5CTYA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based discovery of DNA gyrase inhibitors targeting the ATPase subunit of GyrB.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 65
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5ctyA00
2XDXA 4CE2A 3LNUA 2Q2EB 1TBWA 2YJWA 4L8ZA 3A0ZA 1YT1A 1B63A 2Q8HA 1NHJA 4CWFA 3EKOA 4EEHA 2IORA 4HY1A 3TZ0A 4JAVA 1YSZA 2YKIA 2H55A 2YE9A 5IN9A 4NH9A 3QTFA 1AM1A 4KFGA 4O04A 2BU2A 3CRLA 2WI6A 4BIZA 1B62A 3HYYA 2VW5A 3PEHA 4HYMA 5D6QA 1L0OA 3R91A 2BU6A 2YEFA 3ZXQA 1NHIA 2YE5A 1UYIA 3B26A 1UY9A 1BGQA 4XITA 2XJXA 1I5BA 1R62A 2XX5A 4FPPA 3GIFA 1MU5A 4U7OA 4PL9A 4FCQA 2YI6A 2VCJA 4XE2A 1U0ZA 4MP7A 2XX4A 1TC6A 3R4PA 1GKXA 2FWYA 3TZ5A 4U93A 1Y4UA 3B25A 2YEIA 4BIUA 3HZ5A 1AH6A 5M4HA 2CCTA 2FWZA 5BOCA 5M4PA 4LWGA 4XTJA 2BZ5A 3A0RA 4EGKA 4CWOA 3INWA 4CWRA 5CPHA 3O2FA 3EKRA 1YETA 2EXLA 4CWPA 2WI5A 2YECA 4L90A 2BU8A 2H8MA 1Y4SA 5M4EA 2O1UA 2YK9A 2ZBKB 4H85A 1Z5BA 2O1WA 4MPEA 2YI7A 4MP2A 5CTUA 4E00A 3TTZA 5IDMA 2QF6A 4QPKA 4GQTA 4YKZA 4HY6A 3A0XA 3FT5A 5J71A 5F5RA 2XHXA 2GFDA 3D0BA 2K5BA 4YKQA 3R4OA 2YE3A 4H7QA 3EHFA 4R3AA 3A0WA 4U7NA 4O07A 2Q8IA 1I5AA 4O05A 4BXIA 1H7SA 5M4NA 4YKXA 4XC0A 1UYKA 3CGYA 1BYQA 1UYEA 3EHJA 4BQGA 3A0YA 4V25A 3MNRP 2ZDYA 2UWDA 1I58A 2YGFA 2YGEA 4JASA 4YKTA 2YKCA 2PNRA 4FCRA 2XJGA 2HKJA 4ASGA 3WHAA 1TH8A 3T1KA 2YEAA 1Z5AA 4I5SA 2WERA 4XIQA 4XKOA 2BSMA 2XDUA 1TC0A 2WI7A 2Q8GA 3KE6A 4P7AA 2BT0A 4XIPA 4AS9A 2IWXA 2JJCA 2YJXA 4JQLA 4KP4A 3OWBA 5FWKA 2YE8A 4YKWA 4WUCA 2BRCA 3CGZA 2BYIA 1YSRA 2XHRA 3RLQA 2QG2A 4JAUA 3U2KA 4L93A 3OPDA 4LPBA 2WI4A 5FNDA 4CWQA 1A4HA 2IOPA 1US7A 5FNFA 2YI5A 4LWEA 4PRVA 4E01A 2BU5A 4HYPA 1TILA 5IDJA 3G7EA 4AWPA 4DZYA 2QG0A 4I3HA 4EM7A 3CRKA 2Q8FA 3O0IA 2C2AA 1YC4A 2BTZA 3HZ1A 5CTWA 2XDLA 1UYHA 3INXA 3BM9A 2QFOA 4DUHA 4LP0A 5C93A 2ZKJA 1AMWA 4MBCA 1UYLA 4MOTA 1UYGA 3OWDA 1BXDA 4MB9A 1S14A 4XKAA 4CWSA 2YEEA 3C11A 4URNA 2VCIA 3Q5LA 3K98A 3RLRA 4FMTA 4AWQA 2O1VA 2YEJA 2FYPA 2ESAA 1ZXMA 4K4OA 1YC1A 1UYFA 2YE7A 5D7RA 3K97A 3FT8A 4YKYA 4KTNA 2BYHA 3BMYA 4GT8A 2WI3A 2IOQA 2JKIA 1I59A 2XDKA 3EHGA 1UY8A 2GQPA 1UY7A 4LWHA 3D36A 5CF0A 4MPCA 5D6PA 1OSFA 5M4KA 1I5CA 2YKJA 4ZKIA 5FNCA 4NH8A 1Z5CA 4EMVA 1UY6A 1Y8NA 1QZRA 2CCSA 5L3JA 3U67A 2YEBA 1Y8OA 1UYCA 4CWNA 1THNA 4GFNA 2CG9A 2CGFA 2WEQA 4YKUA 1YT0A 3TZ4A 3H4LA 4EFUA 3GIEA 5J6AA 3K60A 3OMUA 1ZWHA 3R92A 3VADA 4BAEA 1H7UA 2YEHA 3R4MA 3FV5A 1YERA 4AWOA 2WEPA 3EHHA 3NMQA 2E0AA 2HG1A 5D7CA 4L94A 4URLA 4X9LA 1GJVA 5F3KA 3QDDA 3Q5JA 4GEEA 4NH7A 3VHCA 2IWUA 4O0BA 3PEJA 1ZW9A 2YGAA 2YK2A 3TUHA 2IWSA 1YESA 4YKRA 4GCZA 1S16A 1KIJA 4LWFA 1AH8A 2YE4A 3G75A 4O09A 4HZ5A 2ZDXA 4XCLA 3OW6A 4QPJA 2XCMA 2FXSA 1MX0A 1EA6A 3D2RA 4V26A 4CWTA 3HYZA 4WUBA 4EGIA 3HHUA 1JM6A 3RLPA 4EGHA 2YKEA 3C0EA 2YEGA 5BODA 3HEKA 4LWIA 4Q20A 4P8OA 4XDMA 2YEDA 4ASBA 1QYEA 3O6OA 1NHHA 4L91A 3LPSA 2HCHA 4GGLA 5CTXA 2VWCA 4XIRA 4HXWA 1YT2A 2XK2A 4KSGA 4B7PA 4CE3A 3GIGA 2BU7A 2XJJA 4URMA 4UROA 2BREA 2XX2A 2XD6A 2AKPA 2XABA 4MPNA 3T0HA 1UYMA 1YS3A 3JZ3A 1GKZA 4ASFA 3H80A 1ZXNA 3K99A 5M4MA 3GIGB 4EFTA 2XDSA 1B3QA 2WI2A 3VHAA 1EI1A 4KSHA 3B27A 3ZKDA 5GGZA 4ASAA 5D7DA 4BQJA 2YKBA 1I5DA 2CH4A 3Q5KA 4E02A 4XCJA 3ZKBA 1PVGA 2YI0A 1AJ6A 3T10A 3R4NA 4HXZA 1YC3A 4XKKA 4ZVIA 4R3MA 2YE2A 3G7BA 1U2OA 2YE6A 4H81A 1BKNA 4R1FA 3T2SA 3U2DA 1Y8PA 4PU9A 3VHDA 2WI1A 3B28A 3WQ9A 4WUDA 3A0TA 3SL2A 1KZNA 4KQVA 1UYDA 2CCUA 4PRXA 2XHTA 3IEDA 1ID0A 3ZM7A 1Z59A 4HZ0A 3DGEA 3TZ2A 4CE1A 3RKZA 4FCPA 4B6CA 5CTYA 4XD8A 3CWVA 4W7TA 1QY8A 3B24A 3ZXOA 1TIDA 3T0ZA
chains in the Genus database with same CATH superfamily
2XDXA 4CE2A 3LNUA 3LMMA 2Q2EB 1TBWA 2YJWA 4L8ZA 3A0ZA 1YT1A 1B63A 2Q8HA 1NHJA 4CWFA 3EKOA 4EEHA 2IORA 4HY1A 3TZ0A 4JAVA 1YSZA 2YKIA 2H55A 2YE9A 5IN9A 4NH9A 3QTFA 1AM1A 4KFGA 4O04A 2BU2A 3CRLA 2WI6A 4BIZA 1B62A 3HYYA 2VW5A 3PEHA 4HYMA 5D6QA 1L0OA 3R91A 2BU6A 2YEFA 3ZXQA 1NHIA 2YE5A 1UYIA 3B26A 1UY9A 1BGQA 4XITA 2XJXA 1I5BA 1R62A 2XX5A 4FPPA 3GIFA 1MU5A 4U7OA 4PL9A 4E72A 4FCQA 2YI6A 2VCJA 4XE2A 1U0ZA 4MP7A 2XX4A 1TC6A 3R4PA 1GKXA 2C1IA 2FWYA 3TZ5A 4U93A 1Y4UA 3B25A 2YEIA 4BIUA 3HZ5A 1AH6A 5M4HA 2CCTA 2FWZA 5BOCA 5M4PA 4LWGA 4XTJA 2BZ5A 3A0RA 4EGKA 4CWOA 3INWA 4CWRA 5CPHA 3O2FA 3EKRA 1YETA 2EXLA 4CWPA 2WI5A 2YECA 4L90A 2BU8A 2H8MA 1Y4SA 5M4EA 2O1UA 2YK9A 2ZBKB 4H85A 1Z5BA 2O1WA 4MPEA 2YI7A 4MP2A 5CTUA 4E00A 3TTZA 5IDMA 2QF6A 4QPKA 4GQTA 4YKZA 4HY6A 3A0XA 3FT5A 5J71A 5F5RA 2XHXA 2GFDA 3D0BA 2K5BA 4YKQA 3R4OA 2YE3A 4H7QA 3EHFA 4R3AA 3A0WA 4U7NA 4O07A 2Q8IA 1I5AA 4O05A 4BXIA 1H7SA 5M4NA 4YKXA 4XC0A 1UYKA 3CGYA 1BYQA 1UYEA 3EHJA 4BQGA 3CYGA 3A0YA 4V25A 3MNRP 2ZDYA 2UWDA 1I58A 2YGFA 2YGEA 4JASA 4YKTA 2YKCA 2PNRA 4FCRA 2XJGA 2HKJA 4ASGA 3WHAA 1TH8A 3T1KA 2YEAA 1Z5AA 4I5SA 2WERA 4XIQA 4XKOA 2BSMA 2XDUA 1TC0A 2WI7A 2Q8GA 3KE6A 4P7AA 2BT0A 4XIPA 4AS9A 2IWXA 2JJCA 2YJXA 4JQLA 4KP4A 3OWBA 5FWKA 2YE8A 4YKWA 4WUCA 2BRCA 3CGZA 2BYIA 1YSRA 2XHRA 3RLQA 2QG2A 4JAUA 3U2KA 4L93A 3OPDA 4LPBA 2WI4A 5FNDA 4CWQA 1A4HA 2IOPA 1US7A 5FNFA 2YI5A 4LWEA 4PRVA 4E01A 2BU5A 4HYPA 1TILA 5IDJA 3G7EA 4AWPA 4DZYA 3S5TA 2QG0A 4I3HA 4EM7A 3CRKA 2Q8FA 3O0IA 2C2AA 1YC4A 2BTZA 3HZ1A 5CTWA 2XDLA 1UYHA 3INXA 3BM9A 2QFOA 4DUHA 4LP0A 5C93A 2ZKJA 1AMWA 4MBCA 1UYLA 4MOTA 1UYGA 3OWDA 1BXDA 4MB9A 1S14A 4XKAA 4CWSA 2YEEA 3C11A 4URNA 2VCIA 3Q5LA 3K98A 3RLRA 4FMTA 4AWQA 2O1VA 2YEJA 2FYPA 2ESAA 1ZXMA 4K4OA 1YC1A 1UYFA 2YE7A 5D7RA 3K97A 3FT8A 4YKYA 4KTNA 2BYHA 3BMYA 4GT8A 2WI3A 2IOQA 2JKIA 1I59A 2XDKA 3EHGA 1UY8A 2GQPA 1UY7A 4LWHA 3D36A 5CF0A 4MPCA 5D6PA 1OSFA 5M4KA 1I5CA 2YKJA 4ZKIA 5FNCA 4NH8A 1Z5CA 4EMVA 1UY6A 1Y8NA 1QZRA 2CCSA 5L3JA 3U67A 2YEBA 1Y8OA 1UYCA 4CWNA 1THNA 4GFNA 2CG9A 2CGFA 2WEQA 4YKUA 1YT0A 3TZ4A 3H4LA 4EFUA 3GIEA 5J6AA 3K60A 3OMUA 1ZWHA 3R92A 3VADA 4BAEA 1H7UA 2YEHA 3R4MA 3FV5A 1YERA 4AWOA 2WEPA 3EHHA 3NMQA 2E0AA 2HG1A 5D7CA 4L94A 4URLA 4X9LA 1GJVA 5F3KA 3QDDA 3Q5JA 4GEEA 4NH7A 3VHCA 2IWUA 4O0BA 3PEJA 1ZW9A 2YGAA 2YK2A 2HHIA 3TUHA 2IWSA 1YESA 4YKRA 4GCZA 1S16A 1KIJA 4LWFA 1AH8A 2YE4A 3G75A 4O09A 4HZ5A 2ZDXA 4XCLA 3OW6A 4QPJA 2XCMA 2FXSA 1MX0A 1F51A 1EA6A 3D2RA 4V26A 2C1GA 4CWTA 3HYZA 4WUBA 4EGIA 3HHUA 1JM6A 3RLPA 4EGHA 2YKEA 3C0EA 2YEGA 5BODA 3HEKA 4LWIA 4Q20A 4P8OA 4XDMA 2YEDA 4ASBA 1QYEA 3O6OA 1NHHA 4L91A 1IXMA 3LPSA 2HCHA 2FTKA 4GGLA 5CTXA 2VWCA 4XIRA 4HXWA 1YT2A 2XK2A 4KSGA 4B7PA 4CE3A 3GIGA 2BU7A 2XJJA 4URMA 4UROA 2BREA 2XX2A 2XD6A 2AKPA 2XABA 4MPNA 3T0HA 1UYMA 1YS3A 3JZ3A 1GKZA 4ASFA 3H80A 1ZXNA 3K99A 5M4MA 3GIGB 4EFTA 2XDSA 1B3QA 2WI2A 3VHAA 1EI1A 4KSHA 3B27A 3ZKDA 5GGZA 4ASAA 5D7DA 4BQJA 2YKBA 1I5DA 2CH4A 3Q5KA 4E02A 4XCJA 3ZKBA 1PVGA 2YI0A 1AJ6A 3T10A 3R4NA 4HXZA 1YC3A 4XKKA 4ZVIA 4R3MA 2YE2A 3G7BA 1U2OA 2YE6A 4H81A 1BKNA 4R1FA 3T2SA 3U2DA 1Y8PA 5JENA 4PU9A 3VHDA 2WI1A 3B28A 3WQ9A 4WUDA 3A0TA 3SL2A 1KZNA 4KQVA 1UYDA 2CCUA 4PRXA 2XHTA 3IEDA 1ID0A 3ZM7A 1Z59A 4HZ0A 3DGEA 3TZ2A 4CE1A 3RKZA 4FCPA 4B6CA 5CTYA 4XD8A 3CWVA 4W7TA 1QY8A 3B24A 3ZXOA 1TIDA 3T0ZA
chains in the Genus database with same CATH topology
2XDXA 4CE2A 3LNUA 2Q2EB 1TBWA 2YJWA 4L8ZA 3A0ZA 1YT1A 1B63A 2Q8HA 1NHJA 4CWFA 3EKOA 4EEHA 2IORA 4HY1A 3TZ0A 4JAVA 1YSZA 2YKIA 2H55A 2YE9A 5IN9A 4NH9A 3QTFA 1AM1A 4KFGA 4O04A 2BU2A 3CRLA 2WI6A 4BIZA 1B62A 3HYYA 2VW5A 3PEHA 4HYMA 5D6QA 1L0OA 3R91A 2BU6A 2YEFA 3ZXQA 1NHIA 2YE5A 1UYIA 3B26A 1UY9A 1BGQA 4XITA 2XJXA 1I5BA 1R62A 2XX5A 4FPPA 3GIFA 1MU5A 4U7OA 4PL9A 4FCQA 2YI6A 2VCJA 4XE2A 1U0ZA 4MP7A 2XX4A 1TC6A 3R4PA 1GKXA 2FWYA 3TZ5A 4U93A 1Y4UA 3B25A 2YEIA 4BIUA 3HZ5A 1AH6A 5M4HA 2CCTA 2FWZA 5BOCA 5M4PA 4LWGA 4XTJA 2BZ5A 3A0RA 4EGKA 4CWOA 3INWA 4CWRA 5CPHA 3O2FA 3EKRA 1YETA 2EXLA 4CWPA 2WI5A 2YECA 4L90A 2BU8A 2H8MA 1Y4SA 5M4EA 2O1UA 2YK9A 2ZBKB 4H85A 1Z5BA 2O1WA 4MPEA 2YI7A 4MP2A 5CTUA 4E00A 3TTZA 5IDMA 2QF6A 4QPKA 4GQTA 4YKZA 4HY6A 3A0XA 3FT5A 5J71A 5F5RA 2XHXA 2GFDA 3D0BA 2K5BA 4YKQA 3R4OA 2YE3A 4H7QA 3EHFA 4R3AA 3A0WA 4U7NA 4O07A 2Q8IA 1I5AA 4O05A 4BXIA 1H7SA 5M4NA 4YKXA 4XC0A 1UYKA 3CGYA 1BYQA 1UYEA 3EHJA 4BQGA 3A0YA 4V25A 3MNRP 2ZDYA 2UWDA 1I58A 2YGFA 2YGEA 4JASA 4YKTA 2YKCA 2PNRA 4FCRA 2XJGA 2HKJA 4ASGA 3WHAA 1TH8A 3T1KA 2YEAA 1Z5AA 4I5SA 2WERA 4XIQA 4XKOA 2BSMA 2XDUA 1TC0A 2WI7A 2Q8GA 3KE6A 4P7AA 2BT0A 4XIPA 4AS9A 2IWXA 2JJCA 2YJXA 4JQLA 4KP4A 3OWBA 5FWKA 2YE8A 4YKWA 4WUCA 2BRCA 3CGZA 2BYIA 1YSRA 2XHRA 3RLQA 2QG2A 4JAUA 3U2KA 4L93A 3OPDA 4LPBA 2WI4A 5FNDA 4CWQA 1A4HA 2IOPA 1US7A 5FNFA 2YI5A 4LWEA 4PRVA 4E01A 2BU5A 4HYPA 1TILA 5IDJA 3G7EA 4AWPA 4DZYA 2QG0A 4I3HA 4EM7A 3CRKA 2Q8FA 3O0IA 2C2AA 1YC4A 2BTZA 3HZ1A 5CTWA 2XDLA 1UYHA 3INXA 3BM9A 2QFOA 4DUHA 4LP0A 5C93A 2ZKJA 1AMWA 4MBCA 1UYLA 4MOTA 1UYGA 3OWDA 1BXDA 4MB9A 1S14A 4XKAA 4CWSA 2YEEA 3C11A 4URNA 2VCIA 3Q5LA 3K98A 3RLRA 4FMTA 4AWQA 2O1VA 2YEJA 2FYPA 2ESAA 1ZXMA 4K4OA 1YC1A 1UYFA 2YE7A 5D7RA 3K97A 3FT8A 4YKYA 4KTNA 2BYHA 3BMYA 4GT8A 2WI3A 2IOQA 2JKIA 1I59A 2XDKA 3EHGA 1UY8A 2GQPA 1UY7A 4LWHA 3D36A 5CF0A 4MPCA 5D6PA 1OSFA 5M4KA 1I5CA 2YKJA 4ZKIA 5FNCA 4NH8A 1Z5CA 4EMVA 1UY6A 1Y8NA 1QZRA 2CCSA 5L3JA 3U67A 2YEBA 1Y8OA 1UYCA 4CWNA 1THNA 4GFNA 2CG9A 2CGFA 2WEQA 4YKUA 1YT0A 3TZ4A 3H4LA 4EFUA 3GIEA 5J6AA 3K60A 3OMUA 1ZWHA 3R92A 3VADA 4BAEA 1H7UA 2YEHA 3R4MA 3FV5A 1YERA 4AWOA 2WEPA 3EHHA 3NMQA 2E0AA 2HG1A 5D7CA 4L94A 4URLA 4X9LA 1GJVA 5F3KA 3QDDA 3Q5JA 4GEEA 4NH7A 3VHCA 2IWUA 4O0BA 3PEJA 1ZW9A 2YGAA 2YK2A 3TUHA 2IWSA 1YESA 4YKRA 4GCZA 1S16A 1KIJA 4LWFA 1AH8A 2YE4A 3G75A 4O09A 4HZ5A 2ZDXA 4XCLA 3OW6A 4QPJA 2XCMA 2FXSA 1MX0A 1EA6A 3D2RA 4V26A 4CWTA 3HYZA 4WUBA 4EGIA 3HHUA 1JM6A 3RLPA 4EGHA 2YKEA 3C0EA 2YEGA 5BODA 3HEKA 4LWIA 4Q20A 4P8OA 4XDMA 2YEDA 4ASBA 1QYEA 3O6OA 1NHHA 4L91A 3LPSA 2HCHA 4GGLA 5CTXA 2VWCA 4XIRA 4HXWA 1YT2A 2XK2A 4KSGA 4B7PA 4CE3A 3GIGA 2BU7A 2XJJA 4URMA 4UROA 2BREA 2XX2A 2XD6A 2AKPA 2XABA 4MPNA 3T0HA 1UYMA 1YS3A 3JZ3A 1GKZA 4ASFA 3H80A 1ZXNA 3K99A 5M4MA 3GIGB 4EFTA 2XDSA 1B3QA 2WI2A 3VHAA 1EI1A 4KSHA 3B27A 3ZKDA 5GGZA 4ASAA 5D7DA 4BQJA 2YKBA 1I5DA 2CH4A 3Q5KA 4E02A 4XCJA 3ZKBA 1PVGA 2YI0A 1AJ6A 3T10A 3R4NA 4HXZA 1YC3A 4XKKA 4ZVIA 4R3MA 2YE2A 3G7BA 1U2OA 2YE6A 4H81A 1BKNA 4R1FA 3T2SA 3U2DA 1Y8PA 4PU9A 3VHDA 2WI1A 3B28A 3WQ9A 4WUDA 3A0TA 3SL2A 1KZNA 4KQVA 1UYDA 2CCUA 4PRXA 2XHTA 3IEDA 1ID0A 3ZM7A 1Z59A 4HZ0A 3DGEA 3TZ2A 4CE1A 3RKZA 4FCPA 4B6CA 5CTYA 4XD8A 3CWVA 4W7TA 1QY8A 3B24A 3ZXOA 1TIDA 3T0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDX A;  4CE2 A;  3LNU A;  2Q2E B;  1TBW A;  2YJW A;  4L8Z A;  3A0Z A;  1YT1 A;  1B63 A;  2Q8H A;  1NHJ A;  4CWF A;  3EKO A;  4EEH A;  2IOR A;  4HY1 A;  3TZ0 A;  4JAV A;  1YSZ A;  2YKI A;  2H55 A;  2YE9 A;  5IN9 A;  4NH9 A;  3QTF A;  1AM1 A;  4KFG A;  4O04 A;  2BU2 A;  3CRL A;  2WI6 A;  4BIZ A;  1B62 A;  3HYY A;  2VW5 A;  3PEH A;  4HYM A;  5D6Q A;  1L0O A;  3R91 A;  2BU6 A;  2YEF A;  3ZXQ A;  1NHI A;  2YE5 A;  1UYI A;  3B26 A;  1UY9 A;  1BGQ A;  4XIT A;  2XJX A;  1I5B A;  1R62 A;  2XX5 A;  4FPP A;  3GIF A;  1MU5 A;  4U7O A;  4PL9 A;  4FCQ A;  2YI6 A;  2VCJ A;  4XE2 A;  1U0Z A;  4MP7 A;  2XX4 A;  1TC6 A;  3R4P A;  1GKX A;  2FWY A;  3TZ5 A;  4U93 A;  1Y4U A;  3B25 A;  2YEI A;  4BIU A;  3HZ5 A;  1AH6 A;  5M4H A;  2CCT A;  2FWZ A;  5BOC A;  5M4P A;  4LWG A;  4XTJ A;  2BZ5 A;  3A0R A;  4EGK A;  4CWO A;  3INW A;  4CWR A;  5CPH A;  3O2F A;  3EKR A;  1YET A;  2EXL A;  4CWP A;  2WI5 A;  2YEC A;  4L90 A;  2BU8 A;  2H8M A;  1Y4S A;  5M4E A;  2O1U A;  2YK9 A;  2ZBK B;  4H85 A;  1Z5B A;  2O1W A;  4MPE A;  2YI7 A;  4MP2 A;  5CTU A;  4E00 A;  3TTZ A;  5IDM A;  2QF6 A;  4QPK A;  4GQT A;  4YKZ A;  4HY6 A;  3A0X A;  3FT5 A;  5J71 A;  5F5R A;  2XHX A;  2GFD A;  3D0B A;  2K5B A;  4YKQ A;  3R4O A;  2YE3 A;  4H7Q A;  3EHF A;  4R3A A;  3A0W A;  4U7N A;  4O07 A;  2Q8I A;  1I5A A;  4O05 A;  4BXI A;  1H7S A;  5M4N A;  4YKX A;  4XC0 A;  1UYK A;  3CGY A;  1BYQ A;  1UYE A;  3EHJ A;  4BQG A;  3A0Y A;  4V25 A;  3MNR P;  2ZDY A;  2UWD A;  1I58 A;  2YGF A;  2YGE A;  4JAS A;  4YKT A;  2YKC A;  2PNR A;  4FCR A;  2XJG A;  2HKJ A;  4ASG A;  3WHA A;  1TH8 A;  3T1K A;  2YEA A;  1Z5A A;  4I5S A;  2WER A;  4XIQ A;  4XKO A;  2BSM A;  2XDU A;  1TC0 A;  2WI7 A;  2Q8G A;  3KE6 A;  4P7A A;  2BT0 A;  4XIP A;  4AS9 A;  2IWX A;  2JJC A;  2YJX A;  4JQL A;  4KP4 A;  3OWB A;  5FWK A;  2YE8 A;  4YKW A;  4WUC A;  2BRC A;  3CGZ A;  2BYI A;  1YSR A;  2XHR A;  3RLQ A;  2QG2 A;  4JAU A;  3U2K A;  4L93 A;  3OPD A;  4LPB A;  2WI4 A;  5FND A;  4CWQ A;  1A4H A;  2IOP A;  1US7 A;  5FNF A;  2YI5 A;  4LWE A;  4PRV A;  4E01 A;  2BU5 A;  4HYP A;  1TIL A;  5IDJ A;  3G7E A;  4AWP A;  4DZY A;  2QG0 A;  4I3H A;  4EM7 A;  3CRK A;  2Q8F A;  3O0I A;  2C2A A;  1YC4 A;  2BTZ A;  3HZ1 A;  5CTW A;  2XDL A;  1UYH A;  3INX A;  3BM9 A;  2QFO A;  4DUH A;  4LP0 A;  5C93 A;  2ZKJ A;  1AMW A;  4MBC A;  1UYL A;  4MOT A;  1UYG A;  3OWD A;  1BXD A;  4MB9 A;  1S14 A;  4XKA A;  4CWS A;  2YEE A;  3C11 A;  4URN A;  2VCI A;  3Q5L A;  3K98 A;  3RLR A;  4FMT A;  4AWQ A;  2O1V A;  2YEJ A;  2FYP A;  2ESA A;  1ZXM A;  4K4O A;  1YC1 A;  1UYF A;  2YE7 A;  5D7R A;  3K97 A;  3FT8 A;  4YKY A;  4KTN A;  2BYH A;  3BMY A;  4GT8 A;  2WI3 A;  2IOQ A;  2JKI A;  1I59 A;  2XDK A;  3EHG A;  1UY8 A;  2GQP A;  1UY7 A;  4LWH A;  3D36 A;  5CF0 A;  4MPC A;  5D6P A;  1OSF A;  5M4K A;  1I5C A;  2YKJ A;  4ZKI A;  5FNC A;  4NH8 A;  1Z5C A;  4EMV A;  1UY6 A;  1Y8N A;  1QZR A;  2CCS A;  5L3J A;  3U67 A;  2YEB A;  1Y8O A;  1UYC A;  4CWN A;  1THN A;  4GFN A;  2CG9 A;  2CGF A;  2WEQ A;  4YKU A;  1YT0 A;  3TZ4 A;  3H4L A;  4EFU A;  3GIE A;  5J6A A;  3K60 A;  3OMU A;  1ZWH A;  3R92 A;  3VAD A;  4BAE A;  1H7U A;  2YEH A;  3R4M A;  3FV5 A;  1YER A;  4AWO A;  2WEP A;  3EHH A;  3NMQ A;  2E0A A;  2HG1 A;  5D7C A;  4L94 A;  4URL A;  4X9L A;  1GJV A;  5F3K A;  3QDD A;  3Q5J A;  4GEE A;  4NH7 A;  3VHC A;  2IWU A;  4O0B A;  3PEJ A;  1ZW9 A;  2YGA A;  2YK2 A;  3TUH A;  2IWS A;  1YES A;  4YKR A;  4GCZ A;  1S16 A;  1KIJ A;  4LWF A;  1AH8 A;  2YE4 A;  3G75 A;  4O09 A;  4HZ5 A;  2ZDX A;  4XCL A;  3OW6 A;  4QPJ A;  2XCM A;  2FXS A;  1MX0 A;  1EA6 A;  3D2R A;  4V26 A;  4CWT A;  3HYZ A;  4WUB A;  4EGI A;  3HHU A;  1JM6 A;  3RLP A;  4EGH A;  2YKE A;  3C0E A;  2YEG A;  5BOD A;  3HEK A;  4LWI A;  4Q20 A;  4P8O A;  4XDM A;  2YED A;  4ASB A;  1QYE A;  3O6O A;  1NHH A;  4L91 A;  3LPS A;  2HCH A;  4GGL A;  5CTX A;  2VWC A;  4XIR A;  4HXW A;  1YT2 A;  2XK2 A;  4KSG A;  4B7P A;  4CE3 A;  3GIG A;  2BU7 A;  2XJJ A;  4URM A;  4URO A;  2BRE A;  2XX2 A;  2XD6 A;  2AKP A;  2XAB A;  4MPN A;  3T0H A;  1UYM A;  1YS3 A;  3JZ3 A;  1GKZ A;  4ASF A;  3H80 A;  1ZXN A;  3K99 A;  5M4M A;  3GIG B;  4EFT A;  2XDS A;  1B3Q A;  2WI2 A;  3VHA A;  1EI1 A;  4KSH A;  3B27 A;  3ZKD A;  5GGZ A;  4ASA A;  5D7D A;  4BQJ A;  2YKB A;  1I5D A;  2CH4 A;  3Q5K A;  4E02 A;  4XCJ A;  3ZKB A;  1PVG A;  2YI0 A;  1AJ6 A;  3T10 A;  3R4N A;  4HXZ A;  1YC3 A;  4XKK A;  4ZVI A;  4R3M A;  2YE2 A;  3G7B A;  1U2O A;  2YE6 A;  4H81 A;  1BKN A;  4R1F A;  3T2S A;  3U2D A;  1Y8P A;  4PU9 A;  3VHD A;  2WI1 A;  3B28 A;  3WQ9 A;  4WUD A;  3A0T A;  3SL2 A;  1KZN A;  4KQV A;  1UYD A;  2CCU A;  4PRX A;  2XHT A;  3IED A;  1ID0 A;  3ZM7 A;  1Z59 A;  4HZ0 A;  3DGE A;  3TZ2 A;  4CE1 A;  3RKZ A;  4FCP A;  4B6C A;  5CTY A;  4XD8 A;  3CWV A;  4W7T A;  1QY8 A;  3B24 A;  3ZXO A;  1TID A;  3T0Z A; 
#chains in the Genus database with same CATH topology
 2XDX A;  4CE2 A;  3LNU A;  3LMM A;  2Q2E B;  1TBW A;  2YJW A;  4L8Z A;  3A0Z A;  1YT1 A;  1B63 A;  2Q8H A;  1NHJ A;  4CWF A;  3EKO A;  4EEH A;  2IOR A;  4HY1 A;  3TZ0 A;  4JAV A;  1YSZ A;  2YKI A;  2H55 A;  2YE9 A;  5IN9 A;  4NH9 A;  3QTF A;  1AM1 A;  4KFG A;  4O04 A;  2BU2 A;  3CRL A;  2WI6 A;  4BIZ A;  1B62 A;  3HYY A;  2VW5 A;  3PEH A;  4HYM A;  5D6Q A;  1L0O A;  3R91 A;  2BU6 A;  2YEF A;  3ZXQ A;  1NHI A;  2YE5 A;  1UYI A;  3B26 A;  1UY9 A;  1BGQ A;  4XIT A;  2XJX A;  1I5B A;  1R62 A;  2XX5 A;  4FPP A;  3GIF A;  1MU5 A;  4U7O A;  4PL9 A;  4E72 A;  4FCQ A;  2YI6 A;  2VCJ A;  4XE2 A;  1U0Z A;  4MP7 A;  2XX4 A;  1TC6 A;  3R4P A;  1GKX A;  2C1I A;  2FWY A;  3TZ5 A;  4U93 A;  1Y4U A;  3B25 A;  2YEI A;  4BIU A;  3HZ5 A;  1AH6 A;  5M4H A;  2CCT A;  2FWZ A;  5BOC A;  5M4P A;  4LWG A;  4XTJ A;  2BZ5 A;  3A0R A;  4EGK A;  4CWO A;  3INW A;  4CWR A;  5CPH A;  3O2F A;  3EKR A;  1YET A;  2EXL A;  4CWP A;  2WI5 A;  2YEC A;  4L90 A;  2BU8 A;  2H8M A;  1Y4S A;  5M4E A;  2O1U A;  2YK9 A;  2ZBK B;  4H85 A;  1Z5B A;  2O1W A;  4MPE A;  2YI7 A;  4MP2 A;  5CTU A;  4E00 A;  3TTZ A;  5IDM A;  2QF6 A;  4QPK A;  4GQT A;  4YKZ A;  4HY6 A;  3A0X A;  3FT5 A;  5J71 A;  5F5R A;  2XHX A;  2GFD A;  3D0B A;  2K5B A;  4YKQ A;  3R4O A;  2YE3 A;  4H7Q A;  3EHF A;  4R3A A;  3A0W A;  4U7N A;  4O07 A;  2Q8I A;  1I5A A;  4O05 A;  4BXI A;  1H7S A;  5M4N A;  4YKX A;  4XC0 A;  1UYK A;  3CGY A;  1BYQ A;  1UYE A;  3EHJ A;  4BQG A;  3CYG A;  3A0Y A;  4V25 A;  3MNR P;  2ZDY A;  2UWD A;  1I58 A;  2YGF A;  2YGE A;  4JAS A;  4YKT A;  2YKC A;  2PNR A;  4FCR A;  2XJG A;  2HKJ A;  4ASG A;  3WHA A;  1TH8 A;  3T1K A;  2YEA A;  1Z5A A;  4I5S A;  2WER A;  4XIQ A;  4XKO A;  2BSM A;  2XDU A;  1TC0 A;  2WI7 A;  2Q8G A;  3KE6 A;  4P7A A;  2BT0 A;  4XIP A;  4AS9 A;  2IWX A;  2JJC A;  2YJX A;  4JQL A;  4KP4 A;  3OWB A;  5FWK A;  2YE8 A;  4YKW A;  4WUC A;  2BRC A;  3CGZ A;  2BYI A;  1YSR A;  2XHR A;  3RLQ A;  2QG2 A;  4JAU A;  3U2K A;  4L93 A;  3OPD A;  4LPB A;  2WI4 A;  5FND A;  4CWQ A;  1A4H A;  2IOP A;  1US7 A;  5FNF A;  2YI5 A;  4LWE A;  4PRV A;  4E01 A;  2BU5 A;  4HYP A;  1TIL A;  5IDJ A;  3G7E A;  4AWP A;  4DZY A;  3S5T A;  2QG0 A;  4I3H A;  4EM7 A;  3CRK A;  2Q8F A;  3O0I A;  2C2A A;  1YC4 A;  2BTZ A;  3HZ1 A;  5CTW A;  2XDL A;  1UYH A;  3INX A;  3BM9 A;  2QFO A;  4DUH A;  4LP0 A;  5C93 A;  2ZKJ A;  1AMW A;  4MBC A;  1UYL A;  4MOT A;  1UYG A;  3OWD A;  1BXD A;  4MB9 A;  1S14 A;  4XKA A;  4CWS A;  2YEE A;  3C11 A;  4URN A;  2VCI A;  3Q5L A;  3K98 A;  3RLR A;  4FMT A;  4AWQ A;  2O1V A;  2YEJ A;  2FYP A;  2ESA A;  1ZXM A;  4K4O A;  1YC1 A;  1UYF A;  2YE7 A;  5D7R A;  3K97 A;  3FT8 A;  4YKY A;  4KTN A;  2BYH A;  3BMY A;  4GT8 A;  2WI3 A;  2IOQ A;  2JKI A;  1I59 A;  2XDK A;  3EHG A;  1UY8 A;  2GQP A;  1UY7 A;  4LWH A;  3D36 A;  5CF0 A;  4MPC A;  5D6P A;  1OSF A;  5M4K A;  1I5C A;  2YKJ A;  4ZKI A;  5FNC A;  4NH8 A;  1Z5C A;  4EMV A;  1UY6 A;  1Y8N A;  1QZR A;  2CCS A;  5L3J A;  3U67 A;  2YEB A;  1Y8O A;  1UYC A;  4CWN A;  1THN A;  4GFN A;  2CG9 A;  2CGF A;  2WEQ A;  4YKU A;  1YT0 A;  3TZ4 A;  3H4L A;  4EFU A;  3GIE A;  5J6A A;  3K60 A;  3OMU A;  1ZWH A;  3R92 A;  3VAD A;  4BAE A;  1H7U A;  2YEH A;  3R4M A;  3FV5 A;  1YER A;  4AWO A;  2WEP A;  3EHH A;  3NMQ A;  2E0A A;  2HG1 A;  5D7C A;  4L94 A;  4URL A;  4X9L A;  1GJV A;  5F3K A;  3QDD A;  3Q5J A;  4GEE A;  4NH7 A;  3VHC A;  2IWU A;  4O0B A;  3PEJ A;  1ZW9 A;  2YGA A;  2YK2 A;  2HHI A;  3TUH A;  2IWS A;  1YES A;  4YKR A;  4GCZ A;  1S16 A;  1KIJ A;  4LWF A;  1AH8 A;  2YE4 A;  3G75 A;  4O09 A;  4HZ5 A;  2ZDX A;  4XCL A;  3OW6 A;  4QPJ A;  2XCM A;  2FXS A;  1MX0 A;  1F51 A;  1EA6 A;  3D2R A;  4V26 A;  2C1G A;  4CWT A;  3HYZ A;  4WUB A;  4EGI A;  3HHU A;  1JM6 A;  3RLP A;  4EGH A;  2YKE A;  3C0E A;  2YEG A;  5BOD A;  3HEK A;  4LWI A;  4Q20 A;  4P8O A;  4XDM A;  2YED A;  4ASB A;  1QYE A;  3O6O A;  1NHH A;  4L91 A;  1IXM A;  3LPS A;  2HCH A;  2FTK A;  4GGL A;  5CTX A;  2VWC A;  4XIR A;  4HXW A;  1YT2 A;  2XK2 A;  4KSG A;  4B7P A;  4CE3 A;  3GIG A;  2BU7 A;  2XJJ A;  4URM A;  4URO A;  2BRE A;  2XX2 A;  2XD6 A;  2AKP A;  2XAB A;  4MPN A;  3T0H A;  1UYM A;  1YS3 A;  3JZ3 A;  1GKZ A;  4ASF A;  3H80 A;  1ZXN A;  3K99 A;  5M4M A;  3GIG B;  4EFT A;  2XDS A;  1B3Q A;  2WI2 A;  3VHA A;  1EI1 A;  4KSH A;  3B27 A;  3ZKD A;  5GGZ A;  4ASA A;  5D7D A;  4BQJ A;  2YKB A;  1I5D A;  2CH4 A;  3Q5K A;  4E02 A;  4XCJ A;  3ZKB A;  1PVG A;  2YI0 A;  1AJ6 A;  3T10 A;  3R4N A;  4HXZ A;  1YC3 A;  4XKK A;  4ZVI A;  4R3M A;  2YE2 A;  3G7B A;  1U2O A;  2YE6 A;  4H81 A;  1BKN A;  4R1F A;  3T2S A;  3U2D A;  1Y8P A;  5JEN A;  4PU9 A;  3VHD A;  2WI1 A;  3B28 A;  3WQ9 A;  4WUD A;  3A0T A;  3SL2 A;  1KZN A;  4KQV A;  1UYD A;  2CCU A;  4PRX A;  2XHT A;  3IED A;  1ID0 A;  3ZM7 A;  1Z59 A;  4HZ0 A;  3DGE A;  3TZ2 A;  4CE1 A;  3RKZ A;  4FCP A;  4B6C A;  5CTY A;  4XD8 A;  3CWV A;  4W7T A;  1QY8 A;  3B24 A;  3ZXO A;  1TID A;  3T0Z A; 
#chains in the Genus database with same CATH homology
 2XDX A;  4CE2 A;  3LNU A;  2Q2E B;  1TBW A;  2YJW A;  4L8Z A;  3A0Z A;  1YT1 A;  1B63 A;  2Q8H A;  1NHJ A;  4CWF A;  3EKO A;  4EEH A;  2IOR A;  4HY1 A;  3TZ0 A;  4JAV A;  1YSZ A;  2YKI A;  2H55 A;  2YE9 A;  5IN9 A;  4NH9 A;  3QTF A;  1AM1 A;  4KFG A;  4O04 A;  2BU2 A;  3CRL A;  2WI6 A;  4BIZ A;  1B62 A;  3HYY A;  2VW5 A;  3PEH A;  4HYM A;  5D6Q A;  1L0O A;  3R91 A;  2BU6 A;  2YEF A;  3ZXQ A;  1NHI A;  2YE5 A;  1UYI A;  3B26 A;  1UY9 A;  1BGQ A;  4XIT A;  2XJX A;  1I5B A;  1R62 A;  2XX5 A;  4FPP A;  3GIF A;  1MU5 A;  4U7O A;  4PL9 A;  4FCQ A;  2YI6 A;  2VCJ A;  4XE2 A;  1U0Z A;  4MP7 A;  2XX4 A;  1TC6 A;  3R4P A;  1GKX A;  2FWY A;  3TZ5 A;  4U93 A;  1Y4U A;  3B25 A;  2YEI A;  4BIU A;  3HZ5 A;  1AH6 A;  5M4H A;  2CCT A;  2FWZ A;  5BOC A;  5M4P A;  4LWG A;  4XTJ A;  2BZ5 A;  3A0R A;  4EGK A;  4CWO A;  3INW A;  4CWR A;  5CPH A;  3O2F A;  3EKR A;  1YET A;  2EXL A;  4CWP A;  2WI5 A;  2YEC A;  4L90 A;  2BU8 A;  2H8M A;  1Y4S A;  5M4E A;  2O1U A;  2YK9 A;  2ZBK B;  4H85 A;  1Z5B A;  2O1W A;  4MPE A;  2YI7 A;  4MP2 A;  5CTU A;  4E00 A;  3TTZ A;  5IDM A;  2QF6 A;  4QPK A;  4GQT A;  4YKZ A;  4HY6 A;  3A0X A;  3FT5 A;  5J71 A;  5F5R A;  2XHX A;  2GFD A;  3D0B A;  2K5B A;  4YKQ A;  3R4O A;  2YE3 A;  4H7Q A;  3EHF A;  4R3A A;  3A0W A;  4U7N A;  4O07 A;  2Q8I A;  1I5A A;  4O05 A;  4BXI A;  1H7S A;  5M4N A;  4YKX A;  4XC0 A;  1UYK A;  3CGY A;  1BYQ A;  1UYE A;  3EHJ A;  4BQG A;  3A0Y A;  4V25 A;  3MNR P;  2ZDY A;  2UWD A;  1I58 A;  2YGF A;  2YGE A;  4JAS A;  4YKT A;  2YKC A;  2PNR A;  4FCR A;  2XJG A;  2HKJ A;  4ASG A;  3WHA A;  1TH8 A;  3T1K A;  2YEA A;  1Z5A A;  4I5S A;  2WER A;  4XIQ A;  4XKO A;  2BSM A;  2XDU A;  1TC0 A;  2WI7 A;  2Q8G A;  3KE6 A;  4P7A A;  2BT0 A;  4XIP A;  4AS9 A;  2IWX A;  2JJC A;  2YJX A;  4JQL A;  4KP4 A;  3OWB A;  5FWK A;  2YE8 A;  4YKW A;  4WUC A;  2BRC A;  3CGZ A;  2BYI A;  1YSR A;  2XHR A;  3RLQ A;  2QG2 A;  4JAU A;  3U2K A;  4L93 A;  3OPD A;  4LPB A;  2WI4 A;  5FND A;  4CWQ A;  1A4H A;  2IOP A;  1US7 A;  5FNF A;  2YI5 A;  4LWE A;  4PRV A;  4E01 A;  2BU5 A;  4HYP A;  1TIL A;  5IDJ A;  3G7E A;  4AWP A;  4DZY A;  2QG0 A;  4I3H A;  4EM7 A;  3CRK A;  2Q8F A;  3O0I A;  2C2A A;  1YC4 A;  2BTZ A;  3HZ1 A;  5CTW A;  2XDL A;  1UYH A;  3INX A;  3BM9 A;  2QFO A;  4DUH A;  4LP0 A;  5C93 A;  2ZKJ A;  1AMW A;  4MBC A;  1UYL A;  4MOT A;  1UYG A;  3OWD A;  1BXD A;  4MB9 A;  1S14 A;  4XKA A;  4CWS A;  2YEE A;  3C11 A;  4URN A;  2VCI A;  3Q5L A;  3K98 A;  3RLR A;  4FMT A;  4AWQ A;  2O1V A;  2YEJ A;  2FYP A;  2ESA A;  1ZXM A;  4K4O A;  1YC1 A;  1UYF A;  2YE7 A;  5D7R A;  3K97 A;  3FT8 A;  4YKY A;  4KTN A;  2BYH A;  3BMY A;  4GT8 A;  2WI3 A;  2IOQ A;  2JKI A;  1I59 A;  2XDK A;  3EHG A;  1UY8 A;  2GQP A;  1UY7 A;  4LWH A;  3D36 A;  5CF0 A;  4MPC A;  5D6P A;  1OSF A;  5M4K A;  1I5C A;  2YKJ A;  4ZKI A;  5FNC A;  4NH8 A;  1Z5C A;  4EMV A;  1UY6 A;  1Y8N A;  1QZR A;  2CCS A;  5L3J A;  3U67 A;  2YEB A;  1Y8O A;  1UYC A;  4CWN A;  1THN A;  4GFN A;  2CG9 A;  2CGF A;  2WEQ A;  4YKU A;  1YT0 A;  3TZ4 A;  3H4L A;  4EFU A;  3GIE A;  5J6A A;  3K60 A;  3OMU A;  1ZWH A;  3R92 A;  3VAD A;  4BAE A;  1H7U A;  2YEH A;  3R4M A;  3FV5 A;  1YER A;  4AWO A;  2WEP A;  3EHH A;  3NMQ A;  2E0A A;  2HG1 A;  5D7C A;  4L94 A;  4URL A;  4X9L A;  1GJV A;  5F3K A;  3QDD A;  3Q5J A;  4GEE A;  4NH7 A;  3VHC A;  2IWU A;  4O0B A;  3PEJ A;  1ZW9 A;  2YGA A;  2YK2 A;  3TUH A;  2IWS A;  1YES A;  4YKR A;  4GCZ A;  1S16 A;  1KIJ A;  4LWF A;  1AH8 A;  2YE4 A;  3G75 A;  4O09 A;  4HZ5 A;  2ZDX A;  4XCL A;  3OW6 A;  4QPJ A;  2XCM A;  2FXS A;  1MX0 A;  1EA6 A;  3D2R A;  4V26 A;  4CWT A;  3HYZ A;  4WUB A;  4EGI A;  3HHU A;  1JM6 A;  3RLP A;  4EGH A;  2YKE A;  3C0E A;  2YEG A;  5BOD A;  3HEK A;  4LWI A;  4Q20 A;  4P8O A;  4XDM A;  2YED A;  4ASB A;  1QYE A;  3O6O A;  1NHH A;  4L91 A;  3LPS A;  2HCH A;  4GGL A;  5CTX A;  2VWC A;  4XIR A;  4HXW A;  1YT2 A;  2XK2 A;  4KSG A;  4B7P A;  4CE3 A;  3GIG A;  2BU7 A;  2XJJ A;  4URM A;  4URO A;  2BRE A;  2XX2 A;  2XD6 A;  2AKP A;  2XAB A;  4MPN A;  3T0H A;  1UYM A;  1YS3 A;  3JZ3 A;  1GKZ A;  4ASF A;  3H80 A;  1ZXN A;  3K99 A;  5M4M A;  3GIG B;  4EFT A;  2XDS A;  1B3Q A;  2WI2 A;  3VHA A;  1EI1 A;  4KSH A;  3B27 A;  3ZKD A;  5GGZ A;  4ASA A;  5D7D A;  4BQJ A;  2YKB A;  1I5D A;  2CH4 A;  3Q5K A;  4E02 A;  4XCJ A;  3ZKB A;  1PVG A;  2YI0 A;  1AJ6 A;  3T10 A;  3R4N A;  4HXZ A;  1YC3 A;  4XKK A;  4ZVI A;  4R3M A;  2YE2 A;  3G7B A;  1U2O A;  2YE6 A;  4H81 A;  1BKN A;  4R1F A;  3T2S A;  3U2D A;  1Y8P A;  4PU9 A;  3VHD A;  2WI1 A;  3B28 A;  3WQ9 A;  4WUD A;  3A0T A;  3SL2 A;  1KZN A;  4KQV A;  1UYD A;  2CCU A;  4PRX A;  2XHT A;  3IED A;  1ID0 A;  3ZM7 A;  1Z59 A;  4HZ0 A;  3DGE A;  3TZ2 A;  4CE1 A;  3RKZ A;  4FCP A;  4B6C A;  5CTY A;  4XD8 A;  3CWV A;  4W7T A;  1QY8 A;  3B24 A;  3ZXO A;  1TID A;  3T0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...