4UROA

Crystal structure of staph gyraseb 24kda in complex with novobiocin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
187
Chain Sequence
EAARKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Kibdelomycin Bound to Staphylococcus Aureus Gyrb and Pare Showed a Novel U-Shaped Binding Mode.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase
molecule keywords DNA GYRASE SUBUNIT B
total genus 53
structure length 187
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4uroA00
4AWOA 4ASFA 2HKJA 2XK2A 4XD8A 1TILA 4FPPA 1UYEA 4URMA 4O09A 1YSZA 4CWRA 4BXIA 3KE6A 4EEHA 2YJWA 4V26A 1BKNA 3LNUA 2BYIA 1PVGA 1UYLA 2HCHA 5CTXA 5M4MA 2QF6A 2GQPA 3R91A 3D0BA 3RLRA 2WEPA 4XCJA 3FT5A 3BM9A 5D7RA 3RKZA 4B7PA 4BIZA 2QFOA 4H7QA 4FCPA 1BXDA 4UROA 3MNRP 2IWXA 5CTWA 2YE5A 4NH7A 2XDLA 4JQLA 2WEQA 3QDDA 2VWCA 2Q8HA 4LWIA 4XKAA 4PU9A 3C11A 5D6PA 3HZ1A 4LPBA 3ZXOA 3PEHA 3PEJA 2BYHA 1B62A 1UYHA 2YGAA 1YT1A 1BGQA 1UY6A 2PNRA 2YEBA 5F3KA 3EHGA 4HYMA 2YKBA 3Q5LA 2BU6A 3EKRA 3JZ3A 3OMUA 1I5CA 4XKOA 4CWOA 2JKIA 4EGIA 2O1WA 5BODA 2XHXA 4JAUA 3G7EA 3OPDA 2XDKA 2YE3A 1NHHA 3OWBA 1UYGA 1I5DA 3T2SA 4GCZA 4MOTA 4NH8A 3TZ2A 1UYFA 5J6AA 3TZ4A 4HXZA 3R92A 4ASBA 3EHHA 2FWZA 5FNDA 2XHRA 3CWVA 2E0AA 4HYPA 3D2RA 4XIPA 2O1VA 1GJVA 1Z59A 2YEEA 4YKYA 5IN9A 4CWNA 2YI7A 1QZRA 2BU2A 4I3HA 3B27A 2CCSA 4P7AA 4QPKA 3K99A 3VADA 3VHCA 4WUCA 4XDMA 2XHTA 4O04A 2IOPA 1US7A 4GGLA 1Y4UA 3A0WA 2YI6A 3B26A 4BIUA 2YKCA 2WI5A 4XTJA 3A0XA 2YEGA 4U93A 1TBWA 4CWPA 2WI1A 3H80A 1YESA 1MU5A 2QG0A 2WERA 5CTUA 5M4NA 4CWSA 2WI3A 3HEKA 1AH8A 3D36A 4EFTA 4YKRA 2YEFA 4HY1A 2WI4A 2YE4A 3HYZA 2BSMA 4CE2A 1QY8A 2Q2EB 4HY6A 4YKWA 1OSFA 4LWEA 4HZ5A 3HHUA 1MX0A 3BMYA 2ZDXA 4E01A 4XCLA 4GQTA 2YKEA 3A0ZA 3T0ZA 1B3QA 5FNFA 1YC1A 2XX2A 5C93A 3DGEA 4LWHA 3ZM7A 2WI6A 5D7DA 2BREA 4MBCA 5M4HA 3K97A 1A4HA 1Y8PA 3GIGA 3QTFA 3T0HA 4FCQA 3GIEA 5CTYA 4YKXA 4Q20A 4H81A 3TUHA 2BTZA 2IORA 4W7TA 5D7CA 3ZKDA 4ZVIA 1AH6A 3K60A 3O0IA 3R4NA 3ZKBA 3A0YA 3U2DA 1NHJA 2YI5A 1UYMA 4XKKA 2XCMA 2CH4A 1S16A 5GGZA 2BRCA 4XIRA 1AM1A 2C2AA 3U2KA 3H4LA 4CWQA 4PRVA 4MPCA 3B24A 2K5BA 3G7BA 4CWTA 4KFGA 4EFUA 1UYCA 2YK9A 1YT2A 2ESAA 3B25A 4EGKA 2YGFA 3R4MA 1YERA 2IOQA 3A0RA 3Q5JA 4O07A 4MB9A 3TZ5A 3HZ5A 3CGZA 4WUBA 1UY7A 2YEHA 2BU7A 3K98A 2FXSA 4QPJA 2WI7A 1S14A 2YI0A 1TH8A 2IWSA 2BZ5A 4MPNA 2BT0A 2HG1A 1TIDA 4HXWA 1JM6A 4CE3A 1YC3A 2WI2A 4KTNA 2YE9A 3VHAA 3GIGB 4L8ZA 4MP7A 4PRXA 2JJCA 2YK2A 3O2FA 3IEDA 2XD6A 3GIFA 2EXLA 2YE2A 2QG2A 4GT8A 2Q8GA 1AMWA 4K4OA 4CE1A 2VW5A 2ZBKB 1U2OA 4GEEA 4DUHA 3INXA 2H55A 5IDMA 5BOCA 4URLA 3CRLA 3T1KA 5IDJA 2YEIA 1YT0A 1UY9A 4EM7A 2XABA 3TZ0A 4EMVA 3O6OA 4ASGA 3ZXQA 5M4EA 2YE6A 2VCJA 2FWYA 3FV5A 1NHIA 2Q8IA 4PL9A 4XC0A 1KZNA 4KP4A 1UY8A 1EI1A 2ZKJA 1YSRA 3EHJA 2XDXA 4H85A 1TC0A 1ID0A 3EHFA 1I5AA 4ZKIA 2XJXA 4KQVA 5M4KA 2YE8A 2XDSA 4HZ0A 3U67A 4I5SA 3EKOA 3LPSA 2YKIA 1KIJA 2YKJA 4URNA 2YEAA 4LWFA 1ZXMA 1TC6A 4EGHA 4B6CA 4BAEA 2GFDA 4KSGA 4U7OA 2UWDA 2O1UA 4P8OA 3T10A 1YETA 2XJJA 3TTZA 2CG9A 4WUDA 2CGFA 5F5RA 4XIQA 1H7SA 1Z5CA 2IWUA 3R4OA 4X9LA 2BU5A 5CF0A 4AWPA 4LWGA 4KSHA 3R4PA 1B63A 1ZWHA 1ZXNA 1GKXA 4R3AA 1U0ZA 2AKPA 3OWDA 3INWA 1GKZA 1YS3A 4BQGA 4YKZA 4U7NA 1THNA 1Z5BA 2BU8A 4E00A 4V25A 3WHAA 2YECA 2VCIA 4GFNA 2YE7A 3HYYA 1ZW9A 5FWKA 1UYKA 1Y4SA 4YKUA 2YEDA 3RLPA 2YEJA 1R62A 1BYQA 5CPHA 3RLQA 2XJGA 3FT8A 5L3JA 1I5BA 1H7UA 4LP0A 4JAVA 2ZDYA 4NH9A 2XDUA 4E02A 1Z5AA 4L91A 3C0EA 4R3MA 1AJ6A 4XE2A 4FCRA 1I59A 4YKTA 1UYDA 3A0TA 4O0BA 2XX4A 2H8MA 4O05A 3G75A 3VHDA 1I58A 4XITA 5D6QA 2YGEA 3NMQA 4ASAA 4MPEA 1Y8NA 3OW6A 5FNCA 4R1FA 4L93A 4L94A 1QYEA 1EA6A 3CRKA 1UYIA 2XX5A 2FYPA 3Q5KA 2CCUA 4JASA 5J71A 2CCTA 3CGYA 1Y8OA 4CWFA 4DZYA 5M4PA 4L90A 4FMTA 3WQ9A 4AS9A 4MP2A 1L0OA 3B28A 2Q8FA 4AWQA 1YC4A 2YJXA 4YKQA 4BQJA 3SL2A
chains in the Genus database with same CATH superfamily
5JENA 4AWOA 4ASFA 2HKJA 2XK2A 4XD8A 1TILA 4FPPA 1UYEA 4URMA 4E72A 4O09A 1YSZA 4CWRA 4BXIA 3KE6A 4EEHA 2YJWA 4V26A 1BKNA 3LNUA 2BYIA 1PVGA 1UYLA 2HCHA 5CTXA 5M4MA 2QF6A 2GQPA 3R91A 3D0BA 3RLRA 2WEPA 4XCJA 3FT5A 3BM9A 5D7RA 3RKZA 4B7PA 4BIZA 2QFOA 4H7QA 4FCPA 1BXDA 4UROA 3MNRP 2IWXA 5CTWA 2YE5A 2FTKA 4NH7A 2XDLA 4JQLA 2WEQA 3QDDA 2VWCA 2Q8HA 4LWIA 4XKAA 4PU9A 3C11A 5D6PA 3HZ1A 4LPBA 3ZXOA 3PEHA 3S5TA 3PEJA 2BYHA 1B62A 1UYHA 2YGAA 1BGQA 1YT1A 1UY6A 2PNRA 2YEBA 5F3KA 3EHGA 4HYMA 2YKBA 3Q5LA 2BU6A 3EKRA 3JZ3A 3OMUA 1I5CA 4XKOA 4CWOA 2JKIA 4EGIA 2O1WA 5BODA 2XHXA 4JAUA 3G7EA 3OPDA 2XDKA 2YE3A 1NHHA 3OWBA 1UYGA 1I5DA 3T2SA 4GCZA 4MOTA 4NH8A 3TZ2A 1UYFA 5J6AA 3TZ4A 4HXZA 3R92A 4ASBA 3EHHA 2FWZA 5FNDA 2XHRA 3CWVA 2E0AA 4HYPA 3D2RA 4XIPA 2O1VA 1GJVA 1Z59A 2YEEA 4YKYA 5IN9A 4CWNA 2YI7A 2C1GA 1QZRA 2BU2A 4I3HA 3B27A 2CCSA 4P7AA 4QPKA 3K99A 3VADA 3VHCA 4WUCA 4XDMA 2XHTA 4O04A 2IOPA 1US7A 4GGLA 1Y4UA 3A0WA 2YI6A 3B26A 4BIUA 2YKCA 2WI5A 4XTJA 3A0XA 2YEGA 4U93A 1TBWA 4CWPA 2WI1A 3H80A 1YESA 1MU5A 2QG0A 2WERA 5CTUA 5M4NA 4CWSA 2WI3A 3HEKA 1AH8A 3D36A 4EFTA 4YKRA 2YEFA 4HY1A 2WI4A 2YE4A 3HYZA 2BSMA 4CE2A 1QY8A 2Q2EB 4HY6A 4YKWA 3LMMA 1OSFA 4LWEA 4HZ5A 3HHUA 1MX0A 3BMYA 2ZDXA 4E01A 4XCLA 4GQTA 2YKEA 3A0ZA 3T0ZA 1B3QA 1IXMA 5FNFA 1YC1A 2XX2A 5C93A 3DGEA 4LWHA 3ZM7A 2WI6A 5D7DA 2BREA 4MBCA 5M4HA 3K97A 1A4HA 1Y8PA 3GIGA 3QTFA 3T0HA 4FCQA 3GIEA 5CTYA 4YKXA 4Q20A 4H81A 3TUHA 2BTZA 2IORA 4W7TA 5D7CA 3ZKDA 4ZVIA 1AH6A 3K60A 3O0IA 3R4NA 3ZKBA 3A0YA 3U2DA 1NHJA 2YI5A 1UYMA 4XKKA 2XCMA 2CH4A 1S16A 5GGZA 2BRCA 4XIRA 1AM1A 2C2AA 3U2KA 3H4LA 4CWQA 4PRVA 4MPCA 3B24A 2K5BA 3G7BA 4CWTA 4KFGA 4EFUA 1F51A 1UYCA 2YK9A 1YT2A 2ESAA 3B25A 3CYGA 4EGKA 2YGFA 3R4MA 1YERA 2IOQA 3A0RA 3Q5JA 4O07A 4MB9A 3TZ5A 3HZ5A 3CGZA 4WUBA 1UY7A 2YEHA 2BU7A 3K98A 2FXSA 4QPJA 2WI7A 1S14A 2YI0A 1TH8A 2IWSA 2BZ5A 4MPNA 2BT0A 2HG1A 1TIDA 4HXWA 1JM6A 4CE3A 1YC3A 2WI2A 4KTNA 2YE9A 3VHAA 3GIGB 2C1IA 4L8ZA 4MP7A 4PRXA 2JJCA 2YK2A 3O2FA 3IEDA 2XD6A 3GIFA 2EXLA 2YE2A 2QG2A 4GT8A 2Q8GA 1AMWA 4K4OA 4CE1A 2VW5A 2ZBKB 1U2OA 4GEEA 4DUHA 3INXA 2H55A 5IDMA 5BOCA 4URLA 3CRLA 3T1KA 5IDJA 2YEIA 1YT0A 1UY9A 4EM7A 2XABA 3TZ0A 4EMVA 3O6OA 4ASGA 3ZXQA 5M4EA 2YE6A 2VCJA 2FWYA 3FV5A 1NHIA 2Q8IA 4PL9A 4XC0A 1KZNA 4KP4A 1UY8A 1EI1A 2ZKJA 1YSRA 3EHJA 2XDXA 4H85A 1TC0A 1ID0A 3EHFA 1I5AA 4ZKIA 2XJXA 4KQVA 5M4KA 2YE8A 2XDSA 4HZ0A 3U67A 4I5SA 3EKOA 3LPSA 2YKIA 1KIJA 2YKJA 4URNA 2YEAA 4LWFA 1ZXMA 1TC6A 4EGHA 4B6CA 4BAEA 2GFDA 4KSGA 4U7OA 2UWDA 2O1UA 4P8OA 3T10A 1YETA 2XJJA 3TTZA 2CG9A 4WUDA 2CGFA 5F5RA 4XIQA 1H7SA 1Z5CA 2IWUA 3R4OA 4X9LA 2BU5A 5CF0A 4AWPA 4LWGA 4KSHA 3R4PA 1B63A 1ZWHA 1ZXNA 1GKXA 4R3AA 1U0ZA 2AKPA 3OWDA 3INWA 1GKZA 1YS3A 2HHIA 4BQGA 4YKZA 4U7NA 1THNA 1Z5BA 2BU8A 4E00A 4V25A 3WHAA 2YECA 2VCIA 4GFNA 2YE7A 3HYYA 1ZW9A 5FWKA 1UYKA 1Y4SA 4YKUA 2YEDA 3RLPA 2YEJA 1R62A 1BYQA 5CPHA 3RLQA 2XJGA 3FT8A 5L3JA 1I5BA 1H7UA 4LP0A 4JAVA 2ZDYA 4NH9A 2XDUA 4E02A 1Z5AA 4L91A 3C0EA 4R3MA 1AJ6A 4XE2A 4FCRA 1I59A 4YKTA 1UYDA 3A0TA 4O0BA 2XX4A 2H8MA 4O05A 3G75A 3VHDA 1I58A 4XITA 5D6QA 2YGEA 3NMQA 4ASAA 4MPEA 1Y8NA 3OW6A 5FNCA 4R1FA 4L93A 4L94A 1QYEA 1EA6A 3CRKA 1UYIA 2XX5A 2FYPA 3Q5KA 2CCUA 4JASA 5J71A 2CCTA 3CGYA 1Y8OA 4CWFA 4DZYA 5M4PA 4L90A 4FMTA 3WQ9A 4AS9A 4MP2A 1L0OA 3B28A 2Q8FA 4AWQA 1YC4A 2YJXA 4YKQA 4BQJA 3SL2A
chains in the Genus database with same CATH topology
4AWOA 4ASFA 2HKJA 2XK2A 4XD8A 1TILA 4FPPA 1UYEA 4URMA 4O09A 1YSZA 4CWRA 4BXIA 3KE6A 4EEHA 2YJWA 4V26A 1BKNA 3LNUA 2BYIA 1PVGA 1UYLA 2HCHA 5CTXA 5M4MA 2QF6A 2GQPA 3R91A 3D0BA 3RLRA 2WEPA 4XCJA 3FT5A 3BM9A 5D7RA 3RKZA 4B7PA 4BIZA 2QFOA 4H7QA 4FCPA 1BXDA 4UROA 3MNRP 2IWXA 5CTWA 2YE5A 4NH7A 2XDLA 4JQLA 2WEQA 3QDDA 2VWCA 2Q8HA 4LWIA 4XKAA 4PU9A 3C11A 5D6PA 3HZ1A 4LPBA 3ZXOA 3PEHA 3PEJA 2BYHA 1B62A 1UYHA 2YGAA 1YT1A 1BGQA 1UY6A 2PNRA 2YEBA 5F3KA 3EHGA 4HYMA 2YKBA 3Q5LA 2BU6A 3EKRA 3JZ3A 3OMUA 1I5CA 4XKOA 4CWOA 2JKIA 4EGIA 2O1WA 5BODA 2XHXA 4JAUA 3G7EA 3OPDA 2XDKA 2YE3A 1NHHA 3OWBA 1UYGA 1I5DA 3T2SA 4GCZA 4MOTA 4NH8A 3TZ2A 1UYFA 5J6AA 3TZ4A 4HXZA 3R92A 4ASBA 3EHHA 2FWZA 5FNDA 2XHRA 3CWVA 2E0AA 4HYPA 3D2RA 4XIPA 2O1VA 1GJVA 1Z59A 2YEEA 4YKYA 5IN9A 4CWNA 2YI7A 1QZRA 2BU2A 4I3HA 3B27A 2CCSA 4P7AA 4QPKA 3K99A 3VADA 3VHCA 4WUCA 4XDMA 2XHTA 4O04A 2IOPA 1US7A 4GGLA 1Y4UA 3A0WA 2YI6A 3B26A 4BIUA 2YKCA 2WI5A 4XTJA 3A0XA 2YEGA 4U93A 1TBWA 4CWPA 2WI1A 3H80A 1YESA 1MU5A 2QG0A 2WERA 5CTUA 5M4NA 4CWSA 2WI3A 3HEKA 1AH8A 3D36A 4EFTA 4YKRA 2YEFA 4HY1A 2WI4A 2YE4A 3HYZA 2BSMA 4CE2A 1QY8A 2Q2EB 4HY6A 4YKWA 1OSFA 4LWEA 4HZ5A 3HHUA 1MX0A 3BMYA 2ZDXA 4E01A 4XCLA 4GQTA 2YKEA 3A0ZA 3T0ZA 1B3QA 5FNFA 1YC1A 2XX2A 5C93A 3DGEA 4LWHA 3ZM7A 2WI6A 5D7DA 2BREA 4MBCA 5M4HA 3K97A 1A4HA 1Y8PA 3GIGA 3QTFA 3T0HA 4FCQA 3GIEA 5CTYA 4YKXA 4Q20A 4H81A 3TUHA 2BTZA 2IORA 4W7TA 5D7CA 3ZKDA 4ZVIA 1AH6A 3K60A 3O0IA 3R4NA 3ZKBA 3A0YA 3U2DA 1NHJA 2YI5A 1UYMA 4XKKA 2XCMA 2CH4A 1S16A 5GGZA 2BRCA 4XIRA 1AM1A 2C2AA 3U2KA 3H4LA 4CWQA 4PRVA 4MPCA 3B24A 2K5BA 3G7BA 4CWTA 4KFGA 4EFUA 1UYCA 2YK9A 1YT2A 2ESAA 3B25A 4EGKA 2YGFA 3R4MA 1YERA 2IOQA 3A0RA 3Q5JA 4O07A 4MB9A 3TZ5A 3HZ5A 3CGZA 4WUBA 1UY7A 2YEHA 2BU7A 3K98A 2FXSA 4QPJA 2WI7A 1S14A 2YI0A 1TH8A 2IWSA 2BZ5A 4MPNA 2BT0A 2HG1A 1TIDA 4HXWA 1JM6A 4CE3A 1YC3A 2WI2A 4KTNA 2YE9A 3VHAA 3GIGB 4L8ZA 4MP7A 4PRXA 2JJCA 2YK2A 3O2FA 3IEDA 2XD6A 3GIFA 2EXLA 2YE2A 2QG2A 4GT8A 2Q8GA 1AMWA 4K4OA 4CE1A 2VW5A 2ZBKB 1U2OA 4GEEA 4DUHA 3INXA 2H55A 5IDMA 5BOCA 4URLA 3CRLA 3T1KA 5IDJA 2YEIA 1YT0A 1UY9A 4EM7A 2XABA 3TZ0A 4EMVA 3O6OA 4ASGA 3ZXQA 5M4EA 2YE6A 2VCJA 2FWYA 3FV5A 1NHIA 2Q8IA 4PL9A 4XC0A 1KZNA 4KP4A 1UY8A 1EI1A 2ZKJA 1YSRA 3EHJA 2XDXA 4H85A 1TC0A 1ID0A 3EHFA 1I5AA 4ZKIA 2XJXA 4KQVA 5M4KA 2YE8A 2XDSA 4HZ0A 3U67A 4I5SA 3EKOA 3LPSA 2YKIA 1KIJA 2YKJA 4URNA 2YEAA 4LWFA 1ZXMA 1TC6A 4EGHA 4B6CA 4BAEA 2GFDA 4KSGA 4U7OA 2UWDA 2O1UA 4P8OA 3T10A 1YETA 2XJJA 3TTZA 2CG9A 4WUDA 2CGFA 5F5RA 4XIQA 1H7SA 1Z5CA 2IWUA 3R4OA 4X9LA 2BU5A 5CF0A 4AWPA 4LWGA 4KSHA 3R4PA 1B63A 1ZWHA 1ZXNA 1GKXA 4R3AA 1U0ZA 2AKPA 3OWDA 3INWA 1GKZA 1YS3A 4BQGA 4YKZA 4U7NA 1THNA 1Z5BA 2BU8A 4E00A 4V25A 3WHAA 2YECA 2VCIA 4GFNA 2YE7A 3HYYA 1ZW9A 5FWKA 1UYKA 1Y4SA 4YKUA 2YEDA 3RLPA 2YEJA 1R62A 1BYQA 5CPHA 3RLQA 2XJGA 3FT8A 5L3JA 1I5BA 1H7UA 4LP0A 4JAVA 2ZDYA 4NH9A 2XDUA 4E02A 1Z5AA 4L91A 3C0EA 4R3MA 1AJ6A 4XE2A 4FCRA 1I59A 4YKTA 1UYDA 3A0TA 4O0BA 2XX4A 2H8MA 4O05A 3G75A 3VHDA 1I58A 4XITA 5D6QA 2YGEA 3NMQA 4ASAA 4MPEA 1Y8NA 3OW6A 5FNCA 4R1FA 4L93A 4L94A 1QYEA 1EA6A 3CRKA 1UYIA 2XX5A 2FYPA 3Q5KA 2CCUA 4JASA 5J71A 2CCTA 3CGYA 1Y8OA 4CWFA 4DZYA 5M4PA 4L90A 4FMTA 3WQ9A 4AS9A 4MP2A 1L0OA 3B28A 2Q8FA 4AWQA 1YC4A 2YJXA 4YKQA 4BQJA 3SL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AWO A;  4ASF A;  2HKJ A;  2XK2 A;  4XD8 A;  1TIL A;  4FPP A;  1UYE A;  4URM A;  4O09 A;  1YSZ A;  4CWR A;  4BXI A;  3KE6 A;  4EEH A;  2YJW A;  4V26 A;  1BKN A;  3LNU A;  2BYI A;  1PVG A;  1UYL A;  2HCH A;  5CTX A;  5M4M A;  2QF6 A;  2GQP A;  3R91 A;  3D0B A;  3RLR A;  2WEP A;  4XCJ A;  3FT5 A;  3BM9 A;  5D7R A;  3RKZ A;  4B7P A;  4BIZ A;  2QFO A;  4H7Q A;  4FCP A;  1BXD A;  4URO A;  3MNR P;  2IWX A;  5CTW A;  2YE5 A;  4NH7 A;  2XDL A;  4JQL A;  2WEQ A;  3QDD A;  2VWC A;  2Q8H A;  4LWI A;  4XKA A;  4PU9 A;  3C11 A;  5D6P A;  3HZ1 A;  4LPB A;  3ZXO A;  3PEH A;  3PEJ A;  2BYH A;  1B62 A;  1UYH A;  2YGA A;  1YT1 A;  1BGQ A;  1UY6 A;  2PNR A;  2YEB A;  5F3K A;  3EHG A;  4HYM A;  2YKB A;  3Q5L A;  2BU6 A;  3EKR A;  3JZ3 A;  3OMU A;  1I5C A;  4XKO A;  4CWO A;  2JKI A;  4EGI A;  2O1W A;  5BOD A;  2XHX A;  4JAU A;  3G7E A;  3OPD A;  2XDK A;  2YE3 A;  1NHH A;  3OWB A;  1UYG A;  1I5D A;  3T2S A;  4GCZ A;  4MOT A;  4NH8 A;  3TZ2 A;  1UYF A;  5J6A A;  3TZ4 A;  4HXZ A;  3R92 A;  4ASB A;  3EHH A;  2FWZ A;  5FND A;  2XHR A;  3CWV A;  2E0A A;  4HYP A;  3D2R A;  4XIP A;  2O1V A;  1GJV A;  1Z59 A;  2YEE A;  4YKY A;  5IN9 A;  4CWN A;  2YI7 A;  1QZR A;  2BU2 A;  4I3H A;  3B27 A;  2CCS A;  4P7A A;  4QPK A;  3K99 A;  3VAD A;  3VHC A;  4WUC A;  4XDM A;  2XHT A;  4O04 A;  2IOP A;  1US7 A;  4GGL A;  1Y4U A;  3A0W A;  2YI6 A;  3B26 A;  4BIU A;  2YKC A;  2WI5 A;  4XTJ A;  3A0X A;  2YEG A;  4U93 A;  1TBW A;  4CWP A;  2WI1 A;  3H80 A;  1YES A;  1MU5 A;  2QG0 A;  2WER A;  5CTU A;  5M4N A;  4CWS A;  2WI3 A;  3HEK A;  1AH8 A;  3D36 A;  4EFT A;  4YKR A;  2YEF A;  4HY1 A;  2WI4 A;  2YE4 A;  3HYZ A;  2BSM A;  4CE2 A;  1QY8 A;  2Q2E B;  4HY6 A;  4YKW A;  1OSF A;  4LWE A;  4HZ5 A;  3HHU A;  1MX0 A;  3BMY A;  2ZDX A;  4E01 A;  4XCL A;  4GQT A;  2YKE A;  3A0Z A;  3T0Z A;  1B3Q A;  5FNF A;  1YC1 A;  2XX2 A;  5C93 A;  3DGE A;  4LWH A;  3ZM7 A;  2WI6 A;  5D7D A;  2BRE A;  4MBC A;  5M4H A;  3K97 A;  1A4H A;  1Y8P A;  3GIG A;  3QTF A;  3T0H A;  4FCQ A;  3GIE A;  5CTY A;  4YKX A;  4Q20 A;  4H81 A;  3TUH A;  2BTZ A;  2IOR A;  4W7T A;  5D7C A;  3ZKD A;  4ZVI A;  1AH6 A;  3K60 A;  3O0I A;  3R4N A;  3ZKB A;  3A0Y A;  3U2D A;  1NHJ A;  2YI5 A;  1UYM A;  4XKK A;  2XCM A;  2CH4 A;  1S16 A;  5GGZ A;  2BRC A;  4XIR A;  1AM1 A;  2C2A A;  3U2K A;  3H4L A;  4CWQ A;  4PRV A;  4MPC A;  3B24 A;  2K5B A;  3G7B A;  4CWT A;  4KFG A;  4EFU A;  1UYC A;  2YK9 A;  1YT2 A;  2ESA A;  3B25 A;  4EGK A;  2YGF A;  3R4M A;  1YER A;  2IOQ A;  3A0R A;  3Q5J A;  4O07 A;  4MB9 A;  3TZ5 A;  3HZ5 A;  3CGZ A;  4WUB A;  1UY7 A;  2YEH A;  2BU7 A;  3K98 A;  2FXS A;  4QPJ A;  2WI7 A;  1S14 A;  2YI0 A;  1TH8 A;  2IWS A;  2BZ5 A;  4MPN A;  2BT0 A;  2HG1 A;  1TID A;  4HXW A;  1JM6 A;  4CE3 A;  1YC3 A;  2WI2 A;  4KTN A;  2YE9 A;  3VHA A;  3GIG B;  4L8Z A;  4MP7 A;  4PRX A;  2JJC A;  2YK2 A;  3O2F A;  3IED A;  2XD6 A;  3GIF A;  2EXL A;  2YE2 A;  2QG2 A;  4GT8 A;  2Q8G A;  1AMW A;  4K4O A;  4CE1 A;  2VW5 A;  2ZBK B;  1U2O A;  4GEE A;  4DUH A;  3INX A;  2H55 A;  5IDM A;  5BOC A;  4URL A;  3CRL A;  3T1K A;  5IDJ A;  2YEI A;  1YT0 A;  1UY9 A;  4EM7 A;  2XAB A;  3TZ0 A;  4EMV A;  3O6O A;  4ASG A;  3ZXQ A;  5M4E A;  2YE6 A;  2VCJ A;  2FWY A;  3FV5 A;  1NHI A;  2Q8I A;  4PL9 A;  4XC0 A;  1KZN A;  4KP4 A;  1UY8 A;  1EI1 A;  2ZKJ A;  1YSR A;  3EHJ A;  2XDX A;  4H85 A;  1TC0 A;  1ID0 A;  3EHF A;  1I5A A;  4ZKI A;  2XJX A;  4KQV A;  5M4K A;  2YE8 A;  2XDS A;  4HZ0 A;  3U67 A;  4I5S A;  3EKO A;  3LPS A;  2YKI A;  1KIJ A;  2YKJ A;  4URN A;  2YEA A;  4LWF A;  1ZXM A;  1TC6 A;  4EGH A;  4B6C A;  4BAE A;  2GFD A;  4KSG A;  4U7O A;  2UWD A;  2O1U A;  4P8O A;  3T10 A;  1YET A;  2XJJ A;  3TTZ A;  2CG9 A;  4WUD A;  2CGF A;  5F5R A;  4XIQ A;  1H7S A;  1Z5C A;  2IWU A;  3R4O A;  4X9L A;  2BU5 A;  5CF0 A;  4AWP A;  4LWG A;  4KSH A;  3R4P A;  1B63 A;  1ZWH A;  1ZXN A;  1GKX A;  4R3A A;  1U0Z A;  2AKP A;  3OWD A;  3INW A;  1GKZ A;  1YS3 A;  4BQG A;  4YKZ A;  4U7N A;  1THN A;  1Z5B A;  2BU8 A;  4E00 A;  4V25 A;  3WHA A;  2YEC A;  2VCI A;  4GFN A;  2YE7 A;  3HYY A;  1ZW9 A;  5FWK A;  1UYK A;  1Y4S A;  4YKU A;  2YED A;  3RLP A;  2YEJ A;  1R62 A;  1BYQ A;  5CPH A;  3RLQ A;  2XJG A;  3FT8 A;  5L3J A;  1I5B A;  1H7U A;  4LP0 A;  4JAV A;  2ZDY A;  4NH9 A;  2XDU A;  4E02 A;  1Z5A A;  4L91 A;  3C0E A;  4R3M A;  1AJ6 A;  4XE2 A;  4FCR A;  1I59 A;  4YKT A;  1UYD A;  3A0T A;  4O0B A;  2XX4 A;  2H8M A;  4O05 A;  3G75 A;  3VHD A;  1I58 A;  4XIT A;  5D6Q A;  2YGE A;  3NMQ A;  4ASA A;  4MPE A;  1Y8N A;  3OW6 A;  5FNC A;  4R1F A;  4L93 A;  4L94 A;  1QYE A;  1EA6 A;  3CRK A;  1UYI A;  2XX5 A;  2FYP A;  3Q5K A;  2CCU A;  4JAS A;  5J71 A;  2CCT A;  3CGY A;  1Y8O A;  4CWF A;  4DZY A;  5M4P A;  4L90 A;  4FMT A;  3WQ9 A;  4AS9 A;  4MP2 A;  1L0O A;  3B28 A;  2Q8F A;  4AWQ A;  1YC4 A;  2YJX A;  4YKQ A;  4BQJ A;  3SL2 A; 
#chains in the Genus database with same CATH topology
 5JEN A;  4AWO A;  4ASF A;  2HKJ A;  2XK2 A;  4XD8 A;  1TIL A;  4FPP A;  1UYE A;  4URM A;  4E72 A;  4O09 A;  1YSZ A;  4CWR A;  4BXI A;  3KE6 A;  4EEH A;  2YJW A;  4V26 A;  1BKN A;  3LNU A;  2BYI A;  1PVG A;  1UYL A;  2HCH A;  5CTX A;  5M4M A;  2QF6 A;  2GQP A;  3R91 A;  3D0B A;  3RLR A;  2WEP A;  4XCJ A;  3FT5 A;  3BM9 A;  5D7R A;  3RKZ A;  4B7P A;  4BIZ A;  2QFO A;  4H7Q A;  4FCP A;  1BXD A;  4URO A;  3MNR P;  2IWX A;  5CTW A;  2YE5 A;  2FTK A;  4NH7 A;  2XDL A;  4JQL A;  2WEQ A;  3QDD A;  2VWC A;  2Q8H A;  4LWI A;  4XKA A;  4PU9 A;  3C11 A;  5D6P A;  3HZ1 A;  4LPB A;  3ZXO A;  3PEH A;  3S5T A;  3PEJ A;  2BYH A;  1B62 A;  1UYH A;  2YGA A;  1BGQ A;  1YT1 A;  1UY6 A;  2PNR A;  2YEB A;  5F3K A;  3EHG A;  4HYM A;  2YKB A;  3Q5L A;  2BU6 A;  3EKR A;  3JZ3 A;  3OMU A;  1I5C A;  4XKO A;  4CWO A;  2JKI A;  4EGI A;  2O1W A;  5BOD A;  2XHX A;  4JAU A;  3G7E A;  3OPD A;  2XDK A;  2YE3 A;  1NHH A;  3OWB A;  1UYG A;  1I5D A;  3T2S A;  4GCZ A;  4MOT A;  4NH8 A;  3TZ2 A;  1UYF A;  5J6A A;  3TZ4 A;  4HXZ A;  3R92 A;  4ASB A;  3EHH A;  2FWZ A;  5FND A;  2XHR A;  3CWV A;  2E0A A;  4HYP A;  3D2R A;  4XIP A;  2O1V A;  1GJV A;  1Z59 A;  2YEE A;  4YKY A;  5IN9 A;  4CWN A;  2YI7 A;  2C1G A;  1QZR A;  2BU2 A;  4I3H A;  3B27 A;  2CCS A;  4P7A A;  4QPK A;  3K99 A;  3VAD A;  3VHC A;  4WUC A;  4XDM A;  2XHT A;  4O04 A;  2IOP A;  1US7 A;  4GGL A;  1Y4U A;  3A0W A;  2YI6 A;  3B26 A;  4BIU A;  2YKC A;  2WI5 A;  4XTJ A;  3A0X A;  2YEG A;  4U93 A;  1TBW A;  4CWP A;  2WI1 A;  3H80 A;  1YES A;  1MU5 A;  2QG0 A;  2WER A;  5CTU A;  5M4N A;  4CWS A;  2WI3 A;  3HEK A;  1AH8 A;  3D36 A;  4EFT A;  4YKR A;  2YEF A;  4HY1 A;  2WI4 A;  2YE4 A;  3HYZ A;  2BSM A;  4CE2 A;  1QY8 A;  2Q2E B;  4HY6 A;  4YKW A;  3LMM A;  1OSF A;  4LWE A;  4HZ5 A;  3HHU A;  1MX0 A;  3BMY A;  2ZDX A;  4E01 A;  4XCL A;  4GQT A;  2YKE A;  3A0Z A;  3T0Z A;  1B3Q A;  1IXM A;  5FNF A;  1YC1 A;  2XX2 A;  5C93 A;  3DGE A;  4LWH A;  3ZM7 A;  2WI6 A;  5D7D A;  2BRE A;  4MBC A;  5M4H A;  3K97 A;  1A4H A;  1Y8P A;  3GIG A;  3QTF A;  3T0H A;  4FCQ A;  3GIE A;  5CTY A;  4YKX A;  4Q20 A;  4H81 A;  3TUH A;  2BTZ A;  2IOR A;  4W7T A;  5D7C A;  3ZKD A;  4ZVI A;  1AH6 A;  3K60 A;  3O0I A;  3R4N A;  3ZKB A;  3A0Y A;  3U2D A;  1NHJ A;  2YI5 A;  1UYM A;  4XKK A;  2XCM A;  2CH4 A;  1S16 A;  5GGZ A;  2BRC A;  4XIR A;  1AM1 A;  2C2A A;  3U2K A;  3H4L A;  4CWQ A;  4PRV A;  4MPC A;  3B24 A;  2K5B A;  3G7B A;  4CWT A;  4KFG A;  4EFU A;  1F51 A;  1UYC A;  2YK9 A;  1YT2 A;  2ESA A;  3B25 A;  3CYG A;  4EGK A;  2YGF A;  3R4M A;  1YER A;  2IOQ A;  3A0R A;  3Q5J A;  4O07 A;  4MB9 A;  3TZ5 A;  3HZ5 A;  3CGZ A;  4WUB A;  1UY7 A;  2YEH A;  2BU7 A;  3K98 A;  2FXS A;  4QPJ A;  2WI7 A;  1S14 A;  2YI0 A;  1TH8 A;  2IWS A;  2BZ5 A;  4MPN A;  2BT0 A;  2HG1 A;  1TID A;  4HXW A;  1JM6 A;  4CE3 A;  1YC3 A;  2WI2 A;  4KTN A;  2YE9 A;  3VHA A;  3GIG B;  2C1I A;  4L8Z A;  4MP7 A;  4PRX A;  2JJC A;  2YK2 A;  3O2F A;  3IED A;  2XD6 A;  3GIF A;  2EXL A;  2YE2 A;  2QG2 A;  4GT8 A;  2Q8G A;  1AMW A;  4K4O A;  4CE1 A;  2VW5 A;  2ZBK B;  1U2O A;  4GEE A;  4DUH A;  3INX A;  2H55 A;  5IDM A;  5BOC A;  4URL A;  3CRL A;  3T1K A;  5IDJ A;  2YEI A;  1YT0 A;  1UY9 A;  4EM7 A;  2XAB A;  3TZ0 A;  4EMV A;  3O6O A;  4ASG A;  3ZXQ A;  5M4E A;  2YE6 A;  2VCJ A;  2FWY A;  3FV5 A;  1NHI A;  2Q8I A;  4PL9 A;  4XC0 A;  1KZN A;  4KP4 A;  1UY8 A;  1EI1 A;  2ZKJ A;  1YSR A;  3EHJ A;  2XDX A;  4H85 A;  1TC0 A;  1ID0 A;  3EHF A;  1I5A A;  4ZKI A;  2XJX A;  4KQV A;  5M4K A;  2YE8 A;  2XDS A;  4HZ0 A;  3U67 A;  4I5S A;  3EKO A;  3LPS A;  2YKI A;  1KIJ A;  2YKJ A;  4URN A;  2YEA A;  4LWF A;  1ZXM A;  1TC6 A;  4EGH A;  4B6C A;  4BAE A;  2GFD A;  4KSG A;  4U7O A;  2UWD A;  2O1U A;  4P8O A;  3T10 A;  1YET A;  2XJJ A;  3TTZ A;  2CG9 A;  4WUD A;  2CGF A;  5F5R A;  4XIQ A;  1H7S A;  1Z5C A;  2IWU A;  3R4O A;  4X9L A;  2BU5 A;  5CF0 A;  4AWP A;  4LWG A;  4KSH A;  3R4P A;  1B63 A;  1ZWH A;  1ZXN A;  1GKX A;  4R3A A;  1U0Z A;  2AKP A;  3OWD A;  3INW A;  1GKZ A;  1YS3 A;  2HHI A;  4BQG A;  4YKZ A;  4U7N A;  1THN A;  1Z5B A;  2BU8 A;  4E00 A;  4V25 A;  3WHA A;  2YEC A;  2VCI A;  4GFN A;  2YE7 A;  3HYY A;  1ZW9 A;  5FWK A;  1UYK A;  1Y4S A;  4YKU A;  2YED A;  3RLP A;  2YEJ A;  1R62 A;  1BYQ A;  5CPH A;  3RLQ A;  2XJG A;  3FT8 A;  5L3J A;  1I5B A;  1H7U A;  4LP0 A;  4JAV A;  2ZDY A;  4NH9 A;  2XDU A;  4E02 A;  1Z5A A;  4L91 A;  3C0E A;  4R3M A;  1AJ6 A;  4XE2 A;  4FCR A;  1I59 A;  4YKT A;  1UYD A;  3A0T A;  4O0B A;  2XX4 A;  2H8M A;  4O05 A;  3G75 A;  3VHD A;  1I58 A;  4XIT A;  5D6Q A;  2YGE A;  3NMQ A;  4ASA A;  4MPE A;  1Y8N A;  3OW6 A;  5FNC A;  4R1F A;  4L93 A;  4L94 A;  1QYE A;  1EA6 A;  3CRK A;  1UYI A;  2XX5 A;  2FYP A;  3Q5K A;  2CCU A;  4JAS A;  5J71 A;  2CCT A;  3CGY A;  1Y8O A;  4CWF A;  4DZY A;  5M4P A;  4L90 A;  4FMT A;  3WQ9 A;  4AS9 A;  4MP2 A;  1L0O A;  3B28 A;  2Q8F A;  4AWQ A;  1YC4 A;  2YJX A;  4YKQ A;  4BQJ A;  3SL2 A; 
#chains in the Genus database with same CATH homology
 4AWO A;  4ASF A;  2HKJ A;  2XK2 A;  4XD8 A;  1TIL A;  4FPP A;  1UYE A;  4URM A;  4O09 A;  1YSZ A;  4CWR A;  4BXI A;  3KE6 A;  4EEH A;  2YJW A;  4V26 A;  1BKN A;  3LNU A;  2BYI A;  1PVG A;  1UYL A;  2HCH A;  5CTX A;  5M4M A;  2QF6 A;  2GQP A;  3R91 A;  3D0B A;  3RLR A;  2WEP A;  4XCJ A;  3FT5 A;  3BM9 A;  5D7R A;  3RKZ A;  4B7P A;  4BIZ A;  2QFO A;  4H7Q A;  4FCP A;  1BXD A;  4URO A;  3MNR P;  2IWX A;  5CTW A;  2YE5 A;  4NH7 A;  2XDL A;  4JQL A;  2WEQ A;  3QDD A;  2VWC A;  2Q8H A;  4LWI A;  4XKA A;  4PU9 A;  3C11 A;  5D6P A;  3HZ1 A;  4LPB A;  3ZXO A;  3PEH A;  3PEJ A;  2BYH A;  1B62 A;  1UYH A;  2YGA A;  1YT1 A;  1BGQ A;  1UY6 A;  2PNR A;  2YEB A;  5F3K A;  3EHG A;  4HYM A;  2YKB A;  3Q5L A;  2BU6 A;  3EKR A;  3JZ3 A;  3OMU A;  1I5C A;  4XKO A;  4CWO A;  2JKI A;  4EGI A;  2O1W A;  5BOD A;  2XHX A;  4JAU A;  3G7E A;  3OPD A;  2XDK A;  2YE3 A;  1NHH A;  3OWB A;  1UYG A;  1I5D A;  3T2S A;  4GCZ A;  4MOT A;  4NH8 A;  3TZ2 A;  1UYF A;  5J6A A;  3TZ4 A;  4HXZ A;  3R92 A;  4ASB A;  3EHH A;  2FWZ A;  5FND A;  2XHR A;  3CWV A;  2E0A A;  4HYP A;  3D2R A;  4XIP A;  2O1V A;  1GJV A;  1Z59 A;  2YEE A;  4YKY A;  5IN9 A;  4CWN A;  2YI7 A;  1QZR A;  2BU2 A;  4I3H A;  3B27 A;  2CCS A;  4P7A A;  4QPK A;  3K99 A;  3VAD A;  3VHC A;  4WUC A;  4XDM A;  2XHT A;  4O04 A;  2IOP A;  1US7 A;  4GGL A;  1Y4U A;  3A0W A;  2YI6 A;  3B26 A;  4BIU A;  2YKC A;  2WI5 A;  4XTJ A;  3A0X A;  2YEG A;  4U93 A;  1TBW A;  4CWP A;  2WI1 A;  3H80 A;  1YES A;  1MU5 A;  2QG0 A;  2WER A;  5CTU A;  5M4N A;  4CWS A;  2WI3 A;  3HEK A;  1AH8 A;  3D36 A;  4EFT A;  4YKR A;  2YEF A;  4HY1 A;  2WI4 A;  2YE4 A;  3HYZ A;  2BSM A;  4CE2 A;  1QY8 A;  2Q2E B;  4HY6 A;  4YKW A;  1OSF A;  4LWE A;  4HZ5 A;  3HHU A;  1MX0 A;  3BMY A;  2ZDX A;  4E01 A;  4XCL A;  4GQT A;  2YKE A;  3A0Z A;  3T0Z A;  1B3Q A;  5FNF A;  1YC1 A;  2XX2 A;  5C93 A;  3DGE A;  4LWH A;  3ZM7 A;  2WI6 A;  5D7D A;  2BRE A;  4MBC A;  5M4H A;  3K97 A;  1A4H A;  1Y8P A;  3GIG A;  3QTF A;  3T0H A;  4FCQ A;  3GIE A;  5CTY A;  4YKX A;  4Q20 A;  4H81 A;  3TUH A;  2BTZ A;  2IOR A;  4W7T A;  5D7C A;  3ZKD A;  4ZVI A;  1AH6 A;  3K60 A;  3O0I A;  3R4N A;  3ZKB A;  3A0Y A;  3U2D A;  1NHJ A;  2YI5 A;  1UYM A;  4XKK A;  2XCM A;  2CH4 A;  1S16 A;  5GGZ A;  2BRC A;  4XIR A;  1AM1 A;  2C2A A;  3U2K A;  3H4L A;  4CWQ A;  4PRV A;  4MPC A;  3B24 A;  2K5B A;  3G7B A;  4CWT A;  4KFG A;  4EFU A;  1UYC A;  2YK9 A;  1YT2 A;  2ESA A;  3B25 A;  4EGK A;  2YGF A;  3R4M A;  1YER A;  2IOQ A;  3A0R A;  3Q5J A;  4O07 A;  4MB9 A;  3TZ5 A;  3HZ5 A;  3CGZ A;  4WUB A;  1UY7 A;  2YEH A;  2BU7 A;  3K98 A;  2FXS A;  4QPJ A;  2WI7 A;  1S14 A;  2YI0 A;  1TH8 A;  2IWS A;  2BZ5 A;  4MPN A;  2BT0 A;  2HG1 A;  1TID A;  4HXW A;  1JM6 A;  4CE3 A;  1YC3 A;  2WI2 A;  4KTN A;  2YE9 A;  3VHA A;  3GIG B;  4L8Z A;  4MP7 A;  4PRX A;  2JJC A;  2YK2 A;  3O2F A;  3IED A;  2XD6 A;  3GIF A;  2EXL A;  2YE2 A;  2QG2 A;  4GT8 A;  2Q8G A;  1AMW A;  4K4O A;  4CE1 A;  2VW5 A;  2ZBK B;  1U2O A;  4GEE A;  4DUH A;  3INX A;  2H55 A;  5IDM A;  5BOC A;  4URL A;  3CRL A;  3T1K A;  5IDJ A;  2YEI A;  1YT0 A;  1UY9 A;  4EM7 A;  2XAB A;  3TZ0 A;  4EMV A;  3O6O A;  4ASG A;  3ZXQ A;  5M4E A;  2YE6 A;  2VCJ A;  2FWY A;  3FV5 A;  1NHI A;  2Q8I A;  4PL9 A;  4XC0 A;  1KZN A;  4KP4 A;  1UY8 A;  1EI1 A;  2ZKJ A;  1YSR A;  3EHJ A;  2XDX A;  4H85 A;  1TC0 A;  1ID0 A;  3EHF A;  1I5A A;  4ZKI A;  2XJX A;  4KQV A;  5M4K A;  2YE8 A;  2XDS A;  4HZ0 A;  3U67 A;  4I5S A;  3EKO A;  3LPS A;  2YKI A;  1KIJ A;  2YKJ A;  4URN A;  2YEA A;  4LWF A;  1ZXM A;  1TC6 A;  4EGH A;  4B6C A;  4BAE A;  2GFD A;  4KSG A;  4U7O A;  2UWD A;  2O1U A;  4P8O A;  3T10 A;  1YET A;  2XJJ A;  3TTZ A;  2CG9 A;  4WUD A;  2CGF A;  5F5R A;  4XIQ A;  1H7S A;  1Z5C A;  2IWU A;  3R4O A;  4X9L A;  2BU5 A;  5CF0 A;  4AWP A;  4LWG A;  4KSH A;  3R4P A;  1B63 A;  1ZWH A;  1ZXN A;  1GKX A;  4R3A A;  1U0Z A;  2AKP A;  3OWD A;  3INW A;  1GKZ A;  1YS3 A;  4BQG A;  4YKZ A;  4U7N A;  1THN A;  1Z5B A;  2BU8 A;  4E00 A;  4V25 A;  3WHA A;  2YEC A;  2VCI A;  4GFN A;  2YE7 A;  3HYY A;  1ZW9 A;  5FWK A;  1UYK A;  1Y4S A;  4YKU A;  2YED A;  3RLP A;  2YEJ A;  1R62 A;  1BYQ A;  5CPH A;  3RLQ A;  2XJG A;  3FT8 A;  5L3J A;  1I5B A;  1H7U A;  4LP0 A;  4JAV A;  2ZDY A;  4NH9 A;  2XDU A;  4E02 A;  1Z5A A;  4L91 A;  3C0E A;  4R3M A;  1AJ6 A;  4XE2 A;  4FCR A;  1I59 A;  4YKT A;  1UYD A;  3A0T A;  4O0B A;  2XX4 A;  2H8M A;  4O05 A;  3G75 A;  3VHD A;  1I58 A;  4XIT A;  5D6Q A;  2YGE A;  3NMQ A;  4ASA A;  4MPE A;  1Y8N A;  3OW6 A;  5FNC A;  4R1F A;  4L93 A;  4L94 A;  1QYE A;  1EA6 A;  3CRK A;  1UYI A;  2XX5 A;  2FYP A;  3Q5K A;  2CCU A;  4JAS A;  5J71 A;  2CCT A;  3CGY A;  1Y8O A;  4CWF A;  4DZY A;  5M4P A;  4L90 A;  4FMT A;  3WQ9 A;  4AS9 A;  4MP2 A;  1L0O A;  3B28 A;  2Q8F A;  4AWQ A;  1YC4 A;  2YJX A;  4YKQ A;  4BQJ A;  3SL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...