;  1K4C C;  4LF4 O;  2FML A;  1TBW A;  2FL4 A;  1YDX A;  3OTF A;  3VQY A;  2DE0 X;  4DR3 B;  2YID A;  1AMW A;  3H4L A;  2R70 A;  1GN2 A;  2BT0 A;  5BXZ A;  3APO A;  1FAF A;  2Q8G A;  2JS3 A;  3ASN B;  4UVC A;  4L8J A;  2GDS A;  3U0Z A;  1H7S A;  1PNL A;  1MSD A;  1UPG A;  3F7Y C;  1YTF B;  1A4H A;  1VQ4 V;  1S14 A;  4FLU A;  2FKX A;  3VQX A;  3C0E A;  3CRQ A;  1M9N A;  4Q20 A;  3U11 A;  3CXC U;  1IBM O;  3PEH A;  4XE2 A;  1K8A W;  3FKS G;  5L3C A;  3CRA A;  5KLV H;  4IHJ A;  1BGQ A;  1H2G A;  2BRE A;  3C11 A;  4ZIB A;  4RQF A;  1FKA O;  5BMV B;  4JI4 B;  2XJJ A;  2CTP A;  4IYI A;  4OPA A;  1BQZ A;  2B1G A;  4BQJ A;  1NU1 H;  4XIQ A;  2RCV A;  4B3R O;  2CUG A;  2R9R B;  3LSQ A;  2PYL A;  2Q6A A;  3B24 A;  4P30 A;  4OXS A;  1K9M W;  1OJH A;  1Q6U A;  2Y0P A;  3PJS K;  1S0V A;  1S16 A;  4LF6 O;  4QGP A;  2IJH A;  3CCV V;  1OHH G;  3K5N A;  4JI5 O;  3B09 A;  2ADQ B;  4AQY O;  4CH4 A;  4H44 B;  4XDM A;  4JI0 B;  4FZ0 A;  5JCO A;  2EZP A;  5BMV A;  3QTF A;  3TK1 A;  5KHK A;  2YS8 A;  1MX0 A;  2HP8 A;  5IN9 A;  2UUC O;  2F4V O;  3WG7 B;  2YXL A;  3OEH G;  2GTA A;  2BZ5 A;  2BCC H;  2YI7 A;  3D2R A;  5FNF A;  4L91 A;  2P90 A;  3X2Q B;  2YEF A;  4O4L B;  1ZWI C;  1NH2 D;  1HP8 A;  1FXV A;  3M99 B;  4URM A;  4F4L A;  4LP8 A;  3MAQ A;  1GKZ A;  2F66 C;  2LO1 A;  3IJ4 A;  2JKI A;  2QG0 A;  1H2M A;  5IDJ A;  3INX A;  1SF9 A;  1DTO A;  3K08 A;  2H3O A;  4BW9 A;  1S76 D;  2BYH A;  2OT5 A;  3FB5 C;  4DK1 A;  2XHX A;  1XEQ A;  4CS2 A;  4FM0 A;  1AR5 A;  4LF8 O;  2UU9 B;  1ARO P;  2BRC A;  2OYQ A;  3ZRW B;  5C8Y A;  4RQE A;  1HW7 A;  3RFR A;  2E0A A;  4MB9 A;  2HCH A; 
#chains in the Genus database with same CATH homology
 2K1E A;  1SRY A;  3CCS V;  1YC1 A;  4YKT A;  1S3J A;  4HYO A;  1F4N A;  1KD1 W;  3FB8 C;  5KUK A;  4EFT A;  2X6B A;  1HWY A;  2ZKJ A;  3OW2 U;  1B3Q A;  2ZQM A;  3MHS C;  4UXN A;  4PA7 A;  4XBF A;  2XJX A;  2LFS A;  1UYI A;  2WEP A;  2FWZ A;  2PNR A;  4ZKI A;  2Q68 A;  3OUS A;  2OTL V;  3BMY A;  2Q8H A;  1P4R A;  4GT8 A;  2JIZ G;  4O0B A;  1JM6 A;  3EKO A;  4P9P A;  1NHI A;  4N21 A;  3HYY A;  3BM9 A;  3SYP A;  4MP7 A;  3TZ4 A;  4KUM A;  2JK5 C;  2ZDI C;  4YKU A;  4L94 A;  4E2L A;  3AG2 B;  4PA4 A;  3OGC C;  4KSH A;  3I56 V;  3ABK C;  1P7B A;  1K33 A;  2YGF A;  1W0K G;  5H9C A;  4Z1M G;  3CCR V;  3F5W C;  2MK3 A;  3OMN B;  1MU5 A;  3RLR A;  3IFX A;  4NH7 A;  1CEZ A;  4B7P A;  2YEV B;  1ZXN A;  3CCQ V;  4H7Q A;  4LWH A;  1Y66 A;  3SYA A;  4HYM A;  5IYC O;  2O1U A;  2Q67 A;  2YKJ A;  3K98 A;  2QKS A;  2QF6 A;  1VQO V;  3SYO A;  4GGL A;  5C93 A;  1GKX A;  2JJC A;  1K5Q A;  3GIF A;  3PEJ A;  4R6Z A;  1KC8 W;  3JZ3 A;  2XDK A;  1BKN A;  4NH8 A;  3A0W A;  2YJX A;  1M56 C;  2YE4 A;  1B62 A;  3ETG A;  3B8M A;  3LDD A;  2ZXW B;  1US7 A;  3SYC A;  1H8E G;  2IWS A;  1UYD A;  2XHT A;  1K73 W;  3R91 A;  4P2Z A;  3D0B A;  1EFR G;  3ZMZ A;  4FJC C;  5EBM C;  1QLE C;  1Z5B A;  2CGF A;  1K7D A;  1V54 C;  3B26 A;  4YKZ A;  1KEC A;  2WPD G;  5GGZ A;  4CE1 A;  4WF9 V;  1MAB G;  2BU6 A;  1GKF A;  2QFO A;  4XIR A;  4CWN A;  3O2F A;  3H80 A;  1JJ2 U;  5M4N A;  4BAY A;  1YJN V;  2ITD C;  4CWT A;  2XND G;  3CPW U;  2HJF C;  1Q7Y W;  1QR8 A;  4MT8 A;  3OW6 A;  1OCR C;  2OCC B;  4ZBM A;  2JJ1 G;  3RKZ A;  4L8Z A;  3RLQ A;  3OAA G;  5IY5 B;  4MPN A;  3AG1 C;  4FCR A;  3ZRX A;  4N23 A;  3ZM7 A;  5H6R A;  1V55 B;  4LWG A;  1MSW D;  1TC0 A;  1U2O A;  4X88 A;  3W7X A;  3A0R A;  1M57 C;  5EC2 C;  2XJG A;  2BOC C;  2XAQ A;  3JD4 A;  2WEQ A;  4QPJ A;  4YKY A;  5IYB O;  3T0H A;  1UYH A;  2YEJ A;  2HFE C;  2EIN B;  1Y8N A;  4PRV A;  4PA3 A;  3CCL V;  1QLN A;  1GMG A;  2HVJ C;  1THZ A;  4G27 B;  1I5B A;  2WWW A;  3ASO C;  3RBZ A;  2EIM C;  2YSU B;  5CTX A;  2X0L A;  3ZMU A;  1UYE A;  3AG4 B;  2BSM A;  5IDM A;  1PNM A;  2BU8 A;  1OCC C;  3UKM A;  5CTW A;  2WLI A;  2FXS A;  2DQ0 A;  4AS9 A;  2IU3 A;  2P6J A;  3T1C A;  2YEH A;  2W6I G;  1FXK B;  1YTF D;  1R6K A;  3JD0 A;  1H7U A;  1L0O A;  3CGZ A;  4CWO A;  1OZ0 A;  3IED A;  2X6C A;  4ASU G;  1LNQ A;  1VQN V;  4JF3 A;  1OCO C;  1U0Z A;  2Y69 B;  1AJP A;  3GIG B;  4UV9 A;  3VOU A;  2YEI A;  2IWX A;  1VQ9 V;  3STZ C;  5KA6 A;  4K4O A;  3CRK A;  4GT1 A;  4O05 A;  5FNC A;  5L3E A;  5KA5 A;  5GW7 A;  1K92 A;  2V1D A;  3T1K A;  1GTO A;  3K9A A;  3K03 A;  5CMU A;  1QYE A;  3R65 A;  2YE3 A;  1SZT A;  4PRX A;  4MPC A;  4GX2 A;  3GIG A;  5B1A C;  4JQL A;  4CWS A;  1EZJ A;  2HG5 C;  1K3E A;  3GB7 C;  2IOQ A;  1Y4S A;  3LDC A;  2WLK A;  3RVZ A;  5LBQ A;  1NKD A;  1L1F A;  1KP3 A;  2BOB C;  4L90 A;  5LGN A;  1PKX A;  5M4M A;  3JCZ A;  4TWK A;  1BYQ A;  5EC1 C;  2GFD A;  2IU0 A;  4EGI A;  3GIE A;  2VCJ A;  3VHC A;  2QM8 A;  1S77 D;  3INW A;  4MPE A;  2GSM B;  2YED A;  3EHF A;  5F5R A;  3CCE V;  3SL2 A;  2IJI A;  3OWD A;  2IW5 A;  2UWD A;  2JEX A;  5J71 A;  4O09 A;  1COW G;  4QNH B;  2WI1 A;  2YE2 A;  4URO A;  4PDM A;  4CWP A;  3MHH C;  2YEE A;  2WLL A;  3K04 A;  1I5X A;  5DM6 V;  2DYR B;  4HXW A;  3CME V;  3LNU A;  1KP2 A;  4G28 B;  1YSC A;  4KFM A;  2K5B A;  3G71 V;  3E8H A;  2DYS C;  2QTO A;  3FYI B;  2YEB A;  4CZZ A;  4MS2 A;  4MW8 A;  5FL7 G;  4FIP C;  2B1I A;  1FXH A;  1MOF A;  4LWI A;  5LHH A;  3AG3 C;  3H01 A;  1RPR A;  4WFH A;  3B77 A;  4MSW C;  4QIW F;  1Y4M A;  3W7U A;  2EZO A;  1UY8 A;  4GCZ A;  4MVS A;  3T10 A;  4QPK A;  3ZCC A;  3TZ5 A;  1RM1 C;  4PA9 A;  3LNM B;  1G4Y B;  4MVM A;  2XHR A;  1EBO A;  1I58 A;  4JGS A;  4URL A;  2BYI A;  2ESA A;  3QDD A;  4XKK A;  2YK2 A;  1YIJ V;  1N8R W;  4JAS A;  1AI5 A;  3FT8 A;  3UM7 A;  2XCM A;  2HKJ A;  1S72 V;  4BXI A;  2XD6 A;  2NNU A;  5B1N A;  2WLM A;  4GX0 A;  3CMA V;  5L3D A;  3QO5 A;  2YGE A;  4H37 A;  5EBW C;  2XDU A;  2KB1 A;  4WUB A;  1TID A;  2BTZ A;  2EIJ C;  4XDJ A;  3JD2 A;  5EBL C;  4I5S A;  4PDV A;  2CCS A;  3K0D A;  3OR7 C;  2XAG A;  3K06 A;  3ZRW A;  1R3J C;  4R8C A;  1YER A;  5M4K A;  2CG9 A;  3Q5K A;  3ETD A;  3EHB B;  2XDL A;  3ZKD A;  1VQM V;  3NMQ A;  4U7N A;  3ABL C;  2XX4 A;  4XTJ A;  4UVA A;  2D3O W;  1AI7 A;  1ROP A;  1R3L C;  2R9I A;  2EJR A;  1Q81 W;  3E83 A;  4HZ0 A;  4FMT A;  2AHZ A;  3ABM C;  3A0Z A;  1R62 A;  2ZBK B;  4HZ5 A;  3CCJ V;  2WI4 A;  4PA6 A;  1ORQ C;  4GQT A;  4HXZ A;  4ZVI A;  2QG2 A;  2Q8I A;  3JD1 A;  1GO3 F;  3OM3 B;  4BW5 A;  3K3W A;  1BHB A;  3ZXO A;  5B3S C;  1OCO B;  3BEH A;  2EIL C;  3K99 A;  4KQV A;  2A0L A;  5M4E A;  2WI7 A;  4P8O A;  5LHG A;  4GFN A;  2Q8F A;  5FND A;  1PVG A;  1BXD A;  1AM1 A;  3T2M A;  1NH2 B;  3B27 A;  4YKX A;  4LP0 A;  4QE7 A;  2YI5 A;  2XAF A;  3IGA C;  3EHH A;  5H6Q A;  1Z5A A;  4MVR A;  3SPC A;  3CRL A;  4ASA A;  2YEV A;  3KG2 A;  2XK2 A;  4O04 A;  2IH1 C;  1K97 A;  5CBH A;  4BIU A;  1XL4 A;  1JVM A;  1GJV A;  1K5S A;  3ZN1 A;  4RO2 A;  1YES A;  3K79 A;  3WHA A;  2EIK B;  4CWF A;  5HFM A;  3ASN C;  3G6E V;  5D6P A;  4QJF B;  4WFE A;  4EMV A;  1KZN A;  1VQ5 V;  3MNR P;  2H55 A;  4EGK A;  2ZD9 A;  4YXW G;  1I59 A;  2V7Q G;  4MVO A;  1QR9 A;  5E1A C;  1AJ6 A;  1QVF U;  2FYP A;  5L3J A;  4RAI A;  2X6A A;  1F4M A;  3O0I A;  1WPX A;  2X7R B;  5M4H A;  2WLJ A;  5CTU A;  3E8F A;  4EM7 A;  3OPD A;  4MTF A;  3OUF A;  4B6C A;  5D7D A;  3O6O A;  2FTK A;  3OR6 C;  3EFF K;  4PL9 A;  1TIL A;  1R6N A;  1K34 A;  1BHA A;  2HG1 A;  4AWO A;  3WG7 C;  4MOT A;  2PI4 A;  4H81 A;  3EKR A;  2YJW A;  4LBE C;  3X2Q C;  4RUE A;  2YKC A;  4XDL A;  1Y8O A;  4WCE V;  2CK3 G;  4MW3 A;  3ZJZ A;  2QM7 A;  1I5D A;  1Y8P A;  1B6Q A;  1AJN A;  3HPL C;  2EBO A;  4L87 A;  5IYD O;  3CWV A;  2HLD G;  5CN0 A;  1UYF A;  4U7O A;  3CC4 V;  4MTX A;  3AEI A;  3OMU A;  1OSF A;  2A9H A;  2B5U A;  4EGH A;  3WFV A;  4EKW A;  1YC3 A;  4PU9 A;  3HEK A;  4JAU A;  4JTD B;  4UUJ C;  3F7V C;  2QA4 V;  4R7C A;  4KFG A;  4RUF A;  4GX5 A;  2BU2 A;  1Y4U A;  1CPY A;  1Z5C A;  2UXN A;  3VBB A;  2YGA A;  1R3K C;  4WUC A;  3OMA B;  4CE3 A;  4X89 A;  4E01 A;  5B1O A;  2WAM A;  3CCU V;  1YT1 A;  5L3G A;  4WFG A;  3SPI A;  1E1Q G;  4YKW A;  1UY9 A;  2C2A A;  1ZWH A;  1GK9 A;  3ZIA G;  3R4M A;  2WI2 A;  4X8A A;  3AG2 C;  4DUH A;  4R50 A;  3G7E A;  2FWY A;  1NVP B;  3FB6 C;  2ZR2 A;  1FXK A;  1SER A;  4H85 A;  3P32 A;  4E02 A;  5HFL A;  2YK9 A;  1OCZ C;  1Q86 W;  2WI5 A;  2DWE C;  2EXL A;  3LUT B;  2GQP A;  5BOC A;  3TTZ A;  4W7T A;  5F3K A;  4KSG A;  4XDK A;  1QBZ A;  4GEE A;  3FT5 A;  1NR1 A;  1TC6 A;  3Q5J A;  3ABK B;  3B8N A;  3R4O A;  1YSR A;  3RLP A;  2AKP A;  1YJW V;  4XC0 A;  1UYG A;  2Q2E B;  2ZDI A;  1VQP V;  5D7R A;  1JQ0 A;  1EA6 A;  4XCJ A;  2EIL B;  3TZ0 A;  1DF4 A;  4L93 A;  3TCU A;  1AR1 B;  3ZRS A;  4XKA A;  4KP4 A;  4JAV A;  2ZXW C;  4BQG A;  3EHG A;  1YHQ V;  3KE6 A;  3DTU B;  2WSS G;  1TH8 A;  3R4N A;  4URN A;  3ABT A;  5DN6 G;  2GHY A;  1M56 B;  4R1F A;  4V25 A;  3HZ5 A;  3ABU A;  1NR7 A;  3CP1 A;  5LGU A;  3E8B A;  2LFR A;  4I3H A;  1VQ7 V;  3SYQ A;  3CCM V;  1YIT V;  2YE9 A;  3TET A;  4O07 A;  5M4P A;  3ML0 A;  3ZKB A;  1THN A;  2WLH A;  4PDR A;  1QLE B;  2YKE A;  4BAE A;  4X9L A;  1Q82 W;  1V54 B;  5CTY A;  1NQT A;  2YEA A;  2DW4 A;  2OCC C;  5KUM A;  4TSF G;  4ASG A;  4H33 A;  5IY5 C;  3ZMV A;  3RVY A;  4HYP A;  2YE6 A;  1V55 C;  1FS0 G;  1UYM A;  3W7T A;  3A0X A;  2HR3 A;  2Y48 A;  1WLE A;  4CWR A;  1E79 G;  3TUH A;  5CF0 A;  2VW5 A;  4P9O A;  1R73 A;  1TUE B;  1OCR B;  4HAM A;  2XAS A;  1J95 A;  5BZB A;  4MP2 A;  3AG1 B;  2EIN C;  4V26 A;  1AH6 A;  5CBG A;  3OFN G;  1JCH A;  1PD3 A;  2XOK G;  2XDX A;  4XIP A;  4FK5 C;  3OWB A;  1M57 B;  4LWF A;  2NLJ C;  2Q69 A;  4FCP A;  3DGE A;  3AG4 C;  4JYC A;  3ZMS A;  3P30 A;  3ZN0 A;  4ASB A;  3CYO A;  4WFB V;  2HVK C;  2WI3 A;  5CPH A;  1Z59 A;  4WFF A;  1YT0 A;  3ASO B;  5L3F A;  2YEG A;  3R92 A;  2EIM B;  1FXK C;  1B63 A;  4AWQ A;  2QE7 G;  2PI5 A;  1G8M A;  1NHH A;  4MVU A;  3SJQ C;  2ATK C;  1YS3 A;  3A0Y A;  5B1B C;  3T4D A;  1OCC B;  4FCQ A;  1RPO A;  4UVB A;  3OMI B;  2Y69 C;  2AHY A;  1F23 A;  1YI2 V;  1UYL A;  4XCL A;  2P7T C;  1BMF G;  3T0Z A;  4WFA V;  2XX2 A;  3HYZ A;  3G4S V;  2ZR3 A;  1YT2 A;  2H8P C;  5BOD A;  3FB7 C;  2IJJ A;  1QCE A;  5LHI A;  1S5H C;  3ETE A;  1UY6 A;  4PEL A;  3GWO A;  3B28 A;  1OCZ B;  1I5Y A;  4JPR A;  2VWC A;  3OEE G;  2VCI A;  3E35 A;  3E86 A;  3QO7 A;  2W6J G;  3RW0 A;  4CE2 A;  3LPS A;  2IH3 C;  4YKQ A;  4P7A A;  1I5A A;  1AJQ A;  2QEX V;  3K60 A;  5LGT A;  3Q5L A;  5B1A B;  1GM9 A;  3FYE B;  4MVZ A;  2M7W A;  3A0T A;  3U2D A;  4EEH A;  3U2K A;  3I55 V;  1QZR A;  2XAJ A;  1GM8 A;  1NJI W;  2YEC A;  1K4D C;  3E89 A;  1IXM A;  3HB3 B;  3MD0 A;  3D3I A;  4DZY A;  4J9Y B;  1KKD A;  2WER A;  3CC2 V;  2BU5 A;  1JPX A;  3D36 A;  4LCU C;  2DYR C;  1M1K W;  1AH8 A;  1UYC A;  2UXX A;  3TZ2 A;  3T4Z A;  3HZ1 A;  4UV8 A;  4HZ3 A;  1JX9 A;  3U67 A;  2DQ3 A;  1YET A;  5D6Q A;  3SPG A;  3ZMT A;  4E00 A;  1F51 A;  2H8M A;  1BL8 A;  1SES A;  5L3B A;  3K97 A;  4HY1 A;  5J6A A;  1KQS U;  3G75 A;  1KIJ A;  4YKR A;  3HHU A;  5J9P C;  2CH4 A;  4JTC B;  4WUD A;  3VAD A;  4LWE A;  4PDL A;  3W7W A;  2BU7 A;  2YI0 A;  1ID0 A;  2XDS A;  2JEU A;  1NVP D;  2JDI G;  4J9Z B;  2DYS B;  2YKI A;  2O1V A;  4QE9 A;  1ZW9 A;  1W2B U;  1SET A;  2CCT A;  2YE8 A;  1ENV A;  3AG3 B;  4DO2 A;  1PNK A;  1R3I C;  4G2K A;  4TT3 G;  1AI4 A;  1YJ9 V;  2IWU A;  3LDE A;  4R3M A;  4HY6 A;  3SPH A;  3QO8 A;  1RM1 B;  1QVG U;  5D7C A;  2W0F C;  1CP9 A;  2DWD C;  3JD3 A;  4FPP A;  4ASF A;  5FWK A;  2WI6 A;  5EK0 A;  4EFU A;  2XAH A;  2YE7 A;  1W0J G;  4AWP A;  4U93 A;  3SPJ A;  2H94 A;  1DLB A;  1FFT B;  2YE5 A;  2CCU A;  3G7B A;  2WLI B;  1ZXM A;  1VQK V;  2ITC C;  1XL6 A;  1YC4 A;  1EI1 A;  3B25 A;  3CGY A;  4MTO A;  4JTA B;  2EIJ B;  4JYB A;  2IOR A;  4CBC A;  3IC7 A;  1UJW B;  2ZDX A;  4KTN A;  3FV5 A;  3NXS A;  1NHJ A;  2Z5U A;  3ZXQ A;  4CWQ A;  4MBC A;  3T2S A;  3CC7 V;  4MTG A;  1I5C A;  3ABL B;  1GM7 A;  4LPB A;  2O1W A;  1YSZ A;  3LSS A;  1PL0 A;  4LC1 A;  5B1B B;  1MG1 A;  3K0G A;  4GX1 A;  1AI6 A;  4NH9 A;  3BY6 A;  2F43 G;  2XX5 A;  3WQ9 A;  3ABM B;  1H8H G;  3EHJ A;  1VQ8 V;  2OTJ V;  4MVQ A;  2IOP A;  1QY8 A;  3E2E A;  1UYK A;  4DXW A;  4XKO A;  2LP7 A;  2HKO A;  3VHD A;  3VHA A;  4BIZ A;  3STL C;  2IJK A;  2YI6 A;  2Z3Y A;  2JJ2 G;  5B3S B;  3ZRV A;  4XD8 A;  1VQL V;  1JOY A;  2ZDY A;  2A79 B;  5CA3 A;  3CD6 V;  3OE7 G;  2WLN A;  3E8G A;  4XIT A;  3JYC A;  1DF5 A;  1NBM G;  1H38 A;  2P67 A;  5CBF A;  2EIK C;  3QNE A;  3W7S A;  1UY7 A;  1E1R G;  4R3A A;  4I9W A;  2WLL B;  2YKB A;  2XAB A;  1VQ6 V;  1M90 W;  3R4P A;  1K4C C;  1TBW A;  1AMW A;  3H4L A;  2BT0 A;  2Q8G A;  3ASN B;  4UVC A;  1H7S A;  1PNL A;  3F7Y C;  1YTF B;  1A4H A;  1VQ4 V;  1S14 A;  3C0E A;  4Q20 A;  1M9N A;  3CXC U;  4XE2 A;  3PEH A;  1K8A W;  3FKS G;  5L3C A;  1BGQ A;  1H2G A;  2BRE A;  3C11 A;  4RQF A;  2XJJ A;  2B1G A;  4BQJ A;  4XIQ A;  2R9R B;  3LSQ A;  2Q6A A;  3B24 A;  4P30 A;  4OXS A;  1K9M W;  3PJS K;  1S0V A;  1S16 A;  2IJH A;  3CCV V;  1OHH G;  4XDM A;  3QTF A;  2EZP A;  3TK1 A;  1MX0 A;  5IN9 A;  3WG7 B;  3OEH G;  5FNF A;  2BZ5 A;  2YI7 A;  3D2R A;  4L91 A;  2P90 A;  3X2Q B;  2YEF A;  1ZWI C;  1NH2 D;  1FXV A;  3M99 B;  4URM A;  4F4L A;  4LP8 A;  1GKZ A;  2JKI A;  2QG0 A;  5IDJ A;  3INX A;  1DTO A;  3K08 A;  1S76 D;  2BYH A;  2OT5 A;  3FB5 C;  2XHX A;  1ARO P;  2BRC A;  3ZRW B;  4RQE A;  2E0A A;  4MB9 A;  2HCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...