5CTYA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based discovery of DNA gyrase inhibitors targeting the ATPase subunit of GyrB.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 65
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5ctyA00
5D7RA 2BZ5A 3A0TA 4O05A 3D36A 4XIRA 4WUCA 3EHFA 1S14A 1R62A 2QG2A 2UWDA 4FCPA 4U7NA 2XDKA 4URMA 3K97A 3K99A 4R3AA 2XABA 4L8ZA 4KTNA 1I5DA 1MX0A 1ZXNA 2YKBA 2YJXA 1ZWHA 4CWOA 4YKUA 1NHJA 2YE9A 5CTYA 1Y4UA 4URNA 2BU8A 2WI3A 4FCRA 4HXWA 2YE8A 2YEBA 2YE7A 1UY8A 4U7OA 4CWQA 2YGFA 4L91A 1TBWA 2HCHA 2BSMA 2ZKJA 3LPSA 1BKNA 4AS9A 3EHHA 1AH6A 4CE1A 2XD6A 2IWUA 1Y8PA 2QG0A 1UY6A 2FXSA 1YETA 1I5CA 5C93A 3K98A 2YEEA 1TIDA 2YE4A 4WUBA 1Z5AA 3GIEA 4ASBA 2VCIA 4E01A 3CRLA 3T1KA 3VADA 4EEHA 4AWPA 3QTFA 4YKQA 4BQJA 2QFOA 1B3QA 3T2SA 4GCZA 3Q5LA 2BYHA 1QY8A 2XHTA 4XKKA 3VHAA 2YKJA 2YEDA 4W7TA 1GKXA 3HYZA 2CH4A 4O09A 3OPDA 1UYIA 3CRKA 1YC4A 4DUHA 4PRVA 2HG1A 1BGQA 4XITA 2XHRA 4QPJA 3U2DA 2WI4A 1EA6A 3HZ1A 2BU6A 3PEHA 2EXLA 4CE2A 5IDMA 4UROA 5FNCA 4R3MA 1KZNA 2BTZA 3QDDA 1YT1A 2WEPA 3H4LA 2VW5A 2XDLA 3OW6A 4EGKA 2IORA 1TH8A 1AM1A 2CGFA 3EKRA 4WUDA 3VHCA 4Q20A 4AWOA 2YEIA 4CE3A 3O2FA 3B25A 4PU9A 1TC0A 3MNRP 4I5SA 2YI6A 2ZDYA 3OWBA 4BIUA 2CCUA 4U93A 3NMQA 1ID0A 2GQPA 2YE2A 2YJWA 4URLA 3G7BA 2YI5A 3R4PA 4ZKIA 5D6PA 4MBCA 1NHIA 4XCLA 2YEJA 4FMTA 3TZ5A 2H8MA 1AJ6A 2YEGA 4XIPA 3OMUA 4V26A 5L3JA 4MOTA 1UY9A 2XJGA 5IDJA 4KSGA 5FWKA 5GGZA 4NH7A 1L0OA 2Q2EB 4MP2A 4GQTA 2E0AA 4HYMA 4O0BA 2FYPA 1TC6A 3T10A 2AKPA 3BM9A 4LWIA 3G75A 4XKAA 4YKZA 1H7SA 3FT8A 4EGHA 4MPNA 1UY7A 3EKOA 3Q5KA 3T0HA 3ZKDA 2YEFA 4MPEA 2O1WA 2YE5A 4KSHA 2XX2A 3GIFA 2Q8IA 2YGEA 2CG9A 2WI5A 4V25A 4KP4A 1OSFA 4FCQA 2BREA 5FNDA 3PEJA 4NH9A 2Q8HA 2CCTA 4B6CA 4BAEA 1YT0A 3LNUA 4PRXA 4XIQA 2BU2A 1UYGA 3R4MA 1YC3A 4BIZA 3A0RA 3ZM7A 4CWSA 4PL9A 4NH8A 1Z5CA 2YK9A 2WI7A 4BQGA 4JAUA 4BXIA 2H55A 1Z5BA 5M4PA 3B24A 1YC1A 3C11A 3GIGB 2GFDA 4GGLA 1UYFA 5M4NA 5M4EA 2YKCA 4LPBA 5F3KA 2O1UA 2WI2A 4FPPA 4B7PA 5M4HA 5CPHA 2PNRA 3RLRA 1UYMA 3Q5JA 4HYPA 5CTWA 3FT5A 1PVGA 4EGIA 2QF6A 3A0XA 2ESAA 5J6AA 3B27A 1H7UA 4EFUA 3K60A 2BU5A 2Q8FA 1NHHA 1AH8A 2IOQA 2YECA 3IEDA 4ASFA 3TUHA 1YERA 1UYHA 2K5BA 2XK2A 3OWDA 3ZXOA 4P7AA 3R4NA 3U67A 5IN9A 4JASA 1I5AA 1MU5A 4O04A 4CWNA 1GKZA 3U2KA 3INWA 5BOCA 2VWCA 2BYIA 4LP0A 4LWHA 1UYDA 4XD8A 1QYEA 3BMYA 4P8OA 2JKIA 4E02A 2XHXA 3GIGA 3KE6A 1Y8OA 3HYYA 2YGAA 3TZ0A 1YSRA 1GJVA 4XE2A 1UYEA 4HXZA 4O07A 4LWFA 4X9LA 2HKJA 4L94A 2CCSA 1US7A 4YKRA 1KIJA 4GEEA 4LWEA 2YE6A 2BRCA 4H7QA 4ASGA 3A0ZA 3T0ZA 3HEKA 4KQVA 3R4OA 4L90A 1B62A 4EMVA 4E00A 1UYCA 2FWZA 5CTXA 4ZVIA 5FNFA 2WI1A 3WHAA 2YEHA 2BU7A 1YT2A 5BODA 4YKXA 4HY1A 2XDXA 4L93A 4I3HA 2WI6A 2XCMA 4HZ5A 2YKEA 3VHDA 1I5BA 3B26A 3G7EA 4CWRA 1I59A 1B63A 4K4OA 3O0IA 5M4MA 1YESA 3CGZA 4JQLA 1Z59A 3CGYA 4DZYA 2XDSA 3R92A 4XTJA 3D0BA 1TILA 1ZXMA 1I58A 4XC0A 3ZXQA 4YKYA 3HHUA 4H85A 3INXA 2JJCA 5F5RA 3RKZA 1UYKA 3A0YA 3TZ4A 3C0EA 2YEAA 2XDUA 2BT0A 2FWYA 1JM6A 1U2OA 2YKIA 4MP7A 4CWTA 2ZDXA 4CWFA 2VCJA 3R91A 4XKOA 3A0WA 1Y4SA 3H80A 1UYLA 3EHJA 4XDMA 2WEQA 2WERA 5D6QA 4ASAA 4HZ0A 4EM7A 4MPCA 2ZBKB 1S16A 1U0ZA 2IOPA 5CF0A 1ZW9A 4HY6A 4GT8A 4QPKA 5D7DA 4YKWA 3D2RA 2XX5A 3RLPA 3O6OA 4R1FA 1BXDA 1Y8NA 5M4KA 1YS3A 1EI1A 1A4HA 3RLQA 4AWQA 5J71A 3EHGA 3JZ3A 4MB9A 3SL2A 4XCJA 1BYQA 2XX4A 2XJJA 2Q8GA 3B28A 2IWXA 3ZKBA 4H81A 4YKTA 2YE3A 5CTUA 1THNA 2O1VA 3DGEA 4CWPA 2IWSA 1QZRA 3FV5A 2YI7A 3HZ5A 3CWVA 1AMWA 4JAVA 3TTZA 4EFTA 4GFNA 4KFGA 5D7CA 2YK2A 1YSZA 2XJXA 2YI0A 4LWGA 2C2AA 3TZ2A 3WQ9A
chains in the Genus database with same CATH superfamily
5D7RA 2BZ5A 3A0TA 4O05A 3D36A 4XIRA 4WUCA 3EHFA 1S14A 1R62A 2QG2A 2UWDA 4FCPA 4U7NA 2XDKA 4URMA 3K97A 3K99A 4R3AA 3S5TA 2XABA 4L8ZA 4KTNA 1I5DA 4E72A 1MX0A 1ZXNA 2YKBA 2YJXA 1ZWHA 4CWOA 4YKUA 1NHJA 2C1IA 2YE9A 5CTYA 1Y4UA 4URNA 2BU8A 2WI3A 4FCRA 4HXWA 2YE8A 2YEBA 2YE7A 1UY8A 4U7OA 4CWQA 2YGFA 4L91A 1TBWA 2HCHA 2C1GA 2BSMA 2ZKJA 3LPSA 1BKNA 4AS9A 3EHHA 1AH6A 4CE1A 2XD6A 2IWUA 1Y8PA 2QG0A 1UY6A 2FXSA 1YETA 3CYGA 1I5CA 5C93A 3K98A 2YEEA 1TIDA 2YE4A 4WUBA 1Z5AA 3GIEA 4ASBA 2VCIA 4E01A 3CRLA 3T1KA 3VADA 4EEHA 4AWPA 3QTFA 4YKQA 4BQJA 2QFOA 1B3QA 3T2SA 4GCZA 3Q5LA 2BYHA 1QY8A 2XHTA 4XKKA 3VHAA 2YKJA 2YEDA 4W7TA 1GKXA 3HYZA 2CH4A 4O09A 3OPDA 1UYIA 3CRKA 1YC4A 4DUHA 4PRVA 2HG1A 1BGQA 4XITA 2XHRA 4QPJA 3U2DA 2WI4A 1EA6A 3HZ1A 2BU6A 3PEHA 2EXLA 4CE2A 5IDMA 4UROA 5FNCA 4R3MA 1KZNA 2BTZA 3QDDA 1YT1A 2WEPA 3LMMA 3H4LA 2VW5A 2XDLA 3OW6A 4EGKA 2IORA 1TH8A 1AM1A 2CGFA 5JENA 3EKRA 4WUDA 3VHCA 4Q20A 4AWOA 2YEIA 4CE3A 3O2FA 3B25A 4PU9A 1TC0A 3MNRP 4I5SA 2YI6A 2ZDYA 3OWBA 4BIUA 2CCUA 4U93A 3NMQA 1ID0A 2GQPA 2YE2A 2YJWA 4URLA 3G7BA 2YI5A 3R4PA 4ZKIA 5D6PA 4MBCA 1NHIA 4XCLA 2YEJA 4FMTA 3TZ5A 2H8MA 1AJ6A 2YEGA 4XIPA 3OMUA 4V26A 5L3JA 4MOTA 1UY9A 2XJGA 5IDJA 4KSGA 5FWKA 5GGZA 4NH7A 1L0OA 2Q2EB 4MP2A 4GQTA 2E0AA 4HYMA 4O0BA 2FYPA 1TC6A 3T10A 2AKPA 3BM9A 4LWIA 3G75A 4XKAA 4YKZA 1H7SA 3FT8A 4EGHA 4MPNA 1UY7A 3EKOA 3Q5KA 3T0HA 3ZKDA 2YEFA 4MPEA 2O1WA 2YE5A 4KSHA 2XX2A 3GIFA 2Q8IA 2YGEA 2CG9A 2WI5A 4V25A 4KP4A 1OSFA 4FCQA 2BREA 5FNDA 3PEJA 4NH9A 2Q8HA 2CCTA 4B6CA 4BAEA 1YT0A 3LNUA 4PRXA 4XIQA 2BU2A 1UYGA 3R4MA 1YC3A 4BIZA 3A0RA 3ZM7A 4CWSA 4PL9A 4NH8A 1Z5CA 2YK9A 2WI7A 4BQGA 4JAUA 1IXMA 4BXIA 2H55A 1Z5BA 5M4PA 3B24A 1YC1A 3C11A 3GIGB 2GFDA 4GGLA 1UYFA 5M4NA 5M4EA 2YKCA 4LPBA 5F3KA 2O1UA 2WI2A 4FPPA 4B7PA 5M4HA 5CPHA 2PNRA 3RLRA 1UYMA 3Q5JA 4HYPA 5CTWA 3FT5A 1PVGA 4EGIA 2QF6A 3A0XA 2ESAA 5J6AA 3B27A 1H7UA 4EFUA 3K60A 2BU5A 2Q8FA 1NHHA 1AH8A 2IOQA 2YECA 3IEDA 4ASFA 3TUHA 1YERA 1UYHA 2K5BA 2XK2A 3OWDA 3ZXOA 4P7AA 3R4NA 3U67A 5IN9A 4JASA 1I5AA 1MU5A 4O04A 4CWNA 1GKZA 3U2KA 3INWA 5BOCA 2VWCA 2BYIA 4LP0A 4LWHA 1UYDA 4XD8A 1QYEA 3BMYA 4P8OA 2JKIA 4E02A 2XHXA 3GIGA 3KE6A 1Y8OA 3HYYA 2YGAA 3TZ0A 1YSRA 1GJVA 4XE2A 1UYEA 4HXZA 4O07A 4LWFA 4X9LA 2HKJA 4L94A 2CCSA 1US7A 4YKRA 1KIJA 1F51A 4GEEA 4LWEA 2YE6A 2BRCA 4H7QA 4ASGA 3A0ZA 3T0ZA 3HEKA 4KQVA 3R4OA 4L90A 1B62A 4EMVA 4E00A 1UYCA 2FWZA 5CTXA 4ZVIA 5FNFA 2WI1A 3WHAA 2YEHA 2BU7A 1YT2A 5BODA 4YKXA 4HY1A 2XDXA 4L93A 4I3HA 2WI6A 2XCMA 4HZ5A 2YKEA 3VHDA 1I5BA 3B26A 3G7EA 4CWRA 1I59A 1B63A 4K4OA 3O0IA 5M4MA 1YESA 3CGZA 4JQLA 1Z59A 3CGYA 4DZYA 2XDSA 3R92A 4XTJA 3D0BA 1TILA 1ZXMA 1I58A 4XC0A 3ZXQA 4YKYA 3HHUA 4H85A 3INXA 2JJCA 5F5RA 3RKZA 1UYKA 3A0YA 3TZ4A 3C0EA 2YEAA 2XDUA 2BT0A 2FWYA 1JM6A 1U2OA 2YKIA 4MP7A 4CWTA 2ZDXA 4CWFA 2VCJA 3R91A 4XKOA 3A0WA 1Y4SA 3H80A 1UYLA 3EHJA 4XDMA 2WEQA 2WERA 5D6QA 4ASAA 4HZ0A 4EM7A 4MPCA 2ZBKB 1S16A 1U0ZA 2IOPA 5CF0A 1ZW9A 4HY6A 2HHIA 4GT8A 4QPKA 5D7DA 4YKWA 3D2RA 2XX5A 3RLPA 3O6OA 4R1FA 1BXDA 1Y8NA 5M4KA 1YS3A 1EI1A 1A4HA 3RLQA 4AWQA 5J71A 3EHGA 3JZ3A 4MB9A 3SL2A 4XCJA 1BYQA 2XX4A 2XJJA 2Q8GA 3B28A 2IWXA 3ZKBA 4H81A 4YKTA 2YE3A 5CTUA 1THNA 2O1VA 3DGEA 4CWPA 2IWSA 1QZRA 3FV5A 2YI7A 3HZ5A 3CWVA 1AMWA 4JAVA 3TTZA 4EFTA 4GFNA 4KFGA 5D7CA 2YK2A 2FTKA 1YSZA 2XJXA 2YI0A 4LWGA 2C2AA 3TZ2A 3WQ9A
chains in the Genus database with same CATH topology
5D7RA 2BZ5A 3A0TA 4O05A 3D36A 4XIRA 4WUCA 3EHFA 1S14A 1R62A 2QG2A 2UWDA 4FCPA 4U7NA 2XDKA 4URMA 3K97A 3K99A 4R3AA 2XABA 4L8ZA 4KTNA 1I5DA 1MX0A 1ZXNA 2YKBA 2YJXA 1ZWHA 4CWOA 4YKUA 1NHJA 2YE9A 5CTYA 1Y4UA 4URNA 2BU8A 2WI3A 4FCRA 4HXWA 2YE8A 2YEBA 2YE7A 1UY8A 4U7OA 4CWQA 2YGFA 4L91A 1TBWA 2HCHA 2BSMA 2ZKJA 3LPSA 1BKNA 4AS9A 3EHHA 1AH6A 4CE1A 2XD6A 2IWUA 1Y8PA 2QG0A 1UY6A 2FXSA 1YETA 1I5CA 5C93A 3K98A 2YEEA 1TIDA 2YE4A 4WUBA 1Z5AA 3GIEA 4ASBA 2VCIA 4E01A 3CRLA 3T1KA 3VADA 4EEHA 4AWPA 3QTFA 4YKQA 4BQJA 2QFOA 1B3QA 3T2SA 4GCZA 3Q5LA 2BYHA 1QY8A 2XHTA 4XKKA 3VHAA 2YKJA 2YEDA 4W7TA 1GKXA 3HYZA 2CH4A 4O09A 3OPDA 1UYIA 3CRKA 1YC4A 4DUHA 4PRVA 2HG1A 1BGQA 4XITA 2XHRA 4QPJA 3U2DA 2WI4A 1EA6A 3HZ1A 2BU6A 3PEHA 2EXLA 4CE2A 5IDMA 4UROA 5FNCA 4R3MA 1KZNA 2BTZA 3QDDA 1YT1A 2WEPA 3H4LA 2VW5A 2XDLA 3OW6A 4EGKA 2IORA 1TH8A 1AM1A 2CGFA 3EKRA 4WUDA 3VHCA 4Q20A 4AWOA 2YEIA 4CE3A 3O2FA 3B25A 4PU9A 1TC0A 3MNRP 4I5SA 2YI6A 2ZDYA 3OWBA 4BIUA 2CCUA 4U93A 3NMQA 1ID0A 2GQPA 2YE2A 2YJWA 4URLA 3G7BA 2YI5A 3R4PA 4ZKIA 5D6PA 4MBCA 1NHIA 4XCLA 2YEJA 4FMTA 3TZ5A 2H8MA 1AJ6A 2YEGA 4XIPA 3OMUA 4V26A 5L3JA 4MOTA 1UY9A 2XJGA 5IDJA 4KSGA 5FWKA 5GGZA 4NH7A 1L0OA 2Q2EB 4MP2A 4GQTA 2E0AA 4HYMA 4O0BA 2FYPA 1TC6A 3T10A 2AKPA 3BM9A 4LWIA 3G75A 4XKAA 4YKZA 1H7SA 3FT8A 4EGHA 4MPNA 1UY7A 3EKOA 3Q5KA 3T0HA 3ZKDA 2YEFA 4MPEA 2O1WA 2YE5A 4KSHA 2XX2A 3GIFA 2Q8IA 2YGEA 2CG9A 2WI5A 4V25A 4KP4A 1OSFA 4FCQA 2BREA 5FNDA 3PEJA 4NH9A 2Q8HA 2CCTA 4B6CA 4BAEA 1YT0A 3LNUA 4PRXA 4XIQA 2BU2A 1UYGA 3R4MA 1YC3A 4BIZA 3A0RA 3ZM7A 4CWSA 4PL9A 4NH8A 1Z5CA 2YK9A 2WI7A 4BQGA 4JAUA 4BXIA 2H55A 1Z5BA 5M4PA 3B24A 1YC1A 3C11A 3GIGB 2GFDA 4GGLA 1UYFA 5M4NA 5M4EA 2YKCA 4LPBA 5F3KA 2O1UA 2WI2A 4FPPA 4B7PA 5M4HA 5CPHA 2PNRA 3RLRA 1UYMA 3Q5JA 4HYPA 5CTWA 3FT5A 1PVGA 4EGIA 2QF6A 3A0XA 2ESAA 5J6AA 3B27A 1H7UA 4EFUA 3K60A 2BU5A 2Q8FA 1NHHA 1AH8A 2IOQA 2YECA 3IEDA 4ASFA 3TUHA 1YERA 1UYHA 2K5BA 2XK2A 3OWDA 3ZXOA 4P7AA 3R4NA 3U67A 5IN9A 4JASA 1I5AA 1MU5A 4O04A 4CWNA 1GKZA 3U2KA 3INWA 5BOCA 2VWCA 2BYIA 4LP0A 4LWHA 1UYDA 4XD8A 1QYEA 3BMYA 4P8OA 2JKIA 4E02A 2XHXA 3GIGA 3KE6A 1Y8OA 3HYYA 2YGAA 3TZ0A 1YSRA 1GJVA 4XE2A 1UYEA 4HXZA 4O07A 4LWFA 4X9LA 2HKJA 4L94A 2CCSA 1US7A 4YKRA 1KIJA 4GEEA 4LWEA 2YE6A 2BRCA 4H7QA 4ASGA 3A0ZA 3T0ZA 3HEKA 4KQVA 3R4OA 4L90A 1B62A 4EMVA 4E00A 1UYCA 2FWZA 5CTXA 4ZVIA 5FNFA 2WI1A 3WHAA 2YEHA 2BU7A 1YT2A 5BODA 4YKXA 4HY1A 2XDXA 4L93A 4I3HA 2WI6A 2XCMA 4HZ5A 2YKEA 3VHDA 1I5BA 3B26A 3G7EA 4CWRA 1I59A 1B63A 4K4OA 3O0IA 5M4MA 1YESA 3CGZA 4JQLA 1Z59A 3CGYA 4DZYA 2XDSA 3R92A 4XTJA 3D0BA 1TILA 1ZXMA 1I58A 4XC0A 3ZXQA 4YKYA 3HHUA 4H85A 3INXA 2JJCA 5F5RA 3RKZA 1UYKA 3A0YA 3TZ4A 3C0EA 2YEAA 2XDUA 2BT0A 2FWYA 1JM6A 1U2OA 2YKIA 4MP7A 4CWTA 2ZDXA 4CWFA 2VCJA 3R91A 4XKOA 3A0WA 1Y4SA 3H80A 1UYLA 3EHJA 4XDMA 2WEQA 2WERA 5D6QA 4ASAA 4HZ0A 4EM7A 4MPCA 2ZBKB 1S16A 1U0ZA 2IOPA 5CF0A 1ZW9A 4HY6A 4GT8A 4QPKA 5D7DA 4YKWA 3D2RA 2XX5A 3RLPA 3O6OA 4R1FA 1BXDA 1Y8NA 5M4KA 1YS3A 1EI1A 1A4HA 3RLQA 4AWQA 5J71A 3EHGA 3JZ3A 4MB9A 3SL2A 4XCJA 1BYQA 2XX4A 2XJJA 2Q8GA 3B28A 2IWXA 3ZKBA 4H81A 4YKTA 2YE3A 5CTUA 1THNA 2O1VA 3DGEA 4CWPA 2IWSA 1QZRA 3FV5A 2YI7A 3HZ5A 3CWVA 1AMWA 4JAVA 3TTZA 4EFTA 4GFNA 4KFGA 5D7CA 2YK2A 1YSZA 2XJXA 2YI0A 4LWGA 2C2AA 3TZ2A 3WQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D7R A;  2BZ5 A;  3A0T A;  4O05 A;  3D36 A;  4XIR A;  4WUC A;  3EHF A;  1S14 A;  1R62 A;  2QG2 A;  2UWD A;  4FCP A;  4U7N A;  2XDK A;  4URM A;  3K97 A;  3K99 A;  4R3A A;  2XAB A;  4L8Z A;  4KTN A;  1I5D A;  1MX0 A;  1ZXN A;  2YKB A;  2YJX A;  1ZWH A;  4CWO A;  4YKU A;  1NHJ A;  2YE9 A;  5CTY A;  1Y4U A;  4URN A;  2BU8 A;  2WI3 A;  4FCR A;  4HXW A;  2YE8 A;  2YEB A;  2YE7 A;  1UY8 A;  4U7O A;  4CWQ A;  2YGF A;  4L91 A;  1TBW A;  2HCH A;  2BSM A;  2ZKJ A;  3LPS A;  1BKN A;  4AS9 A;  3EHH A;  1AH6 A;  4CE1 A;  2XD6 A;  2IWU A;  1Y8P A;  2QG0 A;  1UY6 A;  2FXS A;  1YET A;  1I5C A;  5C93 A;  3K98 A;  2YEE A;  1TID A;  2YE4 A;  4WUB A;  1Z5A A;  3GIE A;  4ASB A;  2VCI A;  4E01 A;  3CRL A;  3T1K A;  3VAD A;  4EEH A;  4AWP A;  3QTF A;  4YKQ A;  4BQJ A;  2QFO A;  1B3Q A;  3T2S A;  4GCZ A;  3Q5L A;  2BYH A;  1QY8 A;  2XHT A;  4XKK A;  3VHA A;  2YKJ A;  2YED A;  4W7T A;  1GKX A;  3HYZ A;  2CH4 A;  4O09 A;  3OPD A;  1UYI A;  3CRK A;  1YC4 A;  4DUH A;  4PRV A;  2HG1 A;  1BGQ A;  4XIT A;  2XHR A;  4QPJ A;  3U2D A;  2WI4 A;  1EA6 A;  3HZ1 A;  2BU6 A;  3PEH A;  2EXL A;  4CE2 A;  5IDM A;  4URO A;  5FNC A;  4R3M A;  1KZN A;  2BTZ A;  3QDD A;  1YT1 A;  2WEP A;  3H4L A;  2VW5 A;  2XDL A;  3OW6 A;  4EGK A;  2IOR A;  1TH8 A;  1AM1 A;  2CGF A;  3EKR A;  4WUD A;  3VHC A;  4Q20 A;  4AWO A;  2YEI A;  4CE3 A;  3O2F A;  3B25 A;  4PU9 A;  1TC0 A;  3MNR P;  4I5S A;  2YI6 A;  2ZDY A;  3OWB A;  4BIU A;  2CCU A;  4U93 A;  3NMQ A;  1ID0 A;  2GQP A;  2YE2 A;  2YJW A;  4URL A;  3G7B A;  2YI5 A;  3R4P A;  4ZKI A;  5D6P A;  4MBC A;  1NHI A;  4XCL A;  2YEJ A;  4FMT A;  3TZ5 A;  2H8M A;  1AJ6 A;  2YEG A;  4XIP A;  3OMU A;  4V26 A;  5L3J A;  4MOT A;  1UY9 A;  2XJG A;  5IDJ A;  4KSG A;  5FWK A;  5GGZ A;  4NH7 A;  1L0O A;  2Q2E B;  4MP2 A;  4GQT A;  2E0A A;  4HYM A;  4O0B A;  2FYP A;  1TC6 A;  3T10 A;  2AKP A;  3BM9 A;  4LWI A;  3G75 A;  4XKA A;  4YKZ A;  1H7S A;  3FT8 A;  4EGH A;  4MPN A;  1UY7 A;  3EKO A;  3Q5K A;  3T0H A;  3ZKD A;  2YEF A;  4MPE A;  2O1W A;  2YE5 A;  4KSH A;  2XX2 A;  3GIF A;  2Q8I A;  2YGE A;  2CG9 A;  2WI5 A;  4V25 A;  4KP4 A;  1OSF A;  4FCQ A;  2BRE A;  5FND A;  3PEJ A;  4NH9 A;  2Q8H A;  2CCT A;  4B6C A;  4BAE A;  1YT0 A;  3LNU A;  4PRX A;  4XIQ A;  2BU2 A;  1UYG A;  3R4M A;  1YC3 A;  4BIZ A;  3A0R A;  3ZM7 A;  4CWS A;  4PL9 A;  4NH8 A;  1Z5C A;  2YK9 A;  2WI7 A;  4BQG A;  4JAU A;  4BXI A;  2H55 A;  1Z5B A;  5M4P A;  3B24 A;  1YC1 A;  3C11 A;  3GIG B;  2GFD A;  4GGL A;  1UYF A;  5M4N A;  5M4E A;  2YKC A;  4LPB A;  5F3K A;  2O1U A;  2WI2 A;  4FPP A;  4B7P A;  5M4H A;  5CPH A;  2PNR A;  3RLR A;  1UYM A;  3Q5J A;  4HYP A;  5CTW A;  3FT5 A;  1PVG A;  4EGI A;  2QF6 A;  3A0X A;  2ESA A;  5J6A A;  3B27 A;  1H7U A;  4EFU A;  3K60 A;  2BU5 A;  2Q8F A;  1NHH A;  1AH8 A;  2IOQ A;  2YEC A;  3IED A;  4ASF A;  3TUH A;  1YER A;  1UYH A;  2K5B A;  2XK2 A;  3OWD A;  3ZXO A;  4P7A A;  3R4N A;  3U67 A;  5IN9 A;  4JAS A;  1I5A A;  1MU5 A;  4O04 A;  4CWN A;  1GKZ A;  3U2K A;  3INW A;  5BOC A;  2VWC A;  2BYI A;  4LP0 A;  4LWH A;  1UYD A;  4XD8 A;  1QYE A;  3BMY A;  4P8O A;  2JKI A;  4E02 A;  2XHX A;  3GIG A;  3KE6 A;  1Y8O A;  3HYY A;  2YGA A;  3TZ0 A;  1YSR A;  1GJV A;  4XE2 A;  1UYE A;  4HXZ A;  4O07 A;  4LWF A;  4X9L A;  2HKJ A;  4L94 A;  2CCS A;  1US7 A;  4YKR A;  1KIJ A;  4GEE A;  4LWE A;  2YE6 A;  2BRC A;  4H7Q A;  4ASG A;  3A0Z A;  3T0Z A;  3HEK A;  4KQV A;  3R4O A;  4L90 A;  1B62 A;  4EMV A;  4E00 A;  1UYC A;  2FWZ A;  5CTX A;  4ZVI A;  5FNF A;  2WI1 A;  3WHA A;  2YEH A;  2BU7 A;  1YT2 A;  5BOD A;  4YKX A;  4HY1 A;  2XDX A;  4L93 A;  4I3H A;  2WI6 A;  2XCM A;  4HZ5 A;  2YKE A;  3VHD A;  1I5B A;  3B26 A;  3G7E A;  4CWR A;  1I59 A;  1B63 A;  4K4O A;  3O0I A;  5M4M A;  1YES A;  3CGZ A;  4JQL A;  1Z59 A;  3CGY A;  4DZY A;  2XDS A;  3R92 A;  4XTJ A;  3D0B A;  1TIL A;  1ZXM A;  1I58 A;  4XC0 A;  3ZXQ A;  4YKY A;  3HHU A;  4H85 A;  3INX A;  2JJC A;  5F5R A;  3RKZ A;  1UYK A;  3A0Y A;  3TZ4 A;  3C0E A;  2YEA A;  2XDU A;  2BT0 A;  2FWY A;  1JM6 A;  1U2O A;  2YKI A;  4MP7 A;  4CWT A;  2ZDX A;  4CWF A;  2VCJ A;  3R91 A;  4XKO A;  3A0W A;  1Y4S A;  3H80 A;  1UYL A;  3EHJ A;  4XDM A;  2WEQ A;  2WER A;  5D6Q A;  4ASA A;  4HZ0 A;  4EM7 A;  4MPC A;  2ZBK B;  1S16 A;  1U0Z A;  2IOP A;  5CF0 A;  1ZW9 A;  4HY6 A;  4GT8 A;  4QPK A;  5D7D A;  4YKW A;  3D2R A;  2XX5 A;  3RLP A;  3O6O A;  4R1F A;  1BXD A;  1Y8N A;  5M4K A;  1YS3 A;  1EI1 A;  1A4H A;  3RLQ A;  4AWQ A;  5J71 A;  3EHG A;  3JZ3 A;  4MB9 A;  3SL2 A;  4XCJ A;  1BYQ A;  2XX4 A;  2XJJ A;  2Q8G A;  3B28 A;  2IWX A;  3ZKB A;  4H81 A;  4YKT A;  2YE3 A;  5CTU A;  1THN A;  2O1V A;  3DGE A;  4CWP A;  2IWS A;  1QZR A;  3FV5 A;  2YI7 A;  3HZ5 A;  3CWV A;  1AMW A;  4JAV A;  3TTZ A;  4EFT A;  4GFN A;  4KFG A;  5D7C A;  2YK2 A;  1YSZ A;  2XJX A;  2YI0 A;  4LWG A;  2C2A A;  3TZ2 A;  3WQ9 A; 
#chains in the Genus database with same CATH topology
 5D7R A;  2BZ5 A;  3A0T A;  4O05 A;  3D36 A;  4XIR A;  4WUC A;  3EHF A;  1S14 A;  1R62 A;  2QG2 A;  2UWD A;  4FCP A;  4U7N A;  2XDK A;  4URM A;  3K97 A;  3K99 A;  4R3A A;  3S5T A;  2XAB A;  4L8Z A;  4KTN A;  1I5D A;  4E72 A;  1MX0 A;  1ZXN A;  2YKB A;  2YJX A;  1ZWH A;  4CWO A;  4YKU A;  1NHJ A;  2C1I A;  2YE9 A;  5CTY A;  1Y4U A;  4URN A;  2BU8 A;  2WI3 A;  4FCR A;  4HXW A;  2YE8 A;  2YEB A;  2YE7 A;  1UY8 A;  4U7O A;  4CWQ A;  2YGF A;  4L91 A;  1TBW A;  2HCH A;  2C1G A;  2BSM A;  2ZKJ A;  3LPS A;  1BKN A;  4AS9 A;  3EHH A;  1AH6 A;  4CE1 A;  2XD6 A;  2IWU A;  1Y8P A;  2QG0 A;  1UY6 A;  2FXS A;  1YET A;  3CYG A;  1I5C A;  5C93 A;  3K98 A;  2YEE A;  1TID A;  2YE4 A;  4WUB A;  1Z5A A;  3GIE A;  4ASB A;  2VCI A;  4E01 A;  3CRL A;  3T1K A;  3VAD A;  4EEH A;  4AWP A;  3QTF A;  4YKQ A;  4BQJ A;  2QFO A;  1B3Q A;  3T2S A;  4GCZ A;  3Q5L A;  2BYH A;  1QY8 A;  2XHT A;  4XKK A;  3VHA A;  2YKJ A;  2YED A;  4W7T A;  1GKX A;  3HYZ A;  2CH4 A;  4O09 A;  3OPD A;  1UYI A;  3CRK A;  1YC4 A;  4DUH A;  4PRV A;  2HG1 A;  1BGQ A;  4XIT A;  2XHR A;  4QPJ A;  3U2D A;  2WI4 A;  1EA6 A;  3HZ1 A;  2BU6 A;  3PEH A;  2EXL A;  4CE2 A;  5IDM A;  4URO A;  5FNC A;  4R3M A;  1KZN A;  2BTZ A;  3QDD A;  1YT1 A;  2WEP A;  3LMM A;  3H4L A;  2VW5 A;  2XDL A;  3OW6 A;  4EGK A;  2IOR A;  1TH8 A;  1AM1 A;  2CGF A;  5JEN A;  3EKR A;  4WUD A;  3VHC A;  4Q20 A;  4AWO A;  2YEI A;  4CE3 A;  3O2F A;  3B25 A;  4PU9 A;  1TC0 A;  3MNR P;  4I5S A;  2YI6 A;  2ZDY A;  3OWB A;  4BIU A;  2CCU A;  4U93 A;  3NMQ A;  1ID0 A;  2GQP A;  2YE2 A;  2YJW A;  4URL A;  3G7B A;  2YI5 A;  3R4P A;  4ZKI A;  5D6P A;  4MBC A;  1NHI A;  4XCL A;  2YEJ A;  4FMT A;  3TZ5 A;  2H8M A;  1AJ6 A;  2YEG A;  4XIP A;  3OMU A;  4V26 A;  5L3J A;  4MOT A;  1UY9 A;  2XJG A;  5IDJ A;  4KSG A;  5FWK A;  5GGZ A;  4NH7 A;  1L0O A;  2Q2E B;  4MP2 A;  4GQT A;  2E0A A;  4HYM A;  4O0B A;  2FYP A;  1TC6 A;  3T10 A;  2AKP A;  3BM9 A;  4LWI A;  3G75 A;  4XKA A;  4YKZ A;  1H7S A;  3FT8 A;  4EGH A;  4MPN A;  1UY7 A;  3EKO A;  3Q5K A;  3T0H A;  3ZKD A;  2YEF A;  4MPE A;  2O1W A;  2YE5 A;  4KSH A;  2XX2 A;  3GIF A;  2Q8I A;  2YGE A;  2CG9 A;  2WI5 A;  4V25 A;  4KP4 A;  1OSF A;  4FCQ A;  2BRE A;  5FND A;  3PEJ A;  4NH9 A;  2Q8H A;  2CCT A;  4B6C A;  4BAE A;  1YT0 A;  3LNU A;  4PRX A;  4XIQ A;  2BU2 A;  1UYG A;  3R4M A;  1YC3 A;  4BIZ A;  3A0R A;  3ZM7 A;  4CWS A;  4PL9 A;  4NH8 A;  1Z5C A;  2YK9 A;  2WI7 A;  4BQG A;  4JAU A;  1IXM A;  4BXI A;  2H55 A;  1Z5B A;  5M4P A;  3B24 A;  1YC1 A;  3C11 A;  3GIG B;  2GFD A;  4GGL A;  1UYF A;  5M4N A;  5M4E A;  2YKC A;  4LPB A;  5F3K A;  2O1U A;  2WI2 A;  4FPP A;  4B7P A;  5M4H A;  5CPH A;  2PNR A;  3RLR A;  1UYM A;  3Q5J A;  4HYP A;  5CTW A;  3FT5 A;  1PVG A;  4EGI A;  2QF6 A;  3A0X A;  2ESA A;  5J6A A;  3B27 A;  1H7U A;  4EFU A;  3K60 A;  2BU5 A;  2Q8F A;  1NHH A;  1AH8 A;  2IOQ A;  2YEC A;  3IED A;  4ASF A;  3TUH A;  1YER A;  1UYH A;  2K5B A;  2XK2 A;  3OWD A;  3ZXO A;  4P7A A;  3R4N A;  3U67 A;  5IN9 A;  4JAS A;  1I5A A;  1MU5 A;  4O04 A;  4CWN A;  1GKZ A;  3U2K A;  3INW A;  5BOC A;  2VWC A;  2BYI A;  4LP0 A;  4LWH A;  1UYD A;  4XD8 A;  1QYE A;  3BMY A;  4P8O A;  2JKI A;  4E02 A;  2XHX A;  3GIG A;  3KE6 A;  1Y8O A;  3HYY A;  2YGA A;  3TZ0 A;  1YSR A;  1GJV A;  4XE2 A;  1UYE A;  4HXZ A;  4O07 A;  4LWF A;  4X9L A;  2HKJ A;  4L94 A;  2CCS A;  1US7 A;  4YKR A;  1KIJ A;  1F51 A;  4GEE A;  4LWE A;  2YE6 A;  2BRC A;  4H7Q A;  4ASG A;  3A0Z A;  3T0Z A;  3HEK A;  4KQV A;  3R4O A;  4L90 A;  1B62 A;  4EMV A;  4E00 A;  1UYC A;  2FWZ A;  5CTX A;  4ZVI A;  5FNF A;  2WI1 A;  3WHA A;  2YEH A;  2BU7 A;  1YT2 A;  5BOD A;  4YKX A;  4HY1 A;  2XDX A;  4L93 A;  4I3H A;  2WI6 A;  2XCM A;  4HZ5 A;  2YKE A;  3VHD A;  1I5B A;  3B26 A;  3G7E A;  4CWR A;  1I59 A;  1B63 A;  4K4O A;  3O0I A;  5M4M A;  1YES A;  3CGZ A;  4JQL A;  1Z59 A;  3CGY A;  4DZY A;  2XDS A;  3R92 A;  4XTJ A;  3D0B A;  1TIL A;  1ZXM A;  1I58 A;  4XC0 A;  3ZXQ A;  4YKY A;  3HHU A;  4H85 A;  3INX A;  2JJC A;  5F5R A;  3RKZ A;  1UYK A;  3A0Y A;  3TZ4 A;  3C0E A;  2YEA A;  2XDU A;  2BT0 A;  2FWY A;  1JM6 A;  1U2O A;  2YKI A;  4MP7 A;  4CWT A;  2ZDX A;  4CWF A;  2VCJ A;  3R91 A;  4XKO A;  3A0W A;  1Y4S A;  3H80 A;  1UYL A;  3EHJ A;  4XDM A;  2WEQ A;  2WER A;  5D6Q A;  4ASA A;  4HZ0 A;  4EM7 A;  4MPC A;  2ZBK B;  1S16 A;  1U0Z A;  2IOP A;  5CF0 A;  1ZW9 A;  4HY6 A;  2HHI A;  4GT8 A;  4QPK A;  5D7D A;  4YKW A;  3D2R A;  2XX5 A;  3RLP A;  3O6O A;  4R1F A;  1BXD A;  1Y8N A;  5M4K A;  1YS3 A;  1EI1 A;  1A4H A;  3RLQ A;  4AWQ A;  5J71 A;  3EHG A;  3JZ3 A;  4MB9 A;  3SL2 A;  4XCJ A;  1BYQ A;  2XX4 A;  2XJJ A;  2Q8G A;  3B28 A;  2IWX A;  3ZKB A;  4H81 A;  4YKT A;  2YE3 A;  5CTU A;  1THN A;  2O1V A;  3DGE A;  4CWP A;  2IWS A;  1QZR A;  3FV5 A;  2YI7 A;  3HZ5 A;  3CWV A;  1AMW A;  4JAV A;  3TTZ A;  4EFT A;  4GFN A;  4KFG A;  5D7C A;  2YK2 A;  2FTK A;  1YSZ A;  2XJX A;  2YI0 A;  4LWG A;  2C2A A;  3TZ2 A;  3WQ9 A; 
#chains in the Genus database with same CATH homology
 5D7R A;  2BZ5 A;  3A0T A;  4O05 A;  3D36 A;  4XIR A;  4WUC A;  3EHF A;  1S14 A;  1R62 A;  2QG2 A;  2UWD A;  4FCP A;  4U7N A;  2XDK A;  4URM A;  3K97 A;  3K99 A;  4R3A A;  2XAB A;  4L8Z A;  4KTN A;  1I5D A;  1MX0 A;  1ZXN A;  2YKB A;  2YJX A;  1ZWH A;  4CWO A;  4YKU A;  1NHJ A;  2YE9 A;  5CTY A;  1Y4U A;  4URN A;  2BU8 A;  2WI3 A;  4FCR A;  4HXW A;  2YE8 A;  2YEB A;  2YE7 A;  1UY8 A;  4U7O A;  4CWQ A;  2YGF A;  4L91 A;  1TBW A;  2HCH A;  2BSM A;  2ZKJ A;  3LPS A;  1BKN A;  4AS9 A;  3EHH A;  1AH6 A;  4CE1 A;  2XD6 A;  2IWU A;  1Y8P A;  2QG0 A;  1UY6 A;  2FXS A;  1YET A;  1I5C A;  5C93 A;  3K98 A;  2YEE A;  1TID A;  2YE4 A;  4WUB A;  1Z5A A;  3GIE A;  4ASB A;  2VCI A;  4E01 A;  3CRL A;  3T1K A;  3VAD A;  4EEH A;  4AWP A;  3QTF A;  4YKQ A;  4BQJ A;  2QFO A;  1B3Q A;  3T2S A;  4GCZ A;  3Q5L A;  2BYH A;  1QY8 A;  2XHT A;  4XKK A;  3VHA A;  2YKJ A;  2YED A;  4W7T A;  1GKX A;  3HYZ A;  2CH4 A;  4O09 A;  3OPD A;  1UYI A;  3CRK A;  1YC4 A;  4DUH A;  4PRV A;  2HG1 A;  1BGQ A;  4XIT A;  2XHR A;  4QPJ A;  3U2D A;  2WI4 A;  1EA6 A;  3HZ1 A;  2BU6 A;  3PEH A;  2EXL A;  4CE2 A;  5IDM A;  4URO A;  5FNC A;  4R3M A;  1KZN A;  2BTZ A;  3QDD A;  1YT1 A;  2WEP A;  3H4L A;  2VW5 A;  2XDL A;  3OW6 A;  4EGK A;  2IOR A;  1TH8 A;  1AM1 A;  2CGF A;  3EKR A;  4WUD A;  3VHC A;  4Q20 A;  4AWO A;  2YEI A;  4CE3 A;  3O2F A;  3B25 A;  4PU9 A;  1TC0 A;  3MNR P;  4I5S A;  2YI6 A;  2ZDY A;  3OWB A;  4BIU A;  2CCU A;  4U93 A;  3NMQ A;  1ID0 A;  2GQP A;  2YE2 A;  2YJW A;  4URL A;  3G7B A;  2YI5 A;  3R4P A;  4ZKI A;  5D6P A;  4MBC A;  1NHI A;  4XCL A;  2YEJ A;  4FMT A;  3TZ5 A;  2H8M A;  1AJ6 A;  2YEG A;  4XIP A;  3OMU A;  4V26 A;  5L3J A;  4MOT A;  1UY9 A;  2XJG A;  5IDJ A;  4KSG A;  5FWK A;  5GGZ A;  4NH7 A;  1L0O A;  2Q2E B;  4MP2 A;  4GQT A;  2E0A A;  4HYM A;  4O0B A;  2FYP A;  1TC6 A;  3T10 A;  2AKP A;  3BM9 A;  4LWI A;  3G75 A;  4XKA A;  4YKZ A;  1H7S A;  3FT8 A;  4EGH A;  4MPN A;  1UY7 A;  3EKO A;  3Q5K A;  3T0H A;  3ZKD A;  2YEF A;  4MPE A;  2O1W A;  2YE5 A;  4KSH A;  2XX2 A;  3GIF A;  2Q8I A;  2YGE A;  2CG9 A;  2WI5 A;  4V25 A;  4KP4 A;  1OSF A;  4FCQ A;  2BRE A;  5FND A;  3PEJ A;  4NH9 A;  2Q8H A;  2CCT A;  4B6C A;  4BAE A;  1YT0 A;  3LNU A;  4PRX A;  4XIQ A;  2BU2 A;  1UYG A;  3R4M A;  1YC3 A;  4BIZ A;  3A0R A;  3ZM7 A;  4CWS A;  4PL9 A;  4NH8 A;  1Z5C A;  2YK9 A;  2WI7 A;  4BQG A;  4JAU A;  4BXI A;  2H55 A;  1Z5B A;  5M4P A;  3B24 A;  1YC1 A;  3C11 A;  3GIG B;  2GFD A;  4GGL A;  1UYF A;  5M4N A;  5M4E A;  2YKC A;  4LPB A;  5F3K A;  2O1U A;  2WI2 A;  4FPP A;  4B7P A;  5M4H A;  5CPH A;  2PNR A;  3RLR A;  1UYM A;  3Q5J A;  4HYP A;  5CTW A;  3FT5 A;  1PVG A;  4EGI A;  2QF6 A;  3A0X A;  2ESA A;  5J6A A;  3B27 A;  1H7U A;  4EFU A;  3K60 A;  2BU5 A;  2Q8F A;  1NHH A;  1AH8 A;  2IOQ A;  2YEC A;  3IED A;  4ASF A;  3TUH A;  1YER A;  1UYH A;  2K5B A;  2XK2 A;  3OWD A;  3ZXO A;  4P7A A;  3R4N A;  3U67 A;  5IN9 A;  4JAS A;  1I5A A;  1MU5 A;  4O04 A;  4CWN A;  1GKZ A;  3U2K A;  3INW A;  5BOC A;  2VWC A;  2BYI A;  4LP0 A;  4LWH A;  1UYD A;  4XD8 A;  1QYE A;  3BMY A;  4P8O A;  2JKI A;  4E02 A;  2XHX A;  3GIG A;  3KE6 A;  1Y8O A;  3HYY A;  2YGA A;  3TZ0 A;  1YSR A;  1GJV A;  4XE2 A;  1UYE A;  4HXZ A;  4O07 A;  4LWF A;  4X9L A;  2HKJ A;  4L94 A;  2CCS A;  1US7 A;  4YKR A;  1KIJ A;  4GEE A;  4LWE A;  2YE6 A;  2BRC A;  4H7Q A;  4ASG A;  3A0Z A;  3T0Z A;  3HEK A;  4KQV A;  3R4O A;  4L90 A;  1B62 A;  4EMV A;  4E00 A;  1UYC A;  2FWZ A;  5CTX A;  4ZVI A;  5FNF A;  2WI1 A;  3WHA A;  2YEH A;  2BU7 A;  1YT2 A;  5BOD A;  4YKX A;  4HY1 A;  2XDX A;  4L93 A;  4I3H A;  2WI6 A;  2XCM A;  4HZ5 A;  2YKE A;  3VHD A;  1I5B A;  3B26 A;  3G7E A;  4CWR A;  1I59 A;  1B63 A;  4K4O A;  3O0I A;  5M4M A;  1YES A;  3CGZ A;  4JQL A;  1Z59 A;  3CGY A;  4DZY A;  2XDS A;  3R92 A;  4XTJ A;  3D0B A;  1TIL A;  1ZXM A;  1I58 A;  4XC0 A;  3ZXQ A;  4YKY A;  3HHU A;  4H85 A;  3INX A;  2JJC A;  5F5R A;  3RKZ A;  1UYK A;  3A0Y A;  3TZ4 A;  3C0E A;  2YEA A;  2XDU A;  2BT0 A;  2FWY A;  1JM6 A;  1U2O A;  2YKI A;  4MP7 A;  4CWT A;  2ZDX A;  4CWF A;  2VCJ A;  3R91 A;  4XKO A;  3A0W A;  1Y4S A;  3H80 A;  1UYL A;  3EHJ A;  4XDM A;  2WEQ A;  2WER A;  5D6Q A;  4ASA A;  4HZ0 A;  4EM7 A;  4MPC A;  2ZBK B;  1S16 A;  1U0Z A;  2IOP A;  5CF0 A;  1ZW9 A;  4HY6 A;  4GT8 A;  4QPK A;  5D7D A;  4YKW A;  3D2R A;  2XX5 A;  3RLP A;  3O6O A;  4R1F A;  1BXD A;  1Y8N A;  5M4K A;  1YS3 A;  1EI1 A;  1A4H A;  3RLQ A;  4AWQ A;  5J71 A;  3EHG A;  3JZ3 A;  4MB9 A;  3SL2 A;  4XCJ A;  1BYQ A;  2XX4 A;  2XJJ A;  2Q8G A;  3B28 A;  2IWX A;  3ZKB A;  4H81 A;  4YKT A;  2YE3 A;  5CTU A;  1THN A;  2O1V A;  3DGE A;  4CWP A;  2IWS A;  1QZR A;  3FV5 A;  2YI7 A;  3HZ5 A;  3CWV A;  1AMW A;  4JAV A;  3TTZ A;  4EFT A;  4GFN A;  4KFG A;  5D7C A;  2YK2 A;  1YSZ A;  2XJX A;  2YI0 A;  4LWG A;  2C2A A;  3TZ2 A;  3WQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...