1TC0A

Ligand induced conformational shifts in the n-terminal domain of grp94, open conformation complexed with the physiological partner atp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
225
structure length
222
Chain Sequence
FAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTGKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-induced Conformational Shift in the N-terminal Domain of GRP94, an Hsp90 Chaperone.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 73
structure length 222
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1tc0A00
2YI6A 3WHAA 2YGEA 2GFDA 1BXDA 2YE8A 3GIGA 3GIFA 2VCJA 1ZXMA 1A4HA 4HY6A 3VHCA 1EI1A 5D6QA 2BZ5A 2YJWA 3INWA 1ID0A 1TC6A 3C0EA 4I3HA 2YEBA 2HG1A 4X9LA 3EKRA 1YT2A 3D36A 3T0ZA 4EGHA 1S14A 4NH9A 4L8ZA 1BGQA 1UYIA 2H8MA 4FPPA 1UYCA 2IOQA 4URNA 3R4MA 4XD8A 4R3AA 4CE2A 4WUCA 1U2OA 2YJXA 3RLRA 4B6CA 3G7BA 2CG9A 3B26A 1UYLA 3CRLA 1H7UA 5CTYA 2YKBA 5CTXA 3RKZA 3HZ1A 4BIUA 2QG0A 3RLQA 3TZ2A 2ESAA 4JAUA 4JQLA 4EGKA 3G7EA 4KFGA 2Q8FA 1BKNA 4XIRA 3B27A 4P8OA 3G75A 1TC0A 4U93A 1I59A 4BQGA 2IWUA 3R4OA 4L94A 2YE4A 3GIEA 4EFUA 4MPNA 2YGFA 4HY1A 2WEPA 4AWQA 2WERA 2XJJA 2XD6A 4YKUA 1AH8A 4YKWA 2CCUA 1UYHA 4CE1A 5IN9A 2IWXA 4AWOA 1UY8A 2YE9A 4URLA 4LWGA 5BODA 4EGIA 4W7TA 2CCTA 2EXLA 4P7AA 4KP4A 4LP0A 2YK2A 5M4EA 2FWYA 3A0XA 2YGAA 4LWIA 2BU2A 3ZKDA 4YKZA 2XDKA 1UY9A 1I5AA 4ASFA 1UYEA 4GGLA 2YI0A 5D6PA 4EMVA 4FCRA 3EKOA 4CWOA 4CWFA 2YEHA 4H7QA 1NHHA 2BSMA 1B62A 1YC1A 1I5CA 2JKIA 3SL2A 4E01A 4JAVA 1YC4A 4L93A 2YE2A 4CWPA 1YT0A 4CWRA 2WI6A 1ZWHA 2WI1A 4XCLA 4XIPA 2XJGA 2YKIA 1TBWA 3VHDA 5CTWA 1UYMA 1AM1A 2XX2A 1I58A 3PEJA 2WI7A 5GGZA 3B28A 3K60A 4GQTA 3A0YA 4R3MA 2XDXA 4YKYA 2YEFA 2ZDXA 1B3QA 4CWSA 2IORA 3FT8A 2XDUA 2YEIA 3QTFA 4XIQA 2YKJA 2QF6A 2YE3A 4Q20A 4CWNA 3CRKA 2YEEA 4XC0A 2XCMA 1ZXNA 4HXZA 4AS9A 3A0ZA 1AJ6A 4PRVA 4NH8A 5CTUA 4HYPA 5M4KA 4HZ5A 3ZM7A 1PVGA 2YKEA 3O0IA 3Q5KA 2YEJA 1Y8NA 1U0ZA 5CPHA 3OW6A 1ZW9A 5M4MA 3PEHA 3IEDA 3TZ5A 1KZNA 4FCPA 2BT0A 4XE2A 5F5RA 1Z5CA 4MB9A 4XITA 5D7DA 5M4NA 1UYDA 3H4LA 2WI2A 2XK2A 2O1VA 2PNRA 2BREA 4GCZA 1JM6A 4HZ0A 4YKTA 2CH4A 3R4NA 3H80A 1KIJA 4V25A 2YI5A 3Q5JA 4FCQA 4YKQA 3D0BA 2WI5A 4XKAA 3T2SA 2WI3A 4H85A 1Z59A 3TUHA 2ZKJA 3OWBA 3TZ0A 5D7RA 2VCIA 3ZKBA 1YS3A 4O05A 4CWQA 2CCSA 3EHGA 1YT1A 2YI7A 3HZ5A 4EM7A 2FWZA 5L3JA 4MP2A 2XABA 3R91A 4LWFA 1GKXA 2YKCA 4YKXA 1NHIA 1OSFA 1YERA 4B7PA 2YE6A 3OMUA 4YKRA 2BRCA 1Y4SA 2C2AA 3T10A 3A0WA 4E00A 4H81A 3KE6A 4K4OA 4U7NA 3Q5LA 1QYEA 4MPCA 4KTNA 4HXWA 3D2RA 1GJVA 1H7SA 3QDDA 4BXIA 3A0TA 4XKKA 4DUHA 4FMTA 3R92A 1YC3A 5FNDA 1YSRA 2HKJA 1UY6A 3C11A 1Y8PA 4V26A 4U7OA 2BYIA 4QPKA 1AMWA 4GEEA 4NH7A 3TZ4A 4ASBA 3FV5A 3OWDA 5BOCA 4ZKIA 1THNA 4LPBA 2Q8IA 1TILA 5FWKA 1NHJA 1UYFA 2YEGA 5J71A 4QPJA 3U2KA 4KSHA 2WEQA 2FYPA 3EHHA 4L91A 3HYZA 5CF0A 2ZBKB 3HYYA 1US7A 4O0BA 2Q2EB 1I5DA 4PU9A 1TIDA 3CWVA 3EHJA 4UROA 2ZDYA 2CGFA 3RLPA 4AWPA 5C93A 3O2FA 5M4HA 3BM9A 4URMA 1UY7A 2BU7A 3HHUA 4BAEA 1UYGA 4L90A 4GT8A 4I5SA 4HYMA 2YE5A 3CGYA 2O1WA 2HCHA 2XX5A 1MU5A 3TTZA 1UYKA 3K99A 4O09A 3VHAA 3O6OA 2JJCA 2YEDA 1Z5BA 3NMQA 2UWDA 4BIZA 3U67A 4LWHA 3ZXQA 1TH8A 4O04A 1B63A 5IDJA 3T0HA 3LPSA 5J6AA 2BU8A 3BMYA 1R62A 4DZYA 4EFTA 2BU5A 2QG2A 2BYHA 3R4PA 3FT5A 1QZRA 2E0AA 1Y4UA 2IWSA 1AH6A 3U2DA 4WUDA 2VWCA 4CE3A 1YSZA 1S16A 1EA6A 1Z5AA 3JZ3A 3B25A 4PL9A 2YK9A 2H55A 4LWEA 4ASAA 4EEHA 3OPDA 2Q8GA 4CWTA 2QFOA 2K5BA 3VADA 2FXSA 1QY8A 4MPEA 1GKZA 5M4PA 2XHTA 1I5BA 2XX4A 2YECA 4ASGA 3GIGB 3LNUA 5F3KA 4PRXA 2VW5A 1BYQA 2XHXA 4KQVA 4BQJA 4ZVIA 1YETA 3MNRP 4XDMA 5D7CA 4MBCA 2GQPA 4XTJA 5FNCA 1YESA 4GFNA 3CGZA 3K98A 3INXA 2IOPA 2Q8HA 3HEKA 3T1KA 2XDSA 3WQ9A 4WUBA 2BTZA 4O07A 1MX0A 2YEAA 4MOTA 3EHFA 2WI4A 4XKOA 5IDMA 4JASA 3ZXOA 5FNFA 3DGEA 4E02A 4R1FA 2AKPA 2YE7A 4XCJA 2XJXA 1L0OA 3A0RA 3B24A 2XDLA 2XHRA 1Y8OA 2O1UA 3K97A 4MP7A 2BU6A 4KSGA
chains in the Genus database with same CATH superfamily
2YI6A 3WHAA 2YGEA 2GFDA 1BXDA 2YE8A 3GIGA 3GIFA 2VCJA 1ZXMA 1A4HA 4HY6A 3VHCA 1EI1A 5D6QA 2BZ5A 2YJWA 3INWA 1ID0A 1TC6A 3C0EA 4I3HA 2YEBA 2HG1A 4X9LA 3EKRA 1YT2A 3D36A 3T0ZA 4EGHA 1S14A 4NH9A 4L8ZA 1BGQA 1UYIA 2H8MA 4FPPA 1UYCA 2IOQA 4URNA 3R4MA 4XD8A 4R3AA 4CE2A 4WUCA 1U2OA 2YJXA 3RLRA 4B6CA 3G7BA 2CG9A 3B26A 1UYLA 3CRLA 1H7UA 1IXMA 5CTYA 2YKBA 5CTXA 3RKZA 3HZ1A 4BIUA 2QG0A 3RLQA 3TZ2A 2ESAA 4JAUA 4JQLA 4EGKA 3G7EA 4KFGA 2Q8FA 1BKNA 4XIRA 3B27A 4P8OA 3G75A 1TC0A 4U93A 1I59A 4BQGA 2IWUA 3R4OA 4L94A 2YE4A 3GIEA 4EFUA 4MPNA 2YGFA 4HY1A 2WEPA 4AWQA 2WERA 2XJJA 2XD6A 4YKUA 1AH8A 4YKWA 2CCUA 1UYHA 4CE1A 5IN9A 2IWXA 4AWOA 1UY8A 2YE9A 4URLA 4LWGA 5BODA 4EGIA 4W7TA 2CCTA 2EXLA 4P7AA 4KP4A 4LP0A 2YK2A 5M4EA 2FWYA 3A0XA 2YGAA 4LWIA 2BU2A 3ZKDA 4YKZA 2XDKA 1UY9A 1I5AA 2FTKA 4ASFA 1UYEA 4GGLA 2YI0A 5D6PA 4EMVA 4FCRA 3EKOA 4CWOA 4CWFA 2YEHA 4H7QA 1NHHA 2BSMA 1B62A 1YC1A 1I5CA 2JKIA 3SL2A 4E01A 4JAVA 1YC4A 4L93A 2YE2A 4CWPA 1YT0A 4CWRA 2C1GA 2WI6A 1ZWHA 2WI1A 4XCLA 4XIPA 2XJGA 2YKIA 1TBWA 3VHDA 5CTWA 1UYMA 1AM1A 2XX2A 1I58A 3PEJA 2WI7A 5GGZA 3B28A 3K60A 4GQTA 3A0YA 4R3MA 2XDXA 4YKYA 2YEFA 2ZDXA 1B3QA 4CWSA 2IORA 3FT8A 3LMMA 2XDUA 2YEIA 3QTFA 4XIQA 2YKJA 2QF6A 2YE3A 4Q20A 4CWNA 3CRKA 2YEEA 4XC0A 2XCMA 1ZXNA 4E72A 4HXZA 4AS9A 3A0ZA 1AJ6A 4PRVA 4NH8A 5CTUA 4HYPA 5M4KA 4HZ5A 3ZM7A 1PVGA 2YKEA 3O0IA 3Q5KA 2YEJA 1Y8NA 1U0ZA 5CPHA 3OW6A 1ZW9A 5M4MA 3PEHA 3IEDA 3TZ5A 1KZNA 4FCPA 2BT0A 4XE2A 5F5RA 1Z5CA 4MB9A 4XITA 5D7DA 5M4NA 1UYDA 3H4LA 2WI2A 2XK2A 2O1VA 2PNRA 2BREA 4GCZA 1JM6A 4HZ0A 4YKTA 2CH4A 3R4NA 3H80A 1KIJA 4V25A 2YI5A 2C1IA 3Q5JA 4FCQA 4YKQA 3D0BA 2WI5A 4XKAA 3T2SA 2WI3A 4H85A 1Z59A 3TUHA 2ZKJA 3OWBA 3TZ0A 5D7RA 2VCIA 3ZKBA 1YS3A 4O05A 4CWQA 2CCSA 3EHGA 1YT1A 2YI7A 3HZ5A 4EM7A 2FWZA 5L3JA 4MP2A 2XABA 3R91A 4LWFA 1GKXA 2YKCA 4YKXA 1NHIA 1OSFA 1YERA 4B7PA 2YE6A 3OMUA 4YKRA 2BRCA 1Y4SA 2C2AA 3T10A 3A0WA 4E00A 4H81A 3KE6A 4K4OA 4U7NA 3Q5LA 1QYEA 4MPCA 4KTNA 4HXWA 3D2RA 1GJVA 1H7SA 3QDDA 4BXIA 3A0TA 4XKKA 4DUHA 4FMTA 1F51A 3R92A 1YC3A 5FNDA 1YSRA 2HKJA 1UY6A 3C11A 1Y8PA 4V26A 4U7OA 2BYIA 4QPKA 1AMWA 4GEEA 4NH7A 3TZ4A 4ASBA 3FV5A 3OWDA 5BOCA 4ZKIA 1THNA 4LPBA 2Q8IA 1TILA 5FWKA 1NHJA 1UYFA 2YEGA 5J71A 4QPJA 3U2KA 4KSHA 2WEQA 2FYPA 3EHHA 4L91A 3HYZA 5CF0A 2ZBKB 3HYYA 1US7A 4O0BA 2Q2EB 1I5DA 4PU9A 1TIDA 3CWVA 3EHJA 5JENA 4UROA 2ZDYA 2CGFA 3RLPA 4AWPA 5C93A 3O2FA 5M4HA 3BM9A 4URMA 1UY7A 2BU7A 3HHUA 4BAEA 1UYGA 4L90A 4GT8A 4I5SA 4HYMA 2YE5A 3CGYA 2O1WA 2HCHA 2XX5A 1MU5A 3TTZA 1UYKA 3K99A 4O09A 3VHAA 3O6OA 2JJCA 2YEDA 1Z5BA 3NMQA 2UWDA 4BIZA 3U67A 4LWHA 3ZXQA 1TH8A 4O04A 1B63A 5IDJA 3T0HA 3LPSA 5J6AA 2BU8A 3BMYA 1R62A 3CYGA 4DZYA 4EFTA 2BU5A 2QG2A 2BYHA 3R4PA 3FT5A 1QZRA 2E0AA 1Y4UA 2IWSA 1AH6A 3U2DA 4WUDA 2VWCA 4CE3A 1YSZA 1S16A 1EA6A 1Z5AA 3JZ3A 3B25A 4PL9A 2YK9A 2H55A 4LWEA 4ASAA 4EEHA 3OPDA 2Q8GA 4CWTA 2QFOA 2K5BA 3VADA 2FXSA 1QY8A 2HHIA 4MPEA 1GKZA 5M4PA 2XHTA 1I5BA 2XX4A 2YECA 4ASGA 3GIGB 3LNUA 5F3KA 4PRXA 2VW5A 1BYQA 2XHXA 4KQVA 4BQJA 4ZVIA 1YETA 3MNRP 4XDMA 5D7CA 4MBCA 2GQPA 4XTJA 5FNCA 1YESA 4GFNA 3CGZA 3K98A 3INXA 2IOPA 2Q8HA 3HEKA 3T1KA 2XDSA 3WQ9A 4WUBA 2BTZA 4O07A 1MX0A 2YEAA 4MOTA 3EHFA 2WI4A 4XKOA 5IDMA 4JASA 3ZXOA 5FNFA 3DGEA 4E02A 4R1FA 2AKPA 2YE7A 4XCJA 3S5TA 2XJXA 1L0OA 3A0RA 3B24A 2XDLA 2XHRA 1Y8OA 2O1UA 3K97A 4MP7A 2BU6A 4KSGA
chains in the Genus database with same CATH topology
2YI6A 3WHAA 2YGEA 2GFDA 1BXDA 2YE8A 3GIGA 3GIFA 2VCJA 1ZXMA 1A4HA 4HY6A 3VHCA 1EI1A 5D6QA 2BZ5A 2YJWA 3INWA 1ID0A 1TC6A 3C0EA 4I3HA 2YEBA 2HG1A 4X9LA 3EKRA 1YT2A 3D36A 3T0ZA 4EGHA 1S14A 4NH9A 4L8ZA 1BGQA 1UYIA 2H8MA 4FPPA 1UYCA 2IOQA 4URNA 3R4MA 4XD8A 4R3AA 4CE2A 4WUCA 1U2OA 2YJXA 3RLRA 4B6CA 3G7BA 2CG9A 3B26A 1UYLA 3CRLA 1H7UA 5CTYA 2YKBA 5CTXA 3RKZA 3HZ1A 4BIUA 2QG0A 3RLQA 3TZ2A 2ESAA 4JAUA 4JQLA 4EGKA 3G7EA 4KFGA 2Q8FA 1BKNA 4XIRA 3B27A 4P8OA 3G75A 1TC0A 4U93A 1I59A 4BQGA 2IWUA 3R4OA 4L94A 2YE4A 3GIEA 4EFUA 4MPNA 2YGFA 4HY1A 2WEPA 4AWQA 2WERA 2XJJA 2XD6A 4YKUA 1AH8A 4YKWA 2CCUA 1UYHA 4CE1A 5IN9A 2IWXA 4AWOA 1UY8A 2YE9A 4URLA 4LWGA 5BODA 4EGIA 4W7TA 2CCTA 2EXLA 4P7AA 4KP4A 4LP0A 2YK2A 5M4EA 2FWYA 3A0XA 2YGAA 4LWIA 2BU2A 3ZKDA 4YKZA 2XDKA 1UY9A 1I5AA 4ASFA 1UYEA 4GGLA 2YI0A 5D6PA 4EMVA 4FCRA 3EKOA 4CWOA 4CWFA 2YEHA 4H7QA 1NHHA 2BSMA 1B62A 1YC1A 1I5CA 2JKIA 3SL2A 4E01A 4JAVA 1YC4A 4L93A 2YE2A 4CWPA 1YT0A 4CWRA 2WI6A 1ZWHA 2WI1A 4XCLA 4XIPA 2XJGA 2YKIA 1TBWA 3VHDA 5CTWA 1UYMA 1AM1A 2XX2A 1I58A 3PEJA 2WI7A 5GGZA 3B28A 3K60A 4GQTA 3A0YA 4R3MA 2XDXA 4YKYA 2YEFA 2ZDXA 1B3QA 4CWSA 2IORA 3FT8A 2XDUA 2YEIA 3QTFA 4XIQA 2YKJA 2QF6A 2YE3A 4Q20A 4CWNA 3CRKA 2YEEA 4XC0A 2XCMA 1ZXNA 4HXZA 4AS9A 3A0ZA 1AJ6A 4PRVA 4NH8A 5CTUA 4HYPA 5M4KA 4HZ5A 3ZM7A 1PVGA 2YKEA 3O0IA 3Q5KA 2YEJA 1Y8NA 1U0ZA 5CPHA 3OW6A 1ZW9A 5M4MA 3PEHA 3IEDA 3TZ5A 1KZNA 4FCPA 2BT0A 4XE2A 5F5RA 1Z5CA 4MB9A 4XITA 5D7DA 5M4NA 1UYDA 3H4LA 2WI2A 2XK2A 2O1VA 2PNRA 2BREA 4GCZA 1JM6A 4HZ0A 4YKTA 2CH4A 3R4NA 3H80A 1KIJA 4V25A 2YI5A 3Q5JA 4FCQA 4YKQA 3D0BA 2WI5A 4XKAA 3T2SA 2WI3A 4H85A 1Z59A 3TUHA 2ZKJA 3OWBA 3TZ0A 5D7RA 2VCIA 3ZKBA 1YS3A 4O05A 4CWQA 2CCSA 3EHGA 1YT1A 2YI7A 3HZ5A 4EM7A 2FWZA 5L3JA 4MP2A 2XABA 3R91A 4LWFA 1GKXA 2YKCA 4YKXA 1NHIA 1OSFA 1YERA 4B7PA 2YE6A 3OMUA 4YKRA 2BRCA 1Y4SA 2C2AA 3T10A 3A0WA 4E00A 4H81A 3KE6A 4K4OA 4U7NA 3Q5LA 1QYEA 4MPCA 4KTNA 4HXWA 3D2RA 1GJVA 1H7SA 3QDDA 4BXIA 3A0TA 4XKKA 4DUHA 4FMTA 3R92A 1YC3A 5FNDA 1YSRA 2HKJA 1UY6A 3C11A 1Y8PA 4V26A 4U7OA 2BYIA 4QPKA 1AMWA 4GEEA 4NH7A 3TZ4A 4ASBA 3FV5A 3OWDA 5BOCA 4ZKIA 1THNA 4LPBA 2Q8IA 1TILA 5FWKA 1NHJA 1UYFA 2YEGA 5J71A 4QPJA 3U2KA 4KSHA 2WEQA 2FYPA 3EHHA 4L91A 3HYZA 5CF0A 2ZBKB 3HYYA 1US7A 4O0BA 2Q2EB 1I5DA 4PU9A 1TIDA 3CWVA 3EHJA 4UROA 2ZDYA 2CGFA 3RLPA 4AWPA 5C93A 3O2FA 5M4HA 3BM9A 4URMA 1UY7A 2BU7A 3HHUA 4BAEA 1UYGA 4L90A 4GT8A 4I5SA 4HYMA 2YE5A 3CGYA 2O1WA 2HCHA 2XX5A 1MU5A 3TTZA 1UYKA 3K99A 4O09A 3VHAA 3O6OA 2JJCA 2YEDA 1Z5BA 3NMQA 2UWDA 4BIZA 3U67A 4LWHA 3ZXQA 1TH8A 4O04A 1B63A 5IDJA 3T0HA 3LPSA 5J6AA 2BU8A 3BMYA 1R62A 4DZYA 4EFTA 2BU5A 2QG2A 2BYHA 3R4PA 3FT5A 1QZRA 2E0AA 1Y4UA 2IWSA 1AH6A 3U2DA 4WUDA 2VWCA 4CE3A 1YSZA 1S16A 1EA6A 1Z5AA 3JZ3A 3B25A 4PL9A 2YK9A 2H55A 4LWEA 4ASAA 4EEHA 3OPDA 2Q8GA 4CWTA 2QFOA 2K5BA 3VADA 2FXSA 1QY8A 4MPEA 1GKZA 5M4PA 2XHTA 1I5BA 2XX4A 2YECA 4ASGA 3GIGB 3LNUA 5F3KA 4PRXA 2VW5A 1BYQA 2XHXA 4KQVA 4BQJA 4ZVIA 1YETA 3MNRP 4XDMA 5D7CA 4MBCA 2GQPA 4XTJA 5FNCA 1YESA 4GFNA 3CGZA 3K98A 3INXA 2IOPA 2Q8HA 3HEKA 3T1KA 2XDSA 3WQ9A 4WUBA 2BTZA 4O07A 1MX0A 2YEAA 4MOTA 3EHFA 2WI4A 4XKOA 5IDMA 4JASA 3ZXOA 5FNFA 3DGEA 4E02A 4R1FA 2AKPA 2YE7A 4XCJA 2XJXA 1L0OA 3A0RA 3B24A 2XDLA 2XHRA 1Y8OA 2O1UA 3K97A 4MP7A 2BU6A 4KSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YI6 A;  3WHA A;  2YGE A;  2GFD A;  1BXD A;  2YE8 A;  3GIG A;  3GIF A;  2VCJ A;  1ZXM A;  1A4H A;  4HY6 A;  3VHC A;  1EI1 A;  5D6Q A;  2BZ5 A;  2YJW A;  3INW A;  1ID0 A;  1TC6 A;  3C0E A;  4I3H A;  2YEB A;  2HG1 A;  4X9L A;  3EKR A;  1YT2 A;  3D36 A;  3T0Z A;  4EGH A;  1S14 A;  4NH9 A;  4L8Z A;  1BGQ A;  1UYI A;  2H8M A;  4FPP A;  1UYC A;  2IOQ A;  4URN A;  3R4M A;  4XD8 A;  4R3A A;  4CE2 A;  4WUC A;  1U2O A;  2YJX A;  3RLR A;  4B6C A;  3G7B A;  2CG9 A;  3B26 A;  1UYL A;  3CRL A;  1H7U A;  5CTY A;  2YKB A;  5CTX A;  3RKZ A;  3HZ1 A;  4BIU A;  2QG0 A;  3RLQ A;  3TZ2 A;  2ESA A;  4JAU A;  4JQL A;  4EGK A;  3G7E A;  4KFG A;  2Q8F A;  1BKN A;  4XIR A;  3B27 A;  4P8O A;  3G75 A;  1TC0 A;  4U93 A;  1I59 A;  4BQG A;  2IWU A;  3R4O A;  4L94 A;  2YE4 A;  3GIE A;  4EFU A;  4MPN A;  2YGF A;  4HY1 A;  2WEP A;  4AWQ A;  2WER A;  2XJJ A;  2XD6 A;  4YKU A;  1AH8 A;  4YKW A;  2CCU A;  1UYH A;  4CE1 A;  5IN9 A;  2IWX A;  4AWO A;  1UY8 A;  2YE9 A;  4URL A;  4LWG A;  5BOD A;  4EGI A;  4W7T A;  2CCT A;  2EXL A;  4P7A A;  4KP4 A;  4LP0 A;  2YK2 A;  5M4E A;  2FWY A;  3A0X A;  2YGA A;  4LWI A;  2BU2 A;  3ZKD A;  4YKZ A;  2XDK A;  1UY9 A;  1I5A A;  4ASF A;  1UYE A;  4GGL A;  2YI0 A;  5D6P A;  4EMV A;  4FCR A;  3EKO A;  4CWO A;  4CWF A;  2YEH A;  4H7Q A;  1NHH A;  2BSM A;  1B62 A;  1YC1 A;  1I5C A;  2JKI A;  3SL2 A;  4E01 A;  4JAV A;  1YC4 A;  4L93 A;  2YE2 A;  4CWP A;  1YT0 A;  4CWR A;  2WI6 A;  1ZWH A;  2WI1 A;  4XCL A;  4XIP A;  2XJG A;  2YKI A;  1TBW A;  3VHD A;  5CTW A;  1UYM A;  1AM1 A;  2XX2 A;  1I58 A;  3PEJ A;  2WI7 A;  5GGZ A;  3B28 A;  3K60 A;  4GQT A;  3A0Y A;  4R3M A;  2XDX A;  4YKY A;  2YEF A;  2ZDX A;  1B3Q A;  4CWS A;  2IOR A;  3FT8 A;  2XDU A;  2YEI A;  3QTF A;  4XIQ A;  2YKJ A;  2QF6 A;  2YE3 A;  4Q20 A;  4CWN A;  3CRK A;  2YEE A;  4XC0 A;  2XCM A;  1ZXN A;  4HXZ A;  4AS9 A;  3A0Z A;  1AJ6 A;  4PRV A;  4NH8 A;  5CTU A;  4HYP A;  5M4K A;  4HZ5 A;  3ZM7 A;  1PVG A;  2YKE A;  3O0I A;  3Q5K A;  2YEJ A;  1Y8N A;  1U0Z A;  5CPH A;  3OW6 A;  1ZW9 A;  5M4M A;  3PEH A;  3IED A;  3TZ5 A;  1KZN A;  4FCP A;  2BT0 A;  4XE2 A;  5F5R A;  1Z5C A;  4MB9 A;  4XIT A;  5D7D A;  5M4N A;  1UYD A;  3H4L A;  2WI2 A;  2XK2 A;  2O1V A;  2PNR A;  2BRE A;  4GCZ A;  1JM6 A;  4HZ0 A;  4YKT A;  2CH4 A;  3R4N A;  3H80 A;  1KIJ A;  4V25 A;  2YI5 A;  3Q5J A;  4FCQ A;  4YKQ A;  3D0B A;  2WI5 A;  4XKA A;  3T2S A;  2WI3 A;  4H85 A;  1Z59 A;  3TUH A;  2ZKJ A;  3OWB A;  3TZ0 A;  5D7R A;  2VCI A;  3ZKB A;  1YS3 A;  4O05 A;  4CWQ A;  2CCS A;  3EHG A;  1YT1 A;  2YI7 A;  3HZ5 A;  4EM7 A;  2FWZ A;  5L3J A;  4MP2 A;  2XAB A;  3R91 A;  4LWF A;  1GKX A;  2YKC A;  4YKX A;  1NHI A;  1OSF A;  1YER A;  4B7P A;  2YE6 A;  3OMU A;  4YKR A;  2BRC A;  1Y4S A;  2C2A A;  3T10 A;  3A0W A;  4E00 A;  4H81 A;  3KE6 A;  4K4O A;  4U7N A;  3Q5L A;  1QYE A;  4MPC A;  4KTN A;  4HXW A;  3D2R A;  1GJV A;  1H7S A;  3QDD A;  4BXI A;  3A0T A;  4XKK A;  4DUH A;  4FMT A;  3R92 A;  1YC3 A;  5FND A;  1YSR A;  2HKJ A;  1UY6 A;  3C11 A;  1Y8P A;  4V26 A;  4U7O A;  2BYI A;  4QPK A;  1AMW A;  4GEE A;  4NH7 A;  3TZ4 A;  4ASB A;  3FV5 A;  3OWD A;  5BOC A;  4ZKI A;  1THN A;  4LPB A;  2Q8I A;  1TIL A;  5FWK A;  1NHJ A;  1UYF A;  2YEG A;  5J71 A;  4QPJ A;  3U2K A;  4KSH A;  2WEQ A;  2FYP A;  3EHH A;  4L91 A;  3HYZ A;  5CF0 A;  2ZBK B;  3HYY A;  1US7 A;  4O0B A;  2Q2E B;  1I5D A;  4PU9 A;  1TID A;  3CWV A;  3EHJ A;  4URO A;  2ZDY A;  2CGF A;  3RLP A;  4AWP A;  5C93 A;  3O2F A;  5M4H A;  3BM9 A;  4URM A;  1UY7 A;  2BU7 A;  3HHU A;  4BAE A;  1UYG A;  4L90 A;  4GT8 A;  4I5S A;  4HYM A;  2YE5 A;  3CGY A;  2O1W A;  2HCH A;  2XX5 A;  1MU5 A;  3TTZ A;  1UYK A;  3K99 A;  4O09 A;  3VHA A;  3O6O A;  2JJC A;  2YED A;  1Z5B A;  3NMQ A;  2UWD A;  4BIZ A;  3U67 A;  4LWH A;  3ZXQ A;  1TH8 A;  4O04 A;  1B63 A;  5IDJ A;  3T0H A;  3LPS A;  5J6A A;  2BU8 A;  3BMY A;  1R62 A;  4DZY A;  4EFT A;  2BU5 A;  2QG2 A;  2BYH A;  3R4P A;  3FT5 A;  1QZR A;  2E0A A;  1Y4U A;  2IWS A;  1AH6 A;  3U2D A;  4WUD A;  2VWC A;  4CE3 A;  1YSZ A;  1S16 A;  1EA6 A;  1Z5A A;  3JZ3 A;  3B25 A;  4PL9 A;  2YK9 A;  2H55 A;  4LWE A;  4ASA A;  4EEH A;  3OPD A;  2Q8G A;  4CWT A;  2QFO A;  2K5B A;  3VAD A;  2FXS A;  1QY8 A;  4MPE A;  1GKZ A;  5M4P A;  2XHT A;  1I5B A;  2XX4 A;  2YEC A;  4ASG A;  3GIG B;  3LNU A;  5F3K A;  4PRX A;  2VW5 A;  1BYQ A;  2XHX A;  4KQV A;  4BQJ A;  4ZVI A;  1YET A;  3MNR P;  4XDM A;  5D7C A;  4MBC A;  2GQP A;  4XTJ A;  5FNC A;  1YES A;  4GFN A;  3CGZ A;  3K98 A;  3INX A;  2IOP A;  2Q8H A;  3HEK A;  3T1K A;  2XDS A;  3WQ9 A;  4WUB A;  2BTZ A;  4O07 A;  1MX0 A;  2YEA A;  4MOT A;  3EHF A;  2WI4 A;  4XKO A;  5IDM A;  4JAS A;  3ZXO A;  5FNF A;  3DGE A;  4E02 A;  4R1F A;  2AKP A;  2YE7 A;  4XCJ A;  2XJX A;  1L0O A;  3A0R A;  3B24 A;  2XDL A;  2XHR A;  1Y8O A;  2O1U A;  3K97 A;  4MP7 A;  2BU6 A;  4KSG A; 
#chains in the Genus database with same CATH topology
 2YI6 A;  3WHA A;  2YGE A;  2GFD A;  1BXD A;  2YE8 A;  3GIG A;  3GIF A;  2VCJ A;  1ZXM A;  1A4H A;  4HY6 A;  3VHC A;  1EI1 A;  5D6Q A;  2BZ5 A;  2YJW A;  3INW A;  1ID0 A;  1TC6 A;  3C0E A;  4I3H A;  2YEB A;  2HG1 A;  4X9L A;  3EKR A;  1YT2 A;  3D36 A;  3T0Z A;  4EGH A;  1S14 A;  4NH9 A;  4L8Z A;  1BGQ A;  1UYI A;  2H8M A;  4FPP A;  1UYC A;  2IOQ A;  4URN A;  3R4M A;  4XD8 A;  4R3A A;  4CE2 A;  4WUC A;  1U2O A;  2YJX A;  3RLR A;  4B6C A;  3G7B A;  2CG9 A;  3B26 A;  1UYL A;  3CRL A;  1H7U A;  1IXM A;  5CTY A;  2YKB A;  5CTX A;  3RKZ A;  3HZ1 A;  4BIU A;  2QG0 A;  3RLQ A;  3TZ2 A;  2ESA A;  4JAU A;  4JQL A;  4EGK A;  3G7E A;  4KFG A;  2Q8F A;  1BKN A;  4XIR A;  3B27 A;  4P8O A;  3G75 A;  1TC0 A;  4U93 A;  1I59 A;  4BQG A;  2IWU A;  3R4O A;  4L94 A;  2YE4 A;  3GIE A;  4EFU A;  4MPN A;  2YGF A;  4HY1 A;  2WEP A;  4AWQ A;  2WER A;  2XJJ A;  2XD6 A;  4YKU A;  1AH8 A;  4YKW A;  2CCU A;  1UYH A;  4CE1 A;  5IN9 A;  2IWX A;  4AWO A;  1UY8 A;  2YE9 A;  4URL A;  4LWG A;  5BOD A;  4EGI A;  4W7T A;  2CCT A;  2EXL A;  4P7A A;  4KP4 A;  4LP0 A;  2YK2 A;  5M4E A;  2FWY A;  3A0X A;  2YGA A;  4LWI A;  2BU2 A;  3ZKD A;  4YKZ A;  2XDK A;  1UY9 A;  1I5A A;  2FTK A;  4ASF A;  1UYE A;  4GGL A;  2YI0 A;  5D6P A;  4EMV A;  4FCR A;  3EKO A;  4CWO A;  4CWF A;  2YEH A;  4H7Q A;  1NHH A;  2BSM A;  1B62 A;  1YC1 A;  1I5C A;  2JKI A;  3SL2 A;  4E01 A;  4JAV A;  1YC4 A;  4L93 A;  2YE2 A;  4CWP A;  1YT0 A;  4CWR A;  2C1G A;  2WI6 A;  1ZWH A;  2WI1 A;  4XCL A;  4XIP A;  2XJG A;  2YKI A;  1TBW A;  3VHD A;  5CTW A;  1UYM A;  1AM1 A;  2XX2 A;  1I58 A;  3PEJ A;  2WI7 A;  5GGZ A;  3B28 A;  3K60 A;  4GQT A;  3A0Y A;  4R3M A;  2XDX A;  4YKY A;  2YEF A;  2ZDX A;  1B3Q A;  4CWS A;  2IOR A;  3FT8 A;  3LMM A;  2XDU A;  2YEI A;  3QTF A;  4XIQ A;  2YKJ A;  2QF6 A;  2YE3 A;  4Q20 A;  4CWN A;  3CRK A;  2YEE A;  4XC0 A;  2XCM A;  1ZXN A;  4E72 A;  4HXZ A;  4AS9 A;  3A0Z A;  1AJ6 A;  4PRV A;  4NH8 A;  5CTU A;  4HYP A;  5M4K A;  4HZ5 A;  3ZM7 A;  1PVG A;  2YKE A;  3O0I A;  3Q5K A;  2YEJ A;  1Y8N A;  1U0Z A;  5CPH A;  3OW6 A;  1ZW9 A;  5M4M A;  3PEH A;  3IED A;  3TZ5 A;  1KZN A;  4FCP A;  2BT0 A;  4XE2 A;  5F5R A;  1Z5C A;  4MB9 A;  4XIT A;  5D7D A;  5M4N A;  1UYD A;  3H4L A;  2WI2 A;  2XK2 A;  2O1V A;  2PNR A;  2BRE A;  4GCZ A;  1JM6 A;  4HZ0 A;  4YKT A;  2CH4 A;  3R4N A;  3H80 A;  1KIJ A;  4V25 A;  2YI5 A;  2C1I A;  3Q5J A;  4FCQ A;  4YKQ A;  3D0B A;  2WI5 A;  4XKA A;  3T2S A;  2WI3 A;  4H85 A;  1Z59 A;  3TUH A;  2ZKJ A;  3OWB A;  3TZ0 A;  5D7R A;  2VCI A;  3ZKB A;  1YS3 A;  4O05 A;  4CWQ A;  2CCS A;  3EHG A;  1YT1 A;  2YI7 A;  3HZ5 A;  4EM7 A;  2FWZ A;  5L3J A;  4MP2 A;  2XAB A;  3R91 A;  4LWF A;  1GKX A;  2YKC A;  4YKX A;  1NHI A;  1OSF A;  1YER A;  4B7P A;  2YE6 A;  3OMU A;  4YKR A;  2BRC A;  1Y4S A;  2C2A A;  3T10 A;  3A0W A;  4E00 A;  4H81 A;  3KE6 A;  4K4O A;  4U7N A;  3Q5L A;  1QYE A;  4MPC A;  4KTN A;  4HXW A;  3D2R A;  1GJV A;  1H7S A;  3QDD A;  4BXI A;  3A0T A;  4XKK A;  4DUH A;  4FMT A;  1F51 A;  3R92 A;  1YC3 A;  5FND A;  1YSR A;  2HKJ A;  1UY6 A;  3C11 A;  1Y8P A;  4V26 A;  4U7O A;  2BYI A;  4QPK A;  1AMW A;  4GEE A;  4NH7 A;  3TZ4 A;  4ASB A;  3FV5 A;  3OWD A;  5BOC A;  4ZKI A;  1THN A;  4LPB A;  2Q8I A;  1TIL A;  5FWK A;  1NHJ A;  1UYF A;  2YEG A;  5J71 A;  4QPJ A;  3U2K A;  4KSH A;  2WEQ A;  2FYP A;  3EHH A;  4L91 A;  3HYZ A;  5CF0 A;  2ZBK B;  3HYY A;  1US7 A;  4O0B A;  2Q2E B;  1I5D A;  4PU9 A;  1TID A;  3CWV A;  3EHJ A;  5JEN A;  4URO A;  2ZDY A;  2CGF A;  3RLP A;  4AWP A;  5C93 A;  3O2F A;  5M4H A;  3BM9 A;  4URM A;  1UY7 A;  2BU7 A;  3HHU A;  4BAE A;  1UYG A;  4L90 A;  4GT8 A;  4I5S A;  4HYM A;  2YE5 A;  3CGY A;  2O1W A;  2HCH A;  2XX5 A;  1MU5 A;  3TTZ A;  1UYK A;  3K99 A;  4O09 A;  3VHA A;  3O6O A;  2JJC A;  2YED A;  1Z5B A;  3NMQ A;  2UWD A;  4BIZ A;  3U67 A;  4LWH A;  3ZXQ A;  1TH8 A;  4O04 A;  1B63 A;  5IDJ A;  3T0H A;  3LPS A;  5J6A A;  2BU8 A;  3BMY A;  1R62 A;  3CYG A;  4DZY A;  4EFT A;  2BU5 A;  2QG2 A;  2BYH A;  3R4P A;  3FT5 A;  1QZR A;  2E0A A;  1Y4U A;  2IWS A;  1AH6 A;  3U2D A;  4WUD A;  2VWC A;  4CE3 A;  1YSZ A;  1S16 A;  1EA6 A;  1Z5A A;  3JZ3 A;  3B25 A;  4PL9 A;  2YK9 A;  2H55 A;  4LWE A;  4ASA A;  4EEH A;  3OPD A;  2Q8G A;  4CWT A;  2QFO A;  2K5B A;  3VAD A;  2FXS A;  1QY8 A;  2HHI A;  4MPE A;  1GKZ A;  5M4P A;  2XHT A;  1I5B A;  2XX4 A;  2YEC A;  4ASG A;  3GIG B;  3LNU A;  5F3K A;  4PRX A;  2VW5 A;  1BYQ A;  2XHX A;  4KQV A;  4BQJ A;  4ZVI A;  1YET A;  3MNR P;  4XDM A;  5D7C A;  4MBC A;  2GQP A;  4XTJ A;  5FNC A;  1YES A;  4GFN A;  3CGZ A;  3K98 A;  3INX A;  2IOP A;  2Q8H A;  3HEK A;  3T1K A;  2XDS A;  3WQ9 A;  4WUB A;  2BTZ A;  4O07 A;  1MX0 A;  2YEA A;  4MOT A;  3EHF A;  2WI4 A;  4XKO A;  5IDM A;  4JAS A;  3ZXO A;  5FNF A;  3DGE A;  4E02 A;  4R1F A;  2AKP A;  2YE7 A;  4XCJ A;  3S5T A;  2XJX A;  1L0O A;  3A0R A;  3B24 A;  2XDL A;  2XHR A;  1Y8O A;  2O1U A;  3K97 A;  4MP7 A;  2BU6 A;  4KSG A; 
#chains in the Genus database with same CATH homology
 2YI6 A;  3WHA A;  2YGE A;  2GFD A;  1BXD A;  2YE8 A;  3GIG A;  3GIF A;  2VCJ A;  1ZXM A;  1A4H A;  4HY6 A;  3VHC A;  1EI1 A;  5D6Q A;  2BZ5 A;  2YJW A;  3INW A;  1ID0 A;  1TC6 A;  3C0E A;  4I3H A;  2YEB A;  2HG1 A;  4X9L A;  3EKR A;  1YT2 A;  3D36 A;  3T0Z A;  4EGH A;  1S14 A;  4NH9 A;  4L8Z A;  1BGQ A;  1UYI A;  2H8M A;  4FPP A;  1UYC A;  2IOQ A;  4URN A;  3R4M A;  4XD8 A;  4R3A A;  4CE2 A;  4WUC A;  1U2O A;  2YJX A;  3RLR A;  4B6C A;  3G7B A;  2CG9 A;  3B26 A;  1UYL A;  3CRL A;  1H7U A;  5CTY A;  2YKB A;  5CTX A;  3RKZ A;  3HZ1 A;  4BIU A;  2QG0 A;  3RLQ A;  3TZ2 A;  2ESA A;  4JAU A;  4JQL A;  4EGK A;  3G7E A;  4KFG A;  2Q8F A;  1BKN A;  4XIR A;  3B27 A;  4P8O A;  3G75 A;  1TC0 A;  4U93 A;  1I59 A;  4BQG A;  2IWU A;  3R4O A;  4L94 A;  2YE4 A;  3GIE A;  4EFU A;  4MPN A;  2YGF A;  4HY1 A;  2WEP A;  4AWQ A;  2WER A;  2XJJ A;  2XD6 A;  4YKU A;  1AH8 A;  4YKW A;  2CCU A;  1UYH A;  4CE1 A;  5IN9 A;  2IWX A;  4AWO A;  1UY8 A;  2YE9 A;  4URL A;  4LWG A;  5BOD A;  4EGI A;  4W7T A;  2CCT A;  2EXL A;  4P7A A;  4KP4 A;  4LP0 A;  2YK2 A;  5M4E A;  2FWY A;  3A0X A;  2YGA A;  4LWI A;  2BU2 A;  3ZKD A;  4YKZ A;  2XDK A;  1UY9 A;  1I5A A;  4ASF A;  1UYE A;  4GGL A;  2YI0 A;  5D6P A;  4EMV A;  4FCR A;  3EKO A;  4CWO A;  4CWF A;  2YEH A;  4H7Q A;  1NHH A;  2BSM A;  1B62 A;  1YC1 A;  1I5C A;  2JKI A;  3SL2 A;  4E01 A;  4JAV A;  1YC4 A;  4L93 A;  2YE2 A;  4CWP A;  1YT0 A;  4CWR A;  2WI6 A;  1ZWH A;  2WI1 A;  4XCL A;  4XIP A;  2XJG A;  2YKI A;  1TBW A;  3VHD A;  5CTW A;  1UYM A;  1AM1 A;  2XX2 A;  1I58 A;  3PEJ A;  2WI7 A;  5GGZ A;  3B28 A;  3K60 A;  4GQT A;  3A0Y A;  4R3M A;  2XDX A;  4YKY A;  2YEF A;  2ZDX A;  1B3Q A;  4CWS A;  2IOR A;  3FT8 A;  2XDU A;  2YEI A;  3QTF A;  4XIQ A;  2YKJ A;  2QF6 A;  2YE3 A;  4Q20 A;  4CWN A;  3CRK A;  2YEE A;  4XC0 A;  2XCM A;  1ZXN A;  4HXZ A;  4AS9 A;  3A0Z A;  1AJ6 A;  4PRV A;  4NH8 A;  5CTU A;  4HYP A;  5M4K A;  4HZ5 A;  3ZM7 A;  1PVG A;  2YKE A;  3O0I A;  3Q5K A;  2YEJ A;  1Y8N A;  1U0Z A;  5CPH A;  3OW6 A;  1ZW9 A;  5M4M A;  3PEH A;  3IED A;  3TZ5 A;  1KZN A;  4FCP A;  2BT0 A;  4XE2 A;  5F5R A;  1Z5C A;  4MB9 A;  4XIT A;  5D7D A;  5M4N A;  1UYD A;  3H4L A;  2WI2 A;  2XK2 A;  2O1V A;  2PNR A;  2BRE A;  4GCZ A;  1JM6 A;  4HZ0 A;  4YKT A;  2CH4 A;  3R4N A;  3H80 A;  1KIJ A;  4V25 A;  2YI5 A;  3Q5J A;  4FCQ A;  4YKQ A;  3D0B A;  2WI5 A;  4XKA A;  3T2S A;  2WI3 A;  4H85 A;  1Z59 A;  3TUH A;  2ZKJ A;  3OWB A;  3TZ0 A;  5D7R A;  2VCI A;  3ZKB A;  1YS3 A;  4O05 A;  4CWQ A;  2CCS A;  3EHG A;  1YT1 A;  2YI7 A;  3HZ5 A;  4EM7 A;  2FWZ A;  5L3J A;  4MP2 A;  2XAB A;  3R91 A;  4LWF A;  1GKX A;  2YKC A;  4YKX A;  1NHI A;  1OSF A;  1YER A;  4B7P A;  2YE6 A;  3OMU A;  4YKR A;  2BRC A;  1Y4S A;  2C2A A;  3T10 A;  3A0W A;  4E00 A;  4H81 A;  3KE6 A;  4K4O A;  4U7N A;  3Q5L A;  1QYE A;  4MPC A;  4KTN A;  4HXW A;  3D2R A;  1GJV A;  1H7S A;  3QDD A;  4BXI A;  3A0T A;  4XKK A;  4DUH A;  4FMT A;  3R92 A;  1YC3 A;  5FND A;  1YSR A;  2HKJ A;  1UY6 A;  3C11 A;  1Y8P A;  4V26 A;  4U7O A;  2BYI A;  4QPK A;  1AMW A;  4GEE A;  4NH7 A;  3TZ4 A;  4ASB A;  3FV5 A;  3OWD A;  5BOC A;  4ZKI A;  1THN A;  4LPB A;  2Q8I A;  1TIL A;  5FWK A;  1NHJ A;  1UYF A;  2YEG A;  5J71 A;  4QPJ A;  3U2K A;  4KSH A;  2WEQ A;  2FYP A;  3EHH A;  4L91 A;  3HYZ A;  5CF0 A;  2ZBK B;  3HYY A;  1US7 A;  4O0B A;  2Q2E B;  1I5D A;  4PU9 A;  1TID A;  3CWV A;  3EHJ A;  4URO A;  2ZDY A;  2CGF A;  3RLP A;  4AWP A;  5C93 A;  3O2F A;  5M4H A;  3BM9 A;  4URM A;  1UY7 A;  2BU7 A;  3HHU A;  4BAE A;  1UYG A;  4L90 A;  4GT8 A;  4I5S A;  4HYM A;  2YE5 A;  3CGY A;  2O1W A;  2HCH A;  2XX5 A;  1MU5 A;  3TTZ A;  1UYK A;  3K99 A;  4O09 A;  3VHA A;  3O6O A;  2JJC A;  2YED A;  1Z5B A;  3NMQ A;  2UWD A;  4BIZ A;  3U67 A;  4LWH A;  3ZXQ A;  1TH8 A;  4O04 A;  1B63 A;  5IDJ A;  3T0H A;  3LPS A;  5J6A A;  2BU8 A;  3BMY A;  1R62 A;  4DZY A;  4EFT A;  2BU5 A;  2QG2 A;  2BYH A;  3R4P A;  3FT5 A;  1QZR A;  2E0A A;  1Y4U A;  2IWS A;  1AH6 A;  3U2D A;  4WUD A;  2VWC A;  4CE3 A;  1YSZ A;  1S16 A;  1EA6 A;  1Z5A A;  3JZ3 A;  3B25 A;  4PL9 A;  2YK9 A;  2H55 A;  4LWE A;  4ASA A;  4EEH A;  3OPD A;  2Q8G A;  4CWT A;  2QFO A;  2K5B A;  3VAD A;  2FXS A;  1QY8 A;  4MPE A;  1GKZ A;  5M4P A;  2XHT A;  1I5B A;  2XX4 A;  2YEC A;  4ASG A;  3GIG B;  3LNU A;  5F3K A;  4PRX A;  2VW5 A;  1BYQ A;  2XHX A;  4KQV A;  4BQJ A;  4ZVI A;  1YET A;  3MNR P;  4XDM A;  5D7C A;  4MBC A;  2GQP A;  4XTJ A;  5FNC A;  1YES A;  4GFN A;  3CGZ A;  3K98 A;  3INX A;  2IOP A;  2Q8H A;  3HEK A;  3T1K A;  2XDS A;  3WQ9 A;  4WUB A;  2BTZ A;  4O07 A;  1MX0 A;  2YEA A;  4MOT A;  3EHF A;  2WI4 A;  4XKO A;  5IDM A;  4JAS A;  3ZXO A;  5FNF A;  3DGE A;  4E02 A;  4R1F A;  2AKP A;  2YE7 A;  4XCJ A;  2XJX A;  1L0O A;  3A0R A;  3B24 A;  2XDL A;  2XHR A;  1Y8O A;  2O1U A;  3K97 A;  4MP7 A;  2BU6 A;  4KSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...