4UROA

Crystal structure of staph gyraseb 24kda in complex with novobiocin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
187
Chain Sequence
EAARKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords DNA GYRASE SUBUNIT B
publication title Structures of Kibdelomycin Bound to Staphylococcus Aureus Gyrb and Pare Showed a Novel U-Shaped Binding Mode.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 53
structure length 187
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4uroA00
1UYKA 3IEDA 3D36A 5BOCA 2XJXA 4QPKA 4AWOA 3R4MA 1TBWA 3A0TA 4GFNA 4PRVA 2ZKJA 2YKIA 3R92A 1UYGA 1YC1A 3D2RA 3EKRA 1Y8NA 4EFTA 4QPJA 2Q2EB 1AMWA 3DGEA 3VHCA 3GIFA 3K97A 1UYHA 4YKTA 2C2AA 5IN9A 3K98A 4O07A 1YC3A 5D7RA 4MB9A 3G7EA 4HYPA 4FCPA 4FPPA 3CRKA 2BTZA 4V26A 4BXIA 4XD8A 2IWSA 4YKYA 2WI6A 5L3JA 5GGZA 1KIJA 3R4NA 2YE8A 3CGYA 4FMTA 1ZW9A 3LPSA 4EM7A 1THNA 4GCZA 1PVGA 1Z5AA 3HHUA 3NMQA 3KE6A 3SL2A 2XDUA 3VHDA 4GT8A 3VADA 5FNCA 4P7AA 5FNFA 4HY6A 2XX2A 4EFUA 5CTYA 2VW5A 4KSGA 3U2KA 4MPNA 1R62A 2CG9A 2YI5A 4BQJA 2YEJA 1YT0A 2YKJA 4L90A 2WI2A 2YE3A 4WUCA 4L8ZA 1TIDA 3EHHA 4P8OA 1YC4A 4H85A 4XE2A 2IOPA 2XD6A 1UYDA 1UYCA 4CE3A 5F3KA 4MP2A 1US7A 5CF0A 4XIRA 5M4HA 2BU5A 2YE4A 2BZ5A 4JASA 1TH8A 4KTNA 2XDKA 2QFOA 1BYQA 2YEFA 2FXSA 1AM1A 1I5AA 2QG0A 4DUHA 1GJVA 1AH6A 1ZWHA 4CWNA 4HZ5A 4KQVA 1BXDA 2Q8HA 4HXZA 3B24A 2WEQA 2BU6A 4EMVA 4XIQA 4LWEA 3FV5A 2FYPA 5M4EA 2XCMA 3CGZA 4W7TA 1ZXNA 3EHFA 4L93A 1YSRA 4EGIA 4BAEA 2WI1A 2O1VA 5CTXA 4O04A 4CWSA 1BGQA 4YKUA 2FWYA 4CWRA 1Y8OA 4U7NA 4XCLA 1AJ6A 4CWTA 1YERA 4MPCA 3JZ3A 1EI1A 2H8MA 3OWBA 1Y4SA 4H81A 1GKXA 4HYMA 4E01A 4URLA 4AS9A 1YT1A 3INWA 4ASBA 4O05A 1Y4UA 3OWDA 3OW6A 3A0RA 4XCJA 3VHAA 4FCRA 3G75A 4MBCA 2XJGA 4JAUA 3QDDA 3H4LA 3OPDA 2WI4A 1YSZA 1TC0A 3PEHA 1U0ZA 3PEJA 4U7OA 2YEBA 5CTWA 4E00A 1L0OA 3H80A 1UYMA 4CWOA 1UY9A 4ASAA 2WEPA 3TZ4A 2BU8A 1B63A 4V25A 1UY6A 2BRCA 4GQTA 1ID0A 4BIZA 3Q5LA 1I5BA 2XDXA 3B25A 1QYEA 4XTJA 3RLQA 4KP4A 4MOTA 2Q8FA 2ZDXA 2CCUA 1KZNA 4URNA 4LWIA 4XC0A 4WUDA 5IDMA 5FWKA 5J6AA 1UY8A 2XX4A 5CPHA 1JM6A 3MNRP 4Q20A 4LWGA 4NH7A 3T0ZA 4YKRA 2EXLA 3O6OA 3T2SA 3C11A 3Q5KA 4LWFA 3WHAA 2YE7A 4O09A 4JQLA 2YGEA 3INXA 3RKZA 4ZKIA 5FNDA 2JKIA 4HZ0A 1NHHA 3T1KA 4H7QA 1H7UA 2HCHA 2YI7A 3R91A 4MPEA 1UYIA 3O0IA 3EHJA 3ZKBA 4DZYA 2VWCA 2VCJA 2O1WA 3GIEA 1YETA 2WI7A 2BREA 3RLRA 2PNRA 3K99A 3U2DA 4KFGA 4PRXA 3LNUA 3TTZA 4K4OA 2IWUA 1MU5A 2YEIA 2YJWA 4ASGA 5M4KA 3OMUA 4R1FA 4CE1A 3EKOA 5D7DA 3TZ0A 4EEHA 3A0XA 1Y8PA 2WI5A 1UY7A 4CE2A 4B7PA 4UROA 4EGHA 1I59A 3BMYA 4U93A 2Q8GA 2YI0A 4PU9A 4R3MA 1A4HA 3BM9A 2WERA 3ZM7A 2BYHA 2XHTA 2BU7A 2XDLA 5J71A 4O0BA 2YE5A 1NHIA 2YEEA 3A0ZA 3G7BA 3QTFA 2XDSA 2YK2A 5CTUA 2CCSA 4CWQA 1I5DA 2CGFA 3Q5JA 2JJCA 3FT5A 2QG2A 2YE9A 1Z5BA 2XHRA 1I5CA 3B26A 3D0BA 2YE2A 1B3QA 1S14A 2YGAA 3B28A 3HZ1A 2BU2A 2BT0A 3HYYA 2BSMA 1BKNA 2YEAA 4YKXA 1U2OA 1TILA 3A0YA 1UYLA 2XABA 1S16A 4NH9A 2GQPA 3ZXQA 5M4NA 4AWQA 3CRLA 2YE6A 4KSHA 4YKQA 2YJXA 2VCIA 2WI3A 5F5RA 2YEHA 1B62A 4L91A 1NHJA 2AKPA 5D6PA 4XDMA 2O1UA 3T0HA 1GKZA 2CCTA 1YESA 2IOQA 1EA6A 4GGLA 2GFDA 3RLPA 4L94A 3EHGA 4XKOA 4XKAA 2ZDYA 4YKZA 4GEEA 1YS3A 2IWXA 5C93A 2HKJA 4LP0A 1ZXMA 2E0AA 2XJJA 3B27A 4B6CA 3HEKA 5IDJA 3TZ2A 2UWDA 3HYZA 4LWHA 4JAVA 4HY1A 4BQGA 2XHXA 1OSFA 4I5SA 2QF6A 1I58A 1UYEA 3ZXOA 3TUHA 4MP7A 3C0EA 4X9LA 2YEDA 4LPBA 3GIGA 2XK2A 3TZ5A 2YKBA 3R4OA 4E02A 5D6QA 1QY8A 4CWPA 2IORA 2YKCA 4CWFA 2YEGA 1UYFA 2YGFA 2YECA 1Z59A 4BIUA 1TC6A 2FWZA 2H55A 4XKKA 3O2FA 3U67A 5D7CA 4NH8A 1QZRA 4HXWA 4ASFA 2XX5A 4YKWA 5M4PA 5BODA 2BYIA 4I3HA 1AH8A 2YK9A 4XITA 3K60A 3FT8A 2YKEA 4URMA 2K5BA 3ZKDA 3CWVA 4R3AA 4AWPA 1MX0A 4EGKA 1H7SA 1Z5CA 2Q8IA 4ZVIA 3GIGB 3HZ5A 3WQ9A 4FCQA 4PL9A 4XIPA 4WUBA 3T10A 3R4PA 5M4MA 3A0WA 2YI6A 1YT2A 2ZBKB 2HG1A 2ESAA 2CH4A
chains in the Genus database with same CATH superfamily
1UYKA 3IEDA 3D36A 5BOCA 2XJXA 4QPKA 4AWOA 3R4MA 1TBWA 3A0TA 4GFNA 4PRVA 2ZKJA 2YKIA 3R92A 1UYGA 1YC1A 3D2RA 3EKRA 1Y8NA 4EFTA 4QPJA 2Q2EB 1AMWA 3DGEA 3VHCA 3GIFA 3K97A 1UYHA 4YKTA 4E72A 2C2AA 5IN9A 3K98A 4O07A 1YC3A 5D7RA 4MB9A 3G7EA 4HYPA 4FCPA 4FPPA 3CRKA 2BTZA 4V26A 4BXIA 4XD8A 2IWSA 4YKYA 2WI6A 5L3JA 5GGZA 1KIJA 3R4NA 2YE8A 3CGYA 4FMTA 1ZW9A 3LPSA 4EM7A 1THNA 4GCZA 1PVGA 1Z5AA 3HHUA 3NMQA 3KE6A 3SL2A 2XDUA 3VHDA 4GT8A 3VADA 5FNCA 4P7AA 5FNFA 4HY6A 2XX2A 4EFUA 5CTYA 2VW5A 4KSGA 3U2KA 4MPNA 1R62A 2CG9A 2YI5A 4BQJA 2YEJA 1YT0A 2YKJA 4L90A 2WI2A 2YE3A 4WUCA 4L8ZA 1TIDA 3EHHA 4P8OA 1YC4A 4H85A 4XE2A 2IOPA 2XD6A 1UYDA 1UYCA 4CE3A 5F3KA 4MP2A 1US7A 5CF0A 4XIRA 5M4HA 2BU5A 2YE4A 2BZ5A 4JASA 1TH8A 4KTNA 2XDKA 2QFOA 1BYQA 2YEFA 2FXSA 1AM1A 1I5AA 2QG0A 4DUHA 1GJVA 1AH6A 1ZWHA 4CWNA 4HZ5A 4KQVA 1BXDA 2Q8HA 4HXZA 3B24A 2WEQA 2BU6A 4EMVA 4XIQA 4LWEA 3FV5A 2FYPA 5M4EA 2XCMA 3CGZA 4W7TA 1ZXNA 3EHFA 4L93A 1YSRA 4EGIA 4BAEA 2WI1A 2O1VA 5CTXA 4O04A 4CWSA 1BGQA 4YKUA 2FWYA 4CWRA 1Y8OA 4U7NA 4XCLA 1AJ6A 4CWTA 1YERA 4MPCA 3JZ3A 1EI1A 2H8MA 3OWBA 1Y4SA 4H81A 1GKXA 4HYMA 5JENA 4E01A 4URLA 4AS9A 1YT1A 3INWA 4ASBA 4O05A 1Y4UA 3OWDA 3OW6A 3A0RA 4XCJA 3VHAA 4FCRA 3G75A 4MBCA 2XJGA 4JAUA 3QDDA 3H4LA 3OPDA 2WI4A 1YSZA 1TC0A 3PEHA 1U0ZA 3PEJA 4U7OA 2YEBA 5CTWA 4E00A 1L0OA 3H80A 1UYMA 4CWOA 1UY9A 4ASAA 2WEPA 3TZ4A 2BU8A 1B63A 4V25A 1UY6A 2BRCA 4GQTA 1ID0A 4BIZA 3Q5LA 1I5BA 2XDXA 3B25A 1QYEA 4XTJA 3RLQA 1IXMA 2C1GA 4KP4A 4MOTA 2Q8FA 2ZDXA 2CCUA 1KZNA 4URNA 4LWIA 4XC0A 4WUDA 5IDMA 5FWKA 5J6AA 1UY8A 2XX4A 5CPHA 1JM6A 3MNRP 4Q20A 4LWGA 4NH7A 3T0ZA 4YKRA 2EXLA 3O6OA 3T2SA 3C11A 3Q5KA 4LWFA 3WHAA 2YE7A 4O09A 4JQLA 2YGEA 3CYGA 3INXA 3RKZA 4ZKIA 5FNDA 2JKIA 4HZ0A 1NHHA 3T1KA 4H7QA 1H7UA 2HCHA 2YI7A 3R91A 4MPEA 1UYIA 3O0IA 3EHJA 2HHIA 3ZKBA 4DZYA 2VWCA 2VCJA 2O1WA 3GIEA 1YETA 2WI7A 2BREA 3RLRA 2PNRA 3K99A 3U2DA 2C1IA 4KFGA 4PRXA 3LNUA 3TTZA 4K4OA 2IWUA 1MU5A 2YEIA 2YJWA 4ASGA 5M4KA 3OMUA 4R1FA 4CE1A 3EKOA 5D7DA 3TZ0A 4EEHA 3A0XA 1Y8PA 2WI5A 1UY7A 4CE2A 4B7PA 4UROA 4EGHA 1I59A 3BMYA 4U93A 2Q8GA 2YI0A 4PU9A 4R3MA 1A4HA 3BM9A 2WERA 3ZM7A 2BYHA 2XHTA 2BU7A 2XDLA 5J71A 4O0BA 2YE5A 1NHIA 2YEEA 3A0ZA 3G7BA 3QTFA 2XDSA 2YK2A 5CTUA 2CCSA 4CWQA 1I5DA 2CGFA 3Q5JA 2JJCA 3FT5A 2QG2A 2YE9A 1Z5BA 2XHRA 1I5CA 3B26A 3D0BA 2YE2A 1B3QA 1S14A 2YGAA 3B28A 3HZ1A 2BU2A 2BT0A 3HYYA 2BSMA 1BKNA 2YEAA 4YKXA 1U2OA 1TILA 3A0YA 1UYLA 2XABA 1S16A 4NH9A 2GQPA 3ZXQA 5M4NA 4AWQA 3CRLA 2YE6A 4KSHA 4YKQA 2YJXA 2VCIA 2WI3A 5F5RA 2YEHA 1B62A 4L91A 1NHJA 2AKPA 5D6PA 4XDMA 2O1UA 3T0HA 1GKZA 2CCTA 1YESA 2IOQA 1EA6A 4GGLA 2GFDA 3RLPA 4L94A 3EHGA 4XKOA 3LMMA 4XKAA 2ZDYA 4YKZA 4GEEA 1YS3A 2IWXA 5C93A 2HKJA 4LP0A 1ZXMA 2E0AA 2XJJA 3B27A 4B6CA 3HEKA 5IDJA 3TZ2A 2UWDA 3HYZA 4LWHA 4JAVA 4HY1A 4BQGA 2XHXA 1OSFA 4I5SA 2QF6A 1I58A 1UYEA 3ZXOA 3TUHA 4MP7A 3C0EA 4X9LA 2YEDA 4LPBA 3GIGA 2XK2A 3TZ5A 2YKBA 3R4OA 4E02A 5D6QA 1QY8A 4CWPA 2IORA 2YKCA 4CWFA 2YEGA 1UYFA 2YGFA 2YECA 1Z59A 4BIUA 1TC6A 2FWZA 2H55A 3S5TA 4XKKA 3O2FA 3U67A 5D7CA 4NH8A 1QZRA 4HXWA 4ASFA 2XX5A 4YKWA 5M4PA 5BODA 2BYIA 4I3HA 1AH8A 2YK9A 4XITA 3K60A 3FT8A 2FTKA 2YKEA 4URMA 2K5BA 3ZKDA 3CWVA 4R3AA 4AWPA 1MX0A 4EGKA 1H7SA 1Z5CA 2Q8IA 4ZVIA 3GIGB 3HZ5A 3WQ9A 4FCQA 4PL9A 4XIPA 4WUBA 3T10A 3R4PA 5M4MA 3A0WA 2YI6A 1YT2A 1F51A 2ZBKB 2HG1A 2ESAA 2CH4A
chains in the Genus database with same CATH topology
1UYKA 3IEDA 3D36A 5BOCA 2XJXA 4QPKA 4AWOA 3R4MA 1TBWA 3A0TA 4GFNA 4PRVA 2ZKJA 2YKIA 3R92A 1UYGA 1YC1A 3D2RA 3EKRA 1Y8NA 4EFTA 4QPJA 2Q2EB 1AMWA 3DGEA 3VHCA 3GIFA 3K97A 1UYHA 4YKTA 2C2AA 5IN9A 3K98A 4O07A 1YC3A 5D7RA 4MB9A 3G7EA 4HYPA 4FCPA 4FPPA 3CRKA 2BTZA 4V26A 4BXIA 4XD8A 2IWSA 4YKYA 2WI6A 5L3JA 5GGZA 1KIJA 3R4NA 2YE8A 3CGYA 4FMTA 1ZW9A 3LPSA 4EM7A 1THNA 4GCZA 1PVGA 1Z5AA 3HHUA 3NMQA 3KE6A 3SL2A 2XDUA 3VHDA 4GT8A 3VADA 5FNCA 4P7AA 5FNFA 4HY6A 2XX2A 4EFUA 5CTYA 2VW5A 4KSGA 3U2KA 4MPNA 1R62A 2CG9A 2YI5A 4BQJA 2YEJA 1YT0A 2YKJA 4L90A 2WI2A 2YE3A 4WUCA 4L8ZA 1TIDA 3EHHA 4P8OA 1YC4A 4H85A 4XE2A 2IOPA 2XD6A 1UYDA 1UYCA 4CE3A 5F3KA 4MP2A 1US7A 5CF0A 4XIRA 5M4HA 2BU5A 2YE4A 2BZ5A 4JASA 1TH8A 4KTNA 2XDKA 2QFOA 1BYQA 2YEFA 2FXSA 1AM1A 1I5AA 2QG0A 4DUHA 1GJVA 1AH6A 1ZWHA 4CWNA 4HZ5A 4KQVA 1BXDA 2Q8HA 4HXZA 3B24A 2WEQA 2BU6A 4EMVA 4XIQA 4LWEA 3FV5A 2FYPA 5M4EA 2XCMA 3CGZA 4W7TA 1ZXNA 3EHFA 4L93A 1YSRA 4EGIA 4BAEA 2WI1A 2O1VA 5CTXA 4O04A 4CWSA 1BGQA 4YKUA 2FWYA 4CWRA 1Y8OA 4U7NA 4XCLA 1AJ6A 4CWTA 1YERA 4MPCA 3JZ3A 1EI1A 2H8MA 3OWBA 1Y4SA 4H81A 1GKXA 4HYMA 4E01A 4URLA 4AS9A 1YT1A 3INWA 4ASBA 4O05A 1Y4UA 3OWDA 3OW6A 3A0RA 4XCJA 3VHAA 4FCRA 3G75A 4MBCA 2XJGA 4JAUA 3QDDA 3H4LA 3OPDA 2WI4A 1YSZA 1TC0A 3PEHA 1U0ZA 3PEJA 4U7OA 2YEBA 5CTWA 4E00A 1L0OA 3H80A 1UYMA 4CWOA 1UY9A 4ASAA 2WEPA 3TZ4A 2BU8A 1B63A 4V25A 1UY6A 2BRCA 4GQTA 1ID0A 4BIZA 3Q5LA 1I5BA 2XDXA 3B25A 1QYEA 4XTJA 3RLQA 4KP4A 4MOTA 2Q8FA 2ZDXA 2CCUA 1KZNA 4URNA 4LWIA 4XC0A 4WUDA 5IDMA 5FWKA 5J6AA 1UY8A 2XX4A 5CPHA 1JM6A 3MNRP 4Q20A 4LWGA 4NH7A 3T0ZA 4YKRA 2EXLA 3O6OA 3T2SA 3C11A 3Q5KA 4LWFA 3WHAA 2YE7A 4O09A 4JQLA 2YGEA 3INXA 3RKZA 4ZKIA 5FNDA 2JKIA 4HZ0A 1NHHA 3T1KA 4H7QA 1H7UA 2HCHA 2YI7A 3R91A 4MPEA 1UYIA 3O0IA 3EHJA 3ZKBA 4DZYA 2VWCA 2VCJA 2O1WA 3GIEA 1YETA 2WI7A 2BREA 3RLRA 2PNRA 3K99A 3U2DA 4KFGA 4PRXA 3LNUA 3TTZA 4K4OA 2IWUA 1MU5A 2YEIA 2YJWA 4ASGA 5M4KA 3OMUA 4R1FA 4CE1A 3EKOA 5D7DA 3TZ0A 4EEHA 3A0XA 1Y8PA 2WI5A 1UY7A 4CE2A 4B7PA 4UROA 4EGHA 1I59A 3BMYA 4U93A 2Q8GA 2YI0A 4PU9A 4R3MA 1A4HA 3BM9A 2WERA 3ZM7A 2BYHA 2XHTA 2BU7A 2XDLA 5J71A 4O0BA 2YE5A 1NHIA 2YEEA 3A0ZA 3G7BA 3QTFA 2XDSA 2YK2A 5CTUA 2CCSA 4CWQA 1I5DA 2CGFA 3Q5JA 2JJCA 3FT5A 2QG2A 2YE9A 1Z5BA 2XHRA 1I5CA 3B26A 3D0BA 2YE2A 1B3QA 1S14A 2YGAA 3B28A 3HZ1A 2BU2A 2BT0A 3HYYA 2BSMA 1BKNA 2YEAA 4YKXA 1U2OA 1TILA 3A0YA 1UYLA 2XABA 1S16A 4NH9A 2GQPA 3ZXQA 5M4NA 4AWQA 3CRLA 2YE6A 4KSHA 4YKQA 2YJXA 2VCIA 2WI3A 5F5RA 2YEHA 1B62A 4L91A 1NHJA 2AKPA 5D6PA 4XDMA 2O1UA 3T0HA 1GKZA 2CCTA 1YESA 2IOQA 1EA6A 4GGLA 2GFDA 3RLPA 4L94A 3EHGA 4XKOA 4XKAA 2ZDYA 4YKZA 4GEEA 1YS3A 2IWXA 5C93A 2HKJA 4LP0A 1ZXMA 2E0AA 2XJJA 3B27A 4B6CA 3HEKA 5IDJA 3TZ2A 2UWDA 3HYZA 4LWHA 4JAVA 4HY1A 4BQGA 2XHXA 1OSFA 4I5SA 2QF6A 1I58A 1UYEA 3ZXOA 3TUHA 4MP7A 3C0EA 4X9LA 2YEDA 4LPBA 3GIGA 2XK2A 3TZ5A 2YKBA 3R4OA 4E02A 5D6QA 1QY8A 4CWPA 2IORA 2YKCA 4CWFA 2YEGA 1UYFA 2YGFA 2YECA 1Z59A 4BIUA 1TC6A 2FWZA 2H55A 4XKKA 3O2FA 3U67A 5D7CA 4NH8A 1QZRA 4HXWA 4ASFA 2XX5A 4YKWA 5M4PA 5BODA 2BYIA 4I3HA 1AH8A 2YK9A 4XITA 3K60A 3FT8A 2YKEA 4URMA 2K5BA 3ZKDA 3CWVA 4R3AA 4AWPA 1MX0A 4EGKA 1H7SA 1Z5CA 2Q8IA 4ZVIA 3GIGB 3HZ5A 3WQ9A 4FCQA 4PL9A 4XIPA 4WUBA 3T10A 3R4PA 5M4MA 3A0WA 2YI6A 1YT2A 2ZBKB 2HG1A 2ESAA 2CH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UYK A;  3IED A;  3D36 A;  5BOC A;  2XJX A;  4QPK A;  4AWO A;  3R4M A;  1TBW A;  3A0T A;  4GFN A;  4PRV A;  2ZKJ A;  2YKI A;  3R92 A;  1UYG A;  1YC1 A;  3D2R A;  3EKR A;  1Y8N A;  4EFT A;  4QPJ A;  2Q2E B;  1AMW A;  3DGE A;  3VHC A;  3GIF A;  3K97 A;  1UYH A;  4YKT A;  2C2A A;  5IN9 A;  3K98 A;  4O07 A;  1YC3 A;  5D7R A;  4MB9 A;  3G7E A;  4HYP A;  4FCP A;  4FPP A;  3CRK A;  2BTZ A;  4V26 A;  4BXI A;  4XD8 A;  2IWS A;  4YKY A;  2WI6 A;  5L3J A;  5GGZ A;  1KIJ A;  3R4N A;  2YE8 A;  3CGY A;  4FMT A;  1ZW9 A;  3LPS A;  4EM7 A;  1THN A;  4GCZ A;  1PVG A;  1Z5A A;  3HHU A;  3NMQ A;  3KE6 A;  3SL2 A;  2XDU A;  3VHD A;  4GT8 A;  3VAD A;  5FNC A;  4P7A A;  5FNF A;  4HY6 A;  2XX2 A;  4EFU A;  5CTY A;  2VW5 A;  4KSG A;  3U2K A;  4MPN A;  1R62 A;  2CG9 A;  2YI5 A;  4BQJ A;  2YEJ A;  1YT0 A;  2YKJ A;  4L90 A;  2WI2 A;  2YE3 A;  4WUC A;  4L8Z A;  1TID A;  3EHH A;  4P8O A;  1YC4 A;  4H85 A;  4XE2 A;  2IOP A;  2XD6 A;  1UYD A;  1UYC A;  4CE3 A;  5F3K A;  4MP2 A;  1US7 A;  5CF0 A;  4XIR A;  5M4H A;  2BU5 A;  2YE4 A;  2BZ5 A;  4JAS A;  1TH8 A;  4KTN A;  2XDK A;  2QFO A;  1BYQ A;  2YEF A;  2FXS A;  1AM1 A;  1I5A A;  2QG0 A;  4DUH A;  1GJV A;  1AH6 A;  1ZWH A;  4CWN A;  4HZ5 A;  4KQV A;  1BXD A;  2Q8H A;  4HXZ A;  3B24 A;  2WEQ A;  2BU6 A;  4EMV A;  4XIQ A;  4LWE A;  3FV5 A;  2FYP A;  5M4E A;  2XCM A;  3CGZ A;  4W7T A;  1ZXN A;  3EHF A;  4L93 A;  1YSR A;  4EGI A;  4BAE A;  2WI1 A;  2O1V A;  5CTX A;  4O04 A;  4CWS A;  1BGQ A;  4YKU A;  2FWY A;  4CWR A;  1Y8O A;  4U7N A;  4XCL A;  1AJ6 A;  4CWT A;  1YER A;  4MPC A;  3JZ3 A;  1EI1 A;  2H8M A;  3OWB A;  1Y4S A;  4H81 A;  1GKX A;  4HYM A;  4E01 A;  4URL A;  4AS9 A;  1YT1 A;  3INW A;  4ASB A;  4O05 A;  1Y4U A;  3OWD A;  3OW6 A;  3A0R A;  4XCJ A;  3VHA A;  4FCR A;  3G75 A;  4MBC A;  2XJG A;  4JAU A;  3QDD A;  3H4L A;  3OPD A;  2WI4 A;  1YSZ A;  1TC0 A;  3PEH A;  1U0Z A;  3PEJ A;  4U7O A;  2YEB A;  5CTW A;  4E00 A;  1L0O A;  3H80 A;  1UYM A;  4CWO A;  1UY9 A;  4ASA A;  2WEP A;  3TZ4 A;  2BU8 A;  1B63 A;  4V25 A;  1UY6 A;  2BRC A;  4GQT A;  1ID0 A;  4BIZ A;  3Q5L A;  1I5B A;  2XDX A;  3B25 A;  1QYE A;  4XTJ A;  3RLQ A;  4KP4 A;  4MOT A;  2Q8F A;  2ZDX A;  2CCU A;  1KZN A;  4URN A;  4LWI A;  4XC0 A;  4WUD A;  5IDM A;  5FWK A;  5J6A A;  1UY8 A;  2XX4 A;  5CPH A;  1JM6 A;  3MNR P;  4Q20 A;  4LWG A;  4NH7 A;  3T0Z A;  4YKR A;  2EXL A;  3O6O A;  3T2S A;  3C11 A;  3Q5K A;  4LWF A;  3WHA A;  2YE7 A;  4O09 A;  4JQL A;  2YGE A;  3INX A;  3RKZ A;  4ZKI A;  5FND A;  2JKI A;  4HZ0 A;  1NHH A;  3T1K A;  4H7Q A;  1H7U A;  2HCH A;  2YI7 A;  3R91 A;  4MPE A;  1UYI A;  3O0I A;  3EHJ A;  3ZKB A;  4DZY A;  2VWC A;  2VCJ A;  2O1W A;  3GIE A;  1YET A;  2WI7 A;  2BRE A;  3RLR A;  2PNR A;  3K99 A;  3U2D A;  4KFG A;  4PRX A;  3LNU A;  3TTZ A;  4K4O A;  2IWU A;  1MU5 A;  2YEI A;  2YJW A;  4ASG A;  5M4K A;  3OMU A;  4R1F A;  4CE1 A;  3EKO A;  5D7D A;  3TZ0 A;  4EEH A;  3A0X A;  1Y8P A;  2WI5 A;  1UY7 A;  4CE2 A;  4B7P A;  4URO A;  4EGH A;  1I59 A;  3BMY A;  4U93 A;  2Q8G A;  2YI0 A;  4PU9 A;  4R3M A;  1A4H A;  3BM9 A;  2WER A;  3ZM7 A;  2BYH A;  2XHT A;  2BU7 A;  2XDL A;  5J71 A;  4O0B A;  2YE5 A;  1NHI A;  2YEE A;  3A0Z A;  3G7B A;  3QTF A;  2XDS A;  2YK2 A;  5CTU A;  2CCS A;  4CWQ A;  1I5D A;  2CGF A;  3Q5J A;  2JJC A;  3FT5 A;  2QG2 A;  2YE9 A;  1Z5B A;  2XHR A;  1I5C A;  3B26 A;  3D0B A;  2YE2 A;  1B3Q A;  1S14 A;  2YGA A;  3B28 A;  3HZ1 A;  2BU2 A;  2BT0 A;  3HYY A;  2BSM A;  1BKN A;  2YEA A;  4YKX A;  1U2O A;  1TIL A;  3A0Y A;  1UYL A;  2XAB A;  1S16 A;  4NH9 A;  2GQP A;  3ZXQ A;  5M4N A;  4AWQ A;  3CRL A;  2YE6 A;  4KSH A;  4YKQ A;  2YJX A;  2VCI A;  2WI3 A;  5F5R A;  2YEH A;  1B62 A;  4L91 A;  1NHJ A;  2AKP A;  5D6P A;  4XDM A;  2O1U A;  3T0H A;  1GKZ A;  2CCT A;  1YES A;  2IOQ A;  1EA6 A;  4GGL A;  2GFD A;  3RLP A;  4L94 A;  3EHG A;  4XKO A;  4XKA A;  2ZDY A;  4YKZ A;  4GEE A;  1YS3 A;  2IWX A;  5C93 A;  2HKJ A;  4LP0 A;  1ZXM A;  2E0A A;  2XJJ A;  3B27 A;  4B6C A;  3HEK A;  5IDJ A;  3TZ2 A;  2UWD A;  3HYZ A;  4LWH A;  4JAV A;  4HY1 A;  4BQG A;  2XHX A;  1OSF A;  4I5S A;  2QF6 A;  1I58 A;  1UYE A;  3ZXO A;  3TUH A;  4MP7 A;  3C0E A;  4X9L A;  2YED A;  4LPB A;  3GIG A;  2XK2 A;  3TZ5 A;  2YKB A;  3R4O A;  4E02 A;  5D6Q A;  1QY8 A;  4CWP A;  2IOR A;  2YKC A;  4CWF A;  2YEG A;  1UYF A;  2YGF A;  2YEC A;  1Z59 A;  4BIU A;  1TC6 A;  2FWZ A;  2H55 A;  4XKK A;  3O2F A;  3U67 A;  5D7C A;  4NH8 A;  1QZR A;  4HXW A;  4ASF A;  2XX5 A;  4YKW A;  5M4P A;  5BOD A;  2BYI A;  4I3H A;  1AH8 A;  2YK9 A;  4XIT A;  3K60 A;  3FT8 A;  2YKE A;  4URM A;  2K5B A;  3ZKD A;  3CWV A;  4R3A A;  4AWP A;  1MX0 A;  4EGK A;  1H7S A;  1Z5C A;  2Q8I A;  4ZVI A;  3GIG B;  3HZ5 A;  3WQ9 A;  4FCQ A;  4PL9 A;  4XIP A;  4WUB A;  3T10 A;  3R4P A;  5M4M A;  3A0W A;  2YI6 A;  1YT2 A;  2ZBK B;  2HG1 A;  2ESA A;  2CH4 A; 
#chains in the Genus database with same CATH topology
 1UYK A;  3IED A;  3D36 A;  5BOC A;  2XJX A;  4QPK A;  4AWO A;  3R4M A;  1TBW A;  3A0T A;  4GFN A;  4PRV A;  2ZKJ A;  2YKI A;  3R92 A;  1UYG A;  1YC1 A;  3D2R A;  3EKR A;  1Y8N A;  4EFT A;  4QPJ A;  2Q2E B;  1AMW A;  3DGE A;  3VHC A;  3GIF A;  3K97 A;  1UYH A;  4YKT A;  4E72 A;  2C2A A;  5IN9 A;  3K98 A;  4O07 A;  1YC3 A;  5D7R A;  4MB9 A;  3G7E A;  4HYP A;  4FCP A;  4FPP A;  3CRK A;  2BTZ A;  4V26 A;  4BXI A;  4XD8 A;  2IWS A;  4YKY A;  2WI6 A;  5L3J A;  5GGZ A;  1KIJ A;  3R4N A;  2YE8 A;  3CGY A;  4FMT A;  1ZW9 A;  3LPS A;  4EM7 A;  1THN A;  4GCZ A;  1PVG A;  1Z5A A;  3HHU A;  3NMQ A;  3KE6 A;  3SL2 A;  2XDU A;  3VHD A;  4GT8 A;  3VAD A;  5FNC A;  4P7A A;  5FNF A;  4HY6 A;  2XX2 A;  4EFU A;  5CTY A;  2VW5 A;  4KSG A;  3U2K A;  4MPN A;  1R62 A;  2CG9 A;  2YI5 A;  4BQJ A;  2YEJ A;  1YT0 A;  2YKJ A;  4L90 A;  2WI2 A;  2YE3 A;  4WUC A;  4L8Z A;  1TID A;  3EHH A;  4P8O A;  1YC4 A;  4H85 A;  4XE2 A;  2IOP A;  2XD6 A;  1UYD A;  1UYC A;  4CE3 A;  5F3K A;  4MP2 A;  1US7 A;  5CF0 A;  4XIR A;  5M4H A;  2BU5 A;  2YE4 A;  2BZ5 A;  4JAS A;  1TH8 A;  4KTN A;  2XDK A;  2QFO A;  1BYQ A;  2YEF A;  2FXS A;  1AM1 A;  1I5A A;  2QG0 A;  4DUH A;  1GJV A;  1AH6 A;  1ZWH A;  4CWN A;  4HZ5 A;  4KQV A;  1BXD A;  2Q8H A;  4HXZ A;  3B24 A;  2WEQ A;  2BU6 A;  4EMV A;  4XIQ A;  4LWE A;  3FV5 A;  2FYP A;  5M4E A;  2XCM A;  3CGZ A;  4W7T A;  1ZXN A;  3EHF A;  4L93 A;  1YSR A;  4EGI A;  4BAE A;  2WI1 A;  2O1V A;  5CTX A;  4O04 A;  4CWS A;  1BGQ A;  4YKU A;  2FWY A;  4CWR A;  1Y8O A;  4U7N A;  4XCL A;  1AJ6 A;  4CWT A;  1YER A;  4MPC A;  3JZ3 A;  1EI1 A;  2H8M A;  3OWB A;  1Y4S A;  4H81 A;  1GKX A;  4HYM A;  5JEN A;  4E01 A;  4URL A;  4AS9 A;  1YT1 A;  3INW A;  4ASB A;  4O05 A;  1Y4U A;  3OWD A;  3OW6 A;  3A0R A;  4XCJ A;  3VHA A;  4FCR A;  3G75 A;  4MBC A;  2XJG A;  4JAU A;  3QDD A;  3H4L A;  3OPD A;  2WI4 A;  1YSZ A;  1TC0 A;  3PEH A;  1U0Z A;  3PEJ A;  4U7O A;  2YEB A;  5CTW A;  4E00 A;  1L0O A;  3H80 A;  1UYM A;  4CWO A;  1UY9 A;  4ASA A;  2WEP A;  3TZ4 A;  2BU8 A;  1B63 A;  4V25 A;  1UY6 A;  2BRC A;  4GQT A;  1ID0 A;  4BIZ A;  3Q5L A;  1I5B A;  2XDX A;  3B25 A;  1QYE A;  4XTJ A;  3RLQ A;  1IXM A;  2C1G A;  4KP4 A;  4MOT A;  2Q8F A;  2ZDX A;  2CCU A;  1KZN A;  4URN A;  4LWI A;  4XC0 A;  4WUD A;  5IDM A;  5FWK A;  5J6A A;  1UY8 A;  2XX4 A;  5CPH A;  1JM6 A;  3MNR P;  4Q20 A;  4LWG A;  4NH7 A;  3T0Z A;  4YKR A;  2EXL A;  3O6O A;  3T2S A;  3C11 A;  3Q5K A;  4LWF A;  3WHA A;  2YE7 A;  4O09 A;  4JQL A;  2YGE A;  3CYG A;  3INX A;  3RKZ A;  4ZKI A;  5FND A;  2JKI A;  4HZ0 A;  1NHH A;  3T1K A;  4H7Q A;  1H7U A;  2HCH A;  2YI7 A;  3R91 A;  4MPE A;  1UYI A;  3O0I A;  3EHJ A;  2HHI A;  3ZKB A;  4DZY A;  2VWC A;  2VCJ A;  2O1W A;  3GIE A;  1YET A;  2WI7 A;  2BRE A;  3RLR A;  2PNR A;  3K99 A;  3U2D A;  2C1I A;  4KFG A;  4PRX A;  3LNU A;  3TTZ A;  4K4O A;  2IWU A;  1MU5 A;  2YEI A;  2YJW A;  4ASG A;  5M4K A;  3OMU A;  4R1F A;  4CE1 A;  3EKO A;  5D7D A;  3TZ0 A;  4EEH A;  3A0X A;  1Y8P A;  2WI5 A;  1UY7 A;  4CE2 A;  4B7P A;  4URO A;  4EGH A;  1I59 A;  3BMY A;  4U93 A;  2Q8G A;  2YI0 A;  4PU9 A;  4R3M A;  1A4H A;  3BM9 A;  2WER A;  3ZM7 A;  2BYH A;  2XHT A;  2BU7 A;  2XDL A;  5J71 A;  4O0B A;  2YE5 A;  1NHI A;  2YEE A;  3A0Z A;  3G7B A;  3QTF A;  2XDS A;  2YK2 A;  5CTU A;  2CCS A;  4CWQ A;  1I5D A;  2CGF A;  3Q5J A;  2JJC A;  3FT5 A;  2QG2 A;  2YE9 A;  1Z5B A;  2XHR A;  1I5C A;  3B26 A;  3D0B A;  2YE2 A;  1B3Q A;  1S14 A;  2YGA A;  3B28 A;  3HZ1 A;  2BU2 A;  2BT0 A;  3HYY A;  2BSM A;  1BKN A;  2YEA A;  4YKX A;  1U2O A;  1TIL A;  3A0Y A;  1UYL A;  2XAB A;  1S16 A;  4NH9 A;  2GQP A;  3ZXQ A;  5M4N A;  4AWQ A;  3CRL A;  2YE6 A;  4KSH A;  4YKQ A;  2YJX A;  2VCI A;  2WI3 A;  5F5R A;  2YEH A;  1B62 A;  4L91 A;  1NHJ A;  2AKP A;  5D6P A;  4XDM A;  2O1U A;  3T0H A;  1GKZ A;  2CCT A;  1YES A;  2IOQ A;  1EA6 A;  4GGL A;  2GFD A;  3RLP A;  4L94 A;  3EHG A;  4XKO A;  3LMM A;  4XKA A;  2ZDY A;  4YKZ A;  4GEE A;  1YS3 A;  2IWX A;  5C93 A;  2HKJ A;  4LP0 A;  1ZXM A;  2E0A A;  2XJJ A;  3B27 A;  4B6C A;  3HEK A;  5IDJ A;  3TZ2 A;  2UWD A;  3HYZ A;  4LWH A;  4JAV A;  4HY1 A;  4BQG A;  2XHX A;  1OSF A;  4I5S A;  2QF6 A;  1I58 A;  1UYE A;  3ZXO A;  3TUH A;  4MP7 A;  3C0E A;  4X9L A;  2YED A;  4LPB A;  3GIG A;  2XK2 A;  3TZ5 A;  2YKB A;  3R4O A;  4E02 A;  5D6Q A;  1QY8 A;  4CWP A;  2IOR A;  2YKC A;  4CWF A;  2YEG A;  1UYF A;  2YGF A;  2YEC A;  1Z59 A;  4BIU A;  1TC6 A;  2FWZ A;  2H55 A;  3S5T A;  4XKK A;  3O2F A;  3U67 A;  5D7C A;  4NH8 A;  1QZR A;  4HXW A;  4ASF A;  2XX5 A;  4YKW A;  5M4P A;  5BOD A;  2BYI A;  4I3H A;  1AH8 A;  2YK9 A;  4XIT A;  3K60 A;  3FT8 A;  2FTK A;  2YKE A;  4URM A;  2K5B A;  3ZKD A;  3CWV A;  4R3A A;  4AWP A;  1MX0 A;  4EGK A;  1H7S A;  1Z5C A;  2Q8I A;  4ZVI A;  3GIG B;  3HZ5 A;  3WQ9 A;  4FCQ A;  4PL9 A;  4XIP A;  4WUB A;  3T10 A;  3R4P A;  5M4M A;  3A0W A;  2YI6 A;  1YT2 A;  1F51 A;  2ZBK B;  2HG1 A;  2ESA A;  2CH4 A; 
#chains in the Genus database with same CATH homology
 1UYK A;  3IED A;  3D36 A;  5BOC A;  2XJX A;  4QPK A;  4AWO A;  3R4M A;  1TBW A;  3A0T A;  4GFN A;  4PRV A;  2ZKJ A;  2YKI A;  3R92 A;  1UYG A;  1YC1 A;  3D2R A;  3EKR A;  1Y8N A;  4EFT A;  4QPJ A;  2Q2E B;  1AMW A;  3DGE A;  3VHC A;  3GIF A;  3K97 A;  1UYH A;  4YKT A;  2C2A A;  5IN9 A;  3K98 A;  4O07 A;  1YC3 A;  5D7R A;  4MB9 A;  3G7E A;  4HYP A;  4FCP A;  4FPP A;  3CRK A;  2BTZ A;  4V26 A;  4BXI A;  4XD8 A;  2IWS A;  4YKY A;  2WI6 A;  5L3J A;  5GGZ A;  1KIJ A;  3R4N A;  2YE8 A;  3CGY A;  4FMT A;  1ZW9 A;  3LPS A;  4EM7 A;  1THN A;  4GCZ A;  1PVG A;  1Z5A A;  3HHU A;  3NMQ A;  3KE6 A;  3SL2 A;  2XDU A;  3VHD A;  4GT8 A;  3VAD A;  5FNC A;  4P7A A;  5FNF A;  4HY6 A;  2XX2 A;  4EFU A;  5CTY A;  2VW5 A;  4KSG A;  3U2K A;  4MPN A;  1R62 A;  2CG9 A;  2YI5 A;  4BQJ A;  2YEJ A;  1YT0 A;  2YKJ A;  4L90 A;  2WI2 A;  2YE3 A;  4WUC A;  4L8Z A;  1TID A;  3EHH A;  4P8O A;  1YC4 A;  4H85 A;  4XE2 A;  2IOP A;  2XD6 A;  1UYD A;  1UYC A;  4CE3 A;  5F3K A;  4MP2 A;  1US7 A;  5CF0 A;  4XIR A;  5M4H A;  2BU5 A;  2YE4 A;  2BZ5 A;  4JAS A;  1TH8 A;  4KTN A;  2XDK A;  2QFO A;  1BYQ A;  2YEF A;  2FXS A;  1AM1 A;  1I5A A;  2QG0 A;  4DUH A;  1GJV A;  1AH6 A;  1ZWH A;  4CWN A;  4HZ5 A;  4KQV A;  1BXD A;  2Q8H A;  4HXZ A;  3B24 A;  2WEQ A;  2BU6 A;  4EMV A;  4XIQ A;  4LWE A;  3FV5 A;  2FYP A;  5M4E A;  2XCM A;  3CGZ A;  4W7T A;  1ZXN A;  3EHF A;  4L93 A;  1YSR A;  4EGI A;  4BAE A;  2WI1 A;  2O1V A;  5CTX A;  4O04 A;  4CWS A;  1BGQ A;  4YKU A;  2FWY A;  4CWR A;  1Y8O A;  4U7N A;  4XCL A;  1AJ6 A;  4CWT A;  1YER A;  4MPC A;  3JZ3 A;  1EI1 A;  2H8M A;  3OWB A;  1Y4S A;  4H81 A;  1GKX A;  4HYM A;  4E01 A;  4URL A;  4AS9 A;  1YT1 A;  3INW A;  4ASB A;  4O05 A;  1Y4U A;  3OWD A;  3OW6 A;  3A0R A;  4XCJ A;  3VHA A;  4FCR A;  3G75 A;  4MBC A;  2XJG A;  4JAU A;  3QDD A;  3H4L A;  3OPD A;  2WI4 A;  1YSZ A;  1TC0 A;  3PEH A;  1U0Z A;  3PEJ A;  4U7O A;  2YEB A;  5CTW A;  4E00 A;  1L0O A;  3H80 A;  1UYM A;  4CWO A;  1UY9 A;  4ASA A;  2WEP A;  3TZ4 A;  2BU8 A;  1B63 A;  4V25 A;  1UY6 A;  2BRC A;  4GQT A;  1ID0 A;  4BIZ A;  3Q5L A;  1I5B A;  2XDX A;  3B25 A;  1QYE A;  4XTJ A;  3RLQ A;  4KP4 A;  4MOT A;  2Q8F A;  2ZDX A;  2CCU A;  1KZN A;  4URN A;  4LWI A;  4XC0 A;  4WUD A;  5IDM A;  5FWK A;  5J6A A;  1UY8 A;  2XX4 A;  5CPH A;  1JM6 A;  3MNR P;  4Q20 A;  4LWG A;  4NH7 A;  3T0Z A;  4YKR A;  2EXL A;  3O6O A;  3T2S A;  3C11 A;  3Q5K A;  4LWF A;  3WHA A;  2YE7 A;  4O09 A;  4JQL A;  2YGE A;  3INX A;  3RKZ A;  4ZKI A;  5FND A;  2JKI A;  4HZ0 A;  1NHH A;  3T1K A;  4H7Q A;  1H7U A;  2HCH A;  2YI7 A;  3R91 A;  4MPE A;  1UYI A;  3O0I A;  3EHJ A;  3ZKB A;  4DZY A;  2VWC A;  2VCJ A;  2O1W A;  3GIE A;  1YET A;  2WI7 A;  2BRE A;  3RLR A;  2PNR A;  3K99 A;  3U2D A;  4KFG A;  4PRX A;  3LNU A;  3TTZ A;  4K4O A;  2IWU A;  1MU5 A;  2YEI A;  2YJW A;  4ASG A;  5M4K A;  3OMU A;  4R1F A;  4CE1 A;  3EKO A;  5D7D A;  3TZ0 A;  4EEH A;  3A0X A;  1Y8P A;  2WI5 A;  1UY7 A;  4CE2 A;  4B7P A;  4URO A;  4EGH A;  1I59 A;  3BMY A;  4U93 A;  2Q8G A;  2YI0 A;  4PU9 A;  4R3M A;  1A4H A;  3BM9 A;  2WER A;  3ZM7 A;  2BYH A;  2XHT A;  2BU7 A;  2XDL A;  5J71 A;  4O0B A;  2YE5 A;  1NHI A;  2YEE A;  3A0Z A;  3G7B A;  3QTF A;  2XDS A;  2YK2 A;  5CTU A;  2CCS A;  4CWQ A;  1I5D A;  2CGF A;  3Q5J A;  2JJC A;  3FT5 A;  2QG2 A;  2YE9 A;  1Z5B A;  2XHR A;  1I5C A;  3B26 A;  3D0B A;  2YE2 A;  1B3Q A;  1S14 A;  2YGA A;  3B28 A;  3HZ1 A;  2BU2 A;  2BT0 A;  3HYY A;  2BSM A;  1BKN A;  2YEA A;  4YKX A;  1U2O A;  1TIL A;  3A0Y A;  1UYL A;  2XAB A;  1S16 A;  4NH9 A;  2GQP A;  3ZXQ A;  5M4N A;  4AWQ A;  3CRL A;  2YE6 A;  4KSH A;  4YKQ A;  2YJX A;  2VCI A;  2WI3 A;  5F5R A;  2YEH A;  1B62 A;  4L91 A;  1NHJ A;  2AKP A;  5D6P A;  4XDM A;  2O1U A;  3T0H A;  1GKZ A;  2CCT A;  1YES A;  2IOQ A;  1EA6 A;  4GGL A;  2GFD A;  3RLP A;  4L94 A;  3EHG A;  4XKO A;  4XKA A;  2ZDY A;  4YKZ A;  4GEE A;  1YS3 A;  2IWX A;  5C93 A;  2HKJ A;  4LP0 A;  1ZXM A;  2E0A A;  2XJJ A;  3B27 A;  4B6C A;  3HEK A;  5IDJ A;  3TZ2 A;  2UWD A;  3HYZ A;  4LWH A;  4JAV A;  4HY1 A;  4BQG A;  2XHX A;  1OSF A;  4I5S A;  2QF6 A;  1I58 A;  1UYE A;  3ZXO A;  3TUH A;  4MP7 A;  3C0E A;  4X9L A;  2YED A;  4LPB A;  3GIG A;  2XK2 A;  3TZ5 A;  2YKB A;  3R4O A;  4E02 A;  5D6Q A;  1QY8 A;  4CWP A;  2IOR A;  2YKC A;  4CWF A;  2YEG A;  1UYF A;  2YGF A;  2YEC A;  1Z59 A;  4BIU A;  1TC6 A;  2FWZ A;  2H55 A;  4XKK A;  3O2F A;  3U67 A;  5D7C A;  4NH8 A;  1QZR A;  4HXW A;  4ASF A;  2XX5 A;  4YKW A;  5M4P A;  5BOD A;  2BYI A;  4I3H A;  1AH8 A;  2YK9 A;  4XIT A;  3K60 A;  3FT8 A;  2YKE A;  4URM A;  2K5B A;  3ZKD A;  3CWV A;  4R3A A;  4AWP A;  1MX0 A;  4EGK A;  1H7S A;  1Z5C A;  2Q8I A;  4ZVI A;  3GIG B;  3HZ5 A;  3WQ9 A;  4FCQ A;  4PL9 A;  4XIP A;  4WUB A;  3T10 A;  3R4P A;  5M4M A;  3A0W A;  2YI6 A;  1YT2 A;  2ZBK B;  2HG1 A;  2ESA A;  2CH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...