4UROA

Crystal structure of staph gyraseb 24kda in complex with novobiocin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
187
Chain Sequence
EAARKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Kibdelomycin Bound to Staphylococcus Aureus Gyrb and Pare Showed a Novel U-Shaped Binding Mode.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase
molecule keywords DNA GYRASE SUBUNIT B
total genus 53
structure length 187
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4uroA00
1GJVA 3EHHA 4HXZA 4KSGA 1YESA 2YEHA 2WI7A 3CWVA 4H7QA 1YC4A 4K4OA 2AKPA 5M4NA 2O1VA 3B24A 4O04A 2YGFA 4EGHA 2VWCA 1YT2A 1NHIA 3NMQA 3T10A 4JQLA 3ZM7A 1UY7A 2XHXA 3MNRP 4LWFA 3EKRA 3U67A 4KQVA 3TUHA 3RLQA 4CWSA 1U0ZA 1I5DA 2VCJA 3K97A 3G7BA 3WHAA 4URMA 3OMUA 3CGZA 4NH7A 3LNUA 1AMWA 5FNFA 4MP7A 4XD8A 4YKUA 1UY9A 2FWYA 2BU2A 4YKYA 2YKBA 4XKKA 4XTJA 1UYDA 1UYLA 1Z5AA 3Q5LA 4JASA 4CWTA 4ASAA 4HY6A 1R62A 1BXDA 4U93A 3H80A 2XX5A 2YKJA 4BAEA 4CWQA 2ESAA 1Y8OA 1Z5CA 3C0EA 4XDMA 4FMTA 4QPKA 2YEEA 2YE9A 3GIGA 2BYIA 3R4MA 5FNCA 1PVGA 2XDSA 4MP2A 4QPJA 5CTUA 3OW6A 4E01A 5CTYA 3ZKBA 4GCZA 4JAVA 4KP4A 4V26A 1S16A 5J71A 3U2KA 3R4NA 4ZVIA 2ZDYA 4FCRA 4NH8A 2QF6A 1UY6A 2BRCA 2H8MA 4L93A 3D2RA 1ZW9A 4KTNA 5FWKA 1TC6A 4KSHA 3O0IA 4EFUA 2HCHA 3QTFA 4B7PA 4GFNA 4WUBA 3CRKA 2CG9A 1QYEA 1AM1A 2XDKA 2YI7A 4O0BA 4DZYA 2O1UA 3EHFA 2YE8A 2WERA 4EM7A 4CE1A 3B28A 2WI3A 2XX2A 2WI5A 3PEJA 3Q5KA 2JKIA 4YKZA 1THNA 1UYMA 1I5BA 1BKNA 2IOPA 2VW5A 1NHHA 1UY8A 2H55A 3TZ2A 2YKCA 3CRLA 4LWIA 1ZXMA 1NHJA 1B3QA 1BYQA 1UYHA 2BYHA 2YI5A 4YKRA 4P7AA 2CCTA 2ZBKB 2IWXA 1ID0A 1YT1A 4LP0A 3K99A 2Q2EB 1Y8PA 2XJXA 3B25A 4XKAA 4GT8A 1UYIA 4HZ5A 3FT5A 3OPDA 4XITA 5J6AA 2YEFA 1JM6A 3O6OA 4URNA 1I59A 1L0OA 2YECA 4MPCA 2YEAA 4O07A 3TZ4A 3R91A 3T0HA 2YEBA 5D7DA 2GFDA 4XIRA 2XHTA 4CWNA 2IWUA 1ZXNA 1TILA 2BU5A 2Q8HA 2CH4A 5BODA 4MPNA 3R4OA 2XD6A 3VHDA 1TH8A 3R4PA 2FWZA 2BZ5A 2YK2A 3T0ZA 2YEJA 5D7CA 2YE6A 3VHAA 4ZKIA 1U2OA 2CCUA 4FPPA 4LPBA 1BGQA 3OWBA 3QDDA 4W7TA 4P8OA 3LPSA 4U7OA 1Z59A 3PEHA 5IN9A 2QFOA 2IORA 4AWQA 2YEDA 2Q8IA 4MB9A 4PU9A 4YKTA 3EHGA 2HG1A 4GGLA 4XCLA 2C2AA 4EGIA 1KIJA 4MPEA 2XX4A 3G7EA 5C93A 3B26A 4L91A 2GQPA 2Q8GA 2WI1A 4MBCA 4CWPA 4HZ0A 1Y8NA 1UYKA 5M4KA 3DGEA 3R92A 4YKQA 2YI6A 4ASBA 3BM9A 5D6PA 5GGZA 4GEEA 4XE2A 2HKJA 1OSFA 1EA6A 2E0AA 4E02A 4XKOA 3FT8A 1TC0A 2YEGA 2BSMA 3RKZA 3ZXQA 1MU5A 2XJJA 4U7NA 4WUDA 4YKWA 2YE4A 1TBWA 2PNRA 4EFTA 3K98A 2Q8FA 2YJXA 3INWA 4HYPA 5FNDA 2YKIA 4UROA 3SL2A 4I5SA 1GKXA 2WEQA 4CE2A 4FCPA 5M4PA 2UWDA 3TTZA 4AWPA 1UYCA 4JAUA 1TIDA 2O1WA 3VHCA 2BU7A 3RLPA 2CCSA 4PRVA 1B63A 1GKZA 2FYPA 2XDLA 4EEHA 1B62A 4LWEA 2K5BA 1US7A 2XABA 5D7RA 3ZXOA 4CE3A 3TZ0A 1EI1A 1Z5BA 3HEKA 2WI4A 2VCIA 2FXSA 4PL9A 1AH8A 4GQTA 4Q20A 5CPHA 2YJWA 4AWOA 3OWDA 3EHJA 5IDJA 3VADA 5M4MA 5CTWA 2QG0A 1I5CA 2BTZA 3BMYA 2BREA 4HXWA 4CWOA 1Y4UA 3A0ZA 3GIFA 2XDXA 4H85A 3G75A 1MX0A 1QY8A 3HYYA 3K60A 3C11A 4NH9A 2YE7A 2WI6A 4BIUA 2YE3A 5CF0A 3HHUA 4KFGA 2YE5A 4EGKA 4LWGA 1YS3A 1H7UA 1QZRA 2YKEA 2BU8A 4ASFA 2BT0A 4HYMA 2EXLA 1ZWHA 3A0WA 3EKOA 4L90A 5IDMA 3Q5JA 4L94A 2WI2A 1YC3A 1AJ6A 1YERA 1Y4SA 4AS9A 2ZDXA 2CGFA 5M4HA 3GIEA 3D0BA 4E00A 4I3HA 2YE2A 2IOQA 2XHRA 1YC1A 3A0RA 3FV5A 4DUHA 2YK9A 1A4HA 2YI0A 3H4LA 4URLA 1YSRA 3JZ3A 4X9LA 4BIZA 3HZ5A 5F5RA 4XCJA 2XK2A 2BU6A 2IWSA 1I58A 1UYFA 4L8ZA 4LWHA 4R1FA 5D6QA 1S14A 3O2FA 4BQGA 3A0YA 5M4EA 4HY1A 5L3JA 4H81A 4BQJA 4O05A 4YKXA 4B6CA 2XDUA 3RLRA 5BOCA 4FCQA 5F3KA 3A0XA 4PRXA 3U2DA 4ASGA 1YSZA 4BXIA 2JJCA 3WQ9A 3A0TA 2QG2A 4R3MA 1KZNA 3IEDA 2XJGA 3INXA 2YEIA 2ZKJA 1UYEA 2WEPA 3HYZA 4MOTA 4CWRA 3B27A 3D36A 3T1KA 4XIPA 3GIGB 4R3AA 3TZ5A 4EMVA 3KE6A 2YGAA 4WUCA 1H7SA 1YETA 3HZ1A 4O09A 3CGYA 1YT0A 4XIQA 4CWFA 3ZKDA 4V25A 1I5AA 1UYGA 2XCMA 2YGEA 4XC0A 5CTXA 3T2SA 1AH6A
chains in the Genus database with same CATH superfamily
1GJVA 3EHHA 4HXZA 4KSGA 1YESA 2YEHA 2WI7A 3CWVA 4H7QA 1YC4A 4K4OA 2AKPA 5M4NA 2O1VA 2HHIA 3B24A 4O04A 2YGFA 4EGHA 2VWCA 1YT2A 1NHIA 3NMQA 3T10A 4JQLA 3ZM7A 1UY7A 2XHXA 3MNRP 4LWFA 3EKRA 3U67A 4KQVA 3TUHA 3RLQA 4CWSA 1U0ZA 1I5DA 2VCJA 1IXMA 3K97A 3G7BA 3WHAA 4URMA 3OMUA 3CGZA 4NH7A 3LNUA 1AMWA 5FNFA 4MP7A 4XD8A 4YKUA 1UY9A 2FWYA 2BU2A 4YKYA 2YKBA 4XKKA 4XTJA 1UYDA 1UYLA 1Z5AA 3Q5LA 4JASA 4CWTA 4ASAA 4HY6A 1R62A 1BXDA 4U93A 3H80A 2XX5A 2YKJA 4BAEA 4CWQA 2ESAA 1Y8OA 1Z5CA 3C0EA 4XDMA 4FMTA 4QPKA 2YEEA 2YE9A 3GIGA 2BYIA 3R4MA 5FNCA 1PVGA 2XDSA 4MP2A 4QPJA 5CTUA 3OW6A 4E01A 5CTYA 3ZKBA 4GCZA 4JAVA 4KP4A 4V26A 1S16A 5J71A 3U2KA 3R4NA 4ZVIA 2ZDYA 4FCRA 4NH8A 2QF6A 1UY6A 2BRCA 2H8MA 4L93A 3D2RA 1ZW9A 4KTNA 5FWKA 1TC6A 4KSHA 3O0IA 4EFUA 2HCHA 3QTFA 4B7PA 4GFNA 4WUBA 5JENA 3CRKA 2CG9A 1QYEA 1AM1A 2XDKA 2YI7A 4O0BA 4DZYA 2O1UA 3EHFA 2YE8A 2WERA 4EM7A 4CE1A 3B28A 2WI3A 2XX2A 2WI5A 3PEJA 3Q5KA 2JKIA 4YKZA 1THNA 1UYMA 1I5BA 1BKNA 2IOPA 2VW5A 1NHHA 1UY8A 2H55A 3TZ2A 2YKCA 3CRLA 4LWIA 1ZXMA 1NHJA 1B3QA 1BYQA 1UYHA 2BYHA 2YI5A 4YKRA 4P7AA 2CCTA 2ZBKB 2IWXA 1ID0A 1YT1A 4LP0A 3K99A 2Q2EB 1Y8PA 2XJXA 3B25A 4XKAA 4GT8A 1UYIA 4HZ5A 3FT5A 3OPDA 4XITA 5J6AA 2YEFA 1JM6A 3O6OA 4URNA 1I59A 1L0OA 2YECA 4MPCA 2YEAA 4O07A 3TZ4A 3R91A 3T0HA 2YEBA 5D7DA 2GFDA 4XIRA 2XHTA 4CWNA 2IWUA 1ZXNA 1TILA 2BU5A 2Q8HA 2CH4A 5BODA 4MPNA 3R4OA 2XD6A 4E72A 3VHDA 1TH8A 3R4PA 2FWZA 2BZ5A 2YK2A 3T0ZA 2YEJA 5D7CA 2YE6A 3VHAA 4ZKIA 1U2OA 2CCUA 4FPPA 4LPBA 1BGQA 3OWBA 3QDDA 4W7TA 4P8OA 3LPSA 4U7OA 1Z59A 3PEHA 5IN9A 2QFOA 2IORA 4AWQA 2YEDA 2Q8IA 4MB9A 4PU9A 4YKTA 3EHGA 2HG1A 4GGLA 4XCLA 2C2AA 4EGIA 1KIJA 4MPEA 2XX4A 3G7EA 5C93A 3B26A 4L91A 2GQPA 2Q8GA 2WI1A 4MBCA 4CWPA 4HZ0A 1Y8NA 1UYKA 5M4KA 3DGEA 3R92A 4YKQA 2YI6A 4ASBA 3BM9A 5D6PA 5GGZA 4GEEA 4XE2A 2HKJA 1OSFA 1EA6A 2E0AA 4E02A 4XKOA 3FT8A 1TC0A 2YEGA 2BSMA 3RKZA 3ZXQA 1MU5A 2XJJA 4U7NA 4WUDA 4YKWA 3LMMA 2YE4A 1TBWA 2PNRA 4EFTA 3K98A 2Q8FA 2YJXA 3INWA 4HYPA 5FNDA 2YKIA 4UROA 3SL2A 4I5SA 1GKXA 2WEQA 4CE2A 4FCPA 5M4PA 2UWDA 3TTZA 4AWPA 1UYCA 4JAUA 1TIDA 2O1WA 3VHCA 2BU7A 3RLPA 2CCSA 4PRVA 1B63A 1GKZA 2FYPA 2XDLA 4EEHA 1B62A 4LWEA 1F51A 2K5BA 1US7A 2XABA 5D7RA 3ZXOA 4CE3A 3TZ0A 1EI1A 1Z5BA 3HEKA 2WI4A 2VCIA 2FXSA 4PL9A 1AH8A 4GQTA 4Q20A 5CPHA 2YJWA 4AWOA 3OWDA 3EHJA 5IDJA 3VADA 5M4MA 5CTWA 2QG0A 1I5CA 2BTZA 3BMYA 2BREA 4HXWA 4CWOA 1Y4UA 3A0ZA 3GIFA 2XDXA 4H85A 3G75A 1MX0A 1QY8A 3HYYA 3K60A 3C11A 4NH9A 2YE7A 2WI6A 4BIUA 2YE3A 5CF0A 3HHUA 4KFGA 2YE5A 4EGKA 4LWGA 1YS3A 1H7UA 1QZRA 2YKEA 2BU8A 4ASFA 2BT0A 4HYMA 2EXLA 1ZWHA 3A0WA 3EKOA 4L90A 5IDMA 3Q5JA 4L94A 2WI2A 1YC3A 1AJ6A 1YERA 1Y4SA 4AS9A 2ZDXA 2CGFA 5M4HA 3GIEA 3D0BA 4E00A 4I3HA 2YE2A 2IOQA 2C1IA 2XHRA 1YC1A 3A0RA 3FV5A 4DUHA 2YK9A 1A4HA 2YI0A 3H4LA 4URLA 1YSRA 3JZ3A 4X9LA 4BIZA 3HZ5A 5F5RA 4XCJA 2XK2A 2BU6A 2IWSA 1I58A 1UYFA 4L8ZA 2FTKA 4LWHA 4R1FA 3CYGA 5D6QA 1S14A 3O2FA 4BQGA 3A0YA 5M4EA 4HY1A 5L3JA 4H81A 4BQJA 4O05A 4YKXA 4B6CA 2XDUA 3S5TA 3RLRA 5BOCA 4FCQA 5F3KA 3A0XA 4PRXA 3U2DA 2C1GA 4ASGA 1YSZA 4BXIA 2JJCA 3WQ9A 3A0TA 2QG2A 4R3MA 1KZNA 3IEDA 2XJGA 3INXA 2YEIA 2ZKJA 1UYEA 2WEPA 3HYZA 4MOTA 4CWRA 3B27A 3D36A 3T1KA 4XIPA 3GIGB 4R3AA 3TZ5A 4EMVA 3KE6A 2YGAA 4WUCA 1H7SA 1YETA 3HZ1A 4O09A 3CGYA 1YT0A 4XIQA 4CWFA 3ZKDA 4V25A 1I5AA 1UYGA 2XCMA 2YGEA 4XC0A 5CTXA 3T2SA 1AH6A
chains in the Genus database with same CATH topology
1GJVA 3EHHA 4HXZA 4KSGA 1YESA 2YEHA 2WI7A 3CWVA 4H7QA 1YC4A 4K4OA 2AKPA 5M4NA 2O1VA 3B24A 4O04A 2YGFA 4EGHA 2VWCA 1YT2A 1NHIA 3NMQA 3T10A 4JQLA 3ZM7A 1UY7A 2XHXA 3MNRP 4LWFA 3EKRA 3U67A 4KQVA 3TUHA 3RLQA 4CWSA 1U0ZA 1I5DA 2VCJA 3K97A 3G7BA 3WHAA 4URMA 3OMUA 3CGZA 4NH7A 3LNUA 1AMWA 5FNFA 4MP7A 4XD8A 4YKUA 1UY9A 2FWYA 2BU2A 4YKYA 2YKBA 4XKKA 4XTJA 1UYDA 1UYLA 1Z5AA 3Q5LA 4JASA 4CWTA 4ASAA 4HY6A 1R62A 1BXDA 4U93A 3H80A 2XX5A 2YKJA 4BAEA 4CWQA 2ESAA 1Y8OA 1Z5CA 3C0EA 4XDMA 4FMTA 4QPKA 2YEEA 2YE9A 3GIGA 2BYIA 3R4MA 5FNCA 1PVGA 2XDSA 4MP2A 4QPJA 5CTUA 3OW6A 4E01A 5CTYA 3ZKBA 4GCZA 4JAVA 4KP4A 4V26A 1S16A 5J71A 3U2KA 3R4NA 4ZVIA 2ZDYA 4FCRA 4NH8A 2QF6A 1UY6A 2BRCA 2H8MA 4L93A 3D2RA 1ZW9A 4KTNA 5FWKA 1TC6A 4KSHA 3O0IA 4EFUA 2HCHA 3QTFA 4B7PA 4GFNA 4WUBA 3CRKA 2CG9A 1QYEA 1AM1A 2XDKA 2YI7A 4O0BA 4DZYA 2O1UA 3EHFA 2YE8A 2WERA 4EM7A 4CE1A 3B28A 2WI3A 2XX2A 2WI5A 3PEJA 3Q5KA 2JKIA 4YKZA 1THNA 1UYMA 1I5BA 1BKNA 2IOPA 2VW5A 1NHHA 1UY8A 2H55A 3TZ2A 2YKCA 3CRLA 4LWIA 1ZXMA 1NHJA 1B3QA 1BYQA 1UYHA 2BYHA 2YI5A 4YKRA 4P7AA 2CCTA 2ZBKB 2IWXA 1ID0A 1YT1A 4LP0A 3K99A 2Q2EB 1Y8PA 2XJXA 3B25A 4XKAA 4GT8A 1UYIA 4HZ5A 3FT5A 3OPDA 4XITA 5J6AA 2YEFA 1JM6A 3O6OA 4URNA 1I59A 1L0OA 2YECA 4MPCA 2YEAA 4O07A 3TZ4A 3R91A 3T0HA 2YEBA 5D7DA 2GFDA 4XIRA 2XHTA 4CWNA 2IWUA 1ZXNA 1TILA 2BU5A 2Q8HA 2CH4A 5BODA 4MPNA 3R4OA 2XD6A 3VHDA 1TH8A 3R4PA 2FWZA 2BZ5A 2YK2A 3T0ZA 2YEJA 5D7CA 2YE6A 3VHAA 4ZKIA 1U2OA 2CCUA 4FPPA 4LPBA 1BGQA 3OWBA 3QDDA 4W7TA 4P8OA 3LPSA 4U7OA 1Z59A 3PEHA 5IN9A 2QFOA 2IORA 4AWQA 2YEDA 2Q8IA 4MB9A 4PU9A 4YKTA 3EHGA 2HG1A 4GGLA 4XCLA 2C2AA 4EGIA 1KIJA 4MPEA 2XX4A 3G7EA 5C93A 3B26A 4L91A 2GQPA 2Q8GA 2WI1A 4MBCA 4CWPA 4HZ0A 1Y8NA 1UYKA 5M4KA 3DGEA 3R92A 4YKQA 2YI6A 4ASBA 3BM9A 5D6PA 5GGZA 4GEEA 4XE2A 2HKJA 1OSFA 1EA6A 2E0AA 4E02A 4XKOA 3FT8A 1TC0A 2YEGA 2BSMA 3RKZA 3ZXQA 1MU5A 2XJJA 4U7NA 4WUDA 4YKWA 2YE4A 1TBWA 2PNRA 4EFTA 3K98A 2Q8FA 2YJXA 3INWA 4HYPA 5FNDA 2YKIA 4UROA 3SL2A 4I5SA 1GKXA 2WEQA 4CE2A 4FCPA 5M4PA 2UWDA 3TTZA 4AWPA 1UYCA 4JAUA 1TIDA 2O1WA 3VHCA 2BU7A 3RLPA 2CCSA 4PRVA 1B63A 1GKZA 2FYPA 2XDLA 4EEHA 1B62A 4LWEA 2K5BA 1US7A 2XABA 5D7RA 3ZXOA 4CE3A 3TZ0A 1EI1A 1Z5BA 3HEKA 2WI4A 2VCIA 2FXSA 4PL9A 1AH8A 4GQTA 4Q20A 5CPHA 2YJWA 4AWOA 3OWDA 3EHJA 5IDJA 3VADA 5M4MA 5CTWA 2QG0A 1I5CA 2BTZA 3BMYA 2BREA 4HXWA 4CWOA 1Y4UA 3A0ZA 3GIFA 2XDXA 4H85A 3G75A 1MX0A 1QY8A 3HYYA 3K60A 3C11A 4NH9A 2YE7A 2WI6A 4BIUA 2YE3A 5CF0A 3HHUA 4KFGA 2YE5A 4EGKA 4LWGA 1YS3A 1H7UA 1QZRA 2YKEA 2BU8A 4ASFA 2BT0A 4HYMA 2EXLA 1ZWHA 3A0WA 3EKOA 4L90A 5IDMA 3Q5JA 4L94A 2WI2A 1YC3A 1AJ6A 1YERA 1Y4SA 4AS9A 2ZDXA 2CGFA 5M4HA 3GIEA 3D0BA 4E00A 4I3HA 2YE2A 2IOQA 2XHRA 1YC1A 3A0RA 3FV5A 4DUHA 2YK9A 1A4HA 2YI0A 3H4LA 4URLA 1YSRA 3JZ3A 4X9LA 4BIZA 3HZ5A 5F5RA 4XCJA 2XK2A 2BU6A 2IWSA 1I58A 1UYFA 4L8ZA 4LWHA 4R1FA 5D6QA 1S14A 3O2FA 4BQGA 3A0YA 5M4EA 4HY1A 5L3JA 4H81A 4BQJA 4O05A 4YKXA 4B6CA 2XDUA 3RLRA 5BOCA 4FCQA 5F3KA 3A0XA 4PRXA 3U2DA 4ASGA 1YSZA 4BXIA 2JJCA 3WQ9A 3A0TA 2QG2A 4R3MA 1KZNA 3IEDA 2XJGA 3INXA 2YEIA 2ZKJA 1UYEA 2WEPA 3HYZA 4MOTA 4CWRA 3B27A 3D36A 3T1KA 4XIPA 3GIGB 4R3AA 3TZ5A 4EMVA 3KE6A 2YGAA 4WUCA 1H7SA 1YETA 3HZ1A 4O09A 3CGYA 1YT0A 4XIQA 4CWFA 3ZKDA 4V25A 1I5AA 1UYGA 2XCMA 2YGEA 4XC0A 5CTXA 3T2SA 1AH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJV A;  3EHH A;  4HXZ A;  4KSG A;  1YES A;  2YEH A;  2WI7 A;  3CWV A;  4H7Q A;  1YC4 A;  4K4O A;  2AKP A;  5M4N A;  2O1V A;  3B24 A;  4O04 A;  2YGF A;  4EGH A;  2VWC A;  1YT2 A;  1NHI A;  3NMQ A;  3T10 A;  4JQL A;  3ZM7 A;  1UY7 A;  2XHX A;  3MNR P;  4LWF A;  3EKR A;  3U67 A;  4KQV A;  3TUH A;  3RLQ A;  4CWS A;  1U0Z A;  1I5D A;  2VCJ A;  3K97 A;  3G7B A;  3WHA A;  4URM A;  3OMU A;  3CGZ A;  4NH7 A;  3LNU A;  1AMW A;  5FNF A;  4MP7 A;  4XD8 A;  4YKU A;  1UY9 A;  2FWY A;  2BU2 A;  4YKY A;  2YKB A;  4XKK A;  4XTJ A;  1UYD A;  1UYL A;  1Z5A A;  3Q5L A;  4JAS A;  4CWT A;  4ASA A;  4HY6 A;  1R62 A;  1BXD A;  4U93 A;  3H80 A;  2XX5 A;  2YKJ A;  4BAE A;  4CWQ A;  2ESA A;  1Y8O A;  1Z5C A;  3C0E A;  4XDM A;  4FMT A;  4QPK A;  2YEE A;  2YE9 A;  3GIG A;  2BYI A;  3R4M A;  5FNC A;  1PVG A;  2XDS A;  4MP2 A;  4QPJ A;  5CTU A;  3OW6 A;  4E01 A;  5CTY A;  3ZKB A;  4GCZ A;  4JAV A;  4KP4 A;  4V26 A;  1S16 A;  5J71 A;  3U2K A;  3R4N A;  4ZVI A;  2ZDY A;  4FCR A;  4NH8 A;  2QF6 A;  1UY6 A;  2BRC A;  2H8M A;  4L93 A;  3D2R A;  1ZW9 A;  4KTN A;  5FWK A;  1TC6 A;  4KSH A;  3O0I A;  4EFU A;  2HCH A;  3QTF A;  4B7P A;  4GFN A;  4WUB A;  3CRK A;  2CG9 A;  1QYE A;  1AM1 A;  2XDK A;  2YI7 A;  4O0B A;  4DZY A;  2O1U A;  3EHF A;  2YE8 A;  2WER A;  4EM7 A;  4CE1 A;  3B28 A;  2WI3 A;  2XX2 A;  2WI5 A;  3PEJ A;  3Q5K A;  2JKI A;  4YKZ A;  1THN A;  1UYM A;  1I5B A;  1BKN A;  2IOP A;  2VW5 A;  1NHH A;  1UY8 A;  2H55 A;  3TZ2 A;  2YKC A;  3CRL A;  4LWI A;  1ZXM A;  1NHJ A;  1B3Q A;  1BYQ A;  1UYH A;  2BYH A;  2YI5 A;  4YKR A;  4P7A A;  2CCT A;  2ZBK B;  2IWX A;  1ID0 A;  1YT1 A;  4LP0 A;  3K99 A;  2Q2E B;  1Y8P A;  2XJX A;  3B25 A;  4XKA A;  4GT8 A;  1UYI A;  4HZ5 A;  3FT5 A;  3OPD A;  4XIT A;  5J6A A;  2YEF A;  1JM6 A;  3O6O A;  4URN A;  1I59 A;  1L0O A;  2YEC A;  4MPC A;  2YEA A;  4O07 A;  3TZ4 A;  3R91 A;  3T0H A;  2YEB A;  5D7D A;  2GFD A;  4XIR A;  2XHT A;  4CWN A;  2IWU A;  1ZXN A;  1TIL A;  2BU5 A;  2Q8H A;  2CH4 A;  5BOD A;  4MPN A;  3R4O A;  2XD6 A;  3VHD A;  1TH8 A;  3R4P A;  2FWZ A;  2BZ5 A;  2YK2 A;  3T0Z A;  2YEJ A;  5D7C A;  2YE6 A;  3VHA A;  4ZKI A;  1U2O A;  2CCU A;  4FPP A;  4LPB A;  1BGQ A;  3OWB A;  3QDD A;  4W7T A;  4P8O A;  3LPS A;  4U7O A;  1Z59 A;  3PEH A;  5IN9 A;  2QFO A;  2IOR A;  4AWQ A;  2YED A;  2Q8I A;  4MB9 A;  4PU9 A;  4YKT A;  3EHG A;  2HG1 A;  4GGL A;  4XCL A;  2C2A A;  4EGI A;  1KIJ A;  4MPE A;  2XX4 A;  3G7E A;  5C93 A;  3B26 A;  4L91 A;  2GQP A;  2Q8G A;  2WI1 A;  4MBC A;  4CWP A;  4HZ0 A;  1Y8N A;  1UYK A;  5M4K A;  3DGE A;  3R92 A;  4YKQ A;  2YI6 A;  4ASB A;  3BM9 A;  5D6P A;  5GGZ A;  4GEE A;  4XE2 A;  2HKJ A;  1OSF A;  1EA6 A;  2E0A A;  4E02 A;  4XKO A;  3FT8 A;  1TC0 A;  2YEG A;  2BSM A;  3RKZ A;  3ZXQ A;  1MU5 A;  2XJJ A;  4U7N A;  4WUD A;  4YKW A;  2YE4 A;  1TBW A;  2PNR A;  4EFT A;  3K98 A;  2Q8F A;  2YJX A;  3INW A;  4HYP A;  5FND A;  2YKI A;  4URO A;  3SL2 A;  4I5S A;  1GKX A;  2WEQ A;  4CE2 A;  4FCP A;  5M4P A;  2UWD A;  3TTZ A;  4AWP A;  1UYC A;  4JAU A;  1TID A;  2O1W A;  3VHC A;  2BU7 A;  3RLP A;  2CCS A;  4PRV A;  1B63 A;  1GKZ A;  2FYP A;  2XDL A;  4EEH A;  1B62 A;  4LWE A;  2K5B A;  1US7 A;  2XAB A;  5D7R A;  3ZXO A;  4CE3 A;  3TZ0 A;  1EI1 A;  1Z5B A;  3HEK A;  2WI4 A;  2VCI A;  2FXS A;  4PL9 A;  1AH8 A;  4GQT A;  4Q20 A;  5CPH A;  2YJW A;  4AWO A;  3OWD A;  3EHJ A;  5IDJ A;  3VAD A;  5M4M A;  5CTW A;  2QG0 A;  1I5C A;  2BTZ A;  3BMY A;  2BRE A;  4HXW A;  4CWO A;  1Y4U A;  3A0Z A;  3GIF A;  2XDX A;  4H85 A;  3G75 A;  1MX0 A;  1QY8 A;  3HYY A;  3K60 A;  3C11 A;  4NH9 A;  2YE7 A;  2WI6 A;  4BIU A;  2YE3 A;  5CF0 A;  3HHU A;  4KFG A;  2YE5 A;  4EGK A;  4LWG A;  1YS3 A;  1H7U A;  1QZR A;  2YKE A;  2BU8 A;  4ASF A;  2BT0 A;  4HYM A;  2EXL A;  1ZWH A;  3A0W A;  3EKO A;  4L90 A;  5IDM A;  3Q5J A;  4L94 A;  2WI2 A;  1YC3 A;  1AJ6 A;  1YER A;  1Y4S A;  4AS9 A;  2ZDX A;  2CGF A;  5M4H A;  3GIE A;  3D0B A;  4E00 A;  4I3H A;  2YE2 A;  2IOQ A;  2XHR A;  1YC1 A;  3A0R A;  3FV5 A;  4DUH A;  2YK9 A;  1A4H A;  2YI0 A;  3H4L A;  4URL A;  1YSR A;  3JZ3 A;  4X9L A;  4BIZ A;  3HZ5 A;  5F5R A;  4XCJ A;  2XK2 A;  2BU6 A;  2IWS A;  1I58 A;  1UYF A;  4L8Z A;  4LWH A;  4R1F A;  5D6Q A;  1S14 A;  3O2F A;  4BQG A;  3A0Y A;  5M4E A;  4HY1 A;  5L3J A;  4H81 A;  4BQJ A;  4O05 A;  4YKX A;  4B6C A;  2XDU A;  3RLR A;  5BOC A;  4FCQ A;  5F3K A;  3A0X A;  4PRX A;  3U2D A;  4ASG A;  1YSZ A;  4BXI A;  2JJC A;  3WQ9 A;  3A0T A;  2QG2 A;  4R3M A;  1KZN A;  3IED A;  2XJG A;  3INX A;  2YEI A;  2ZKJ A;  1UYE A;  2WEP A;  3HYZ A;  4MOT A;  4CWR A;  3B27 A;  3D36 A;  3T1K A;  4XIP A;  3GIG B;  4R3A A;  3TZ5 A;  4EMV A;  3KE6 A;  2YGA A;  4WUC A;  1H7S A;  1YET A;  3HZ1 A;  4O09 A;  3CGY A;  1YT0 A;  4XIQ A;  4CWF A;  3ZKD A;  4V25 A;  1I5A A;  1UYG A;  2XCM A;  2YGE A;  4XC0 A;  5CTX A;  3T2S A;  1AH6 A; 
#chains in the Genus database with same CATH topology
 1GJV A;  3EHH A;  4HXZ A;  4KSG A;  1YES A;  2YEH A;  2WI7 A;  3CWV A;  4H7Q A;  1YC4 A;  4K4O A;  2AKP A;  5M4N A;  2O1V A;  2HHI A;  3B24 A;  4O04 A;  2YGF A;  4EGH A;  2VWC A;  1YT2 A;  1NHI A;  3NMQ A;  3T10 A;  4JQL A;  3ZM7 A;  1UY7 A;  2XHX A;  3MNR P;  4LWF A;  3EKR A;  3U67 A;  4KQV A;  3TUH A;  3RLQ A;  4CWS A;  1U0Z A;  1I5D A;  2VCJ A;  1IXM A;  3K97 A;  3G7B A;  3WHA A;  4URM A;  3OMU A;  3CGZ A;  4NH7 A;  3LNU A;  1AMW A;  5FNF A;  4MP7 A;  4XD8 A;  4YKU A;  1UY9 A;  2FWY A;  2BU2 A;  4YKY A;  2YKB A;  4XKK A;  4XTJ A;  1UYD A;  1UYL A;  1Z5A A;  3Q5L A;  4JAS A;  4CWT A;  4ASA A;  4HY6 A;  1R62 A;  1BXD A;  4U93 A;  3H80 A;  2XX5 A;  2YKJ A;  4BAE A;  4CWQ A;  2ESA A;  1Y8O A;  1Z5C A;  3C0E A;  4XDM A;  4FMT A;  4QPK A;  2YEE A;  2YE9 A;  3GIG A;  2BYI A;  3R4M A;  5FNC A;  1PVG A;  2XDS A;  4MP2 A;  4QPJ A;  5CTU A;  3OW6 A;  4E01 A;  5CTY A;  3ZKB A;  4GCZ A;  4JAV A;  4KP4 A;  4V26 A;  1S16 A;  5J71 A;  3U2K A;  3R4N A;  4ZVI A;  2ZDY A;  4FCR A;  4NH8 A;  2QF6 A;  1UY6 A;  2BRC A;  2H8M A;  4L93 A;  3D2R A;  1ZW9 A;  4KTN A;  5FWK A;  1TC6 A;  4KSH A;  3O0I A;  4EFU A;  2HCH A;  3QTF A;  4B7P A;  4GFN A;  4WUB A;  5JEN A;  3CRK A;  2CG9 A;  1QYE A;  1AM1 A;  2XDK A;  2YI7 A;  4O0B A;  4DZY A;  2O1U A;  3EHF A;  2YE8 A;  2WER A;  4EM7 A;  4CE1 A;  3B28 A;  2WI3 A;  2XX2 A;  2WI5 A;  3PEJ A;  3Q5K A;  2JKI A;  4YKZ A;  1THN A;  1UYM A;  1I5B A;  1BKN A;  2IOP A;  2VW5 A;  1NHH A;  1UY8 A;  2H55 A;  3TZ2 A;  2YKC A;  3CRL A;  4LWI A;  1ZXM A;  1NHJ A;  1B3Q A;  1BYQ A;  1UYH A;  2BYH A;  2YI5 A;  4YKR A;  4P7A A;  2CCT A;  2ZBK B;  2IWX A;  1ID0 A;  1YT1 A;  4LP0 A;  3K99 A;  2Q2E B;  1Y8P A;  2XJX A;  3B25 A;  4XKA A;  4GT8 A;  1UYI A;  4HZ5 A;  3FT5 A;  3OPD A;  4XIT A;  5J6A A;  2YEF A;  1JM6 A;  3O6O A;  4URN A;  1I59 A;  1L0O A;  2YEC A;  4MPC A;  2YEA A;  4O07 A;  3TZ4 A;  3R91 A;  3T0H A;  2YEB A;  5D7D A;  2GFD A;  4XIR A;  2XHT A;  4CWN A;  2IWU A;  1ZXN A;  1TIL A;  2BU5 A;  2Q8H A;  2CH4 A;  5BOD A;  4MPN A;  3R4O A;  2XD6 A;  4E72 A;  3VHD A;  1TH8 A;  3R4P A;  2FWZ A;  2BZ5 A;  2YK2 A;  3T0Z A;  2YEJ A;  5D7C A;  2YE6 A;  3VHA A;  4ZKI A;  1U2O A;  2CCU A;  4FPP A;  4LPB A;  1BGQ A;  3OWB A;  3QDD A;  4W7T A;  4P8O A;  3LPS A;  4U7O A;  1Z59 A;  3PEH A;  5IN9 A;  2QFO A;  2IOR A;  4AWQ A;  2YED A;  2Q8I A;  4MB9 A;  4PU9 A;  4YKT A;  3EHG A;  2HG1 A;  4GGL A;  4XCL A;  2C2A A;  4EGI A;  1KIJ A;  4MPE A;  2XX4 A;  3G7E A;  5C93 A;  3B26 A;  4L91 A;  2GQP A;  2Q8G A;  2WI1 A;  4MBC A;  4CWP A;  4HZ0 A;  1Y8N A;  1UYK A;  5M4K A;  3DGE A;  3R92 A;  4YKQ A;  2YI6 A;  4ASB A;  3BM9 A;  5D6P A;  5GGZ A;  4GEE A;  4XE2 A;  2HKJ A;  1OSF A;  1EA6 A;  2E0A A;  4E02 A;  4XKO A;  3FT8 A;  1TC0 A;  2YEG A;  2BSM A;  3RKZ A;  3ZXQ A;  1MU5 A;  2XJJ A;  4U7N A;  4WUD A;  4YKW A;  3LMM A;  2YE4 A;  1TBW A;  2PNR A;  4EFT A;  3K98 A;  2Q8F A;  2YJX A;  3INW A;  4HYP A;  5FND A;  2YKI A;  4URO A;  3SL2 A;  4I5S A;  1GKX A;  2WEQ A;  4CE2 A;  4FCP A;  5M4P A;  2UWD A;  3TTZ A;  4AWP A;  1UYC A;  4JAU A;  1TID A;  2O1W A;  3VHC A;  2BU7 A;  3RLP A;  2CCS A;  4PRV A;  1B63 A;  1GKZ A;  2FYP A;  2XDL A;  4EEH A;  1B62 A;  4LWE A;  1F51 A;  2K5B A;  1US7 A;  2XAB A;  5D7R A;  3ZXO A;  4CE3 A;  3TZ0 A;  1EI1 A;  1Z5B A;  3HEK A;  2WI4 A;  2VCI A;  2FXS A;  4PL9 A;  1AH8 A;  4GQT A;  4Q20 A;  5CPH A;  2YJW A;  4AWO A;  3OWD A;  3EHJ A;  5IDJ A;  3VAD A;  5M4M A;  5CTW A;  2QG0 A;  1I5C A;  2BTZ A;  3BMY A;  2BRE A;  4HXW A;  4CWO A;  1Y4U A;  3A0Z A;  3GIF A;  2XDX A;  4H85 A;  3G75 A;  1MX0 A;  1QY8 A;  3HYY A;  3K60 A;  3C11 A;  4NH9 A;  2YE7 A;  2WI6 A;  4BIU A;  2YE3 A;  5CF0 A;  3HHU A;  4KFG A;  2YE5 A;  4EGK A;  4LWG A;  1YS3 A;  1H7U A;  1QZR A;  2YKE A;  2BU8 A;  4ASF A;  2BT0 A;  4HYM A;  2EXL A;  1ZWH A;  3A0W A;  3EKO A;  4L90 A;  5IDM A;  3Q5J A;  4L94 A;  2WI2 A;  1YC3 A;  1AJ6 A;  1YER A;  1Y4S A;  4AS9 A;  2ZDX A;  2CGF A;  5M4H A;  3GIE A;  3D0B A;  4E00 A;  4I3H A;  2YE2 A;  2IOQ A;  2C1I A;  2XHR A;  1YC1 A;  3A0R A;  3FV5 A;  4DUH A;  2YK9 A;  1A4H A;  2YI0 A;  3H4L A;  4URL A;  1YSR A;  3JZ3 A;  4X9L A;  4BIZ A;  3HZ5 A;  5F5R A;  4XCJ A;  2XK2 A;  2BU6 A;  2IWS A;  1I58 A;  1UYF A;  4L8Z A;  2FTK A;  4LWH A;  4R1F A;  3CYG A;  5D6Q A;  1S14 A;  3O2F A;  4BQG A;  3A0Y A;  5M4E A;  4HY1 A;  5L3J A;  4H81 A;  4BQJ A;  4O05 A;  4YKX A;  4B6C A;  2XDU A;  3S5T A;  3RLR A;  5BOC A;  4FCQ A;  5F3K A;  3A0X A;  4PRX A;  3U2D A;  2C1G A;  4ASG A;  1YSZ A;  4BXI A;  2JJC A;  3WQ9 A;  3A0T A;  2QG2 A;  4R3M A;  1KZN A;  3IED A;  2XJG A;  3INX A;  2YEI A;  2ZKJ A;  1UYE A;  2WEP A;  3HYZ A;  4MOT A;  4CWR A;  3B27 A;  3D36 A;  3T1K A;  4XIP A;  3GIG B;  4R3A A;  3TZ5 A;  4EMV A;  3KE6 A;  2YGA A;  4WUC A;  1H7S A;  1YET A;  3HZ1 A;  4O09 A;  3CGY A;  1YT0 A;  4XIQ A;  4CWF A;  3ZKD A;  4V25 A;  1I5A A;  1UYG A;  2XCM A;  2YGE A;  4XC0 A;  5CTX A;  3T2S A;  1AH6 A; 
#chains in the Genus database with same CATH homology
 1GJV A;  3EHH A;  4HXZ A;  4KSG A;  1YES A;  2YEH A;  2WI7 A;  3CWV A;  4H7Q A;  1YC4 A;  4K4O A;  2AKP A;  5M4N A;  2O1V A;  3B24 A;  4O04 A;  2YGF A;  4EGH A;  2VWC A;  1YT2 A;  1NHI A;  3NMQ A;  3T10 A;  4JQL A;  3ZM7 A;  1UY7 A;  2XHX A;  3MNR P;  4LWF A;  3EKR A;  3U67 A;  4KQV A;  3TUH A;  3RLQ A;  4CWS A;  1U0Z A;  1I5D A;  2VCJ A;  3K97 A;  3G7B A;  3WHA A;  4URM A;  3OMU A;  3CGZ A;  4NH7 A;  3LNU A;  1AMW A;  5FNF A;  4MP7 A;  4XD8 A;  4YKU A;  1UY9 A;  2FWY A;  2BU2 A;  4YKY A;  2YKB A;  4XKK A;  4XTJ A;  1UYD A;  1UYL A;  1Z5A A;  3Q5L A;  4JAS A;  4CWT A;  4ASA A;  4HY6 A;  1R62 A;  1BXD A;  4U93 A;  3H80 A;  2XX5 A;  2YKJ A;  4BAE A;  4CWQ A;  2ESA A;  1Y8O A;  1Z5C A;  3C0E A;  4XDM A;  4FMT A;  4QPK A;  2YEE A;  2YE9 A;  3GIG A;  2BYI A;  3R4M A;  5FNC A;  1PVG A;  2XDS A;  4MP2 A;  4QPJ A;  5CTU A;  3OW6 A;  4E01 A;  5CTY A;  3ZKB A;  4GCZ A;  4JAV A;  4KP4 A;  4V26 A;  1S16 A;  5J71 A;  3U2K A;  3R4N A;  4ZVI A;  2ZDY A;  4FCR A;  4NH8 A;  2QF6 A;  1UY6 A;  2BRC A;  2H8M A;  4L93 A;  3D2R A;  1ZW9 A;  4KTN A;  5FWK A;  1TC6 A;  4KSH A;  3O0I A;  4EFU A;  2HCH A;  3QTF A;  4B7P A;  4GFN A;  4WUB A;  3CRK A;  2CG9 A;  1QYE A;  1AM1 A;  2XDK A;  2YI7 A;  4O0B A;  4DZY A;  2O1U A;  3EHF A;  2YE8 A;  2WER A;  4EM7 A;  4CE1 A;  3B28 A;  2WI3 A;  2XX2 A;  2WI5 A;  3PEJ A;  3Q5K A;  2JKI A;  4YKZ A;  1THN A;  1UYM A;  1I5B A;  1BKN A;  2IOP A;  2VW5 A;  1NHH A;  1UY8 A;  2H55 A;  3TZ2 A;  2YKC A;  3CRL A;  4LWI A;  1ZXM A;  1NHJ A;  1B3Q A;  1BYQ A;  1UYH A;  2BYH A;  2YI5 A;  4YKR A;  4P7A A;  2CCT A;  2ZBK B;  2IWX A;  1ID0 A;  1YT1 A;  4LP0 A;  3K99 A;  2Q2E B;  1Y8P A;  2XJX A;  3B25 A;  4XKA A;  4GT8 A;  1UYI A;  4HZ5 A;  3FT5 A;  3OPD A;  4XIT A;  5J6A A;  2YEF A;  1JM6 A;  3O6O A;  4URN A;  1I59 A;  1L0O A;  2YEC A;  4MPC A;  2YEA A;  4O07 A;  3TZ4 A;  3R91 A;  3T0H A;  2YEB A;  5D7D A;  2GFD A;  4XIR A;  2XHT A;  4CWN A;  2IWU A;  1ZXN A;  1TIL A;  2BU5 A;  2Q8H A;  2CH4 A;  5BOD A;  4MPN A;  3R4O A;  2XD6 A;  3VHD A;  1TH8 A;  3R4P A;  2FWZ A;  2BZ5 A;  2YK2 A;  3T0Z A;  2YEJ A;  5D7C A;  2YE6 A;  3VHA A;  4ZKI A;  1U2O A;  2CCU A;  4FPP A;  4LPB A;  1BGQ A;  3OWB A;  3QDD A;  4W7T A;  4P8O A;  3LPS A;  4U7O A;  1Z59 A;  3PEH A;  5IN9 A;  2QFO A;  2IOR A;  4AWQ A;  2YED A;  2Q8I A;  4MB9 A;  4PU9 A;  4YKT A;  3EHG A;  2HG1 A;  4GGL A;  4XCL A;  2C2A A;  4EGI A;  1KIJ A;  4MPE A;  2XX4 A;  3G7E A;  5C93 A;  3B26 A;  4L91 A;  2GQP A;  2Q8G A;  2WI1 A;  4MBC A;  4CWP A;  4HZ0 A;  1Y8N A;  1UYK A;  5M4K A;  3DGE A;  3R92 A;  4YKQ A;  2YI6 A;  4ASB A;  3BM9 A;  5D6P A;  5GGZ A;  4GEE A;  4XE2 A;  2HKJ A;  1OSF A;  1EA6 A;  2E0A A;  4E02 A;  4XKO A;  3FT8 A;  1TC0 A;  2YEG A;  2BSM A;  3RKZ A;  3ZXQ A;  1MU5 A;  2XJJ A;  4U7N A;  4WUD A;  4YKW A;  2YE4 A;  1TBW A;  2PNR A;  4EFT A;  3K98 A;  2Q8F A;  2YJX A;  3INW A;  4HYP A;  5FND A;  2YKI A;  4URO A;  3SL2 A;  4I5S A;  1GKX A;  2WEQ A;  4CE2 A;  4FCP A;  5M4P A;  2UWD A;  3TTZ A;  4AWP A;  1UYC A;  4JAU A;  1TID A;  2O1W A;  3VHC A;  2BU7 A;  3RLP A;  2CCS A;  4PRV A;  1B63 A;  1GKZ A;  2FYP A;  2XDL A;  4EEH A;  1B62 A;  4LWE A;  2K5B A;  1US7 A;  2XAB A;  5D7R A;  3ZXO A;  4CE3 A;  3TZ0 A;  1EI1 A;  1Z5B A;  3HEK A;  2WI4 A;  2VCI A;  2FXS A;  4PL9 A;  1AH8 A;  4GQT A;  4Q20 A;  5CPH A;  2YJW A;  4AWO A;  3OWD A;  3EHJ A;  5IDJ A;  3VAD A;  5M4M A;  5CTW A;  2QG0 A;  1I5C A;  2BTZ A;  3BMY A;  2BRE A;  4HXW A;  4CWO A;  1Y4U A;  3A0Z A;  3GIF A;  2XDX A;  4H85 A;  3G75 A;  1MX0 A;  1QY8 A;  3HYY A;  3K60 A;  3C11 A;  4NH9 A;  2YE7 A;  2WI6 A;  4BIU A;  2YE3 A;  5CF0 A;  3HHU A;  4KFG A;  2YE5 A;  4EGK A;  4LWG A;  1YS3 A;  1H7U A;  1QZR A;  2YKE A;  2BU8 A;  4ASF A;  2BT0 A;  4HYM A;  2EXL A;  1ZWH A;  3A0W A;  3EKO A;  4L90 A;  5IDM A;  3Q5J A;  4L94 A;  2WI2 A;  1YC3 A;  1AJ6 A;  1YER A;  1Y4S A;  4AS9 A;  2ZDX A;  2CGF A;  5M4H A;  3GIE A;  3D0B A;  4E00 A;  4I3H A;  2YE2 A;  2IOQ A;  2XHR A;  1YC1 A;  3A0R A;  3FV5 A;  4DUH A;  2YK9 A;  1A4H A;  2YI0 A;  3H4L A;  4URL A;  1YSR A;  3JZ3 A;  4X9L A;  4BIZ A;  3HZ5 A;  5F5R A;  4XCJ A;  2XK2 A;  2BU6 A;  2IWS A;  1I58 A;  1UYF A;  4L8Z A;  4LWH A;  4R1F A;  5D6Q A;  1S14 A;  3O2F A;  4BQG A;  3A0Y A;  5M4E A;  4HY1 A;  5L3J A;  4H81 A;  4BQJ A;  4O05 A;  4YKX A;  4B6C A;  2XDU A;  3RLR A;  5BOC A;  4FCQ A;  5F3K A;  3A0X A;  4PRX A;  3U2D A;  4ASG A;  1YSZ A;  4BXI A;  2JJC A;  3WQ9 A;  3A0T A;  2QG2 A;  4R3M A;  1KZN A;  3IED A;  2XJG A;  3INX A;  2YEI A;  2ZKJ A;  1UYE A;  2WEP A;  3HYZ A;  4MOT A;  4CWR A;  3B27 A;  3D36 A;  3T1K A;  4XIP A;  3GIG B;  4R3A A;  3TZ5 A;  4EMV A;  3KE6 A;  2YGA A;  4WUC A;  1H7S A;  1YET A;  3HZ1 A;  4O09 A;  3CGY A;  1YT0 A;  4XIQ A;  4CWF A;  3ZKD A;  4V25 A;  1I5A A;  1UYG A;  2XCM A;  2YGE A;  4XC0 A;  5CTX A;  3T2S A;  1AH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...