2HCHA

N-domain of grp94 in complex with the novel ligand n-(2-amino)ethyl carboxyamido adenosine
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
236
structure length
221
Chain Sequence
GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTESTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Endoplasmin
publication title N-Domain Of Grp94 In Complex With the Novel Ligand N-aminoethyl Carboxyamido Adenosine
rcsb
source organism Canis lupus familiaris
total genus 65
structure length 221
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2hchA00
1BXDA 2XDKA 2BYHA 3T2SA 4CWOA 2YEDA 4I3HA 3WHAA 3BM9A 2YEIA 1THNA 3MNRP 3CRKA 1I5BA 3ZKBA 4AS9A 2WI2A 4MPNA 4P8OA 2JJCA 2XJXA 5BOCA 2VCIA 1TBWA 3ZM7A 4XIPA 1UYHA 1QY8A 3G7EA 4BIZA 2IORA 3KE6A 5IDJA 4EGKA 3K60A 3T0HA 1ZXNA 5F3KA 4CE3A 4HXZA 5M4PA 2YE6A 4WUDA 2XHXA 3OWDA 4I5SA 3T10A 4PL9A 4BQJA 4B7PA 1I5CA 2YKBA 3D0BA 4CWTA 4FCRA 2BSMA 4JAUA 4W7TA 3VHDA 1OSFA 2Q2EB 3RLPA 3ZXQA 3HHUA 5CTUA 2YE4A 3C0EA 2BZ5A 2BU8A 4GQTA 1TILA 5CF0A 4XIQA 2C2AA 3EHGA 3OMUA 4EMVA 4CWPA 3A0YA 4WUCA 4DZYA 1A4HA 2XD6A 4BQGA 4O04A 4CE2A 4KTNA 4AWQA 1H7UA 3HZ5A 2QG2A 4XCJA 2FYPA 3Q5KA 4YKRA 1YSRA 4HY6A 1UY8A 4BXIA 4MPEA 4QPJA 5FNDA 2CCTA 2VWCA 3Q5JA 2YGFA 3PEJA 4FPPA 2YGEA 3C11A 3K98A 5D6PA 2XCMA 3GIFA 1QYEA 4CWSA 3QDDA 5M4NA 3VHCA 1H7SA 2BYIA 4PRXA 3NMQA 3K97A 3A0WA 2WI1A 2YEHA 4YKTA 4YKWA 1Y4UA 3R4OA 3EHJA 2FXSA 2BU6A 1ZXMA 4FCQA 2YI7A 5D7CA 3T1KA 3R4MA 1YSZA 2YKCA 1U0ZA 3EKRA 2WERA 3R92A 3HZ1A 4KP4A 2WI5A 3A0TA 5FNFA 4U7OA 4ZKIA 1UYIA 2CH4A 3BMYA 2YI5A 1L0OA 1AMWA 3G7BA 4E00A 3B25A 3HYZA 2XABA 2YKIA 4HZ0A 4EGIA 2H8MA 1PVGA 1B3QA 2K5BA 5FNCA 4XKKA 1MU5A 5GGZA 4KSHA 4EGHA 4AWPA 1Y8PA 4O05A 1R62A 1UYDA 2H55A 5FWKA 4P7AA 3VADA 2VCJA 4GT8A 3B26A 4PU9A 4CWFA 3FV5A 1UY6A 3OPDA 4XKAA 2PNRA 2QG0A 3RKZA 4GFNA 1YERA 2Q8GA 4LWIA 1BKNA 3OWBA 2O1WA 2BTZA 4ASGA 1I58A 2XJJA 3D2RA 2BU5A 3O0IA 4L8ZA 3JZ3A 1UY9A 4LWEA 1Z5CA 4NH9A 4DUHA 1US7A 5CPHA 2YEEA 5IDMA 3SL2A 1UYCA 2ZKJA 2XDSA 2WEPA 3DGEA 3A0XA 1YESA 1ID0A 2WI7A 3FT8A 3Q5LA 4L93A 3TZ5A 1YT0A 2IOQA 2QFOA 3O6OA 1UYGA 1S14A 1BYQA 2CG9A 4HY1A 1YC3A 3GIEA 4R1FA 5L3JA 1MX0A 1YC4A 2IWSA 3B24A 2YI0A 2XK2A 2YEBA 4QPKA 4X9LA 4URNA 5M4MA 3OW6A 2YEGA 1UYLA 4FCPA 4EM7A 2O1VA 2XX2A 1ZW9A 2E0AA 4KFGA 4YKYA 1UYMA 4KSGA 1B62A 2JKIA 3G75A 4MP7A 1NHHA 1Z59A 2YE2A 2IWXA 5D6QA 4U93A 1AH8A 3WQ9A 1KZNA 2HG1A 2YEAA 4B6CA 2YECA 3K99A 3B28A 3ZXOA 4H85A 4HYPA 1UY7A 2BU7A 1TC0A 5M4EA 3LPSA 1JM6A 4MOTA 2IOPA 4NH7A 2Q8FA 4XDMA 3VHAA 4R3AA 1TIDA 4LPBA 1I5DA 4KQVA 4FMTA 5M4HA 2XHRA 2YE7A 3HEKA 2XHTA 4NH8A 2EXLA 1GJVA 3H80A 1UYEA 2BREA 3IEDA 4YKQA 4ASFA 4L91A 1GKZA 4EFTA 3INXA 3T0ZA 2Q8IA 2YI6A 4Q20A 1AJ6A 2GFDA 1U2OA 2WI4A 1EA6A 3D36A 2WI6A 4XITA 4MB9A 2UWDA 4JASA 2WEQA 3PEHA 2FWYA 4EEHA 5F5RA 3HYYA 3B27A 2O1UA 4MBCA 1Z5AA 2XJGA 3U2DA 2YE3A 4LWGA 3CGYA 4R3MA 4V25A 2CCUA 4H7QA 3R4PA 4HZ5A 2ZDYA 1YT2A 4EFUA 4XD8A 2VW5A 4WUBA 4JQLA 3EKOA 3RLQA 4O07A 4HYMA 5CTYA 4O09A 1YETA 4URMA 1AH6A 5C93A 3H4LA 4GEEA 4XKOA 4GCZA 3TZ2A 5J6AA 2ZDXA 1I5AA 2YE8A 4K4OA 3RLRA 1UYKA 1EI1A 1YC1A 5J71A 1TC6A 3A0RA 1YS3A 2IWUA 3FT5A 2CGFA 4XIRA 4XC0A 1Z5BA 5BODA 2FWZA 4XE2A 4LP0A 1Y8NA 4XTJA 4HXWA 2XX4A 3EHHA 5CTWA 4MPCA 2Q8HA 4CE1A 2ESAA 4ASBA 4O0BA 3ZKDA 4MP2A 3EHFA 3GIGB 4PRVA 3O2FA 2YE5A 1GKXA 1BGQA 4CWRA 3LNUA 4JAVA 2XDXA 2YEJA 1S16A 2XDUA 2HKJA 3R4NA 2CCSA 4GGLA 3TZ4A 4YKXA 3U2KA 3A0ZA 2XX5A 2YK2A 4URLA 4LWFA 4H81A 1KIJA 2YJXA 4ZVIA 4ASAA 4AWOA 4UROA 3QTFA 2YJWA 3CWVA 1NHJA 1ZWHA 2GQPA 1UYFA 1YT1A 4U7NA 2YEFA 2YGAA 4BAEA 4CWNA 1I59A 1NHIA 4L90A 2ZBKB 4E01A 2XDLA 2BT0A 1Y8OA 1AM1A 5D7DA 3INWA 4YKZA 3U67A 4E02A 2YK9A 2AKPA 5CTXA 3TTZA 3GIGA 4LWHA 4L94A 2YKJA 1QZRA 2BRCA 3CRLA 4YKUA 4BIUA 4XCLA 2QF6A 2YE9A 3TZ0A 2WI3A 3R91A 5M4KA 5IN9A 1TH8A 1Y4SA 1B63A 4CWQA 5D7RA 3TUHA 3CGZA 2BU2A 2HCHA 2YKEA 4V26A
chains in the Genus database with same CATH superfamily
1BXDA 2XDKA 2BYHA 3T2SA 4CWOA 2YEDA 4I3HA 3WHAA 3BM9A 2YEIA 1THNA 3MNRP 3CRKA 1I5BA 3ZKBA 4AS9A 2WI2A 4MPNA 4P8OA 2JJCA 2XJXA 5BOCA 2VCIA 1TBWA 3ZM7A 4XIPA 1UYHA 1QY8A 3G7EA 4BIZA 2IORA 3KE6A 5IDJA 4EGKA 3K60A 3T0HA 1ZXNA 5F3KA 4CE3A 1IXMA 4HXZA 5M4PA 2YE6A 4WUDA 2XHXA 3OWDA 4I5SA 3T10A 4PL9A 4BQJA 4B7PA 1I5CA 2YKBA 3D0BA 4CWTA 4FCRA 2BSMA 4JAUA 4W7TA 3VHDA 1OSFA 2Q2EB 3RLPA 3ZXQA 3HHUA 5CTUA 2YE4A 3C0EA 2BZ5A 2BU8A 4GQTA 1TILA 5CF0A 4XIQA 2C2AA 3EHGA 3OMUA 4EMVA 4CWPA 3A0YA 4WUCA 4DZYA 1A4HA 2XD6A 4BQGA 4O04A 4CE2A 4E72A 4KTNA 4AWQA 1H7UA 3HZ5A 2QG2A 4XCJA 2FYPA 3Q5KA 4YKRA 1YSRA 4HY6A 1UY8A 4BXIA 4MPEA 4QPJA 5FNDA 2CCTA 2VWCA 3Q5JA 2YGFA 3PEJA 4FPPA 2YGEA 3C11A 3K98A 5D6PA 2XCMA 3GIFA 1QYEA 4CWSA 3QDDA 5M4NA 3VHCA 1H7SA 2BYIA 4PRXA 3NMQA 3K97A 3A0WA 2WI1A 2YEHA 4YKTA 4YKWA 1Y4UA 3R4OA 3EHJA 2FXSA 2BU6A 1ZXMA 4FCQA 2YI7A 5D7CA 3T1KA 3R4MA 1YSZA 2YKCA 1U0ZA 3EKRA 2WERA 3R92A 3HZ1A 4KP4A 2WI5A 3A0TA 5FNFA 4U7OA 4ZKIA 1UYIA 1F51A 2CH4A 3BMYA 2YI5A 1L0OA 1AMWA 3G7BA 4E00A 3B25A 3HYZA 3CYGA 2XABA 2YKIA 4HZ0A 4EGIA 2H8MA 1PVGA 1B3QA 2K5BA 5FNCA 4XKKA 1MU5A 2C1IA 5GGZA 4KSHA 4EGHA 4AWPA 1Y8PA 4O05A 1R62A 1UYDA 2H55A 5FWKA 4P7AA 3VADA 2VCJA 4GT8A 3B26A 4PU9A 4CWFA 3FV5A 1UY6A 3OPDA 4XKAA 2PNRA 2QG0A 3RKZA 4GFNA 1YERA 2Q8GA 4LWIA 1BKNA 5JENA 3OWBA 2O1WA 2BTZA 4ASGA 1I58A 2XJJA 3D2RA 2BU5A 3O0IA 3LMMA 4L8ZA 3JZ3A 1UY9A 4LWEA 1Z5CA 4NH9A 4DUHA 1US7A 5CPHA 2YEEA 5IDMA 3SL2A 1UYCA 2ZKJA 2XDSA 2WEPA 3DGEA 3A0XA 1YESA 1ID0A 2WI7A 3FT8A 3Q5LA 4L93A 3TZ5A 1YT0A 2IOQA 2QFOA 3O6OA 1UYGA 1S14A 1BYQA 2CG9A 4HY1A 1YC3A 3GIEA 4R1FA 5L3JA 1MX0A 1YC4A 2IWSA 3B24A 2YI0A 2FTKA 2XK2A 2YEBA 4QPKA 4X9LA 4URNA 5M4MA 3OW6A 2YEGA 1UYLA 4FCPA 4EM7A 2O1VA 2XX2A 1ZW9A 2E0AA 4KFGA 4YKYA 1UYMA 4KSGA 1B62A 2JKIA 3G75A 4MP7A 1NHHA 1Z59A 2YE2A 2C1GA 2IWXA 5D6QA 4U93A 1AH8A 3WQ9A 1KZNA 2HG1A 2YEAA 4B6CA 2YECA 3K99A 3B28A 3ZXOA 4H85A 4HYPA 1UY7A 2BU7A 1TC0A 5M4EA 3LPSA 1JM6A 4MOTA 2IOPA 4NH7A 2Q8FA 4XDMA 3VHAA 4R3AA 1TIDA 4LPBA 1I5DA 4KQVA 4FMTA 5M4HA 2XHRA 2YE7A 3HEKA 2XHTA 4NH8A 2EXLA 1GJVA 3H80A 1UYEA 2BREA 3IEDA 4YKQA 4ASFA 4L91A 1GKZA 4EFTA 3INXA 3T0ZA 2Q8IA 2YI6A 4Q20A 1AJ6A 2GFDA 1U2OA 2WI4A 1EA6A 3D36A 2WI6A 4XITA 4MB9A 2UWDA 4JASA 2WEQA 3PEHA 2FWYA 4EEHA 5F5RA 3HYYA 3B27A 2O1UA 4MBCA 1Z5AA 2XJGA 3U2DA 2YE3A 4LWGA 3CGYA 4R3MA 4V25A 2CCUA 4H7QA 3S5TA 3R4PA 4HZ5A 2ZDYA 1YT2A 4EFUA 4XD8A 2VW5A 4WUBA 4JQLA 3EKOA 3RLQA 4O07A 4HYMA 5CTYA 4O09A 1YETA 4URMA 1AH6A 5C93A 3H4LA 4GEEA 4XKOA 4GCZA 3TZ2A 5J6AA 2ZDXA 1I5AA 2YE8A 4K4OA 3RLRA 1UYKA 1EI1A 1YC1A 5J71A 1TC6A 3A0RA 1YS3A 2IWUA 3FT5A 2CGFA 4XIRA 4XC0A 1Z5BA 5BODA 2FWZA 4XE2A 4LP0A 1Y8NA 4XTJA 4HXWA 2XX4A 3EHHA 5CTWA 4MPCA 2Q8HA 4CE1A 2ESAA 4ASBA 4O0BA 3ZKDA 4MP2A 3EHFA 3GIGB 4PRVA 3O2FA 2YE5A 1GKXA 1BGQA 4CWRA 3LNUA 4JAVA 2XDXA 2YEJA 1S16A 2XDUA 2HKJA 3R4NA 2CCSA 4GGLA 3TZ4A 4YKXA 3U2KA 3A0ZA 2XX5A 2YK2A 4URLA 4LWFA 4H81A 1KIJA 2YJXA 4ZVIA 4ASAA 4AWOA 4UROA 3QTFA 2YJWA 3CWVA 1NHJA 1ZWHA 2GQPA 1UYFA 1YT1A 4U7NA 2YEFA 2YGAA 4BAEA 4CWNA 1I59A 1NHIA 4L90A 2ZBKB 4E01A 2XDLA 2BT0A 1Y8OA 1AM1A 5D7DA 3INWA 4YKZA 3U67A 4E02A 2YK9A 2AKPA 5CTXA 3TTZA 2HHIA 3GIGA 4LWHA 4L94A 2YKJA 1QZRA 2BRCA 3CRLA 4YKUA 4BIUA 4XCLA 2QF6A 2YE9A 3TZ0A 2WI3A 3R91A 5M4KA 5IN9A 1TH8A 1Y4SA 1B63A 4CWQA 5D7RA 3TUHA 3CGZA 2BU2A 2HCHA 2YKEA 4V26A
chains in the Genus database with same CATH topology
1BXDA 2XDKA 2BYHA 3T2SA 4CWOA 2YEDA 4I3HA 3WHAA 3BM9A 2YEIA 1THNA 3MNRP 3CRKA 1I5BA 3ZKBA 4AS9A 2WI2A 4MPNA 4P8OA 2JJCA 2XJXA 5BOCA 2VCIA 1TBWA 3ZM7A 4XIPA 1UYHA 1QY8A 3G7EA 4BIZA 2IORA 3KE6A 5IDJA 4EGKA 3K60A 3T0HA 1ZXNA 5F3KA 4CE3A 4HXZA 5M4PA 2YE6A 4WUDA 2XHXA 3OWDA 4I5SA 3T10A 4PL9A 4BQJA 4B7PA 1I5CA 2YKBA 3D0BA 4CWTA 4FCRA 2BSMA 4JAUA 4W7TA 3VHDA 1OSFA 2Q2EB 3RLPA 3ZXQA 3HHUA 5CTUA 2YE4A 3C0EA 2BZ5A 2BU8A 4GQTA 1TILA 5CF0A 4XIQA 2C2AA 3EHGA 3OMUA 4EMVA 4CWPA 3A0YA 4WUCA 4DZYA 1A4HA 2XD6A 4BQGA 4O04A 4CE2A 4KTNA 4AWQA 1H7UA 3HZ5A 2QG2A 4XCJA 2FYPA 3Q5KA 4YKRA 1YSRA 4HY6A 1UY8A 4BXIA 4MPEA 4QPJA 5FNDA 2CCTA 2VWCA 3Q5JA 2YGFA 3PEJA 4FPPA 2YGEA 3C11A 3K98A 5D6PA 2XCMA 3GIFA 1QYEA 4CWSA 3QDDA 5M4NA 3VHCA 1H7SA 2BYIA 4PRXA 3NMQA 3K97A 3A0WA 2WI1A 2YEHA 4YKTA 4YKWA 1Y4UA 3R4OA 3EHJA 2FXSA 2BU6A 1ZXMA 4FCQA 2YI7A 5D7CA 3T1KA 3R4MA 1YSZA 2YKCA 1U0ZA 3EKRA 2WERA 3R92A 3HZ1A 4KP4A 2WI5A 3A0TA 5FNFA 4U7OA 4ZKIA 1UYIA 2CH4A 3BMYA 2YI5A 1L0OA 1AMWA 3G7BA 4E00A 3B25A 3HYZA 2XABA 2YKIA 4HZ0A 4EGIA 2H8MA 1PVGA 1B3QA 2K5BA 5FNCA 4XKKA 1MU5A 5GGZA 4KSHA 4EGHA 4AWPA 1Y8PA 4O05A 1R62A 1UYDA 2H55A 5FWKA 4P7AA 3VADA 2VCJA 4GT8A 3B26A 4PU9A 4CWFA 3FV5A 1UY6A 3OPDA 4XKAA 2PNRA 2QG0A 3RKZA 4GFNA 1YERA 2Q8GA 4LWIA 1BKNA 3OWBA 2O1WA 2BTZA 4ASGA 1I58A 2XJJA 3D2RA 2BU5A 3O0IA 4L8ZA 3JZ3A 1UY9A 4LWEA 1Z5CA 4NH9A 4DUHA 1US7A 5CPHA 2YEEA 5IDMA 3SL2A 1UYCA 2ZKJA 2XDSA 2WEPA 3DGEA 3A0XA 1YESA 1ID0A 2WI7A 3FT8A 3Q5LA 4L93A 3TZ5A 1YT0A 2IOQA 2QFOA 3O6OA 1UYGA 1S14A 1BYQA 2CG9A 4HY1A 1YC3A 3GIEA 4R1FA 5L3JA 1MX0A 1YC4A 2IWSA 3B24A 2YI0A 2XK2A 2YEBA 4QPKA 4X9LA 4URNA 5M4MA 3OW6A 2YEGA 1UYLA 4FCPA 4EM7A 2O1VA 2XX2A 1ZW9A 2E0AA 4KFGA 4YKYA 1UYMA 4KSGA 1B62A 2JKIA 3G75A 4MP7A 1NHHA 1Z59A 2YE2A 2IWXA 5D6QA 4U93A 1AH8A 3WQ9A 1KZNA 2HG1A 2YEAA 4B6CA 2YECA 3K99A 3B28A 3ZXOA 4H85A 4HYPA 1UY7A 2BU7A 1TC0A 5M4EA 3LPSA 1JM6A 4MOTA 2IOPA 4NH7A 2Q8FA 4XDMA 3VHAA 4R3AA 1TIDA 4LPBA 1I5DA 4KQVA 4FMTA 5M4HA 2XHRA 2YE7A 3HEKA 2XHTA 4NH8A 2EXLA 1GJVA 3H80A 1UYEA 2BREA 3IEDA 4YKQA 4ASFA 4L91A 1GKZA 4EFTA 3INXA 3T0ZA 2Q8IA 2YI6A 4Q20A 1AJ6A 2GFDA 1U2OA 2WI4A 1EA6A 3D36A 2WI6A 4XITA 4MB9A 2UWDA 4JASA 2WEQA 3PEHA 2FWYA 4EEHA 5F5RA 3HYYA 3B27A 2O1UA 4MBCA 1Z5AA 2XJGA 3U2DA 2YE3A 4LWGA 3CGYA 4R3MA 4V25A 2CCUA 4H7QA 3R4PA 4HZ5A 2ZDYA 1YT2A 4EFUA 4XD8A 2VW5A 4WUBA 4JQLA 3EKOA 3RLQA 4O07A 4HYMA 5CTYA 4O09A 1YETA 4URMA 1AH6A 5C93A 3H4LA 4GEEA 4XKOA 4GCZA 3TZ2A 5J6AA 2ZDXA 1I5AA 2YE8A 4K4OA 3RLRA 1UYKA 1EI1A 1YC1A 5J71A 1TC6A 3A0RA 1YS3A 2IWUA 3FT5A 2CGFA 4XIRA 4XC0A 1Z5BA 5BODA 2FWZA 4XE2A 4LP0A 1Y8NA 4XTJA 4HXWA 2XX4A 3EHHA 5CTWA 4MPCA 2Q8HA 4CE1A 2ESAA 4ASBA 4O0BA 3ZKDA 4MP2A 3EHFA 3GIGB 4PRVA 3O2FA 2YE5A 1GKXA 1BGQA 4CWRA 3LNUA 4JAVA 2XDXA 2YEJA 1S16A 2XDUA 2HKJA 3R4NA 2CCSA 4GGLA 3TZ4A 4YKXA 3U2KA 3A0ZA 2XX5A 2YK2A 4URLA 4LWFA 4H81A 1KIJA 2YJXA 4ZVIA 4ASAA 4AWOA 4UROA 3QTFA 2YJWA 3CWVA 1NHJA 1ZWHA 2GQPA 1UYFA 1YT1A 4U7NA 2YEFA 2YGAA 4BAEA 4CWNA 1I59A 1NHIA 4L90A 2ZBKB 4E01A 2XDLA 2BT0A 1Y8OA 1AM1A 5D7DA 3INWA 4YKZA 3U67A 4E02A 2YK9A 2AKPA 5CTXA 3TTZA 3GIGA 4LWHA 4L94A 2YKJA 1QZRA 2BRCA 3CRLA 4YKUA 4BIUA 4XCLA 2QF6A 2YE9A 3TZ0A 2WI3A 3R91A 5M4KA 5IN9A 1TH8A 1Y4SA 1B63A 4CWQA 5D7RA 3TUHA 3CGZA 2BU2A 2HCHA 2YKEA 4V26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BXD A;  2XDK A;  2BYH A;  3T2S A;  4CWO A;  2YED A;  4I3H A;  3WHA A;  3BM9 A;  2YEI A;  1THN A;  3MNR P;  3CRK A;  1I5B A;  3ZKB A;  4AS9 A;  2WI2 A;  4MPN A;  4P8O A;  2JJC A;  2XJX A;  5BOC A;  2VCI A;  1TBW A;  3ZM7 A;  4XIP A;  1UYH A;  1QY8 A;  3G7E A;  4BIZ A;  2IOR A;  3KE6 A;  5IDJ A;  4EGK A;  3K60 A;  3T0H A;  1ZXN A;  5F3K A;  4CE3 A;  4HXZ A;  5M4P A;  2YE6 A;  4WUD A;  2XHX A;  3OWD A;  4I5S A;  3T10 A;  4PL9 A;  4BQJ A;  4B7P A;  1I5C A;  2YKB A;  3D0B A;  4CWT A;  4FCR A;  2BSM A;  4JAU A;  4W7T A;  3VHD A;  1OSF A;  2Q2E B;  3RLP A;  3ZXQ A;  3HHU A;  5CTU A;  2YE4 A;  3C0E A;  2BZ5 A;  2BU8 A;  4GQT A;  1TIL A;  5CF0 A;  4XIQ A;  2C2A A;  3EHG A;  3OMU A;  4EMV A;  4CWP A;  3A0Y A;  4WUC A;  4DZY A;  1A4H A;  2XD6 A;  4BQG A;  4O04 A;  4CE2 A;  4KTN A;  4AWQ A;  1H7U A;  3HZ5 A;  2QG2 A;  4XCJ A;  2FYP A;  3Q5K A;  4YKR A;  1YSR A;  4HY6 A;  1UY8 A;  4BXI A;  4MPE A;  4QPJ A;  5FND A;  2CCT A;  2VWC A;  3Q5J A;  2YGF A;  3PEJ A;  4FPP A;  2YGE A;  3C11 A;  3K98 A;  5D6P A;  2XCM A;  3GIF A;  1QYE A;  4CWS A;  3QDD A;  5M4N A;  3VHC A;  1H7S A;  2BYI A;  4PRX A;  3NMQ A;  3K97 A;  3A0W A;  2WI1 A;  2YEH A;  4YKT A;  4YKW A;  1Y4U A;  3R4O A;  3EHJ A;  2FXS A;  2BU6 A;  1ZXM A;  4FCQ A;  2YI7 A;  5D7C A;  3T1K A;  3R4M A;  1YSZ A;  2YKC A;  1U0Z A;  3EKR A;  2WER A;  3R92 A;  3HZ1 A;  4KP4 A;  2WI5 A;  3A0T A;  5FNF A;  4U7O A;  4ZKI A;  1UYI A;  2CH4 A;  3BMY A;  2YI5 A;  1L0O A;  1AMW A;  3G7B A;  4E00 A;  3B25 A;  3HYZ A;  2XAB A;  2YKI A;  4HZ0 A;  4EGI A;  2H8M A;  1PVG A;  1B3Q A;  2K5B A;  5FNC A;  4XKK A;  1MU5 A;  5GGZ A;  4KSH A;  4EGH A;  4AWP A;  1Y8P A;  4O05 A;  1R62 A;  1UYD A;  2H55 A;  5FWK A;  4P7A A;  3VAD A;  2VCJ A;  4GT8 A;  3B26 A;  4PU9 A;  4CWF A;  3FV5 A;  1UY6 A;  3OPD A;  4XKA A;  2PNR A;  2QG0 A;  3RKZ A;  4GFN A;  1YER A;  2Q8G A;  4LWI A;  1BKN A;  3OWB A;  2O1W A;  2BTZ A;  4ASG A;  1I58 A;  2XJJ A;  3D2R A;  2BU5 A;  3O0I A;  4L8Z A;  3JZ3 A;  1UY9 A;  4LWE A;  1Z5C A;  4NH9 A;  4DUH A;  1US7 A;  5CPH A;  2YEE A;  5IDM A;  3SL2 A;  1UYC A;  2ZKJ A;  2XDS A;  2WEP A;  3DGE A;  3A0X A;  1YES A;  1ID0 A;  2WI7 A;  3FT8 A;  3Q5L A;  4L93 A;  3TZ5 A;  1YT0 A;  2IOQ A;  2QFO A;  3O6O A;  1UYG A;  1S14 A;  1BYQ A;  2CG9 A;  4HY1 A;  1YC3 A;  3GIE A;  4R1F A;  5L3J A;  1MX0 A;  1YC4 A;  2IWS A;  3B24 A;  2YI0 A;  2XK2 A;  2YEB A;  4QPK A;  4X9L A;  4URN A;  5M4M A;  3OW6 A;  2YEG A;  1UYL A;  4FCP A;  4EM7 A;  2O1V A;  2XX2 A;  1ZW9 A;  2E0A A;  4KFG A;  4YKY A;  1UYM A;  4KSG A;  1B62 A;  2JKI A;  3G75 A;  4MP7 A;  1NHH A;  1Z59 A;  2YE2 A;  2IWX A;  5D6Q A;  4U93 A;  1AH8 A;  3WQ9 A;  1KZN A;  2HG1 A;  2YEA A;  4B6C A;  2YEC A;  3K99 A;  3B28 A;  3ZXO A;  4H85 A;  4HYP A;  1UY7 A;  2BU7 A;  1TC0 A;  5M4E A;  3LPS A;  1JM6 A;  4MOT A;  2IOP A;  4NH7 A;  2Q8F A;  4XDM A;  3VHA A;  4R3A A;  1TID A;  4LPB A;  1I5D A;  4KQV A;  4FMT A;  5M4H A;  2XHR A;  2YE7 A;  3HEK A;  2XHT A;  4NH8 A;  2EXL A;  1GJV A;  3H80 A;  1UYE A;  2BRE A;  3IED A;  4YKQ A;  4ASF A;  4L91 A;  1GKZ A;  4EFT A;  3INX A;  3T0Z A;  2Q8I A;  2YI6 A;  4Q20 A;  1AJ6 A;  2GFD A;  1U2O A;  2WI4 A;  1EA6 A;  3D36 A;  2WI6 A;  4XIT A;  4MB9 A;  2UWD A;  4JAS A;  2WEQ A;  3PEH A;  2FWY A;  4EEH A;  5F5R A;  3HYY A;  3B27 A;  2O1U A;  4MBC A;  1Z5A A;  2XJG A;  3U2D A;  2YE3 A;  4LWG A;  3CGY A;  4R3M A;  4V25 A;  2CCU A;  4H7Q A;  3R4P A;  4HZ5 A;  2ZDY A;  1YT2 A;  4EFU A;  4XD8 A;  2VW5 A;  4WUB A;  4JQL A;  3EKO A;  3RLQ A;  4O07 A;  4HYM A;  5CTY A;  4O09 A;  1YET A;  4URM A;  1AH6 A;  5C93 A;  3H4L A;  4GEE A;  4XKO A;  4GCZ A;  3TZ2 A;  5J6A A;  2ZDX A;  1I5A A;  2YE8 A;  4K4O A;  3RLR A;  1UYK A;  1EI1 A;  1YC1 A;  5J71 A;  1TC6 A;  3A0R A;  1YS3 A;  2IWU A;  3FT5 A;  2CGF A;  4XIR A;  4XC0 A;  1Z5B A;  5BOD A;  2FWZ A;  4XE2 A;  4LP0 A;  1Y8N A;  4XTJ A;  4HXW A;  2XX4 A;  3EHH A;  5CTW A;  4MPC A;  2Q8H A;  4CE1 A;  2ESA A;  4ASB A;  4O0B A;  3ZKD A;  4MP2 A;  3EHF A;  3GIG B;  4PRV A;  3O2F A;  2YE5 A;  1GKX A;  1BGQ A;  4CWR A;  3LNU A;  4JAV A;  2XDX A;  2YEJ A;  1S16 A;  2XDU A;  2HKJ A;  3R4N A;  2CCS A;  4GGL A;  3TZ4 A;  4YKX A;  3U2K A;  3A0Z A;  2XX5 A;  2YK2 A;  4URL A;  4LWF A;  4H81 A;  1KIJ A;  2YJX A;  4ZVI A;  4ASA A;  4AWO A;  4URO A;  3QTF A;  2YJW A;  3CWV A;  1NHJ A;  1ZWH A;  2GQP A;  1UYF A;  1YT1 A;  4U7N A;  2YEF A;  2YGA A;  4BAE A;  4CWN A;  1I59 A;  1NHI A;  4L90 A;  2ZBK B;  4E01 A;  2XDL A;  2BT0 A;  1Y8O A;  1AM1 A;  5D7D A;  3INW A;  4YKZ A;  3U67 A;  4E02 A;  2YK9 A;  2AKP A;  5CTX A;  3TTZ A;  3GIG A;  4LWH A;  4L94 A;  2YKJ A;  1QZR A;  2BRC A;  3CRL A;  4YKU A;  4BIU A;  4XCL A;  2QF6 A;  2YE9 A;  3TZ0 A;  2WI3 A;  3R91 A;  5M4K A;  5IN9 A;  1TH8 A;  1Y4S A;  1B63 A;  4CWQ A;  5D7R A;  3TUH A;  3CGZ A;  2BU2 A;  2HCH A;  2YKE A;  4V26 A; 
#chains in the Genus database with same CATH topology
 1BXD A;  2XDK A;  2BYH A;  3T2S A;  4CWO A;  2YED A;  4I3H A;  3WHA A;  3BM9 A;  2YEI A;  1THN A;  3MNR P;  3CRK A;  1I5B A;  3ZKB A;  4AS9 A;  2WI2 A;  4MPN A;  4P8O A;  2JJC A;  2XJX A;  5BOC A;  2VCI A;  1TBW A;  3ZM7 A;  4XIP A;  1UYH A;  1QY8 A;  3G7E A;  4BIZ A;  2IOR A;  3KE6 A;  5IDJ A;  4EGK A;  3K60 A;  3T0H A;  1ZXN A;  5F3K A;  4CE3 A;  1IXM A;  4HXZ A;  5M4P A;  2YE6 A;  4WUD A;  2XHX A;  3OWD A;  4I5S A;  3T10 A;  4PL9 A;  4BQJ A;  4B7P A;  1I5C A;  2YKB A;  3D0B A;  4CWT A;  4FCR A;  2BSM A;  4JAU A;  4W7T A;  3VHD A;  1OSF A;  2Q2E B;  3RLP A;  3ZXQ A;  3HHU A;  5CTU A;  2YE4 A;  3C0E A;  2BZ5 A;  2BU8 A;  4GQT A;  1TIL A;  5CF0 A;  4XIQ A;  2C2A A;  3EHG A;  3OMU A;  4EMV A;  4CWP A;  3A0Y A;  4WUC A;  4DZY A;  1A4H A;  2XD6 A;  4BQG A;  4O04 A;  4CE2 A;  4E72 A;  4KTN A;  4AWQ A;  1H7U A;  3HZ5 A;  2QG2 A;  4XCJ A;  2FYP A;  3Q5K A;  4YKR A;  1YSR A;  4HY6 A;  1UY8 A;  4BXI A;  4MPE A;  4QPJ A;  5FND A;  2CCT A;  2VWC A;  3Q5J A;  2YGF A;  3PEJ A;  4FPP A;  2YGE A;  3C11 A;  3K98 A;  5D6P A;  2XCM A;  3GIF A;  1QYE A;  4CWS A;  3QDD A;  5M4N A;  3VHC A;  1H7S A;  2BYI A;  4PRX A;  3NMQ A;  3K97 A;  3A0W A;  2WI1 A;  2YEH A;  4YKT A;  4YKW A;  1Y4U A;  3R4O A;  3EHJ A;  2FXS A;  2BU6 A;  1ZXM A;  4FCQ A;  2YI7 A;  5D7C A;  3T1K A;  3R4M A;  1YSZ A;  2YKC A;  1U0Z A;  3EKR A;  2WER A;  3R92 A;  3HZ1 A;  4KP4 A;  2WI5 A;  3A0T A;  5FNF A;  4U7O A;  4ZKI A;  1UYI A;  1F51 A;  2CH4 A;  3BMY A;  2YI5 A;  1L0O A;  1AMW A;  3G7B A;  4E00 A;  3B25 A;  3HYZ A;  3CYG A;  2XAB A;  2YKI A;  4HZ0 A;  4EGI A;  2H8M A;  1PVG A;  1B3Q A;  2K5B A;  5FNC A;  4XKK A;  1MU5 A;  2C1I A;  5GGZ A;  4KSH A;  4EGH A;  4AWP A;  1Y8P A;  4O05 A;  1R62 A;  1UYD A;  2H55 A;  5FWK A;  4P7A A;  3VAD A;  2VCJ A;  4GT8 A;  3B26 A;  4PU9 A;  4CWF A;  3FV5 A;  1UY6 A;  3OPD A;  4XKA A;  2PNR A;  2QG0 A;  3RKZ A;  4GFN A;  1YER A;  2Q8G A;  4LWI A;  1BKN A;  5JEN A;  3OWB A;  2O1W A;  2BTZ A;  4ASG A;  1I58 A;  2XJJ A;  3D2R A;  2BU5 A;  3O0I A;  3LMM A;  4L8Z A;  3JZ3 A;  1UY9 A;  4LWE A;  1Z5C A;  4NH9 A;  4DUH A;  1US7 A;  5CPH A;  2YEE A;  5IDM A;  3SL2 A;  1UYC A;  2ZKJ A;  2XDS A;  2WEP A;  3DGE A;  3A0X A;  1YES A;  1ID0 A;  2WI7 A;  3FT8 A;  3Q5L A;  4L93 A;  3TZ5 A;  1YT0 A;  2IOQ A;  2QFO A;  3O6O A;  1UYG A;  1S14 A;  1BYQ A;  2CG9 A;  4HY1 A;  1YC3 A;  3GIE A;  4R1F A;  5L3J A;  1MX0 A;  1YC4 A;  2IWS A;  3B24 A;  2YI0 A;  2FTK A;  2XK2 A;  2YEB A;  4QPK A;  4X9L A;  4URN A;  5M4M A;  3OW6 A;  2YEG A;  1UYL A;  4FCP A;  4EM7 A;  2O1V A;  2XX2 A;  1ZW9 A;  2E0A A;  4KFG A;  4YKY A;  1UYM A;  4KSG A;  1B62 A;  2JKI A;  3G75 A;  4MP7 A;  1NHH A;  1Z59 A;  2YE2 A;  2C1G A;  2IWX A;  5D6Q A;  4U93 A;  1AH8 A;  3WQ9 A;  1KZN A;  2HG1 A;  2YEA A;  4B6C A;  2YEC A;  3K99 A;  3B28 A;  3ZXO A;  4H85 A;  4HYP A;  1UY7 A;  2BU7 A;  1TC0 A;  5M4E A;  3LPS A;  1JM6 A;  4MOT A;  2IOP A;  4NH7 A;  2Q8F A;  4XDM A;  3VHA A;  4R3A A;  1TID A;  4LPB A;  1I5D A;  4KQV A;  4FMT A;  5M4H A;  2XHR A;  2YE7 A;  3HEK A;  2XHT A;  4NH8 A;  2EXL A;  1GJV A;  3H80 A;  1UYE A;  2BRE A;  3IED A;  4YKQ A;  4ASF A;  4L91 A;  1GKZ A;  4EFT A;  3INX A;  3T0Z A;  2Q8I A;  2YI6 A;  4Q20 A;  1AJ6 A;  2GFD A;  1U2O A;  2WI4 A;  1EA6 A;  3D36 A;  2WI6 A;  4XIT A;  4MB9 A;  2UWD A;  4JAS A;  2WEQ A;  3PEH A;  2FWY A;  4EEH A;  5F5R A;  3HYY A;  3B27 A;  2O1U A;  4MBC A;  1Z5A A;  2XJG A;  3U2D A;  2YE3 A;  4LWG A;  3CGY A;  4R3M A;  4V25 A;  2CCU A;  4H7Q A;  3S5T A;  3R4P A;  4HZ5 A;  2ZDY A;  1YT2 A;  4EFU A;  4XD8 A;  2VW5 A;  4WUB A;  4JQL A;  3EKO A;  3RLQ A;  4O07 A;  4HYM A;  5CTY A;  4O09 A;  1YET A;  4URM A;  1AH6 A;  5C93 A;  3H4L A;  4GEE A;  4XKO A;  4GCZ A;  3TZ2 A;  5J6A A;  2ZDX A;  1I5A A;  2YE8 A;  4K4O A;  3RLR A;  1UYK A;  1EI1 A;  1YC1 A;  5J71 A;  1TC6 A;  3A0R A;  1YS3 A;  2IWU A;  3FT5 A;  2CGF A;  4XIR A;  4XC0 A;  1Z5B A;  5BOD A;  2FWZ A;  4XE2 A;  4LP0 A;  1Y8N A;  4XTJ A;  4HXW A;  2XX4 A;  3EHH A;  5CTW A;  4MPC A;  2Q8H A;  4CE1 A;  2ESA A;  4ASB A;  4O0B A;  3ZKD A;  4MP2 A;  3EHF A;  3GIG B;  4PRV A;  3O2F A;  2YE5 A;  1GKX A;  1BGQ A;  4CWR A;  3LNU A;  4JAV A;  2XDX A;  2YEJ A;  1S16 A;  2XDU A;  2HKJ A;  3R4N A;  2CCS A;  4GGL A;  3TZ4 A;  4YKX A;  3U2K A;  3A0Z A;  2XX5 A;  2YK2 A;  4URL A;  4LWF A;  4H81 A;  1KIJ A;  2YJX A;  4ZVI A;  4ASA A;  4AWO A;  4URO A;  3QTF A;  2YJW A;  3CWV A;  1NHJ A;  1ZWH A;  2GQP A;  1UYF A;  1YT1 A;  4U7N A;  2YEF A;  2YGA A;  4BAE A;  4CWN A;  1I59 A;  1NHI A;  4L90 A;  2ZBK B;  4E01 A;  2XDL A;  2BT0 A;  1Y8O A;  1AM1 A;  5D7D A;  3INW A;  4YKZ A;  3U67 A;  4E02 A;  2YK9 A;  2AKP A;  5CTX A;  3TTZ A;  2HHI A;  3GIG A;  4LWH A;  4L94 A;  2YKJ A;  1QZR A;  2BRC A;  3CRL A;  4YKU A;  4BIU A;  4XCL A;  2QF6 A;  2YE9 A;  3TZ0 A;  2WI3 A;  3R91 A;  5M4K A;  5IN9 A;  1TH8 A;  1Y4S A;  1B63 A;  4CWQ A;  5D7R A;  3TUH A;  3CGZ A;  2BU2 A;  2HCH A;  2YKE A;  4V26 A; 
#chains in the Genus database with same CATH homology
 1BXD A;  2XDK A;  2BYH A;  3T2S A;  4CWO A;  2YED A;  4I3H A;  3WHA A;  3BM9 A;  2YEI A;  1THN A;  3MNR P;  3CRK A;  1I5B A;  3ZKB A;  4AS9 A;  2WI2 A;  4MPN A;  4P8O A;  2JJC A;  2XJX A;  5BOC A;  2VCI A;  1TBW A;  3ZM7 A;  4XIP A;  1UYH A;  1QY8 A;  3G7E A;  4BIZ A;  2IOR A;  3KE6 A;  5IDJ A;  4EGK A;  3K60 A;  3T0H A;  1ZXN A;  5F3K A;  4CE3 A;  4HXZ A;  5M4P A;  2YE6 A;  4WUD A;  2XHX A;  3OWD A;  4I5S A;  3T10 A;  4PL9 A;  4BQJ A;  4B7P A;  1I5C A;  2YKB A;  3D0B A;  4CWT A;  4FCR A;  2BSM A;  4JAU A;  4W7T A;  3VHD A;  1OSF A;  2Q2E B;  3RLP A;  3ZXQ A;  3HHU A;  5CTU A;  2YE4 A;  3C0E A;  2BZ5 A;  2BU8 A;  4GQT A;  1TIL A;  5CF0 A;  4XIQ A;  2C2A A;  3EHG A;  3OMU A;  4EMV A;  4CWP A;  3A0Y A;  4WUC A;  4DZY A;  1A4H A;  2XD6 A;  4BQG A;  4O04 A;  4CE2 A;  4KTN A;  4AWQ A;  1H7U A;  3HZ5 A;  2QG2 A;  4XCJ A;  2FYP A;  3Q5K A;  4YKR A;  1YSR A;  4HY6 A;  1UY8 A;  4BXI A;  4MPE A;  4QPJ A;  5FND A;  2CCT A;  2VWC A;  3Q5J A;  2YGF A;  3PEJ A;  4FPP A;  2YGE A;  3C11 A;  3K98 A;  5D6P A;  2XCM A;  3GIF A;  1QYE A;  4CWS A;  3QDD A;  5M4N A;  3VHC A;  1H7S A;  2BYI A;  4PRX A;  3NMQ A;  3K97 A;  3A0W A;  2WI1 A;  2YEH A;  4YKT A;  4YKW A;  1Y4U A;  3R4O A;  3EHJ A;  2FXS A;  2BU6 A;  1ZXM A;  4FCQ A;  2YI7 A;  5D7C A;  3T1K A;  3R4M A;  1YSZ A;  2YKC A;  1U0Z A;  3EKR A;  2WER A;  3R92 A;  3HZ1 A;  4KP4 A;  2WI5 A;  3A0T A;  5FNF A;  4U7O A;  4ZKI A;  1UYI A;  2CH4 A;  3BMY A;  2YI5 A;  1L0O A;  1AMW A;  3G7B A;  4E00 A;  3B25 A;  3HYZ A;  2XAB A;  2YKI A;  4HZ0 A;  4EGI A;  2H8M A;  1PVG A;  1B3Q A;  2K5B A;  5FNC A;  4XKK A;  1MU5 A;  5GGZ A;  4KSH A;  4EGH A;  4AWP A;  1Y8P A;  4O05 A;  1R62 A;  1UYD A;  2H55 A;  5FWK A;  4P7A A;  3VAD A;  2VCJ A;  4GT8 A;  3B26 A;  4PU9 A;  4CWF A;  3FV5 A;  1UY6 A;  3OPD A;  4XKA A;  2PNR A;  2QG0 A;  3RKZ A;  4GFN A;  1YER A;  2Q8G A;  4LWI A;  1BKN A;  3OWB A;  2O1W A;  2BTZ A;  4ASG A;  1I58 A;  2XJJ A;  3D2R A;  2BU5 A;  3O0I A;  4L8Z A;  3JZ3 A;  1UY9 A;  4LWE A;  1Z5C A;  4NH9 A;  4DUH A;  1US7 A;  5CPH A;  2YEE A;  5IDM A;  3SL2 A;  1UYC A;  2ZKJ A;  2XDS A;  2WEP A;  3DGE A;  3A0X A;  1YES A;  1ID0 A;  2WI7 A;  3FT8 A;  3Q5L A;  4L93 A;  3TZ5 A;  1YT0 A;  2IOQ A;  2QFO A;  3O6O A;  1UYG A;  1S14 A;  1BYQ A;  2CG9 A;  4HY1 A;  1YC3 A;  3GIE A;  4R1F A;  5L3J A;  1MX0 A;  1YC4 A;  2IWS A;  3B24 A;  2YI0 A;  2XK2 A;  2YEB A;  4QPK A;  4X9L A;  4URN A;  5M4M A;  3OW6 A;  2YEG A;  1UYL A;  4FCP A;  4EM7 A;  2O1V A;  2XX2 A;  1ZW9 A;  2E0A A;  4KFG A;  4YKY A;  1UYM A;  4KSG A;  1B62 A;  2JKI A;  3G75 A;  4MP7 A;  1NHH A;  1Z59 A;  2YE2 A;  2IWX A;  5D6Q A;  4U93 A;  1AH8 A;  3WQ9 A;  1KZN A;  2HG1 A;  2YEA A;  4B6C A;  2YEC A;  3K99 A;  3B28 A;  3ZXO A;  4H85 A;  4HYP A;  1UY7 A;  2BU7 A;  1TC0 A;  5M4E A;  3LPS A;  1JM6 A;  4MOT A;  2IOP A;  4NH7 A;  2Q8F A;  4XDM A;  3VHA A;  4R3A A;  1TID A;  4LPB A;  1I5D A;  4KQV A;  4FMT A;  5M4H A;  2XHR A;  2YE7 A;  3HEK A;  2XHT A;  4NH8 A;  2EXL A;  1GJV A;  3H80 A;  1UYE A;  2BRE A;  3IED A;  4YKQ A;  4ASF A;  4L91 A;  1GKZ A;  4EFT A;  3INX A;  3T0Z A;  2Q8I A;  2YI6 A;  4Q20 A;  1AJ6 A;  2GFD A;  1U2O A;  2WI4 A;  1EA6 A;  3D36 A;  2WI6 A;  4XIT A;  4MB9 A;  2UWD A;  4JAS A;  2WEQ A;  3PEH A;  2FWY A;  4EEH A;  5F5R A;  3HYY A;  3B27 A;  2O1U A;  4MBC A;  1Z5A A;  2XJG A;  3U2D A;  2YE3 A;  4LWG A;  3CGY A;  4R3M A;  4V25 A;  2CCU A;  4H7Q A;  3R4P A;  4HZ5 A;  2ZDY A;  1YT2 A;  4EFU A;  4XD8 A;  2VW5 A;  4WUB A;  4JQL A;  3EKO A;  3RLQ A;  4O07 A;  4HYM A;  5CTY A;  4O09 A;  1YET A;  4URM A;  1AH6 A;  5C93 A;  3H4L A;  4GEE A;  4XKO A;  4GCZ A;  3TZ2 A;  5J6A A;  2ZDX A;  1I5A A;  2YE8 A;  4K4O A;  3RLR A;  1UYK A;  1EI1 A;  1YC1 A;  5J71 A;  1TC6 A;  3A0R A;  1YS3 A;  2IWU A;  3FT5 A;  2CGF A;  4XIR A;  4XC0 A;  1Z5B A;  5BOD A;  2FWZ A;  4XE2 A;  4LP0 A;  1Y8N A;  4XTJ A;  4HXW A;  2XX4 A;  3EHH A;  5CTW A;  4MPC A;  2Q8H A;  4CE1 A;  2ESA A;  4ASB A;  4O0B A;  3ZKD A;  4MP2 A;  3EHF A;  3GIG B;  4PRV A;  3O2F A;  2YE5 A;  1GKX A;  1BGQ A;  4CWR A;  3LNU A;  4JAV A;  2XDX A;  2YEJ A;  1S16 A;  2XDU A;  2HKJ A;  3R4N A;  2CCS A;  4GGL A;  3TZ4 A;  4YKX A;  3U2K A;  3A0Z A;  2XX5 A;  2YK2 A;  4URL A;  4LWF A;  4H81 A;  1KIJ A;  2YJX A;  4ZVI A;  4ASA A;  4AWO A;  4URO A;  3QTF A;  2YJW A;  3CWV A;  1NHJ A;  1ZWH A;  2GQP A;  1UYF A;  1YT1 A;  4U7N A;  2YEF A;  2YGA A;  4BAE A;  4CWN A;  1I59 A;  1NHI A;  4L90 A;  2ZBK B;  4E01 A;  2XDL A;  2BT0 A;  1Y8O A;  1AM1 A;  5D7D A;  3INW A;  4YKZ A;  3U67 A;  4E02 A;  2YK9 A;  2AKP A;  5CTX A;  3TTZ A;  3GIG A;  4LWH A;  4L94 A;  2YKJ A;  1QZR A;  2BRC A;  3CRL A;  4YKU A;  4BIU A;  4XCL A;  2QF6 A;  2YE9 A;  3TZ0 A;  2WI3 A;  3R91 A;  5M4K A;  5IN9 A;  1TH8 A;  1Y4S A;  1B63 A;  4CWQ A;  5D7R A;  3TUH A;  3CGZ A;  2BU2 A;  2HCH A;  2YKE A;  4V26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...