5IDJA

Bifunctional histidine kinase ccka (domains dhp-ca) in complex with adp/mg2+
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
242
structure length
242
Chain Sequence
LSQAQKMQAIGQLAGGVAHDFNNLLTAIQLRLDQLLHRHPVGDPSYEGLNEIRQTGVRAADLVRKLLAFSRKQTVQREVLDLGELISEFEVLLRRLLREDVKLITDYGRDLPQVRADKSQLETAVMNLAVNARDAVRAAKGGGVVRIRTARLTRDEAIQLGFPAADGDTAFIEVSDDGPGIPPDVMGKIFDPFFTTKPVGEGTGLGLATVYGIVKQSDGWIHVHSRPNEGAAFRIFLPVYEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell cycle histidine kinase CckA
publication title Cyclic di-GMP mediates a histidine kinase/phosphatase switch by noncovalent domain cross-linking.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase
total genus 63
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5idjA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5idjA02
1GJVA 1UYKA 2YKCA 1UYMA 3TK1A 3ZRVA 2LFSA 3ZRWB 3QTFA 3WQ9A 1YT1A 4O04A 3HYZA 4JYBA 2Q8IA 2XDUA 4EFUA 2XJJA 1YC1A 3Q5JA 2Q8HA 2FYPA 3PEJA 3ZRXA 1Z59A 5M4NA 3T10A 2XHRA 3VADA 2YEJA 3RLRA 1YT2A 3G75A 4GQTA 4LWHA 2XCMA 4CWRA 3A0XA 1AMWA 2WI7A 4YKZA 1JOYA 1YSRA 4EMVA 2AKPA 2YI6A 3G7BA 3H80A 4GT8A 1UYIA 2XDXA 3FT8A 2BU5A 1YT0A 4PRVA 4CE3A 1YERA 3ZXQA 4PU9A 3B26A 4FPPA 2BSMA 1MX0A 5D6PA 5L3JA 4HXZA 2CH4A 1UYFA 2O1UA 2JKIA 4CWFA 4HZ0A 1YC4A 1TC0A 4O0BA 3R4PA 3O0IA 4XIQA 2YE6A 4CWQA 4LWIA 3GIGB 3HZ1A 4LWFA 2YKIA 1NHHA 4L8ZA 2LFRA 3CRLA 2UWDA 3TZ4A 1OSFA 3B28A 1ZXNA 3B27A 1EI1A 4L90A 3GIFA 2Q8GA 2YE4A 1ZW9A 4XKOA 2BZ5A 5CTWA 4CE2A 5F3KA 3CWVA 3D36A 1GKXA 4P8OA 5J71A 4CWPA 5J6AA 3LNUA 4KP4A 4JQLA 4ASAA 2YKBA 2VCJA 4JYCA 4MOTA 4CWSA 3P32A 4BQGA 4QPJA 3K99A 1QYEA 1I59A 4CWTA 3G7EA 3TZ0A 3H4LA 3DGEA 4LWGA 3T0ZA 3TUHA 4WUDA 4ZKIA 4KSGA 2ZDXA 3OMUA 3CGYA 4MPEA 2WI5A 4LPBA 3K60A 4DZYA 4XCJA 4EGKA 1F51A 4YKYA 2K5BA 1YETA 4CWOA 3O2FA 4MP7A 4DUHA 4MB9A 1UYGA 3MNRP 5CTXA 3R92A 5M4PA 1TBWA 1PVGA 2WI6A 1AH6A 1U2OA 5B1OA 1YSZA 4HZ5A 2YJWA 2YGAA 2YE8A 4JAUA 2WI1A 1UYLA 4AWOA 2HCHA 3R4NA 2ESAA 3INWA 3A0ZA 2QG2A 3BMYA 1I5DA 1TIDA 2IWUA 4XE2A 1UY8A 1TILA 4LP0A 2O1WA 2E0AA 2YEEA 3FT5A 3SL2A 2CCSA 4AWPA 1S16A 1QY8A 2H55A 1BYQA 4GEEA 2IWXA 4R3MA 3U2DA 2YEAA 3ZCCA 3A0YA 3U67A 4AWQA 2GFDA 2BYHA 1KZNA 2YGFA 2PNRA 2YEBA 2ZKJA 1UYHA 2FWYA 5CTUA 3VHAA 3HZ5A 1I5AA 2IORA 1UYCA 4MPCA 4MTXA 3R4OA 4PRXA 4BAEA 5D6QA 2H8MA 2QFOA 3BM9A 2YK9A 5M4EA 2YEGA 2XHXA 1L0OA 4KSHA 4XKAA 3IEDA 4MBCA 3INXA 2XJXA 3EHHA 4BQJA 2C2AA 4YKTA 4XITA 2YEIA 1AJ6A 1KIJA 1TH8A 2WI4A 4XCLA 2EXLA 5CTYA 5FNFA 1JM6A 2WWWA 4E02A 4H81A 2YKJA 4GT1A 4GFNA 2YE3A 4EM7A 4B7PA 2YGEA 3D0BA 2VWCA 1ID0A 3QDDA 4QPKA 4YKXA 4L93A 1MU5A 3ZKBA 3O6OA 4YKUA 3GIEA 3HYYA 1NHIA 3A0TA 4FCPA 3WHAA 4L91A 2QM8A 4URNA 3KE6A 5BODA 2BREA 3Q5KA 4NH8A 5B1NA 2WERA 4URLA 4V26A 1THNA 2IWSA 4X9LA 3EHFA 1S14A 2HG1A 3NMQA 4HYPA 1A4HA 4U7OA 4XC0A 4EGIA 2BTZA 1UY6A 5M4HA 2YE9A 5IDJA 4MP2A 4Q20A 4NH9A 2VCIA 4ASBA 4HXWA 4EEHA 1ZWHA 4O09A 1Y4SA 2Q8FA 2BYIA 4ASFA 4WUBA 4XTJA 1YESA 5FWKA 3B24A 3K98A 4EFTA 3A0RA 4U7NA 4I5SA 4FCQA 4NH7A 3OW6A 4PL9A 5IN9A 4BIUA 1US7A 2XDLA 4BIZA 2Q2EB 4KTNA 1B3QA 3JZ3A 1Z5CA 4R3AA 3VHDA 3C0EA 4LWEA 3TTZA 2FTKA 4HY6A 5BOCA 3D2RA 1BGQA 1H7UA 3C11A 5D7RA 3OPDA 4B6CA 3EHJA 4FCRA 3T1KA 4HYMA 1UYEA 2YE2A 2QF6A 4W7TA 4XD8A 1UY7A 3HEKA 4YKWA 2YECA 4I3HA 4AS9A 3ZRWA 5IDMA 3PEHA 2CGFA 4E00A 2XABA 2YK2A 3A0WA 2YI0A 4HY1A 4LC1A 3HHUA 2YE5A 4JASA 1GKZA 3OWDA 5M4MA 2XX2A 3T0HA 4UROA 4ASGA 1UY9A 4O05A 4XKKA 2XX5A 5FNCA 3LPSA 4P7AA 1YC3A 2XX4A 4K4OA 1IXMA 3R4MA 4KFGA 1Z5AA 5D7CA 4FMTA 3EHGA 1Y8OA 4EGHA 2P67A 2JJCA 3VHCA 2ZBKB 1YS3A 2CCTA 2BU7A 4H85A 2BRCA 1TC6A 3T2SA 3RKZA 3TZ5A 5M4KA 4MPNA 1AH8A 4V25A 2HKJA 2XD6A 3CGZA 3R91A 2XJGA 2WEQA 2WI2A 2WEPA 4XDMA 3U2KA 1AM1A 5F5RA 1BXDA 4KQVA 1Z5BA 4CE1A 3TZ2A 4H7QA 3K97A 4YKQA 3RLQA 1Y8NA 2YKEA 1EA6A 1I5BA 1B63A 3RLPA 2QG0A 3ZM7A 3GIGA 2BU2A 1Y8PA 3CRKA 2BU6A 3EKOA 5CPHA 4E01A 4JAVA 2YEFA 4O07A 2ZDYA 1R62A 5GGZA 3ZXOA 4BXIA 2VW5A 3B25A 1Y4UA 1UYDA 4GGLA 3MD0A 2CCUA 4MT8A 2BU8A 4CWNA 2IOQA 2YE7A 1NHJA 4WUCA 2YJXA 4L94A 4ZVIA 5D7DA 4R1FA 2QM7A 1I5CA 1I58A 2YI5A 4GCZA 3OWBA 2XHTA 2XDKA 1BKNA 2WI3A 2IOPA 2GQPA 5FNDA 2O1VA 3FV5A 3Q5LA 5C93A 3EKRA 1U0ZA 2FXSA 4YKRA 2XK2A 2BT0A 3NXSA 4U93A 2YEDA 5CF0A 4XIRA 2XDSA 4URMA 1H7SA 2CG9A 4XIPA 2FWZA 1QZRA 3ZKDA 1ZXMA 2YI7A 2YEHA 1B62A
chains in the Genus database with same CATH superfamily
1BE3H 3E8FA 4J7KA 1GJVA 3ZMVA 3QTFA 4JI2O 4O04A 5AG2A 3HYZA 2Q8IA 5DM6V 3T1HB 2ZQMA 2IBZH 1SQPH 1YC1A 1H2GA 3IGAC 1WA8A 5IY5B 3TCUA 2Y0IA 4BIOA 4BWAA 4J41A 4RQFA 3ZBHA 2YIDA 3PEJA 3ZRXA 4JGSA 1Z59A 2ZE8A 1HNWO 4UVCA 1VARA 2ZKOA 2QM4A 1DF5A 3QVNA 4W4LA 4EB6B 2EIJC 2YEJA 1JMKC 4PA9A 2C1IA 4FFKA 2Q7EA 5LYJB 2YXYA 1H2MA 1YT2A 3G75A 2XCMA 5IYDO 2IH1C 4MTOA 1KMIZ 1AMWA 4YKZA 4NXNO 2Q7HA 3JATA 3ABLC 1ZLZA 4X20A 5F2VO 1Q86W 4LF4O 1UYIA 1J95A 1IVSA 1Q6UA 1R3KC 4CS3A 1YHQV 3AG4B 4PRVA 1YERA 4CE3A 4R50A 2BSMA 2LJ2A 1F7YA 5D6PA 1VQNV 4ZHQB 3FKSG 4OX9O 4CH6A 1WP8A 3ZMSA 1TC0A 1LUVA 3L72H 4O0BA 4X66O 1WNSA 5H2FZ 3OUSA 1OCCC 5CBGA 2ZIMA 3GIGB 3HZ1A 2YKIA 3K58A 1NHHA 1N0JA 3HKEB 4I50A 2UWDA 2V7QG 4DV7O 2DYSC 1THZA 3JD1A 4PELA 1W0KG 1EI1A 1HNZB 2YE4A 1ZW9A 4XKOA 1Y76A 4DRXB 3I55V 2LP7A 3JARA 2W6JG 2WLIB 4P8OA 4JQLA 1O9GA 5LOVB 1N8RW 3S3WA 4LF6B 2L35A 2ZDIA 4YY3B 3VBBA 4NYKA 4QPJA 4X1IB 3ETQA 1Q6HA 1NH2D 3HB3B 1HW7A 2R72A 4YIPA 3TZ0A 1YXBA 1RPRA 2BOBC 3DGEA 1MSWD 2CGNA 4DK1A 3RVYA 1OCCB 4LF9O 3OMUA 3BCCH 4LPBA 1P7BA 3G6EV 3K60A 2Q0AA 2LO1A 3GWKC 4N23A 4J42A 2UU9O 4LF8O 4CWOA 5BR8B 3FAVB 1FJGB 4NXMO 4MP7A 1R73A 5IYCO 4MB9A 2HFEC 3FYIB 3MNRP 3OTOO 5M4PA 4FM2A 3GVMA 4E72A 2V1DA 5B1OA 3DXRA 2XAHA 1KKDA 2WI1A 1RP3B 1V54B 5L3CA 2HCHA 4G27B 1HDJA 5EBLC 3HR0A 4HZ3A 3SPIA 1XNQB 4DR6O 2OIGA 4X62B 2RN9A 1O9HA 4CH4A 1M56B 1UY8A 1NZ6A 1R3IC 3B4SA 4U3FH 3SL2A 4AWPA 2R70A 1QY8A 3OAAG 4GEEA 4OXSA 1M4UA 4R3MA 5KHHA 2ZM6B 1DGSA 2YEAA 3ZCCA 4CH5A 2OCCB 1CP9A 1QBZA 2ADPA 3HKBA 4AWQA 5CA3A 2YEBA 1F4NA 1M5IA 1OV9A 4DR4O 4MPCA 4NVPA 1RM1C 4PDLA 5D6QA 2H8MA 2QFOA 1ZTEA 2IM9A 1KYOF 2YEGA 1L0OA 4XKAA 4O2BA 3K9SA 2UXCO 4MBCA 5B1BC 3INXA 3WB1A 2WAMA 4TUYA 5B5EZ 4JYAB 5LHHA 3N2GB 5J2UB 2CDYA 4XCLA 5FPOA 5FNFA 5EYPB 1JM6A 3FYEB 2UXBB 4XDJA 1PD3A 4MW3A 4GFNA 5KAIZ 3CMEV 2XASA 2VWCA 5HFLA 4KUMA 4RWUA 2UUAO 5L3GA 4L93A 4LH6A 3ZKBA 4YKUA 1HNXO 3GIEA 2JIZG 2PYLA 2Q8VA 3A0TA 1NQTA 3K06A 4JI7B 1N0NA 4GUNA 2XAGA 1X4TA 4URNA 5LBQA 2BREA 1S5HC 1D2DA 4GLXA 4MTFA 4V26A 4DUZO 2BSKA 1THNA 2YDEA 3B09A 4UV8A 4HYPA 4GKJO 1A4HA 2IW5A 1HR0O 2YE9A 2WLJA 4Q20A 4MP2A 1R6KA 3MDSA 4UB8Z 2VCIA 2JJ1G 4EEHA 3MHSC 4TV9A 1ZWHA 1IXBA 5LMUO 2VRZA 4WUBA 3CCJV 5LL6Y 1YESA 5EC2C 3K98A 4AQYO 3W7SA 5JCOC 4NH7A 1TUBB 4K3AA 1JR9A 1Q6IA 4XDKA 1US7A 3JAWB 4KXRA 4KTNA 1K5SA 2BCCH 3A8TA 4UXNA 5ITZB 3E8BA 3SJCC 3H9VA 3ZJZA 4H33A 3TTZA 1BSMA 3D2RA 4TWKA 2ARHA 2IJHA 5IJ0B 3QO7A 3I56V 3T2MA 3AK3A 5D7RA 3K04A 2PY5A 1GM9A 3JD2A 4MVOA 2QDOA 3ZMTA 3AG3C 1CXZB 2MK3A 1Y74B 4FCRA 1GN6A 4HYMA 2PZSA 2YICA 4W7TA 1RSOB 1UY7A 4I3HA 4Z1VA 5LGUA 1FYJA 5IDMA 5EZYA 4O4HB 4E00A 1I94B 1KD1W 4K0KO 3APQA 2Z0AA 4X9QA 4QE9A 2E74B 2DN9A 2EILB 4P2ZA 1HWYA 3OWDA 1V55C 3Q4HA 2XX2A 3CC7V 1YJNV 4X8AA 2AW9A 4DUYO 4DV1O 4XKKA 2XX5A 4B3SB 4P7AA 3IAYA 1U96A 2XX4A 5DEDA 4WCEV 4ZI7A 3HKDA 3J81N 3WG7C 4FMTA 3G80A 3EHGA 3FB7C 5BMVB 5EC1C 1BL8A 2WLLA 2JJCA 3K3WA 3AG3B 3LNMB 4H85A 2Q9LA 1N32B 4IYHA 2IH3C 1J5EB 5JJNB 3RKZA 3TZ5A 1YDXA 4PJ0Z 2HKJA 2XD6A 1HP8A 3R91A 4UVAA 2VQEB 1XMQO 1XILA 2WI2A 2WEPA 1GN2A 1AP6A 1OJHA 3ASNC 5LP6A 4FM1A 1AM1A 4JI0O 4H7QA 1N33O 4O4IA 3K97A 4YKQA 4OPAA 3F7VC 3SYQA 1FPOA 3RLQA 3S5TA 4LFCO 4N21A 1V55B 4PI0A 3STLC 1I5BA 2C1GA 4FZ0A 3K57A 3ZM7A 1BQZA 5CPHA 4PDVA 1IBKO 1PKXA 2YEFA 4O07A 3WU2Z 2ITCC 3ZXOA 3CWBH 2VW5A 3A0BZ 2EIMC 3OEHG 4DR1O 1FXKA 1X59A 4X64O 5BZBA 3ZMUA 1E79G 4RQEA 3EXAA 4RUFA 1I5CA 3QTCA 4O4JB 4P9PA 5IJ9B 1GO3F 1BKNA 4L87A 3S3XA 2WI3A 2P7TC 2WLHA 2GDSA 3ASNB 1SESA 2CK3G 4D7TA 4I55A 1FFXB 2QTSA 1NVPD 3CJHB 5C93A 2FXSA 3G71V 2QWOB 5C8YA 3H1LH 5LGNA 1VQ8V 1N34O 4U93A 1A32A 1P84F 5CF0A 3OMAB 4O2AA 2XDSA 4LNUB 5CA0A 4XIPA 4WBNB 4X88A 2FWZA 5K1XA 5CB4B 3CXCU 1ZXMA 2YEHA 1B62A 4PA7A 2ZIOA 3K0DA 1UYKA 2YKCA 4PDRA 1UYMA 3TK1A 3MAQA 2E76B 3ZRWB 4E4EA 2DOSA 1YT1A 1Y4MA 4J7ZA 1KECA 1ZAUA 4BW9A 2XJJA 3TXSA 3E22B 5CBFA 3UQ8A 2YXLA 3SPCA 3J80N 3RYCA 2Q8HA 1XREA 4JV5O 2FYPA 1XEQA 3T10A 2XAJA 3G6BA 3VADA 1WLEA 3R65A 1WJZA 1AB3A 2DE0X 3CYOA 3K08A 2E3CA 2JEXA 5A2QN 3RLRA 4LF5B 4KL1A 2FMLA 4PA3A 3P3PA 4ASUG 4GQTA 2UXNA 3UCSC 3J7AU 2DYRB 3L9DA 1JX9A 2WI7A 4EFBA 2WSSG 5TISZ 2JEUA 1P7GA 4FFBB 3G7BA 3ABUA 5KHKA 5FPRA 2BU5A 5LMNB 4B3TB 2ZR2A 4PU9A 3O65A 3EHBB 1XOUA 5CN0A 2CH4A 3DSQA 4YJ3A 3CP1A 5DN6G 2KG7A 2ZT9B 5GTHZ 3JYCA 2DWDC 1QLEC 2AHYA 5L3EA 3BHPA 4WFGA 1SA0A 4LWIA 4ZOLB 4LWFA 3N2KB 4FIPC 5JQGA 3OW2U 4DV0B 1OSFA 3LNNA 2LW1A 1JPXA 4CS2A 3RYFA 2P5OA 2ZE5A 3ZHQA 1QHTA 2ZE7A 1YITV 1XDCA 1NTKH 4L90A 2Q8GA 4MSWC 1G6UA 2F23A 2F4VO 5CTWA 2QWPB 5F3KA 3JD4A 1GKXA 5IY5C 1K5QA 2QGNA 4DV4B 2YKBA 2VCJA 3K5OA 3OR7C 3L73H 2RJZA 4DR7B 1Y67A 2XTAA 1OCRB 4CWSA 3SYOA 4QNHB 4X65B 2B1IA 2D3OW 5CA1B 1WB7A 4G2KA 3VOUA 1Q7YW 4YXWG 2X0LA 2GTAA 1QLEB 3U10A 1XHXA 1QLNA 1L8DA 3CYGA 4NTWA 1VQMV 3T0ZA 2HVKC 4ZKIA 2ZDXA 4GX0A 4I4TB 2Y48A 4FK5C 1XNRO 1BHBA 4DZYA 1VQKV 5DECA 2VWKA 4YKYA 1YETA 3OD4A 3AG4C 4DUHA 4G28B 4JI5O 3L74H 3CRRA 1WA8B 1TBWA 1PVGA 2X6BA 1AH6A 2WI6A 4B3RB 4HZ5A 2YJWA 5EIBC 4JI3O 3R66A 4JAUA 4DYLA 4F6RA 5KX5A 4J11A 2BOCC 3TGUH 1IURA 2ESAA 3A0ZA 3THOA 2QG2A 4TOIA 2B9ZA 1AI5A 2UUBB 1I5DA 4K8XA 4XE2A 2NR5A 2P22C 1M1KW 2H94A 3JALA 1TILA 4LP0A 2H3OA 1I5XA 2VQFO 1MG1A 3F5WC 4DV3B 2CCSA 2H55A 2PYJA 2EZPA 4U3JB 4J9YB 3U2DA 1W2BU 3DC6A 2D2CB 3RYIA 2B5UA 3HKCB 3A0YA 4U3JA 3JATB 4X20B 2JK5C 3JSLA 3HKCA 4JI8O 2ZKJA 1COWG 3VHAA 2QE7G 2Q0OC 2ZDIC 5KLVH 4LFBO 2QR4A 1I5AA 1UYCA 2IORA 5JENA 4MTXA 3R4OA 3FD9A 3CHXA 3BM9A 1JCHA 2Q67A 2JS3A 4EKWA 1MMMA 4DR3O 2OT5A 2Q68A 2GBOA 4IYIA 2UUCO 2XJXA 1XMOB 3CB2A 1PL4A 3H1JH 1VQ6V 2KSDA 1TVKA 2YEIA 1AJ6A 2WI4A 2EXLA 3VQXA 4I50B 2ZNIA 2WWWA 4FJCC 2YKJA 4BR6A 2CGOA 4DV5B 5KUKA 4B7PA 4LBEC 3U11A 5A9GA 2UXDB 4YKXA 3E86A 1Y76B 5JWPA 5H9CA 2WA3A 3JARB 3APOA 1NHIA 1M57B 3TXQA 2P4KA 1TA8A 2QM8A 3W7WA 5L3BA 2Q69A 3KE6A 5BODA 2P4VA 3Q5KA 4NH8A 3B40A 2WERA 4YJ2A 1V54C 2HKOA 2QWQB 1NR1A 1Y6XA 4I7ZB 4JI4O 1E1QG 3EHFA 4H37A 1LNQA 4U7OA 5KA5A 4EGIA 5M4HA 3P30A 1M56C 1SQGA 2QSAA 4JI1B 1AJNA 4ASBA 1YJ9V 2A79B 4MVUA 1RFYA 3ML0A 3CCVV 2Q8FA 4DV6B 3AEIA 1Q3EA 2IU3A 5FWKA 4EFTA 3A0RA 2OCCC 4UCUA 1Q43A 5E79Z 4FLZA 4PL9A 3OE7G 5IN9A 1K4CC 2JS5A 1URFA 2XDLA 4IIJA 1S77D 1GK9A 2A06H 1AJQA 2M6YA 3LDEA 3JZ3A 4R3AA 1GRJA 1BMFG 2QA4V 3SGIA 3PJSK 3ZN0A 1EN6A 3T4DA 4X1YA 3DXRB 4JI6B 4DO2A 4HY6A 1BGQA 3OUFA 4YHHB 3ETGA 1K8AW 3ZRSA 2K1EA 1N36B 1KU9A 2F93B 2LGQA 2E5LB 3TETA 1YTFD 1MZFA 2CTPA 3DTUB 2YE2A 4XD8A 4B7KA 2UXXA 2YS8A 4YKWA 2AGAA 4FLYA 1S72V 1US6A 3P3NA 4NTXA 1XL4A 4J10A 4L8JA 4AS9A 2HHIA 3OFNG 1QNMA 4WFEA 3HKBB 3BVOA 3RFRA 4XDLA 4B3MB 1WAZA 1BQ0A 3E35A 1KB9F 2A7WA 3D36C 4DK0A 2ODMA 3HHUA 4TSFG 1AJPA 4KHPO 4JASA 1GKZA 1B6QA 3CSXA 4UVBA 2NLJC 4QE7A 5KHJA 1N4CA 4LF7B 1AP5A 4E2LA 2A3QA 4OPHA 3RWRD 4O2BB 1K7DA 3T1YO 1OCOC 1S3JA 2W0FC 1JFFA 3R4MA 4KFGA 1MZEA 2FYUH 1Z5AA 5KA6A 5D7CA 5J2TA 1GM7A 4H0LB 4TUYB 4O4LA 2P67A 3OM3B 1VF6A 2HG5C 3VHCA 4LFAB 4JF3A 1AVMA 4EFEA 2YXHA 3BA9A 2FL4A 5M4KA 4V25A 4UCSA 2HVJC 1PP9H 3UM7A 1XI1A 2ZXWB 1IBLB 1E1RG 1Z5BA 5IT9N 2QTOA 4D6TH 1NH2B 2HHHO 1K4DC 1PNMA 4IHJA 2PTMA 5EBMC 5IE9A 1IBMO 3LUTB 2BSKB 5LXTA 1EA6A 1B63A 3BA8A 3RLPA 3AK1A 3OT7A 2BU2A 1Y8PA 2ADQB 1SQQH 4GZRB 1R1BA 1OCOB 2JGDA 4UB6Z 4TV9B 2ZDYA 1S76D 3B25A 4DW1A 3MD0A 2CCUA 4DV2B 4CWNA 2Q4PA 2IOQA 2YE7A 4FLWA 2YJXA 4WFBV 5EK0A 3T1HO 2RNBA 4DR2B 4ZVIA 5BY1A 4R1FA 2QM7A 3ZHVA 2EILC 3ASOB 2DW4A 4GCZA 3OWBA 5KHGA 4HNAA 1S5JA 5GTIZ 1G8MA 2Y4UA 3C3TA 2GQPA 2VS0A 3Q5LA 1GN3A 4TV8A 2ATKC 1U0ZA 3SJQC 4MVMA 4GKKB 2BT0A 1CEZA 2YEDA 4R7CA 3FB5C 2CG9A 3SYAA 3GB7C 1AR1B 3ZKDA 3CX5F 2X6AA 1YZBA 1GH6A 4MS2A 3OGIB 1R3JC 5K1PA 3ZRVA 2LFSA 3WQ9A 5LP6C 5EZYB 4I0XA 4EFUA 4WFAV 5IWAB 3A0HZ 3OR6C 4OGQB 3RGBA 2DJVA 2QWRB 3Q4HB 3RYHA 1RPOA 5M4NA 2NNUA 3NR7A 2EULA 3K03A 1SZXA 1H2SB 2Q6AA 1QCEA 3UT5A 2Q7GA 4DR5B 1MOFA 2EX3A 3LSUA 4ZI7B 3HKDB 4B7EA 2YI9A 2HJFC 1I08A 4JTDB 4TT3G 1PL0A 1R3LC 3JCUZ 4LWHA 2JDIG 4CWRA 3SDLA 2WLLB 1Z5WA 1HNZO 4JYYA 1G1XB 1NU1H 2WPDG 1JOYA 1S5LZ 1YSRA 4EMVA 4GT8A 2E75B 2K9PA 3CCQV 4JI2B 1YT0A 4C7UA 3ZXQA 1MX0A 5LP6B 2CTRA 4LF6O 4HXZA 2YEVB 5GW7A 1DLBA 4YY3O 1K73W 1UYFA 3VQVA 4CWFA 1SS3A 2YEVA 4O4IB 4HZ0A 3FX7A 3X2QC 2ETNA 4ZIBA 1HNWB 3R4PA 1EFRG 2YI8A 1OZ0A 5KUMA 1XL6A 4CWQA 2WLMA 2EBOA 4L8ZA 2B1GA 3CRLA 1VQ5V 3TZ4A 4LWSA 1YI2V 3KZIZ 5B3SC 5LA6A 3BABA 1VQPV 5B66Z 1M9NA 4Q6GA 3K59A 3B28A 1FAFA 5EBWC 1ZXNA 2CH7A 1FXKB 2XAFA 3SJAC 1TUEB 2F66C 2WA4A 1L0LH 3GIFA 3JAKA 5BR8O 4NXNB 1FJGO 5IYZB 3W7UA 1H2LA 4XBFA 1NI8A 4LF4B 1ROPA 2RQ6A 4ZBMA 5JH7A 1QVGU 1K34A 3CWVA 3B8NA 3G67A 5IYZA 2GUZB 5J71A 1SETA 3K9AA 4TQDA 5J6AA 3JASA 1AI7A 4KP4A 4ASAA 2GUZA 4QGPA 3CXHF 1FS0G 4JYCA 2YSUB 4OX9B 3JCZA 3P32A 4BQGA 1XNQO 1AR4A 4I55B 1VIBA 4X62O 4NTYA 2BTQA 4X66B 3G7EA 4LR3A 1OCZB 5C8YB 3H4LA 5CBHA 3X2QB 1ZX3A 1XBLA 2L6LA 4O2AB 2ZE6A 4JTAB 5CA0B 4LWGA 3TUHA 1SQFA 4KSGA 2DYRC 4DV7B 2ZM6O 2W6IG 4MPEA 3AG1C 3BPZA 3ZMZA 3OMNB 2PGGA 5B3SB 2KKWA 4XCJA 2KQXA 5KMGA 1NTZH 3O9OA 4JTCB 4NR1A 4AHCA 3O2FA 1PM9A 3ZIAG 3R92A 3FB8C 3BAAA 3RYCB 1TGOA 1YSZA 1AROP 2YE8A 2RDCA 3KKYA 2MW2B 1WB8A 3D3IA 1B04A 3BMYA 4JYAO 2IWUA 2O1WA 2E0AA 2YEEA 3FT5A 3DC5A 2UXBO 1WPBA 1VQ7V 4LF9B 3M7MX 2YC0A 2XAQA 3U67A 2GFDA 2BYHA 3AG1B 1KZNA 2YGFA 4JI7O 3ZX6A 2XUMA 3AG2B 2UU9B 5LHGA 4LF8B 3HZ5A 4NXMB 4PRXA 3D8CA 2EINB 3OTOB 3CS5A 4GX5A 2YK9A 1OCRC 3ZHSA 4YJ3B 5M4EA 4CBCA 2KG7B 1BT8A 1P49A 1R6TA 3IEDA 2Y4TA 4DR6B 2C2AA 2P90A 4DXWA 1SA0B 2OTJV 2Y69B 1KIJA 1VQ4V 5JQGB 4PD4F 5CTYA 2QWNB 1M93A 1JJOA 2DWEC 2HLDG 2YE3A 3RYFB 2PUSA 3ZEDA 2GTSA 2M7WA 2ILMA 1ID0A 3QDDA 4QPKA 1MU5A 3LSSA 3O6OA 1PPJH 1EBOA 5JVDA 3CCMV 4FCPA 3WHAA 4L91A 3WB2A 2KB1A 4DR4B 1NVPB 1EZVH 5LGTA 4HAMA 3CEIA 4X1KA 2XOKG 4CC5A 4FLTA 4X9LA 1S14A 2HG1A 4WF9V 3NMQA 1PNLA 2G38A 1FD9A 5FNVA 1UY6A 3ZN1A 5IDJA 2UXCB 2QEXV 1MA1A 5EIBD 2IJJA 1Q82W 1VQ9V 1FXHA 4HXWA 1BGYH 3E89A 4X89A 1Y4SA 1DF4A 2OIEA 4GX2A 4CS4A 3B24A 4W4KA 3ABKC 2ZINA 1UPGA 3UO3A 1I94O 3STZC 4AILC 1KQSU 3CCEV 2PI4A 3OW6A 2UUAB 5L3DA 4BIUA 2EIKB 4ABMA 5JJJB 4P9OA 1IZ3A 4BIZA 2Q2EB 4UCVA 3RT3C 4D7SA 4YIOA 1HNXB 3AK2A 1OHHG 1B3QA 1Z5CA 5CMUA 3SJBC 5E1AC 3ETEA 4DUZB 2GV9A 3CCSV 1YCIA 4F6RB 2OCHA 5KX5B 4B3SO 1Y66A 2GHYA 4UV9A 2F1MA 4GKJB 4I9WA 3C11A 3H01A 3SPGA 1HR0B 4PA4A 4B6CA 3B8MA 3EHJA 3JALB 1GMGA 3CCUV 3ABMC 4K35A 5GONA 2YIBD 1UYEA 4FLXA 3CPWU 1N32O 1J5EO 3HEKA 4PV1B 1PNKA 5LMUB 2YECA 3M8AA 2VQEO 3RYIB 4AQYB 1S0VA 2XABA 1M90W 1M57C 2QKCA 2YI0A 4HY1A 3ABKB 3H1HH 4LC1A 3VQWA 1SZTA 1I5YA 5M4MA 4J7JA 3K5MA 3TJTA 1VP7A 2RCVA 4EB6A 4TQFA 1UY9A 4O05A 3RW0A 1NTMH 1UJWB 4IGGA 1YC3A 1IXMA 4R8CA 2CTWA 1TVKB 4UCTA 5LYJA 3T4ZA 1Y8OA 4EGHA 4P30A 2ZBKB 1YS3A 2CCTA 4J9ZB 2BU7A 2JJ2G 1TC6A 1NKDA 3ABMB 3E8GA 2EJRA 2XHBA 1Q81W 4MPNA 1AH8A 3CGZA 4HBNA 2R9AA 4CZZA 5KAFZ 2WEQA 3CE2A 3LSQA 2PF4E 4JAAA 2AHZA 4K0KB 3U2KA 5J9PC 5F5RA 1BXDA 2A9HA 4ZHQA 4CE1A 2O57A 1BCCH 2PI5A 4YJ2B 1ENVA 1IX9A 1AILA 1SQVH 2P6JA 4FLVA 2GSMB 4DUYB 4DV1B 2EIJB 3GIGA 2IU0A 1LUWA 4K8ZA 2BU6A 3EKOA 3HKEA 4E01A 3CMAV 3BY6A 4LCUC 2FB5A 2Y0PA 1F23A 1H8EG 1UYDA 4GGLA 1H2KA 4MT8A 2BU8A 1TAEA 4DRXA 1KUQA 3ABLB 4L94A 1ZSPA 5D7DA 1Z2GA 2WLIA 4IIJB 1ZWIC 2W0XA 1XMQB 2XHTA 2DQ3A 5LOVA 2XDKA 1QVFU 5FNDA 2O1VA 4JI0B 4X1IA 2R9IA 3FV5A 1N33B 4X1YB 3B77A 3L75H 2YIBA 4LFCB 2CUGA 3NXSA 4LF5O 2JGUA 1F4MA 1NBMG 4XIRA 1VF6C 4URMA 1IBKB 2YI7A 2DYSB 5FLXN 2BTOA 3CC2V 4DR1B 4X64B 1WN7A 1I7FA 4PHZA 3FAVA 5LMNO 4JYBA 2XDUA 4WFFA 4B3TO 1JQ0A 4RUEA 4FM0A 2ZXWC 2ZR3A 2F95B 3Q5JA 3LMMA 4J80A 3E8HA 2ZNJA 1EN4A 2XHRA 3ETDA 4WFHA 1JFFB 3K5NA 1Q90D 2H8PC 4FLUA 4DV0O 1N34B 5J2TB 2HR3A 4LH7A 4O4LB 2RMKB 3ZHRA 2LQTA 3QO8A 3A0XA 1YF2A 2QJ1A 4CH3A 3EFFK 1DK1A 1EM1A 3F7YC 2AKPA 2YI6A 3H80A 1T5EA 3JD0A 1H38A 2XDXA 3FT8A 2CTQA 4DW0A 2Z5UA 4BAYA 3ASOC 4DV4O 3B26A 4FPPA 5L3JA 1QR9A 2ITDC 1YSCA 4DR7O 3BRCA 1NR7A 1VF7A 4X65O 2O1UA 2DMXA 3QG5A 2JKIA 1GTOA 2N04A 4IHJB 1NJIW 3E2EA 4JV5B 1YC4A 4RAIA 5LXTB 5D5QA 3MHHC 4A5UB 5H6RA 3O0IA 3H1KH 4XIQA 5IYBO 2YE6A 1DTOA 3QO5A 3N2GA 5J2UA 1SKVA 1SRYA 2LFRA 1NS1A 5EYPA 5BXZA 2JGDB 5JJEB 3H1IH 1AR5A 3D3QA 1NT2B 2CAZC 3B27A 5B1AC 1P4RA 2BZ5A 3CRMA 1B06A 2YIAA 1YJWV 4CE2A 2NN4A 3D36A 4CWPA 1SF9A 3LNUA 4EEQA 1RM1B 4B3RO 5H5NA 4HNAB 2OWOA 4MOTA 4KFMA 2AZ2A 3W7TA 3FFQA 3K99A 1YTFB 1VQOV 2WLKA 2UUBO 2F43G 1I59A 1QYEA 1K97A 4TV8B 4UCOA 4CWTA 3K0GA 5B1BB 3ABTA 4MVSA 2ZCEA 1VF5B 4DV3O 3SYCA 4WUDA 1KC8W 4H44B 4Z1MG 2BE3A 3QNEA 3CGYA 2WI5A 2JVDA 1FFTB 3L71H 4Z2WA 1TUBA 4LP8A 3M99B 3G4SV 4EGKA 1F51A 2K5BA 5B1AB 3JAWA 2F4VB 4I0XB 5ITZA 1UYGA 5CTXA 3IFXA 4ICGA 1BHAA 4FZ1A 2LGWA 2DQ0A 2AXTZ 1U2OA 2YGAA 4CC6A 2A0LA 5IJ0A 1UYLA 3RYHB 4AWOA 2N74A 3R4NA 3INWA 1XMOO 3A2FA 3UT5B 3VQYA 1BS3A 3LDCA 3OEEG 1TIDA 2OTLV 1Y74A 1H2NA 4NB5A 4DV5O 1S16A 1RSOA 1BYQA 2IWXA 4BW5A 1V9PA 1FXKC 2UXDO 1K3EA 4JZGA 3PN1A 3N27A 4O4HA 1XNRB 4JPRA 1BZKA 2CE4A 1D5NA 2FKXA 5FL7G 2PNRA 1UYHA 2FWYA 5CTUA 5JCOA 2EJ7A 4AI8A 4JI5B 3HPLC 4BAEA 1PV0A 4GX1A 2XHXA 3CRAA 1JJ2U 4KSHA 4JI3B 2YUAA 2IJKA 3EHHA 1WP7A 4JI1O 1OCZC 3SR2C 4BQJA 4YKTA 4XITA 1L0NH 5BMVA 1TH8A 4DV6O 4QIWF 1QU7A 1VMGA 4LWSB 2VQFB 4E02A 4H81A 1Z5VA 1Q8IA 5LA6B 4GT1A 4EM7A 4I9QA 1Q5OA 2YGEA 2QKAA 3D0BA 3K79A 2CH7B 4IT5A 3F5TA 3JAKB 5HFMA 3HYYA 1ZUQA 3T1CA 4IL6Z 1LR1A 2LW7A 5JH7B 1QQCA 4JI8B 1EZJA 3JASB 3EVKA 4LFBB 4JI6O 5B1NA 4URLA 5H6QA 2X7RB 5D5PA 4PA6A 3KG2A 3CRQA 4YHHO 2IWSA 4DR3B 1N36O 4XC0A 3CC4V 4GYCB 2BTZA 2VWJA 2BTQB 2E5LO 4NH9A 2UUCB 2X6CA 3WG7B 3JSNA 1K9MW 4O09A 1EN5A 2BYIA 4ASFA 4XTJA 4PDMA 1XUQA 4U7NA 3KCYA 1XHZA 1D5AA 4I5SA 3CCLV 1K33A 1GM8A 4B3MO 4FCQA 2P06A 1SQBH 1VQLV 3AG2C 1R6NA 5KMGB 4FVMA 4O4JA 1SC5B 1ZL8B 5IJ9A 3B2EE 1U97A 2HP8A 1ZL8A 2JRIA 2EINC 4LF7O 3AG7A 3VHDA 3C0EA 4LWEA 3RBZA 1FFXA 2FTKA 3ZHTA 5BOCA 4QJFB 3CJHA 1H7UA 4MTGA 4F4LA 4JI4B 1KP2A 1VEWA 3C90A 2Q73A 4LNUA 3OPDA 2Y69C 4WBNA 5CB4A 1KBHA 1W59A 3SPJA 3T1KA 2V4DA 2HEPA 2Q5ZA 4LFAO 2QF6A 3L70H 3JAMN 1JVMA 3ZHUA 2EIMB 1MSDA 3IC9A 1JA8A 4NKGB 3ZRWA 4F6EA 3PEHA 3LDDA 2CGFA 3QF7A 3E22A 2YK2A 3A0WA 1IBLO 2YE5A 3UO2A 1QR8A 3OTFA 4H13B 2AZ0A 3WB0A 4MVRA 3T0HA 1G4YB 4UROA 3BEHA 4ASGA 1IDSA 1KP3A 3UKMA 1FXVA 5FNCA 3LPSA 1YIJV 1GN4A 4K4OA 3RN4A 3ZS8C 4MW8A 1L1FA 2WLNA 1H8HG 1I0HA 1YEWA 1YVWA 4UCRA 2XNDG 3U0ZA 4DV2O 2BRCA 4JZ2A 3CD6V 3T2SA 2OYQA 4FFBA 2EZOA 2IJIA 4HYOA 3ICXA 4MVQA 4DR2O 3CCRV 2XJGA 3IC7A 3IJ4A 2EIKC 1MNGA 1AI6A 4PI2A 5L3FA 3E83A 1CPYA 5JVDB 1SERA 3KCXA 4XDMA 4R6ZA 3WFVA 4KQVA 4KHPB 2N05A 3TZ2A 1GKFA 1Y8NA 1GAXA 2YKEA 4X1KB 3CRCA 4GKKO 2XT9A 2ZD9A 2QG0A 3SPHA 5FNVB 4ZOLA 3T1YB 3N2KA 3CRKA 4B08A 5LHIA 4JAVA 3K5LA 2QKSA 1XQ8A 1KKCA 1R62A 5GGZA 4UUJC 4BXIA 3RVZA 2R9RB 1Y4UA 3I5DA 4RO2A 5KHIA 3C3SA 4UFZA 2Z3YA 1NHJA 4WUCA 2HJDA 5IWAO 1I58A 2YI5A 1SQXH 2IOPA 3JD3A 2HHHB 1FKAO 1IBMB 5CA1A 3EKRA 4DR5O 1WPXA 3W7XA 2XK2A 4YKRA 3SYPA 1ORQC 1UFIA 4MVZA 3OMIB 1H7SA 1AI4A 3OGCC 3GWOA 1QZRA 4I4TA 3BFRA 1K92A 1W0JG 3FB6C 5GONB 1MABG
chains in the Genus database with same CATH topology
3E8FA 1GJVA 3ZMVA 3QTFA 4O04A 3HYZA 2Q8IA 5DM6V 2ZQMA 1YC1A 1H2GA 3IGAC 5IY5B 3TCUA 4RQFA 3PEJA 3ZRXA 4JGSA 1Z59A 4UVCA 1DF5A 2EIJC 2YEJA 4PA9A 1YT2A 3G75A 2XCMA 5IYDO 2IH1C 4MTOA 1AMWA 4YKZA 3ABLC 1Q86W 1UYIA 1J95A 1R3KC 1YHQV 3AG4B 4PRVA 1YERA 4CE3A 4R50A 2BSMA 5D6PA 1VQNV 3FKSG 3ZMSA 1TC0A 4O0BA 3OUSA 1OCCC 5CBGA 3GIGB 3HZ1A 2YKIA 1NHHA 2UWDA 2V7QG 2DYSC 1THZA 3JD1A 4PELA 1W0KG 1EI1A 2YE4A 1ZW9A 4XKOA 3I55V 2LP7A 2W6JG 2WLIB 4P8OA 4JQLA 1N8RW 2ZDIA 3VBBA 4QPJA 1NH2D 3HB3B 3TZ0A 1RPRA 2BOBC 3DGEA 1MSWD 3RVYA 1OCCB 3OMUA 4LPBA 1P7BA 3G6EV 3K60A 4N23A 4CWOA 4MP7A 1R73A 5IYCO 4MB9A 2HFEC 3FYIB 3MNRP 5M4PA 2V1DA 5B1OA 2XAHA 1KKDA 2WI1A 1V54B 5L3CA 2HCHA 4G27B 5EBLC 4HZ3A 3SPIA 1M56B 1UY8A 1R3IC 3SL2A 4AWPA 1QY8A 3OAAG 4GEEA 4OXSA 4R3MA 2YEAA 3ZCCA 2OCCB 1CP9A 1QBZA 4AWQA 5CA3A 2YEBA 1F4NA 4MPCA 1RM1C 4PDLA 5D6QA 2H8MA 2QFOA 2YEGA 1L0OA 4XKAA 4MBCA 5B1BC 3INXA 2WAMA 5LHHA 4XCLA 5FNFA 1JM6A 3FYEB 1PD3A 4XDJA 4MW3A 4GFNA 3CMEV 2XASA 2VWCA 5HFLA 4KUMA 5L3GA 4L93A 3ZKBA 4YKUA 3GIEA 2JIZG 3A0TA 1NQTA 3K06A 2XAGA 4URNA 5LBQA 2BREA 1S5HC 4MTFA 4V26A 1THNA 4UV8A 4HYPA 1A4HA 2IW5A 2YE9A 2WLJA 4Q20A 4MP2A 1R6KA 2VCIA 2JJ1G 4EEHA 3MHSC 1ZWHA 4WUBA 3CCJV 1YESA 5EC2C 3K98A 3W7SA 4NH7A 4XDKA 1US7A 4KTNA 1K5SA 4UXNA 3E8BA 3ZJZA 4H33A 3TTZA 3D2RA 4TWKA 2IJHA 3QO7A 3I56V 3T2MA 5D7RA 3K04A 1GM9A 3JD2A 4MVOA 3ZMTA 3AG3C 2MK3A 4FCRA 4HYMA 4W7TA 1UY7A 4I3HA 5LGUA 5IDMA 4E00A 1KD1W 4QE9A 2EILB 4P2ZA 1HWYA 3OWDA 1V55C 2XX2A 3CC7V 1YJNV 4X8AA 4XKKA 2XX5A 4P7AA 2XX4A 4WCEV 3WG7C 4FMTA 3EHGA 3FB7C 5EC1C 1BL8A 2WLLA 2JJCA 3K3WA 3AG3B 3LNMB 4H85A 2IH3C 3RKZA 3TZ5A 2HKJA 2XD6A 3R91A 4UVAA 2WI2A 2WEPA 3ASNC 1AM1A 4H7QA 3K97A 4YKQA 3F7VC 3SYQA 3RLQA 4N21A 1V55B 3STLC 1I5BA 3ZM7A 5CPHA 4PDVA 1PKXA 2YEFA 4O07A 2ITCC 3ZXOA 2VW5A 2EIMC 3OEHG 1FXKA 5BZBA 3ZMUA 1E79G 4RQEA 4RUFA 1I5CA 4P9PA 1GO3F 1BKNA 4L87A 2WI3A 2P7TC 2WLHA 3ASNB 1SESA 2CK3G 1NVPD 5C93A 2FXSA 3G71V 5LGNA 1VQ8V 4U93A 5CF0A 3OMAB 2XDSA 4XIPA 2FWZA 4X88A 3CXCU 1ZXMA 2YEHA 1B62A 4PA7A 3K0DA 1UYKA 2YKCA 4PDRA 1UYMA 3TK1A 3ZRWB 1YT1A 1Y4MA 1KECA 2XJJA 5CBFA 3SPCA 2Q8HA 2FYPA 3T10A 2XAJA 3VADA 1WLEA 3R65A 3CYOA 3K08A 2JEXA 3RLRA 4PA3A 4ASUG 4GQTA 2UXNA 2DYRB 1JX9A 2WI7A 2WSSG 2JEUA 3G7BA 3ABUA 2BU5A 2ZR2A 4PU9A 3EHBB 2CH4A 5CN0A 3CP1A 5DN6G 3JYCA 2DWDC 1QLEC 2AHYA 5L3EA 4WFGA 4LWIA 4LWFA 4FIPC 3OW2U 1OSFA 1JPXA 1YITV 4L90A 2Q8GA 4MSWC 5CTWA 5F3KA 3JD4A 1GKXA 5IY5C 1K5QA 2YKBA 2VCJA 3OR7C 1OCRB 4CWSA 3SYOA 4QNHB 2B1IA 2D3OW 4G2KA 3VOUA 1Q7YW 4YXWG 2X0LA 1QLEB 1QLNA 1VQMV 3T0ZA 2HVKC 4ZKIA 2ZDXA 4GX0A 2Y48A 4FK5C 1BHBA 4DZYA 1VQKV 4YKYA 1YETA 3AG4C 4DUHA 4G28B 1TBWA 1PVGA 2X6BA 1AH6A 2WI6A 4HZ5A 2YJWA 4JAUA 2BOCC 2ESAA 3A0ZA 2QG2A 1AI5A 1I5DA 4XE2A 1M1KW 2H94A 1TILA 4LP0A 1I5XA 1MG1A 3F5WC 2CCSA 2H55A 2EZPA 4J9YB 3U2DA 1W2BU 2B5UA 3A0YA 2JK5C 2ZKJA 1COWG 3VHAA 2QE7G 2ZDIC 1I5AA 2IORA 1UYCA 4MTXA 3R4OA 3BM9A 1JCHA 2Q67A 4EKWA 2OT5A 2Q68A 2XJXA 1VQ6V 2YEIA 1AJ6A 2WI4A 2EXLA 2WWWA 4FJCC 2YKJA 5KUKA 4B7PA 4LBEC 4YKXA 3E86A 5H9CA 1NHIA 1M57B 2QM8A 3W7WA 5L3BA 2Q69A 3KE6A 5BODA 3Q5KA 4NH8A 2WERA 1V54C 2HKOA 1NR1A 1E1QG 3EHFA 4H37A 1LNQA 4U7OA 5KA5A 4EGIA 5M4HA 3P30A 1M56C 1AJNA 4ASBA 1YJ9V 2A79B 4MVUA 3ML0A 3CCVV 2Q8FA 3AEIA 2IU3A 5FWKA 4EFTA 3A0RA 2OCCC 4PL9A 3OE7G 5IN9A 1K4CC 2XDLA 1S77D 1GK9A 1AJQA 3LDEA 3JZ3A 4R3AA 1BMFG 2QA4V 3PJSK 3ZN0A 3T4DA 4DO2A 4HY6A 1BGQA 3OUFA 3ETGA 1K8AW 3ZRSA 2K1EA 3TETA 1YTFD 3DTUB 2YE2A 4XD8A 2UXXA 4YKWA 1S72V 1XL4A 4AS9A 3OFNG 4WFEA 4XDLA 3E35A 3HHUA 4TSFG 1AJPA 4JASA 1GKZA 1B6QA 4UVBA 2NLJC 4QE7A 4E2LA 1K7DA 1OCOC 1S3JA 2W0FC 3R4MA 4KFGA 1Z5AA 5KA6A 5D7CA 1GM7A 2P67A 3OM3B 3VHCA 2HG5C 4JF3A 5M4KA 4V25A 2HVJC 3UM7A 2ZXWB 1E1RG 1Z5BA 2QTOA 1NH2B 1K4DC 1PNMA 5EBMC 3LUTB 1EA6A 1B63A 3RLPA 2BU2A 1Y8PA 1OCOB 2ZDYA 1S76D 3B25A 3MD0A 2CCUA 4CWNA 2IOQA 2YE7A 2YJXA 4WFBV 5EK0A 4ZVIA 4R1FA 2QM7A 2EILC 3ASOB 2DW4A 4GCZA 3OWBA 1G8MA 2GQPA 3Q5LA 2ATKC 1U0ZA 3SJQC 4MVMA 2BT0A 1CEZA 2YEDA 4R7CA 3FB5C 2CG9A 3SYAA 3GB7C 1AR1B 3ZKDA 2X6AA 4MS2A 1R3JC 3ZRVA 2LFSA 3WQ9A 4EFUA 4WFAV 3OR6C 1RPOA 5M4NA 2NNUA 3K03A 2Q6AA 1QCEA 1MOFA 2HJFC 4JTDB 4TT3G 1PL0A 1R3LC 4LWHA 2JDIG 4CWRA 2WLLB 2WPDG 1JOYA 1YSRA 4EMVA 4GT8A 3CCQV 1YT0A 3ZXQA 1MX0A 4HXZA 2YEVB 5GW7A 1DLBA 1K73W 1UYFA 4CWFA 4HZ0A 2YEVA 3X2QC 3R4PA 1EFRG 1OZ0A 5KUMA 1XL6A 4CWQA 2WLMA 2EBOA 4L8ZA 2B1GA 3CRLA 1VQ5V 3TZ4A 1YI2V 5B3SC 1VQPV 1M9NA 3B28A 5EBWC 1ZXNA 1FXKB 2XAFA 1TUEB 3GIFA 3W7UA 4XBFA 1ROPA 4ZBMA 1QVGU 3CWVA 1K34A 3B8NA 5J71A 1SETA 3K9AA 5J6AA 1AI7A 4KP4A 4ASAA 1FS0G 4JYCA 2YSUB 3JCZA 3P32A 4BQGA 3G7EA 1OCZB 3H4LA 5CBHA 3X2QB 4JTAB 4LWGA 3TUHA 4KSGA 2DYRC 2W6IG 4MPEA 3AG1C 3ZMZA 3OMNB 5B3SB 4XCJA 4JTCB 3O2FA 3ZIAG 3R92A 3FB8C 1YSZA 1AROP 2YE8A 3D3IA 3BMYA 2IWUA 2O1WA 2E0AA 2YEEA 3FT5A 1VQ7V 2XAQA 3U67A 2GFDA 2BYHA 3AG1B 1KZNA 2YGFA 3AG2B 5LHGA 3HZ5A 4PRXA 2EINB 4GX5A 2YK9A 1OCRC 5M4EA 4CBCA 3IEDA 2C2AA 2P90A 4DXWA 2OTJV 2Y69B 1KIJA 1VQ4V 5CTYA 2DWEC 2HLDG 2YE3A 2M7WA 1ID0A 3QDDA 4QPKA 1MU5A 3LSSA 3O6OA 1EBOA 3CCMV 4FCPA 3WHAA 4L91A 2KB1A 1NVPB 5LGTA 4HAMA 2XOKG 4X9LA 1S14A 2HG1A 4WF9V 3NMQA 1PNLA 1UY6A 3ZN1A 5IDJA 2QEXV 2IJJA 1Q82W 1VQ9V 1FXHA 4HXWA 3E89A 4X89A 1Y4SA 1DF4A 4GX2A 3B24A 3ABKC 3STZC 1KQSU 3CCEV 2PI4A 3OW6A 5L3DA 4BIUA 2EIKB 4P9OA 4BIZA 2Q2EB 1OHHG 1B3QA 1Z5CA 5CMUA 5E1AC 3ETEA 3CCSV 1Y66A 2GHYA 4UV9A 4I9WA 3C11A 3H01A 3SPGA 4PA4A 4B6CA 3B8MA 3EHJA 1GMGA 3CCUV 3ABMC 1UYEA 3CPWU 3HEKA 1PNKA 2YECA 1S0VA 2XABA 1M90W 1M57C 2YI0A 4HY1A 3ABKB 4LC1A 1SZTA 1I5YA 5M4MA 1UY9A 4O05A 3RW0A 1UJWB 1YC3A 1IXMA 4R8CA 3T4ZA 1Y8OA 4EGHA 4P30A 2ZBKB 1YS3A 2CCTA 4J9ZB 2BU7A 2JJ2G 1TC6A 1NKDA 3ABMB 3E8GA 2EJRA 1Q81W 4MPNA 1AH8A 3CGZA 4CZZA 2WEQA 3LSQA 2AHZA 3U2KA 5J9PC 5F5RA 1BXDA 2A9HA 4CE1A 2PI5A 1ENVA 2P6JA 2GSMB 2EIJB 3GIGA 2IU0A 2BU6A 3EKOA 4E01A 3CMAV 3BY6A 4LCUC 1F23A 1H8EG 1UYDA 4GGLA 4MT8A 2BU8A 3ABLB 4L94A 5D7DA 2WLIA 1ZWIC 2XHTA 2DQ3A 2XDKA 1QVFU 5FNDA 2O1VA 2R9IA 3FV5A 3B77A 3NXSA 1F4MA 1NBMG 4XIRA 4URMA 2YI7A 2DYSB 3CC2V 4JYBA 2XDUA 4WFFA 1JQ0A 4RUEA 2ZXWC 2ZR3A 3Q5JA 3E8HA 2XHRA 3ETDA 4WFHA 2H8PC 2HR3A 3QO8A 3A0XA 3EFFK 2AKPA 3F7YC 2YI6A 3H80A 3JD0A 1H38A 2XDXA 3FT8A 2Z5UA 4BAYA 3ASOC 3B26A 4FPPA 5L3JA 1QR9A 2ITDC 1YSCA 1NR7A 2O1UA 2JKIA 1GTOA 3E2EA 1NJIW 1YC4A 4RAIA 3MHHC 5H6RA 3O0IA 4XIQA 5IYBO 2YE6A 1DTOA 3QO5A 1SRYA 2LFRA 3B27A 5B1AC 1P4RA 2BZ5A 1YJWV 4CE2A 3D36A 4CWPA 3LNUA 1RM1B 4MOTA 4KFMA 3W7TA 3K99A 1YTFB 1VQOV 2WLKA 1QYEA 2F43G 1I59A 1K97A 4CWTA 3K0GA 5B1BB 3ABTA 4MVSA 3SYCA 4WUDA 1KC8W 4Z1MG 3QNEA 3CGYA 2WI5A 1FFTB 4LP8A 3M99B 3G4SV 4EGKA 1F51A 2K5BA 5B1AB 1UYGA 5CTXA 3IFXA 1BHAA 2DQ0A 1U2OA 2YGAA 2A0LA 1UYLA 4AWOA 3R4NA 3INWA 3LDCA 3OEEG 1TIDA 2OTLV 1S16A 1BYQA 2IWXA 4BW5A 1FXKC 1K3EA 4JPRA 5FL7G 2PNRA 1UYHA 2FWYA 5CTUA 3HPLC 4BAEA 4GX1A 2XHXA 1JJ2U 4KSHA 2IJKA 3EHHA 1OCZC 4BQJA 4YKTA 4XITA 1TH8A 4QIWF 4E02A 4H81A 4GT1A 4EM7A 2YGEA 3D0BA 3K79A 5HFMA 3HYYA 3T1CA 1EZJA 5B1NA 4URLA 5H6QA 2X7RB 4PA6A 3KG2A 2IWSA 4XC0A 3CC4V 2BTZA 4NH9A 2X6CA 3WG7B 1K9MW 4O09A 2BYIA 4ASFA 4XTJA 4PDMA 4U7NA 4I5SA 3CCLV 1K33A 1GM8A 4FCQA 1VQLV 3AG2C 1R6NA 2EINC 3VHDA 3C0EA 4LWEA 3RBZA 2FTKA 5BOCA 4QJFB 1H7UA 4MTGA 4F4LA 1KP2A 3OPDA 2Y69C 3T1KA 3SPJA 2QF6A 1JVMA 2EIMB 3ZRWA 3PEHA 3LDDA 2CGFA 2YK2A 3A0WA 2YE5A 1QR8A 4MVRA 3T0HA 1G4YB 4UROA 3BEHA 4ASGA 1KP3A 3UKMA 1FXVA 5FNCA 3LPSA 1YIJV 4K4OA 4MW8A 2WLNA 1L1FA 1H8HG 2XNDG 2BRCA 3CD6V 3T2SA 2EZOA 2IJIA 4HYOA 4MVQA 3CCRV 2XJGA 3IC7A 2EIKC 1AI6A 5L3FA 3E83A 1CPYA 1SERA 4XDMA 4R6ZA 3WFVA 4KQVA 3TZ2A 1GKFA 1Y8NA 2YKEA 2ZD9A 2QG0A 3SPHA 3CRKA 5LHIA 4JAVA 2QKSA 1R62A 5GGZA 4UUJC 4BXIA 3RVZA 2R9RB 1Y4UA 4RO2A 2Z3YA 1NHJA 4WUCA 1I58A 2YI5A 2IOPA 3JD3A 3EKRA 1WPXA 3W7XA 2XK2A 4YKRA 3SYPA 1ORQC 4MVZA 3OMIB 1H7SA 1AI4A 3OGCC 3GWOA 1QZRA 1K92A 1W0JG 3FB6C 1MABG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJV A;  1UYK A;  2YKC A;  1UYM A;  3TK1 A;  3ZRV A;  2LFS A;  3ZRW B;  3QTF A;  3WQ9 A;  1YT1 A;  4O04 A;  3HYZ A;  4JYB A;  2Q8I A;  2XDU A;  4EFU A;  2XJJ A;  1YC1 A;  3Q5J A;  2Q8H A;  2FYP A;  3PEJ A;  3ZRX A;  1Z59 A;  5M4N A;  3T10 A;  2XHR A;  3VAD A;  2YEJ A;  3RLR A;  1YT2 A;  3G75 A;  4GQT A;  4LWH A;  2XCM A;  4CWR A;  3A0X A;  1AMW A;  2WI7 A;  4YKZ A;  1JOY A;  1YSR A;  4EMV A;  2AKP A;  2YI6 A;  3G7B A;  3H80 A;  4GT8 A;  1UYI A;  2XDX A;  3FT8 A;  2BU5 A;  1YT0 A;  4PRV A;  4CE3 A;  1YER A;  3ZXQ A;  4PU9 A;  3B26 A;  4FPP A;  2BSM A;  1MX0 A;  5D6P A;  5L3J A;  4HXZ A;  2CH4 A;  1UYF A;  2O1U A;  2JKI A;  4CWF A;  4HZ0 A;  1YC4 A;  1TC0 A;  4O0B A;  3R4P A;  3O0I A;  4XIQ A;  2YE6 A;  4CWQ A;  4LWI A;  3GIG B;  3HZ1 A;  4LWF A;  2YKI A;  1NHH A;  4L8Z A;  2LFR A;  3CRL A;  2UWD A;  3TZ4 A;  1OSF A;  3B28 A;  1ZXN A;  3B27 A;  1EI1 A;  4L90 A;  3GIF A;  2Q8G A;  2YE4 A;  1ZW9 A;  4XKO A;  2BZ5 A;  5CTW A;  4CE2 A;  5F3K A;  3CWV A;  3D36 A;  1GKX A;  4P8O A;  5J71 A;  4CWP A;  5J6A A;  3LNU A;  4KP4 A;  4JQL A;  4ASA A;  2YKB A;  2VCJ A;  4JYC A;  4MOT A;  4CWS A;  3P32 A;  4BQG A;  4QPJ A;  3K99 A;  1QYE A;  1I59 A;  4CWT A;  3G7E A;  3TZ0 A;  3H4L A;  3DGE A;  4LWG A;  3T0Z A;  3TUH A;  4WUD A;  4ZKI A;  4KSG A;  2ZDX A;  3OMU A;  3CGY A;  4MPE A;  2WI5 A;  4LPB A;  3K60 A;  4DZY A;  4XCJ A;  4EGK A;  1F51 A;  4YKY A;  2K5B A;  1YET A;  4CWO A;  3O2F A;  4MP7 A;  4DUH A;  4MB9 A;  1UYG A;  3MNR P;  5CTX A;  3R92 A;  5M4P A;  1TBW A;  1PVG A;  2WI6 A;  1AH6 A;  1U2O A;  5B1O A;  1YSZ A;  4HZ5 A;  2YJW A;  2YGA A;  2YE8 A;  4JAU A;  2WI1 A;  1UYL A;  4AWO A;  2HCH A;  3R4N A;  2ESA A;  3INW A;  3A0Z A;  2QG2 A;  3BMY A;  1I5D A;  1TID A;  2IWU A;  4XE2 A;  1UY8 A;  1TIL A;  4LP0 A;  2O1W A;  2E0A A;  2YEE A;  3FT5 A;  3SL2 A;  2CCS A;  4AWP A;  1S16 A;  1QY8 A;  2H55 A;  1BYQ A;  4GEE A;  2IWX A;  4R3M A;  3U2D A;  2YEA A;  3ZCC A;  3A0Y A;  3U67 A;  4AWQ A;  2GFD A;  2BYH A;  1KZN A;  2YGF A;  2PNR A;  2YEB A;  2ZKJ A;  1UYH A;  2FWY A;  5CTU A;  3VHA A;  3HZ5 A;  1I5A A;  2IOR A;  1UYC A;  4MPC A;  4MTX A;  3R4O A;  4PRX A;  4BAE A;  5D6Q A;  2H8M A;  2QFO A;  3BM9 A;  2YK9 A;  5M4E A;  2YEG A;  2XHX A;  1L0O A;  4KSH A;  4XKA A;  3IED A;  4MBC A;  3INX A;  2XJX A;  3EHH A;  4BQJ A;  2C2A A;  4YKT A;  4XIT A;  2YEI A;  1AJ6 A;  1KIJ A;  1TH8 A;  2WI4 A;  4XCL A;  2EXL A;  5CTY A;  5FNF A;  1JM6 A;  2WWW A;  4E02 A;  4H81 A;  2YKJ A;  4GT1 A;  4GFN A;  2YE3 A;  4EM7 A;  4B7P A;  2YGE A;  3D0B A;  2VWC A;  1ID0 A;  3QDD A;  4QPK A;  4YKX A;  4L93 A;  1MU5 A;  3ZKB A;  3O6O A;  4YKU A;  3GIE A;  3HYY A;  1NHI A;  3A0T A;  4FCP A;  3WHA A;  4L91 A;  2QM8 A;  4URN A;  3KE6 A;  5BOD A;  2BRE A;  3Q5K A;  4NH8 A;  5B1N A;  2WER A;  4URL A;  4V26 A;  1THN A;  2IWS A;  4X9L A;  3EHF A;  1S14 A;  2HG1 A;  3NMQ A;  4HYP A;  1A4H A;  4U7O A;  4XC0 A;  4EGI A;  2BTZ A;  1UY6 A;  5M4H A;  2YE9 A;  5IDJ A;  4MP2 A;  4Q20 A;  4NH9 A;  2VCI A;  4ASB A;  4HXW A;  4EEH A;  1ZWH A;  4O09 A;  1Y4S A;  2Q8F A;  2BYI A;  4ASF A;  4WUB A;  4XTJ A;  1YES A;  5FWK A;  3B24 A;  3K98 A;  4EFT A;  3A0R A;  4U7N A;  4I5S A;  4FCQ A;  4NH7 A;  3OW6 A;  4PL9 A;  5IN9 A;  4BIU A;  1US7 A;  2XDL A;  4BIZ A;  2Q2E B;  4KTN A;  1B3Q A;  3JZ3 A;  1Z5C A;  4R3A A;  3VHD A;  3C0E A;  4LWE A;  3TTZ A;  2FTK A;  4HY6 A;  5BOC A;  3D2R A;  1BGQ A;  1H7U A;  3C11 A;  5D7R A;  3OPD A;  4B6C A;  3EHJ A;  4FCR A;  3T1K A;  4HYM A;  1UYE A;  2YE2 A;  2QF6 A;  4W7T A;  4XD8 A;  1UY7 A;  3HEK A;  4YKW A;  2YEC A;  4I3H A;  4AS9 A;  3ZRW A;  5IDM A;  3PEH A;  2CGF A;  4E00 A;  2XAB A;  2YK2 A;  3A0W A;  2YI0 A;  4HY1 A;  4LC1 A;  3HHU A;  2YE5 A;  4JAS A;  1GKZ A;  3OWD A;  5M4M A;  2XX2 A;  3T0H A;  4URO A;  4ASG A;  1UY9 A;  4O05 A;  4XKK A;  2XX5 A;  5FNC A;  3LPS A;  4P7A A;  1YC3 A;  2XX4 A;  4K4O A;  1IXM A;  3R4M A;  4KFG A;  1Z5A A;  5D7C A;  4FMT A;  3EHG A;  1Y8O A;  4EGH A;  2P67 A;  2JJC A;  3VHC A;  2ZBK B;  1YS3 A;  2CCT A;  2BU7 A;  4H85 A;  2BRC A;  1TC6 A;  3T2S A;  3RKZ A;  3TZ5 A;  5M4K A;  4MPN A;  1AH8 A;  4V25 A;  2HKJ A;  2XD6 A;  3CGZ A;  3R91 A;  2XJG A;  2WEQ A;  2WI2 A;  2WEP A;  4XDM A;  3U2K A;  1AM1 A;  5F5R A;  1BXD A;  4KQV A;  1Z5B A;  4CE1 A;  3TZ2 A;  4H7Q A;  3K97 A;  4YKQ A;  3RLQ A;  1Y8N A;  2YKE A;  1EA6 A;  1I5B A;  1B63 A;  3RLP A;  2QG0 A;  3ZM7 A;  3GIG A;  2BU2 A;  1Y8P A;  3CRK A;  2BU6 A;  3EKO A;  5CPH A;  4E01 A;  4JAV A;  2YEF A;  4O07 A;  2ZDY A;  1R62 A;  5GGZ A;  3ZXO A;  4BXI A;  2VW5 A;  3B25 A;  1Y4U A;  1UYD A;  4GGL A;  3MD0 A;  2CCU A;  4MT8 A;  2BU8 A;  4CWN A;  2IOQ A;  2YE7 A;  1NHJ A;  4WUC A;  2YJX A;  4L94 A;  4ZVI A;  5D7D A;  4R1F A;  2QM7 A;  1I5C A;  1I58 A;  2YI5 A;  4GCZ A;  3OWB A;  2XHT A;  2XDK A;  1BKN A;  2WI3 A;  2IOP A;  2GQP A;  5FND A;  2O1V A;  3FV5 A;  3Q5L A;  5C93 A;  3EKR A;  1U0Z A;  2FXS A;  4YKR A;  2XK2 A;  2BT0 A;  3NXS A;  4U93 A;  2YED A;  5CF0 A;  4XIR A;  2XDS A;  4URM A;  1H7S A;  2CG9 A;  4XIP A;  2FWZ A;  1QZR A;  3ZKD A;  1ZXM A;  2YI7 A;  2YEH A;  1B62 A; 
#chains in the Genus database with same CATH topology
 1BE3 H;  3E8F A;  4J7K A;  1GJV A;  3ZMV A;  3QTF A;  4JI2 O;  4O04 A;  5AG2 A;  3HYZ A;  2Q8I A;  5DM6 V;  3T1H B;  2ZQM A;  2IBZ H;  1SQP H;  1YC1 A;  1H2G A;  3IGA C;  1WA8 A;  5IY5 B;  3TCU A;  2Y0I A;  4BIO A;  4BWA A;  4J41 A;  4RQF A;  3ZBH A;  2YID A;  3PEJ A;  3ZRX A;  4JGS A;  1Z59 A;  2ZE8 A;  1HNW O;  4UVC A;  1VAR A;  2ZKO A;  2QM4 A;  1DF5 A;  3QVN A;  4W4L A;  4EB6 B;  2EIJ C;  2YEJ A;  1JMK C;  4PA9 A;  2C1I A;  4FFK A;  2Q7E A;  5LYJ B;  2YXY A;  1H2M A;  1YT2 A;  3G75 A;  2XCM A;  5IYD O;  2IH1 C;  4MTO A;  1KMI Z;  1AMW A;  4YKZ A;  4NXN O;  2Q7H A;  3JAT A;  3ABL C;  1ZLZ A;  4X20 A;  5F2V O;  1Q86 W;  4LF4 O;  1UYI A;  1J95 A;  1IVS A;  1Q6U A;  1R3K C;  4CS3 A;  1YHQ V;  3AG4 B;  4PRV A;  1YER A;  4CE3 A;  4R50 A;  2BSM A;  2LJ2 A;  1F7Y A;  5D6P A;  1VQN V;  4ZHQ B;  3FKS G;  4OX9 O;  4CH6 A;  1WP8 A;  3ZMS A;  1TC0 A;  1LUV A;  3L72 H;  4O0B A;  4X66 O;  1WNS A;  5H2F Z;  3OUS A;  1OCC C;  5CBG A;  2ZIM A;  3GIG B;  3HZ1 A;  2YKI A;  3K58 A;  1NHH A;  1N0J A;  3HKE B;  4I50 A;  2UWD A;  2V7Q G;  4DV7 O;  2DYS C;  1THZ A;  3JD1 A;  4PEL A;  1W0K G;  1EI1 A;  1HNZ B;  2YE4 A;  1ZW9 A;  4XKO A;  1Y76 A;  4DRX B;  3I55 V;  2LP7 A;  3JAR A;  2W6J G;  2WLI B;  4P8O A;  4JQL A;  1O9G A;  5LOV B;  1N8R W;  3S3W A;  4LF6 B;  2L35 A;  2ZDI A;  4YY3 B;  3VBB A;  4NYK A;  4QPJ A;  4X1I B;  3ETQ A;  1Q6H A;  1NH2 D;  3HB3 B;  1HW7 A;  2R72 A;  4YIP A;  3TZ0 A;  1YXB A;  1RPR A;  2BOB C;  3DGE A;  1MSW D;  2CGN A;  4DK1 A;  3RVY A;  1OCC B;  4LF9 O;  3OMU A;  3BCC H;  4LPB A;  1P7B A;  3G6E V;  3K60 A;  2Q0A A;  2LO1 A;  3GWK C;  4N23 A;  4J42 A;  2UU9 O;  4LF8 O;  4CWO A;  5BR8 B;  3FAV B;  1FJG B;  4NXM O;  4MP7 A;  1R73 A;  5IYC O;  4MB9 A;  2HFE C;  3FYI B;  3MNR P;  3OTO O;  5M4P A;  4FM2 A;  3GVM A;  4E72 A;  2V1D A;  5B1O A;  3DXR A;  2XAH A;  1KKD A;  2WI1 A;  1RP3 B;  1V54 B;  5L3C A;  2HCH A;  4G27 B;  1HDJ A;  5EBL C;  3HR0 A;  4HZ3 A;  3SPI A;  1XNQ B;  4DR6 O;  2OIG A;  4X62 B;  2RN9 A;  1O9H A;  4CH4 A;  1M56 B;  1UY8 A;  1NZ6 A;  1R3I C;  3B4S A;  4U3F H;  3SL2 A;  4AWP A;  2R70 A;  1QY8 A;  3OAA G;  4GEE A;  4OXS A;  1M4U A;  4R3M A;  5KHH A;  2ZM6 B;  1DGS A;  2YEA A;  3ZCC A;  4CH5 A;  2OCC B;  1CP9 A;  1QBZ A;  2ADP A;  3HKB A;  4AWQ A;  5CA3 A;  2YEB A;  1F4N A;  1M5I A;  1OV9 A;  4DR4 O;  4MPC A;  4NVP A;  1RM1 C;  4PDL A;  5D6Q A;  2H8M A;  2QFO A;  1ZTE A;  2IM9 A;  1KYO F;  2YEG A;  1L0O A;  4XKA A;  4O2B A;  3K9S A;  2UXC O;  4MBC A;  5B1B C;  3INX A;  3WB1 A;  2WAM A;  4TUY A;  5B5E Z;  4JYA B;  5LHH A;  3N2G B;  5J2U B;  2CDY A;  4XCL A;  5FPO A;  5FNF A;  5EYP B;  1JM6 A;  3FYE B;  2UXB B;  4XDJ A;  1PD3 A;  4MW3 A;  4GFN A;  5KAI Z;  3CME V;  2XAS A;  2VWC A;  5HFL A;  4KUM A;  4RWU A;  2UUA O;  5L3G A;  4L93 A;  4LH6 A;  3ZKB A;  4YKU A;  1HNX O;  3GIE A;  2JIZ G;  2PYL A;  2Q8V A;  3A0T A;  1NQT A;  3K06 A;  4JI7 B;  1N0N A;  4GUN A;  2XAG A;  1X4T A;  4URN A;  5LBQ A;  2BRE A;  1S5H C;  1D2D A;  4GLX A;  4MTF A;  4V26 A;  4DUZ O;  2BSK A;  1THN A;  2YDE A;  3B09 A;  4UV8 A;  4HYP A;  4GKJ O;  1A4H A;  2IW5 A;  1HR0 O;  2YE9 A;  2WLJ A;  4Q20 A;  4MP2 A;  1R6K A;  3MDS A;  4UB8 Z;  2VCI A;  2JJ1 G;  4EEH A;  3MHS C;  4TV9 A;  1ZWH A;  1IXB A;  5LMU O;  2VRZ A;  4WUB A;  3CCJ V;  5LL6 Y;  1YES A;  5EC2 C;  3K98 A;  4AQY O;  3W7S A;  5JCO C;  4NH7 A;  1TUB B;  4K3A A;  1JR9 A;  1Q6I A;  4XDK A;  1US7 A;  3JAW B;  4KXR A;  4KTN A;  1K5S A;  2BCC H;  3A8T A;  4UXN A;  5ITZ B;  3E8B A;  3SJC C;  3H9V A;  3ZJZ A;  4H33 A;  3TTZ A;  1BSM A;  3D2R A;  4TWK A;  2ARH A;  2IJH A;  5IJ0 B;  3QO7 A;  3I56 V;  3T2M A;  3AK3 A;  5D7R A;  3K04 A;  2PY5 A;  1GM9 A;  3JD2 A;  4MVO A;  2QDO A;  3ZMT A;  3AG3 C;  1CXZ B;  2MK3 A;  1Y74 B;  4FCR A;  1GN6 A;  4HYM A;  2PZS A;  2YIC A;  4W7T A;  1RSO B;  1UY7 A;  4I3H A;  4Z1V A;  5LGU A;  1FYJ A;  5IDM A;  5EZY A;  4O4H B;  4E00 A;  1I94 B;  1KD1 W;  4K0K O;  3APQ A;  2Z0A A;  4X9Q A;  4QE9 A;  2E74 B;  2DN9 A;  2EIL B;  4P2Z A;  1HWY A;  3OWD A;  1V55 C;  3Q4H A;  2XX2 A;  3CC7 V;  1YJN V;  4X8A A;  2AW9 A;  4DUY O;  4DV1 O;  4XKK A;  2XX5 A;  4B3S B;  4P7A A;  3IAY A;  1U96 A;  2XX4 A;  5DED A;  4WCE V;  4ZI7 A;  3HKD A;  3J81 N;  3WG7 C;  4FMT A;  3G80 A;  3EHG A;  3FB7 C;  5BMV B;  5EC1 C;  1BL8 A;  2WLL A;  2JJC A;  3K3W A;  3AG3 B;  3LNM B;  4H85 A;  2Q9L A;  1N32 B;  4IYH A;  2IH3 C;  1J5E B;  5JJN B;  3RKZ A;  3TZ5 A;  1YDX A;  4PJ0 Z;  2HKJ A;  2XD6 A;  1HP8 A;  3R91 A;  4UVA A;  2VQE B;  1XMQ O;  1XIL A;  2WI2 A;  2WEP A;  1GN2 A;  1AP6 A;  1OJH A;  3ASN C;  5LP6 A;  4FM1 A;  1AM1 A;  4JI0 O;  4H7Q A;  1N33 O;  4O4I A;  3K97 A;  4YKQ A;  4OPA A;  3F7V C;  3SYQ A;  1FPO A;  3RLQ A;  3S5T A;  4LFC O;  4N21 A;  1V55 B;  4PI0 A;  3STL C;  1I5B A;  2C1G A;  4FZ0 A;  3K57 A;  3ZM7 A;  1BQZ A;  5CPH A;  4PDV A;  1IBK O;  1PKX A;  2YEF A;  4O07 A;  3WU2 Z;  2ITC C;  3ZXO A;  3CWB H;  2VW5 A;  3A0B Z;  2EIM C;  3OEH G;  4DR1 O;  1FXK A;  1X59 A;  4X64 O;  5BZB A;  3ZMU A;  1E79 G;  4RQE A;  3EXA A;  4RUF A;  1I5C A;  3QTC A;  4O4J B;  4P9P A;  5IJ9 B;  1GO3 F;  1BKN A;  4L87 A;  3S3X A;  2WI3 A;  2P7T C;  2WLH A;  2GDS A;  3ASN B;  1SES A;  2CK3 G;  4D7T A;  4I55 A;  1FFX B;  2QTS A;  1NVP D;  3CJH B;  5C93 A;  2FXS A;  3G71 V;  2QWO B;  5C8Y A;  3H1L H;  5LGN A;  1VQ8 V;  1N34 O;  4U93 A;  1A32 A;  1P84 F;  5CF0 A;  3OMA B;  4O2A A;  2XDS A;  4LNU B;  5CA0 A;  4XIP A;  4WBN B;  4X88 A;  2FWZ A;  5K1X A;  5CB4 B;  3CXC U;  1ZXM A;  2YEH A;  1B62 A;  4PA7 A;  2ZIO A;  3K0D A;  1UYK A;  2YKC A;  4PDR A;  1UYM A;  3TK1 A;  3MAQ A;  2E76 B;  3ZRW B;  4E4E A;  2DOS A;  1YT1 A;  1Y4M A;  4J7Z A;  1KEC A;  1ZAU A;  4BW9 A;  2XJJ A;  3TXS A;  3E22 B;  5CBF A;  3UQ8 A;  2YXL A;  3SPC A;  3J80 N;  3RYC A;  2Q8H A;  1XRE A;  4JV5 O;  2FYP A;  1XEQ A;  3T10 A;  2XAJ A;  3G6B A;  3VAD A;  1WLE A;  3R65 A;  1WJZ A;  1AB3 A;  2DE0 X;  3CYO A;  3K08 A;  2E3C A;  2JEX A;  5A2Q N;  3RLR A;  4LF5 B;  4KL1 A;  2FML A;  4PA3 A;  3P3P A;  4ASU G;  4GQT A;  2UXN A;  3UCS C;  3J7A U;  2DYR B;  3L9D A;  1JX9 A;  2WI7 A;  4EFB A;  2WSS G;  5TIS Z;  2JEU A;  1P7G A;  4FFB B;  3G7B A;  3ABU A;  5KHK A;  5FPR A;  2BU5 A;  5LMN B;  4B3T B;  2ZR2 A;  4PU9 A;  3O65 A;  3EHB B;  1XOU A;  5CN0 A;  2CH4 A;  3DSQ A;  4YJ3 A;  3CP1 A;  5DN6 G;  2KG7 A;  2ZT9 B;  5GTH Z;  3JYC A;  2DWD C;  1QLE C;  2AHY A;  5L3E A;  3BHP A;  4WFG A;  1SA0 A;  4LWI A;  4ZOL B;  4LWF A;  3N2K B;  4FIP C;  5JQG A;  3OW2 U;  4DV0 B;  1OSF A;  3LNN A;  2LW1 A;  1JPX A;  4CS2 A;  3RYF A;  2P5O A;  2ZE5 A;  3ZHQ A;  1QHT A;  2ZE7 A;  1YIT V;  1XDC A;  1NTK H;  4L90 A;  2Q8G A;  4MSW C;  1G6U A;  2F23 A;  2F4V O;  5CTW A;  2QWP B;  5F3K A;  3JD4 A;  1GKX A;  5IY5 C;  1K5Q A;  2QGN A;  4DV4 B;  2YKB A;  2VCJ A;  3K5O A;  3OR7 C;  3L73 H;  2RJZ A;  4DR7 B;  1Y67 A;  2XTA A;  1OCR B;  4CWS A;  3SYO A;  4QNH B;  4X65 B;  2B1I A;  2D3O W;  5CA1 B;  1WB7 A;  4G2K A;  3VOU A;  1Q7Y W;  4YXW G;  2X0L A;  2GTA A;  1QLE B;  3U10 A;  1XHX A;  1QLN A;  1L8D A;  3CYG A;  4NTW A;  1VQM V;  3T0Z A;  2HVK C;  4ZKI A;  2ZDX A;  4GX0 A;  4I4T B;  2Y48 A;  4FK5 C;  1XNR O;  1BHB A;  4DZY A;  1VQK V;  5DEC A;  2VWK A;  4YKY A;  1YET A;  3OD4 A;  3AG4 C;  4DUH A;  4G28 B;  4JI5 O;  3L74 H;  3CRR A;  1WA8 B;  1TBW A;  1PVG A;  2X6B A;  1AH6 A;  2WI6 A;  4B3R B;  4HZ5 A;  2YJW A;  5EIB C;  4JI3 O;  3R66 A;  4JAU A;  4DYL A;  4F6R A;  5KX5 A;  4J11 A;  2BOC C;  3TGU H;  1IUR A;  2ESA A;  3A0Z A;  3THO A;  2QG2 A;  4TOI A;  2B9Z A;  1AI5 A;  2UUB B;  1I5D A;  4K8X A;  4XE2 A;  2NR5 A;  2P22 C;  1M1K W;  2H94 A;  3JAL A;  1TIL A;  4LP0 A;  2H3O A;  1I5X A;  2VQF O;  1MG1 A;  3F5W C;  4DV3 B;  2CCS A;  2H55 A;  2PYJ A;  2EZP A;  4U3J B;  4J9Y B;  3U2D A;  1W2B U;  3DC6 A;  2D2C B;  3RYI A;  2B5U A;  3HKC B;  3A0Y A;  4U3J A;  3JAT B;  4X20 B;  2JK5 C;  3JSL A;  3HKC A;  4JI8 O;  2ZKJ A;  1COW G;  3VHA A;  2QE7 G;  2Q0O C;  2ZDI C;  5KLV H;  4LFB O;  2QR4 A;  1I5A A;  1UYC A;  2IOR A;  5JEN A;  4MTX A;  3R4O A;  3FD9 A;  3CHX A;  3BM9 A;  1JCH A;  2Q67 A;  2JS3 A;  4EKW A;  1MMM A;  4DR3 O;  2OT5 A;  2Q68 A;  2GBO A;  4IYI A;  2UUC O;  2XJX A;  1XMO B;  3CB2 A;  1PL4 A;  3H1J H;  1VQ6 V;  2KSD A;  1TVK A;  2YEI A;  1AJ6 A;  2WI4 A;  2EXL A;  3VQX A;  4I50 B;  2ZNI A;  2WWW A;  4FJC C;  2YKJ A;  4BR6 A;  2CGO A;  4DV5 B;  5KUK A;  4B7P A;  4LBE C;  3U11 A;  5A9G A;  2UXD B;  4YKX A;  3E86 A;  1Y76 B;  5JWP A;  5H9C A;  2WA3 A;  3JAR B;  3APO A;  1NHI A;  1M57 B;  3TXQ A;  2P4K A;  1TA8 A;  2QM8 A;  3W7W A;  5L3B A;  2Q69 A;  3KE6 A;  5BOD A;  2P4V A;  3Q5K A;  4NH8 A;  3B40 A;  2WER A;  4YJ2 A;  1V54 C;  2HKO A;  2QWQ B;  1NR1 A;  1Y6X A;  4I7Z B;  4JI4 O;  1E1Q G;  3EHF A;  4H37 A;  1LNQ A;  4U7O A;  5KA5 A;  4EGI A;  5M4H A;  3P30 A;  1M56 C;  1SQG A;  2QSA A;  4JI1 B;  1AJN A;  4ASB A;  1YJ9 V;  2A79 B;  4MVU A;  1RFY A;  3ML0 A;  3CCV V;  2Q8F A;  4DV6 B;  3AEI A;  1Q3E A;  2IU3 A;  5FWK A;  4EFT A;  3A0R A;  2OCC C;  4UCU A;  1Q43 A;  5E79 Z;  4FLZ A;  4PL9 A;  3OE7 G;  5IN9 A;  1K4C C;  2JS5 A;  1URF A;  2XDL A;  4IIJ A;  1S77 D;  1GK9 A;  2A06 H;  1AJQ A;  2M6Y A;  3LDE A;  3JZ3 A;  4R3A A;  1GRJ A;  1BMF G;  2QA4 V;  3SGI A;  3PJS K;  3ZN0 A;  1EN6 A;  3T4D A;  4X1Y A;  3DXR B;  4JI6 B;  4DO2 A;  4HY6 A;  1BGQ A;  3OUF A;  4YHH B;  3ETG A;  1K8A W;  3ZRS A;  2K1E A;  1N36 B;  1KU9 A;  2F93 B;  2LGQ A;  2E5L B;  3TET A;  1YTF D;  1MZF A;  2CTP A;  3DTU B;  2YE2 A;  4XD8 A;  4B7K A;  2UXX A;  2YS8 A;  4YKW A;  2AGA A;  4FLY A;  1S72 V;  1US6 A;  3P3N A;  4NTX A;  1XL4 A;  4J10 A;  4L8J A;  4AS9 A;  2HHI A;  3OFN G;  1QNM A;  4WFE A;  3HKB B;  3BVO A;  3RFR A;  4XDL A;  4B3M B;  1WAZ A;  1BQ0 A;  3E35 A;  1KB9 F;  2A7W A;  3D36 C;  4DK0 A;  2ODM A;  3HHU A;  4TSF G;  1AJP A;  4KHP O;  4JAS A;  1GKZ A;  1B6Q A;  3CSX A;  4UVB A;  2NLJ C;  4QE7 A;  5KHJ A;  1N4C A;  4LF7 B;  1AP5 A;  4E2L A;  2A3Q A;  4OPH A;  3RWR D;  4O2B B;  1K7D A;  3T1Y O;  1OCO C;  1S3J A;  2W0F C;  1JFF A;  3R4M A;  4KFG A;  1MZE A;  2FYU H;  1Z5A A;  5KA6 A;  5D7C A;  5J2T A;  1GM7 A;  4H0L B;  4TUY B;  4O4L A;  2P67 A;  3OM3 B;  1VF6 A;  2HG5 C;  3VHC A;  4LFA B;  4JF3 A;  1AVM A;  4EFE A;  2YXH A;  3BA9 A;  2FL4 A;  5M4K A;  4V25 A;  4UCS A;  2HVJ C;  1PP9 H;  3UM7 A;  1XI1 A;  2ZXW B;  1IBL B;  1E1R G;  1Z5B A;  5IT9 N;  2QTO A;  4D6T H;  1NH2 B;  2HHH O;  1K4D C;  1PNM A;  4IHJ A;  2PTM A;  5EBM C;  5IE9 A;  1IBM O;  3LUT B;  2BSK B;  5LXT A;  1EA6 A;  1B63 A;  3BA8 A;  3RLP A;  3AK1 A;  3OT7 A;  2BU2 A;  1Y8P A;  2ADQ B;  1SQQ H;  4GZR B;  1R1B A;  1OCO B;  2JGD A;  4UB6 Z;  4TV9 B;  2ZDY A;  1S76 D;  3B25 A;  4DW1 A;  3MD0 A;  2CCU A;  4DV2 B;  4CWN A;  2Q4P A;  2IOQ A;  2YE7 A;  4FLW A;  2YJX A;  4WFB V;  5EK0 A;  3T1H O;  2RNB A;  4DR2 B;  4ZVI A;  5BY1 A;  4R1F A;  2QM7 A;  3ZHV A;  2EIL C;  3ASO B;  2DW4 A;  4GCZ A;  3OWB A;  5KHG A;  4HNA A;  1S5J A;  5GTI Z;  1G8M A;  2Y4U A;  3C3T A;  2GQP A;  2VS0 A;  3Q5L A;  1GN3 A;  4TV8 A;  2ATK C;  1U0Z A;  3SJQ C;  4MVM A;  4GKK B;  2BT0 A;  1CEZ A;  2YED A;  4R7C A;  3FB5 C;  2CG9 A;  3SYA A;  3GB7 C;  1AR1 B;  3ZKD A;  3CX5 F;  2X6A A;  1YZB A;  1GH6 A;  4MS2 A;  3OGI B;  1R3J C;  5K1P A;  3ZRV A;  2LFS A;  3WQ9 A;  5LP6 C;  5EZY B;  4I0X A;  4EFU A;  4WFA V;  5IWA B;  3A0H Z;  3OR6 C;  4OGQ B;  3RGB A;  2DJV A;  2QWR B;  3Q4H B;  3RYH A;  1RPO A;  5M4N A;  2NNU A;  3NR7 A;  2EUL A;  3K03 A;  1SZX A;  1H2S B;  2Q6A A;  1QCE A;  3UT5 A;  2Q7G A;  4DR5 B;  1MOF A;  2EX3 A;  3LSU A;  4ZI7 B;  3HKD B;  4B7E A;  2YI9 A;  2HJF C;  1I08 A;  4JTD B;  4TT3 G;  1PL0 A;  1R3L C;  3JCU Z;  4LWH A;  2JDI G;  4CWR A;  3SDL A;  2WLL B;  1Z5W A;  1HNZ O;  4JYY A;  1G1X B;  1NU1 H;  2WPD G;  1JOY A;  1S5L Z;  1YSR A;  4EMV A;  4GT8 A;  2E75 B;  2K9P A;  3CCQ V;  4JI2 B;  1YT0 A;  4C7U A;  3ZXQ A;  1MX0 A;  5LP6 B;  2CTR A;  4LF6 O;  4HXZ A;  2YEV B;  5GW7 A;  1DLB A;  4YY3 O;  1K73 W;  1UYF A;  3VQV A;  4CWF A;  1SS3 A;  2YEV A;  4O4I B;  4HZ0 A;  3FX7 A;  3X2Q C;  2ETN A;  4ZIB A;  1HNW B;  3R4P A;  1EFR G;  2YI8 A;  1OZ0 A;  5KUM A;  1XL6 A;  4CWQ A;  2WLM A;  2EBO A;  4L8Z A;  2B1G A;  3CRL A;  1VQ5 V;  3TZ4 A;  4LWS A;  1YI2 V;  3KZI Z;  5B3S C;  5LA6 A;  3BAB A;  1VQP V;  5B66 Z;  1M9N A;  4Q6G A;  3K59 A;  3B28 A;  1FAF A;  5EBW C;  1ZXN A;  2CH7 A;  1FXK B;  2XAF A;  3SJA C;  1TUE B;  2F66 C;  2WA4 A;  1L0L H;  3GIF A;  3JAK A;  5BR8 O;  4NXN B;  1FJG O;  5IYZ B;  3W7U A;  1H2L A;  4XBF A;  1NI8 A;  4LF4 B;  1ROP A;  2RQ6 A;  4ZBM A;  5JH7 A;  1QVG U;  1K34 A;  3CWV A;  3B8N A;  3G67 A;  5IYZ A;  2GUZ B;  5J71 A;  1SET A;  3K9A A;  4TQD A;  5J6A A;  3JAS A;  1AI7 A;  4KP4 A;  4ASA A;  2GUZ A;  4QGP A;  3CXH F;  1FS0 G;  4JYC A;  2YSU B;  4OX9 B;  3JCZ A;  3P32 A;  4BQG A;  1XNQ O;  1AR4 A;  4I55 B;  1VIB A;  4X62 O;  4NTY A;  2BTQ A;  4X66 B;  3G7E A;  4LR3 A;  1OCZ B;  5C8Y B;  3H4L A;  5CBH A;  3X2Q B;  1ZX3 A;  1XBL A;  2L6L A;  4O2A B;  2ZE6 A;  4JTA B;  5CA0 B;  4LWG A;  3TUH A;  1SQF A;  4KSG A;  2DYR C;  4DV7 B;  2ZM6 O;  2W6I G;  4MPE A;  3AG1 C;  3BPZ A;  3ZMZ A;  3OMN B;  2PGG A;  5B3S B;  2KKW A;  4XCJ A;  2KQX A;  5KMG A;  1NTZ H;  3O9O A;  4JTC B;  4NR1 A;  4AHC A;  3O2F A;  1PM9 A;  3ZIA G;  3R92 A;  3FB8 C;  3BAA A;  3RYC B;  1TGO A;  1YSZ A;  1ARO P;  2YE8 A;  2RDC A;  3KKY A;  2MW2 B;  1WB8 A;  3D3I A;  1B04 A;  3BMY A;  4JYA O;  2IWU A;  2O1W A;  2E0A A;  2YEE A;  3FT5 A;  3DC5 A;  2UXB O;  1WPB A;  1VQ7 V;  4LF9 B;  3M7M X;  2YC0 A;  2XAQ A;  3U67 A;  2GFD A;  2BYH A;  3AG1 B;  1KZN A;  2YGF A;  4JI7 O;  3ZX6 A;  2XUM A;  3AG2 B;  2UU9 B;  5LHG A;  4LF8 B;  3HZ5 A;  4NXM B;  4PRX A;  3D8C A;  2EIN B;  3OTO B;  3CS5 A;  4GX5 A;  2YK9 A;  1OCR C;  3ZHS A;  4YJ3 B;  5M4E A;  4CBC A;  2KG7 B;  1BT8 A;  1P49 A;  1R6T A;  3IED A;  2Y4T A;  4DR6 B;  2C2A A;  2P90 A;  4DXW A;  1SA0 B;  2OTJ V;  2Y69 B;  1KIJ A;  1VQ4 V;  5JQG B;  4PD4 F;  5CTY A;  2QWN B;  1M93 A;  1JJO A;  2DWE C;  2HLD G;  2YE3 A;  3RYF B;  2PUS A;  3ZED A;  2GTS A;  2M7W A;  2ILM A;  1ID0 A;  3QDD A;  4QPK A;  1MU5 A;  3LSS A;  3O6O A;  1PPJ H;  1EBO A;  5JVD A;  3CCM V;  4FCP A;  3WHA A;  4L91 A;  3WB2 A;  2KB1 A;  4DR4 B;  1NVP B;  1EZV H;  5LGT A;  4HAM A;  3CEI A;  4X1K A;  2XOK G;  4CC5 A;  4FLT A;  4X9L A;  1S14 A;  2HG1 A;  4WF9 V;  3NMQ A;  1PNL A;  2G38 A;  1FD9 A;  5FNV A;  1UY6 A;  3ZN1 A;  5IDJ A;  2UXC B;  2QEX V;  1MA1 A;  5EIB D;  2IJJ A;  1Q82 W;  1VQ9 V;  1FXH A;  4HXW A;  1BGY H;  3E89 A;  4X89 A;  1Y4S A;  1DF4 A;  2OIE A;  4GX2 A;  4CS4 A;  3B24 A;  4W4K A;  3ABK C;  2ZIN A;  1UPG A;  3UO3 A;  1I94 O;  3STZ C;  4AIL C;  1KQS U;  3CCE V;  2PI4 A;  3OW6 A;  2UUA B;  5L3D A;  4BIU A;  2EIK B;  4ABM A;  5JJJ B;  4P9O A;  1IZ3 A;  4BIZ A;  2Q2E B;  4UCV A;  3RT3 C;  4D7S A;  4YIO A;  1HNX B;  3AK2 A;  1OHH G;  1B3Q A;  1Z5C A;  5CMU A;  3SJB C;  5E1A C;  3ETE A;  4DUZ B;  2GV9 A;  3CCS V;  1YCI A;  4F6R B;  2OCH A;  5KX5 B;  4B3S O;  1Y66 A;  2GHY A;  4UV9 A;  2F1M A;  4GKJ B;  4I9W A;  3C11 A;  3H01 A;  3SPG A;  1HR0 B;  4PA4 A;  4B6C A;  3B8M A;  3EHJ A;  3JAL B;  1GMG A;  3CCU V;  3ABM C;  4K35 A;  5GON A;  2YIB D;  1UYE A;  4FLX A;  3CPW U;  1N32 O;  1J5E O;  3HEK A;  4PV1 B;  1PNK A;  5LMU B;  2YEC A;  3M8A A;  2VQE O;  3RYI B;  4AQY B;  1S0V A;  2XAB A;  1M90 W;  1M57 C;  2QKC A;  2YI0 A;  4HY1 A;  3ABK B;  3H1H H;  4LC1 A;  3VQW A;  1SZT A;  1I5Y A;  5M4M A;  4J7J A;  3K5M A;  3TJT A;  1VP7 A;  2RCV A;  4EB6 A;  4TQF A;  1UY9 A;  4O05 A;  3RW0 A;  1NTM H;  1UJW B;  4IGG A;  1YC3 A;  1IXM A;  4R8C A;  2CTW A;  1TVK B;  4UCT A;  5LYJ A;  3T4Z A;  1Y8O A;  4EGH A;  4P30 A;  2ZBK B;  1YS3 A;  2CCT A;  4J9Z B;  2BU7 A;  2JJ2 G;  1TC6 A;  1NKD A;  3ABM B;  3E8G A;  2EJR A;  2XHB A;  1Q81 W;  4MPN A;  1AH8 A;  3CGZ A;  4HBN A;  2R9A A;  4CZZ A;  5KAF Z;  2WEQ A;  3CE2 A;  3LSQ A;  2PF4 E;  4JAA A;  2AHZ A;  4K0K B;  3U2K A;  5J9P C;  5F5R A;  1BXD A;  2A9H A;  4ZHQ A;  4CE1 A;  2O57 A;  1BCC H;  2PI5 A;  4YJ2 B;  1ENV A;  1IX9 A;  1AIL A;  1SQV H;  2P6J A;  4FLV A;  2GSM B;  4DUY B;  4DV1 B;  2EIJ B;  3GIG A;  2IU0 A;  1LUW A;  4K8Z A;  2BU6 A;  3EKO A;  3HKE A;  4E01 A;  3CMA V;  3BY6 A;  4LCU C;  2FB5 A;  2Y0P A;  1F23 A;  1H8E G;  1UYD A;  4GGL A;  1H2K A;  4MT8 A;  2BU8 A;  1TAE A;  4DRX A;  1KUQ A;  3ABL B;  4L94 A;  1ZSP A;  5D7D A;  1Z2G A;  2WLI A;  4IIJ B;  1ZWI C;  2W0X A;  1XMQ B;  2XHT A;  2DQ3 A;  5LOV A;  2XDK A;  1QVF U;  5FND A;  2O1V A;  4JI0 B;  4X1I A;  2R9I A;  3FV5 A;  1N33 B;  4X1Y B;  3B77 A;  3L75 H;  2YIB A;  4LFC B;  2CUG A;  3NXS A;  4LF5 O;  2JGU A;  1F4M A;  1NBM G;  4XIR A;  1VF6 C;  4URM A;  1IBK B;  2YI7 A;  2DYS B;  5FLX N;  2BTO A;  3CC2 V;  4DR1 B;  4X64 B;  1WN7 A;  1I7F A;  4PHZ A;  3FAV A;  5LMN O;  4JYB A;  2XDU A;  4WFF A;  4B3T O;  1JQ0 A;  4RUE A;  4FM0 A;  2ZXW C;  2ZR3 A;  2F95 B;  3Q5J A;  3LMM A;  4J80 A;  3E8H A;  2ZNJ A;  1EN4 A;  2XHR A;  3ETD A;  4WFH A;  1JFF B;  3K5N A;  1Q90 D;  2H8P C;  4FLU A;  4DV0 O;  1N34 B;  5J2T B;  2HR3 A;  4LH7 A;  4O4L B;  2RMK B;  3ZHR A;  2LQT A;  3QO8 A;  3A0X A;  1YF2 A;  2QJ1 A;  4CH3 A;  3EFF K;  1DK1 A;  1EM1 A;  3F7Y C;  2AKP A;  2YI6 A;  3H80 A;  1T5E A;  3JD0 A;  1H38 A;  2XDX A;  3FT8 A;  2CTQ A;  4DW0 A;  2Z5U A;  4BAY A;  3ASO C;  4DV4 O;  3B26 A;  4FPP A;  5L3J A;  1QR9 A;  2ITD C;  1YSC A;  4DR7 O;  3BRC A;  1NR7 A;  1VF7 A;  4X65 O;  2O1U A;  2DMX A;  3QG5 A;  2JKI A;  1GTO A;  2N04 A;  4IHJ B;  1NJI W;  3E2E A;  4JV5 B;  1YC4 A;  4RAI A;  5LXT B;  5D5Q A;  3MHH C;  4A5U B;  5H6R A;  3O0I A;  3H1K H;  4XIQ A;  5IYB O;  2YE6 A;  1DTO A;  3QO5 A;  3N2G A;  5J2U A;  1SKV A;  1SRY A;  2LFR A;  1NS1 A;  5EYP A;  5BXZ A;  2JGD B;  5JJE B;  3H1I H;  1AR5 A;  3D3Q A;  1NT2 B;  2CAZ C;  3B27 A;  5B1A C;  1P4R A;  2BZ5 A;  3CRM A;  1B06 A;  2YIA A;  1YJW V;  4CE2 A;  2NN4 A;  3D36 A;  4CWP A;  1SF9 A;  3LNU A;  4EEQ A;  1RM1 B;  4B3R O;  5H5N A;  4HNA B;  2OWO A;  4MOT A;  4KFM A;  2AZ2 A;  3W7T A;  3FFQ A;  3K99 A;  1YTF B;  1VQO V;  2WLK A;  2UUB O;  2F43 G;  1I59 A;  1QYE A;  1K97 A;  4TV8 B;  4UCO A;  4CWT A;  3K0G A;  5B1B B;  3ABT A;  4MVS A;  2ZCE A;  1VF5 B;  4DV3 O;  3SYC A;  4WUD A;  1KC8 W;  4H44 B;  4Z1M G;  2BE3 A;  3QNE A;  3CGY A;  2WI5 A;  2JVD A;  1FFT B;  3L71 H;  4Z2W A;  1TUB A;  4LP8 A;  3M99 B;  3G4S V;  4EGK A;  1F51 A;  2K5B A;  5B1A B;  3JAW A;  2F4V B;  4I0X B;  5ITZ A;  1UYG A;  5CTX A;  3IFX A;  4ICG A;  1BHA A;  4FZ1 A;  2LGW A;  2DQ0 A;  2AXT Z;  1U2O A;  2YGA A;  4CC6 A;  2A0L A;  5IJ0 A;  1UYL A;  3RYH B;  4AWO A;  2N74 A;  3R4N A;  3INW A;  1XMO O;  3A2F A;  3UT5 B;  3VQY A;  1BS3 A;  3LDC A;  3OEE G;  1TID A;  2OTL V;  1Y74 A;  1H2N A;  4NB5 A;  4DV5 O;  1S16 A;  1RSO A;  1BYQ A;  2IWX A;  4BW5 A;  1V9P A;  1FXK C;  2UXD O;  1K3E A;  4JZG A;  3PN1 A;  3N27 A;  4O4H A;  1XNR B;  4JPR A;  1BZK A;  2CE4 A;  1D5N A;  2FKX A;  5FL7 G;  2PNR A;  1UYH A;  2FWY A;  5CTU A;  5JCO A;  2EJ7 A;  4AI8 A;  4JI5 B;  3HPL C;  4BAE A;  1PV0 A;  4GX1 A;  2XHX A;  3CRA A;  1JJ2 U;  4KSH A;  4JI3 B;  2YUA A;  2IJK A;  3EHH A;  1WP7 A;  4JI1 O;  1OCZ C;  3SR2 C;  4BQJ A;  4YKT A;  4XIT A;  1L0N H;  5BMV A;  1TH8 A;  4DV6 O;  4QIW F;  1QU7 A;  1VMG A;  4LWS B;  2VQF B;  4E02 A;  4H81 A;  1Z5V A;  1Q8I A;  5LA6 B;  4GT1 A;  4EM7 A;  4I9Q A;  1Q5O A;  2YGE A;  2QKA A;  3D0B A;  3K79 A;  2CH7 B;  4IT5 A;  3F5T A;  3JAK B;  5HFM A;  3HYY A;  1ZUQ A;  3T1C A;  4IL6 Z;  1LR1 A;  2LW7 A;  5JH7 B;  1QQC A;  4JI8 B;  1EZJ A;  3JAS B;  3EVK A;  4LFB B;  4JI6 O;  5B1N A;  4URL A;  5H6Q A;  2X7R B;  5D5P A;  4PA6 A;  3KG2 A;  3CRQ A;  4YHH O;  2IWS A;  4DR3 B;  1N36 O;  4XC0 A;  3CC4 V;  4GYC B;  2BTZ A;  2VWJ A;  2BTQ B;  2E5L O;  4NH9 A;  2UUC B;  2X6C A;  3WG7 B;  3JSN A;  1K9M W;  4O09 A;  1EN5 A;  2BYI A;  4ASF A;  4XTJ A;  4PDM A;  1XUQ A;  4U7N A;  3KCY A;  1XHZ A;  1D5A A;  4I5S A;  3CCL V;  1K33 A;  1GM8 A;  4B3M O;  4FCQ A;  2P06 A;  1SQB H;  1VQL V;  3AG2 C;  1R6N A;  5KMG B;  4FVM A;  4O4J A;  1SC5 B;  1ZL8 B;  5IJ9 A;  3B2E E;  1U97 A;  2HP8 A;  1ZL8 A;  2JRI A;  2EIN C;  4LF7 O;  3AG7 A;  3VHD A;  3C0E A;  4LWE A;  3RBZ A;  1FFX A;  2FTK A;  3ZHT A;  5BOC A;  4QJF B;  3CJH A;  1H7U A;  4MTG A;  4F4L A;  4JI4 B;  1KP2 A;  1VEW A;  3C90 A;  2Q73 A;  4LNU A;  3OPD A;  2Y69 C;  4WBN A;  5CB4 A;  1KBH A;  1W59 A;  3SPJ A;  3T1K A;  2V4D A;  2HEP A;  2Q5Z A;  4LFA O;  2QF6 A;  3L70 H;  3JAM N;  1JVM A;  3ZHU A;  2EIM B;  1MSD A;  3IC9 A;  1JA8 A;  4NKG B;  3ZRW A;  4F6E A;  3PEH A;  3LDD A;  2CGF A;  3QF7 A;  3E22 A;  2YK2 A;  3A0W A;  1IBL O;  2YE5 A;  3UO2 A;  1QR8 A;  3OTF A;  4H13 B;  2AZ0 A;  3WB0 A;  4MVR A;  3T0H A;  1G4Y B;  4URO A;  3BEH A;  4ASG A;  1IDS A;  1KP3 A;  3UKM A;  1FXV A;  5FNC A;  3LPS A;  1YIJ V;  1GN4 A;  4K4O A;  3RN4 A;  3ZS8 C;  4MW8 A;  1L1F A;  2WLN A;  1H8H G;  1I0H A;  1YEW A;  1YVW A;  4UCR A;  2XND G;  3U0Z A;  4DV2 O;  2BRC A;  4JZ2 A;  3CD6 V;  3T2S A;  2OYQ A;  4FFB A;  2EZO A;  2IJI A;  4HYO A;  3ICX A;  4MVQ A;  4DR2 O;  3CCR V;  2XJG A;  3IC7 A;  3IJ4 A;  2EIK C;  1MNG A;  1AI6 A;  4PI2 A;  5L3F A;  3E83 A;  1CPY A;  5JVD B;  1SER A;  3KCX A;  4XDM A;  4R6Z A;  3WFV A;  4KQV A;  4KHP B;  2N05 A;  3TZ2 A;  1GKF A;  1Y8N A;  1GAX A;  2YKE A;  4X1K B;  3CRC A;  4GKK O;  2XT9 A;  2ZD9 A;  2QG0 A;  3SPH A;  5FNV B;  4ZOL A;  3T1Y B;  3N2K A;  3CRK A;  4B08 A;  5LHI A;  4JAV A;  3K5L A;  2QKS A;  1XQ8 A;  1KKC A;  1R62 A;  5GGZ A;  4UUJ C;  4BXI A;  3RVZ A;  2R9R B;  1Y4U A;  3I5D A;  4RO2 A;  5KHI A;  3C3S A;  4UFZ A;  2Z3Y A;  1NHJ A;  4WUC A;  2HJD A;  5IWA O;  1I58 A;  2YI5 A;  1SQX H;  2IOP A;  3JD3 A;  2HHH B;  1FKA O;  1IBM B;  5CA1 A;  3EKR A;  4DR5 O;  1WPX A;  3W7X A;  2XK2 A;  4YKR A;  3SYP A;  1ORQ C;  1UFI A;  4MVZ A;  3OMI B;  1H7S A;  1AI4 A;  3OGC C;  3GWO A;  1QZR A;  4I4T A;  3BFR A;  1K92 A;  1W0J G;  3FB6 C;  5GON B;  1MAB G; 
#chains in the Genus database with same CATH homology
 3E8F A;  1GJV A;  3ZMV A;  3QTF A;  4O04 A;  3HYZ A;  2Q8I A;  5DM6 V;  2ZQM A;  1YC1 A;  1H2G A;  3IGA C;  5IY5 B;  3TCU A;  4RQF A;  3PEJ A;  3ZRX A;  4JGS A;  1Z59 A;  4UVC A;  1DF5 A;  2EIJ C;  2YEJ A;  4PA9 A;  1YT2 A;  3G75 A;  2XCM A;  5IYD O;  2IH1 C;  4MTO A;  1AMW A;  4YKZ A;  3ABL C;  1Q86 W;  1UYI A;  1J95 A;  1R3K C;  1YHQ V;  3AG4 B;  4PRV A;  1YER A;  4CE3 A;  4R50 A;  2BSM A;  5D6P A;  1VQN V;  3FKS G;  3ZMS A;  1TC0 A;  4O0B A;  3OUS A;  1OCC C;  5CBG A;  3GIG B;  3HZ1 A;  2YKI A;  1NHH A;  2UWD A;  2V7Q G;  2DYS C;  1THZ A;  3JD1 A;  4PEL A;  1W0K G;  1EI1 A;  2YE4 A;  1ZW9 A;  4XKO A;  3I55 V;  2LP7 A;  2W6J G;  2WLI B;  4P8O A;  4JQL A;  1N8R W;  2ZDI A;  3VBB A;  4QPJ A;  1NH2 D;  3HB3 B;  3TZ0 A;  1RPR A;  2BOB C;  3DGE A;  1MSW D;  3RVY A;  1OCC B;  3OMU A;  4LPB A;  1P7B A;  3G6E V;  3K60 A;  4N23 A;  4CWO A;  4MP7 A;  1R73 A;  5IYC O;  4MB9 A;  2HFE C;  3FYI B;  3MNR P;  5M4P A;  2V1D A;  5B1O A;  2XAH A;  1KKD A;  2WI1 A;  1V54 B;  5L3C A;  2HCH A;  4G27 B;  5EBL C;  4HZ3 A;  3SPI A;  1M56 B;  1UY8 A;  1R3I C;  3SL2 A;  4AWP A;  1QY8 A;  3OAA G;  4GEE A;  4OXS A;  4R3M A;  2YEA A;  3ZCC A;  2OCC B;  1CP9 A;  1QBZ A;  4AWQ A;  5CA3 A;  2YEB A;  1F4N A;  4MPC A;  1RM1 C;  4PDL A;  5D6Q A;  2H8M A;  2QFO A;  2YEG A;  1L0O A;  4XKA A;  4MBC A;  5B1B C;  3INX A;  2WAM A;  5LHH A;  4XCL A;  5FNF A;  1JM6 A;  3FYE B;  1PD3 A;  4XDJ A;  4MW3 A;  4GFN A;  3CME V;  2XAS A;  2VWC A;  5HFL A;  4KUM A;  5L3G A;  4L93 A;  3ZKB A;  4YKU A;  3GIE A;  2JIZ G;  3A0T A;  1NQT A;  3K06 A;  2XAG A;  4URN A;  5LBQ A;  2BRE A;  1S5H C;  4MTF A;  4V26 A;  1THN A;  4UV8 A;  4HYP A;  1A4H A;  2IW5 A;  2YE9 A;  2WLJ A;  4Q20 A;  4MP2 A;  1R6K A;  2VCI A;  2JJ1 G;  4EEH A;  3MHS C;  1ZWH A;  4WUB A;  3CCJ V;  1YES A;  5EC2 C;  3K98 A;  3W7S A;  4NH7 A;  4XDK A;  1US7 A;  4KTN A;  1K5S A;  4UXN A;  3E8B A;  3ZJZ A;  4H33 A;  3TTZ A;  3D2R A;  4TWK A;  2IJH A;  3QO7 A;  3I56 V;  3T2M A;  5D7R A;  3K04 A;  1GM9 A;  3JD2 A;  4MVO A;  3ZMT A;  3AG3 C;  2MK3 A;  4FCR A;  4HYM A;  4W7T A;  1UY7 A;  4I3H A;  5LGU A;  5IDM A;  4E00 A;  1KD1 W;  4QE9 A;  2EIL B;  4P2Z A;  1HWY A;  3OWD A;  1V55 C;  2XX2 A;  3CC7 V;  1YJN V;  4X8A A;  4XKK A;  2XX5 A;  4P7A A;  2XX4 A;  4WCE V;  3WG7 C;  4FMT A;  3EHG A;  3FB7 C;  5EC1 C;  1BL8 A;  2WLL A;  2JJC A;  3K3W A;  3AG3 B;  3LNM B;  4H85 A;  2IH3 C;  3RKZ A;  3TZ5 A;  2HKJ A;  2XD6 A;  3R91 A;  4UVA A;  2WI2 A;  2WEP A;  3ASN C;  1AM1 A;  4H7Q A;  3K97 A;  4YKQ A;  3F7V C;  3SYQ A;  3RLQ A;  4N21 A;  1V55 B;  3STL C;  1I5B A;  3ZM7 A;  5CPH A;  4PDV A;  1PKX A;  2YEF A;  4O07 A;  2ITC C;  3ZXO A;  2VW5 A;  2EIM C;  3OEH G;  1FXK A;  5BZB A;  3ZMU A;  1E79 G;  4RQE A;  4RUF A;  1I5C A;  4P9P A;  1GO3 F;  1BKN A;  4L87 A;  2WI3 A;  2P7T C;  2WLH A;  3ASN B;  1SES A;  2CK3 G;  1NVP D;  5C93 A;  2FXS A;  3G71 V;  5LGN A;  1VQ8 V;  4U93 A;  5CF0 A;  3OMA B;  2XDS A;  4XIP A;  2FWZ A;  4X88 A;  3CXC U;  1ZXM A;  2YEH A;  1B62 A;  4PA7 A;  3K0D A;  1UYK A;  2YKC A;  4PDR A;  1UYM A;  3TK1 A;  3ZRW B;  1YT1 A;  1Y4M A;  1KEC A;  2XJJ A;  5CBF A;  3SPC A;  2Q8H A;  2FYP A;  3T10 A;  2XAJ A;  3VAD A;  1WLE A;  3R65 A;  3CYO A;  3K08 A;  2JEX A;  3RLR A;  4PA3 A;  4ASU G;  4GQT A;  2UXN A;  2DYR B;  1JX9 A;  2WI7 A;  2WSS G;  2JEU A;  3G7B A;  3ABU A;  2BU5 A;  2ZR2 A;  4PU9 A;  3EHB B;  2CH4 A;  5CN0 A;  3CP1 A;  5DN6 G;  3JYC A;  2DWD C;  1QLE C;  2AHY A;  5L3E A;  4WFG A;  4LWI A;  4LWF A;  4FIP C;  3OW2 U;  1OSF A;  1JPX A;  1YIT V;  4L90 A;  2Q8G A;  4MSW C;  5CTW A;  5F3K A;  3JD4 A;  1GKX A;  5IY5 C;  1K5Q A;  2YKB A;  2VCJ A;  3OR7 C;  1OCR B;  4CWS A;  3SYO A;  4QNH B;  2B1I A;  2D3O W;  4G2K A;  3VOU A;  1Q7Y W;  4YXW G;  2X0L A;  1QLE B;  1QLN A;  1VQM V;  3T0Z A;  2HVK C;  4ZKI A;  2ZDX A;  4GX0 A;  2Y48 A;  4FK5 C;  1BHB A;  4DZY A;  1VQK V;  4YKY A;  1YET A;  3AG4 C;  4DUH A;  4G28 B;  1TBW A;  1PVG A;  2X6B A;  1AH6 A;  2WI6 A;  4HZ5 A;  2YJW A;  4JAU A;  2BOC C;  2ESA A;  3A0Z A;  2QG2 A;  1AI5 A;  1I5D A;  4XE2 A;  1M1K W;  2H94 A;  1TIL A;  4LP0 A;  1I5X A;  1MG1 A;  3F5W C;  2CCS A;  2H55 A;  2EZP A;  4J9Y B;  3U2D A;  1W2B U;  2B5U A;  3A0Y A;  2JK5 C;  2ZKJ A;  1COW G;  3VHA A;  2QE7 G;  2ZDI C;  1I5A A;  2IOR A;  1UYC A;  4MTX A;  3R4O A;  3BM9 A;  1JCH A;  2Q67 A;  4EKW A;  2OT5 A;  2Q68 A;  2XJX A;  1VQ6 V;  2YEI A;  1AJ6 A;  2WI4 A;  2EXL A;  2WWW A;  4FJC C;  2YKJ A;  5KUK A;  4B7P A;  4LBE C;  4YKX A;  3E86 A;  5H9C A;  1NHI A;  1M57 B;  2QM8 A;  3W7W A;  5L3B A;  2Q69 A;  3KE6 A;  5BOD A;  3Q5K A;  4NH8 A;  2WER A;  1V54 C;  2HKO A;  1NR1 A;  1E1Q G;  3EHF A;  4H37 A;  1LNQ A;  4U7O A;  5KA5 A;  4EGI A;  5M4H A;  3P30 A;  1M56 C;  1AJN A;  4ASB A;  1YJ9 V;  2A79 B;  4MVU A;  3ML0 A;  3CCV V;  2Q8F A;  3AEI A;  2IU3 A;  5FWK A;  4EFT A;  3A0R A;  2OCC C;  4PL9 A;  3OE7 G;  5IN9 A;  1K4C C;  2XDL A;  1S77 D;  1GK9 A;  1AJQ A;  3LDE A;  3JZ3 A;  4R3A A;  1BMF G;  2QA4 V;  3PJS K;  3ZN0 A;  3T4D A;  4DO2 A;  4HY6 A;  1BGQ A;  3OUF A;  3ETG A;  1K8A W;  3ZRS A;  2K1E A;  3TET A;  1YTF D;  3DTU B;  2YE2 A;  4XD8 A;  2UXX A;  4YKW A;  1S72 V;  1XL4 A;  4AS9 A;  3OFN G;  4WFE A;  4XDL A;  3E35 A;  3HHU A;  4TSF G;  1AJP A;  4JAS A;  1GKZ A;  1B6Q A;  4UVB A;  2NLJ C;  4QE7 A;  4E2L A;  1K7D A;  1OCO C;  1S3J A;  2W0F C;  3R4M A;  4KFG A;  1Z5A A;  5KA6 A;  5D7C A;  1GM7 A;  2P67 A;  3OM3 B;  3VHC A;  2HG5 C;  4JF3 A;  5M4K A;  4V25 A;  2HVJ C;  3UM7 A;  2ZXW B;  1E1R G;  1Z5B A;  2QTO A;  1NH2 B;  1K4D C;  1PNM A;  5EBM C;  3LUT B;  1EA6 A;  1B63 A;  3RLP A;  2BU2 A;  1Y8P A;  1OCO B;  2ZDY A;  1S76 D;  3B25 A;  3MD0 A;  2CCU A;  4CWN A;  2IOQ A;  2YE7 A;  2YJX A;  4WFB V;  5EK0 A;  4ZVI A;  4R1F A;  2QM7 A;  2EIL C;  3ASO B;  2DW4 A;  4GCZ A;  3OWB A;  1G8M A;  2GQP A;  3Q5L A;  2ATK C;  1U0Z A;  3SJQ C;  4MVM A;  2BT0 A;  1CEZ A;  2YED A;  4R7C A;  3FB5 C;  2CG9 A;  3SYA A;  3GB7 C;  1AR1 B;  3ZKD A;  2X6A A;  4MS2 A;  1R3J C;  3ZRV A;  2LFS A;  3WQ9 A;  4EFU A;  4WFA V;  3OR6 C;  1RPO A;  5M4N A;  2NNU A;  3K03 A;  2Q6A A;  1QCE A;  1MOF A;  2HJF C;  4JTD B;  4TT3 G;  1PL0 A;  1R3L C;  4LWH A;  2JDI G;  4CWR A;  2WLL B;  2WPD G;  1JOY A;  1YSR A;  4EMV A;  4GT8 A;  3CCQ V;  1YT0 A;  3ZXQ A;  1MX0 A;  4HXZ A;  2YEV B;  5GW7 A;  1DLB A;  1K73 W;  1UYF A;  4CWF A;  4HZ0 A;  2YEV A;  3X2Q C;  3R4P A;  1EFR G;  1OZ0 A;  5KUM A;  1XL6 A;  4CWQ A;  2WLM A;  2EBO A;  4L8Z A;  2B1G A;  3CRL A;  1VQ5 V;  3TZ4 A;  1YI2 V;  5B3S C;  1VQP V;  1M9N A;  3B28 A;  5EBW C;  1ZXN A;  1FXK B;  2XAF A;  1TUE B;  3GIF A;  3W7U A;  4XBF A;  1ROP A;  4ZBM A;  1QVG U;  3CWV A;  1K34 A;  3B8N A;  5J71 A;  1SET A;  3K9A A;  5J6A A;  1AI7 A;  4KP4 A;  4ASA A;  1FS0 G;  4JYC A;  2YSU B;  3JCZ A;  3P32 A;  4BQG A;  3G7E A;  1OCZ B;  3H4L A;  5CBH A;  3X2Q B;  4JTA B;  4LWG A;  3TUH A;  4KSG A;  2DYR C;  2W6I G;  4MPE A;  3AG1 C;  3ZMZ A;  3OMN B;  5B3S B;  4XCJ A;  4JTC B;  3O2F A;  3ZIA G;  3R92 A;  3FB8 C;  1YSZ A;  1ARO P;  2YE8 A;  3D3I A;  3BMY A;  2IWU A;  2O1W A;  2E0A A;  2YEE A;  3FT5 A;  1VQ7 V;  2XAQ A;  3U67 A;  2GFD A;  2BYH A;  3AG1 B;  1KZN A;  2YGF A;  3AG2 B;  5LHG A;  3HZ5 A;  4PRX A;  2EIN B;  4GX5 A;  2YK9 A;  1OCR C;  5M4E A;  4CBC A;  3IED A;  2C2A A;  2P90 A;  4DXW A;  2OTJ V;  2Y69 B;  1KIJ A;  1VQ4 V;  5CTY A;  2DWE C;  2HLD G;  2YE3 A;  2M7W A;  1ID0 A;  3QDD A;  4QPK A;  1MU5 A;  3LSS A;  3O6O A;  1EBO A;  3CCM V;  4FCP A;  3WHA A;  4L91 A;  2KB1 A;  1NVP B;  5LGT A;  4HAM A;  2XOK G;  4X9L A;  1S14 A;  2HG1 A;  4WF9 V;  3NMQ A;  1PNL A;  1UY6 A;  3ZN1 A;  5IDJ A;  2QEX V;  2IJJ A;  1Q82 W;  1VQ9 V;  1FXH A;  4HXW A;  3E89 A;  4X89 A;  1Y4S A;  1DF4 A;  4GX2 A;  3B24 A;  3ABK C;  3STZ C;  1KQS U;  3CCE V;  2PI4 A;  3OW6 A;  5L3D A;  4BIU A;  2EIK B;  4P9O A;  4BIZ A;  2Q2E B;  1OHH G;  1B3Q A;  1Z5C A;  5CMU A;  5E1A C;  3ETE A;  3CCS V;  1Y66 A;  2GHY A;  4UV9 A;  4I9W A;  3C11 A;  3H01 A;  3SPG A;  4PA4 A;  4B6C A;  3B8M A;  3EHJ A;  1GMG A;  3CCU V;  3ABM C;  1UYE A;  3CPW U;  3HEK A;  1PNK A;  2YEC A;  1S0V A;  2XAB A;  1M90 W;  1M57 C;  2YI0 A;  4HY1 A;  3ABK B;  4LC1 A;  1SZT A;  1I5Y A;  5M4M A;  1UY9 A;  4O05 A;  3RW0 A;  1UJW B;  1YC3 A;  1IXM A;  4R8C A;  3T4Z A;  1Y8O A;  4EGH A;  4P30 A;  2ZBK B;  1YS3 A;  2CCT A;  4J9Z B;  2BU7 A;  2JJ2 G;  1TC6 A;  1NKD A;  3ABM B;  3E8G A;  2EJR A;  1Q81 W;  4MPN A;  1AH8 A;  3CGZ A;  4CZZ A;  2WEQ A;  3LSQ A;  2AHZ A;  3U2K A;  5J9P C;  5F5R A;  1BXD A;  2A9H A;  4CE1 A;  2PI5 A;  1ENV A;  2P6J A;  2GSM B;  2EIJ B;  3GIG A;  2IU0 A;  2BU6 A;  3EKO A;  4E01 A;  3CMA V;  3BY6 A;  4LCU C;  1F23 A;  1H8E G;  1UYD A;  4GGL A;  4MT8 A;  2BU8 A;  3ABL B;  4L94 A;  5D7D A;  2WLI A;  1ZWI C;  2XHT A;  2DQ3 A;  2XDK A;  1QVF U;  5FND A;  2O1V A;  2R9I A;  3FV5 A;  3B77 A;  3NXS A;  1F4M A;  1NBM G;  4XIR A;  4URM A;  2YI7 A;  2DYS B;  3CC2 V;  4JYB A;  2XDU A;  4WFF A;  1JQ0 A;  4RUE A;  2ZXW C;  2ZR3 A;  3Q5J A;  3E8H A;  2XHR A;  3ETD A;  4WFH A;  2H8P C;  2HR3 A;  3QO8 A;  3A0X A;  3EFF K;  2AKP A;  3F7Y C;  2YI6 A;  3H80 A;  3JD0 A;  1H38 A;  2XDX A;  3FT8 A;  2Z5U A;  4BAY A;  3ASO C;  3B26 A;  4FPP A;  5L3J A;  1QR9 A;  2ITD C;  1YSC A;  1NR7 A;  2O1U A;  2JKI A;  1GTO A;  3E2E A;  1NJI W;  1YC4 A;  4RAI A;  3MHH C;  5H6R A;  3O0I A;  4XIQ A;  5IYB O;  2YE6 A;  1DTO A;  3QO5 A;  1SRY A;  2LFR A;  3B27 A;  5B1A C;  1P4R A;  2BZ5 A;  1YJW V;  4CE2 A;  3D36 A;  4CWP A;  3LNU A;  1RM1 B;  4MOT A;  4KFM A;  3W7T A;  3K99 A;  1YTF B;  1VQO V;  2WLK A;  1QYE A;  2F43 G;  1I59 A;  1K97 A;  4CWT A;  3K0G A;  5B1B B;  3ABT A;  4MVS A;  3SYC A;  4WUD A;  1KC8 W;  4Z1M G;  3QNE A;  3CGY A;  2WI5 A;  1FFT B;  4LP8 A;  3M99 B;  3G4S V;  4EGK A;  1F51 A;  2K5B A;  5B1A B;  1UYG A;  5CTX A;  3IFX A;  1BHA A;  2DQ0 A;  1U2O A;  2YGA A;  2A0L A;  1UYL A;  4AWO A;  3R4N A;  3INW A;  3LDC A;  3OEE G;  1TID A;  2OTL V;  1S16 A;  1BYQ A;  2IWX A;  4BW5 A;  1FXK C;  1K3E A;  4JPR A;  5FL7 G;  2PNR A;  1UYH A;  2FWY A;  5CTU A;  3HPL C;  4BAE A;  4GX1 A;  2XHX A;  1JJ2 U;  4KSH A;  2IJK A;  3EHH A;  1OCZ C;  4BQJ A;  4YKT A;  4XIT A;  1TH8 A;  4QIW F;  4E02 A;  4H81 A;  4GT1 A;  4EM7 A;  2YGE A;  3D0B A;  3K79 A;  5HFM A;  3HYY A;  3T1C A;  1EZJ A;  5B1N A;  4URL A;  5H6Q A;  2X7R B;  4PA6 A;  3KG2 A;  2IWS A;  4XC0 A;  3CC4 V;  2BTZ A;  4NH9 A;  2X6C A;  3WG7 B;  1K9M W;  4O09 A;  2BYI A;  4ASF A;  4XTJ A;  4PDM A;  4U7N A;  4I5S A;  3CCL V;  1K33 A;  1GM8 A;  4FCQ A;  1VQL V;  3AG2 C;  1R6N A;  2EIN C;  3VHD A;  3C0E A;  4LWE A;  3RBZ A;  2FTK A;  5BOC A;  4QJF B;  1H7U A;  4MTG A;  4F4L A;  1KP2 A;  3OPD A;  2Y69 C;  3T1K A;  3SPJ A;  2QF6 A;  1JVM A;  2EIM B;  3ZRW A;  3PEH A;  3LDD A;  2CGF A;  2YK2 A;  3A0W A;  2YE5 A;  1QR8 A;  4MVR A;  3T0H A;  1G4Y B;  4URO A;  3BEH A;  4ASG A;  1KP3 A;  3UKM A;  1FXV A;  5FNC A;  3LPS A;  1YIJ V;  4K4O A;  4MW8 A;  2WLN A;  1L1F A;  1H8H G;  2XND G;  2BRC A;  3CD6 V;  3T2S A;  2EZO A;  2IJI A;  4HYO A;  4MVQ A;  3CCR V;  2XJG A;  3IC7 A;  2EIK C;  1AI6 A;  5L3F A;  3E83 A;  1CPY A;  1SER A;  4XDM A;  4R6Z A;  3WFV A;  4KQV A;  3TZ2 A;  1GKF A;  1Y8N A;  2YKE A;  2ZD9 A;  2QG0 A;  3SPH A;  3CRK A;  5LHI A;  4JAV A;  2QKS A;  1R62 A;  5GGZ A;  4UUJ C;  4BXI A;  3RVZ A;  2R9R B;  1Y4U A;  4RO2 A;  2Z3Y A;  1NHJ A;  4WUC A;  1I58 A;  2YI5 A;  2IOP A;  3JD3 A;  3EKR A;  1WPX A;  3W7X A;  2XK2 A;  4YKR A;  3SYP A;  1ORQ C;  4MVZ A;  3OMI B;  1H7S A;  1AI4 A;  3OGC C;  3GWO A;  1QZR A;  1K92 A;  1W0J G;  3FB6 C;  1MAB G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...