4NH9A

Correlation between chemotype-dependent binding conformations of hsp90 alpha/beta and isoform selectivity
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
265
structure length
214
Chain Sequence
SEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTEKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlation between chemotype-dependent binding conformations of HSP90 alpha / beta and isoform selectivity-Implications for the structure-based design of HSP90 alpha / beta selective inhibitors for treating neurodegenerative diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 55
structure length 214
sequence length 265
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4nh9A00
2YEIA 1GKXA 4YKUA 4YKRA 4HZ5A 1ZWHA 4KSGA 4HYMA 4ASBA 3EKRA 4BIUA 1Z59A 2YGAA 1GKZA 4CWFA 1ID0A 2ZBKB 4L93A 3O2FA 3K97A 2YE2A 2XJJA 2HCHA 3GIGA 1S14A 3K98A 1NHIA 3A0ZA 3EHJA 1UYGA 3U2DA 4LP0A 1ZXMA 1UYDA 2XDKA 1TIDA 2Q8IA 3CRLA 4U93A 2ESAA 4YKYA 1MX0A 1YERA 2YE8A 4O07A 1Y8PA 2YKIA 1YETA 4I3HA 2WEPA 3INWA 2WI6A 4U7OA 5M4MA 2QFOA 2VCIA 3C0EA 1UY6A 2CG9A 4LPBA 2YEJA 4L8ZA 4L91A 5M4HA 3FV5A 2WI4A 4AWOA 3Q5LA 2YEEA 3T10A 4HXZA 4FMTA 3VHAA 3C11A 4XD8A 3PEHA 5CTXA 4R3AA 3EHHA 4XDMA 2XJGA 5CPHA 3A0RA 2XX5A 4ZKIA 2PNRA 2WI1A 3ZKDA 4EGIA 4L90A 2WI5A 4GQTA 5BODA 3B25A 3OW6A 2GQPA 2C2AA 4DUHA 2BU2A 5CTYA 4EFUA 2H8MA 2Q2EB 2UWDA 2XDUA 3TZ5A 1TC0A 4BQJA 2BZ5A 4GGLA 4Q20A 4HZ0A 3R4MA 2YKBA 3B26A 3HYZA 4GT8A 1KZNA 4CWOA 3O0IA 3VHDA 3RLQA 4JAVA 4KP4A 3TTZA 4NH9A 4E02A 1UYFA 2BTZA 4FCQA 1UY9A 2HKJA 4HY1A 4JQLA 1BYQA 4MPCA 2H55A 3TZ2A 5CF0A 5D7RA 4ASFA 3RLPA 3LNUA 4V25A 1YSRA 3D0BA 4YKZA 2Q8HA 4XKOA 4XKAA 3ZXQA 4XE2A 3T1KA 5L3JA 3OPDA 4URMA 4LWIA 2CCSA 4XCJA 5J6AA 2YI6A 3TZ0A 5FNFA 3B27A 5CTUA 1TILA 2XABA 5M4PA 5D7DA 1Y4UA 2VW5A 5IDJA 1Z5BA 3VADA 5IN9A 2IWXA 4FCPA 3KE6A 3RKZA 5C93A 2YGEA 3JZ3A 4NH7A 5FNCA 1KIJA 3BM9A 2IWSA 4K4OA 4R3MA 2YEHA 3K99A 3B24A 1I59A 3QTFA 3R4NA 4QPJA 4XIPA 2YEAA 4YKWA 4XIQA 1S16A 3G7BA 4FPPA 3O6OA 4BIZA 2O1VA 3A0WA 3D2RA 1ZXNA 2JKIA 4BQGA 3R4OA 4YKTA 3GIEA 2BREA 1I58A 2BU5A 2EXLA 2XX4A 2CH4A 4H7QA 1Z5AA 1TC6A 2XJXA 3PEJA 2VCJA 2ZDXA 1UY8A 4E01A 4GFNA 4P8OA 1YESA 2YK2A 2YE7A 4ZVIA 3D36A 1UYLA 3ZKBA 4CWSA 3R91A 3OWDA 2XCMA 3MNRP 2FXSA 4EEHA 1AJ6A 4PL9A 2YE4A 3IEDA 1AM1A 3TUHA 3A0TA 2BU7A 1TBWA 3LPSA 2FWYA 1BGQA 3NMQA 2YK9A 1BKNA 2BRCA 3ZM7A 1U0ZA 2YKJA 3INXA 3SL2A 4CE2A 4XTJA 1AH6A 1YC4A 4HYPA 4B6CA 4XITA 3T2SA 4KFGA 4LWEA 1YC3A 4QPKA 4WUDA 4L94A 1THNA 4MP2A 4B7PA 5M4NA 1U2OA 2XDXA 4KTNA 4WUCA 5GGZA 4CWQA 4XC0A 4HXWA 4AWPA 4CWTA 4H81A 3TZ4A 1AH8A 4XCLA 3ZXOA 1MU5A 2YKCA 1BXDA 5FWKA 5BOCA 5M4EA 3T0ZA 1PVGA 4CWPA 2FYPA 2YE5A 3DGEA 2YEDA 4NH8A 3OWBA 2YJXA 4XKKA 2IORA 2HG1A 2YKEA 4GCZA 1B3QA 3HYYA 2XDSA 2VWCA 2YE9A 3CRKA 4EGKA 3K60A 4O05A 3CGYA 2GFDA 3GIFA 2YEBA 2IOPA 2BT0A 1NHJA 4CE1A 1B62A 3QDDA 2XHXA 5F3KA 3EKOA 4PU9A 2WEQA 1EA6A 2ZDYA 1QYEA 2QG2A 2YJWA 4CE3A 2YI7A 4LWFA 4MB9A 1Y8OA 5FNDA 2O1UA 2Q8FA 1QY8A 2AKPA 2XDLA 1UYCA 3T0HA 3VHCA 3CGZA 4R1FA 4AWQA 3BMYA 4P7AA 1EI1A 1US7A 3A0XA 5D6PA 4EM7A 3B28A 5F5RA 4YKQA 4EGHA 5IDMA 4URLA 2IOQA 1AMWA 1YS3A 2YEFA 2CCTA 2XX2A 4MOTA 1I5DA 1NHHA 4JASA 4WUBA 2YE6A 4W7TA 4FCRA 4H85A 1H7SA 3EHFA 4X9LA 3WHAA 4O04A 1B63A 2ZKJA 2IWUA 1ZW9A 4XIRA 4AS9A 1I5CA 4YKXA 2FWZA 2QG0A 4CWRA 2E0AA 3HEKA 2YE3A 3CWVA 3FT5A 1Z5CA 1L0OA 1YT1A 2BSMA 4PRXA 4PRVA 2YGFA 2YEGA 1TH8A 1JM6A 1UYKA 3FT8A 4I5SA 1Y4SA 3HZ5A 1I5AA 4MP7A 3WQ9A 4U7NA 4ASAA 2BYIA 1Y8NA 3GIGB 1OSFA 4E00A 1UY7A 5M4KA 1UYEA 1UYMA 2WI7A 4O09A 3A0YA 4DZYA 1YC1A 4KSHA 1UYIA 4BAEA 2K5BA 2Q8GA 4UROA 2JJCA 4LWGA 1H7UA 3H80A 4CWNA 4HY6A 5J71A 2XHRA 1YT2A 4GEEA 2CCUA 4MPEA 3U67A 3Q5JA 3HZ1A 4O0BA 3HHUA 5CTWA 2O1WA 4MPNA 3G7EA 2YECA 2CGFA 2YI5A 4BXIA 2XK2A 5D6QA 1R62A 3OMUA 4URNA 2WI2A 2BU6A 2QF6A 3Q5KA 4EFTA 3G75A 2WERA 1I5BA 1YSZA 2XD6A 3H4LA 3RLRA 1YT0A 4V26A 4JAUA 1UYHA 4LWHA 3U2KA 2XHTA 4MBCA 4KQVA 4ASGA 1GJVA 2BU8A 1A4HA 2WI3A 2YI0A 3EHGA 1QZRA 3R4PA 5D7CA 2BYHA 3R92A 4EMVA
chains in the Genus database with same CATH superfamily
2YEIA 1GKXA 4YKUA 4YKRA 4HZ5A 1ZWHA 4KSGA 4HYMA 4ASBA 3EKRA 4BIUA 1Z59A 2YGAA 1GKZA 4CWFA 1ID0A 2ZBKB 4L93A 3O2FA 3K97A 2YE2A 2XJJA 2HCHA 3GIGA 1S14A 3K98A 1NHIA 3A0ZA 3EHJA 1UYGA 3U2DA 4LP0A 1ZXMA 1UYDA 2XDKA 1TIDA 2Q8IA 3CRLA 4U93A 2ESAA 4YKYA 1MX0A 1YERA 2YE8A 4O07A 1Y8PA 2YKIA 1YETA 4I3HA 2WEPA 3INWA 2WI6A 4U7OA 5M4MA 2QFOA 2VCIA 3C0EA 1UY6A 2CG9A 4LPBA 2YEJA 4L8ZA 4L91A 5M4HA 3FV5A 2WI4A 4AWOA 3Q5LA 2YEEA 3T10A 4HXZA 4FMTA 3VHAA 3C11A 4XD8A 3PEHA 5CTXA 4R3AA 3EHHA 4XDMA 2XJGA 5CPHA 3A0RA 2XX5A 4ZKIA 2PNRA 2WI1A 3ZKDA 4EGIA 4L90A 2WI5A 4GQTA 5BODA 3B25A 3OW6A 2GQPA 2C2AA 4DUHA 2BU2A 5CTYA 4EFUA 2H8MA 2Q2EB 2UWDA 2XDUA 3TZ5A 1TC0A 4BQJA 2BZ5A 4GGLA 4Q20A 4HZ0A 3R4MA 2YKBA 3B26A 3HYZA 4GT8A 1KZNA 4CWOA 3O0IA 3VHDA 3RLQA 4JAVA 4KP4A 3TTZA 4NH9A 4E02A 1UYFA 2BTZA 4FCQA 1UY9A 2HKJA 4HY1A 4JQLA 1BYQA 4MPCA 2H55A 3TZ2A 5CF0A 5D7RA 4ASFA 3RLPA 3LNUA 4V25A 1YSRA 3D0BA 4YKZA 2Q8HA 4XKOA 4XKAA 3ZXQA 4XE2A 3T1KA 5L3JA 3OPDA 4URMA 4LWIA 2CCSA 4XCJA 5J6AA 2YI6A 3TZ0A 5FNFA 3B27A 1IXMA 5CTUA 1TILA 2XABA 5M4PA 5D7DA 1Y4UA 2VW5A 5IDJA 1Z5BA 3VADA 5IN9A 2IWXA 4FCPA 3KE6A 3RKZA 5C93A 2YGEA 3JZ3A 4NH7A 5FNCA 1KIJA 3BM9A 2IWSA 4K4OA 4R3MA 2YEHA 3K99A 3B24A 1I59A 3QTFA 3R4NA 4QPJA 4XIPA 2YEAA 2FTKA 4YKWA 4XIQA 1S16A 3G7BA 4FPPA 3O6OA 4BIZA 2O1VA 3A0WA 3D2RA 1ZXNA 2JKIA 4BQGA 3R4OA 4YKTA 3GIEA 2BREA 1I58A 2BU5A 2EXLA 2XX4A 2CH4A 4H7QA 1Z5AA 1TC6A 2XJXA 3S5TA 3PEJA 2VCJA 2ZDXA 1UY8A 4E01A 4GFNA 4P8OA 1YESA 2YK2A 2YE7A 4ZVIA 3D36A 1UYLA 3ZKBA 4CWSA 3R91A 3OWDA 2XCMA 3MNRP 2FXSA 4EEHA 1AJ6A 4PL9A 2YE4A 3IEDA 1AM1A 3TUHA 3A0TA 2BU7A 1TBWA 3LPSA 2FWYA 1BGQA 3NMQA 2YK9A 1BKNA 2BRCA 3ZM7A 1U0ZA 2YKJA 3INXA 3SL2A 4CE2A 4XTJA 1AH6A 1YC4A 4HYPA 4B6CA 4XITA 3T2SA 4KFGA 4LWEA 1YC3A 4QPKA 4WUDA 4L94A 1THNA 4MP2A 4B7PA 5M4NA 1U2OA 2XDXA 4KTNA 4WUCA 5GGZA 4CWQA 4XC0A 4HXWA 4AWPA 4CWTA 4H81A 3TZ4A 1AH8A 4XCLA 3ZXOA 1MU5A 2YKCA 1BXDA 5FWKA 5BOCA 5M4EA 3T0ZA 1PVGA 4CWPA 2FYPA 2YE5A 3DGEA 2YEDA 4NH8A 3OWBA 2YJXA 4XKKA 2IORA 2HG1A 2YKEA 4GCZA 1B3QA 3HYYA 2XDSA 2VWCA 2YE9A 3CRKA 4EGKA 3K60A 4O05A 3CGYA 2GFDA 3GIFA 2YEBA 2IOPA 2BT0A 1NHJA 4CE1A 1B62A 3QDDA 2XHXA 5F3KA 3EKOA 4PU9A 2WEQA 1EA6A 2ZDYA 1QYEA 2QG2A 2YJWA 3CYGA 4CE3A 2YI7A 4LWFA 4MB9A 1Y8OA 5FNDA 2O1UA 2Q8FA 1QY8A 2AKPA 2XDLA 1F51A 1UYCA 3T0HA 3VHCA 3CGZA 4R1FA 4AWQA 3BMYA 4P7AA 1EI1A 1US7A 3A0XA 5D6PA 4EM7A 5JENA 3B28A 5F5RA 4YKQA 4EGHA 5IDMA 4URLA 2IOQA 1AMWA 1YS3A 2YEFA 2CCTA 2XX2A 4MOTA 1I5DA 1NHHA 4JASA 4WUBA 2YE6A 4W7TA 4FCRA 4H85A 1H7SA 3EHFA 4X9LA 3WHAA 4O04A 1B63A 2ZKJA 2IWUA 1ZW9A 4XIRA 4AS9A 1I5CA 4YKXA 2FWZA 2QG0A 4CWRA 2HHIA 2E0AA 3HEKA 2YE3A 3CWVA 3FT5A 1Z5CA 1L0OA 1YT1A 2BSMA 4PRXA 4PRVA 2YGFA 2YEGA 1TH8A 1JM6A 1UYKA 3FT8A 4I5SA 1Y4SA 3HZ5A 1I5AA 4MP7A 3WQ9A 4U7NA 4ASAA 2BYIA 1Y8NA 3GIGB 1OSFA 4E00A 1UY7A 5M4KA 1UYEA 1UYMA 2WI7A 4O09A 3A0YA 4DZYA 1YC1A 4KSHA 1UYIA 4BAEA 2K5BA 2Q8GA 4UROA 2JJCA 4LWGA 1H7UA 3H80A 4CWNA 4HY6A 5J71A 2XHRA 1YT2A 4GEEA 2CCUA 4MPEA 3U67A 3Q5JA 3HZ1A 4O0BA 3HHUA 5CTWA 2C1IA 2O1WA 4MPNA 3G7EA 2YECA 2CGFA 2YI5A 4BXIA 2XK2A 5D6QA 1R62A 3OMUA 4URNA 2WI2A 2BU6A 2QF6A 3Q5KA 4EFTA 3G75A 2WERA 1I5BA 1YSZA 2XD6A 3H4LA 3RLRA 1YT0A 4E72A 4V26A 4JAUA 1UYHA 3LMMA 4LWHA 3U2KA 2XHTA 4MBCA 4KQVA 4ASGA 1GJVA 2BU8A 1A4HA 2WI3A 2YI0A 3EHGA 2C1GA 1QZRA 3R4PA 5D7CA 2BYHA 3R92A 4EMVA
chains in the Genus database with same CATH topology
2YEIA 1GKXA 4YKUA 4YKRA 4HZ5A 1ZWHA 4KSGA 4HYMA 4ASBA 3EKRA 4BIUA 1Z59A 2YGAA 1GKZA 4CWFA 1ID0A 2ZBKB 4L93A 3O2FA 3K97A 2YE2A 2XJJA 2HCHA 3GIGA 1S14A 3K98A 1NHIA 3A0ZA 3EHJA 1UYGA 3U2DA 4LP0A 1ZXMA 1UYDA 2XDKA 1TIDA 2Q8IA 3CRLA 4U93A 2ESAA 4YKYA 1MX0A 1YERA 2YE8A 4O07A 1Y8PA 2YKIA 1YETA 4I3HA 2WEPA 3INWA 2WI6A 4U7OA 5M4MA 2QFOA 2VCIA 3C0EA 1UY6A 2CG9A 4LPBA 2YEJA 4L8ZA 4L91A 5M4HA 3FV5A 2WI4A 4AWOA 3Q5LA 2YEEA 3T10A 4HXZA 4FMTA 3VHAA 3C11A 4XD8A 3PEHA 5CTXA 4R3AA 3EHHA 4XDMA 2XJGA 5CPHA 3A0RA 2XX5A 4ZKIA 2PNRA 2WI1A 3ZKDA 4EGIA 4L90A 2WI5A 4GQTA 5BODA 3B25A 3OW6A 2GQPA 2C2AA 4DUHA 2BU2A 5CTYA 4EFUA 2H8MA 2Q2EB 2UWDA 2XDUA 3TZ5A 1TC0A 4BQJA 2BZ5A 4GGLA 4Q20A 4HZ0A 3R4MA 2YKBA 3B26A 3HYZA 4GT8A 1KZNA 4CWOA 3O0IA 3VHDA 3RLQA 4JAVA 4KP4A 3TTZA 4NH9A 4E02A 1UYFA 2BTZA 4FCQA 1UY9A 2HKJA 4HY1A 4JQLA 1BYQA 4MPCA 2H55A 3TZ2A 5CF0A 5D7RA 4ASFA 3RLPA 3LNUA 4V25A 1YSRA 3D0BA 4YKZA 2Q8HA 4XKOA 4XKAA 3ZXQA 4XE2A 3T1KA 5L3JA 3OPDA 4URMA 4LWIA 2CCSA 4XCJA 5J6AA 2YI6A 3TZ0A 5FNFA 3B27A 5CTUA 1TILA 2XABA 5M4PA 5D7DA 1Y4UA 2VW5A 5IDJA 1Z5BA 3VADA 5IN9A 2IWXA 4FCPA 3KE6A 3RKZA 5C93A 2YGEA 3JZ3A 4NH7A 5FNCA 1KIJA 3BM9A 2IWSA 4K4OA 4R3MA 2YEHA 3K99A 3B24A 1I59A 3QTFA 3R4NA 4QPJA 4XIPA 2YEAA 4YKWA 4XIQA 1S16A 3G7BA 4FPPA 3O6OA 4BIZA 2O1VA 3A0WA 3D2RA 1ZXNA 2JKIA 4BQGA 3R4OA 4YKTA 3GIEA 2BREA 1I58A 2BU5A 2EXLA 2XX4A 2CH4A 4H7QA 1Z5AA 1TC6A 2XJXA 3PEJA 2VCJA 2ZDXA 1UY8A 4E01A 4GFNA 4P8OA 1YESA 2YK2A 2YE7A 4ZVIA 3D36A 1UYLA 3ZKBA 4CWSA 3R91A 3OWDA 2XCMA 3MNRP 2FXSA 4EEHA 1AJ6A 4PL9A 2YE4A 3IEDA 1AM1A 3TUHA 3A0TA 2BU7A 1TBWA 3LPSA 2FWYA 1BGQA 3NMQA 2YK9A 1BKNA 2BRCA 3ZM7A 1U0ZA 2YKJA 3INXA 3SL2A 4CE2A 4XTJA 1AH6A 1YC4A 4HYPA 4B6CA 4XITA 3T2SA 4KFGA 4LWEA 1YC3A 4QPKA 4WUDA 4L94A 1THNA 4MP2A 4B7PA 5M4NA 1U2OA 2XDXA 4KTNA 4WUCA 5GGZA 4CWQA 4XC0A 4HXWA 4AWPA 4CWTA 4H81A 3TZ4A 1AH8A 4XCLA 3ZXOA 1MU5A 2YKCA 1BXDA 5FWKA 5BOCA 5M4EA 3T0ZA 1PVGA 4CWPA 2FYPA 2YE5A 3DGEA 2YEDA 4NH8A 3OWBA 2YJXA 4XKKA 2IORA 2HG1A 2YKEA 4GCZA 1B3QA 3HYYA 2XDSA 2VWCA 2YE9A 3CRKA 4EGKA 3K60A 4O05A 3CGYA 2GFDA 3GIFA 2YEBA 2IOPA 2BT0A 1NHJA 4CE1A 1B62A 3QDDA 2XHXA 5F3KA 3EKOA 4PU9A 2WEQA 1EA6A 2ZDYA 1QYEA 2QG2A 2YJWA 4CE3A 2YI7A 4LWFA 4MB9A 1Y8OA 5FNDA 2O1UA 2Q8FA 1QY8A 2AKPA 2XDLA 1UYCA 3T0HA 3VHCA 3CGZA 4R1FA 4AWQA 3BMYA 4P7AA 1EI1A 1US7A 3A0XA 5D6PA 4EM7A 3B28A 5F5RA 4YKQA 4EGHA 5IDMA 4URLA 2IOQA 1AMWA 1YS3A 2YEFA 2CCTA 2XX2A 4MOTA 1I5DA 1NHHA 4JASA 4WUBA 2YE6A 4W7TA 4FCRA 4H85A 1H7SA 3EHFA 4X9LA 3WHAA 4O04A 1B63A 2ZKJA 2IWUA 1ZW9A 4XIRA 4AS9A 1I5CA 4YKXA 2FWZA 2QG0A 4CWRA 2E0AA 3HEKA 2YE3A 3CWVA 3FT5A 1Z5CA 1L0OA 1YT1A 2BSMA 4PRXA 4PRVA 2YGFA 2YEGA 1TH8A 1JM6A 1UYKA 3FT8A 4I5SA 1Y4SA 3HZ5A 1I5AA 4MP7A 3WQ9A 4U7NA 4ASAA 2BYIA 1Y8NA 3GIGB 1OSFA 4E00A 1UY7A 5M4KA 1UYEA 1UYMA 2WI7A 4O09A 3A0YA 4DZYA 1YC1A 4KSHA 1UYIA 4BAEA 2K5BA 2Q8GA 4UROA 2JJCA 4LWGA 1H7UA 3H80A 4CWNA 4HY6A 5J71A 2XHRA 1YT2A 4GEEA 2CCUA 4MPEA 3U67A 3Q5JA 3HZ1A 4O0BA 3HHUA 5CTWA 2O1WA 4MPNA 3G7EA 2YECA 2CGFA 2YI5A 4BXIA 2XK2A 5D6QA 1R62A 3OMUA 4URNA 2WI2A 2BU6A 2QF6A 3Q5KA 4EFTA 3G75A 2WERA 1I5BA 1YSZA 2XD6A 3H4LA 3RLRA 1YT0A 4V26A 4JAUA 1UYHA 4LWHA 3U2KA 2XHTA 4MBCA 4KQVA 4ASGA 1GJVA 2BU8A 1A4HA 2WI3A 2YI0A 3EHGA 1QZRA 3R4PA 5D7CA 2BYHA 3R92A 4EMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEI A;  1GKX A;  4YKU A;  4YKR A;  4HZ5 A;  1ZWH A;  4KSG A;  4HYM A;  4ASB A;  3EKR A;  4BIU A;  1Z59 A;  2YGA A;  1GKZ A;  4CWF A;  1ID0 A;  2ZBK B;  4L93 A;  3O2F A;  3K97 A;  2YE2 A;  2XJJ A;  2HCH A;  3GIG A;  1S14 A;  3K98 A;  1NHI A;  3A0Z A;  3EHJ A;  1UYG A;  3U2D A;  4LP0 A;  1ZXM A;  1UYD A;  2XDK A;  1TID A;  2Q8I A;  3CRL A;  4U93 A;  2ESA A;  4YKY A;  1MX0 A;  1YER A;  2YE8 A;  4O07 A;  1Y8P A;  2YKI A;  1YET A;  4I3H A;  2WEP A;  3INW A;  2WI6 A;  4U7O A;  5M4M A;  2QFO A;  2VCI A;  3C0E A;  1UY6 A;  2CG9 A;  4LPB A;  2YEJ A;  4L8Z A;  4L91 A;  5M4H A;  3FV5 A;  2WI4 A;  4AWO A;  3Q5L A;  2YEE A;  3T10 A;  4HXZ A;  4FMT A;  3VHA A;  3C11 A;  4XD8 A;  3PEH A;  5CTX A;  4R3A A;  3EHH A;  4XDM A;  2XJG A;  5CPH A;  3A0R A;  2XX5 A;  4ZKI A;  2PNR A;  2WI1 A;  3ZKD A;  4EGI A;  4L90 A;  2WI5 A;  4GQT A;  5BOD A;  3B25 A;  3OW6 A;  2GQP A;  2C2A A;  4DUH A;  2BU2 A;  5CTY A;  4EFU A;  2H8M A;  2Q2E B;  2UWD A;  2XDU A;  3TZ5 A;  1TC0 A;  4BQJ A;  2BZ5 A;  4GGL A;  4Q20 A;  4HZ0 A;  3R4M A;  2YKB A;  3B26 A;  3HYZ A;  4GT8 A;  1KZN A;  4CWO A;  3O0I A;  3VHD A;  3RLQ A;  4JAV A;  4KP4 A;  3TTZ A;  4NH9 A;  4E02 A;  1UYF A;  2BTZ A;  4FCQ A;  1UY9 A;  2HKJ A;  4HY1 A;  4JQL A;  1BYQ A;  4MPC A;  2H55 A;  3TZ2 A;  5CF0 A;  5D7R A;  4ASF A;  3RLP A;  3LNU A;  4V25 A;  1YSR A;  3D0B A;  4YKZ A;  2Q8H A;  4XKO A;  4XKA A;  3ZXQ A;  4XE2 A;  3T1K A;  5L3J A;  3OPD A;  4URM A;  4LWI A;  2CCS A;  4XCJ A;  5J6A A;  2YI6 A;  3TZ0 A;  5FNF A;  3B27 A;  5CTU A;  1TIL A;  2XAB A;  5M4P A;  5D7D A;  1Y4U A;  2VW5 A;  5IDJ A;  1Z5B A;  3VAD A;  5IN9 A;  2IWX A;  4FCP A;  3KE6 A;  3RKZ A;  5C93 A;  2YGE A;  3JZ3 A;  4NH7 A;  5FNC A;  1KIJ A;  3BM9 A;  2IWS A;  4K4O A;  4R3M A;  2YEH A;  3K99 A;  3B24 A;  1I59 A;  3QTF A;  3R4N A;  4QPJ A;  4XIP A;  2YEA A;  4YKW A;  4XIQ A;  1S16 A;  3G7B A;  4FPP A;  3O6O A;  4BIZ A;  2O1V A;  3A0W A;  3D2R A;  1ZXN A;  2JKI A;  4BQG A;  3R4O A;  4YKT A;  3GIE A;  2BRE A;  1I58 A;  2BU5 A;  2EXL A;  2XX4 A;  2CH4 A;  4H7Q A;  1Z5A A;  1TC6 A;  2XJX A;  3PEJ A;  2VCJ A;  2ZDX A;  1UY8 A;  4E01 A;  4GFN A;  4P8O A;  1YES A;  2YK2 A;  2YE7 A;  4ZVI A;  3D36 A;  1UYL A;  3ZKB A;  4CWS A;  3R91 A;  3OWD A;  2XCM A;  3MNR P;  2FXS A;  4EEH A;  1AJ6 A;  4PL9 A;  2YE4 A;  3IED A;  1AM1 A;  3TUH A;  3A0T A;  2BU7 A;  1TBW A;  3LPS A;  2FWY A;  1BGQ A;  3NMQ A;  2YK9 A;  1BKN A;  2BRC A;  3ZM7 A;  1U0Z A;  2YKJ A;  3INX A;  3SL2 A;  4CE2 A;  4XTJ A;  1AH6 A;  1YC4 A;  4HYP A;  4B6C A;  4XIT A;  3T2S A;  4KFG A;  4LWE A;  1YC3 A;  4QPK A;  4WUD A;  4L94 A;  1THN A;  4MP2 A;  4B7P A;  5M4N A;  1U2O A;  2XDX A;  4KTN A;  4WUC A;  5GGZ A;  4CWQ A;  4XC0 A;  4HXW A;  4AWP A;  4CWT A;  4H81 A;  3TZ4 A;  1AH8 A;  4XCL A;  3ZXO A;  1MU5 A;  2YKC A;  1BXD A;  5FWK A;  5BOC A;  5M4E A;  3T0Z A;  1PVG A;  4CWP A;  2FYP A;  2YE5 A;  3DGE A;  2YED A;  4NH8 A;  3OWB A;  2YJX A;  4XKK A;  2IOR A;  2HG1 A;  2YKE A;  4GCZ A;  1B3Q A;  3HYY A;  2XDS A;  2VWC A;  2YE9 A;  3CRK A;  4EGK A;  3K60 A;  4O05 A;  3CGY A;  2GFD A;  3GIF A;  2YEB A;  2IOP A;  2BT0 A;  1NHJ A;  4CE1 A;  1B62 A;  3QDD A;  2XHX A;  5F3K A;  3EKO A;  4PU9 A;  2WEQ A;  1EA6 A;  2ZDY A;  1QYE A;  2QG2 A;  2YJW A;  4CE3 A;  2YI7 A;  4LWF A;  4MB9 A;  1Y8O A;  5FND A;  2O1U A;  2Q8F A;  1QY8 A;  2AKP A;  2XDL A;  1UYC A;  3T0H A;  3VHC A;  3CGZ A;  4R1F A;  4AWQ A;  3BMY A;  4P7A A;  1EI1 A;  1US7 A;  3A0X A;  5D6P A;  4EM7 A;  3B28 A;  5F5R A;  4YKQ A;  4EGH A;  5IDM A;  4URL A;  2IOQ A;  1AMW A;  1YS3 A;  2YEF A;  2CCT A;  2XX2 A;  4MOT A;  1I5D A;  1NHH A;  4JAS A;  4WUB A;  2YE6 A;  4W7T A;  4FCR A;  4H85 A;  1H7S A;  3EHF A;  4X9L A;  3WHA A;  4O04 A;  1B63 A;  2ZKJ A;  2IWU A;  1ZW9 A;  4XIR A;  4AS9 A;  1I5C A;  4YKX A;  2FWZ A;  2QG0 A;  4CWR A;  2E0A A;  3HEK A;  2YE3 A;  3CWV A;  3FT5 A;  1Z5C A;  1L0O A;  1YT1 A;  2BSM A;  4PRX A;  4PRV A;  2YGF A;  2YEG A;  1TH8 A;  1JM6 A;  1UYK A;  3FT8 A;  4I5S A;  1Y4S A;  3HZ5 A;  1I5A A;  4MP7 A;  3WQ9 A;  4U7N A;  4ASA A;  2BYI A;  1Y8N A;  3GIG B;  1OSF A;  4E00 A;  1UY7 A;  5M4K A;  1UYE A;  1UYM A;  2WI7 A;  4O09 A;  3A0Y A;  4DZY A;  1YC1 A;  4KSH A;  1UYI A;  4BAE A;  2K5B A;  2Q8G A;  4URO A;  2JJC A;  4LWG A;  1H7U A;  3H80 A;  4CWN A;  4HY6 A;  5J71 A;  2XHR A;  1YT2 A;  4GEE A;  2CCU A;  4MPE A;  3U67 A;  3Q5J A;  3HZ1 A;  4O0B A;  3HHU A;  5CTW A;  2O1W A;  4MPN A;  3G7E A;  2YEC A;  2CGF A;  2YI5 A;  4BXI A;  2XK2 A;  5D6Q A;  1R62 A;  3OMU A;  4URN A;  2WI2 A;  2BU6 A;  2QF6 A;  3Q5K A;  4EFT A;  3G75 A;  2WER A;  1I5B A;  1YSZ A;  2XD6 A;  3H4L A;  3RLR A;  1YT0 A;  4V26 A;  4JAU A;  1UYH A;  4LWH A;  3U2K A;  2XHT A;  4MBC A;  4KQV A;  4ASG A;  1GJV A;  2BU8 A;  1A4H A;  2WI3 A;  2YI0 A;  3EHG A;  1QZR A;  3R4P A;  5D7C A;  2BYH A;  3R92 A;  4EMV A; 
#chains in the Genus database with same CATH topology
 2YEI A;  1GKX A;  4YKU A;  4YKR A;  4HZ5 A;  1ZWH A;  4KSG A;  4HYM A;  4ASB A;  3EKR A;  4BIU A;  1Z59 A;  2YGA A;  1GKZ A;  4CWF A;  1ID0 A;  2ZBK B;  4L93 A;  3O2F A;  3K97 A;  2YE2 A;  2XJJ A;  2HCH A;  3GIG A;  1S14 A;  3K98 A;  1NHI A;  3A0Z A;  3EHJ A;  1UYG A;  3U2D A;  4LP0 A;  1ZXM A;  1UYD A;  2XDK A;  1TID A;  2Q8I A;  3CRL A;  4U93 A;  2ESA A;  4YKY A;  1MX0 A;  1YER A;  2YE8 A;  4O07 A;  1Y8P A;  2YKI A;  1YET A;  4I3H A;  2WEP A;  3INW A;  2WI6 A;  4U7O A;  5M4M A;  2QFO A;  2VCI A;  3C0E A;  1UY6 A;  2CG9 A;  4LPB A;  2YEJ A;  4L8Z A;  4L91 A;  5M4H A;  3FV5 A;  2WI4 A;  4AWO A;  3Q5L A;  2YEE A;  3T10 A;  4HXZ A;  4FMT A;  3VHA A;  3C11 A;  4XD8 A;  3PEH A;  5CTX A;  4R3A A;  3EHH A;  4XDM A;  2XJG A;  5CPH A;  3A0R A;  2XX5 A;  4ZKI A;  2PNR A;  2WI1 A;  3ZKD A;  4EGI A;  4L90 A;  2WI5 A;  4GQT A;  5BOD A;  3B25 A;  3OW6 A;  2GQP A;  2C2A A;  4DUH A;  2BU2 A;  5CTY A;  4EFU A;  2H8M A;  2Q2E B;  2UWD A;  2XDU A;  3TZ5 A;  1TC0 A;  4BQJ A;  2BZ5 A;  4GGL A;  4Q20 A;  4HZ0 A;  3R4M A;  2YKB A;  3B26 A;  3HYZ A;  4GT8 A;  1KZN A;  4CWO A;  3O0I A;  3VHD A;  3RLQ A;  4JAV A;  4KP4 A;  3TTZ A;  4NH9 A;  4E02 A;  1UYF A;  2BTZ A;  4FCQ A;  1UY9 A;  2HKJ A;  4HY1 A;  4JQL A;  1BYQ A;  4MPC A;  2H55 A;  3TZ2 A;  5CF0 A;  5D7R A;  4ASF A;  3RLP A;  3LNU A;  4V25 A;  1YSR A;  3D0B A;  4YKZ A;  2Q8H A;  4XKO A;  4XKA A;  3ZXQ A;  4XE2 A;  3T1K A;  5L3J A;  3OPD A;  4URM A;  4LWI A;  2CCS A;  4XCJ A;  5J6A A;  2YI6 A;  3TZ0 A;  5FNF A;  3B27 A;  1IXM A;  5CTU A;  1TIL A;  2XAB A;  5M4P A;  5D7D A;  1Y4U A;  2VW5 A;  5IDJ A;  1Z5B A;  3VAD A;  5IN9 A;  2IWX A;  4FCP A;  3KE6 A;  3RKZ A;  5C93 A;  2YGE A;  3JZ3 A;  4NH7 A;  5FNC A;  1KIJ A;  3BM9 A;  2IWS A;  4K4O A;  4R3M A;  2YEH A;  3K99 A;  3B24 A;  1I59 A;  3QTF A;  3R4N A;  4QPJ A;  4XIP A;  2YEA A;  2FTK A;  4YKW A;  4XIQ A;  1S16 A;  3G7B A;  4FPP A;  3O6O A;  4BIZ A;  2O1V A;  3A0W A;  3D2R A;  1ZXN A;  2JKI A;  4BQG A;  3R4O A;  4YKT A;  3GIE A;  2BRE A;  1I58 A;  2BU5 A;  2EXL A;  2XX4 A;  2CH4 A;  4H7Q A;  1Z5A A;  1TC6 A;  2XJX A;  3S5T A;  3PEJ A;  2VCJ A;  2ZDX A;  1UY8 A;  4E01 A;  4GFN A;  4P8O A;  1YES A;  2YK2 A;  2YE7 A;  4ZVI A;  3D36 A;  1UYL A;  3ZKB A;  4CWS A;  3R91 A;  3OWD A;  2XCM A;  3MNR P;  2FXS A;  4EEH A;  1AJ6 A;  4PL9 A;  2YE4 A;  3IED A;  1AM1 A;  3TUH A;  3A0T A;  2BU7 A;  1TBW A;  3LPS A;  2FWY A;  1BGQ A;  3NMQ A;  2YK9 A;  1BKN A;  2BRC A;  3ZM7 A;  1U0Z A;  2YKJ A;  3INX A;  3SL2 A;  4CE2 A;  4XTJ A;  1AH6 A;  1YC4 A;  4HYP A;  4B6C A;  4XIT A;  3T2S A;  4KFG A;  4LWE A;  1YC3 A;  4QPK A;  4WUD A;  4L94 A;  1THN A;  4MP2 A;  4B7P A;  5M4N A;  1U2O A;  2XDX A;  4KTN A;  4WUC A;  5GGZ A;  4CWQ A;  4XC0 A;  4HXW A;  4AWP A;  4CWT A;  4H81 A;  3TZ4 A;  1AH8 A;  4XCL A;  3ZXO A;  1MU5 A;  2YKC A;  1BXD A;  5FWK A;  5BOC A;  5M4E A;  3T0Z A;  1PVG A;  4CWP A;  2FYP A;  2YE5 A;  3DGE A;  2YED A;  4NH8 A;  3OWB A;  2YJX A;  4XKK A;  2IOR A;  2HG1 A;  2YKE A;  4GCZ A;  1B3Q A;  3HYY A;  2XDS A;  2VWC A;  2YE9 A;  3CRK A;  4EGK A;  3K60 A;  4O05 A;  3CGY A;  2GFD A;  3GIF A;  2YEB A;  2IOP A;  2BT0 A;  1NHJ A;  4CE1 A;  1B62 A;  3QDD A;  2XHX A;  5F3K A;  3EKO A;  4PU9 A;  2WEQ A;  1EA6 A;  2ZDY A;  1QYE A;  2QG2 A;  2YJW A;  3CYG A;  4CE3 A;  2YI7 A;  4LWF A;  4MB9 A;  1Y8O A;  5FND A;  2O1U A;  2Q8F A;  1QY8 A;  2AKP A;  2XDL A;  1F51 A;  1UYC A;  3T0H A;  3VHC A;  3CGZ A;  4R1F A;  4AWQ A;  3BMY A;  4P7A A;  1EI1 A;  1US7 A;  3A0X A;  5D6P A;  4EM7 A;  5JEN A;  3B28 A;  5F5R A;  4YKQ A;  4EGH A;  5IDM A;  4URL A;  2IOQ A;  1AMW A;  1YS3 A;  2YEF A;  2CCT A;  2XX2 A;  4MOT A;  1I5D A;  1NHH A;  4JAS A;  4WUB A;  2YE6 A;  4W7T A;  4FCR A;  4H85 A;  1H7S A;  3EHF A;  4X9L A;  3WHA A;  4O04 A;  1B63 A;  2ZKJ A;  2IWU A;  1ZW9 A;  4XIR A;  4AS9 A;  1I5C A;  4YKX A;  2FWZ A;  2QG0 A;  4CWR A;  2HHI A;  2E0A A;  3HEK A;  2YE3 A;  3CWV A;  3FT5 A;  1Z5C A;  1L0O A;  1YT1 A;  2BSM A;  4PRX A;  4PRV A;  2YGF A;  2YEG A;  1TH8 A;  1JM6 A;  1UYK A;  3FT8 A;  4I5S A;  1Y4S A;  3HZ5 A;  1I5A A;  4MP7 A;  3WQ9 A;  4U7N A;  4ASA A;  2BYI A;  1Y8N A;  3GIG B;  1OSF A;  4E00 A;  1UY7 A;  5M4K A;  1UYE A;  1UYM A;  2WI7 A;  4O09 A;  3A0Y A;  4DZY A;  1YC1 A;  4KSH A;  1UYI A;  4BAE A;  2K5B A;  2Q8G A;  4URO A;  2JJC A;  4LWG A;  1H7U A;  3H80 A;  4CWN A;  4HY6 A;  5J71 A;  2XHR A;  1YT2 A;  4GEE A;  2CCU A;  4MPE A;  3U67 A;  3Q5J A;  3HZ1 A;  4O0B A;  3HHU A;  5CTW A;  2C1I A;  2O1W A;  4MPN A;  3G7E A;  2YEC A;  2CGF A;  2YI5 A;  4BXI A;  2XK2 A;  5D6Q A;  1R62 A;  3OMU A;  4URN A;  2WI2 A;  2BU6 A;  2QF6 A;  3Q5K A;  4EFT A;  3G75 A;  2WER A;  1I5B A;  1YSZ A;  2XD6 A;  3H4L A;  3RLR A;  1YT0 A;  4E72 A;  4V26 A;  4JAU A;  1UYH A;  3LMM A;  4LWH A;  3U2K A;  2XHT A;  4MBC A;  4KQV A;  4ASG A;  1GJV A;  2BU8 A;  1A4H A;  2WI3 A;  2YI0 A;  3EHG A;  2C1G A;  1QZR A;  3R4P A;  5D7C A;  2BYH A;  3R92 A;  4EMV A; 
#chains in the Genus database with same CATH homology
 2YEI A;  1GKX A;  4YKU A;  4YKR A;  4HZ5 A;  1ZWH A;  4KSG A;  4HYM A;  4ASB A;  3EKR A;  4BIU A;  1Z59 A;  2YGA A;  1GKZ A;  4CWF A;  1ID0 A;  2ZBK B;  4L93 A;  3O2F A;  3K97 A;  2YE2 A;  2XJJ A;  2HCH A;  3GIG A;  1S14 A;  3K98 A;  1NHI A;  3A0Z A;  3EHJ A;  1UYG A;  3U2D A;  4LP0 A;  1ZXM A;  1UYD A;  2XDK A;  1TID A;  2Q8I A;  3CRL A;  4U93 A;  2ESA A;  4YKY A;  1MX0 A;  1YER A;  2YE8 A;  4O07 A;  1Y8P A;  2YKI A;  1YET A;  4I3H A;  2WEP A;  3INW A;  2WI6 A;  4U7O A;  5M4M A;  2QFO A;  2VCI A;  3C0E A;  1UY6 A;  2CG9 A;  4LPB A;  2YEJ A;  4L8Z A;  4L91 A;  5M4H A;  3FV5 A;  2WI4 A;  4AWO A;  3Q5L A;  2YEE A;  3T10 A;  4HXZ A;  4FMT A;  3VHA A;  3C11 A;  4XD8 A;  3PEH A;  5CTX A;  4R3A A;  3EHH A;  4XDM A;  2XJG A;  5CPH A;  3A0R A;  2XX5 A;  4ZKI A;  2PNR A;  2WI1 A;  3ZKD A;  4EGI A;  4L90 A;  2WI5 A;  4GQT A;  5BOD A;  3B25 A;  3OW6 A;  2GQP A;  2C2A A;  4DUH A;  2BU2 A;  5CTY A;  4EFU A;  2H8M A;  2Q2E B;  2UWD A;  2XDU A;  3TZ5 A;  1TC0 A;  4BQJ A;  2BZ5 A;  4GGL A;  4Q20 A;  4HZ0 A;  3R4M A;  2YKB A;  3B26 A;  3HYZ A;  4GT8 A;  1KZN A;  4CWO A;  3O0I A;  3VHD A;  3RLQ A;  4JAV A;  4KP4 A;  3TTZ A;  4NH9 A;  4E02 A;  1UYF A;  2BTZ A;  4FCQ A;  1UY9 A;  2HKJ A;  4HY1 A;  4JQL A;  1BYQ A;  4MPC A;  2H55 A;  3TZ2 A;  5CF0 A;  5D7R A;  4ASF A;  3RLP A;  3LNU A;  4V25 A;  1YSR A;  3D0B A;  4YKZ A;  2Q8H A;  4XKO A;  4XKA A;  3ZXQ A;  4XE2 A;  3T1K A;  5L3J A;  3OPD A;  4URM A;  4LWI A;  2CCS A;  4XCJ A;  5J6A A;  2YI6 A;  3TZ0 A;  5FNF A;  3B27 A;  5CTU A;  1TIL A;  2XAB A;  5M4P A;  5D7D A;  1Y4U A;  2VW5 A;  5IDJ A;  1Z5B A;  3VAD A;  5IN9 A;  2IWX A;  4FCP A;  3KE6 A;  3RKZ A;  5C93 A;  2YGE A;  3JZ3 A;  4NH7 A;  5FNC A;  1KIJ A;  3BM9 A;  2IWS A;  4K4O A;  4R3M A;  2YEH A;  3K99 A;  3B24 A;  1I59 A;  3QTF A;  3R4N A;  4QPJ A;  4XIP A;  2YEA A;  4YKW A;  4XIQ A;  1S16 A;  3G7B A;  4FPP A;  3O6O A;  4BIZ A;  2O1V A;  3A0W A;  3D2R A;  1ZXN A;  2JKI A;  4BQG A;  3R4O A;  4YKT A;  3GIE A;  2BRE A;  1I58 A;  2BU5 A;  2EXL A;  2XX4 A;  2CH4 A;  4H7Q A;  1Z5A A;  1TC6 A;  2XJX A;  3PEJ A;  2VCJ A;  2ZDX A;  1UY8 A;  4E01 A;  4GFN A;  4P8O A;  1YES A;  2YK2 A;  2YE7 A;  4ZVI A;  3D36 A;  1UYL A;  3ZKB A;  4CWS A;  3R91 A;  3OWD A;  2XCM A;  3MNR P;  2FXS A;  4EEH A;  1AJ6 A;  4PL9 A;  2YE4 A;  3IED A;  1AM1 A;  3TUH A;  3A0T A;  2BU7 A;  1TBW A;  3LPS A;  2FWY A;  1BGQ A;  3NMQ A;  2YK9 A;  1BKN A;  2BRC A;  3ZM7 A;  1U0Z A;  2YKJ A;  3INX A;  3SL2 A;  4CE2 A;  4XTJ A;  1AH6 A;  1YC4 A;  4HYP A;  4B6C A;  4XIT A;  3T2S A;  4KFG A;  4LWE A;  1YC3 A;  4QPK A;  4WUD A;  4L94 A;  1THN A;  4MP2 A;  4B7P A;  5M4N A;  1U2O A;  2XDX A;  4KTN A;  4WUC A;  5GGZ A;  4CWQ A;  4XC0 A;  4HXW A;  4AWP A;  4CWT A;  4H81 A;  3TZ4 A;  1AH8 A;  4XCL A;  3ZXO A;  1MU5 A;  2YKC A;  1BXD A;  5FWK A;  5BOC A;  5M4E A;  3T0Z A;  1PVG A;  4CWP A;  2FYP A;  2YE5 A;  3DGE A;  2YED A;  4NH8 A;  3OWB A;  2YJX A;  4XKK A;  2IOR A;  2HG1 A;  2YKE A;  4GCZ A;  1B3Q A;  3HYY A;  2XDS A;  2VWC A;  2YE9 A;  3CRK A;  4EGK A;  3K60 A;  4O05 A;  3CGY A;  2GFD A;  3GIF A;  2YEB A;  2IOP A;  2BT0 A;  1NHJ A;  4CE1 A;  1B62 A;  3QDD A;  2XHX A;  5F3K A;  3EKO A;  4PU9 A;  2WEQ A;  1EA6 A;  2ZDY A;  1QYE A;  2QG2 A;  2YJW A;  4CE3 A;  2YI7 A;  4LWF A;  4MB9 A;  1Y8O A;  5FND A;  2O1U A;  2Q8F A;  1QY8 A;  2AKP A;  2XDL A;  1UYC A;  3T0H A;  3VHC A;  3CGZ A;  4R1F A;  4AWQ A;  3BMY A;  4P7A A;  1EI1 A;  1US7 A;  3A0X A;  5D6P A;  4EM7 A;  3B28 A;  5F5R A;  4YKQ A;  4EGH A;  5IDM A;  4URL A;  2IOQ A;  1AMW A;  1YS3 A;  2YEF A;  2CCT A;  2XX2 A;  4MOT A;  1I5D A;  1NHH A;  4JAS A;  4WUB A;  2YE6 A;  4W7T A;  4FCR A;  4H85 A;  1H7S A;  3EHF A;  4X9L A;  3WHA A;  4O04 A;  1B63 A;  2ZKJ A;  2IWU A;  1ZW9 A;  4XIR A;  4AS9 A;  1I5C A;  4YKX A;  2FWZ A;  2QG0 A;  4CWR A;  2E0A A;  3HEK A;  2YE3 A;  3CWV A;  3FT5 A;  1Z5C A;  1L0O A;  1YT1 A;  2BSM A;  4PRX A;  4PRV A;  2YGF A;  2YEG A;  1TH8 A;  1JM6 A;  1UYK A;  3FT8 A;  4I5S A;  1Y4S A;  3HZ5 A;  1I5A A;  4MP7 A;  3WQ9 A;  4U7N A;  4ASA A;  2BYI A;  1Y8N A;  3GIG B;  1OSF A;  4E00 A;  1UY7 A;  5M4K A;  1UYE A;  1UYM A;  2WI7 A;  4O09 A;  3A0Y A;  4DZY A;  1YC1 A;  4KSH A;  1UYI A;  4BAE A;  2K5B A;  2Q8G A;  4URO A;  2JJC A;  4LWG A;  1H7U A;  3H80 A;  4CWN A;  4HY6 A;  5J71 A;  2XHR A;  1YT2 A;  4GEE A;  2CCU A;  4MPE A;  3U67 A;  3Q5J A;  3HZ1 A;  4O0B A;  3HHU A;  5CTW A;  2O1W A;  4MPN A;  3G7E A;  2YEC A;  2CGF A;  2YI5 A;  4BXI A;  2XK2 A;  5D6Q A;  1R62 A;  3OMU A;  4URN A;  2WI2 A;  2BU6 A;  2QF6 A;  3Q5K A;  4EFT A;  3G75 A;  2WER A;  1I5B A;  1YSZ A;  2XD6 A;  3H4L A;  3RLR A;  1YT0 A;  4V26 A;  4JAU A;  1UYH A;  4LWH A;  3U2K A;  2XHT A;  4MBC A;  4KQV A;  4ASG A;  1GJV A;  2BU8 A;  1A4H A;  2WI3 A;  2YI0 A;  3EHG A;  1QZR A;  3R4P A;  5D7C A;  2BYH A;  3R92 A;  4EMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...