4NH9A

Correlation between chemotype-dependent binding conformations of hsp90 alpha/beta and isoform selectivity
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
265
structure length
214
Chain Sequence
b'SEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTEKTVWDWELMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title Correlation between chemotype-dependent binding conformations of HSP90 alpha / beta and isoform selectivity-Implications for the structure-based design of HSP90 alpha / beta selective inhibitors for treating neurodegenerative diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 55
structure length 214
sequence length 265
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4nh9A00
2WI4A 4HY6A 1YC4A 4EFTA 2QF6A 2BU2A 3HZ1A 2YEHA 3CGZA 3PEJA 2BU6A 4KQVA 3D2RA 5FNDA 4GEEA 2BU7A 2WEPA 1ZXNA 2IORA 3VADA 2YEEA 3QTFA 1B3QA 2IOPA 4CWSA 4CWTA 2Q2EB 4BAEA 2YJWA 3RLQA 4KFGA 2YI5A 4CWFA 2WERA 3K99A 4L93A 4DZYA 5FNFA 4O0BA 4XC0A 5CTUA 5D6QA 3Q5LA 2Q8FA 3QDDA 3DGEA 2YGAA 3U67A 3LPSA 4ASAA 4EFUA 4LWHA 2K5BA 1Z59A 4XIPA 4ZVIA 2CH4A 5CF0A 4MPEA 3FT8A 1THNA 3B28A 5BODA 3C11A 1YSRA 3T0HA 2WI2A 4ASFA 3Q5KA 3G75A 1ZWHA 2WEQA 2Q8IA 2CG9A 5C93A 2JJCA 2YKIA 2YK2A 4CWOA 1YESA 5CTXA 3ZKBA 5M4PA 1TH8A 3U2KA 1NHIA 4AWPA 2XJGA 2BYHA 4Q20A 1BXDA 3EHHA 3A0ZA 3Q5JA 5GGZA 2XDKA 4LWEA 2ZDYA 5BOCA 4WUBA 3T10A 1YETA 5IDJA 1H7UA 4GQTA 1GKXA 4XD8A 4EGHA 3FV5A 4ZKIA 1Y4SA 3R4OA 2CGFA 4O07A 1MX0A 1OSFA 5CTWA 5D7DA 4HYPA 2YEAA 1I58A 2EXLA 4EM7A 2QG2A 3K98A 1UYCA 2YECA 2HCHA 3CRKA 4B7PA 3RLRA 3OPDA 5FWKA 1TILA 4H85A 3GIGB 4JAUA 2BTZA 4R3MA 1UY8A 1UYEA 3O2FA 3TZ2A 1I59A 3B25A 3MNRP 2YE5A 2ZDXA 4E00A 2YKJA 4GT8A 3BMYA 2XJXA 1TBWA 2O1VA 5CPHA 5FNCA 4CE1A 5IDMA 5M4KA 3B27A 1I5DA 3FT5A 2O1WA 3R4PA 4XIQA 4B6CA 4BXIA 2YEDA 5D7CA 4FCQA 4R1FA 4CWPA 3TZ0A 3CGYA 4CWNA 4W7TA 1R62A 4URLA 2GFDA 4U7OA 2YKBA 2HG1A 3ZXOA 1MU5A 1B63A 3CRLA 4H7QA 4KP4A 1YT0A 1AMWA 3B24A 4LPBA 3VHAA 4BIUA 2YI6A 4MPCA 2AKPA 2BSMA 5CTYA 4URMA 4ASGA 2JKIA 2E0AA 4YKZA 2QG0A 4KTNA 4BQGA 2YE9A 4XKAA 2XJJA 1S14A 1KIJA 3GIFA 1QZRA 1I5BA 3TZ5A 5F5RA 2Q8GA 2YJXA 3T2SA 3EKRA 3B26A 4URNA 2VWCA 3BM9A 2WI5A 4V25A 3D36A 1YS3A 2BU8A 1UYFA 4NH7A 4NH8A 4FMTA 2XCMA 4PRXA 4FPPA 1BGQA 4E02A 2YEBA 1A4HA 1B62A 3INXA 2IWSA 3EHFA 1I5AA 2XX2A 3WQ9A 2ZKJA 2WI1A 1UYLA 4JAVA 3H4LA 3EKOA 3OMUA 4YKQA 2BU5A 1NHHA 1EA6A 3HHUA 4XCLA 2WI3A 5M4EA 3JZ3A 4QPJA 2PNRA 2XK2A 5J6AA 3ZXQA 4EEHA 4EGKA 3A0XA 4NH9A 4YKUA 1Z5CA 1ZXMA 4V26A 1U0ZA 2CCTA 3OWBA 1QYEA 4KSGA 3R91A 3EHGA 3R4NA 4PRVA 4GCZA 1YC1A 3O6OA 4HXZA 2UWDA 4HYMA 2CCUA 3LNUA 4L90A 4I5SA 4K4OA 3RKZA 2YEJA 3D0BA 4XCJA 2VW5A 1AM1A 4GFNA 3O0IA 4LWFA 1U2OA 1TC0A 2QFOA 3T0ZA 1UY7A 2IOQA 3C0EA 4LWIA 4L8ZA 2XDLA 2XDXA 3NMQA 4XDMA 1ID0A 1L0OA 4BIZA 4UROA 3GIEA 2YE6A 4YKWA 2FWZA 4QPKA 5L3JA 2BZ5A 1YT1A 2XABA 1UYDA 4YKRA 1YT2A 4AS9A 4LP0A 4P7AA 3KE6A 4EMVA 2BT0A 2FWYA 4MP7A 4AWOA 3TUHA 1I5CA 1ZW9A 4XKKA 1S16A 1EI1A 1YC3A 4JQLA 3IEDA 3H80A 1QY8A 3HZ5A 4PL9A 1BYQA 2XHXA 1US7A 2WI7A 4PU9A 2YEGA 5J71A 3R4MA 1YERA 3G7EA 4HXWA 4MPNA 4O05A 2O1UA 4CWQA 1UY6A 2ESAA 4HZ5A 2YKEA 3TTZA 1GJVA 5M4HA 2XX4A 2BRCA 1KZNA 3RLPA 4XIRA 3K97A 1PVGA 1TIDA 3T1KA 5M4NA 2YKCA 2BYIA 2XHRA 3A0WA 4AWQA 1JM6A 4EGIA 5M4MA 1YSZA 1AH8A 4O04A 4HY1A 4XTJA 2YE8A 3VHCA 4O09A 3OW6A 2YI0A 4JASA 3GIGA 3VHDA 4FCPA 1TC6A 3U2DA 4WUDA 1UYHA 1NHJA 3ZKDA 2VCJA 4GGLA 2YGEA 4MB9A 5D6PA 3INWA 4CE3A 4WUCA 4P8OA 2FYPA 2YE3A 2YK9A 1UYIA 4R3AA 4FCRA 5F3KA 2VCIA 1UYMA 4I3HA 3HYZA 3HYYA 2YEFA 3A0RA 4X9LA 1AJ6A 2XDSA 3ZM7A 2YE2A 2CCSA 2H8MA 1Y8OA 4XE2A 4U93A 4CWRA 2XHTA 4MP2A 3WHAA 1Y4UA 2ZBKB 2IWUA 2XX5A 1H7SA 3OWDA 3G7BA 3CWVA 1AH6A 3R92A 2FXSA 1Z5BA 3SL2A 3HEKA 2H55A 4BQJA 2YI7A 5D7RA 4L94A 1UY9A 4XKOA 1Y8NA 1UYKA 4KSHA 4LWGA 4DUHA 4HZ0A 3EHJA 4MOTA 2YGFA 2XD6A 3PEHA 4U7NA 4YKXA 2YE4A 1Y8PA 3A0TA 1Z5AA 2IWXA 2YEIA 5IN9A 3TZ4A 4CE2A 2GQPA 3A0YA 4YKTA 1UYGA 4E01A 4XITA 1GKZA 1BKNA 4YKYA 2Q8HA 2WI6A 4L91A 2BREA 2C2AA 3K60A 4ASBA 2HKJA 4MBCA 2XDUA 2YE7A 4H81A
chains in the Genus database with same CATH superfamily
2WI4A 4HY6A 5JENA 1YC4A 4EFTA 2QF6A 2BU2A 3HZ1A 2YEHA 3CGZA 3PEJA 2BU6A 4KQVA 3D2RA 5FNDA 4GEEA 2BU7A 2WEPA 1ZXNA 2IORA 3VADA 2YEEA 3QTFA 1B3QA 2IOPA 4CWSA 4CWTA 2Q2EB 4BAEA 2YJWA 3RLQA 4KFGA 2YI5A 4CWFA 2WERA 3K99A 4L93A 4DZYA 5FNFA 4O0BA 4XC0A 5CTUA 5D6QA 3Q5LA 2Q8FA 3QDDA 3DGEA 2YGAA 3U67A 3LPSA 4ASAA 4EFUA 4LWHA 2K5BA 1Z59A 4XIPA 4ZVIA 2CH4A 5CF0A 4MPEA 3FT8A 1THNA 3B28A 5BODA 3C11A 1YSRA 3T0HA 2WI2A 4ASFA 3Q5KA 3G75A 1ZWHA 2WEQA 2Q8IA 2CG9A 5C93A 2JJCA 2YKIA 2YK2A 4CWOA 1YESA 5CTXA 3ZKBA 5M4PA 1TH8A 3U2KA 1NHIA 4AWPA 2XJGA 2BYHA 4Q20A 1BXDA 3EHHA 3A0ZA 3Q5JA 5GGZA 2XDKA 4LWEA 2ZDYA 5BOCA 4WUBA 3T10A 1YETA 5IDJA 1H7UA 4GQTA 1GKXA 4XD8A 4EGHA 3FV5A 4ZKIA 1Y4SA 3R4OA 2CGFA 4O07A 1MX0A 1OSFA 5CTWA 5D7DA 4HYPA 2YEAA 1I58A 2EXLA 4EM7A 2QG2A 3K98A 1UYCA 2YECA 2HCHA 3CRKA 4B7PA 3RLRA 3OPDA 5FWKA 1TILA 4H85A 3GIGB 4JAUA 2BTZA 4R3MA 1UY8A 1UYEA 3O2FA 3TZ2A 1I59A 3B25A 3MNRP 2YE5A 2ZDXA 4E00A 2YKJA 4GT8A 3BMYA 2XJXA 1TBWA 2O1VA 5CPHA 2FTKA 5FNCA 4CE1A 5IDMA 5M4KA 3B27A 1I5DA 3FT5A 2O1WA 3R4PA 4XIQA 4B6CA 4BXIA 2YEDA 5D7CA 4FCQA 4R1FA 4CWPA 3TZ0A 3CGYA 4CWNA 4W7TA 1R62A 4URLA 2GFDA 4U7OA 2YKBA 3CYGA 2HG1A 3ZXOA 1MU5A 1B63A 3CRLA 4H7QA 4KP4A 1YT0A 1AMWA 3B24A 4LPBA 3VHAA 4BIUA 2YI6A 4MPCA 2AKPA 2BSMA 5CTYA 4URMA 4ASGA 2JKIA 2E0AA 4YKZA 2QG0A 4KTNA 4BQGA 2YE9A 4XKAA 2XJJA 1S14A 1KIJA 2C1IA 3GIFA 1QZRA 1I5BA 3TZ5A 5F5RA 2Q8GA 2YJXA 3T2SA 3EKRA 3B26A 4URNA 2VWCA 3BM9A 2WI5A 4V25A 3D36A 1YS3A 2BU8A 1UYFA 4NH7A 4NH8A 4FMTA 2XCMA 4PRXA 4FPPA 1BGQA 4E02A 2YEBA 1A4HA 1B62A 1F51A 3INXA 2IWSA 3EHFA 1I5AA 2XX2A 3WQ9A 2ZKJA 2WI1A 1UYLA 4JAVA 3H4LA 3EKOA 3OMUA 4YKQA 2BU5A 1NHHA 1EA6A 3HHUA 4XCLA 2WI3A 5M4EA 3JZ3A 4QPJA 2PNRA 2XK2A 5J6AA 3ZXQA 4EEHA 4EGKA 3A0XA 4NH9A 4YKUA 1Z5CA 1ZXMA 4V26A 1U0ZA 2CCTA 3OWBA 1QYEA 4KSGA 3R91A 3EHGA 3R4NA 4PRVA 1IXMA 4GCZA 1YC1A 3O6OA 4HXZA 2UWDA 4HYMA 2CCUA 3LNUA 4L90A 4I5SA 4K4OA 3RKZA 2YEJA 3D0BA 4XCJA 2VW5A 1AM1A 4GFNA 3O0IA 4LWFA 1U2OA 1TC0A 2QFOA 3T0ZA 1UY7A 2IOQA 3C0EA 4LWIA 4L8ZA 2XDLA 2XDXA 3NMQA 4XDMA 1ID0A 1L0OA 4BIZA 4UROA 3GIEA 2YE6A 4YKWA 2FWZA 4QPKA 5L3JA 2BZ5A 1YT1A 2XABA 1UYDA 4YKRA 1YT2A 4AS9A 4LP0A 4P7AA 3KE6A 4EMVA 2BT0A 2FWYA 4MP7A 4AWOA 3TUHA 1I5CA 1ZW9A 4XKKA 1S16A 1EI1A 1YC3A 4JQLA 3IEDA 3H80A 1QY8A 3HZ5A 4PL9A 1BYQA 2XHXA 1US7A 2WI7A 4PU9A 2YEGA 5J71A 3R4MA 1YERA 3G7EA 4HXWA 4MPNA 4O05A 2O1UA 4CWQA 1UY6A 2ESAA 4HZ5A 3LMMA 2YKEA 3TTZA 1GJVA 5M4HA 2XX4A 2BRCA 1KZNA 3RLPA 4XIRA 3K97A 1PVGA 1TIDA 3T1KA 5M4NA 2YKCA 2BYIA 2XHRA 3A0WA 4AWQA 1JM6A 4EGIA 5M4MA 1YSZA 1AH8A 4O04A 4HY1A 4XTJA 2YE8A 3VHCA 4O09A 3OW6A 2YI0A 4JASA 2HHIA 3GIGA 3VHDA 4FCPA 1TC6A 3U2DA 4WUDA 1UYHA 1NHJA 3ZKDA 2VCJA 4GGLA 2YGEA 4MB9A 5D6PA 3INWA 4CE3A 4WUCA 4P8OA 2FYPA 2YE3A 2YK9A 1UYIA 4R3AA 4FCRA 5F3KA 2VCIA 1UYMA 4I3HA 3HYZA 3HYYA 2YEFA 3A0RA 4X9LA 1AJ6A 4E72A 2C1GA 2XDSA 3ZM7A 2YE2A 2CCSA 2H8MA 1Y8OA 4XE2A 4U93A 4CWRA 2XHTA 4MP2A 3WHAA 1Y4UA 2ZBKB 2IWUA 2XX5A 1H7SA 3OWDA 3G7BA 3CWVA 1AH6A 3R92A 2FXSA 1Z5BA 3SL2A 3HEKA 2H55A 4BQJA 2YI7A 5D7RA 4L94A 1UY9A 4XKOA 1Y8NA 1UYKA 4KSHA 4LWGA 4DUHA 4HZ0A 3EHJA 4MOTA 2YGFA 2XD6A 3PEHA 4U7NA 4YKXA 2YE4A 1Y8PA 3S5TA 3A0TA 1Z5AA 2IWXA 2YEIA 5IN9A 3TZ4A 4CE2A 2GQPA 3A0YA 4YKTA 1UYGA 4E01A 4XITA 1GKZA 1BKNA 4YKYA 2Q8HA 2WI6A 4L91A 2BREA 2C2AA 3K60A 4ASBA 2HKJA 4MBCA 2XDUA 2YE7A 4H81A
chains in the Genus database with same CATH topology
2WI4A 4HY6A 1YC4A 4EFTA 2QF6A 2BU2A 3HZ1A 2YEHA 3CGZA 3PEJA 2BU6A 4KQVA 3D2RA 5FNDA 4GEEA 2BU7A 2WEPA 1ZXNA 2IORA 3VADA 2YEEA 3QTFA 1B3QA 2IOPA 4CWSA 4CWTA 2Q2EB 4BAEA 2YJWA 3RLQA 4KFGA 2YI5A 4CWFA 2WERA 3K99A 4L93A 4DZYA 5FNFA 4O0BA 4XC0A 5CTUA 5D6QA 3Q5LA 2Q8FA 3QDDA 3DGEA 2YGAA 3U67A 3LPSA 4ASAA 4EFUA 4LWHA 2K5BA 1Z59A 4XIPA 4ZVIA 2CH4A 5CF0A 4MPEA 3FT8A 1THNA 3B28A 5BODA 3C11A 1YSRA 3T0HA 2WI2A 4ASFA 3Q5KA 3G75A 1ZWHA 2WEQA 2Q8IA 2CG9A 5C93A 2JJCA 2YKIA 2YK2A 4CWOA 1YESA 5CTXA 3ZKBA 5M4PA 1TH8A 3U2KA 1NHIA 4AWPA 2XJGA 2BYHA 4Q20A 1BXDA 3EHHA 3A0ZA 3Q5JA 5GGZA 2XDKA 4LWEA 2ZDYA 5BOCA 4WUBA 3T10A 1YETA 5IDJA 1H7UA 4GQTA 1GKXA 4XD8A 4EGHA 3FV5A 4ZKIA 1Y4SA 3R4OA 2CGFA 4O07A 1MX0A 1OSFA 5CTWA 5D7DA 4HYPA 2YEAA 1I58A 2EXLA 4EM7A 2QG2A 3K98A 1UYCA 2YECA 2HCHA 3CRKA 4B7PA 3RLRA 3OPDA 5FWKA 1TILA 4H85A 3GIGB 4JAUA 2BTZA 4R3MA 1UY8A 1UYEA 3O2FA 3TZ2A 1I59A 3B25A 3MNRP 2YE5A 2ZDXA 4E00A 2YKJA 4GT8A 3BMYA 2XJXA 1TBWA 2O1VA 5CPHA 5FNCA 4CE1A 5IDMA 5M4KA 3B27A 1I5DA 3FT5A 2O1WA 3R4PA 4XIQA 4B6CA 4BXIA 2YEDA 5D7CA 4FCQA 4R1FA 4CWPA 3TZ0A 3CGYA 4CWNA 4W7TA 1R62A 4URLA 2GFDA 4U7OA 2YKBA 2HG1A 3ZXOA 1MU5A 1B63A 3CRLA 4H7QA 4KP4A 1YT0A 1AMWA 3B24A 4LPBA 3VHAA 4BIUA 2YI6A 4MPCA 2AKPA 2BSMA 5CTYA 4URMA 4ASGA 2JKIA 2E0AA 4YKZA 2QG0A 4KTNA 4BQGA 2YE9A 4XKAA 2XJJA 1S14A 1KIJA 3GIFA 1QZRA 1I5BA 3TZ5A 5F5RA 2Q8GA 2YJXA 3T2SA 3EKRA 3B26A 4URNA 2VWCA 3BM9A 2WI5A 4V25A 3D36A 1YS3A 2BU8A 1UYFA 4NH7A 4NH8A 4FMTA 2XCMA 4PRXA 4FPPA 1BGQA 4E02A 2YEBA 1A4HA 1B62A 3INXA 2IWSA 3EHFA 1I5AA 2XX2A 3WQ9A 2ZKJA 2WI1A 1UYLA 4JAVA 3H4LA 3EKOA 3OMUA 4YKQA 2BU5A 1NHHA 1EA6A 3HHUA 4XCLA 2WI3A 5M4EA 3JZ3A 4QPJA 2PNRA 2XK2A 5J6AA 3ZXQA 4EEHA 4EGKA 3A0XA 4NH9A 4YKUA 1Z5CA 1ZXMA 4V26A 1U0ZA 2CCTA 3OWBA 1QYEA 4KSGA 3R91A 3EHGA 3R4NA 4PRVA 4GCZA 1YC1A 3O6OA 4HXZA 2UWDA 4HYMA 2CCUA 3LNUA 4L90A 4I5SA 4K4OA 3RKZA 2YEJA 3D0BA 4XCJA 2VW5A 1AM1A 4GFNA 3O0IA 4LWFA 1U2OA 1TC0A 2QFOA 3T0ZA 1UY7A 2IOQA 3C0EA 4LWIA 4L8ZA 2XDLA 2XDXA 3NMQA 4XDMA 1ID0A 1L0OA 4BIZA 4UROA 3GIEA 2YE6A 4YKWA 2FWZA 4QPKA 5L3JA 2BZ5A 1YT1A 2XABA 1UYDA 4YKRA 1YT2A 4AS9A 4LP0A 4P7AA 3KE6A 4EMVA 2BT0A 2FWYA 4MP7A 4AWOA 3TUHA 1I5CA 1ZW9A 4XKKA 1S16A 1EI1A 1YC3A 4JQLA 3IEDA 3H80A 1QY8A 3HZ5A 4PL9A 1BYQA 2XHXA 1US7A 2WI7A 4PU9A 2YEGA 5J71A 3R4MA 1YERA 3G7EA 4HXWA 4MPNA 4O05A 2O1UA 4CWQA 1UY6A 2ESAA 4HZ5A 2YKEA 3TTZA 1GJVA 5M4HA 2XX4A 2BRCA 1KZNA 3RLPA 4XIRA 3K97A 1PVGA 1TIDA 3T1KA 5M4NA 2YKCA 2BYIA 2XHRA 3A0WA 4AWQA 1JM6A 4EGIA 5M4MA 1YSZA 1AH8A 4O04A 4HY1A 4XTJA 2YE8A 3VHCA 4O09A 3OW6A 2YI0A 4JASA 3GIGA 3VHDA 4FCPA 1TC6A 3U2DA 4WUDA 1UYHA 1NHJA 3ZKDA 2VCJA 4GGLA 2YGEA 4MB9A 5D6PA 3INWA 4CE3A 4WUCA 4P8OA 2FYPA 2YE3A 2YK9A 1UYIA 4R3AA 4FCRA 5F3KA 2VCIA 1UYMA 4I3HA 3HYZA 3HYYA 2YEFA 3A0RA 4X9LA 1AJ6A 2XDSA 3ZM7A 2YE2A 2CCSA 2H8MA 1Y8OA 4XE2A 4U93A 4CWRA 2XHTA 4MP2A 3WHAA 1Y4UA 2ZBKB 2IWUA 2XX5A 1H7SA 3OWDA 3G7BA 3CWVA 1AH6A 3R92A 2FXSA 1Z5BA 3SL2A 3HEKA 2H55A 4BQJA 2YI7A 5D7RA 4L94A 1UY9A 4XKOA 1Y8NA 1UYKA 4KSHA 4LWGA 4DUHA 4HZ0A 3EHJA 4MOTA 2YGFA 2XD6A 3PEHA 4U7NA 4YKXA 2YE4A 1Y8PA 3A0TA 1Z5AA 2IWXA 2YEIA 5IN9A 3TZ4A 4CE2A 2GQPA 3A0YA 4YKTA 1UYGA 4E01A 4XITA 1GKZA 1BKNA 4YKYA 2Q8HA 2WI6A 4L91A 2BREA 2C2AA 3K60A 4ASBA 2HKJA 4MBCA 2XDUA 2YE7A 4H81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WI4 A;  4HY6 A;  1YC4 A;  4EFT A;  2QF6 A;  2BU2 A;  3HZ1 A;  2YEH A;  3CGZ A;  3PEJ A;  2BU6 A;  4KQV A;  3D2R A;  5FND A;  4GEE A;  2BU7 A;  2WEP A;  1ZXN A;  2IOR A;  3VAD A;  2YEE A;  3QTF A;  1B3Q A;  2IOP A;  4CWS A;  4CWT A;  2Q2E B;  4BAE A;  2YJW A;  3RLQ A;  4KFG A;  2YI5 A;  4CWF A;  2WER A;  3K99 A;  4L93 A;  4DZY A;  5FNF A;  4O0B A;  4XC0 A;  5CTU A;  5D6Q A;  3Q5L A;  2Q8F A;  3QDD A;  3DGE A;  2YGA A;  3U67 A;  3LPS A;  4ASA A;  4EFU A;  4LWH A;  2K5B A;  1Z59 A;  4XIP A;  4ZVI A;  2CH4 A;  5CF0 A;  4MPE A;  3FT8 A;  1THN A;  3B28 A;  5BOD A;  3C11 A;  1YSR A;  3T0H A;  2WI2 A;  4ASF A;  3Q5K A;  3G75 A;  1ZWH A;  2WEQ A;  2Q8I A;  2CG9 A;  5C93 A;  2JJC A;  2YKI A;  2YK2 A;  4CWO A;  1YES A;  5CTX A;  3ZKB A;  5M4P A;  1TH8 A;  3U2K A;  1NHI A;  4AWP A;  2XJG A;  2BYH A;  4Q20 A;  1BXD A;  3EHH A;  3A0Z A;  3Q5J A;  5GGZ A;  2XDK A;  4LWE A;  2ZDY A;  5BOC A;  4WUB A;  3T10 A;  1YET A;  5IDJ A;  1H7U A;  4GQT A;  1GKX A;  4XD8 A;  4EGH A;  3FV5 A;  4ZKI A;  1Y4S A;  3R4O A;  2CGF A;  4O07 A;  1MX0 A;  1OSF A;  5CTW A;  5D7D A;  4HYP A;  2YEA A;  1I58 A;  2EXL A;  4EM7 A;  2QG2 A;  3K98 A;  1UYC A;  2YEC A;  2HCH A;  3CRK A;  4B7P A;  3RLR A;  3OPD A;  5FWK A;  1TIL A;  4H85 A;  3GIG B;  4JAU A;  2BTZ A;  4R3M A;  1UY8 A;  1UYE A;  3O2F A;  3TZ2 A;  1I59 A;  3B25 A;  3MNR P;  2YE5 A;  2ZDX A;  4E00 A;  2YKJ A;  4GT8 A;  3BMY A;  2XJX A;  1TBW A;  2O1V A;  5CPH A;  5FNC A;  4CE1 A;  5IDM A;  5M4K A;  3B27 A;  1I5D A;  3FT5 A;  2O1W A;  3R4P A;  4XIQ A;  4B6C A;  4BXI A;  2YED A;  5D7C A;  4FCQ A;  4R1F A;  4CWP A;  3TZ0 A;  3CGY A;  4CWN A;  4W7T A;  1R62 A;  4URL A;  2GFD A;  4U7O A;  2YKB A;  2HG1 A;  3ZXO A;  1MU5 A;  1B63 A;  3CRL A;  4H7Q A;  4KP4 A;  1YT0 A;  1AMW A;  3B24 A;  4LPB A;  3VHA A;  4BIU A;  2YI6 A;  4MPC A;  2AKP A;  2BSM A;  5CTY A;  4URM A;  4ASG A;  2JKI A;  2E0A A;  4YKZ A;  2QG0 A;  4KTN A;  4BQG A;  2YE9 A;  4XKA A;  2XJJ A;  1S14 A;  1KIJ A;  3GIF A;  1QZR A;  1I5B A;  3TZ5 A;  5F5R A;  2Q8G A;  2YJX A;  3T2S A;  3EKR A;  3B26 A;  4URN A;  2VWC A;  3BM9 A;  2WI5 A;  4V25 A;  3D36 A;  1YS3 A;  2BU8 A;  1UYF A;  4NH7 A;  4NH8 A;  4FMT A;  2XCM A;  4PRX A;  4FPP A;  1BGQ A;  4E02 A;  2YEB A;  1A4H A;  1B62 A;  3INX A;  2IWS A;  3EHF A;  1I5A A;  2XX2 A;  3WQ9 A;  2ZKJ A;  2WI1 A;  1UYL A;  4JAV A;  3H4L A;  3EKO A;  3OMU A;  4YKQ A;  2BU5 A;  1NHH A;  1EA6 A;  3HHU A;  4XCL A;  2WI3 A;  5M4E A;  3JZ3 A;  4QPJ A;  2PNR A;  2XK2 A;  5J6A A;  3ZXQ A;  4EEH A;  4EGK A;  3A0X A;  4NH9 A;  4YKU A;  1Z5C A;  1ZXM A;  4V26 A;  1U0Z A;  2CCT A;  3OWB A;  1QYE A;  4KSG A;  3R91 A;  3EHG A;  3R4N A;  4PRV A;  4GCZ A;  1YC1 A;  3O6O A;  4HXZ A;  2UWD A;  4HYM A;  2CCU A;  3LNU A;  4L90 A;  4I5S A;  4K4O A;  3RKZ A;  2YEJ A;  3D0B A;  4XCJ A;  2VW5 A;  1AM1 A;  4GFN A;  3O0I A;  4LWF A;  1U2O A;  1TC0 A;  2QFO A;  3T0Z A;  1UY7 A;  2IOQ A;  3C0E A;  4LWI A;  4L8Z A;  2XDL A;  2XDX A;  3NMQ A;  4XDM A;  1ID0 A;  1L0O A;  4BIZ A;  4URO A;  3GIE A;  2YE6 A;  4YKW A;  2FWZ A;  4QPK A;  5L3J A;  2BZ5 A;  1YT1 A;  2XAB A;  1UYD A;  4YKR A;  1YT2 A;  4AS9 A;  4LP0 A;  4P7A A;  3KE6 A;  4EMV A;  2BT0 A;  2FWY A;  4MP7 A;  4AWO A;  3TUH A;  1I5C A;  1ZW9 A;  4XKK A;  1S16 A;  1EI1 A;  1YC3 A;  4JQL A;  3IED A;  3H80 A;  1QY8 A;  3HZ5 A;  4PL9 A;  1BYQ A;  2XHX A;  1US7 A;  2WI7 A;  4PU9 A;  2YEG A;  5J71 A;  3R4M A;  1YER A;  3G7E A;  4HXW A;  4MPN A;  4O05 A;  2O1U A;  4CWQ A;  1UY6 A;  2ESA A;  4HZ5 A;  2YKE A;  3TTZ A;  1GJV A;  5M4H A;  2XX4 A;  2BRC A;  1KZN A;  3RLP A;  4XIR A;  3K97 A;  1PVG A;  1TID A;  3T1K A;  5M4N A;  2YKC A;  2BYI A;  2XHR A;  3A0W A;  4AWQ A;  1JM6 A;  4EGI A;  5M4M A;  1YSZ A;  1AH8 A;  4O04 A;  4HY1 A;  4XTJ A;  2YE8 A;  3VHC A;  4O09 A;  3OW6 A;  2YI0 A;  4JAS A;  3GIG A;  3VHD A;  4FCP A;  1TC6 A;  3U2D A;  4WUD A;  1UYH A;  1NHJ A;  3ZKD A;  2VCJ A;  4GGL A;  2YGE A;  4MB9 A;  5D6P A;  3INW A;  4CE3 A;  4WUC A;  4P8O A;  2FYP A;  2YE3 A;  2YK9 A;  1UYI A;  4R3A A;  4FCR A;  5F3K A;  2VCI A;  1UYM A;  4I3H A;  3HYZ A;  3HYY A;  2YEF A;  3A0R A;  4X9L A;  1AJ6 A;  2XDS A;  3ZM7 A;  2YE2 A;  2CCS A;  2H8M A;  1Y8O A;  4XE2 A;  4U93 A;  4CWR A;  2XHT A;  4MP2 A;  3WHA A;  1Y4U A;  2ZBK B;  2IWU A;  2XX5 A;  1H7S A;  3OWD A;  3G7B A;  3CWV A;  1AH6 A;  3R92 A;  2FXS A;  1Z5B A;  3SL2 A;  3HEK A;  2H55 A;  4BQJ A;  2YI7 A;  5D7R A;  4L94 A;  1UY9 A;  4XKO A;  1Y8N A;  1UYK A;  4KSH A;  4LWG A;  4DUH A;  4HZ0 A;  3EHJ A;  4MOT A;  2YGF A;  2XD6 A;  3PEH A;  4U7N A;  4YKX A;  2YE4 A;  1Y8P A;  3A0T A;  1Z5A A;  2IWX A;  2YEI A;  5IN9 A;  3TZ4 A;  4CE2 A;  2GQP A;  3A0Y A;  4YKT A;  1UYG A;  4E01 A;  4XIT A;  1GKZ A;  1BKN A;  4YKY A;  2Q8H A;  2WI6 A;  4L91 A;  2BRE A;  2C2A A;  3K60 A;  4ASB A;  2HKJ A;  4MBC A;  2XDU A;  2YE7 A;  4H81 A; 
#chains in the Genus database with same CATH topology
 2WI4 A;  4HY6 A;  5JEN A;  1YC4 A;  4EFT A;  2QF6 A;  2BU2 A;  3HZ1 A;  2YEH A;  3CGZ A;  3PEJ A;  2BU6 A;  4KQV A;  3D2R A;  5FND A;  4GEE A;  2BU7 A;  2WEP A;  1ZXN A;  2IOR A;  3VAD A;  2YEE A;  3QTF A;  1B3Q A;  2IOP A;  4CWS A;  4CWT A;  2Q2E B;  4BAE A;  2YJW A;  3RLQ A;  4KFG A;  2YI5 A;  4CWF A;  2WER A;  3K99 A;  4L93 A;  4DZY A;  5FNF A;  4O0B A;  4XC0 A;  5CTU A;  5D6Q A;  3Q5L A;  2Q8F A;  3QDD A;  3DGE A;  2YGA A;  3U67 A;  3LPS A;  4ASA A;  4EFU A;  4LWH A;  2K5B A;  1Z59 A;  4XIP A;  4ZVI A;  2CH4 A;  5CF0 A;  4MPE A;  3FT8 A;  1THN A;  3B28 A;  5BOD A;  3C11 A;  1YSR A;  3T0H A;  2WI2 A;  4ASF A;  3Q5K A;  3G75 A;  1ZWH A;  2WEQ A;  2Q8I A;  2CG9 A;  5C93 A;  2JJC A;  2YKI A;  2YK2 A;  4CWO A;  1YES A;  5CTX A;  3ZKB A;  5M4P A;  1TH8 A;  3U2K A;  1NHI A;  4AWP A;  2XJG A;  2BYH A;  4Q20 A;  1BXD A;  3EHH A;  3A0Z A;  3Q5J A;  5GGZ A;  2XDK A;  4LWE A;  2ZDY A;  5BOC A;  4WUB A;  3T10 A;  1YET A;  5IDJ A;  1H7U A;  4GQT A;  1GKX A;  4XD8 A;  4EGH A;  3FV5 A;  4ZKI A;  1Y4S A;  3R4O A;  2CGF A;  4O07 A;  1MX0 A;  1OSF A;  5CTW A;  5D7D A;  4HYP A;  2YEA A;  1I58 A;  2EXL A;  4EM7 A;  2QG2 A;  3K98 A;  1UYC A;  2YEC A;  2HCH A;  3CRK A;  4B7P A;  3RLR A;  3OPD A;  5FWK A;  1TIL A;  4H85 A;  3GIG B;  4JAU A;  2BTZ A;  4R3M A;  1UY8 A;  1UYE A;  3O2F A;  3TZ2 A;  1I59 A;  3B25 A;  3MNR P;  2YE5 A;  2ZDX A;  4E00 A;  2YKJ A;  4GT8 A;  3BMY A;  2XJX A;  1TBW A;  2O1V A;  5CPH A;  2FTK A;  5FNC A;  4CE1 A;  5IDM A;  5M4K A;  3B27 A;  1I5D A;  3FT5 A;  2O1W A;  3R4P A;  4XIQ A;  4B6C A;  4BXI A;  2YED A;  5D7C A;  4FCQ A;  4R1F A;  4CWP A;  3TZ0 A;  3CGY A;  4CWN A;  4W7T A;  1R62 A;  4URL A;  2GFD A;  4U7O A;  2YKB A;  3CYG A;  2HG1 A;  3ZXO A;  1MU5 A;  1B63 A;  3CRL A;  4H7Q A;  4KP4 A;  1YT0 A;  1AMW A;  3B24 A;  4LPB A;  3VHA A;  4BIU A;  2YI6 A;  4MPC A;  2AKP A;  2BSM A;  5CTY A;  4URM A;  4ASG A;  2JKI A;  2E0A A;  4YKZ A;  2QG0 A;  4KTN A;  4BQG A;  2YE9 A;  4XKA A;  2XJJ A;  1S14 A;  1KIJ A;  2C1I A;  3GIF A;  1QZR A;  1I5B A;  3TZ5 A;  5F5R A;  2Q8G A;  2YJX A;  3T2S A;  3EKR A;  3B26 A;  4URN A;  2VWC A;  3BM9 A;  2WI5 A;  4V25 A;  3D36 A;  1YS3 A;  2BU8 A;  1UYF A;  4NH7 A;  4NH8 A;  4FMT A;  2XCM A;  4PRX A;  4FPP A;  1BGQ A;  4E02 A;  2YEB A;  1A4H A;  1B62 A;  1F51 A;  3INX A;  2IWS A;  3EHF A;  1I5A A;  2XX2 A;  3WQ9 A;  2ZKJ A;  2WI1 A;  1UYL A;  4JAV A;  3H4L A;  3EKO A;  3OMU A;  4YKQ A;  2BU5 A;  1NHH A;  1EA6 A;  3HHU A;  4XCL A;  2WI3 A;  5M4E A;  3JZ3 A;  4QPJ A;  2PNR A;  2XK2 A;  5J6A A;  3ZXQ A;  4EEH A;  4EGK A;  3A0X A;  4NH9 A;  4YKU A;  1Z5C A;  1ZXM A;  4V26 A;  1U0Z A;  2CCT A;  3OWB A;  1QYE A;  4KSG A;  3R91 A;  3EHG A;  3R4N A;  4PRV A;  1IXM A;  4GCZ A;  1YC1 A;  3O6O A;  4HXZ A;  2UWD A;  4HYM A;  2CCU A;  3LNU A;  4L90 A;  4I5S A;  4K4O A;  3RKZ A;  2YEJ A;  3D0B A;  4XCJ A;  2VW5 A;  1AM1 A;  4GFN A;  3O0I A;  4LWF A;  1U2O A;  1TC0 A;  2QFO A;  3T0Z A;  1UY7 A;  2IOQ A;  3C0E A;  4LWI A;  4L8Z A;  2XDL A;  2XDX A;  3NMQ A;  4XDM A;  1ID0 A;  1L0O A;  4BIZ A;  4URO A;  3GIE A;  2YE6 A;  4YKW A;  2FWZ A;  4QPK A;  5L3J A;  2BZ5 A;  1YT1 A;  2XAB A;  1UYD A;  4YKR A;  1YT2 A;  4AS9 A;  4LP0 A;  4P7A A;  3KE6 A;  4EMV A;  2BT0 A;  2FWY A;  4MP7 A;  4AWO A;  3TUH A;  1I5C A;  1ZW9 A;  4XKK A;  1S16 A;  1EI1 A;  1YC3 A;  4JQL A;  3IED A;  3H80 A;  1QY8 A;  3HZ5 A;  4PL9 A;  1BYQ A;  2XHX A;  1US7 A;  2WI7 A;  4PU9 A;  2YEG A;  5J71 A;  3R4M A;  1YER A;  3G7E A;  4HXW A;  4MPN A;  4O05 A;  2O1U A;  4CWQ A;  1UY6 A;  2ESA A;  4HZ5 A;  3LMM A;  2YKE A;  3TTZ A;  1GJV A;  5M4H A;  2XX4 A;  2BRC A;  1KZN A;  3RLP A;  4XIR A;  3K97 A;  1PVG A;  1TID A;  3T1K A;  5M4N A;  2YKC A;  2BYI A;  2XHR A;  3A0W A;  4AWQ A;  1JM6 A;  4EGI A;  5M4M A;  1YSZ A;  1AH8 A;  4O04 A;  4HY1 A;  4XTJ A;  2YE8 A;  3VHC A;  4O09 A;  3OW6 A;  2YI0 A;  4JAS A;  2HHI A;  3GIG A;  3VHD A;  4FCP A;  1TC6 A;  3U2D A;  4WUD A;  1UYH A;  1NHJ A;  3ZKD A;  2VCJ A;  4GGL A;  2YGE A;  4MB9 A;  5D6P A;  3INW A;  4CE3 A;  4WUC A;  4P8O A;  2FYP A;  2YE3 A;  2YK9 A;  1UYI A;  4R3A A;  4FCR A;  5F3K A;  2VCI A;  1UYM A;  4I3H A;  3HYZ A;  3HYY A;  2YEF A;  3A0R A;  4X9L A;  1AJ6 A;  4E72 A;  2C1G A;  2XDS A;  3ZM7 A;  2YE2 A;  2CCS A;  2H8M A;  1Y8O A;  4XE2 A;  4U93 A;  4CWR A;  2XHT A;  4MP2 A;  3WHA A;  1Y4U A;  2ZBK B;  2IWU A;  2XX5 A;  1H7S A;  3OWD A;  3G7B A;  3CWV A;  1AH6 A;  3R92 A;  2FXS A;  1Z5B A;  3SL2 A;  3HEK A;  2H55 A;  4BQJ A;  2YI7 A;  5D7R A;  4L94 A;  1UY9 A;  4XKO A;  1Y8N A;  1UYK A;  4KSH A;  4LWG A;  4DUH A;  4HZ0 A;  3EHJ A;  4MOT A;  2YGF A;  2XD6 A;  3PEH A;  4U7N A;  4YKX A;  2YE4 A;  1Y8P A;  3S5T A;  3A0T A;  1Z5A A;  2IWX A;  2YEI A;  5IN9 A;  3TZ4 A;  4CE2 A;  2GQP A;  3A0Y A;  4YKT A;  1UYG A;  4E01 A;  4XIT A;  1GKZ A;  1BKN A;  4YKY A;  2Q8H A;  2WI6 A;  4L91 A;  2BRE A;  2C2A A;  3K60 A;  4ASB A;  2HKJ A;  4MBC A;  2XDU A;  2YE7 A;  4H81 A; 
#chains in the Genus database with same CATH homology
 2WI4 A;  4HY6 A;  1YC4 A;  4EFT A;  2QF6 A;  2BU2 A;  3HZ1 A;  2YEH A;  3CGZ A;  3PEJ A;  2BU6 A;  4KQV A;  3D2R A;  5FND A;  4GEE A;  2BU7 A;  2WEP A;  1ZXN A;  2IOR A;  3VAD A;  2YEE A;  3QTF A;  1B3Q A;  2IOP A;  4CWS A;  4CWT A;  2Q2E B;  4BAE A;  2YJW A;  3RLQ A;  4KFG A;  2YI5 A;  4CWF A;  2WER A;  3K99 A;  4L93 A;  4DZY A;  5FNF A;  4O0B A;  4XC0 A;  5CTU A;  5D6Q A;  3Q5L A;  2Q8F A;  3QDD A;  3DGE A;  2YGA A;  3U67 A;  3LPS A;  4ASA A;  4EFU A;  4LWH A;  2K5B A;  1Z59 A;  4XIP A;  4ZVI A;  2CH4 A;  5CF0 A;  4MPE A;  3FT8 A;  1THN A;  3B28 A;  5BOD A;  3C11 A;  1YSR A;  3T0H A;  2WI2 A;  4ASF A;  3Q5K A;  3G75 A;  1ZWH A;  2WEQ A;  2Q8I A;  2CG9 A;  5C93 A;  2JJC A;  2YKI A;  2YK2 A;  4CWO A;  1YES A;  5CTX A;  3ZKB A;  5M4P A;  1TH8 A;  3U2K A;  1NHI A;  4AWP A;  2XJG A;  2BYH A;  4Q20 A;  1BXD A;  3EHH A;  3A0Z A;  3Q5J A;  5GGZ A;  2XDK A;  4LWE A;  2ZDY A;  5BOC A;  4WUB A;  3T10 A;  1YET A;  5IDJ A;  1H7U A;  4GQT A;  1GKX A;  4XD8 A;  4EGH A;  3FV5 A;  4ZKI A;  1Y4S A;  3R4O A;  2CGF A;  4O07 A;  1MX0 A;  1OSF A;  5CTW A;  5D7D A;  4HYP A;  2YEA A;  1I58 A;  2EXL A;  4EM7 A;  2QG2 A;  3K98 A;  1UYC A;  2YEC A;  2HCH A;  3CRK A;  4B7P A;  3RLR A;  3OPD A;  5FWK A;  1TIL A;  4H85 A;  3GIG B;  4JAU A;  2BTZ A;  4R3M A;  1UY8 A;  1UYE A;  3O2F A;  3TZ2 A;  1I59 A;  3B25 A;  3MNR P;  2YE5 A;  2ZDX A;  4E00 A;  2YKJ A;  4GT8 A;  3BMY A;  2XJX A;  1TBW A;  2O1V A;  5CPH A;  5FNC A;  4CE1 A;  5IDM A;  5M4K A;  3B27 A;  1I5D A;  3FT5 A;  2O1W A;  3R4P A;  4XIQ A;  4B6C A;  4BXI A;  2YED A;  5D7C A;  4FCQ A;  4R1F A;  4CWP A;  3TZ0 A;  3CGY A;  4CWN A;  4W7T A;  1R62 A;  4URL A;  2GFD A;  4U7O A;  2YKB A;  2HG1 A;  3ZXO A;  1MU5 A;  1B63 A;  3CRL A;  4H7Q A;  4KP4 A;  1YT0 A;  1AMW A;  3B24 A;  4LPB A;  3VHA A;  4BIU A;  2YI6 A;  4MPC A;  2AKP A;  2BSM A;  5CTY A;  4URM A;  4ASG A;  2JKI A;  2E0A A;  4YKZ A;  2QG0 A;  4KTN A;  4BQG A;  2YE9 A;  4XKA A;  2XJJ A;  1S14 A;  1KIJ A;  3GIF A;  1QZR A;  1I5B A;  3TZ5 A;  5F5R A;  2Q8G A;  2YJX A;  3T2S A;  3EKR A;  3B26 A;  4URN A;  2VWC A;  3BM9 A;  2WI5 A;  4V25 A;  3D36 A;  1YS3 A;  2BU8 A;  1UYF A;  4NH7 A;  4NH8 A;  4FMT A;  2XCM A;  4PRX A;  4FPP A;  1BGQ A;  4E02 A;  2YEB A;  1A4H A;  1B62 A;  3INX A;  2IWS A;  3EHF A;  1I5A A;  2XX2 A;  3WQ9 A;  2ZKJ A;  2WI1 A;  1UYL A;  4JAV A;  3H4L A;  3EKO A;  3OMU A;  4YKQ A;  2BU5 A;  1NHH A;  1EA6 A;  3HHU A;  4XCL A;  2WI3 A;  5M4E A;  3JZ3 A;  4QPJ A;  2PNR A;  2XK2 A;  5J6A A;  3ZXQ A;  4EEH A;  4EGK A;  3A0X A;  4NH9 A;  4YKU A;  1Z5C A;  1ZXM A;  4V26 A;  1U0Z A;  2CCT A;  3OWB A;  1QYE A;  4KSG A;  3R91 A;  3EHG A;  3R4N A;  4PRV A;  4GCZ A;  1YC1 A;  3O6O A;  4HXZ A;  2UWD A;  4HYM A;  2CCU A;  3LNU A;  4L90 A;  4I5S A;  4K4O A;  3RKZ A;  2YEJ A;  3D0B A;  4XCJ A;  2VW5 A;  1AM1 A;  4GFN A;  3O0I A;  4LWF A;  1U2O A;  1TC0 A;  2QFO A;  3T0Z A;  1UY7 A;  2IOQ A;  3C0E A;  4LWI A;  4L8Z A;  2XDL A;  2XDX A;  3NMQ A;  4XDM A;  1ID0 A;  1L0O A;  4BIZ A;  4URO A;  3GIE A;  2YE6 A;  4YKW A;  2FWZ A;  4QPK A;  5L3J A;  2BZ5 A;  1YT1 A;  2XAB A;  1UYD A;  4YKR A;  1YT2 A;  4AS9 A;  4LP0 A;  4P7A A;  3KE6 A;  4EMV A;  2BT0 A;  2FWY A;  4MP7 A;  4AWO A;  3TUH A;  1I5C A;  1ZW9 A;  4XKK A;  1S16 A;  1EI1 A;  1YC3 A;  4JQL A;  3IED A;  3H80 A;  1QY8 A;  3HZ5 A;  4PL9 A;  1BYQ A;  2XHX A;  1US7 A;  2WI7 A;  4PU9 A;  2YEG A;  5J71 A;  3R4M A;  1YER A;  3G7E A;  4HXW A;  4MPN A;  4O05 A;  2O1U A;  4CWQ A;  1UY6 A;  2ESA A;  4HZ5 A;  2YKE A;  3TTZ A;  1GJV A;  5M4H A;  2XX4 A;  2BRC A;  1KZN A;  3RLP A;  4XIR A;  3K97 A;  1PVG A;  1TID A;  3T1K A;  5M4N A;  2YKC A;  2BYI A;  2XHR A;  3A0W A;  4AWQ A;  1JM6 A;  4EGI A;  5M4M A;  1YSZ A;  1AH8 A;  4O04 A;  4HY1 A;  4XTJ A;  2YE8 A;  3VHC A;  4O09 A;  3OW6 A;  2YI0 A;  4JAS A;  3GIG A;  3VHD A;  4FCP A;  1TC6 A;  3U2D A;  4WUD A;  1UYH A;  1NHJ A;  3ZKD A;  2VCJ A;  4GGL A;  2YGE A;  4MB9 A;  5D6P A;  3INW A;  4CE3 A;  4WUC A;  4P8O A;  2FYP A;  2YE3 A;  2YK9 A;  1UYI A;  4R3A A;  4FCR A;  5F3K A;  2VCI A;  1UYM A;  4I3H A;  3HYZ A;  3HYY A;  2YEF A;  3A0R A;  4X9L A;  1AJ6 A;  2XDS A;  3ZM7 A;  2YE2 A;  2CCS A;  2H8M A;  1Y8O A;  4XE2 A;  4U93 A;  4CWR A;  2XHT A;  4MP2 A;  3WHA A;  1Y4U A;  2ZBK B;  2IWU A;  2XX5 A;  1H7S A;  3OWD A;  3G7B A;  3CWV A;  1AH6 A;  3R92 A;  2FXS A;  1Z5B A;  3SL2 A;  3HEK A;  2H55 A;  4BQJ A;  2YI7 A;  5D7R A;  4L94 A;  1UY9 A;  4XKO A;  1Y8N A;  1UYK A;  4KSH A;  4LWG A;  4DUH A;  4HZ0 A;  3EHJ A;  4MOT A;  2YGF A;  2XD6 A;  3PEH A;  4U7N A;  4YKX A;  2YE4 A;  1Y8P A;  3A0T A;  1Z5A A;  2IWX A;  2YEI A;  5IN9 A;  3TZ4 A;  4CE2 A;  2GQP A;  3A0Y A;  4YKT A;  1UYG A;  4E01 A;  4XIT A;  1GKZ A;  1BKN A;  4YKY A;  2Q8H A;  2WI6 A;  4L91 A;  2BRE A;  2C2A A;  3K60 A;  4ASB A;  2HKJ A;  4MBC A;  2XDU A;  2YE7 A;  4H81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...