5IDJA

Bifunctional histidine kinase ccka (domains dhp-ca) in complex with adp/mg2+
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
242
structure length
242
Chain Sequence
LSQAQKMQAIGQLAGGVAHDFNNLLTAIQLRLDQLLHRHPVGDPSYEGLNEIRQTGVRAADLVRKLLAFSRKQTVQREVLDLGELISEFEVLLRRLLREDVKLITDYGRDLPQVRADKSQLETAVMNLAVNARDAVRAAKGGGVVRIRTARLTRDEAIQLGFPAADGDTAFIEVSDDGPGIPPDVMGKIFDPFFTTKPVGEGTGLGLATVYGIVKQSDGWIHVHSRPNEGAAFRIFLPVYEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic di-GMP mediates a histidine kinase/phosphatase switch by noncovalent domain cross-linking.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase
molecule keywords Cell cycle histidine kinase CckA
total genus 63
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5idjA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5idjA02
5M4MA 3TZ5A 2BU6A 2YEDA 3JZ3A 5M4PA 4WUDA 4KSGA 1S16A 5FNCA 4XIQA 3EKRA 1KZNA 3ZRWB 4BAEA 1UYDA 4KQVA 2BU7A 3EHFA 3GIEA 2YE4A 3BM9A 2CCSA 4MPNA 1ZW9A 1TILA 4ASFA 4JQLA 1ID0A 4K4OA 2FXSA 1UYMA 2YGEA 2O1WA 4L94A 1I5CA 4MPCA 2YGFA 1AH8A 4FPPA 5FNFA 3G7BA 4P7AA 3WHAA 2YK9A 2XJJA 4I3HA 3U2KA 3TUHA 1YETA 3HYYA 2XHXA 2BYHA 4W7TA 3K97A 2YE6A 3TTZA 3A0TA 2YE5A 4U93A 2YEAA 1H7SA 2K5BA 3ZKBA 2YI7A 1Y8OA 4LPBA 1Z5CA 2ZDXA 4CWNA 4BQJA 2YE3A 3CWVA 4WUBA 2BU5A 2XCMA 3A0ZA 4XTJA 4V25A 4YKWA 2QG2A 2FTKA 3LPSA 4NH8A 3HYZA 5CTWA 1US7A 3H80A 3CRLA 3KE6A 3G75A 4R3AA 1UY6A 4O05A 3T10A 3EHJA 4R1FA 2GQPA 2GFDA 2WI6A 2XX4A 4HXWA 2P67A 4GEEA 3OWBA 1L0OA 2YEIA 1A4HA 4LP0A 3U67A 2XDXA 3FT5A 4EEHA 3HHUA 1U2OA 2JKIA 3GIGB 1TIDA 4BXIA 4E00A 5M4NA 1MU5A 5IDMA 4O0BA 4KP4A 5BODA 2WI5A 4E02A 4CWPA 3A0RA 2WI1A 2CCTA 4XKAA 1EI1A 2HCHA 4ASGA 2UWDA 2WWWA 1QYEA 3Q5LA 1Z5AA 4GT8A 4FCPA 2BU2A 1BKNA 4JYCA 1YS3A 4EM7A 2BRCA 4EFUA 4GGLA 3RLPA 1AM1A 4HY6A 2PNRA 1UYFA 2YJXA 4FMTA 5C93A 2YKCA 1TH8A 1YESA 2XDLA 4E01A 5CPHA 1BGQA 4CWFA 4AWOA 1UY9A 1ZWHA 4BQGA 4GQTA 2XDSA 2QG0A 1UYEA 2HG1A 5D6QA 3HZ5A 3R4PA 4QPKA 5FWKA 2XDUA 4MTXA 1TC6A 3GIGA 3D36A 2BYIA 4PRVA 2Q8FA 4CE3A 1B3QA 3ZKDA 3TZ4A 3PEHA 4NH7A 3CGYA 5F5RA 2Q8IA 2XX2A 2YE9A 2VCIA 2QM8A 2JJCA 4Q20A 3SL2A 4YKZA 1MX0A 3ZRVA 1UYGA 1YC1A 4L8ZA 2YK2A 4MB9A 4GCZA 2YEEA 3RLQA 1I5BA 3FT8A 4LWIA 4YKTA 3R4NA 2YJWA 1UYHA 4JYBA 4P8OA 2WERA 4EGHA 4MOTA 4WUCA 4HYMA 3FV5A 4PL9A 5BOCA 4EFTA 4I5SA 3VHDA 1YT1A 3TZ2A 2YI0A 3RKZA 2LFSA 4XIRA 2IWSA 4JASA 3R91A 4LWGA 5CTYA 2H55A 5L3JA 1GKXA 2YEGA 3C0EA 1YC4A 2YI5A 4EMVA 5J71A 4MT8A 4PRXA 3P32A 4L93A 2XJXA 1YERA 3D0BA 5CTUA 2YGAA 1EA6A 4FCRA 2BSMA 4H81A 2BZ5A 2FWZA 1Y8NA 1UYIA 2VWCA 4JAUA 3B28A 4GT1A 1H7UA 4HXZA 1S14A 1I58A 4XKOA 3VHAA 4CE1A 2XHRA 4AS9A 2IOPA 3ZCCA 2ZDYA 1IXMA 2VW5A 2YKIA 4XC0A 1YSRA 1B63A 1I5DA 2YKJA 1THNA 4AWQA 3HZ1A 3ZRXA 4EGIA 3VHCA 2QM7A 2HKJA 3CRKA 5CF0A 2YE8A 4XCJA 3R4MA 3B24A 4PU9A 2ESAA 2WI4A 3PEJA 2IWUA 2BREA 4XD8A 4O04A 3T0ZA 2YKEA 1AJ6A 2ZKJA 4EGKA 4LC1A 1BXDA 4LWEA 4H7QA 5M4EA 4XIPA 1NHHA 4CWSA 1I5AA 4CE2A 2XD6A 1Z5BA 4AWPA 3GIFA 4NH9A 1UYLA 2ZBKB 3B27A 2WEPA 2CH4A 4URNA 3WQ9A 5D7RA 1NHIA 1YT2A 2BU8A 3Q5KA 4XDMA 2WI3A 2YE2A 2YEJA 5B1OA 4KFGA 4H85A 3QTFA 3EKOA 1Y4SA 2YE7A 3H4LA 1UY7A 1B62A 1I59A 4YKYA 4XKKA 4CWOA 3A0YA 5B1NA 2QF6A 5CTXA 5FNDA 1PVGA 5IDJA 4CWRA 2EXLA 3O2FA 2FWYA 4ZVIA 3T0HA 4KTNA 1GKZA 2XDKA 3MNRP 1Y4UA 3R4OA 2Q8HA 4O07A 4ASAA 1GJVA 4B7PA 5D7CA 2YI6A 3K60A 4MBCA 3LNUA 1F51A 1UYCA 4HYPA 2E0AA 4HZ0A 3OWDA 3T1KA 3VADA 3K98A 4GFNA 4V26A 2IORA 3TK1A 2IWXA 1YC3A 3B26A 3B25A 4YKRA 1ZXNA 3NXSA 3C11A 3T2SA 2BTZA 3R92A 1TBWA 1KIJA 2CG9A 3HEKA 3IEDA 3INWA 1QY8A 3ZRWA 2CGFA 2O1VA 4DZYA 5J6AA 4KSHA 2WI2A 3Q5JA 2VCJA 2WEQA 2YEHA 1YSZA 4URMA 4X9LA 4U7NA 1JM6A 1Z59A 4ASBA 3QDDA 1AH6A 1NHJA 4QPJA 3TZ0A 2AKPA 3K99A 4O09A 2H8MA 2Q2EB 3DGEA 4L91A 4YKXA 5D6PA 1TC0A 1ZXMA 1AMWA 3O0IA 2XK2A 4HZ5A 4CWTA 3EHGA 4ZKIA 3OPDA 2XX5A 3BMYA 1R62A 4MP7A 2XJGA 2XHTA 5D7DA 4CWQA 1JOYA 3D2RA 5F3KA 4L90A 3G7EA 3MD0A 4MPEA 1YT0A 2IOQA 2YEBA 3CGZA 3U2DA 1OSFA 4MP2A 2FYPA 4UROA 4YKUA 3INXA 4YKQA 4DUHA 5IN9A 4U7OA 5M4KA 1UY8A 3O6OA 4URLA 2O1UA 3A0WA 2XABA 2YEFA 2QFOA 3OW6A 1Y8PA 4XITA 2WI7A 3NMQA 1U0ZA 4JAVA 2YKBA 4XE2A 3RLRA 4BIUA 1QZRA 4HY1A 4B6CA 1BYQA 4FCQA 4XCLA 4BIZA 2BT0A 2YECA 3EHHA 3ZXOA 2CCUA 3ZM7A 3OMUA 3ZXQA 2C2AA 2LFRA 4LWHA 3A0XA 4R3MA 2Q8GA 4LWFA 5GGZA 5M4HA 1UYKA
chains in the Genus database with same CATH superfamily
1LUWA 5M4MA 4MVOA 5IWAO 2IH1C 3BHPA 2CUGA 5J2TB 4G28B 1RP3B 4KSGA 1NH2D 3JAKA 5FNCA 4UVBA 2DN9A 5L3FA 1CP9A 4EFBA 2P06A 3K06A 2CDYA 3L70H 1JVMA 3ZRWB 3E83A 1KZNA 3WB0A 3H1LH 5EBLC 3B2EE 1IVSA 2BU7A 3EHFA 5KHHA 5GONB 4BAYA 2YE4A 2ZT9B 1HWYA 1VQ4V 4CC5A 4MPNA 4DV4O 2H8PC 1AROP 2YXYA 1ID0A 4JQLA 4ASFA 1Q86W 1VF5B 3TJTA 2BSKB 3G71V 2FXSA 2FL4A 2O1WA 4L94A 5IYZA 2EZOA 2YXLA 2ADPA 3CX5F 2F43G 4FZ1A 1JJOA 2R70A 2Y4UA 4DW0A 4I3HA 3U2KA 3TUHA 5JJEB 4P9PA 5D5PA 4CS3A 2XAJA 3RBZA 2ZD9A 2YE5A 3P30A 3A0TA 1H7SA 4Z1VA 2N04A 3SPCA 3A0BZ 3ZKBA 4WFGA 3RYHA 4AILC 1LR1A 3OW2U 3N2GA 1YTFB 5J9PC 2BU5A 2KSDA 4H33A 2FTKA 3LPSA 4NH8A 3ABUA 4W4LA 4G2KA 3RGBA 3JALB 1I94B 4R3AA 1FXVA 2F23A 4AQYB 1UY6A 4UB6Z 4O05A 3HKCB 1EN6A 1L1FA 5F2VO 4LFBO 1VQ5V 4R1FA 3DSQA 4RO2A 3JCUZ 4HXWA 2KB1A 5IE9A 3OWBA 4MTGA 2M6YA 1O9GA 3OR6C 4LF4O 1GRJA 1WPBA 4GX2A 1H2GA 2WLJA 4UCUA 1N0NA 2WI5A 3B8MA 1VQKV 4CWPA 1EZVH 3A0RA 2WI1A 3ETQA 2CCTA 3C90A 1CPYA 1BL8A 5KHIA 2UWDA 2WWWA 3ML0A 1K7DA 3OTFA 4U3JB 1N32B 4EM7A 2BRCA 1QU7A 3MAQA 2PNRA 2PYLA 2Q68A 3JAWA 2P6JA 1H2KA 1D2DA 3IAYA 1WN7A 1F4NA 4LCUC 3UM7A 2XDLA 5LMNO 4E01A 4CWFA 4AWOA 2R9IA 1UY9A 1WNSA 5J2UB 4QGPA 2IJKA 2WLLA 2AZ0A 3AG4C 4FJCC 2QEXV 1QVGU 4CS2A 2A7WA 3HZ5A 3WFVA 3F5TA 3R4PA 5FWKA 2XAQA 2V7QG 2YI9A 3OTOB 3OUSA 1E1QG 3WU2Z 4WBNB 2WLNA 2WPDG 2CK3G 4LF6O 1MSDA 2B5UA 5IJ9B 3E35A 3ZKDA 3JD1A 1XI1A 3TZ4A 3PEHA 5CN0A 2XAFA 1V54B 5EBMC 4DV2O 5F5RA 2VCIA 2JJCA 2N74A 4Q20A 3SL2A 1QLNA 1MX0A 5C8YA 1YC1A 4ICGA 4MB9A 1VIBA 3UO3A 2YEEA 3UCSC 4YY3O 1S77D 4LWIA 2YJWA 2FMLA 4DR6B 4CC6A 2WSSG 3N2GB 4TQDA 3AK2A 4P8OA 4DYLA 4EGHA 4PL9A 4PV1B 1HNZO 1Z2GA 3TZ2A 5B1AB 2GBOA 2IJIA 2IWSA 4JASA 1US6A 3X2QB 4ZI7A 1KECA 5EIBD 4BR6A 5LHHA 1FD9A 2YI8A 5CTYA 1M57C 1FS0G 5L3JA 4WFAV 1KMIZ 4CH4A 4RAIA 4ZI7B 2BTOA 3ZHVA 2OTJV 4ABMA 1M5IA 5CA0B 2DOSA 4WFBV 1SETA 4PJ0Z 4PRXA 3P32A 4UCSA 3SYPA 2XJXA 2HR3A 4MVSA 3BA8A 4DRXA 3CP1A 1R3LC 3O65A 1IBMO 4H0LB 2A06H 5J2UA 2DYRB 4JI4B 2BZ5A 1AI6A 2FWZA 1Y8NA 4MVUA 3MHHC 2VWCA 3N2KB 4UVCA 5J2TA 3JSNA 2XHRA 4O4JB 3FB5C 2VW5A 2W6JG 4XC0A 4JI5B 1VP7A 1YSRA 1B63A 1JFFA 4DV5B 4EB6B 3LSUA 2PTMA 4AWQA 1N4CA 5IYCO 1R6TA 3JD0A 4MW3A 4O2BB 1EN4A 5CF0A 5LHIA 1VQPV 4XCJA 2Q4PA 4PU9A 2QTOA 2B1GA 2EILB 2R9RB 3K03A 3PEJA 3S5TA 3CMEV 4B3SO 3T0ZA 1XHXA 3ASOB 2CTRA 2YIAA 4CH6A 2ZKJA 4EGKA 2JS5A 1EM1A 5LYJB 5M4EA 1NHHA 2RQ6A 1SERA 1Q90D 3GWKC 4AWPA 3JARA 2Q7EA 4FM1A 4JZGA 1XNQO 4H44B 2QWQB 3AK3A 3LUTB 2BU8A 4DR7O 2YEJA 3P3NA 2HJDA 5B1OA 2JDIG 4XBFA 4KFGA 4H85A 1NTKH 1AR4A 5IYDO 4IT5A 3CCUV 2YS8A 3HR0A 1TAEA 4DV0O 1HDJA 1GH6A 3AG7A 1KKDA 2HP8A 1Q5OA 3QF7A 4DV1B 1I0HA 2E74B 1PVGA 1Z5VA 3OMIB 1XEQA 1BE3H 2CH7A 4ZVIA 3UT5A 4KTNA 1H2LA 4BWAA 4MSWC 2BTQB 4DK0A 3ETEA 3JD4A 4CBCA 4LF8O 2YI6A 1ZTEA 2YEVA 3BVOA 4LFAO 3SYCA 5HFLA 3H01A 2HG5C 3ABLC 1WA8A 3GWOA 3OWDA 1ROPA 1GM7A 4V26A 1GAXA 1H38A 2XUMA 4GZRB 3T1CA 4LF6B 1ZXNA 3C11A 1M9NA 4MW8A 4DR2O 4LFCB 1Y74B 2UUAO 1TBWA 1XILA 1JQ0A 2R9AA 4N23A 3K3WA 3HPLC 2CGFA 2AHYA 2VCJA 4E2LA 1PM9A 3IGAC 2DYRC 2ITCC 1FJGB 2YEHA 4LFBB 5LMNB 3TGUH 1K9MW 1AH6A 1XMQO 1GN6A 4HAMA 3AG1B 3I56V 3LMMA 2AW9A 2EILC 3RYIB 2QDOA 4KHPO 1OCCB 3UKMA 4JI1O 4TUYB 2P90A 5LGTA 1ZXMA 5JCOC 1PL0A 2Q6AA 3CCMV 1YVWA 4JGSA 2XX5A 5GONA 2EJRA 3BMYA 3BAAA 5D7DA 1P7GA 5LGUA 3D2RA 1W2BU 3KCYA 5JJNB 1OCRB 2XNDG 1CXZB 4L90A 1R6NA 2XASA 2QJ1A 3MD0A 1BT8A 3J80N 4UB8Z 2IOQA 4HZ3A 4NVPA 1OSFA 4UROA 4DV7B 4H13B 2OIEA 3RVYA 4PDMA 4DUHA 3HKEA 2DQ0A 5IN9A 4U7OA 5HFMA 2EX3A 3NR7A 4TT3G 2YDEA 2AZ2A 2UU9O 2W0FC 5LYJA 4DV4B 1DF4A 1VQ8V 2NLJC 1H2MA 4B7EA 3OW6A 1NTZH 4XITA 2IU3A 1O9HA 3B77A 4NYKA 3CC2V 5JQGA 3NMQA 1U0ZA 4JAVA 3FB6C 1TVKA 2GUZB 1EFRG 2WLIA 1QZRA 4B6CA 1MOFA 4K3AA 3L73H 3ICXA 1ZUQA 3F7VC 2R72A 3W7SA 3ZXOA 3CHXA 1QVFU 2C2AA 4EB6A 2Q8GA 2EZPA 2X6BA 4E4EA 3CE2A 4WFFA 1AP6A 2C1GA 2ODMA 3W7WA 2BU6A 3JZ3A 4WUDA 4DR5O 1S16A 3RYFA 3STLC 1JPXA 2PF4E 4XIQA 1FXKA 1SQQH 2UXXA 3L75H 1UYDA 3GIEA 3IFXA 5L3DA 2D3OW 3CCLV 3L72H 2CCSA 1TILA 1T5EA 4YXWG 2JEUA 2YGEA 1I5CA 1K33A 1H8EG 1QCEA 4O4IB 2YGFA 2QSAA 4FPPA 4X62O 4DR3O 2WLKA 3RYIA 3G7BA 3M99B 5B1BC 1DTOA 4R50A 2YK9A 3APOA 2UXNA 4O4HA 3MDSA 1NJIW 4GUNA 3HYYA 2XHXA 2BYHA 4W7TA 1ORQC 1UPGA 2G38A 2WA3A 4UFZA 3VBBA 2ETNA 1BCCH 3OEHG 4LF7O 4DR6O 5B1BB 2HFEC 5BXZA 1Y8OA 4LPBA 1XL6A 1Z5CA 2ZDXA 1YXBA 2YE3A 3CWVA 3A0ZA 4Z2WA 2VWJA 1Y74A 4F6RA 4V25A 3ZX6A 3E86A 3FX7A 1IZ3A 3APQA 2CTWA 3CRLA 4X66O 1YCIA 4CH5A 2YIBA 1L0LH 4LF7B 3CCRV 1BZKA 4F6EA 4EFEA 1KP2A 1N34O 1F23A 4JI1B 4ZOLA 3G6BA 3EHJA 1SQBH 1RPRA 2GQPA 4LBEC 4QIWF 1GN3A 1KP3A 4G27B 4OGQB 1VQOV 1L0OA 5KHKA 2DYSC 3LDDA 5L3CA 3U67A 3ZMVA 1RSOB 3ASOC 4X62B 3CC7V 2XDXA 1K34A 1U2OA 3GIGB 5LMUB 5M4NA 1HNXO 4XDKA 1FXKC 5LMUO 4E02A 3C3TA 3AEIA 5IY5B 2RCVA 3CS5A 1LNQA 1K5SA 2LW7A 3K59A 4JTDB 4IIJB 2F66C 4RQFA 1QYEA 3Q5LA 2PYJA 1VQ9V 1NZ6A 1Z5AA 3E8BA 2ZNIA 3ABMB 4FFKA 4MVMA 1FKAO 2EINC 1Z5WA 2NR5A 1MSWD 5E1AC 5IWAB 4GGLA 3RLPA 4X64B 2UUCO 4DV7O 1VF7A 1JFFB 3W7UA 1UYFA 1Y76A 1SRYA 3DXRA 1N33O 5C93A 2DE0X 3CD6V 1EZJA 2YKCA 4LR3A 2YC0A 1J5EO 1YESA 3ZHRA 2QKSA 1B06A 1ZWHA 2X6AA 3HB3B 2QG0A 3JCZA 3RYHB 4LF4B 4X89A 2XDUA 4FFBA 1IBKO 3K9SA 4GX5A 2XAHA 1I7FA 3D36A 2OYQA 4PRVA 3SYQA 1Q82W 3LNMB 5FNVB 4CE3A 2Y0IA 1WP7A 5KAFZ 1QHTA 4DV0B 2H94A 4JV5O 4DR4O 2Q8IA 2N05A 1FJGO 2XX2A 1NVPB 2QM8A 4NB5A 1VQNV 1M93A 5B66Z 2FB5A 3IJ4A 3ZRVA 2Z5UA 5DN6G 2BSKA 2QKCA 1K73W 3RLQA 4HNAB 3K57A 4PDVA 1AVMA 4I7ZB 3QO8A 4TQFA 1SC5B 4I0XA 4TV8B 4K35A 2RJZA 4DV3O 4X65B 1UYHA 4HYMA 5LOVB 1SQGA 4JI3B 2YSUB 5DECA 3VQWA 1M90W 3OUFA 4YJ2B 1L0NH 1G4YB 5CA0A 2JGDA 1SQXH 3CRCA 3ZS8C 4X1KB 5KUMA 2YEGA 5IJ9A 3C0EA 4CS4A 4EMVA 5KHGA 4MT8A 1HR0O 1TGOA 1AJNA 1YERA 2YXHA 3MHSC 3TXSA 2UUAB 5CTUA 1A32A 1ZL8B 4L8JA 3E2EA 3ABKB 5IT9N 5GW7A 3RYFB 1H7UA 1S14A 1I58A 3VHAA 3AG3C 4AS9A 3U0ZA 2HHHB 2JJ2G 2QGNA 1BHAA 1AR1B 5H2FZ 4JYAB 4YJ3B 2EIJC 4HBNA 4I9QA 1THNA 5JENA 4PA3A 1M56C 4TV9A 5LA6B 1YZBA 1XNQB 1URFA 4EGIA 1GKFA 2ZNJA 1Q8IA 2K1EA 2CGOA 1MZFA 2ZXWB 1NBMG 2ZDIC 2RNBA 5B5EZ 1V54C 4ZHQB 2ESAA 2WI4A 4KHPB 2OCHA 2IWUA 3QO7A 2BREA 4O04A 3O9OA 5IYBO 3ZBHA 3SYOA 4LC1A 1FPOA 4LWSA 1I5AA 2XD6A 1Z5BA 1ZAUA 3GIFA 3M7MX 2D2CB 4DR7B 2P22C 1PNLA 2CH4A 4URNA 1WAZA 4JYAO 2WI3A 2YE2A 4MVQA 3CYGA 3T4DA 3QTFA 1P7BA 2OWOA 1Q81W 1UY7A 1B62A 3SR2C 4YKYA 4QJFB 3A0YA 1DLBA 5LP6A 4IYIA 1W0JG 5IDJA 1IXBA 1NQTA 1YI2V 5B3SB 2E5LO 4TUYA 2Q69A 2EXLA 2DQ3A 2FWYA 3T0HA 2A9HA 1GKZA 3OM3B 2ZM6O 3MNRP 1Y4UA 2Q8HA 4I9WA 1GJVA 1FFXB 1Q3EA 3K60A 1BMFG 4MBCA 4DV5O 3ZHUA 1QLEC 3E8FA 1UYCA 4HYPA 2BTQA 4GYCB 4ASUG 3ABTA 4PA4A 4JI8B 3H1IH 4DV1O 4GX1A 2CH7B 5CB4B 3B25A 4UV8A 1IBMB 2UUBO 4R7CA 2BTZA 1GTOA 1R73A 4FLXA 2P5OA 2Y69B 5LBQA 1NR7A 2EBOA 4MTOA 1W0KG 2ZKOA 1OCCC 2BOBC 1FXKB 5J6AA 2WI2A 2CE4A 2ZE6A 4WCEV 3CCQV 2WEQA 4YIPA 2DYSB 2EIMC 2LO1A 4U7NA 2CAZC 1KBHA 1Z59A 3E22A 3WG7C 4X1IB 1ENVA 1OCOB 4IHJB 2AKPA 3K99A 3ZN0A 2YUAA 2YIBD 5CBGA 4X88A 4DW1A 5EBWC 4EKWA 3ZMSA 1TC0A 1FXHA 2XOKG 3K08A 1HR0B 1JMKC 1AMWA 3O0IA 4ZKIA 4ZHQA 2KG7A 5JH7B 4MS2A 3SPGA 3RW0A 1R62A 2X7RB 2XJGA 1SA0A 1KKCA 1JOYA 3FB8C 4JI2B 3FB7C 4X9QA 2OT5A 3G7EA 2QR4A 1OZ0A 1PNKA 2YEBA 4K0KO 3CGZA 2UUCB 1GM8A 1P84F 3INXA 4YKUA 5M4KA 3L74H 4J7KA 5LHGA 1N32O 2BE3A 4LNUA 2O1UA 4GLXA 3OGIB 2QFOA 3B09A 3D36C 1Y8PA 3KKYA 5JCOA 1MA1A 2YKBA 2A0LA 4IGGA 3ZMUA 3RLRA 1CEZA 4FCQA 2QTSA 3T2MA 1BS3A 1NKDA 1XMOB 2BT0A 1K4CC 2JS3A 2VQEB 4JTAB 5BY1A 1GMGA 4B3MO 3OMUA 1SQFA 2QWNB 5CA3A 4X1IA 1KYOF 3A0XA 1WPXA 2F1MA 3QNEA 1PNMA 5GGZA 5BMVB 2UU9B 1BQZA 1UYKA 5M4HA 4CZZA 3L9DA 1PV0A 1YJNV 2O57A 5EZYA 3R65A 3TCUA 2YEDA 3TZ5A 5M4PA 3Q4HA 5H6RA 3EKRA 3LNNA 2PZSA 2UXDB 2FKXA 3WB1A 1DF5A 2Q5ZA 3OMAB 1COWG 1KC8W 1ZW9A 3BABA 4BIOA 5IJ0B 4K4OA 1UYMA 2VRZA 2EJ7A 2UUBB 4NXNO 3CXHF 1KD1W 4P7AA 3CCVV 3FKSG 3F5WC 3SJQC 2DMXA 4X20B 2ZCEA 4CH3A 3G80A 1YETA 3CC4V 4O4LB 2VQEO 2YE6A 4LH6A 2JK5C 5AG2A 2YEAA 1TUBA 2GHYA 2K5BA 1G1XB 4DK1A 1HNXB 2Q67A 1OCZC 3FAVB 2XTAA 4CWNA 4OX9B 4BQJA 2ZM6B 1OCZB 4P2ZA 3B4SA 5CTWA 4PI2A 2Q73A 3H80A 4LFCO 4PDLA 2AGAA 2QWOB 3JAWB 1D5NA 4I4TB 1XDCA 3ZMZA 1YJWV 4TSFG 1K4DC 3JD3A 3BA9A 2XX4A 4OPAA 2WI6A 1GN2A 2P67A 2ZE8A 2YEIA 4NXMO 1A4HA 2JEXA 4LP0A 3T4ZA 3EHBB 4EEHA 2UXDO 2JKIA 3HHUA 4E00A 2OCCC 1D5AA 5IDMA 1K97A 2WA4A 4KP4A 5BODA 3ABMC 4FVMA 4FLVA 4PA6A 4B7KA 5LP6B 2HCHA 4ASGA 4XDJA 5L3EA 4FM0A 3DXRB 1SQVH 3SPIA 1BHBA 3ZN1A 3A0HZ 1I94O 4EFUA 1MG1A 1YTFD 3JYCA 5FLXN 4HY6A 4K8XA 5K1PA 1YIJV 4RQEA 4JI7O 4B3RB 2YJXA 5K1XA 4UCVA 5B1AC 4GX0A 2DJVA 2C1IA 5CBFA 4IIJA 5L3GA 1B6QA 1AR5A 1Q6HA 2Y48A 5CPHA 1BGQA 1QLEB 1R3IC 2K9PA 2DW4A 4EEQA 2HG1A 1B04A 4KFMA 4QPKA 3GIGA 1TC6A 2Z3YA 4D6TH 1IURA 1XBLA 2MW2B 4B3SB 1NU1H 4JYYA 2BYIA 3PJSK 3AG1C 3LDCA 4NH7A 1MABG 3HKCA 4OPHA 1ZX3A 3RN4A 3JALA 4YKZA 5BR8O 3AG2C 4B3MB 2Q0AA 1UYGA 4O4JA 3DC5A 1Q7YW 1S0VA 2Q8VA 4GCZA 2GTAA 1MZEA 2E5LB 1I5BA 4HYOA 4F6RB 4YKTA 4NTYA 3EFFK 3R4NA 1F7YA 2QKAA 4JYBA 5JVDB 2WERA 4GKJO 4MOTA 2LGWA 5BOCA 4I5SA 1NI8A 3VQVA 3VHDA 4DXWA 2YI0A 1ZWIC 3CRQA 5FL7G 1IX9A 2EIMB 1VQ6V 3R91A 4LWGA 2ATKC 2L6LA 2H55A 5EC2C 1PL4A 5CMUA 4K0KB 3K5NA 2ZIMA 3CRAA 4DR4B 1YC4A 2YI5A 4JI6O 2EULA 1Q6UA 4P30A 4L93A 5KX5A 3LDEA 2YGAA 2RN9A 3F7YC 1S5HC 2V4DA 1EBOA 1SQPH 2BSMA 2OCCB 2WAMA 4JI0O 3B28A 4HXZA 4XKOA 2JRIA 1KB9F 2ITDC 1YITV 1IBLO 1XNRB 2ZDYA 3I55V 4LF9O 4J80A 2F95B 4YY3B 2YKIA 3K04A 4J7ZA 2Q0OC 5KUKA 1I5DA 1RFYA 3D3IA 5GTIZ 4LF5O 3PN1A 1SESA 4MVZA 3UO2A 3CXCU 2BCCH 4UCTA 2E76B 2HKJA 3CRKA 3FFQA 3OGCC 4DV2B 2YE8A 5LXTB 4U3JA 3B24A 1J95A 1AP5A 4FFBB 1AJQA 4PELA 3DTUB 3FD9A 1XNRO 3R66A 2WLLB 2YICA 3H1JH 1DK1A 4R8CA 1BXDA 4WF9V 4LWEA 5FPOA 3OT7A 3CB2A 4XIPA 2HEPA 4CE2A 4LF8B 1UJWB 2LJ2A 1AI5A 3E22B 1QBZA 4NH9A 1UYLA 5B3SC 4QNHB 5D7RA 4I55B 4ZOLB 3SYAA 1QQCA 1JR9A 1FYJA 1Y4SA 3H4LA 1N36B 4FLUA 4A5UB 1BSMA 3G4SV 3K0DA 2H3OA 4CWOA 4UCOA 3J7AU 2QF6A 3A8TA 5FNDA 5JJJB 2Y69C 3FAVA 2WLHA 2Z0AA 3BEHA 3HKBA 2XDKA 3ETGA 1G6UA 3JASB 4B3RO 4O07A 4ASAA 5BZBA 2GV9A 4UVAA 1XHZA 4J9YB 1N8RW 4LF5B 5EC1C 3C3SA 2VQFO 5TISZ 4HZ0A 3OTOO 3K98A 4GFNA 3CRRA 3TK1A 1YC3A 1OJHA 4ZBMA 2IWXA 3B26A 2AXTZ 1HP8A 2IH3C 3T2SA 1M56B 4H37A 3QG5A 3J81N 3R92A 3W7XA 4NTXA 1KIJA 1NTMH 2CG9A 4NR1A 1QY8A 4AHCA 3ZRWA 5FPRA 3THOA 2GTSA 1X4TA 2O1VA 4DZYA 2P4KA 4NXMB 4KSHA 2GSMB 3SPJA 1BGYH 5EYPB 5JWPA 4NKGB 3ZHSA 4I55A 2EIJB 5EZYB 1R1BA 3KCXA 3HKDA 1VARA 4DR5B 4URMA 2QA4V 3ETDA 2E75B 4ASBA 3QDDA 3TZ0A 3CJHB 4DO2A 2ZXWC 3OEEG 2H8MA 3CCEV 2HHHO 2Q2EB 4YKXA 2GDSA 3W7TA 5D6PA 4FLWA 5ITZB 3BRCA 2W6IG 5IJ0A 2JGUA 4HZ5A 4CWTA 1N36O 3I5DA 4MP7A 5LXTA 2IU0A 2Q7HA 1NT2B 2XHTA 4CWQA 4K8ZA 5F3KA 3DC6A 4N21A 1P4RA 4UUJC 1THZA 4P9OA 1VQ7V 1IBKB 1YT0A 1LUVA 1K8AW 4J42A 1N34B 2HLDG 3T1YO 1SF9A 1QR9A 4MTFA 4R6ZA 4FLTA 3O6OA 3CCJV 1AB3A 4LWSB 5KMGA 4KL1A 3K5LA 3A0WA 3H1HH 1JX9A 2XABA 2YEFA 2LGQA 4X1YA 3ZHQA 2CGNA 1V55B 2WI7A 1N33B 2PUSA 3FYIB 4XE2A 4HY1A 2RDCA 1BYQA 4BIZA 4PA7A 1VQMV 3EHHA 5LL6Y 2CCUA 3ZM7A 1V9PA 1W59A 3ASNB 3ZXQA 1P49A 2DWDC 4L87A 1WJZA 4JI7B 3IC9A 2DWEC 5H9CA 3ZMTA 2NNUA 2NN4A 1XMQB 3JSLA 3B8NA 3P3PA 4NTWA 5EK0A 1Y6XA 5LOVA 4U3FH 2PI5A 1U97A 1TUEB 1ZSPA 1WLEA 2VWKA 4BAEA 1Y66A 2X6CA 1ZL8A 4KQVA 2ZIOA 3A2FA 2BOCC 3BM9A 2QM4A 2CTPA 4DR2B 3WG7B 5C8YB 5CB4A 4MPCA 3CMAV 1AH8A 3OMNB 5FNFA 4IHJA 3WHAA 2XJJA 2EINB 5FNVA 1Q6IA 4YJ2A 4X64O 3K97A 1K3EA 4JI2O 5E79Z 4LFAB 2UXBO 3TTZA 2HVJC 3GVMA 5KLVH 3OFNG 5EYPA 2P7TC 4U93A 2B1IA 4AI8A 1YF2A 4LP8A 4WFEA 2YI7A 1WP8A 2W0XA 4TV8A 4WUBA 1JJ2U 1N0JA 2XCMA 4XTJA 4HNAA 4YKWA 2QG2A 3HYZA 2IW5A 1US7A 3RYCA 3ZHTA 3KE6A 5H6QA 1K5QA 1QR8A 3G75A 3BFRA 1U96A 1XUQA 3M8AA 2UXBB 4DR3B 3SGIA 3T10A 5LP6C 1S5JA 2Q9LA 2JIZG 2GFDA 4J41A 2YEVB 4GEEA 1IDSA 3U10A 2HVKC 2Q7GA 1FFXA 5KA5A 3FT5A 1HNWB 1HW7A 1I5YA 2ZE7A 3JASA 4I50A 3CRMA 4NXNB 4BXIA 3ABLB 1TIDA 4DR1B 2ZR2A 1XOUA 1MU5A 2JJ1G 3HKBB 4PHZA 4X66B 4E72A 4O0BA 2ARHA 1G8MA 5KA6A 1HNWO 3GB7C 5LGNA 2QE7G 3G67A 1FAFA 4XKAA 1XREA 2P4VA 1EI1A 2UXCB 3QTCA 1L8DA 5CA1B 1RSOA 1R3KC 4GT8A 4JZ2A 4FCPA 1BQ0A 2MK3A 4O2BA 3STZC 1Y76B 2BU2A 1BKNA 4JYCA 1AJPA 1Y67A 1YS3A 2F4VO 3K5MA 1M57B 3ZRSA 1PD3A 1I5XA 1AM1A 2QWPB 4W4KA 3E8HA 3OE7G 1XQ8A 4OXSA 4FMTA 4KUMA 1YSCA 5CA1A 1TH8A 2XHBA 1RM1B 4QE9A 1AI7A 1XMOO 4XDLA 1DGSA 1OCRC 3LSSA 3TETA 4YHHO 4BQGA 1H2NA 3CYOA 5D5QA 4GQTA 2LQTA 2XDSA 1UYEA 4DRXB 5D6QA 2ZDIA 3S3XA 5DEDA 3S3WA 4JI4O 4MTXA 3LSQA 3T1HB 2Y0PA 1S72V 1M4UA 1KUQA 2IJHA 2Q8FA 4BW9A 4O4HB 1B3QA 2M7WA 3T1YB 4X20A 3CGYA 5LA6A 2HKOA 2ILMA 3CSXA 2YE9A 3BY6A 2PY5A 2JGDB 1YHQV 3K5OA 4JAAA 1NH2B 4L8ZA 3RYCB 2YK2A 4D7SA 1VMGA 3FT8A 4JF3A 3AG4B 3D8CA 5JVDA 2AHZA 3JAMN 1NS1A 1HNZB 4I0XB 1PPJH 4WUCA 1TUBB 1PP9H 3K9AA 3FV5A 4EFTA 4UCRA 1SZXA 2HJFC 4PA9A 3RT3C 1YT1A 3RKZA 2LFSA 3SJCC 3BPZA 4XIRA 3N27A 2RMKB 2VQFB 1YDXA 4UV9A 4X1KA 1XL4A 3TXQA 4FZ0A 1R3JC 1GKXA 2LP7A 1GO3F 3QO5A 1AI4A 3IC7A 5IYZB 5J71A 1JCHA 1YEWA 4WFHA 1VF6A 1KU9A 5L3BA 1AILA 1WB7A 4ZIBA 3E8GA 1GN4A 3VQYA 3D0BA 2LW1A 4X8AA 4X1YB 5EIBC 1GM9A 2XT9A 1EA6A 4FCRA 1NVPD 4JI0B 3D3QA 4J10A 4H81A 1I08A 1S5LZ 2OTLV 1UYIA 3OAAG 3JAKB 4JAUA 4CE1A 4GT1A 5A2QN 1V55C 3OD4A 2IOPA 1VEWA 3ZCCA 4JI8O 2QWRB 1IXMA 3RVZA 2Y4TA 4GKKO 5BMVA 2YKJA 2V1DA 1Q43A 3JATB 4GKKB 4Z1MG 3HZ1A 3ZRXA 4DV6O 3KZIZ 2QM7A 1SS3A 3VHCA 4B08A 4WBNA 4QE7A 3R4MA 2WLIB 4IL6Z 4B3TB 2KG7B 1TVKB 2GUZA 4F4LA 5JH7A 4DV3B 3VOUA 1KQSU 2KQXA 5GTHZ 4XD8A 4O2AA 4IYHA 2HHIA 2YKEA 2F93B 1AJ6A 4FK5C 3T1HO 3FYEB 4B3TO 5KAIZ 1SKVA 4FIPC 4H7QA 4C7UA 1E79G 4CWSA 3CJHA 2B9ZA 3K79A 1UFIA 3SDLA 4DV6B 3JD2A 4JV5B 2ZBKB 3B27A 2ZINA 2WEPA 2ZE5A 3HKDB 4RUFA 3SJBC 3WQ9A 4TWKA 1QNMA 1NHIA 1YT2A 3Q5KA 3VQXA 4XDMA 1WB8A 1SZTA 5A9GA 4FLZA 1RPOA 1OV9A 2A3QA 4I4TA 1IBLB 3ABKC 3EKOA 2YE7A 4UXNA 3SJAC 4FLYA 1X59A 1VF6C 2EIKB 1MNGA 1I59A 1S3JA 4XKKA 3AG3B 4PDRA 2IJJA 5B1NA 5CTXA 1MMMA 4FM2A 2OIGA 2UXCO 4CWRA 1EN5A 4JI3O 3O2FA 1OHHG 4PI0A 5DM6V 1R6KA 4Q6GA 1WA8B 3R4OA 4KXRA 4X65O 4I50B 4JI6B 3K0GA 4B7PA 5IY5C 5D7CA 3KG2A 4BW5A 3WB2A 5KHJA 3LNUA 3B40A 4YIOA 1GK9A 1F51A 3RWRD 2E0AA 3T1KA 1E1RG 3VADA 1ZLZA 2FYUH 4O4IA 3UT5B 2IORA 4YKRA 2ADQB 3EXAA 3QVNA 3NXSA 1H8HG 4RUEA 2A79B 3HEKA 3CPWU 2XAGA 1VQLV 3IEDA 3INWA 1PKXA 3SPHA 4J9ZB 1F4MA 2L35A 3Q5JA 2IBZH 3Q4HB 4PD4F 3AK1A 4O4LA 1K92A 1YSZA 1NR1A 4X9LA 5CBHA 1JM6A 2F4VB 1S76D 2JVDA 2WLMA 1NHJA 4QPJA 2CTQA 4JI5O 4DUYO 3RFRA 4O09A 2E3CA 4J11A 3E89A 3DGEA 4L91A 3G6EV 3CEIA 3OR7C 4DUZB 4GKJB 4RWUA 2XK2A 3EHGA 3OPDA 4YHHB 1JA8A 3K58A 1M1KW 2ZQMA 1RM1C 3X2QC 1Y4MA 2ZR3A 4D7TA 4DR1O 4TOIA 3ZEDA 5H5NA 3CCSV 5BR8B 4TV9B 4OX9O 3ZIAG 4LF9B 4J7JA 3UQ8A 3CWBH 4MPEA 3ASNC 3U2DA 1YJ9V 4MP2A 2FYPA 4JTCB 4JPRA 2VS0A 1TA8A 2X0LA 4AQYO 3JARB 4YKQA 1UY8A 2PGGA 3N2KA 3H1KH 4URLA 2YIDA 3AG2B 3L71H 3ZJZA 2PI4A 1SA0B 4O2AB 5KX5B 1OCOC 3EVKA 2KKWA 3U11A 5JQGB 1H2SB 4BIUA 3BCCH 3H9VA 2EIKC 4XCLA 5ITZA 2YECA 1J5EB 1FFTB 4LNUB 5KMGB 4DUZO 2LFRA 2IM9A 4LH7A 3JATA 4MVRA 3HKEB 4LWHA 4R3MA 4LWFA 4YJ3A 4DUYB
chains in the Genus database with same CATH topology
4WFFA 1YJNV 5M4MA 4MVOA 2NNUA 3B8NA 2IH1C 3R65A 5EK0A 3TCUA 3W7WA 2BU6A 2YEDA 3JZ3A 3TZ5A 5M4PA 4G28B 4WUDA 4KSGA 1NH2D 2PI5A 1S16A 4UVBA 1JPXA 5H6RA 3STLC 4XIQA 5L3FA 3EKRA 1FXKA 1CP9A 3K06A 1KZNA 1TUEB 1JVMA 3ZRWB 3E83A 2UXXA 1WLEA 4BAEA 1Y66A 2X6CA 1UYDA 1DF5A 5EBLC 2BU7A 3EHFA 4KQVA 3GIEA 3IFXA 5L3DA 3OMAB 4BAYA 2D3OW 3CCLV 2YE4A 2BOCC 1VQ4V 1HWYA 3BM9A 2CCSA 1COWG 1KC8W 1TILA 1ZW9A 4MPNA 2H8PC 1AROP 4JQLA 1ID0A 4K4OA 4ASFA 1Q86W 4YXWG 3WG7B 2FXSA 2JEUA 3G71V 1UYMA 2YGEA 2O1WA 4L94A 1I5CA 1K33A 1H8EG 1QCEA 2EZOA 4MPCA 3CMAV 2F43G 1AH8A 2YGFA 3OMNB 4FPPA 5FNFA 2WLKA 3G7BA 3M99B 5B1BC 1KD1W 3CCVV 4P7AA 3WHAA 3FKSG 1DTOA 3F5WC 4R50A 3SJQC 2YK9A 2XJJA 4I3HA 2UXNA 2EINB 3U2KA 3TUHA 1YETA 1NJIW 4P9PA 3HYYA 2XHXA 2BYHA 3CC4V 4W7TA 3K97A 1ORQC 1K3EA 2XAJA 3VBBA 3RBZA 3OEHG 2YE6A 3TTZA 2HVJC 2ZD9A 2YE5A 3P30A 3A0TA 3U67A 2JK5C 3OFNG 2P7TC 4U93A 2YEAA 1H7SA 5B1BB 2GHYA 2B1IA 2HFEC 4LP8A 3SPCA 4WFEA 1Y8OA 2K5BA 2YI7A 4LPBA 3ZKBA 1XL6A 4WFGA 1Z5CA 2Q67A 2ZDXA 1OCZC 3OW2U 4CWNA 1YTFB 2YE3A 5J9PC 1JJ2U 2BU5A 2XCMA 3A0ZA 3CWVA 4WUBA 1OCZB 4XTJA 4P2ZA 4V25A 4YKWA 4H33A 3E86A 2QG2A 2FTKA 3LPSA 4NH8A 3HYZA 3ABUA 5CTWA 2IW5A 1US7A 4G2KA 3H80A 3CRLA 3KE6A 5H6QA 1K5QA 1QR8A 4PDLA 3G75A 4R3AA 1FXVA 3CCRV 1UY6A 4O05A 1KP2A 1L1FA 1F23A 3T10A 3ZMZA 1YJWV 3EHJA 1RPRA 4TSFG 1K4DC 2JIZG 3JD3A 4RO2A 4LBEC 1VQ5V 2GFDA 2GQPA 2WI6A 2KB1A 2YEVB 2XX4A 4HXWA 4QIWF 1KP3A 2P67A 3OWBA 4GEEA 4G27B 1VQOV 4MTGA 1L0OA 2HVKC 2DYSC 2JEXA 3LDDA 5L3CA 3ZMVA 3ASOC 3OR6C 1A4HA 4LP0A 3T4ZA 5KA5A 3CC7V 2XDXA 3EHBB 3FT5A 1K34A 4EEHA 1I5YA 4GX2A 3HHUA 1U2OA 2JKIA 1H2GA 3ABLB 1TIDA 3GIGB 2ZR2A 2OCCC 4BXIA 4E00A 5M4NA 1MU5A 5IDMA 2JJ1G 4XDKA 1K97A 2WLJA 4O0BA 1FXKC 4KP4A 5BODA 2WI5A 3ABMC 1G8MA 3B8MA 1VQKV 4E02A 3AEIA 5KA6A 4CWPA 3GB7C 3A0RA 5IY5B 5LGNA 2WI1A 1LNQA 1K5SA 2QE7G 2CCTA 4PA6A 4XKAA 1CPYA 1BL8A 1EI1A 2HCHA 4JTDB 4ASGA 4RQFA 2WWWA 3ML0A 4XDJA 1QYEA 2UWDA 3Q5LA 5L3EA 1VQ9V 1K7DA 1Z5AA 3E8BA 1R3KC 3ABMB 4GT8A 4FCPA 4MVMA 2MK3A 3STZC 2EINC 2BU2A 1MSWD 1BKNA 4JYCA 1AJPA 3SPIA 1BHBA 5E1AC 3ZN1A 1YS3A 4EM7A 2BRCA 1M57B 1MG1A 3ZRSA 4GGLA 1YTFD 1PD3A 1I5XA 3JYCA 1AM1A 4HY6A 3RLPA 2PNRA 3E8HA 3OE7G 1YIJV 3W7UA 4RQEA 2Q68A 1UYFA 2YJXA 4OXSA 1SRYA 4FMTA 5B1AC 2P6JA 4GX0A 5C93A 4KUMA 3CD6V 1EZJA 1YSCA 2YKCA 1TH8A 1RM1B 1F4NA 4LCUC 3PEHA 5CBFA 4QE9A 3UM7A 1AI7A 1YESA 5L3GA 1B6QA 2QKSA 2XDLA 4XDLA 4E01A 1OCRC 2Y48A 3LSSA 3TETA 1QLEB 1BGQA 5CPHA 4CWFA 4AWOA 1R3IC 2R9IA 1UY9A 1ZWHA 4BQGA 2X6AA 2IJKA 3CYOA 2WLLA 3HB3B 3AG4C 2DW4A 2XDSA 2QG0A 3JCZA 4FJCC 2QEXV 4GQTA 4X89A 1QVGU 1UYEA 2HG1A 5D6QA 2ZDIA 3HZ5A 4KFMA 3WFVA 3R4PA 4QPKA 5FWKA 2XDUA 2XAQA 4MTXA 1TC6A 3LSQA 3GIGA 1S72V 2Z3YA 2V7QG 4GX5A 2XAHA 2IJHA 1E1QG 3OUSA 3D36A 2BYIA 4PRVA 2WLNA 2Q8FA 3SYQA 1Q82W 3LNMB 2WPDG 2CK3G 3PJSK 1B3QA 2M7WA 2B5UA 4CE3A 3E35A 3ZKDA 3JD1A 3TZ4A 3AG1C 3LDCA 2XAFA 5CN0A 1V54B 2HKOA 5EBMC 2H94A 3CGYA 1MABG 4NH7A 5F5RA 2Q8IA 2XX2A 1NVPB 2VCIA 2QM8A 2YE9A 3BY6A 2JJCA 4Q20A 1VQNV 3SL2A 1YHQV 1QLNA 4YKZA 5DN6G 3ZRVA 2Z5UA 1MX0A 3AG2C 1UYGA 1NH2B 1YC1A 4L8ZA 1Q7YW 1S0VA 2YK2A 4MB9A 4GCZA 1K73W 2YEEA 3RLQA 1I5BA 1S77D 3FT8A 4HYOA 4JF3A 4LWIA 3AG4B 4YKTA 4PDVA 2YJWA 3EFFK 2AHZA 3R4NA 3QO8A 1UYHA 2WSSG 4JYBA 4P8OA 2WERA 4EGHA 4MOTA 4WUCA 3K9AA 3FV5A 4HYMA 4PL9A 5BOCA 4I5SA 4EFTA 2YSUB 3VHDA 4DXWA 2HJFC 4PA9A 1YT1A 3TZ2A 2YI0A 3RKZA 5B1AB 1M90W 1ZWIC 2LFSA 4L91A 5FL7G 3OUFA 2IJIA 4XIRA 1G4YB 2EIMB 1VQ6V 4JASA 2IWSA 3X2QB 1KECA 3R91A 4UV9A 5LHHA 4LWGA 5CTYA 2ATKC 1XL4A 1M57C 1R3JC 2H55A 1FS0G 5EC2C 5L3JA 5KUMA 4WFAV 5CMUA 1GKXA 4RAIA 2YEGA 3C0EA 2LP7A 1GO3F 3QO5A 2OTJV 1AI4A 3IC7A 1YC4A 2YI5A 4EMVA 5J71A 4WFBV 1JCHA 1SETA 4WFHA 5L3BA 4MT8A 4PRXA 4P30A 3P32A 4L93A 1AJNA 3SYPA 2XJXA 3E8GA 1YERA 3MHSC 2HR3A 3LDEA 4MVSA 3D0BA 5CTUA 3CP1A 2YGAA 3F7YC 1R3LC 1S5HC 4X8AA 1GM9A 1EBOA 1EA6A 4FCRA 1NVPD 2BSMA 2DYRB 4H81A 3E2EA 2OTLV 2BZ5A 3ABKB 1AI6A 2OCCB 2FWZA 1Y8NA 1UYIA 4MVUA 3MHHC 5GW7A 3OAAG 2WAMA 4JAUA 2VWCA 4GT1A 1H7UA 3B28A 4UVCA 1I58A 1S14A 3AG3C 4HXZA 4XKOA 3VHAA 2XHRA 1V55C 2ITDC 2IOPA 4AS9A 3ZCCA 1YITV 2JJ2G 2ZDYA 1IXMA 3FB5C 3I55V 2VW5A 2W6JG 1AR1B 1BHAA 2YKIA 3K04A 3RVZA 4XC0A 5KUKA 1YSRA 1B63A 2EIJC 1I5DA 2V1DA 2YKJA 3D3IA 1THNA 4AWQA 1SESA 4PA3A 1M56C 4MVZA 3CXCU 5IYCO 4Z1MG 3HZ1A 3ZRXA 4EGIA 3VHCA 2QM7A 3JD0A 2HKJA 3CRKA 4MW3A 5CF0A 3OGCC 1GKFA 2YE8A 5LHIA 1VQPV 4XCJA 4QE7A 3R4MA 2K1EA 2WLIB 3B24A 4PU9A 1J95A 2ZXWB 1NBMG 2ZDIC 1KQSU 4F4LA 2QTOA 2B1GA 1AJQA 1V54C 2EILB 2R9RB 3K03A 3VOUA 2ESAA 2WI4A 4PELA 3PEJA 5FNCA 2IWUA 3CMEV 3DTUB 3QO7A 2BREA 4O04A 4XD8A 3T0ZA 2YKEA 1AJ6A 3ASOB 5IYBO 4FK5C 2WLLB 2ZKJA 4EGKA 3FYEB 3SYOA 4R8CA 4LC1A 1BXDA 4WF9V 4LWEA 4FIPC 4H7QA 5M4EA 4XIPA 1NHHA 1E79G 4CWSA 1I5AA 3K79A 4CE2A 2XD6A 1UJWB 1SERA 1Z5BA 4AWPA 1AI5A 1QBZA 3GIFA 4NH9A 3JD2A 1UYLA 2ZBKB 5B3SC 3B27A 4QNHB 1PNLA 2WEPA 2CH4A 3LUTB 4URNA 4RUFA 3WQ9A 4TWKA 5D7RA 1NHIA 1YT2A 2BU8A 2YEIA 3Q5KA 4XDMA 1SZTA 3SYAA 2WI3A 2YE2A 2YEJA 4MVQA 3T4DA 4R1FA 5B1OA 2JDIG 4XBFA 4KFGA 1RPOA 3QTFA 4H85A 3ABKC 1P7BA 3EKOA 1Y4SA 2YE7A 5IYDO 3CCUV 3H4LA 1Q81W 4UXNA 1UY7A 1B62A 2EIKB 1I59A 4YKYA 1S3JA 3G4SV 4XKKA 3AG3B 4QJFB 3K0DA 4PDRA 1KKDA 1UYKA 2IJJA 3A0YA 5D6PA 4CWOA 1DLBA 5B1NA 2QF6A 5CTXA 5FNDA 1PVGA 1W0JG 5IDJA 1NQTA 1YI2V 3OMIB 5B3SB 4CWRA 2EXLA 2Q69A 2FWYA 2DQ3A 3O2FA 4ZVIA 2Y69C 3T0HA 4KTNA 2WLHA 3BEHA 2A9HA 1GKZA 1OHHG 3ETGA 1R6KA 3OM3B 5DM6V 2XDKA 4MSWC 3MNRP 1Y4UA 3R4OA 3ETEA 3JD4A 2Q8HA 4O07A 4I9WA 3K0GA 4ASAA 4CBCA 1GJVA 4B7PA 5IY5C 5D7CA 3KG2A 2YI6A 4BW5A 5BZBA 4UVAA 3K60A 1BMFG 4MBCA 3LNUA 2YEVA 4J9YB 1N8RW 5EC1C 3SYCA 1QLEC 1GK9A 3H01A 5HFLA 2HG5C 1F51A 3E8FA 1UYCA 3ABLC 4HYPA 3GWOA 2E0AA 4HZ0A 4ASUG 3OWDA 1E1RG 1ROPA 3ABTA 4PA4A 3K98A 3T1KA 4GFNA 3VADA 4GX1A 1GM7A 4V26A 2IORA 3TK1A 1YC3A 4ZBMA 1H38A 2IWXA 3B26A 3B25A 4YKRA 4UV8A 2IH3C 3T1CA 1ZXNA 3NXSA 3C11A 3T2SA 1M56B 2BTZA 1H8HG 4R7CA 1GTOA 1M9NA 1R73A 4H37A 3W7XA 4RUEA 3R92A 4BQJA 2A79B 4MW8A 1TBWA 2Y69B 5LBQA 1KIJA 2CG9A 1NR7A 2EBOA 3CPWU 2XAGA 1VQLV 3HEKA 4MTOA 1W0KG 3IEDA 3INWA 1JQ0A 1QY8A 4N23A 3ZRWA 3K3WA 3HPLC 1OCCC 2BOBC 2CGFA 2O1VA 1FXKB 1PKXA 4DZYA 5J6AA 2AHYA 3SPHA 2WI2A 4KSHA 4J9ZB 2GSMB 1F4MA 3SPJA 4E2LA 2VCJA 3Q5JA 4CE1A 4WCEV 2EIJB 3IGAC 3CCQV 2WEQA 2DYRC 2ITCC 2YEHA 1K92A 1YSZA 4URMA 2DYSB 2QA4V 1NR1A 4X9LA 2EIMC 5CBHA 3ETDA 4U7NA 1S76D 2WLMA 1JM6A 1Z59A 3QDDA 3WG7C 1K9MW 1AH6A 4ASBA 1NHJA 4QPJA 3TZ0A 4HAMA 1ENVA 3AG1B 3I56V 1OCOB 2AKPA 3K99A 2EILC 4DO2A 4O09A 3ZN0A 2ZXWC 3OEEG 2H8MA 3E89A 3DGEA 5CBGA 3G6EV 4X88A 3W7TA 3OR7C 5EBWC 1OCCB 3UKMA 4EKWA 4YKXA 3ZMSA 1TC0A 1FXHA 2P90A 2XOKG 5LGTA 2W6IG 3K08A 1ZXMA 1PL0A 2Q6AA 1AMWA 2XK2A 3O0IA 4HZ5A 4CWTA 3CCMV 3EHGA 4ZKIA 4JGSA 3OPDA 2XX5A 4MS2A 3SPGA 2EJRA 2ZQMA 1RM1C 3RW0A 3X2QC 1M1KW 1R62A 2X7RB 2XJGA 1Y4MA 2IU0A 3BMYA 2ZR3A 4MP7A 2XHTA 5D7DA 4CWQA 1JOYA 4EFUA 5LGUA 3D2RA 1W2BU 5F3KA 3FB8C 4N21A 1OCRB 1P4RA 2XNDG 3FB7C 4UUJC 1THZA 4P9OA 3CCSV 1VQ7V 2OT5A 3G7EA 1R6NA 3ZIAG 4L90A 2XASA 1OZ0A 3MD0A 1PNKA 4MPEA 3ASNC 1YT0A 2IOQA 2YEBA 3CGZA 3U2DA 4HZ3A 3CCEV 1YJ9V 1K8AW 1OSFA 2FYPA 2Q2EB 4JTCB 4MP2A 4UROA 2HLDG 4JPRA 1GM8A 4YKUA 3RVYA 2X0LA 3INXA 4PDMA 1QR9A 4YKQA 4DUHA 2DQ0A 5IN9A 4MTFA 4U7OA 5M4KA 4R6ZA 5HFMA 1UY8A 3O6OA 4TT3G 5LHGA 3CCJV 4URLA 4CZZA 2W0FC 2O1UA 1DF4A 3A0WA 1VQ8V 2XABA 1JX9A 3AG2B 2NLJC 2YEFA 3ZJZA 2QFOA 3OW6A 2PI4A 1Y8PA 4XITA 1V55B 2IU3A 3B77A 3CC2V 2WI7A 3NMQA 1OCOC 1U0ZA 3FYIB 3FB6C 4JAVA 1EFRG 2YKBA 2A0LA 4XE2A 3ZMUA 4BIUA 2WLIA 1QZRA 4HY1A 1CEZA 3RLRA 4B6CA 1BYQA 4FCQA 1MOFA 2EIKC 4XCLA 3T2MA 1NKDA 4BIZA 3F7VC 4PA7A 1VQMV 2BT0A 1K4CC 2YECA 3W7SA 3EHHA 3ZXOA 2CCUA 1FFTB 4JTAB 3ZM7A 1QVFU 1GMGA 3ASNB 3OMUA 3ZXQA 2C2AA 2LFRA 5CA3A 4LWHA 2DWDC 4L87A 4MVRA 1WPXA 3A0XA 4R3MA 3QNEA 2Q8GA 1PNMA 4LWFA 5GGZA 2EZPA 2DWEC 2X6BA 5M4HA 5H9CA 3ZMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M4M A;  3TZ5 A;  2BU6 A;  2YED A;  3JZ3 A;  5M4P A;  4WUD A;  4KSG A;  1S16 A;  5FNC A;  4XIQ A;  3EKR A;  1KZN A;  3ZRW B;  4BAE A;  1UYD A;  4KQV A;  2BU7 A;  3EHF A;  3GIE A;  2YE4 A;  3BM9 A;  2CCS A;  4MPN A;  1ZW9 A;  1TIL A;  4ASF A;  4JQL A;  1ID0 A;  4K4O A;  2FXS A;  1UYM A;  2YGE A;  2O1W A;  4L94 A;  1I5C A;  4MPC A;  2YGF A;  1AH8 A;  4FPP A;  5FNF A;  3G7B A;  4P7A A;  3WHA A;  2YK9 A;  2XJJ A;  4I3H A;  3U2K A;  3TUH A;  1YET A;  3HYY A;  2XHX A;  2BYH A;  4W7T A;  3K97 A;  2YE6 A;  3TTZ A;  3A0T A;  2YE5 A;  4U93 A;  2YEA A;  1H7S A;  2K5B A;  3ZKB A;  2YI7 A;  1Y8O A;  4LPB A;  1Z5C A;  2ZDX A;  4CWN A;  4BQJ A;  2YE3 A;  3CWV A;  4WUB A;  2BU5 A;  2XCM A;  3A0Z A;  4XTJ A;  4V25 A;  4YKW A;  2QG2 A;  2FTK A;  3LPS A;  4NH8 A;  3HYZ A;  5CTW A;  1US7 A;  3H80 A;  3CRL A;  3KE6 A;  3G75 A;  4R3A A;  1UY6 A;  4O05 A;  3T10 A;  3EHJ A;  4R1F A;  2GQP A;  2GFD A;  2WI6 A;  2XX4 A;  4HXW A;  2P67 A;  4GEE A;  3OWB A;  1L0O A;  2YEI A;  1A4H A;  4LP0 A;  3U67 A;  2XDX A;  3FT5 A;  4EEH A;  3HHU A;  1U2O A;  2JKI A;  3GIG B;  1TID A;  4BXI A;  4E00 A;  5M4N A;  1MU5 A;  5IDM A;  4O0B A;  4KP4 A;  5BOD A;  2WI5 A;  4E02 A;  4CWP A;  3A0R A;  2WI1 A;  2CCT A;  4XKA A;  1EI1 A;  2HCH A;  4ASG A;  2UWD A;  2WWW A;  1QYE A;  3Q5L A;  1Z5A A;  4GT8 A;  4FCP A;  2BU2 A;  1BKN A;  4JYC A;  1YS3 A;  4EM7 A;  2BRC A;  4EFU A;  4GGL A;  3RLP A;  1AM1 A;  4HY6 A;  2PNR A;  1UYF A;  2YJX A;  4FMT A;  5C93 A;  2YKC A;  1TH8 A;  1YES A;  2XDL A;  4E01 A;  5CPH A;  1BGQ A;  4CWF A;  4AWO A;  1UY9 A;  1ZWH A;  4BQG A;  4GQT A;  2XDS A;  2QG0 A;  1UYE A;  2HG1 A;  5D6Q A;  3HZ5 A;  3R4P A;  4QPK A;  5FWK A;  2XDU A;  4MTX A;  1TC6 A;  3GIG A;  3D36 A;  2BYI A;  4PRV A;  2Q8F A;  4CE3 A;  1B3Q A;  3ZKD A;  3TZ4 A;  3PEH A;  4NH7 A;  3CGY A;  5F5R A;  2Q8I A;  2XX2 A;  2YE9 A;  2VCI A;  2QM8 A;  2JJC A;  4Q20 A;  3SL2 A;  4YKZ A;  1MX0 A;  3ZRV A;  1UYG A;  1YC1 A;  4L8Z A;  2YK2 A;  4MB9 A;  4GCZ A;  2YEE A;  3RLQ A;  1I5B A;  3FT8 A;  4LWI A;  4YKT A;  3R4N A;  2YJW A;  1UYH A;  4JYB A;  4P8O A;  2WER A;  4EGH A;  4MOT A;  4WUC A;  4HYM A;  3FV5 A;  4PL9 A;  5BOC A;  4EFT A;  4I5S A;  3VHD A;  1YT1 A;  3TZ2 A;  2YI0 A;  3RKZ A;  2LFS A;  4XIR A;  2IWS A;  4JAS A;  3R91 A;  4LWG A;  5CTY A;  2H55 A;  5L3J A;  1GKX A;  2YEG A;  3C0E A;  1YC4 A;  2YI5 A;  4EMV A;  5J71 A;  4MT8 A;  4PRX A;  3P32 A;  4L93 A;  2XJX A;  1YER A;  3D0B A;  5CTU A;  2YGA A;  1EA6 A;  4FCR A;  2BSM A;  4H81 A;  2BZ5 A;  2FWZ A;  1Y8N A;  1UYI A;  2VWC A;  4JAU A;  3B28 A;  4GT1 A;  1H7U A;  4HXZ A;  1S14 A;  1I58 A;  4XKO A;  3VHA A;  4CE1 A;  2XHR A;  4AS9 A;  2IOP A;  3ZCC A;  2ZDY A;  1IXM A;  2VW5 A;  2YKI A;  4XC0 A;  1YSR A;  1B63 A;  1I5D A;  2YKJ A;  1THN A;  4AWQ A;  3HZ1 A;  3ZRX A;  4EGI A;  3VHC A;  2QM7 A;  2HKJ A;  3CRK A;  5CF0 A;  2YE8 A;  4XCJ A;  3R4M A;  3B24 A;  4PU9 A;  2ESA A;  2WI4 A;  3PEJ A;  2IWU A;  2BRE A;  4XD8 A;  4O04 A;  3T0Z A;  2YKE A;  1AJ6 A;  2ZKJ A;  4EGK A;  4LC1 A;  1BXD A;  4LWE A;  4H7Q A;  5M4E A;  4XIP A;  1NHH A;  4CWS A;  1I5A A;  4CE2 A;  2XD6 A;  1Z5B A;  4AWP A;  3GIF A;  4NH9 A;  1UYL A;  2ZBK B;  3B27 A;  2WEP A;  2CH4 A;  4URN A;  3WQ9 A;  5D7R A;  1NHI A;  1YT2 A;  2BU8 A;  3Q5K A;  4XDM A;  2WI3 A;  2YE2 A;  2YEJ A;  5B1O A;  4KFG A;  4H85 A;  3QTF A;  3EKO A;  1Y4S A;  2YE7 A;  3H4L A;  1UY7 A;  1B62 A;  1I59 A;  4YKY A;  4XKK A;  4CWO A;  3A0Y A;  5B1N A;  2QF6 A;  5CTX A;  5FND A;  1PVG A;  5IDJ A;  4CWR A;  2EXL A;  3O2F A;  2FWY A;  4ZVI A;  3T0H A;  4KTN A;  1GKZ A;  2XDK A;  3MNR P;  1Y4U A;  3R4O A;  2Q8H A;  4O07 A;  4ASA A;  1GJV A;  4B7P A;  5D7C A;  2YI6 A;  3K60 A;  4MBC A;  3LNU A;  1F51 A;  1UYC A;  4HYP A;  2E0A A;  4HZ0 A;  3OWD A;  3T1K A;  3VAD A;  3K98 A;  4GFN A;  4V26 A;  2IOR A;  3TK1 A;  2IWX A;  1YC3 A;  3B26 A;  3B25 A;  4YKR A;  1ZXN A;  3NXS A;  3C11 A;  3T2S A;  2BTZ A;  3R92 A;  1TBW A;  1KIJ A;  2CG9 A;  3HEK A;  3IED A;  3INW A;  1QY8 A;  3ZRW A;  2CGF A;  2O1V A;  4DZY A;  5J6A A;  4KSH A;  2WI2 A;  3Q5J A;  2VCJ A;  2WEQ A;  2YEH A;  1YSZ A;  4URM A;  4X9L A;  4U7N A;  1JM6 A;  1Z59 A;  4ASB A;  3QDD A;  1AH6 A;  1NHJ A;  4QPJ A;  3TZ0 A;  2AKP A;  3K99 A;  4O09 A;  2H8M A;  2Q2E B;  3DGE A;  4L91 A;  4YKX A;  5D6P A;  1TC0 A;  1ZXM A;  1AMW A;  3O0I A;  2XK2 A;  4HZ5 A;  4CWT A;  3EHG A;  4ZKI A;  3OPD A;  2XX5 A;  3BMY A;  1R62 A;  4MP7 A;  2XJG A;  2XHT A;  5D7D A;  4CWQ A;  1JOY A;  3D2R A;  5F3K A;  4L90 A;  3G7E A;  3MD0 A;  4MPE A;  1YT0 A;  2IOQ A;  2YEB A;  3CGZ A;  3U2D A;  1OSF A;  4MP2 A;  2FYP A;  4URO A;  4YKU A;  3INX A;  4YKQ A;  4DUH A;  5IN9 A;  4U7O A;  5M4K A;  1UY8 A;  3O6O A;  4URL A;  2O1U A;  3A0W A;  2XAB A;  2YEF A;  2QFO A;  3OW6 A;  1Y8P A;  4XIT A;  2WI7 A;  3NMQ A;  1U0Z A;  4JAV A;  2YKB A;  4XE2 A;  3RLR A;  4BIU A;  1QZR A;  4HY1 A;  4B6C A;  1BYQ A;  4FCQ A;  4XCL A;  4BIZ A;  2BT0 A;  2YEC A;  3EHH A;  3ZXO A;  2CCU A;  3ZM7 A;  3OMU A;  3ZXQ A;  2C2A A;  2LFR A;  4LWH A;  3A0X A;  4R3M A;  2Q8G A;  4LWF A;  5GGZ A;  5M4H A;  1UYK A; 
#chains in the Genus database with same CATH topology
 1LUW A;  5M4M A;  4MVO A;  5IWA O;  2IH1 C;  3BHP A;  2CUG A;  5J2T B;  4G28 B;  1RP3 B;  4KSG A;  1NH2 D;  3JAK A;  5FNC A;  4UVB A;  2DN9 A;  5L3F A;  1CP9 A;  4EFB A;  2P06 A;  3K06 A;  2CDY A;  3L70 H;  1JVM A;  3ZRW B;  3E83 A;  1KZN A;  3WB0 A;  3H1L H;  5EBL C;  3B2E E;  1IVS A;  2BU7 A;  3EHF A;  5KHH A;  5GON B;  4BAY A;  2YE4 A;  2ZT9 B;  1HWY A;  1VQ4 V;  4CC5 A;  4MPN A;  4DV4 O;  2H8P C;  1ARO P;  2YXY A;  1ID0 A;  4JQL A;  4ASF A;  1Q86 W;  1VF5 B;  3TJT A;  2BSK B;  3G71 V;  2FXS A;  2FL4 A;  2O1W A;  4L94 A;  5IYZ A;  2EZO A;  2YXL A;  2ADP A;  3CX5 F;  2F43 G;  4FZ1 A;  1JJO A;  2R70 A;  2Y4U A;  4DW0 A;  4I3H A;  3U2K A;  3TUH A;  5JJE B;  4P9P A;  5D5P A;  4CS3 A;  2XAJ A;  3RBZ A;  2ZD9 A;  2YE5 A;  3P30 A;  3A0T A;  1H7S A;  4Z1V A;  2N04 A;  3SPC A;  3A0B Z;  3ZKB A;  4WFG A;  3RYH A;  4AIL C;  1LR1 A;  3OW2 U;  3N2G A;  1YTF B;  5J9P C;  2BU5 A;  2KSD A;  4H33 A;  2FTK A;  3LPS A;  4NH8 A;  3ABU A;  4W4L A;  4G2K A;  3RGB A;  3JAL B;  1I94 B;  4R3A A;  1FXV A;  2F23 A;  4AQY B;  1UY6 A;  4UB6 Z;  4O05 A;  3HKC B;  1EN6 A;  1L1F A;  5F2V O;  4LFB O;  1VQ5 V;  4R1F A;  3DSQ A;  4RO2 A;  3JCU Z;  4HXW A;  2KB1 A;  5IE9 A;  3OWB A;  4MTG A;  2M6Y A;  1O9G A;  3OR6 C;  4LF4 O;  1GRJ A;  1WPB A;  4GX2 A;  1H2G A;  2WLJ A;  4UCU A;  1N0N A;  2WI5 A;  3B8M A;  1VQK V;  4CWP A;  1EZV H;  3A0R A;  2WI1 A;  3ETQ A;  2CCT A;  3C90 A;  1CPY A;  1BL8 A;  5KHI A;  2UWD A;  2WWW A;  3ML0 A;  1K7D A;  3OTF A;  4U3J B;  1N32 B;  4EM7 A;  2BRC A;  1QU7 A;  3MAQ A;  2PNR A;  2PYL A;  2Q68 A;  3JAW A;  2P6J A;  1H2K A;  1D2D A;  3IAY A;  1WN7 A;  1F4N A;  4LCU C;  3UM7 A;  2XDL A;  5LMN O;  4E01 A;  4CWF A;  4AWO A;  2R9I A;  1UY9 A;  1WNS A;  5J2U B;  4QGP A;  2IJK A;  2WLL A;  2AZ0 A;  3AG4 C;  4FJC C;  2QEX V;  1QVG U;  4CS2 A;  2A7W A;  3HZ5 A;  3WFV A;  3F5T A;  3R4P A;  5FWK A;  2XAQ A;  2V7Q G;  2YI9 A;  3OTO B;  3OUS A;  1E1Q G;  3WU2 Z;  4WBN B;  2WLN A;  2WPD G;  2CK3 G;  4LF6 O;  1MSD A;  2B5U A;  5IJ9 B;  3E35 A;  3ZKD A;  3JD1 A;  1XI1 A;  3TZ4 A;  3PEH A;  5CN0 A;  2XAF A;  1V54 B;  5EBM C;  4DV2 O;  5F5R A;  2VCI A;  2JJC A;  2N74 A;  4Q20 A;  3SL2 A;  1QLN A;  1MX0 A;  5C8Y A;  1YC1 A;  4ICG A;  4MB9 A;  1VIB A;  3UO3 A;  2YEE A;  3UCS C;  4YY3 O;  1S77 D;  4LWI A;  2YJW A;  2FML A;  4DR6 B;  4CC6 A;  2WSS G;  3N2G B;  4TQD A;  3AK2 A;  4P8O A;  4DYL A;  4EGH A;  4PL9 A;  4PV1 B;  1HNZ O;  1Z2G A;  3TZ2 A;  5B1A B;  2GBO A;  2IJI A;  2IWS A;  4JAS A;  1US6 A;  3X2Q B;  4ZI7 A;  1KEC A;  5EIB D;  4BR6 A;  5LHH A;  1FD9 A;  2YI8 A;  5CTY A;  1M57 C;  1FS0 G;  5L3J A;  4WFA V;  1KMI Z;  4CH4 A;  4RAI A;  4ZI7 B;  2BTO A;  3ZHV A;  2OTJ V;  4ABM A;  1M5I A;  5CA0 B;  2DOS A;  4WFB V;  1SET A;  4PJ0 Z;  4PRX A;  3P32 A;  4UCS A;  3SYP A;  2XJX A;  2HR3 A;  4MVS A;  3BA8 A;  4DRX A;  3CP1 A;  1R3L C;  3O65 A;  1IBM O;  4H0L B;  2A06 H;  5J2U A;  2DYR B;  4JI4 B;  2BZ5 A;  1AI6 A;  2FWZ A;  1Y8N A;  4MVU A;  3MHH C;  2VWC A;  3N2K B;  4UVC A;  5J2T A;  3JSN A;  2XHR A;  4O4J B;  3FB5 C;  2VW5 A;  2W6J G;  4XC0 A;  4JI5 B;  1VP7 A;  1YSR A;  1B63 A;  1JFF A;  4DV5 B;  4EB6 B;  3LSU A;  2PTM A;  4AWQ A;  1N4C A;  5IYC O;  1R6T A;  3JD0 A;  4MW3 A;  4O2B B;  1EN4 A;  5CF0 A;  5LHI A;  1VQP V;  4XCJ A;  2Q4P A;  4PU9 A;  2QTO A;  2B1G A;  2EIL B;  2R9R B;  3K03 A;  3PEJ A;  3S5T A;  3CME V;  4B3S O;  3T0Z A;  1XHX A;  3ASO B;  2CTR A;  2YIA A;  4CH6 A;  2ZKJ A;  4EGK A;  2JS5 A;  1EM1 A;  5LYJ B;  5M4E A;  1NHH A;  2RQ6 A;  1SER A;  1Q90 D;  3GWK C;  4AWP A;  3JAR A;  2Q7E A;  4FM1 A;  4JZG A;  1XNQ O;  4H44 B;  2QWQ B;  3AK3 A;  3LUT B;  2BU8 A;  4DR7 O;  2YEJ A;  3P3N A;  2HJD A;  5B1O A;  2JDI G;  4XBF A;  4KFG A;  4H85 A;  1NTK H;  1AR4 A;  5IYD O;  4IT5 A;  3CCU V;  2YS8 A;  3HR0 A;  1TAE A;  4DV0 O;  1HDJ A;  1GH6 A;  3AG7 A;  1KKD A;  2HP8 A;  1Q5O A;  3QF7 A;  4DV1 B;  1I0H A;  2E74 B;  1PVG A;  1Z5V A;  3OMI B;  1XEQ A;  1BE3 H;  2CH7 A;  4ZVI A;  3UT5 A;  4KTN A;  1H2L A;  4BWA A;  4MSW C;  2BTQ B;  4DK0 A;  3ETE A;  3JD4 A;  4CBC A;  4LF8 O;  2YI6 A;  1ZTE A;  2YEV A;  3BVO A;  4LFA O;  3SYC A;  5HFL A;  3H01 A;  2HG5 C;  3ABL C;  1WA8 A;  3GWO A;  3OWD A;  1ROP A;  1GM7 A;  4V26 A;  1GAX A;  1H38 A;  2XUM A;  4GZR B;  3T1C A;  4LF6 B;  1ZXN A;  3C11 A;  1M9N A;  4MW8 A;  4DR2 O;  4LFC B;  1Y74 B;  2UUA O;  1TBW A;  1XIL A;  1JQ0 A;  2R9A A;  4N23 A;  3K3W A;  3HPL C;  2CGF A;  2AHY A;  2VCJ A;  4E2L A;  1PM9 A;  3IGA C;  2DYR C;  2ITC C;  1FJG B;  2YEH A;  4LFB B;  5LMN B;  3TGU H;  1K9M W;  1AH6 A;  1XMQ O;  1GN6 A;  4HAM A;  3AG1 B;  3I56 V;  3LMM A;  2AW9 A;  2EIL C;  3RYI B;  2QDO A;  4KHP O;  1OCC B;  3UKM A;  4JI1 O;  4TUY B;  2P90 A;  5LGT A;  1ZXM A;  5JCO C;  1PL0 A;  2Q6A A;  3CCM V;  1YVW A;  4JGS A;  2XX5 A;  5GON A;  2EJR A;  3BMY A;  3BAA A;  5D7D A;  1P7G A;  5LGU A;  3D2R A;  1W2B U;  3KCY A;  5JJN B;  1OCR B;  2XND G;  1CXZ B;  4L90 A;  1R6N A;  2XAS A;  2QJ1 A;  3MD0 A;  1BT8 A;  3J80 N;  4UB8 Z;  2IOQ A;  4HZ3 A;  4NVP A;  1OSF A;  4URO A;  4DV7 B;  4H13 B;  2OIE A;  3RVY A;  4PDM A;  4DUH A;  3HKE A;  2DQ0 A;  5IN9 A;  4U7O A;  5HFM A;  2EX3 A;  3NR7 A;  4TT3 G;  2YDE A;  2AZ2 A;  2UU9 O;  2W0F C;  5LYJ A;  4DV4 B;  1DF4 A;  1VQ8 V;  2NLJ C;  1H2M A;  4B7E A;  3OW6 A;  1NTZ H;  4XIT A;  2IU3 A;  1O9H A;  3B77 A;  4NYK A;  3CC2 V;  5JQG A;  3NMQ A;  1U0Z A;  4JAV A;  3FB6 C;  1TVK A;  2GUZ B;  1EFR G;  2WLI A;  1QZR A;  4B6C A;  1MOF A;  4K3A A;  3L73 H;  3ICX A;  1ZUQ A;  3F7V C;  2R72 A;  3W7S A;  3ZXO A;  3CHX A;  1QVF U;  2C2A A;  4EB6 A;  2Q8G A;  2EZP A;  2X6B A;  4E4E A;  3CE2 A;  4WFF A;  1AP6 A;  2C1G A;  2ODM A;  3W7W A;  2BU6 A;  3JZ3 A;  4WUD A;  4DR5 O;  1S16 A;  3RYF A;  3STL C;  1JPX A;  2PF4 E;  4XIQ A;  1FXK A;  1SQQ H;  2UXX A;  3L75 H;  1UYD A;  3GIE A;  3IFX A;  5L3D A;  2D3O W;  3CCL V;  3L72 H;  2CCS A;  1TIL A;  1T5E A;  4YXW G;  2JEU A;  2YGE A;  1I5C A;  1K33 A;  1H8E G;  1QCE A;  4O4I B;  2YGF A;  2QSA A;  4FPP A;  4X62 O;  4DR3 O;  2WLK A;  3RYI A;  3G7B A;  3M99 B;  5B1B C;  1DTO A;  4R50 A;  2YK9 A;  3APO A;  2UXN A;  4O4H A;  3MDS A;  1NJI W;  4GUN A;  3HYY A;  2XHX A;  2BYH A;  4W7T A;  1ORQ C;  1UPG A;  2G38 A;  2WA3 A;  4UFZ A;  3VBB A;  2ETN A;  1BCC H;  3OEH G;  4LF7 O;  4DR6 O;  5B1B B;  2HFE C;  5BXZ A;  1Y8O A;  4LPB A;  1XL6 A;  1Z5C A;  2ZDX A;  1YXB A;  2YE3 A;  3CWV A;  3A0Z A;  4Z2W A;  2VWJ A;  1Y74 A;  4F6R A;  4V25 A;  3ZX6 A;  3E86 A;  3FX7 A;  1IZ3 A;  3APQ A;  2CTW A;  3CRL A;  4X66 O;  1YCI A;  4CH5 A;  2YIB A;  1L0L H;  4LF7 B;  3CCR V;  1BZK A;  4F6E A;  4EFE A;  1KP2 A;  1N34 O;  1F23 A;  4JI1 B;  4ZOL A;  3G6B A;  3EHJ A;  1SQB H;  1RPR A;  2GQP A;  4LBE C;  4QIW F;  1GN3 A;  1KP3 A;  4G27 B;  4OGQ B;  1VQO V;  1L0O A;  5KHK A;  2DYS C;  3LDD A;  5L3C A;  3U67 A;  3ZMV A;  1RSO B;  3ASO C;  4X62 B;  3CC7 V;  2XDX A;  1K34 A;  1U2O A;  3GIG B;  5LMU B;  5M4N A;  1HNX O;  4XDK A;  1FXK C;  5LMU O;  4E02 A;  3C3T A;  3AEI A;  5IY5 B;  2RCV A;  3CS5 A;  1LNQ A;  1K5S A;  2LW7 A;  3K59 A;  4JTD B;  4IIJ B;  2F66 C;  4RQF A;  1QYE A;  3Q5L A;  2PYJ A;  1VQ9 V;  1NZ6 A;  1Z5A A;  3E8B A;  2ZNI A;  3ABM B;  4FFK A;  4MVM A;  1FKA O;  2EIN C;  1Z5W A;  2NR5 A;  1MSW D;  5E1A C;  5IWA B;  4GGL A;  3RLP A;  4X64 B;  2UUC O;  4DV7 O;  1VF7 A;  1JFF B;  3W7U A;  1UYF A;  1Y76 A;  1SRY A;  3DXR A;  1N33 O;  5C93 A;  2DE0 X;  3CD6 V;  1EZJ A;  2YKC A;  4LR3 A;  2YC0 A;  1J5E O;  1YES A;  3ZHR A;  2QKS A;  1B06 A;  1ZWH A;  2X6A A;  3HB3 B;  2QG0 A;  3JCZ A;  3RYH B;  4LF4 B;  4X89 A;  2XDU A;  4FFB A;  1IBK O;  3K9S A;  4GX5 A;  2XAH A;  1I7F A;  3D36 A;  2OYQ A;  4PRV A;  3SYQ A;  1Q82 W;  3LNM B;  5FNV B;  4CE3 A;  2Y0I A;  1WP7 A;  5KAF Z;  1QHT A;  4DV0 B;  2H94 A;  4JV5 O;  4DR4 O;  2Q8I A;  2N05 A;  1FJG O;  2XX2 A;  1NVP B;  2QM8 A;  4NB5 A;  1VQN V;  1M93 A;  5B66 Z;  2FB5 A;  3IJ4 A;  3ZRV A;  2Z5U A;  5DN6 G;  2BSK A;  2QKC A;  1K73 W;  3RLQ A;  4HNA B;  3K57 A;  4PDV A;  1AVM A;  4I7Z B;  3QO8 A;  4TQF A;  1SC5 B;  4I0X A;  4TV8 B;  4K35 A;  2RJZ A;  4DV3 O;  4X65 B;  1UYH A;  4HYM A;  5LOV B;  1SQG A;  4JI3 B;  2YSU B;  5DEC A;  3VQW A;  1M90 W;  3OUF A;  4YJ2 B;  1L0N H;  1G4Y B;  5CA0 A;  2JGD A;  1SQX H;  3CRC A;  3ZS8 C;  4X1K B;  5KUM A;  2YEG A;  5IJ9 A;  3C0E A;  4CS4 A;  4EMV A;  5KHG A;  4MT8 A;  1HR0 O;  1TGO A;  1AJN A;  1YER A;  2YXH A;  3MHS C;  3TXS A;  2UUA B;  5CTU A;  1A32 A;  1ZL8 B;  4L8J A;  3E2E A;  3ABK B;  5IT9 N;  5GW7 A;  3RYF B;  1H7U A;  1S14 A;  1I58 A;  3VHA A;  3AG3 C;  4AS9 A;  3U0Z A;  2HHH B;  2JJ2 G;  2QGN A;  1BHA A;  1AR1 B;  5H2F Z;  4JYA B;  4YJ3 B;  2EIJ C;  4HBN A;  4I9Q A;  1THN A;  5JEN A;  4PA3 A;  1M56 C;  4TV9 A;  5LA6 B;  1YZB A;  1XNQ B;  1URF A;  4EGI A;  1GKF A;  2ZNJ A;  1Q8I A;  2K1E A;  2CGO A;  1MZF A;  2ZXW B;  1NBM G;  2ZDI C;  2RNB A;  5B5E Z;  1V54 C;  4ZHQ B;  2ESA A;  2WI4 A;  4KHP B;  2OCH A;  2IWU A;  3QO7 A;  2BRE A;  4O04 A;  3O9O A;  5IYB O;  3ZBH A;  3SYO A;  4LC1 A;  1FPO A;  4LWS A;  1I5A A;  2XD6 A;  1Z5B A;  1ZAU A;  3GIF A;  3M7M X;  2D2C B;  4DR7 B;  2P22 C;  1PNL A;  2CH4 A;  4URN A;  1WAZ A;  4JYA O;  2WI3 A;  2YE2 A;  4MVQ A;  3CYG A;  3T4D A;  3QTF A;  1P7B A;  2OWO A;  1Q81 W;  1UY7 A;  1B62 A;  3SR2 C;  4YKY A;  4QJF B;  3A0Y A;  1DLB A;  5LP6 A;  4IYI A;  1W0J G;  5IDJ A;  1IXB A;  1NQT A;  1YI2 V;  5B3S B;  2E5L O;  4TUY A;  2Q69 A;  2EXL A;  2DQ3 A;  2FWY A;  3T0H A;  2A9H A;  1GKZ A;  3OM3 B;  2ZM6 O;  3MNR P;  1Y4U A;  2Q8H A;  4I9W A;  1GJV A;  1FFX B;  1Q3E A;  3K60 A;  1BMF G;  4MBC A;  4DV5 O;  3ZHU A;  1QLE C;  3E8F A;  1UYC A;  4HYP A;  2BTQ A;  4GYC B;  4ASU G;  3ABT A;  4PA4 A;  4JI8 B;  3H1I H;  4DV1 O;  4GX1 A;  2CH7 B;  5CB4 B;  3B25 A;  4UV8 A;  1IBM B;  2UUB O;  4R7C A;  2BTZ A;  1GTO A;  1R73 A;  4FLX A;  2P5O A;  2Y69 B;  5LBQ A;  1NR7 A;  2EBO A;  4MTO A;  1W0K G;  2ZKO A;  1OCC C;  2BOB C;  1FXK B;  5J6A A;  2WI2 A;  2CE4 A;  2ZE6 A;  4WCE V;  3CCQ V;  2WEQ A;  4YIP A;  2DYS B;  2EIM C;  2LO1 A;  4U7N A;  2CAZ C;  1KBH A;  1Z59 A;  3E22 A;  3WG7 C;  4X1I B;  1ENV A;  1OCO B;  4IHJ B;  2AKP A;  3K99 A;  3ZN0 A;  2YUA A;  2YIB D;  5CBG A;  4X88 A;  4DW1 A;  5EBW C;  4EKW A;  3ZMS A;  1TC0 A;  1FXH A;  2XOK G;  3K08 A;  1HR0 B;  1JMK C;  1AMW A;  3O0I A;  4ZKI A;  4ZHQ A;  2KG7 A;  5JH7 B;  4MS2 A;  3SPG A;  3RW0 A;  1R62 A;  2X7R B;  2XJG A;  1SA0 A;  1KKC A;  1JOY A;  3FB8 C;  4JI2 B;  3FB7 C;  4X9Q A;  2OT5 A;  3G7E A;  2QR4 A;  1OZ0 A;  1PNK A;  2YEB A;  4K0K O;  3CGZ A;  2UUC B;  1GM8 A;  1P84 F;  3INX A;  4YKU A;  5M4K A;  3L74 H;  4J7K A;  5LHG A;  1N32 O;  2BE3 A;  4LNU A;  2O1U A;  4GLX A;  3OGI B;  2QFO A;  3B09 A;  3D36 C;  1Y8P A;  3KKY A;  5JCO A;  1MA1 A;  2YKB A;  2A0L A;  4IGG A;  3ZMU A;  3RLR A;  1CEZ A;  4FCQ A;  2QTS A;  3T2M A;  1BS3 A;  1NKD A;  1XMO B;  2BT0 A;  1K4C C;  2JS3 A;  2VQE B;  4JTA B;  5BY1 A;  1GMG A;  4B3M O;  3OMU A;  1SQF A;  2QWN B;  5CA3 A;  4X1I A;  1KYO F;  3A0X A;  1WPX A;  2F1M A;  3QNE A;  1PNM A;  5GGZ A;  5BMV B;  2UU9 B;  1BQZ A;  1UYK A;  5M4H A;  4CZZ A;  3L9D A;  1PV0 A;  1YJN V;  2O57 A;  5EZY A;  3R65 A;  3TCU A;  2YED A;  3TZ5 A;  5M4P A;  3Q4H A;  5H6R A;  3EKR A;  3LNN A;  2PZS A;  2UXD B;  2FKX A;  3WB1 A;  1DF5 A;  2Q5Z A;  3OMA B;  1COW G;  1KC8 W;  1ZW9 A;  3BAB A;  4BIO A;  5IJ0 B;  4K4O A;  1UYM A;  2VRZ A;  2EJ7 A;  2UUB B;  4NXN O;  3CXH F;  1KD1 W;  4P7A A;  3CCV V;  3FKS G;  3F5W C;  3SJQ C;  2DMX A;  4X20 B;  2ZCE A;  4CH3 A;  3G80 A;  1YET A;  3CC4 V;  4O4L B;  2VQE O;  2YE6 A;  4LH6 A;  2JK5 C;  5AG2 A;  2YEA A;  1TUB A;  2GHY A;  2K5B A;  1G1X B;  4DK1 A;  1HNX B;  2Q67 A;  1OCZ C;  3FAV B;  2XTA A;  4CWN A;  4OX9 B;  4BQJ A;  2ZM6 B;  1OCZ B;  4P2Z A;  3B4S A;  5CTW A;  4PI2 A;  2Q73 A;  3H80 A;  4LFC O;  4PDL A;  2AGA A;  2QWO B;  3JAW B;  1D5N A;  4I4T B;  1XDC A;  3ZMZ A;  1YJW V;  4TSF G;  1K4D C;  3JD3 A;  3BA9 A;  2XX4 A;  4OPA A;  2WI6 A;  1GN2 A;  2P67 A;  2ZE8 A;  2YEI A;  4NXM O;  1A4H A;  2JEX A;  4LP0 A;  3T4Z A;  3EHB B;  4EEH A;  2UXD O;  2JKI A;  3HHU A;  4E00 A;  2OCC C;  1D5A A;  5IDM A;  1K97 A;  2WA4 A;  4KP4 A;  5BOD A;  3ABM C;  4FVM A;  4FLV A;  4PA6 A;  4B7K A;  5LP6 B;  2HCH A;  4ASG A;  4XDJ A;  5L3E A;  4FM0 A;  3DXR B;  1SQV H;  3SPI A;  1BHB A;  3ZN1 A;  3A0H Z;  1I94 O;  4EFU A;  1MG1 A;  1YTF D;  3JYC A;  5FLX N;  4HY6 A;  4K8X A;  5K1P A;  1YIJ V;  4RQE A;  4JI7 O;  4B3R B;  2YJX A;  5K1X A;  4UCV A;  5B1A C;  4GX0 A;  2DJV A;  2C1I A;  5CBF A;  4IIJ A;  5L3G A;  1B6Q A;  1AR5 A;  1Q6H A;  2Y48 A;  5CPH A;  1BGQ A;  1QLE B;  1R3I C;  2K9P A;  2DW4 A;  4EEQ A;  2HG1 A;  1B04 A;  4KFM A;  4QPK A;  3GIG A;  1TC6 A;  2Z3Y A;  4D6T H;  1IUR A;  1XBL A;  2MW2 B;  4B3S B;  1NU1 H;  4JYY A;  2BYI A;  3PJS K;  3AG1 C;  3LDC A;  4NH7 A;  1MAB G;  3HKC A;  4OPH A;  1ZX3 A;  3RN4 A;  3JAL A;  4YKZ A;  5BR8 O;  3AG2 C;  4B3M B;  2Q0A A;  1UYG A;  4O4J A;  3DC5 A;  1Q7Y W;  1S0V A;  2Q8V A;  4GCZ A;  2GTA A;  1MZE A;  2E5L B;  1I5B A;  4HYO A;  4F6R B;  4YKT A;  4NTY A;  3EFF K;  3R4N A;  1F7Y A;  2QKA A;  4JYB A;  5JVD B;  2WER A;  4GKJ O;  4MOT A;  2LGW A;  5BOC A;  4I5S A;  1NI8 A;  3VQV A;  3VHD A;  4DXW A;  2YI0 A;  1ZWI C;  3CRQ A;  5FL7 G;  1IX9 A;  2EIM B;  1VQ6 V;  3R91 A;  4LWG A;  2ATK C;  2L6L A;  2H55 A;  5EC2 C;  1PL4 A;  5CMU A;  4K0K B;  3K5N A;  2ZIM A;  3CRA A;  4DR4 B;  1YC4 A;  2YI5 A;  4JI6 O;  2EUL A;  1Q6U A;  4P30 A;  4L93 A;  5KX5 A;  3LDE A;  2YGA A;  2RN9 A;  3F7Y C;  1S5H C;  2V4D A;  1EBO A;  1SQP H;  2BSM A;  2OCC B;  2WAM A;  4JI0 O;  3B28 A;  4HXZ A;  4XKO A;  2JRI A;  1KB9 F;  2ITD C;  1YIT V;  1IBL O;  1XNR B;  2ZDY A;  3I55 V;  4LF9 O;  4J80 A;  2F95 B;  4YY3 B;  2YKI A;  3K04 A;  4J7Z A;  2Q0O C;  5KUK A;  1I5D A;  1RFY A;  3D3I A;  5GTI Z;  4LF5 O;  3PN1 A;  1SES A;  4MVZ A;  3UO2 A;  3CXC U;  2BCC H;  4UCT A;  2E76 B;  2HKJ A;  3CRK A;  3FFQ A;  3OGC C;  4DV2 B;  2YE8 A;  5LXT B;  4U3J A;  3B24 A;  1J95 A;  1AP5 A;  4FFB B;  1AJQ A;  4PEL A;  3DTU B;  3FD9 A;  1XNR O;  3R66 A;  2WLL B;  2YIC A;  3H1J H;  1DK1 A;  4R8C A;  1BXD A;  4WF9 V;  4LWE A;  5FPO A;  3OT7 A;  3CB2 A;  4XIP A;  2HEP A;  4CE2 A;  4LF8 B;  1UJW B;  2LJ2 A;  1AI5 A;  3E22 B;  1QBZ A;  4NH9 A;  1UYL A;  5B3S C;  4QNH B;  5D7R A;  4I55 B;  4ZOL B;  3SYA A;  1QQC A;  1JR9 A;  1FYJ A;  1Y4S A;  3H4L A;  1N36 B;  4FLU A;  4A5U B;  1BSM A;  3G4S V;  3K0D A;  2H3O A;  4CWO A;  4UCO A;  3J7A U;  2QF6 A;  3A8T A;  5FND A;  5JJJ B;  2Y69 C;  3FAV A;  2WLH A;  2Z0A A;  3BEH A;  3HKB A;  2XDK A;  3ETG A;  1G6U A;  3JAS B;  4B3R O;  4O07 A;  4ASA A;  5BZB A;  2GV9 A;  4UVA A;  1XHZ A;  4J9Y B;  1N8R W;  4LF5 B;  5EC1 C;  3C3S A;  2VQF O;  5TIS Z;  4HZ0 A;  3OTO O;  3K98 A;  4GFN A;  3CRR A;  3TK1 A;  1YC3 A;  1OJH A;  4ZBM A;  2IWX A;  3B26 A;  2AXT Z;  1HP8 A;  2IH3 C;  3T2S A;  1M56 B;  4H37 A;  3QG5 A;  3J81 N;  3R92 A;  3W7X A;  4NTX A;  1KIJ A;  1NTM H;  2CG9 A;  4NR1 A;  1QY8 A;  4AHC A;  3ZRW A;  5FPR A;  3THO A;  2GTS A;  1X4T A;  2O1V A;  4DZY A;  2P4K A;  4NXM B;  4KSH A;  2GSM B;  3SPJ A;  1BGY H;  5EYP B;  5JWP A;  4NKG B;  3ZHS A;  4I55 A;  2EIJ B;  5EZY B;  1R1B A;  3KCX A;  3HKD A;  1VAR A;  4DR5 B;  4URM A;  2QA4 V;  3ETD A;  2E75 B;  4ASB A;  3QDD A;  3TZ0 A;  3CJH B;  4DO2 A;  2ZXW C;  3OEE G;  2H8M A;  3CCE V;  2HHH O;  2Q2E B;  4YKX A;  2GDS A;  3W7T A;  5D6P A;  4FLW A;  5ITZ B;  3BRC A;  2W6I G;  5IJ0 A;  2JGU A;  4HZ5 A;  4CWT A;  1N36 O;  3I5D A;  4MP7 A;  5LXT A;  2IU0 A;  2Q7H A;  1NT2 B;  2XHT A;  4CWQ A;  4K8Z A;  5F3K A;  3DC6 A;  4N21 A;  1P4R A;  4UUJ C;  1THZ A;  4P9O A;  1VQ7 V;  1IBK B;  1YT0 A;  1LUV A;  1K8A W;  4J42 A;  1N34 B;  2HLD G;  3T1Y O;  1SF9 A;  1QR9 A;  4MTF A;  4R6Z A;  4FLT A;  3O6O A;  3CCJ V;  1AB3 A;  4LWS B;  5KMG A;  4KL1 A;  3K5L A;  3A0W A;  3H1H H;  1JX9 A;  2XAB A;  2YEF A;  2LGQ A;  4X1Y A;  3ZHQ A;  2CGN A;  1V55 B;  2WI7 A;  1N33 B;  2PUS A;  3FYI B;  4XE2 A;  4HY1 A;  2RDC A;  1BYQ A;  4BIZ A;  4PA7 A;  1VQM V;  3EHH A;  5LL6 Y;  2CCU A;  3ZM7 A;  1V9P A;  1W59 A;  3ASN B;  3ZXQ A;  1P49 A;  2DWD C;  4L87 A;  1WJZ A;  4JI7 B;  3IC9 A;  2DWE C;  5H9C A;  3ZMT A;  2NNU A;  2NN4 A;  1XMQ B;  3JSL A;  3B8N A;  3P3P A;  4NTW A;  5EK0 A;  1Y6X A;  5LOV A;  4U3F H;  2PI5 A;  1U97 A;  1TUE B;  1ZSP A;  1WLE A;  2VWK A;  4BAE A;  1Y66 A;  2X6C A;  1ZL8 A;  4KQV A;  2ZIO A;  3A2F A;  2BOC C;  3BM9 A;  2QM4 A;  2CTP A;  4DR2 B;  3WG7 B;  5C8Y B;  5CB4 A;  4MPC A;  3CMA V;  1AH8 A;  3OMN B;  5FNF A;  4IHJ A;  3WHA A;  2XJJ A;  2EIN B;  5FNV A;  1Q6I A;  4YJ2 A;  4X64 O;  3K97 A;  1K3E A;  4JI2 O;  5E79 Z;  4LFA B;  2UXB O;  3TTZ A;  2HVJ C;  3GVM A;  5KLV H;  3OFN G;  5EYP A;  2P7T C;  4U93 A;  2B1I A;  4AI8 A;  1YF2 A;  4LP8 A;  4WFE A;  2YI7 A;  1WP8 A;  2W0X A;  4TV8 A;  4WUB A;  1JJ2 U;  1N0J A;  2XCM A;  4XTJ A;  4HNA A;  4YKW A;  2QG2 A;  3HYZ A;  2IW5 A;  1US7 A;  3RYC A;  3ZHT A;  3KE6 A;  5H6Q A;  1K5Q A;  1QR8 A;  3G75 A;  3BFR A;  1U96 A;  1XUQ A;  3M8A A;  2UXB B;  4DR3 B;  3SGI A;  3T10 A;  5LP6 C;  1S5J A;  2Q9L A;  2JIZ G;  2GFD A;  4J41 A;  2YEV B;  4GEE A;  1IDS A;  3U10 A;  2HVK C;  2Q7G A;  1FFX A;  5KA5 A;  3FT5 A;  1HNW B;  1HW7 A;  1I5Y A;  2ZE7 A;  3JAS A;  4I50 A;  3CRM A;  4NXN B;  4BXI A;  3ABL B;  1TID A;  4DR1 B;  2ZR2 A;  1XOU A;  1MU5 A;  2JJ1 G;  3HKB B;  4PHZ A;  4X66 B;  4E72 A;  4O0B A;  2ARH A;  1G8M A;  5KA6 A;  1HNW O;  3GB7 C;  5LGN A;  2QE7 G;  3G67 A;  1FAF A;  4XKA A;  1XRE A;  2P4V A;  1EI1 A;  2UXC B;  3QTC A;  1L8D A;  5CA1 B;  1RSO A;  1R3K C;  4GT8 A;  4JZ2 A;  4FCP A;  1BQ0 A;  2MK3 A;  4O2B A;  3STZ C;  1Y76 B;  2BU2 A;  1BKN A;  4JYC A;  1AJP A;  1Y67 A;  1YS3 A;  2F4V O;  3K5M A;  1M57 B;  3ZRS A;  1PD3 A;  1I5X A;  1AM1 A;  2QWP B;  4W4K A;  3E8H A;  3OE7 G;  1XQ8 A;  4OXS A;  4FMT A;  4KUM A;  1YSC A;  5CA1 A;  1TH8 A;  2XHB A;  1RM1 B;  4QE9 A;  1AI7 A;  1XMO O;  4XDL A;  1DGS A;  1OCR C;  3LSS A;  3TET A;  4YHH O;  4BQG A;  1H2N A;  3CYO A;  5D5Q A;  4GQT A;  2LQT A;  2XDS A;  1UYE A;  4DRX B;  5D6Q A;  2ZDI A;  3S3X A;  5DED A;  3S3W A;  4JI4 O;  4MTX A;  3LSQ A;  3T1H B;  2Y0P A;  1S72 V;  1M4U A;  1KUQ A;  2IJH A;  2Q8F A;  4BW9 A;  4O4H B;  1B3Q A;  2M7W A;  3T1Y B;  4X20 A;  3CGY A;  5LA6 A;  2HKO A;  2ILM A;  3CSX A;  2YE9 A;  3BY6 A;  2PY5 A;  2JGD B;  1YHQ V;  3K5O A;  4JAA A;  1NH2 B;  4L8Z A;  3RYC B;  2YK2 A;  4D7S A;  1VMG A;  3FT8 A;  4JF3 A;  3AG4 B;  3D8C A;  5JVD A;  2AHZ A;  3JAM N;  1NS1 A;  1HNZ B;  4I0X B;  1PPJ H;  4WUC A;  1TUB B;  1PP9 H;  3K9A A;  3FV5 A;  4EFT A;  4UCR A;  1SZX A;  2HJF C;  4PA9 A;  3RT3 C;  1YT1 A;  3RKZ A;  2LFS A;  3SJC C;  3BPZ A;  4XIR A;  3N27 A;  2RMK B;  2VQF B;  1YDX A;  4UV9 A;  4X1K A;  1XL4 A;  3TXQ A;  4FZ0 A;  1R3J C;  1GKX A;  2LP7 A;  1GO3 F;  3QO5 A;  1AI4 A;  3IC7 A;  5IYZ B;  5J71 A;  1JCH A;  1YEW A;  4WFH A;  1VF6 A;  1KU9 A;  5L3B A;  1AIL A;  1WB7 A;  4ZIB A;  3E8G A;  1GN4 A;  3VQY A;  3D0B A;  2LW1 A;  4X8A A;  4X1Y B;  5EIB C;  1GM9 A;  2XT9 A;  1EA6 A;  4FCR A;  1NVP D;  4JI0 B;  3D3Q A;  4J10 A;  4H81 A;  1I08 A;  1S5L Z;  2OTL V;  1UYI A;  3OAA G;  3JAK B;  4JAU A;  4CE1 A;  4GT1 A;  5A2Q N;  1V55 C;  3OD4 A;  2IOP A;  1VEW A;  3ZCC A;  4JI8 O;  2QWR B;  1IXM A;  3RVZ A;  2Y4T A;  4GKK O;  5BMV A;  2YKJ A;  2V1D A;  1Q43 A;  3JAT B;  4GKK B;  4Z1M G;  3HZ1 A;  3ZRX A;  4DV6 O;  3KZI Z;  2QM7 A;  1SS3 A;  3VHC A;  4B08 A;  4WBN A;  4QE7 A;  3R4M A;  2WLI B;  4IL6 Z;  4B3T B;  2KG7 B;  1TVK B;  2GUZ A;  4F4L A;  5JH7 A;  4DV3 B;  3VOU A;  1KQS U;  2KQX A;  5GTH Z;  4XD8 A;  4O2A A;  4IYH A;  2HHI A;  2YKE A;  2F93 B;  1AJ6 A;  4FK5 C;  3T1H O;  3FYE B;  4B3T O;  5KAI Z;  1SKV A;  4FIP C;  4H7Q A;  4C7U A;  1E79 G;  4CWS A;  3CJH A;  2B9Z A;  3K79 A;  1UFI A;  3SDL A;  4DV6 B;  3JD2 A;  4JV5 B;  2ZBK B;  3B27 A;  2ZIN A;  2WEP A;  2ZE5 A;  3HKD B;  4RUF A;  3SJB C;  3WQ9 A;  4TWK A;  1QNM A;  1NHI A;  1YT2 A;  3Q5K A;  3VQX A;  4XDM A;  1WB8 A;  1SZT A;  5A9G A;  4FLZ A;  1RPO A;  1OV9 A;  2A3Q A;  4I4T A;  1IBL B;  3ABK C;  3EKO A;  2YE7 A;  4UXN A;  3SJA C;  4FLY A;  1X59 A;  1VF6 C;  2EIK B;  1MNG A;  1I59 A;  1S3J A;  4XKK A;  3AG3 B;  4PDR A;  2IJJ A;  5B1N A;  5CTX A;  1MMM A;  4FM2 A;  2OIG A;  2UXC O;  4CWR A;  1EN5 A;  4JI3 O;  3O2F A;  1OHH G;  4PI0 A;  5DM6 V;  1R6K A;  4Q6G A;  1WA8 B;  3R4O A;  4KXR A;  4X65 O;  4I50 B;  4JI6 B;  3K0G A;  4B7P A;  5IY5 C;  5D7C A;  3KG2 A;  4BW5 A;  3WB2 A;  5KHJ A;  3LNU A;  3B40 A;  4YIO A;  1GK9 A;  1F51 A;  3RWR D;  2E0A A;  3T1K A;  1E1R G;  3VAD A;  1ZLZ A;  2FYU H;  4O4I A;  3UT5 B;  2IOR A;  4YKR A;  2ADQ B;  3EXA A;  3QVN A;  3NXS A;  1H8H G;  4RUE A;  2A79 B;  3HEK A;  3CPW U;  2XAG A;  1VQL V;  3IED A;  3INW A;  1PKX A;  3SPH A;  4J9Z B;  1F4M A;  2L35 A;  3Q5J A;  2IBZ H;  3Q4H B;  4PD4 F;  3AK1 A;  4O4L A;  1K92 A;  1YSZ A;  1NR1 A;  4X9L A;  5CBH A;  1JM6 A;  2F4V B;  1S76 D;  2JVD A;  2WLM A;  1NHJ A;  4QPJ A;  2CTQ A;  4JI5 O;  4DUY O;  3RFR A;  4O09 A;  2E3C A;  4J11 A;  3E89 A;  3DGE A;  4L91 A;  3G6E V;  3CEI A;  3OR7 C;  4DUZ B;  4GKJ B;  4RWU A;  2XK2 A;  3EHG A;  3OPD A;  4YHH B;  1JA8 A;  3K58 A;  1M1K W;  2ZQM A;  1RM1 C;  3X2Q C;  1Y4M A;  2ZR3 A;  4D7T A;  4DR1 O;  4TOI A;  3ZED A;  5H5N A;  3CCS V;  5BR8 B;  4TV9 B;  4OX9 O;  3ZIA G;  4LF9 B;  4J7J A;  3UQ8 A;  3CWB H;  4MPE A;  3ASN C;  3U2D A;  1YJ9 V;  4MP2 A;  2FYP A;  4JTC B;  4JPR A;  2VS0 A;  1TA8 A;  2X0L A;  4AQY O;  3JAR B;  4YKQ A;  1UY8 A;  2PGG A;  3N2K A;  3H1K H;  4URL A;  2YID A;  3AG2 B;  3L71 H;  3ZJZ A;  2PI4 A;  1SA0 B;  4O2A B;  5KX5 B;  1OCO C;  3EVK A;  2KKW A;  3U11 A;  5JQG B;  1H2S B;  4BIU A;  3BCC H;  3H9V A;  2EIK C;  4XCL A;  5ITZ A;  2YEC A;  1J5E B;  1FFT B;  4LNU B;  5KMG B;  4DUZ O;  2LFR A;  2IM9 A;  4LH7 A;  3JAT A;  4MVR A;  3HKE B;  4LWH A;  4R3M A;  4LWF A;  4YJ3 A;  4DUY B; 
#chains in the Genus database with same CATH homology
 4WFF A;  1YJN V;  5M4M A;  4MVO A;  2NNU A;  3B8N A;  2IH1 C;  3R65 A;  5EK0 A;  3TCU A;  3W7W A;  2BU6 A;  2YED A;  3JZ3 A;  3TZ5 A;  5M4P A;  4G28 B;  4WUD A;  4KSG A;  1NH2 D;  2PI5 A;  1S16 A;  4UVB A;  1JPX A;  5H6R A;  3STL C;  4XIQ A;  5L3F A;  3EKR A;  1FXK A;  1CP9 A;  3K06 A;  1KZN A;  1TUE B;  1JVM A;  3ZRW B;  3E83 A;  2UXX A;  1WLE A;  4BAE A;  1Y66 A;  2X6C A;  1UYD A;  1DF5 A;  5EBL C;  2BU7 A;  3EHF A;  4KQV A;  3GIE A;  3IFX A;  5L3D A;  3OMA B;  4BAY A;  2D3O W;  3CCL V;  2YE4 A;  2BOC C;  1VQ4 V;  1HWY A;  3BM9 A;  2CCS A;  1COW G;  1KC8 W;  1TIL A;  1ZW9 A;  4MPN A;  2H8P C;  1ARO P;  4JQL A;  1ID0 A;  4K4O A;  4ASF A;  1Q86 W;  4YXW G;  3WG7 B;  2FXS A;  2JEU A;  3G71 V;  1UYM A;  2YGE A;  2O1W A;  4L94 A;  1I5C A;  1K33 A;  1H8E G;  1QCE A;  2EZO A;  4MPC A;  3CMA V;  2F43 G;  1AH8 A;  2YGF A;  3OMN B;  4FPP A;  5FNF A;  2WLK A;  3G7B A;  3M99 B;  5B1B C;  1KD1 W;  3CCV V;  4P7A A;  3WHA A;  3FKS G;  1DTO A;  3F5W C;  4R50 A;  3SJQ C;  2YK9 A;  2XJJ A;  4I3H A;  2UXN A;  2EIN B;  3U2K A;  3TUH A;  1YET A;  1NJI W;  4P9P A;  3HYY A;  2XHX A;  2BYH A;  3CC4 V;  4W7T A;  3K97 A;  1ORQ C;  1K3E A;  2XAJ A;  3VBB A;  3RBZ A;  3OEH G;  2YE6 A;  3TTZ A;  2HVJ C;  2ZD9 A;  2YE5 A;  3P30 A;  3A0T A;  3U67 A;  2JK5 C;  3OFN G;  2P7T C;  4U93 A;  2YEA A;  1H7S A;  5B1B B;  2GHY A;  2B1I A;  2HFE C;  4LP8 A;  3SPC A;  4WFE A;  1Y8O A;  2K5B A;  2YI7 A;  4LPB A;  3ZKB A;  1XL6 A;  4WFG A;  1Z5C A;  2Q67 A;  2ZDX A;  1OCZ C;  3OW2 U;  4CWN A;  1YTF B;  2YE3 A;  5J9P C;  1JJ2 U;  2BU5 A;  2XCM A;  3A0Z A;  3CWV A;  4WUB A;  1OCZ B;  4XTJ A;  4P2Z A;  4V25 A;  4YKW A;  4H33 A;  3E86 A;  2QG2 A;  2FTK A;  3LPS A;  4NH8 A;  3HYZ A;  3ABU A;  5CTW A;  2IW5 A;  1US7 A;  4G2K A;  3H80 A;  3CRL A;  3KE6 A;  5H6Q A;  1K5Q A;  1QR8 A;  4PDL A;  3G75 A;  4R3A A;  1FXV A;  3CCR V;  1UY6 A;  4O05 A;  1KP2 A;  1L1F A;  1F23 A;  3T10 A;  3ZMZ A;  1YJW V;  3EHJ A;  1RPR A;  4TSF G;  1K4D C;  2JIZ G;  3JD3 A;  4RO2 A;  4LBE C;  1VQ5 V;  2GFD A;  2GQP A;  2WI6 A;  2KB1 A;  2YEV B;  2XX4 A;  4HXW A;  4QIW F;  1KP3 A;  2P67 A;  3OWB A;  4GEE A;  4G27 B;  1VQO V;  4MTG A;  1L0O A;  2HVK C;  2DYS C;  2JEX A;  3LDD A;  5L3C A;  3ZMV A;  3ASO C;  3OR6 C;  1A4H A;  4LP0 A;  3T4Z A;  5KA5 A;  3CC7 V;  2XDX A;  3EHB B;  3FT5 A;  1K34 A;  4EEH A;  1I5Y A;  4GX2 A;  3HHU A;  1U2O A;  2JKI A;  1H2G A;  3ABL B;  1TID A;  3GIG B;  2ZR2 A;  2OCC C;  4BXI A;  4E00 A;  5M4N A;  1MU5 A;  5IDM A;  2JJ1 G;  4XDK A;  1K97 A;  2WLJ A;  4O0B A;  1FXK C;  4KP4 A;  5BOD A;  2WI5 A;  3ABM C;  1G8M A;  3B8M A;  1VQK V;  4E02 A;  3AEI A;  5KA6 A;  4CWP A;  3GB7 C;  3A0R A;  5IY5 B;  5LGN A;  2WI1 A;  1LNQ A;  1K5S A;  2QE7 G;  2CCT A;  4PA6 A;  4XKA A;  1CPY A;  1BL8 A;  1EI1 A;  2HCH A;  4JTD B;  4ASG A;  4RQF A;  2WWW A;  3ML0 A;  4XDJ A;  1QYE A;  2UWD A;  3Q5L A;  5L3E A;  1VQ9 V;  1K7D A;  1Z5A A;  3E8B A;  1R3K C;  3ABM B;  4GT8 A;  4FCP A;  4MVM A;  2MK3 A;  3STZ C;  2EIN C;  2BU2 A;  1MSW D;  1BKN A;  4JYC A;  1AJP A;  3SPI A;  1BHB A;  5E1A C;  3ZN1 A;  1YS3 A;  4EM7 A;  2BRC A;  1M57 B;  1MG1 A;  3ZRS A;  4GGL A;  1YTF D;  1PD3 A;  1I5X A;  3JYC A;  1AM1 A;  4HY6 A;  3RLP A;  2PNR A;  3E8H A;  3OE7 G;  1YIJ V;  3W7U A;  4RQE A;  2Q68 A;  1UYF A;  2YJX A;  4OXS A;  1SRY A;  4FMT A;  5B1A C;  2P6J A;  4GX0 A;  5C93 A;  4KUM A;  3CD6 V;  1EZJ A;  1YSC A;  2YKC A;  1TH8 A;  1RM1 B;  1F4N A;  4LCU C;  3PEH A;  5CBF A;  4QE9 A;  3UM7 A;  1AI7 A;  1YES A;  5L3G A;  1B6Q A;  2QKS A;  2XDL A;  4XDL A;  4E01 A;  1OCR C;  2Y48 A;  3LSS A;  3TET A;  1QLE B;  1BGQ A;  5CPH A;  4CWF A;  4AWO A;  1R3I C;  2R9I A;  1UY9 A;  1ZWH A;  4BQG A;  2X6A A;  2IJK A;  3CYO A;  2WLL A;  3HB3 B;  3AG4 C;  2DW4 A;  2XDS A;  2QG0 A;  3JCZ A;  4FJC C;  2QEX V;  4GQT A;  4X89 A;  1QVG U;  1UYE A;  2HG1 A;  5D6Q A;  2ZDI A;  3HZ5 A;  4KFM A;  3WFV A;  3R4P A;  4QPK A;  5FWK A;  2XDU A;  2XAQ A;  4MTX A;  1TC6 A;  3LSQ A;  3GIG A;  1S72 V;  2Z3Y A;  2V7Q G;  4GX5 A;  2XAH A;  2IJH A;  1E1Q G;  3OUS A;  3D36 A;  2BYI A;  4PRV A;  2WLN A;  2Q8F A;  3SYQ A;  1Q82 W;  3LNM B;  2WPD G;  2CK3 G;  3PJS K;  1B3Q A;  2M7W A;  2B5U A;  4CE3 A;  3E35 A;  3ZKD A;  3JD1 A;  3TZ4 A;  3AG1 C;  3LDC A;  2XAF A;  5CN0 A;  1V54 B;  2HKO A;  5EBM C;  2H94 A;  3CGY A;  1MAB G;  4NH7 A;  5F5R A;  2Q8I A;  2XX2 A;  1NVP B;  2VCI A;  2QM8 A;  2YE9 A;  3BY6 A;  2JJC A;  4Q20 A;  1VQN V;  3SL2 A;  1YHQ V;  1QLN A;  4YKZ A;  5DN6 G;  3ZRV A;  2Z5U A;  1MX0 A;  3AG2 C;  1UYG A;  1NH2 B;  1YC1 A;  4L8Z A;  1Q7Y W;  1S0V A;  2YK2 A;  4MB9 A;  4GCZ A;  1K73 W;  2YEE A;  3RLQ A;  1I5B A;  1S77 D;  3FT8 A;  4HYO A;  4JF3 A;  4LWI A;  3AG4 B;  4YKT A;  4PDV A;  2YJW A;  3EFF K;  2AHZ A;  3R4N A;  3QO8 A;  1UYH A;  2WSS G;  4JYB A;  4P8O A;  2WER A;  4EGH A;  4MOT A;  4WUC A;  3K9A A;  3FV5 A;  4HYM A;  4PL9 A;  5BOC A;  4I5S A;  4EFT A;  2YSU B;  3VHD A;  4DXW A;  2HJF C;  4PA9 A;  1YT1 A;  3TZ2 A;  2YI0 A;  3RKZ A;  5B1A B;  1M90 W;  1ZWI C;  2LFS A;  4L91 A;  5FL7 G;  3OUF A;  2IJI A;  4XIR A;  1G4Y B;  2EIM B;  1VQ6 V;  4JAS A;  2IWS A;  3X2Q B;  1KEC A;  3R91 A;  4UV9 A;  5LHH A;  4LWG A;  5CTY A;  2ATK C;  1XL4 A;  1M57 C;  1R3J C;  2H55 A;  1FS0 G;  5EC2 C;  5L3J A;  5KUM A;  4WFA V;  5CMU A;  1GKX A;  4RAI A;  2YEG A;  3C0E A;  2LP7 A;  1GO3 F;  3QO5 A;  2OTJ V;  1AI4 A;  3IC7 A;  1YC4 A;  2YI5 A;  4EMV A;  5J71 A;  4WFB V;  1JCH A;  1SET A;  4WFH A;  5L3B A;  4MT8 A;  4PRX A;  4P30 A;  3P32 A;  4L93 A;  1AJN A;  3SYP A;  2XJX A;  3E8G A;  1YER A;  3MHS C;  2HR3 A;  3LDE A;  4MVS A;  3D0B A;  5CTU A;  3CP1 A;  2YGA A;  3F7Y C;  1R3L C;  1S5H C;  4X8A A;  1GM9 A;  1EBO A;  1EA6 A;  4FCR A;  1NVP D;  2BSM A;  2DYR B;  4H81 A;  3E2E A;  2OTL V;  2BZ5 A;  3ABK B;  1AI6 A;  2OCC B;  2FWZ A;  1Y8N A;  1UYI A;  4MVU A;  3MHH C;  5GW7 A;  3OAA G;  2WAM A;  4JAU A;  2VWC A;  4GT1 A;  1H7U A;  3B28 A;  4UVC A;  1I58 A;  1S14 A;  3AG3 C;  4HXZ A;  4XKO A;  3VHA A;  2XHR A;  1V55 C;  2ITD C;  2IOP A;  4AS9 A;  3ZCC A;  1YIT V;  2JJ2 G;  2ZDY A;  1IXM A;  3FB5 C;  3I55 V;  2VW5 A;  2W6J G;  1AR1 B;  1BHA A;  2YKI A;  3K04 A;  3RVZ A;  4XC0 A;  5KUK A;  1YSR A;  1B63 A;  2EIJ C;  1I5D A;  2V1D A;  2YKJ A;  3D3I A;  1THN A;  4AWQ A;  1SES A;  4PA3 A;  1M56 C;  4MVZ A;  3CXC U;  5IYC O;  4Z1M G;  3HZ1 A;  3ZRX A;  4EGI A;  3VHC A;  2QM7 A;  3JD0 A;  2HKJ A;  3CRK A;  4MW3 A;  5CF0 A;  3OGC C;  1GKF A;  2YE8 A;  5LHI A;  1VQP V;  4XCJ A;  4QE7 A;  3R4M A;  2K1E A;  2WLI B;  3B24 A;  4PU9 A;  1J95 A;  2ZXW B;  1NBM G;  2ZDI C;  1KQS U;  4F4L A;  2QTO A;  2B1G A;  1AJQ A;  1V54 C;  2EIL B;  2R9R B;  3K03 A;  3VOU A;  2ESA A;  2WI4 A;  4PEL A;  3PEJ A;  5FNC A;  2IWU A;  3CME V;  3DTU B;  3QO7 A;  2BRE A;  4O04 A;  4XD8 A;  3T0Z A;  2YKE A;  1AJ6 A;  3ASO B;  5IYB O;  4FK5 C;  2WLL B;  2ZKJ A;  4EGK A;  3FYE B;  3SYO A;  4R8C A;  4LC1 A;  1BXD A;  4WF9 V;  4LWE A;  4FIP C;  4H7Q A;  5M4E A;  4XIP A;  1NHH A;  1E79 G;  4CWS A;  1I5A A;  3K79 A;  4CE2 A;  2XD6 A;  1UJW B;  1SER A;  1Z5B A;  4AWP A;  1AI5 A;  1QBZ A;  3GIF A;  4NH9 A;  3JD2 A;  1UYL A;  2ZBK B;  5B3S C;  3B27 A;  4QNH B;  1PNL A;  2WEP A;  2CH4 A;  3LUT B;  4URN A;  4RUF A;  3WQ9 A;  4TWK A;  5D7R A;  1NHI A;  1YT2 A;  2BU8 A;  2YEI A;  3Q5K A;  4XDM A;  1SZT A;  3SYA A;  2WI3 A;  2YE2 A;  2YEJ A;  4MVQ A;  3T4D A;  4R1F A;  5B1O A;  2JDI G;  4XBF A;  4KFG A;  1RPO A;  3QTF A;  4H85 A;  3ABK C;  1P7B A;  3EKO A;  1Y4S A;  2YE7 A;  5IYD O;  3CCU V;  3H4L A;  1Q81 W;  4UXN A;  1UY7 A;  1B62 A;  2EIK B;  1I59 A;  4YKY A;  1S3J A;  3G4S V;  4XKK A;  3AG3 B;  4QJF B;  3K0D A;  4PDR A;  1KKD A;  1UYK A;  2IJJ A;  3A0Y A;  5D6P A;  4CWO A;  1DLB A;  5B1N A;  2QF6 A;  5CTX A;  5FND A;  1PVG A;  1W0J G;  5IDJ A;  1NQT A;  1YI2 V;  3OMI B;  5B3S B;  4CWR A;  2EXL A;  2Q69 A;  2FWY A;  2DQ3 A;  3O2F A;  4ZVI A;  2Y69 C;  3T0H A;  4KTN A;  2WLH A;  3BEH A;  2A9H A;  1GKZ A;  1OHH G;  3ETG A;  1R6K A;  3OM3 B;  5DM6 V;  2XDK A;  4MSW C;  3MNR P;  1Y4U A;  3R4O A;  3ETE A;  3JD4 A;  2Q8H A;  4O07 A;  4I9W A;  3K0G A;  4ASA A;  4CBC A;  1GJV A;  4B7P A;  5IY5 C;  5D7C A;  3KG2 A;  2YI6 A;  4BW5 A;  5BZB A;  4UVA A;  3K60 A;  1BMF G;  4MBC A;  3LNU A;  2YEV A;  4J9Y B;  1N8R W;  5EC1 C;  3SYC A;  1QLE C;  1GK9 A;  3H01 A;  5HFL A;  2HG5 C;  1F51 A;  3E8F A;  1UYC A;  3ABL C;  4HYP A;  3GWO A;  2E0A A;  4HZ0 A;  4ASU G;  3OWD A;  1E1R G;  1ROP A;  3ABT A;  4PA4 A;  3K98 A;  3T1K A;  4GFN A;  3VAD A;  4GX1 A;  1GM7 A;  4V26 A;  2IOR A;  3TK1 A;  1YC3 A;  4ZBM A;  1H38 A;  2IWX A;  3B26 A;  3B25 A;  4YKR A;  4UV8 A;  2IH3 C;  3T1C A;  1ZXN A;  3NXS A;  3C11 A;  3T2S A;  1M56 B;  2BTZ A;  1H8H G;  4R7C A;  1GTO A;  1M9N A;  1R73 A;  4H37 A;  3W7X A;  4RUE A;  3R92 A;  4BQJ A;  2A79 B;  4MW8 A;  1TBW A;  2Y69 B;  5LBQ A;  1KIJ A;  2CG9 A;  1NR7 A;  2EBO A;  3CPW U;  2XAG A;  1VQL V;  3HEK A;  4MTO A;  1W0K G;  3IED A;  3INW A;  1JQ0 A;  1QY8 A;  4N23 A;  3ZRW A;  3K3W A;  3HPL C;  1OCC C;  2BOB C;  2CGF A;  2O1V A;  1FXK B;  1PKX A;  4DZY A;  5J6A A;  2AHY A;  3SPH A;  2WI2 A;  4KSH A;  4J9Z B;  2GSM B;  1F4M A;  3SPJ A;  4E2L A;  2VCJ A;  3Q5J A;  4CE1 A;  4WCE V;  2EIJ B;  3IGA C;  3CCQ V;  2WEQ A;  2DYR C;  2ITC C;  2YEH A;  1K92 A;  1YSZ A;  4URM A;  2DYS B;  2QA4 V;  1NR1 A;  4X9L A;  2EIM C;  5CBH A;  3ETD A;  4U7N A;  1S76 D;  2WLM A;  1JM6 A;  1Z59 A;  3QDD A;  3WG7 C;  1K9M W;  1AH6 A;  4ASB A;  1NHJ A;  4QPJ A;  3TZ0 A;  4HAM A;  1ENV A;  3AG1 B;  3I56 V;  1OCO B;  2AKP A;  3K99 A;  2EIL C;  4DO2 A;  4O09 A;  3ZN0 A;  2ZXW C;  3OEE G;  2H8M A;  3E89 A;  3DGE A;  5CBG A;  3G6E V;  4X88 A;  3W7T A;  3OR7 C;  5EBW C;  1OCC B;  3UKM A;  4EKW A;  4YKX A;  3ZMS A;  1TC0 A;  1FXH A;  2P90 A;  2XOK G;  5LGT A;  2W6I G;  3K08 A;  1ZXM A;  1PL0 A;  2Q6A A;  1AMW A;  2XK2 A;  3O0I A;  4HZ5 A;  4CWT A;  3CCM V;  3EHG A;  4ZKI A;  4JGS A;  3OPD A;  2XX5 A;  4MS2 A;  3SPG A;  2EJR A;  2ZQM A;  1RM1 C;  3RW0 A;  3X2Q C;  1M1K W;  1R62 A;  2X7R B;  2XJG A;  1Y4M A;  2IU0 A;  3BMY A;  2ZR3 A;  4MP7 A;  2XHT A;  5D7D A;  4CWQ A;  1JOY A;  4EFU A;  5LGU A;  3D2R A;  1W2B U;  5F3K A;  3FB8 C;  4N21 A;  1OCR B;  1P4R A;  2XND G;  3FB7 C;  4UUJ C;  1THZ A;  4P9O A;  3CCS V;  1VQ7 V;  2OT5 A;  3G7E A;  1R6N A;  3ZIA G;  4L90 A;  2XAS A;  1OZ0 A;  3MD0 A;  1PNK A;  4MPE A;  3ASN C;  1YT0 A;  2IOQ A;  2YEB A;  3CGZ A;  3U2D A;  4HZ3 A;  3CCE V;  1YJ9 V;  1K8A W;  1OSF A;  2FYP A;  2Q2E B;  4JTC B;  4MP2 A;  4URO A;  2HLD G;  4JPR A;  1GM8 A;  4YKU A;  3RVY A;  2X0L A;  3INX A;  4PDM A;  1QR9 A;  4YKQ A;  4DUH A;  2DQ0 A;  5IN9 A;  4MTF A;  4U7O A;  5M4K A;  4R6Z A;  5HFM A;  1UY8 A;  3O6O A;  4TT3 G;  5LHG A;  3CCJ V;  4URL A;  4CZZ A;  2W0F C;  2O1U A;  1DF4 A;  3A0W A;  1VQ8 V;  2XAB A;  1JX9 A;  3AG2 B;  2NLJ C;  2YEF A;  3ZJZ A;  2QFO A;  3OW6 A;  2PI4 A;  1Y8P A;  4XIT A;  1V55 B;  2IU3 A;  3B77 A;  3CC2 V;  2WI7 A;  3NMQ A;  1OCO C;  1U0Z A;  3FYI B;  3FB6 C;  4JAV A;  1EFR G;  2YKB A;  2A0L A;  4XE2 A;  3ZMU A;  4BIU A;  2WLI A;  1QZR A;  4HY1 A;  1CEZ A;  3RLR A;  4B6C A;  1BYQ A;  4FCQ A;  1MOF A;  2EIK C;  4XCL A;  3T2M A;  1NKD A;  4BIZ A;  3F7V C;  4PA7 A;  1VQM V;  2BT0 A;  1K4C C;  2YEC A;  3W7S A;  3EHH A;  3ZXO A;  2CCU A;  1FFT B;  4JTA B;  3ZM7 A;  1QVF U;  1GMG A;  3ASN B;  3OMU A;  3ZXQ A;  2C2A A;  2LFR A;  5CA3 A;  4LWH A;  2DWD C;  4L87 A;  4MVR A;  1WPX A;  3A0X A;  4R3M A;  3QNE A;  2Q8G A;  1PNM A;  4LWF A;  5GGZ A;  2EZP A;  2DWE C;  2X6B A;  5M4H A;  5H9C A;  3ZMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...