4NH9A

Correlation between chemotype-dependent binding conformations of hsp90 alpha/beta and isoform selectivity
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
265
structure length
214
Chain Sequence
SEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTEKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Endoplasmin
publication title Correlation between chemotype-dependent binding conformations of HSP90 alpha / beta and isoform selectivity-Implications for the structure-based design of HSP90 alpha / beta selective inhibitors for treating neurodegenerative diseases.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 214
sequence length 265
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4nh9A00
4XIPA 4KSGA 3K98A 2YEHA 4MPCA 3OPDA 3K60A 5IDMA 4GCZA 1UYEA 1I5AA 4JAUA 1BXDA 2IWUA 4BQGA 4YKWA 1L0OA 3Q5KA 4DUHA 4W7TA 3O0IA 2JJCA 1B63A 1UYHA 2XDLA 3R4NA 4BIUA 1I58A 3U2KA 3K97A 4YKZA 1AMWA 2XABA 3TZ2A 1S16A 3TZ4A 4EGKA 1Z5BA 1UYCA 2ESAA 2YEAA 3EHJA 2BZ5A 4CWFA 1EI1A 1YT2A 4FCRA 2AKPA 2XJXA 3KE6A 4XCJA 2EXLA 2YKJA 3T0ZA 2YE5A 1I59A 2XJJA 2XD6A 2XDUA 3VADA 2ZBKB 4LWEA 1TC6A 3CGZA 2BU8A 3O6OA 1PVGA 2IWXA 2YE3A 1UYIA 4X9LA 2ZKJA 2WI7A 4LWGA 4WUBA 4EGIA 3D36A 3FV5A 1R62A 4YKUA 2BT0A 4CWPA 4LWIA 1TBWA 3INXA 4Q20A 2CCUA 2YEGA 1AH8A 5D6PA 5CTYA 2XHXA 4PRVA 3TTZA 2YKBA 1H7UA 3HHUA 2WI2A 3ZM7A 4HYMA 2YI7A 2XDSA 2ZDXA 4O0BA 3U2DA 3R4MA 4I5SA 4LPBA 4XC0A 2Q8FA 4AS9A 5M4MA 2H8MA 3OWDA 4CWNA 2Q8HA 1TC0A 4NH8A 1Y8PA 4GGLA 1U0ZA 1S14A 3OW6A 4MOTA 5FNCA 3R91A 4EEHA 3K99A 2YE9A 2YECA 2YI0A 4JASA 3B28A 3WHAA 3RLQA 2WEPA 2YEJA 3VHCA 2VWCA 3FT8A 2CH4A 4URMA 2QG2A 3G7BA 3GIGA 4V26A 2WI3A 2YEIA 2YEFA 2O1WA 3INWA 2C2AA 4HZ0A 4R1FA 4QPJA 5M4PA 4YKXA 4CWQA 1I5DA 4XTJA 1OSFA 1UYLA 3NMQA 5D7RA 4I3HA 1Z5AA 4MP7A 2YJXA 4H7QA 4E00A 3A0ZA 1ID0A 1MX0A 5F3KA 2Q8GA 4LWFA 5IN9A 3WQ9A 3ZKBA 4KQVA 3A0RA 1TH8A 4L93A 4HY1A 3C11A 3SL2A 4CWRA 2O1VA 2VCIA 1TILA 4AWOA 4HXZA 1BKNA 1UYGA 3RLPA 2HKJA 2YKCA 2IOQA 3BMYA 4GQTA 5FNFA 1NHIA 2BU5A 1U2OA 3T1KA 1THNA 3T0HA 2QF6A 2K5BA 2YK2A 4URLA 4WUCA 1ZXNA 3C0EA 5IDJA 1Y4SA 2BYIA 4XIQA 1UY8A 3G7EA 5BOCA 3T2SA 4CWOA 3B25A 4EMVA 2XHRA 1H7SA 3TZ0A 4AWQA 4PL9A 4DZYA 1ZWHA 3B27A 1YSZA 4CE2A 1ZW9A 1YS3A 1BGQA 1UY6A 3CGYA 4R3MA 2XHTA 2IORA 2BYHA 2YEEA 3RLRA 4HYPA 2HCHA 4ASAA 3HYZA 4JAVA 1MU5A 5D7CA 2UWDA 4JQLA 3A0TA 3HZ1A 1QZRA 4XKOA 2YE4A 1YESA 1YERA 4FMTA 5CPHA 1QYEA 4EFTA 5M4HA 1GJVA 3GIEA 1AH6A 4P8OA 3IEDA 5F5RA 3PEJA 2BRCA 4U7OA 2XCMA 2YE7A 5CTXA 4WUDA 4ZVIA 2YI5A 3CWVA 2CCSA 4BIZA 4CE1A 2WI1A 1NHHA 3DGEA 4FPPA 4XCLA 4YKYA 3H80A 1BYQA 3OWBA 2WI4A 5BODA 2BTZA 1Z59A 2YKIA 2XX4A 2Q2EB 1YT1A 2FWYA 2ZDYA 3O2FA 4MPNA 1UYKA 4KTNA 5D7DA 3B24A 4BAEA 2XK2A 3MNRP 4O05A 4EGHA 4O09A 3QTFA 3A0WA 4O04A 4L8ZA 1NHJA 4EFUA 2WI5A 1Z5CA 4L90A 2YGFA 2CCTA 5M4KA 1JM6A 4PRXA 4ZKIA 3TZ5A 4ASGA 1UYMA 5CTUA 4MPEA 4K4OA 1UYFA 4PU9A 2YKEA 3ZXOA 1GKZA 2YE6A 2CGFA 4E02A 2WEQA 2FYPA 3HEKA 4MB9A 4P7AA 3VHDA 2HG1A 3R92A 2YGEA 2H55A 4H81A 2QFOA 4HXWA 3HYYA 3CRKA 1Y8OA 2YI6A 3QDDA 3Q5LA 1UY7A 2YEBA 1A4HA 3PEHA 4KFGA 1UY9A 4XITA 2WI6A 1YETA 2IWSA 4BXIA 5L3JA 3EHFA 5FWKA 4EM7A 4AWPA 2CG9A 2PNRA 4HY6A 4XDMA 4CWTA 2XDKA 4CWSA 3ZKDA 1I5BA 2WERA 5FNDA 3RKZA 4B7PA 2QG0A 2IOPA 3HZ5A 3D2RA 3GIFA 2XDXA 1UYDA 4UROA 3G75A 3JZ3A 4KSHA 1YC4A 3VHAA 4E01A 1Y8NA 4XIRA 4ASFA 2JKIA 4NH9A 4MP2A 4V25A 2YE2A 3LNUA 4L91A 4GEEA 4U93A 1US7A 2YJWA 4XE2A 5CF0A 4FCQA 3BM9A 4HZ5A 3FT5A 5CTWA 4XKAA 5M4NA 3ZXQA 1YC1A 2VCJA 4MBCA 1EA6A 4GT8A 2BREA 4KP4A 4H85A 2YE8A 4LP0A 2XX5A 3CRLA 4XD8A 2VW5A 4XKKA 3EHGA 3H4LA 3A0XA 3R4OA 4YKQA 3GIGB 2BU7A 5D6QA 4FCPA 4B6CA 2FXSA 4BQJA 1YT0A 3B26A 3TUHA 1AJ6A 1TIDA 3R4PA 2BU6A 1KIJA 2GFDA 5J6AA 1B62A 3D0BA 3EKOA 2Q8IA 4R3AA 3U67A 1B3QA 2XX2A 1Y4UA 2YGAA 4NH7A 4YKTA 4QPKA 4L94A 2E0AA 3A0YA 5GGZA 2GQPA 5M4EA 2O1UA 3Q5JA 3EHHA 1YC3A 4GFNA 3T10A 1QY8A 4ASBA 4O07A 3EKRA 2BU2A 4URNA 2YEDA 1I5CA 1KZNA 2XJGA 3LPSA 1AM1A 2BSMA 1ZXMA 2YK9A 4LWHA 5J71A 1GKXA 4U7NA 2FWZA 3OMUA 5C93A 1YSRA 4YKRA 4CE3A
chains in the Genus database with same CATH superfamily
4XIPA 4KSGA 3K98A 2YEHA 4MPCA 3OPDA 3K60A 5IDMA 4GCZA 1UYEA 1I5AA 4JAUA 1BXDA 2IWUA 4BQGA 4YKWA 1L0OA 3Q5KA 4DUHA 4W7TA 3O0IA 2JJCA 1B63A 1UYHA 2XDLA 3R4NA 4BIUA 1I58A 3U2KA 3K97A 4YKZA 1AMWA 2XABA 3TZ2A 1S16A 3TZ4A 4EGKA 1Z5BA 1UYCA 2ESAA 2YEAA 3EHJA 2BZ5A 4CWFA 1EI1A 1YT2A 4FCRA 2C1GA 2AKPA 2XJXA 3KE6A 4XCJA 2EXLA 2YKJA 3T0ZA 2YE5A 1I59A 2XJJA 2XD6A 2XDUA 3VADA 2ZBKB 4LWEA 1TC6A 3CGZA 2BU8A 3O6OA 1PVGA 2IWXA 2YE3A 1UYIA 4X9LA 2ZKJA 2WI7A 4LWGA 4WUBA 4EGIA 3D36A 3FV5A 1R62A 4YKUA 2BT0A 4CWPA 4LWIA 1TBWA 3INXA 4Q20A 1F51A 2CCUA 2YEGA 1AH8A 5D6PA 5CTYA 2XHXA 4PRVA 3TTZA 2YKBA 1H7UA 3HHUA 2WI2A 3ZM7A 4HYMA 2YI7A 2XDSA 2ZDXA 4O0BA 3U2DA 3R4MA 4I5SA 4LPBA 4XC0A 2Q8FA 4AS9A 5M4MA 2H8MA 3OWDA 4CWNA 2Q8HA 1TC0A 4NH8A 1Y8PA 4GGLA 1U0ZA 1S14A 3OW6A 4MOTA 5FNCA 3R91A 4EEHA 3K99A 2YE9A 2YECA 2YI0A 4JASA 3B28A 3WHAA 3RLQA 2WEPA 2YEJA 3VHCA 2VWCA 3FT8A 2CH4A 4URMA 2QG2A 3G7BA 3GIGA 4V26A 2WI3A 2YEIA 2YEFA 2O1WA 3INWA 2C2AA 4HZ0A 4R1FA 4QPJA 5M4PA 4YKXA 4CWQA 1I5DA 4XTJA 1OSFA 1UYLA 3NMQA 5D7RA 4I3HA 1Z5AA 4MP7A 2YJXA 4H7QA 4E00A 3A0ZA 1ID0A 1MX0A 5F3KA 2Q8GA 4LWFA 5IN9A 3WQ9A 3ZKBA 4KQVA 3A0RA 1TH8A 4L93A 4HY1A 3C11A 3SL2A 4CWRA 2O1VA 2VCIA 1TILA 4AWOA 4HXZA 5JENA 1BKNA 1UYGA 3RLPA 2HKJA 2YKCA 2IOQA 3BMYA 4GQTA 5FNFA 1NHIA 2BU5A 1U2OA 3T1KA 1THNA 3T0HA 2FTKA 2QF6A 2K5BA 2YK2A 4URLA 4WUCA 1ZXNA 3C0EA 5IDJA 1Y4SA 2BYIA 4XIQA 1UY8A 3G7EA 5BOCA 3T2SA 4CWOA 3B25A 3LMMA 4EMVA 2XHRA 1H7SA 3TZ0A 4AWQA 4PL9A 4DZYA 1ZWHA 3B27A 1YSZA 4CE2A 1ZW9A 1YS3A 1BGQA 1UY6A 3CGYA 4R3MA 2XHTA 2IORA 2BYHA 2YEEA 3RLRA 4HYPA 2HCHA 4ASAA 3HYZA 4JAVA 1MU5A 5D7CA 2UWDA 4JQLA 3A0TA 3HZ1A 1QZRA 4XKOA 2YE4A 1YESA 1YERA 4FMTA 5CPHA 1QYEA 4EFTA 5M4HA 1GJVA 3GIEA 1AH6A 4P8OA 3IEDA 5F5RA 3PEJA 2BRCA 4U7OA 2XCMA 2YE7A 5CTXA 4WUDA 4ZVIA 2YI5A 3CWVA 2HHIA 2CCSA 2C1IA 4BIZA 4CE1A 2WI1A 1NHHA 3DGEA 4FPPA 4XCLA 4YKYA 3H80A 1BYQA 3OWBA 2WI4A 5BODA 2BTZA 1Z59A 2YKIA 2XX4A 2Q2EB 1YT1A 2FWYA 2ZDYA 3O2FA 4MPNA 1UYKA 4KTNA 5D7DA 4E72A 3B24A 4BAEA 2XK2A 3MNRP 4O05A 4EGHA 4O09A 3QTFA 3A0WA 4O04A 4L8ZA 1NHJA 4EFUA 2WI5A 1Z5CA 4L90A 2YGFA 2CCTA 5M4KA 1JM6A 4PRXA 4ZKIA 3TZ5A 4ASGA 1UYMA 5CTUA 4MPEA 4K4OA 1UYFA 4PU9A 2YKEA 3ZXOA 1GKZA 2YE6A 2CGFA 4E02A 2WEQA 2FYPA 3HEKA 4MB9A 4P7AA 3VHDA 2HG1A 3R92A 2YGEA 2H55A 4H81A 2QFOA 4HXWA 3HYYA 3CRKA 1Y8OA 2YI6A 3QDDA 3Q5LA 1UY7A 2YEBA 1A4HA 3PEHA 4KFGA 1UY9A 4XITA 2WI6A 1YETA 2IWSA 4BXIA 5L3JA 3EHFA 5FWKA 4EM7A 4AWPA 2CG9A 2PNRA 4HY6A 4XDMA 4CWTA 2XDKA 4CWSA 3ZKDA 1I5BA 2WERA 5FNDA 3RKZA 4B7PA 2QG0A 2IOPA 3HZ5A 3D2RA 3GIFA 2XDXA 1UYDA 4UROA 3G75A 3JZ3A 4KSHA 1YC4A 3VHAA 4E01A 1Y8NA 4XIRA 4ASFA 2JKIA 4NH9A 4MP2A 4V25A 2YE2A 3LNUA 4L91A 4GEEA 4U93A 1US7A 2YJWA 4XE2A 5CF0A 4FCQA 3BM9A 4HZ5A 3FT5A 5CTWA 4XKAA 5M4NA 3ZXQA 1YC1A 2VCJA 4MBCA 1EA6A 4GT8A 2BREA 4KP4A 4H85A 2YE8A 4LP0A 2XX5A 3CRLA 4XD8A 2VW5A 4XKKA 3EHGA 3H4LA 3A0XA 3R4OA 4YKQA 3GIGB 2BU7A 5D6QA 4FCPA 4B6CA 2FXSA 4BQJA 1YT0A 3B26A 3TUHA 1AJ6A 1TIDA 3R4PA 2BU6A 1KIJA 2GFDA 5J6AA 1B62A 3D0BA 3EKOA 2Q8IA 4R3AA 3U67A 1B3QA 2XX2A 1Y4UA 2YGAA 4NH7A 4YKTA 4QPKA 4L94A 2E0AA 3A0YA 5GGZA 3S5TA 2GQPA 5M4EA 2O1UA 3Q5JA 3EHHA 1YC3A 4GFNA 3T10A 1QY8A 4ASBA 4O07A 3EKRA 2BU2A 4URNA 3CYGA 2YEDA 1I5CA 1KZNA 2XJGA 3LPSA 1AM1A 2BSMA 1ZXMA 2YK9A 4LWHA 5J71A 1GKXA 4U7NA 2FWZA 1IXMA 3OMUA 5C93A 1YSRA 4YKRA 4CE3A
chains in the Genus database with same CATH topology
4XIPA 4KSGA 3K98A 2YEHA 4MPCA 3OPDA 3K60A 5IDMA 4GCZA 1UYEA 1I5AA 4JAUA 1BXDA 2IWUA 4BQGA 4YKWA 1L0OA 3Q5KA 4DUHA 4W7TA 3O0IA 2JJCA 1B63A 1UYHA 2XDLA 3R4NA 4BIUA 1I58A 3U2KA 3K97A 4YKZA 1AMWA 2XABA 3TZ2A 1S16A 3TZ4A 4EGKA 1Z5BA 1UYCA 2ESAA 2YEAA 3EHJA 2BZ5A 4CWFA 1EI1A 1YT2A 4FCRA 2AKPA 2XJXA 3KE6A 4XCJA 2EXLA 2YKJA 3T0ZA 2YE5A 1I59A 2XJJA 2XD6A 2XDUA 3VADA 2ZBKB 4LWEA 1TC6A 3CGZA 2BU8A 3O6OA 1PVGA 2IWXA 2YE3A 1UYIA 4X9LA 2ZKJA 2WI7A 4LWGA 4WUBA 4EGIA 3D36A 3FV5A 1R62A 4YKUA 2BT0A 4CWPA 4LWIA 1TBWA 3INXA 4Q20A 2CCUA 2YEGA 1AH8A 5D6PA 5CTYA 2XHXA 4PRVA 3TTZA 2YKBA 1H7UA 3HHUA 2WI2A 3ZM7A 4HYMA 2YI7A 2XDSA 2ZDXA 4O0BA 3U2DA 3R4MA 4I5SA 4LPBA 4XC0A 2Q8FA 4AS9A 5M4MA 2H8MA 3OWDA 4CWNA 2Q8HA 1TC0A 4NH8A 1Y8PA 4GGLA 1U0ZA 1S14A 3OW6A 4MOTA 5FNCA 3R91A 4EEHA 3K99A 2YE9A 2YECA 2YI0A 4JASA 3B28A 3WHAA 3RLQA 2WEPA 2YEJA 3VHCA 2VWCA 3FT8A 2CH4A 4URMA 2QG2A 3G7BA 3GIGA 4V26A 2WI3A 2YEIA 2YEFA 2O1WA 3INWA 2C2AA 4HZ0A 4R1FA 4QPJA 5M4PA 4YKXA 4CWQA 1I5DA 4XTJA 1OSFA 1UYLA 3NMQA 5D7RA 4I3HA 1Z5AA 4MP7A 2YJXA 4H7QA 4E00A 3A0ZA 1ID0A 1MX0A 5F3KA 2Q8GA 4LWFA 5IN9A 3WQ9A 3ZKBA 4KQVA 3A0RA 1TH8A 4L93A 4HY1A 3C11A 3SL2A 4CWRA 2O1VA 2VCIA 1TILA 4AWOA 4HXZA 1BKNA 1UYGA 3RLPA 2HKJA 2YKCA 2IOQA 3BMYA 4GQTA 5FNFA 1NHIA 2BU5A 1U2OA 3T1KA 1THNA 3T0HA 2QF6A 2K5BA 2YK2A 4URLA 4WUCA 1ZXNA 3C0EA 5IDJA 1Y4SA 2BYIA 4XIQA 1UY8A 3G7EA 5BOCA 3T2SA 4CWOA 3B25A 4EMVA 2XHRA 1H7SA 3TZ0A 4AWQA 4PL9A 4DZYA 1ZWHA 3B27A 1YSZA 4CE2A 1ZW9A 1YS3A 1BGQA 1UY6A 3CGYA 4R3MA 2XHTA 2IORA 2BYHA 2YEEA 3RLRA 4HYPA 2HCHA 4ASAA 3HYZA 4JAVA 1MU5A 5D7CA 2UWDA 4JQLA 3A0TA 3HZ1A 1QZRA 4XKOA 2YE4A 1YESA 1YERA 4FMTA 5CPHA 1QYEA 4EFTA 5M4HA 1GJVA 3GIEA 1AH6A 4P8OA 3IEDA 5F5RA 3PEJA 2BRCA 4U7OA 2XCMA 2YE7A 5CTXA 4WUDA 4ZVIA 2YI5A 3CWVA 2CCSA 4BIZA 4CE1A 2WI1A 1NHHA 3DGEA 4FPPA 4XCLA 4YKYA 3H80A 1BYQA 3OWBA 2WI4A 5BODA 2BTZA 1Z59A 2YKIA 2XX4A 2Q2EB 1YT1A 2FWYA 2ZDYA 3O2FA 4MPNA 1UYKA 4KTNA 5D7DA 3B24A 4BAEA 2XK2A 3MNRP 4O05A 4EGHA 4O09A 3QTFA 3A0WA 4O04A 4L8ZA 1NHJA 4EFUA 2WI5A 1Z5CA 4L90A 2YGFA 2CCTA 5M4KA 1JM6A 4PRXA 4ZKIA 3TZ5A 4ASGA 1UYMA 5CTUA 4MPEA 4K4OA 1UYFA 4PU9A 2YKEA 3ZXOA 1GKZA 2YE6A 2CGFA 4E02A 2WEQA 2FYPA 3HEKA 4MB9A 4P7AA 3VHDA 2HG1A 3R92A 2YGEA 2H55A 4H81A 2QFOA 4HXWA 3HYYA 3CRKA 1Y8OA 2YI6A 3QDDA 3Q5LA 1UY7A 2YEBA 1A4HA 3PEHA 4KFGA 1UY9A 4XITA 2WI6A 1YETA 2IWSA 4BXIA 5L3JA 3EHFA 5FWKA 4EM7A 4AWPA 2CG9A 2PNRA 4HY6A 4XDMA 4CWTA 2XDKA 4CWSA 3ZKDA 1I5BA 2WERA 5FNDA 3RKZA 4B7PA 2QG0A 2IOPA 3HZ5A 3D2RA 3GIFA 2XDXA 1UYDA 4UROA 3G75A 3JZ3A 4KSHA 1YC4A 3VHAA 4E01A 1Y8NA 4XIRA 4ASFA 2JKIA 4NH9A 4MP2A 4V25A 2YE2A 3LNUA 4L91A 4GEEA 4U93A 1US7A 2YJWA 4XE2A 5CF0A 4FCQA 3BM9A 4HZ5A 3FT5A 5CTWA 4XKAA 5M4NA 3ZXQA 1YC1A 2VCJA 4MBCA 1EA6A 4GT8A 2BREA 4KP4A 4H85A 2YE8A 4LP0A 2XX5A 3CRLA 4XD8A 2VW5A 4XKKA 3EHGA 3H4LA 3A0XA 3R4OA 4YKQA 3GIGB 2BU7A 5D6QA 4FCPA 4B6CA 2FXSA 4BQJA 1YT0A 3B26A 3TUHA 1AJ6A 1TIDA 3R4PA 2BU6A 1KIJA 2GFDA 5J6AA 1B62A 3D0BA 3EKOA 2Q8IA 4R3AA 3U67A 1B3QA 2XX2A 1Y4UA 2YGAA 4NH7A 4YKTA 4QPKA 4L94A 2E0AA 3A0YA 5GGZA 2GQPA 5M4EA 2O1UA 3Q5JA 3EHHA 1YC3A 4GFNA 3T10A 1QY8A 4ASBA 4O07A 3EKRA 2BU2A 4URNA 2YEDA 1I5CA 1KZNA 2XJGA 3LPSA 1AM1A 2BSMA 1ZXMA 2YK9A 4LWHA 5J71A 1GKXA 4U7NA 2FWZA 3OMUA 5C93A 1YSRA 4YKRA 4CE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XIP A;  4KSG A;  3K98 A;  2YEH A;  4MPC A;  3OPD A;  3K60 A;  5IDM A;  4GCZ A;  1UYE A;  1I5A A;  4JAU A;  1BXD A;  2IWU A;  4BQG A;  4YKW A;  1L0O A;  3Q5K A;  4DUH A;  4W7T A;  3O0I A;  2JJC A;  1B63 A;  1UYH A;  2XDL A;  3R4N A;  4BIU A;  1I58 A;  3U2K A;  3K97 A;  4YKZ A;  1AMW A;  2XAB A;  3TZ2 A;  1S16 A;  3TZ4 A;  4EGK A;  1Z5B A;  1UYC A;  2ESA A;  2YEA A;  3EHJ A;  2BZ5 A;  4CWF A;  1EI1 A;  1YT2 A;  4FCR A;  2AKP A;  2XJX A;  3KE6 A;  4XCJ A;  2EXL A;  2YKJ A;  3T0Z A;  2YE5 A;  1I59 A;  2XJJ A;  2XD6 A;  2XDU A;  3VAD A;  2ZBK B;  4LWE A;  1TC6 A;  3CGZ A;  2BU8 A;  3O6O A;  1PVG A;  2IWX A;  2YE3 A;  1UYI A;  4X9L A;  2ZKJ A;  2WI7 A;  4LWG A;  4WUB A;  4EGI A;  3D36 A;  3FV5 A;  1R62 A;  4YKU A;  2BT0 A;  4CWP A;  4LWI A;  1TBW A;  3INX A;  4Q20 A;  2CCU A;  2YEG A;  1AH8 A;  5D6P A;  5CTY A;  2XHX A;  4PRV A;  3TTZ A;  2YKB A;  1H7U A;  3HHU A;  2WI2 A;  3ZM7 A;  4HYM A;  2YI7 A;  2XDS A;  2ZDX A;  4O0B A;  3U2D A;  3R4M A;  4I5S A;  4LPB A;  4XC0 A;  2Q8F A;  4AS9 A;  5M4M A;  2H8M A;  3OWD A;  4CWN A;  2Q8H A;  1TC0 A;  4NH8 A;  1Y8P A;  4GGL A;  1U0Z A;  1S14 A;  3OW6 A;  4MOT A;  5FNC A;  3R91 A;  4EEH A;  3K99 A;  2YE9 A;  2YEC A;  2YI0 A;  4JAS A;  3B28 A;  3WHA A;  3RLQ A;  2WEP A;  2YEJ A;  3VHC A;  2VWC A;  3FT8 A;  2CH4 A;  4URM A;  2QG2 A;  3G7B A;  3GIG A;  4V26 A;  2WI3 A;  2YEI A;  2YEF A;  2O1W A;  3INW A;  2C2A A;  4HZ0 A;  4R1F A;  4QPJ A;  5M4P A;  4YKX A;  4CWQ A;  1I5D A;  4XTJ A;  1OSF A;  1UYL A;  3NMQ A;  5D7R A;  4I3H A;  1Z5A A;  4MP7 A;  2YJX A;  4H7Q A;  4E00 A;  3A0Z A;  1ID0 A;  1MX0 A;  5F3K A;  2Q8G A;  4LWF A;  5IN9 A;  3WQ9 A;  3ZKB A;  4KQV A;  3A0R A;  1TH8 A;  4L93 A;  4HY1 A;  3C11 A;  3SL2 A;  4CWR A;  2O1V A;  2VCI A;  1TIL A;  4AWO A;  4HXZ A;  1BKN A;  1UYG A;  3RLP A;  2HKJ A;  2YKC A;  2IOQ A;  3BMY A;  4GQT A;  5FNF A;  1NHI A;  2BU5 A;  1U2O A;  3T1K A;  1THN A;  3T0H A;  2QF6 A;  2K5B A;  2YK2 A;  4URL A;  4WUC A;  1ZXN A;  3C0E A;  5IDJ A;  1Y4S A;  2BYI A;  4XIQ A;  1UY8 A;  3G7E A;  5BOC A;  3T2S A;  4CWO A;  3B25 A;  4EMV A;  2XHR A;  1H7S A;  3TZ0 A;  4AWQ A;  4PL9 A;  4DZY A;  1ZWH A;  3B27 A;  1YSZ A;  4CE2 A;  1ZW9 A;  1YS3 A;  1BGQ A;  1UY6 A;  3CGY A;  4R3M A;  2XHT A;  2IOR A;  2BYH A;  2YEE A;  3RLR A;  4HYP A;  2HCH A;  4ASA A;  3HYZ A;  4JAV A;  1MU5 A;  5D7C A;  2UWD A;  4JQL A;  3A0T A;  3HZ1 A;  1QZR A;  4XKO A;  2YE4 A;  1YES A;  1YER A;  4FMT A;  5CPH A;  1QYE A;  4EFT A;  5M4H A;  1GJV A;  3GIE A;  1AH6 A;  4P8O A;  3IED A;  5F5R A;  3PEJ A;  2BRC A;  4U7O A;  2XCM A;  2YE7 A;  5CTX A;  4WUD A;  4ZVI A;  2YI5 A;  3CWV A;  2CCS A;  4BIZ A;  4CE1 A;  2WI1 A;  1NHH A;  3DGE A;  4FPP A;  4XCL A;  4YKY A;  3H80 A;  1BYQ A;  3OWB A;  2WI4 A;  5BOD A;  2BTZ A;  1Z59 A;  2YKI A;  2XX4 A;  2Q2E B;  1YT1 A;  2FWY A;  2ZDY A;  3O2F A;  4MPN A;  1UYK A;  4KTN A;  5D7D A;  3B24 A;  4BAE A;  2XK2 A;  3MNR P;  4O05 A;  4EGH A;  4O09 A;  3QTF A;  3A0W A;  4O04 A;  4L8Z A;  1NHJ A;  4EFU A;  2WI5 A;  1Z5C A;  4L90 A;  2YGF A;  2CCT A;  5M4K A;  1JM6 A;  4PRX A;  4ZKI A;  3TZ5 A;  4ASG A;  1UYM A;  5CTU A;  4MPE A;  4K4O A;  1UYF A;  4PU9 A;  2YKE A;  3ZXO A;  1GKZ A;  2YE6 A;  2CGF A;  4E02 A;  2WEQ A;  2FYP A;  3HEK A;  4MB9 A;  4P7A A;  3VHD A;  2HG1 A;  3R92 A;  2YGE A;  2H55 A;  4H81 A;  2QFO A;  4HXW A;  3HYY A;  3CRK A;  1Y8O A;  2YI6 A;  3QDD A;  3Q5L A;  1UY7 A;  2YEB A;  1A4H A;  3PEH A;  4KFG A;  1UY9 A;  4XIT A;  2WI6 A;  1YET A;  2IWS A;  4BXI A;  5L3J A;  3EHF A;  5FWK A;  4EM7 A;  4AWP A;  2CG9 A;  2PNR A;  4HY6 A;  4XDM A;  4CWT A;  2XDK A;  4CWS A;  3ZKD A;  1I5B A;  2WER A;  5FND A;  3RKZ A;  4B7P A;  2QG0 A;  2IOP A;  3HZ5 A;  3D2R A;  3GIF A;  2XDX A;  1UYD A;  4URO A;  3G75 A;  3JZ3 A;  4KSH A;  1YC4 A;  3VHA A;  4E01 A;  1Y8N A;  4XIR A;  4ASF A;  2JKI A;  4NH9 A;  4MP2 A;  4V25 A;  2YE2 A;  3LNU A;  4L91 A;  4GEE A;  4U93 A;  1US7 A;  2YJW A;  4XE2 A;  5CF0 A;  4FCQ A;  3BM9 A;  4HZ5 A;  3FT5 A;  5CTW A;  4XKA A;  5M4N A;  3ZXQ A;  1YC1 A;  2VCJ A;  4MBC A;  1EA6 A;  4GT8 A;  2BRE A;  4KP4 A;  4H85 A;  2YE8 A;  4LP0 A;  2XX5 A;  3CRL A;  4XD8 A;  2VW5 A;  4XKK A;  3EHG A;  3H4L A;  3A0X A;  3R4O A;  4YKQ A;  3GIG B;  2BU7 A;  5D6Q A;  4FCP A;  4B6C A;  2FXS A;  4BQJ A;  1YT0 A;  3B26 A;  3TUH A;  1AJ6 A;  1TID A;  3R4P A;  2BU6 A;  1KIJ A;  2GFD A;  5J6A A;  1B62 A;  3D0B A;  3EKO A;  2Q8I A;  4R3A A;  3U67 A;  1B3Q A;  2XX2 A;  1Y4U A;  2YGA A;  4NH7 A;  4YKT A;  4QPK A;  4L94 A;  2E0A A;  3A0Y A;  5GGZ A;  2GQP A;  5M4E A;  2O1U A;  3Q5J A;  3EHH A;  1YC3 A;  4GFN A;  3T10 A;  1QY8 A;  4ASB A;  4O07 A;  3EKR A;  2BU2 A;  4URN A;  2YED A;  1I5C A;  1KZN A;  2XJG A;  3LPS A;  1AM1 A;  2BSM A;  1ZXM A;  2YK9 A;  4LWH A;  5J71 A;  1GKX A;  4U7N A;  2FWZ A;  3OMU A;  5C93 A;  1YSR A;  4YKR A;  4CE3 A; 
#chains in the Genus database with same CATH topology
 4XIP A;  4KSG A;  3K98 A;  2YEH A;  4MPC A;  3OPD A;  3K60 A;  5IDM A;  4GCZ A;  1UYE A;  1I5A A;  4JAU A;  1BXD A;  2IWU A;  4BQG A;  4YKW A;  1L0O A;  3Q5K A;  4DUH A;  4W7T A;  3O0I A;  2JJC A;  1B63 A;  1UYH A;  2XDL A;  3R4N A;  4BIU A;  1I58 A;  3U2K A;  3K97 A;  4YKZ A;  1AMW A;  2XAB A;  3TZ2 A;  1S16 A;  3TZ4 A;  4EGK A;  1Z5B A;  1UYC A;  2ESA A;  2YEA A;  3EHJ A;  2BZ5 A;  4CWF A;  1EI1 A;  1YT2 A;  4FCR A;  2C1G A;  2AKP A;  2XJX A;  3KE6 A;  4XCJ A;  2EXL A;  2YKJ A;  3T0Z A;  2YE5 A;  1I59 A;  2XJJ A;  2XD6 A;  2XDU A;  3VAD A;  2ZBK B;  4LWE A;  1TC6 A;  3CGZ A;  2BU8 A;  3O6O A;  1PVG A;  2IWX A;  2YE3 A;  1UYI A;  4X9L A;  2ZKJ A;  2WI7 A;  4LWG A;  4WUB A;  4EGI A;  3D36 A;  3FV5 A;  1R62 A;  4YKU A;  2BT0 A;  4CWP A;  4LWI A;  1TBW A;  3INX A;  4Q20 A;  1F51 A;  2CCU A;  2YEG A;  1AH8 A;  5D6P A;  5CTY A;  2XHX A;  4PRV A;  3TTZ A;  2YKB A;  1H7U A;  3HHU A;  2WI2 A;  3ZM7 A;  4HYM A;  2YI7 A;  2XDS A;  2ZDX A;  4O0B A;  3U2D A;  3R4M A;  4I5S A;  4LPB A;  4XC0 A;  2Q8F A;  4AS9 A;  5M4M A;  2H8M A;  3OWD A;  4CWN A;  2Q8H A;  1TC0 A;  4NH8 A;  1Y8P A;  4GGL A;  1U0Z A;  1S14 A;  3OW6 A;  4MOT A;  5FNC A;  3R91 A;  4EEH A;  3K99 A;  2YE9 A;  2YEC A;  2YI0 A;  4JAS A;  3B28 A;  3WHA A;  3RLQ A;  2WEP A;  2YEJ A;  3VHC A;  2VWC A;  3FT8 A;  2CH4 A;  4URM A;  2QG2 A;  3G7B A;  3GIG A;  4V26 A;  2WI3 A;  2YEI A;  2YEF A;  2O1W A;  3INW A;  2C2A A;  4HZ0 A;  4R1F A;  4QPJ A;  5M4P A;  4YKX A;  4CWQ A;  1I5D A;  4XTJ A;  1OSF A;  1UYL A;  3NMQ A;  5D7R A;  4I3H A;  1Z5A A;  4MP7 A;  2YJX A;  4H7Q A;  4E00 A;  3A0Z A;  1ID0 A;  1MX0 A;  5F3K A;  2Q8G A;  4LWF A;  5IN9 A;  3WQ9 A;  3ZKB A;  4KQV A;  3A0R A;  1TH8 A;  4L93 A;  4HY1 A;  3C11 A;  3SL2 A;  4CWR A;  2O1V A;  2VCI A;  1TIL A;  4AWO A;  4HXZ A;  5JEN A;  1BKN A;  1UYG A;  3RLP A;  2HKJ A;  2YKC A;  2IOQ A;  3BMY A;  4GQT A;  5FNF A;  1NHI A;  2BU5 A;  1U2O A;  3T1K A;  1THN A;  3T0H A;  2FTK A;  2QF6 A;  2K5B A;  2YK2 A;  4URL A;  4WUC A;  1ZXN A;  3C0E A;  5IDJ A;  1Y4S A;  2BYI A;  4XIQ A;  1UY8 A;  3G7E A;  5BOC A;  3T2S A;  4CWO A;  3B25 A;  3LMM A;  4EMV A;  2XHR A;  1H7S A;  3TZ0 A;  4AWQ A;  4PL9 A;  4DZY A;  1ZWH A;  3B27 A;  1YSZ A;  4CE2 A;  1ZW9 A;  1YS3 A;  1BGQ A;  1UY6 A;  3CGY A;  4R3M A;  2XHT A;  2IOR A;  2BYH A;  2YEE A;  3RLR A;  4HYP A;  2HCH A;  4ASA A;  3HYZ A;  4JAV A;  1MU5 A;  5D7C A;  2UWD A;  4JQL A;  3A0T A;  3HZ1 A;  1QZR A;  4XKO A;  2YE4 A;  1YES A;  1YER A;  4FMT A;  5CPH A;  1QYE A;  4EFT A;  5M4H A;  1GJV A;  3GIE A;  1AH6 A;  4P8O A;  3IED A;  5F5R A;  3PEJ A;  2BRC A;  4U7O A;  2XCM A;  2YE7 A;  5CTX A;  4WUD A;  4ZVI A;  2YI5 A;  3CWV A;  2HHI A;  2CCS A;  2C1I A;  4BIZ A;  4CE1 A;  2WI1 A;  1NHH A;  3DGE A;  4FPP A;  4XCL A;  4YKY A;  3H80 A;  1BYQ A;  3OWB A;  2WI4 A;  5BOD A;  2BTZ A;  1Z59 A;  2YKI A;  2XX4 A;  2Q2E B;  1YT1 A;  2FWY A;  2ZDY A;  3O2F A;  4MPN A;  1UYK A;  4KTN A;  5D7D A;  4E72 A;  3B24 A;  4BAE A;  2XK2 A;  3MNR P;  4O05 A;  4EGH A;  4O09 A;  3QTF A;  3A0W A;  4O04 A;  4L8Z A;  1NHJ A;  4EFU A;  2WI5 A;  1Z5C A;  4L90 A;  2YGF A;  2CCT A;  5M4K A;  1JM6 A;  4PRX A;  4ZKI A;  3TZ5 A;  4ASG A;  1UYM A;  5CTU A;  4MPE A;  4K4O A;  1UYF A;  4PU9 A;  2YKE A;  3ZXO A;  1GKZ A;  2YE6 A;  2CGF A;  4E02 A;  2WEQ A;  2FYP A;  3HEK A;  4MB9 A;  4P7A A;  3VHD A;  2HG1 A;  3R92 A;  2YGE A;  2H55 A;  4H81 A;  2QFO A;  4HXW A;  3HYY A;  3CRK A;  1Y8O A;  2YI6 A;  3QDD A;  3Q5L A;  1UY7 A;  2YEB A;  1A4H A;  3PEH A;  4KFG A;  1UY9 A;  4XIT A;  2WI6 A;  1YET A;  2IWS A;  4BXI A;  5L3J A;  3EHF A;  5FWK A;  4EM7 A;  4AWP A;  2CG9 A;  2PNR A;  4HY6 A;  4XDM A;  4CWT A;  2XDK A;  4CWS A;  3ZKD A;  1I5B A;  2WER A;  5FND A;  3RKZ A;  4B7P A;  2QG0 A;  2IOP A;  3HZ5 A;  3D2R A;  3GIF A;  2XDX A;  1UYD A;  4URO A;  3G75 A;  3JZ3 A;  4KSH A;  1YC4 A;  3VHA A;  4E01 A;  1Y8N A;  4XIR A;  4ASF A;  2JKI A;  4NH9 A;  4MP2 A;  4V25 A;  2YE2 A;  3LNU A;  4L91 A;  4GEE A;  4U93 A;  1US7 A;  2YJW A;  4XE2 A;  5CF0 A;  4FCQ A;  3BM9 A;  4HZ5 A;  3FT5 A;  5CTW A;  4XKA A;  5M4N A;  3ZXQ A;  1YC1 A;  2VCJ A;  4MBC A;  1EA6 A;  4GT8 A;  2BRE A;  4KP4 A;  4H85 A;  2YE8 A;  4LP0 A;  2XX5 A;  3CRL A;  4XD8 A;  2VW5 A;  4XKK A;  3EHG A;  3H4L A;  3A0X A;  3R4O A;  4YKQ A;  3GIG B;  2BU7 A;  5D6Q A;  4FCP A;  4B6C A;  2FXS A;  4BQJ A;  1YT0 A;  3B26 A;  3TUH A;  1AJ6 A;  1TID A;  3R4P A;  2BU6 A;  1KIJ A;  2GFD A;  5J6A A;  1B62 A;  3D0B A;  3EKO A;  2Q8I A;  4R3A A;  3U67 A;  1B3Q A;  2XX2 A;  1Y4U A;  2YGA A;  4NH7 A;  4YKT A;  4QPK A;  4L94 A;  2E0A A;  3A0Y A;  5GGZ A;  3S5T A;  2GQP A;  5M4E A;  2O1U A;  3Q5J A;  3EHH A;  1YC3 A;  4GFN A;  3T10 A;  1QY8 A;  4ASB A;  4O07 A;  3EKR A;  2BU2 A;  4URN A;  3CYG A;  2YED A;  1I5C A;  1KZN A;  2XJG A;  3LPS A;  1AM1 A;  2BSM A;  1ZXM A;  2YK9 A;  4LWH A;  5J71 A;  1GKX A;  4U7N A;  2FWZ A;  1IXM A;  3OMU A;  5C93 A;  1YSR A;  4YKR A;  4CE3 A; 
#chains in the Genus database with same CATH homology
 4XIP A;  4KSG A;  3K98 A;  2YEH A;  4MPC A;  3OPD A;  3K60 A;  5IDM A;  4GCZ A;  1UYE A;  1I5A A;  4JAU A;  1BXD A;  2IWU A;  4BQG A;  4YKW A;  1L0O A;  3Q5K A;  4DUH A;  4W7T A;  3O0I A;  2JJC A;  1B63 A;  1UYH A;  2XDL A;  3R4N A;  4BIU A;  1I58 A;  3U2K A;  3K97 A;  4YKZ A;  1AMW A;  2XAB A;  3TZ2 A;  1S16 A;  3TZ4 A;  4EGK A;  1Z5B A;  1UYC A;  2ESA A;  2YEA A;  3EHJ A;  2BZ5 A;  4CWF A;  1EI1 A;  1YT2 A;  4FCR A;  2AKP A;  2XJX A;  3KE6 A;  4XCJ A;  2EXL A;  2YKJ A;  3T0Z A;  2YE5 A;  1I59 A;  2XJJ A;  2XD6 A;  2XDU A;  3VAD A;  2ZBK B;  4LWE A;  1TC6 A;  3CGZ A;  2BU8 A;  3O6O A;  1PVG A;  2IWX A;  2YE3 A;  1UYI A;  4X9L A;  2ZKJ A;  2WI7 A;  4LWG A;  4WUB A;  4EGI A;  3D36 A;  3FV5 A;  1R62 A;  4YKU A;  2BT0 A;  4CWP A;  4LWI A;  1TBW A;  3INX A;  4Q20 A;  2CCU A;  2YEG A;  1AH8 A;  5D6P A;  5CTY A;  2XHX A;  4PRV A;  3TTZ A;  2YKB A;  1H7U A;  3HHU A;  2WI2 A;  3ZM7 A;  4HYM A;  2YI7 A;  2XDS A;  2ZDX A;  4O0B A;  3U2D A;  3R4M A;  4I5S A;  4LPB A;  4XC0 A;  2Q8F A;  4AS9 A;  5M4M A;  2H8M A;  3OWD A;  4CWN A;  2Q8H A;  1TC0 A;  4NH8 A;  1Y8P A;  4GGL A;  1U0Z A;  1S14 A;  3OW6 A;  4MOT A;  5FNC A;  3R91 A;  4EEH A;  3K99 A;  2YE9 A;  2YEC A;  2YI0 A;  4JAS A;  3B28 A;  3WHA A;  3RLQ A;  2WEP A;  2YEJ A;  3VHC A;  2VWC A;  3FT8 A;  2CH4 A;  4URM A;  2QG2 A;  3G7B A;  3GIG A;  4V26 A;  2WI3 A;  2YEI A;  2YEF A;  2O1W A;  3INW A;  2C2A A;  4HZ0 A;  4R1F A;  4QPJ A;  5M4P A;  4YKX A;  4CWQ A;  1I5D A;  4XTJ A;  1OSF A;  1UYL A;  3NMQ A;  5D7R A;  4I3H A;  1Z5A A;  4MP7 A;  2YJX A;  4H7Q A;  4E00 A;  3A0Z A;  1ID0 A;  1MX0 A;  5F3K A;  2Q8G A;  4LWF A;  5IN9 A;  3WQ9 A;  3ZKB A;  4KQV A;  3A0R A;  1TH8 A;  4L93 A;  4HY1 A;  3C11 A;  3SL2 A;  4CWR A;  2O1V A;  2VCI A;  1TIL A;  4AWO A;  4HXZ A;  1BKN A;  1UYG A;  3RLP A;  2HKJ A;  2YKC A;  2IOQ A;  3BMY A;  4GQT A;  5FNF A;  1NHI A;  2BU5 A;  1U2O A;  3T1K A;  1THN A;  3T0H A;  2QF6 A;  2K5B A;  2YK2 A;  4URL A;  4WUC A;  1ZXN A;  3C0E A;  5IDJ A;  1Y4S A;  2BYI A;  4XIQ A;  1UY8 A;  3G7E A;  5BOC A;  3T2S A;  4CWO A;  3B25 A;  4EMV A;  2XHR A;  1H7S A;  3TZ0 A;  4AWQ A;  4PL9 A;  4DZY A;  1ZWH A;  3B27 A;  1YSZ A;  4CE2 A;  1ZW9 A;  1YS3 A;  1BGQ A;  1UY6 A;  3CGY A;  4R3M A;  2XHT A;  2IOR A;  2BYH A;  2YEE A;  3RLR A;  4HYP A;  2HCH A;  4ASA A;  3HYZ A;  4JAV A;  1MU5 A;  5D7C A;  2UWD A;  4JQL A;  3A0T A;  3HZ1 A;  1QZR A;  4XKO A;  2YE4 A;  1YES A;  1YER A;  4FMT A;  5CPH A;  1QYE A;  4EFT A;  5M4H A;  1GJV A;  3GIE A;  1AH6 A;  4P8O A;  3IED A;  5F5R A;  3PEJ A;  2BRC A;  4U7O A;  2XCM A;  2YE7 A;  5CTX A;  4WUD A;  4ZVI A;  2YI5 A;  3CWV A;  2CCS A;  4BIZ A;  4CE1 A;  2WI1 A;  1NHH A;  3DGE A;  4FPP A;  4XCL A;  4YKY A;  3H80 A;  1BYQ A;  3OWB A;  2WI4 A;  5BOD A;  2BTZ A;  1Z59 A;  2YKI A;  2XX4 A;  2Q2E B;  1YT1 A;  2FWY A;  2ZDY A;  3O2F A;  4MPN A;  1UYK A;  4KTN A;  5D7D A;  3B24 A;  4BAE A;  2XK2 A;  3MNR P;  4O05 A;  4EGH A;  4O09 A;  3QTF A;  3A0W A;  4O04 A;  4L8Z A;  1NHJ A;  4EFU A;  2WI5 A;  1Z5C A;  4L90 A;  2YGF A;  2CCT A;  5M4K A;  1JM6 A;  4PRX A;  4ZKI A;  3TZ5 A;  4ASG A;  1UYM A;  5CTU A;  4MPE A;  4K4O A;  1UYF A;  4PU9 A;  2YKE A;  3ZXO A;  1GKZ A;  2YE6 A;  2CGF A;  4E02 A;  2WEQ A;  2FYP A;  3HEK A;  4MB9 A;  4P7A A;  3VHD A;  2HG1 A;  3R92 A;  2YGE A;  2H55 A;  4H81 A;  2QFO A;  4HXW A;  3HYY A;  3CRK A;  1Y8O A;  2YI6 A;  3QDD A;  3Q5L A;  1UY7 A;  2YEB A;  1A4H A;  3PEH A;  4KFG A;  1UY9 A;  4XIT A;  2WI6 A;  1YET A;  2IWS A;  4BXI A;  5L3J A;  3EHF A;  5FWK A;  4EM7 A;  4AWP A;  2CG9 A;  2PNR A;  4HY6 A;  4XDM A;  4CWT A;  2XDK A;  4CWS A;  3ZKD A;  1I5B A;  2WER A;  5FND A;  3RKZ A;  4B7P A;  2QG0 A;  2IOP A;  3HZ5 A;  3D2R A;  3GIF A;  2XDX A;  1UYD A;  4URO A;  3G75 A;  3JZ3 A;  4KSH A;  1YC4 A;  3VHA A;  4E01 A;  1Y8N A;  4XIR A;  4ASF A;  2JKI A;  4NH9 A;  4MP2 A;  4V25 A;  2YE2 A;  3LNU A;  4L91 A;  4GEE A;  4U93 A;  1US7 A;  2YJW A;  4XE2 A;  5CF0 A;  4FCQ A;  3BM9 A;  4HZ5 A;  3FT5 A;  5CTW A;  4XKA A;  5M4N A;  3ZXQ A;  1YC1 A;  2VCJ A;  4MBC A;  1EA6 A;  4GT8 A;  2BRE A;  4KP4 A;  4H85 A;  2YE8 A;  4LP0 A;  2XX5 A;  3CRL A;  4XD8 A;  2VW5 A;  4XKK A;  3EHG A;  3H4L A;  3A0X A;  3R4O A;  4YKQ A;  3GIG B;  2BU7 A;  5D6Q A;  4FCP A;  4B6C A;  2FXS A;  4BQJ A;  1YT0 A;  3B26 A;  3TUH A;  1AJ6 A;  1TID A;  3R4P A;  2BU6 A;  1KIJ A;  2GFD A;  5J6A A;  1B62 A;  3D0B A;  3EKO A;  2Q8I A;  4R3A A;  3U67 A;  1B3Q A;  2XX2 A;  1Y4U A;  2YGA A;  4NH7 A;  4YKT A;  4QPK A;  4L94 A;  2E0A A;  3A0Y A;  5GGZ A;  2GQP A;  5M4E A;  2O1U A;  3Q5J A;  3EHH A;  1YC3 A;  4GFN A;  3T10 A;  1QY8 A;  4ASB A;  4O07 A;  3EKR A;  2BU2 A;  4URN A;  2YED A;  1I5C A;  1KZN A;  2XJG A;  3LPS A;  1AM1 A;  2BSM A;  1ZXM A;  2YK9 A;  4LWH A;  5J71 A;  1GKX A;  4U7N A;  2FWZ A;  3OMU A;  5C93 A;  1YSR A;  4YKR A;  4CE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...