5IDJA

Bifunctional histidine kinase ccka (domains dhp-ca) in complex with adp/mg2+
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
242
structure length
242
Chain Sequence
b'LSQAQKMQAIGQLAGGVAHDFNNLLTAIQLRLDQLLHRHPVGDPSYEGLNEIRQTGVRAADLVRKLLAFSRKQTVQREVLDLGELISEFEVLLRRLLREDVKLITDYGRDLPQVRADKSQLETAVMNLAVNARDAVRAAKGGGVVRIRTARLTRDEAIQLGFPAADGDTAFIEVSDDGPGIPPDVMGKIFDPFFTTKPVGEGTGLGLATVYGIVKQSDGWIHVHSRPNEGAAFRIFLPVYEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell cycle histidine kinase CckA
publication title Cyclic di-GMP mediates a histidine kinase/phosphatase switch by noncovalent domain cross-linking.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase
total genus 63
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5idjA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5idjA02
2WI1A 3TTZA 1MU5A 2BU7A 2JKIA 3R4MA 2YEHA 1I5DA 1UYDA 3Q5KA 4PRVA 3T2SA 2BU2A 5L3JA 3U67A 4R1FA 4FCPA 2WERA 4KSHA 5C93A 1ZXNA 4V25A 3O2FA 4GT1A 2YE6A 3OPDA 3RKZA 2YI5A 4L93A 2YE3A 4MBCA 2BU6A 1OSFA 1Z59A 2ZDYA 2BYHA 2XK2A 3FV5A 4GQTA 4XKOA 5J71A 4QPKA 4YKUA 2YJXA 3H80A 4PRXA 1EI1A 4ASAA 4XITA 2YE8A 3R92A 1BKNA 2E0AA 3OMUA 4FMTA 4QPJA 3ZM7A 3INWA 5D7CA 5M4KA 4XIQA 4CE1A 4NH7A 3GIGB 4ASGA 4HXZA 4HY1A 1I5CA 1YC3A 2YEDA 3PEJA 1IXMA 4U93A 4GFNA 4YKYA 2YKEA 4FCQA 4WUBA 4B6CA 4X9LA 2YECA 4EMVA 3FT8A 4U7NA 2GQPA 1THNA 2XX5A 4L8ZA 4ASBA 3LPSA 2Q8IA 2FWYA 4XCLA 3ZXQA 4XE2A 2ZDXA 3Q5JA 4YKQA 4GEEA 1YT1A 1YT2A 2HKJA 1Z5CA 1H7UA 1H7SA 1I5BA 1ZW9A 1Z5AA 2XJJA 2QM8A 1MX0A 4EEHA 2YEJA 4GGLA 2K5BA 3A0TA 4JYBA 4PU9A 3JZ3A 3EHHA 4EFTA 3ZXOA 4YKWA 1UYEA 3SL2A 3LNUA 5CTUA 5F5RA 4DUHA 4LWFA 4R3AA 5FNFA 3ZKDA 3P32A 5CTWA 4V26A 4AWQA 5IDJA 2BSMA 1QZRA 4ZVIA 5CTXA 2IOPA 4ASFA 1AJ6A 3C11A 1UY8A 1AM1A 2HCHA 1UYFA 1KIJA 5BODA 3CRLA 4O04A 2YEBA 4MP7A 2XHTA 4O05A 3WHAA 1Y8PA 3K97A 1GKZA 2VCJA 5IN9A 2BTZA 1Z5BA 1B3QA 2GFDA 2AKPA 4L91A 5IDMA 3RLPA 5D7RA 4CE2A 4HYMA 5B1NA 3G7EA 2YE2A 3TUHA 2YKBA 3BMYA 4URNA 4HY6A 4CWRA 1YERA 1F51A 2IWXA 1UYCA 1R62A 2IWUA 1YETA 4EFUA 1Y8OA 2Q8GA 3TZ2A 3INXA 1AMWA 1TC0A 2FXSA 4H81A 4WUCA 1Y4SA 4EM7A 2BREA 2CCSA 2QFOA 4Q20A 4CWTA 4EGKA 2QG0A 5CPHA 4B7PA 1TH8A 3B26A 4K4OA 1ZWHA 3EKRA 4XC0A 1YC1A 1BYQA 1PVGA 2CCUA 1QY8A 2YI6A 3U2KA 4P8OA 1JOYA 4CWPA 2WI7A 4MPNA 4LC1A 4W7TA 4MP2A 1AH6A 2H55A 4E00A 1UYLA 3A0ZA 3CWVA 2WI6A 3QDDA 4E01A 3NMQA 2YK9A 5J6AA 3H4LA 4NH8A 3WQ9A 4CWNA 1GKXA 3O0IA 4MB9A 2BRCA 5BOCA 2XX4A 4XD8A 4URLA 2CH4A 2YE5A 3EHGA 4O09A 2JJCA 5F3KA 1NHHA 2O1WA 1UYKA 3ZRWA 4BIUA 4AWPA 2YI7A 4JASA 3R91A 3C0EA 1TILA 4BAEA 3VADA 3T0ZA 3QTFA 5FWKA 2QM7A 3GIEA 2Q8FA 4WUDA 4XIPA 4DZYA 3Q5LA 2BU8A 2VWCA 2XHXA 4E02A 2XJXA 3BM9A 4YKTA 3B25A 2CGFA 2WWWA 3IEDA 1YSZA 1B62A 2ZBKB 2P67A 4KQVA 3HZ1A 2YE7A 4FCRA 4R3MA 4XKAA 4BQJA 3HHUA 2H8MA 2FYPA 3CRKA 4GT8A 1B63A 2HG1A 4HZ0A 4JAVA 3B28A 4MPEA 4MTXA 4CWOA 4PL9A 4XDMA 2CCTA 3HEKA 3VHAA 1GJVA 4FPPA 1TBWA 2BU5A 1ID0A 3VHDA 5M4MA 1BGQA 3B27A 3OWBA 1A4HA 3U2DA 3K99A 3TZ5A 5M4EA 3G75A 4L90A 4ZKIA 3KE6A 3CGZA 4CWSA 4XCJA 2WEQA 3R4OA 4BIZA 2YKCA 2Q8HA 1UYHA 3R4PA 4LWEA 4I3HA 2YEFA 2XDXA 2YGEA 3HYYA 4BXIA 2XDKA 3K60A 2CG9A 1YSRA 1UY9A 2QG2A 4KSGA 3T10A 1U0ZA 2YGAA 3G7BA 1UY7A 4L94A 4H85A 3TZ0A 4KFGA 4O0BA 3TZ4A 3EHJA 2LFSA 2XDUA 4I5SA 4JYCA 4LWHA 2O1VA 4AWOA 4XTJA 3O6OA 4YKZA 2PNRA 4KTNA 2UWDA 4LP0A 2Q2EB 4CWFA 2VCIA 5D7DA 5CTYA 2WI5A 1YC4A 3ZRWB 2YKJA 2WI4A 1I58A 5GGZA 1JM6A 3NXSA 2XDLA 5M4HA 1US7A 3A0YA 2XCMA 1KZNA 3RLRA 2BT0A 4EGIA 1S14A 2XDSA 4BQGA 5B1OA 5FNDA 4HYPA 1NHJA 1EA6A 5CF0A 3A0XA 1YS3A 2XABA 2C2AA 2YEGA 1BXDA 2XD6A 2YE4A 4H7QA 4YKRA 4MPCA 3RLQA 5FNCA 2YEAA 3T0HA 2LFRA 3A0RA 2YEEA 3ZCCA 1S16A 3MNRP 4UROA 1U2OA 4XKKA 4LWIA 2QF6A 4KP4A 1Y8NA 2XJGA 3DGEA 3MD0A 4NH9A 3EKOA 2ZKJA 3B24A 1UYGA 5M4NA 2YI0A 4URMA 3VHCA 3ZRXA 2YGFA 1YT0A 1I5AA 3GIGA 4JAUA 4AS9A 1TC6A 1L0OA 3R4NA 4CE3A 2IWSA 2WI3A 4MT8A 3HZ5A 4GCZA 3CGYA 4MOTA 1QYEA 4HXWA 1ZXMA 3K98A 2ESAA 2VW5A 1UY6A 3T1KA 1Y4UA 5D6QA 3EHFA 2WEPA 4LPBA 2YK2A 1NHIA 2BZ5A 3TK1A 5M4PA 1UYMA 1YESA 4YKXA 2YKIA 1UYIA 2YJWA 3GIFA 3HYZA 2FWZA 3A0WA 4LWGA 3ZKBA 2FTKA 4EGHA 2IORA 1TIDA 2EXLA 2BYIA 4XIRA 5D6PA 4U7OA 2XX2A 2IOQA 3D36A 3PEHA 1AH8A 2XHRA 4P7AA 3D2RA 4CWQA 2YE9A 2O1UA 2YEIA 4HZ5A 3FT5A 1I59A 4O07A 4JQLA 3OWDA 3ZRVA 2WI2A 3OW6A 3D0BA
chains in the Genus database with same CATH superfamily
2WI1A 1HW7A 2Q7GA 1EFRG 1TVKB 3K5NA 1EM1A 5KUMA 1UYDA 4UV9A 3Q5KA 4PRVA 4BIOA 2O57A 2BU2A 4R1FA 3OTOB 1IBLO 4KSHA 2OIGA 1ZXNA 2H8PC 2EX3A 3ZMZA 3BEHA 2YE6A 2RDCA 3BFRA 2E5LB 1AILA 4FFBA 1OCRC 1WB8A 4MBCA 1HNXB 1Z59A 2BYHA 1EI1A 2DYSC 4K3AA 2BTOA 2E0AA 4TUYA 3P3NA 4UCRA 5IYCO 2YXHA 1JA8A 1NH2B 3GIGB 4NH7A 1ZUQA 4JV5O 4YJ3A 3ML0A 1V54B 1U96A 4X20B 4U93A 4D7TA 4JI8O 4GFNA 4YKYA 3C3SA 1COWG 2YECA 3FT8A 2GQPA 1N0NA 2XX5A 4ASBA 1AI4A 3A0HZ 3FKSG 3LPSA 2Q8IA 5L3BA 1VQ8V 5LOVB 4UXNA 3CSXA 4PDVA 2UUAO 4KFMA 3HKEA 5KHHA 1K4CC 1WB7A 3APQA 1VQ7V 5IY5B 3TGUH 4ZIBA 2PGGA 3WB1A 2ZR3A 1FD9A 2JVDA 5LP6C 4YJ2A 4F6RB 1ZSPA 1RP3B 4PI0A 2ZE8A 3SPJA 4CS3A 1MX0A 1RSOB 2UXBO 4EEHA 1Y66A 3FYEB 1Q6UA 2YEJA 4GGLA 1MNGA 2YXLA 3ASOB 4IL6Z 4LFAB 1VQMV 1SZTA 3D3QA 4XDJA 3JCZA 4LCUC 4LFBB 4DV3B 3RVYA 4D6TH 4DUHA 2Q69A 2ZXWC 3CRQA 1GO3F 1M1KW 5CTWA 5IDJA 3O9OA 1G6UA 1SZXA 1QZRA 4DV7O 3ZX6A 1AJ6A 1AM1A 2HCHA 1UYFA 4B3SO 2OCCB 4JZ2A 1M57B 4ZBMA 5BODA 3AK3A 3H1LH 3K9AA 3ETEA 5B3SC 3WHAA 1Y8PA 2IJHA 2VCJA 4FFBB 2Q6AA 1Z5BA 1M9NA 1GN3A 5EC2C 1SESA 1NKDA 3AK2A 4TUYB 1OHHG 2XOKG 2DWDC 1RFYA 3BY6A 1YERA 4YJ3B 2IWXA 5LMUB 2EZOA 3BABA 4WFGA 1OCCB 2HG5C 1JJOA 2L35A 1KU9A 2FMLA 2P7TC 4WFEA 4KHPB 1Y8OA 2DJVA 3OW2U 2YSUB 1N33O 2YIBA 1WLEA 1IBKO 2FXSA 1H2GA 5BR8O 4H81A 5JH7A 4XDKA 4RWUA 4LNUA 5KLVH 2MK3A 4EGKA 1VEWA 3ZHUA 2QG0A 1FXVA 3HKEB 2W6IG 2QWPB 1IURA 3B26A 2C1GA 2CE4A 4X62B 1AP6A 3X2QB 1BYQA 3Q4HA 1MABG 2GBOA 4GKKO 1PVGA 1YC1A 3SYPA 1I5YA 3ETGA 3AG7A 4YJ2B 1KD1W 1H38A 4P8OA 4PA3A 4MPNA 1W59A 1HNWO 3T1HO 1Y76B 1F23A 2H55A 4E00A 3RYHA 2WAMA 4K35A 3CCUV 2YK9A 5J6AA 1G4YB 3H4LA 4NH8A 2H3OA 2FYUH 1S76D 1DLBA 2ZDIC 2BRCA 4MB9A 5BOCA 2XX4A 5B66Z 4PJ0Z 4NXNB 3CCJV 1Q3EA 2G38A 3FYIB 4GZRB 2KB1A 2Q0OC 3N2KA 2IH3C 4K8XA 4FLXA 4K0KB 1NTMH 3JALA 4EFEA 4G2KA 2XAQA 4DV5B 1TILA 4LFCB 2UU9O 2GTSA 1ZAUA 4AILC 1P84F 3ZS8C 3QTFA 3CE2A 2ZD9A 3ABMC 4O4LB 5TISZ 4XIPA 2CDYA 4NB5A 3TCUA 4LF5O 3Q5LA 4B7KA 2VWCA 4E02A 1J5EO 3EVKA 4WF9V 3BM9A 1NU1H 5JCOC 4H0LB 4GKJO 2ZE7A 2A79B 4MVOA 1KBHA 4UVAA 4FCRA 2HFEC 1ZWIC 2WLHA 5JQGA 4PDRA 3HHUA 2H8MA 3I5DA 2DQ0A 2DW4A 2HG1A 3GVMA 4JAVA 5JVDB 2QKAA 1FFXA 4LF4B 1BCCH 3HEKA 3OMAB 3J81N 3VHDA 3ZIAG 3ABTA 4PA4A 3B40A 3OWBA 1A4HA 5JH7B 3RYCA 2ZNJA 3TZ5A 1A32A 2VQEB 5M4EA 3ABLC 2EIJB 3AG3B 4E2LA 3SR2C 2NNUA 1KMIZ 2ETNA 2HJDA 1JMKC 1SQBH 4B3TB 1AI7A 2Q8HA 4UCSA 2V1DA 1QLEB 3W7WA 4DR1B 1OV9A 1VF5B 4I7ZB 3CMAV 2B1GA 3J80N 4W4KA 1Q6HA 1OZ0A 3HYYA 1YTFB 2XDKA 3K60A 1FPOA 2ADPA 4UUJC 5FPRA 3HKBA 1QBZA 3T10A 4L94A 4Z1VA 1GMGA 2ITDC 3G6BA 3CHXA 5A2QN 3J7AU 2EIMC 4FVMA 3O6OA 3JD2A 1H2NA 2Y0PA 4KTNA 2UWDA 2BOCC 4LP0A 4WFHA 5LHGA 3RYIB 1YC4A 2WI4A 5LP6A 1I58A 5LMNB 4DV0O 3JALB 2WSSG 2XDLA 5M4HA 1US7A 3A0YA 3APOA 2YEVB 2HLDG 1SS3A 1BSMA 3RLRA 2W0XA 4TWKA 2KQXA 4DV4O 2ATKC 3K5MA 3T2MA 2KG7A 5CF0A 4JI4B 3A0XA 1YS3A 1BXDA 2CK3G 2YE4A 3L9DA 4X66B 1M57C 5JQGB 1AJPA 2LFRA 1WN7A 4JI7B 1QHTA 2ZIMA 5L3CA 4UROA 5CA3A 4H13B 1M90W 1YXBA 2ZM6B 1VARA 2XJGA 3JATA 2Z3YA 4DUZB 3EKOA 4FZ0A 3B24A 1OCRB 4URMA 3VHCA 3E89A 3LUTB 3RYCB 4LF6B 4AS9A 4DR6O 1L0OA 3R4NA 1AR5A 2DYSB 4MT8A 1OCCC 4MOTA 1QYEA 3CMEV 1B06A 1EZVH 3K03A 4LF8B 2P22C 3KKYA 2V7QG 2EJ7A 5LXTB 5IT9N 3B4SA 4MW3A 5D5QA 3JAMN 2Q4PA 3D3IA 3QO5A 4U3FH 1GN4A 3W7SA 1IZ3A 4B7EA 1K4DC 1UYMA 4D7SA 4X64B 3X2QC 4N23A 3HKBB 1QLNA 4W4LA 2YJWA 2E75B 2XUMA 2F4VB 4TV8B 3S5TA 1KUQA 4LF7O 1YSCA 1ZLZA 3RYFA 3SJAC 5H9CA 1VP7A 1YHQV 2RCVA 1VF6C 5EZYA 4ICGA 3JAKB 2EXLA 1NJIW 1I0HA 3ABUA 3CPWU 2VWKA 5LP6B 2IOQA 5EIBD 1K5SA 2XHRA 4HZ5A 3DTUB 2AW9A 3JCUZ 4JQLA 2GV9A 2QR4A 2X6AA 3AEIA 2WI2A 3OW6A 3TTZA 1MU5A 4GX5A 2BU7A 1L0NH 2YEHA 4JI1O 2ZCEA 3RN4A 2KG7B 1NVPB 1I5DA 3T2SA 2ZDIA 2YXYA 4X89A 3U67A 4FCPA 2RQ6A 5H6QA 1KC8W 2ZXWB 3JSLA 1N0JA 3RKZA 2YI5A 1XMQB 4J41A 2BU6A 4DR7B 3FV5A 2ZDYA 4XKOA 2XK2A 4XDLA 3SPIA 4PRXA 4DV6B 2HHHO 3AG2B 1KKDA 5IJ9A 3R92A 2JIZG 3JATB 1LUWA 1GH6A 1WPXA 3ICXA 4UCOA 1TVKA 5ITZB 4OX9O 4I0XB 5JCOA 4ASGA 4HXZA 2IM9A 2WLLA 3PEJA 1VIBA 1XHXA 2JEUA 3CD6V 2YKEA 2HKOA 1FJGO 4I9WA 4WUBA 4EMVA 1MG1A 4MW8A 1Y67A 4L8ZA 1WP8A 1WNSA 4FLYA 3OUFA 2EIJC 3AG3C 3G80A 3OT7A 3Q5JA 4LWSA 1Q82W 1Q8IA 1M93A 3HPLC 1ZW9A 2XAHA 1T5EA 1Z2GA 2XJJA 1QLEC 3HKDA 1EN6A 3OM3B 5CN0A 1DK1A 2P4VA 1H8EG 4X9QA 1K34A 1S3JA 3A0TA 5EZYB 3OE7G 3LMMA 5KHIA 3VOUA 4PU9A 5C8YA 5L3GA 3KCXA 2RNBA 4PA9A 3G6EV 1AB3A 1YI2V 3LNUA 4MTOA 2JEXA 2K9PA 2IBZH 4R3AA 4CC6A 5FNFA 5BZBA 2L6LA 2R70A 4RQEA 3ZHSA 2QWNB 4ZVIA 2PYLA 1H2SB 4G27B 3S3WA 3H1JH 2BOBC 1KIJA 5A9GA 3FB5C 1XUQA 2UXCB 4O04A 1EZJA 2NN4A 5B1BC 2EILC 4UB6Z 2YEBA 3WB2A 2XHTA 4O05A 1YIJV 3K97A 1B3QA 4DR2O 2GFDA 4YHHO 1P7BA 4L91A 4DR4B 1XI1A 4I4TB 4WBNB 4DR5B 3ABMB 3PN1A 1S5JA 5JJJB 2YE2A 3G7EA 4BW9A 2ARHA 1N32O 5LGNA 4AQYO 2YICA 1Q5OA 4A5UB 1Z5VA 1I94B 1PL4A 2NR5A 1R62A 2WLLB 4FIPC 1K92A 2GUZA 5GTHZ 2GHYA 2EULA 4H44B 1YETA 3E8HA 2R9IA 3K3WA 3G4SV 1XMOB 2Q8GA 2Q7HA 2UUBO 1V55C 2X6CA 2JK5C 4WUCA 1Y4SA 4EM7A 4JYYA 2UUCB 1XREA 4Q20A 2PZSA 2QFOA 3CYOA 3B8MA 4NR1A 3BAAA 4J80A 4B7PA 3CC7V 3L73H 4YY3B 3JD4A 4LWSB 4FJCC 2DOSA 4OPHA 3ZHQA 4QJFB 2Q7EA 2CCUA 3I56V 4X1YA 4MTGA 3GWOA 3ABLB 5EBWC 3HKDB 2DYRC 5DN6G 3D36C 1JOYA 2WI7A 3K9SA 4LC1A 2PI4A 1AI5A 4W7TA 5IWAB 4UCVA 2XAGA 3CWVA 2UXDO 2WI6A 2V4DA 1SETA 4B3RO 3CCSV 4E01A 1F4MA 2RJZA 4BWAA 3BA9A 5C8YB 3QO7A 1HNZB 3H01A 1GKXA 3E2EA 1OCOB 1R6NA 1YEWA 3CWBH 3ETQA 4XD8A 4URLA 3QTCA 2JJCA 1HWYA 2ZT9B 5F3KA 1NHHA 2O1WA 1UYKA 5IJ9B 4JI0B 2JS5A 1EN4A 2QA4V 3MAQA 3IFXA 1Y76A 3K08A 2EIMB 3T0ZA 3UM7A 1VF6A 1IBKB 5CA1A 1XNQO 1EBOA 4TQFA 4DV1O 1NS1A 2Q8FA 2Y4UA 4WUDA 2LQTA 3ZMUA 1M5IA 1QR8A 3ABKB 4YKTA 2CGFA 2WWWA 3IEDA 1YSZA 1IBMB 1SQPH 3BRCA 3HZ1A 4GKKB 2YE7A 2FYPA 3CRKA 3OTOO 1AJQA 4ASUG 1R3JC 3L70H 4RUEA 3W7XA 3CRCA 3LSSA 1HNWB 1NI8A 5JJNB 4MPEA 4CWOA 4X65B 2CCTA 1D2DA 2E5LO 3VBBA 3T1YB 2GUZB 3AG2C 1HNXO 4K8ZA 4WFBV 2IW5A 4O4LA 3W7UA 1FXKC 1BGQA 1Q7YW 3K99A 3OUSA 1LUVA 3L71H 1JJ2U 4C7UA 4F6EA 3L75H 2HEPA 4ZKIA 1K33A 2LJ2A 4CWSA 2JGUA 3OEHG 4UVCA 3JD1A 5JVDA 4CZZA 4X1YB 1BGYH 4JI2B 2YIBD 1UYHA 2LGQA 1IDSA 3CJHA 4I3HA 4TV9A 5DECA 5B1AB 3RT3C 5E79Z 2NLJC 2Y0IA 2XHBA 2OCHA 4LF5B 2YGEA 2OT5A 1GK9A 2QG2A 2LO1A 3CCVV 1U0ZA 3AG1B 3FX7A 1Z5WA 4MS2A 3T4DA 2XDUA 4JYCA 2O1VA 4XTJA 3OAAG 1I7FA 3N27A 3N2GB 4Q6GA 1ZX3A 2FL4A 1YZBA 4UV8A 2IU0A 2WI5A 1YJ9V 2EBOA 2YKJA 5EC1C 3F7YC 5DM6V 1YITV 4LFAO 2A3QA 4EEQA 5CA1B 1VQPV 2WLIA 1S14A 3CXHF 3QG5A 2CGNA 3CRMA 2WLNA 2F95B 4LFBO 4DV3O 4DUYB 3BCCH 4IT5A 4OXSA 2XABA 4ZHQB 3BVOA 3TETA 4YKRA 3KZIZ 3CCLV 2QE7G 1R73A 4MSWC 2YEAA 1G1XB 4UCTA 2F43G 3RYIA 2YEEA 4TOIA 1O9HA 2LW7A 5KA5A 3ZRSA 5EIBC 2Q0AA 3RFRA 2YEVA 2LW1A 4LWIA 3JASB 4KP4A 1GRJA 3DGEA 2UXXA 2Q9LA 4NH9A 1SERA 1S77D 2ZKJA 3FAVB 4JAAA 5EK0A 5M4NA 2Q68A 2YGFA 5BMVB 2M6YA 4NXMO 2IJKA 4CE3A 2WI3A 4WFAV 2HVKC 5D5PA 2QTOA 2ODMA 2Q8VA 5LMUO 5KX5A 3K98A 4KHPO 1K7DA 3CJHB 4TV9B 5BXZA 2WEPA 1NHIA 5M4PA 3SJQC 1YESA 4PELA 4O2AA 2YKIA 4L87A 3HYZA 4JI3B 4X62O 1MSWD 4LF9B 1R3KC 2PUSA 1Q6IA 3ZJZA 4DV2B 5KHGA 5CA0B 2FTKA 4B08A 2IORA 1K8AW 1E79G 4MVRA 1Q43A 5LXTA 2XX2A 2P4KA 2MW2B 1RM1C 3D36A 1YCIA 1AH8A 3CCQV 3D2RA 2YE9A 1OCOC 2YEIA 1I59A 1VQ6V 3OWDA 3CYGA 5LYJB 3ZRVA 2GTAA 1KECA 1N36B 2WLIB 1CPYA 1WA8A 4J42A 1BMFG 3B77A 3U0ZA 3H1HH 4TV8A 4NXNO 4ZI7B 1I5XA 5GONB 2CUGA 1Q86W 5L3JA 1S5HC 4TSFG 3ZHVA 4K0KO 4BAYA 3O2FA 4NYKA 1E1QG 1WP7A 1BQZA 2XAJA 4OPAA 3JAKA 4RO2A 3OPDA 2FB5A 4DV5O 4B3MB 4LFCO 4L93A 1M4UA 1I08A 1M56C 3ABKC 4JTAB 3K5LA 1NVPD 3SJCC 4GQTA 1XDCA 3T4ZA 4QPKA 1YVWA 5L3EA 4XITA 2W0FC 2YE8A 5J2UB 1BKNA 2VRZA 2EILB 5B1BB 4FMTA 4X1IA 4QPJA 4JYAB 4P9OA 3RW0A 4ZOLA 4CE1A 5J2TA 4PI2A 2YS8A 1E1RG 5LHHA 2N04A 1XNRB 2HHIA 2PTMA 1K5QA 2BCCH 3K59A 1B6QA 5JENA 1TUBA 2ITCC 2UXNA 4LF4O 3LSUA 3DXRA 5K1PA 5EBMC 4LH7A 5DEDA 4MVSA 4MTFA 5L3FA 3SJBC 5KX5B 4MVZA 4B6CA 4X9LA 3MDSA 3EHBB 3AG4C 3H1KH 2XASA 2ZNIA 4XE2A 1VQ4V 3VQXA 2ZDXA 2E76B 2JDIG 3K06A 4JI1B 1SF9A 5ITZA 4YKQA 4Z1MG 2VQEO 1YT1A 1FXKA 2QJ1A 1L8DA 2HKJA 1V55B 1H7UA 4O2AB 1GN2A 4I0XA 2Y69C 1LR1A 1Q90D 2B9ZA 2ILMA 1WJZA 4B3TO 5B1AC 2IJJA 1YDXA 2AXTZ 1BHBA 3M99B 2K5BA 5LHIA 1THZA 3K5OA 4JYBA 5GW7A 3A8TA 2DWEC 2DYRB 2YDEA 3AG1C 2HHHB 1X4TA 1UYEA 3O65A 4MVQA 1F7YA 3SL2A 3EFFK 2X7RB 2P90A 2F1MA 1WA8B 3P32A 3SDLA 5IJ0A 1N8RW 4FZ1A 2EINC 4UB8Z 4DXWA 3C11A 1UY8A 2JJ1G 4HBNA 5LMNO 2EZPA 1UPGA 1AI6A 4DR3B 4MP7A 3EXAA 3CXCU 2P5OA 1GKZA 2ZR2A 2BTZA 1XBLA 2AKPA 5IDMA 5H6RA 3CRRA 4JI4O 4DRXA 3RLPA 4X1IB 4ZOLB 1EN5A 5J2TB 4X66O 3U10A 5IYDO 4HY6A 1W0KG 4JI5B 1F51A 4JI7O 1UFIA 1UYCA 1GN6A 3CS5A 1Y4MA 2IWUA 4JPRA 3BPZA 4EFUA 4HZ3A 3ASNC 4O2BB 1TUBB 1DF5A 2W6JG 3DXRB 3CP1A 3TZ2A 1AMWA 1X59A 4UCUA 2ZM6O 3JARA 1TC0A 3UKMA 3H9VA 4EKWA 1F4NA 2CCSA 3TXQA 4DUZO 4JI6B 4I4TA 1N34B 4WBNA 1Y74B 1H2MA 5KA6A 3OGIB 3RWRD 2CH7A 2D2CB 4LF6O 1NBMG 4RUFA 1ZWHA 1FXKB 1J95A 4PV1B 5CBGA 1QY8A 3MHSC 5L3DA 1GM7A 1K97A 2EIKC 3WG7C 3U2KA 1OCZC 5FLXN 3CC4V 1QNMA 4GX0A 1HR0B 2VQFB 4JTDB 1XHZA 1UYLA 1D5AA 4LP8A 4YHHB 3E86A 3NMQA 1BE3H 4Z2WA 1S0VA 3FB6C 4R8CA 3FD9A 3WQ9A 1AP5A 4QIWF 3ETDA 1NH2D 1JPXA 4X64O 5EYPA 3UCSC 2WLKA 3QF7A 1VMGA 2CH4A 2YE5A 2F4VO 3EHGA 3JD0A 4TT3G 5BY1A 5IJ0B 2XNDG 4CS2A 1IBLB 3ZRWA 2ZIOA 1TAEA 3ZMVA 3SPHA 4JASA 3R91A 1PL0A 4FLWA 1ORQC 3C0EA 3M8AA 3HKCB 4BAEA 1NTZH 3SPCA 1FYJA 3GWKC 3VADA 1PPJH 4FFKA 5FWKA 1PKXA 2QM7A 3GIEA 1H2LA 2PY5A 1DGSA 1SQVH 2BU8A 1PNMA 1SRYA 2R72A 3GB7C 2XHXA 2XJXA 4J11A 2P6JA 2PF4E 1B62A 3CCEV 2WLJA 3IC9A 2ZBKB 2A0LA 5HFMA 4DRXB 4BQJA 3FFQA 4JV5B 1MZEA 3RBZA 4HZ0A 4MVUA 1D5NA 4CH5A 4JI8B 4XDMA 4FM1A 5LBQA 3M7MX 1XL6A 1XMQO 4FPPA 3SYOA 3CB2A 3E8GA 2BU5A 3DC5A 3R65A 4H33A 1FAFA 5M4MA 1MMMA 4DV6O 3JARB 2UUAB 5H5NA 2P06A 3U2DA 4NKGB 1PNLA 1JFFA 3G75A 4E4EA 1CP9A 4PD4F 4IHJA 3IJ4A 2CH7B 3KCYA 3LNMB 3CGZA 2Z5UA 1SQFA 2WEQA 1GAXA 2IU3A 5KUKA 1HDJA 4FK5C 4O4IA 2UXBB 1SC5B 1IXBA 1NTKH 3F5TA 1VQLV 2AZ0A 1NR1A 4DV1B 4KUMA 1QCEA 2XDXA 3JSNA 5FNVA 1UY9A 4KSGA 2CGOA 4PA7A 4HNAB 1ENVA 2E3CA 4J7KA 1UY7A 4H85A 3TZ0A 1LNQA 1JVMA 1BQ0A 3TZ4A 3EHJA 2LFSA 5EYPB 4I5SA 4LWHA 4J9YB 4LR3A 2QEXV 4AWOA 4YKZA 2FKXA 4DV7B 1GM9A 4CWFA 1VQNV 1JX9A 4B3SB 3ZRWB 2R9AA 5GGZA 3ZBHA 1JM6A 2N74A 3NXSA 2GDSA 4R50A 4DW0A 5JWPA 1KZNA 3F5WC 4QGPA 4BQGA 5FNDA 3E8FA 5IE9A 4HYPA 5KMGA 1RM1B 1NHJA 1EA6A 2C2AA 1HP8A 2Y4TA 2YEGA 1BZKA 2VWJA 2XD6A 4I55A 1Y6XA 1VQKV 4FM2A 4MPCA 3RLQA 1CEZA 3N2GA 1AR4A 3A0RA 3K79A 5AG2A 3ZCCA 4JF3A 1SA0B 2F66C 2UXCO 2OWOA 2WLMA 2OTLV 4GX1A 1AJNA 5FPOA 4XKKA 1N33B 2A06H 3CC2V 3QNEA 5BR8B 2LP7A 3VQWA 4DR4O 4LH6A 1UYGA 3FB8C 2YI0A 1JR9A 3ZRXA 1M56B 5FL7G 1I5AA 4DR5O 1TA8A 3C3TA 4TQDA 4ZHQA 1R3IC 1TC6A 1JFFB 2IWSA 3HB3B 4IHJB 1KP2A 3CGYA 3B8NA 1I94O 1P4RA 4HXWA 4X8AA 1ZXMA 3ZHTA 1PV0A 3ZEDA 3LSQA 4O4IB 3T1HB 2VS0A 1ZL8B 1XMOO 2DQ3A 2VW5A 3PJSK 3T1KA 4GUNA 5LGUA 3JASA 1WAZA 5KAFZ 3EHFA 1QVGU 5FNVB 2YK2A 2BZ5A 3OTFA 2UUCO 2XAFA 3FAVA 3TK1A 4IYIA 4CH6A 5BMVA 4RQFA 4YY3O 3GIFA 3AG4B 3A0WA 4CS4A 4LWGA 2QWRB 2OYQA 3IC7A 3JAWA 1VF7A 2F93B 2WPDG 4I50A 2XTAA 2Y69B 1FKAO 1MA1A 2UU9B 4XIRA 5IWAO 5D6PA 1BHAA 4O4HA 4P7AA 4CWQA 5CMUA 3MHHC 3QO8A 4O07A 4DYLA 1HNZO 1J5EB 2QWQB 3L72H 1W0JG 3D0BA 1PD3A 1PNKA 3K04A 4RAIA 3WFVA 4GKJB 4NXMB 3OEEG 2JKIA 3R4MA 1OJHA 5KHKA 5KMGB 2WA3A 2Y48A 4GYCB 2XT9A 2JRIA 4FLZA 3CCMV 2Q67A 4I55B 2WERA 1W2BU 5C93A 4V25A 4JI0O 1SQXH 3E35A 5CA0A 4QE9A 4GT1A 2AGAA 3IGAC 1YTFD 3FB7C 4QNHB 2D3OW 4DW1A 2YE3A 4YXWG 2EINB 1JQ0A 1OSFA 5J71A 4YKUA 1QU7A 2YJXA 3H80A 4ASAA 5LYJA 3VQVA 2C1IA 3OMUA 3ZM7A 3INWA 1P49A 5D7CA 5M4KA 3E22A 1IBMO 4XIQA 4ZI7A 4DK0A 2GSMB 5GONA 4HY1A 2YIDA 4J7ZA 4CBCA 1I5CA 1YC3A 3K0GA 4PDLA 2EJRA 5B5EZ 2YEDA 4L8JA 1IXMA 4X65O 2H94A 3T1YO 4FCQA 4E72A 4U7NA 1THNA 1US6A 2FWYA 4XCLA 1K73W 1BT8A 2CTWA 5CB4A 3ZXQA 4X88A 5J2UA 2OTJV 3ASNB 4GEEA 1YT2A 1Z5CA 3STLC 1H7SA 1I5BA 4J7JA 1B04A 1Z5AA 1YJWV 4J9ZB 4EB6A 3BA8A 3JAWB 2QM8A 4PHZA 3SYQA 1UJWB 4JI2O 4I50B 4DV0B 1K9MW 3A2FA 4JTCB 2EIKB 3E8BA 3WG7B 3JZ3A 4NVPA 2K1EA 1OCZB 3EHHA 4O4HB 4EFTA 3ZXOA 4YKWA 2CTRA 3SYCA 5IYZA 4R7CA 4DV4B 1R1BA 4X1KA 5CTUA 5F5RA 4LWFA 2X0LA 3JYCA 4GX2A 4O4JA 3ZKDA 4V26A 4AWQA 1R6TA 1S72V 2BSMA 3P30A 2QWOB 5CTXA 1DTOA 2IOPA 4ASFA 1CXZB 1KP3A 3CRLA 1YF2A 2YC0A 3UT5A 3SGIA 2CTQA 1K3EA 3T1CA 2ADQB 4QE7A 4FLUA 5IN9A 1BL8A 4CH3A 4LNUB 1AROP 4DUYO 3RVZA 2Z0AA 4HYOA 1V54C 1QQCA 5D7RA 4CE2A 4HYMA 2R9RB 5B1NA 3TUHA 4ABMA 4FM0A 4DR6B 3E22B 2YIAA 2YKBA 3CX5F 3Q4HB 5LGTA 3BMYA 3JD3A 1MSDA 4URNA 4H37A 4CWRA 4YIPA 3ZN0A 1KB9F 4IYHA 1S5LZ 1XQ8A 4PA6A 3THOA 1BS3A 1V9PA 3RYHB 5IY5C 3INXA 3SYAA 1NQTA 2ZQMA 2CTPA 1PM9A 1NR7A 3OR6C 2BREA 3WU2Z 2QDOA 1KKCA 1SKVA 4PDMA 1KYOF 5CB4B 4CWTA 1Q81W 1NT2B 2BSKA 5CPHA 1TH8A 4K4OA 2AHZA 1FFTB 3C90A 4LF7B 3OFNG 3EKRA 4XC0A 3ASOC 4FLVA 2PYJA 5EBLC 3N2KB 4CH4A 2YI6A 3LDEA 4F4LA 4CWPA 4EB6B 1IVSA 4MP2A 1AH6A 4O2BA 2QSAA 1P7GA 2BE3A 3A0ZA 4BW5A 1VQOV 4FLTA 5JJEB 3QDDA 3F7VC 1YJNV 3VQYA 4UFZA 4CWNA 2A9HA 5E1AC 3O0IA 3NR7A 5IYZB 1Y74A 4X1KB 3L74H 4N21A 2OCCC 4O09A 4JI3O 4O4JB 1RPOA 4LF9O 2QM4A 5F2VO 4BIUA 4DV2O 4AWPA 2YI7A 1WPBA 2ZE6A 3UO2A 3OGCC 1FFXB 4WFFA 3WB0A 2YI9A 4MVMA 4DR1O 2QKSA 2AHYA 4JGSA 3UT5B 2IH1C 4P2ZA 4DZYA 1JCHA 4YIOA 1XL4A 2QKCA 4DO2A 1N36O 2Q5ZA 3B25A 3OMNB 4AHCA 2CAZC 4OX9B 2P67A 4KQVA 4XKAA 4R3MA 1XEQA 4NTYA 4GT8A 3W7TA 1B63A 2WA4A 3CRAA 4KL1A 3B28A 4IIJA 1QVFU 2LGWA 2X6BA 3HKCA 4MTXA 4OGQB 4B3MO 4PL9A 4U3JA 1FJGB 3VHAA 1L0LH 2QTSA 3OD4A 3K58A 4P9PA 1GJVA 1TBWA 1L1FA 4GLXA 1ID0A 4LBEC 1RPRA 2JGDA 3B27A 1N4CA 2RN9A 5GTIZ 5LA6A 4JYAO 4HAMA 3AK1A 3DSQA 3K57A 3OR7C 1H2KA 2BSKB 4L90A 4I9QA 3KE6A 1XNRO 4XCJA 3R4OA 4WCEV 3ZMTA 4BIZA 3TXSA 2YKCA 3LNNA 1FS0G 3QVNA 3R4PA 4LWEA 1KQSU 1VQ9V 1FXHA 4J10A 2YEFA 3ZN1A 3STZC 3R66A 4KXRA 1U97A 4BXIA 1R6KA 1PP9H 3CEIA 3DC6A 1YSRA 2CG9A 3K0DA 3U11A 2JJ2G 2YGAA 3G7BA 3TJTA 1ROPA 3ZHRA 4KFGA 4O0BA 1XILA 2QGNA 3RGBA 2E74B 2BTQA 1MOFA 2N05A 2PNRA 5HFLA 2Q2EB 2VCIA 5D7DA 5CTYA 2ZE5A 3I55V 4LF8O 2KKWA 2XCMA 1AVMA 2BT0A 1G8MA 2YUAA 3SPGA 4EGIA 4DR2B 2XDSA 2A7WA 4XBFA 2JS3A 5B1OA 1O9GA 5B3SB 4HNAA 1XOUA 2M7WA 2DMXA 1N32B 4AQYB 4H7QA 1TGOA 1URFA 3HR0A 4R6ZA 2OIEA 5FNCA 3T0HA 2AZ2A 3OMIB 2B5UA 1S16A 3MNRP 4IIJB 1SQQH 4DR3O 3IAYA 1U2OA 4U3JB 2UUBB 2QF6A 1Y8NA 2F23A 3MD0A 4AI8A 3G71V 2B1IA 2JGDB 2HJFC 3P3PA 3CCRV 1TUEB 1YT0A 1QR9A 3GIGA 5LA6B 4JAUA 4DK1A 4CC5A 1GTOA 2RMKB 3LDCA 2IJIA 3RYFB 1NZ6A 2HP8A 3HZ5A 4GCZA 4JZGA 3BHPA 4NTXA 4X20A 4JI5O 1GM8A 5KAIZ 3UQ8A 5CBHA 3E83A 1SA0A 4BR6A 2DN9A 4IGGA 3S3XA 3A0BZ 2ESAA 3B09A 3KG2A 2UXDB 3LDDA 1UY6A 2KSDA 5LOVA 4B3RB 1Y4UA 5D6QA 3H1IH 4EFBA 1IX9A 4G28B 4DR7O 5J9PC 1ZTEA 4LPBA 1DF4A 2PI5A 1H8HG 4JI6O 2YI8A 5CBFA 5H2FZ 1N34O 4YKXA 1UYIA 3ZMSA 2DE0X 4F6RA 2FWZA 3D8CA 1RSOA 2BTQB 5LL6Y 4UVBA 2HR3A 2HVJC 3ZKBA 1R3LC 1VQ5V 4EGHA 3G67A 1TIDA 2BYIA 4U7OA 1ZL8A 1GKFA 2VQFO 1HR0O 5K1XA 3PEHA 4P30A 1XNQB 2O1UA 1MZFA 2Q73A 3B2EE 3FT5A 1AR1B 2ZINA 5IYBO 2ZKOA 4NTWA 5KHJA 3UO3A 1SQGA
chains in the Genus database with same CATH topology
2WI1A 1EFRG 5KUMA 1UYDA 4UV9A 3Q5KA 4PRVA 2BU2A 4R1FA 4KSHA 1ZXNA 2H8PC 3ZMZA 3BEHA 2YE6A 1OCRC 4MBCA 1Z59A 2BYHA 1EI1A 2DYSC 2E0AA 5IYCO 1NH2B 3GIGB 4NH7A 3ML0A 1V54B 4U93A 4GFNA 4YKYA 1COWG 2YECA 3FT8A 2GQPA 4ASBA 2XX5A 1AI4A 3FKSG 3LPSA 2Q8IA 5L3BA 1VQ8V 4UXNA 4PDVA 4KFMA 1K4CC 1VQ7V 5IY5B 2ZR3A 3SPJA 1MX0A 4EEHA 1Y66A 3FYEB 2YEJA 4GGLA 3ASOB 1VQMV 1SZTA 4XDJA 3JCZA 4LCUC 3RVYA 4DUHA 2Q69A 2ZXWC 1GO3F 1M1KW 5CTWA 5IDJA 1QZRA 1AJ6A 1AM1A 2HCHA 1UYFA 2OCCB 4ZBMA 1M57B 5BODA 3K9AA 3ETEA 5B3SC 3WHAA 1Y8PA 2IJHA 2VCJA 2Q6AA 1Z5BA 1M9NA 5EC2C 1SESA 1NKDA 1OHHG 2XOKG 2DWDC 3BY6A 1YERA 2IWXA 2EZOA 4WFGA 1OCCB 2HG5C 2P7TC 4WFEA 1Y8OA 3OW2U 2YSUB 1WLEA 2FXSA 1H2GA 4H81A 4XDKA 2MK3A 4EGKA 2QG0A 1FXVA 2W6IG 3B26A 3X2QB 1YC1A 1BYQA 1MABG 1PVGA 3SYPA 1I5YA 3ETGA 1H38A 1KD1W 4P8OA 4PA3A 4MPNA 1F23A 2H55A 4E00A 2WAMA 3CCUV 2YK9A 5J6AA 1G4YB 3H4LA 4NH8A 1S76D 4MB9A 1DLBA 2ZDIC 2BRCA 5BOCA 2XX4A 3CCJV 3FYIB 2KB1A 2IH3C 4G2KA 2XAQA 1TILA 3QTFA 2ZD9A 3ABMC 4XIPA 3TCUA 3Q5LA 2VWCA 4E02A 4WF9V 3BM9A 2A79B 4MVOA 4UVAA 4FCRA 2HFEC 1ZWIC 2WLHA 4PDRA 3HHUA 2H8MA 2DQ0A 2DW4A 2HG1A 4JAVA 3HEKA 3OMAB 3VHDA 3ZIAG 3ABTA 4PA4A 3OWBA 1A4HA 3TZ5A 5M4EA 3ABLC 2EIJB 3AG3B 4E2LA 2NNUA 1AI7A 2Q8HA 2V1DA 1QLEB 3W7WA 3CMAV 2B1GA 1OZ0A 3HYYA 1YTFB 2XDKA 3K60A 4UUJC 1QBZA 3T10A 4L94A 1GMGA 2ITDC 2EIMC 3O6OA 3JD2A 4KTNA 2UWDA 2BOCC 4LP0A 4WFHA 5LHGA 1YC4A 2WI4A 1I58A 2WSSG 2XDLA 5M4HA 1US7A 3A0YA 2YEVB 2HLDG 3RLRA 4TWKA 2ATKC 3T2MA 5CF0A 3A0XA 1YS3A 1BXDA 2CK3G 2YE4A 1M57C 1AJPA 2LFRA 5L3CA 4UROA 5CA3A 1M90W 2XJGA 2Z3YA 3EKOA 3B24A 1OCRB 4URMA 3VHCA 3E89A 3LUTB 4AS9A 1L0OA 3R4NA 2DYSB 4MT8A 1OCCC 4MOTA 1QYEA 3CMEV 3K03A 2V7QG 4MW3A 3D3IA 3QO5A 3W7SA 1K4DC 1UYMA 3X2QC 4N23A 1QLNA 2YJWA 1YSCA 5H9CA 1YHQV 2EXLA 1NJIW 3ABUA 3CPWU 2IOQA 1K5SA 2XHRA 4HZ5A 3DTUB 4JQLA 2WI2A 2X6AA 3AEIA 3OW6A 3TTZA 1MU5A 4GX5A 2BU7A 2YEHA 1NVPB 1I5DA 3T2SA 2ZDIA 4X89A 3U67A 4FCPA 5H6QA 1KC8W 2ZXWB 3RKZA 2YI5A 2BU6A 3FV5A 2ZDYA 4XKOA 2XK2A 4XDLA 3SPIA 4PRXA 3R92A 3AG2B 1KKDA 2JIZG 1WPXA 4ASGA 4HXZA 2WLLA 3PEJA 2JEUA 3CD6V 2YKEA 2HKOA 4I9WA 4WUBA 4EMVA 1MG1A 4MW8A 4L8ZA 3OUFA 2EIJC 3AG3C 3Q5JA 1Q82W 3HPLC 1ZW9A 2XAHA 2XJJA 1QLEC 5CN0A 3OM3B 1H8EG 1K34A 1S3JA 3A0TA 3OE7G 3VOUA 4PU9A 5L3GA 4PA9A 3G6EV 1YI2V 3LNUA 4MTOA 2JEXA 4R3AA 5FNFA 5BZBA 4RQEA 4ZVIA 4G27B 2BOBC 1KIJA 3FB5C 4O04A 1EZJA 5B1BC 2EILC 2YEBA 2XHTA 4O05A 1YIJV 3K97A 1B3QA 2GFDA 1P7BA 4L91A 3ABMB 3G7EA 2YE2A 5LGNA 1R62A 2WLLB 4FIPC 1K92A 2GHYA 1YETA 3E8HA 2R9IA 3K3WA 3G4SV 2Q8GA 1V55C 2X6CA 2JK5C 4WUCA 1Y4SA 4EM7A 2QFOA 4Q20A 3CYOA 3B8MA 4B7PA 3CC7V 3JD4A 4FJCC 4QJFB 2CCUA 3I56V 4MTGA 3GWOA 3ABLB 5EBWC 2DYRC 5DN6G 1JOYA 2WI7A 4LC1A 2PI4A 1AI5A 4W7TA 2XAGA 3CWVA 2WI6A 1SETA 3CCSV 4E01A 1F4MA 3QO7A 3H01A 1GKXA 3E2EA 1OCOB 1R6NA 4XD8A 4URLA 2JJCA 1HWYA 5F3KA 1NHHA 2O1WA 1UYKA 2QA4V 3IFXA 3K08A 2EIMB 3T0ZA 3UM7A 1EBOA 2Q8FA 4WUDA 3ZMUA 1QR8A 3ABKB 4YKTA 2CGFA 2WWWA 3IEDA 1YSZA 3HZ1A 2YE7A 2FYPA 3CRKA 1AJQA 4ASUG 1R3JC 4RUEA 3W7XA 3LSSA 4MPEA 4CWOA 2CCTA 3VBBA 3AG2C 4WFBV 2IW5A 3W7UA 1FXKC 1BGQA 1Q7YW 3K99A 3OUSA 1JJ2U 4ZKIA 1K33A 4CWSA 3OEHG 4UVCA 3JD1A 4CZZA 1UYHA 4I3HA 5B1AB 2NLJC 2YGEA 2OT5A 1GK9A 2QG2A 3CCVV 1U0ZA 3AG1B 4MS2A 3T4DA 2XDUA 4JYCA 2O1VA 4XTJA 3OAAG 4UV8A 2IU0A 2WI5A 1YJ9V 2EBOA 2YKJA 5EC1C 3F7YC 5DM6V 1YITV 1VQPV 2WLIA 1S14A 2WLNA 4OXSA 2XABA 3TETA 4YKRA 2YEAA 3CCLV 2QE7G 1R73A 4MSWC 2F43G 2YEEA 5KA5A 3ZRSA 2YEVA 4LWIA 4KP4A 3DGEA 2UXXA 4NH9A 1SERA 1S77D 2ZKJA 5EK0A 5M4NA 2Q68A 2YGFA 2IJKA 4CE3A 2WI3A 4WFAV 2HVKC 2QTOA 3K98A 1K7DA 2WEPA 1NHIA 5M4PA 3SJQC 1YESA 4PELA 2YKIA 4L87A 3HYZA 1MSWD 1R3KC 3ZJZA 2FTKA 2IORA 1K8AW 1E79G 4MVRA 2XX2A 1RM1C 3D36A 1AH8A 3CCQV 3D2RA 2YE9A 1OCOC 2YEIA 1I59A 1VQ6V 3OWDA 3ZRVA 1KECA 2WLIB 1CPYA 1BMFG 3B77A 1I5XA 1Q86W 5L3JA 1S5HC 4TSFG 4BAYA 3O2FA 1E1QG 2XAJA 4RO2A 3OPDA 4L93A 3ABKC 1M56C 4JTAB 1NVPD 4GQTA 3T4ZA 4QPKA 5L3EA 4XITA 2W0FC 2YE8A 1BKNA 5B1BB 2EILB 4FMTA 4QPJA 4P9OA 3RW0A 4CE1A 1E1RG 5LHHA 1K5QA 1B6QA 2ITCC 2UXNA 5EBMC 4MVSA 4MTFA 5L3FA 4MVZA 4B6CA 4X9LA 3EHBB 3AG4C 2XASA 4XE2A 1VQ4V 2ZDXA 2JDIG 3K06A 4YKQA 4Z1MG 1YT1A 1FXKA 2HKJA 1V55B 1H7UA 2Y69C 5B1AC 2IJJA 1BHBA 3M99B 2K5BA 5LHIA 1THZA 4JYBA 5GW7A 2DWEC 2DYRB 3AG1C 1UYEA 4MVQA 3SL2A 3EFFK 2X7RB 2P90A 3P32A 1N8RW 2EINC 4DXWA 3C11A 1UY8A 2JJ1G 2EZPA 1AI6A 4MP7A 3CXCU 1GKZA 2ZR2A 2BTZA 2AKPA 5IDMA 5H6RA 3RLPA 5IYDO 4HY6A 1W0KG 1F51A 1UYCA 1Y4MA 2IWUA 4JPRA 4EFUA 3ASNC 4HZ3A 1DF5A 2W6JG 3CP1A 3TZ2A 1AMWA 1TC0A 3UKMA 4EKWA 1F4NA 2CCSA 5KA6A 1NBMG 4RUFA 1ZWHA 1FXKB 1J95A 5CBGA 1QY8A 3MHSC 5L3DA 1GM7A 1K97A 2EIKC 3WG7C 3U2KA 1OCZC 3CC4V 4GX0A 4JTDB 1UYLA 4LP8A 3E86A 3NMQA 1S0VA 3FB6C 4R8CA 3WQ9A 4QIWF 3ETDA 1NH2D 1JPXA 2WLKA 2CH4A 2YE5A 3EHGA 3JD0A 4TT3G 2XNDG 3ZRWA 3ZMVA 3SPHA 4JASA 3R91A 1PL0A 1ORQC 3C0EA 4BAEA 3SPCA 3VADA 5FWKA 1PKXA 2QM7A 3GIEA 2BU8A 1PNMA 1SRYA 3GB7C 2XHXA 2XJXA 2P6JA 1B62A 3CCEV 2WLJA 2ZBKB 2A0LA 5HFMA 4BQJA 3RBZA 4HZ0A 4MVUA 4XDMA 5LBQA 1XL6A 4FPPA 3SYOA 3E8GA 2BU5A 3R65A 4H33A 5M4MA 3U2DA 1PNLA 3G75A 1CP9A 3LNMB 3CGZA 2Z5UA 2WEQA 2IU3A 5KUKA 4FK5C 1VQLV 1NR1A 4KUMA 1QCEA 2XDXA 1UY9A 4KSGA 4PA7A 1ENVA 1UY7A 4H85A 3TZ0A 1LNQA 1JVMA 3TZ4A 3EHJA 2LFSA 4I5SA 4LWHA 4J9YB 2QEXV 4AWOA 4YKZA 1GM9A 4CWFA 1VQNV 1JX9A 3ZRWB 5GGZA 1JM6A 3NXSA 4R50A 1KZNA 3F5WC 4BQGA 5FNDA 3E8FA 4HYPA 1RM1B 1NHJA 1EA6A 2C2AA 2YEGA 2XD6A 1VQKV 4MPCA 3RLQA 1CEZA 3A0RA 3K79A 3ZCCA 4JF3A 2WLMA 2OTLV 4GX1A 1AJNA 4XKKA 3CC2V 3QNEA 2LP7A 1UYGA 3FB8C 2YI0A 3ZRXA 1M56B 5FL7G 1I5AA 1R3IC 1TC6A 2IWSA 3HB3B 1KP2A 3CGYA 3B8NA 1P4RA 4HXWA 4X8AA 1ZXMA 3LSQA 2DQ3A 2VW5A 3PJSK 3T1KA 5LGUA 3EHFA 1QVGU 2YK2A 2BZ5A 2XAFA 3TK1A 4RQFA 3GIFA 3AG4B 3A0WA 4LWGA 3IC7A 2WPDG 2Y69B 4XIRA 5D6PA 1BHAA 4P7AA 4CWQA 5CMUA 3MHHC 3QO8A 4O07A 1W0JG 3D0BA 1PD3A 1PNKA 3K04A 4RAIA 3WFVA 3OEEG 2JKIA 3R4MA 2Y48A 3CCMV 2Q67A 2WERA 1W2BU 5C93A 4V25A 3E35A 4QE9A 4GT1A 3IGAC 1YTFD 3FB7C 4QNHB 2D3OW 2YE3A 4YXWG 2EINB 1JQ0A 1OSFA 5J71A 4YKUA 2YJXA 3H80A 4ASAA 3OMUA 3ZM7A 3INWA 5D7CA 5M4KA 4XIQA 2GSMB 4HY1A 4CBCA 1I5CA 1YC3A 3K0GA 4PDLA 2EJRA 2YEDA 1IXMA 2H94A 4FCQA 4U7NA 1THNA 2FWYA 4XCLA 1K73W 3ZXQA 4X88A 2OTJV 3ASNB 4GEEA 1YT2A 1Z5CA 3STLC 1H7SA 1I5BA 1Z5AA 1YJWV 4J9ZB 3SYQA 2QM8A 1UJWB 1K9MW 4JTCB 2EIKB 3E8BA 3WG7B 3JZ3A 2K1EA 1OCZB 3EHHA 4EFTA 3ZXOA 4YKWA 3SYCA 4R7CA 5CTUA 5F5RA 4LWFA 2X0LA 3JYCA 4GX2A 3ZKDA 4V26A 4AWQA 1S72V 2BSMA 3P30A 5CTXA 1DTOA 2IOPA 4ASFA 1KP3A 3CRLA 1K3EA 3T1CA 4QE7A 5IN9A 1BL8A 1AROP 3RVZA 4HYOA 1V54C 5D7RA 4CE2A 4HYMA 2R9RB 5B1NA 3TUHA 2YKBA 5LGTA 3BMYA 3JD3A 4URNA 4H37A 4CWRA 3ZN0A 4PA6A 5IY5C 3INXA 3SYAA 1NQTA 2ZQMA 1NR7A 3OR6C 2BREA 4PDMA 4CWTA 1Q81W 5CPHA 1TH8A 4K4OA 2AHZA 1FFTB 3EKRA 3OFNG 4XC0A 3ASOC 5EBLC 2YI6A 3LDEA 4F4LA 4CWPA 4MP2A 1AH6A 3A0ZA 4BW5A 1VQOV 3QDDA 3F7VC 1YJNV 4CWNA 2A9HA 5E1AC 3O0IA 4N21A 2OCCC 4O09A 1RPOA 4BIUA 4AWPA 2YI7A 3OGCC 4WFFA 4MVMA 2QKSA 2AHYA 4JGSA 2IH1C 4P2ZA 4DZYA 1JCHA 1XL4A 4DO2A 3B25A 3OMNB 2P67A 4KQVA 4XKAA 4R3MA 4GT8A 3W7TA 1B63A 3B28A 1QVFU 2X6BA 4MTXA 4PL9A 3VHAA 1GJVA 4P9PA 1TBWA 1L1FA 1ID0A 4LBEC 1RPRA 3B27A 4HAMA 3OR7C 4L90A 3KE6A 4XCJA 3R4OA 4WCEV 3ZMTA 4BIZA 2YKCA 1FS0G 3R4PA 4LWEA 1KQSU 1VQ9V 1FXHA 2YEFA 3ZN1A 3STZC 4BXIA 1R6KA 1YSRA 2CG9A 3K0DA 2JJ2G 2YGAA 3G7BA 1ROPA 4KFGA 4O0BA 1MOFA 2PNRA 5HFLA 2Q2EB 2VCIA 5D7DA 5CTYA 3I55V 2XCMA 2BT0A 1G8MA 3SPGA 4EGIA 2XDSA 4XBFA 5B1OA 5B3SB 2M7WA 4H7QA 4R6ZA 5FNCA 3T0HA 3OMIB 2B5UA 1S16A 3MNRP 1U2OA 2QF6A 1Y8NA 3MD0A 3G71V 2B1IA 2HJFC 3CCRV 1TUEB 1YT0A 1QR9A 3GIGA 4JAUA 1GTOA 3LDCA 2IJIA 3HZ5A 4GCZA 1GM8A 5CBHA 3E83A 2ESAA 3KG2A 3LDDA 1UY6A 1Y4UA 5D6QA 4G28B 5J9PC 4LPBA 1DF4A 2PI5A 1H8HG 5CBFA 4YKXA 1UYIA 3ZMSA 2FWZA 4UVBA 2HR3A 2HVJC 3ZKBA 1R3LC 1VQ5V 4EGHA 1TIDA 2BYIA 4U7OA 1GKFA 3PEHA 4P30A 2O1UA 3FT5A 1AR1B 5IYBO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WI1 A;  3TTZ A;  1MU5 A;  2BU7 A;  2JKI A;  3R4M A;  2YEH A;  1I5D A;  1UYD A;  3Q5K A;  4PRV A;  3T2S A;  2BU2 A;  5L3J A;  3U67 A;  4R1F A;  4FCP A;  2WER A;  4KSH A;  5C93 A;  1ZXN A;  4V25 A;  3O2F A;  4GT1 A;  2YE6 A;  3OPD A;  3RKZ A;  2YI5 A;  4L93 A;  2YE3 A;  4MBC A;  2BU6 A;  1OSF A;  1Z59 A;  2ZDY A;  2BYH A;  2XK2 A;  3FV5 A;  4GQT A;  4XKO A;  5J71 A;  4QPK A;  4YKU A;  2YJX A;  3H80 A;  4PRX A;  1EI1 A;  4ASA A;  4XIT A;  2YE8 A;  3R92 A;  1BKN A;  2E0A A;  3OMU A;  4FMT A;  4QPJ A;  3ZM7 A;  3INW A;  5D7C A;  5M4K A;  4XIQ A;  4CE1 A;  4NH7 A;  3GIG B;  4ASG A;  4HXZ A;  4HY1 A;  1I5C A;  1YC3 A;  2YED A;  3PEJ A;  1IXM A;  4U93 A;  4GFN A;  4YKY A;  2YKE A;  4FCQ A;  4WUB A;  4B6C A;  4X9L A;  2YEC A;  4EMV A;  3FT8 A;  4U7N A;  2GQP A;  1THN A;  2XX5 A;  4L8Z A;  4ASB A;  3LPS A;  2Q8I A;  2FWY A;  4XCL A;  3ZXQ A;  4XE2 A;  2ZDX A;  3Q5J A;  4YKQ A;  4GEE A;  1YT1 A;  1YT2 A;  2HKJ A;  1Z5C A;  1H7U A;  1H7S A;  1I5B A;  1ZW9 A;  1Z5A A;  2XJJ A;  2QM8 A;  1MX0 A;  4EEH A;  2YEJ A;  4GGL A;  2K5B A;  3A0T A;  4JYB A;  4PU9 A;  3JZ3 A;  3EHH A;  4EFT A;  3ZXO A;  4YKW A;  1UYE A;  3SL2 A;  3LNU A;  5CTU A;  5F5R A;  4DUH A;  4LWF A;  4R3A A;  5FNF A;  3ZKD A;  3P32 A;  5CTW A;  4V26 A;  4AWQ A;  5IDJ A;  2BSM A;  1QZR A;  4ZVI A;  5CTX A;  2IOP A;  4ASF A;  1AJ6 A;  3C11 A;  1UY8 A;  1AM1 A;  2HCH A;  1UYF A;  1KIJ A;  5BOD A;  3CRL A;  4O04 A;  2YEB A;  4MP7 A;  2XHT A;  4O05 A;  3WHA A;  1Y8P A;  3K97 A;  1GKZ A;  2VCJ A;  5IN9 A;  2BTZ A;  1Z5B A;  1B3Q A;  2GFD A;  2AKP A;  4L91 A;  5IDM A;  3RLP A;  5D7R A;  4CE2 A;  4HYM A;  5B1N A;  3G7E A;  2YE2 A;  3TUH A;  2YKB A;  3BMY A;  4URN A;  4HY6 A;  4CWR A;  1YER A;  1F51 A;  2IWX A;  1UYC A;  1R62 A;  2IWU A;  1YET A;  4EFU A;  1Y8O A;  2Q8G A;  3TZ2 A;  3INX A;  1AMW A;  1TC0 A;  2FXS A;  4H81 A;  4WUC A;  1Y4S A;  4EM7 A;  2BRE A;  2CCS A;  2QFO A;  4Q20 A;  4CWT A;  4EGK A;  2QG0 A;  5CPH A;  4B7P A;  1TH8 A;  3B26 A;  4K4O A;  1ZWH A;  3EKR A;  4XC0 A;  1YC1 A;  1BYQ A;  1PVG A;  2CCU A;  1QY8 A;  2YI6 A;  3U2K A;  4P8O A;  1JOY A;  4CWP A;  2WI7 A;  4MPN A;  4LC1 A;  4W7T A;  4MP2 A;  1AH6 A;  2H55 A;  4E00 A;  1UYL A;  3A0Z A;  3CWV A;  2WI6 A;  3QDD A;  4E01 A;  3NMQ A;  2YK9 A;  5J6A A;  3H4L A;  4NH8 A;  3WQ9 A;  4CWN A;  1GKX A;  3O0I A;  4MB9 A;  2BRC A;  5BOC A;  2XX4 A;  4XD8 A;  4URL A;  2CH4 A;  2YE5 A;  3EHG A;  4O09 A;  2JJC A;  5F3K A;  1NHH A;  2O1W A;  1UYK A;  3ZRW A;  4BIU A;  4AWP A;  2YI7 A;  4JAS A;  3R91 A;  3C0E A;  1TIL A;  4BAE A;  3VAD A;  3T0Z A;  3QTF A;  5FWK A;  2QM7 A;  3GIE A;  2Q8F A;  4WUD A;  4XIP A;  4DZY A;  3Q5L A;  2BU8 A;  2VWC A;  2XHX A;  4E02 A;  2XJX A;  3BM9 A;  4YKT A;  3B25 A;  2CGF A;  2WWW A;  3IED A;  1YSZ A;  1B62 A;  2ZBK B;  2P67 A;  4KQV A;  3HZ1 A;  2YE7 A;  4FCR A;  4R3M A;  4XKA A;  4BQJ A;  3HHU A;  2H8M A;  2FYP A;  3CRK A;  4GT8 A;  1B63 A;  2HG1 A;  4HZ0 A;  4JAV A;  3B28 A;  4MPE A;  4MTX A;  4CWO A;  4PL9 A;  4XDM A;  2CCT A;  3HEK A;  3VHA A;  1GJV A;  4FPP A;  1TBW A;  2BU5 A;  1ID0 A;  3VHD A;  5M4M A;  1BGQ A;  3B27 A;  3OWB A;  1A4H A;  3U2D A;  3K99 A;  3TZ5 A;  5M4E A;  3G75 A;  4L90 A;  4ZKI A;  3KE6 A;  3CGZ A;  4CWS A;  4XCJ A;  2WEQ A;  3R4O A;  4BIZ A;  2YKC A;  2Q8H A;  1UYH A;  3R4P A;  4LWE A;  4I3H A;  2YEF A;  2XDX A;  2YGE A;  3HYY A;  4BXI A;  2XDK A;  3K60 A;  2CG9 A;  1YSR A;  1UY9 A;  2QG2 A;  4KSG A;  3T10 A;  1U0Z A;  2YGA A;  3G7B A;  1UY7 A;  4L94 A;  4H85 A;  3TZ0 A;  4KFG A;  4O0B A;  3TZ4 A;  3EHJ A;  2LFS A;  2XDU A;  4I5S A;  4JYC A;  4LWH A;  2O1V A;  4AWO A;  4XTJ A;  3O6O A;  4YKZ A;  2PNR A;  4KTN A;  2UWD A;  4LP0 A;  2Q2E B;  4CWF A;  2VCI A;  5D7D A;  5CTY A;  2WI5 A;  1YC4 A;  3ZRW B;  2YKJ A;  2WI4 A;  1I58 A;  5GGZ A;  1JM6 A;  3NXS A;  2XDL A;  5M4H A;  1US7 A;  3A0Y A;  2XCM A;  1KZN A;  3RLR A;  2BT0 A;  4EGI A;  1S14 A;  2XDS A;  4BQG A;  5B1O A;  5FND A;  4HYP A;  1NHJ A;  1EA6 A;  5CF0 A;  3A0X A;  1YS3 A;  2XAB A;  2C2A A;  2YEG A;  1BXD A;  2XD6 A;  2YE4 A;  4H7Q A;  4YKR A;  4MPC A;  3RLQ A;  5FNC A;  2YEA A;  3T0H A;  2LFR A;  3A0R A;  2YEE A;  3ZCC A;  1S16 A;  3MNR P;  4URO A;  1U2O A;  4XKK A;  4LWI A;  2QF6 A;  4KP4 A;  1Y8N A;  2XJG A;  3DGE A;  3MD0 A;  4NH9 A;  3EKO A;  2ZKJ A;  3B24 A;  1UYG A;  5M4N A;  2YI0 A;  4URM A;  3VHC A;  3ZRX A;  2YGF A;  1YT0 A;  1I5A A;  3GIG A;  4JAU A;  4AS9 A;  1TC6 A;  1L0O A;  3R4N A;  4CE3 A;  2IWS A;  2WI3 A;  4MT8 A;  3HZ5 A;  4GCZ A;  3CGY A;  4MOT A;  1QYE A;  4HXW A;  1ZXM A;  3K98 A;  2ESA A;  2VW5 A;  1UY6 A;  3T1K A;  1Y4U A;  5D6Q A;  3EHF A;  2WEP A;  4LPB A;  2YK2 A;  1NHI A;  2BZ5 A;  3TK1 A;  5M4P A;  1UYM A;  1YES A;  4YKX A;  2YKI A;  1UYI A;  2YJW A;  3GIF A;  3HYZ A;  2FWZ A;  3A0W A;  4LWG A;  3ZKB A;  2FTK A;  4EGH A;  2IOR A;  1TID A;  2EXL A;  2BYI A;  4XIR A;  5D6P A;  4U7O A;  2XX2 A;  2IOQ A;  3D36 A;  3PEH A;  1AH8 A;  2XHR A;  4P7A A;  3D2R A;  4CWQ A;  2YE9 A;  2O1U A;  2YEI A;  4HZ5 A;  3FT5 A;  1I59 A;  4O07 A;  4JQL A;  3OWD A;  3ZRV A;  2WI2 A;  3OW6 A;  3D0B A; 
#chains in the Genus database with same CATH topology
 2WI1 A;  1HW7 A;  2Q7G A;  1EFR G;  1TVK B;  3K5N A;  1EM1 A;  5KUM A;  1UYD A;  4UV9 A;  3Q5K A;  4PRV A;  4BIO A;  2O57 A;  2BU2 A;  4R1F A;  3OTO B;  1IBL O;  4KSH A;  2OIG A;  1ZXN A;  2H8P C;  2EX3 A;  3ZMZ A;  3BEH A;  2YE6 A;  2RDC A;  3BFR A;  2E5L B;  1AIL A;  4FFB A;  1OCR C;  1WB8 A;  4MBC A;  1HNX B;  1Z59 A;  2BYH A;  1EI1 A;  2DYS C;  4K3A A;  2BTO A;  2E0A A;  4TUY A;  3P3N A;  4UCR A;  5IYC O;  2YXH A;  1JA8 A;  1NH2 B;  3GIG B;  4NH7 A;  1ZUQ A;  4JV5 O;  4YJ3 A;  3ML0 A;  1V54 B;  1U96 A;  4X20 B;  4U93 A;  4D7T A;  4JI8 O;  4GFN A;  4YKY A;  3C3S A;  1COW G;  2YEC A;  3FT8 A;  2GQP A;  1N0N A;  2XX5 A;  4ASB A;  1AI4 A;  3A0H Z;  3FKS G;  3LPS A;  2Q8I A;  5L3B A;  1VQ8 V;  5LOV B;  4UXN A;  3CSX A;  4PDV A;  2UUA O;  4KFM A;  3HKE A;  5KHH A;  1K4C C;  1WB7 A;  3APQ A;  1VQ7 V;  5IY5 B;  3TGU H;  4ZIB A;  2PGG A;  3WB1 A;  2ZR3 A;  1FD9 A;  2JVD A;  5LP6 C;  4YJ2 A;  4F6R B;  1ZSP A;  1RP3 B;  4PI0 A;  2ZE8 A;  3SPJ A;  4CS3 A;  1MX0 A;  1RSO B;  2UXB O;  4EEH A;  1Y66 A;  3FYE B;  1Q6U A;  2YEJ A;  4GGL A;  1MNG A;  2YXL A;  3ASO B;  4IL6 Z;  4LFA B;  1VQM V;  1SZT A;  3D3Q A;  4XDJ A;  3JCZ A;  4LCU C;  4LFB B;  4DV3 B;  3RVY A;  4D6T H;  4DUH A;  2Q69 A;  2ZXW C;  3CRQ A;  1GO3 F;  1M1K W;  5CTW A;  5IDJ A;  3O9O A;  1G6U A;  1SZX A;  1QZR A;  4DV7 O;  3ZX6 A;  1AJ6 A;  1AM1 A;  2HCH A;  1UYF A;  4B3S O;  2OCC B;  4JZ2 A;  1M57 B;  4ZBM A;  5BOD A;  3AK3 A;  3H1L H;  3K9A A;  3ETE A;  5B3S C;  3WHA A;  1Y8P A;  2IJH A;  2VCJ A;  4FFB B;  2Q6A A;  1Z5B A;  1M9N A;  1GN3 A;  5EC2 C;  1SES A;  1NKD A;  3AK2 A;  4TUY B;  1OHH G;  2XOK G;  2DWD C;  1RFY A;  3BY6 A;  1YER A;  4YJ3 B;  2IWX A;  5LMU B;  2EZO A;  3BAB A;  4WFG A;  1OCC B;  2HG5 C;  1JJO A;  2L35 A;  1KU9 A;  2FML A;  2P7T C;  4WFE A;  4KHP B;  1Y8O A;  2DJV A;  3OW2 U;  2YSU B;  1N33 O;  2YIB A;  1WLE A;  1IBK O;  2FXS A;  1H2G A;  5BR8 O;  4H81 A;  5JH7 A;  4XDK A;  4RWU A;  4LNU A;  5KLV H;  2MK3 A;  4EGK A;  1VEW A;  3ZHU A;  2QG0 A;  1FXV A;  3HKE B;  2W6I G;  2QWP B;  1IUR A;  3B26 A;  2C1G A;  2CE4 A;  4X62 B;  1AP6 A;  3X2Q B;  1BYQ A;  3Q4H A;  1MAB G;  2GBO A;  4GKK O;  1PVG A;  1YC1 A;  3SYP A;  1I5Y A;  3ETG A;  3AG7 A;  4YJ2 B;  1KD1 W;  1H38 A;  4P8O A;  4PA3 A;  4MPN A;  1W59 A;  1HNW O;  3T1H O;  1Y76 B;  1F23 A;  2H55 A;  4E00 A;  3RYH A;  2WAM A;  4K35 A;  3CCU V;  2YK9 A;  5J6A A;  1G4Y B;  3H4L A;  4NH8 A;  2H3O A;  2FYU H;  1S76 D;  1DLB A;  2ZDI C;  2BRC A;  4MB9 A;  5BOC A;  2XX4 A;  5B66 Z;  4PJ0 Z;  4NXN B;  3CCJ V;  1Q3E A;  2G38 A;  3FYI B;  4GZR B;  2KB1 A;  2Q0O C;  3N2K A;  2IH3 C;  4K8X A;  4FLX A;  4K0K B;  1NTM H;  3JAL A;  4EFE A;  4G2K A;  2XAQ A;  4DV5 B;  1TIL A;  4LFC B;  2UU9 O;  2GTS A;  1ZAU A;  4AIL C;  1P84 F;  3ZS8 C;  3QTF A;  3CE2 A;  2ZD9 A;  3ABM C;  4O4L B;  5TIS Z;  4XIP A;  2CDY A;  4NB5 A;  3TCU A;  4LF5 O;  3Q5L A;  4B7K A;  2VWC A;  4E02 A;  1J5E O;  3EVK A;  4WF9 V;  3BM9 A;  1NU1 H;  5JCO C;  4H0L B;  4GKJ O;  2ZE7 A;  2A79 B;  4MVO A;  1KBH A;  4UVA A;  4FCR A;  2HFE C;  1ZWI C;  2WLH A;  5JQG A;  4PDR A;  3HHU A;  2H8M A;  3I5D A;  2DQ0 A;  2DW4 A;  2HG1 A;  3GVM A;  4JAV A;  5JVD B;  2QKA A;  1FFX A;  4LF4 B;  1BCC H;  3HEK A;  3OMA B;  3J81 N;  3VHD A;  3ZIA G;  3ABT A;  4PA4 A;  3B40 A;  3OWB A;  1A4H A;  5JH7 B;  3RYC A;  2ZNJ A;  3TZ5 A;  1A32 A;  2VQE B;  5M4E A;  3ABL C;  2EIJ B;  3AG3 B;  4E2L A;  3SR2 C;  2NNU A;  1KMI Z;  2ETN A;  2HJD A;  1JMK C;  1SQB H;  4B3T B;  1AI7 A;  2Q8H A;  4UCS A;  2V1D A;  1QLE B;  3W7W A;  4DR1 B;  1OV9 A;  1VF5 B;  4I7Z B;  3CMA V;  2B1G A;  3J80 N;  4W4K A;  1Q6H A;  1OZ0 A;  3HYY A;  1YTF B;  2XDK A;  3K60 A;  1FPO A;  2ADP A;  4UUJ C;  5FPR A;  3HKB A;  1QBZ A;  3T10 A;  4L94 A;  4Z1V A;  1GMG A;  2ITD C;  3G6B A;  3CHX A;  5A2Q N;  3J7A U;  2EIM C;  4FVM A;  3O6O A;  3JD2 A;  1H2N A;  2Y0P A;  4KTN A;  2UWD A;  2BOC C;  4LP0 A;  4WFH A;  5LHG A;  3RYI B;  1YC4 A;  2WI4 A;  5LP6 A;  1I58 A;  5LMN B;  4DV0 O;  3JAL B;  2WSS G;  2XDL A;  5M4H A;  1US7 A;  3A0Y A;  3APO A;  2YEV B;  2HLD G;  1SS3 A;  1BSM A;  3RLR A;  2W0X A;  4TWK A;  2KQX A;  4DV4 O;  2ATK C;  3K5M A;  3T2M A;  2KG7 A;  5CF0 A;  4JI4 B;  3A0X A;  1YS3 A;  1BXD A;  2CK3 G;  2YE4 A;  3L9D A;  4X66 B;  1M57 C;  5JQG B;  1AJP A;  2LFR A;  1WN7 A;  4JI7 B;  1QHT A;  2ZIM A;  5L3C A;  4URO A;  5CA3 A;  4H13 B;  1M90 W;  1YXB A;  2ZM6 B;  1VAR A;  2XJG A;  3JAT A;  2Z3Y A;  4DUZ B;  3EKO A;  4FZ0 A;  3B24 A;  1OCR B;  4URM A;  3VHC A;  3E89 A;  3LUT B;  3RYC B;  4LF6 B;  4AS9 A;  4DR6 O;  1L0O A;  3R4N A;  1AR5 A;  2DYS B;  4MT8 A;  1OCC C;  4MOT A;  1QYE A;  3CME V;  1B06 A;  1EZV H;  3K03 A;  4LF8 B;  2P22 C;  3KKY A;  2V7Q G;  2EJ7 A;  5LXT B;  5IT9 N;  3B4S A;  4MW3 A;  5D5Q A;  3JAM N;  2Q4P A;  3D3I A;  3QO5 A;  4U3F H;  1GN4 A;  3W7S A;  1IZ3 A;  4B7E A;  1K4D C;  1UYM A;  4D7S A;  4X64 B;  3X2Q C;  4N23 A;  3HKB B;  1QLN A;  4W4L A;  2YJW A;  2E75 B;  2XUM A;  2F4V B;  4TV8 B;  3S5T A;  1KUQ A;  4LF7 O;  1YSC A;  1ZLZ A;  3RYF A;  3SJA C;  5H9C A;  1VP7 A;  1YHQ V;  2RCV A;  1VF6 C;  5EZY A;  4ICG A;  3JAK B;  2EXL A;  1NJI W;  1I0H A;  3ABU A;  3CPW U;  2VWK A;  5LP6 B;  2IOQ A;  5EIB D;  1K5S A;  2XHR A;  4HZ5 A;  3DTU B;  2AW9 A;  3JCU Z;  4JQL A;  2GV9 A;  2QR4 A;  2X6A A;  3AEI A;  2WI2 A;  3OW6 A;  3TTZ A;  1MU5 A;  4GX5 A;  2BU7 A;  1L0N H;  2YEH A;  4JI1 O;  2ZCE A;  3RN4 A;  2KG7 B;  1NVP B;  1I5D A;  3T2S A;  2ZDI A;  2YXY A;  4X89 A;  3U67 A;  4FCP A;  2RQ6 A;  5H6Q A;  1KC8 W;  2ZXW B;  3JSL A;  1N0J A;  3RKZ A;  2YI5 A;  1XMQ B;  4J41 A;  2BU6 A;  4DR7 B;  3FV5 A;  2ZDY A;  4XKO A;  2XK2 A;  4XDL A;  3SPI A;  4PRX A;  4DV6 B;  2HHH O;  3AG2 B;  1KKD A;  5IJ9 A;  3R92 A;  2JIZ G;  3JAT B;  1LUW A;  1GH6 A;  1WPX A;  3ICX A;  4UCO A;  1TVK A;  5ITZ B;  4OX9 O;  4I0X B;  5JCO A;  4ASG A;  4HXZ A;  2IM9 A;  2WLL A;  3PEJ A;  1VIB A;  1XHX A;  2JEU A;  3CD6 V;  2YKE A;  2HKO A;  1FJG O;  4I9W A;  4WUB A;  4EMV A;  1MG1 A;  4MW8 A;  1Y67 A;  4L8Z A;  1WP8 A;  1WNS A;  4FLY A;  3OUF A;  2EIJ C;  3AG3 C;  3G80 A;  3OT7 A;  3Q5J A;  4LWS A;  1Q82 W;  1Q8I A;  1M93 A;  3HPL C;  1ZW9 A;  2XAH A;  1T5E A;  1Z2G A;  2XJJ A;  1QLE C;  3HKD A;  1EN6 A;  3OM3 B;  5CN0 A;  1DK1 A;  2P4V A;  1H8E G;  4X9Q A;  1K34 A;  1S3J A;  3A0T A;  5EZY B;  3OE7 G;  3LMM A;  5KHI A;  3VOU A;  4PU9 A;  5C8Y A;  5L3G A;  3KCX A;  2RNB A;  4PA9 A;  3G6E V;  1AB3 A;  1YI2 V;  3LNU A;  4MTO A;  2JEX A;  2K9P A;  2IBZ H;  4R3A A;  4CC6 A;  5FNF A;  5BZB A;  2L6L A;  2R70 A;  4RQE A;  3ZHS A;  2QWN B;  4ZVI A;  2PYL A;  1H2S B;  4G27 B;  3S3W A;  3H1J H;  2BOB C;  1KIJ A;  5A9G A;  3FB5 C;  1XUQ A;  2UXC B;  4O04 A;  1EZJ A;  2NN4 A;  5B1B C;  2EIL C;  4UB6 Z;  2YEB A;  3WB2 A;  2XHT A;  4O05 A;  1YIJ V;  3K97 A;  1B3Q A;  4DR2 O;  2GFD A;  4YHH O;  1P7B A;  4L91 A;  4DR4 B;  1XI1 A;  4I4T B;  4WBN B;  4DR5 B;  3ABM B;  3PN1 A;  1S5J A;  5JJJ B;  2YE2 A;  3G7E A;  4BW9 A;  2ARH A;  1N32 O;  5LGN A;  4AQY O;  2YIC A;  1Q5O A;  4A5U B;  1Z5V A;  1I94 B;  1PL4 A;  2NR5 A;  1R62 A;  2WLL B;  4FIP C;  1K92 A;  2GUZ A;  5GTH Z;  2GHY A;  2EUL A;  4H44 B;  1YET A;  3E8H A;  2R9I A;  3K3W A;  3G4S V;  1XMO B;  2Q8G A;  2Q7H A;  2UUB O;  1V55 C;  2X6C A;  2JK5 C;  4WUC A;  1Y4S A;  4EM7 A;  4JYY A;  2UUC B;  1XRE A;  4Q20 A;  2PZS A;  2QFO A;  3CYO A;  3B8M A;  4NR1 A;  3BAA A;  4J80 A;  4B7P A;  3CC7 V;  3L73 H;  4YY3 B;  3JD4 A;  4LWS B;  4FJC C;  2DOS A;  4OPH A;  3ZHQ A;  4QJF B;  2Q7E A;  2CCU A;  3I56 V;  4X1Y A;  4MTG A;  3GWO A;  3ABL B;  5EBW C;  3HKD B;  2DYR C;  5DN6 G;  3D36 C;  1JOY A;  2WI7 A;  3K9S A;  4LC1 A;  2PI4 A;  1AI5 A;  4W7T A;  5IWA B;  4UCV A;  2XAG A;  3CWV A;  2UXD O;  2WI6 A;  2V4D A;  1SET A;  4B3R O;  3CCS V;  4E01 A;  1F4M A;  2RJZ A;  4BWA A;  3BA9 A;  5C8Y B;  3QO7 A;  1HNZ B;  3H01 A;  1GKX A;  3E2E A;  1OCO B;  1R6N A;  1YEW A;  3CWB H;  3ETQ A;  4XD8 A;  4URL A;  3QTC A;  2JJC A;  1HWY A;  2ZT9 B;  5F3K A;  1NHH A;  2O1W A;  1UYK A;  5IJ9 B;  4JI0 B;  2JS5 A;  1EN4 A;  2QA4 V;  3MAQ A;  3IFX A;  1Y76 A;  3K08 A;  2EIM B;  3T0Z A;  3UM7 A;  1VF6 A;  1IBK B;  5CA1 A;  1XNQ O;  1EBO A;  4TQF A;  4DV1 O;  1NS1 A;  2Q8F A;  2Y4U A;  4WUD A;  2LQT A;  3ZMU A;  1M5I A;  1QR8 A;  3ABK B;  4YKT A;  2CGF A;  2WWW A;  3IED A;  1YSZ A;  1IBM B;  1SQP H;  3BRC A;  3HZ1 A;  4GKK B;  2YE7 A;  2FYP A;  3CRK A;  3OTO O;  1AJQ A;  4ASU G;  1R3J C;  3L70 H;  4RUE A;  3W7X A;  3CRC A;  3LSS A;  1HNW B;  1NI8 A;  5JJN B;  4MPE A;  4CWO A;  4X65 B;  2CCT A;  1D2D A;  2E5L O;  3VBB A;  3T1Y B;  2GUZ B;  3AG2 C;  1HNX O;  4K8Z A;  4WFB V;  2IW5 A;  4O4L A;  3W7U A;  1FXK C;  1BGQ A;  1Q7Y W;  3K99 A;  3OUS A;  1LUV A;  3L71 H;  1JJ2 U;  4C7U A;  4F6E A;  3L75 H;  2HEP A;  4ZKI A;  1K33 A;  2LJ2 A;  4CWS A;  2JGU A;  3OEH G;  4UVC A;  3JD1 A;  5JVD A;  4CZZ A;  4X1Y B;  1BGY H;  4JI2 B;  2YIB D;  1UYH A;  2LGQ A;  1IDS A;  3CJH A;  4I3H A;  4TV9 A;  5DEC A;  5B1A B;  3RT3 C;  5E79 Z;  2NLJ C;  2Y0I A;  2XHB A;  2OCH A;  4LF5 B;  2YGE A;  2OT5 A;  1GK9 A;  2QG2 A;  2LO1 A;  3CCV V;  1U0Z A;  3AG1 B;  3FX7 A;  1Z5W A;  4MS2 A;  3T4D A;  2XDU A;  4JYC A;  2O1V A;  4XTJ A;  3OAA G;  1I7F A;  3N27 A;  3N2G B;  4Q6G A;  1ZX3 A;  2FL4 A;  1YZB A;  4UV8 A;  2IU0 A;  2WI5 A;  1YJ9 V;  2EBO A;  2YKJ A;  5EC1 C;  3F7Y C;  5DM6 V;  1YIT V;  4LFA O;  2A3Q A;  4EEQ A;  5CA1 B;  1VQP V;  2WLI A;  1S14 A;  3CXH F;  3QG5 A;  2CGN A;  3CRM A;  2WLN A;  2F95 B;  4LFB O;  4DV3 O;  4DUY B;  3BCC H;  4IT5 A;  4OXS A;  2XAB A;  4ZHQ B;  3BVO A;  3TET A;  4YKR A;  3KZI Z;  3CCL V;  2QE7 G;  1R73 A;  4MSW C;  2YEA A;  1G1X B;  4UCT A;  2F43 G;  3RYI A;  2YEE A;  4TOI A;  1O9H A;  2LW7 A;  5KA5 A;  3ZRS A;  5EIB C;  2Q0A A;  3RFR A;  2YEV A;  2LW1 A;  4LWI A;  3JAS B;  4KP4 A;  1GRJ A;  3DGE A;  2UXX A;  2Q9L A;  4NH9 A;  1SER A;  1S77 D;  2ZKJ A;  3FAV B;  4JAA A;  5EK0 A;  5M4N A;  2Q68 A;  2YGF A;  5BMV B;  2M6Y A;  4NXM O;  2IJK A;  4CE3 A;  2WI3 A;  4WFA V;  2HVK C;  5D5P A;  2QTO A;  2ODM A;  2Q8V A;  5LMU O;  5KX5 A;  3K98 A;  4KHP O;  1K7D A;  3CJH B;  4TV9 B;  5BXZ A;  2WEP A;  1NHI A;  5M4P A;  3SJQ C;  1YES A;  4PEL A;  4O2A A;  2YKI A;  4L87 A;  3HYZ A;  4JI3 B;  4X62 O;  1MSW D;  4LF9 B;  1R3K C;  2PUS A;  1Q6I A;  3ZJZ A;  4DV2 B;  5KHG A;  5CA0 B;  2FTK A;  4B08 A;  2IOR A;  1K8A W;  1E79 G;  4MVR A;  1Q43 A;  5LXT A;  2XX2 A;  2P4K A;  2MW2 B;  1RM1 C;  3D36 A;  1YCI A;  1AH8 A;  3CCQ V;  3D2R A;  2YE9 A;  1OCO C;  2YEI A;  1I59 A;  1VQ6 V;  3OWD A;  3CYG A;  5LYJ B;  3ZRV A;  2GTA A;  1KEC A;  1N36 B;  2WLI B;  1CPY A;  1WA8 A;  4J42 A;  1BMF G;  3B77 A;  3U0Z A;  3H1H H;  4TV8 A;  4NXN O;  4ZI7 B;  1I5X A;  5GON B;  2CUG A;  1Q86 W;  5L3J A;  1S5H C;  4TSF G;  3ZHV A;  4K0K O;  4BAY A;  3O2F A;  4NYK A;  1E1Q G;  1WP7 A;  1BQZ A;  2XAJ A;  4OPA A;  3JAK A;  4RO2 A;  3OPD A;  2FB5 A;  4DV5 O;  4B3M B;  4LFC O;  4L93 A;  1M4U A;  1I08 A;  1M56 C;  3ABK C;  4JTA B;  3K5L A;  1NVP D;  3SJC C;  4GQT A;  1XDC A;  3T4Z A;  4QPK A;  1YVW A;  5L3E A;  4XIT A;  2W0F C;  2YE8 A;  5J2U B;  1BKN A;  2VRZ A;  2EIL B;  5B1B B;  4FMT A;  4X1I A;  4QPJ A;  4JYA B;  4P9O A;  3RW0 A;  4ZOL A;  4CE1 A;  5J2T A;  4PI2 A;  2YS8 A;  1E1R G;  5LHH A;  2N04 A;  1XNR B;  2HHI A;  2PTM A;  1K5Q A;  2BCC H;  3K59 A;  1B6Q A;  5JEN A;  1TUB A;  2ITC C;  2UXN A;  4LF4 O;  3LSU A;  3DXR A;  5K1P A;  5EBM C;  4LH7 A;  5DED A;  4MVS A;  4MTF A;  5L3F A;  3SJB C;  5KX5 B;  4MVZ A;  4B6C A;  4X9L A;  3MDS A;  3EHB B;  3AG4 C;  3H1K H;  2XAS A;  2ZNI A;  4XE2 A;  1VQ4 V;  3VQX A;  2ZDX A;  2E76 B;  2JDI G;  3K06 A;  4JI1 B;  1SF9 A;  5ITZ A;  4YKQ A;  4Z1M G;  2VQE O;  1YT1 A;  1FXK A;  2QJ1 A;  1L8D A;  2HKJ A;  1V55 B;  1H7U A;  4O2A B;  1GN2 A;  4I0X A;  2Y69 C;  1LR1 A;  1Q90 D;  2B9Z A;  2ILM A;  1WJZ A;  4B3T O;  5B1A C;  2IJJ A;  1YDX A;  2AXT Z;  1BHB A;  3M99 B;  2K5B A;  5LHI A;  1THZ A;  3K5O A;  4JYB A;  5GW7 A;  3A8T A;  2DWE C;  2DYR B;  2YDE A;  3AG1 C;  2HHH B;  1X4T A;  1UYE A;  3O65 A;  4MVQ A;  1F7Y A;  3SL2 A;  3EFF K;  2X7R B;  2P90 A;  2F1M A;  1WA8 B;  3P32 A;  3SDL A;  5IJ0 A;  1N8R W;  4FZ1 A;  2EIN C;  4UB8 Z;  4DXW A;  3C11 A;  1UY8 A;  2JJ1 G;  4HBN A;  5LMN O;  2EZP A;  1UPG A;  1AI6 A;  4DR3 B;  4MP7 A;  3EXA A;  3CXC U;  2P5O A;  1GKZ A;  2ZR2 A;  2BTZ A;  1XBL A;  2AKP A;  5IDM A;  5H6R A;  3CRR A;  4JI4 O;  4DRX A;  3RLP A;  4X1I B;  4ZOL B;  1EN5 A;  5J2T B;  4X66 O;  3U10 A;  5IYD O;  4HY6 A;  1W0K G;  4JI5 B;  1F51 A;  4JI7 O;  1UFI A;  1UYC A;  1GN6 A;  3CS5 A;  1Y4M A;  2IWU A;  4JPR A;  3BPZ A;  4EFU A;  4HZ3 A;  3ASN C;  4O2B B;  1TUB B;  1DF5 A;  2W6J G;  3DXR B;  3CP1 A;  3TZ2 A;  1AMW A;  1X59 A;  4UCU A;  2ZM6 O;  3JAR A;  1TC0 A;  3UKM A;  3H9V A;  4EKW A;  1F4N A;  2CCS A;  3TXQ A;  4DUZ O;  4JI6 B;  4I4T A;  1N34 B;  4WBN A;  1Y74 B;  1H2M A;  5KA6 A;  3OGI B;  3RWR D;  2CH7 A;  2D2C B;  4LF6 O;  1NBM G;  4RUF A;  1ZWH A;  1FXK B;  1J95 A;  4PV1 B;  5CBG A;  1QY8 A;  3MHS C;  5L3D A;  1GM7 A;  1K97 A;  2EIK C;  3WG7 C;  3U2K A;  1OCZ C;  5FLX N;  3CC4 V;  1QNM A;  4GX0 A;  1HR0 B;  2VQF B;  4JTD B;  1XHZ A;  1UYL A;  1D5A A;  4LP8 A;  4YHH B;  3E86 A;  3NMQ A;  1BE3 H;  4Z2W A;  1S0V A;  3FB6 C;  4R8C A;  3FD9 A;  3WQ9 A;  1AP5 A;  4QIW F;  3ETD A;  1NH2 D;  1JPX A;  4X64 O;  5EYP A;  3UCS C;  2WLK A;  3QF7 A;  1VMG A;  2CH4 A;  2YE5 A;  2F4V O;  3EHG A;  3JD0 A;  4TT3 G;  5BY1 A;  5IJ0 B;  2XND G;  4CS2 A;  1IBL B;  3ZRW A;  2ZIO A;  1TAE A;  3ZMV A;  3SPH A;  4JAS A;  3R91 A;  1PL0 A;  4FLW A;  1ORQ C;  3C0E A;  3M8A A;  3HKC B;  4BAE A;  1NTZ H;  3SPC A;  1FYJ A;  3GWK C;  3VAD A;  1PPJ H;  4FFK A;  5FWK A;  1PKX A;  2QM7 A;  3GIE A;  1H2L A;  2PY5 A;  1DGS A;  1SQV H;  2BU8 A;  1PNM A;  1SRY A;  2R72 A;  3GB7 C;  2XHX A;  2XJX A;  4J11 A;  2P6J A;  2PF4 E;  1B62 A;  3CCE V;  2WLJ A;  3IC9 A;  2ZBK B;  2A0L A;  5HFM A;  4DRX B;  4BQJ A;  3FFQ A;  4JV5 B;  1MZE A;  3RBZ A;  4HZ0 A;  4MVU A;  1D5N A;  4CH5 A;  4JI8 B;  4XDM A;  4FM1 A;  5LBQ A;  3M7M X;  1XL6 A;  1XMQ O;  4FPP A;  3SYO A;  3CB2 A;  3E8G A;  2BU5 A;  3DC5 A;  3R65 A;  4H33 A;  1FAF A;  5M4M A;  1MMM A;  4DV6 O;  3JAR B;  2UUA B;  5H5N A;  2P06 A;  3U2D A;  4NKG B;  1PNL A;  1JFF A;  3G75 A;  4E4E A;  1CP9 A;  4PD4 F;  4IHJ A;  3IJ4 A;  2CH7 B;  3KCY A;  3LNM B;  3CGZ A;  2Z5U A;  1SQF A;  2WEQ A;  1GAX A;  2IU3 A;  5KUK A;  1HDJ A;  4FK5 C;  4O4I A;  2UXB B;  1SC5 B;  1IXB A;  1NTK H;  3F5T A;  1VQL V;  2AZ0 A;  1NR1 A;  4DV1 B;  4KUM A;  1QCE A;  2XDX A;  3JSN A;  5FNV A;  1UY9 A;  4KSG A;  2CGO A;  4PA7 A;  4HNA B;  1ENV A;  2E3C A;  4J7K A;  1UY7 A;  4H85 A;  3TZ0 A;  1LNQ A;  1JVM A;  1BQ0 A;  3TZ4 A;  3EHJ A;  2LFS A;  5EYP B;  4I5S A;  4LWH A;  4J9Y B;  4LR3 A;  2QEX V;  4AWO A;  4YKZ A;  2FKX A;  4DV7 B;  1GM9 A;  4CWF A;  1VQN V;  1JX9 A;  4B3S B;  3ZRW B;  2R9A A;  5GGZ A;  3ZBH A;  1JM6 A;  2N74 A;  3NXS A;  2GDS A;  4R50 A;  4DW0 A;  5JWP A;  1KZN A;  3F5W C;  4QGP A;  4BQG A;  5FND A;  3E8F A;  5IE9 A;  4HYP A;  5KMG A;  1RM1 B;  1NHJ A;  1EA6 A;  2C2A A;  1HP8 A;  2Y4T A;  2YEG A;  1BZK A;  2VWJ A;  2XD6 A;  4I55 A;  1Y6X A;  1VQK V;  4FM2 A;  4MPC A;  3RLQ A;  1CEZ A;  3N2G A;  1AR4 A;  3A0R A;  3K79 A;  5AG2 A;  3ZCC A;  4JF3 A;  1SA0 B;  2F66 C;  2UXC O;  2OWO A;  2WLM A;  2OTL V;  4GX1 A;  1AJN A;  5FPO A;  4XKK A;  1N33 B;  2A06 H;  3CC2 V;  3QNE A;  5BR8 B;  2LP7 A;  3VQW A;  4DR4 O;  4LH6 A;  1UYG A;  3FB8 C;  2YI0 A;  1JR9 A;  3ZRX A;  1M56 B;  5FL7 G;  1I5A A;  4DR5 O;  1TA8 A;  3C3T A;  4TQD A;  4ZHQ A;  1R3I C;  1TC6 A;  1JFF B;  2IWS A;  3HB3 B;  4IHJ B;  1KP2 A;  3CGY A;  3B8N A;  1I94 O;  1P4R A;  4HXW A;  4X8A A;  1ZXM A;  3ZHT A;  1PV0 A;  3ZED A;  3LSQ A;  4O4I B;  3T1H B;  2VS0 A;  1ZL8 B;  1XMO O;  2DQ3 A;  2VW5 A;  3PJS K;  3T1K A;  4GUN A;  5LGU A;  3JAS A;  1WAZ A;  5KAF Z;  3EHF A;  1QVG U;  5FNV B;  2YK2 A;  2BZ5 A;  3OTF A;  2UUC O;  2XAF A;  3FAV A;  3TK1 A;  4IYI A;  4CH6 A;  5BMV A;  4RQF A;  4YY3 O;  3GIF A;  3AG4 B;  3A0W A;  4CS4 A;  4LWG A;  2QWR B;  2OYQ A;  3IC7 A;  3JAW A;  1VF7 A;  2F93 B;  2WPD G;  4I50 A;  2XTA A;  2Y69 B;  1FKA O;  1MA1 A;  2UU9 B;  4XIR A;  5IWA O;  5D6P A;  1BHA A;  4O4H A;  4P7A A;  4CWQ A;  5CMU A;  3MHH C;  3QO8 A;  4O07 A;  4DYL A;  1HNZ O;  1J5E B;  2QWQ B;  3L72 H;  1W0J G;  3D0B A;  1PD3 A;  1PNK A;  3K04 A;  4RAI A;  3WFV A;  4GKJ B;  4NXM B;  3OEE G;  2JKI A;  3R4M A;  1OJH A;  5KHK A;  5KMG B;  2WA3 A;  2Y48 A;  4GYC B;  2XT9 A;  2JRI A;  4FLZ A;  3CCM V;  2Q67 A;  4I55 B;  2WER A;  1W2B U;  5C93 A;  4V25 A;  4JI0 O;  1SQX H;  3E35 A;  5CA0 A;  4QE9 A;  4GT1 A;  2AGA A;  3IGA C;  1YTF D;  3FB7 C;  4QNH B;  2D3O W;  4DW1 A;  2YE3 A;  4YXW G;  2EIN B;  1JQ0 A;  1OSF A;  5J71 A;  4YKU A;  1QU7 A;  2YJX A;  3H80 A;  4ASA A;  5LYJ A;  3VQV A;  2C1I A;  3OMU A;  3ZM7 A;  3INW A;  1P49 A;  5D7C A;  5M4K A;  3E22 A;  1IBM O;  4XIQ A;  4ZI7 A;  4DK0 A;  2GSM B;  5GON A;  4HY1 A;  2YID A;  4J7Z A;  4CBC A;  1I5C A;  1YC3 A;  3K0G A;  4PDL A;  2EJR A;  5B5E Z;  2YED A;  4L8J A;  1IXM A;  4X65 O;  2H94 A;  3T1Y O;  4FCQ A;  4E72 A;  4U7N A;  1THN A;  1US6 A;  2FWY A;  4XCL A;  1K73 W;  1BT8 A;  2CTW A;  5CB4 A;  3ZXQ A;  4X88 A;  5J2U A;  2OTJ V;  3ASN B;  4GEE A;  1YT2 A;  1Z5C A;  3STL C;  1H7S A;  1I5B A;  4J7J A;  1B04 A;  1Z5A A;  1YJW V;  4J9Z B;  4EB6 A;  3BA8 A;  3JAW B;  2QM8 A;  4PHZ A;  3SYQ A;  1UJW B;  4JI2 O;  4I50 B;  4DV0 B;  1K9M W;  3A2F A;  4JTC B;  2EIK B;  3E8B A;  3WG7 B;  3JZ3 A;  4NVP A;  2K1E A;  1OCZ B;  3EHH A;  4O4H B;  4EFT A;  3ZXO A;  4YKW A;  2CTR A;  3SYC A;  5IYZ A;  4R7C A;  4DV4 B;  1R1B A;  4X1K A;  5CTU A;  5F5R A;  4LWF A;  2X0L A;  3JYC A;  4GX2 A;  4O4J A;  3ZKD A;  4V26 A;  4AWQ A;  1R6T A;  1S72 V;  2BSM A;  3P30 A;  2QWO B;  5CTX A;  1DTO A;  2IOP A;  4ASF A;  1CXZ B;  1KP3 A;  3CRL A;  1YF2 A;  2YC0 A;  3UT5 A;  3SGI A;  2CTQ A;  1K3E A;  3T1C A;  2ADQ B;  4QE7 A;  4FLU A;  5IN9 A;  1BL8 A;  4CH3 A;  4LNU B;  1ARO P;  4DUY O;  3RVZ A;  2Z0A A;  4HYO A;  1V54 C;  1QQC A;  5D7R A;  4CE2 A;  4HYM A;  2R9R B;  5B1N A;  3TUH A;  4ABM A;  4FM0 A;  4DR6 B;  3E22 B;  2YIA A;  2YKB A;  3CX5 F;  3Q4H B;  5LGT A;  3BMY A;  3JD3 A;  1MSD A;  4URN A;  4H37 A;  4CWR A;  4YIP A;  3ZN0 A;  1KB9 F;  4IYH A;  1S5L Z;  1XQ8 A;  4PA6 A;  3THO A;  1BS3 A;  1V9P A;  3RYH B;  5IY5 C;  3INX A;  3SYA A;  1NQT A;  2ZQM A;  2CTP A;  1PM9 A;  1NR7 A;  3OR6 C;  2BRE A;  3WU2 Z;  2QDO A;  1KKC A;  1SKV A;  4PDM A;  1KYO F;  5CB4 B;  4CWT A;  1Q81 W;  1NT2 B;  2BSK A;  5CPH A;  1TH8 A;  4K4O A;  2AHZ A;  1FFT B;  3C90 A;  4LF7 B;  3OFN G;  3EKR A;  4XC0 A;  3ASO C;  4FLV A;  2PYJ A;  5EBL C;  3N2K B;  4CH4 A;  2YI6 A;  3LDE A;  4F4L A;  4CWP A;  4EB6 B;  1IVS A;  4MP2 A;  1AH6 A;  4O2B A;  2QSA A;  1P7G A;  2BE3 A;  3A0Z A;  4BW5 A;  1VQO V;  4FLT A;  5JJE B;  3QDD A;  3F7V C;  1YJN V;  3VQY A;  4UFZ A;  4CWN A;  2A9H A;  5E1A C;  3O0I A;  3NR7 A;  5IYZ B;  1Y74 A;  4X1K B;  3L74 H;  4N21 A;  2OCC C;  4O09 A;  4JI3 O;  4O4J B;  1RPO A;  4LF9 O;  2QM4 A;  5F2V O;  4BIU A;  4DV2 O;  4AWP A;  2YI7 A;  1WPB A;  2ZE6 A;  3UO2 A;  3OGC C;  1FFX B;  4WFF A;  3WB0 A;  2YI9 A;  4MVM A;  4DR1 O;  2QKS A;  2AHY A;  4JGS A;  3UT5 B;  2IH1 C;  4P2Z A;  4DZY A;  1JCH A;  4YIO A;  1XL4 A;  2QKC A;  4DO2 A;  1N36 O;  2Q5Z A;  3B25 A;  3OMN B;  4AHC A;  2CAZ C;  4OX9 B;  2P67 A;  4KQV A;  4XKA A;  4R3M A;  1XEQ A;  4NTY A;  4GT8 A;  3W7T A;  1B63 A;  2WA4 A;  3CRA A;  4KL1 A;  3B28 A;  4IIJ A;  1QVF U;  2LGW A;  2X6B A;  3HKC A;  4MTX A;  4OGQ B;  4B3M O;  4PL9 A;  4U3J A;  1FJG B;  3VHA A;  1L0L H;  2QTS A;  3OD4 A;  3K58 A;  4P9P A;  1GJV A;  1TBW A;  1L1F A;  4GLX A;  1ID0 A;  4LBE C;  1RPR A;  2JGD A;  3B27 A;  1N4C A;  2RN9 A;  5GTI Z;  5LA6 A;  4JYA O;  4HAM A;  3AK1 A;  3DSQ A;  3K57 A;  3OR7 C;  1H2K A;  2BSK B;  4L90 A;  4I9Q A;  3KE6 A;  1XNR O;  4XCJ A;  3R4O A;  4WCE V;  3ZMT A;  4BIZ A;  3TXS A;  2YKC A;  3LNN A;  1FS0 G;  3QVN A;  3R4P A;  4LWE A;  1KQS U;  1VQ9 V;  1FXH A;  4J10 A;  2YEF A;  3ZN1 A;  3STZ C;  3R66 A;  4KXR A;  1U97 A;  4BXI A;  1R6K A;  1PP9 H;  3CEI A;  3DC6 A;  1YSR A;  2CG9 A;  3K0D A;  3U11 A;  2JJ2 G;  2YGA A;  3G7B A;  3TJT A;  1ROP A;  3ZHR A;  4KFG A;  4O0B A;  1XIL A;  2QGN A;  3RGB A;  2E74 B;  2BTQ A;  1MOF A;  2N05 A;  2PNR A;  5HFL A;  2Q2E B;  2VCI A;  5D7D A;  5CTY A;  2ZE5 A;  3I55 V;  4LF8 O;  2KKW A;  2XCM A;  1AVM A;  2BT0 A;  1G8M A;  2YUA A;  3SPG A;  4EGI A;  4DR2 B;  2XDS A;  2A7W A;  4XBF A;  2JS3 A;  5B1O A;  1O9G A;  5B3S B;  4HNA A;  1XOU A;  2M7W A;  2DMX A;  1N32 B;  4AQY B;  4H7Q A;  1TGO A;  1URF A;  3HR0 A;  4R6Z A;  2OIE A;  5FNC A;  3T0H A;  2AZ2 A;  3OMI B;  2B5U A;  1S16 A;  3MNR P;  4IIJ B;  1SQQ H;  4DR3 O;  3IAY A;  1U2O A;  4U3J B;  2UUB B;  2QF6 A;  1Y8N A;  2F23 A;  3MD0 A;  4AI8 A;  3G71 V;  2B1I A;  2JGD B;  2HJF C;  3P3P A;  3CCR V;  1TUE B;  1YT0 A;  1QR9 A;  3GIG A;  5LA6 B;  4JAU A;  4DK1 A;  4CC5 A;  1GTO A;  2RMK B;  3LDC A;  2IJI A;  3RYF B;  1NZ6 A;  2HP8 A;  3HZ5 A;  4GCZ A;  4JZG A;  3BHP A;  4NTX A;  4X20 A;  4JI5 O;  1GM8 A;  5KAI Z;  3UQ8 A;  5CBH A;  3E83 A;  1SA0 A;  4BR6 A;  2DN9 A;  4IGG A;  3S3X A;  3A0B Z;  2ESA A;  3B09 A;  3KG2 A;  2UXD B;  3LDD A;  1UY6 A;  2KSD A;  5LOV A;  4B3R B;  1Y4U A;  5D6Q A;  3H1I H;  4EFB A;  1IX9 A;  4G28 B;  4DR7 O;  5J9P C;  1ZTE A;  4LPB A;  1DF4 A;  2PI5 A;  1H8H G;  4JI6 O;  2YI8 A;  5CBF A;  5H2F Z;  1N34 O;  4YKX A;  1UYI A;  3ZMS A;  2DE0 X;  4F6R A;  2FWZ A;  3D8C A;  1RSO A;  2BTQ B;  5LL6 Y;  4UVB A;  2HR3 A;  2HVJ C;  3ZKB A;  1R3L C;  1VQ5 V;  4EGH A;  3G67 A;  1TID A;  2BYI A;  4U7O A;  1ZL8 A;  1GKF A;  2VQF O;  1HR0 O;  5K1X A;  3PEH A;  4P30 A;  1XNQ B;  2O1U A;  1MZF A;  2Q73 A;  3B2E E;  3FT5 A;  1AR1 B;  2ZIN A;  5IYB O;  2ZKO A;  4NTW A;  5KHJ A;  3UO3 A;  1SQG A; 
#chains in the Genus database with same CATH homology
 2WI1 A;  1EFR G;  5KUM A;  1UYD A;  4UV9 A;  3Q5K A;  4PRV A;  2BU2 A;  4R1F A;  4KSH A;  1ZXN A;  2H8P C;  3ZMZ A;  3BEH A;  2YE6 A;  1OCR C;  4MBC A;  1Z59 A;  2BYH A;  1EI1 A;  2DYS C;  2E0A A;  5IYC O;  1NH2 B;  3GIG B;  4NH7 A;  3ML0 A;  1V54 B;  4U93 A;  4GFN A;  4YKY A;  1COW G;  2YEC A;  3FT8 A;  2GQP A;  4ASB A;  2XX5 A;  1AI4 A;  3FKS G;  3LPS A;  2Q8I A;  5L3B A;  1VQ8 V;  4UXN A;  4PDV A;  4KFM A;  1K4C C;  1VQ7 V;  5IY5 B;  2ZR3 A;  3SPJ A;  1MX0 A;  4EEH A;  1Y66 A;  3FYE B;  2YEJ A;  4GGL A;  3ASO B;  1VQM V;  1SZT A;  4XDJ A;  3JCZ A;  4LCU C;  3RVY A;  4DUH A;  2Q69 A;  2ZXW C;  1GO3 F;  1M1K W;  5CTW A;  5IDJ A;  1QZR A;  1AJ6 A;  1AM1 A;  2HCH A;  1UYF A;  2OCC B;  4ZBM A;  1M57 B;  5BOD A;  3K9A A;  3ETE A;  5B3S C;  3WHA A;  1Y8P A;  2IJH A;  2VCJ A;  2Q6A A;  1Z5B A;  1M9N A;  5EC2 C;  1SES A;  1NKD A;  1OHH G;  2XOK G;  2DWD C;  3BY6 A;  1YER A;  2IWX A;  2EZO A;  4WFG A;  1OCC B;  2HG5 C;  2P7T C;  4WFE A;  1Y8O A;  3OW2 U;  2YSU B;  1WLE A;  2FXS A;  1H2G A;  4H81 A;  4XDK A;  2MK3 A;  4EGK A;  2QG0 A;  1FXV A;  2W6I G;  3B26 A;  3X2Q B;  1YC1 A;  1BYQ A;  1MAB G;  1PVG A;  3SYP A;  1I5Y A;  3ETG A;  1H38 A;  1KD1 W;  4P8O A;  4PA3 A;  4MPN A;  1F23 A;  2H55 A;  4E00 A;  2WAM A;  3CCU V;  2YK9 A;  5J6A A;  1G4Y B;  3H4L A;  4NH8 A;  1S76 D;  4MB9 A;  1DLB A;  2ZDI C;  2BRC A;  5BOC A;  2XX4 A;  3CCJ V;  3FYI B;  2KB1 A;  2IH3 C;  4G2K A;  2XAQ A;  1TIL A;  3QTF A;  2ZD9 A;  3ABM C;  4XIP A;  3TCU A;  3Q5L A;  2VWC A;  4E02 A;  4WF9 V;  3BM9 A;  2A79 B;  4MVO A;  4UVA A;  4FCR A;  2HFE C;  1ZWI C;  2WLH A;  4PDR A;  3HHU A;  2H8M A;  2DQ0 A;  2DW4 A;  2HG1 A;  4JAV A;  3HEK A;  3OMA B;  3VHD A;  3ZIA G;  3ABT A;  4PA4 A;  3OWB A;  1A4H A;  3TZ5 A;  5M4E A;  3ABL C;  2EIJ B;  3AG3 B;  4E2L A;  2NNU A;  1AI7 A;  2Q8H A;  2V1D A;  1QLE B;  3W7W A;  3CMA V;  2B1G A;  1OZ0 A;  3HYY A;  1YTF B;  2XDK A;  3K60 A;  4UUJ C;  1QBZ A;  3T10 A;  4L94 A;  1GMG A;  2ITD C;  2EIM C;  3O6O A;  3JD2 A;  4KTN A;  2UWD A;  2BOC C;  4LP0 A;  4WFH A;  5LHG A;  1YC4 A;  2WI4 A;  1I58 A;  2WSS G;  2XDL A;  5M4H A;  1US7 A;  3A0Y A;  2YEV B;  2HLD G;  3RLR A;  4TWK A;  2ATK C;  3T2M A;  5CF0 A;  3A0X A;  1YS3 A;  1BXD A;  2CK3 G;  2YE4 A;  1M57 C;  1AJP A;  2LFR A;  5L3C A;  4URO A;  5CA3 A;  1M90 W;  2XJG A;  2Z3Y A;  3EKO A;  3B24 A;  1OCR B;  4URM A;  3VHC A;  3E89 A;  3LUT B;  4AS9 A;  1L0O A;  3R4N A;  2DYS B;  4MT8 A;  1OCC C;  4MOT A;  1QYE A;  3CME V;  3K03 A;  2V7Q G;  4MW3 A;  3D3I A;  3QO5 A;  3W7S A;  1K4D C;  1UYM A;  3X2Q C;  4N23 A;  1QLN A;  2YJW A;  1YSC A;  5H9C A;  1YHQ V;  2EXL A;  1NJI W;  3ABU A;  3CPW U;  2IOQ A;  1K5S A;  2XHR A;  4HZ5 A;  3DTU B;  4JQL A;  2WI2 A;  2X6A A;  3AEI A;  3OW6 A;  3TTZ A;  1MU5 A;  4GX5 A;  2BU7 A;  2YEH A;  1NVP B;  1I5D A;  3T2S A;  2ZDI A;  4X89 A;  3U67 A;  4FCP A;  5H6Q A;  1KC8 W;  2ZXW B;  3RKZ A;  2YI5 A;  2BU6 A;  3FV5 A;  2ZDY A;  4XKO A;  2XK2 A;  4XDL A;  3SPI A;  4PRX A;  3R92 A;  3AG2 B;  1KKD A;  2JIZ G;  1WPX A;  4ASG A;  4HXZ A;  2WLL A;  3PEJ A;  2JEU A;  3CD6 V;  2YKE A;  2HKO A;  4I9W A;  4WUB A;  4EMV A;  1MG1 A;  4MW8 A;  4L8Z A;  3OUF A;  2EIJ C;  3AG3 C;  3Q5J A;  1Q82 W;  3HPL C;  1ZW9 A;  2XAH A;  2XJJ A;  1QLE C;  5CN0 A;  3OM3 B;  1H8E G;  1K34 A;  1S3J A;  3A0T A;  3OE7 G;  3VOU A;  4PU9 A;  5L3G A;  4PA9 A;  3G6E V;  1YI2 V;  3LNU A;  4MTO A;  2JEX A;  4R3A A;  5FNF A;  5BZB A;  4RQE A;  4ZVI A;  4G27 B;  2BOB C;  1KIJ A;  3FB5 C;  4O04 A;  1EZJ A;  5B1B C;  2EIL C;  2YEB A;  2XHT A;  4O05 A;  1YIJ V;  3K97 A;  1B3Q A;  2GFD A;  1P7B A;  4L91 A;  3ABM B;  3G7E A;  2YE2 A;  5LGN A;  1R62 A;  2WLL B;  4FIP C;  1K92 A;  2GHY A;  1YET A;  3E8H A;  2R9I A;  3K3W A;  3G4S V;  2Q8G A;  1V55 C;  2X6C A;  2JK5 C;  4WUC A;  1Y4S A;  4EM7 A;  2QFO A;  4Q20 A;  3CYO A;  3B8M A;  4B7P A;  3CC7 V;  3JD4 A;  4FJC C;  4QJF B;  2CCU A;  3I56 V;  4MTG A;  3GWO A;  3ABL B;  5EBW C;  2DYR C;  5DN6 G;  1JOY A;  2WI7 A;  4LC1 A;  2PI4 A;  1AI5 A;  4W7T A;  2XAG A;  3CWV A;  2WI6 A;  1SET A;  3CCS V;  4E01 A;  1F4M A;  3QO7 A;  3H01 A;  1GKX A;  3E2E A;  1OCO B;  1R6N A;  4XD8 A;  4URL A;  2JJC A;  1HWY A;  5F3K A;  1NHH A;  2O1W A;  1UYK A;  2QA4 V;  3IFX A;  3K08 A;  2EIM B;  3T0Z A;  3UM7 A;  1EBO A;  2Q8F A;  4WUD A;  3ZMU A;  1QR8 A;  3ABK B;  4YKT A;  2CGF A;  2WWW A;  3IED A;  1YSZ A;  3HZ1 A;  2YE7 A;  2FYP A;  3CRK A;  1AJQ A;  4ASU G;  1R3J C;  4RUE A;  3W7X A;  3LSS A;  4MPE A;  4CWO A;  2CCT A;  3VBB A;  3AG2 C;  4WFB V;  2IW5 A;  3W7U A;  1FXK C;  1BGQ A;  1Q7Y W;  3K99 A;  3OUS A;  1JJ2 U;  4ZKI A;  1K33 A;  4CWS A;  3OEH G;  4UVC A;  3JD1 A;  4CZZ A;  1UYH A;  4I3H A;  5B1A B;  2NLJ C;  2YGE A;  2OT5 A;  1GK9 A;  2QG2 A;  3CCV V;  1U0Z A;  3AG1 B;  4MS2 A;  3T4D A;  2XDU A;  4JYC A;  2O1V A;  4XTJ A;  3OAA G;  4UV8 A;  2IU0 A;  2WI5 A;  1YJ9 V;  2EBO A;  2YKJ A;  5EC1 C;  3F7Y C;  5DM6 V;  1YIT V;  1VQP V;  2WLI A;  1S14 A;  2WLN A;  4OXS A;  2XAB A;  3TET A;  4YKR A;  2YEA A;  3CCL V;  2QE7 G;  1R73 A;  4MSW C;  2F43 G;  2YEE A;  5KA5 A;  3ZRS A;  2YEV A;  4LWI A;  4KP4 A;  3DGE A;  2UXX A;  4NH9 A;  1SER A;  1S77 D;  2ZKJ A;  5EK0 A;  5M4N A;  2Q68 A;  2YGF A;  2IJK A;  4CE3 A;  2WI3 A;  4WFA V;  2HVK C;  2QTO A;  3K98 A;  1K7D A;  2WEP A;  1NHI A;  5M4P A;  3SJQ C;  1YES A;  4PEL A;  2YKI A;  4L87 A;  3HYZ A;  1MSW D;  1R3K C;  3ZJZ A;  2FTK A;  2IOR A;  1K8A W;  1E79 G;  4MVR A;  2XX2 A;  1RM1 C;  3D36 A;  1AH8 A;  3CCQ V;  3D2R A;  2YE9 A;  1OCO C;  2YEI A;  1I59 A;  1VQ6 V;  3OWD A;  3ZRV A;  1KEC A;  2WLI B;  1CPY A;  1BMF G;  3B77 A;  1I5X A;  1Q86 W;  5L3J A;  1S5H C;  4TSF G;  4BAY A;  3O2F A;  1E1Q G;  2XAJ A;  4RO2 A;  3OPD A;  4L93 A;  3ABK C;  1M56 C;  4JTA B;  1NVP D;  4GQT A;  3T4Z A;  4QPK A;  5L3E A;  4XIT A;  2W0F C;  2YE8 A;  1BKN A;  5B1B B;  2EIL B;  4FMT A;  4QPJ A;  4P9O A;  3RW0 A;  4CE1 A;  1E1R G;  5LHH A;  1K5Q A;  1B6Q A;  2ITC C;  2UXN A;  5EBM C;  4MVS A;  4MTF A;  5L3F A;  4MVZ A;  4B6C A;  4X9L A;  3EHB B;  3AG4 C;  2XAS A;  4XE2 A;  1VQ4 V;  2ZDX A;  2JDI G;  3K06 A;  4YKQ A;  4Z1M G;  1YT1 A;  1FXK A;  2HKJ A;  1V55 B;  1H7U A;  2Y69 C;  5B1A C;  2IJJ A;  1BHB A;  3M99 B;  2K5B A;  5LHI A;  1THZ A;  4JYB A;  5GW7 A;  2DWE C;  2DYR B;  3AG1 C;  1UYE A;  4MVQ A;  3SL2 A;  3EFF K;  2X7R B;  2P90 A;  3P32 A;  1N8R W;  2EIN C;  4DXW A;  3C11 A;  1UY8 A;  2JJ1 G;  2EZP A;  1AI6 A;  4MP7 A;  3CXC U;  1GKZ A;  2ZR2 A;  2BTZ A;  2AKP A;  5IDM A;  5H6R A;  3RLP A;  5IYD O;  4HY6 A;  1W0K G;  1F51 A;  1UYC A;  1Y4M A;  2IWU A;  4JPR A;  4EFU A;  3ASN C;  4HZ3 A;  1DF5 A;  2W6J G;  3CP1 A;  3TZ2 A;  1AMW A;  1TC0 A;  3UKM A;  4EKW A;  1F4N A;  2CCS A;  5KA6 A;  1NBM G;  4RUF A;  1ZWH A;  1FXK B;  1J95 A;  5CBG A;  1QY8 A;  3MHS C;  5L3D A;  1GM7 A;  1K97 A;  2EIK C;  3WG7 C;  3U2K A;  1OCZ C;  3CC4 V;  4GX0 A;  4JTD B;  1UYL A;  4LP8 A;  3E86 A;  3NMQ A;  1S0V A;  3FB6 C;  4R8C A;  3WQ9 A;  4QIW F;  3ETD A;  1NH2 D;  1JPX A;  2WLK A;  2CH4 A;  2YE5 A;  3EHG A;  3JD0 A;  4TT3 G;  2XND G;  3ZRW A;  3ZMV A;  3SPH A;  4JAS A;  3R91 A;  1PL0 A;  1ORQ C;  3C0E A;  4BAE A;  3SPC A;  3VAD A;  5FWK A;  1PKX A;  2QM7 A;  3GIE A;  2BU8 A;  1PNM A;  1SRY A;  3GB7 C;  2XHX A;  2XJX A;  2P6J A;  1B62 A;  3CCE V;  2WLJ A;  2ZBK B;  2A0L A;  5HFM A;  4BQJ A;  3RBZ A;  4HZ0 A;  4MVU A;  4XDM A;  5LBQ A;  1XL6 A;  4FPP A;  3SYO A;  3E8G A;  2BU5 A;  3R65 A;  4H33 A;  5M4M A;  3U2D A;  1PNL A;  3G75 A;  1CP9 A;  3LNM B;  3CGZ A;  2Z5U A;  2WEQ A;  2IU3 A;  5KUK A;  4FK5 C;  1VQL V;  1NR1 A;  4KUM A;  1QCE A;  2XDX A;  1UY9 A;  4KSG A;  4PA7 A;  1ENV A;  1UY7 A;  4H85 A;  3TZ0 A;  1LNQ A;  1JVM A;  3TZ4 A;  3EHJ A;  2LFS A;  4I5S A;  4LWH A;  4J9Y B;  2QEX V;  4AWO A;  4YKZ A;  1GM9 A;  4CWF A;  1VQN V;  1JX9 A;  3ZRW B;  5GGZ A;  1JM6 A;  3NXS A;  4R50 A;  1KZN A;  3F5W C;  4BQG A;  5FND A;  3E8F A;  4HYP A;  1RM1 B;  1NHJ A;  1EA6 A;  2C2A A;  2YEG A;  2XD6 A;  1VQK V;  4MPC A;  3RLQ A;  1CEZ A;  3A0R A;  3K79 A;  3ZCC A;  4JF3 A;  2WLM A;  2OTL V;  4GX1 A;  1AJN A;  4XKK A;  3CC2 V;  3QNE A;  2LP7 A;  1UYG A;  3FB8 C;  2YI0 A;  3ZRX A;  1M56 B;  5FL7 G;  1I5A A;  1R3I C;  1TC6 A;  2IWS A;  3HB3 B;  1KP2 A;  3CGY A;  3B8N A;  1P4R A;  4HXW A;  4X8A A;  1ZXM A;  3LSQ A;  2DQ3 A;  2VW5 A;  3PJS K;  3T1K A;  5LGU A;  3EHF A;  1QVG U;  2YK2 A;  2BZ5 A;  2XAF A;  3TK1 A;  4RQF A;  3GIF A;  3AG4 B;  3A0W A;  4LWG A;  3IC7 A;  2WPD G;  2Y69 B;  4XIR A;  5D6P A;  1BHA A;  4P7A A;  4CWQ A;  5CMU A;  3MHH C;  3QO8 A;  4O07 A;  1W0J G;  3D0B A;  1PD3 A;  1PNK A;  3K04 A;  4RAI A;  3WFV A;  3OEE G;  2JKI A;  3R4M A;  2Y48 A;  3CCM V;  2Q67 A;  2WER A;  1W2B U;  5C93 A;  4V25 A;  3E35 A;  4QE9 A;  4GT1 A;  3IGA C;  1YTF D;  3FB7 C;  4QNH B;  2D3O W;  2YE3 A;  4YXW G;  2EIN B;  1JQ0 A;  1OSF A;  5J71 A;  4YKU A;  2YJX A;  3H80 A;  4ASA A;  3OMU A;  3ZM7 A;  3INW A;  5D7C A;  5M4K A;  4XIQ A;  2GSM B;  4HY1 A;  4CBC A;  1I5C A;  1YC3 A;  3K0G A;  4PDL A;  2EJR A;  2YED A;  1IXM A;  2H94 A;  4FCQ A;  4U7N A;  1THN A;  2FWY A;  4XCL A;  1K73 W;  3ZXQ A;  4X88 A;  2OTJ V;  3ASN B;  4GEE A;  1YT2 A;  1Z5C A;  3STL C;  1H7S A;  1I5B A;  1Z5A A;  1YJW V;  4J9Z B;  3SYQ A;  2QM8 A;  1UJW B;  1K9M W;  4JTC B;  2EIK B;  3E8B A;  3WG7 B;  3JZ3 A;  2K1E A;  1OCZ B;  3EHH A;  4EFT A;  3ZXO A;  4YKW A;  3SYC A;  4R7C A;  5CTU A;  5F5R A;  4LWF A;  2X0L A;  3JYC A;  4GX2 A;  3ZKD A;  4V26 A;  4AWQ A;  1S72 V;  2BSM A;  3P30 A;  5CTX A;  1DTO A;  2IOP A;  4ASF A;  1KP3 A;  3CRL A;  1K3E A;  3T1C A;  4QE7 A;  5IN9 A;  1BL8 A;  1ARO P;  3RVZ A;  4HYO A;  1V54 C;  5D7R A;  4CE2 A;  4HYM A;  2R9R B;  5B1N A;  3TUH A;  2YKB A;  5LGT A;  3BMY A;  3JD3 A;  4URN A;  4H37 A;  4CWR A;  3ZN0 A;  4PA6 A;  5IY5 C;  3INX A;  3SYA A;  1NQT A;  2ZQM A;  1NR7 A;  3OR6 C;  2BRE A;  4PDM A;  4CWT A;  1Q81 W;  5CPH A;  1TH8 A;  4K4O A;  2AHZ A;  1FFT B;  3EKR A;  3OFN G;  4XC0 A;  3ASO C;  5EBL C;  2YI6 A;  3LDE A;  4F4L A;  4CWP A;  4MP2 A;  1AH6 A;  3A0Z A;  4BW5 A;  1VQO V;  3QDD A;  3F7V C;  1YJN V;  4CWN A;  2A9H A;  5E1A C;  3O0I A;  4N21 A;  2OCC C;  4O09 A;  1RPO A;  4BIU A;  4AWP A;  2YI7 A;  3OGC C;  4WFF A;  4MVM A;  2QKS A;  2AHY A;  4JGS A;  2IH1 C;  4P2Z A;  4DZY A;  1JCH A;  1XL4 A;  4DO2 A;  3B25 A;  3OMN B;  2P67 A;  4KQV A;  4XKA A;  4R3M A;  4GT8 A;  3W7T A;  1B63 A;  3B28 A;  1QVF U;  2X6B A;  4MTX A;  4PL9 A;  3VHA A;  1GJV A;  4P9P A;  1TBW A;  1L1F A;  1ID0 A;  4LBE C;  1RPR A;  3B27 A;  4HAM A;  3OR7 C;  4L90 A;  3KE6 A;  4XCJ A;  3R4O A;  4WCE V;  3ZMT A;  4BIZ A;  2YKC A;  1FS0 G;  3R4P A;  4LWE A;  1KQS U;  1VQ9 V;  1FXH A;  2YEF A;  3ZN1 A;  3STZ C;  4BXI A;  1R6K A;  1YSR A;  2CG9 A;  3K0D A;  2JJ2 G;  2YGA A;  3G7B A;  1ROP A;  4KFG A;  4O0B A;  1MOF A;  2PNR A;  5HFL A;  2Q2E B;  2VCI A;  5D7D A;  5CTY A;  3I55 V;  2XCM A;  2BT0 A;  1G8M A;  3SPG A;  4EGI A;  2XDS A;  4XBF A;  5B1O A;  5B3S B;  2M7W A;  4H7Q A;  4R6Z A;  5FNC A;  3T0H A;  3OMI B;  2B5U A;  1S16 A;  3MNR P;  1U2O A;  2QF6 A;  1Y8N A;  3MD0 A;  3G71 V;  2B1I A;  2HJF C;  3CCR V;  1TUE B;  1YT0 A;  1QR9 A;  3GIG A;  4JAU A;  1GTO A;  3LDC A;  2IJI A;  3HZ5 A;  4GCZ A;  1GM8 A;  5CBH A;  3E83 A;  2ESA A;  3KG2 A;  3LDD A;  1UY6 A;  1Y4U A;  5D6Q A;  4G28 B;  5J9P C;  4LPB A;  1DF4 A;  2PI5 A;  1H8H G;  5CBF A;  4YKX A;  1UYI A;  3ZMS A;  2FWZ A;  4UVB A;  2HR3 A;  2HVJ C;  3ZKB A;  1R3L C;  1VQ5 V;  4EGH A;  1TID A;  2BYI A;  4U7O A;  1GKF A;  3PEH A;  4P30 A;  2O1U A;  3FT5 A;  1AR1 B;  5IYB O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...