2FYPA

Grp94 in complex with the novel hsp90 inhibitor radester amine
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
236
structure length
232
Chain Sequence
GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Endoplasmin
publication title Inhibittory Ligands Adopt Different Conformations When Bound to Hsp90 or GRP94: Implications for Paralog-specific Drug Design
rcsb
source organism Canis lupus
total genus 65
structure length 232
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2fypA00
3LNUA 4JAUA 4WUBA 3RLRA 3FT8A 4CE2A 2YGFA 5M4NA 4Q20A 4DUHA 3ZXOA 3PEHA 2YE4A 2IORA 3RKZA 1NHHA 4PRXA 4ASAA 2PNRA 4O07A 3VHDA 4E01A 4EGHA 3INXA 2WI5A 4MP7A 3ZKDA 2XHXA 3QTFA 4U7OA 4XTJA 1AMWA 3CWVA 4MPEA 4LWEA 3O6OA 2WEQA 1GKXA 3VHCA 2YEJA 2YKBA 3HHUA 1UYCA 2O1WA 4FPPA 4PU9A 2YI5A 4LWGA 3R92A 3G75A 2CCUA 4XCLA 5J71A 2YGEA 1UY7A 3H4LA 2BREA 3EHFA 2IOPA 5J6AA 2JJCA 4H81A 4GCZA 3K97A 2WI4A 1BXDA 1UYIA 2WI3A 3CGYA 4EFUA 4YKRA 2Q8FA 3Q5LA 4GEEA 3ZKBA 2ZBKB 2CCTA 4P8OA 3K98A 4BIUA 4L90A 2IWXA 4XC0A 1Y4SA 4R1FA 1YT2A 3R4OA 1I5CA 1EA6A 1UYDA 3BM9A 1S16A 1U0ZA 2BTZA 1YSRA 3B27A 4MBCA 1TIDA 3A0WA 1UYGA 3OWDA 1BYQA 2QFOA 3A0ZA 4O0BA 2YEDA 2O1VA 3CRKA 1ID0A 1H7UA 4WUCA 3Q5KA 2ZDYA 2BU5A 1YC1A 1R62A 4R3AA 2FWZA 2YGAA 3D2RA 4PL9A 3WQ9A 4DZYA 2YE2A 2XJJA 2GFDA 4CWPA 3TTZA 1UYEA 1KIJA 3EKRA 4NH7A 2HCHA 2YEFA 1Z5CA 4NH8A 4ZKIA 1U2OA 3O2FA 4YKYA 1B63A 5CTYA 1YS3A 4URNA 2BT0A 4FCPA 4L91A 2Q8IA 2XK2A 1ZXMA 2XDKA 3B26A 4WUDA 2WI6A 2ZKJA 3B24A 4HY6A 4HZ5A 3KE6A 2XDUA 1BGQA 4XKOA 2FWYA 4V25A 4AWPA 3TUHA 3QDDA 4CWNA 1UYMA 4URLA 3T0ZA 5CTXA 3RLQA 4JASA 4AS9A 4H85A 4YKZA 2BYIA 1Z5AA 5FNDA 4FCQA 2CG9A 2HG1A 5M4HA 2BZ5A 1Y8NA 4KQVA 4XITA 4CWTA 2CH4A 2XCMA 3D36A 3BMYA 2YEIA 4YKWA 1I58A 4URMA 4KFGA 4EGIA 2K5BA 3A0TA 4EEHA 3G7BA 1GKZA 2JKIA 1YERA 2XABA 2ESAA 2XX5A 4EM7A 3T1KA 4XKKA 4B6CA 5F5RA 2YKJA 4CWSA 1YT0A 3RLPA 3D0BA 1Z59A 4BIZA 1Y4UA 4NH9A 4W7TA 2XHRA 3WHAA 2H55A 4LWFA 3EHHA 2WI7A 4XE2A 2YI0A 4XDMA 4X9LA 1Z5BA 3T0HA 4O09A 4YKXA 5BODA 2IWUA 2VCIA 3VHAA 3HYYA 1QZRA 2XX4A 2AKPA 5D7RA 1YT1A 1ZWHA 1ZW9A 3A0YA 2YE7A 4GQTA 3FV5A 4P7AA 2UWDA 1US7A 3C11A 4ASGA 5CF0A 4E00A 3K60A 4AWQA 4AWOA 1AH6A 1TC6A 2VWCA 3ZM7A 3R4PA 4CWOA 4H7QA 2YE6A 1AH8A 4CWQA 1UYLA 1BKNA 2YKCA 5GGZA 3Q5JA 2XX2A 4PRVA 3C0EA 4XIQA 3OWBA 3G7EA 3TZ2A 4U93A 4CWFA 4U7NA 4GGLA 2YECA 2E0AA 2XJXA 1TILA 4LPBA 3U67A 2BU7A 1YESA 2WI1A 1OSFA 3GIFA 3H80A 5CPHA 3TZ5A 3A0XA 4UROA 3EHJA 1L0OA 2IWSA 3GIEA 2BU6A 1A4HA 3R4MA 1KZNA 1YETA 5D7CA 1NHJA 3INWA 2YI6A 1Y8PA 3GIGB 1B3QA 1PVGA 2QF6A 3B28A 1EI1A 5M4KA 4HYPA 3CGZA 3MNRP 4ASBA 2BU8A 2GQPA 2C2AA 2IOQA 1UYFA 3HZ1A 1AM1A 1UYKA 4L94A 5D7DA 1NHIA 4CE3A 1I5AA 2XJGA 3LPSA 4KTNA 4MPNA 1AJ6A 3O0IA 2YEAA 2YKEA 2YKIA 2YK2A 3CRLA 1UY9A 3HEKA 4R3MA 3GIGA 3T10A 2O1UA 4XD8A 3HYZA 3IEDA 2YE3A 4XKAA 3VADA 1I5BA 2YEBA 3EKOA 4FMTA 2HKJA 1Y8OA 2XHTA 3ZXQA 1MX0A 2BU2A 4XIRA 4QPKA 2YK9A 2VCJA 3SL2A 5M4PA 4CE1A 5IDMA 1TH8A 4MP2A 4B7PA 1B62A 4FCRA 4BAEA 1TC0A 4MB9A 2XDLA 5FWKA 2WEPA 3JZ3A 4LP0A 5M4MA 2Q8HA 2CCSA 5FNFA 4JAVA 1YC4A 3HZ5A 1ZXNA 2XD6A 3R91A 3OW6A 3FT5A 4K4OA 2YEHA 3R4NA 5F3KA 4EMVA 5IDJA 4XCJA 2YJWA 4HYMA 1QYEA 2ZDXA 2FXSA 4HY1A 5M4EA 3OPDA 2BRCA 2XDSA 1S14A 3EHGA 5FNCA 4CWRA 2WERA 4KSHA 5CTWA 4I3HA 2YJXA 2QG0A 2YEEA 4LWIA 5C93A 2Q2EB 2BYHA 1YSZA 3OMUA 5BOCA 4EFTA 2YEGA 1GJVA 2CGFA 4L8ZA 4EGKA 3DGEA 2EXLA 1I59A 4GT8A 5IN9A 1H7SA 1UYHA 4L93A 3K99A 2XDXA 4YKQA 1MU5A 1THNA 1UY8A 4ASFA 4BQGA 3B25A 4E02A 2FYPA 4O05A 2QG2A 3U2KA 4KSGA 4GFNA 1QY8A 4MPCA 2BSMA 2YE8A 3U2DA 4I5SA 4KP4A 1TBWA 3PEJA 1I5DA 3NMQA 1YC3A 1UY6A 5CTUA 4V26A 5D6QA 2Q8GA 4YKUA 4LWHA 2H8MA 4HZ0A 3TZ4A 4O04A 4HXZA 4XIPA 5D6PA 4QPJA 3T2SA 3TZ0A 4JQLA 4MOTA 4ZVIA 1JM6A 2VW5A 4BQJA 2YE5A 2YE9A 4YKTA 4BXIA 5L3JA 2WI2A 2YI7A 3A0RA 4HXWA
chains in the Genus database with same CATH superfamily
3LNUA 4JAUA 4WUBA 3RLRA 3FT8A 4CE2A 2YGFA 5M4NA 4Q20A 4DUHA 3ZXOA 3PEHA 2YE4A 2IORA 3RKZA 1NHHA 4PRXA 4ASAA 2PNRA 4O07A 3VHDA 4E01A 4EGHA 3INXA 2WI5A 4MP7A 3ZKDA 2XHXA 3QTFA 4U7OA 4XTJA 1AMWA 3CWVA 4MPEA 4LWEA 3O6OA 2WEQA 1GKXA 3VHCA 2YEJA 2YKBA 3HHUA 1UYCA 2O1WA 4FPPA 4PU9A 2YI5A 4LWGA 3R92A 3G75A 2CCUA 4XCLA 5J71A 2YGEA 1UY7A 3H4LA 2BREA 3EHFA 2IOPA 5J6AA 2JJCA 4H81A 4GCZA 3K97A 2WI4A 1BXDA 1UYIA 2WI3A 3CGYA 4EFUA 4YKRA 2Q8FA 3Q5LA 4GEEA 3ZKBA 2ZBKB 2CCTA 4P8OA 3K98A 4BIUA 4L90A 2IWXA 4XC0A 1Y4SA 4R1FA 1YT2A 3R4OA 1I5CA 2C1IA 1EA6A 1UYDA 3BM9A 1S16A 1U0ZA 2BTZA 1YSRA 3B27A 4MBCA 1TIDA 3A0WA 1UYGA 3OWDA 1BYQA 2QFOA 3A0ZA 4O0BA 2YEDA 2O1VA 3CRKA 1ID0A 1H7UA 4E72A 4WUCA 3Q5KA 2ZDYA 2BU5A 1YC1A 1R62A 4R3AA 2FWZA 2YGAA 3S5TA 3D2RA 4PL9A 3WQ9A 4DZYA 2YE2A 2XJJA 2GFDA 4CWPA 3TTZA 1UYEA 1KIJA 3EKRA 4NH7A 2HCHA 2YEFA 1Z5CA 4NH8A 4ZKIA 1U2OA 3O2FA 4YKYA 1B63A 5CTYA 1YS3A 4URNA 2BT0A 1IXMA 4FCPA 2HHIA 4L91A 2Q8IA 2XK2A 1ZXMA 2XDKA 3B26A 4WUDA 2WI6A 2ZKJA 3B24A 4HY6A 4HZ5A 3KE6A 2XDUA 1BGQA 4XKOA 2FWYA 4V25A 4AWPA 3TUHA 3QDDA 4CWNA 1UYMA 4URLA 3T0ZA 5CTXA 3RLQA 4JASA 4AS9A 4H85A 4YKZA 2BYIA 1Z5AA 5FNDA 4FCQA 2CG9A 2HG1A 5M4HA 2BZ5A 1Y8NA 4KQVA 4XITA 4CWTA 2CH4A 2XCMA 3D36A 3BMYA 2YEIA 4YKWA 1I58A 4URMA 4KFGA 4EGIA 2K5BA 3A0TA 4EEHA 3G7BA 1GKZA 2JKIA 1YERA 2XABA 2ESAA 2XX5A 4EM7A 3T1KA 4XKKA 4B6CA 5F5RA 2YKJA 4CWSA 1YT0A 3RLPA 3D0BA 1Z59A 4BIZA 1Y4UA 4NH9A 4W7TA 2XHRA 3WHAA 2H55A 4LWFA 3EHHA 2WI7A 4XE2A 2YI0A 4XDMA 4X9LA 1Z5BA 3T0HA 4O09A 4YKXA 5BODA 2IWUA 2VCIA 3VHAA 3HYYA 1QZRA 2XX4A 2AKPA 5D7RA 1YT1A 1ZWHA 1ZW9A 3A0YA 2YE7A 4GQTA 3FV5A 4P7AA 2UWDA 1US7A 3C11A 4ASGA 5CF0A 4E00A 3K60A 4AWQA 4AWOA 1AH6A 1TC6A 2VWCA 3ZM7A 3R4PA 4CWOA 4H7QA 2YE6A 3CYGA 1AH8A 4CWQA 1UYLA 1BKNA 2YKCA 5GGZA 3Q5JA 2XX2A 4PRVA 3C0EA 4XIQA 3OWBA 3G7EA 3TZ2A 4U93A 4CWFA 4U7NA 4GGLA 2YECA 2E0AA 2XJXA 1TILA 4LPBA 3U67A 2BU7A 1YESA 2WI1A 1OSFA 3GIFA 3H80A 5CPHA 3TZ5A 3A0XA 4UROA 3EHJA 1L0OA 2IWSA 3GIEA 2BU6A 1A4HA 2FTKA 3R4MA 1KZNA 1YETA 5JENA 5D7CA 1NHJA 3INWA 2YI6A 1Y8PA 3GIGB 1B3QA 1PVGA 2QF6A 3B28A 1EI1A 5M4KA 4HYPA 3CGZA 3MNRP 4ASBA 2BU8A 2GQPA 2C2AA 2IOQA 1UYFA 3HZ1A 1AM1A 1UYKA 4L94A 5D7DA 1NHIA 4CE3A 1I5AA 2XJGA 3LPSA 4KTNA 4MPNA 1AJ6A 3O0IA 2YEAA 2YKEA 2YKIA 2YK2A 3CRLA 3LMMA 1UY9A 3HEKA 4R3MA 3GIGA 3T10A 2O1UA 4XD8A 3HYZA 3IEDA 2YE3A 4XKAA 3VADA 1I5BA 2YEBA 3EKOA 4FMTA 2HKJA 1Y8OA 2XHTA 3ZXQA 1MX0A 2BU2A 4XIRA 4QPKA 2YK9A 2VCJA 3SL2A 5M4PA 4CE1A 5IDMA 1TH8A 4MP2A 4B7PA 1B62A 4FCRA 4BAEA 1TC0A 4MB9A 2XDLA 5FWKA 2WEPA 3JZ3A 4LP0A 5M4MA 2Q8HA 2CCSA 5FNFA 4JAVA 1YC4A 3HZ5A 1ZXNA 2XD6A 3R91A 3OW6A 3FT5A 4K4OA 2YEHA 3R4NA 5F3KA 4EMVA 5IDJA 4XCJA 2YJWA 4HYMA 1QYEA 2ZDXA 1F51A 2FXSA 4HY1A 5M4EA 3OPDA 2BRCA 2XDSA 1S14A 3EHGA 5FNCA 4CWRA 2WERA 4KSHA 5CTWA 4I3HA 2YJXA 2QG0A 2YEEA 4LWIA 2C1GA 5C93A 2Q2EB 2BYHA 1YSZA 3OMUA 5BOCA 4EFTA 2YEGA 1GJVA 2CGFA 4L8ZA 4EGKA 3DGEA 2EXLA 1I59A 4GT8A 5IN9A 1H7SA 1UYHA 4L93A 3K99A 2XDXA 4YKQA 1MU5A 1THNA 1UY8A 4ASFA 4BQGA 3B25A 4E02A 2FYPA 4O05A 2QG2A 3U2KA 4KSGA 4GFNA 1QY8A 4MPCA 2BSMA 2YE8A 3U2DA 4I5SA 4KP4A 1TBWA 3PEJA 1I5DA 3NMQA 1YC3A 1UY6A 5CTUA 4V26A 5D6QA 2Q8GA 4YKUA 4LWHA 2H8MA 4HZ0A 3TZ4A 4O04A 4HXZA 4XIPA 5D6PA 4QPJA 3T2SA 3TZ0A 4JQLA 4MOTA 4ZVIA 1JM6A 2VW5A 4BQJA 2YE5A 2YE9A 4YKTA 4BXIA 5L3JA 2WI2A 2YI7A 3A0RA 4HXWA
chains in the Genus database with same CATH topology
3LNUA 4JAUA 4WUBA 3RLRA 3FT8A 4CE2A 2YGFA 5M4NA 4Q20A 4DUHA 3ZXOA 3PEHA 2YE4A 2IORA 3RKZA 1NHHA 4PRXA 4ASAA 2PNRA 4O07A 3VHDA 4E01A 4EGHA 3INXA 2WI5A 4MP7A 3ZKDA 2XHXA 3QTFA 4U7OA 4XTJA 1AMWA 3CWVA 4MPEA 4LWEA 3O6OA 2WEQA 1GKXA 3VHCA 2YEJA 2YKBA 3HHUA 1UYCA 2O1WA 4FPPA 4PU9A 2YI5A 4LWGA 3R92A 3G75A 2CCUA 4XCLA 5J71A 2YGEA 1UY7A 3H4LA 2BREA 3EHFA 2IOPA 5J6AA 2JJCA 4H81A 4GCZA 3K97A 2WI4A 1BXDA 1UYIA 2WI3A 3CGYA 4EFUA 4YKRA 2Q8FA 3Q5LA 4GEEA 3ZKBA 2ZBKB 2CCTA 4P8OA 3K98A 4BIUA 4L90A 2IWXA 4XC0A 1Y4SA 4R1FA 1YT2A 3R4OA 1I5CA 1EA6A 1UYDA 3BM9A 1S16A 1U0ZA 2BTZA 1YSRA 3B27A 4MBCA 1TIDA 3A0WA 1UYGA 3OWDA 1BYQA 2QFOA 3A0ZA 4O0BA 2YEDA 2O1VA 3CRKA 1ID0A 1H7UA 4WUCA 3Q5KA 2ZDYA 2BU5A 1YC1A 1R62A 4R3AA 2FWZA 2YGAA 3D2RA 4PL9A 3WQ9A 4DZYA 2YE2A 2XJJA 2GFDA 4CWPA 3TTZA 1UYEA 1KIJA 3EKRA 4NH7A 2HCHA 2YEFA 1Z5CA 4NH8A 4ZKIA 1U2OA 3O2FA 4YKYA 1B63A 5CTYA 1YS3A 4URNA 2BT0A 4FCPA 4L91A 2Q8IA 2XK2A 1ZXMA 2XDKA 3B26A 4WUDA 2WI6A 2ZKJA 3B24A 4HY6A 4HZ5A 3KE6A 2XDUA 1BGQA 4XKOA 2FWYA 4V25A 4AWPA 3TUHA 3QDDA 4CWNA 1UYMA 4URLA 3T0ZA 5CTXA 3RLQA 4JASA 4AS9A 4H85A 4YKZA 2BYIA 1Z5AA 5FNDA 4FCQA 2CG9A 2HG1A 5M4HA 2BZ5A 1Y8NA 4KQVA 4XITA 4CWTA 2CH4A 2XCMA 3D36A 3BMYA 2YEIA 4YKWA 1I58A 4URMA 4KFGA 4EGIA 2K5BA 3A0TA 4EEHA 3G7BA 1GKZA 2JKIA 1YERA 2XABA 2ESAA 2XX5A 4EM7A 3T1KA 4XKKA 4B6CA 5F5RA 2YKJA 4CWSA 1YT0A 3RLPA 3D0BA 1Z59A 4BIZA 1Y4UA 4NH9A 4W7TA 2XHRA 3WHAA 2H55A 4LWFA 3EHHA 2WI7A 4XE2A 2YI0A 4XDMA 4X9LA 1Z5BA 3T0HA 4O09A 4YKXA 5BODA 2IWUA 2VCIA 3VHAA 3HYYA 1QZRA 2XX4A 2AKPA 5D7RA 1YT1A 1ZWHA 1ZW9A 3A0YA 2YE7A 4GQTA 3FV5A 4P7AA 2UWDA 1US7A 3C11A 4ASGA 5CF0A 4E00A 3K60A 4AWQA 4AWOA 1AH6A 1TC6A 2VWCA 3ZM7A 3R4PA 4CWOA 4H7QA 2YE6A 1AH8A 4CWQA 1UYLA 1BKNA 2YKCA 5GGZA 3Q5JA 2XX2A 4PRVA 3C0EA 4XIQA 3OWBA 3G7EA 3TZ2A 4U93A 4CWFA 4U7NA 4GGLA 2YECA 2E0AA 2XJXA 1TILA 4LPBA 3U67A 2BU7A 1YESA 2WI1A 1OSFA 3GIFA 3H80A 5CPHA 3TZ5A 3A0XA 4UROA 3EHJA 1L0OA 2IWSA 3GIEA 2BU6A 1A4HA 3R4MA 1KZNA 1YETA 5D7CA 1NHJA 3INWA 2YI6A 1Y8PA 3GIGB 1B3QA 1PVGA 2QF6A 3B28A 1EI1A 5M4KA 4HYPA 3CGZA 3MNRP 4ASBA 2BU8A 2GQPA 2C2AA 2IOQA 1UYFA 3HZ1A 1AM1A 1UYKA 4L94A 5D7DA 1NHIA 4CE3A 1I5AA 2XJGA 3LPSA 4KTNA 4MPNA 1AJ6A 3O0IA 2YEAA 2YKEA 2YKIA 2YK2A 3CRLA 1UY9A 3HEKA 4R3MA 3GIGA 3T10A 2O1UA 4XD8A 3HYZA 3IEDA 2YE3A 4XKAA 3VADA 1I5BA 2YEBA 3EKOA 4FMTA 2HKJA 1Y8OA 2XHTA 3ZXQA 1MX0A 2BU2A 4XIRA 4QPKA 2YK9A 2VCJA 3SL2A 5M4PA 4CE1A 5IDMA 1TH8A 4MP2A 4B7PA 1B62A 4FCRA 4BAEA 1TC0A 4MB9A 2XDLA 5FWKA 2WEPA 3JZ3A 4LP0A 5M4MA 2Q8HA 2CCSA 5FNFA 4JAVA 1YC4A 3HZ5A 1ZXNA 2XD6A 3R91A 3OW6A 3FT5A 4K4OA 2YEHA 3R4NA 5F3KA 4EMVA 5IDJA 4XCJA 2YJWA 4HYMA 1QYEA 2ZDXA 2FXSA 4HY1A 5M4EA 3OPDA 2BRCA 2XDSA 1S14A 3EHGA 5FNCA 4CWRA 2WERA 4KSHA 5CTWA 4I3HA 2YJXA 2QG0A 2YEEA 4LWIA 5C93A 2Q2EB 2BYHA 1YSZA 3OMUA 5BOCA 4EFTA 2YEGA 1GJVA 2CGFA 4L8ZA 4EGKA 3DGEA 2EXLA 1I59A 4GT8A 5IN9A 1H7SA 1UYHA 4L93A 3K99A 2XDXA 4YKQA 1MU5A 1THNA 1UY8A 4ASFA 4BQGA 3B25A 4E02A 2FYPA 4O05A 2QG2A 3U2KA 4KSGA 4GFNA 1QY8A 4MPCA 2BSMA 2YE8A 3U2DA 4I5SA 4KP4A 1TBWA 3PEJA 1I5DA 3NMQA 1YC3A 1UY6A 5CTUA 4V26A 5D6QA 2Q8GA 4YKUA 4LWHA 2H8MA 4HZ0A 3TZ4A 4O04A 4HXZA 4XIPA 5D6PA 4QPJA 3T2SA 3TZ0A 4JQLA 4MOTA 4ZVIA 1JM6A 2VW5A 4BQJA 2YE5A 2YE9A 4YKTA 4BXIA 5L3JA 2WI2A 2YI7A 3A0RA 4HXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LNU A;  4JAU A;  4WUB A;  3RLR A;  3FT8 A;  4CE2 A;  2YGF A;  5M4N A;  4Q20 A;  4DUH A;  3ZXO A;  3PEH A;  2YE4 A;  2IOR A;  3RKZ A;  1NHH A;  4PRX A;  4ASA A;  2PNR A;  4O07 A;  3VHD A;  4E01 A;  4EGH A;  3INX A;  2WI5 A;  4MP7 A;  3ZKD A;  2XHX A;  3QTF A;  4U7O A;  4XTJ A;  1AMW A;  3CWV A;  4MPE A;  4LWE A;  3O6O A;  2WEQ A;  1GKX A;  3VHC A;  2YEJ A;  2YKB A;  3HHU A;  1UYC A;  2O1W A;  4FPP A;  4PU9 A;  2YI5 A;  4LWG A;  3R92 A;  3G75 A;  2CCU A;  4XCL A;  5J71 A;  2YGE A;  1UY7 A;  3H4L A;  2BRE A;  3EHF A;  2IOP A;  5J6A A;  2JJC A;  4H81 A;  4GCZ A;  3K97 A;  2WI4 A;  1BXD A;  1UYI A;  2WI3 A;  3CGY A;  4EFU A;  4YKR A;  2Q8F A;  3Q5L A;  4GEE A;  3ZKB A;  2ZBK B;  2CCT A;  4P8O A;  3K98 A;  4BIU A;  4L90 A;  2IWX A;  4XC0 A;  1Y4S A;  4R1F A;  1YT2 A;  3R4O A;  1I5C A;  1EA6 A;  1UYD A;  3BM9 A;  1S16 A;  1U0Z A;  2BTZ A;  1YSR A;  3B27 A;  4MBC A;  1TID A;  3A0W A;  1UYG A;  3OWD A;  1BYQ A;  2QFO A;  3A0Z A;  4O0B A;  2YED A;  2O1V A;  3CRK A;  1ID0 A;  1H7U A;  4WUC A;  3Q5K A;  2ZDY A;  2BU5 A;  1YC1 A;  1R62 A;  4R3A A;  2FWZ A;  2YGA A;  3D2R A;  4PL9 A;  3WQ9 A;  4DZY A;  2YE2 A;  2XJJ A;  2GFD A;  4CWP A;  3TTZ A;  1UYE A;  1KIJ A;  3EKR A;  4NH7 A;  2HCH A;  2YEF A;  1Z5C A;  4NH8 A;  4ZKI A;  1U2O A;  3O2F A;  4YKY A;  1B63 A;  5CTY A;  1YS3 A;  4URN A;  2BT0 A;  4FCP A;  4L91 A;  2Q8I A;  2XK2 A;  1ZXM A;  2XDK A;  3B26 A;  4WUD A;  2WI6 A;  2ZKJ A;  3B24 A;  4HY6 A;  4HZ5 A;  3KE6 A;  2XDU A;  1BGQ A;  4XKO A;  2FWY A;  4V25 A;  4AWP A;  3TUH A;  3QDD A;  4CWN A;  1UYM A;  4URL A;  3T0Z A;  5CTX A;  3RLQ A;  4JAS A;  4AS9 A;  4H85 A;  4YKZ A;  2BYI A;  1Z5A A;  5FND A;  4FCQ A;  2CG9 A;  2HG1 A;  5M4H A;  2BZ5 A;  1Y8N A;  4KQV A;  4XIT A;  4CWT A;  2CH4 A;  2XCM A;  3D36 A;  3BMY A;  2YEI A;  4YKW A;  1I58 A;  4URM A;  4KFG A;  4EGI A;  2K5B A;  3A0T A;  4EEH A;  3G7B A;  1GKZ A;  2JKI A;  1YER A;  2XAB A;  2ESA A;  2XX5 A;  4EM7 A;  3T1K A;  4XKK A;  4B6C A;  5F5R A;  2YKJ A;  4CWS A;  1YT0 A;  3RLP A;  3D0B A;  1Z59 A;  4BIZ A;  1Y4U A;  4NH9 A;  4W7T A;  2XHR A;  3WHA A;  2H55 A;  4LWF A;  3EHH A;  2WI7 A;  4XE2 A;  2YI0 A;  4XDM A;  4X9L A;  1Z5B A;  3T0H A;  4O09 A;  4YKX A;  5BOD A;  2IWU A;  2VCI A;  3VHA A;  3HYY A;  1QZR A;  2XX4 A;  2AKP A;  5D7R A;  1YT1 A;  1ZWH A;  1ZW9 A;  3A0Y A;  2YE7 A;  4GQT A;  3FV5 A;  4P7A A;  2UWD A;  1US7 A;  3C11 A;  4ASG A;  5CF0 A;  4E00 A;  3K60 A;  4AWQ A;  4AWO A;  1AH6 A;  1TC6 A;  2VWC A;  3ZM7 A;  3R4P A;  4CWO A;  4H7Q A;  2YE6 A;  1AH8 A;  4CWQ A;  1UYL A;  1BKN A;  2YKC A;  5GGZ A;  3Q5J A;  2XX2 A;  4PRV A;  3C0E A;  4XIQ A;  3OWB A;  3G7E A;  3TZ2 A;  4U93 A;  4CWF A;  4U7N A;  4GGL A;  2YEC A;  2E0A A;  2XJX A;  1TIL A;  4LPB A;  3U67 A;  2BU7 A;  1YES A;  2WI1 A;  1OSF A;  3GIF A;  3H80 A;  5CPH A;  3TZ5 A;  3A0X A;  4URO A;  3EHJ A;  1L0O A;  2IWS A;  3GIE A;  2BU6 A;  1A4H A;  3R4M A;  1KZN A;  1YET A;  5D7C A;  1NHJ A;  3INW A;  2YI6 A;  1Y8P A;  3GIG B;  1B3Q A;  1PVG A;  2QF6 A;  3B28 A;  1EI1 A;  5M4K A;  4HYP A;  3CGZ A;  3MNR P;  4ASB A;  2BU8 A;  2GQP A;  2C2A A;  2IOQ A;  1UYF A;  3HZ1 A;  1AM1 A;  1UYK A;  4L94 A;  5D7D A;  1NHI A;  4CE3 A;  1I5A A;  2XJG A;  3LPS A;  4KTN A;  4MPN A;  1AJ6 A;  3O0I A;  2YEA A;  2YKE A;  2YKI A;  2YK2 A;  3CRL A;  1UY9 A;  3HEK A;  4R3M A;  3GIG A;  3T10 A;  2O1U A;  4XD8 A;  3HYZ A;  3IED A;  2YE3 A;  4XKA A;  3VAD A;  1I5B A;  2YEB A;  3EKO A;  4FMT A;  2HKJ A;  1Y8O A;  2XHT A;  3ZXQ A;  1MX0 A;  2BU2 A;  4XIR A;  4QPK A;  2YK9 A;  2VCJ A;  3SL2 A;  5M4P A;  4CE1 A;  5IDM A;  1TH8 A;  4MP2 A;  4B7P A;  1B62 A;  4FCR A;  4BAE A;  1TC0 A;  4MB9 A;  2XDL A;  5FWK A;  2WEP A;  3JZ3 A;  4LP0 A;  5M4M A;  2Q8H A;  2CCS A;  5FNF A;  4JAV A;  1YC4 A;  3HZ5 A;  1ZXN A;  2XD6 A;  3R91 A;  3OW6 A;  3FT5 A;  4K4O A;  2YEH A;  3R4N A;  5F3K A;  4EMV A;  5IDJ A;  4XCJ A;  2YJW A;  4HYM A;  1QYE A;  2ZDX A;  2FXS A;  4HY1 A;  5M4E A;  3OPD A;  2BRC A;  2XDS A;  1S14 A;  3EHG A;  5FNC A;  4CWR A;  2WER A;  4KSH A;  5CTW A;  4I3H A;  2YJX A;  2QG0 A;  2YEE A;  4LWI A;  5C93 A;  2Q2E B;  2BYH A;  1YSZ A;  3OMU A;  5BOC A;  4EFT A;  2YEG A;  1GJV A;  2CGF A;  4L8Z A;  4EGK A;  3DGE A;  2EXL A;  1I59 A;  4GT8 A;  5IN9 A;  1H7S A;  1UYH A;  4L93 A;  3K99 A;  2XDX A;  4YKQ A;  1MU5 A;  1THN A;  1UY8 A;  4ASF A;  4BQG A;  3B25 A;  4E02 A;  2FYP A;  4O05 A;  2QG2 A;  3U2K A;  4KSG A;  4GFN A;  1QY8 A;  4MPC A;  2BSM A;  2YE8 A;  3U2D A;  4I5S A;  4KP4 A;  1TBW A;  3PEJ A;  1I5D A;  3NMQ A;  1YC3 A;  1UY6 A;  5CTU A;  4V26 A;  5D6Q A;  2Q8G A;  4YKU A;  4LWH A;  2H8M A;  4HZ0 A;  3TZ4 A;  4O04 A;  4HXZ A;  4XIP A;  5D6P A;  4QPJ A;  3T2S A;  3TZ0 A;  4JQL A;  4MOT A;  4ZVI A;  1JM6 A;  2VW5 A;  4BQJ A;  2YE5 A;  2YE9 A;  4YKT A;  4BXI A;  5L3J A;  2WI2 A;  2YI7 A;  3A0R A;  4HXW A; 
#chains in the Genus database with same CATH topology
 3LNU A;  4JAU A;  4WUB A;  3RLR A;  3FT8 A;  4CE2 A;  2YGF A;  5M4N A;  4Q20 A;  4DUH A;  3ZXO A;  3PEH A;  2YE4 A;  2IOR A;  3RKZ A;  1NHH A;  4PRX A;  4ASA A;  2PNR A;  4O07 A;  3VHD A;  4E01 A;  4EGH A;  3INX A;  2WI5 A;  4MP7 A;  3ZKD A;  2XHX A;  3QTF A;  4U7O A;  4XTJ A;  1AMW A;  3CWV A;  4MPE A;  4LWE A;  3O6O A;  2WEQ A;  1GKX A;  3VHC A;  2YEJ A;  2YKB A;  3HHU A;  1UYC A;  2O1W A;  4FPP A;  4PU9 A;  2YI5 A;  4LWG A;  3R92 A;  3G75 A;  2CCU A;  4XCL A;  5J71 A;  2YGE A;  1UY7 A;  3H4L A;  2BRE A;  3EHF A;  2IOP A;  5J6A A;  2JJC A;  4H81 A;  4GCZ A;  3K97 A;  2WI4 A;  1BXD A;  1UYI A;  2WI3 A;  3CGY A;  4EFU A;  4YKR A;  2Q8F A;  3Q5L A;  4GEE A;  3ZKB A;  2ZBK B;  2CCT A;  4P8O A;  3K98 A;  4BIU A;  4L90 A;  2IWX A;  4XC0 A;  1Y4S A;  4R1F A;  1YT2 A;  3R4O A;  1I5C A;  2C1I A;  1EA6 A;  1UYD A;  3BM9 A;  1S16 A;  1U0Z A;  2BTZ A;  1YSR A;  3B27 A;  4MBC A;  1TID A;  3A0W A;  1UYG A;  3OWD A;  1BYQ A;  2QFO A;  3A0Z A;  4O0B A;  2YED A;  2O1V A;  3CRK A;  1ID0 A;  1H7U A;  4E72 A;  4WUC A;  3Q5K A;  2ZDY A;  2BU5 A;  1YC1 A;  1R62 A;  4R3A A;  2FWZ A;  2YGA A;  3S5T A;  3D2R A;  4PL9 A;  3WQ9 A;  4DZY A;  2YE2 A;  2XJJ A;  2GFD A;  4CWP A;  3TTZ A;  1UYE A;  1KIJ A;  3EKR A;  4NH7 A;  2HCH A;  2YEF A;  1Z5C A;  4NH8 A;  4ZKI A;  1U2O A;  3O2F A;  4YKY A;  1B63 A;  5CTY A;  1YS3 A;  4URN A;  2BT0 A;  1IXM A;  4FCP A;  2HHI A;  4L91 A;  2Q8I A;  2XK2 A;  1ZXM A;  2XDK A;  3B26 A;  4WUD A;  2WI6 A;  2ZKJ A;  3B24 A;  4HY6 A;  4HZ5 A;  3KE6 A;  2XDU A;  1BGQ A;  4XKO A;  2FWY A;  4V25 A;  4AWP A;  3TUH A;  3QDD A;  4CWN A;  1UYM A;  4URL A;  3T0Z A;  5CTX A;  3RLQ A;  4JAS A;  4AS9 A;  4H85 A;  4YKZ A;  2BYI A;  1Z5A A;  5FND A;  4FCQ A;  2CG9 A;  2HG1 A;  5M4H A;  2BZ5 A;  1Y8N A;  4KQV A;  4XIT A;  4CWT A;  2CH4 A;  2XCM A;  3D36 A;  3BMY A;  2YEI A;  4YKW A;  1I58 A;  4URM A;  4KFG A;  4EGI A;  2K5B A;  3A0T A;  4EEH A;  3G7B A;  1GKZ A;  2JKI A;  1YER A;  2XAB A;  2ESA A;  2XX5 A;  4EM7 A;  3T1K A;  4XKK A;  4B6C A;  5F5R A;  2YKJ A;  4CWS A;  1YT0 A;  3RLP A;  3D0B A;  1Z59 A;  4BIZ A;  1Y4U A;  4NH9 A;  4W7T A;  2XHR A;  3WHA A;  2H55 A;  4LWF A;  3EHH A;  2WI7 A;  4XE2 A;  2YI0 A;  4XDM A;  4X9L A;  1Z5B A;  3T0H A;  4O09 A;  4YKX A;  5BOD A;  2IWU A;  2VCI A;  3VHA A;  3HYY A;  1QZR A;  2XX4 A;  2AKP A;  5D7R A;  1YT1 A;  1ZWH A;  1ZW9 A;  3A0Y A;  2YE7 A;  4GQT A;  3FV5 A;  4P7A A;  2UWD A;  1US7 A;  3C11 A;  4ASG A;  5CF0 A;  4E00 A;  3K60 A;  4AWQ A;  4AWO A;  1AH6 A;  1TC6 A;  2VWC A;  3ZM7 A;  3R4P A;  4CWO A;  4H7Q A;  2YE6 A;  3CYG A;  1AH8 A;  4CWQ A;  1UYL A;  1BKN A;  2YKC A;  5GGZ A;  3Q5J A;  2XX2 A;  4PRV A;  3C0E A;  4XIQ A;  3OWB A;  3G7E A;  3TZ2 A;  4U93 A;  4CWF A;  4U7N A;  4GGL A;  2YEC A;  2E0A A;  2XJX A;  1TIL A;  4LPB A;  3U67 A;  2BU7 A;  1YES A;  2WI1 A;  1OSF A;  3GIF A;  3H80 A;  5CPH A;  3TZ5 A;  3A0X A;  4URO A;  3EHJ A;  1L0O A;  2IWS A;  3GIE A;  2BU6 A;  1A4H A;  2FTK A;  3R4M A;  1KZN A;  1YET A;  5JEN A;  5D7C A;  1NHJ A;  3INW A;  2YI6 A;  1Y8P A;  3GIG B;  1B3Q A;  1PVG A;  2QF6 A;  3B28 A;  1EI1 A;  5M4K A;  4HYP A;  3CGZ A;  3MNR P;  4ASB A;  2BU8 A;  2GQP A;  2C2A A;  2IOQ A;  1UYF A;  3HZ1 A;  1AM1 A;  1UYK A;  4L94 A;  5D7D A;  1NHI A;  4CE3 A;  1I5A A;  2XJG A;  3LPS A;  4KTN A;  4MPN A;  1AJ6 A;  3O0I A;  2YEA A;  2YKE A;  2YKI A;  2YK2 A;  3CRL A;  3LMM A;  1UY9 A;  3HEK A;  4R3M A;  3GIG A;  3T10 A;  2O1U A;  4XD8 A;  3HYZ A;  3IED A;  2YE3 A;  4XKA A;  3VAD A;  1I5B A;  2YEB A;  3EKO A;  4FMT A;  2HKJ A;  1Y8O A;  2XHT A;  3ZXQ A;  1MX0 A;  2BU2 A;  4XIR A;  4QPK A;  2YK9 A;  2VCJ A;  3SL2 A;  5M4P A;  4CE1 A;  5IDM A;  1TH8 A;  4MP2 A;  4B7P A;  1B62 A;  4FCR A;  4BAE A;  1TC0 A;  4MB9 A;  2XDL A;  5FWK A;  2WEP A;  3JZ3 A;  4LP0 A;  5M4M A;  2Q8H A;  2CCS A;  5FNF A;  4JAV A;  1YC4 A;  3HZ5 A;  1ZXN A;  2XD6 A;  3R91 A;  3OW6 A;  3FT5 A;  4K4O A;  2YEH A;  3R4N A;  5F3K A;  4EMV A;  5IDJ A;  4XCJ A;  2YJW A;  4HYM A;  1QYE A;  2ZDX A;  1F51 A;  2FXS A;  4HY1 A;  5M4E A;  3OPD A;  2BRC A;  2XDS A;  1S14 A;  3EHG A;  5FNC A;  4CWR A;  2WER A;  4KSH A;  5CTW A;  4I3H A;  2YJX A;  2QG0 A;  2YEE A;  4LWI A;  2C1G A;  5C93 A;  2Q2E B;  2BYH A;  1YSZ A;  3OMU A;  5BOC A;  4EFT A;  2YEG A;  1GJV A;  2CGF A;  4L8Z A;  4EGK A;  3DGE A;  2EXL A;  1I59 A;  4GT8 A;  5IN9 A;  1H7S A;  1UYH A;  4L93 A;  3K99 A;  2XDX A;  4YKQ A;  1MU5 A;  1THN A;  1UY8 A;  4ASF A;  4BQG A;  3B25 A;  4E02 A;  2FYP A;  4O05 A;  2QG2 A;  3U2K A;  4KSG A;  4GFN A;  1QY8 A;  4MPC A;  2BSM A;  2YE8 A;  3U2D A;  4I5S A;  4KP4 A;  1TBW A;  3PEJ A;  1I5D A;  3NMQ A;  1YC3 A;  1UY6 A;  5CTU A;  4V26 A;  5D6Q A;  2Q8G A;  4YKU A;  4LWH A;  2H8M A;  4HZ0 A;  3TZ4 A;  4O04 A;  4HXZ A;  4XIP A;  5D6P A;  4QPJ A;  3T2S A;  3TZ0 A;  4JQL A;  4MOT A;  4ZVI A;  1JM6 A;  2VW5 A;  4BQJ A;  2YE5 A;  2YE9 A;  4YKT A;  4BXI A;  5L3J A;  2WI2 A;  2YI7 A;  3A0R A;  4HXW A; 
#chains in the Genus database with same CATH homology
 3LNU A;  4JAU A;  4WUB A;  3RLR A;  3FT8 A;  4CE2 A;  2YGF A;  5M4N A;  4Q20 A;  4DUH A;  3ZXO A;  3PEH A;  2YE4 A;  2IOR A;  3RKZ A;  1NHH A;  4PRX A;  4ASA A;  2PNR A;  4O07 A;  3VHD A;  4E01 A;  4EGH A;  3INX A;  2WI5 A;  4MP7 A;  3ZKD A;  2XHX A;  3QTF A;  4U7O A;  4XTJ A;  1AMW A;  3CWV A;  4MPE A;  4LWE A;  3O6O A;  2WEQ A;  1GKX A;  3VHC A;  2YEJ A;  2YKB A;  3HHU A;  1UYC A;  2O1W A;  4FPP A;  4PU9 A;  2YI5 A;  4LWG A;  3R92 A;  3G75 A;  2CCU A;  4XCL A;  5J71 A;  2YGE A;  1UY7 A;  3H4L A;  2BRE A;  3EHF A;  2IOP A;  5J6A A;  2JJC A;  4H81 A;  4GCZ A;  3K97 A;  2WI4 A;  1BXD A;  1UYI A;  2WI3 A;  3CGY A;  4EFU A;  4YKR A;  2Q8F A;  3Q5L A;  4GEE A;  3ZKB A;  2ZBK B;  2CCT A;  4P8O A;  3K98 A;  4BIU A;  4L90 A;  2IWX A;  4XC0 A;  1Y4S A;  4R1F A;  1YT2 A;  3R4O A;  1I5C A;  1EA6 A;  1UYD A;  3BM9 A;  1S16 A;  1U0Z A;  2BTZ A;  1YSR A;  3B27 A;  4MBC A;  1TID A;  3A0W A;  1UYG A;  3OWD A;  1BYQ A;  2QFO A;  3A0Z A;  4O0B A;  2YED A;  2O1V A;  3CRK A;  1ID0 A;  1H7U A;  4WUC A;  3Q5K A;  2ZDY A;  2BU5 A;  1YC1 A;  1R62 A;  4R3A A;  2FWZ A;  2YGA A;  3D2R A;  4PL9 A;  3WQ9 A;  4DZY A;  2YE2 A;  2XJJ A;  2GFD A;  4CWP A;  3TTZ A;  1UYE A;  1KIJ A;  3EKR A;  4NH7 A;  2HCH A;  2YEF A;  1Z5C A;  4NH8 A;  4ZKI A;  1U2O A;  3O2F A;  4YKY A;  1B63 A;  5CTY A;  1YS3 A;  4URN A;  2BT0 A;  4FCP A;  4L91 A;  2Q8I A;  2XK2 A;  1ZXM A;  2XDK A;  3B26 A;  4WUD A;  2WI6 A;  2ZKJ A;  3B24 A;  4HY6 A;  4HZ5 A;  3KE6 A;  2XDU A;  1BGQ A;  4XKO A;  2FWY A;  4V25 A;  4AWP A;  3TUH A;  3QDD A;  4CWN A;  1UYM A;  4URL A;  3T0Z A;  5CTX A;  3RLQ A;  4JAS A;  4AS9 A;  4H85 A;  4YKZ A;  2BYI A;  1Z5A A;  5FND A;  4FCQ A;  2CG9 A;  2HG1 A;  5M4H A;  2BZ5 A;  1Y8N A;  4KQV A;  4XIT A;  4CWT A;  2CH4 A;  2XCM A;  3D36 A;  3BMY A;  2YEI A;  4YKW A;  1I58 A;  4URM A;  4KFG A;  4EGI A;  2K5B A;  3A0T A;  4EEH A;  3G7B A;  1GKZ A;  2JKI A;  1YER A;  2XAB A;  2ESA A;  2XX5 A;  4EM7 A;  3T1K A;  4XKK A;  4B6C A;  5F5R A;  2YKJ A;  4CWS A;  1YT0 A;  3RLP A;  3D0B A;  1Z59 A;  4BIZ A;  1Y4U A;  4NH9 A;  4W7T A;  2XHR A;  3WHA A;  2H55 A;  4LWF A;  3EHH A;  2WI7 A;  4XE2 A;  2YI0 A;  4XDM A;  4X9L A;  1Z5B A;  3T0H A;  4O09 A;  4YKX A;  5BOD A;  2IWU A;  2VCI A;  3VHA A;  3HYY A;  1QZR A;  2XX4 A;  2AKP A;  5D7R A;  1YT1 A;  1ZWH A;  1ZW9 A;  3A0Y A;  2YE7 A;  4GQT A;  3FV5 A;  4P7A A;  2UWD A;  1US7 A;  3C11 A;  4ASG A;  5CF0 A;  4E00 A;  3K60 A;  4AWQ A;  4AWO A;  1AH6 A;  1TC6 A;  2VWC A;  3ZM7 A;  3R4P A;  4CWO A;  4H7Q A;  2YE6 A;  1AH8 A;  4CWQ A;  1UYL A;  1BKN A;  2YKC A;  5GGZ A;  3Q5J A;  2XX2 A;  4PRV A;  3C0E A;  4XIQ A;  3OWB A;  3G7E A;  3TZ2 A;  4U93 A;  4CWF A;  4U7N A;  4GGL A;  2YEC A;  2E0A A;  2XJX A;  1TIL A;  4LPB A;  3U67 A;  2BU7 A;  1YES A;  2WI1 A;  1OSF A;  3GIF A;  3H80 A;  5CPH A;  3TZ5 A;  3A0X A;  4URO A;  3EHJ A;  1L0O A;  2IWS A;  3GIE A;  2BU6 A;  1A4H A;  3R4M A;  1KZN A;  1YET A;  5D7C A;  1NHJ A;  3INW A;  2YI6 A;  1Y8P A;  3GIG B;  1B3Q A;  1PVG A;  2QF6 A;  3B28 A;  1EI1 A;  5M4K A;  4HYP A;  3CGZ A;  3MNR P;  4ASB A;  2BU8 A;  2GQP A;  2C2A A;  2IOQ A;  1UYF A;  3HZ1 A;  1AM1 A;  1UYK A;  4L94 A;  5D7D A;  1NHI A;  4CE3 A;  1I5A A;  2XJG A;  3LPS A;  4KTN A;  4MPN A;  1AJ6 A;  3O0I A;  2YEA A;  2YKE A;  2YKI A;  2YK2 A;  3CRL A;  1UY9 A;  3HEK A;  4R3M A;  3GIG A;  3T10 A;  2O1U A;  4XD8 A;  3HYZ A;  3IED A;  2YE3 A;  4XKA A;  3VAD A;  1I5B A;  2YEB A;  3EKO A;  4FMT A;  2HKJ A;  1Y8O A;  2XHT A;  3ZXQ A;  1MX0 A;  2BU2 A;  4XIR A;  4QPK A;  2YK9 A;  2VCJ A;  3SL2 A;  5M4P A;  4CE1 A;  5IDM A;  1TH8 A;  4MP2 A;  4B7P A;  1B62 A;  4FCR A;  4BAE A;  1TC0 A;  4MB9 A;  2XDL A;  5FWK A;  2WEP A;  3JZ3 A;  4LP0 A;  5M4M A;  2Q8H A;  2CCS A;  5FNF A;  4JAV A;  1YC4 A;  3HZ5 A;  1ZXN A;  2XD6 A;  3R91 A;  3OW6 A;  3FT5 A;  4K4O A;  2YEH A;  3R4N A;  5F3K A;  4EMV A;  5IDJ A;  4XCJ A;  2YJW A;  4HYM A;  1QYE A;  2ZDX A;  2FXS A;  4HY1 A;  5M4E A;  3OPD A;  2BRC A;  2XDS A;  1S14 A;  3EHG A;  5FNC A;  4CWR A;  2WER A;  4KSH A;  5CTW A;  4I3H A;  2YJX A;  2QG0 A;  2YEE A;  4LWI A;  5C93 A;  2Q2E B;  2BYH A;  1YSZ A;  3OMU A;  5BOC A;  4EFT A;  2YEG A;  1GJV A;  2CGF A;  4L8Z A;  4EGK A;  3DGE A;  2EXL A;  1I59 A;  4GT8 A;  5IN9 A;  1H7S A;  1UYH A;  4L93 A;  3K99 A;  2XDX A;  4YKQ A;  1MU5 A;  1THN A;  1UY8 A;  4ASF A;  4BQG A;  3B25 A;  4E02 A;  2FYP A;  4O05 A;  2QG2 A;  3U2K A;  4KSG A;  4GFN A;  1QY8 A;  4MPC A;  2BSM A;  2YE8 A;  3U2D A;  4I5S A;  4KP4 A;  1TBW A;  3PEJ A;  1I5D A;  3NMQ A;  1YC3 A;  1UY6 A;  5CTU A;  4V26 A;  5D6Q A;  2Q8G A;  4YKU A;  4LWH A;  2H8M A;  4HZ0 A;  3TZ4 A;  4O04 A;  4HXZ A;  4XIP A;  5D6P A;  4QPJ A;  3T2S A;  3TZ0 A;  4JQL A;  4MOT A;  4ZVI A;  1JM6 A;  2VW5 A;  4BQJ A;  2YE5 A;  2YE9 A;  4YKT A;  4BXI A;  5L3J A;  2WI2 A;  2YI7 A;  3A0R A;  4HXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...