5CTYA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
publication title Fragment-based discovery of DNA gyrase inhibitors targeting the ATPase subunit of GyrB.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 65
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5ctyA00
1YSRA 4XKAA 1NHHA 3JZ3A 2XJJA 1B62A 1QZRA 1B3QA 1Y4SA 2AKPA 2QG2A 5F5RA 1YESA 2ZBKB 4V25A 2BYIA 1YERA 1Y8OA 1UYMA 4URMA 4DUHA 2Q8IA 4PRVA 1YT0A 4AWOA 3ZKDA 2CCSA 1THNA 2WI2A 2QF6A 3TZ0A 4FCPA 4B6CA 4GQTA 3OPDA 1UY7A 4WUDA 3B28A 1TBWA 2XX5A 5J71A 2YEIA 4LP0A 2GQPA 3HYYA 5IDMA 3RLRA 1UYGA 1ZXNA 5CTXA 4AWQA 2GFDA 1TIDA 3HEKA 2BU5A 1OSFA 3VHDA 3CRLA 4KSGA 4H85A 4URLA 2YEDA 1Z5CA 2IWSA 3NMQA 3Q5JA 1TC6A 3A0ZA 4ASBA 2QG0A 4MP2A 3R4NA 2YEBA 3B27A 3OMUA 3FV5A 1UY6A 3T1KA 1MX0A 1TH8A 3B26A 1NHJA 1I5AA 4PL9A 2YI6A 4XITA 3HYZA 1YC3A 3RLQA 4HY6A 1UYHA 3GIEA 2WEPA 3G75A 3CRKA 2HKJA 4ZKIA 2JJCA 1GKXA 2IOQA 4I5SA 2XJGA 4K4OA 3A0YA 2Q8HA 1BXDA 3WQ9A 4E01A 3TTZA 3C11A 1AM1A 4EEHA 5IDJA 1L0OA 1EI1A 2CCUA 1BKNA 1R62A 2BTZA 3U2KA 4XCJA 1Y8PA 2IWXA 4XC0A 4MOTA 5D7DA 4E00A 2YJWA 5F3KA 1UYDA 5M4KA 4BIZA 1S14A 2Q2EB 2XHXA 3OWBA 5FWKA 3R4PA 1NHIA 2VWCA 4MPNA 3K98A 4DZYA 4GGLA 2PNRA 1BYQA 2EXLA 2K5BA 5M4EA 3U67A 1US7A 2XHTA 2ESAA 2YKBA 4WUBA 4NH9A 4MP7A 3SL2A 4JASA 2VCIA 2WI4A 2WI5A 4CE3A 4YKYA 2XDLA 2FWZA 3B25A 2IWUA 3KE6A 2YE6A 2YEHA 2XJXA 2YE5A 5CTYA 3TZ5A 2BYHA 1I5BA 4O04A 2VCJA 3R91A 1AH8A 4O05A 1A4HA 4HY1A 4LWGA 4HZ5A 2BRCA 2YE7A 5CTUA 3EHGA 3EHHA 4CWOA 5J6AA 3CGZA 2YE8A 4CWTA 3GIFA 4JAVA 2YE9A 3LNUA 1I5DA 1UY9A 3VHAA 3K99A 1B63A 2XCMA 5M4NA 3T0HA 4BAEA 3ZM7A 2XDXA 1H7UA 4H7QA 2H55A 3FT5A 2BU8A 2FWYA 2YEJA 2YEFA 3RKZA 2ZKJA 4P8OA 4W7TA 1KIJA 4YKZA 3TZ2A 3GIGA 2O1VA 3HZ5A 2YE2A 3O6OA 5D6PA 1AJ6A 2FYPA 1H7SA 5L3JA 4JQLA 2CGFA 3EHJA 1UYKA 4XE2A 4ASFA 4BIUA 4P7AA 3ZXOA 3BMYA 3T10A 1GKZA 3H80A 2O1WA 3PEJA 4LWHA 4NH7A 3QTFA 4U7OA 4BQGA 3T0ZA 2Q8GA 1PVGA 5C93A 4JAUA 4YKXA 1S16A 4HYPA 3LPSA 3D2RA 3QDDA 2IOPA 1UYLA 4U7NA 4GCZA 4MPCA 4ASAA 1YC1A 1BGQA 2CCTA 3Q5KA 4CWNA 3ZXQA 4MPEA 3ZKBA 2Q8FA 4CWPA 2YE4A 4EGIA 2ZDXA 1Y8NA 1Z5AA 1TC0A 3FT8A 2YK2A 4MB9A 2FXSA 5FNDA 4XKKA 3BM9A 2XK2A 3A0WA 4HXWA 3EKOA 5M4PA 4XKOA 3B24A 1YS3A 2YGFA 1I5CA 3HHUA 2C2AA 4HYMA 4R3AA 2YI0A 4FCQA 3TUHA 5IN9A 3PEHA 4XTJA 5M4MA 1QYEA 1UYIA 4YKQA 4ASGA 2BU2A 2BREA 2IORA 4FPPA 4EFUA 2O1UA 2YJXA 3OW6A 2VW5A 1ZXMA 4Q20A 4EMVA 4PU9A 1JM6A 2CG9A 2XX2A 2XX4A 2BT0A 1AH6A 4X9LA 4QPJA 1YC4A 4HXZA 4LPBA 2YEEA 1ZWHA 3G7EA 2E0AA 1ID0A 5CPHA 3Q5LA 4ZVIA 2YGAA 4YKWA 1Z59A 3HZ1A 4L90A 3INWA 4EGHA 1YT2A 2YECA 4O07A 2UWDA 1YSZA 3C0EA 2HG1A 5D7CA 3A0RA 2BU7A 2YKEA 4L94A 4CE2A 4KQVA 1Y4UA 2ZDYA 4FCRA 1I58A 1EA6A 1YT1A 3R92A 3U2DA 1AMWA 4KP4A 3TZ4A 1TILA 5D6QA 3K97A 4MBCA 2WI7A 4EFTA 2XHRA 3T2SA 2BU6A 3R4OA 3VHCA 1QY8A 2BSMA 4NH8A 4L8ZA 5D7RA 4EGKA 2YKJA 4FMTA 4URNA 1I59A 4UROA 4YKRA 4LWIA 5GGZA 3CWVA 2YE3A 4GFNA 3EKRA 4XD8A 5FNFA 2H8MA 1UY8A 3A0XA 4PRXA 4LWFA 2WEQA 3O0IA 4U93A 2YKIA 4L91A 4CWFA 3GIGB 3A0TA 4KFGA 3EHFA 4V26A 2XDUA 5M4HA 4WUCA 5FNCA 1Z5BA 3WHAA 2WI6A 2YKCA 3H4LA 1GJVA 4AS9A 3RLPA 2WERA 1YETA 2CH4A 4I3HA 4EM7A 1MU5A 3CGYA 1U2OA 4R3MA 2YI7A 1UYFA 4HZ0A 2YK9A 4O0BA 5BODA 4GEEA 3G7BA 4E02A 2XDSA 2YEGA 2JKIA 2YEAA 5CF0A 1UYEA 4AWPA 4GT8A 2YGEA 1KZNA 4XIRA 2WI3A 3IEDA 2XABA 2BZ5A 4XCLA 4XIQA 4BQJA 4O09A 3R4MA 4CWRA 4H81A 2HCHA 3OWDA 4BXIA 3K60A 4CE1A 1ZW9A 4YKUA 5CTWA 4KSHA 4QPKA 2XDKA 4R1FA 3MNRP 3INXA 2WI1A 2YI5A 1UYCA 4XIPA 5BOCA 4CWQA 2QFOA 4YKTA 3VADA 4KTNA 1U0ZA 3D0BA 4L93A 4XDMA 4LWEA 4B7PA 3D36A 4CWSA 2XD6A 3DGEA 3O2FA
chains in the Genus database with same CATH superfamily
1YSRA 4XKAA 1NHHA 3JZ3A 2XJJA 1B62A 1QZRA 1B3QA 1Y4SA 2AKPA 2QG2A 5F5RA 1YESA 2ZBKB 4V25A 2BYIA 1YERA 1Y8OA 1UYMA 4URMA 4DUHA 2Q8IA 4PRVA 1YT0A 4AWOA 3ZKDA 2CCSA 1THNA 2WI2A 2QF6A 3TZ0A 4FCPA 4B6CA 4GQTA 3OPDA 1UY7A 4WUDA 3B28A 1TBWA 2XX5A 5J71A 2YEIA 4LP0A 2GQPA 3HYYA 5IDMA 3RLRA 1UYGA 1ZXNA 5CTXA 4AWQA 2GFDA 1TIDA 3HEKA 2BU5A 1OSFA 3VHDA 3CRLA 4KSGA 4H85A 4URLA 2YEDA 1Z5CA 2IWSA 3NMQA 3Q5JA 1TC6A 3A0ZA 4ASBA 2QG0A 4MP2A 3R4NA 2YEBA 3B27A 3OMUA 3FV5A 1UY6A 3T1KA 1MX0A 1TH8A 3B26A 1NHJA 1I5AA 4PL9A 2YI6A 4XITA 3HYZA 1YC3A 3RLQA 4HY6A 1UYHA 3GIEA 2WEPA 3G75A 3CRKA 2HKJA 4ZKIA 2JJCA 1GKXA 2IOQA 4I5SA 2XJGA 4K4OA 3A0YA 2Q8HA 1BXDA 3WQ9A 4E01A 3TTZA 3C11A 1AM1A 4EEHA 5IDJA 1L0OA 2FTKA 1EI1A 2CCUA 1BKNA 1R62A 2BTZA 3U2KA 4XCJA 1F51A 1Y8PA 2IWXA 4XC0A 4MOTA 5D7DA 4E00A 2YJWA 5F3KA 1UYDA 5M4KA 4BIZA 1S14A 2Q2EB 2XHXA 1IXMA 3OWBA 5FWKA 3R4PA 1NHIA 2VWCA 4MPNA 3K98A 4DZYA 4GGLA 2PNRA 1BYQA 2EXLA 2K5BA 5M4EA 3U67A 1US7A 2XHTA 2ESAA 2YKBA 4WUBA 3S5TA 4NH9A 4MP7A 3SL2A 4JASA 2VCIA 2WI4A 2WI5A 4CE3A 4YKYA 2XDLA 3LMMA 2FWZA 3B25A 2IWUA 3KE6A 2YE6A 2YEHA 2XJXA 2YE5A 5CTYA 3TZ5A 2BYHA 1I5BA 4O04A 2VCJA 3R91A 1AH8A 4O05A 1A4HA 4HY1A 4LWGA 4HZ5A 2BRCA 2YE7A 5CTUA 3EHGA 3EHHA 4CWOA 5J6AA 3CGZA 2YE8A 4CWTA 3GIFA 4JAVA 2YE9A 3LNUA 1I5DA 1UY9A 3VHAA 3K99A 1B63A 2XCMA 5M4NA 3T0HA 4BAEA 3ZM7A 2XDXA 1H7UA 4H7QA 2H55A 3FT5A 2BU8A 2FWYA 2YEJA 2YEFA 3RKZA 2ZKJA 4P8OA 4W7TA 1KIJA 4YKZA 3TZ2A 3GIGA 2O1VA 3HZ5A 2YE2A 3O6OA 5D6PA 1AJ6A 2FYPA 1H7SA 5L3JA 4JQLA 2CGFA 3EHJA 1UYKA 4XE2A 4ASFA 4BIUA 4P7AA 3ZXOA 3BMYA 3T10A 1GKZA 3H80A 2O1WA 3PEJA 4LWHA 4NH7A 3QTFA 4U7OA 4BQGA 2HHIA 3T0ZA 2Q8GA 1PVGA 5C93A 4JAUA 4YKXA 1S16A 2C1GA 4HYPA 3LPSA 3D2RA 3QDDA 2IOPA 1UYLA 4U7NA 4GCZA 4MPCA 4ASAA 1YC1A 1BGQA 2CCTA 3Q5KA 4CWNA 3ZXQA 4MPEA 3ZKBA 2Q8FA 4CWPA 2YE4A 4EGIA 2ZDXA 1Y8NA 1Z5AA 1TC0A 3FT8A 2YK2A 4MB9A 2FXSA 5FNDA 4XKKA 3BM9A 2XK2A 3A0WA 4HXWA 3EKOA 5M4PA 4XKOA 3B24A 1YS3A 2YGFA 1I5CA 3HHUA 2C2AA 4HYMA 4R3AA 2YI0A 4FCQA 3TUHA 5IN9A 3PEHA 4XTJA 5M4MA 1QYEA 1UYIA 4YKQA 4ASGA 2BU2A 2BREA 2IORA 4FPPA 4EFUA 2O1UA 2YJXA 5JENA 3OW6A 2VW5A 1ZXMA 4Q20A 4EMVA 4PU9A 1JM6A 2CG9A 2XX2A 2XX4A 2BT0A 1AH6A 4X9LA 4QPJA 1YC4A 4HXZA 4LPBA 2YEEA 1ZWHA 3G7EA 2E0AA 1ID0A 5CPHA 3Q5LA 4ZVIA 2YGAA 4YKWA 1Z59A 3HZ1A 4L90A 3INWA 4EGHA 1YT2A 2YECA 4O07A 2UWDA 1YSZA 3C0EA 2HG1A 4E72A 5D7CA 3A0RA 2BU7A 2YKEA 4L94A 4CE2A 4KQVA 1Y4UA 2ZDYA 4FCRA 1I58A 1EA6A 1YT1A 3R92A 3U2DA 1AMWA 4KP4A 3TZ4A 1TILA 5D6QA 3K97A 4MBCA 2WI7A 4EFTA 2XHRA 3T2SA 3CYGA 2BU6A 3R4OA 3VHCA 1QY8A 2BSMA 4NH8A 4L8ZA 5D7RA 4EGKA 2YKJA 4FMTA 4URNA 1I59A 4UROA 4YKRA 4LWIA 5GGZA 3CWVA 2YE3A 4GFNA 3EKRA 4XD8A 5FNFA 2C1IA 2H8MA 1UY8A 3A0XA 4PRXA 4LWFA 2WEQA 3O0IA 4U93A 2YKIA 4L91A 4CWFA 3GIGB 3A0TA 4KFGA 3EHFA 4V26A 2XDUA 5M4HA 4WUCA 5FNCA 1Z5BA 3WHAA 2WI6A 2YKCA 3H4LA 1GJVA 4AS9A 3RLPA 2WERA 1YETA 2CH4A 4I3HA 4EM7A 1MU5A 3CGYA 1U2OA 4R3MA 2YI7A 1UYFA 4HZ0A 2YK9A 4O0BA 5BODA 4GEEA 3G7BA 4E02A 2XDSA 2YEGA 2JKIA 2YEAA 5CF0A 1UYEA 4AWPA 4GT8A 2YGEA 1KZNA 4XIRA 2WI3A 3IEDA 2XABA 2BZ5A 4XCLA 4XIQA 4BQJA 4O09A 3R4MA 4CWRA 4H81A 2HCHA 3OWDA 4BXIA 3K60A 4CE1A 1ZW9A 4YKUA 5CTWA 4KSHA 4QPKA 2XDKA 4R1FA 3MNRP 3INXA 2WI1A 2YI5A 1UYCA 4XIPA 5BOCA 4CWQA 2QFOA 4YKTA 3VADA 4KTNA 1U0ZA 3D0BA 4L93A 4XDMA 4LWEA 4B7PA 3D36A 4CWSA 2XD6A 3DGEA 3O2FA
chains in the Genus database with same CATH topology
1YSRA 4XKAA 1NHHA 3JZ3A 2XJJA 1B62A 1QZRA 1B3QA 1Y4SA 2AKPA 2QG2A 5F5RA 1YESA 2ZBKB 4V25A 2BYIA 1YERA 1Y8OA 1UYMA 4URMA 4DUHA 2Q8IA 4PRVA 1YT0A 4AWOA 3ZKDA 2CCSA 1THNA 2WI2A 2QF6A 3TZ0A 4FCPA 4B6CA 4GQTA 3OPDA 1UY7A 4WUDA 3B28A 1TBWA 2XX5A 5J71A 2YEIA 4LP0A 2GQPA 3HYYA 5IDMA 3RLRA 1UYGA 1ZXNA 5CTXA 4AWQA 2GFDA 1TIDA 3HEKA 2BU5A 1OSFA 3VHDA 3CRLA 4KSGA 4H85A 4URLA 2YEDA 1Z5CA 2IWSA 3NMQA 3Q5JA 1TC6A 3A0ZA 4ASBA 2QG0A 4MP2A 3R4NA 2YEBA 3B27A 3OMUA 3FV5A 1UY6A 3T1KA 1MX0A 1TH8A 3B26A 1NHJA 1I5AA 4PL9A 2YI6A 4XITA 3HYZA 1YC3A 3RLQA 4HY6A 1UYHA 3GIEA 2WEPA 3G75A 3CRKA 2HKJA 4ZKIA 2JJCA 1GKXA 2IOQA 4I5SA 2XJGA 4K4OA 3A0YA 2Q8HA 1BXDA 3WQ9A 4E01A 3TTZA 3C11A 1AM1A 4EEHA 5IDJA 1L0OA 1EI1A 2CCUA 1BKNA 1R62A 2BTZA 3U2KA 4XCJA 1Y8PA 2IWXA 4XC0A 4MOTA 5D7DA 4E00A 2YJWA 5F3KA 1UYDA 5M4KA 4BIZA 1S14A 2Q2EB 2XHXA 3OWBA 5FWKA 3R4PA 1NHIA 2VWCA 4MPNA 3K98A 4DZYA 4GGLA 2PNRA 1BYQA 2EXLA 2K5BA 5M4EA 3U67A 1US7A 2XHTA 2ESAA 2YKBA 4WUBA 4NH9A 4MP7A 3SL2A 4JASA 2VCIA 2WI4A 2WI5A 4CE3A 4YKYA 2XDLA 2FWZA 3B25A 2IWUA 3KE6A 2YE6A 2YEHA 2XJXA 2YE5A 5CTYA 3TZ5A 2BYHA 1I5BA 4O04A 2VCJA 3R91A 1AH8A 4O05A 1A4HA 4HY1A 4LWGA 4HZ5A 2BRCA 2YE7A 5CTUA 3EHGA 3EHHA 4CWOA 5J6AA 3CGZA 2YE8A 4CWTA 3GIFA 4JAVA 2YE9A 3LNUA 1I5DA 1UY9A 3VHAA 3K99A 1B63A 2XCMA 5M4NA 3T0HA 4BAEA 3ZM7A 2XDXA 1H7UA 4H7QA 2H55A 3FT5A 2BU8A 2FWYA 2YEJA 2YEFA 3RKZA 2ZKJA 4P8OA 4W7TA 1KIJA 4YKZA 3TZ2A 3GIGA 2O1VA 3HZ5A 2YE2A 3O6OA 5D6PA 1AJ6A 2FYPA 1H7SA 5L3JA 4JQLA 2CGFA 3EHJA 1UYKA 4XE2A 4ASFA 4BIUA 4P7AA 3ZXOA 3BMYA 3T10A 1GKZA 3H80A 2O1WA 3PEJA 4LWHA 4NH7A 3QTFA 4U7OA 4BQGA 3T0ZA 2Q8GA 1PVGA 5C93A 4JAUA 4YKXA 1S16A 4HYPA 3LPSA 3D2RA 3QDDA 2IOPA 1UYLA 4U7NA 4GCZA 4MPCA 4ASAA 1YC1A 1BGQA 2CCTA 3Q5KA 4CWNA 3ZXQA 4MPEA 3ZKBA 2Q8FA 4CWPA 2YE4A 4EGIA 2ZDXA 1Y8NA 1Z5AA 1TC0A 3FT8A 2YK2A 4MB9A 2FXSA 5FNDA 4XKKA 3BM9A 2XK2A 3A0WA 4HXWA 3EKOA 5M4PA 4XKOA 3B24A 1YS3A 2YGFA 1I5CA 3HHUA 2C2AA 4HYMA 4R3AA 2YI0A 4FCQA 3TUHA 5IN9A 3PEHA 4XTJA 5M4MA 1QYEA 1UYIA 4YKQA 4ASGA 2BU2A 2BREA 2IORA 4FPPA 4EFUA 2O1UA 2YJXA 3OW6A 2VW5A 1ZXMA 4Q20A 4EMVA 4PU9A 1JM6A 2CG9A 2XX2A 2XX4A 2BT0A 1AH6A 4X9LA 4QPJA 1YC4A 4HXZA 4LPBA 2YEEA 1ZWHA 3G7EA 2E0AA 1ID0A 5CPHA 3Q5LA 4ZVIA 2YGAA 4YKWA 1Z59A 3HZ1A 4L90A 3INWA 4EGHA 1YT2A 2YECA 4O07A 2UWDA 1YSZA 3C0EA 2HG1A 5D7CA 3A0RA 2BU7A 2YKEA 4L94A 4CE2A 4KQVA 1Y4UA 2ZDYA 4FCRA 1I58A 1EA6A 1YT1A 3R92A 3U2DA 1AMWA 4KP4A 3TZ4A 1TILA 5D6QA 3K97A 4MBCA 2WI7A 4EFTA 2XHRA 3T2SA 2BU6A 3R4OA 3VHCA 1QY8A 2BSMA 4NH8A 4L8ZA 5D7RA 4EGKA 2YKJA 4FMTA 4URNA 1I59A 4UROA 4YKRA 4LWIA 5GGZA 3CWVA 2YE3A 4GFNA 3EKRA 4XD8A 5FNFA 2H8MA 1UY8A 3A0XA 4PRXA 4LWFA 2WEQA 3O0IA 4U93A 2YKIA 4L91A 4CWFA 3GIGB 3A0TA 4KFGA 3EHFA 4V26A 2XDUA 5M4HA 4WUCA 5FNCA 1Z5BA 3WHAA 2WI6A 2YKCA 3H4LA 1GJVA 4AS9A 3RLPA 2WERA 1YETA 2CH4A 4I3HA 4EM7A 1MU5A 3CGYA 1U2OA 4R3MA 2YI7A 1UYFA 4HZ0A 2YK9A 4O0BA 5BODA 4GEEA 3G7BA 4E02A 2XDSA 2YEGA 2JKIA 2YEAA 5CF0A 1UYEA 4AWPA 4GT8A 2YGEA 1KZNA 4XIRA 2WI3A 3IEDA 2XABA 2BZ5A 4XCLA 4XIQA 4BQJA 4O09A 3R4MA 4CWRA 4H81A 2HCHA 3OWDA 4BXIA 3K60A 4CE1A 1ZW9A 4YKUA 5CTWA 4KSHA 4QPKA 2XDKA 4R1FA 3MNRP 3INXA 2WI1A 2YI5A 1UYCA 4XIPA 5BOCA 4CWQA 2QFOA 4YKTA 3VADA 4KTNA 1U0ZA 3D0BA 4L93A 4XDMA 4LWEA 4B7PA 3D36A 4CWSA 2XD6A 3DGEA 3O2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YSR A;  4XKA A;  1NHH A;  3JZ3 A;  2XJJ A;  1B62 A;  1QZR A;  1B3Q A;  1Y4S A;  2AKP A;  2QG2 A;  5F5R A;  1YES A;  2ZBK B;  4V25 A;  2BYI A;  1YER A;  1Y8O A;  1UYM A;  4URM A;  4DUH A;  2Q8I A;  4PRV A;  1YT0 A;  4AWO A;  3ZKD A;  2CCS A;  1THN A;  2WI2 A;  2QF6 A;  3TZ0 A;  4FCP A;  4B6C A;  4GQT A;  3OPD A;  1UY7 A;  4WUD A;  3B28 A;  1TBW A;  2XX5 A;  5J71 A;  2YEI A;  4LP0 A;  2GQP A;  3HYY A;  5IDM A;  3RLR A;  1UYG A;  1ZXN A;  5CTX A;  4AWQ A;  2GFD A;  1TID A;  3HEK A;  2BU5 A;  1OSF A;  3VHD A;  3CRL A;  4KSG A;  4H85 A;  4URL A;  2YED A;  1Z5C A;  2IWS A;  3NMQ A;  3Q5J A;  1TC6 A;  3A0Z A;  4ASB A;  2QG0 A;  4MP2 A;  3R4N A;  2YEB A;  3B27 A;  3OMU A;  3FV5 A;  1UY6 A;  3T1K A;  1MX0 A;  1TH8 A;  3B26 A;  1NHJ A;  1I5A A;  4PL9 A;  2YI6 A;  4XIT A;  3HYZ A;  1YC3 A;  3RLQ A;  4HY6 A;  1UYH A;  3GIE A;  2WEP A;  3G75 A;  3CRK A;  2HKJ A;  4ZKI A;  2JJC A;  1GKX A;  2IOQ A;  4I5S A;  2XJG A;  4K4O A;  3A0Y A;  2Q8H A;  1BXD A;  3WQ9 A;  4E01 A;  3TTZ A;  3C11 A;  1AM1 A;  4EEH A;  5IDJ A;  1L0O A;  1EI1 A;  2CCU A;  1BKN A;  1R62 A;  2BTZ A;  3U2K A;  4XCJ A;  1Y8P A;  2IWX A;  4XC0 A;  4MOT A;  5D7D A;  4E00 A;  2YJW A;  5F3K A;  1UYD A;  5M4K A;  4BIZ A;  1S14 A;  2Q2E B;  2XHX A;  3OWB A;  5FWK A;  3R4P A;  1NHI A;  2VWC A;  4MPN A;  3K98 A;  4DZY A;  4GGL A;  2PNR A;  1BYQ A;  2EXL A;  2K5B A;  5M4E A;  3U67 A;  1US7 A;  2XHT A;  2ESA A;  2YKB A;  4WUB A;  4NH9 A;  4MP7 A;  3SL2 A;  4JAS A;  2VCI A;  2WI4 A;  2WI5 A;  4CE3 A;  4YKY A;  2XDL A;  2FWZ A;  3B25 A;  2IWU A;  3KE6 A;  2YE6 A;  2YEH A;  2XJX A;  2YE5 A;  5CTY A;  3TZ5 A;  2BYH A;  1I5B A;  4O04 A;  2VCJ A;  3R91 A;  1AH8 A;  4O05 A;  1A4H A;  4HY1 A;  4LWG A;  4HZ5 A;  2BRC A;  2YE7 A;  5CTU A;  3EHG A;  3EHH A;  4CWO A;  5J6A A;  3CGZ A;  2YE8 A;  4CWT A;  3GIF A;  4JAV A;  2YE9 A;  3LNU A;  1I5D A;  1UY9 A;  3VHA A;  3K99 A;  1B63 A;  2XCM A;  5M4N A;  3T0H A;  4BAE A;  3ZM7 A;  2XDX A;  1H7U A;  4H7Q A;  2H55 A;  3FT5 A;  2BU8 A;  2FWY A;  2YEJ A;  2YEF A;  3RKZ A;  2ZKJ A;  4P8O A;  4W7T A;  1KIJ A;  4YKZ A;  3TZ2 A;  3GIG A;  2O1V A;  3HZ5 A;  2YE2 A;  3O6O A;  5D6P A;  1AJ6 A;  2FYP A;  1H7S A;  5L3J A;  4JQL A;  2CGF A;  3EHJ A;  1UYK A;  4XE2 A;  4ASF A;  4BIU A;  4P7A A;  3ZXO A;  3BMY A;  3T10 A;  1GKZ A;  3H80 A;  2O1W A;  3PEJ A;  4LWH A;  4NH7 A;  3QTF A;  4U7O A;  4BQG A;  3T0Z A;  2Q8G A;  1PVG A;  5C93 A;  4JAU A;  4YKX A;  1S16 A;  4HYP A;  3LPS A;  3D2R A;  3QDD A;  2IOP A;  1UYL A;  4U7N A;  4GCZ A;  4MPC A;  4ASA A;  1YC1 A;  1BGQ A;  2CCT A;  3Q5K A;  4CWN A;  3ZXQ A;  4MPE A;  3ZKB A;  2Q8F A;  4CWP A;  2YE4 A;  4EGI A;  2ZDX A;  1Y8N A;  1Z5A A;  1TC0 A;  3FT8 A;  2YK2 A;  4MB9 A;  2FXS A;  5FND A;  4XKK A;  3BM9 A;  2XK2 A;  3A0W A;  4HXW A;  3EKO A;  5M4P A;  4XKO A;  3B24 A;  1YS3 A;  2YGF A;  1I5C A;  3HHU A;  2C2A A;  4HYM A;  4R3A A;  2YI0 A;  4FCQ A;  3TUH A;  5IN9 A;  3PEH A;  4XTJ A;  5M4M A;  1QYE A;  1UYI A;  4YKQ A;  4ASG A;  2BU2 A;  2BRE A;  2IOR A;  4FPP A;  4EFU A;  2O1U A;  2YJX A;  3OW6 A;  2VW5 A;  1ZXM A;  4Q20 A;  4EMV A;  4PU9 A;  1JM6 A;  2CG9 A;  2XX2 A;  2XX4 A;  2BT0 A;  1AH6 A;  4X9L A;  4QPJ A;  1YC4 A;  4HXZ A;  4LPB A;  2YEE A;  1ZWH A;  3G7E A;  2E0A A;  1ID0 A;  5CPH A;  3Q5L A;  4ZVI A;  2YGA A;  4YKW A;  1Z59 A;  3HZ1 A;  4L90 A;  3INW A;  4EGH A;  1YT2 A;  2YEC A;  4O07 A;  2UWD A;  1YSZ A;  3C0E A;  2HG1 A;  5D7C A;  3A0R A;  2BU7 A;  2YKE A;  4L94 A;  4CE2 A;  4KQV A;  1Y4U A;  2ZDY A;  4FCR A;  1I58 A;  1EA6 A;  1YT1 A;  3R92 A;  3U2D A;  1AMW A;  4KP4 A;  3TZ4 A;  1TIL A;  5D6Q A;  3K97 A;  4MBC A;  2WI7 A;  4EFT A;  2XHR A;  3T2S A;  2BU6 A;  3R4O A;  3VHC A;  1QY8 A;  2BSM A;  4NH8 A;  4L8Z A;  5D7R A;  4EGK A;  2YKJ A;  4FMT A;  4URN A;  1I59 A;  4URO A;  4YKR A;  4LWI A;  5GGZ A;  3CWV A;  2YE3 A;  4GFN A;  3EKR A;  4XD8 A;  5FNF A;  2H8M A;  1UY8 A;  3A0X A;  4PRX A;  4LWF A;  2WEQ A;  3O0I A;  4U93 A;  2YKI A;  4L91 A;  4CWF A;  3GIG B;  3A0T A;  4KFG A;  3EHF A;  4V26 A;  2XDU A;  5M4H A;  4WUC A;  5FNC A;  1Z5B A;  3WHA A;  2WI6 A;  2YKC A;  3H4L A;  1GJV A;  4AS9 A;  3RLP A;  2WER A;  1YET A;  2CH4 A;  4I3H A;  4EM7 A;  1MU5 A;  3CGY A;  1U2O A;  4R3M A;  2YI7 A;  1UYF A;  4HZ0 A;  2YK9 A;  4O0B A;  5BOD A;  4GEE A;  3G7B A;  4E02 A;  2XDS A;  2YEG A;  2JKI A;  2YEA A;  5CF0 A;  1UYE A;  4AWP A;  4GT8 A;  2YGE A;  1KZN A;  4XIR A;  2WI3 A;  3IED A;  2XAB A;  2BZ5 A;  4XCL A;  4XIQ A;  4BQJ A;  4O09 A;  3R4M A;  4CWR A;  4H81 A;  2HCH A;  3OWD A;  4BXI A;  3K60 A;  4CE1 A;  1ZW9 A;  4YKU A;  5CTW A;  4KSH A;  4QPK A;  2XDK A;  4R1F A;  3MNR P;  3INX A;  2WI1 A;  2YI5 A;  1UYC A;  4XIP A;  5BOC A;  4CWQ A;  2QFO A;  4YKT A;  3VAD A;  4KTN A;  1U0Z A;  3D0B A;  4L93 A;  4XDM A;  4LWE A;  4B7P A;  3D36 A;  4CWS A;  2XD6 A;  3DGE A;  3O2F A; 
#chains in the Genus database with same CATH topology
 1YSR A;  4XKA A;  1NHH A;  3JZ3 A;  2XJJ A;  1B62 A;  1QZR A;  1B3Q A;  1Y4S A;  2AKP A;  2QG2 A;  5F5R A;  1YES A;  2ZBK B;  4V25 A;  2BYI A;  1YER A;  1Y8O A;  1UYM A;  4URM A;  4DUH A;  2Q8I A;  4PRV A;  1YT0 A;  4AWO A;  3ZKD A;  2CCS A;  1THN A;  2WI2 A;  2QF6 A;  3TZ0 A;  4FCP A;  4B6C A;  4GQT A;  3OPD A;  1UY7 A;  4WUD A;  3B28 A;  1TBW A;  2XX5 A;  5J71 A;  2YEI A;  4LP0 A;  2GQP A;  3HYY A;  5IDM A;  3RLR A;  1UYG A;  1ZXN A;  5CTX A;  4AWQ A;  2GFD A;  1TID A;  3HEK A;  2BU5 A;  1OSF A;  3VHD A;  3CRL A;  4KSG A;  4H85 A;  4URL A;  2YED A;  1Z5C A;  2IWS A;  3NMQ A;  3Q5J A;  1TC6 A;  3A0Z A;  4ASB A;  2QG0 A;  4MP2 A;  3R4N A;  2YEB A;  3B27 A;  3OMU A;  3FV5 A;  1UY6 A;  3T1K A;  1MX0 A;  1TH8 A;  3B26 A;  1NHJ A;  1I5A A;  4PL9 A;  2YI6 A;  4XIT A;  3HYZ A;  1YC3 A;  3RLQ A;  4HY6 A;  1UYH A;  3GIE A;  2WEP A;  3G75 A;  3CRK A;  2HKJ A;  4ZKI A;  2JJC A;  1GKX A;  2IOQ A;  4I5S A;  2XJG A;  4K4O A;  3A0Y A;  2Q8H A;  1BXD A;  3WQ9 A;  4E01 A;  3TTZ A;  3C11 A;  1AM1 A;  4EEH A;  5IDJ A;  1L0O A;  2FTK A;  1EI1 A;  2CCU A;  1BKN A;  1R62 A;  2BTZ A;  3U2K A;  4XCJ A;  1F51 A;  1Y8P A;  2IWX A;  4XC0 A;  4MOT A;  5D7D A;  4E00 A;  2YJW A;  5F3K A;  1UYD A;  5M4K A;  4BIZ A;  1S14 A;  2Q2E B;  2XHX A;  1IXM A;  3OWB A;  5FWK A;  3R4P A;  1NHI A;  2VWC A;  4MPN A;  3K98 A;  4DZY A;  4GGL A;  2PNR A;  1BYQ A;  2EXL A;  2K5B A;  5M4E A;  3U67 A;  1US7 A;  2XHT A;  2ESA A;  2YKB A;  4WUB A;  3S5T A;  4NH9 A;  4MP7 A;  3SL2 A;  4JAS A;  2VCI A;  2WI4 A;  2WI5 A;  4CE3 A;  4YKY A;  2XDL A;  3LMM A;  2FWZ A;  3B25 A;  2IWU A;  3KE6 A;  2YE6 A;  2YEH A;  2XJX A;  2YE5 A;  5CTY A;  3TZ5 A;  2BYH A;  1I5B A;  4O04 A;  2VCJ A;  3R91 A;  1AH8 A;  4O05 A;  1A4H A;  4HY1 A;  4LWG A;  4HZ5 A;  2BRC A;  2YE7 A;  5CTU A;  3EHG A;  3EHH A;  4CWO A;  5J6A A;  3CGZ A;  2YE8 A;  4CWT A;  3GIF A;  4JAV A;  2YE9 A;  3LNU A;  1I5D A;  1UY9 A;  3VHA A;  3K99 A;  1B63 A;  2XCM A;  5M4N A;  3T0H A;  4BAE A;  3ZM7 A;  2XDX A;  1H7U A;  4H7Q A;  2H55 A;  3FT5 A;  2BU8 A;  2FWY A;  2YEJ A;  2YEF A;  3RKZ A;  2ZKJ A;  4P8O A;  4W7T A;  1KIJ A;  4YKZ A;  3TZ2 A;  3GIG A;  2O1V A;  3HZ5 A;  2YE2 A;  3O6O A;  5D6P A;  1AJ6 A;  2FYP A;  1H7S A;  5L3J A;  4JQL A;  2CGF A;  3EHJ A;  1UYK A;  4XE2 A;  4ASF A;  4BIU A;  4P7A A;  3ZXO A;  3BMY A;  3T10 A;  1GKZ A;  3H80 A;  2O1W A;  3PEJ A;  4LWH A;  4NH7 A;  3QTF A;  4U7O A;  4BQG A;  2HHI A;  3T0Z A;  2Q8G A;  1PVG A;  5C93 A;  4JAU A;  4YKX A;  1S16 A;  2C1G A;  4HYP A;  3LPS A;  3D2R A;  3QDD A;  2IOP A;  1UYL A;  4U7N A;  4GCZ A;  4MPC A;  4ASA A;  1YC1 A;  1BGQ A;  2CCT A;  3Q5K A;  4CWN A;  3ZXQ A;  4MPE A;  3ZKB A;  2Q8F A;  4CWP A;  2YE4 A;  4EGI A;  2ZDX A;  1Y8N A;  1Z5A A;  1TC0 A;  3FT8 A;  2YK2 A;  4MB9 A;  2FXS A;  5FND A;  4XKK A;  3BM9 A;  2XK2 A;  3A0W A;  4HXW A;  3EKO A;  5M4P A;  4XKO A;  3B24 A;  1YS3 A;  2YGF A;  1I5C A;  3HHU A;  2C2A A;  4HYM A;  4R3A A;  2YI0 A;  4FCQ A;  3TUH A;  5IN9 A;  3PEH A;  4XTJ A;  5M4M A;  1QYE A;  1UYI A;  4YKQ A;  4ASG A;  2BU2 A;  2BRE A;  2IOR A;  4FPP A;  4EFU A;  2O1U A;  2YJX A;  5JEN A;  3OW6 A;  2VW5 A;  1ZXM A;  4Q20 A;  4EMV A;  4PU9 A;  1JM6 A;  2CG9 A;  2XX2 A;  2XX4 A;  2BT0 A;  1AH6 A;  4X9L A;  4QPJ A;  1YC4 A;  4HXZ A;  4LPB A;  2YEE A;  1ZWH A;  3G7E A;  2E0A A;  1ID0 A;  5CPH A;  3Q5L A;  4ZVI A;  2YGA A;  4YKW A;  1Z59 A;  3HZ1 A;  4L90 A;  3INW A;  4EGH A;  1YT2 A;  2YEC A;  4O07 A;  2UWD A;  1YSZ A;  3C0E A;  2HG1 A;  4E72 A;  5D7C A;  3A0R A;  2BU7 A;  2YKE A;  4L94 A;  4CE2 A;  4KQV A;  1Y4U A;  2ZDY A;  4FCR A;  1I58 A;  1EA6 A;  1YT1 A;  3R92 A;  3U2D A;  1AMW A;  4KP4 A;  3TZ4 A;  1TIL A;  5D6Q A;  3K97 A;  4MBC A;  2WI7 A;  4EFT A;  2XHR A;  3T2S A;  3CYG A;  2BU6 A;  3R4O A;  3VHC A;  1QY8 A;  2BSM A;  4NH8 A;  4L8Z A;  5D7R A;  4EGK A;  2YKJ A;  4FMT A;  4URN A;  1I59 A;  4URO A;  4YKR A;  4LWI A;  5GGZ A;  3CWV A;  2YE3 A;  4GFN A;  3EKR A;  4XD8 A;  5FNF A;  2C1I A;  2H8M A;  1UY8 A;  3A0X A;  4PRX A;  4LWF A;  2WEQ A;  3O0I A;  4U93 A;  2YKI A;  4L91 A;  4CWF A;  3GIG B;  3A0T A;  4KFG A;  3EHF A;  4V26 A;  2XDU A;  5M4H A;  4WUC A;  5FNC A;  1Z5B A;  3WHA A;  2WI6 A;  2YKC A;  3H4L A;  1GJV A;  4AS9 A;  3RLP A;  2WER A;  1YET A;  2CH4 A;  4I3H A;  4EM7 A;  1MU5 A;  3CGY A;  1U2O A;  4R3M A;  2YI7 A;  1UYF A;  4HZ0 A;  2YK9 A;  4O0B A;  5BOD A;  4GEE A;  3G7B A;  4E02 A;  2XDS A;  2YEG A;  2JKI A;  2YEA A;  5CF0 A;  1UYE A;  4AWP A;  4GT8 A;  2YGE A;  1KZN A;  4XIR A;  2WI3 A;  3IED A;  2XAB A;  2BZ5 A;  4XCL A;  4XIQ A;  4BQJ A;  4O09 A;  3R4M A;  4CWR A;  4H81 A;  2HCH A;  3OWD A;  4BXI A;  3K60 A;  4CE1 A;  1ZW9 A;  4YKU A;  5CTW A;  4KSH A;  4QPK A;  2XDK A;  4R1F A;  3MNR P;  3INX A;  2WI1 A;  2YI5 A;  1UYC A;  4XIP A;  5BOC A;  4CWQ A;  2QFO A;  4YKT A;  3VAD A;  4KTN A;  1U0Z A;  3D0B A;  4L93 A;  4XDM A;  4LWE A;  4B7P A;  3D36 A;  4CWS A;  2XD6 A;  3DGE A;  3O2F A; 
#chains in the Genus database with same CATH homology
 1YSR A;  4XKA A;  1NHH A;  3JZ3 A;  2XJJ A;  1B62 A;  1QZR A;  1B3Q A;  1Y4S A;  2AKP A;  2QG2 A;  5F5R A;  1YES A;  2ZBK B;  4V25 A;  2BYI A;  1YER A;  1Y8O A;  1UYM A;  4URM A;  4DUH A;  2Q8I A;  4PRV A;  1YT0 A;  4AWO A;  3ZKD A;  2CCS A;  1THN A;  2WI2 A;  2QF6 A;  3TZ0 A;  4FCP A;  4B6C A;  4GQT A;  3OPD A;  1UY7 A;  4WUD A;  3B28 A;  1TBW A;  2XX5 A;  5J71 A;  2YEI A;  4LP0 A;  2GQP A;  3HYY A;  5IDM A;  3RLR A;  1UYG A;  1ZXN A;  5CTX A;  4AWQ A;  2GFD A;  1TID A;  3HEK A;  2BU5 A;  1OSF A;  3VHD A;  3CRL A;  4KSG A;  4H85 A;  4URL A;  2YED A;  1Z5C A;  2IWS A;  3NMQ A;  3Q5J A;  1TC6 A;  3A0Z A;  4ASB A;  2QG0 A;  4MP2 A;  3R4N A;  2YEB A;  3B27 A;  3OMU A;  3FV5 A;  1UY6 A;  3T1K A;  1MX0 A;  1TH8 A;  3B26 A;  1NHJ A;  1I5A A;  4PL9 A;  2YI6 A;  4XIT A;  3HYZ A;  1YC3 A;  3RLQ A;  4HY6 A;  1UYH A;  3GIE A;  2WEP A;  3G75 A;  3CRK A;  2HKJ A;  4ZKI A;  2JJC A;  1GKX A;  2IOQ A;  4I5S A;  2XJG A;  4K4O A;  3A0Y A;  2Q8H A;  1BXD A;  3WQ9 A;  4E01 A;  3TTZ A;  3C11 A;  1AM1 A;  4EEH A;  5IDJ A;  1L0O A;  1EI1 A;  2CCU A;  1BKN A;  1R62 A;  2BTZ A;  3U2K A;  4XCJ A;  1Y8P A;  2IWX A;  4XC0 A;  4MOT A;  5D7D A;  4E00 A;  2YJW A;  5F3K A;  1UYD A;  5M4K A;  4BIZ A;  1S14 A;  2Q2E B;  2XHX A;  3OWB A;  5FWK A;  3R4P A;  1NHI A;  2VWC A;  4MPN A;  3K98 A;  4DZY A;  4GGL A;  2PNR A;  1BYQ A;  2EXL A;  2K5B A;  5M4E A;  3U67 A;  1US7 A;  2XHT A;  2ESA A;  2YKB A;  4WUB A;  4NH9 A;  4MP7 A;  3SL2 A;  4JAS A;  2VCI A;  2WI4 A;  2WI5 A;  4CE3 A;  4YKY A;  2XDL A;  2FWZ A;  3B25 A;  2IWU A;  3KE6 A;  2YE6 A;  2YEH A;  2XJX A;  2YE5 A;  5CTY A;  3TZ5 A;  2BYH A;  1I5B A;  4O04 A;  2VCJ A;  3R91 A;  1AH8 A;  4O05 A;  1A4H A;  4HY1 A;  4LWG A;  4HZ5 A;  2BRC A;  2YE7 A;  5CTU A;  3EHG A;  3EHH A;  4CWO A;  5J6A A;  3CGZ A;  2YE8 A;  4CWT A;  3GIF A;  4JAV A;  2YE9 A;  3LNU A;  1I5D A;  1UY9 A;  3VHA A;  3K99 A;  1B63 A;  2XCM A;  5M4N A;  3T0H A;  4BAE A;  3ZM7 A;  2XDX A;  1H7U A;  4H7Q A;  2H55 A;  3FT5 A;  2BU8 A;  2FWY A;  2YEJ A;  2YEF A;  3RKZ A;  2ZKJ A;  4P8O A;  4W7T A;  1KIJ A;  4YKZ A;  3TZ2 A;  3GIG A;  2O1V A;  3HZ5 A;  2YE2 A;  3O6O A;  5D6P A;  1AJ6 A;  2FYP A;  1H7S A;  5L3J A;  4JQL A;  2CGF A;  3EHJ A;  1UYK A;  4XE2 A;  4ASF A;  4BIU A;  4P7A A;  3ZXO A;  3BMY A;  3T10 A;  1GKZ A;  3H80 A;  2O1W A;  3PEJ A;  4LWH A;  4NH7 A;  3QTF A;  4U7O A;  4BQG A;  3T0Z A;  2Q8G A;  1PVG A;  5C93 A;  4JAU A;  4YKX A;  1S16 A;  4HYP A;  3LPS A;  3D2R A;  3QDD A;  2IOP A;  1UYL A;  4U7N A;  4GCZ A;  4MPC A;  4ASA A;  1YC1 A;  1BGQ A;  2CCT A;  3Q5K A;  4CWN A;  3ZXQ A;  4MPE A;  3ZKB A;  2Q8F A;  4CWP A;  2YE4 A;  4EGI A;  2ZDX A;  1Y8N A;  1Z5A A;  1TC0 A;  3FT8 A;  2YK2 A;  4MB9 A;  2FXS A;  5FND A;  4XKK A;  3BM9 A;  2XK2 A;  3A0W A;  4HXW A;  3EKO A;  5M4P A;  4XKO A;  3B24 A;  1YS3 A;  2YGF A;  1I5C A;  3HHU A;  2C2A A;  4HYM A;  4R3A A;  2YI0 A;  4FCQ A;  3TUH A;  5IN9 A;  3PEH A;  4XTJ A;  5M4M A;  1QYE A;  1UYI A;  4YKQ A;  4ASG A;  2BU2 A;  2BRE A;  2IOR A;  4FPP A;  4EFU A;  2O1U A;  2YJX A;  3OW6 A;  2VW5 A;  1ZXM A;  4Q20 A;  4EMV A;  4PU9 A;  1JM6 A;  2CG9 A;  2XX2 A;  2XX4 A;  2BT0 A;  1AH6 A;  4X9L A;  4QPJ A;  1YC4 A;  4HXZ A;  4LPB A;  2YEE A;  1ZWH A;  3G7E A;  2E0A A;  1ID0 A;  5CPH A;  3Q5L A;  4ZVI A;  2YGA A;  4YKW A;  1Z59 A;  3HZ1 A;  4L90 A;  3INW A;  4EGH A;  1YT2 A;  2YEC A;  4O07 A;  2UWD A;  1YSZ A;  3C0E A;  2HG1 A;  5D7C A;  3A0R A;  2BU7 A;  2YKE A;  4L94 A;  4CE2 A;  4KQV A;  1Y4U A;  2ZDY A;  4FCR A;  1I58 A;  1EA6 A;  1YT1 A;  3R92 A;  3U2D A;  1AMW A;  4KP4 A;  3TZ4 A;  1TIL A;  5D6Q A;  3K97 A;  4MBC A;  2WI7 A;  4EFT A;  2XHR A;  3T2S A;  2BU6 A;  3R4O A;  3VHC A;  1QY8 A;  2BSM A;  4NH8 A;  4L8Z A;  5D7R A;  4EGK A;  2YKJ A;  4FMT A;  4URN A;  1I59 A;  4URO A;  4YKR A;  4LWI A;  5GGZ A;  3CWV A;  2YE3 A;  4GFN A;  3EKR A;  4XD8 A;  5FNF A;  2H8M A;  1UY8 A;  3A0X A;  4PRX A;  4LWF A;  2WEQ A;  3O0I A;  4U93 A;  2YKI A;  4L91 A;  4CWF A;  3GIG B;  3A0T A;  4KFG A;  3EHF A;  4V26 A;  2XDU A;  5M4H A;  4WUC A;  5FNC A;  1Z5B A;  3WHA A;  2WI6 A;  2YKC A;  3H4L A;  1GJV A;  4AS9 A;  3RLP A;  2WER A;  1YET A;  2CH4 A;  4I3H A;  4EM7 A;  1MU5 A;  3CGY A;  1U2O A;  4R3M A;  2YI7 A;  1UYF A;  4HZ0 A;  2YK9 A;  4O0B A;  5BOD A;  4GEE A;  3G7B A;  4E02 A;  2XDS A;  2YEG A;  2JKI A;  2YEA A;  5CF0 A;  1UYE A;  4AWP A;  4GT8 A;  2YGE A;  1KZN A;  4XIR A;  2WI3 A;  3IED A;  2XAB A;  2BZ5 A;  4XCL A;  4XIQ A;  4BQJ A;  4O09 A;  3R4M A;  4CWR A;  4H81 A;  2HCH A;  3OWD A;  4BXI A;  3K60 A;  4CE1 A;  1ZW9 A;  4YKU A;  5CTW A;  4KSH A;  4QPK A;  2XDK A;  4R1F A;  3MNR P;  3INX A;  2WI1 A;  2YI5 A;  1UYC A;  4XIP A;  5BOC A;  4CWQ A;  2QFO A;  4YKT A;  3VAD A;  4KTN A;  1U0Z A;  3D0B A;  4L93 A;  4XDM A;  4LWE A;  4B7P A;  3D36 A;  4CWS A;  2XD6 A;  3DGE A;  3O2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...