1TC0A

Ligand induced conformational shifts in the n-terminal domain of grp94, open conformation complexed with the physiological partner atp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
225
structure length
222
Chain Sequence
FAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTGKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Endoplasmin
publication title Ligand-induced Conformational Shift in the N-terminal Domain of GRP94, an Hsp90 Chaperone.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 73
structure length 222
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1tc0A00
2XJGA 2CG9A 3INWA 4HZ5A 4FCPA 4GT8A 3T2SA 4K4OA 4ASGA 4YKWA 2PNRA 4YKYA 2XJJA 3HZ1A 3FT8A 1B62A 4E00A 4CE1A 3TTZA 3FV5A 5D7DA 2WI3A 2K5BA 2BU8A 4U93A 1S16A 1YSZA 4FPPA 4XITA 4BAEA 1TC6A 2ZBKB 2YEJA 4O04A 4U7NA 4YKUA 4LWIA 3FT5A 3K98A 2WERA 4U7OA 1I59A 3R4NA 4MP2A 3A0WA 1UYDA 4DZYA 2CCSA 2YEAA 4MB9A 1UY7A 4HY6A 3A0XA 2O1WA 4L93A 4CE2A 4WUDA 4R3AA 1Y4SA 1NHHA 5J71A 2YE9A 3NMQA 4EFUA 4URLA 3VHAA 4O09A 3T1KA 1US7A 4L94A 3A0TA 4WUBA 1YSRA 2YI5A 1I5BA 1UYMA 5CTXA 3INXA 4I3HA 4BQJA 1YC4A 4Q20A 2YE5A 2ZKJA 4MPEA 1UY9A 4YKTA 4O07A 4H7QA 3G7BA 4EMVA 2CCTA 3EKOA 2IOPA 3CGZA 4DUHA 2BRCA 5BODA 5F5RA 4R1FA 4MPNA 2FYPA 2XX4A 3R91A 4LWHA 3CRLA 5L3JA 4B6CA 2BSMA 2WEQA 2YE8A 4QPJA 3B24A 2WI1A 4H85A 5C93A 4W7TA 1KZNA 1AJ6A 2ZDYA 3ZXQA 4NH7A 3Q5JA 1Y8OA 2Q8GA 1U2OA 4E01A 5BOCA 1L0OA 2XDSA 3D0BA 2BREA 1QZRA 1Y4UA 4PU9A 1B3QA 1ZXNA 4YKZA 1TIDA 4GCZA 2WI5A 3OPDA 1ZW9A 4XCJA 2FWZA 5J6AA 3H4LA 2XHTA 4HYPA 3H80A 2BZ5A 2BU6A 4WUCA 5D6PA 3WHAA 2XDUA 4XD8A 4MOTA 3QDDA 2YI7A 4LP0A 2YGEA 1TILA 1EA6A 5IDJA 3RLQA 4PRXA 1I5DA 2CGFA 5M4MA 3LNUA 2BYHA 3D36A 1BKNA 3EHGA 2ESAA 2YEFA 2ZDXA 2YEEA 3R4OA 1TBWA 3HYZA 2YKIA 3G75A 3TZ5A 1UYEA 2XX5A 2Q8FA 3RLPA 1MX0A 2YEDA 1Z5AA 3PEHA 1YC3A 4V26A 4ASAA 4GQTA 2Q2EB 3R4MA 1UYLA 2JKIA 2QG2A 4EGKA 1I5CA 3OMUA 2YKJA 3LPSA 4BIZA 4FCRA 1QY8A 1PVGA 4XKKA 4URNA 1BYQA 5FWKA 2XDXA 2YKEA 2VW5A 3JZ3A 1Y8NA 3ZKBA 2XDKA 2YJWA 1UYFA 2WI4A 5GGZA 2H55A 4XE2A 2UWDA 4NH8A 3O2FA 4XDMA 4CWOA 1TC0A 3VHDA 3IEDA 2C2AA 2QFOA 2WI6A 4KSHA 5CPHA 5IN9A 4EFTA 3EHHA 4BXIA 4MBCA 4HY1A 4LWFA 4XIQA 2AKPA 1UYKA 5D6QA 3T10A 1JM6A 2XDLA 4XIPA 2XABA 1UYIA 4LPBA 4QPKA 3SL2A 4UROA 1R62A 2YJXA 4XKOA 1BGQA 5D7CA 2YKCA 2FXSA 3B25A 3PEJA 2O1VA 3EHFA 3ZM7A 4AWPA 1GKZA 5FNDA 4NH9A 2YEGA 1ID0A 1GJVA 2HCHA 3TUHA 4GEEA 4JAVA 1Y8PA 4LWEA 4AWQA 5FNFA 3GIEA 1UY8A 4MP7A 3BMYA 3B27A 3KE6A 2EXLA 4KSGA 2XCMA 4EM7A 1B63A 3K60A 1YS3A 4CE3A 2FWYA 3TZ2A 5CTUA 2HG1A 1Z5BA 2IWSA 4PRVA 1S14A 3CGYA 4ASFA 3HYYA 3CWVA 2YE6A 4EGIA 2XHXA 2CH4A 1YT1A 2YE2A 4P8OA 2XHRA 5IDMA 4URMA 2IOQA 3HEKA 1NHIA 3BM9A 1I5AA 4HXZA 4KP4A 2BU7A 4XCLA 2YE3A 2GFDA 2YE4A 2YEBA 4R3MA 5FNCA 4FCQA 5CF0A 3U2KA 4GGLA 2Q8IA 5M4HA 2VCJA 2O1UA 1YERA 4CWNA 3GIFA 4LWGA 4B7PA 4XC0A 1BXDA 3TZ4A 3B28A 3Q5LA 1H7SA 2YECA 3ZXOA 2YKBA 4L91A 3HHUA 5M4PA 3K99A 4GFNA 4P7AA 2H8MA 3K97A 3G7EA 3A0YA 2VWCA 3O0IA 2QG0A 4ZKIA 1GKXA 4KTNA 2IWXA 1EI1A 3TZ0A 2E0AA 5M4EA 2BTZA 4JAUA 3VHCA 2YGAA 1NHJA 1YT2A 4YKQA 1YETA 4JQLA 3QTFA 4EEHA 2QF6A 2YEIA 4CWTA 3R92A 1AH6A 4L8ZA 4CWFA 1TH8A 4BIUA 1UYGA 2XK2A 4KFGA 3RLRA 3MNRP 4XTJA 3T0HA 5F3KA 1AMWA 2XD6A 3R4PA 2YEHA 1KIJA 4CWPA 1U0ZA 4CWRA 2WEPA 3GIGA 3ZKDA 2YI6A 3C0EA 5D7RA 2HKJA 2CCUA 3WQ9A 4CWQA 3Q5KA 4MPCA 1UYCA 2XX2A 2WI2A 1Z5CA 1YESA 2VCIA 2YGFA 4YKXA 4HZ0A 4KQVA 4XKAA 4BQGA 3O6OA 2BU5A 5M4KA 4E02A 4CWSA 4L90A 2YK9A 3T0ZA 1UYHA 4ZVIA 2Q8HA 4O0BA 4X9LA 3B26A 4H81A 1MU5A 1QYEA 4O05A 4XIRA 4HYMA 2BT0A 3OW6A 1ZXMA 3GIGB 2YI0A 4PL9A 2JJCA 4AS9A 1UY6A 3VADA 3HZ5A 4ASBA 3C11A 1ZWHA 3DGEA 2IORA 1H7UA 2YE7A 4V25A 5CTWA 3D2RA 4AWOA 1YC1A 1I58A 2BYIA 4HXWA 3U67A 3OWBA 3U2DA 1YT0A 3OWDA 4I5SA 3A0ZA 4FMTA 3EHJA 4YKRA 1THNA 2GQPA 2XJXA 1AM1A 1Z59A 4EGHA 2YK2A 1OSFA 1AH8A 4JASA 5CTYA 3EKRA 3CRKA 2WI7A 3A0RA 5M4NA 2IWUA 3RKZA 2BU2A 1A4HA
chains in the Genus database with same CATH superfamily
2XJGA 2CG9A 3INWA 4HZ5A 4FCPA 4GT8A 3T2SA 4K4OA 4ASGA 4YKWA 2PNRA 4YKYA 2XJJA 3HZ1A 3FT8A 1B62A 4E00A 4CE1A 3TTZA 3FV5A 5D7DA 2WI3A 2K5BA 2BU8A 4U93A 1S16A 1YSZA 4FPPA 4XITA 4BAEA 1TC6A 2ZBKB 2YEJA 4O04A 4U7NA 4YKUA 4LWIA 3FT5A 3K98A 2WERA 4U7OA 1I59A 3R4NA 4MP2A 3A0WA 1UYDA 4DZYA 2CCSA 2YEAA 4MB9A 1UY7A 4HY6A 3A0XA 2O1WA 4L93A 4CE2A 4WUDA 4R3AA 1Y4SA 1NHHA 5J71A 2YE9A 3NMQA 4EFUA 4URLA 3VHAA 4O09A 3T1KA 1US7A 4L94A 3A0TA 4WUBA 1YSRA 2YI5A 1I5BA 1UYMA 5CTXA 3INXA 4I3HA 4BQJA 1YC4A 4Q20A 2YE5A 2ZKJA 4MPEA 1UY9A 4YKTA 4O07A 3S5TA 4H7QA 3G7BA 4EMVA 2CCTA 3EKOA 2IOPA 3CGZA 4DUHA 2BRCA 5BODA 5F5RA 4R1FA 4MPNA 2FYPA 2XX4A 3R91A 4LWHA 3CRLA 5L3JA 4B6CA 2BSMA 2WEQA 2YE8A 4QPJA 3B24A 2WI1A 4H85A 5C93A 4W7TA 1KZNA 1AJ6A 2ZDYA 4E72A 3ZXQA 4NH7A 3Q5JA 1Y8OA 2Q8GA 1U2OA 4E01A 5BOCA 1L0OA 2XDSA 3D0BA 2BREA 1QZRA 1Y4UA 4PU9A 1B3QA 1ZXNA 4YKZA 1TIDA 4GCZA 2C1IA 2WI5A 3OPDA 1ZW9A 4XCJA 2FWZA 5J6AA 3H4LA 2XHTA 4HYPA 3H80A 2BZ5A 3LMMA 2BU6A 4WUCA 5D6PA 3WHAA 2XDUA 4XD8A 4MOTA 3QDDA 2YI7A 4LP0A 2YGEA 1TILA 1EA6A 5IDJA 3RLQA 4PRXA 1I5DA 2CGFA 5M4MA 3LNUA 2BYHA 3D36A 1BKNA 3EHGA 2ESAA 2YEFA 2ZDXA 2YEEA 3R4OA 1TBWA 3HYZA 2YKIA 3G75A 3TZ5A 1UYEA 2XX5A 2Q8FA 3RLPA 1MX0A 2YEDA 1Z5AA 3PEHA 1YC3A 4V26A 4ASAA 4GQTA 2Q2EB 3R4MA 1UYLA 2JKIA 2QG2A 4EGKA 1I5CA 3OMUA 5JENA 2YKJA 3LPSA 4BIZA 4FCRA 1QY8A 1PVGA 4XKKA 4URNA 1BYQA 5FWKA 2XDXA 2YKEA 2VW5A 3JZ3A 1Y8NA 3ZKBA 2XDKA 2YJWA 1UYFA 2WI4A 5GGZA 2H55A 4XE2A 2UWDA 4NH8A 3O2FA 4XDMA 4CWOA 1TC0A 3VHDA 3IEDA 1F51A 2C2AA 2QFOA 2WI6A 4KSHA 5CPHA 5IN9A 4EFTA 3EHHA 4BXIA 4MBCA 4HY1A 4LWFA 4XIQA 2AKPA 1UYKA 5D6QA 3T10A 1JM6A 2XDLA 4XIPA 2XABA 1UYIA 4LPBA 4QPKA 3SL2A 4UROA 1R62A 2YJXA 4XKOA 1BGQA 5D7CA 2YKCA 2FXSA 3B25A 3PEJA 2O1VA 3EHFA 3ZM7A 4AWPA 1GKZA 5FNDA 4NH9A 2YEGA 1ID0A 1GJVA 2HCHA 3TUHA 4GEEA 4JAVA 1Y8PA 4LWEA 4AWQA 5FNFA 3GIEA 1UY8A 4MP7A 3BMYA 3B27A 3KE6A 2EXLA 4KSGA 2XCMA 4EM7A 1B63A 3K60A 1YS3A 4CE3A 2FWYA 3TZ2A 5CTUA 2HG1A 1Z5BA 2IWSA 2C1GA 1S14A 4PRVA 3CGYA 4ASFA 3HYYA 3CWVA 2YE6A 4EGIA 2XHXA 2CH4A 1YT1A 2FTKA 2YE2A 4P8OA 2XHRA 5IDMA 4URMA 2IOQA 3HEKA 1NHIA 3BM9A 1I5AA 4HXZA 4KP4A 2BU7A 4XCLA 2YE3A 2GFDA 2YE4A 2YEBA 4R3MA 5FNCA 4FCQA 5CF0A 3U2KA 4GGLA 2Q8IA 5M4HA 2VCJA 2O1UA 1YERA 4CWNA 3GIFA 4LWGA 4B7PA 4XC0A 1BXDA 3TZ4A 3B28A 3Q5LA 1H7SA 2YECA 3ZXOA 2YKBA 4L91A 3HHUA 5M4PA 3K99A 4GFNA 1IXMA 4P7AA 2H8MA 3K97A 3G7EA 3A0YA 2VWCA 3O0IA 2QG0A 4ZKIA 1GKXA 4KTNA 2IWXA 1EI1A 3TZ0A 2E0AA 5M4EA 2BTZA 4JAUA 3VHCA 2YGAA 1NHJA 1YT2A 4YKQA 2HHIA 1YETA 4JQLA 3QTFA 4EEHA 2QF6A 2YEIA 4CWTA 3R92A 1AH6A 4L8ZA 4CWFA 1TH8A 4BIUA 1UYGA 2XK2A 4KFGA 3RLRA 3MNRP 4XTJA 3T0HA 5F3KA 1AMWA 2XD6A 3R4PA 2YEHA 1KIJA 4CWPA 1U0ZA 3CYGA 4CWRA 2WEPA 3GIGA 3ZKDA 2YI6A 3C0EA 5D7RA 2HKJA 2CCUA 3WQ9A 4CWQA 3Q5KA 4MPCA 1UYCA 2XX2A 2WI2A 1Z5CA 1YESA 2VCIA 2YGFA 4YKXA 4HZ0A 4KQVA 4XKAA 4BQGA 3O6OA 2BU5A 5M4KA 4E02A 4CWSA 4L90A 2YK9A 3T0ZA 1UYHA 4ZVIA 2Q8HA 4O0BA 4X9LA 3B26A 4H81A 1MU5A 1QYEA 4O05A 4XIRA 4HYMA 2BT0A 3OW6A 1ZXMA 3GIGB 2YI0A 4PL9A 2JJCA 4AS9A 1UY6A 3VADA 3HZ5A 4ASBA 3C11A 1ZWHA 3DGEA 2IORA 1H7UA 2YE7A 4V25A 5CTWA 3D2RA 4AWOA 1YC1A 1I58A 2BYIA 4HXWA 3U67A 3OWBA 3U2DA 1YT0A 3OWDA 4I5SA 3A0ZA 4FMTA 3EHJA 4YKRA 1THNA 2GQPA 2XJXA 1AM1A 1Z59A 4EGHA 2YK2A 1OSFA 1AH8A 4JASA 5CTYA 3EKRA 3CRKA 2WI7A 3A0RA 5M4NA 2IWUA 3RKZA 2BU2A 1A4HA
chains in the Genus database with same CATH topology
2XJGA 2CG9A 3INWA 4HZ5A 4FCPA 4GT8A 3T2SA 4K4OA 4ASGA 4YKWA 2PNRA 4YKYA 2XJJA 3HZ1A 3FT8A 1B62A 4E00A 4CE1A 3TTZA 3FV5A 5D7DA 2WI3A 2K5BA 2BU8A 4U93A 1S16A 1YSZA 4FPPA 4XITA 4BAEA 1TC6A 2ZBKB 2YEJA 4O04A 4U7NA 4YKUA 4LWIA 3FT5A 3K98A 2WERA 4U7OA 1I59A 3R4NA 4MP2A 3A0WA 1UYDA 4DZYA 2CCSA 2YEAA 4MB9A 1UY7A 4HY6A 3A0XA 2O1WA 4L93A 4CE2A 4WUDA 4R3AA 1Y4SA 1NHHA 5J71A 2YE9A 3NMQA 4EFUA 4URLA 3VHAA 4O09A 3T1KA 1US7A 4L94A 3A0TA 4WUBA 1YSRA 2YI5A 1I5BA 1UYMA 5CTXA 3INXA 4I3HA 4BQJA 1YC4A 4Q20A 2YE5A 2ZKJA 4MPEA 1UY9A 4YKTA 4O07A 4H7QA 3G7BA 4EMVA 2CCTA 3EKOA 2IOPA 3CGZA 4DUHA 2BRCA 5BODA 5F5RA 4R1FA 4MPNA 2FYPA 2XX4A 3R91A 4LWHA 3CRLA 5L3JA 4B6CA 2BSMA 2WEQA 2YE8A 4QPJA 3B24A 2WI1A 4H85A 5C93A 4W7TA 1KZNA 1AJ6A 2ZDYA 3ZXQA 4NH7A 3Q5JA 1Y8OA 2Q8GA 1U2OA 4E01A 5BOCA 1L0OA 2XDSA 3D0BA 2BREA 1QZRA 1Y4UA 4PU9A 1B3QA 1ZXNA 4YKZA 1TIDA 4GCZA 2WI5A 3OPDA 1ZW9A 4XCJA 2FWZA 5J6AA 3H4LA 2XHTA 4HYPA 3H80A 2BZ5A 2BU6A 4WUCA 5D6PA 3WHAA 2XDUA 4XD8A 4MOTA 3QDDA 2YI7A 4LP0A 2YGEA 1TILA 1EA6A 5IDJA 3RLQA 4PRXA 1I5DA 2CGFA 5M4MA 3LNUA 2BYHA 3D36A 1BKNA 3EHGA 2ESAA 2YEFA 2ZDXA 2YEEA 3R4OA 1TBWA 3HYZA 2YKIA 3G75A 3TZ5A 1UYEA 2XX5A 2Q8FA 3RLPA 1MX0A 2YEDA 1Z5AA 3PEHA 1YC3A 4V26A 4ASAA 4GQTA 2Q2EB 3R4MA 1UYLA 2JKIA 2QG2A 4EGKA 1I5CA 3OMUA 2YKJA 3LPSA 4BIZA 4FCRA 1QY8A 1PVGA 4XKKA 4URNA 1BYQA 5FWKA 2XDXA 2YKEA 2VW5A 3JZ3A 1Y8NA 3ZKBA 2XDKA 2YJWA 1UYFA 2WI4A 5GGZA 2H55A 4XE2A 2UWDA 4NH8A 3O2FA 4XDMA 4CWOA 1TC0A 3VHDA 3IEDA 2C2AA 2QFOA 2WI6A 4KSHA 5CPHA 5IN9A 4EFTA 3EHHA 4BXIA 4MBCA 4HY1A 4LWFA 4XIQA 2AKPA 1UYKA 5D6QA 3T10A 1JM6A 2XDLA 4XIPA 2XABA 1UYIA 4LPBA 4QPKA 3SL2A 4UROA 1R62A 2YJXA 4XKOA 1BGQA 5D7CA 2YKCA 2FXSA 3B25A 3PEJA 2O1VA 3EHFA 3ZM7A 4AWPA 1GKZA 5FNDA 4NH9A 2YEGA 1ID0A 1GJVA 2HCHA 3TUHA 4GEEA 4JAVA 1Y8PA 4LWEA 4AWQA 5FNFA 3GIEA 1UY8A 4MP7A 3BMYA 3B27A 3KE6A 2EXLA 4KSGA 2XCMA 4EM7A 1B63A 3K60A 1YS3A 4CE3A 2FWYA 3TZ2A 5CTUA 2HG1A 1Z5BA 2IWSA 4PRVA 1S14A 3CGYA 4ASFA 3HYYA 3CWVA 2YE6A 4EGIA 2XHXA 2CH4A 1YT1A 2YE2A 4P8OA 2XHRA 5IDMA 4URMA 2IOQA 3HEKA 1NHIA 3BM9A 1I5AA 4HXZA 4KP4A 2BU7A 4XCLA 2YE3A 2GFDA 2YE4A 2YEBA 4R3MA 5FNCA 4FCQA 5CF0A 3U2KA 4GGLA 2Q8IA 5M4HA 2VCJA 2O1UA 1YERA 4CWNA 3GIFA 4LWGA 4B7PA 4XC0A 1BXDA 3TZ4A 3B28A 3Q5LA 1H7SA 2YECA 3ZXOA 2YKBA 4L91A 3HHUA 5M4PA 3K99A 4GFNA 4P7AA 2H8MA 3K97A 3G7EA 3A0YA 2VWCA 3O0IA 2QG0A 4ZKIA 1GKXA 4KTNA 2IWXA 1EI1A 3TZ0A 2E0AA 5M4EA 2BTZA 4JAUA 3VHCA 2YGAA 1NHJA 1YT2A 4YKQA 1YETA 4JQLA 3QTFA 4EEHA 2QF6A 2YEIA 4CWTA 3R92A 1AH6A 4L8ZA 4CWFA 1TH8A 4BIUA 1UYGA 2XK2A 4KFGA 3RLRA 3MNRP 4XTJA 3T0HA 5F3KA 1AMWA 2XD6A 3R4PA 2YEHA 1KIJA 4CWPA 1U0ZA 4CWRA 2WEPA 3GIGA 3ZKDA 2YI6A 3C0EA 5D7RA 2HKJA 2CCUA 3WQ9A 4CWQA 3Q5KA 4MPCA 1UYCA 2XX2A 2WI2A 1Z5CA 1YESA 2VCIA 2YGFA 4YKXA 4HZ0A 4KQVA 4XKAA 4BQGA 3O6OA 2BU5A 5M4KA 4E02A 4CWSA 4L90A 2YK9A 3T0ZA 1UYHA 4ZVIA 2Q8HA 4O0BA 4X9LA 3B26A 4H81A 1MU5A 1QYEA 4O05A 4XIRA 4HYMA 2BT0A 3OW6A 1ZXMA 3GIGB 2YI0A 4PL9A 2JJCA 4AS9A 1UY6A 3VADA 3HZ5A 4ASBA 3C11A 1ZWHA 3DGEA 2IORA 1H7UA 2YE7A 4V25A 5CTWA 3D2RA 4AWOA 1YC1A 1I58A 2BYIA 4HXWA 3U67A 3OWBA 3U2DA 1YT0A 3OWDA 4I5SA 3A0ZA 4FMTA 3EHJA 4YKRA 1THNA 2GQPA 2XJXA 1AM1A 1Z59A 4EGHA 2YK2A 1OSFA 1AH8A 4JASA 5CTYA 3EKRA 3CRKA 2WI7A 3A0RA 5M4NA 2IWUA 3RKZA 2BU2A 1A4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XJG A;  2CG9 A;  3INW A;  4HZ5 A;  4FCP A;  4GT8 A;  3T2S A;  4K4O A;  4ASG A;  4YKW A;  2PNR A;  4YKY A;  2XJJ A;  3HZ1 A;  3FT8 A;  1B62 A;  4E00 A;  4CE1 A;  3TTZ A;  3FV5 A;  5D7D A;  2WI3 A;  2K5B A;  2BU8 A;  4U93 A;  1S16 A;  1YSZ A;  4FPP A;  4XIT A;  4BAE A;  1TC6 A;  2ZBK B;  2YEJ A;  4O04 A;  4U7N A;  4YKU A;  4LWI A;  3FT5 A;  3K98 A;  2WER A;  4U7O A;  1I59 A;  3R4N A;  4MP2 A;  3A0W A;  1UYD A;  4DZY A;  2CCS A;  2YEA A;  4MB9 A;  1UY7 A;  4HY6 A;  3A0X A;  2O1W A;  4L93 A;  4CE2 A;  4WUD A;  4R3A A;  1Y4S A;  1NHH A;  5J71 A;  2YE9 A;  3NMQ A;  4EFU A;  4URL A;  3VHA A;  4O09 A;  3T1K A;  1US7 A;  4L94 A;  3A0T A;  4WUB A;  1YSR A;  2YI5 A;  1I5B A;  1UYM A;  5CTX A;  3INX A;  4I3H A;  4BQJ A;  1YC4 A;  4Q20 A;  2YE5 A;  2ZKJ A;  4MPE A;  1UY9 A;  4YKT A;  4O07 A;  4H7Q A;  3G7B A;  4EMV A;  2CCT A;  3EKO A;  2IOP A;  3CGZ A;  4DUH A;  2BRC A;  5BOD A;  5F5R A;  4R1F A;  4MPN A;  2FYP A;  2XX4 A;  3R91 A;  4LWH A;  3CRL A;  5L3J A;  4B6C A;  2BSM A;  2WEQ A;  2YE8 A;  4QPJ A;  3B24 A;  2WI1 A;  4H85 A;  5C93 A;  4W7T A;  1KZN A;  1AJ6 A;  2ZDY A;  3ZXQ A;  4NH7 A;  3Q5J A;  1Y8O A;  2Q8G A;  1U2O A;  4E01 A;  5BOC A;  1L0O A;  2XDS A;  3D0B A;  2BRE A;  1QZR A;  1Y4U A;  4PU9 A;  1B3Q A;  1ZXN A;  4YKZ A;  1TID A;  4GCZ A;  2WI5 A;  3OPD A;  1ZW9 A;  4XCJ A;  2FWZ A;  5J6A A;  3H4L A;  2XHT A;  4HYP A;  3H80 A;  2BZ5 A;  2BU6 A;  4WUC A;  5D6P A;  3WHA A;  2XDU A;  4XD8 A;  4MOT A;  3QDD A;  2YI7 A;  4LP0 A;  2YGE A;  1TIL A;  1EA6 A;  5IDJ A;  3RLQ A;  4PRX A;  1I5D A;  2CGF A;  5M4M A;  3LNU A;  2BYH A;  3D36 A;  1BKN A;  3EHG A;  2ESA A;  2YEF A;  2ZDX A;  2YEE A;  3R4O A;  1TBW A;  3HYZ A;  2YKI A;  3G75 A;  3TZ5 A;  1UYE A;  2XX5 A;  2Q8F A;  3RLP A;  1MX0 A;  2YED A;  1Z5A A;  3PEH A;  1YC3 A;  4V26 A;  4ASA A;  4GQT A;  2Q2E B;  3R4M A;  1UYL A;  2JKI A;  2QG2 A;  4EGK A;  1I5C A;  3OMU A;  2YKJ A;  3LPS A;  4BIZ A;  4FCR A;  1QY8 A;  1PVG A;  4XKK A;  4URN A;  1BYQ A;  5FWK A;  2XDX A;  2YKE A;  2VW5 A;  3JZ3 A;  1Y8N A;  3ZKB A;  2XDK A;  2YJW A;  1UYF A;  2WI4 A;  5GGZ A;  2H55 A;  4XE2 A;  2UWD A;  4NH8 A;  3O2F A;  4XDM A;  4CWO A;  1TC0 A;  3VHD A;  3IED A;  2C2A A;  2QFO A;  2WI6 A;  4KSH A;  5CPH A;  5IN9 A;  4EFT A;  3EHH A;  4BXI A;  4MBC A;  4HY1 A;  4LWF A;  4XIQ A;  2AKP A;  1UYK A;  5D6Q A;  3T10 A;  1JM6 A;  2XDL A;  4XIP A;  2XAB A;  1UYI A;  4LPB A;  4QPK A;  3SL2 A;  4URO A;  1R62 A;  2YJX A;  4XKO A;  1BGQ A;  5D7C A;  2YKC A;  2FXS A;  3B25 A;  3PEJ A;  2O1V A;  3EHF A;  3ZM7 A;  4AWP A;  1GKZ A;  5FND A;  4NH9 A;  2YEG A;  1ID0 A;  1GJV A;  2HCH A;  3TUH A;  4GEE A;  4JAV A;  1Y8P A;  4LWE A;  4AWQ A;  5FNF A;  3GIE A;  1UY8 A;  4MP7 A;  3BMY A;  3B27 A;  3KE6 A;  2EXL A;  4KSG A;  2XCM A;  4EM7 A;  1B63 A;  3K60 A;  1YS3 A;  4CE3 A;  2FWY A;  3TZ2 A;  5CTU A;  2HG1 A;  1Z5B A;  2IWS A;  4PRV A;  1S14 A;  3CGY A;  4ASF A;  3HYY A;  3CWV A;  2YE6 A;  4EGI A;  2XHX A;  2CH4 A;  1YT1 A;  2YE2 A;  4P8O A;  2XHR A;  5IDM A;  4URM A;  2IOQ A;  3HEK A;  1NHI A;  3BM9 A;  1I5A A;  4HXZ A;  4KP4 A;  2BU7 A;  4XCL A;  2YE3 A;  2GFD A;  2YE4 A;  2YEB A;  4R3M A;  5FNC A;  4FCQ A;  5CF0 A;  3U2K A;  4GGL A;  2Q8I A;  5M4H A;  2VCJ A;  2O1U A;  1YER A;  4CWN A;  3GIF A;  4LWG A;  4B7P A;  4XC0 A;  1BXD A;  3TZ4 A;  3B28 A;  3Q5L A;  1H7S A;  2YEC A;  3ZXO A;  2YKB A;  4L91 A;  3HHU A;  5M4P A;  3K99 A;  4GFN A;  4P7A A;  2H8M A;  3K97 A;  3G7E A;  3A0Y A;  2VWC A;  3O0I A;  2QG0 A;  4ZKI A;  1GKX A;  4KTN A;  2IWX A;  1EI1 A;  3TZ0 A;  2E0A A;  5M4E A;  2BTZ A;  4JAU A;  3VHC A;  2YGA A;  1NHJ A;  1YT2 A;  4YKQ A;  1YET A;  4JQL A;  3QTF A;  4EEH A;  2QF6 A;  2YEI A;  4CWT A;  3R92 A;  1AH6 A;  4L8Z A;  4CWF A;  1TH8 A;  4BIU A;  1UYG A;  2XK2 A;  4KFG A;  3RLR A;  3MNR P;  4XTJ A;  3T0H A;  5F3K A;  1AMW A;  2XD6 A;  3R4P A;  2YEH A;  1KIJ A;  4CWP A;  1U0Z A;  4CWR A;  2WEP A;  3GIG A;  3ZKD A;  2YI6 A;  3C0E A;  5D7R A;  2HKJ A;  2CCU A;  3WQ9 A;  4CWQ A;  3Q5K A;  4MPC A;  1UYC A;  2XX2 A;  2WI2 A;  1Z5C A;  1YES A;  2VCI A;  2YGF A;  4YKX A;  4HZ0 A;  4KQV A;  4XKA A;  4BQG A;  3O6O A;  2BU5 A;  5M4K A;  4E02 A;  4CWS A;  4L90 A;  2YK9 A;  3T0Z A;  1UYH A;  4ZVI A;  2Q8H A;  4O0B A;  4X9L A;  3B26 A;  4H81 A;  1MU5 A;  1QYE A;  4O05 A;  4XIR A;  4HYM A;  2BT0 A;  3OW6 A;  1ZXM A;  3GIG B;  2YI0 A;  4PL9 A;  2JJC A;  4AS9 A;  1UY6 A;  3VAD A;  3HZ5 A;  4ASB A;  3C11 A;  1ZWH A;  3DGE A;  2IOR A;  1H7U A;  2YE7 A;  4V25 A;  5CTW A;  3D2R A;  4AWO A;  1YC1 A;  1I58 A;  2BYI A;  4HXW A;  3U67 A;  3OWB A;  3U2D A;  1YT0 A;  3OWD A;  4I5S A;  3A0Z A;  4FMT A;  3EHJ A;  4YKR A;  1THN A;  2GQP A;  2XJX A;  1AM1 A;  1Z59 A;  4EGH A;  2YK2 A;  1OSF A;  1AH8 A;  4JAS A;  5CTY A;  3EKR A;  3CRK A;  2WI7 A;  3A0R A;  5M4N A;  2IWU A;  3RKZ A;  2BU2 A;  1A4H A; 
#chains in the Genus database with same CATH topology
 2XJG A;  2CG9 A;  3INW A;  4HZ5 A;  4FCP A;  4GT8 A;  3T2S A;  4K4O A;  4ASG A;  4YKW A;  2PNR A;  4YKY A;  2XJJ A;  3HZ1 A;  3FT8 A;  1B62 A;  4E00 A;  4CE1 A;  3TTZ A;  3FV5 A;  5D7D A;  2WI3 A;  2K5B A;  2BU8 A;  4U93 A;  1S16 A;  1YSZ A;  4FPP A;  4XIT A;  4BAE A;  1TC6 A;  2ZBK B;  2YEJ A;  4O04 A;  4U7N A;  4YKU A;  4LWI A;  3FT5 A;  3K98 A;  2WER A;  4U7O A;  1I59 A;  3R4N A;  4MP2 A;  3A0W A;  1UYD A;  4DZY A;  2CCS A;  2YEA A;  4MB9 A;  1UY7 A;  4HY6 A;  3A0X A;  2O1W A;  4L93 A;  4CE2 A;  4WUD A;  4R3A A;  1Y4S A;  1NHH A;  5J71 A;  2YE9 A;  3NMQ A;  4EFU A;  4URL A;  3VHA A;  4O09 A;  3T1K A;  1US7 A;  4L94 A;  3A0T A;  4WUB A;  1YSR A;  2YI5 A;  1I5B A;  1UYM A;  5CTX A;  3INX A;  4I3H A;  4BQJ A;  1YC4 A;  4Q20 A;  2YE5 A;  2ZKJ A;  4MPE A;  1UY9 A;  4YKT A;  4O07 A;  3S5T A;  4H7Q A;  3G7B A;  4EMV A;  2CCT A;  3EKO A;  2IOP A;  3CGZ A;  4DUH A;  2BRC A;  5BOD A;  5F5R A;  4R1F A;  4MPN A;  2FYP A;  2XX4 A;  3R91 A;  4LWH A;  3CRL A;  5L3J A;  4B6C A;  2BSM A;  2WEQ A;  2YE8 A;  4QPJ A;  3B24 A;  2WI1 A;  4H85 A;  5C93 A;  4W7T A;  1KZN A;  1AJ6 A;  2ZDY A;  4E72 A;  3ZXQ A;  4NH7 A;  3Q5J A;  1Y8O A;  2Q8G A;  1U2O A;  4E01 A;  5BOC A;  1L0O A;  2XDS A;  3D0B A;  2BRE A;  1QZR A;  1Y4U A;  4PU9 A;  1B3Q A;  1ZXN A;  4YKZ A;  1TID A;  4GCZ A;  2C1I A;  2WI5 A;  3OPD A;  1ZW9 A;  4XCJ A;  2FWZ A;  5J6A A;  3H4L A;  2XHT A;  4HYP A;  3H80 A;  2BZ5 A;  3LMM A;  2BU6 A;  4WUC A;  5D6P A;  3WHA A;  2XDU A;  4XD8 A;  4MOT A;  3QDD A;  2YI7 A;  4LP0 A;  2YGE A;  1TIL A;  1EA6 A;  5IDJ A;  3RLQ A;  4PRX A;  1I5D A;  2CGF A;  5M4M A;  3LNU A;  2BYH A;  3D36 A;  1BKN A;  3EHG A;  2ESA A;  2YEF A;  2ZDX A;  2YEE A;  3R4O A;  1TBW A;  3HYZ A;  2YKI A;  3G75 A;  3TZ5 A;  1UYE A;  2XX5 A;  2Q8F A;  3RLP A;  1MX0 A;  2YED A;  1Z5A A;  3PEH A;  1YC3 A;  4V26 A;  4ASA A;  4GQT A;  2Q2E B;  3R4M A;  1UYL A;  2JKI A;  2QG2 A;  4EGK A;  1I5C A;  3OMU A;  5JEN A;  2YKJ A;  3LPS A;  4BIZ A;  4FCR A;  1QY8 A;  1PVG A;  4XKK A;  4URN A;  1BYQ A;  5FWK A;  2XDX A;  2YKE A;  2VW5 A;  3JZ3 A;  1Y8N A;  3ZKB A;  2XDK A;  2YJW A;  1UYF A;  2WI4 A;  5GGZ A;  2H55 A;  4XE2 A;  2UWD A;  4NH8 A;  3O2F A;  4XDM A;  4CWO A;  1TC0 A;  3VHD A;  3IED A;  1F51 A;  2C2A A;  2QFO A;  2WI6 A;  4KSH A;  5CPH A;  5IN9 A;  4EFT A;  3EHH A;  4BXI A;  4MBC A;  4HY1 A;  4LWF A;  4XIQ A;  2AKP A;  1UYK A;  5D6Q A;  3T10 A;  1JM6 A;  2XDL A;  4XIP A;  2XAB A;  1UYI A;  4LPB A;  4QPK A;  3SL2 A;  4URO A;  1R62 A;  2YJX A;  4XKO A;  1BGQ A;  5D7C A;  2YKC A;  2FXS A;  3B25 A;  3PEJ A;  2O1V A;  3EHF A;  3ZM7 A;  4AWP A;  1GKZ A;  5FND A;  4NH9 A;  2YEG A;  1ID0 A;  1GJV A;  2HCH A;  3TUH A;  4GEE A;  4JAV A;  1Y8P A;  4LWE A;  4AWQ A;  5FNF A;  3GIE A;  1UY8 A;  4MP7 A;  3BMY A;  3B27 A;  3KE6 A;  2EXL A;  4KSG A;  2XCM A;  4EM7 A;  1B63 A;  3K60 A;  1YS3 A;  4CE3 A;  2FWY A;  3TZ2 A;  5CTU A;  2HG1 A;  1Z5B A;  2IWS A;  2C1G A;  1S14 A;  4PRV A;  3CGY A;  4ASF A;  3HYY A;  3CWV A;  2YE6 A;  4EGI A;  2XHX A;  2CH4 A;  1YT1 A;  2FTK A;  2YE2 A;  4P8O A;  2XHR A;  5IDM A;  4URM A;  2IOQ A;  3HEK A;  1NHI A;  3BM9 A;  1I5A A;  4HXZ A;  4KP4 A;  2BU7 A;  4XCL A;  2YE3 A;  2GFD A;  2YE4 A;  2YEB A;  4R3M A;  5FNC A;  4FCQ A;  5CF0 A;  3U2K A;  4GGL A;  2Q8I A;  5M4H A;  2VCJ A;  2O1U A;  1YER A;  4CWN A;  3GIF A;  4LWG A;  4B7P A;  4XC0 A;  1BXD A;  3TZ4 A;  3B28 A;  3Q5L A;  1H7S A;  2YEC A;  3ZXO A;  2YKB A;  4L91 A;  3HHU A;  5M4P A;  3K99 A;  4GFN A;  1IXM A;  4P7A A;  2H8M A;  3K97 A;  3G7E A;  3A0Y A;  2VWC A;  3O0I A;  2QG0 A;  4ZKI A;  1GKX A;  4KTN A;  2IWX A;  1EI1 A;  3TZ0 A;  2E0A A;  5M4E A;  2BTZ A;  4JAU A;  3VHC A;  2YGA A;  1NHJ A;  1YT2 A;  4YKQ A;  2HHI A;  1YET A;  4JQL A;  3QTF A;  4EEH A;  2QF6 A;  2YEI A;  4CWT A;  3R92 A;  1AH6 A;  4L8Z A;  4CWF A;  1TH8 A;  4BIU A;  1UYG A;  2XK2 A;  4KFG A;  3RLR A;  3MNR P;  4XTJ A;  3T0H A;  5F3K A;  1AMW A;  2XD6 A;  3R4P A;  2YEH A;  1KIJ A;  4CWP A;  1U0Z A;  3CYG A;  4CWR A;  2WEP A;  3GIG A;  3ZKD A;  2YI6 A;  3C0E A;  5D7R A;  2HKJ A;  2CCU A;  3WQ9 A;  4CWQ A;  3Q5K A;  4MPC A;  1UYC A;  2XX2 A;  2WI2 A;  1Z5C A;  1YES A;  2VCI A;  2YGF A;  4YKX A;  4HZ0 A;  4KQV A;  4XKA A;  4BQG A;  3O6O A;  2BU5 A;  5M4K A;  4E02 A;  4CWS A;  4L90 A;  2YK9 A;  3T0Z A;  1UYH A;  4ZVI A;  2Q8H A;  4O0B A;  4X9L A;  3B26 A;  4H81 A;  1MU5 A;  1QYE A;  4O05 A;  4XIR A;  4HYM A;  2BT0 A;  3OW6 A;  1ZXM A;  3GIG B;  2YI0 A;  4PL9 A;  2JJC A;  4AS9 A;  1UY6 A;  3VAD A;  3HZ5 A;  4ASB A;  3C11 A;  1ZWH A;  3DGE A;  2IOR A;  1H7U A;  2YE7 A;  4V25 A;  5CTW A;  3D2R A;  4AWO A;  1YC1 A;  1I58 A;  2BYI A;  4HXW A;  3U67 A;  3OWB A;  3U2D A;  1YT0 A;  3OWD A;  4I5S A;  3A0Z A;  4FMT A;  3EHJ A;  4YKR A;  1THN A;  2GQP A;  2XJX A;  1AM1 A;  1Z59 A;  4EGH A;  2YK2 A;  1OSF A;  1AH8 A;  4JAS A;  5CTY A;  3EKR A;  3CRK A;  2WI7 A;  3A0R A;  5M4N A;  2IWU A;  3RKZ A;  2BU2 A;  1A4H A; 
#chains in the Genus database with same CATH homology
 2XJG A;  2CG9 A;  3INW A;  4HZ5 A;  4FCP A;  4GT8 A;  3T2S A;  4K4O A;  4ASG A;  4YKW A;  2PNR A;  4YKY A;  2XJJ A;  3HZ1 A;  3FT8 A;  1B62 A;  4E00 A;  4CE1 A;  3TTZ A;  3FV5 A;  5D7D A;  2WI3 A;  2K5B A;  2BU8 A;  4U93 A;  1S16 A;  1YSZ A;  4FPP A;  4XIT A;  4BAE A;  1TC6 A;  2ZBK B;  2YEJ A;  4O04 A;  4U7N A;  4YKU A;  4LWI A;  3FT5 A;  3K98 A;  2WER A;  4U7O A;  1I59 A;  3R4N A;  4MP2 A;  3A0W A;  1UYD A;  4DZY A;  2CCS A;  2YEA A;  4MB9 A;  1UY7 A;  4HY6 A;  3A0X A;  2O1W A;  4L93 A;  4CE2 A;  4WUD A;  4R3A A;  1Y4S A;  1NHH A;  5J71 A;  2YE9 A;  3NMQ A;  4EFU A;  4URL A;  3VHA A;  4O09 A;  3T1K A;  1US7 A;  4L94 A;  3A0T A;  4WUB A;  1YSR A;  2YI5 A;  1I5B A;  1UYM A;  5CTX A;  3INX A;  4I3H A;  4BQJ A;  1YC4 A;  4Q20 A;  2YE5 A;  2ZKJ A;  4MPE A;  1UY9 A;  4YKT A;  4O07 A;  4H7Q A;  3G7B A;  4EMV A;  2CCT A;  3EKO A;  2IOP A;  3CGZ A;  4DUH A;  2BRC A;  5BOD A;  5F5R A;  4R1F A;  4MPN A;  2FYP A;  2XX4 A;  3R91 A;  4LWH A;  3CRL A;  5L3J A;  4B6C A;  2BSM A;  2WEQ A;  2YE8 A;  4QPJ A;  3B24 A;  2WI1 A;  4H85 A;  5C93 A;  4W7T A;  1KZN A;  1AJ6 A;  2ZDY A;  3ZXQ A;  4NH7 A;  3Q5J A;  1Y8O A;  2Q8G A;  1U2O A;  4E01 A;  5BOC A;  1L0O A;  2XDS A;  3D0B A;  2BRE A;  1QZR A;  1Y4U A;  4PU9 A;  1B3Q A;  1ZXN A;  4YKZ A;  1TID A;  4GCZ A;  2WI5 A;  3OPD A;  1ZW9 A;  4XCJ A;  2FWZ A;  5J6A A;  3H4L A;  2XHT A;  4HYP A;  3H80 A;  2BZ5 A;  2BU6 A;  4WUC A;  5D6P A;  3WHA A;  2XDU A;  4XD8 A;  4MOT A;  3QDD A;  2YI7 A;  4LP0 A;  2YGE A;  1TIL A;  1EA6 A;  5IDJ A;  3RLQ A;  4PRX A;  1I5D A;  2CGF A;  5M4M A;  3LNU A;  2BYH A;  3D36 A;  1BKN A;  3EHG A;  2ESA A;  2YEF A;  2ZDX A;  2YEE A;  3R4O A;  1TBW A;  3HYZ A;  2YKI A;  3G75 A;  3TZ5 A;  1UYE A;  2XX5 A;  2Q8F A;  3RLP A;  1MX0 A;  2YED A;  1Z5A A;  3PEH A;  1YC3 A;  4V26 A;  4ASA A;  4GQT A;  2Q2E B;  3R4M A;  1UYL A;  2JKI A;  2QG2 A;  4EGK A;  1I5C A;  3OMU A;  2YKJ A;  3LPS A;  4BIZ A;  4FCR A;  1QY8 A;  1PVG A;  4XKK A;  4URN A;  1BYQ A;  5FWK A;  2XDX A;  2YKE A;  2VW5 A;  3JZ3 A;  1Y8N A;  3ZKB A;  2XDK A;  2YJW A;  1UYF A;  2WI4 A;  5GGZ A;  2H55 A;  4XE2 A;  2UWD A;  4NH8 A;  3O2F A;  4XDM A;  4CWO A;  1TC0 A;  3VHD A;  3IED A;  2C2A A;  2QFO A;  2WI6 A;  4KSH A;  5CPH A;  5IN9 A;  4EFT A;  3EHH A;  4BXI A;  4MBC A;  4HY1 A;  4LWF A;  4XIQ A;  2AKP A;  1UYK A;  5D6Q A;  3T10 A;  1JM6 A;  2XDL A;  4XIP A;  2XAB A;  1UYI A;  4LPB A;  4QPK A;  3SL2 A;  4URO A;  1R62 A;  2YJX A;  4XKO A;  1BGQ A;  5D7C A;  2YKC A;  2FXS A;  3B25 A;  3PEJ A;  2O1V A;  3EHF A;  3ZM7 A;  4AWP A;  1GKZ A;  5FND A;  4NH9 A;  2YEG A;  1ID0 A;  1GJV A;  2HCH A;  3TUH A;  4GEE A;  4JAV A;  1Y8P A;  4LWE A;  4AWQ A;  5FNF A;  3GIE A;  1UY8 A;  4MP7 A;  3BMY A;  3B27 A;  3KE6 A;  2EXL A;  4KSG A;  2XCM A;  4EM7 A;  1B63 A;  3K60 A;  1YS3 A;  4CE3 A;  2FWY A;  3TZ2 A;  5CTU A;  2HG1 A;  1Z5B A;  2IWS A;  4PRV A;  1S14 A;  3CGY A;  4ASF A;  3HYY A;  3CWV A;  2YE6 A;  4EGI A;  2XHX A;  2CH4 A;  1YT1 A;  2YE2 A;  4P8O A;  2XHR A;  5IDM A;  4URM A;  2IOQ A;  3HEK A;  1NHI A;  3BM9 A;  1I5A A;  4HXZ A;  4KP4 A;  2BU7 A;  4XCL A;  2YE3 A;  2GFD A;  2YE4 A;  2YEB A;  4R3M A;  5FNC A;  4FCQ A;  5CF0 A;  3U2K A;  4GGL A;  2Q8I A;  5M4H A;  2VCJ A;  2O1U A;  1YER A;  4CWN A;  3GIF A;  4LWG A;  4B7P A;  4XC0 A;  1BXD A;  3TZ4 A;  3B28 A;  3Q5L A;  1H7S A;  2YEC A;  3ZXO A;  2YKB A;  4L91 A;  3HHU A;  5M4P A;  3K99 A;  4GFN A;  4P7A A;  2H8M A;  3K97 A;  3G7E A;  3A0Y A;  2VWC A;  3O0I A;  2QG0 A;  4ZKI A;  1GKX A;  4KTN A;  2IWX A;  1EI1 A;  3TZ0 A;  2E0A A;  5M4E A;  2BTZ A;  4JAU A;  3VHC A;  2YGA A;  1NHJ A;  1YT2 A;  4YKQ A;  1YET A;  4JQL A;  3QTF A;  4EEH A;  2QF6 A;  2YEI A;  4CWT A;  3R92 A;  1AH6 A;  4L8Z A;  4CWF A;  1TH8 A;  4BIU A;  1UYG A;  2XK2 A;  4KFG A;  3RLR A;  3MNR P;  4XTJ A;  3T0H A;  5F3K A;  1AMW A;  2XD6 A;  3R4P A;  2YEH A;  1KIJ A;  4CWP A;  1U0Z A;  4CWR A;  2WEP A;  3GIG A;  3ZKD A;  2YI6 A;  3C0E A;  5D7R A;  2HKJ A;  2CCU A;  3WQ9 A;  4CWQ A;  3Q5K A;  4MPC A;  1UYC A;  2XX2 A;  2WI2 A;  1Z5C A;  1YES A;  2VCI A;  2YGF A;  4YKX A;  4HZ0 A;  4KQV A;  4XKA A;  4BQG A;  3O6O A;  2BU5 A;  5M4K A;  4E02 A;  4CWS A;  4L90 A;  2YK9 A;  3T0Z A;  1UYH A;  4ZVI A;  2Q8H A;  4O0B A;  4X9L A;  3B26 A;  4H81 A;  1MU5 A;  1QYE A;  4O05 A;  4XIR A;  4HYM A;  2BT0 A;  3OW6 A;  1ZXM A;  3GIG B;  2YI0 A;  4PL9 A;  2JJC A;  4AS9 A;  1UY6 A;  3VAD A;  3HZ5 A;  4ASB A;  3C11 A;  1ZWH A;  3DGE A;  2IOR A;  1H7U A;  2YE7 A;  4V25 A;  5CTW A;  3D2R A;  4AWO A;  1YC1 A;  1I58 A;  2BYI A;  4HXW A;  3U67 A;  3OWB A;  3U2D A;  1YT0 A;  3OWD A;  4I5S A;  3A0Z A;  4FMT A;  3EHJ A;  4YKR A;  1THN A;  2GQP A;  2XJX A;  1AM1 A;  1Z59 A;  4EGH A;  2YK2 A;  1OSF A;  1AH8 A;  4JAS A;  5CTY A;  3EKR A;  3CRK A;  2WI7 A;  3A0R A;  5M4N A;  2IWU A;  3RKZ A;  2BU2 A;  1A4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...