5IDJA

Bifunctional histidine kinase ccka (domains dhp-ca) in complex with adp/mg2+
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
242
structure length
242
Chain Sequence
LSQAQKMQAIGQLAGGVAHDFNNLLTAIQLRLDQLLHRHPVGDPSYEGLNEIRQTGVRAADLVRKLLAFSRKQTVQREVLDLGELISEFEVLLRRLLREDVKLITDYGRDLPQVRADKSQLETAVMNLAVNARDAVRAAKGGGVVRIRTARLTRDEAIQLGFPAADGDTAFIEVSDDGPGIPPDVMGKIFDPFFTTKPVGEGTGLGLATVYGIVKQSDGWIHVHSRPNEGAAFRIFLPVYEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell cycle histidine kinase CckA
publication title Cyclic di-GMP mediates a histidine kinase/phosphatase switch by noncovalent domain cross-linking.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase
total genus 63
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5idjA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5idjA02
1NHJA 5M4NA 5B1OA 4I3HA 1KIJA 2XHTA 4ZKIA 2HCHA 3R4NA 2Q8FA 2YKIA 1JOYA 2XDKA 3A0WA 2WERA 3B26A 2CGFA 4XKOA 2IOPA 2CCUA 4BXIA 4MB9A 3SL2A 1UY6A 2IWUA 1TILA 2XDLA 5FWKA 1MU5A 1THNA 2YK9A 2AKPA 2WI1A 3HZ1A 1BXDA 2YEHA 3D0BA 1UYGA 4YKRA 2YKCA 3ZXQA 4R3AA 4LP0A 3PEJA 3G7EA 4KFGA 1BKNA 5F3KA 2LFRA 2XABA 2JJCA 2ZKJA 1ZXNA 1I59A 1TC6A 1UYMA 3OW6A 2WWWA 4BQGA 1PVGA 2YE4A 4E00A 2XCMA 4DUHA 1TBWA 2CCTA 3A0RA 2IWXA 3HYYA 2YK2A 4B6CA 2WI7A 4URLA 4EGHA 3G7BA 5CTXA 1UY9A 3O6OA 2CG9A 2CCSA 3K60A 4MP7A 1Y8NA 4GGLA 3BMYA 2XDSA 4XITA 2YJXA 3R4OA 4FPPA 3CRKA 3CRLA 5IDJA 4H7QA 3A0ZA 4WUCA 3K99A 1UYIA 5IDMA 1ZXMA 3A0YA 2YE2A 3Q5KA 1UY7A 1YT0A 3ZRXA 4XIQA 5B1NA 2IORA 1UYFA 1H7SA 1I5AA 3ZKDA 2XHXA 5C93A 1U2OA 3IEDA 2XJJA 3A0XA 2YI7A 3JZ3A 3G75A 3B27A 2YI5A 4R1FA 2YEFA 2BSMA 2YGAA 3O2FA 4XKAA 3EKRA 5D7DA 4EGIA 4EEHA 2BTZA 3KE6A 2YEEA 4FCQA 4U93A 3EHFA 1BGQA 1YT1A 1JM6A 2YGEA 2IWSA 2GFDA 1YC1A 4P7AA 4XE2A 3INXA 4CWSA 3QTFA 2Q8HA 3VHDA 4U7OA 5M4KA 1QYEA 4X9LA 2QM8A 1UYEA 4B7PA 2LFSA 4L93A 5FNFA 1AM1A 4KP4A 1B63A 1TC0A 1U0ZA 3K98A 4HY6A 4MPNA 4CWRA 1QY8A 1I58A 4GEEA 3ZXOA 2XK2A 3TK1A 4FMTA 2UWDA 5CPHA 3MD0A 4O07A 4XKKA 5D6PA 4MPEA 1GJVA 4NH9A 2FTKA 2WEPA 1GKXA 1KZNA 3PEHA 4URMA 1AH6A 2XD6A 3HZ5A 4HZ5A 3CGZA 4MT8A 2BRCA 2VW5A 1UYCA 3MNRP 5M4PA 2CH4A 3ZCCA 4Q20A 2BU6A 4FCPA 1L0OA 4MPCA 4WUDA 3H80A 2HG1A 2FWYA 1S14A 3TUHA 5M4HA 3ZRWB 1YSZA 4V25A 4V26A 4LWIA 3R91A 4LWFA 2YE5A 3ZRWA 3U67A 2C2AA 4BIUA 1YS3A 4ASAA 2PNRA 2IOQA 1TIDA 2VCJA 1YC3A 4P8OA 4GFNA 4O04A 2BU7A 2BYHA 2YKBA 1EA6A 4H81A 2Q2EB 4U7NA 2XX2A 3DGEA 1BYQA 4W7TA 4R3MA 2WI5A 2WI4A 3GIGB 3ZM7A 5FNCA 4PRVA 2YE8A 2ZDXA 4URNA 4KQVA 4GCZA 3GIGA 4CWTA 4E02A 2XJXA 1Z5AA 1NHHA 4YKQA 4CWQA 4XD8A 3TZ5A 2QG0A 2YE3A 4PU9A 2YI0A 2YKJA 5L3JA 3D2RA 2WI3A 2WEQA 4ASFA 4CWPA 1Z59A 3TTZA 4O09A 3T2SA 1UY8A 2YEAA 4JASA 1Y8OA 4ZVIA 4CE1A 4CE3A 2YECA 3HYZA 3T0ZA 4JYCA 3OPDA 1YSRA 2E0AA 4NH8A 3C11A 1B3QA 1NHIA 3WHAA 3BM9A 1I5CA 4YKWA 2YE9A 4JYBA 5GGZA 3RKZA 5IN9A 3LPSA 3C0EA 2HKJA 2WI2A 3RLPA 4LPBA 3R4PA 4L90A 1YETA 4MOTA 2YEIA 2YEJA 3FT8A 4BAEA 4JAVA 3T1KA 2BU5A 1US7A 2FWZA 3TZ2A 4MP2A 3R92A 4AWQA 3RLRA 2VCIA 1Z5BA 4KTNA 1AJ6A 4EMVA 3D36A 3OMUA 4HY1A 3EKOA 4MTXA 1GKZA 4L94A 3CWVA 5FNDA 2EXLA 4CWFA 3OWBA 3EHGA 3EHJA 5J6AA 4XCLA 4CWOA 2WI6A 1I5DA 4LWEA 4GT8A 3A0TA 2O1UA 1H7UA 3OWDA 3HHUA 4L8ZA 2ZDYA 2Q8IA 3GIFA 4YKZA 5CTYA 2FYPA 2JKIA 4FCRA 3TZ4A 4E01A 4HYMA 4WUBA 1UYDA 2XHRA 4PRXA 4XIRA 1ID0A 4I5SA 1IXMA 3K97A 4LWGA 1Z5CA 4YKTA 1TH8A 3B28A 2BU8A 2XDXA 2BREA 1A4HA 3U2KA 1ZWHA 2BU2A 2ESAA 4H85A 2QM7A 4DZYA 3ZKBA 3B25A 2BT0A 2XX5A 4AWOA 5M4EA 1S16A 2QF6A 4YKYA 1AMWA 2XDUA 4EFUA 5BOCA 3TZ0A 3FT5A 2ZBKB 1B62A 1ZW9A 3RLQA 3Q5JA 4XIPA 2P67A 2VWCA 5CF0A 3HEKA 2YEDA 1YT2A 1UYLA 3INWA 1YC4A 4O05A 3ZRVA 4KSHA 4XCJA 4EGKA 3O0IA 4MBCA 4XC0A 5D7RA 2O1VA 3T0HA 4KSGA 4GQTA 1YERA 3QDDA 4YKUA 4BIZA 1UYHA 5D6QA 3P32A 2O1WA 4L91A 4JAUA 4QPJA 4AS9A 1R62A 2YGFA 4K4OA 4ASBA 4AWPA 1I5BA 4XDMA 3LNUA 4ASGA 2K5BA 4NH7A 1UYKA 4XTJA 3NXSA 5F5RA 5D7CA 3FV5A 4HXWA 2YEBA 4HYPA 2YE7A 5BODA 4HZ0A 1QZRA 1EI1A 2YI6A 4BQJA 1OSFA 2YJWA 1Y4SA 3R4MA 4LC1A 3GIEA 3EHHA 1F51A 3VHAA 4YKXA 2FXSA 3CGYA 3T10A 2BZ5A 3U2DA 2XX4A 3B24A 5M4MA 1Y8PA 4CWNA 5CTUA 3H4LA 4EFTA 2GQPA 5J71A 3VADA 2YEGA 3Q5LA 2XJGA 4CE2A 2H55A 4GT1A 2YE6A 4PL9A 4O0BA 4LWHA 1YESA 1Y4UA 2QFOA 2YKEA 4UROA 2BYIA 2H8MA 3NMQA 3VHCA 4HXZA 1MX0A 2QG2A 4JQLA 3WQ9A 2Q8GA 5CTWA 1AH8A 4EM7A 4QPKA
chains in the Genus database with same CATH superfamily
4DV3O 4X1KA 2KSDA 4JI2B 2BTQB 1KIJA 2CGNA 2HCHA 4G2KA 5IY5C 3JD3A 2WERA 1BT8A 3Q4HB 4XDJA 4DR4B 4DV7O 1UJWB 2IH1C 1NS1A 4BIOA 3ABLB 1UY6A 2IWUA 1TILA 4DR6O 2YS8A 2XDLA 1EN4A 1G4YB 2YIBA 2YC0A 3D0BA 3PEJA 1DF5A 2QJ1A 4KFGA 4NTXA 2ZM6B 1GKFA 2LFRA 1ZXNA 2XAJA 2H3OA 4X62O 4IIJB 5KA6A 1PVGA 5KAFZ 1XHZA 4EFBA 4DV4B 4DUHA 1OCCC 3H9VA 4JI3B 1CEZA 2YK2A 2Q73A 1JMKC 1IBMO 4GX0A 4URLA 4TWKA 4LF6O 3O6OA 2CG9A 1WPXA 3K60A 4MP7A 1Z2GA 2ZNIA 1H2NA 4BW9A 4MVZA 5B66Z 1JQ0A 3CRKA 3HR0A 2UUAO 2B1IA 3N2KA 4X66O 4ZIBA 5B3SC 4KXRA 4IT5A 5IDMA 1LUVA 4UVAA 3RBZA 5B1AB 1UY7A 1UYFA 3HKEA 3SDLA 1N36O 3A0HZ 2B9ZA 4J80A 2XUMA 2Q69A 1JFFA 4K0KB 2XJJA 2W0XA 1VQOV 3OR7C 1WB8A 3OMNB 5KHGA 5LHHA 1N32B 2ZDIA 3J7AU 2BTZA 4FCQA 1AP5A 3STZC 3EHFA 5L3GA 1JM6A 1EZVH 3BPZA 2IWSA 4U3JA 1KQSU 3LDCA 1OCOB 1SERA 2K1EA 5A9GA 4KFMA 2ADQB 2WLLB 3FB5C 2R9AA 4X9LA 3OT7A 1UYEA 4NXNO 1N33B 3K5OA 4JI1B 4WFHA 3JATA 1QR8A 5IYCO 1GAXA 3K98A 3AEIA 5B5EZ 1XMQB 5GTHZ 5LA6B 1Q8IA 4MPNA 2G38A 4CWRA 1RPRA 3OEEG 2CE4A 1OHHG 1QY8A 4KHPO 2QEXV 2WSSG 3UCSC 5C8YB 2F66C 4FMTA 3AK2A 1FKAO 3C3TA 2UXCO 4O07A 4XKKA 2FKXA 4MPEA 1GJVA 1FXKC 2FTKA 3K59A 1W0JG 5CA1A 1YJWV 2KQXA 1BHAA 1QVFU 4OGQB 4JV5B 4D7TA 2BRCA 1IBKO 5M4PA 3CC4V 3T4ZA 4LF5O 2BU6A 4EFEA 3B8NA 3ETQA 4FCPA 1NQTA 5JH7A 5K1PA 4UV9A 4X65O 1WLEA 3K0GA 3B09A 4O2AB 3TUHA 5M4HA 3ZRWB 4PDLA 1SQVH 5B1BC 4LWIA 3R91A 4LWFA 2YE5A 2QGNA 1GM7A 3ICXA 4MVUA 4BIUA 1AR5A 2PNRA 3CRCA 5FPOA 3L74H 1OCRC 4RAIA 3CC7V 4DR7O 5DM6V 3JARB 2GV9A 4MVSA 1VF6A 3AG1C 4MS2A 1AP6A 2BYHA 1EA6A 4Z1MG 4KL1A 3E89A 2Q2EB 3BRCA 2XX2A 1Y76A 4R3MA 1D5NA 3GIGB 2EIMC 1NR1A 2NLJC 4PRVA 2YE8A 5LMNO 1OCCB 4GCZA 3AG2C 3T1YO 4E02A 1TVKB 3UT5B 3BA8A 4CWQA 3SR2C 4XD8A 3TZ5A 1D2DA 1EN6A 5KUKA 5L3JA 3T1HO 4CWPA 4HBNA 4ASFA 4X8AA 2IJKA 3T2SA 1JR9A 3SYCA 2OWOA 1UY8A 2YEAA 4JASA 2F4VB 5GW7A 1Y8OA 4CS3A 4CE3A 1JPXA 2UXXA 4K3AA 4YJ2A 2EIJC 4NH8A 2EJRA 3APQA 1QLEC 4NTWA 3CSXA 1SETA 5B3SB 4FM2A 4JI4B 4J10A 1YIJV 2YE9A 3SJCC 3RYHA 5GGZA 1FXVA 3WG7C 1V9PA 3VQVA 4DV6B 3QF7A 1VF7A 3C0EA 1DLBA 3ZN1A 4J9ZB 4J41A 3OUSA 4LPBA 1K97A 3ABUA 4L90A 2KB1A 3CD6V 4RQEA 3K57A 2YEIA 4AQYO 2BU5A 4NYKA 1US7A 4TQFA 4LNUB 1HWYA 4B3TB 3L70H 1WB7A 3HB3B 3ETDA 1QNMA 1VEWA 1BQZA 4UXNA 1N34B 3MHSC 5LHGA 3CMEV 2ZXWC 2YIBD 3CE2A 4MTXA 3G6BA 3T2MA 5JJEB 2KG7A 2PUSA 2EXLA 1JA8A 2IJHA 5LYJB 1M93A 4R50A 4UCOA 2PI4A 1LR1A 3SYOA 2PYLA 1H7UA 2O1UA 3A0TA 4L8ZA 2Q8IA 1QBZA 2Q7HA 3E8GA 2LW7A 4N21A 2JKIA 1FFTB 3TZ4A 2R70A 3G67A 1BGYH 2QE7G 5DECA 4HYMA 1UYDA 2XHRA 3FKSG 5EC1C 4DV1O 1PNMA 2VQEO 4UFZA 5CBHA 3JSNA 1GN2A 2QWRB 1FXKB 1K8AW 1R3JC 1TH8A 2UU9O 1Q6IA 3N27A 5EK0A 1XNRO 4J7JA 3OW2U 4YXWG 4TUYA 1YF2A 2ESAA 3A2FA 1AVMA 1F7YA 2L6LA 3DSQA 2XX5A 4AWOA 2F23A 1H38A 2QF6A 2HLDG 4LWSA 4YKYA 4PDVA 5EZYB 3TZ0A 1DTOA 3FT5A 4E4EA 5A2QN 3RLQA 1SQPH 4F6EA 2PTMA 1K5QA 2P67A 1OCRB 5CF0A 4XCJA 3AG1B 4RUEA 5L3DA 1HR0O 1BL8A 4MBCA 5KUMA 2Y69C 3EHBB 1Y74B 1FYJA 3JAWA 4GQTA 4NKGB 1RM1C 2HKOA 1YERA 2EIMB 3K3WA 4RQFA 5JVDA 3TGUH 3P32A 1ZTEA 5JCOA 4CC5A 1I94B 3AG2B 5CA3A 3C90A 4L91A 4FFKA 1J5EB 1S0VA 2EX3A 1HNZO 3B8MA 1R3KC 3E86A 3U10A 4CH6A 2ZR3A 1R3LC 3SPGA 1K34A 4RWUA 4CH5A 4O4IB 2R9RB 2EIJB 1IXBA 1QLEB 3AG7A 4O4JA 3TCUA 2YEBA 4HYPA 3CXCU 3WG7B 4DK1A 4MW8A 2ZDIC 1RP3B 1OSFA 2YJWA 1Y4SA 3ABMC 1QR9A 1K92A 4YKXA 2CAZC 2WPDG 2FXSA 3GWKC 1NTZH 2QKCA 3STLC 4W4LA 3B24A 4X89A 3SPIA 1Y8PA 4UCUA 3GVMA 2RMKB 2YI9A 5IJ9B 3K58A 2UXNA 1YTFB 2GQPA 5J71A 3VADA 3T4DA 4H37A 3Q5LA 3X2QC 3F7YC 4O0BA 1Y4UA 1IURA 2Q68A 2YKEA 4JTDB 5LGNA 3CCQV 1PNLA 3KKYA 3WFVA 4UROA 2EJ7A 1SC5B 1GN4A 3QTCA 1I0HA 4B3SO 1AROP 2E5LO 2YXYA 4I55B 5CTWA 1ZL8B 3KCXA 4EM7A 1YJ9V 2JJ2G 2HJFC 4B3RB 1W2BU 2OTLV 1W59A 2JRIA 2Z3YA 2LQTA 1SA0B 3BA9A 5LBQA 2CGFA 3SL2A 1CXZB 3H1LH 2ARHA 5FWKA 1E1QG 1TUBB 2YK9A 2AKPA 4PD4F 5E1AC 4BW5A 1M90W 2DYRC 1VF6C 4YJ3B 4LFAO 2DYSC 3B2EE 4WCEV 3LMMA 4LP0A 1BKNA 4FLZA 5F3KA 2XABA 1MABG 2JJCA 4P9PA 4NXMO 1I59A 1MNGA 1TC6A 4UB6Z 5LL6Y 1X4TA 4DV5O 4DUYO 4GKKO 3JASA 3E8BA 3HKBB 3T1CA 1QHTA 5LMUB 1XI1A 3CCLV 1JCHA 2CCTA 2Y0PA 5CB4B 2OCHA 2Y69B 3HYYA 2HP8A 2WI7A 3F5WC 2JEUA 2UUBB 2DW4A 4D7SA 4LF7O 1F4MA 3G71V 2YXHA 2IU3A 3KG2A 2Q4PA 2QA4V 1VQKV 4GGLA 1I5YA 3C3SA 3BMYA 4W4KA 4LF4O 2XDSA 2YJXA 3RVYA 3R4OA 5IDJA 1HNXB 1SQQH 3A0ZA 2EILC 4UB8Z 3K99A 3A8TA 2E74B 2YE2A 1FD9A 1YT0A 3ZRXA 1H8EG 1JFFB 4PJ0Z 2XHXA 1NI8A 2DJVA 1YI2V 2BSKA 3CCVV 5IYZB 2YI7A 3ZHQA 3I5DA 4MTFA 2YI5A 3JD0A 1XNQB 4I4TA 2BSMA 4LF8B 1Q7YW 3O2FA 5EYPA 4DUZO 1HP8A 2GUZB 2D2CB 2YEEA 3ABMB 5JQGB 2P5OA 2XAGA 4UVBA 2GFDA 4C7UA 1YZBA 4CWSA 2F95B 3BVOA 3VHDA 4U7OA 4HNAA 1O9GA 5CBGA 2QM8A 1US6A 2LGQA 1FS0G 1SESA 2JGUA 3JATB 2QKAA 3K03A 1GK9A 3JSLA 2JS3A 1MSWD 4OX9B 3X2QB 2LJ2A 1U0ZA 3RYCA 1EN5A 4J11A 1ZSPA 4ZOLA 1OCZC 2C1IA 4HY6A 4BWAA 3ABKC 2IU0A 1H2MA 4JI4O 2XAFA 3FD9A 1SQXH 2ITCC 1I58A 1SQGA 3CYOA 2X7RB 2UWDA 1RSOB 4U3FH 5BR8O 4O4HA 5BMVB 5CA1B 4BAYA 3M99B 1Q82W 4URMA 4I0XB 3D3IA 1XBLA 4R8CA 3CGZA 1HNWB 2ZE6A 4MT8A 4JI0O 4OPHA 1UYCA 4J7ZA 4X88A 3TJTA 1L0OA 3LDDA 1UFIA 2HG5C 2HG1A 3FB7C 1S14A 3M7MX 1YSCA 2VWJA 4BR6A 4EKWA 2Q9LA 4LH6A 4X64O 4UUJC 5CA0A 2PI5A 1ENVA 1S72V 2UXDB 5CMUA 2HHHB 5KX5B 1YS3A 1NJIW 2CH7B 2IOQA 2CK3G 3CCJV 3KZIZ 2F43G 3BABA 4MVMA 2DYRB 1VQ8V 1PD3A 2IJJA 1YC3A 2DYSB 1W0KG 4DW0A 2OYQA 4O04A 1U96A 4QJFB 4DV0O 3LUTB 4DR1O 1IVSA 1BS3A 3W7TA 2BU7A 1K33A 3K04A 3WB0A 4UCSA 4MSWC 1Y76B 1CP9A 4A5UB 3QG5A 4UV8A 2WI5A 2N74A 3SYPA 3JD2A 2ZDXA 3IC7A 5LP6A 5FNVA 2ZKOA 1IBLB 4JI5O 1Z5AA 2XOKG 3EVKA 4ASUG 4I50A 3SPJA 4FLWA 4K35A 2QG0A 3CC2V 2YE3A 2Q5ZA 2E76B 3F5TA 2WEQA 1Z59A 3TTZA 2X0LA 2GBOA 5IWAO 4YJ2B 3ZJZA 1JVMA 2AXTZ 4I7ZB 4CE1A 4MVOA 4LFBB 3T0ZA 2VS0A 1R6KA 3ASNC 2E0AA 1B3QA 3WHAA 5LOVB 4O4LB 3BAAA 1MZFA 4JPRA 3N2GB 2QSAA 3RKZA 4WBNB 3OM3B 4LR3A 2LO1A 5IN9A 3VQYA 5GTIZ 3RLPA 3HKDA 4MOTA 4ICGA 3THOA 2YEJA 4E2LA 3FT8A 5L3CA 1XHXA 4JAVA 3FYIB 3RYIB 3T1KA 3LNNA 2P6JA 3TZ2A 2E75B 4YY3B 2VCIA 3AG3C 1QCEA 4CC6A 2UXBB 3D36A 5HFMA 5IE9A 2YXLA 2UUCB 2JDIG 2HVKC 3W7SA 3E8HA 4HY1A 5EIBD 2P06A 4GKJB 1GH6A 4DV2O 5FNDA 1XMOO 2WLNA 4XCLA 4B3MB 1GMGA 4OXSA 1NVPB 4JI8O 4Q6GA 2BE3A 4GT8A 3OWDA 3GIFA 4LF9O 4JI7B 1GRJA 1OCZB 3SYAA 1YITV 4FCRA 3ABKB 5ITZA 2QWOB 2NN4A 1H2SB 3FB6C 4H0LB 2CDYA 5JWPA 4PI0A 1NBMG 2EIKC 4LWGA 4DR2O 4YKTA 2XHBA 1IZ3A 4LFCO 3ETEA 3ZMVA 1B04A 5IY5B 5LXTA 2DWDC 2YIDA 4DRXA 4FLUA 2XDXA 3B77A 3ZMUA 2PF4E 1COWG 2NNUA 2Q6AA 3JALA 1L8DA 1ZWHA 2DQ3A 5IT9N 2BU2A 5KHIA 4WFGA 4X1YB 5D5PA 3P3PA 4DZYA 1JJ2U 4DR3B 2JGDB 4JF3A 1S16A 5IJ0A 3H01A 1V55C 1AMWA 4EFUA 3L72H 1B62A 4ZHQB 2DWEC 1OZ0A 3Q5JA 5CBFA 3RYFB 2DN9A 1M9NA 3BFRA 1UYLA 1U97A 4XDLA 3ZRVA 4LH7A 1SQFA 4JYAO 2ITDC 2V7QG 1YEWA 4PA7A 5D7RA 3K9AA 2O1VA 5JVDB 4KSGA 4HZ3A 4ZI7B 3ZMZA 1PV0A 3P3NA 1ZWIC 4YKUA 3L9DA 4BIZA 5D6QA 2O1WA 1K5SA 2AHZA 3W7UA 3HKCB 1VQPV 4QE7A 4JAUA 4QPJA 3S3XA 4TV9A 1R62A 2YGFA 1KC8W 1YHQV 4AWPA 2HJDA 4XDMA 3LNUA 2HR3A 4FLVA 1UYKA 4XTJA 3OTOB 2W6IG 2FB5A 3CCEV 5D5QA 2VRZA 4GYCB 5KLVH 5BODA 3CEIA 4FJCC 1QZRA 1S5HC 2RJZA 4F4LA 1ZAUA 1FJGB 1K4DC 5H6RA 2Z0AA 3VHAA 1HW7A 3QO7A 4O2BB 1XOUA 2ZIOA 4ZBMA 2IW5A 3T10A 4DR5O 4E72A 2BZ5A 4X1IB 3CCUV 3AG3B 3U2DA 2N04A 1AJQA 1A32A 4DV7B 4YHHO 5CTUA 3H4LA 4L87A 3VQWA 2YEGA 1YVWA 5JJNB 1M57C 4DR6B 2XJGA 4CE2A 2PGGA 3ZMSA 2WLLA 4LWHA 2WA4A 2QFOA 3PJSK 3G4SV 1NH2D 2A7WA 2BYIA 3E22B 2HVJC 3H1KH 2QG2A 2BTOA 1AB3A 1KP2A 1URFA 4X62B 5J2UA 1I08A 1MZEA 2VQFO 5LA6A 1IX9A 2YEVA 1AI7A 1NHJA 5B1OA 1KKDA 2WLJA 3UO2A 3FAVA 4JI6O 5C8YA 2EIKB 4LP8A 2YICA 1IBMB 2XHTA 4ZKIA 3H1IH 4LF6B 2Q8FA 1JOYA 3VOUA 3K79A 2IOPA 2ZINA 2CCUA 5B1BB 1F4NA 2UUAB 1AI5A 4X66B 3UO3A 1LUWA 2M6YA 1MU5A 4FFBA 1Y67A 2WI1A 4UCTA 2Y48A 1BXDA 1MMMA 1UYGA 4YKRA 4O2AA 3DC6A 1V55B 3G7EA 1XUQA 1R6TA 3CWBH 1N36B 2Q7GA 1SRYA 3CRMA 5H6QA 1WA8A 2AHYA 1UYMA 3OW6A 1O9HA 4BQGA 1WP8A 2Y4UA 3HPLC 5LP6C 2YE4A 3ASOC 1E79G 4E00A 2XCMA 2IH3C 4Z2WA 4JI2O 1R73A 1VQ6V 3A0RA 3JARA 1VQ4V 2IWXA 1GM8A 1MSDA 4B6CA 5KMGB 4WF9V 3FFQA 4B7KA 4F6RA 3TXQA 4EGHA 5CTXA 2CCSA 3OEHG 5EBLC 1Y8NA 4UVCA 4DR4O 2GDSA 3IJ4A 4IHJB 2CGOA 2P4VA 4K8ZA 4YIPA 3DXRB 4FPPA 1TVKA 3CRLA 3UT5A 1Z5WA 4H7QA 2A9HA 4J42A 4NXNB 4WUCA 2O57A 1AI4A 4FK5C 2P90A 2WLIA 1ZXMA 2X6CA 4EB6A 3CJHB 3Q5KA 2ZQMA 3OD4A 2QWPB 1Q3EA 4WFFA 2BSKB 3ZKDA 5C93A 2ZM6O 1QU7A 1U2OA 2PYJA 3IEDA 3E35A 4KHPB 4JAAA 2P22C 3A0XA 1R1BA 3G75A 3B27A 2UXCB 2YEFA 4DV4O 4XKAA 3EKRA 5D7DA 4JI3O 4EGIA 4EEHA 3KE6A 5GONB 4Z1VA 1KD1W 1VQ5V 1ZX3A 2ZXWB 1Y66A 4TV8B 5EBWC 1IBKB 4AHCA 4LNUA 4LF5B 3QTFA 1FPOA 1QYEA 4X65B 1XQ8A 3CXHF 4L93A 5FNFA 3RYCB 2XASA 1WJZA 1M57B 2B1GA 1NR7A 2Q7EA 3UM7A 3RW0A 4X1KB 5DEDA 5FL7G 1SQBH 4K0KO 3D3QA 1GN6A 4QGPA 4DR7B 2RQ6A 4GEEA 5H9CA 3ZXOA 3TK1A 1JX9A 1N32O 4CS4A 1Q6UA 1GKXA 1KZNA 4WFAV 1E1RG 1AH6A 4JZ2A 5LMNB 3HZ5A 1EM1A 4HZ5A 1NT2B 3FB8C 3T1YB 2VW5A 3MNRP 1G8MA 1FFXA 3ZCCA 1WPBA 2X6BA 4Q20A 3T1HB 4MPCA 1XDCA 3LNMB 2C1GA 2XNDG 1YSZA 4V25A 4V26A 5IYBO 1N33O 2XAHA 4JI1O 2ZE7A 3OGIB 1XMQO 1BQ0A 3J80N 1YCIA 1ORQC 2H8PC 5EC2C 4ASAA 3VBBA 4IYHA 2VCJA 3SPHA 2YI8A 4GFNA 3MDSA 2K9PA 2WLHA 1H2LA 4I9WA 5BZBA 5AG2A 1AJPA 3UQ8A 2YKBA 4AI8A 5EZYA 1N0JA 4GX1A 4H81A 1WNSA 4AQYB 3DGEA 4W7TA 1RM1B 2AZ0A 4URNA 2WLKA 4JYYA 5H2FZ 4JV5O 3H1HH 3N2KB 3LDEA 2YKJA 3D2RA 1VQMV 2IM9A 3JCUZ 4O09A 4PA4A 1S5LZ 3R65A 4ABMA 3I56V 2YECA 3HKEB 3HYZA 1BZKA 2RDCA 3ZHRA 4JYCA 4RUFA 3OPDA 3J81N 4DK0A 4YKWA 3KCYA 5B1AC 4OPAA 5J2TA 2HKJA 4GZRB 2JJ1G 1NVPD 4MW3A 3R4PA 1P7GA 1VQ7V 1YETA 5L3FA 4U3JB 4BAEA 4QE9A 3OR6C 4DV1B 1D5AA 2VQEB 2H94A 2PZSA 1I7FA 2QR4A 4GLXA 3R92A 4AWQA 3RT3C 3RLRA 1Z5BA 2UU9B 1HDJA 1NTKH 5L3EA 1XNRB 2PY5A 4X20A 1OCOC 1PKXA 3EKOA 2NR5A 2F4VO 1OV9A 1V54C 3M8AA 3CWVA 2OCCC 2CTQA 3CPWU 3EHGA 1DGSA 3GB7C 1SZXA 4CBCA 4WFEA 2QWNB 2WI6A 5IJ9A 4CWOA 3BHPA 3SYQA 1KECA 4MVQA 4D6TH 4DV6O 3HHUA 2ZNJA 2ZDYA 4YKZA 1I5XA 1L1FA 5KHJA 4X9QA 3ZX6A 4NR1A 4XIRA 3APOA 3B4SA 1ID0A 1HR0B 4B3TO 2HHIA 1K4CC 5LXTB 5JH7B 4DRXB 4I55A 1ZL8A 2BU8A 1N34O 4IGGA 1NZ6A 3JALB 1AR4A 2E3CA 1R3IC 2BREA 4MTGA 1A4HA 3U2KA 3P30A 4HYOA 3JCZA 1K9MW 4CH3A 1G1XB 1HNZB 3IGAC 2JVDA 3QO8A 2MW2B 1GM9A 4HAMA 4H85A 2QM7A 5IJ0B 1SA0A 3ZKBA 2BT0A 1M1KW 2F93B 5KAIZ 2XDUA 5BOCA 4FM1A 4YIOA 2XAQA 4TT3G 2ZBKB 2FMLA 1QLNA 1ZW9A 1TUBA 2VWCA 1BSMA 1Y6XA 2Z5UA 5JCOC 3INWA 3U11A 4YJ3A 4EGKA 3O0IA 4XC0A 2HEPA 3GWOA 3K0DA 1GO3F 3T0HA 3RWRD 1P4RA 2XTAA 1VP7A 4UCVA 3QDDA 1UYHA 4FLYA 3HKBA 5CB4A 3SJBC 4TV9B 1B6QA 3CRRA 4AS9A 3RYHB 3WU2Z 2EILB 4K4OA 2JEXA 1I5BA 4PA3A 4LBEC 3WB2A 2M7WA 1L0NH 4ASGA 2K5BA 2W6JG 3JD1A 4NH7A 3I55V 1PL0A 2R9IA 4TSFG 2KKWA 4UCRA 3OAAG 2Y0IA 1THZA 2YE7A 4HZ0A 4B3SB 1T5EA 1KYOF 3CX5F 2E5LB 4CH4A 4G28B 3K5NA 3GIEA 3EHHA 1F51A 2X6AA 2QWQB 3G80A 4XBFA 5IYZA 3UKMA 2YSUB 4PHZA 2KG7B 1I94O 3EFFK 2XX4A 1QVGU 2GUZA 1J5EO 2QKSA 5JQGA 3E2EA 4CWNA 4EFTA 3EXAA 1V54B 2OCCB 1H2GA 3ZEDA 3OE7G 4TQDA 4IYIA 3JAKA 3W7WA 3FYEB 3K06A 2WLMA 1S5JA 4LFAB 4CS2A 4QNHB 3IFXA 2H8MA 2XT9A 1P49A 3VHCA 5J2UB 1K3EA 4PA9A 1MX0A 4NXMB 2YEVB 2Q8GA 1MG1A 3OUFA 2ADPA 4DV5B 4DUYB 4GKKB 4QPKA 3FAVB 2D3OW 5M4NA 2DE0X 1NU1H 4I3HA 3CHXA 4TUYB 1RSOA 1RPOA 1GN3A 2QDOA 5EIBC 3R4NA 1MOFA 1P84F 2BTQA 5BMVA 2YKIA 1N0NA 4DXWA 4LF7B 2XDKA 3A0WA 2WAMA 4H33A 1S77D 3B26A 1XEQA 4XKOA 3B40A 2OT5A 4I0XA 3ML0A 4KUMA 4LWSB 4LF4B 4BXIA 3Q4HA 4MB9A 3A0BZ 3OMAB 4FFBB 5TISZ 5CN0A 1THNA 3LSQA 4B08A 1AILA 1GTOA 1RFYA 3HZ1A 1VQLV 2A79B 2YEHA 2CTPA 2YKCA 3ZXQA 4R3AA 1ZUQA 1WA8B 1KMIZ 3ZRSA 1PM9A 3AK3A 4FVMA 5DN6G 3JAWB 2ZKJA 1VIBA 2ILMA 2LW1A 5KX5A 2WWWA 3L73H 4PELA 2CH7A 3CS5A 1M56C 2MK3A 1XL6A 3F7VC 3ZMTA 4IIJA 1TBWA 2Q8VA 2RNBA 4F6RB 3SPCA 4DUZB 1FAFA 1TA8A 4B3RO 1WAZA 3E8FA 3OTFA 2DMXA 1K7DA 2CTRA 3G7BA 4R6ZA 1UY9A 3PN1A 2QTOA 3QNEA 2OIGA 1DK1A 2Y4TA 4XITA 5HFLA 1H8HG 1SS3A 3ASNB 4O4JB 2JK5C 1YTFD 2WLIB 1S3JA 4EB6B 1UYIA 2LP7A 4B7EA 3A0YA 5FLXN 4R7CA 2FL4A 1AR1B 4XIQA 5B1NA 2IORA 1H7SA 1I5AA 3SJAC 2A3QA 3JAMN 1VQNV 1KKCA 1TAEA 4DV3B 3JZ3A 5LOVA 4O4LA 2ZIMA 5BR8B 5LMUO 4R1FA 3N2GA 4WBNA 4FLTA 2YGAA 4L8JA 1L0LH 1LNQA 2R72A 4NB5A 1WP7A 2BOCC 4U93A 2UUBO 2OIEA 1BGQA 1YT1A 4JGSA 2YGEA 4PDRA 3RYIA 4JI0B 1YC1A 4P7AA 4XE2A 3AK1A 3INXA 1BMFG 2EZPA 4DYLA 2Q8HA 2N05A 2ATKC 1PPJH 2ZT9B 3DTUB 1ROPA 5M4KA 1HNXO 3W7XA 1PL4A 4B7PA 2EINC 2LFSA 3MHHC 1AM1A 4KP4A 3E83A 3O65A 4X64B 5FPRA 1B63A 1TC0A 3OFNG 3BY6A 2ODMA 2VWKA 2YIAA 1JJOA 3MAQA 2V4DA 2XK2A 4DV0B 4DR1B 5CPHA 3MD0A 4XDKA 2EZOA 1KU9A 5D6PA 1XNQO 3K5MA 4LF8O 4NH9A 2A0LA 2WEPA 3ZN0A 3PEHA 4FZ1A 1X59A 2XD6A 1EBOA 2A06H 1FFXB 4JI5B 4K8XA 3U0ZA 1CPYA 3OGCC 2Q67A 2CH4A 1KB9F 3DC5A 2WA3A 4AILC 2B5UA 2ZCEA 4WUDA 3SGIA 3VQXA 3H80A 1Z5VA 5BY1A 5IWAB 1G6UA 3ZBHA 2FWYA 1ZLZA 1QQCA 1P7BA 1M4UA 2GHYA 2Q0OC 4OX9O 3ZRWA 3U67A 2YUAA 5JENA 2C2AA 1IDSA 3JASB 4X1YA 1TIDA 2AW9A 3S3WA 4P8OA 1EZJA 2V1DA 2JGDA 3WB1A 4I9QA 4RO2A 3LSSA 3RN4A 1XREA 4ZHQA 4U7NA 1BYQA 2WI4A 1M56B 2ZE5A 1YXBA 5KHKA 5FNCA 3ZM7A 3ZHVA 1TUEB 3RYFA 4CZZA 4KQVA 2FYUH 3GIGA 2JS5A 1HNWO 4CWTA 1FXHA 2XJXA 1NHHA 4YKQA 1VQ9V 3ZS8C 3G6EV 2CUGA 4PU9A 2YI0A 5IYDO 2WI3A 1OJHA 4ZI7A 4H44B 4ZVIA 5F2VO 3CP1A 4GX5A 4DV2B 1YSRA 3HKCA 1XMOB 3C11A 2UXDO 2HHHO 1NHIA 3BM9A 4JI8B 1I5CA 5J2TB 2ZE8A 4JYBA 5LGUA 1N4CA 4NTYA 4I4TB 3ABTA 3LPSA 2WI2A 5EYPB 4LF9B 1S76D 3ZIAG 1SKVA 1NTMH 3D36C 2YDEA 2P7TC 1UPGA 2FWZA 2LGWA 1NKDA 1Q5OA 4MP2A 4DR2B 1IBLO 1EFRG 3BEHA 4HNAB 4X20B 4LFCB 4G27B 4KTNA 1AJ6A 4EMVA 2ZR2A 3ETGA 3OMUA 4JTCB 1KP3A 4LCUC 1J95A 2HFEC 4O2BA 1GKZA 4L94A 4ZOLB 4LFBO 1R6NA 3AG4C 4CWFA 3FX7A 1YDXA 3OWBA 4X1IA 3IC9A 1KUQA 2EINB 3EHJA 2CTWA 4GUNA 5J6AA 5LYJA 2GSMB 4PV1B 3K5LA 2AZ2A 1I5DA 4LWEA 4O4HB 4P30A 5CTYA 3K9SA 1KBHA 4FZ0A 2FYPA 3CRQA 3CMAV 4E01A 1XILA 4WUBA 5BXZA 4H13B 4PRXA 5KA5A 4DW1A 4JTAB 5LHIA 4I5SA 3LSUA 1IXMA 2ETNA 4JYAB 4JZGA 3K97A 3E22A 3K08A 2ZD9A 1Z5CA 4YY3O 3B28A 2AGAA 1FXKA 2UXBO 1VMGA 4TOIA 1BHBA 3S5TA 2UUCO 3RVZA 4P9OA 5JJJB 1AI6A 5CA0B 5K1XA 2F1MA 1SF9A 4IL6Z 3ABLC 4GKJO 3CB2A 1PNKA 3TXSA 3TETA 1SZTA 2BOBC 1DF4A 4B3MO 3B25A 2P4KA 5M4EA 1Q6HA 3CCMV 1XL4A 1TGOA 4PI2A 1NH2B 3H1JH 4JI7O 2JIZG 2BCCH 4XIPA 4MTOA 2OTJV 3HEKA 2YEDA 4PA6A 5LP6B 5FNVB 1YT2A 3ASOB 1YC4A 5H5NA 4KSHA 4O05A 2RN9A 2EULA 4I50B 4NVPA 1BCCH 3L71H 3QVNA 1BE3H 1Y4MA 3ZHTA 1Y74A 2GTAA 3CYGA 3SJQC 3NR7A 4DR5B 3O9OA 4J9YB 2QM4A 4FIPC 5KMGA 2DQ0A 4WFBV 1B06A 4YHHB 1VARA 4ASBA 4N23A 4DR3O 4FM0A 2Q0AA 4IHJA 3NXSA 3OMIB 3HKDB 5F5RA 5D7CA 2W0FC 3FV5A 3DXRA 4O4IA 4HXWA 3RFRA 1Q43A 1EI1A 4GX2A 1M5IA 2YI6A 4BQJA 1Q81W 1WN7A 3CJHA 3CCRV 3R4MA 4MVRA 3JD4A 1VF5B 2IJIA 3CRAA 5LGTA 4DO2A 2VQFB 4LC1A 5L3BA 2EBOA 1N8RW 5J9PC 4JI6B 3RGBA 2IBZH 1YJNV 3CGYA 3R66A 4QIWF 4P2ZA 3L75H 5M4MA 1H2KA 5GONA 1MA1A 1F23A 3ZHUA 2GTSA 1Q86W 1K73W 3D8CA 3JYCA 3BCCH 4TV8A 4EEQA 3JAKB 3AG4B 2H55A 4GT1A 2YE6A 4PDMA 5ITZB 4PL9A 2L35A 4J7KA 3QO5A 3OTOO 4FLXA 1YESA 2QTSA 3CCSV 1PP9H 3NMQA 2RCVA 4HXZA 2DOSA 5KHHA 3ZHSA 1Q90D 5E79Z 5EBMC 4JQLA 1FJGO 3WQ9A 1AJNA 1AH8A 3IAYA
chains in the Genus database with same CATH topology
1KIJA 2HCHA 4G2KA 5IY5C 3JD3A 2WERA 4XDJA 1UJWB 2IH1C 3ABLB 1UY6A 2IWUA 1TILA 2XDLA 1G4YB 3D0BA 3PEJA 1DF5A 4KFGA 1GKFA 2LFRA 1ZXNA 2XAJA 5KA6A 1PVGA 4DUHA 1OCCC 1CEZA 2YK2A 4GX0A 4URLA 4TWKA 3O6OA 2CG9A 1WPXA 3K60A 4MP7A 4MVZA 1JQ0A 3CRKA 2B1IA 5B3SC 5IDMA 4UVAA 3RBZA 5B1AB 1UY7A 1UYFA 2Q69A 2XJJA 1VQOV 3OR7C 3OMNB 5LHHA 2ZDIA 2BTZA 4FCQA 3STZC 3EHFA 5L3GA 1JM6A 2IWSA 1KQSU 3LDCA 1OCOB 1SERA 2K1EA 4KFMA 2WLLB 3FB5C 4X9LA 1UYEA 4WFHA 5IYCO 1QR8A 3K98A 3AEIA 4MPNA 4CWRA 1RPRA 3OEEG 1OHHG 1QY8A 2QEXV 2WSSG 4FMTA 4O07A 4XKKA 4MPEA 1GJVA 1FXKC 2FTKA 1W0JG 1YJWV 1BHAA 1QVFU 2BRCA 5M4PA 3CC4V 3T4ZA 2BU6A 3B8NA 4FCPA 1NQTA 4UV9A 1WLEA 3K0GA 3TUHA 5M4HA 3ZRWB 4PDLA 5B1BC 4LWIA 3R91A 4LWFA 2YE5A 1GM7A 4MVUA 4BIUA 2PNRA 1OCRC 4RAIA 3CC7V 5DM6V 4MVSA 3AG1C 4MS2A 2BYHA 1EA6A 4Z1MG 3E89A 2Q2EB 2XX2A 4R3MA 3GIGB 2EIMC 1NR1A 2NLJC 4PRVA 2YE8A 1OCCB 4GCZA 3AG2C 4E02A 4CWQA 4XD8A 3TZ5A 5KUKA 5L3JA 4CWPA 4ASFA 4X8AA 2IJKA 3T2SA 3SYCA 1UY8A 2YEAA 4JASA 5GW7A 1Y8OA 4CE3A 1JPXA 2UXXA 2EIJC 4NH8A 2EJRA 1QLEC 1SETA 5B3SB 1YIJV 2YE9A 5GGZA 1FXVA 3WG7C 3C0EA 1DLBA 3ZN1A 4J9ZB 3OUSA 4LPBA 1K97A 3ABUA 4L90A 2KB1A 3CD6V 4RQEA 2YEIA 2BU5A 1US7A 1HWYA 3HB3B 3ETDA 4UXNA 3MHSC 5LHGA 3CMEV 2ZXWC 4MTXA 3T2MA 2EXLA 2IJHA 4R50A 2PI4A 3SYOA 2O1UA 1H7UA 3A0TA 4L8ZA 2Q8IA 1QBZA 3E8GA 4N21A 2JKIA 1FFTB 3TZ4A 2QE7G 4HYMA 1UYDA 2XHRA 3FKSG 5EC1C 1PNMA 5CBHA 1K8AW 1FXKB 1R3JC 1TH8A 5EK0A 3OW2U 4YXWG 2ESAA 2XX5A 4AWOA 1H38A 2QF6A 2HLDG 4YKYA 4PDVA 3TZ0A 1DTOA 3FT5A 3RLQA 1K5QA 2P67A 1OCRB 5CF0A 4XCJA 3AG1B 4RUEA 5L3DA 1BL8A 4MBCA 5KUMA 2Y69C 3EHBB 4GQTA 1RM1C 2HKOA 1YERA 2EIMB 3K3WA 4RQFA 3P32A 3AG2B 5CA3A 4L91A 1S0VA 3B8MA 1R3KC 3E86A 2ZR3A 1R3LC 3SPGA 1K34A 2R9RB 2EIJB 1QLEB 3TCUA 2YEBA 4HYPA 3CXCU 3WG7B 4MW8A 2ZDIC 1OSFA 2YJWA 1Y4SA 3ABMC 1QR9A 1K92A 4YKXA 2WPDG 2FXSA 3STLC 3B24A 4X89A 3SPIA 1Y8PA 2UXNA 1YTFB 2GQPA 5J71A 3VADA 3T4DA 4H37A 3Q5LA 3X2QC 3F7YC 4O0BA 1Y4UA 2Q68A 2YKEA 4JTDB 5LGNA 3CCQV 1PNLA 3WFVA 4UROA 1AROP 5CTWA 4EM7A 1YJ9V 2JJ2G 2HJFC 1W2BU 2OTLV 2Z3YA 5LBQA 2CGFA 3SL2A 5FWKA 1E1QG 2YK9A 2AKPA 5E1AC 4BW5A 1M90W 2DYRC 2DYSC 4WCEV 4LP0A 1BKNA 5F3KA 2XABA 1MABG 2JJCA 4P9PA 1I59A 1TC6A 3E8BA 3T1CA 3CCLV 1JCHA 2CCTA 2Y69B 3HYYA 2WI7A 3F5WC 2JEUA 2DW4A 1F4MA 3G71V 2IU3A 3KG2A 2QA4V 1VQKV 4GGLA 1I5YA 3BMYA 2XDSA 2YJXA 3RVYA 3R4OA 5IDJA 3A0ZA 2EILC 3K99A 2YE2A 1YT0A 3ZRXA 1H8EG 2XHXA 1YI2V 3CCVV 2YI7A 4MTFA 2YI5A 3JD0A 2BSMA 1Q7YW 3O2FA 2YEEA 3ABMB 2XAGA 4UVBA 2GFDA 4CWSA 3VHDA 4U7OA 5CBGA 2QM8A 1FS0G 1SESA 3K03A 1GK9A 1MSWD 1U0ZA 3X2QB 1OCZC 4HY6A 3ABKC 2IU0A 2XAFA 2ITCC 1I58A 3CYOA 2X7RB 2UWDA 4BAYA 3M99B 1Q82W 4URMA 3D3IA 4R8CA 3CGZA 4MT8A 1UYCA 4X88A 1L0OA 3LDDA 2HG5C 2HG1A 3FB7C 1S14A 1YSCA 4EKWA 4UUJC 2PI5A 1ENVA 1S72V 5CMUA 1YS3A 1NJIW 2IOQA 2CK3G 3CCJV 2F43G 4MVMA 2DYRB 1VQ8V 1PD3A 2IJJA 1YC3A 2DYSB 1W0KG 4O04A 4QJFB 3LUTB 2BU7A 3W7TA 1K33A 3K04A 4MSWC 1CP9A 4UV8A 2WI5A 3SYPA 3JD2A 2ZDXA 3IC7A 1Z5AA 2XOKG 4ASUG 3SPJA 2QG0A 3CC2V 2YE3A 2WEQA 1Z59A 3TTZA 2X0LA 3ZJZA 1JVMA 4CE1A 4MVOA 3T0ZA 1R6KA 3ASNC 2E0AA 1B3QA 3WHAA 4JPRA 3RKZA 3OM3B 5IN9A 3RLPA 4MOTA 2YEJA 3FT8A 4E2LA 5L3CA 4JAVA 3FYIB 3T1KA 2P6JA 3TZ2A 2VCIA 3AG3C 1QCEA 3D36A 5HFMA 2JDIG 2HVKC 3W7SA 3E8HA 4HY1A 5FNDA 2WLNA 4XCLA 1GMGA 4OXSA 1NVPB 4GT8A 3OWDA 3GIFA 1OCZB 3SYAA 1YITV 4FCRA 3ABKB 3FB6C 1NBMG 2EIKC 4LWGA 4YKTA 3ETEA 3ZMVA 5IY5B 2DWDC 2XDXA 3B77A 3ZMUA 1COWG 2NNUA 2Q6AA 1ZWHA 2DQ3A 2BU2A 4WFGA 4DZYA 1JJ2U 4JF3A 1S16A 3H01A 1V55C 1AMWA 4EFUA 1B62A 2DWEC 1OZ0A 3Q5JA 5CBFA 1M9NA 1UYLA 4XDLA 3ZRVA 2ITDC 2V7QG 4PA7A 5D7RA 3K9AA 2O1VA 4KSGA 4HZ3A 3ZMZA 1ZWIC 4YKUA 4BIZA 5D6QA 2O1WA 1K5SA 2AHZA 3W7UA 1VQPV 4QE7A 4JAUA 4QPJA 1R62A 2YGFA 1KC8W 1YHQV 4AWPA 4XDMA 3LNUA 2HR3A 1UYKA 4XTJA 2W6IG 3CCEV 5BODA 4FJCC 1QZRA 1S5HC 4F4LA 1K4DC 5H6RA 3VHAA 3QO7A 4ZBMA 2IW5A 3T10A 2BZ5A 3U2DA 3CCUV 3AG3B 1AJQA 5CTUA 3H4LA 4L87A 2YEGA 1M57C 2XJGA 4CE2A 3ZMSA 2WLLA 4LWHA 2QFOA 3PJSK 3G4SV 1NH2D 2BYIA 2HVJC 2QG2A 1KP2A 1AI7A 2YEVA 1NHJA 5B1OA 1KKDA 2WLJA 2EIKB 4LP8A 2XHTA 4ZKIA 2Q8FA 1JOYA 3VOUA 3K79A 2IOPA 2CCUA 5B1BB 1F4NA 1AI5A 1MU5A 2WI1A 2Y48A 1BXDA 1UYGA 4YKRA 1V55B 3G7EA 1SRYA 5H6QA 2AHYA 1UYMA 3OW6A 4BQGA 3HPLC 2YE4A 3ASOC 1E79G 4E00A 2XCMA 2IH3C 1R73A 1VQ6V 3A0RA 1VQ4V 2IWXA 1GM8A 4B6CA 4WF9V 4EGHA 5CTXA 2CCSA 3OEHG 5EBLC 1Y8NA 4UVCA 4FPPA 3CRLA 4H7QA 2A9HA 4WUCA 1AI4A 4FK5C 2P90A 2WLIA 1ZXMA 2X6CA 3Q5KA 2ZQMA 4WFFA 3ZKDA 5C93A 1U2OA 3IEDA 3E35A 3A0XA 3G75A 3B27A 2YEFA 4XKAA 3EKRA 5D7DA 4EGIA 4EEHA 3KE6A 1KD1W 1VQ5V 2ZXWB 1Y66A 5EBWC 3QTFA 1QYEA 4L93A 5FNFA 2XASA 1M57B 2B1GA 1NR7A 3UM7A 3RW0A 5FL7G 4GEEA 5H9CA 3ZXOA 3TK1A 1JX9A 1GKXA 1KZNA 4WFAV 1E1RG 1AH6A 3HZ5A 4HZ5A 3FB8C 2VW5A 3MNRP 1G8MA 3ZCCA 2X6BA 4Q20A 4MPCA 3LNMB 2XNDG 1YSZA 4V25A 4V26A 5IYBO 2XAHA 1ORQC 2H8PC 5EC2C 4ASAA 3VBBA 2VCJA 3SPHA 4GFNA 2WLHA 4I9WA 5BZBA 1AJPA 2YKBA 4GX1A 4H81A 3DGEA 4W7TA 1RM1B 4URNA 2WLKA 3LDEA 2YKJA 3D2RA 1VQMV 4O09A 4PA4A 3R65A 3I56V 2YECA 3HYZA 4JYCA 4RUFA 3OPDA 4YKWA 5B1AC 2HKJA 2JJ1G 1NVPD 4MW3A 3R4PA 1VQ7V 1YETA 5L3FA 4BAEA 4QE9A 3OR6C 2H94A 3R92A 4AWQA 3RLRA 1Z5BA 5L3EA 1OCOC 1PKXA 3EKOA 1V54C 3CWVA 2OCCC 3CPWU 3EHGA 3GB7C 4CBCA 4WFEA 4CWOA 2WI6A 3SYQA 1KECA 4MVQA 3HHUA 2ZDYA 4YKZA 1I5XA 1L1FA 4XIRA 1ID0A 1K4CC 2BU8A 1R3IC 2BREA 4MTGA 1A4HA 3U2KA 3P30A 4HYOA 3JCZA 1K9MW 3IGAC 3QO8A 1GM9A 4HAMA 4H85A 2QM7A 3ZKBA 2BT0A 1M1KW 2XDUA 5BOCA 2XAQA 4TT3G 2ZBKB 1QLNA 1ZW9A 2VWCA 2Z5UA 3INWA 4EGKA 3O0IA 4XC0A 3GWOA 3K0DA 1GO3F 3T0HA 1P4RA 3QDDA 1UYHA 1B6QA 4AS9A 2EILB 4K4OA 2JEXA 1I5BA 4PA3A 4LBEC 2M7WA 4ASGA 2K5BA 2W6JG 3JD1A 4NH7A 3I55V 1PL0A 2R9IA 4TSFG 3OAAG 1THZA 2YE7A 4HZ0A 4G28B 3GIEA 3EHHA 1F51A 2X6AA 4XBFA 3UKMA 2YSUB 3EFFK 2XX4A 1QVGU 2QKSA 3E2EA 4CWNA 4EFTA 1V54B 2OCCB 1H2GA 3OE7G 3W7WA 3FYEB 3K06A 2WLMA 4QNHB 3IFXA 2H8MA 3VHCA 1K3EA 4PA9A 1MX0A 2YEVB 2Q8GA 1MG1A 3OUFA 4QPKA 2D3OW 5M4NA 4I3HA 1RPOA 3R4NA 1MOFA 2YKIA 4DXWA 2XDKA 3A0WA 2WAMA 4H33A 1S77D 3B26A 4XKOA 2OT5A 3ML0A 4KUMA 4BXIA 4MB9A 3OMAB 5CN0A 1THNA 3LSQA 1GTOA 3HZ1A 1VQLV 2A79B 2YEHA 2YKCA 3ZXQA 4R3AA 3ZRSA 5DN6G 2ZKJA 2WWWA 4PELA 1M56C 2MK3A 1XL6A 3F7VC 3ZMTA 1TBWA 3SPCA 3E8FA 1K7DA 3G7BA 4R6ZA 1UY9A 2QTOA 3QNEA 4XITA 5HFLA 1H8HG 3ASNB 2JK5C 1YTFD 2WLIB 1S3JA 1UYIA 2LP7A 3A0YA 4R7CA 1AR1B 4XIQA 5B1NA 2IORA 1H7SA 1I5AA 1VQNV 3JZ3A 4R1FA 2YGAA 1LNQA 2BOCC 4U93A 1BGQA 1YT1A 4JGSA 2YGEA 4PDRA 1YC1A 4P7AA 4XE2A 3INXA 1BMFG 2EZPA 2Q8HA 2ATKC 3DTUB 1ROPA 5M4KA 3W7XA 4B7PA 2EINC 2LFSA 3MHHC 1AM1A 4KP4A 3E83A 1B63A 1TC0A 3OFNG 3BY6A 2XK2A 5CPHA 3MD0A 4XDKA 2EZOA 5D6PA 4NH9A 2A0LA 2WEPA 3ZN0A 3PEHA 2XD6A 1EBOA 1CPYA 3OGCC 2Q67A 2CH4A 2B5UA 4WUDA 3H80A 2FWYA 1P7BA 2GHYA 3ZRWA 3U67A 2C2AA 1TIDA 4P8OA 1EZJA 2V1DA 4RO2A 3LSSA 4U7NA 1BYQA 2WI4A 1M56B 3ZM7A 5FNCA 1TUEB 4CZZA 4KQVA 3GIGA 4CWTA 1FXHA 2XJXA 1NHHA 4YKQA 1VQ9V 3G6EV 4PU9A 2YI0A 5IYDO 2WI3A 4ZVIA 3CP1A 4GX5A 1YSRA 3C11A 1NHIA 3BM9A 1I5CA 5LGUA 4JYBA 3ABTA 3LPSA 2WI2A 1S76D 3ZIAG 2P7TC 2FWZA 1NKDA 4MP2A 1EFRG 3BEHA 4G27B 4KTNA 1AJ6A 4EMVA 2ZR2A 3ETGA 3OMUA 4JTCB 1KP3A 4LCUC 1J95A 2HFEC 1GKZA 4L94A 1R6NA 3AG4C 4CWFA 3OWBA 3EHJA 2EINB 5J6AA 2GSMB 1I5DA 4LWEA 4P30A 5CTYA 2FYPA 3CMAV 4E01A 4WUBA 4PRXA 5KA5A 4JTAB 5LHIA 4I5SA 1IXMA 3K97A 3K08A 2ZD9A 1Z5CA 3B28A 1FXKA 1BHBA 3RVZA 4P9OA 1AI6A 3ABLC 1PNKA 3TETA 1SZTA 2BOBC 1DF4A 3B25A 5M4EA 3CCMV 1XL4A 1NH2B 2JIZG 4XIPA 4MTOA 2OTJV 3HEKA 2YEDA 4PA6A 1YT2A 3ASOB 1YC4A 4O05A 4KSHA 1Y4MA 3SJQC 4J9YB 4FIPC 2DQ0A 4WFBV 4ASBA 4N23A 3NXSA 3OMIB 5F5RA 5D7CA 2W0FC 3FV5A 4HXWA 1EI1A 4GX2A 2YI6A 4BQJA 1Q81W 3CCRV 3R4MA 4MVRA 3JD4A 2IJIA 5LGTA 4DO2A 4LC1A 5L3BA 2EBOA 1N8RW 5J9PC 1YJNV 3CGYA 4QIWF 4P2ZA 5M4MA 1F23A 1Q86W 1K73W 3JYCA 3AG4B 2H55A 4GT1A 2YE6A 4PDMA 4PL9A 3QO5A 1YESA 3CCSV 3NMQA 4HXZA 5EBMC 4JQLA 3WQ9A 1AJNA 1AH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHJ A;  5M4N A;  5B1O A;  4I3H A;  1KIJ A;  2XHT A;  4ZKI A;  2HCH A;  3R4N A;  2Q8F A;  2YKI A;  1JOY A;  2XDK A;  3A0W A;  2WER A;  3B26 A;  2CGF A;  4XKO A;  2IOP A;  2CCU A;  4BXI A;  4MB9 A;  3SL2 A;  1UY6 A;  2IWU A;  1TIL A;  2XDL A;  5FWK A;  1MU5 A;  1THN A;  2YK9 A;  2AKP A;  2WI1 A;  3HZ1 A;  1BXD A;  2YEH A;  3D0B A;  1UYG A;  4YKR A;  2YKC A;  3ZXQ A;  4R3A A;  4LP0 A;  3PEJ A;  3G7E A;  4KFG A;  1BKN A;  5F3K A;  2LFR A;  2XAB A;  2JJC A;  2ZKJ A;  1ZXN A;  1I59 A;  1TC6 A;  1UYM A;  3OW6 A;  2WWW A;  4BQG A;  1PVG A;  2YE4 A;  4E00 A;  2XCM A;  4DUH A;  1TBW A;  2CCT A;  3A0R A;  2IWX A;  3HYY A;  2YK2 A;  4B6C A;  2WI7 A;  4URL A;  4EGH A;  3G7B A;  5CTX A;  1UY9 A;  3O6O A;  2CG9 A;  2CCS A;  3K60 A;  4MP7 A;  1Y8N A;  4GGL A;  3BMY A;  2XDS A;  4XIT A;  2YJX A;  3R4O A;  4FPP A;  3CRK A;  3CRL A;  5IDJ A;  4H7Q A;  3A0Z A;  4WUC A;  3K99 A;  1UYI A;  5IDM A;  1ZXM A;  3A0Y A;  2YE2 A;  3Q5K A;  1UY7 A;  1YT0 A;  3ZRX A;  4XIQ A;  5B1N A;  2IOR A;  1UYF A;  1H7S A;  1I5A A;  3ZKD A;  2XHX A;  5C93 A;  1U2O A;  3IED A;  2XJJ A;  3A0X A;  2YI7 A;  3JZ3 A;  3G75 A;  3B27 A;  2YI5 A;  4R1F A;  2YEF A;  2BSM A;  2YGA A;  3O2F A;  4XKA A;  3EKR A;  5D7D A;  4EGI A;  4EEH A;  2BTZ A;  3KE6 A;  2YEE A;  4FCQ A;  4U93 A;  3EHF A;  1BGQ A;  1YT1 A;  1JM6 A;  2YGE A;  2IWS A;  2GFD A;  1YC1 A;  4P7A A;  4XE2 A;  3INX A;  4CWS A;  3QTF A;  2Q8H A;  3VHD A;  4U7O A;  5M4K A;  1QYE A;  4X9L A;  2QM8 A;  1UYE A;  4B7P A;  2LFS A;  4L93 A;  5FNF A;  1AM1 A;  4KP4 A;  1B63 A;  1TC0 A;  1U0Z A;  3K98 A;  4HY6 A;  4MPN A;  4CWR A;  1QY8 A;  1I58 A;  4GEE A;  3ZXO A;  2XK2 A;  3TK1 A;  4FMT A;  2UWD A;  5CPH A;  3MD0 A;  4O07 A;  4XKK A;  5D6P A;  4MPE A;  1GJV A;  4NH9 A;  2FTK A;  2WEP A;  1GKX A;  1KZN A;  3PEH A;  4URM A;  1AH6 A;  2XD6 A;  3HZ5 A;  4HZ5 A;  3CGZ A;  4MT8 A;  2BRC A;  2VW5 A;  1UYC A;  3MNR P;  5M4P A;  2CH4 A;  3ZCC A;  4Q20 A;  2BU6 A;  4FCP A;  1L0O A;  4MPC A;  4WUD A;  3H80 A;  2HG1 A;  2FWY A;  1S14 A;  3TUH A;  5M4H A;  3ZRW B;  1YSZ A;  4V25 A;  4V26 A;  4LWI A;  3R91 A;  4LWF A;  2YE5 A;  3ZRW A;  3U67 A;  2C2A A;  4BIU A;  1YS3 A;  4ASA A;  2PNR A;  2IOQ A;  1TID A;  2VCJ A;  1YC3 A;  4P8O A;  4GFN A;  4O04 A;  2BU7 A;  2BYH A;  2YKB A;  1EA6 A;  4H81 A;  2Q2E B;  4U7N A;  2XX2 A;  3DGE A;  1BYQ A;  4W7T A;  4R3M A;  2WI5 A;  2WI4 A;  3GIG B;  3ZM7 A;  5FNC A;  4PRV A;  2YE8 A;  2ZDX A;  4URN A;  4KQV A;  4GCZ A;  3GIG A;  4CWT A;  4E02 A;  2XJX A;  1Z5A A;  1NHH A;  4YKQ A;  4CWQ A;  4XD8 A;  3TZ5 A;  2QG0 A;  2YE3 A;  4PU9 A;  2YI0 A;  2YKJ A;  5L3J A;  3D2R A;  2WI3 A;  2WEQ A;  4ASF A;  4CWP A;  1Z59 A;  3TTZ A;  4O09 A;  3T2S A;  1UY8 A;  2YEA A;  4JAS A;  1Y8O A;  4ZVI A;  4CE1 A;  4CE3 A;  2YEC A;  3HYZ A;  3T0Z A;  4JYC A;  3OPD A;  1YSR A;  2E0A A;  4NH8 A;  3C11 A;  1B3Q A;  1NHI A;  3WHA A;  3BM9 A;  1I5C A;  4YKW A;  2YE9 A;  4JYB A;  5GGZ A;  3RKZ A;  5IN9 A;  3LPS A;  3C0E A;  2HKJ A;  2WI2 A;  3RLP A;  4LPB A;  3R4P A;  4L90 A;  1YET A;  4MOT A;  2YEI A;  2YEJ A;  3FT8 A;  4BAE A;  4JAV A;  3T1K A;  2BU5 A;  1US7 A;  2FWZ A;  3TZ2 A;  4MP2 A;  3R92 A;  4AWQ A;  3RLR A;  2VCI A;  1Z5B A;  4KTN A;  1AJ6 A;  4EMV A;  3D36 A;  3OMU A;  4HY1 A;  3EKO A;  4MTX A;  1GKZ A;  4L94 A;  3CWV A;  5FND A;  2EXL A;  4CWF A;  3OWB A;  3EHG A;  3EHJ A;  5J6A A;  4XCL A;  4CWO A;  2WI6 A;  1I5D A;  4LWE A;  4GT8 A;  3A0T A;  2O1U A;  1H7U A;  3OWD A;  3HHU A;  4L8Z A;  2ZDY A;  2Q8I A;  3GIF A;  4YKZ A;  5CTY A;  2FYP A;  2JKI A;  4FCR A;  3TZ4 A;  4E01 A;  4HYM A;  4WUB A;  1UYD A;  2XHR A;  4PRX A;  4XIR A;  1ID0 A;  4I5S A;  1IXM A;  3K97 A;  4LWG A;  1Z5C A;  4YKT A;  1TH8 A;  3B28 A;  2BU8 A;  2XDX A;  2BRE A;  1A4H A;  3U2K A;  1ZWH A;  2BU2 A;  2ESA A;  4H85 A;  2QM7 A;  4DZY A;  3ZKB A;  3B25 A;  2BT0 A;  2XX5 A;  4AWO A;  5M4E A;  1S16 A;  2QF6 A;  4YKY A;  1AMW A;  2XDU A;  4EFU A;  5BOC A;  3TZ0 A;  3FT5 A;  2ZBK B;  1B62 A;  1ZW9 A;  3RLQ A;  3Q5J A;  4XIP A;  2P67 A;  2VWC A;  5CF0 A;  3HEK A;  2YED A;  1YT2 A;  1UYL A;  3INW A;  1YC4 A;  4O05 A;  3ZRV A;  4KSH A;  4XCJ A;  4EGK A;  3O0I A;  4MBC A;  4XC0 A;  5D7R A;  2O1V A;  3T0H A;  4KSG A;  4GQT A;  1YER A;  3QDD A;  4YKU A;  4BIZ A;  1UYH A;  5D6Q A;  3P32 A;  2O1W A;  4L91 A;  4JAU A;  4QPJ A;  4AS9 A;  1R62 A;  2YGF A;  4K4O A;  4ASB A;  4AWP A;  1I5B A;  4XDM A;  3LNU A;  4ASG A;  2K5B A;  4NH7 A;  1UYK A;  4XTJ A;  3NXS A;  5F5R A;  5D7C A;  3FV5 A;  4HXW A;  2YEB A;  4HYP A;  2YE7 A;  5BOD A;  4HZ0 A;  1QZR A;  1EI1 A;  2YI6 A;  4BQJ A;  1OSF A;  2YJW A;  1Y4S A;  3R4M A;  4LC1 A;  3GIE A;  3EHH A;  1F51 A;  3VHA A;  4YKX A;  2FXS A;  3CGY A;  3T10 A;  2BZ5 A;  3U2D A;  2XX4 A;  3B24 A;  5M4M A;  1Y8P A;  4CWN A;  5CTU A;  3H4L A;  4EFT A;  2GQP A;  5J71 A;  3VAD A;  2YEG A;  3Q5L A;  2XJG A;  4CE2 A;  2H55 A;  4GT1 A;  2YE6 A;  4PL9 A;  4O0B A;  4LWH A;  1YES A;  1Y4U A;  2QFO A;  2YKE A;  4URO A;  2BYI A;  2H8M A;  3NMQ A;  3VHC A;  4HXZ A;  1MX0 A;  2QG2 A;  4JQL A;  3WQ9 A;  2Q8G A;  5CTW A;  1AH8 A;  4EM7 A;  4QPK A; 
#chains in the Genus database with same CATH topology
 4DV3 O;  4X1K A;  2KSD A;  4JI2 B;  2BTQ B;  1KIJ A;  2CGN A;  2HCH A;  4G2K A;  5IY5 C;  3JD3 A;  2WER A;  1BT8 A;  3Q4H B;  4XDJ A;  4DR4 B;  4DV7 O;  1UJW B;  2IH1 C;  1NS1 A;  4BIO A;  3ABL B;  1UY6 A;  2IWU A;  1TIL A;  4DR6 O;  2YS8 A;  2XDL A;  1EN4 A;  1G4Y B;  2YIB A;  2YC0 A;  3D0B A;  3PEJ A;  1DF5 A;  2QJ1 A;  4KFG A;  4NTX A;  2ZM6 B;  1GKF A;  2LFR A;  1ZXN A;  2XAJ A;  2H3O A;  4X62 O;  4IIJ B;  5KA6 A;  1PVG A;  5KAF Z;  1XHZ A;  4EFB A;  4DV4 B;  4DUH A;  1OCC C;  3H9V A;  4JI3 B;  1CEZ A;  2YK2 A;  2Q73 A;  1JMK C;  1IBM O;  4GX0 A;  4URL A;  4TWK A;  4LF6 O;  3O6O A;  2CG9 A;  1WPX A;  3K60 A;  4MP7 A;  1Z2G A;  2ZNI A;  1H2N A;  4BW9 A;  4MVZ A;  5B66 Z;  1JQ0 A;  3CRK A;  3HR0 A;  2UUA O;  2B1I A;  3N2K A;  4X66 O;  4ZIB A;  5B3S C;  4KXR A;  4IT5 A;  5IDM A;  1LUV A;  4UVA A;  3RBZ A;  5B1A B;  1UY7 A;  1UYF A;  3HKE A;  3SDL A;  1N36 O;  3A0H Z;  2B9Z A;  4J80 A;  2XUM A;  2Q69 A;  1JFF A;  4K0K B;  2XJJ A;  2W0X A;  1VQO V;  3OR7 C;  1WB8 A;  3OMN B;  5KHG A;  5LHH A;  1N32 B;  2ZDI A;  3J7A U;  2BTZ A;  4FCQ A;  1AP5 A;  3STZ C;  3EHF A;  5L3G A;  1JM6 A;  1EZV H;  3BPZ A;  2IWS A;  4U3J A;  1KQS U;  3LDC A;  1OCO B;  1SER A;  2K1E A;  5A9G A;  4KFM A;  2ADQ B;  2WLL B;  3FB5 C;  2R9A A;  4X9L A;  3OT7 A;  1UYE A;  4NXN O;  1N33 B;  3K5O A;  4JI1 B;  4WFH A;  3JAT A;  1QR8 A;  5IYC O;  1GAX A;  3K98 A;  3AEI A;  5B5E Z;  1XMQ B;  5GTH Z;  5LA6 B;  1Q8I A;  4MPN A;  2G38 A;  4CWR A;  1RPR A;  3OEE G;  2CE4 A;  1OHH G;  1QY8 A;  4KHP O;  2QEX V;  2WSS G;  3UCS C;  5C8Y B;  2F66 C;  4FMT A;  3AK2 A;  1FKA O;  3C3T A;  2UXC O;  4O07 A;  4XKK A;  2FKX A;  4MPE A;  1GJV A;  1FXK C;  2FTK A;  3K59 A;  1W0J G;  5CA1 A;  1YJW V;  2KQX A;  1BHA A;  1QVF U;  4OGQ B;  4JV5 B;  4D7T A;  2BRC A;  1IBK O;  5M4P A;  3CC4 V;  3T4Z A;  4LF5 O;  2BU6 A;  4EFE A;  3B8N A;  3ETQ A;  4FCP A;  1NQT A;  5JH7 A;  5K1P A;  4UV9 A;  4X65 O;  1WLE A;  3K0G A;  3B09 A;  4O2A B;  3TUH A;  5M4H A;  3ZRW B;  4PDL A;  1SQV H;  5B1B C;  4LWI A;  3R91 A;  4LWF A;  2YE5 A;  2QGN A;  1GM7 A;  3ICX A;  4MVU A;  4BIU A;  1AR5 A;  2PNR A;  3CRC A;  5FPO A;  3L74 H;  1OCR C;  4RAI A;  3CC7 V;  4DR7 O;  5DM6 V;  3JAR B;  2GV9 A;  4MVS A;  1VF6 A;  3AG1 C;  4MS2 A;  1AP6 A;  2BYH A;  1EA6 A;  4Z1M G;  4KL1 A;  3E89 A;  2Q2E B;  3BRC A;  2XX2 A;  1Y76 A;  4R3M A;  1D5N A;  3GIG B;  2EIM C;  1NR1 A;  2NLJ C;  4PRV A;  2YE8 A;  5LMN O;  1OCC B;  4GCZ A;  3AG2 C;  3T1Y O;  4E02 A;  1TVK B;  3UT5 B;  3BA8 A;  4CWQ A;  3SR2 C;  4XD8 A;  3TZ5 A;  1D2D A;  1EN6 A;  5KUK A;  5L3J A;  3T1H O;  4CWP A;  4HBN A;  4ASF A;  4X8A A;  2IJK A;  3T2S A;  1JR9 A;  3SYC A;  2OWO A;  1UY8 A;  2YEA A;  4JAS A;  2F4V B;  5GW7 A;  1Y8O A;  4CS3 A;  4CE3 A;  1JPX A;  2UXX A;  4K3A A;  4YJ2 A;  2EIJ C;  4NH8 A;  2EJR A;  3APQ A;  1QLE C;  4NTW A;  3CSX A;  1SET A;  5B3S B;  4FM2 A;  4JI4 B;  4J10 A;  1YIJ V;  2YE9 A;  3SJC C;  3RYH A;  5GGZ A;  1FXV A;  3WG7 C;  1V9P A;  3VQV A;  4DV6 B;  3QF7 A;  1VF7 A;  3C0E A;  1DLB A;  3ZN1 A;  4J9Z B;  4J41 A;  3OUS A;  4LPB A;  1K97 A;  3ABU A;  4L90 A;  2KB1 A;  3CD6 V;  4RQE A;  3K57 A;  2YEI A;  4AQY O;  2BU5 A;  4NYK A;  1US7 A;  4TQF A;  4LNU B;  1HWY A;  4B3T B;  3L70 H;  1WB7 A;  3HB3 B;  3ETD A;  1QNM A;  1VEW A;  1BQZ A;  4UXN A;  1N34 B;  3MHS C;  5LHG A;  3CME V;  2ZXW C;  2YIB D;  3CE2 A;  4MTX A;  3G6B A;  3T2M A;  5JJE B;  2KG7 A;  2PUS A;  2EXL A;  1JA8 A;  2IJH A;  5LYJ B;  1M93 A;  4R50 A;  4UCO A;  2PI4 A;  1LR1 A;  3SYO A;  2PYL A;  1H7U A;  2O1U A;  3A0T A;  4L8Z A;  2Q8I A;  1QBZ A;  2Q7H A;  3E8G A;  2LW7 A;  4N21 A;  2JKI A;  1FFT B;  3TZ4 A;  2R70 A;  3G67 A;  1BGY H;  2QE7 G;  5DEC A;  4HYM A;  1UYD A;  2XHR A;  3FKS G;  5EC1 C;  4DV1 O;  1PNM A;  2VQE O;  4UFZ A;  5CBH A;  3JSN A;  1GN2 A;  2QWR B;  1FXK B;  1K8A W;  1R3J C;  1TH8 A;  2UU9 O;  1Q6I A;  3N27 A;  5EK0 A;  1XNR O;  4J7J A;  3OW2 U;  4YXW G;  4TUY A;  1YF2 A;  2ESA A;  3A2F A;  1AVM A;  1F7Y A;  2L6L A;  3DSQ A;  2XX5 A;  4AWO A;  2F23 A;  1H38 A;  2QF6 A;  2HLD G;  4LWS A;  4YKY A;  4PDV A;  5EZY B;  3TZ0 A;  1DTO A;  3FT5 A;  4E4E A;  5A2Q N;  3RLQ A;  1SQP H;  4F6E A;  2PTM A;  1K5Q A;  2P67 A;  1OCR B;  5CF0 A;  4XCJ A;  3AG1 B;  4RUE A;  5L3D A;  1HR0 O;  1BL8 A;  4MBC A;  5KUM A;  2Y69 C;  3EHB B;  1Y74 B;  1FYJ A;  3JAW A;  4GQT A;  4NKG B;  1RM1 C;  2HKO A;  1YER A;  2EIM B;  3K3W A;  4RQF A;  5JVD A;  3TGU H;  3P32 A;  1ZTE A;  5JCO A;  4CC5 A;  1I94 B;  3AG2 B;  5CA3 A;  3C90 A;  4L91 A;  4FFK A;  1J5E B;  1S0V A;  2EX3 A;  1HNZ O;  3B8M A;  1R3K C;  3E86 A;  3U10 A;  4CH6 A;  2ZR3 A;  1R3L C;  3SPG A;  1K34 A;  4RWU A;  4CH5 A;  4O4I B;  2R9R B;  2EIJ B;  1IXB A;  1QLE B;  3AG7 A;  4O4J A;  3TCU A;  2YEB A;  4HYP A;  3CXC U;  3WG7 B;  4DK1 A;  4MW8 A;  2ZDI C;  1RP3 B;  1OSF A;  2YJW A;  1Y4S A;  3ABM C;  1QR9 A;  1K92 A;  4YKX A;  2CAZ C;  2WPD G;  2FXS A;  3GWK C;  1NTZ H;  2QKC A;  3STL C;  4W4L A;  3B24 A;  4X89 A;  3SPI A;  1Y8P A;  4UCU A;  3GVM A;  2RMK B;  2YI9 A;  5IJ9 B;  3K58 A;  2UXN A;  1YTF B;  2GQP A;  5J71 A;  3VAD A;  3T4D A;  4H37 A;  3Q5L A;  3X2Q C;  3F7Y C;  4O0B A;  1Y4U A;  1IUR A;  2Q68 A;  2YKE A;  4JTD B;  5LGN A;  3CCQ V;  1PNL A;  3KKY A;  3WFV A;  4URO A;  2EJ7 A;  1SC5 B;  1GN4 A;  3QTC A;  1I0H A;  4B3S O;  1ARO P;  2E5L O;  2YXY A;  4I55 B;  5CTW A;  1ZL8 B;  3KCX A;  4EM7 A;  1YJ9 V;  2JJ2 G;  2HJF C;  4B3R B;  1W2B U;  2OTL V;  1W59 A;  2JRI A;  2Z3Y A;  2LQT A;  1SA0 B;  3BA9 A;  5LBQ A;  2CGF A;  3SL2 A;  1CXZ B;  3H1L H;  2ARH A;  5FWK A;  1E1Q G;  1TUB B;  2YK9 A;  2AKP A;  4PD4 F;  5E1A C;  4BW5 A;  1M90 W;  2DYR C;  1VF6 C;  4YJ3 B;  4LFA O;  2DYS C;  3B2E E;  4WCE V;  3LMM A;  4LP0 A;  1BKN A;  4FLZ A;  5F3K A;  2XAB A;  1MAB G;  2JJC A;  4P9P A;  4NXM O;  1I59 A;  1MNG A;  1TC6 A;  4UB6 Z;  5LL6 Y;  1X4T A;  4DV5 O;  4DUY O;  4GKK O;  3JAS A;  3E8B A;  3HKB B;  3T1C A;  1QHT A;  5LMU B;  1XI1 A;  3CCL V;  1JCH A;  2CCT A;  2Y0P A;  5CB4 B;  2OCH A;  2Y69 B;  3HYY A;  2HP8 A;  2WI7 A;  3F5W C;  2JEU A;  2UUB B;  2DW4 A;  4D7S A;  4LF7 O;  1F4M A;  3G71 V;  2YXH A;  2IU3 A;  3KG2 A;  2Q4P A;  2QA4 V;  1VQK V;  4GGL A;  1I5Y A;  3C3S A;  3BMY A;  4W4K A;  4LF4 O;  2XDS A;  2YJX A;  3RVY A;  3R4O A;  5IDJ A;  1HNX B;  1SQQ H;  3A0Z A;  2EIL C;  4UB8 Z;  3K99 A;  3A8T A;  2E74 B;  2YE2 A;  1FD9 A;  1YT0 A;  3ZRX A;  1H8E G;  1JFF B;  4PJ0 Z;  2XHX A;  1NI8 A;  2DJV A;  1YI2 V;  2BSK A;  3CCV V;  5IYZ B;  2YI7 A;  3ZHQ A;  3I5D A;  4MTF A;  2YI5 A;  3JD0 A;  1XNQ B;  4I4T A;  2BSM A;  4LF8 B;  1Q7Y W;  3O2F A;  5EYP A;  4DUZ O;  1HP8 A;  2GUZ B;  2D2C B;  2YEE A;  3ABM B;  5JQG B;  2P5O A;  2XAG A;  4UVB A;  2GFD A;  4C7U A;  1YZB A;  4CWS A;  2F95 B;  3BVO A;  3VHD A;  4U7O A;  4HNA A;  1O9G A;  5CBG A;  2QM8 A;  1US6 A;  2LGQ A;  1FS0 G;  1SES A;  2JGU A;  3JAT B;  2QKA A;  3K03 A;  1GK9 A;  3JSL A;  2JS3 A;  1MSW D;  4OX9 B;  3X2Q B;  2LJ2 A;  1U0Z A;  3RYC A;  1EN5 A;  4J11 A;  1ZSP A;  4ZOL A;  1OCZ C;  2C1I A;  4HY6 A;  4BWA A;  3ABK C;  2IU0 A;  1H2M A;  4JI4 O;  2XAF A;  3FD9 A;  1SQX H;  2ITC C;  1I58 A;  1SQG A;  3CYO A;  2X7R B;  2UWD A;  1RSO B;  4U3F H;  5BR8 O;  4O4H A;  5BMV B;  5CA1 B;  4BAY A;  3M99 B;  1Q82 W;  4URM A;  4I0X B;  3D3I A;  1XBL A;  4R8C A;  3CGZ A;  1HNW B;  2ZE6 A;  4MT8 A;  4JI0 O;  4OPH A;  1UYC A;  4J7Z A;  4X88 A;  3TJT A;  1L0O A;  3LDD A;  1UFI A;  2HG5 C;  2HG1 A;  3FB7 C;  1S14 A;  3M7M X;  1YSC A;  2VWJ A;  4BR6 A;  4EKW A;  2Q9L A;  4LH6 A;  4X64 O;  4UUJ C;  5CA0 A;  2PI5 A;  1ENV A;  1S72 V;  2UXD B;  5CMU A;  2HHH B;  5KX5 B;  1YS3 A;  1NJI W;  2CH7 B;  2IOQ A;  2CK3 G;  3CCJ V;  3KZI Z;  2F43 G;  3BAB A;  4MVM A;  2DYR B;  1VQ8 V;  1PD3 A;  2IJJ A;  1YC3 A;  2DYS B;  1W0K G;  4DW0 A;  2OYQ A;  4O04 A;  1U96 A;  4QJF B;  4DV0 O;  3LUT B;  4DR1 O;  1IVS A;  1BS3 A;  3W7T A;  2BU7 A;  1K33 A;  3K04 A;  3WB0 A;  4UCS A;  4MSW C;  1Y76 B;  1CP9 A;  4A5U B;  3QG5 A;  4UV8 A;  2WI5 A;  2N74 A;  3SYP A;  3JD2 A;  2ZDX A;  3IC7 A;  5LP6 A;  5FNV A;  2ZKO A;  1IBL B;  4JI5 O;  1Z5A A;  2XOK G;  3EVK A;  4ASU G;  4I50 A;  3SPJ A;  4FLW A;  4K35 A;  2QG0 A;  3CC2 V;  2YE3 A;  2Q5Z A;  2E76 B;  3F5T A;  2WEQ A;  1Z59 A;  3TTZ A;  2X0L A;  2GBO A;  5IWA O;  4YJ2 B;  3ZJZ A;  1JVM A;  2AXT Z;  4I7Z B;  4CE1 A;  4MVO A;  4LFB B;  3T0Z A;  2VS0 A;  1R6K A;  3ASN C;  2E0A A;  1B3Q A;  3WHA A;  5LOV B;  4O4L B;  3BAA A;  1MZF A;  4JPR A;  3N2G B;  2QSA A;  3RKZ A;  4WBN B;  3OM3 B;  4LR3 A;  2LO1 A;  5IN9 A;  3VQY A;  5GTI Z;  3RLP A;  3HKD A;  4MOT A;  4ICG A;  3THO A;  2YEJ A;  4E2L A;  3FT8 A;  5L3C A;  1XHX A;  4JAV A;  3FYI B;  3RYI B;  3T1K A;  3LNN A;  2P6J A;  3TZ2 A;  2E75 B;  4YY3 B;  2VCI A;  3AG3 C;  1QCE A;  4CC6 A;  2UXB B;  3D36 A;  5HFM A;  5IE9 A;  2YXL A;  2UUC B;  2JDI G;  2HVK C;  3W7S A;  3E8H A;  4HY1 A;  5EIB D;  2P06 A;  4GKJ B;  1GH6 A;  4DV2 O;  5FND A;  1XMO O;  2WLN A;  4XCL A;  4B3M B;  1GMG A;  4OXS A;  1NVP B;  4JI8 O;  4Q6G A;  2BE3 A;  4GT8 A;  3OWD A;  3GIF A;  4LF9 O;  4JI7 B;  1GRJ A;  1OCZ B;  3SYA A;  1YIT V;  4FCR A;  3ABK B;  5ITZ A;  2QWO B;  2NN4 A;  1H2S B;  3FB6 C;  4H0L B;  2CDY A;  5JWP A;  4PI0 A;  1NBM G;  2EIK C;  4LWG A;  4DR2 O;  4YKT A;  2XHB A;  1IZ3 A;  4LFC O;  3ETE A;  3ZMV A;  1B04 A;  5IY5 B;  5LXT A;  2DWD C;  2YID A;  4DRX A;  4FLU A;  2XDX A;  3B77 A;  3ZMU A;  2PF4 E;  1COW G;  2NNU A;  2Q6A A;  3JAL A;  1L8D A;  1ZWH A;  2DQ3 A;  5IT9 N;  2BU2 A;  5KHI A;  4WFG A;  4X1Y B;  5D5P A;  3P3P A;  4DZY A;  1JJ2 U;  4DR3 B;  2JGD B;  4JF3 A;  1S16 A;  5IJ0 A;  3H01 A;  1V55 C;  1AMW A;  4EFU A;  3L72 H;  1B62 A;  4ZHQ B;  2DWE C;  1OZ0 A;  3Q5J A;  5CBF A;  3RYF B;  2DN9 A;  1M9N A;  3BFR A;  1UYL A;  1U97 A;  4XDL A;  3ZRV A;  4LH7 A;  1SQF A;  4JYA O;  2ITD C;  2V7Q G;  1YEW A;  4PA7 A;  5D7R A;  3K9A A;  2O1V A;  5JVD B;  4KSG A;  4HZ3 A;  4ZI7 B;  3ZMZ A;  1PV0 A;  3P3N A;  1ZWI C;  4YKU A;  3L9D A;  4BIZ A;  5D6Q A;  2O1W A;  1K5S A;  2AHZ A;  3W7U A;  3HKC B;  1VQP V;  4QE7 A;  4JAU A;  4QPJ A;  3S3X A;  4TV9 A;  1R62 A;  2YGF A;  1KC8 W;  1YHQ V;  4AWP A;  2HJD A;  4XDM A;  3LNU A;  2HR3 A;  4FLV A;  1UYK A;  4XTJ A;  3OTO B;  2W6I G;  2FB5 A;  3CCE V;  5D5Q A;  2VRZ A;  4GYC B;  5KLV H;  5BOD A;  3CEI A;  4FJC C;  1QZR A;  1S5H C;  2RJZ A;  4F4L A;  1ZAU A;  1FJG B;  1K4D C;  5H6R A;  2Z0A A;  3VHA A;  1HW7 A;  3QO7 A;  4O2B B;  1XOU A;  2ZIO A;  4ZBM A;  2IW5 A;  3T10 A;  4DR5 O;  4E72 A;  2BZ5 A;  4X1I B;  3CCU V;  3AG3 B;  3U2D A;  2N04 A;  1AJQ A;  1A32 A;  4DV7 B;  4YHH O;  5CTU A;  3H4L A;  4L87 A;  3VQW A;  2YEG A;  1YVW A;  5JJN B;  1M57 C;  4DR6 B;  2XJG A;  4CE2 A;  2PGG A;  3ZMS A;  2WLL A;  4LWH A;  2WA4 A;  2QFO A;  3PJS K;  3G4S V;  1NH2 D;  2A7W A;  2BYI A;  3E22 B;  2HVJ C;  3H1K H;  2QG2 A;  2BTO A;  1AB3 A;  1KP2 A;  1URF A;  4X62 B;  5J2U A;  1I08 A;  1MZE A;  2VQF O;  5LA6 A;  1IX9 A;  2YEV A;  1AI7 A;  1NHJ A;  5B1O A;  1KKD A;  2WLJ A;  3UO2 A;  3FAV A;  4JI6 O;  5C8Y A;  2EIK B;  4LP8 A;  2YIC A;  1IBM B;  2XHT A;  4ZKI A;  3H1I H;  4LF6 B;  2Q8F A;  1JOY A;  3VOU A;  3K79 A;  2IOP A;  2ZIN A;  2CCU A;  5B1B B;  1F4N A;  2UUA B;  1AI5 A;  4X66 B;  3UO3 A;  1LUW A;  2M6Y A;  1MU5 A;  4FFB A;  1Y67 A;  2WI1 A;  4UCT A;  2Y48 A;  1BXD A;  1MMM A;  1UYG A;  4YKR A;  4O2A A;  3DC6 A;  1V55 B;  3G7E A;  1XUQ A;  1R6T A;  3CWB H;  1N36 B;  2Q7G A;  1SRY A;  3CRM A;  5H6Q A;  1WA8 A;  2AHY A;  1UYM A;  3OW6 A;  1O9H A;  4BQG A;  1WP8 A;  2Y4U A;  3HPL C;  5LP6 C;  2YE4 A;  3ASO C;  1E79 G;  4E00 A;  2XCM A;  2IH3 C;  4Z2W A;  4JI2 O;  1R73 A;  1VQ6 V;  3A0R A;  3JAR A;  1VQ4 V;  2IWX A;  1GM8 A;  1MSD A;  4B6C A;  5KMG B;  4WF9 V;  3FFQ A;  4B7K A;  4F6R A;  3TXQ A;  4EGH A;  5CTX A;  2CCS A;  3OEH G;  5EBL C;  1Y8N A;  4UVC A;  4DR4 O;  2GDS A;  3IJ4 A;  4IHJ B;  2CGO A;  2P4V A;  4K8Z A;  4YIP A;  3DXR B;  4FPP A;  1TVK A;  3CRL A;  3UT5 A;  1Z5W A;  4H7Q A;  2A9H A;  4J42 A;  4NXN B;  4WUC A;  2O57 A;  1AI4 A;  4FK5 C;  2P90 A;  2WLI A;  1ZXM A;  2X6C A;  4EB6 A;  3CJH B;  3Q5K A;  2ZQM A;  3OD4 A;  2QWP B;  1Q3E A;  4WFF A;  2BSK B;  3ZKD A;  5C93 A;  2ZM6 O;  1QU7 A;  1U2O A;  2PYJ A;  3IED A;  3E35 A;  4KHP B;  4JAA A;  2P22 C;  3A0X A;  1R1B A;  3G75 A;  3B27 A;  2UXC B;  2YEF A;  4DV4 O;  4XKA A;  3EKR A;  5D7D A;  4JI3 O;  4EGI A;  4EEH A;  3KE6 A;  5GON B;  4Z1V A;  1KD1 W;  1VQ5 V;  1ZX3 A;  2ZXW B;  1Y66 A;  4TV8 B;  5EBW C;  1IBK B;  4AHC A;  4LNU A;  4LF5 B;  3QTF A;  1FPO A;  1QYE A;  4X65 B;  1XQ8 A;  3CXH F;  4L93 A;  5FNF A;  3RYC B;  2XAS A;  1WJZ A;  1M57 B;  2B1G A;  1NR7 A;  2Q7E A;  3UM7 A;  3RW0 A;  4X1K B;  5DED A;  5FL7 G;  1SQB H;  4K0K O;  3D3Q A;  1GN6 A;  4QGP A;  4DR7 B;  2RQ6 A;  4GEE A;  5H9C A;  3ZXO A;  3TK1 A;  1JX9 A;  1N32 O;  4CS4 A;  1Q6U A;  1GKX A;  1KZN A;  4WFA V;  1E1R G;  1AH6 A;  4JZ2 A;  5LMN B;  3HZ5 A;  1EM1 A;  4HZ5 A;  1NT2 B;  3FB8 C;  3T1Y B;  2VW5 A;  3MNR P;  1G8M A;  1FFX A;  3ZCC A;  1WPB A;  2X6B A;  4Q20 A;  3T1H B;  4MPC A;  1XDC A;  3LNM B;  2C1G A;  2XND G;  1YSZ A;  4V25 A;  4V26 A;  5IYB O;  1N33 O;  2XAH A;  4JI1 O;  2ZE7 A;  3OGI B;  1XMQ O;  1BQ0 A;  3J80 N;  1YCI A;  1ORQ C;  2H8P C;  5EC2 C;  4ASA A;  3VBB A;  4IYH A;  2VCJ A;  3SPH A;  2YI8 A;  4GFN A;  3MDS A;  2K9P A;  2WLH A;  1H2L A;  4I9W A;  5BZB A;  5AG2 A;  1AJP A;  3UQ8 A;  2YKB A;  4AI8 A;  5EZY A;  1N0J A;  4GX1 A;  4H81 A;  1WNS A;  4AQY B;  3DGE A;  4W7T A;  1RM1 B;  2AZ0 A;  4URN A;  2WLK A;  4JYY A;  5H2F Z;  4JV5 O;  3H1H H;  3N2K B;  3LDE A;  2YKJ A;  3D2R A;  1VQM V;  2IM9 A;  3JCU Z;  4O09 A;  4PA4 A;  1S5L Z;  3R65 A;  4ABM A;  3I56 V;  2YEC A;  3HKE B;  3HYZ A;  1BZK A;  2RDC A;  3ZHR A;  4JYC A;  4RUF A;  3OPD A;  3J81 N;  4DK0 A;  4YKW A;  3KCY A;  5B1A C;  4OPA A;  5J2T A;  2HKJ A;  4GZR B;  2JJ1 G;  1NVP D;  4MW3 A;  3R4P A;  1P7G A;  1VQ7 V;  1YET A;  5L3F A;  4U3J B;  4BAE A;  4QE9 A;  3OR6 C;  4DV1 B;  1D5A A;  2VQE B;  2H94 A;  2PZS A;  1I7F A;  2QR4 A;  4GLX A;  3R92 A;  4AWQ A;  3RT3 C;  3RLR A;  1Z5B A;  2UU9 B;  1HDJ A;  1NTK H;  5L3E A;  1XNR B;  2PY5 A;  4X20 A;  1OCO C;  1PKX A;  3EKO A;  2NR5 A;  2F4V O;  1OV9 A;  1V54 C;  3M8A A;  3CWV A;  2OCC C;  2CTQ A;  3CPW U;  3EHG A;  1DGS A;  3GB7 C;  1SZX A;  4CBC A;  4WFE A;  2QWN B;  2WI6 A;  5IJ9 A;  4CWO A;  3BHP A;  3SYQ A;  1KEC A;  4MVQ A;  4D6T H;  4DV6 O;  3HHU A;  2ZNJ A;  2ZDY A;  4YKZ A;  1I5X A;  1L1F A;  5KHJ A;  4X9Q A;  3ZX6 A;  4NR1 A;  4XIR A;  3APO A;  3B4S A;  1ID0 A;  1HR0 B;  4B3T O;  2HHI A;  1K4C C;  5LXT B;  5JH7 B;  4DRX B;  4I55 A;  1ZL8 A;  2BU8 A;  1N34 O;  4IGG A;  1NZ6 A;  3JAL B;  1AR4 A;  2E3C A;  1R3I C;  2BRE A;  4MTG A;  1A4H A;  3U2K A;  3P30 A;  4HYO A;  3JCZ A;  1K9M W;  4CH3 A;  1G1X B;  1HNZ B;  3IGA C;  2JVD A;  3QO8 A;  2MW2 B;  1GM9 A;  4HAM A;  4H85 A;  2QM7 A;  5IJ0 B;  1SA0 A;  3ZKB A;  2BT0 A;  1M1K W;  2F93 B;  5KAI Z;  2XDU A;  5BOC A;  4FM1 A;  4YIO A;  2XAQ A;  4TT3 G;  2ZBK B;  2FML A;  1QLN A;  1ZW9 A;  1TUB A;  2VWC A;  1BSM A;  1Y6X A;  2Z5U A;  5JCO C;  3INW A;  3U11 A;  4YJ3 A;  4EGK A;  3O0I A;  4XC0 A;  2HEP A;  3GWO A;  3K0D A;  1GO3 F;  3T0H A;  3RWR D;  1P4R A;  2XTA A;  1VP7 A;  4UCV A;  3QDD A;  1UYH A;  4FLY A;  3HKB A;  5CB4 A;  3SJB C;  4TV9 B;  1B6Q A;  3CRR A;  4AS9 A;  3RYH B;  3WU2 Z;  2EIL B;  4K4O A;  2JEX A;  1I5B A;  4PA3 A;  4LBE C;  3WB2 A;  2M7W A;  1L0N H;  4ASG A;  2K5B A;  2W6J G;  3JD1 A;  4NH7 A;  3I55 V;  1PL0 A;  2R9I A;  4TSF G;  2KKW A;  4UCR A;  3OAA G;  2Y0I A;  1THZ A;  2YE7 A;  4HZ0 A;  4B3S B;  1T5E A;  1KYO F;  3CX5 F;  2E5L B;  4CH4 A;  4G28 B;  3K5N A;  3GIE A;  3EHH A;  1F51 A;  2X6A A;  2QWQ B;  3G80 A;  4XBF A;  5IYZ A;  3UKM A;  2YSU B;  4PHZ A;  2KG7 B;  1I94 O;  3EFF K;  2XX4 A;  1QVG U;  2GUZ A;  1J5E O;  2QKS A;  5JQG A;  3E2E A;  4CWN A;  4EFT A;  3EXA A;  1V54 B;  2OCC B;  1H2G A;  3ZED A;  3OE7 G;  4TQD A;  4IYI A;  3JAK A;  3W7W A;  3FYE B;  3K06 A;  2WLM A;  1S5J A;  4LFA B;  4CS2 A;  4QNH B;  3IFX A;  2H8M A;  2XT9 A;  1P49 A;  3VHC A;  5J2U B;  1K3E A;  4PA9 A;  1MX0 A;  4NXM B;  2YEV B;  2Q8G A;  1MG1 A;  3OUF A;  2ADP A;  4DV5 B;  4DUY B;  4GKK B;  4QPK A;  3FAV B;  2D3O W;  5M4N A;  2DE0 X;  1NU1 H;  4I3H A;  3CHX A;  4TUY B;  1RSO A;  1RPO A;  1GN3 A;  2QDO A;  5EIB C;  3R4N A;  1MOF A;  1P84 F;  2BTQ A;  5BMV A;  2YKI A;  1N0N A;  4DXW A;  4LF7 B;  2XDK A;  3A0W A;  2WAM A;  4H33 A;  1S77 D;  3B26 A;  1XEQ A;  4XKO A;  3B40 A;  2OT5 A;  4I0X A;  3ML0 A;  4KUM A;  4LWS B;  4LF4 B;  4BXI A;  3Q4H A;  4MB9 A;  3A0B Z;  3OMA B;  4FFB B;  5TIS Z;  5CN0 A;  1THN A;  3LSQ A;  4B08 A;  1AIL A;  1GTO A;  1RFY A;  3HZ1 A;  1VQL V;  2A79 B;  2YEH A;  2CTP A;  2YKC A;  3ZXQ A;  4R3A A;  1ZUQ A;  1WA8 B;  1KMI Z;  3ZRS A;  1PM9 A;  3AK3 A;  4FVM A;  5DN6 G;  3JAW B;  2ZKJ A;  1VIB A;  2ILM A;  2LW1 A;  5KX5 A;  2WWW A;  3L73 H;  4PEL A;  2CH7 A;  3CS5 A;  1M56 C;  2MK3 A;  1XL6 A;  3F7V C;  3ZMT A;  4IIJ A;  1TBW A;  2Q8V A;  2RNB A;  4F6R B;  3SPC A;  4DUZ B;  1FAF A;  1TA8 A;  4B3R O;  1WAZ A;  3E8F A;  3OTF A;  2DMX A;  1K7D A;  2CTR A;  3G7B A;  4R6Z A;  1UY9 A;  3PN1 A;  2QTO A;  3QNE A;  2OIG A;  1DK1 A;  2Y4T A;  4XIT A;  5HFL A;  1H8H G;  1SS3 A;  3ASN B;  4O4J B;  2JK5 C;  1YTF D;  2WLI B;  1S3J A;  4EB6 B;  1UYI A;  2LP7 A;  4B7E A;  3A0Y A;  5FLX N;  4R7C A;  2FL4 A;  1AR1 B;  4XIQ A;  5B1N A;  2IOR A;  1H7S A;  1I5A A;  3SJA C;  2A3Q A;  3JAM N;  1VQN V;  1KKC A;  1TAE A;  4DV3 B;  3JZ3 A;  5LOV A;  4O4L A;  2ZIM A;  5BR8 B;  5LMU O;  4R1F A;  3N2G A;  4WBN A;  4FLT A;  2YGA A;  4L8J A;  1L0L H;  1LNQ A;  2R72 A;  4NB5 A;  1WP7 A;  2BOC C;  4U93 A;  2UUB O;  2OIE A;  1BGQ A;  1YT1 A;  4JGS A;  2YGE A;  4PDR A;  3RYI A;  4JI0 B;  1YC1 A;  4P7A A;  4XE2 A;  3AK1 A;  3INX A;  1BMF G;  2EZP A;  4DYL A;  2Q8H A;  2N05 A;  2ATK C;  1PPJ H;  2ZT9 B;  3DTU B;  1ROP A;  5M4K A;  1HNX O;  3W7X A;  1PL4 A;  4B7P A;  2EIN C;  2LFS A;  3MHH C;  1AM1 A;  4KP4 A;  3E83 A;  3O65 A;  4X64 B;  5FPR A;  1B63 A;  1TC0 A;  3OFN G;  3BY6 A;  2ODM A;  2VWK A;  2YIA A;  1JJO A;  3MAQ A;  2V4D A;  2XK2 A;  4DV0 B;  4DR1 B;  5CPH A;  3MD0 A;  4XDK A;  2EZO A;  1KU9 A;  5D6P A;  1XNQ O;  3K5M A;  4LF8 O;  4NH9 A;  2A0L A;  2WEP A;  3ZN0 A;  3PEH A;  4FZ1 A;  1X59 A;  2XD6 A;  1EBO A;  2A06 H;  1FFX B;  4JI5 B;  4K8X A;  3U0Z A;  1CPY A;  3OGC C;  2Q67 A;  2CH4 A;  1KB9 F;  3DC5 A;  2WA3 A;  4AIL C;  2B5U A;  2ZCE A;  4WUD A;  3SGI A;  3VQX A;  3H80 A;  1Z5V A;  5BY1 A;  5IWA B;  1G6U A;  3ZBH A;  2FWY A;  1ZLZ A;  1QQC A;  1P7B A;  1M4U A;  2GHY A;  2Q0O C;  4OX9 O;  3ZRW A;  3U67 A;  2YUA A;  5JEN A;  2C2A A;  1IDS A;  3JAS B;  4X1Y A;  1TID A;  2AW9 A;  3S3W A;  4P8O A;  1EZJ A;  2V1D A;  2JGD A;  3WB1 A;  4I9Q A;  4RO2 A;  3LSS A;  3RN4 A;  1XRE A;  4ZHQ A;  4U7N A;  1BYQ A;  2WI4 A;  1M56 B;  2ZE5 A;  1YXB A;  5KHK A;  5FNC A;  3ZM7 A;  3ZHV A;  1TUE B;  3RYF A;  4CZZ A;  4KQV A;  2FYU H;  3GIG A;  2JS5 A;  1HNW O;  4CWT A;  1FXH A;  2XJX A;  1NHH A;  4YKQ A;  1VQ9 V;  3ZS8 C;  3G6E V;  2CUG A;  4PU9 A;  2YI0 A;  5IYD O;  2WI3 A;  1OJH A;  4ZI7 A;  4H44 B;  4ZVI A;  5F2V O;  3CP1 A;  4GX5 A;  4DV2 B;  1YSR A;  3HKC A;  1XMO B;  3C11 A;  2UXD O;  2HHH O;  1NHI A;  3BM9 A;  4JI8 B;  1I5C A;  5J2T B;  2ZE8 A;  4JYB A;  5LGU A;  1N4C A;  4NTY A;  4I4T B;  3ABT A;  3LPS A;  2WI2 A;  5EYP B;  4LF9 B;  1S76 D;  3ZIA G;  1SKV A;  1NTM H;  3D36 C;  2YDE A;  2P7T C;  1UPG A;  2FWZ A;  2LGW A;  1NKD A;  1Q5O A;  4MP2 A;  4DR2 B;  1IBL O;  1EFR G;  3BEH A;  4HNA B;  4X20 B;  4LFC B;  4G27 B;  4KTN A;  1AJ6 A;  4EMV A;  2ZR2 A;  3ETG A;  3OMU A;  4JTC B;  1KP3 A;  4LCU C;  1J95 A;  2HFE C;  4O2B A;  1GKZ A;  4L94 A;  4ZOL B;  4LFB O;  1R6N A;  3AG4 C;  4CWF A;  3FX7 A;  1YDX A;  3OWB A;  4X1I A;  3IC9 A;  1KUQ A;  2EIN B;  3EHJ A;  2CTW A;  4GUN A;  5J6A A;  5LYJ A;  2GSM B;  4PV1 B;  3K5L A;  2AZ2 A;  1I5D A;  4LWE A;  4O4H B;  4P30 A;  5CTY A;  3K9S A;  1KBH A;  4FZ0 A;  2FYP A;  3CRQ A;  3CMA V;  4E01 A;  1XIL A;  4WUB A;  5BXZ A;  4H13 B;  4PRX A;  5KA5 A;  4DW1 A;  4JTA B;  5LHI A;  4I5S A;  3LSU A;  1IXM A;  2ETN A;  4JYA B;  4JZG A;  3K97 A;  3E22 A;  3K08 A;  2ZD9 A;  1Z5C A;  4YY3 O;  3B28 A;  2AGA A;  1FXK A;  2UXB O;  1VMG A;  4TOI A;  1BHB A;  3S5T A;  2UUC O;  3RVZ A;  4P9O A;  5JJJ B;  1AI6 A;  5CA0 B;  5K1X A;  2F1M A;  1SF9 A;  4IL6 Z;  3ABL C;  4GKJ O;  3CB2 A;  1PNK A;  3TXS A;  3TET A;  1SZT A;  2BOB C;  1DF4 A;  4B3M O;  3B25 A;  2P4K A;  5M4E A;  1Q6H A;  3CCM V;  1XL4 A;  1TGO A;  4PI2 A;  1NH2 B;  3H1J H;  4JI7 O;  2JIZ G;  2BCC H;  4XIP A;  4MTO A;  2OTJ V;  3HEK A;  2YED A;  4PA6 A;  5LP6 B;  5FNV B;  1YT2 A;  3ASO B;  1YC4 A;  5H5N A;  4KSH A;  4O05 A;  2RN9 A;  2EUL A;  4I50 B;  4NVP A;  1BCC H;  3L71 H;  3QVN A;  1BE3 H;  1Y4M A;  3ZHT A;  1Y74 A;  2GTA A;  3CYG A;  3SJQ C;  3NR7 A;  4DR5 B;  3O9O A;  4J9Y B;  2QM4 A;  4FIP C;  5KMG A;  2DQ0 A;  4WFB V;  1B06 A;  4YHH B;  1VAR A;  4ASB A;  4N23 A;  4DR3 O;  4FM0 A;  2Q0A A;  4IHJ A;  3NXS A;  3OMI B;  3HKD B;  5F5R A;  5D7C A;  2W0F C;  3FV5 A;  3DXR A;  4O4I A;  4HXW A;  3RFR A;  1Q43 A;  1EI1 A;  4GX2 A;  1M5I A;  2YI6 A;  4BQJ A;  1Q81 W;  1WN7 A;  3CJH A;  3CCR V;  3R4M A;  4MVR A;  3JD4 A;  1VF5 B;  2IJI A;  3CRA A;  5LGT A;  4DO2 A;  2VQF B;  4LC1 A;  5L3B A;  2EBO A;  1N8R W;  5J9P C;  4JI6 B;  3RGB A;  2IBZ H;  1YJN V;  3CGY A;  3R66 A;  4QIW F;  4P2Z A;  3L75 H;  5M4M A;  1H2K A;  5GON A;  1MA1 A;  1F23 A;  3ZHU A;  2GTS A;  1Q86 W;  1K73 W;  3D8C A;  3JYC A;  3BCC H;  4TV8 A;  4EEQ A;  3JAK B;  3AG4 B;  2H55 A;  4GT1 A;  2YE6 A;  4PDM A;  5ITZ B;  4PL9 A;  2L35 A;  4J7K A;  3QO5 A;  3OTO O;  4FLX A;  1YES A;  2QTS A;  3CCS V;  1PP9 H;  3NMQ A;  2RCV A;  4HXZ A;  2DOS A;  5KHH A;  3ZHS A;  1Q90 D;  5E79 Z;  5EBM C;  4JQL A;  1FJG O;  3WQ9 A;  1AJN A;  1AH8 A;  3IAY A; 
#chains in the Genus database with same CATH homology
 1KIJ A;  2HCH A;  4G2K A;  5IY5 C;  3JD3 A;  2WER A;  4XDJ A;  1UJW B;  2IH1 C;  3ABL B;  1UY6 A;  2IWU A;  1TIL A;  2XDL A;  1G4Y B;  3D0B A;  3PEJ A;  1DF5 A;  4KFG A;  1GKF A;  2LFR A;  1ZXN A;  2XAJ A;  5KA6 A;  1PVG A;  4DUH A;  1OCC C;  1CEZ A;  2YK2 A;  4GX0 A;  4URL A;  4TWK A;  3O6O A;  2CG9 A;  1WPX A;  3K60 A;  4MP7 A;  4MVZ A;  1JQ0 A;  3CRK A;  2B1I A;  5B3S C;  5IDM A;  4UVA A;  3RBZ A;  5B1A B;  1UY7 A;  1UYF A;  2Q69 A;  2XJJ A;  1VQO V;  3OR7 C;  3OMN B;  5LHH A;  2ZDI A;  2BTZ A;  4FCQ A;  3STZ C;  3EHF A;  5L3G A;  1JM6 A;  2IWS A;  1KQS U;  3LDC A;  1OCO B;  1SER A;  2K1E A;  4KFM A;  2WLL B;  3FB5 C;  4X9L A;  1UYE A;  4WFH A;  5IYC O;  1QR8 A;  3K98 A;  3AEI A;  4MPN A;  4CWR A;  1RPR A;  3OEE G;  1OHH G;  1QY8 A;  2QEX V;  2WSS G;  4FMT A;  4O07 A;  4XKK A;  4MPE A;  1GJV A;  1FXK C;  2FTK A;  1W0J G;  1YJW V;  1BHA A;  1QVF U;  2BRC A;  5M4P A;  3CC4 V;  3T4Z A;  2BU6 A;  3B8N A;  4FCP A;  1NQT A;  4UV9 A;  1WLE A;  3K0G A;  3TUH A;  5M4H A;  3ZRW B;  4PDL A;  5B1B C;  4LWI A;  3R91 A;  4LWF A;  2YE5 A;  1GM7 A;  4MVU A;  4BIU A;  2PNR A;  1OCR C;  4RAI A;  3CC7 V;  5DM6 V;  4MVS A;  3AG1 C;  4MS2 A;  2BYH A;  1EA6 A;  4Z1M G;  3E89 A;  2Q2E B;  2XX2 A;  4R3M A;  3GIG B;  2EIM C;  1NR1 A;  2NLJ C;  4PRV A;  2YE8 A;  1OCC B;  4GCZ A;  3AG2 C;  4E02 A;  4CWQ A;  4XD8 A;  3TZ5 A;  5KUK A;  5L3J A;  4CWP A;  4ASF A;  4X8A A;  2IJK A;  3T2S A;  3SYC A;  1UY8 A;  2YEA A;  4JAS A;  5GW7 A;  1Y8O A;  4CE3 A;  1JPX A;  2UXX A;  2EIJ C;  4NH8 A;  2EJR A;  1QLE C;  1SET A;  5B3S B;  1YIJ V;  2YE9 A;  5GGZ A;  1FXV A;  3WG7 C;  3C0E A;  1DLB A;  3ZN1 A;  4J9Z B;  3OUS A;  4LPB A;  1K97 A;  3ABU A;  4L90 A;  2KB1 A;  3CD6 V;  4RQE A;  2YEI A;  2BU5 A;  1US7 A;  1HWY A;  3HB3 B;  3ETD A;  4UXN A;  3MHS C;  5LHG A;  3CME V;  2ZXW C;  4MTX A;  3T2M A;  2EXL A;  2IJH A;  4R50 A;  2PI4 A;  3SYO A;  2O1U A;  1H7U A;  3A0T A;  4L8Z A;  2Q8I A;  1QBZ A;  3E8G A;  4N21 A;  2JKI A;  1FFT B;  3TZ4 A;  2QE7 G;  4HYM A;  1UYD A;  2XHR A;  3FKS G;  5EC1 C;  1PNM A;  5CBH A;  1K8A W;  1FXK B;  1R3J C;  1TH8 A;  5EK0 A;  3OW2 U;  4YXW G;  2ESA A;  2XX5 A;  4AWO A;  1H38 A;  2QF6 A;  2HLD G;  4YKY A;  4PDV A;  3TZ0 A;  1DTO A;  3FT5 A;  3RLQ A;  1K5Q A;  2P67 A;  1OCR B;  5CF0 A;  4XCJ A;  3AG1 B;  4RUE A;  5L3D A;  1BL8 A;  4MBC A;  5KUM A;  2Y69 C;  3EHB B;  4GQT A;  1RM1 C;  2HKO A;  1YER A;  2EIM B;  3K3W A;  4RQF A;  3P32 A;  3AG2 B;  5CA3 A;  4L91 A;  1S0V A;  3B8M A;  1R3K C;  3E86 A;  2ZR3 A;  1R3L C;  3SPG A;  1K34 A;  2R9R B;  2EIJ B;  1QLE B;  3TCU A;  2YEB A;  4HYP A;  3CXC U;  3WG7 B;  4MW8 A;  2ZDI C;  1OSF A;  2YJW A;  1Y4S A;  3ABM C;  1QR9 A;  1K92 A;  4YKX A;  2WPD G;  2FXS A;  3STL C;  3B24 A;  4X89 A;  3SPI A;  1Y8P A;  2UXN A;  1YTF B;  2GQP A;  5J71 A;  3VAD A;  3T4D A;  4H37 A;  3Q5L A;  3X2Q C;  3F7Y C;  4O0B A;  1Y4U A;  2Q68 A;  2YKE A;  4JTD B;  5LGN A;  3CCQ V;  1PNL A;  3WFV A;  4URO A;  1ARO P;  5CTW A;  4EM7 A;  1YJ9 V;  2JJ2 G;  2HJF C;  1W2B U;  2OTL V;  2Z3Y A;  5LBQ A;  2CGF A;  3SL2 A;  5FWK A;  1E1Q G;  2YK9 A;  2AKP A;  5E1A C;  4BW5 A;  1M90 W;  2DYR C;  2DYS C;  4WCE V;  4LP0 A;  1BKN A;  5F3K A;  2XAB A;  1MAB G;  2JJC A;  4P9P A;  1I59 A;  1TC6 A;  3E8B A;  3T1C A;  3CCL V;  1JCH A;  2CCT A;  2Y69 B;  3HYY A;  2WI7 A;  3F5W C;  2JEU A;  2DW4 A;  1F4M A;  3G71 V;  2IU3 A;  3KG2 A;  2QA4 V;  1VQK V;  4GGL A;  1I5Y A;  3BMY A;  2XDS A;  2YJX A;  3RVY A;  3R4O A;  5IDJ A;  3A0Z A;  2EIL C;  3K99 A;  2YE2 A;  1YT0 A;  3ZRX A;  1H8E G;  2XHX A;  1YI2 V;  3CCV V;  2YI7 A;  4MTF A;  2YI5 A;  3JD0 A;  2BSM A;  1Q7Y W;  3O2F A;  2YEE A;  3ABM B;  2XAG A;  4UVB A;  2GFD A;  4CWS A;  3VHD A;  4U7O A;  5CBG A;  2QM8 A;  1FS0 G;  1SES A;  3K03 A;  1GK9 A;  1MSW D;  1U0Z A;  3X2Q B;  1OCZ C;  4HY6 A;  3ABK C;  2IU0 A;  2XAF A;  2ITC C;  1I58 A;  3CYO A;  2X7R B;  2UWD A;  4BAY A;  3M99 B;  1Q82 W;  4URM A;  3D3I A;  4R8C A;  3CGZ A;  4MT8 A;  1UYC A;  4X88 A;  1L0O A;  3LDD A;  2HG5 C;  2HG1 A;  3FB7 C;  1S14 A;  1YSC A;  4EKW A;  4UUJ C;  2PI5 A;  1ENV A;  1S72 V;  5CMU A;  1YS3 A;  1NJI W;  2IOQ A;  2CK3 G;  3CCJ V;  2F43 G;  4MVM A;  2DYR B;  1VQ8 V;  1PD3 A;  2IJJ A;  1YC3 A;  2DYS B;  1W0K G;  4O04 A;  4QJF B;  3LUT B;  2BU7 A;  3W7T A;  1K33 A;  3K04 A;  4MSW C;  1CP9 A;  4UV8 A;  2WI5 A;  3SYP A;  3JD2 A;  2ZDX A;  3IC7 A;  1Z5A A;  2XOK G;  4ASU G;  3SPJ A;  2QG0 A;  3CC2 V;  2YE3 A;  2WEQ A;  1Z59 A;  3TTZ A;  2X0L A;  3ZJZ A;  1JVM A;  4CE1 A;  4MVO A;  3T0Z A;  1R6K A;  3ASN C;  2E0A A;  1B3Q A;  3WHA A;  4JPR A;  3RKZ A;  3OM3 B;  5IN9 A;  3RLP A;  4MOT A;  2YEJ A;  3FT8 A;  4E2L A;  5L3C A;  4JAV A;  3FYI B;  3T1K A;  2P6J A;  3TZ2 A;  2VCI A;  3AG3 C;  1QCE A;  3D36 A;  5HFM A;  2JDI G;  2HVK C;  3W7S A;  3E8H A;  4HY1 A;  5FND A;  2WLN A;  4XCL A;  1GMG A;  4OXS A;  1NVP B;  4GT8 A;  3OWD A;  3GIF A;  1OCZ B;  3SYA A;  1YIT V;  4FCR A;  3ABK B;  3FB6 C;  1NBM G;  2EIK C;  4LWG A;  4YKT A;  3ETE A;  3ZMV A;  5IY5 B;  2DWD C;  2XDX A;  3B77 A;  3ZMU A;  1COW G;  2NNU A;  2Q6A A;  1ZWH A;  2DQ3 A;  2BU2 A;  4WFG A;  4DZY A;  1JJ2 U;  4JF3 A;  1S16 A;  3H01 A;  1V55 C;  1AMW A;  4EFU A;  1B62 A;  2DWE C;  1OZ0 A;  3Q5J A;  5CBF A;  1M9N A;  1UYL A;  4XDL A;  3ZRV A;  2ITD C;  2V7Q G;  4PA7 A;  5D7R A;  3K9A A;  2O1V A;  4KSG A;  4HZ3 A;  3ZMZ A;  1ZWI C;  4YKU A;  4BIZ A;  5D6Q A;  2O1W A;  1K5S A;  2AHZ A;  3W7U A;  1VQP V;  4QE7 A;  4JAU A;  4QPJ A;  1R62 A;  2YGF A;  1KC8 W;  1YHQ V;  4AWP A;  4XDM A;  3LNU A;  2HR3 A;  1UYK A;  4XTJ A;  2W6I G;  3CCE V;  5BOD A;  4FJC C;  1QZR A;  1S5H C;  4F4L A;  1K4D C;  5H6R A;  3VHA A;  3QO7 A;  4ZBM A;  2IW5 A;  3T10 A;  2BZ5 A;  3U2D A;  3CCU V;  3AG3 B;  1AJQ A;  5CTU A;  3H4L A;  4L87 A;  2YEG A;  1M57 C;  2XJG A;  4CE2 A;  3ZMS A;  2WLL A;  4LWH A;  2QFO A;  3PJS K;  3G4S V;  1NH2 D;  2BYI A;  2HVJ C;  2QG2 A;  1KP2 A;  1AI7 A;  2YEV A;  1NHJ A;  5B1O A;  1KKD A;  2WLJ A;  2EIK B;  4LP8 A;  2XHT A;  4ZKI A;  2Q8F A;  1JOY A;  3VOU A;  3K79 A;  2IOP A;  2CCU A;  5B1B B;  1F4N A;  1AI5 A;  1MU5 A;  2WI1 A;  2Y48 A;  1BXD A;  1UYG A;  4YKR A;  1V55 B;  3G7E A;  1SRY A;  5H6Q A;  2AHY A;  1UYM A;  3OW6 A;  4BQG A;  3HPL C;  2YE4 A;  3ASO C;  1E79 G;  4E00 A;  2XCM A;  2IH3 C;  1R73 A;  1VQ6 V;  3A0R A;  1VQ4 V;  2IWX A;  1GM8 A;  4B6C A;  4WF9 V;  4EGH A;  5CTX A;  2CCS A;  3OEH G;  5EBL C;  1Y8N A;  4UVC A;  4FPP A;  3CRL A;  4H7Q A;  2A9H A;  4WUC A;  1AI4 A;  4FK5 C;  2P90 A;  2WLI A;  1ZXM A;  2X6C A;  3Q5K A;  2ZQM A;  4WFF A;  3ZKD A;  5C93 A;  1U2O A;  3IED A;  3E35 A;  3A0X A;  3G75 A;  3B27 A;  2YEF A;  4XKA A;  3EKR A;  5D7D A;  4EGI A;  4EEH A;  3KE6 A;  1KD1 W;  1VQ5 V;  2ZXW B;  1Y66 A;  5EBW C;  3QTF A;  1QYE A;  4L93 A;  5FNF A;  2XAS A;  1M57 B;  2B1G A;  1NR7 A;  3UM7 A;  3RW0 A;  5FL7 G;  4GEE A;  5H9C A;  3ZXO A;  3TK1 A;  1JX9 A;  1GKX A;  1KZN A;  4WFA V;  1E1R G;  1AH6 A;  3HZ5 A;  4HZ5 A;  3FB8 C;  2VW5 A;  3MNR P;  1G8M A;  3ZCC A;  2X6B A;  4Q20 A;  4MPC A;  3LNM B;  2XND G;  1YSZ A;  4V25 A;  4V26 A;  5IYB O;  2XAH A;  1ORQ C;  2H8P C;  5EC2 C;  4ASA A;  3VBB A;  2VCJ A;  3SPH A;  4GFN A;  2WLH A;  4I9W A;  5BZB A;  1AJP A;  2YKB A;  4GX1 A;  4H81 A;  3DGE A;  4W7T A;  1RM1 B;  4URN A;  2WLK A;  3LDE A;  2YKJ A;  3D2R A;  1VQM V;  4O09 A;  4PA4 A;  3R65 A;  3I56 V;  2YEC A;  3HYZ A;  4JYC A;  4RUF A;  3OPD A;  4YKW A;  5B1A C;  2HKJ A;  2JJ1 G;  1NVP D;  4MW3 A;  3R4P A;  1VQ7 V;  1YET A;  5L3F A;  4BAE A;  4QE9 A;  3OR6 C;  2H94 A;  3R92 A;  4AWQ A;  3RLR A;  1Z5B A;  5L3E A;  1OCO C;  1PKX A;  3EKO A;  1V54 C;  3CWV A;  2OCC C;  3CPW U;  3EHG A;  3GB7 C;  4CBC A;  4WFE A;  4CWO A;  2WI6 A;  3SYQ A;  1KEC A;  4MVQ A;  3HHU A;  2ZDY A;  4YKZ A;  1I5X A;  1L1F A;  4XIR A;  1ID0 A;  1K4C C;  2BU8 A;  1R3I C;  2BRE A;  4MTG A;  1A4H A;  3U2K A;  3P30 A;  4HYO A;  3JCZ A;  1K9M W;  3IGA C;  3QO8 A;  1GM9 A;  4HAM A;  4H85 A;  2QM7 A;  3ZKB A;  2BT0 A;  1M1K W;  2XDU A;  5BOC A;  2XAQ A;  4TT3 G;  2ZBK B;  1QLN A;  1ZW9 A;  2VWC A;  2Z5U A;  3INW A;  4EGK A;  3O0I A;  4XC0 A;  3GWO A;  3K0D A;  1GO3 F;  3T0H A;  1P4R A;  3QDD A;  1UYH A;  1B6Q A;  4AS9 A;  2EIL B;  4K4O A;  2JEX A;  1I5B A;  4PA3 A;  4LBE C;  2M7W A;  4ASG A;  2K5B A;  2W6J G;  3JD1 A;  4NH7 A;  3I55 V;  1PL0 A;  2R9I A;  4TSF G;  3OAA G;  1THZ A;  2YE7 A;  4HZ0 A;  4G28 B;  3GIE A;  3EHH A;  1F51 A;  2X6A A;  4XBF A;  3UKM A;  2YSU B;  3EFF K;  2XX4 A;  1QVG U;  2QKS A;  3E2E A;  4CWN A;  4EFT A;  1V54 B;  2OCC B;  1H2G A;  3OE7 G;  3W7W A;  3FYE B;  3K06 A;  2WLM A;  4QNH B;  3IFX A;  2H8M A;  3VHC A;  1K3E A;  4PA9 A;  1MX0 A;  2YEV B;  2Q8G A;  1MG1 A;  3OUF A;  4QPK A;  2D3O W;  5M4N A;  4I3H A;  1RPO A;  3R4N A;  1MOF A;  2YKI A;  4DXW A;  2XDK A;  3A0W A;  2WAM A;  4H33 A;  1S77 D;  3B26 A;  4XKO A;  2OT5 A;  3ML0 A;  4KUM A;  4BXI A;  4MB9 A;  3OMA B;  5CN0 A;  1THN A;  3LSQ A;  1GTO A;  3HZ1 A;  1VQL V;  2A79 B;  2YEH A;  2YKC A;  3ZXQ A;  4R3A A;  3ZRS A;  5DN6 G;  2ZKJ A;  2WWW A;  4PEL A;  1M56 C;  2MK3 A;  1XL6 A;  3F7V C;  3ZMT A;  1TBW A;  3SPC A;  3E8F A;  1K7D A;  3G7B A;  4R6Z A;  1UY9 A;  2QTO A;  3QNE A;  4XIT A;  5HFL A;  1H8H G;  3ASN B;  2JK5 C;  1YTF D;  2WLI B;  1S3J A;  1UYI A;  2LP7 A;  3A0Y A;  4R7C A;  1AR1 B;  4XIQ A;  5B1N A;  2IOR A;  1H7S A;  1I5A A;  1VQN V;  3JZ3 A;  4R1F A;  2YGA A;  1LNQ A;  2BOC C;  4U93 A;  1BGQ A;  1YT1 A;  4JGS A;  2YGE A;  4PDR A;  1YC1 A;  4P7A A;  4XE2 A;  3INX A;  1BMF G;  2EZP A;  2Q8H A;  2ATK C;  3DTU B;  1ROP A;  5M4K A;  3W7X A;  4B7P A;  2EIN C;  2LFS A;  3MHH C;  1AM1 A;  4KP4 A;  3E83 A;  1B63 A;  1TC0 A;  3OFN G;  3BY6 A;  2XK2 A;  5CPH A;  3MD0 A;  4XDK A;  2EZO A;  5D6P A;  4NH9 A;  2A0L A;  2WEP A;  3ZN0 A;  3PEH A;  2XD6 A;  1EBO A;  1CPY A;  3OGC C;  2Q67 A;  2CH4 A;  2B5U A;  4WUD A;  3H80 A;  2FWY A;  1P7B A;  2GHY A;  3ZRW A;  3U67 A;  2C2A A;  1TID A;  4P8O A;  1EZJ A;  2V1D A;  4RO2 A;  3LSS A;  4U7N A;  1BYQ A;  2WI4 A;  1M56 B;  3ZM7 A;  5FNC A;  1TUE B;  4CZZ A;  4KQV A;  3GIG A;  4CWT A;  1FXH A;  2XJX A;  1NHH A;  4YKQ A;  1VQ9 V;  3G6E V;  4PU9 A;  2YI0 A;  5IYD O;  2WI3 A;  4ZVI A;  3CP1 A;  4GX5 A;  1YSR A;  3C11 A;  1NHI A;  3BM9 A;  1I5C A;  5LGU A;  4JYB A;  3ABT A;  3LPS A;  2WI2 A;  1S76 D;  3ZIA G;  2P7T C;  2FWZ A;  1NKD A;  4MP2 A;  1EFR G;  3BEH A;  4G27 B;  4KTN A;  1AJ6 A;  4EMV A;  2ZR2 A;  3ETG A;  3OMU A;  4JTC B;  1KP3 A;  4LCU C;  1J95 A;  2HFE C;  1GKZ A;  4L94 A;  1R6N A;  3AG4 C;  4CWF A;  3OWB A;  3EHJ A;  2EIN B;  5J6A A;  2GSM B;  1I5D A;  4LWE A;  4P30 A;  5CTY A;  2FYP A;  3CMA V;  4E01 A;  4WUB A;  4PRX A;  5KA5 A;  4JTA B;  5LHI A;  4I5S A;  1IXM A;  3K97 A;  3K08 A;  2ZD9 A;  1Z5C A;  3B28 A;  1FXK A;  1BHB A;  3RVZ A;  4P9O A;  1AI6 A;  3ABL C;  1PNK A;  3TET A;  1SZT A;  2BOB C;  1DF4 A;  3B25 A;  5M4E A;  3CCM V;  1XL4 A;  1NH2 B;  2JIZ G;  4XIP A;  4MTO A;  2OTJ V;  3HEK A;  2YED A;  4PA6 A;  1YT2 A;  3ASO B;  1YC4 A;  4O05 A;  4KSH A;  1Y4M A;  3SJQ C;  4J9Y B;  4FIP C;  2DQ0 A;  4WFB V;  4ASB A;  4N23 A;  3NXS A;  3OMI B;  5F5R A;  5D7C A;  2W0F C;  3FV5 A;  4HXW A;  1EI1 A;  4GX2 A;  2YI6 A;  4BQJ A;  1Q81 W;  3CCR V;  3R4M A;  4MVR A;  3JD4 A;  2IJI A;  5LGT A;  4DO2 A;  4LC1 A;  5L3B A;  2EBO A;  1N8R W;  5J9P C;  1YJN V;  3CGY A;  4QIW F;  4P2Z A;  5M4M A;  1F23 A;  1Q86 W;  1K73 W;  3JYC A;  3AG4 B;  2H55 A;  4GT1 A;  2YE6 A;  4PDM A;  4PL9 A;  3QO5 A;  1YES A;  3CCS V;  3NMQ A;  4HXZ A;  5EBM C;  4JQL A;  3WQ9 A;  1AJN A;  1AH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...