4NH9A

Correlation between chemotype-dependent binding conformations of hsp90 alpha/beta and isoform selectivity
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
265
structure length
214
Chain Sequence
SEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTEKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlation between chemotype-dependent binding conformations of HSP90 alpha / beta and isoform selectivity-Implications for the structure-based design of HSP90 alpha / beta selective inhibitors for treating neurodegenerative diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 55
structure length 214
sequence length 265
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4nh9A00
3TTZA 4CWPA 1AH6A 2YEIA 4U93A 3RLQA 5J6AA 4CWNA 1AH8A 2YE9A 1Y8OA 3Q5LA 3TZ0A 4XITA 2XDXA 1UY7A 4EFTA 2XHRA 1MX0A 2WERA 3H4LA 4JQLA 3TZ5A 4AS9A 4O0BA 4EMVA 2PNRA 3TUHA 2Q2EB 3CGZA 1THNA 2YGFA 2YK2A 3D0BA 3R91A 4E02A 2O1WA 4EM7A 2ZDXA 5D6QA 1Z59A 2ZBKB 2IWXA 3R92A 1UYFA 2BYIA 2XHTA 1YT0A 3WQ9A 4CWSA 3ZXQA 3C0EA 2WI4A 3GIEA 1GJVA 3A0RA 1UYMA 1H7UA 4CE3A 3EKRA 4PRVA 4H81A 1L0OA 1EA6A 3VHCA 4LWEA 5FNFA 3TZ2A 1YESA 1YC1A 2IWUA 3HZ1A 4XCJA 5CF0A 2H8MA 4L91A 2YKCA 2YJWA 4XE2A 4PU9A 4ASBA 1UY6A 2YEGA 4HZ0A 2BYHA 4EFUA 2UWDA 1GKZA 2VCIA 3OWDA 2YEDA 4BXIA 1Z5AA 4FMTA 3T0HA 4GEEA 3KE6A 2FWYA 4MP7A 5M4NA 3VHDA 1UYKA 4XC0A 4MB9A 1AJ6A 4CE2A 1KZNA 3OWBA 3EKOA 4WUDA 5L3JA 3R4OA 4U7OA 4WUBA 4XIQA 1YS3A 4XCLA 1NHIA 1B63A 2YI6A 3H80A 2YEJA 5M4MA 4QPJA 2BU8A 1YSRA 4HY6A 2XJJA 1TH8A 3B25A 4MP2A 4YKUA 2YE5A 1NHJA 3JZ3A 1I5BA 4BIZA 2E0AA 4O07A 1YC4A 2YEHA 4ASFA 1TC0A 1S14A 2Q8FA 4B7PA 1BYQA 4XIRA 4K4OA 3WHAA 4YKQA 1ZXMA 4LPBA 4O04A 3O6OA 4GGLA 3B26A 1TILA 2IORA 2BRCA 2YI7A 2EXLA 4KSGA 2CCTA 2CG9A 1U2OA 4XD8A 2YI5A 1TBWA 3B28A 4HYPA 4L94A 2YK9A 4KQVA 2GFDA 4LWHA 1MU5A 1ZWHA 2WI7A 4DUHA 2WEPA 1ID0A 1S16A 4HZ5A 4MBCA 1UYHA 4CE1A 1A4HA 4HXWA 3VADA 3Q5KA 3SL2A 4AWOA 4URNA 3CRLA 4XIPA 2YKEA 5M4HA 3BM9A 4DZYA 2BU5A 3O0IA 5J71A 4AWQA 2YEEA 3ZXOA 1U0ZA 2VWCA 3R4NA 4P8OA 4JAVA 2BU6A 1AMWA 2XJXA 4EGKA 1Y8PA 2XDKA 5M4KA 1US7A 5CTWA 3C11A 4FCRA 3A0YA 3GIGA 4R3MA 4BQGA 2XDLA 4E00A 4GT8A 1B62A 1UYDA 4EGHA 1R62A 2IWSA 3FT8A 3T1KA 2YEFA 2YE7A 1OSFA 3ZKDA 3NMQA 2YKBA 2YE6A 4YKTA 4XKOA 2CCSA 2CH4A 4MPCA 4ASAA 5IN9A 1UYGA 1TC6A 2Q8GA 3ZKBA 3U2DA 4CWQA 1YERA 3BMYA 3EHGA 3R4MA 4H7QA 3D36A 1Y8NA 2HCHA 2YE2A 4HY1A 3GIFA 4MOTA 1JM6A 4YKWA 3EHFA 5CTXA 1BXDA 4XKKA 4ZKIA 2XCMA 4PL9A 4KP4A 3RKZA 4Q20A 4ZVIA 2YKIA 5D7DA 2WI1A 3INWA 2YI0A 3K98A 1NHHA 3A0XA 4CWTA 4CWRA 3HYYA 1YETA 1Z5CA 1I5DA 2IOPA 2YECA 2WI3A 5IDMA 3QTFA 5F5RA 2HKJA 2QF6A 2FXSA 4LP0A 4P7AA 2Q8HA 3RLRA 4XDMA 2XX4A 2CCUA 3PEJA 2YE3A 2ESAA 1BKNA 4L90A 2BT0A 2YE8A 4YKXA 4BIUA 4KFGA 4NH8A 3K99A 4H85A 3HHUA 2JKIA 5CTYA 3B27A 4JASA 3HYZA 4YKRA 4LWFA 2YGAA 4V26A 4LWIA 1UY8A 5FNDA 1Z5BA 1PVGA 3CWVA 2AKPA 2K5BA 3K60A 3RLPA 2BU2A 2Q8IA 4CWOA 2XDUA 4YKZA 2JJCA 4I5SA 1ZW9A 2YJXA 3O2FA 4HXZA 4XKAA 5CPHA 1I59A 3A0WA 4GCZA 2XABA 1BGQA 4EGIA 2XDSA 3EHJA 3GIGB 4LWGA 1UYCA 3R4PA 3FT5A 1YSZA 5C93A 3U67A 4GQTA 2WI6A 4AWPA 3G7EA 4U7NA 2FWZA 3VHAA 1AM1A 5D7RA 2FYPA 2YEAA 3U2KA 3CRKA 3ZM7A 4FCPA 3OMUA 4BQJA 2WI5A 2BZ5A 4EEHA 3G7BA 2BTZA 4R3AA 4YKYA 2HG1A 3IEDA 5FWKA 3INXA 1I5AA 3DGEA 5BOCA 3LPSA 4E01A 2ZDYA 4UROA 4NH9A 4JAUA 4W7TA 4O09A 5D6PA 3PEHA 3LNUA 2H55A 3D2RA 4NH7A 4I3HA 4XTJA 1YC3A 3Q5JA 1H7SA 4L93A 4FPPA 2O1UA 2GQPA 4MPEA 2VCJA 3A0TA 1TIDA 2YEBA 2IOQA 4URLA 1EI1A 1KIJA 3EHHA 2XX2A 2XX5A 3MNRP 2CGFA 4QPKA 3HEKA 1I5CA 1QY8A 3T2SA 3FV5A 5F3KA 5CTUA 2XHXA 5D7CA 5M4EA 1UYLA 5BODA 3OPDA 4CWFA 3HZ5A 2C2AA 4B6CA 4V25A 3G75A 2YKJA 4MPNA 1YT1A 2BREA 2YE4A 1B3QA 1Y4SA 2XD6A 3K97A 4GFNA 3T0ZA 2WI2A 4X9LA 3CGYA 2XJGA 4FCQA 2QG2A 3OW6A 5GGZA 3A0ZA 1ZXNA 5IDJA 1QYEA 1QZRA 2ZKJA 2BU7A 1Y4UA 3QDDA 5FNCA 4HYMA 2BSMA 2QG0A 2WEQA 1UY9A 4ASGA 4PRXA 4R1FA 4BAEA 1YT2A 2YGEA 4KSHA 4L8ZA 3B24A 2O1VA 1I58A 1UYEA 2VW5A 4KTNA 1UYIA 4O05A 4WUCA 5M4PA 4URMA 2XK2A 1GKXA 3TZ4A 2QFOA 3T10A
chains in the Genus database with same CATH superfamily
3TTZA 4CWPA 1AH6A 2YEIA 4U93A 3RLQA 1F51A 5J6AA 4CWNA 1AH8A 2YE9A 1Y8OA 3Q5LA 3TZ0A 4XITA 2XDXA 1UY7A 4EFTA 2XHRA 1MX0A 2WERA 3H4LA 2C1IA 4JQLA 3TZ5A 4O0BA 4AS9A 2PNRA 4EMVA 3TUHA 2Q2EB 3LMMA 3CGZA 1THNA 2YGFA 2YK2A 3D0BA 3R91A 4E02A 2O1WA 4EM7A 2ZDXA 5D6QA 1Z59A 2ZBKB 2IWXA 3R92A 1UYFA 2BYIA 2XHTA 1YT0A 3WQ9A 4CWSA 3ZXQA 3C0EA 2WI4A 3GIEA 1GJVA 3A0RA 1UYMA 1H7UA 4CE3A 3EKRA 4PRVA 4H81A 1L0OA 1EA6A 3VHCA 4LWEA 5FNFA 3TZ2A 1YESA 1YC1A 2IWUA 3HZ1A 4XCJA 5CF0A 2H8MA 4L91A 2YKCA 2YJWA 4XE2A 4PU9A 4ASBA 1UY6A 2YEGA 4HZ0A 2BYHA 4EFUA 2UWDA 1GKZA 2VCIA 3OWDA 2YEDA 4BXIA 1Z5AA 4FMTA 3T0HA 4GEEA 3KE6A 2FWYA 4MP7A 5M4NA 3VHDA 1UYKA 4XC0A 4MB9A 1AJ6A 4CE2A 1KZNA 3OWBA 3EKOA 4WUDA 5L3JA 3R4OA 4U7OA 4WUBA 4XIQA 1YS3A 4XCLA 1NHIA 1B63A 2YI6A 3H80A 2YEJA 5M4MA 4QPJA 2BU8A 1YSRA 4HY6A 2XJJA 1TH8A 3B25A 4MP2A 4YKUA 2YE5A 1NHJA 3JZ3A 1I5BA 4BIZA 2E0AA 4O07A 1YC4A 2YEHA 4ASFA 1TC0A 1S14A 2Q8FA 4B7PA 1BYQA 4XIRA 4K4OA 3WHAA 4YKQA 1ZXMA 4LPBA 4O04A 3O6OA 4GGLA 3B26A 1TILA 2IORA 2BRCA 2YI7A 2EXLA 4KSGA 2CCTA 2CG9A 1U2OA 4XD8A 2YI5A 1TBWA 3B28A 4HYPA 4L94A 2YK9A 4KQVA 2GFDA 4LWHA 1MU5A 1ZWHA 2WI7A 4DUHA 2WEPA 1ID0A 1S16A 2C1GA 4HZ5A 4MBCA 1UYHA 4CE1A 1A4HA 4HXWA 3VADA 3Q5KA 3SL2A 4AWOA 4URNA 3CRLA 4XIPA 2YKEA 5M4HA 3BM9A 4DZYA 2BU5A 3O0IA 5J71A 4AWQA 2YEEA 3ZXOA 1U0ZA 2VWCA 3R4NA 4P8OA 4JAVA 2BU6A 1AMWA 2XJXA 4EGKA 1Y8PA 2XDKA 5M4KA 1US7A 5CTWA 3C11A 4FCRA 3A0YA 3GIGA 4R3MA 4BQGA 2XDLA 4E00A 4GT8A 1B62A 1UYDA 4EGHA 1R62A 2IWSA 3FT8A 3T1KA 2YEFA 2YE7A 1OSFA 3ZKDA 3NMQA 2YKBA 2YE6A 2FTKA 4YKTA 4XKOA 2CCSA 2CH4A 4MPCA 4ASAA 5IN9A 1UYGA 1TC6A 2Q8GA 3ZKBA 3U2DA 4CWQA 1YERA 3BMYA 3EHGA 3R4MA 4H7QA 3D36A 1Y8NA 2HCHA 2YE2A 4HY1A 3S5TA 3GIFA 4MOTA 1JM6A 4YKWA 3EHFA 5CTXA 1BXDA 4XKKA 4ZKIA 2XCMA 4PL9A 4KP4A 3RKZA 4Q20A 4ZVIA 2YKIA 5D7DA 2WI1A 3INWA 2YI0A 3K98A 1NHHA 3A0XA 4CWTA 4CWRA 3HYYA 1YETA 1Z5CA 1I5DA 2IOPA 2YECA 2WI3A 5IDMA 3QTFA 5F5RA 2HKJA 2QF6A 2FXSA 4LP0A 4P7AA 2Q8HA 3RLRA 4XDMA 2XX4A 2CCUA 3PEJA 2YE3A 2ESAA 1BKNA 4L90A 2BT0A 2YE8A 4YKXA 4BIUA 4KFGA 4NH8A 3K99A 4H85A 3HHUA 2JKIA 4E72A 5JENA 5CTYA 3B27A 4JASA 3HYZA 4YKRA 4LWFA 2YGAA 4V26A 1UY8A 4LWIA 5FNDA 1Z5BA 1PVGA 3CWVA 2AKPA 2K5BA 3K60A 3RLPA 2BU2A 2Q8IA 4CWOA 2XDUA 4YKZA 2JJCA 4I5SA 1ZW9A 2YJXA 3O2FA 4HXZA 4XKAA 5CPHA 1I59A 3A0WA 4GCZA 1IXMA 2XABA 1BGQA 4EGIA 2XDSA 3EHJA 3GIGB 4LWGA 1UYCA 3R4PA 3FT5A 1YSZA 5C93A 3U67A 4GQTA 2WI6A 4AWPA 3G7EA 4U7NA 2FWZA 3VHAA 1AM1A 5D7RA 2FYPA 2YEAA 3U2KA 3CRKA 3ZM7A 4FCPA 3OMUA 4BQJA 2WI5A 2BZ5A 4EEHA 3G7BA 2BTZA 4R3AA 4YKYA 2HG1A 3IEDA 5FWKA 3INXA 1I5AA 3DGEA 5BOCA 3LPSA 4E01A 2ZDYA 4UROA 4NH9A 4JAUA 4W7TA 4O09A 5D6PA 3PEHA 3LNUA 2H55A 3D2RA 4NH7A 4I3HA 4XTJA 1YC3A 3Q5JA 1H7SA 4L93A 4FPPA 2O1UA 2GQPA 4MPEA 2VCJA 3A0TA 1TIDA 2YEBA 2IOQA 2HHIA 4URLA 1EI1A 1KIJA 3EHHA 2XX2A 2XX5A 3MNRP 2CGFA 4QPKA 3HEKA 1I5CA 1QY8A 3T2SA 3FV5A 5F3KA 5CTUA 2XHXA 5D7CA 5M4EA 1UYLA 5BODA 3OPDA 4CWFA 3HZ5A 2C2AA 4B6CA 4V25A 3G75A 2YKJA 4MPNA 1YT1A 2BREA 2YE4A 1B3QA 1Y4SA 2XD6A 3K97A 4GFNA 3T0ZA 2WI2A 4X9LA 3CGYA 2XJGA 4FCQA 2QG2A 3OW6A 5GGZA 3A0ZA 1ZXNA 5IDJA 1QYEA 1QZRA 2ZKJA 2BU7A 1Y4UA 3QDDA 5FNCA 4HYMA 2BSMA 2QG0A 2WEQA 1UY9A 4ASGA 4PRXA 4R1FA 4BAEA 1YT2A 2YGEA 4KSHA 4L8ZA 3B24A 2O1VA 1I58A 1UYEA 2VW5A 4KTNA 1UYIA 4O05A 4WUCA 5M4PA 4URMA 2XK2A 1GKXA 3TZ4A 3CYGA 2QFOA 3T10A
chains in the Genus database with same CATH topology
3TTZA 4CWPA 1AH6A 2YEIA 4U93A 3RLQA 5J6AA 4CWNA 1AH8A 2YE9A 1Y8OA 3Q5LA 3TZ0A 4XITA 2XDXA 1UY7A 4EFTA 2XHRA 1MX0A 2WERA 3H4LA 4JQLA 3TZ5A 4AS9A 4O0BA 4EMVA 2PNRA 3TUHA 2Q2EB 3CGZA 1THNA 2YGFA 2YK2A 3D0BA 3R91A 4E02A 2O1WA 4EM7A 2ZDXA 5D6QA 1Z59A 2ZBKB 2IWXA 3R92A 1UYFA 2BYIA 2XHTA 1YT0A 3WQ9A 4CWSA 3ZXQA 3C0EA 2WI4A 3GIEA 1GJVA 3A0RA 1UYMA 1H7UA 4CE3A 3EKRA 4PRVA 4H81A 1L0OA 1EA6A 3VHCA 4LWEA 5FNFA 3TZ2A 1YESA 1YC1A 2IWUA 3HZ1A 4XCJA 5CF0A 2H8MA 4L91A 2YKCA 2YJWA 4XE2A 4PU9A 4ASBA 1UY6A 2YEGA 4HZ0A 2BYHA 4EFUA 2UWDA 1GKZA 2VCIA 3OWDA 2YEDA 4BXIA 1Z5AA 4FMTA 3T0HA 4GEEA 3KE6A 2FWYA 4MP7A 5M4NA 3VHDA 1UYKA 4XC0A 4MB9A 1AJ6A 4CE2A 1KZNA 3OWBA 3EKOA 4WUDA 5L3JA 3R4OA 4U7OA 4WUBA 4XIQA 1YS3A 4XCLA 1NHIA 1B63A 2YI6A 3H80A 2YEJA 5M4MA 4QPJA 2BU8A 1YSRA 4HY6A 2XJJA 1TH8A 3B25A 4MP2A 4YKUA 2YE5A 1NHJA 3JZ3A 1I5BA 4BIZA 2E0AA 4O07A 1YC4A 2YEHA 4ASFA 1TC0A 1S14A 2Q8FA 4B7PA 1BYQA 4XIRA 4K4OA 3WHAA 4YKQA 1ZXMA 4LPBA 4O04A 3O6OA 4GGLA 3B26A 1TILA 2IORA 2BRCA 2YI7A 2EXLA 4KSGA 2CCTA 2CG9A 1U2OA 4XD8A 2YI5A 1TBWA 3B28A 4HYPA 4L94A 2YK9A 4KQVA 2GFDA 4LWHA 1MU5A 1ZWHA 2WI7A 4DUHA 2WEPA 1ID0A 1S16A 4HZ5A 4MBCA 1UYHA 4CE1A 1A4HA 4HXWA 3VADA 3Q5KA 3SL2A 4AWOA 4URNA 3CRLA 4XIPA 2YKEA 5M4HA 3BM9A 4DZYA 2BU5A 3O0IA 5J71A 4AWQA 2YEEA 3ZXOA 1U0ZA 2VWCA 3R4NA 4P8OA 4JAVA 2BU6A 1AMWA 2XJXA 4EGKA 1Y8PA 2XDKA 5M4KA 1US7A 5CTWA 3C11A 4FCRA 3A0YA 3GIGA 4R3MA 4BQGA 2XDLA 4E00A 4GT8A 1B62A 1UYDA 4EGHA 1R62A 2IWSA 3FT8A 3T1KA 2YEFA 2YE7A 1OSFA 3ZKDA 3NMQA 2YKBA 2YE6A 4YKTA 4XKOA 2CCSA 2CH4A 4MPCA 4ASAA 5IN9A 1UYGA 1TC6A 2Q8GA 3ZKBA 3U2DA 4CWQA 1YERA 3BMYA 3EHGA 3R4MA 4H7QA 3D36A 1Y8NA 2HCHA 2YE2A 4HY1A 3GIFA 4MOTA 1JM6A 4YKWA 3EHFA 5CTXA 1BXDA 4XKKA 4ZKIA 2XCMA 4PL9A 4KP4A 3RKZA 4Q20A 4ZVIA 2YKIA 5D7DA 2WI1A 3INWA 2YI0A 3K98A 1NHHA 3A0XA 4CWTA 4CWRA 3HYYA 1YETA 1Z5CA 1I5DA 2IOPA 2YECA 2WI3A 5IDMA 3QTFA 5F5RA 2HKJA 2QF6A 2FXSA 4LP0A 4P7AA 2Q8HA 3RLRA 4XDMA 2XX4A 2CCUA 3PEJA 2YE3A 2ESAA 1BKNA 4L90A 2BT0A 2YE8A 4YKXA 4BIUA 4KFGA 4NH8A 3K99A 4H85A 3HHUA 2JKIA 5CTYA 3B27A 4JASA 3HYZA 4YKRA 4LWFA 2YGAA 4V26A 4LWIA 1UY8A 5FNDA 1Z5BA 1PVGA 3CWVA 2AKPA 2K5BA 3K60A 3RLPA 2BU2A 2Q8IA 4CWOA 2XDUA 4YKZA 2JJCA 4I5SA 1ZW9A 2YJXA 3O2FA 4HXZA 4XKAA 5CPHA 1I59A 3A0WA 4GCZA 2XABA 1BGQA 4EGIA 2XDSA 3EHJA 3GIGB 4LWGA 1UYCA 3R4PA 3FT5A 1YSZA 5C93A 3U67A 4GQTA 2WI6A 4AWPA 3G7EA 4U7NA 2FWZA 3VHAA 1AM1A 5D7RA 2FYPA 2YEAA 3U2KA 3CRKA 3ZM7A 4FCPA 3OMUA 4BQJA 2WI5A 2BZ5A 4EEHA 3G7BA 2BTZA 4R3AA 4YKYA 2HG1A 3IEDA 5FWKA 3INXA 1I5AA 3DGEA 5BOCA 3LPSA 4E01A 2ZDYA 4UROA 4NH9A 4JAUA 4W7TA 4O09A 5D6PA 3PEHA 3LNUA 2H55A 3D2RA 4NH7A 4I3HA 4XTJA 1YC3A 3Q5JA 1H7SA 4L93A 4FPPA 2O1UA 2GQPA 4MPEA 2VCJA 3A0TA 1TIDA 2YEBA 2IOQA 4URLA 1EI1A 1KIJA 3EHHA 2XX2A 2XX5A 3MNRP 2CGFA 4QPKA 3HEKA 1I5CA 1QY8A 3T2SA 3FV5A 5F3KA 5CTUA 2XHXA 5D7CA 5M4EA 1UYLA 5BODA 3OPDA 4CWFA 3HZ5A 2C2AA 4B6CA 4V25A 3G75A 2YKJA 4MPNA 1YT1A 2BREA 2YE4A 1B3QA 1Y4SA 2XD6A 3K97A 4GFNA 3T0ZA 2WI2A 4X9LA 3CGYA 2XJGA 4FCQA 2QG2A 3OW6A 5GGZA 3A0ZA 1ZXNA 5IDJA 1QYEA 1QZRA 2ZKJA 2BU7A 1Y4UA 3QDDA 5FNCA 4HYMA 2BSMA 2QG0A 2WEQA 1UY9A 4ASGA 4PRXA 4R1FA 4BAEA 1YT2A 2YGEA 4KSHA 4L8ZA 3B24A 2O1VA 1I58A 1UYEA 2VW5A 4KTNA 1UYIA 4O05A 4WUCA 5M4PA 4URMA 2XK2A 1GKXA 3TZ4A 2QFOA 3T10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TTZ A;  4CWP A;  1AH6 A;  2YEI A;  4U93 A;  3RLQ A;  5J6A A;  4CWN A;  1AH8 A;  2YE9 A;  1Y8O A;  3Q5L A;  3TZ0 A;  4XIT A;  2XDX A;  1UY7 A;  4EFT A;  2XHR A;  1MX0 A;  2WER A;  3H4L A;  4JQL A;  3TZ5 A;  4AS9 A;  4O0B A;  4EMV A;  2PNR A;  3TUH A;  2Q2E B;  3CGZ A;  1THN A;  2YGF A;  2YK2 A;  3D0B A;  3R91 A;  4E02 A;  2O1W A;  4EM7 A;  2ZDX A;  5D6Q A;  1Z59 A;  2ZBK B;  2IWX A;  3R92 A;  1UYF A;  2BYI A;  2XHT A;  1YT0 A;  3WQ9 A;  4CWS A;  3ZXQ A;  3C0E A;  2WI4 A;  3GIE A;  1GJV A;  3A0R A;  1UYM A;  1H7U A;  4CE3 A;  3EKR A;  4PRV A;  4H81 A;  1L0O A;  1EA6 A;  3VHC A;  4LWE A;  5FNF A;  3TZ2 A;  1YES A;  1YC1 A;  2IWU A;  3HZ1 A;  4XCJ A;  5CF0 A;  2H8M A;  4L91 A;  2YKC A;  2YJW A;  4XE2 A;  4PU9 A;  4ASB A;  1UY6 A;  2YEG A;  4HZ0 A;  2BYH A;  4EFU A;  2UWD A;  1GKZ A;  2VCI A;  3OWD A;  2YED A;  4BXI A;  1Z5A A;  4FMT A;  3T0H A;  4GEE A;  3KE6 A;  2FWY A;  4MP7 A;  5M4N A;  3VHD A;  1UYK A;  4XC0 A;  4MB9 A;  1AJ6 A;  4CE2 A;  1KZN A;  3OWB A;  3EKO A;  4WUD A;  5L3J A;  3R4O A;  4U7O A;  4WUB A;  4XIQ A;  1YS3 A;  4XCL A;  1NHI A;  1B63 A;  2YI6 A;  3H80 A;  2YEJ A;  5M4M A;  4QPJ A;  2BU8 A;  1YSR A;  4HY6 A;  2XJJ A;  1TH8 A;  3B25 A;  4MP2 A;  4YKU A;  2YE5 A;  1NHJ A;  3JZ3 A;  1I5B A;  4BIZ A;  2E0A A;  4O07 A;  1YC4 A;  2YEH A;  4ASF A;  1TC0 A;  1S14 A;  2Q8F A;  4B7P A;  1BYQ A;  4XIR A;  4K4O A;  3WHA A;  4YKQ A;  1ZXM A;  4LPB A;  4O04 A;  3O6O A;  4GGL A;  3B26 A;  1TIL A;  2IOR A;  2BRC A;  2YI7 A;  2EXL A;  4KSG A;  2CCT A;  2CG9 A;  1U2O A;  4XD8 A;  2YI5 A;  1TBW A;  3B28 A;  4HYP A;  4L94 A;  2YK9 A;  4KQV A;  2GFD A;  4LWH A;  1MU5 A;  1ZWH A;  2WI7 A;  4DUH A;  2WEP A;  1ID0 A;  1S16 A;  4HZ5 A;  4MBC A;  1UYH A;  4CE1 A;  1A4H A;  4HXW A;  3VAD A;  3Q5K A;  3SL2 A;  4AWO A;  4URN A;  3CRL A;  4XIP A;  2YKE A;  5M4H A;  3BM9 A;  4DZY A;  2BU5 A;  3O0I A;  5J71 A;  4AWQ A;  2YEE A;  3ZXO A;  1U0Z A;  2VWC A;  3R4N A;  4P8O A;  4JAV A;  2BU6 A;  1AMW A;  2XJX A;  4EGK A;  1Y8P A;  2XDK A;  5M4K A;  1US7 A;  5CTW A;  3C11 A;  4FCR A;  3A0Y A;  3GIG A;  4R3M A;  4BQG A;  2XDL A;  4E00 A;  4GT8 A;  1B62 A;  1UYD A;  4EGH A;  1R62 A;  2IWS A;  3FT8 A;  3T1K A;  2YEF A;  2YE7 A;  1OSF A;  3ZKD A;  3NMQ A;  2YKB A;  2YE6 A;  4YKT A;  4XKO A;  2CCS A;  2CH4 A;  4MPC A;  4ASA A;  5IN9 A;  1UYG A;  1TC6 A;  2Q8G A;  3ZKB A;  3U2D A;  4CWQ A;  1YER A;  3BMY A;  3EHG A;  3R4M A;  4H7Q A;  3D36 A;  1Y8N A;  2HCH A;  2YE2 A;  4HY1 A;  3GIF A;  4MOT A;  1JM6 A;  4YKW A;  3EHF A;  5CTX A;  1BXD A;  4XKK A;  4ZKI A;  2XCM A;  4PL9 A;  4KP4 A;  3RKZ A;  4Q20 A;  4ZVI A;  2YKI A;  5D7D A;  2WI1 A;  3INW A;  2YI0 A;  3K98 A;  1NHH A;  3A0X A;  4CWT A;  4CWR A;  3HYY A;  1YET A;  1Z5C A;  1I5D A;  2IOP A;  2YEC A;  2WI3 A;  5IDM A;  3QTF A;  5F5R A;  2HKJ A;  2QF6 A;  2FXS A;  4LP0 A;  4P7A A;  2Q8H A;  3RLR A;  4XDM A;  2XX4 A;  2CCU A;  3PEJ A;  2YE3 A;  2ESA A;  1BKN A;  4L90 A;  2BT0 A;  2YE8 A;  4YKX A;  4BIU A;  4KFG A;  4NH8 A;  3K99 A;  4H85 A;  3HHU A;  2JKI A;  5CTY A;  3B27 A;  4JAS A;  3HYZ A;  4YKR A;  4LWF A;  2YGA A;  4V26 A;  4LWI A;  1UY8 A;  5FND A;  1Z5B A;  1PVG A;  3CWV A;  2AKP A;  2K5B A;  3K60 A;  3RLP A;  2BU2 A;  2Q8I A;  4CWO A;  2XDU A;  4YKZ A;  2JJC A;  4I5S A;  1ZW9 A;  2YJX A;  3O2F A;  4HXZ A;  4XKA A;  5CPH A;  1I59 A;  3A0W A;  4GCZ A;  2XAB A;  1BGQ A;  4EGI A;  2XDS A;  3EHJ A;  3GIG B;  4LWG A;  1UYC A;  3R4P A;  3FT5 A;  1YSZ A;  5C93 A;  3U67 A;  4GQT A;  2WI6 A;  4AWP A;  3G7E A;  4U7N A;  2FWZ A;  3VHA A;  1AM1 A;  5D7R A;  2FYP A;  2YEA A;  3U2K A;  3CRK A;  3ZM7 A;  4FCP A;  3OMU A;  4BQJ A;  2WI5 A;  2BZ5 A;  4EEH A;  3G7B A;  2BTZ A;  4R3A A;  4YKY A;  2HG1 A;  3IED A;  5FWK A;  3INX A;  1I5A A;  3DGE A;  5BOC A;  3LPS A;  4E01 A;  2ZDY A;  4URO A;  4NH9 A;  4JAU A;  4W7T A;  4O09 A;  5D6P A;  3PEH A;  3LNU A;  2H55 A;  3D2R A;  4NH7 A;  4I3H A;  4XTJ A;  1YC3 A;  3Q5J A;  1H7S A;  4L93 A;  4FPP A;  2O1U A;  2GQP A;  4MPE A;  2VCJ A;  3A0T A;  1TID A;  2YEB A;  2IOQ A;  4URL A;  1EI1 A;  1KIJ A;  3EHH A;  2XX2 A;  2XX5 A;  3MNR P;  2CGF A;  4QPK A;  3HEK A;  1I5C A;  1QY8 A;  3T2S A;  3FV5 A;  5F3K A;  5CTU A;  2XHX A;  5D7C A;  5M4E A;  1UYL A;  5BOD A;  3OPD A;  4CWF A;  3HZ5 A;  2C2A A;  4B6C A;  4V25 A;  3G75 A;  2YKJ A;  4MPN A;  1YT1 A;  2BRE A;  2YE4 A;  1B3Q A;  1Y4S A;  2XD6 A;  3K97 A;  4GFN A;  3T0Z A;  2WI2 A;  4X9L A;  3CGY A;  2XJG A;  4FCQ A;  2QG2 A;  3OW6 A;  5GGZ A;  3A0Z A;  1ZXN A;  5IDJ A;  1QYE A;  1QZR A;  2ZKJ A;  2BU7 A;  1Y4U A;  3QDD A;  5FNC A;  4HYM A;  2BSM A;  2QG0 A;  2WEQ A;  1UY9 A;  4ASG A;  4PRX A;  4R1F A;  4BAE A;  1YT2 A;  2YGE A;  4KSH A;  4L8Z A;  3B24 A;  2O1V A;  1I58 A;  1UYE A;  2VW5 A;  4KTN A;  1UYI A;  4O05 A;  4WUC A;  5M4P A;  4URM A;  2XK2 A;  1GKX A;  3TZ4 A;  2QFO A;  3T10 A; 
#chains in the Genus database with same CATH topology
 3TTZ A;  4CWP A;  1AH6 A;  2YEI A;  4U93 A;  3RLQ A;  1F51 A;  5J6A A;  4CWN A;  1AH8 A;  2YE9 A;  1Y8O A;  3Q5L A;  3TZ0 A;  4XIT A;  2XDX A;  1UY7 A;  4EFT A;  2XHR A;  1MX0 A;  2WER A;  3H4L A;  2C1I A;  4JQL A;  3TZ5 A;  4O0B A;  4AS9 A;  2PNR A;  4EMV A;  3TUH A;  2Q2E B;  3LMM A;  3CGZ A;  1THN A;  2YGF A;  2YK2 A;  3D0B A;  3R91 A;  4E02 A;  2O1W A;  4EM7 A;  2ZDX A;  5D6Q A;  1Z59 A;  2ZBK B;  2IWX A;  3R92 A;  1UYF A;  2BYI A;  2XHT A;  1YT0 A;  3WQ9 A;  4CWS A;  3ZXQ A;  3C0E A;  2WI4 A;  3GIE A;  1GJV A;  3A0R A;  1UYM A;  1H7U A;  4CE3 A;  3EKR A;  4PRV A;  4H81 A;  1L0O A;  1EA6 A;  3VHC A;  4LWE A;  5FNF A;  3TZ2 A;  1YES A;  1YC1 A;  2IWU A;  3HZ1 A;  4XCJ A;  5CF0 A;  2H8M A;  4L91 A;  2YKC A;  2YJW A;  4XE2 A;  4PU9 A;  4ASB A;  1UY6 A;  2YEG A;  4HZ0 A;  2BYH A;  4EFU A;  2UWD A;  1GKZ A;  2VCI A;  3OWD A;  2YED A;  4BXI A;  1Z5A A;  4FMT A;  3T0H A;  4GEE A;  3KE6 A;  2FWY A;  4MP7 A;  5M4N A;  3VHD A;  1UYK A;  4XC0 A;  4MB9 A;  1AJ6 A;  4CE2 A;  1KZN A;  3OWB A;  3EKO A;  4WUD A;  5L3J A;  3R4O A;  4U7O A;  4WUB A;  4XIQ A;  1YS3 A;  4XCL A;  1NHI A;  1B63 A;  2YI6 A;  3H80 A;  2YEJ A;  5M4M A;  4QPJ A;  2BU8 A;  1YSR A;  4HY6 A;  2XJJ A;  1TH8 A;  3B25 A;  4MP2 A;  4YKU A;  2YE5 A;  1NHJ A;  3JZ3 A;  1I5B A;  4BIZ A;  2E0A A;  4O07 A;  1YC4 A;  2YEH A;  4ASF A;  1TC0 A;  1S14 A;  2Q8F A;  4B7P A;  1BYQ A;  4XIR A;  4K4O A;  3WHA A;  4YKQ A;  1ZXM A;  4LPB A;  4O04 A;  3O6O A;  4GGL A;  3B26 A;  1TIL A;  2IOR A;  2BRC A;  2YI7 A;  2EXL A;  4KSG A;  2CCT A;  2CG9 A;  1U2O A;  4XD8 A;  2YI5 A;  1TBW A;  3B28 A;  4HYP A;  4L94 A;  2YK9 A;  4KQV A;  2GFD A;  4LWH A;  1MU5 A;  1ZWH A;  2WI7 A;  4DUH A;  2WEP A;  1ID0 A;  1S16 A;  2C1G A;  4HZ5 A;  4MBC A;  1UYH A;  4CE1 A;  1A4H A;  4HXW A;  3VAD A;  3Q5K A;  3SL2 A;  4AWO A;  4URN A;  3CRL A;  4XIP A;  2YKE A;  5M4H A;  3BM9 A;  4DZY A;  2BU5 A;  3O0I A;  5J71 A;  4AWQ A;  2YEE A;  3ZXO A;  1U0Z A;  2VWC A;  3R4N A;  4P8O A;  4JAV A;  2BU6 A;  1AMW A;  2XJX A;  4EGK A;  1Y8P A;  2XDK A;  5M4K A;  1US7 A;  5CTW A;  3C11 A;  4FCR A;  3A0Y A;  3GIG A;  4R3M A;  4BQG A;  2XDL A;  4E00 A;  4GT8 A;  1B62 A;  1UYD A;  4EGH A;  1R62 A;  2IWS A;  3FT8 A;  3T1K A;  2YEF A;  2YE7 A;  1OSF A;  3ZKD A;  3NMQ A;  2YKB A;  2YE6 A;  2FTK A;  4YKT A;  4XKO A;  2CCS A;  2CH4 A;  4MPC A;  4ASA A;  5IN9 A;  1UYG A;  1TC6 A;  2Q8G A;  3ZKB A;  3U2D A;  4CWQ A;  1YER A;  3BMY A;  3EHG A;  3R4M A;  4H7Q A;  3D36 A;  1Y8N A;  2HCH A;  2YE2 A;  4HY1 A;  3S5T A;  3GIF A;  4MOT A;  1JM6 A;  4YKW A;  3EHF A;  5CTX A;  1BXD A;  4XKK A;  4ZKI A;  2XCM A;  4PL9 A;  4KP4 A;  3RKZ A;  4Q20 A;  4ZVI A;  2YKI A;  5D7D A;  2WI1 A;  3INW A;  2YI0 A;  3K98 A;  1NHH A;  3A0X A;  4CWT A;  4CWR A;  3HYY A;  1YET A;  1Z5C A;  1I5D A;  2IOP A;  2YEC A;  2WI3 A;  5IDM A;  3QTF A;  5F5R A;  2HKJ A;  2QF6 A;  2FXS A;  4LP0 A;  4P7A A;  2Q8H A;  3RLR A;  4XDM A;  2XX4 A;  2CCU A;  3PEJ A;  2YE3 A;  2ESA A;  1BKN A;  4L90 A;  2BT0 A;  2YE8 A;  4YKX A;  4BIU A;  4KFG A;  4NH8 A;  3K99 A;  4H85 A;  3HHU A;  2JKI A;  4E72 A;  5JEN A;  5CTY A;  3B27 A;  4JAS A;  3HYZ A;  4YKR A;  4LWF A;  2YGA A;  4V26 A;  1UY8 A;  4LWI A;  5FND A;  1Z5B A;  1PVG A;  3CWV A;  2AKP A;  2K5B A;  3K60 A;  3RLP A;  2BU2 A;  2Q8I A;  4CWO A;  2XDU A;  4YKZ A;  2JJC A;  4I5S A;  1ZW9 A;  2YJX A;  3O2F A;  4HXZ A;  4XKA A;  5CPH A;  1I59 A;  3A0W A;  4GCZ A;  1IXM A;  2XAB A;  1BGQ A;  4EGI A;  2XDS A;  3EHJ A;  3GIG B;  4LWG A;  1UYC A;  3R4P A;  3FT5 A;  1YSZ A;  5C93 A;  3U67 A;  4GQT A;  2WI6 A;  4AWP A;  3G7E A;  4U7N A;  2FWZ A;  3VHA A;  1AM1 A;  5D7R A;  2FYP A;  2YEA A;  3U2K A;  3CRK A;  3ZM7 A;  4FCP A;  3OMU A;  4BQJ A;  2WI5 A;  2BZ5 A;  4EEH A;  3G7B A;  2BTZ A;  4R3A A;  4YKY A;  2HG1 A;  3IED A;  5FWK A;  3INX A;  1I5A A;  3DGE A;  5BOC A;  3LPS A;  4E01 A;  2ZDY A;  4URO A;  4NH9 A;  4JAU A;  4W7T A;  4O09 A;  5D6P A;  3PEH A;  3LNU A;  2H55 A;  3D2R A;  4NH7 A;  4I3H A;  4XTJ A;  1YC3 A;  3Q5J A;  1H7S A;  4L93 A;  4FPP A;  2O1U A;  2GQP A;  4MPE A;  2VCJ A;  3A0T A;  1TID A;  2YEB A;  2IOQ A;  2HHI A;  4URL A;  1EI1 A;  1KIJ A;  3EHH A;  2XX2 A;  2XX5 A;  3MNR P;  2CGF A;  4QPK A;  3HEK A;  1I5C A;  1QY8 A;  3T2S A;  3FV5 A;  5F3K A;  5CTU A;  2XHX A;  5D7C A;  5M4E A;  1UYL A;  5BOD A;  3OPD A;  4CWF A;  3HZ5 A;  2C2A A;  4B6C A;  4V25 A;  3G75 A;  2YKJ A;  4MPN A;  1YT1 A;  2BRE A;  2YE4 A;  1B3Q A;  1Y4S A;  2XD6 A;  3K97 A;  4GFN A;  3T0Z A;  2WI2 A;  4X9L A;  3CGY A;  2XJG A;  4FCQ A;  2QG2 A;  3OW6 A;  5GGZ A;  3A0Z A;  1ZXN A;  5IDJ A;  1QYE A;  1QZR A;  2ZKJ A;  2BU7 A;  1Y4U A;  3QDD A;  5FNC A;  4HYM A;  2BSM A;  2QG0 A;  2WEQ A;  1UY9 A;  4ASG A;  4PRX A;  4R1F A;  4BAE A;  1YT2 A;  2YGE A;  4KSH A;  4L8Z A;  3B24 A;  2O1V A;  1I58 A;  1UYE A;  2VW5 A;  4KTN A;  1UYI A;  4O05 A;  4WUC A;  5M4P A;  4URM A;  2XK2 A;  1GKX A;  3TZ4 A;  3CYG A;  2QFO A;  3T10 A; 
#chains in the Genus database with same CATH homology
 3TTZ A;  4CWP A;  1AH6 A;  2YEI A;  4U93 A;  3RLQ A;  5J6A A;  4CWN A;  1AH8 A;  2YE9 A;  1Y8O A;  3Q5L A;  3TZ0 A;  4XIT A;  2XDX A;  1UY7 A;  4EFT A;  2XHR A;  1MX0 A;  2WER A;  3H4L A;  4JQL A;  3TZ5 A;  4AS9 A;  4O0B A;  4EMV A;  2PNR A;  3TUH A;  2Q2E B;  3CGZ A;  1THN A;  2YGF A;  2YK2 A;  3D0B A;  3R91 A;  4E02 A;  2O1W A;  4EM7 A;  2ZDX A;  5D6Q A;  1Z59 A;  2ZBK B;  2IWX A;  3R92 A;  1UYF A;  2BYI A;  2XHT A;  1YT0 A;  3WQ9 A;  4CWS A;  3ZXQ A;  3C0E A;  2WI4 A;  3GIE A;  1GJV A;  3A0R A;  1UYM A;  1H7U A;  4CE3 A;  3EKR A;  4PRV A;  4H81 A;  1L0O A;  1EA6 A;  3VHC A;  4LWE A;  5FNF A;  3TZ2 A;  1YES A;  1YC1 A;  2IWU A;  3HZ1 A;  4XCJ A;  5CF0 A;  2H8M A;  4L91 A;  2YKC A;  2YJW A;  4XE2 A;  4PU9 A;  4ASB A;  1UY6 A;  2YEG A;  4HZ0 A;  2BYH A;  4EFU A;  2UWD A;  1GKZ A;  2VCI A;  3OWD A;  2YED A;  4BXI A;  1Z5A A;  4FMT A;  3T0H A;  4GEE A;  3KE6 A;  2FWY A;  4MP7 A;  5M4N A;  3VHD A;  1UYK A;  4XC0 A;  4MB9 A;  1AJ6 A;  4CE2 A;  1KZN A;  3OWB A;  3EKO A;  4WUD A;  5L3J A;  3R4O A;  4U7O A;  4WUB A;  4XIQ A;  1YS3 A;  4XCL A;  1NHI A;  1B63 A;  2YI6 A;  3H80 A;  2YEJ A;  5M4M A;  4QPJ A;  2BU8 A;  1YSR A;  4HY6 A;  2XJJ A;  1TH8 A;  3B25 A;  4MP2 A;  4YKU A;  2YE5 A;  1NHJ A;  3JZ3 A;  1I5B A;  4BIZ A;  2E0A A;  4O07 A;  1YC4 A;  2YEH A;  4ASF A;  1TC0 A;  1S14 A;  2Q8F A;  4B7P A;  1BYQ A;  4XIR A;  4K4O A;  3WHA A;  4YKQ A;  1ZXM A;  4LPB A;  4O04 A;  3O6O A;  4GGL A;  3B26 A;  1TIL A;  2IOR A;  2BRC A;  2YI7 A;  2EXL A;  4KSG A;  2CCT A;  2CG9 A;  1U2O A;  4XD8 A;  2YI5 A;  1TBW A;  3B28 A;  4HYP A;  4L94 A;  2YK9 A;  4KQV A;  2GFD A;  4LWH A;  1MU5 A;  1ZWH A;  2WI7 A;  4DUH A;  2WEP A;  1ID0 A;  1S16 A;  4HZ5 A;  4MBC A;  1UYH A;  4CE1 A;  1A4H A;  4HXW A;  3VAD A;  3Q5K A;  3SL2 A;  4AWO A;  4URN A;  3CRL A;  4XIP A;  2YKE A;  5M4H A;  3BM9 A;  4DZY A;  2BU5 A;  3O0I A;  5J71 A;  4AWQ A;  2YEE A;  3ZXO A;  1U0Z A;  2VWC A;  3R4N A;  4P8O A;  4JAV A;  2BU6 A;  1AMW A;  2XJX A;  4EGK A;  1Y8P A;  2XDK A;  5M4K A;  1US7 A;  5CTW A;  3C11 A;  4FCR A;  3A0Y A;  3GIG A;  4R3M A;  4BQG A;  2XDL A;  4E00 A;  4GT8 A;  1B62 A;  1UYD A;  4EGH A;  1R62 A;  2IWS A;  3FT8 A;  3T1K A;  2YEF A;  2YE7 A;  1OSF A;  3ZKD A;  3NMQ A;  2YKB A;  2YE6 A;  4YKT A;  4XKO A;  2CCS A;  2CH4 A;  4MPC A;  4ASA A;  5IN9 A;  1UYG A;  1TC6 A;  2Q8G A;  3ZKB A;  3U2D A;  4CWQ A;  1YER A;  3BMY A;  3EHG A;  3R4M A;  4H7Q A;  3D36 A;  1Y8N A;  2HCH A;  2YE2 A;  4HY1 A;  3GIF A;  4MOT A;  1JM6 A;  4YKW A;  3EHF A;  5CTX A;  1BXD A;  4XKK A;  4ZKI A;  2XCM A;  4PL9 A;  4KP4 A;  3RKZ A;  4Q20 A;  4ZVI A;  2YKI A;  5D7D A;  2WI1 A;  3INW A;  2YI0 A;  3K98 A;  1NHH A;  3A0X A;  4CWT A;  4CWR A;  3HYY A;  1YET A;  1Z5C A;  1I5D A;  2IOP A;  2YEC A;  2WI3 A;  5IDM A;  3QTF A;  5F5R A;  2HKJ A;  2QF6 A;  2FXS A;  4LP0 A;  4P7A A;  2Q8H A;  3RLR A;  4XDM A;  2XX4 A;  2CCU A;  3PEJ A;  2YE3 A;  2ESA A;  1BKN A;  4L90 A;  2BT0 A;  2YE8 A;  4YKX A;  4BIU A;  4KFG A;  4NH8 A;  3K99 A;  4H85 A;  3HHU A;  2JKI A;  5CTY A;  3B27 A;  4JAS A;  3HYZ A;  4YKR A;  4LWF A;  2YGA A;  4V26 A;  4LWI A;  1UY8 A;  5FND A;  1Z5B A;  1PVG A;  3CWV A;  2AKP A;  2K5B A;  3K60 A;  3RLP A;  2BU2 A;  2Q8I A;  4CWO A;  2XDU A;  4YKZ A;  2JJC A;  4I5S A;  1ZW9 A;  2YJX A;  3O2F A;  4HXZ A;  4XKA A;  5CPH A;  1I59 A;  3A0W A;  4GCZ A;  2XAB A;  1BGQ A;  4EGI A;  2XDS A;  3EHJ A;  3GIG B;  4LWG A;  1UYC A;  3R4P A;  3FT5 A;  1YSZ A;  5C93 A;  3U67 A;  4GQT A;  2WI6 A;  4AWP A;  3G7E A;  4U7N A;  2FWZ A;  3VHA A;  1AM1 A;  5D7R A;  2FYP A;  2YEA A;  3U2K A;  3CRK A;  3ZM7 A;  4FCP A;  3OMU A;  4BQJ A;  2WI5 A;  2BZ5 A;  4EEH A;  3G7B A;  2BTZ A;  4R3A A;  4YKY A;  2HG1 A;  3IED A;  5FWK A;  3INX A;  1I5A A;  3DGE A;  5BOC A;  3LPS A;  4E01 A;  2ZDY A;  4URO A;  4NH9 A;  4JAU A;  4W7T A;  4O09 A;  5D6P A;  3PEH A;  3LNU A;  2H55 A;  3D2R A;  4NH7 A;  4I3H A;  4XTJ A;  1YC3 A;  3Q5J A;  1H7S A;  4L93 A;  4FPP A;  2O1U A;  2GQP A;  4MPE A;  2VCJ A;  3A0T A;  1TID A;  2YEB A;  2IOQ A;  4URL A;  1EI1 A;  1KIJ A;  3EHH A;  2XX2 A;  2XX5 A;  3MNR P;  2CGF A;  4QPK A;  3HEK A;  1I5C A;  1QY8 A;  3T2S A;  3FV5 A;  5F3K A;  5CTU A;  2XHX A;  5D7C A;  5M4E A;  1UYL A;  5BOD A;  3OPD A;  4CWF A;  3HZ5 A;  2C2A A;  4B6C A;  4V25 A;  3G75 A;  2YKJ A;  4MPN A;  1YT1 A;  2BRE A;  2YE4 A;  1B3Q A;  1Y4S A;  2XD6 A;  3K97 A;  4GFN A;  3T0Z A;  2WI2 A;  4X9L A;  3CGY A;  2XJG A;  4FCQ A;  2QG2 A;  3OW6 A;  5GGZ A;  3A0Z A;  1ZXN A;  5IDJ A;  1QYE A;  1QZR A;  2ZKJ A;  2BU7 A;  1Y4U A;  3QDD A;  5FNC A;  4HYM A;  2BSM A;  2QG0 A;  2WEQ A;  1UY9 A;  4ASG A;  4PRX A;  4R1F A;  4BAE A;  1YT2 A;  2YGE A;  4KSH A;  4L8Z A;  3B24 A;  2O1V A;  1I58 A;  1UYE A;  2VW5 A;  4KTN A;  1UYI A;  4O05 A;  4WUC A;  5M4P A;  4URM A;  2XK2 A;  1GKX A;  3TZ4 A;  2QFO A;  3T10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...